data_3SQ4
# 
_entry.id   3SQ4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3SQ4         
NDB   NA1208       
RCSB  RCSB066513   
WWPDB D_1000066513 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3SQ2 'RB69 DNA Polymerase Ternary Complex with dTTP Opposite 2AP (AT rich sequence)'         unspecified 
PDB 3SUN 'RB69 DNA Polymerase (Y567A) Ternary Complex with dTTP Opposite 2AP (AT rich sequence)' unspecified 
PDB 3SUO 'RB69 DNA Polymerase (Y567A) Ternary Complex with dTTP Opposite 2AP (GC rich sequence)' unspecified 
PDB 3SUP 'RB69 DNA Polymerase (Y567A) Ternary Complex with dCTP Opposite 2AP (GC rich sequence)' unspecified 
PDB 3SUQ 'RB69 DNA Polymerase (Y567A) Ternary Complex with dCTP Opposite 2AP (AT rich sequence)' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3SQ4 
_pdbx_database_status.recvd_initial_deposition_date   2011-07-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xia, S.'          1 
'Konigsberg, W.H.' 2 
'Wang, J.'         3 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the 2-Aminopurine-Cytosine Base Pair Formed in the Polymerase Active Site of the RB69 Y567A-DNA Polymerase.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            50 
_citation.page_first                10136 
_citation.page_last                 10149 
_citation.year                      2011 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22023103 
_citation.pdbx_database_id_DOI      10.1021/bi2014618 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Reha-Krantz, L.J.' 1 
primary 'Hariharan, C.'     2 
primary 'Subuddhi, U.'      3 
primary 'Xia, S.'           4 
primary 'Zhao, C.'          5 
primary 'Beckman, J.'       6 
primary 'Christian, T.'     7 
primary 'Konigsberg, W.'    8 
# 
_cell.entry_id           3SQ4 
_cell.length_a           74.679 
_cell.length_b           120.467 
_cell.length_c           130.992 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3SQ4 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase'                                                104507.969 1   2.7.7.7 yes ? ?        
2 polymer     syn "5'-D(P*CP*(2PR)P*TP*CP*GP*CP*CP*GP*CP*CP*GP*CP*GP*CP*GP*G)-3'" 4861.131   1   ?       ?   ? template 
3 polymer     syn "5'-D(*CP*GP*CP*GP*CP*GP*GP*CP*GP*GP*CP*GP*(2DA))-3'"           4002.599   1   ?       ?   ? primer   
4 non-polymer syn "THYMIDINE-5'-TRIPHOSPHATE"                                     482.168    1   ?       ?   ? ?        
5 non-polymer syn 'CALCIUM ION'                                                   40.078     5   ?       ?   ? ?        
6 water       nat water                                                           18.015     285 ?       ?   ? ?        
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Gp43 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFD
;
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFD
;
A ? 
2 polydeoxyribonucleotide no yes '(DC)(2PR)(DT)(DC)(DG)(DC)(DC)(DG)(DC)(DC)(DG)(DC)(DG)(DC)(DG)(DG)' CGTCGCCGCCGCGCGG T ? 
3 polydeoxyribonucleotide no yes '(DC)(DG)(DC)(DG)(DC)(DG)(DG)(DC)(DG)(DG)(DC)(DG)(2DA)' CGCGCGGCGGCGA P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLU n 
1 4   PHE n 
1 5   TYR n 
1 6   LEU n 
1 7   THR n 
1 8   VAL n 
1 9   GLU n 
1 10  GLN n 
1 11  ILE n 
1 12  GLY n 
1 13  ASP n 
1 14  SER n 
1 15  ILE n 
1 16  PHE n 
1 17  GLU n 
1 18  ARG n 
1 19  TYR n 
1 20  ILE n 
1 21  ASP n 
1 22  SER n 
1 23  ASN n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ARG n 
1 28  THR n 
1 29  ARG n 
1 30  GLU n 
1 31  VAL n 
1 32  GLU n 
1 33  TYR n 
1 34  LYS n 
1 35  PRO n 
1 36  SER n 
1 37  LEU n 
1 38  PHE n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  PRO n 
1 43  GLU n 
1 44  SER n 
1 45  GLN n 
1 46  ALA n 
1 47  THR n 
1 48  LYS n 
1 49  TYR n 
1 50  PHE n 
1 51  ASP n 
1 52  ILE n 
1 53  TYR n 
1 54  GLY n 
1 55  LYS n 
1 56  PRO n 
1 57  CYS n 
1 58  THR n 
1 59  ARG n 
1 60  LYS n 
1 61  LEU n 
1 62  PHE n 
1 63  ALA n 
1 64  ASN n 
1 65  MET n 
1 66  ARG n 
1 67  ASP n 
1 68  ALA n 
1 69  SER n 
1 70  GLN n 
1 71  TRP n 
1 72  ILE n 
1 73  LYS n 
1 74  ARG n 
1 75  MET n 
1 76  GLU n 
1 77  ASP n 
1 78  ILE n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ALA n 
1 83  LEU n 
1 84  GLY n 
1 85  MET n 
1 86  ASP n 
1 87  ASP n 
1 88  PHE n 
1 89  LYS n 
1 90  LEU n 
1 91  ALA n 
1 92  TYR n 
1 93  LEU n 
1 94  SER n 
1 95  ASP n 
1 96  THR n 
1 97  TYR n 
1 98  ASN n 
1 99  TYR n 
1 100 GLU n 
1 101 ILE n 
1 102 LYS n 
1 103 TYR n 
1 104 ASP n 
1 105 HIS n 
1 106 THR n 
1 107 LYS n 
1 108 ILE n 
1 109 ARG n 
1 110 VAL n 
1 111 ALA n 
1 112 ASN n 
1 113 PHE n 
1 114 ASP n 
1 115 ILE n 
1 116 GLU n 
1 117 VAL n 
1 118 THR n 
1 119 SER n 
1 120 PRO n 
1 121 ASP n 
1 122 GLY n 
1 123 PHE n 
1 124 PRO n 
1 125 GLU n 
1 126 PRO n 
1 127 SER n 
1 128 GLN n 
1 129 ALA n 
1 130 LYS n 
1 131 HIS n 
1 132 PRO n 
1 133 ILE n 
1 134 ASP n 
1 135 ALA n 
1 136 ILE n 
1 137 THR n 
1 138 HIS n 
1 139 TYR n 
1 140 ASP n 
1 141 SER n 
1 142 ILE n 
1 143 ASP n 
1 144 ASP n 
1 145 ARG n 
1 146 PHE n 
1 147 TYR n 
1 148 VAL n 
1 149 PHE n 
1 150 ASP n 
1 151 LEU n 
1 152 LEU n 
1 153 ASN n 
1 154 SER n 
1 155 PRO n 
1 156 TYR n 
1 157 GLY n 
1 158 ASN n 
1 159 VAL n 
1 160 GLU n 
1 161 GLU n 
1 162 TRP n 
1 163 SER n 
1 164 ILE n 
1 165 GLU n 
1 166 ILE n 
1 167 ALA n 
1 168 ALA n 
1 169 LYS n 
1 170 LEU n 
1 171 GLN n 
1 172 GLU n 
1 173 GLN n 
1 174 GLY n 
1 175 GLY n 
1 176 ASP n 
1 177 GLU n 
1 178 VAL n 
1 179 PRO n 
1 180 SER n 
1 181 GLU n 
1 182 ILE n 
1 183 ILE n 
1 184 ASP n 
1 185 LYS n 
1 186 ILE n 
1 187 ILE n 
1 188 TYR n 
1 189 MET n 
1 190 PRO n 
1 191 PHE n 
1 192 ASP n 
1 193 ASN n 
1 194 GLU n 
1 195 LYS n 
1 196 GLU n 
1 197 LEU n 
1 198 LEU n 
1 199 MET n 
1 200 GLU n 
1 201 TYR n 
1 202 LEU n 
1 203 ASN n 
1 204 PHE n 
1 205 TRP n 
1 206 GLN n 
1 207 GLN n 
1 208 LYS n 
1 209 THR n 
1 210 PRO n 
1 211 VAL n 
1 212 ILE n 
1 213 LEU n 
1 214 THR n 
1 215 GLY n 
1 216 TRP n 
1 217 ASN n 
1 218 VAL n 
1 219 GLU n 
1 220 SER n 
1 221 PHE n 
1 222 ALA n 
1 223 ILE n 
1 224 PRO n 
1 225 TYR n 
1 226 VAL n 
1 227 TYR n 
1 228 ASN n 
1 229 ARG n 
1 230 ILE n 
1 231 LYS n 
1 232 ASN n 
1 233 ILE n 
1 234 PHE n 
1 235 GLY n 
1 236 GLU n 
1 237 SER n 
1 238 THR n 
1 239 ALA n 
1 240 LYS n 
1 241 ARG n 
1 242 LEU n 
1 243 SER n 
1 244 PRO n 
1 245 HIS n 
1 246 ARG n 
1 247 LYS n 
1 248 THR n 
1 249 ARG n 
1 250 VAL n 
1 251 LYS n 
1 252 VAL n 
1 253 ILE n 
1 254 GLU n 
1 255 ASN n 
1 256 MET n 
1 257 TYR n 
1 258 GLY n 
1 259 SER n 
1 260 ARG n 
1 261 GLU n 
1 262 ILE n 
1 263 ILE n 
1 264 THR n 
1 265 LEU n 
1 266 PHE n 
1 267 GLY n 
1 268 ILE n 
1 269 SER n 
1 270 VAL n 
1 271 LEU n 
1 272 ASP n 
1 273 TYR n 
1 274 ILE n 
1 275 ASP n 
1 276 LEU n 
1 277 TYR n 
1 278 LYS n 
1 279 LYS n 
1 280 PHE n 
1 281 SER n 
1 282 PHE n 
1 283 THR n 
1 284 ASN n 
1 285 GLN n 
1 286 PRO n 
1 287 SER n 
1 288 TYR n 
1 289 SER n 
1 290 LEU n 
1 291 ASP n 
1 292 TYR n 
1 293 ILE n 
1 294 SER n 
1 295 GLU n 
1 296 PHE n 
1 297 GLU n 
1 298 LEU n 
1 299 ASN n 
1 300 VAL n 
1 301 GLY n 
1 302 LYS n 
1 303 LEU n 
1 304 LYS n 
1 305 TYR n 
1 306 ASP n 
1 307 GLY n 
1 308 PRO n 
1 309 ILE n 
1 310 SER n 
1 311 LYS n 
1 312 LEU n 
1 313 ARG n 
1 314 GLU n 
1 315 SER n 
1 316 ASN n 
1 317 HIS n 
1 318 GLN n 
1 319 ARG n 
1 320 TYR n 
1 321 ILE n 
1 322 SER n 
1 323 TYR n 
1 324 ASN n 
1 325 ILE n 
1 326 ILE n 
1 327 ALA n 
1 328 VAL n 
1 329 TYR n 
1 330 ARG n 
1 331 VAL n 
1 332 LEU n 
1 333 GLN n 
1 334 ILE n 
1 335 ASP n 
1 336 ALA n 
1 337 LYS n 
1 338 ARG n 
1 339 GLN n 
1 340 PHE n 
1 341 ILE n 
1 342 ASN n 
1 343 LEU n 
1 344 SER n 
1 345 LEU n 
1 346 ASP n 
1 347 MET n 
1 348 GLY n 
1 349 TYR n 
1 350 TYR n 
1 351 ALA n 
1 352 LYS n 
1 353 ILE n 
1 354 GLN n 
1 355 ILE n 
1 356 GLN n 
1 357 SER n 
1 358 VAL n 
1 359 PHE n 
1 360 SER n 
1 361 PRO n 
1 362 ILE n 
1 363 LYS n 
1 364 THR n 
1 365 TRP n 
1 366 ASP n 
1 367 ALA n 
1 368 ILE n 
1 369 ILE n 
1 370 PHE n 
1 371 ASN n 
1 372 SER n 
1 373 LEU n 
1 374 LYS n 
1 375 GLU n 
1 376 GLN n 
1 377 ASN n 
1 378 LYS n 
1 379 VAL n 
1 380 ILE n 
1 381 PRO n 
1 382 GLN n 
1 383 GLY n 
1 384 ARG n 
1 385 SER n 
1 386 HIS n 
1 387 PRO n 
1 388 VAL n 
1 389 GLN n 
1 390 PRO n 
1 391 TYR n 
1 392 PRO n 
1 393 GLY n 
1 394 ALA n 
1 395 PHE n 
1 396 VAL n 
1 397 LYS n 
1 398 GLU n 
1 399 PRO n 
1 400 ILE n 
1 401 PRO n 
1 402 ASN n 
1 403 ARG n 
1 404 TYR n 
1 405 LYS n 
1 406 TYR n 
1 407 VAL n 
1 408 MET n 
1 409 SER n 
1 410 PHE n 
1 411 ASP n 
1 412 LEU n 
1 413 THR n 
1 414 SER n 
1 415 LEU n 
1 416 TYR n 
1 417 PRO n 
1 418 SER n 
1 419 ILE n 
1 420 ILE n 
1 421 ARG n 
1 422 GLN n 
1 423 VAL n 
1 424 ASN n 
1 425 ILE n 
1 426 SER n 
1 427 PRO n 
1 428 GLU n 
1 429 THR n 
1 430 ILE n 
1 431 ALA n 
1 432 GLY n 
1 433 THR n 
1 434 PHE n 
1 435 LYS n 
1 436 VAL n 
1 437 ALA n 
1 438 PRO n 
1 439 LEU n 
1 440 HIS n 
1 441 ASP n 
1 442 TYR n 
1 443 ILE n 
1 444 ASN n 
1 445 ALA n 
1 446 VAL n 
1 447 ALA n 
1 448 GLU n 
1 449 ARG n 
1 450 PRO n 
1 451 SER n 
1 452 ASP n 
1 453 VAL n 
1 454 TYR n 
1 455 SER n 
1 456 CYS n 
1 457 SER n 
1 458 PRO n 
1 459 ASN n 
1 460 GLY n 
1 461 MET n 
1 462 MET n 
1 463 TYR n 
1 464 TYR n 
1 465 LYS n 
1 466 ASP n 
1 467 ARG n 
1 468 ASP n 
1 469 GLY n 
1 470 VAL n 
1 471 VAL n 
1 472 PRO n 
1 473 THR n 
1 474 GLU n 
1 475 ILE n 
1 476 THR n 
1 477 LYS n 
1 478 VAL n 
1 479 PHE n 
1 480 ASN n 
1 481 GLN n 
1 482 ARG n 
1 483 LYS n 
1 484 GLU n 
1 485 HIS n 
1 486 LYS n 
1 487 GLY n 
1 488 TYR n 
1 489 MET n 
1 490 LEU n 
1 491 ALA n 
1 492 ALA n 
1 493 GLN n 
1 494 ARG n 
1 495 ASN n 
1 496 GLY n 
1 497 GLU n 
1 498 ILE n 
1 499 ILE n 
1 500 LYS n 
1 501 GLU n 
1 502 ALA n 
1 503 LEU n 
1 504 HIS n 
1 505 ASN n 
1 506 PRO n 
1 507 ASN n 
1 508 LEU n 
1 509 SER n 
1 510 VAL n 
1 511 ASP n 
1 512 GLU n 
1 513 PRO n 
1 514 LEU n 
1 515 ASP n 
1 516 VAL n 
1 517 ASP n 
1 518 TYR n 
1 519 ARG n 
1 520 PHE n 
1 521 ASP n 
1 522 PHE n 
1 523 SER n 
1 524 ASP n 
1 525 GLU n 
1 526 ILE n 
1 527 LYS n 
1 528 GLU n 
1 529 LYS n 
1 530 ILE n 
1 531 LYS n 
1 532 LYS n 
1 533 LEU n 
1 534 SER n 
1 535 ALA n 
1 536 LYS n 
1 537 SER n 
1 538 LEU n 
1 539 ASN n 
1 540 GLU n 
1 541 MET n 
1 542 LEU n 
1 543 PHE n 
1 544 ARG n 
1 545 ALA n 
1 546 GLN n 
1 547 ARG n 
1 548 THR n 
1 549 GLU n 
1 550 VAL n 
1 551 ALA n 
1 552 GLY n 
1 553 MET n 
1 554 THR n 
1 555 ALA n 
1 556 GLN n 
1 557 ILE n 
1 558 ASN n 
1 559 ARG n 
1 560 LYS n 
1 561 LEU n 
1 562 LEU n 
1 563 ILE n 
1 564 ASN n 
1 565 SER n 
1 566 LEU n 
1 567 TYR n 
1 568 GLY n 
1 569 ALA n 
1 570 LEU n 
1 571 GLY n 
1 572 ASN n 
1 573 VAL n 
1 574 TRP n 
1 575 PHE n 
1 576 ARG n 
1 577 TYR n 
1 578 TYR n 
1 579 ASP n 
1 580 LEU n 
1 581 ARG n 
1 582 ASN n 
1 583 ALA n 
1 584 THR n 
1 585 ALA n 
1 586 ILE n 
1 587 THR n 
1 588 THR n 
1 589 PHE n 
1 590 GLY n 
1 591 GLN n 
1 592 MET n 
1 593 ALA n 
1 594 LEU n 
1 595 GLN n 
1 596 TRP n 
1 597 ILE n 
1 598 GLU n 
1 599 ARG n 
1 600 LYS n 
1 601 VAL n 
1 602 ASN n 
1 603 GLU n 
1 604 TYR n 
1 605 LEU n 
1 606 ASN n 
1 607 GLU n 
1 608 VAL n 
1 609 CYS n 
1 610 GLY n 
1 611 THR n 
1 612 GLU n 
1 613 GLY n 
1 614 GLU n 
1 615 ALA n 
1 616 PHE n 
1 617 VAL n 
1 618 LEU n 
1 619 TYR n 
1 620 GLY n 
1 621 ASP n 
1 622 THR n 
1 623 ASP n 
1 624 SER n 
1 625 ILE n 
1 626 TYR n 
1 627 VAL n 
1 628 SER n 
1 629 ALA n 
1 630 ASP n 
1 631 LYS n 
1 632 ILE n 
1 633 ILE n 
1 634 ASP n 
1 635 LYS n 
1 636 VAL n 
1 637 GLY n 
1 638 GLU n 
1 639 SER n 
1 640 LYS n 
1 641 PHE n 
1 642 ARG n 
1 643 ASP n 
1 644 THR n 
1 645 ASN n 
1 646 HIS n 
1 647 TRP n 
1 648 VAL n 
1 649 ASP n 
1 650 PHE n 
1 651 LEU n 
1 652 ASP n 
1 653 LYS n 
1 654 PHE n 
1 655 ALA n 
1 656 ARG n 
1 657 GLU n 
1 658 ARG n 
1 659 MET n 
1 660 GLU n 
1 661 PRO n 
1 662 ALA n 
1 663 ILE n 
1 664 ASP n 
1 665 ARG n 
1 666 GLY n 
1 667 PHE n 
1 668 ARG n 
1 669 GLU n 
1 670 MET n 
1 671 CYS n 
1 672 GLU n 
1 673 TYR n 
1 674 MET n 
1 675 ASN n 
1 676 ASN n 
1 677 LYS n 
1 678 GLN n 
1 679 HIS n 
1 680 LEU n 
1 681 MET n 
1 682 PHE n 
1 683 MET n 
1 684 ASP n 
1 685 ARG n 
1 686 GLU n 
1 687 ALA n 
1 688 ILE n 
1 689 ALA n 
1 690 GLY n 
1 691 PRO n 
1 692 PRO n 
1 693 LEU n 
1 694 GLY n 
1 695 SER n 
1 696 LYS n 
1 697 GLY n 
1 698 ILE n 
1 699 GLY n 
1 700 GLY n 
1 701 PHE n 
1 702 TRP n 
1 703 THR n 
1 704 GLY n 
1 705 LYS n 
1 706 LYS n 
1 707 ARG n 
1 708 TYR n 
1 709 ALA n 
1 710 LEU n 
1 711 ASN n 
1 712 VAL n 
1 713 TRP n 
1 714 ASP n 
1 715 MET n 
1 716 GLU n 
1 717 GLY n 
1 718 THR n 
1 719 ARG n 
1 720 TYR n 
1 721 ALA n 
1 722 GLU n 
1 723 PRO n 
1 724 LYS n 
1 725 LEU n 
1 726 LYS n 
1 727 ILE n 
1 728 MET n 
1 729 GLY n 
1 730 LEU n 
1 731 GLU n 
1 732 THR n 
1 733 GLN n 
1 734 LYS n 
1 735 SER n 
1 736 SER n 
1 737 THR n 
1 738 PRO n 
1 739 LYS n 
1 740 ALA n 
1 741 VAL n 
1 742 GLN n 
1 743 LYS n 
1 744 ALA n 
1 745 LEU n 
1 746 LYS n 
1 747 GLU n 
1 748 CYS n 
1 749 ILE n 
1 750 ARG n 
1 751 ARG n 
1 752 MET n 
1 753 LEU n 
1 754 GLN n 
1 755 GLU n 
1 756 GLY n 
1 757 GLU n 
1 758 GLU n 
1 759 SER n 
1 760 LEU n 
1 761 GLN n 
1 762 GLU n 
1 763 TYR n 
1 764 PHE n 
1 765 LYS n 
1 766 GLU n 
1 767 PHE n 
1 768 GLU n 
1 769 LYS n 
1 770 GLU n 
1 771 PHE n 
1 772 ARG n 
1 773 GLN n 
1 774 LEU n 
1 775 ASN n 
1 776 TYR n 
1 777 ILE n 
1 778 SER n 
1 779 ILE n 
1 780 ALA n 
1 781 SER n 
1 782 VAL n 
1 783 SER n 
1 784 SER n 
1 785 ALA n 
1 786 ASN n 
1 787 ASN n 
1 788 ILE n 
1 789 ALA n 
1 790 LYS n 
1 791 TYR n 
1 792 ASP n 
1 793 VAL n 
1 794 GLY n 
1 795 GLY n 
1 796 PHE n 
1 797 PRO n 
1 798 GLY n 
1 799 PRO n 
1 800 LYS n 
1 801 CYS n 
1 802 PRO n 
1 803 PHE n 
1 804 HIS n 
1 805 ILE n 
1 806 ARG n 
1 807 GLY n 
1 808 ILE n 
1 809 LEU n 
1 810 THR n 
1 811 TYR n 
1 812 ASN n 
1 813 ARG n 
1 814 ALA n 
1 815 ILE n 
1 816 LYS n 
1 817 GLY n 
1 818 ASN n 
1 819 ILE n 
1 820 ASP n 
1 821 ALA n 
1 822 PRO n 
1 823 GLN n 
1 824 VAL n 
1 825 VAL n 
1 826 GLU n 
1 827 GLY n 
1 828 GLU n 
1 829 LYS n 
1 830 VAL n 
1 831 TYR n 
1 832 VAL n 
1 833 LEU n 
1 834 PRO n 
1 835 LEU n 
1 836 ARG n 
1 837 GLU n 
1 838 GLY n 
1 839 ASN n 
1 840 PRO n 
1 841 PHE n 
1 842 GLY n 
1 843 ASP n 
1 844 LYS n 
1 845 CYS n 
1 846 ILE n 
1 847 ALA n 
1 848 TRP n 
1 849 PRO n 
1 850 SER n 
1 851 GLY n 
1 852 THR n 
1 853 GLU n 
1 854 ILE n 
1 855 THR n 
1 856 ASP n 
1 857 LEU n 
1 858 ILE n 
1 859 LYS n 
1 860 ASP n 
1 861 ASP n 
1 862 VAL n 
1 863 LEU n 
1 864 HIS n 
1 865 TRP n 
1 866 MET n 
1 867 ASP n 
1 868 TYR n 
1 869 THR n 
1 870 VAL n 
1 871 LEU n 
1 872 LEU n 
1 873 GLU n 
1 874 LYS n 
1 875 THR n 
1 876 PHE n 
1 877 ILE n 
1 878 LYS n 
1 879 PRO n 
1 880 LEU n 
1 881 GLU n 
1 882 GLY n 
1 883 PHE n 
1 884 THR n 
1 885 SER n 
1 886 ALA n 
1 887 ALA n 
1 888 LYS n 
1 889 LEU n 
1 890 ASP n 
1 891 TYR n 
1 892 GLU n 
1 893 LYS n 
1 894 LYS n 
1 895 ALA n 
1 896 SER n 
1 897 LEU n 
1 898 PHE n 
1 899 ASP n 
1 900 MET n 
1 901 PHE n 
1 902 ASP n 
2 1   DC  n 
2 2   2PR n 
2 3   DT  n 
2 4   DC  n 
2 5   DG  n 
2 6   DC  n 
2 7   DC  n 
2 8   DG  n 
2 9   DC  n 
2 10  DC  n 
2 11  DG  n 
2 12  DC  n 
2 13  DG  n 
2 14  DC  n 
2 15  DG  n 
2 16  DG  n 
3 1   DC  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DC  n 
3 6   DG  n 
3 7   DG  n 
3 8   DC  n 
3 9   DG  n 
3 10  DG  n 
3 11  DC  n 
3 12  DG  n 
3 13  2DA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 43 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage RB69' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12353 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPR69 Q38087 1 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFDIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFD
;
1 ? 
2 PDB 3SQ4       3SQ4   2 'C(2PR)TCGCCGCCGCGCGG' ? ? 
3 PDB 3SQ4       3SQ4   3 'CGCGCGGCGGCG(2DA)' ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3SQ4 A 1 ? 902 ? Q38087 1   ? 902 ? 1   902 
2 2 3SQ4 T 1 ? 16  ? 3SQ4   3   ? 18  ? 3   18  
3 3 3SQ4 P 1 ? 13  ? 3SQ4   103 ? 115 ? 103 115 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3SQ4 ALA A 222 ? UNP Q38087 ASP 222 'ENGINEERED MUTATION' 222 1 
1 3SQ4 ALA A 327 ? UNP Q38087 ASP 327 'ENGINEERED MUTATION' 327 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2DA 'DNA linking'       n "2',3'-DIDEOXYADENOSINE-5'-MONOPHOSPHATE"                     ? 'C10 H14 N5 O5 P'   315.222 
2PR 'DNA linking'       n "2-AMINO-9-[2-DEOXYRIBOFURANOSYL]-9H-PURINE-5'-MONOPHOSPHATE" 
"2-AMINOPURINE-2'-DEOXYRIBO-5'-MONOPHOSPHATE" 'C10 H14 N5 O6 P'   331.222 
ALA 'L-peptide linking' y ALANINE                                                       ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                               ? 'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                                                 ? 'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                                                      ? 'C3 H7 N O2 S'      121.158 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                           ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                          ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                  ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                    ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                    ? 'C11 H12 N2 O2'     204.225 
TTP non-polymer         . "THYMIDINE-5'-TRIPHOSPHATE"                                   ? 'C10 H17 N2 O14 P3' 482.168 
TYR 'L-peptide linking' y TYROSINE                                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3SQ4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.60 
_exptl_crystal.density_percent_sol   52.67 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'150 mM calcium chloride, 15% w/v PEG350 MME, 100 mM sodium cacodylate, pH 6.5, VAPOR DIFFUSION, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'APEX II CCD' 
_diffrn_detector.pdbx_collection_date   2011-02-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
# 
_reflns.entry_id                     3SQ4 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   4.0 
_reflns.d_resolution_low             88.67 
_reflns.d_resolution_high            2.23 
_reflns.number_obs                   54679 
_reflns.number_all                   57939 
_reflns.percent_possible_obs         94.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.23 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3SQ4 
_refine.ls_number_reflns_obs                     54679 
_refine.ls_number_reflns_all                     57939 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             88.67 
_refine.ls_d_res_high                            2.23 
_refine.ls_percent_reflns_obs                    98.74 
_refine.ls_R_factor_obs                          0.20263 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20069 
_refine.ls_R_factor_R_free                       0.23837 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2911 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.943 
_refine.correlation_coeff_Fo_to_Fc_free          0.920 
_refine.B_iso_mean                               36.989 
_refine.aniso_B[1][1]                            -1.13 
_refine.aniso_B[2][2]                            1.79 
_refine.aniso_B[3][3]                            -0.67 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS 
U VALUES      : RESIDUAL ONLY
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.211 
_refine.overall_SU_ML                            0.152 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             13.281 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       0.284 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7363 
_refine_hist.pdbx_number_atoms_nucleic_acid   591 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             285 
_refine_hist.number_atoms_total               8273 
_refine_hist.d_res_high                       2.23 
_refine_hist.d_res_low                        88.67 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.008  0.022  ? 8247  ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.116  2.057  ? 11277 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.100  5.000  ? 905   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       34.877 24.202 ? 376   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       15.024 15.000 ? 1349  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       14.700 15.000 ? 46    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.080  0.200  ? 1193  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.004  0.021  ? 6102  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  1.425  4.000  ? 4507  ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 2.507  6.000  ? 7309  ? 'X-RAY DIFFRACTION' 
r_scbond_it                  2.849  6.000  ? 3740  ? 'X-RAY DIFFRACTION' 
r_scangle_it                 4.263  9.000  ? 3966  ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.230 
_refine_ls_shell.d_res_low                        2.288 
_refine_ls_shell.number_reflns_R_work             3681 
_refine_ls_shell.R_factor_R_work                  0.362 
_refine_ls_shell.percent_reflns_obs               90.47 
_refine_ls_shell.R_factor_R_free                  0.426 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             175 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3SQ4 
_struct.title                     'RB69 DNA Polymerase Ternary Complex with dTTP Opposite 2AP (GC rich sequence)' 
_struct.pdbx_descriptor           'DNA polymerase (E.C.2.7.7.7)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3SQ4 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            '2-Aminopurine, GC rich, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 64  ? GLY A 79  ? ASN A 64  GLY A 79  1 ? 16 
HELX_P HELX_P2  2  ASP A 87  ? TYR A 97  ? ASP A 87  TYR A 97  1 ? 11 
HELX_P HELX_P3  3  ASP A 104 ? ILE A 108 ? ASP A 104 ILE A 108 5 ? 5  
HELX_P HELX_P4  4  SER A 163 ? LYS A 169 ? SER A 163 LYS A 169 1 ? 7  
HELX_P HELX_P5  5  LEU A 170 ? GLY A 174 ? LEU A 170 GLY A 174 5 ? 5  
HELX_P HELX_P6  6  PRO A 179 ? ASP A 184 ? PRO A 179 ASP A 184 1 ? 6  
HELX_P HELX_P7  7  ASN A 193 ? LYS A 208 ? ASN A 193 LYS A 208 1 ? 16 
HELX_P HELX_P8  8  PHE A 221 ? GLY A 235 ? PHE A 221 GLY A 235 1 ? 15 
HELX_P HELX_P9  9  GLY A 235 ? LYS A 240 ? GLY A 235 LYS A 240 1 ? 6  
HELX_P HELX_P10 10 ARG A 241 ? SER A 243 ? ARG A 241 SER A 243 5 ? 3  
HELX_P HELX_P11 11 ASP A 272 ? SER A 281 ? ASP A 272 SER A 281 1 ? 10 
HELX_P HELX_P12 12 SER A 289 ? ASN A 299 ? SER A 289 ASN A 299 1 ? 11 
HELX_P HELX_P13 13 PRO A 308 ? ASN A 316 ? PRO A 308 ASN A 316 1 ? 9  
HELX_P HELX_P14 14 ASN A 316 ? GLN A 339 ? ASN A 316 GLN A 339 1 ? 24 
HELX_P HELX_P15 15 GLN A 339 ? LYS A 352 ? GLN A 339 LYS A 352 1 ? 14 
HELX_P HELX_P16 16 GLN A 354 ? PHE A 359 ? GLN A 354 PHE A 359 5 ? 6  
HELX_P HELX_P17 17 SER A 360 ? GLU A 375 ? SER A 360 GLU A 375 1 ? 16 
HELX_P HELX_P18 18 SER A 414 ? ASN A 424 ? SER A 414 ASN A 424 1 ? 11 
HELX_P HELX_P19 19 SER A 426 ? GLU A 428 ? SER A 426 GLU A 428 5 ? 3  
HELX_P HELX_P20 20 PRO A 438 ? ASN A 444 ? PRO A 438 ASN A 444 1 ? 7  
HELX_P HELX_P21 21 GLY A 469 ? LEU A 503 ? GLY A 469 LEU A 503 1 ? 35 
HELX_P HELX_P22 22 SER A 523 ? LYS A 531 ? SER A 523 LYS A 531 1 ? 9  
HELX_P HELX_P23 23 SER A 534 ? LEU A 570 ? SER A 534 LEU A 570 1 ? 37 
HELX_P HELX_P24 24 ASP A 579 ? GLY A 610 ? ASP A 579 GLY A 610 1 ? 32 
HELX_P HELX_P25 25 ALA A 629 ? GLY A 637 ? ALA A 629 GLY A 637 1 ? 9  
HELX_P HELX_P26 26 GLU A 638 ? PHE A 641 ? GLU A 638 PHE A 641 5 ? 4  
HELX_P HELX_P27 27 ASP A 643 ? ARG A 658 ? ASP A 643 ARG A 658 1 ? 16 
HELX_P HELX_P28 28 ARG A 658 ? ASN A 675 ? ARG A 658 ASN A 675 1 ? 18 
HELX_P HELX_P29 29 LEU A 730 ? LYS A 734 ? LEU A 730 LYS A 734 5 ? 5  
HELX_P HELX_P30 30 PRO A 738 ? GLU A 755 ? PRO A 738 GLU A 755 1 ? 18 
HELX_P HELX_P31 31 GLY A 756 ? PHE A 771 ? GLY A 756 PHE A 771 1 ? 16 
HELX_P HELX_P32 32 ARG A 772 ? LEU A 774 ? ARG A 772 LEU A 774 5 ? 3  
HELX_P HELX_P33 33 ASN A 775 ? ALA A 780 ? ASN A 775 ALA A 780 1 ? 6  
HELX_P HELX_P34 34 ILE A 788 ? LYS A 790 ? ILE A 788 LYS A 790 5 ? 3  
HELX_P HELX_P35 35 PRO A 802 ? LYS A 816 ? PRO A 802 LYS A 816 1 ? 15 
HELX_P HELX_P36 36 ILE A 858 ? MET A 866 ? ILE A 858 MET A 866 1 ? 9  
HELX_P HELX_P37 37 ASP A 867 ? PHE A 876 ? ASP A 867 PHE A 876 1 ? 10 
HELX_P HELX_P38 38 PHE A 876 ? LYS A 888 ? PHE A 876 LYS A 888 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B DC  1   "O3'" ? ? ? 1_555 B 2PR 2  P  ? ? T DC  3   T 2PR 4    1_555 ? ? ? ? ? ? ?            1.599 ? 
covale2  covale ? ? C DG  12  "O3'" ? ? ? 1_555 C 2DA 13 P  ? ? P DG  114 P 2DA 115  1_555 ? ? ? ? ? ? ?            1.598 ? 
metalc1  metalc ? ? A ASP 623 OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 623 A CA  904  1_555 ? ? ? ? ? ? ?            2.236 ? 
metalc2  metalc ? ? D TTP .   O2B   ? ? ? 1_555 E CA  .  CA ? ? A TTP 903 A CA  904  1_555 ? ? ? ? ? ? ?            2.245 ? 
metalc3  metalc ? ? A LYS 531 O     ? ? ? 1_555 G CA  .  CA ? ? A LYS 531 A CA  906  1_555 ? ? ? ? ? ? ?            2.274 ? 
metalc4  metalc ? ? D TTP .   O1G   ? ? ? 1_555 E CA  .  CA ? ? A TTP 903 A CA  904  1_555 ? ? ? ? ? ? ?            2.275 ? 
metalc5  metalc ? ? A ASP 411 OD2   ? ? ? 1_555 E CA  .  CA ? ? A ASP 411 A CA  904  1_555 ? ? ? ? ? ? ?            2.313 ? 
metalc6  metalc ? ? A LEU 412 O     ? ? ? 1_555 E CA  .  CA ? ? A LEU 412 A CA  904  1_555 ? ? ? ? ? ? ?            2.318 ? 
metalc7  metalc ? ? A ASN 507 OD1   ? ? ? 1_555 G CA  .  CA ? ? A ASN 507 A CA  906  1_555 ? ? ? ? ? ? ?            2.361 ? 
metalc8  metalc ? ? A ASN 505 O     ? ? ? 1_555 G CA  .  CA ? ? A ASN 505 A CA  906  1_555 ? ? ? ? ? ? ?            2.398 ? 
metalc9  metalc ? ? D TTP .   O2A   ? ? ? 1_555 F CA  .  CA ? ? A TTP 903 A CA  905  1_555 ? ? ? ? ? ? ?            2.533 ? 
metalc10 metalc ? ? A ASP 411 OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 411 A CA  904  1_555 ? ? ? ? ? ? ?            2.597 ? 
metalc11 metalc ? ? D TTP .   O2A   ? ? ? 1_555 E CA  .  CA ? ? A TTP 903 A CA  904  1_555 ? ? ? ? ? ? ?            2.727 ? 
metalc12 metalc ? ? A GLU 116 OE2   ? ? ? 1_555 I CA  .  CA ? ? A GLU 116 A CA  908  1_555 ? ? ? ? ? ? ?            2.774 ? 
metalc13 metalc ? ? A ASP 623 OD2   ? ? ? 1_555 F CA  .  CA ? ? A ASP 623 A CA  905  1_555 ? ? ? ? ? ? ?            2.854 ? 
metalc14 metalc ? ? A GLU 116 OE1   ? ? ? 1_555 I CA  .  CA ? ? A GLU 116 A CA  908  1_555 ? ? ? ? ? ? ?            2.882 ? 
metalc15 metalc ? ? A ASP 411 OD2   ? ? ? 1_555 F CA  .  CA ? ? A ASP 411 A CA  905  1_555 ? ? ? ? ? ? ?            2.894 ? 
metalc16 metalc ? ? H CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  907 A HOH 1076 1_555 ? ? ? ? ? ? ?            2.307 ? 
metalc17 metalc ? ? I CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  908 A HOH 961  1_555 ? ? ? ? ? ? ?            2.642 ? 
covale3  covale ? ? B 2PR 2   "O3'" ? ? ? 1_555 B DT  3  P  ? ? T 2PR 4   T DT  5    1_555 ? ? ? ? ? ? ?            1.588 ? 
hydrog1  hydrog ? ? B DT  3   N3    ? ? ? 1_555 C 2DA 13 N1 ? ? T DT  5   P 2DA 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DT  3   O4    ? ? ? 1_555 C 2DA 13 N6 ? ? T DT  5   P 2DA 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  4   N3    ? ? ? 1_555 C DG  12 N1 ? ? T DC  6   P DG  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DC  4   N4    ? ? ? 1_555 C DG  12 O6 ? ? T DC  6   P DG  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DC  4   O2    ? ? ? 1_555 C DG  12 N2 ? ? T DC  6   P DG  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  5   N1    ? ? ? 1_555 C DC  11 N3 ? ? T DG  7   P DC  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  5   N2    ? ? ? 1_555 C DC  11 O2 ? ? T DG  7   P DC  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  5   O6    ? ? ? 1_555 C DC  11 N4 ? ? T DG  7   P DC  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DC  6   N3    ? ? ? 1_555 C DG  10 N1 ? ? T DC  8   P DG  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  6   N4    ? ? ? 1_555 C DG  10 O6 ? ? T DC  8   P DG  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  6   O2    ? ? ? 1_555 C DG  10 N2 ? ? T DC  8   P DG  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  7   N3    ? ? ? 1_555 C DG  9  N1 ? ? T DC  9   P DG  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  7   N4    ? ? ? 1_555 C DG  9  O6 ? ? T DC  9   P DG  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  7   O2    ? ? ? 1_555 C DG  9  N2 ? ? T DC  9   P DG  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  8   N1    ? ? ? 1_555 C DC  8  N3 ? ? T DG  10  P DC  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  8   N2    ? ? ? 1_555 C DC  8  O2 ? ? T DG  10  P DC  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  8   O6    ? ? ? 1_555 C DC  8  N4 ? ? T DG  10  P DC  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  7  N1 ? ? T DC  11  P DG  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  7  O6 ? ? T DC  11  P DG  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  7  N2 ? ? T DC  11  P DG  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DC  10  N3    ? ? ? 1_555 C DG  6  N1 ? ? T DC  12  P DG  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DC  10  N4    ? ? ? 1_555 C DG  6  O6 ? ? T DC  12  P DG  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DC  10  O2    ? ? ? 1_555 C DG  6  N2 ? ? T DC  12  P DG  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DG  11  N1    ? ? ? 1_555 C DC  5  N3 ? ? T DG  13  P DC  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DG  11  N2    ? ? ? 1_555 C DC  5  O2 ? ? T DG  13  P DC  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DG  11  O6    ? ? ? 1_555 C DC  5  N4 ? ? T DG  13  P DC  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DC  12  N3    ? ? ? 1_555 C DG  4  N1 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DC  12  N4    ? ? ? 1_555 C DG  4  O6 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DC  12  O2    ? ? ? 1_555 C DG  4  N2 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DG  13  N1    ? ? ? 1_555 C DC  3  N3 ? ? T DG  15  P DC  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DG  13  N2    ? ? ? 1_555 C DC  3  O2 ? ? T DG  15  P DC  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DG  13  O6    ? ? ? 1_555 C DC  3  N4 ? ? T DG  15  P DC  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DC  14  N3    ? ? ? 1_555 C DG  2  N1 ? ? T DC  16  P DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DC  14  N4    ? ? ? 1_555 C DG  2  O6 ? ? T DC  16  P DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DC  14  O2    ? ? ? 1_555 C DG  2  N2 ? ? T DC  16  P DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 6 ? 
D ? 2 ? 
E ? 2 ? 
F ? 7 ? 
G ? 4 ? 
H ? 3 ? 
I ? 3 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 4   ? ILE A 11  ? PHE A 4   ILE A 11  
A 2 SER A 14  ? ILE A 20  ? SER A 14  ILE A 20  
A 3 GLU A 26  ? VAL A 31  ? GLU A 26  VAL A 31  
B 1 SER A 36  ? HIS A 40  ? SER A 36  HIS A 40  
B 2 PRO A 56  ? LEU A 61  ? PRO A 56  LEU A 61  
B 3 TYR A 49  ? ASP A 51  ? TYR A 49  ASP A 51  
B 4 LYS A 378 ? VAL A 379 ? LYS A 378 VAL A 379 
C 1 ILE A 186 ? PHE A 191 ? ILE A 186 PHE A 191 
C 2 ARG A 145 ? LEU A 151 ? ARG A 145 LEU A 151 
C 3 ILE A 133 ? ASP A 140 ? ILE A 133 ASP A 140 
C 4 VAL A 110 ? VAL A 117 ? VAL A 110 VAL A 117 
C 5 ILE A 212 ? THR A 214 ? ILE A 212 THR A 214 
C 6 SER A 269 ? VAL A 270 ? SER A 269 VAL A 270 
D 1 ASN A 153 ? SER A 154 ? ASN A 153 SER A 154 
D 2 GLY A 157 ? ASN A 158 ? GLY A 157 ASN A 158 
E 1 THR A 248 ? ILE A 253 ? THR A 248 ILE A 253 
E 2 ARG A 260 ? LEU A 265 ? ARG A 260 LEU A 265 
F 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
F 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
F 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
F 4 MET A 683 ? ALA A 689 ? MET A 683 ALA A 689 
F 5 VAL A 407 ? LEU A 412 ? VAL A 407 LEU A 412 
F 6 SER A 624 ? SER A 628 ? SER A 624 SER A 628 
F 7 VAL A 617 ? ASP A 621 ? VAL A 617 ASP A 621 
G 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
G 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
G 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
G 4 THR A 718 ? MET A 728 ? THR A 718 MET A 728 
H 1 ILE A 430 ? THR A 433 ? ILE A 430 THR A 433 
H 2 MET A 461 ? TYR A 463 ? MET A 461 TYR A 463 
H 3 SER A 455 ? SER A 457 ? SER A 455 SER A 457 
I 1 SER A 781 ? SER A 784 ? SER A 781 SER A 784 
I 2 LYS A 829 ? PRO A 834 ? LYS A 829 PRO A 834 
I 3 CYS A 845 ? PRO A 849 ? CYS A 845 PRO A 849 
J 1 ASP A 792 ? VAL A 793 ? ASP A 792 VAL A 793 
J 2 PHE A 796 ? PRO A 797 ? PHE A 796 PRO A 797 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 6   ? N LEU A 6   O ARG A 18  ? O ARG A 18  
A 2 3 N TYR A 19  ? N TYR A 19  O ARG A 27  ? O ARG A 27  
B 1 2 N LEU A 37  ? N LEU A 37  O LYS A 60  ? O LYS A 60  
B 2 3 O CYS A 57  ? O CYS A 57  N TYR A 49  ? N TYR A 49  
B 3 4 N PHE A 50  ? N PHE A 50  O VAL A 379 ? O VAL A 379 
C 1 2 O ILE A 187 ? O ILE A 187 N PHE A 146 ? N PHE A 146 
C 2 3 O PHE A 149 ? O PHE A 149 N ILE A 136 ? N ILE A 136 
C 3 4 O TYR A 139 ? O TYR A 139 N ASN A 112 ? N ASN A 112 
C 4 5 N ALA A 111 ? N ALA A 111 O THR A 214 ? O THR A 214 
C 5 6 N LEU A 213 ? N LEU A 213 O SER A 269 ? O SER A 269 
D 1 2 N SER A 154 ? N SER A 154 O GLY A 157 ? O GLY A 157 
E 1 2 N ARG A 249 ? N ARG A 249 O THR A 264 ? O THR A 264 
F 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
F 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
F 3 4 O TRP A 713 ? O TRP A 713 N ILE A 688 ? N ILE A 688 
F 4 5 O ALA A 689 ? O ALA A 689 N VAL A 407 ? N VAL A 407 
F 5 6 N MET A 408 ? N MET A 408 O VAL A 627 ? O VAL A 627 
F 6 7 O TYR A 626 ? O TYR A 626 N TYR A 619 ? N TYR A 619 
G 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
G 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
G 3 4 N TYR A 708 ? N TYR A 708 O MET A 728 ? O MET A 728 
H 1 2 N ALA A 431 ? N ALA A 431 O MET A 462 ? O MET A 462 
H 2 3 O TYR A 463 ? O TYR A 463 N SER A 455 ? N SER A 455 
I 1 2 N SER A 783 ? N SER A 783 O VAL A 830 ? O VAL A 830 
I 2 3 N TYR A 831 ? N TYR A 831 O TRP A 848 ? O TRP A 848 
J 1 2 N VAL A 793 ? N VAL A 793 O PHE A 796 ? O PHE A 796 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE TTP A 903' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 904'  
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA A 905'  
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA A 906'  
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA A 907'  
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA A 908'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 ASP A 411 ? ASP A 411  . ? 1_555 ? 
2  AC1 17 LEU A 412 ? LEU A 412  . ? 1_555 ? 
3  AC1 17 SER A 414 ? SER A 414  . ? 1_555 ? 
4  AC1 17 LEU A 415 ? LEU A 415  . ? 1_555 ? 
5  AC1 17 TYR A 416 ? TYR A 416  . ? 1_555 ? 
6  AC1 17 ARG A 482 ? ARG A 482  . ? 1_555 ? 
7  AC1 17 LYS A 560 ? LYS A 560  . ? 1_555 ? 
8  AC1 17 ASN A 564 ? ASN A 564  . ? 1_555 ? 
9  AC1 17 ASP A 623 ? ASP A 623  . ? 1_555 ? 
10 AC1 17 CA  E .   ? CA  A 904  . ? 1_555 ? 
11 AC1 17 CA  F .   ? CA  A 905  . ? 1_555 ? 
12 AC1 17 HOH J .   ? HOH A 987  . ? 1_555 ? 
13 AC1 17 HOH J .   ? HOH A 1065 . ? 1_555 ? 
14 AC1 17 HOH J .   ? HOH A 1097 . ? 1_555 ? 
15 AC1 17 2DA C 13  ? 2DA P 115  . ? 1_555 ? 
16 AC1 17 2PR B 2   ? 2PR T 4    . ? 1_555 ? 
17 AC1 17 DT  B 3   ? DT  T 5    . ? 1_555 ? 
18 AC2 4  ASP A 411 ? ASP A 411  . ? 1_555 ? 
19 AC2 4  LEU A 412 ? LEU A 412  . ? 1_555 ? 
20 AC2 4  ASP A 623 ? ASP A 623  . ? 1_555 ? 
21 AC2 4  TTP D .   ? TTP A 903  . ? 1_555 ? 
22 AC3 3  ASP A 411 ? ASP A 411  . ? 1_555 ? 
23 AC3 3  ASP A 623 ? ASP A 623  . ? 1_555 ? 
24 AC3 3  TTP D .   ? TTP A 903  . ? 1_555 ? 
25 AC4 3  ASN A 505 ? ASN A 505  . ? 1_555 ? 
26 AC4 3  ASN A 507 ? ASN A 507  . ? 1_555 ? 
27 AC4 3  LYS A 531 ? LYS A 531  . ? 1_555 ? 
28 AC5 3  ASP A 411 ? ASP A 411  . ? 1_555 ? 
29 AC5 3  GLU A 716 ? GLU A 716  . ? 1_555 ? 
30 AC5 3  HOH J .   ? HOH A 1076 . ? 1_555 ? 
31 AC6 2  GLU A 116 ? GLU A 116  . ? 1_555 ? 
32 AC6 2  HOH J .   ? HOH A 961  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3SQ4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3SQ4 
_atom_sites.fract_transf_matrix[1][1]   0.013391 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008301 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007634 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? 37.986  -17.990 -35.463 1.00 55.95  ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? 36.652  -17.590 -35.999 1.00 55.67  ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? 36.412  -16.086 -35.864 1.00 52.56  ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? 37.105  -15.397 -35.108 1.00 49.84  ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? 35.527  -18.386 -35.318 1.00 57.44  ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? 35.441  -18.222 -33.794 1.00 63.51  ? 1    MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? 33.927  -18.898 -33.051 1.00 68.14  ? 1    MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? 32.677  -17.848 -33.789 1.00 67.24  ? 1    MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? 35.435  -15.585 -36.618 1.00 51.21  ? 2    LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? 35.037  -14.187 -36.528 1.00 48.55  ? 2    LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? 34.271  -13.932 -35.235 1.00 44.71  ? 2    LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? 33.320  -14.646 -34.910 1.00 43.67  ? 2    LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? 34.209  -13.759 -37.749 1.00 50.69  ? 2    LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? 35.023  -13.116 -38.878 1.00 56.01  ? 2    LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? 35.772  -11.872 -38.392 1.00 60.32  ? 2    LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? 36.656  -11.257 -39.476 1.00 61.91  ? 2    LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? 35.929  -10.246 -40.301 1.00 62.51  ? 2    LYS A NZ    1 
ATOM   18   N  N     . GLU A 1 3   ? 34.713  -12.917 -34.501 1.00 40.52  ? 3    GLU A N     1 
ATOM   19   C  CA    . GLU A 1 3   ? 34.074  -12.509 -33.260 1.00 38.32  ? 3    GLU A CA    1 
ATOM   20   C  C     . GLU A 1 3   ? 32.646  -12.001 -33.478 1.00 35.26  ? 3    GLU A C     1 
ATOM   21   O  O     . GLU A 1 3   ? 32.346  -11.386 -34.501 1.00 34.04  ? 3    GLU A O     1 
ATOM   22   C  CB    . GLU A 1 3   ? 34.918  -11.442 -32.555 1.00 38.33  ? 3    GLU A CB    1 
ATOM   23   C  CG    . GLU A 1 3   ? 36.365  -11.862 -32.352 1.00 41.87  ? 3    GLU A CG    1 
ATOM   24   C  CD    . GLU A 1 3   ? 37.081  -11.088 -31.259 1.00 45.07  ? 3    GLU A CD    1 
ATOM   25   O  OE1   . GLU A 1 3   ? 38.099  -11.606 -30.746 1.00 49.35  ? 3    GLU A OE1   1 
ATOM   26   O  OE2   . GLU A 1 3   ? 36.642  -9.971  -30.913 1.00 45.18  ? 3    GLU A OE2   1 
ATOM   27   N  N     . PHE A 1 4   ? 31.771  -12.298 -32.519 1.00 31.20  ? 4    PHE A N     1 
ATOM   28   C  CA    . PHE A 1 4   ? 30.427  -11.730 -32.479 1.00 27.95  ? 4    PHE A CA    1 
ATOM   29   C  C     . PHE A 1 4   ? 29.980  -11.415 -31.061 1.00 25.97  ? 4    PHE A C     1 
ATOM   30   O  O     . PHE A 1 4   ? 30.347  -12.103 -30.112 1.00 24.24  ? 4    PHE A O     1 
ATOM   31   C  CB    . PHE A 1 4   ? 29.403  -12.626 -33.188 1.00 26.36  ? 4    PHE A CB    1 
ATOM   32   C  CG    . PHE A 1 4   ? 29.253  -13.996 -32.587 1.00 26.76  ? 4    PHE A CG    1 
ATOM   33   C  CD1   . PHE A 1 4   ? 30.158  -15.007 -32.888 1.00 25.19  ? 4    PHE A CD1   1 
ATOM   34   C  CD2   . PHE A 1 4   ? 28.178  -14.288 -31.752 1.00 23.29  ? 4    PHE A CD2   1 
ATOM   35   C  CE1   . PHE A 1 4   ? 30.009  -16.287 -32.343 1.00 25.44  ? 4    PHE A CE1   1 
ATOM   36   C  CE2   . PHE A 1 4   ? 28.023  -15.566 -31.204 1.00 23.59  ? 4    PHE A CE2   1 
ATOM   37   C  CZ    . PHE A 1 4   ? 28.940  -16.565 -31.506 1.00 24.52  ? 4    PHE A CZ    1 
ATOM   38   N  N     . TYR A 1 5   ? 29.184  -10.362 -30.932 1.00 25.68  ? 5    TYR A N     1 
ATOM   39   C  CA    . TYR A 1 5   ? 28.619  -9.976  -29.648 1.00 24.86  ? 5    TYR A CA    1 
ATOM   40   C  C     . TYR A 1 5   ? 27.548  -10.940 -29.166 1.00 22.48  ? 5    TYR A C     1 
ATOM   41   O  O     . TYR A 1 5   ? 26.964  -11.686 -29.946 1.00 22.28  ? 5    TYR A O     1 
ATOM   42   C  CB    . TYR A 1 5   ? 28.057  -8.549  -29.709 1.00 24.23  ? 5    TYR A CB    1 
ATOM   43   C  CG    . TYR A 1 5   ? 26.802  -8.381  -30.547 1.00 24.70  ? 5    TYR A CG    1 
ATOM   44   C  CD1   . TYR A 1 5   ? 26.883  -8.064  -31.900 1.00 23.32  ? 5    TYR A CD1   1 
ATOM   45   C  CD2   . TYR A 1 5   ? 25.530  -8.514  -29.976 1.00 24.10  ? 5    TYR A CD2   1 
ATOM   46   C  CE1   . TYR A 1 5   ? 25.730  -7.888  -32.667 1.00 26.74  ? 5    TYR A CE1   1 
ATOM   47   C  CE2   . TYR A 1 5   ? 24.373  -8.337  -30.734 1.00 26.35  ? 5    TYR A CE2   1 
ATOM   48   C  CZ    . TYR A 1 5   ? 24.484  -8.028  -32.081 1.00 25.86  ? 5    TYR A CZ    1 
ATOM   49   O  OH    . TYR A 1 5   ? 23.356  -7.853  -32.844 1.00 26.77  ? 5    TYR A OH    1 
ATOM   50   N  N     . LEU A 1 6   ? 27.305  -10.914 -27.863 1.00 24.00  ? 6    LEU A N     1 
ATOM   51   C  CA    . LEU A 1 6   ? 26.213  -11.663 -27.262 1.00 23.07  ? 6    LEU A CA    1 
ATOM   52   C  C     . LEU A 1 6   ? 25.183  -10.673 -26.753 1.00 22.07  ? 6    LEU A C     1 
ATOM   53   O  O     . LEU A 1 6   ? 24.014  -10.758 -27.109 1.00 21.39  ? 6    LEU A O     1 
ATOM   54   C  CB    . LEU A 1 6   ? 26.724  -12.543 -26.126 1.00 22.50  ? 6    LEU A CB    1 
ATOM   55   C  CG    . LEU A 1 6   ? 27.642  -13.716 -26.485 1.00 25.35  ? 6    LEU A CG    1 
ATOM   56   C  CD1   . LEU A 1 6   ? 28.306  -14.222 -25.229 1.00 24.77  ? 6    LEU A CD1   1 
ATOM   57   C  CD2   . LEU A 1 6   ? 26.878  -14.849 -27.169 1.00 23.81  ? 6    LEU A CD2   1 
ATOM   58   N  N     . THR A 1 7   ? 25.626  -9.732  -25.921 1.00 23.12  ? 7    THR A N     1 
ATOM   59   C  CA    . THR A 1 7   ? 24.755  -8.692  -25.385 1.00 22.73  ? 7    THR A CA    1 
ATOM   60   C  C     . THR A 1 7   ? 25.525  -7.391  -25.293 1.00 24.37  ? 7    THR A C     1 
ATOM   61   O  O     . THR A 1 7   ? 26.757  -7.399  -25.199 1.00 27.52  ? 7    THR A O     1 
ATOM   62   C  CB    . THR A 1 7   ? 24.241  -9.031  -23.965 1.00 23.43  ? 7    THR A CB    1 
ATOM   63   O  OG1   . THR A 1 7   ? 25.336  -8.993  -23.044 1.00 26.05  ? 7    THR A OG1   1 
ATOM   64   C  CG2   . THR A 1 7   ? 23.562  -10.413 -23.918 1.00 17.73  ? 7    THR A CG2   1 
ATOM   65   N  N     . VAL A 1 8   ? 24.802  -6.276  -25.307 1.00 22.12  ? 8    VAL A N     1 
ATOM   66   C  CA    . VAL A 1 8   ? 25.417  -4.965  -25.182 1.00 24.33  ? 8    VAL A CA    1 
ATOM   67   C  C     . VAL A 1 8   ? 24.491  -4.058  -24.387 1.00 26.55  ? 8    VAL A C     1 
ATOM   68   O  O     . VAL A 1 8   ? 23.277  -4.110  -24.557 1.00 28.90  ? 8    VAL A O     1 
ATOM   69   C  CB    . VAL A 1 8   ? 25.756  -4.345  -26.574 1.00 25.30  ? 8    VAL A CB    1 
ATOM   70   C  CG1   . VAL A 1 8   ? 24.485  -3.958  -27.340 1.00 26.72  ? 8    VAL A CG1   1 
ATOM   71   C  CG2   . VAL A 1 8   ? 26.672  -3.148  -26.425 1.00 23.46  ? 8    VAL A CG2   1 
ATOM   72   N  N     . GLU A 1 9   ? 25.072  -3.248  -23.507 1.00 27.22  ? 9    GLU A N     1 
ATOM   73   C  CA    . GLU A 1 9   ? 24.319  -2.297  -22.706 1.00 28.76  ? 9    GLU A CA    1 
ATOM   74   C  C     . GLU A 1 9   ? 25.104  -1.003  -22.527 1.00 28.21  ? 9    GLU A C     1 
ATOM   75   O  O     . GLU A 1 9   ? 26.333  -1.019  -22.454 1.00 29.81  ? 9    GLU A O     1 
ATOM   76   C  CB    . GLU A 1 9   ? 24.020  -2.876  -21.316 1.00 28.49  ? 9    GLU A CB    1 
ATOM   77   C  CG    . GLU A 1 9   ? 23.318  -4.230  -21.308 1.00 32.07  ? 9    GLU A CG    1 
ATOM   78   C  CD    . GLU A 1 9   ? 21.813  -4.158  -21.555 1.00 31.60  ? 9    GLU A CD    1 
ATOM   79   O  OE1   . GLU A 1 9   ? 21.278  -3.060  -21.834 1.00 29.90  ? 9    GLU A OE1   1 
ATOM   80   O  OE2   . GLU A 1 9   ? 21.162  -5.222  -21.463 1.00 33.13  ? 9    GLU A OE2   1 
ATOM   81   N  N     . GLN A 1 10  ? 24.389  0.111   -22.447 1.00 27.67  ? 10   GLN A N     1 
ATOM   82   C  CA    . GLN A 1 10  ? 24.980  1.359   -21.990 1.00 28.74  ? 10   GLN A CA    1 
ATOM   83   C  C     . GLN A 1 10  ? 24.687  1.537   -20.509 1.00 31.09  ? 10   GLN A C     1 
ATOM   84   O  O     . GLN A 1 10  ? 23.527  1.505   -20.095 1.00 33.21  ? 10   GLN A O     1 
ATOM   85   C  CB    . GLN A 1 10  ? 24.422  2.553   -22.769 1.00 28.31  ? 10   GLN A CB    1 
ATOM   86   C  CG    . GLN A 1 10  ? 25.122  3.862   -22.417 1.00 30.46  ? 10   GLN A CG    1 
ATOM   87   C  CD    . GLN A 1 10  ? 24.472  5.100   -23.017 1.00 35.37  ? 10   GLN A CD    1 
ATOM   88   O  OE1   . GLN A 1 10  ? 23.707  5.025   -23.986 1.00 33.54  ? 10   GLN A OE1   1 
ATOM   89   N  NE2   . GLN A 1 10  ? 24.788  6.258   -22.441 1.00 37.01  ? 10   GLN A NE2   1 
ATOM   90   N  N     . ILE A 1 11  ? 25.737  1.712   -19.712 1.00 33.76  ? 11   ILE A N     1 
ATOM   91   C  CA    . ILE A 1 11  ? 25.584  2.120   -18.318 1.00 35.34  ? 11   ILE A CA    1 
ATOM   92   C  C     . ILE A 1 11  ? 26.456  3.350   -18.044 1.00 35.99  ? 11   ILE A C     1 
ATOM   93   O  O     . ILE A 1 11  ? 27.686  3.258   -17.912 1.00 34.36  ? 11   ILE A O     1 
ATOM   94   C  CB    . ILE A 1 11  ? 25.866  0.963   -17.322 1.00 37.12  ? 11   ILE A CB    1 
ATOM   95   C  CG1   . ILE A 1 11  ? 24.869  -0.188  -17.544 1.00 39.93  ? 11   ILE A CG1   1 
ATOM   96   C  CG2   . ILE A 1 11  ? 25.781  1.461   -15.879 1.00 38.06  ? 11   ILE A CG2   1 
ATOM   97   C  CD1   . ILE A 1 11  ? 25.325  -1.545  -17.006 1.00 42.33  ? 11   ILE A CD1   1 
ATOM   98   N  N     . GLY A 1 12  ? 25.796  4.505   -17.972 1.00 37.26  ? 12   GLY A N     1 
ATOM   99   C  CA    . GLY A 1 12  ? 26.480  5.789   -17.841 1.00 37.63  ? 12   GLY A CA    1 
ATOM   100  C  C     . GLY A 1 12  ? 27.378  6.033   -19.038 1.00 36.89  ? 12   GLY A C     1 
ATOM   101  O  O     . GLY A 1 12  ? 26.909  6.084   -20.178 1.00 37.96  ? 12   GLY A O     1 
ATOM   102  N  N     . ASP A 1 13  ? 28.675  6.157   -18.774 1.00 35.93  ? 13   ASP A N     1 
ATOM   103  C  CA    . ASP A 1 13  ? 29.663  6.420   -19.815 1.00 34.95  ? 13   ASP A CA    1 
ATOM   104  C  C     . ASP A 1 13  ? 30.404  5.160   -20.236 1.00 34.28  ? 13   ASP A C     1 
ATOM   105  O  O     . ASP A 1 13  ? 31.426  5.223   -20.914 1.00 33.26  ? 13   ASP A O     1 
ATOM   106  C  CB    . ASP A 1 13  ? 30.643  7.503   -19.358 1.00 36.49  ? 13   ASP A CB    1 
ATOM   107  C  CG    . ASP A 1 13  ? 30.023  8.879   -19.363 1.00 37.09  ? 13   ASP A CG    1 
ATOM   108  O  OD1   . ASP A 1 13  ? 30.403  9.719   -18.518 1.00 43.42  ? 13   ASP A OD1   1 
ATOM   109  O  OD2   . ASP A 1 13  ? 29.146  9.119   -20.215 1.00 39.59  ? 13   ASP A OD2   1 
ATOM   110  N  N     . SER A 1 14  ? 29.865  4.010   -19.851 1.00 35.05  ? 14   SER A N     1 
ATOM   111  C  CA    . SER A 1 14  ? 30.460  2.739   -20.216 1.00 34.15  ? 14   SER A CA    1 
ATOM   112  C  C     . SER A 1 14  ? 29.524  1.915   -21.086 1.00 33.18  ? 14   SER A C     1 
ATOM   113  O  O     . SER A 1 14  ? 28.305  1.905   -20.882 1.00 30.71  ? 14   SER A O     1 
ATOM   114  C  CB    . SER A 1 14  ? 30.857  1.957   -18.959 1.00 37.00  ? 14   SER A CB    1 
ATOM   115  O  OG    . SER A 1 14  ? 32.093  2.429   -18.428 1.00 39.79  ? 14   SER A OG    1 
ATOM   116  N  N     . ILE A 1 15  ? 30.107  1.258   -22.083 1.00 31.68  ? 15   ILE A N     1 
ATOM   117  C  CA    . ILE A 1 15  ? 29.452  0.160   -22.766 1.00 29.70  ? 15   ILE A CA    1 
ATOM   118  C  C     . ILE A 1 15  ? 29.868  -1.119  -22.052 1.00 30.30  ? 15   ILE A C     1 
ATOM   119  O  O     . ILE A 1 15  ? 31.054  -1.344  -21.810 1.00 31.45  ? 15   ILE A O     1 
ATOM   120  C  CB    . ILE A 1 15  ? 29.845  0.096   -24.270 1.00 29.59  ? 15   ILE A CB    1 
ATOM   121  C  CG1   . ILE A 1 15  ? 29.225  1.263   -25.061 1.00 28.17  ? 15   ILE A CG1   1 
ATOM   122  C  CG2   . ILE A 1 15  ? 29.447  -1.248  -24.890 1.00 29.30  ? 15   ILE A CG2   1 
ATOM   123  C  CD1   . ILE A 1 15  ? 27.695  1.398   -24.926 1.00 27.35  ? 15   ILE A CD1   1 
ATOM   124  N  N     . PHE A 1 16  ? 28.894  -1.944  -21.690 1.00 29.40  ? 16   PHE A N     1 
ATOM   125  C  CA    . PHE A 1 16  ? 29.194  -3.272  -21.173 1.00 27.47  ? 16   PHE A CA    1 
ATOM   126  C  C     . PHE A 1 16  ? 28.833  -4.273  -22.253 1.00 27.77  ? 16   PHE A C     1 
ATOM   127  O  O     . PHE A 1 16  ? 27.681  -4.334  -22.698 1.00 26.87  ? 16   PHE A O     1 
ATOM   128  C  CB    . PHE A 1 16  ? 28.422  -3.556  -19.881 1.00 28.00  ? 16   PHE A CB    1 
ATOM   129  C  CG    . PHE A 1 16  ? 28.984  -2.858  -18.669 1.00 32.56  ? 16   PHE A CG    1 
ATOM   130  C  CD1   . PHE A 1 16  ? 29.835  -3.531  -17.797 1.00 34.37  ? 16   PHE A CD1   1 
ATOM   131  C  CD2   . PHE A 1 16  ? 28.669  -1.528  -18.402 1.00 32.45  ? 16   PHE A CD2   1 
ATOM   132  C  CE1   . PHE A 1 16  ? 30.364  -2.889  -16.675 1.00 34.83  ? 16   PHE A CE1   1 
ATOM   133  C  CE2   . PHE A 1 16  ? 29.191  -0.878  -17.284 1.00 35.75  ? 16   PHE A CE2   1 
ATOM   134  C  CZ    . PHE A 1 16  ? 30.042  -1.562  -16.418 1.00 36.42  ? 16   PHE A CZ    1 
ATOM   135  N  N     . GLU A 1 17  ? 29.823  -5.050  -22.681 1.00 27.29  ? 17   GLU A N     1 
ATOM   136  C  CA    . GLU A 1 17  ? 29.621  -5.993  -23.762 1.00 26.67  ? 17   GLU A CA    1 
ATOM   137  C  C     . GLU A 1 17  ? 30.024  -7.406  -23.358 1.00 27.70  ? 17   GLU A C     1 
ATOM   138  O  O     . GLU A 1 17  ? 31.117  -7.625  -22.839 1.00 30.13  ? 17   GLU A O     1 
ATOM   139  C  CB    . GLU A 1 17  ? 30.401  -5.566  -25.012 1.00 26.20  ? 17   GLU A CB    1 
ATOM   140  C  CG    . GLU A 1 17  ? 30.017  -6.372  -26.254 1.00 26.57  ? 17   GLU A CG    1 
ATOM   141  C  CD    . GLU A 1 17  ? 31.048  -6.341  -27.365 1.00 27.31  ? 17   GLU A CD    1 
ATOM   142  O  OE1   . GLU A 1 17  ? 30.781  -6.959  -28.415 1.00 27.13  ? 17   GLU A OE1   1 
ATOM   143  O  OE2   . GLU A 1 17  ? 32.120  -5.727  -27.197 1.00 26.94  ? 17   GLU A OE2   1 
ATOM   144  N  N     . ARG A 1 18  ? 29.126  -8.357  -23.592 1.00 26.05  ? 18   ARG A N     1 
ATOM   145  C  CA    . ARG A 1 18  ? 29.478  -9.768  -23.560 1.00 22.89  ? 18   ARG A CA    1 
ATOM   146  C  C     . ARG A 1 18  ? 29.597  -10.198 -25.014 1.00 24.26  ? 18   ARG A C     1 
ATOM   147  O  O     . ARG A 1 18  ? 28.793  -9.786  -25.854 1.00 22.34  ? 18   ARG A O     1 
ATOM   148  C  CB    . ARG A 1 18  ? 28.419  -10.592 -22.820 1.00 22.29  ? 18   ARG A CB    1 
ATOM   149  C  CG    . ARG A 1 18  ? 28.228  -10.174 -21.346 1.00 23.00  ? 18   ARG A CG    1 
ATOM   150  C  CD    . ARG A 1 18  ? 26.976  -10.810 -20.736 1.00 24.76  ? 18   ARG A CD    1 
ATOM   151  N  NE    . ARG A 1 18  ? 27.099  -12.267 -20.602 1.00 23.30  ? 18   ARG A NE    1 
ATOM   152  C  CZ    . ARG A 1 18  ? 26.073  -13.103 -20.465 1.00 22.25  ? 18   ARG A CZ    1 
ATOM   153  N  NH1   . ARG A 1 18  ? 24.828  -12.636 -20.443 1.00 20.80  ? 18   ARG A NH1   1 
ATOM   154  N  NH2   . ARG A 1 18  ? 26.287  -14.413 -20.351 1.00 20.18  ? 18   ARG A NH2   1 
ATOM   155  N  N     . TYR A 1 19  ? 30.616  -10.999 -25.317 1.00 25.20  ? 19   TYR A N     1 
ATOM   156  C  CA    . TYR A 1 19  ? 30.899  -11.386 -26.695 1.00 24.94  ? 19   TYR A CA    1 
ATOM   157  C  C     . TYR A 1 19  ? 31.652  -12.704 -26.745 1.00 27.10  ? 19   TYR A C     1 
ATOM   158  O  O     . TYR A 1 19  ? 32.174  -13.181 -25.729 1.00 27.33  ? 19   TYR A O     1 
ATOM   159  C  CB    . TYR A 1 19  ? 31.697  -10.290 -27.410 1.00 26.81  ? 19   TYR A CB    1 
ATOM   160  C  CG    . TYR A 1 19  ? 33.113  -10.105 -26.902 1.00 27.78  ? 19   TYR A CG    1 
ATOM   161  C  CD1   . TYR A 1 19  ? 33.367  -9.459  -25.690 1.00 29.21  ? 19   TYR A CD1   1 
ATOM   162  C  CD2   . TYR A 1 19  ? 34.204  -10.583 -27.635 1.00 30.41  ? 19   TYR A CD2   1 
ATOM   163  C  CE1   . TYR A 1 19  ? 34.680  -9.290  -25.221 1.00 30.66  ? 19   TYR A CE1   1 
ATOM   164  C  CE2   . TYR A 1 19  ? 35.518  -10.417 -27.177 1.00 27.22  ? 19   TYR A CE2   1 
ATOM   165  C  CZ    . TYR A 1 19  ? 35.745  -9.769  -25.976 1.00 28.41  ? 19   TYR A CZ    1 
ATOM   166  O  OH    . TYR A 1 19  ? 37.034  -9.614  -25.528 1.00 31.58  ? 19   TYR A OH    1 
ATOM   167  N  N     . ILE A 1 20  ? 31.681  -13.290 -27.935 1.00 26.58  ? 20   ILE A N     1 
ATOM   168  C  CA    . ILE A 1 20  ? 32.455  -14.480 -28.203 1.00 27.98  ? 20   ILE A CA    1 
ATOM   169  C  C     . ILE A 1 20  ? 33.706  -14.054 -28.965 1.00 30.53  ? 20   ILE A C     1 
ATOM   170  O  O     . ILE A 1 20  ? 33.617  -13.446 -30.040 1.00 28.70  ? 20   ILE A O     1 
ATOM   171  C  CB    . ILE A 1 20  ? 31.634  -15.520 -29.026 1.00 27.47  ? 20   ILE A CB    1 
ATOM   172  C  CG1   . ILE A 1 20  ? 30.409  -16.000 -28.233 1.00 23.91  ? 20   ILE A CG1   1 
ATOM   173  C  CG2   . ILE A 1 20  ? 32.522  -16.686 -29.472 1.00 26.06  ? 20   ILE A CG2   1 
ATOM   174  C  CD1   . ILE A 1 20  ? 30.723  -16.785 -26.952 1.00 27.03  ? 20   ILE A CD1   1 
ATOM   175  N  N     . ASP A 1 21  ? 34.869  -14.367 -28.398 1.00 31.88  ? 21   ASP A N     1 
ATOM   176  C  CA    . ASP A 1 21  ? 36.132  -13.945 -28.985 1.00 33.42  ? 21   ASP A CA    1 
ATOM   177  C  C     . ASP A 1 21  ? 36.553  -14.845 -30.149 1.00 35.50  ? 21   ASP A C     1 
ATOM   178  O  O     . ASP A 1 21  ? 35.887  -15.843 -30.455 1.00 33.12  ? 21   ASP A O     1 
ATOM   179  C  CB    . ASP A 1 21  ? 37.231  -13.840 -27.915 1.00 33.30  ? 21   ASP A CB    1 
ATOM   180  C  CG    . ASP A 1 21  ? 37.665  -15.197 -27.353 1.00 33.85  ? 21   ASP A CG    1 
ATOM   181  O  OD1   . ASP A 1 21  ? 37.307  -16.264 -27.906 1.00 32.64  ? 21   ASP A OD1   1 
ATOM   182  O  OD2   . ASP A 1 21  ? 38.387  -15.185 -26.336 1.00 33.16  ? 21   ASP A OD2   1 
ATOM   183  N  N     . SER A 1 22  ? 37.670  -14.485 -30.778 1.00 37.72  ? 22   SER A N     1 
ATOM   184  C  CA    . SER A 1 22  ? 38.202  -15.204 -31.935 1.00 40.63  ? 22   SER A CA    1 
ATOM   185  C  C     . SER A 1 22  ? 38.489  -16.688 -31.669 1.00 42.42  ? 22   SER A C     1 
ATOM   186  O  O     . SER A 1 22  ? 38.665  -17.461 -32.607 1.00 43.49  ? 22   SER A O     1 
ATOM   187  C  CB    . SER A 1 22  ? 39.462  -14.506 -32.443 1.00 41.30  ? 22   SER A CB    1 
ATOM   188  O  OG    . SER A 1 22  ? 40.429  -14.405 -31.411 1.00 46.42  ? 22   SER A OG    1 
ATOM   189  N  N     . ASN A 1 23  ? 38.518  -17.082 -30.398 1.00 43.71  ? 23   ASN A N     1 
ATOM   190  C  CA    . ASN A 1 23  ? 38.765  -18.477 -30.026 1.00 45.08  ? 23   ASN A CA    1 
ATOM   191  C  C     . ASN A 1 23  ? 37.506  -19.248 -29.654 1.00 44.53  ? 23   ASN A C     1 
ATOM   192  O  O     . ASN A 1 23  ? 37.564  -20.448 -29.366 1.00 46.06  ? 23   ASN A O     1 
ATOM   193  C  CB    . ASN A 1 23  ? 39.788  -18.549 -28.892 1.00 46.56  ? 23   ASN A CB    1 
ATOM   194  C  CG    . ASN A 1 23  ? 41.163  -18.101 -29.332 1.00 48.28  ? 23   ASN A CG    1 
ATOM   195  O  OD1   . ASN A 1 23  ? 41.716  -18.634 -30.290 1.00 48.52  ? 23   ASN A OD1   1 
ATOM   196  N  ND2   . ASN A 1 23  ? 41.716  -17.109 -28.644 1.00 49.42  ? 23   ASN A ND2   1 
ATOM   197  N  N     . GLY A 1 24  ? 36.369  -18.558 -29.666 1.00 42.00  ? 24   GLY A N     1 
ATOM   198  C  CA    . GLY A 1 24  ? 35.099  -19.178 -29.324 1.00 39.12  ? 24   GLY A CA    1 
ATOM   199  C  C     . GLY A 1 24  ? 34.800  -19.124 -27.839 1.00 37.79  ? 24   GLY A C     1 
ATOM   200  O  O     . GLY A 1 24  ? 33.897  -19.808 -27.354 1.00 36.29  ? 24   GLY A O     1 
ATOM   201  N  N     . ARG A 1 25  ? 35.565  -18.310 -27.119 1.00 36.43  ? 25   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 25  ? 35.356  -18.113 -25.690 1.00 35.94  ? 25   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 25  ? 34.446  -16.919 -25.432 1.00 32.45  ? 25   ARG A C     1 
ATOM   204  O  O     . ARG A 1 25  ? 34.556  -15.895 -26.104 1.00 31.11  ? 25   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 25  ? 36.696  -17.879 -24.982 1.00 37.48  ? 25   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 25  ? 37.422  -19.140 -24.519 1.00 40.94  ? 25   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 25  ? 38.326  -19.728 -25.594 1.00 40.81  ? 25   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 25  ? 39.253  -20.710 -25.031 1.00 40.02  ? 25   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 25  ? 40.496  -20.444 -24.630 1.00 36.67  ? 25   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 25  ? 40.996  -19.216 -24.728 1.00 34.80  ? 25   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 25  ? 41.242  -21.416 -24.124 1.00 34.46  ? 25   ARG A NH2   1 
ATOM   212  N  N     . GLU A 1 26  ? 33.556  -17.059 -24.454 1.00 31.31  ? 26   GLU A N     1 
ATOM   213  C  CA    . GLU A 1 26  ? 32.764  -15.936 -23.959 1.00 31.00  ? 26   GLU A CA    1 
ATOM   214  C  C     . GLU A 1 26  ? 33.613  -15.017 -23.075 1.00 31.67  ? 26   GLU A C     1 
ATOM   215  O  O     . GLU A 1 26  ? 34.304  -15.488 -22.167 1.00 30.50  ? 26   GLU A O     1 
ATOM   216  C  CB    . GLU A 1 26  ? 31.530  -16.426 -23.186 1.00 30.94  ? 26   GLU A CB    1 
ATOM   217  C  CG    . GLU A 1 26  ? 30.651  -15.282 -22.642 1.00 30.06  ? 26   GLU A CG    1 
ATOM   218  C  CD    . GLU A 1 26  ? 29.374  -15.751 -21.952 1.00 32.89  ? 26   GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1 26  ? 28.941  -16.907 -22.178 1.00 30.93  ? 26   GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1 26  ? 28.796  -14.945 -21.185 1.00 31.39  ? 26   GLU A OE2   1 
ATOM   221  N  N     . ARG A 1 27  ? 33.552  -13.713 -23.355 1.00 31.41  ? 27   ARG A N     1 
ATOM   222  C  CA    . ARG A 1 27  ? 34.249  -12.700 -22.563 1.00 32.86  ? 27   ARG A CA    1 
ATOM   223  C  C     . ARG A 1 27  ? 33.316  -11.545 -22.223 1.00 31.90  ? 27   ARG A C     1 
ATOM   224  O  O     . ARG A 1 27  ? 32.229  -11.426 -22.784 1.00 32.26  ? 27   ARG A O     1 
ATOM   225  C  CB    . ARG A 1 27  ? 35.456  -12.138 -23.327 1.00 37.12  ? 27   ARG A CB    1 
ATOM   226  C  CG    . ARG A 1 27  ? 36.387  -13.159 -23.963 1.00 44.48  ? 27   ARG A CG    1 
ATOM   227  C  CD    . ARG A 1 27  ? 37.468  -13.614 -23.015 1.00 53.78  ? 27   ARG A CD    1 
ATOM   228  N  NE    . ARG A 1 27  ? 38.742  -13.737 -23.720 1.00 64.74  ? 27   ARG A NE    1 
ATOM   229  C  CZ    . ARG A 1 27  ? 39.673  -12.786 -23.764 1.00 68.62  ? 27   ARG A CZ    1 
ATOM   230  N  NH1   . ARG A 1 27  ? 39.490  -11.632 -23.126 1.00 66.42  ? 27   ARG A NH1   1 
ATOM   231  N  NH2   . ARG A 1 27  ? 40.798  -12.994 -24.439 1.00 70.67  ? 27   ARG A NH2   1 
ATOM   232  N  N     . THR A 1 28  ? 33.761  -10.686 -21.313 1.00 31.96  ? 28   THR A N     1 
ATOM   233  C  CA    . THR A 1 28  ? 33.050  -9.465  -20.981 1.00 34.75  ? 28   THR A CA    1 
ATOM   234  C  C     . THR A 1 28  ? 34.059  -8.331  -20.964 1.00 35.58  ? 28   THR A C     1 
ATOM   235  O  O     . THR A 1 28  ? 35.205  -8.518  -20.557 1.00 37.37  ? 28   THR A O     1 
ATOM   236  C  CB    . THR A 1 28  ? 32.365  -9.553  -19.597 1.00 36.76  ? 28   THR A CB    1 
ATOM   237  O  OG1   . THR A 1 28  ? 31.774  -10.847 -19.432 1.00 42.00  ? 28   THR A OG1   1 
ATOM   238  C  CG2   . THR A 1 28  ? 31.282  -8.478  -19.446 1.00 34.11  ? 28   THR A CG2   1 
ATOM   239  N  N     . ARG A 1 29  ? 33.637  -7.159  -21.421 1.00 33.92  ? 29   ARG A N     1 
ATOM   240  C  CA    . ARG A 1 29  ? 34.485  -5.980  -21.361 1.00 35.10  ? 29   ARG A CA    1 
ATOM   241  C  C     . ARG A 1 29  ? 33.669  -4.720  -21.107 1.00 36.40  ? 29   ARG A C     1 
ATOM   242  O  O     . ARG A 1 29  ? 32.480  -4.648  -21.432 1.00 36.02  ? 29   ARG A O     1 
ATOM   243  C  CB    . ARG A 1 29  ? 35.345  -5.838  -22.628 1.00 34.78  ? 29   ARG A CB    1 
ATOM   244  C  CG    . ARG A 1 29  ? 34.564  -5.737  -23.935 1.00 32.51  ? 29   ARG A CG    1 
ATOM   245  C  CD    . ARG A 1 29  ? 35.505  -5.761  -25.118 1.00 31.11  ? 29   ARG A CD    1 
ATOM   246  N  NE    . ARG A 1 29  ? 34.790  -5.949  -26.372 1.00 29.68  ? 29   ARG A NE    1 
ATOM   247  C  CZ    . ARG A 1 29  ? 35.333  -6.457  -27.475 1.00 32.02  ? 29   ARG A CZ    1 
ATOM   248  N  NH1   . ARG A 1 29  ? 36.605  -6.837  -27.486 1.00 34.13  ? 29   ARG A NH1   1 
ATOM   249  N  NH2   . ARG A 1 29  ? 34.599  -6.599  -28.567 1.00 29.94  ? 29   ARG A NH2   1 
ATOM   250  N  N     . GLU A 1 30  ? 34.324  -3.742  -20.501 1.00 38.54  ? 30   GLU A N     1 
ATOM   251  C  CA    . GLU A 1 30  ? 33.735  -2.448  -20.244 1.00 39.48  ? 30   GLU A CA    1 
ATOM   252  C  C     . GLU A 1 30  ? 34.545  -1.464  -21.064 1.00 39.95  ? 30   GLU A C     1 
ATOM   253  O  O     . GLU A 1 30  ? 35.758  -1.340  -20.877 1.00 41.50  ? 30   GLU A O     1 
ATOM   254  C  CB    . GLU A 1 30  ? 33.817  -2.118  -18.754 1.00 40.78  ? 30   GLU A CB    1 
ATOM   255  C  CG    . GLU A 1 30  ? 33.107  -0.836  -18.355 1.00 44.18  ? 30   GLU A CG    1 
ATOM   256  C  CD    . GLU A 1 30  ? 33.412  -0.385  -16.931 1.00 46.07  ? 30   GLU A CD    1 
ATOM   257  O  OE1   . GLU A 1 30  ? 33.878  -1.208  -16.108 1.00 47.90  ? 30   GLU A OE1   1 
ATOM   258  O  OE2   . GLU A 1 30  ? 33.174  0.808   -16.637 1.00 46.19  ? 30   GLU A OE2   1 
ATOM   259  N  N     . VAL A 1 31  ? 33.881  -0.793  -21.998 1.00 38.22  ? 31   VAL A N     1 
ATOM   260  C  CA    . VAL A 1 31  ? 34.561  0.149   -22.876 1.00 37.72  ? 31   VAL A CA    1 
ATOM   261  C  C     . VAL A 1 31  ? 34.028  1.554   -22.645 1.00 35.98  ? 31   VAL A C     1 
ATOM   262  O  O     . VAL A 1 31  ? 32.817  1.764   -22.598 1.00 33.72  ? 31   VAL A O     1 
ATOM   263  C  CB    . VAL A 1 31  ? 34.408  -0.237  -24.361 1.00 38.34  ? 31   VAL A CB    1 
ATOM   264  C  CG1   . VAL A 1 31  ? 35.389  0.538   -25.210 1.00 41.37  ? 31   VAL A CG1   1 
ATOM   265  C  CG2   . VAL A 1 31  ? 34.633  -1.734  -24.557 1.00 41.16  ? 31   VAL A CG2   1 
ATOM   266  N  N     . GLU A 1 32  ? 34.941  2.508   -22.483 1.00 36.75  ? 32   GLU A N     1 
ATOM   267  C  CA    . GLU A 1 32  ? 34.570  3.914   -22.351 1.00 38.40  ? 32   GLU A CA    1 
ATOM   268  C  C     . GLU A 1 32  ? 34.380  4.511   -23.747 1.00 37.17  ? 32   GLU A C     1 
ATOM   269  O  O     . GLU A 1 32  ? 35.189  5.314   -24.216 1.00 37.02  ? 32   GLU A O     1 
ATOM   270  C  CB    . GLU A 1 32  ? 35.630  4.683   -21.561 1.00 40.95  ? 32   GLU A CB    1 
ATOM   271  C  CG    . GLU A 1 32  ? 35.763  4.248   -20.108 1.00 48.10  ? 32   GLU A CG    1 
ATOM   272  C  CD    . GLU A 1 32  ? 36.906  4.948   -19.393 1.00 54.25  ? 32   GLU A CD    1 
ATOM   273  O  OE1   . GLU A 1 32  ? 36.960  6.198   -19.428 1.00 56.12  ? 32   GLU A OE1   1 
ATOM   274  O  OE2   . GLU A 1 32  ? 37.750  4.244   -18.795 1.00 56.21  ? 32   GLU A OE2   1 
ATOM   275  N  N     . TYR A 1 33  ? 33.294  4.100   -24.400 1.00 34.72  ? 33   TYR A N     1 
ATOM   276  C  CA    . TYR A 1 33  ? 33.047  4.413   -25.803 1.00 32.70  ? 33   TYR A CA    1 
ATOM   277  C  C     . TYR A 1 33  ? 32.964  5.918   -26.048 1.00 31.87  ? 33   TYR A C     1 
ATOM   278  O  O     . TYR A 1 33  ? 32.303  6.638   -25.305 1.00 32.72  ? 33   TYR A O     1 
ATOM   279  C  CB    . TYR A 1 33  ? 31.765  3.710   -26.263 1.00 29.76  ? 33   TYR A CB    1 
ATOM   280  C  CG    . TYR A 1 33  ? 31.418  3.873   -27.724 1.00 27.60  ? 33   TYR A CG    1 
ATOM   281  C  CD1   . TYR A 1 33  ? 32.304  3.476   -28.732 1.00 29.96  ? 33   TYR A CD1   1 
ATOM   282  C  CD2   . TYR A 1 33  ? 30.190  4.396   -28.104 1.00 25.69  ? 33   TYR A CD2   1 
ATOM   283  C  CE1   . TYR A 1 33  ? 31.971  3.618   -30.083 1.00 26.02  ? 33   TYR A CE1   1 
ATOM   284  C  CE2   . TYR A 1 33  ? 29.849  4.536   -29.452 1.00 26.36  ? 33   TYR A CE2   1 
ATOM   285  C  CZ    . TYR A 1 33  ? 30.738  4.146   -30.429 1.00 23.72  ? 33   TYR A CZ    1 
ATOM   286  O  OH    . TYR A 1 33  ? 30.384  4.297   -31.753 1.00 23.23  ? 33   TYR A OH    1 
ATOM   287  N  N     . LYS A 1 34  ? 33.656  6.378   -27.084 1.00 31.36  ? 34   LYS A N     1 
ATOM   288  C  CA    . LYS A 1 34  ? 33.642  7.795   -27.464 1.00 33.71  ? 34   LYS A CA    1 
ATOM   289  C  C     . LYS A 1 34  ? 32.763  7.937   -28.699 1.00 31.70  ? 34   LYS A C     1 
ATOM   290  O  O     . LYS A 1 34  ? 33.197  7.641   -29.816 1.00 32.68  ? 34   LYS A O     1 
ATOM   291  C  CB    . LYS A 1 34  ? 35.061  8.307   -27.746 1.00 34.06  ? 34   LYS A CB    1 
ATOM   292  C  CG    . LYS A 1 34  ? 36.094  7.930   -26.682 1.00 38.37  ? 34   LYS A CG    1 
ATOM   293  C  CD    . LYS A 1 34  ? 36.588  9.122   -25.886 1.00 43.44  ? 34   LYS A CD    1 
ATOM   294  C  CE    . LYS A 1 34  ? 37.647  9.899   -26.668 1.00 47.82  ? 34   LYS A CE    1 
ATOM   295  N  NZ    . LYS A 1 34  ? 38.789  10.328  -25.793 1.00 53.47  ? 34   LYS A NZ    1 
ATOM   296  N  N     . PRO A 1 35  ? 31.511  8.373   -28.502 1.00 29.82  ? 35   PRO A N     1 
ATOM   297  C  CA    . PRO A 1 35  ? 30.579  8.424   -29.612 1.00 27.07  ? 35   PRO A CA    1 
ATOM   298  C  C     . PRO A 1 35  ? 30.813  9.639   -30.494 1.00 27.85  ? 35   PRO A C     1 
ATOM   299  O  O     . PRO A 1 35  ? 31.389  10.644  -30.045 1.00 25.31  ? 35   PRO A O     1 
ATOM   300  C  CB    . PRO A 1 35  ? 29.217  8.540   -28.920 1.00 26.66  ? 35   PRO A CB    1 
ATOM   301  C  CG    . PRO A 1 35  ? 29.500  9.118   -27.580 1.00 26.85  ? 35   PRO A CG    1 
ATOM   302  C  CD    . PRO A 1 35  ? 30.972  9.026   -27.295 1.00 29.78  ? 35   PRO A CD    1 
ATOM   303  N  N     . SER A 1 36  ? 30.373  9.532   -31.743 1.00 27.51  ? 36   SER A N     1 
ATOM   304  C  CA    . SER A 1 36  ? 30.324  10.680  -32.630 1.00 30.59  ? 36   SER A CA    1 
ATOM   305  C  C     . SER A 1 36  ? 28.888  11.022  -32.992 1.00 30.56  ? 36   SER A C     1 
ATOM   306  O  O     . SER A 1 36  ? 28.046  10.135  -33.159 1.00 30.48  ? 36   SER A O     1 
ATOM   307  C  CB    . SER A 1 36  ? 31.127  10.425  -33.904 1.00 30.32  ? 36   SER A CB    1 
ATOM   308  O  OG    . SER A 1 36  ? 32.516  10.445  -33.643 1.00 31.54  ? 36   SER A OG    1 
ATOM   309  N  N     . LEU A 1 37  ? 28.617  12.322  -33.078 1.00 31.19  ? 37   LEU A N     1 
ATOM   310  C  CA    . LEU A 1 37  ? 27.390  12.832  -33.690 1.00 30.35  ? 37   LEU A CA    1 
ATOM   311  C  C     . LEU A 1 37  ? 27.784  13.895  -34.712 1.00 30.02  ? 37   LEU A C     1 
ATOM   312  O  O     . LEU A 1 37  ? 28.966  14.201  -34.850 1.00 31.56  ? 37   LEU A O     1 
ATOM   313  C  CB    . LEU A 1 37  ? 26.425  13.367  -32.635 1.00 28.85  ? 37   LEU A CB    1 
ATOM   314  C  CG    . LEU A 1 37  ? 25.868  12.294  -31.705 1.00 29.01  ? 37   LEU A CG    1 
ATOM   315  C  CD1   . LEU A 1 37  ? 25.167  12.927  -30.518 1.00 30.34  ? 37   LEU A CD1   1 
ATOM   316  C  CD2   . LEU A 1 37  ? 24.952  11.307  -32.442 1.00 27.89  ? 37   LEU A CD2   1 
ATOM   317  N  N     . PHE A 1 38  ? 26.818  14.435  -35.447 1.00 29.52  ? 38   PHE A N     1 
ATOM   318  C  CA    . PHE A 1 38  ? 27.142  15.293  -36.590 1.00 28.60  ? 38   PHE A CA    1 
ATOM   319  C  C     . PHE A 1 38  ? 26.305  16.554  -36.645 1.00 30.34  ? 38   PHE A C     1 
ATOM   320  O  O     . PHE A 1 38  ? 25.163  16.574  -36.193 1.00 31.01  ? 38   PHE A O     1 
ATOM   321  C  CB    . PHE A 1 38  ? 26.979  14.523  -37.903 1.00 26.82  ? 38   PHE A CB    1 
ATOM   322  C  CG    . PHE A 1 38  ? 27.859  13.309  -38.009 1.00 26.79  ? 38   PHE A CG    1 
ATOM   323  C  CD1   . PHE A 1 38  ? 27.505  12.113  -37.379 1.00 30.47  ? 38   PHE A CD1   1 
ATOM   324  C  CD2   . PHE A 1 38  ? 29.035  13.353  -38.748 1.00 24.22  ? 38   PHE A CD2   1 
ATOM   325  C  CE1   . PHE A 1 38  ? 28.321  10.983  -37.464 1.00 28.06  ? 38   PHE A CE1   1 
ATOM   326  C  CE2   . PHE A 1 38  ? 29.852  12.228  -38.848 1.00 25.94  ? 38   PHE A CE2   1 
ATOM   327  C  CZ    . PHE A 1 38  ? 29.492  11.043  -38.199 1.00 28.97  ? 38   PHE A CZ    1 
ATOM   328  N  N     . ALA A 1 39  ? 26.891  17.602  -37.214 1.00 30.22  ? 39   ALA A N     1 
ATOM   329  C  CA    . ALA A 1 39  ? 26.181  18.835  -37.496 1.00 31.29  ? 39   ALA A CA    1 
ATOM   330  C  C     . ALA A 1 39  ? 26.442  19.239  -38.942 1.00 31.78  ? 39   ALA A C     1 
ATOM   331  O  O     . ALA A 1 39  ? 27.537  19.020  -39.458 1.00 32.13  ? 39   ALA A O     1 
ATOM   332  C  CB    . ALA A 1 39  ? 26.639  19.940  -36.536 1.00 30.20  ? 39   ALA A CB    1 
ATOM   333  N  N     . HIS A 1 40  ? 25.436  19.811  -39.602 1.00 32.47  ? 40   HIS A N     1 
ATOM   334  C  CA    . HIS A 1 40  ? 25.633  20.414  -40.917 1.00 34.62  ? 40   HIS A CA    1 
ATOM   335  C  C     . HIS A 1 40  ? 26.754  21.456  -40.846 1.00 36.22  ? 40   HIS A C     1 
ATOM   336  O  O     . HIS A 1 40  ? 26.844  22.198  -39.875 1.00 35.67  ? 40   HIS A O     1 
ATOM   337  C  CB    . HIS A 1 40  ? 24.337  21.074  -41.407 1.00 34.30  ? 40   HIS A CB    1 
ATOM   338  C  CG    . HIS A 1 40  ? 23.282  20.100  -41.834 1.00 35.17  ? 40   HIS A CG    1 
ATOM   339  N  ND1   . HIS A 1 40  ? 22.006  20.108  -41.311 1.00 36.42  ? 40   HIS A ND1   1 
ATOM   340  C  CD2   . HIS A 1 40  ? 23.313  19.086  -42.731 1.00 35.49  ? 40   HIS A CD2   1 
ATOM   341  C  CE1   . HIS A 1 40  ? 21.296  19.144  -41.871 1.00 35.76  ? 40   HIS A CE1   1 
ATOM   342  N  NE2   . HIS A 1 40  ? 22.065  18.511  -42.738 1.00 36.12  ? 40   HIS A NE2   1 
ATOM   343  N  N     . CYS A 1 41  ? 27.619  21.483  -41.855 1.00 40.47  ? 41   CYS A N     1 
ATOM   344  C  CA    . CYS A 1 41  ? 28.681  22.492  -41.937 1.00 47.29  ? 41   CYS A CA    1 
ATOM   345  C  C     . CYS A 1 41  ? 28.587  23.301  -43.248 1.00 50.55  ? 41   CYS A C     1 
ATOM   346  O  O     . CYS A 1 41  ? 27.761  22.982  -44.104 1.00 50.56  ? 41   CYS A O     1 
ATOM   347  C  CB    . CYS A 1 41  ? 30.061  21.843  -41.762 1.00 46.96  ? 41   CYS A CB    1 
ATOM   348  S  SG    . CYS A 1 41  ? 30.456  20.540  -42.957 1.00 50.33  ? 41   CYS A SG    1 
ATOM   349  N  N     . PRO A 1 42  ? 29.407  24.369  -43.395 1.00 55.51  ? 42   PRO A N     1 
ATOM   350  C  CA    . PRO A 1 42  ? 29.373  25.159  -44.636 1.00 58.27  ? 42   PRO A CA    1 
ATOM   351  C  C     . PRO A 1 42  ? 29.750  24.346  -45.871 1.00 61.54  ? 42   PRO A C     1 
ATOM   352  O  O     . PRO A 1 42  ? 30.586  23.436  -45.794 1.00 61.26  ? 42   PRO A O     1 
ATOM   353  C  CB    . PRO A 1 42  ? 30.417  26.254  -44.391 1.00 58.72  ? 42   PRO A CB    1 
ATOM   354  C  CG    . PRO A 1 42  ? 30.505  26.372  -42.915 1.00 59.00  ? 42   PRO A CG    1 
ATOM   355  C  CD    . PRO A 1 42  ? 30.293  24.982  -42.385 1.00 56.30  ? 42   PRO A CD    1 
ATOM   356  N  N     . GLU A 1 43  ? 29.124  24.687  -46.995 1.00 66.15  ? 43   GLU A N     1 
ATOM   357  C  CA    . GLU A 1 43  ? 29.321  23.987  -48.269 1.00 70.89  ? 43   GLU A CA    1 
ATOM   358  C  C     . GLU A 1 43  ? 30.789  23.944  -48.709 1.00 72.27  ? 43   GLU A C     1 
ATOM   359  O  O     . GLU A 1 43  ? 31.228  22.978  -49.336 1.00 71.66  ? 43   GLU A O     1 
ATOM   360  C  CB    . GLU A 1 43  ? 28.468  24.635  -49.374 1.00 73.22  ? 43   GLU A CB    1 
ATOM   361  C  CG    . GLU A 1 43  ? 26.961  24.745  -49.069 1.00 76.34  ? 43   GLU A CG    1 
ATOM   362  C  CD    . GLU A 1 43  ? 26.235  23.398  -49.055 1.00 79.50  ? 43   GLU A CD    1 
ATOM   363  O  OE1   . GLU A 1 43  ? 26.649  22.470  -49.790 1.00 79.80  ? 43   GLU A OE1   1 
ATOM   364  O  OE2   . GLU A 1 43  ? 25.238  23.272  -48.309 1.00 80.79  ? 43   GLU A OE2   1 
ATOM   365  N  N     . SER A 1 44  ? 31.535  24.993  -48.359 1.00 74.52  ? 44   SER A N     1 
ATOM   366  C  CA    . SER A 1 44  ? 32.920  25.175  -48.804 1.00 76.43  ? 44   SER A CA    1 
ATOM   367  C  C     . SER A 1 44  ? 33.958  24.318  -48.070 1.00 76.16  ? 44   SER A C     1 
ATOM   368  O  O     . SER A 1 44  ? 34.989  23.972  -48.657 1.00 77.78  ? 44   SER A O     1 
ATOM   369  C  CB    . SER A 1 44  ? 33.318  26.656  -48.737 1.00 77.10  ? 44   SER A CB    1 
ATOM   370  O  OG    . SER A 1 44  ? 33.146  27.173  -47.428 1.00 79.41  ? 44   SER A OG    1 
ATOM   371  N  N     . GLN A 1 45  ? 33.700  23.986  -46.802 1.00 74.32  ? 45   GLN A N     1 
ATOM   372  C  CA    . GLN A 1 45  ? 34.667  23.211  -46.010 1.00 72.73  ? 45   GLN A CA    1 
ATOM   373  C  C     . GLN A 1 45  ? 34.686  21.729  -46.403 1.00 70.65  ? 45   GLN A C     1 
ATOM   374  O  O     . GLN A 1 45  ? 33.643  21.142  -46.723 1.00 69.85  ? 45   GLN A O     1 
ATOM   375  C  CB    . GLN A 1 45  ? 34.467  23.403  -44.496 1.00 72.70  ? 45   GLN A CB    1 
ATOM   376  C  CG    . GLN A 1 45  ? 33.400  22.526  -43.854 1.00 74.02  ? 45   GLN A CG    1 
ATOM   377  C  CD    . GLN A 1 45  ? 33.703  22.202  -42.395 1.00 75.87  ? 45   GLN A CD    1 
ATOM   378  O  OE1   . GLN A 1 45  ? 34.091  21.076  -42.066 1.00 74.68  ? 45   GLN A OE1   1 
ATOM   379  N  NE2   . GLN A 1 45  ? 33.530  23.190  -41.516 1.00 74.77  ? 45   GLN A NE2   1 
ATOM   380  N  N     . ALA A 1 46  ? 35.885  21.146  -46.381 1.00 68.01  ? 46   ALA A N     1 
ATOM   381  C  CA    . ALA A 1 46  ? 36.106  19.781  -46.859 1.00 64.74  ? 46   ALA A CA    1 
ATOM   382  C  C     . ALA A 1 46  ? 35.738  18.726  -45.819 1.00 61.93  ? 46   ALA A C     1 
ATOM   383  O  O     . ALA A 1 46  ? 36.203  18.770  -44.671 1.00 61.61  ? 46   ALA A O     1 
ATOM   384  C  CB    . ALA A 1 46  ? 37.552  19.604  -47.319 1.00 66.16  ? 46   ALA A CB    1 
ATOM   385  N  N     . THR A 1 47  ? 34.895  17.782  -46.233 1.00 56.65  ? 47   THR A N     1 
ATOM   386  C  CA    . THR A 1 47  ? 34.501  16.663  -45.384 1.00 51.69  ? 47   THR A CA    1 
ATOM   387  C  C     . THR A 1 47  ? 34.219  15.405  -46.211 1.00 48.50  ? 47   THR A C     1 
ATOM   388  O  O     . THR A 1 47  ? 34.038  15.478  -47.429 1.00 48.74  ? 47   THR A O     1 
ATOM   389  C  CB    . THR A 1 47  ? 33.274  17.024  -44.493 1.00 52.27  ? 47   THR A CB    1 
ATOM   390  O  OG1   . THR A 1 47  ? 33.056  15.991  -43.520 1.00 47.67  ? 47   THR A OG1   1 
ATOM   391  C  CG2   . THR A 1 47  ? 32.010  17.221  -45.337 1.00 50.60  ? 47   THR A CG2   1 
ATOM   392  N  N     . LYS A 1 48  ? 34.194  14.256  -45.543 1.00 43.48  ? 48   LYS A N     1 
ATOM   393  C  CA    . LYS A 1 48  ? 33.790  13.008  -46.186 1.00 40.79  ? 48   LYS A CA    1 
ATOM   394  C  C     . LYS A 1 48  ? 32.427  12.497  -45.686 1.00 37.83  ? 48   LYS A C     1 
ATOM   395  O  O     . LYS A 1 48  ? 31.960  11.438  -46.118 1.00 34.86  ? 48   LYS A O     1 
ATOM   396  C  CB    . LYS A 1 48  ? 34.877  11.935  -46.031 1.00 41.00  ? 48   LYS A CB    1 
ATOM   397  C  CG    . LYS A 1 48  ? 35.095  11.437  -44.601 1.00 42.92  ? 48   LYS A CG    1 
ATOM   398  C  CD    . LYS A 1 48  ? 36.026  10.224  -44.579 1.00 42.08  ? 48   LYS A CD    1 
ATOM   399  C  CE    . LYS A 1 48  ? 36.274  9.752   -43.163 1.00 40.53  ? 48   LYS A CE    1 
ATOM   400  N  NZ    . LYS A 1 48  ? 37.155  8.551   -43.133 1.00 41.56  ? 48   LYS A NZ    1 
ATOM   401  N  N     . TYR A 1 49  ? 31.803  13.244  -44.774 1.00 35.01  ? 49   TYR A N     1 
ATOM   402  C  CA    . TYR A 1 49  ? 30.493  12.871  -44.226 1.00 32.66  ? 49   TYR A CA    1 
ATOM   403  C  C     . TYR A 1 49  ? 29.386  13.740  -44.808 1.00 32.15  ? 49   TYR A C     1 
ATOM   404  O  O     . TYR A 1 49  ? 29.483  14.973  -44.819 1.00 29.73  ? 49   TYR A O     1 
ATOM   405  C  CB    . TYR A 1 49  ? 30.474  12.974  -42.699 1.00 31.13  ? 49   TYR A CB    1 
ATOM   406  C  CG    . TYR A 1 49  ? 31.610  12.254  -42.015 1.00 32.00  ? 49   TYR A CG    1 
ATOM   407  C  CD1   . TYR A 1 49  ? 32.728  12.953  -41.551 1.00 29.90  ? 49   TYR A CD1   1 
ATOM   408  C  CD2   . TYR A 1 49  ? 31.568  10.876  -41.824 1.00 30.56  ? 49   TYR A CD2   1 
ATOM   409  C  CE1   . TYR A 1 49  ? 33.773  12.292  -40.919 1.00 31.22  ? 49   TYR A CE1   1 
ATOM   410  C  CE2   . TYR A 1 49  ? 32.605  10.208  -41.202 1.00 29.78  ? 49   TYR A CE2   1 
ATOM   411  C  CZ    . TYR A 1 49  ? 33.701  10.913  -40.748 1.00 33.32  ? 49   TYR A CZ    1 
ATOM   412  O  OH    . TYR A 1 49  ? 34.722  10.230  -40.120 1.00 34.96  ? 49   TYR A OH    1 
ATOM   413  N  N     . PHE A 1 50  ? 28.335  13.085  -45.293 1.00 31.80  ? 50   PHE A N     1 
ATOM   414  C  CA    . PHE A 1 50  ? 27.195  13.771  -45.899 1.00 30.80  ? 50   PHE A CA    1 
ATOM   415  C  C     . PHE A 1 50  ? 25.885  13.184  -45.396 1.00 31.06  ? 50   PHE A C     1 
ATOM   416  O  O     . PHE A 1 50  ? 25.780  11.968  -45.196 1.00 28.19  ? 50   PHE A O     1 
ATOM   417  C  CB    . PHE A 1 50  ? 27.262  13.671  -47.426 1.00 31.64  ? 50   PHE A CB    1 
ATOM   418  C  CG    . PHE A 1 50  ? 28.454  14.367  -48.023 1.00 32.54  ? 50   PHE A CG    1 
ATOM   419  C  CD1   . PHE A 1 50  ? 29.658  13.692  -48.194 1.00 32.03  ? 50   PHE A CD1   1 
ATOM   420  C  CD2   . PHE A 1 50  ? 28.377  15.706  -48.393 1.00 33.25  ? 50   PHE A CD2   1 
ATOM   421  C  CE1   . PHE A 1 50  ? 30.766  14.344  -48.733 1.00 34.15  ? 50   PHE A CE1   1 
ATOM   422  C  CE2   . PHE A 1 50  ? 29.482  16.366  -48.935 1.00 33.15  ? 50   PHE A CE2   1 
ATOM   423  C  CZ    . PHE A 1 50  ? 30.674  15.681  -49.105 1.00 31.93  ? 50   PHE A CZ    1 
ATOM   424  N  N     . ASP A 1 51  ? 24.885  14.040  -45.191 1.00 29.76  ? 51   ASP A N     1 
ATOM   425  C  CA    . ASP A 1 51  ? 23.563  13.541  -44.822 1.00 29.05  ? 51   ASP A CA    1 
ATOM   426  C  C     . ASP A 1 51  ? 22.921  12.883  -46.039 1.00 30.09  ? 51   ASP A C     1 
ATOM   427  O  O     . ASP A 1 51  ? 23.482  12.937  -47.135 1.00 32.82  ? 51   ASP A O     1 
ATOM   428  C  CB    . ASP A 1 51  ? 22.690  14.629  -44.183 1.00 27.45  ? 51   ASP A CB    1 
ATOM   429  C  CG    . ASP A 1 51  ? 22.184  15.668  -45.173 1.00 29.15  ? 51   ASP A CG    1 
ATOM   430  O  OD1   . ASP A 1 51  ? 22.300  15.497  -46.407 1.00 27.33  ? 51   ASP A OD1   1 
ATOM   431  O  OD2   . ASP A 1 51  ? 21.644  16.681  -44.689 1.00 34.96  ? 51   ASP A OD2   1 
ATOM   432  N  N     . ILE A 1 52  ? 21.765  12.252  -45.856 1.00 30.20  ? 52   ILE A N     1 
ATOM   433  C  CA    . ILE A 1 52  ? 21.173  11.447  -46.935 1.00 30.15  ? 52   ILE A CA    1 
ATOM   434  C  C     . ILE A 1 52  ? 20.813  12.269  -48.179 1.00 31.75  ? 52   ILE A C     1 
ATOM   435  O  O     . ILE A 1 52  ? 20.698  11.721  -49.277 1.00 31.02  ? 52   ILE A O     1 
ATOM   436  C  CB    . ILE A 1 52  ? 19.952  10.608  -46.454 1.00 29.24  ? 52   ILE A CB    1 
ATOM   437  C  CG1   . ILE A 1 52  ? 18.810  11.511  -45.973 1.00 26.23  ? 52   ILE A CG1   1 
ATOM   438  C  CG2   . ILE A 1 52  ? 20.384  9.620   -45.385 1.00 30.11  ? 52   ILE A CG2   1 
ATOM   439  C  CD1   . ILE A 1 52  ? 17.504  10.770  -45.656 1.00 27.32  ? 52   ILE A CD1   1 
ATOM   440  N  N     . TYR A 1 53  ? 20.657  13.581  -47.994 1.00 32.82  ? 53   TYR A N     1 
ATOM   441  C  CA    . TYR A 1 53  ? 20.307  14.503  -49.076 1.00 33.28  ? 53   TYR A CA    1 
ATOM   442  C  C     . TYR A 1 53  ? 21.537  15.113  -49.766 1.00 35.43  ? 53   TYR A C     1 
ATOM   443  O  O     . TYR A 1 53  ? 21.397  15.982  -50.630 1.00 35.78  ? 53   TYR A O     1 
ATOM   444  C  CB    . TYR A 1 53  ? 19.393  15.618  -48.544 1.00 33.72  ? 53   TYR A CB    1 
ATOM   445  C  CG    . TYR A 1 53  ? 18.227  15.106  -47.720 1.00 34.70  ? 53   TYR A CG    1 
ATOM   446  C  CD1   . TYR A 1 53  ? 18.212  15.242  -46.328 1.00 34.70  ? 53   TYR A CD1   1 
ATOM   447  C  CD2   . TYR A 1 53  ? 17.144  14.476  -48.330 1.00 33.52  ? 53   TYR A CD2   1 
ATOM   448  C  CE1   . TYR A 1 53  ? 17.137  14.761  -45.563 1.00 34.46  ? 53   TYR A CE1   1 
ATOM   449  C  CE2   . TYR A 1 53  ? 16.074  13.999  -47.586 1.00 35.78  ? 53   TYR A CE2   1 
ATOM   450  C  CZ    . TYR A 1 53  ? 16.078  14.141  -46.205 1.00 34.86  ? 53   TYR A CZ    1 
ATOM   451  O  OH    . TYR A 1 53  ? 15.016  13.663  -45.482 1.00 36.86  ? 53   TYR A OH    1 
ATOM   452  N  N     . GLY A 1 54  ? 22.733  14.664  -49.378 1.00 35.21  ? 54   GLY A N     1 
ATOM   453  C  CA    . GLY A 1 54  ? 23.981  15.162  -49.955 1.00 34.80  ? 54   GLY A CA    1 
ATOM   454  C  C     . GLY A 1 54  ? 24.503  16.459  -49.351 1.00 36.95  ? 54   GLY A C     1 
ATOM   455  O  O     . GLY A 1 54  ? 25.346  17.137  -49.948 1.00 35.80  ? 54   GLY A O     1 
ATOM   456  N  N     . LYS A 1 55  ? 24.008  16.813  -48.168 1.00 37.66  ? 55   LYS A N     1 
ATOM   457  C  CA    . LYS A 1 55  ? 24.506  17.992  -47.462 1.00 39.24  ? 55   LYS A CA    1 
ATOM   458  C  C     . LYS A 1 55  ? 25.724  17.639  -46.599 1.00 37.52  ? 55   LYS A C     1 
ATOM   459  O  O     . LYS A 1 55  ? 25.701  16.642  -45.872 1.00 37.21  ? 55   LYS A O     1 
ATOM   460  C  CB    . LYS A 1 55  ? 23.402  18.662  -46.632 1.00 41.16  ? 55   LYS A CB    1 
ATOM   461  C  CG    . LYS A 1 55  ? 22.241  19.210  -47.473 1.00 47.68  ? 55   LYS A CG    1 
ATOM   462  C  CD    . LYS A 1 55  ? 21.468  20.322  -46.748 1.00 54.96  ? 55   LYS A CD    1 
ATOM   463  C  CE    . LYS A 1 55  ? 22.081  21.710  -46.969 1.00 58.63  ? 55   LYS A CE    1 
ATOM   464  N  NZ    . LYS A 1 55  ? 21.961  22.175  -48.385 1.00 60.32  ? 55   LYS A NZ    1 
ATOM   465  N  N     . PRO A 1 56  ? 26.795  18.454  -46.692 1.00 36.59  ? 56   PRO A N     1 
ATOM   466  C  CA    . PRO A 1 56  ? 28.050  18.208  -45.978 1.00 35.67  ? 56   PRO A CA    1 
ATOM   467  C  C     . PRO A 1 56  ? 27.904  18.328  -44.461 1.00 35.10  ? 56   PRO A C     1 
ATOM   468  O  O     . PRO A 1 56  ? 27.243  19.249  -43.975 1.00 34.08  ? 56   PRO A O     1 
ATOM   469  C  CB    . PRO A 1 56  ? 28.981  19.299  -46.520 1.00 35.94  ? 56   PRO A CB    1 
ATOM   470  C  CG    . PRO A 1 56  ? 28.077  20.386  -46.955 1.00 35.73  ? 56   PRO A CG    1 
ATOM   471  C  CD    . PRO A 1 56  ? 26.855  19.696  -47.487 1.00 36.17  ? 56   PRO A CD    1 
ATOM   472  N  N     . CYS A 1 57  ? 28.515  17.389  -43.742 1.00 33.11  ? 57   CYS A N     1 
ATOM   473  C  CA    . CYS A 1 57  ? 28.440  17.318  -42.290 1.00 34.14  ? 57   CYS A CA    1 
ATOM   474  C  C     . CYS A 1 57  ? 29.832  17.260  -41.665 1.00 34.57  ? 57   CYS A C     1 
ATOM   475  O  O     . CYS A 1 57  ? 30.762  16.728  -42.257 1.00 36.78  ? 57   CYS A O     1 
ATOM   476  C  CB    . CYS A 1 57  ? 27.651  16.081  -41.858 1.00 34.35  ? 57   CYS A CB    1 
ATOM   477  S  SG    . CYS A 1 57  ? 25.876  16.155  -42.183 1.00 37.54  ? 57   CYS A SG    1 
ATOM   478  N  N     . THR A 1 58  ? 29.965  17.812  -40.468 1.00 33.31  ? 58   THR A N     1 
ATOM   479  C  CA    . THR A 1 58  ? 31.202  17.704  -39.713 1.00 33.14  ? 58   THR A CA    1 
ATOM   480  C  C     . THR A 1 58  ? 30.979  16.756  -38.546 1.00 31.13  ? 58   THR A C     1 
ATOM   481  O  O     . THR A 1 58  ? 29.918  16.778  -37.924 1.00 31.08  ? 58   THR A O     1 
ATOM   482  C  CB    . THR A 1 58  ? 31.721  19.088  -39.210 1.00 34.54  ? 58   THR A CB    1 
ATOM   483  O  OG1   . THR A 1 58  ? 32.811  18.889  -38.304 1.00 38.01  ? 58   THR A OG1   1 
ATOM   484  C  CG2   . THR A 1 58  ? 30.633  19.876  -38.490 1.00 33.45  ? 58   THR A CG2   1 
ATOM   485  N  N     . ARG A 1 59  ? 31.977  15.920  -38.268 1.00 30.83  ? 59   ARG A N     1 
ATOM   486  C  CA    . ARG A 1 59  ? 31.906  14.970  -37.168 1.00 31.49  ? 59   ARG A CA    1 
ATOM   487  C  C     . ARG A 1 59  ? 32.275  15.652  -35.849 1.00 32.73  ? 59   ARG A C     1 
ATOM   488  O  O     . ARG A 1 59  ? 33.228  16.425  -35.788 1.00 32.76  ? 59   ARG A O     1 
ATOM   489  C  CB    . ARG A 1 59  ? 32.816  13.758  -37.430 1.00 30.01  ? 59   ARG A CB    1 
ATOM   490  C  CG    . ARG A 1 59  ? 32.852  12.772  -36.270 1.00 33.82  ? 59   ARG A CG    1 
ATOM   491  C  CD    . ARG A 1 59  ? 33.249  11.376  -36.683 1.00 33.92  ? 59   ARG A CD    1 
ATOM   492  N  NE    . ARG A 1 59  ? 34.684  11.250  -36.882 1.00 37.11  ? 59   ARG A NE    1 
ATOM   493  C  CZ    . ARG A 1 59  ? 35.508  10.553  -36.105 1.00 34.58  ? 59   ARG A CZ    1 
ATOM   494  N  NH1   . ARG A 1 59  ? 35.058  9.892   -35.046 1.00 31.09  ? 59   ARG A NH1   1 
ATOM   495  N  NH2   . ARG A 1 59  ? 36.798  10.519  -36.402 1.00 34.84  ? 59   ARG A NH2   1 
ATOM   496  N  N     . LYS A 1 60  ? 31.500  15.369  -34.809 1.00 33.48  ? 60   LYS A N     1 
ATOM   497  C  CA    . LYS A 1 60  ? 31.792  15.843  -33.468 1.00 34.70  ? 60   LYS A CA    1 
ATOM   498  C  C     . LYS A 1 60  ? 32.031  14.660  -32.547 1.00 34.79  ? 60   LYS A C     1 
ATOM   499  O  O     . LYS A 1 60  ? 31.109  13.908  -32.227 1.00 34.69  ? 60   LYS A O     1 
ATOM   500  C  CB    . LYS A 1 60  ? 30.672  16.746  -32.960 1.00 37.59  ? 60   LYS A CB    1 
ATOM   501  C  CG    . LYS A 1 60  ? 30.595  18.068  -33.726 1.00 42.65  ? 60   LYS A CG    1 
ATOM   502  C  CD    . LYS A 1 60  ? 29.685  19.066  -33.050 1.00 46.57  ? 60   LYS A CD    1 
ATOM   503  C  CE    . LYS A 1 60  ? 29.564  20.346  -33.872 1.00 53.02  ? 60   LYS A CE    1 
ATOM   504  N  NZ    . LYS A 1 60  ? 30.692  21.302  -33.646 1.00 53.14  ? 60   LYS A NZ    1 
ATOM   505  N  N     . LEU A 1 61  ? 33.295  14.492  -32.162 1.00 35.23  ? 61   LEU A N     1 
ATOM   506  C  CA    . LEU A 1 61  ? 33.750  13.390  -31.325 1.00 36.64  ? 61   LEU A CA    1 
ATOM   507  C  C     . LEU A 1 61  ? 33.664  13.838  -29.867 1.00 37.00  ? 61   LEU A C     1 
ATOM   508  O  O     . LEU A 1 61  ? 34.230  14.873  -29.502 1.00 37.04  ? 61   LEU A O     1 
ATOM   509  C  CB    . LEU A 1 61  ? 35.206  13.043  -31.672 1.00 37.36  ? 61   LEU A CB    1 
ATOM   510  C  CG    . LEU A 1 61  ? 35.745  11.604  -31.574 1.00 41.14  ? 61   LEU A CG    1 
ATOM   511  C  CD1   . LEU A 1 61  ? 37.217  11.630  -31.165 1.00 42.37  ? 61   LEU A CD1   1 
ATOM   512  C  CD2   . LEU A 1 61  ? 34.958  10.701  -30.627 1.00 33.56  ? 61   LEU A CD2   1 
ATOM   513  N  N     . PHE A 1 62  ? 32.971  13.055  -29.042 1.00 32.87  ? 62   PHE A N     1 
ATOM   514  C  CA    . PHE A 1 62  ? 32.751  13.413  -27.643 1.00 33.45  ? 62   PHE A CA    1 
ATOM   515  C  C     . PHE A 1 62  ? 33.593  12.598  -26.666 1.00 34.46  ? 62   PHE A C     1 
ATOM   516  O  O     . PHE A 1 62  ? 33.872  11.413  -26.899 1.00 33.88  ? 62   PHE A O     1 
ATOM   517  C  CB    . PHE A 1 62  ? 31.259  13.322  -27.291 1.00 32.09  ? 62   PHE A CB    1 
ATOM   518  C  CG    . PHE A 1 62  ? 30.400  14.262  -28.086 1.00 30.80  ? 62   PHE A CG    1 
ATOM   519  C  CD1   . PHE A 1 62  ? 29.751  13.826  -29.231 1.00 27.76  ? 62   PHE A CD1   1 
ATOM   520  C  CD2   . PHE A 1 62  ? 30.255  15.592  -27.694 1.00 29.00  ? 62   PHE A CD2   1 
ATOM   521  C  CE1   . PHE A 1 62  ? 28.955  14.693  -29.978 1.00 29.70  ? 62   PHE A CE1   1 
ATOM   522  C  CE2   . PHE A 1 62  ? 29.473  16.471  -28.443 1.00 31.65  ? 62   PHE A CE2   1 
ATOM   523  C  CZ    . PHE A 1 62  ? 28.819  16.023  -29.586 1.00 25.33  ? 62   PHE A CZ    1 
ATOM   524  N  N     . ALA A 1 63  ? 33.994  13.247  -25.574 1.00 33.88  ? 63   ALA A N     1 
ATOM   525  C  CA    . ALA A 1 63  ? 34.840  12.631  -24.558 1.00 35.57  ? 63   ALA A CA    1 
ATOM   526  C  C     . ALA A 1 63  ? 34.164  11.432  -23.899 1.00 36.21  ? 63   ALA A C     1 
ATOM   527  O  O     . ALA A 1 63  ? 34.837  10.514  -23.434 1.00 38.46  ? 63   ALA A O     1 
ATOM   528  C  CB    . ALA A 1 63  ? 35.249  13.667  -23.506 1.00 36.72  ? 63   ALA A CB    1 
ATOM   529  N  N     . ASN A 1 64  ? 32.833  11.453  -23.866 1.00 36.11  ? 64   ASN A N     1 
ATOM   530  C  CA    . ASN A 1 64  ? 32.023  10.378  -23.288 1.00 35.34  ? 64   ASN A CA    1 
ATOM   531  C  C     . ASN A 1 64  ? 30.572  10.466  -23.765 1.00 33.81  ? 64   ASN A C     1 
ATOM   532  O  O     . ASN A 1 64  ? 30.167  11.472  -24.357 1.00 33.34  ? 64   ASN A O     1 
ATOM   533  C  CB    . ASN A 1 64  ? 32.084  10.415  -21.753 1.00 35.30  ? 64   ASN A CB    1 
ATOM   534  C  CG    . ASN A 1 64  ? 31.771  11.794  -21.186 1.00 39.13  ? 64   ASN A CG    1 
ATOM   535  O  OD1   . ASN A 1 64  ? 30.725  12.376  -21.481 1.00 41.16  ? 64   ASN A OD1   1 
ATOM   536  N  ND2   . ASN A 1 64  ? 32.682  12.324  -20.368 1.00 37.67  ? 64   ASN A ND2   1 
ATOM   537  N  N     . MET A 1 65  ? 29.790  9.429   -23.478 1.00 32.35  ? 65   MET A N     1 
ATOM   538  C  CA    . MET A 1 65  ? 28.400  9.358   -23.939 1.00 33.32  ? 65   MET A CA    1 
ATOM   539  C  C     . MET A 1 65  ? 27.467  10.396  -23.304 1.00 34.18  ? 65   MET A C     1 
ATOM   540  O  O     . MET A 1 65  ? 26.515  10.848  -23.946 1.00 34.90  ? 65   MET A O     1 
ATOM   541  C  CB    . MET A 1 65  ? 27.840  7.943   -23.772 1.00 30.19  ? 65   MET A CB    1 
ATOM   542  C  CG    . MET A 1 65  ? 28.413  6.961   -24.779 1.00 30.89  ? 65   MET A CG    1 
ATOM   543  S  SD    . MET A 1 65  ? 27.784  5.289   -24.583 1.00 31.65  ? 65   MET A SD    1 
ATOM   544  C  CE    . MET A 1 65  ? 28.621  4.773   -23.086 1.00 28.57  ? 65   MET A CE    1 
ATOM   545  N  N     . ARG A 1 66  ? 27.732  10.769  -22.056 1.00 35.36  ? 66   ARG A N     1 
ATOM   546  C  CA    . ARG A 1 66  ? 26.961  11.837  -21.419 1.00 39.95  ? 66   ARG A CA    1 
ATOM   547  C  C     . ARG A 1 66  ? 27.145  13.184  -22.119 1.00 37.50  ? 66   ARG A C     1 
ATOM   548  O  O     . ARG A 1 66  ? 26.180  13.923  -22.282 1.00 38.03  ? 66   ARG A O     1 
ATOM   549  C  CB    . ARG A 1 66  ? 27.260  11.943  -19.920 1.00 43.50  ? 66   ARG A CB    1 
ATOM   550  C  CG    . ARG A 1 66  ? 26.403  10.986  -19.098 1.00 53.87  ? 66   ARG A CG    1 
ATOM   551  C  CD    . ARG A 1 66  ? 26.851  10.893  -17.648 1.00 62.04  ? 66   ARG A CD    1 
ATOM   552  N  NE    . ARG A 1 66  ? 26.249  9.738   -16.979 1.00 63.71  ? 66   ARG A NE    1 
ATOM   553  C  CZ    . ARG A 1 66  ? 26.578  9.312   -15.763 1.00 67.80  ? 66   ARG A CZ    1 
ATOM   554  N  NH1   . ARG A 1 66  ? 27.515  9.940   -15.057 1.00 69.12  ? 66   ARG A NH1   1 
ATOM   555  N  NH2   . ARG A 1 66  ? 25.969  8.248   -15.250 1.00 69.78  ? 66   ARG A NH2   1 
ATOM   556  N  N     . ASP A 1 67  ? 28.370  13.491  -22.542 1.00 36.12  ? 67   ASP A N     1 
ATOM   557  C  CA    . ASP A 1 67  ? 28.616  14.728  -23.293 1.00 38.32  ? 67   ASP A CA    1 
ATOM   558  C  C     . ASP A 1 67  ? 27.773  14.745  -24.563 1.00 35.97  ? 67   ASP A C     1 
ATOM   559  O  O     . ASP A 1 67  ? 27.097  15.731  -24.846 1.00 36.77  ? 67   ASP A O     1 
ATOM   560  C  CB    . ASP A 1 67  ? 30.102  14.900  -23.636 1.00 39.19  ? 67   ASP A CB    1 
ATOM   561  C  CG    . ASP A 1 67  ? 30.915  15.462  -22.476 1.00 41.94  ? 67   ASP A CG    1 
ATOM   562  O  OD1   . ASP A 1 67  ? 30.318  15.979  -21.510 1.00 44.71  ? 67   ASP A OD1   1 
ATOM   563  O  OD2   . ASP A 1 67  ? 32.160  15.388  -22.535 1.00 45.84  ? 67   ASP A OD2   1 
ATOM   564  N  N     . ALA A 1 68  ? 27.791  13.632  -25.295 1.00 32.80  ? 68   ALA A N     1 
ATOM   565  C  CA    . ALA A 1 68  ? 27.037  13.499  -26.543 1.00 32.31  ? 68   ALA A CA    1 
ATOM   566  C  C     . ALA A 1 68  ? 25.545  13.783  -26.343 1.00 32.59  ? 68   ALA A C     1 
ATOM   567  O  O     . ALA A 1 68  ? 24.943  14.536  -27.122 1.00 31.30  ? 68   ALA A O     1 
ATOM   568  C  CB    . ALA A 1 68  ? 27.252  12.121  -27.146 1.00 30.30  ? 68   ALA A CB    1 
ATOM   569  N  N     . SER A 1 69  ? 24.973  13.201  -25.285 1.00 31.78  ? 69   SER A N     1 
ATOM   570  C  CA    . SER A 1 69  ? 23.567  13.411  -24.922 1.00 33.97  ? 69   SER A CA    1 
ATOM   571  C  C     . SER A 1 69  ? 23.257  14.865  -24.581 1.00 35.06  ? 69   SER A C     1 
ATOM   572  O  O     . SER A 1 69  ? 22.253  15.414  -25.032 1.00 33.46  ? 69   SER A O     1 
ATOM   573  C  CB    . SER A 1 69  ? 23.171  12.508  -23.750 1.00 34.67  ? 69   SER A CB    1 
ATOM   574  O  OG    . SER A 1 69  ? 23.111  11.152  -24.160 1.00 38.14  ? 69   SER A OG    1 
ATOM   575  N  N     . GLN A 1 70  ? 24.122  15.481  -23.783 1.00 36.68  ? 70   GLN A N     1 
ATOM   576  C  CA    . GLN A 1 70  ? 23.951  16.878  -23.409 1.00 38.23  ? 70   GLN A CA    1 
ATOM   577  C  C     . GLN A 1 70  ? 24.066  17.812  -24.613 1.00 36.26  ? 70   GLN A C     1 
ATOM   578  O  O     . GLN A 1 70  ? 23.448  18.876  -24.632 1.00 35.24  ? 70   GLN A O     1 
ATOM   579  C  CB    . GLN A 1 70  ? 24.948  17.282  -22.316 1.00 39.08  ? 70   GLN A CB    1 
ATOM   580  C  CG    . GLN A 1 70  ? 24.675  16.650  -20.947 1.00 48.85  ? 70   GLN A CG    1 
ATOM   581  C  CD    . GLN A 1 70  ? 23.188  16.607  -20.581 1.00 55.31  ? 70   GLN A CD    1 
ATOM   582  O  OE1   . GLN A 1 70  ? 22.583  15.531  -20.528 1.00 58.89  ? 70   GLN A OE1   1 
ATOM   583  N  NE2   . GLN A 1 70  ? 22.595  17.775  -20.338 1.00 57.85  ? 70   GLN A NE2   1 
ATOM   584  N  N     . TRP A 1 71  ? 24.858  17.407  -25.607 1.00 34.61  ? 71   TRP A N     1 
ATOM   585  C  CA    . TRP A 1 71  ? 25.026  18.188  -26.829 1.00 33.34  ? 71   TRP A CA    1 
ATOM   586  C  C     . TRP A 1 71  ? 23.735  18.182  -27.625 1.00 32.35  ? 71   TRP A C     1 
ATOM   587  O  O     . TRP A 1 71  ? 23.330  19.207  -28.167 1.00 31.60  ? 71   TRP A O     1 
ATOM   588  C  CB    . TRP A 1 71  ? 26.183  17.647  -27.682 1.00 32.15  ? 71   TRP A CB    1 
ATOM   589  C  CG    . TRP A 1 71  ? 26.385  18.401  -28.980 1.00 30.14  ? 71   TRP A CG    1 
ATOM   590  C  CD1   . TRP A 1 71  ? 26.960  19.635  -29.133 1.00 30.29  ? 71   TRP A CD1   1 
ATOM   591  C  CD2   . TRP A 1 71  ? 26.013  17.968  -30.296 1.00 26.06  ? 71   TRP A CD2   1 
ATOM   592  N  NE1   . TRP A 1 71  ? 26.970  19.992  -30.462 1.00 30.48  ? 71   TRP A NE1   1 
ATOM   593  C  CE2   . TRP A 1 71  ? 26.393  18.989  -31.196 1.00 27.22  ? 71   TRP A CE2   1 
ATOM   594  C  CE3   . TRP A 1 71  ? 25.397  16.817  -30.803 1.00 27.54  ? 71   TRP A CE3   1 
ATOM   595  C  CZ2   . TRP A 1 71  ? 26.170  18.897  -32.573 1.00 27.61  ? 71   TRP A CZ2   1 
ATOM   596  C  CZ3   . TRP A 1 71  ? 25.179  16.724  -32.176 1.00 26.31  ? 71   TRP A CZ3   1 
ATOM   597  C  CH2   . TRP A 1 71  ? 25.566  17.758  -33.042 1.00 28.16  ? 71   TRP A CH2   1 
ATOM   598  N  N     . ILE A 1 72  ? 23.090  17.021  -27.678 1.00 33.32  ? 72   ILE A N     1 
ATOM   599  C  CA    . ILE A 1 72  ? 21.802  16.875  -28.345 1.00 35.82  ? 72   ILE A CA    1 
ATOM   600  C  C     . ILE A 1 72  ? 20.782  17.853  -27.749 1.00 38.20  ? 72   ILE A C     1 
ATOM   601  O  O     . ILE A 1 72  ? 20.044  18.520  -28.481 1.00 37.72  ? 72   ILE A O     1 
ATOM   602  C  CB    . ILE A 1 72  ? 21.292  15.423  -28.259 1.00 35.29  ? 72   ILE A CB    1 
ATOM   603  C  CG1   . ILE A 1 72  ? 22.137  14.511  -29.162 1.00 35.90  ? 72   ILE A CG1   1 
ATOM   604  C  CG2   . ILE A 1 72  ? 19.804  15.338  -28.622 1.00 37.14  ? 72   ILE A CG2   1 
ATOM   605  C  CD1   . ILE A 1 72  ? 21.870  13.000  -28.970 1.00 38.66  ? 72   ILE A CD1   1 
ATOM   606  N  N     . LYS A 1 73  ? 20.767  17.944  -26.421 1.00 40.52  ? 73   LYS A N     1 
ATOM   607  C  CA    . LYS A 1 73  ? 19.880  18.864  -25.713 1.00 43.78  ? 73   LYS A CA    1 
ATOM   608  C  C     . LYS A 1 73  ? 20.187  20.329  -26.021 1.00 42.87  ? 73   LYS A C     1 
ATOM   609  O  O     . LYS A 1 73  ? 19.270  21.132  -26.180 1.00 42.81  ? 73   LYS A O     1 
ATOM   610  C  CB    . LYS A 1 73  ? 19.902  18.599  -24.206 1.00 45.35  ? 73   LYS A CB    1 
ATOM   611  C  CG    . LYS A 1 73  ? 19.023  17.424  -23.790 1.00 54.76  ? 73   LYS A CG    1 
ATOM   612  C  CD    . LYS A 1 73  ? 19.156  17.118  -22.301 1.00 61.67  ? 73   LYS A CD    1 
ATOM   613  C  CE    . LYS A 1 73  ? 18.170  16.038  -21.859 1.00 65.21  ? 73   LYS A CE    1 
ATOM   614  N  NZ    . LYS A 1 73  ? 16.763  16.543  -21.790 1.00 66.54  ? 73   LYS A NZ    1 
ATOM   615  N  N     . ARG A 1 74  ? 21.468  20.673  -26.124 1.00 43.02  ? 74   ARG A N     1 
ATOM   616  C  CA    . ARG A 1 74  ? 21.846  22.043  -26.482 1.00 44.84  ? 74   ARG A CA    1 
ATOM   617  C  C     . ARG A 1 74  ? 21.445  22.396  -27.908 1.00 43.59  ? 74   ARG A C     1 
ATOM   618  O  O     . ARG A 1 74  ? 21.071  23.536  -28.170 1.00 46.36  ? 74   ARG A O     1 
ATOM   619  C  CB    . ARG A 1 74  ? 23.336  22.304  -26.257 1.00 45.42  ? 74   ARG A CB    1 
ATOM   620  C  CG    . ARG A 1 74  ? 23.730  22.340  -24.791 1.00 48.81  ? 74   ARG A CG    1 
ATOM   621  C  CD    . ARG A 1 74  ? 25.175  22.770  -24.610 1.00 52.98  ? 74   ARG A CD    1 
ATOM   622  N  NE    . ARG A 1 74  ? 25.815  21.992  -23.551 1.00 57.57  ? 74   ARG A NE    1 
ATOM   623  C  CZ    . ARG A 1 74  ? 26.706  21.024  -23.754 1.00 56.65  ? 74   ARG A CZ    1 
ATOM   624  N  NH1   . ARG A 1 74  ? 27.103  20.709  -24.988 1.00 52.09  ? 74   ARG A NH1   1 
ATOM   625  N  NH2   . ARG A 1 74  ? 27.213  20.379  -22.713 1.00 58.12  ? 74   ARG A NH2   1 
ATOM   626  N  N     . MET A 1 75  ? 21.496  21.418  -28.816 1.00 41.95  ? 75   MET A N     1 
ATOM   627  C  CA    . MET A 1 75  ? 21.133  21.646  -30.222 1.00 40.76  ? 75   MET A CA    1 
ATOM   628  C  C     . MET A 1 75  ? 19.636  21.882  -30.377 1.00 43.21  ? 75   MET A C     1 
ATOM   629  O  O     . MET A 1 75  ? 19.201  22.592  -31.293 1.00 43.72  ? 75   MET A O     1 
ATOM   630  C  CB    . MET A 1 75  ? 21.593  20.492  -31.126 1.00 37.08  ? 75   MET A CB    1 
ATOM   631  C  CG    . MET A 1 75  ? 23.107  20.409  -31.325 1.00 34.00  ? 75   MET A CG    1 
ATOM   632  S  SD    . MET A 1 75  ? 23.861  21.839  -32.159 1.00 33.55  ? 75   MET A SD    1 
ATOM   633  C  CE    . MET A 1 75  ? 23.648  21.393  -33.878 1.00 25.13  ? 75   MET A CE    1 
ATOM   634  N  N     . GLU A 1 76  ? 18.857  21.272  -29.485 1.00 44.74  ? 76   GLU A N     1 
ATOM   635  C  CA    . GLU A 1 76  ? 17.416  21.496  -29.428 1.00 46.92  ? 76   GLU A CA    1 
ATOM   636  C  C     . GLU A 1 76  ? 17.144  22.921  -28.939 1.00 46.32  ? 76   GLU A C     1 
ATOM   637  O  O     . GLU A 1 76  ? 16.386  23.657  -29.572 1.00 46.25  ? 76   GLU A O     1 
ATOM   638  C  CB    . GLU A 1 76  ? 16.737  20.455  -28.525 1.00 48.22  ? 76   GLU A CB    1 
ATOM   639  C  CG    . GLU A 1 76  ? 15.205  20.527  -28.505 1.00 54.18  ? 76   GLU A CG    1 
ATOM   640  C  CD    . GLU A 1 76  ? 14.557  19.524  -27.542 1.00 59.52  ? 76   GLU A CD    1 
ATOM   641  O  OE1   . GLU A 1 76  ? 13.401  19.769  -27.122 1.00 60.50  ? 76   GLU A OE1   1 
ATOM   642  O  OE2   . GLU A 1 76  ? 15.191  18.495  -27.205 1.00 60.13  ? 76   GLU A OE2   1 
ATOM   643  N  N     . ASP A 1 77  ? 17.790  23.307  -27.835 1.00 46.02  ? 77   ASP A N     1 
ATOM   644  C  CA    . ASP A 1 77  ? 17.658  24.655  -27.267 1.00 47.22  ? 77   ASP A CA    1 
ATOM   645  C  C     . ASP A 1 77  ? 18.108  25.755  -28.229 1.00 46.75  ? 77   ASP A C     1 
ATOM   646  O  O     . ASP A 1 77  ? 17.628  26.883  -28.138 1.00 47.48  ? 77   ASP A O     1 
ATOM   647  C  CB    . ASP A 1 77  ? 18.445  24.796  -25.956 1.00 47.77  ? 77   ASP A CB    1 
ATOM   648  C  CG    . ASP A 1 77  ? 17.975  23.843  -24.870 1.00 50.43  ? 77   ASP A CG    1 
ATOM   649  O  OD1   . ASP A 1 77  ? 16.830  23.339  -24.945 1.00 51.42  ? 77   ASP A OD1   1 
ATOM   650  O  OD2   . ASP A 1 77  ? 18.764  23.605  -23.929 1.00 50.87  ? 77   ASP A OD2   1 
ATOM   651  N  N     . ILE A 1 78  ? 19.047  25.433  -29.120 1.00 44.84  ? 78   ILE A N     1 
ATOM   652  C  CA    . ILE A 1 78  ? 19.498  26.384  -30.143 1.00 44.04  ? 78   ILE A CA    1 
ATOM   653  C  C     . ILE A 1 78  ? 18.534  26.396  -31.331 1.00 43.18  ? 78   ILE A C     1 
ATOM   654  O  O     . ILE A 1 78  ? 18.243  27.452  -31.880 1.00 44.22  ? 78   ILE A O     1 
ATOM   655  C  CB    . ILE A 1 78  ? 20.953  26.115  -30.613 1.00 43.33  ? 78   ILE A CB    1 
ATOM   656  C  CG1   . ILE A 1 78  ? 21.943  26.394  -29.475 1.00 43.81  ? 78   ILE A CG1   1 
ATOM   657  C  CG2   . ILE A 1 78  ? 21.303  26.987  -31.821 1.00 43.79  ? 78   ILE A CG2   1 
ATOM   658  C  CD1   . ILE A 1 78  ? 23.362  25.931  -29.737 1.00 40.82  ? 78   ILE A CD1   1 
ATOM   659  N  N     . GLY A 1 79  ? 18.037  25.220  -31.707 1.00 42.45  ? 79   GLY A N     1 
ATOM   660  C  CA    . GLY A 1 79  ? 17.103  25.087  -32.822 1.00 42.24  ? 79   GLY A CA    1 
ATOM   661  C  C     . GLY A 1 79  ? 17.716  24.483  -34.071 1.00 41.66  ? 79   GLY A C     1 
ATOM   662  O  O     . GLY A 1 79  ? 17.272  24.765  -35.182 1.00 43.33  ? 79   GLY A O     1 
ATOM   663  N  N     . LEU A 1 80  ? 18.727  23.639  -33.888 1.00 40.71  ? 80   LEU A N     1 
ATOM   664  C  CA    . LEU A 1 80  ? 19.446  23.033  -35.007 1.00 39.61  ? 80   LEU A CA    1 
ATOM   665  C  C     . LEU A 1 80  ? 19.450  21.515  -34.929 1.00 38.58  ? 80   LEU A C     1 
ATOM   666  O  O     . LEU A 1 80  ? 19.461  20.945  -33.832 1.00 38.75  ? 80   LEU A O     1 
ATOM   667  C  CB    . LEU A 1 80  ? 20.892  23.527  -35.035 1.00 38.67  ? 80   LEU A CB    1 
ATOM   668  C  CG    . LEU A 1 80  ? 21.131  24.973  -35.462 1.00 37.82  ? 80   LEU A CG    1 
ATOM   669  C  CD1   . LEU A 1 80  ? 22.492  25.424  -34.970 1.00 33.14  ? 80   LEU A CD1   1 
ATOM   670  C  CD2   . LEU A 1 80  ? 21.016  25.098  -36.975 1.00 34.57  ? 80   LEU A CD2   1 
ATOM   671  N  N     . GLU A 1 81  ? 19.474  20.870  -36.094 1.00 35.98  ? 81   GLU A N     1 
ATOM   672  C  CA    . GLU A 1 81  ? 19.486  19.414  -36.166 1.00 35.57  ? 81   GLU A CA    1 
ATOM   673  C  C     . GLU A 1 81  ? 20.790  18.798  -35.639 1.00 34.94  ? 81   GLU A C     1 
ATOM   674  O  O     . GLU A 1 81  ? 21.890  19.223  -36.014 1.00 34.33  ? 81   GLU A O     1 
ATOM   675  C  CB    . GLU A 1 81  ? 19.226  18.952  -37.598 1.00 35.92  ? 81   GLU A CB    1 
ATOM   676  C  CG    . GLU A 1 81  ? 19.027  17.445  -37.738 1.00 38.28  ? 81   GLU A CG    1 
ATOM   677  C  CD    . GLU A 1 81  ? 18.732  17.020  -39.163 1.00 38.64  ? 81   GLU A CD    1 
ATOM   678  O  OE1   . GLU A 1 81  ? 18.744  17.890  -40.058 1.00 39.84  ? 81   GLU A OE1   1 
ATOM   679  O  OE2   . GLU A 1 81  ? 18.486  15.813  -39.387 1.00 38.70  ? 81   GLU A OE2   1 
ATOM   680  N  N     . ALA A 1 82  ? 20.645  17.807  -34.758 1.00 33.00  ? 82   ALA A N     1 
ATOM   681  C  CA    . ALA A 1 82  ? 21.758  17.006  -34.269 1.00 30.79  ? 82   ALA A CA    1 
ATOM   682  C  C     . ALA A 1 82  ? 21.670  15.632  -34.924 1.00 30.47  ? 82   ALA A C     1 
ATOM   683  O  O     . ALA A 1 82  ? 20.808  14.823  -34.571 1.00 31.44  ? 82   ALA A O     1 
ATOM   684  C  CB    . ALA A 1 82  ? 21.696  16.887  -32.753 1.00 30.21  ? 82   ALA A CB    1 
ATOM   685  N  N     . LEU A 1 83  ? 22.555  15.377  -35.884 1.00 27.88  ? 83   LEU A N     1 
ATOM   686  C  CA    . LEU A 1 83  ? 22.463  14.180  -36.715 1.00 26.92  ? 83   LEU A CA    1 
ATOM   687  C  C     . LEU A 1 83  ? 23.268  13.011  -36.155 1.00 27.42  ? 83   LEU A C     1 
ATOM   688  O  O     . LEU A 1 83  ? 24.179  13.204  -35.341 1.00 27.40  ? 83   LEU A O     1 
ATOM   689  C  CB    . LEU A 1 83  ? 22.916  14.477  -38.146 1.00 24.92  ? 83   LEU A CB    1 
ATOM   690  C  CG    . LEU A 1 83  ? 22.146  15.520  -38.954 1.00 26.72  ? 83   LEU A CG    1 
ATOM   691  C  CD1   . LEU A 1 83  ? 22.757  16.905  -38.760 1.00 23.36  ? 83   LEU A CD1   1 
ATOM   692  C  CD2   . LEU A 1 83  ? 22.133  15.153  -40.429 1.00 23.96  ? 83   LEU A CD2   1 
ATOM   693  N  N     . GLY A 1 84  ? 22.918  11.800  -36.591 1.00 25.09  ? 84   GLY A N     1 
ATOM   694  C  CA    . GLY A 1 84  ? 23.694  10.609  -36.269 1.00 22.90  ? 84   GLY A CA    1 
ATOM   695  C  C     . GLY A 1 84  ? 22.966  9.687   -35.320 1.00 23.63  ? 84   GLY A C     1 
ATOM   696  O  O     . GLY A 1 84  ? 21.889  10.019  -34.817 1.00 23.50  ? 84   GLY A O     1 
ATOM   697  N  N     . MET A 1 85  ? 23.562  8.532   -35.061 1.00 23.54  ? 85   MET A N     1 
ATOM   698  C  CA    . MET A 1 85  ? 22.941  7.529   -34.203 1.00 24.07  ? 85   MET A CA    1 
ATOM   699  C  C     . MET A 1 85  ? 23.036  7.887   -32.721 1.00 25.14  ? 85   MET A C     1 
ATOM   700  O  O     . MET A 1 85  ? 24.090  7.772   -32.097 1.00 27.19  ? 85   MET A O     1 
ATOM   701  C  CB    . MET A 1 85  ? 23.521  6.140   -34.491 1.00 22.33  ? 85   MET A CB    1 
ATOM   702  C  CG    . MET A 1 85  ? 22.974  5.025   -33.602 1.00 23.70  ? 85   MET A CG    1 
ATOM   703  S  SD    . MET A 1 85  ? 21.178  4.933   -33.561 1.00 28.53  ? 85   MET A SD    1 
ATOM   704  C  CE    . MET A 1 85  ? 20.842  4.145   -35.137 1.00 23.35  ? 85   MET A CE    1 
ATOM   705  N  N     . ASP A 1 86  ? 21.901  8.299   -32.173 1.00 28.39  ? 86   ASP A N     1 
ATOM   706  C  CA    . ASP A 1 86  ? 21.771  8.716   -30.781 1.00 29.94  ? 86   ASP A CA    1 
ATOM   707  C  C     . ASP A 1 86  ? 21.637  7.526   -29.813 1.00 30.64  ? 86   ASP A C     1 
ATOM   708  O  O     . ASP A 1 86  ? 21.792  7.688   -28.601 1.00 30.31  ? 86   ASP A O     1 
ATOM   709  C  CB    . ASP A 1 86  ? 20.569  9.655   -30.642 1.00 32.28  ? 86   ASP A CB    1 
ATOM   710  C  CG    . ASP A 1 86  ? 19.292  9.074   -31.257 1.00 37.99  ? 86   ASP A CG    1 
ATOM   711  O  OD1   . ASP A 1 86  ? 18.280  8.977   -30.537 1.00 41.96  ? 86   ASP A OD1   1 
ATOM   712  O  OD2   . ASP A 1 86  ? 19.291  8.715   -32.457 1.00 39.62  ? 86   ASP A OD2   1 
ATOM   713  N  N     . ASP A 1 87  ? 21.337  6.339   -30.341 1.00 29.68  ? 87   ASP A N     1 
ATOM   714  C  CA    . ASP A 1 87  ? 21.398  5.117   -29.532 1.00 28.61  ? 87   ASP A CA    1 
ATOM   715  C  C     . ASP A 1 87  ? 22.838  4.580   -29.602 1.00 28.28  ? 87   ASP A C     1 
ATOM   716  O  O     . ASP A 1 87  ? 23.212  3.833   -30.517 1.00 26.84  ? 87   ASP A O     1 
ATOM   717  C  CB    . ASP A 1 87  ? 20.354  4.084   -29.987 1.00 30.53  ? 87   ASP A CB    1 
ATOM   718  C  CG    . ASP A 1 87  ? 20.243  2.883   -29.031 1.00 33.26  ? 87   ASP A CG    1 
ATOM   719  O  OD1   . ASP A 1 87  ? 21.163  2.651   -28.219 1.00 31.55  ? 87   ASP A OD1   1 
ATOM   720  O  OD2   . ASP A 1 87  ? 19.224  2.165   -29.095 1.00 35.83  ? 87   ASP A OD2   1 
ATOM   721  N  N     . PHE A 1 88  ? 23.636  4.988   -28.620 1.00 26.49  ? 88   PHE A N     1 
ATOM   722  C  CA    . PHE A 1 88  ? 25.081  4.852   -28.674 1.00 27.19  ? 88   PHE A CA    1 
ATOM   723  C  C     . PHE A 1 88  ? 25.563  3.409   -28.715 1.00 28.70  ? 88   PHE A C     1 
ATOM   724  O  O     . PHE A 1 88  ? 26.622  3.133   -29.275 1.00 29.70  ? 88   PHE A O     1 
ATOM   725  C  CB    . PHE A 1 88  ? 25.741  5.622   -27.525 1.00 27.45  ? 88   PHE A CB    1 
ATOM   726  C  CG    . PHE A 1 88  ? 25.446  7.104   -27.542 1.00 26.48  ? 88   PHE A CG    1 
ATOM   727  C  CD1   . PHE A 1 88  ? 25.637  7.851   -28.698 1.00 25.09  ? 88   PHE A CD1   1 
ATOM   728  C  CD2   . PHE A 1 88  ? 24.978  7.744   -26.396 1.00 27.29  ? 88   PHE A CD2   1 
ATOM   729  C  CE1   . PHE A 1 88  ? 25.359  9.217   -28.724 1.00 25.42  ? 88   PHE A CE1   1 
ATOM   730  C  CE2   . PHE A 1 88  ? 24.701  9.104   -26.402 1.00 28.87  ? 88   PHE A CE2   1 
ATOM   731  C  CZ    . PHE A 1 88  ? 24.886  9.844   -27.574 1.00 29.50  ? 88   PHE A CZ    1 
ATOM   732  N  N     . LYS A 1 89  ? 24.787  2.492   -28.146 1.00 25.67  ? 89   LYS A N     1 
ATOM   733  C  CA    . LYS A 1 89  ? 25.153  1.086   -28.215 1.00 28.68  ? 89   LYS A CA    1 
ATOM   734  C  C     . LYS A 1 89  ? 24.996  0.453   -29.612 1.00 27.04  ? 89   LYS A C     1 
ATOM   735  O  O     . LYS A 1 89  ? 25.716  -0.487  -29.943 1.00 29.69  ? 89   LYS A O     1 
ATOM   736  C  CB    . LYS A 1 89  ? 24.474  0.267   -27.112 1.00 29.17  ? 89   LYS A CB    1 
ATOM   737  C  CG    . LYS A 1 89  ? 22.982  0.123   -27.209 1.00 28.35  ? 89   LYS A CG    1 
ATOM   738  C  CD    . LYS A 1 89  ? 22.464  -0.266  -25.820 1.00 30.56  ? 89   LYS A CD    1 
ATOM   739  C  CE    . LYS A 1 89  ? 20.958  -0.386  -25.789 1.00 29.80  ? 89   LYS A CE    1 
ATOM   740  N  NZ    . LYS A 1 89  ? 20.316  0.934   -25.837 1.00 24.45  ? 89   LYS A NZ    1 
ATOM   741  N  N     . LEU A 1 90  ? 24.086  0.983   -30.426 1.00 25.13  ? 90   LEU A N     1 
ATOM   742  C  CA    . LEU A 1 90  ? 23.988  0.587   -31.835 1.00 26.51  ? 90   LEU A CA    1 
ATOM   743  C  C     . LEU A 1 90  ? 25.184  1.099   -32.634 1.00 26.64  ? 90   LEU A C     1 
ATOM   744  O  O     . LEU A 1 90  ? 25.676  0.415   -33.532 1.00 27.36  ? 90   LEU A O     1 
ATOM   745  C  CB    . LEU A 1 90  ? 22.688  1.095   -32.479 1.00 25.47  ? 90   LEU A CB    1 
ATOM   746  C  CG    . LEU A 1 90  ? 21.346  0.585   -31.946 1.00 27.93  ? 90   LEU A CG    1 
ATOM   747  C  CD1   . LEU A 1 90  ? 20.202  1.131   -32.802 1.00 26.64  ? 90   LEU A CD1   1 
ATOM   748  C  CD2   . LEU A 1 90  ? 21.290  -0.948  -31.869 1.00 26.53  ? 90   LEU A CD2   1 
ATOM   749  N  N     . ALA A 1 91  ? 25.645  2.305   -32.309 1.00 26.43  ? 91   ALA A N     1 
ATOM   750  C  CA    . ALA A 1 91  ? 26.840  2.863   -32.939 1.00 23.83  ? 91   ALA A CA    1 
ATOM   751  C  C     . ALA A 1 91  ? 28.088  2.091   -32.510 1.00 23.47  ? 91   ALA A C     1 
ATOM   752  O  O     . ALA A 1 91  ? 28.982  1.841   -33.326 1.00 21.30  ? 91   ALA A O     1 
ATOM   753  C  CB    . ALA A 1 91  ? 26.973  4.349   -32.620 1.00 22.88  ? 91   ALA A CB    1 
ATOM   754  N  N     . TYR A 1 92  ? 28.141  1.700   -31.234 1.00 24.93  ? 92   TYR A N     1 
ATOM   755  C  CA    . TYR A 1 92  ? 29.232  0.852   -30.734 1.00 25.55  ? 92   TYR A CA    1 
ATOM   756  C  C     . TYR A 1 92  ? 29.291  -0.472  -31.498 1.00 26.32  ? 92   TYR A C     1 
ATOM   757  O  O     . TYR A 1 92  ? 30.361  -0.890  -31.955 1.00 27.42  ? 92   TYR A O     1 
ATOM   758  C  CB    . TYR A 1 92  ? 29.088  0.575   -29.229 1.00 27.00  ? 92   TYR A CB    1 
ATOM   759  C  CG    . TYR A 1 92  ? 30.063  -0.476  -28.715 1.00 29.68  ? 92   TYR A CG    1 
ATOM   760  C  CD1   . TYR A 1 92  ? 29.660  -1.800  -28.502 1.00 31.36  ? 92   TYR A CD1   1 
ATOM   761  C  CD2   . TYR A 1 92  ? 31.393  -0.148  -28.463 1.00 32.41  ? 92   TYR A CD2   1 
ATOM   762  C  CE1   . TYR A 1 92  ? 30.571  -2.768  -28.038 1.00 33.61  ? 92   TYR A CE1   1 
ATOM   763  C  CE2   . TYR A 1 92  ? 32.302  -1.101  -28.003 1.00 33.80  ? 92   TYR A CE2   1 
ATOM   764  C  CZ    . TYR A 1 92  ? 31.890  -2.401  -27.792 1.00 34.90  ? 92   TYR A CZ    1 
ATOM   765  O  OH    . TYR A 1 92  ? 32.812  -3.316  -27.334 1.00 36.12  ? 92   TYR A OH    1 
ATOM   766  N  N     . LEU A 1 93  ? 28.138  -1.127  -31.626 1.00 26.33  ? 93   LEU A N     1 
ATOM   767  C  CA    . LEU A 1 93  ? 28.044  -2.407  -32.338 1.00 25.87  ? 93   LEU A CA    1 
ATOM   768  C  C     . LEU A 1 93  ? 28.474  -2.278  -33.790 1.00 26.12  ? 93   LEU A C     1 
ATOM   769  O  O     . LEU A 1 93  ? 29.155  -3.159  -34.327 1.00 26.24  ? 93   LEU A O     1 
ATOM   770  C  CB    . LEU A 1 93  ? 26.626  -2.976  -32.262 1.00 24.39  ? 93   LEU A CB    1 
ATOM   771  C  CG    . LEU A 1 93  ? 26.245  -3.754  -30.998 1.00 23.45  ? 93   LEU A CG    1 
ATOM   772  C  CD1   . LEU A 1 93  ? 24.846  -4.326  -31.165 1.00 19.78  ? 93   LEU A CD1   1 
ATOM   773  C  CD2   . LEU A 1 93  ? 27.239  -4.882  -30.701 1.00 21.55  ? 93   LEU A CD2   1 
ATOM   774  N  N     . SER A 1 94  ? 28.086  -1.167  -34.409 1.00 26.75  ? 94   SER A N     1 
ATOM   775  C  CA    . SER A 1 94  ? 28.429  -0.894  -35.795 1.00 27.56  ? 94   SER A CA    1 
ATOM   776  C  C     . SER A 1 94  ? 29.940  -0.703  -35.969 1.00 27.92  ? 94   SER A C     1 
ATOM   777  O  O     . SER A 1 94  ? 30.521  -1.218  -36.919 1.00 27.31  ? 94   SER A O     1 
ATOM   778  C  CB    . SER A 1 94  ? 27.679  0.338   -36.299 1.00 26.04  ? 94   SER A CB    1 
ATOM   779  O  OG    . SER A 1 94  ? 27.910  0.511   -37.688 1.00 27.18  ? 94   SER A OG    1 
ATOM   780  N  N     . ASP A 1 95  ? 30.559  0.039   -35.049 1.00 27.41  ? 95   ASP A N     1 
ATOM   781  C  CA    . ASP A 1 95  ? 32.011  0.231   -35.033 1.00 26.87  ? 95   ASP A CA    1 
ATOM   782  C  C     . ASP A 1 95  ? 32.793  -1.059  -34.743 1.00 29.08  ? 95   ASP A C     1 
ATOM   783  O  O     . ASP A 1 95  ? 33.812  -1.339  -35.383 1.00 31.39  ? 95   ASP A O     1 
ATOM   784  C  CB    . ASP A 1 95  ? 32.388  1.307   -34.011 1.00 25.03  ? 95   ASP A CB    1 
ATOM   785  C  CG    . ASP A 1 95  ? 32.104  2.718   -34.515 1.00 27.04  ? 95   ASP A CG    1 
ATOM   786  O  OD1   . ASP A 1 95  ? 31.726  3.587   -33.696 1.00 23.14  ? 95   ASP A OD1   1 
ATOM   787  O  OD2   . ASP A 1 95  ? 32.257  2.953   -35.732 1.00 23.91  ? 95   ASP A OD2   1 
ATOM   788  N  N     . THR A 1 96  ? 32.314  -1.837  -33.779 1.00 27.60  ? 96   THR A N     1 
ATOM   789  C  CA    . THR A 1 96  ? 33.032  -3.029  -33.331 1.00 27.63  ? 96   THR A CA    1 
ATOM   790  C  C     . THR A 1 96  ? 32.889  -4.195  -34.324 1.00 27.43  ? 96   THR A C     1 
ATOM   791  O  O     . THR A 1 96  ? 33.825  -4.959  -34.517 1.00 30.48  ? 96   THR A O     1 
ATOM   792  C  CB    . THR A 1 96  ? 32.606  -3.420  -31.893 1.00 26.75  ? 96   THR A CB    1 
ATOM   793  O  OG1   . THR A 1 96  ? 32.574  -2.244  -31.078 1.00 25.28  ? 96   THR A OG1   1 
ATOM   794  C  CG2   . THR A 1 96  ? 33.577  -4.409  -31.271 1.00 26.22  ? 96   THR A CG2   1 
ATOM   795  N  N     . TYR A 1 97  ? 31.735  -4.298  -34.976 1.00 27.65  ? 97   TYR A N     1 
ATOM   796  C  CA    . TYR A 1 97  ? 31.472  -5.373  -35.944 1.00 28.81  ? 97   TYR A CA    1 
ATOM   797  C  C     . TYR A 1 97  ? 31.204  -4.766  -37.321 1.00 30.28  ? 97   TYR A C     1 
ATOM   798  O  O     . TYR A 1 97  ? 30.083  -4.770  -37.824 1.00 31.22  ? 97   TYR A O     1 
ATOM   799  C  CB    . TYR A 1 97  ? 30.344  -6.300  -35.446 1.00 25.37  ? 97   TYR A CB    1 
ATOM   800  C  CG    . TYR A 1 97  ? 30.670  -6.828  -34.068 1.00 24.58  ? 97   TYR A CG    1 
ATOM   801  C  CD1   . TYR A 1 97  ? 30.245  -6.152  -32.920 1.00 23.66  ? 97   TYR A CD1   1 
ATOM   802  C  CD2   . TYR A 1 97  ? 31.483  -7.953  -33.910 1.00 26.28  ? 97   TYR A CD2   1 
ATOM   803  C  CE1   . TYR A 1 97  ? 30.604  -6.604  -31.641 1.00 22.48  ? 97   TYR A CE1   1 
ATOM   804  C  CE2   . TYR A 1 97  ? 31.840  -8.415  -32.650 1.00 27.08  ? 97   TYR A CE2   1 
ATOM   805  C  CZ    . TYR A 1 97  ? 31.401  -7.736  -31.520 1.00 25.21  ? 97   TYR A CZ    1 
ATOM   806  O  OH    . TYR A 1 97  ? 31.755  -8.204  -30.281 1.00 23.13  ? 97   TYR A OH    1 
ATOM   807  N  N     . ASN A 1 98  ? 32.267  -4.227  -37.909 1.00 31.94  ? 98   ASN A N     1 
ATOM   808  C  CA    . ASN A 1 98  ? 32.198  -3.532  -39.184 1.00 35.71  ? 98   ASN A CA    1 
ATOM   809  C  C     . ASN A 1 98  ? 32.293  -4.523  -40.341 1.00 36.60  ? 98   ASN A C     1 
ATOM   810  O  O     . ASN A 1 98  ? 33.028  -4.310  -41.305 1.00 39.00  ? 98   ASN A O     1 
ATOM   811  C  CB    . ASN A 1 98  ? 33.298  -2.465  -39.258 1.00 37.58  ? 98   ASN A CB    1 
ATOM   812  C  CG    . ASN A 1 98  ? 33.044  -1.427  -40.336 1.00 42.45  ? 98   ASN A CG    1 
ATOM   813  O  OD1   . ASN A 1 98  ? 31.977  -1.397  -40.961 1.00 46.87  ? 98   ASN A OD1   1 
ATOM   814  N  ND2   . ASN A 1 98  ? 34.032  -0.564  -40.563 1.00 42.91  ? 98   ASN A ND2   1 
ATOM   815  N  N     . TYR A 1 99  ? 31.543  -5.613  -40.214 1.00 35.82  ? 99   TYR A N     1 
ATOM   816  C  CA    . TYR A 1 99  ? 31.474  -6.679  -41.207 1.00 35.73  ? 99   TYR A CA    1 
ATOM   817  C  C     . TYR A 1 99  ? 30.141  -7.409  -41.038 1.00 35.92  ? 99   TYR A C     1 
ATOM   818  O  O     . TYR A 1 99  ? 29.419  -7.167  -40.059 1.00 34.02  ? 99   TYR A O     1 
ATOM   819  C  CB    . TYR A 1 99  ? 32.649  -7.663  -41.047 1.00 35.86  ? 99   TYR A CB    1 
ATOM   820  C  CG    . TYR A 1 99  ? 32.919  -8.146  -39.623 1.00 37.55  ? 99   TYR A CG    1 
ATOM   821  C  CD1   . TYR A 1 99  ? 33.852  -7.499  -38.813 1.00 36.79  ? 99   TYR A CD1   1 
ATOM   822  C  CD2   . TYR A 1 99  ? 32.253  -9.261  -39.095 1.00 38.50  ? 99   TYR A CD2   1 
ATOM   823  C  CE1   . TYR A 1 99  ? 34.114  -7.939  -37.515 1.00 35.73  ? 99   TYR A CE1   1 
ATOM   824  C  CE2   . TYR A 1 99  ? 32.509  -9.711  -37.798 1.00 34.65  ? 99   TYR A CE2   1 
ATOM   825  C  CZ    . TYR A 1 99  ? 33.441  -9.042  -37.016 1.00 37.53  ? 99   TYR A CZ    1 
ATOM   826  O  OH    . TYR A 1 99  ? 33.703  -9.466  -35.734 1.00 35.45  ? 99   TYR A OH    1 
ATOM   827  N  N     . GLU A 1 100 ? 29.814  -8.287  -41.985 1.00 35.20  ? 100  GLU A N     1 
ATOM   828  C  CA    . GLU A 1 100 ? 28.644  -9.153  -41.854 1.00 37.50  ? 100  GLU A CA    1 
ATOM   829  C  C     . GLU A 1 100 ? 28.899  -10.203 -40.772 1.00 35.90  ? 100  GLU A C     1 
ATOM   830  O  O     . GLU A 1 100 ? 29.852  -10.977 -40.866 1.00 37.86  ? 100  GLU A O     1 
ATOM   831  C  CB    . GLU A 1 100 ? 28.324  -9.846  -43.180 1.00 38.68  ? 100  GLU A CB    1 
ATOM   832  C  CG    . GLU A 1 100 ? 27.028  -10.653 -43.139 1.00 47.79  ? 100  GLU A CG    1 
ATOM   833  C  CD    . GLU A 1 100 ? 26.838  -11.553 -44.350 1.00 55.80  ? 100  GLU A CD    1 
ATOM   834  O  OE1   . GLU A 1 100 ? 25.807  -11.396 -45.046 1.00 59.40  ? 100  GLU A OE1   1 
ATOM   835  O  OE2   . GLU A 1 100 ? 27.713  -12.413 -44.605 1.00 58.85  ? 100  GLU A OE2   1 
ATOM   836  N  N     . ILE A 1 101 ? 28.043  -10.232 -39.757 1.00 33.90  ? 101  ILE A N     1 
ATOM   837  C  CA    . ILE A 1 101 ? 28.221  -11.144 -38.630 1.00 32.16  ? 101  ILE A CA    1 
ATOM   838  C  C     . ILE A 1 101 ? 27.916  -12.589 -38.996 1.00 33.44  ? 101  ILE A C     1 
ATOM   839  O  O     . ILE A 1 101 ? 26.820  -12.911 -39.461 1.00 32.93  ? 101  ILE A O     1 
ATOM   840  C  CB    . ILE A 1 101 ? 27.369  -10.727 -37.412 1.00 30.76  ? 101  ILE A CB    1 
ATOM   841  C  CG1   . ILE A 1 101 ? 27.891  -9.404  -36.844 1.00 31.86  ? 101  ILE A CG1   1 
ATOM   842  C  CG2   . ILE A 1 101 ? 27.370  -11.833 -36.340 1.00 29.99  ? 101  ILE A CG2   1 
ATOM   843  C  CD1   . ILE A 1 101 ? 26.970  -8.738  -35.878 1.00 30.13  ? 101  ILE A CD1   1 
ATOM   844  N  N     . LYS A 1 102 ? 28.914  -13.441 -38.796 1.00 35.06  ? 102  LYS A N     1 
ATOM   845  C  CA    . LYS A 1 102 ? 28.725  -14.876 -38.772 1.00 38.03  ? 102  LYS A CA    1 
ATOM   846  C  C     . LYS A 1 102 ? 28.739  -15.311 -37.319 1.00 36.60  ? 102  LYS A C     1 
ATOM   847  O  O     . LYS A 1 102 ? 29.748  -15.164 -36.629 1.00 38.21  ? 102  LYS A O     1 
ATOM   848  C  CB    . LYS A 1 102 ? 29.830  -15.588 -39.563 1.00 42.69  ? 102  LYS A CB    1 
ATOM   849  C  CG    . LYS A 1 102 ? 29.385  -16.132 -40.923 1.00 51.80  ? 102  LYS A CG    1 
ATOM   850  C  CD    . LYS A 1 102 ? 28.722  -15.066 -41.802 1.00 56.87  ? 102  LYS A CD    1 
ATOM   851  C  CE    . LYS A 1 102 ? 27.644  -15.686 -42.683 1.00 60.78  ? 102  LYS A CE    1 
ATOM   852  N  NZ    . LYS A 1 102 ? 26.717  -14.661 -43.242 1.00 63.47  ? 102  LYS A NZ    1 
ATOM   853  N  N     . TYR A 1 103 ? 27.605  -15.815 -36.847 1.00 34.13  ? 103  TYR A N     1 
ATOM   854  C  CA    . TYR A 1 103 ? 27.493  -16.249 -35.463 1.00 32.17  ? 103  TYR A CA    1 
ATOM   855  C  C     . TYR A 1 103 ? 27.423  -17.767 -35.399 1.00 31.81  ? 103  TYR A C     1 
ATOM   856  O  O     . TYR A 1 103 ? 27.063  -18.423 -36.381 1.00 31.43  ? 103  TYR A O     1 
ATOM   857  C  CB    . TYR A 1 103 ? 26.296  -15.583 -34.765 1.00 28.93  ? 103  TYR A CB    1 
ATOM   858  C  CG    . TYR A 1 103 ? 24.930  -16.101 -35.178 1.00 30.72  ? 103  TYR A CG    1 
ATOM   859  C  CD1   . TYR A 1 103 ? 24.264  -15.583 -36.299 1.00 28.23  ? 103  TYR A CD1   1 
ATOM   860  C  CD2   . TYR A 1 103 ? 24.295  -17.099 -34.438 1.00 28.42  ? 103  TYR A CD2   1 
ATOM   861  C  CE1   . TYR A 1 103 ? 22.997  -16.055 -36.672 1.00 27.56  ? 103  TYR A CE1   1 
ATOM   862  C  CE2   . TYR A 1 103 ? 23.038  -17.582 -34.806 1.00 28.80  ? 103  TYR A CE2   1 
ATOM   863  C  CZ    . TYR A 1 103 ? 22.396  -17.055 -35.915 1.00 29.19  ? 103  TYR A CZ    1 
ATOM   864  O  OH    . TYR A 1 103 ? 21.157  -17.538 -36.256 1.00 28.16  ? 103  TYR A OH    1 
ATOM   865  N  N     . ASP A 1 104 ? 27.796  -18.315 -34.248 1.00 30.49  ? 104  ASP A N     1 
ATOM   866  C  CA    . ASP A 1 104 ? 27.784  -19.756 -34.030 1.00 31.23  ? 104  ASP A CA    1 
ATOM   867  C  C     . ASP A 1 104 ? 26.889  -20.030 -32.831 1.00 30.03  ? 104  ASP A C     1 
ATOM   868  O  O     . ASP A 1 104 ? 27.317  -19.861 -31.690 1.00 31.85  ? 104  ASP A O     1 
ATOM   869  C  CB    . ASP A 1 104 ? 29.211  -20.254 -33.791 1.00 31.11  ? 104  ASP A CB    1 
ATOM   870  C  CG    . ASP A 1 104 ? 29.287  -21.753 -33.479 1.00 36.04  ? 104  ASP A CG    1 
ATOM   871  O  OD1   . ASP A 1 104 ? 28.242  -22.444 -33.389 1.00 37.68  ? 104  ASP A OD1   1 
ATOM   872  O  OD2   . ASP A 1 104 ? 30.425  -22.241 -33.320 1.00 35.19  ? 104  ASP A OD2   1 
ATOM   873  N  N     . HIS A 1 105 ? 25.652  -20.448 -33.100 1.00 29.70  ? 105  HIS A N     1 
ATOM   874  C  CA    . HIS A 1 105 ? 24.631  -20.642 -32.061 1.00 31.52  ? 105  HIS A CA    1 
ATOM   875  C  C     . HIS A 1 105 ? 25.054  -21.561 -30.914 1.00 30.81  ? 105  HIS A C     1 
ATOM   876  O  O     . HIS A 1 105 ? 24.558  -21.418 -29.803 1.00 30.49  ? 105  HIS A O     1 
ATOM   877  C  CB    . HIS A 1 105 ? 23.298  -21.118 -32.659 1.00 31.35  ? 105  HIS A CB    1 
ATOM   878  C  CG    . HIS A 1 105 ? 23.305  -22.541 -33.126 1.00 33.58  ? 105  HIS A CG    1 
ATOM   879  N  ND1   . HIS A 1 105 ? 22.837  -23.581 -32.350 1.00 35.17  ? 105  HIS A ND1   1 
ATOM   880  C  CD2   . HIS A 1 105 ? 23.698  -23.096 -34.298 1.00 36.83  ? 105  HIS A CD2   1 
ATOM   881  C  CE1   . HIS A 1 105 ? 22.955  -24.717 -33.019 1.00 39.12  ? 105  HIS A CE1   1 
ATOM   882  N  NE2   . HIS A 1 105 ? 23.473  -24.449 -34.205 1.00 37.30  ? 105  HIS A NE2   1 
ATOM   883  N  N     . THR A 1 106 ? 25.977  -22.483 -31.184 1.00 31.41  ? 106  THR A N     1 
ATOM   884  C  CA    . THR A 1 106 ? 26.447  -23.431 -30.166 1.00 32.33  ? 106  THR A CA    1 
ATOM   885  C  C     . THR A 1 106 ? 27.303  -22.753 -29.089 1.00 30.60  ? 106  THR A C     1 
ATOM   886  O  O     . THR A 1 106 ? 27.549  -23.335 -28.035 1.00 29.89  ? 106  THR A O     1 
ATOM   887  C  CB    . THR A 1 106 ? 27.220  -24.624 -30.787 1.00 32.40  ? 106  THR A CB    1 
ATOM   888  O  OG1   . THR A 1 106 ? 28.459  -24.161 -31.341 1.00 35.94  ? 106  THR A OG1   1 
ATOM   889  C  CG2   . THR A 1 106 ? 26.389  -25.293 -31.886 1.00 35.41  ? 106  THR A CG2   1 
ATOM   890  N  N     . LYS A 1 107 ? 27.740  -21.523 -29.359 1.00 30.24  ? 107  LYS A N     1 
ATOM   891  C  CA    . LYS A 1 107 ? 28.492  -20.722 -28.385 1.00 30.86  ? 107  LYS A CA    1 
ATOM   892  C  C     . LYS A 1 107 ? 27.593  -19.804 -27.557 1.00 29.80  ? 107  LYS A C     1 
ATOM   893  O  O     . LYS A 1 107 ? 28.037  -19.207 -26.569 1.00 30.91  ? 107  LYS A O     1 
ATOM   894  C  CB    . LYS A 1 107 ? 29.567  -19.884 -29.085 1.00 33.11  ? 107  LYS A CB    1 
ATOM   895  C  CG    . LYS A 1 107 ? 30.528  -20.677 -29.973 1.00 38.09  ? 107  LYS A CG    1 
ATOM   896  C  CD    . LYS A 1 107 ? 31.364  -21.654 -29.174 1.00 40.11  ? 107  LYS A CD    1 
ATOM   897  C  CE    . LYS A 1 107 ? 32.477  -22.250 -30.027 1.00 46.37  ? 107  LYS A CE    1 
ATOM   898  N  NZ    . LYS A 1 107 ? 33.438  -23.003 -29.174 1.00 49.38  ? 107  LYS A NZ    1 
ATOM   899  N  N     . ILE A 1 108 ? 26.335  -19.678 -27.969 1.00 28.12  ? 108  ILE A N     1 
ATOM   900  C  CA    . ILE A 1 108 ? 25.388  -18.791 -27.292 1.00 26.01  ? 108  ILE A CA    1 
ATOM   901  C  C     . ILE A 1 108 ? 24.600  -19.581 -26.254 1.00 25.52  ? 108  ILE A C     1 
ATOM   902  O  O     . ILE A 1 108 ? 23.952  -20.577 -26.576 1.00 26.34  ? 108  ILE A O     1 
ATOM   903  C  CB    . ILE A 1 108 ? 24.418  -18.110 -28.287 1.00 25.65  ? 108  ILE A CB    1 
ATOM   904  C  CG1   . ILE A 1 108 ? 25.206  -17.385 -29.377 1.00 24.24  ? 108  ILE A CG1   1 
ATOM   905  C  CG2   . ILE A 1 108 ? 23.481  -17.155 -27.546 1.00 27.17  ? 108  ILE A CG2   1 
ATOM   906  C  CD1   . ILE A 1 108 ? 24.373  -16.732 -30.450 1.00 24.98  ? 108  ILE A CD1   1 
ATOM   907  N  N     . ARG A 1 109 ? 24.661  -19.129 -25.006 1.00 25.46  ? 109  ARG A N     1 
ATOM   908  C  CA    . ARG A 1 109 ? 23.981  -19.811 -23.919 1.00 21.81  ? 109  ARG A CA    1 
ATOM   909  C  C     . ARG A 1 109 ? 22.515  -19.420 -23.878 1.00 21.19  ? 109  ARG A C     1 
ATOM   910  O  O     . ARG A 1 109 ? 22.175  -18.303 -23.470 1.00 20.84  ? 109  ARG A O     1 
ATOM   911  C  CB    . ARG A 1 109 ? 24.665  -19.508 -22.582 1.00 21.50  ? 109  ARG A CB    1 
ATOM   912  C  CG    . ARG A 1 109 ? 24.174  -20.375 -21.415 1.00 21.12  ? 109  ARG A CG    1 
ATOM   913  C  CD    . ARG A 1 109 ? 24.949  -20.083 -20.124 1.00 18.21  ? 109  ARG A CD    1 
ATOM   914  N  NE    . ARG A 1 109 ? 26.384  -20.294 -20.305 1.00 23.84  ? 109  ARG A NE    1 
ATOM   915  C  CZ    . ARG A 1 109 ? 27.003  -21.456 -20.097 1.00 28.71  ? 109  ARG A CZ    1 
ATOM   916  N  NH1   . ARG A 1 109 ? 26.320  -22.521 -19.685 1.00 25.02  ? 109  ARG A NH1   1 
ATOM   917  N  NH2   . ARG A 1 109 ? 28.310  -21.555 -20.303 1.00 27.29  ? 109  ARG A NH2   1 
ATOM   918  N  N     . VAL A 1 110 ? 21.654  -20.345 -24.300 1.00 21.53  ? 110  VAL A N     1 
ATOM   919  C  CA    . VAL A 1 110 ? 20.207  -20.144 -24.251 1.00 21.99  ? 110  VAL A CA    1 
ATOM   920  C  C     . VAL A 1 110 ? 19.651  -20.902 -23.051 1.00 25.25  ? 110  VAL A C     1 
ATOM   921  O  O     . VAL A 1 110 ? 19.858  -22.117 -22.911 1.00 25.12  ? 110  VAL A O     1 
ATOM   922  C  CB    . VAL A 1 110 ? 19.483  -20.588 -25.563 1.00 21.24  ? 110  VAL A CB    1 
ATOM   923  C  CG1   . VAL A 1 110 ? 17.994  -20.276 -25.490 1.00 18.74  ? 110  VAL A CG1   1 
ATOM   924  C  CG2   . VAL A 1 110 ? 20.083  -19.893 -26.780 1.00 21.84  ? 110  VAL A CG2   1 
ATOM   925  N  N     . ALA A 1 111 ? 18.962  -20.165 -22.184 1.00 24.06  ? 111  ALA A N     1 
ATOM   926  C  CA    . ALA A 1 111 ? 18.385  -20.716 -20.974 1.00 23.53  ? 111  ALA A CA    1 
ATOM   927  C  C     . ALA A 1 111 ? 16.861  -20.724 -21.037 1.00 23.61  ? 111  ALA A C     1 
ATOM   928  O  O     . ALA A 1 111 ? 16.235  -19.714 -21.366 1.00 22.57  ? 111  ALA A O     1 
ATOM   929  C  CB    . ALA A 1 111 ? 18.865  -19.939 -19.748 1.00 22.70  ? 111  ALA A CB    1 
ATOM   930  N  N     . ASN A 1 112 ? 16.308  -21.899 -20.739 1.00 24.58  ? 112  ASN A N     1 
ATOM   931  C  CA    A ASN A 1 112 ? 14.871  -22.119 -20.637 0.50 24.82  ? 112  ASN A CA    1 
ATOM   932  C  CA    B ASN A 1 112 ? 14.871  -22.122 -20.651 0.50 24.84  ? 112  ASN A CA    1 
ATOM   933  C  C     . ASN A 1 112 ? 14.571  -22.522 -19.214 1.00 24.64  ? 112  ASN A C     1 
ATOM   934  O  O     . ASN A 1 112 ? 15.063  -23.546 -18.741 1.00 25.69  ? 112  ASN A O     1 
ATOM   935  C  CB    A ASN A 1 112 ? 14.421  -23.259 -21.556 0.50 25.56  ? 112  ASN A CB    1 
ATOM   936  C  CB    B ASN A 1 112 ? 14.473  -23.252 -21.614 0.50 25.36  ? 112  ASN A CB    1 
ATOM   937  C  CG    A ASN A 1 112 ? 14.283  -22.835 -22.992 0.50 25.79  ? 112  ASN A CG    1 
ATOM   938  C  CG    B ASN A 1 112 ? 12.987  -23.269 -21.942 0.50 26.21  ? 112  ASN A CG    1 
ATOM   939  O  OD1   A ASN A 1 112 ? 13.194  -22.886 -23.559 0.50 30.40  ? 112  ASN A OD1   1 
ATOM   940  O  OD1   B ASN A 1 112 ? 12.129  -23.221 -21.059 0.50 23.68  ? 112  ASN A OD1   1 
ATOM   941  N  ND2   A ASN A 1 112 ? 15.385  -22.426 -23.598 0.50 26.93  ? 112  ASN A ND2   1 
ATOM   942  N  ND2   B ASN A 1 112 ? 12.678  -23.371 -23.230 0.50 29.38  ? 112  ASN A ND2   1 
ATOM   943  N  N     . PHE A 1 113 ? 13.781  -21.717 -18.516 1.00 24.47  ? 113  PHE A N     1 
ATOM   944  C  CA    . PHE A 1 113 ? 13.457  -22.060 -17.139 1.00 26.20  ? 113  PHE A CA    1 
ATOM   945  C  C     . PHE A 1 113 ? 11.999  -21.826 -16.772 1.00 26.65  ? 113  PHE A C     1 
ATOM   946  O  O     . PHE A 1 113 ? 11.297  -21.042 -17.417 1.00 26.74  ? 113  PHE A O     1 
ATOM   947  C  CB    . PHE A 1 113 ? 14.435  -21.395 -16.136 1.00 26.00  ? 113  PHE A CB    1 
ATOM   948  C  CG    . PHE A 1 113 ? 14.035  -20.008 -15.682 1.00 24.90  ? 113  PHE A CG    1 
ATOM   949  C  CD1   . PHE A 1 113 ? 13.872  -18.970 -16.594 1.00 29.45  ? 113  PHE A CD1   1 
ATOM   950  C  CD2   . PHE A 1 113 ? 13.858  -19.739 -14.336 1.00 24.62  ? 113  PHE A CD2   1 
ATOM   951  C  CE1   . PHE A 1 113 ? 13.518  -17.685 -16.159 1.00 31.07  ? 113  PHE A CE1   1 
ATOM   952  C  CE2   . PHE A 1 113 ? 13.505  -18.464 -13.892 1.00 27.84  ? 113  PHE A CE2   1 
ATOM   953  C  CZ    . PHE A 1 113 ? 13.339  -17.433 -14.810 1.00 25.39  ? 113  PHE A CZ    1 
ATOM   954  N  N     . ASP A 1 114 ? 11.548  -22.539 -15.747 1.00 26.97  ? 114  ASP A N     1 
ATOM   955  C  CA    . ASP A 1 114 ? 10.279  -22.228 -15.102 1.00 28.55  ? 114  ASP A CA    1 
ATOM   956  C  C     . ASP A 1 114 ? 10.368  -22.498 -13.612 1.00 27.71  ? 114  ASP A C     1 
ATOM   957  O  O     . ASP A 1 114 ? 11.182  -23.305 -13.162 1.00 29.46  ? 114  ASP A O     1 
ATOM   958  C  CB    . ASP A 1 114 ? 9.105   -22.999 -15.717 1.00 28.14  ? 114  ASP A CB    1 
ATOM   959  C  CG    . ASP A 1 114 ? 7.767   -22.280 -15.512 1.00 38.81  ? 114  ASP A CG    1 
ATOM   960  O  OD1   . ASP A 1 114 ? 7.740   -21.157 -14.918 1.00 41.43  ? 114  ASP A OD1   1 
ATOM   961  O  OD2   . ASP A 1 114 ? 6.737   -22.836 -15.946 1.00 44.82  ? 114  ASP A OD2   1 
ATOM   962  N  N     . ILE A 1 115 ? 9.528   -21.809 -12.852 1.00 28.20  ? 115  ILE A N     1 
ATOM   963  C  CA    . ILE A 1 115 ? 9.519   -21.951 -11.410 1.00 27.65  ? 115  ILE A CA    1 
ATOM   964  C  C     . ILE A 1 115 ? 8.152   -22.435 -10.930 1.00 27.34  ? 115  ILE A C     1 
ATOM   965  O  O     . ILE A 1 115 ? 7.166   -22.355 -11.668 1.00 27.03  ? 115  ILE A O     1 
ATOM   966  C  CB    . ILE A 1 115 ? 9.944   -20.636 -10.698 1.00 28.92  ? 115  ILE A CB    1 
ATOM   967  C  CG1   . ILE A 1 115 ? 8.850   -19.562 -10.788 1.00 26.84  ? 115  ILE A CG1   1 
ATOM   968  C  CG2   . ILE A 1 115 ? 11.291  -20.144 -11.241 1.00 26.71  ? 115  ILE A CG2   1 
ATOM   969  C  CD1   . ILE A 1 115 ? 9.081   -18.359 -9.862  1.00 20.47  ? 115  ILE A CD1   1 
ATOM   970  N  N     . GLU A 1 116 ? 8.123   -22.978 -9.718  1.00 24.34  ? 116  GLU A N     1 
ATOM   971  C  CA    . GLU A 1 116 ? 6.888   -23.328 -9.044  1.00 25.05  ? 116  GLU A CA    1 
ATOM   972  C  C     . GLU A 1 116 ? 6.803   -22.574 -7.727  1.00 27.01  ? 116  GLU A C     1 
ATOM   973  O  O     . GLU A 1 116 ? 7.805   -22.420 -7.025  1.00 28.76  ? 116  GLU A O     1 
ATOM   974  C  CB    . GLU A 1 116 ? 6.819   -24.830 -8.781  1.00 26.74  ? 116  GLU A CB    1 
ATOM   975  C  CG    . GLU A 1 116 ? 6.867   -25.700 -10.033 1.00 31.54  ? 116  GLU A CG    1 
ATOM   976  C  CD    . GLU A 1 116 ? 5.681   -25.481 -10.952 1.00 38.13  ? 116  GLU A CD    1 
ATOM   977  O  OE1   . GLU A 1 116 ? 4.591   -25.117 -10.461 1.00 42.53  ? 116  GLU A OE1   1 
ATOM   978  O  OE2   . GLU A 1 116 ? 5.834   -25.670 -12.177 1.00 42.33  ? 116  GLU A OE2   1 
ATOM   979  N  N     . VAL A 1 117 ? 5.605   -22.088 -7.413  1.00 27.86  ? 117  VAL A N     1 
ATOM   980  C  CA    . VAL A 1 117 ? 5.333   -21.369 -6.175  1.00 28.37  ? 117  VAL A CA    1 
ATOM   981  C  C     . VAL A 1 117 ? 3.991   -21.845 -5.615  1.00 28.30  ? 117  VAL A C     1 
ATOM   982  O  O     . VAL A 1 117 ? 2.947   -21.569 -6.201  1.00 29.09  ? 117  VAL A O     1 
ATOM   983  C  CB    . VAL A 1 117 ? 5.267   -19.830 -6.400  1.00 27.76  ? 117  VAL A CB    1 
ATOM   984  C  CG1   . VAL A 1 117 ? 5.107   -19.091 -5.069  1.00 24.74  ? 117  VAL A CG1   1 
ATOM   985  C  CG2   . VAL A 1 117 ? 6.499   -19.316 -7.157  1.00 27.21  ? 117  VAL A CG2   1 
ATOM   986  N  N     . THR A 1 118 ? 4.023   -22.559 -4.492  1.00 29.45  ? 118  THR A N     1 
ATOM   987  C  CA    . THR A 1 118 ? 2.798   -22.993 -3.805  1.00 32.13  ? 118  THR A CA    1 
ATOM   988  C  C     . THR A 1 118 ? 2.156   -21.791 -3.100  1.00 35.51  ? 118  THR A C     1 
ATOM   989  O  O     . THR A 1 118 ? 2.824   -21.075 -2.343  1.00 34.59  ? 118  THR A O     1 
ATOM   990  C  CB    . THR A 1 118 ? 3.091   -24.144 -2.801  1.00 32.65  ? 118  THR A CB    1 
ATOM   991  O  OG1   . THR A 1 118 ? 3.486   -25.319 -3.523  1.00 32.24  ? 118  THR A OG1   1 
ATOM   992  C  CG2   . THR A 1 118 ? 1.867   -24.472 -1.922  1.00 30.20  ? 118  THR A CG2   1 
ATOM   993  N  N     . SER A 1 119 ? 0.872   -21.562 -3.375  1.00 39.27  ? 119  SER A N     1 
ATOM   994  C  CA    . SER A 1 119 ? 0.134   -20.430 -2.800  1.00 44.34  ? 119  SER A CA    1 
ATOM   995  C  C     . SER A 1 119 ? -1.312  -20.797 -2.435  1.00 47.48  ? 119  SER A C     1 
ATOM   996  O  O     . SER A 1 119 ? -2.130  -21.057 -3.321  1.00 46.70  ? 119  SER A O     1 
ATOM   997  C  CB    . SER A 1 119 ? 0.150   -19.232 -3.754  1.00 44.41  ? 119  SER A CB    1 
ATOM   998  O  OG    . SER A 1 119 ? -0.633  -18.165 -3.241  1.00 47.95  ? 119  SER A OG    1 
ATOM   999  N  N     . PRO A 1 120 ? -1.627  -20.817 -1.123  1.00 51.07  ? 120  PRO A N     1 
ATOM   1000 C  CA    . PRO A 1 120 ? -2.974  -21.143 -0.635  1.00 53.70  ? 120  PRO A CA    1 
ATOM   1001 C  C     . PRO A 1 120 ? -3.961  -19.971 -0.673  1.00 55.85  ? 120  PRO A C     1 
ATOM   1002 O  O     . PRO A 1 120 ? -5.164  -20.182 -0.495  1.00 58.23  ? 120  PRO A O     1 
ATOM   1003 C  CB    . PRO A 1 120 ? -2.721  -21.557 0.817   1.00 54.19  ? 120  PRO A CB    1 
ATOM   1004 C  CG    . PRO A 1 120 ? -1.537  -20.744 1.227   1.00 53.38  ? 120  PRO A CG    1 
ATOM   1005 C  CD    . PRO A 1 120 ? -0.671  -20.636 -0.011  1.00 52.22  ? 120  PRO A CD    1 
ATOM   1006 N  N     . ASP A 1 121 ? -3.459  -18.757 -0.896  1.00 56.12  ? 121  ASP A N     1 
ATOM   1007 C  CA    . ASP A 1 121 ? -4.291  -17.555 -0.855  1.00 57.68  ? 121  ASP A CA    1 
ATOM   1008 C  C     . ASP A 1 121 ? -4.326  -16.798 -2.180  1.00 57.33  ? 121  ASP A C     1 
ATOM   1009 O  O     . ASP A 1 121 ? -4.226  -15.569 -2.208  1.00 57.97  ? 121  ASP A O     1 
ATOM   1010 C  CB    . ASP A 1 121 ? -3.852  -16.626 0.285   1.00 60.61  ? 121  ASP A CB    1 
ATOM   1011 C  CG    . ASP A 1 121 ? -2.367  -16.308 0.248   1.00 63.81  ? 121  ASP A CG    1 
ATOM   1012 O  OD1   . ASP A 1 121 ? -1.550  -17.251 0.329   1.00 66.41  ? 121  ASP A OD1   1 
ATOM   1013 O  OD2   . ASP A 1 121 ? -2.017  -15.112 0.152   1.00 66.47  ? 121  ASP A OD2   1 
ATOM   1014 N  N     . GLY A 1 122 ? -4.478  -17.540 -3.274  1.00 56.28  ? 122  GLY A N     1 
ATOM   1015 C  CA    . GLY A 1 122 ? -4.657  -16.944 -4.595  1.00 54.34  ? 122  GLY A CA    1 
ATOM   1016 C  C     . GLY A 1 122 ? -3.392  -16.929 -5.426  1.00 52.48  ? 122  GLY A C     1 
ATOM   1017 O  O     . GLY A 1 122 ? -2.395  -17.561 -5.068  1.00 51.99  ? 122  GLY A O     1 
ATOM   1018 N  N     . PHE A 1 123 ? -3.441  -16.204 -6.540  1.00 50.93  ? 123  PHE A N     1 
ATOM   1019 C  CA    . PHE A 1 123 ? -2.303  -16.092 -7.449  1.00 49.32  ? 123  PHE A CA    1 
ATOM   1020 C  C     . PHE A 1 123 ? -1.121  -15.401 -6.763  1.00 46.51  ? 123  PHE A C     1 
ATOM   1021 O  O     . PHE A 1 123 ? -1.293  -14.334 -6.159  1.00 46.89  ? 123  PHE A O     1 
ATOM   1022 C  CB    . PHE A 1 123 ? -2.698  -15.333 -8.718  1.00 50.36  ? 123  PHE A CB    1 
ATOM   1023 C  CG    . PHE A 1 123 ? -1.595  -15.228 -9.728  1.00 51.08  ? 123  PHE A CG    1 
ATOM   1024 C  CD1   . PHE A 1 123 ? -1.364  -16.261 -10.631 1.00 50.87  ? 123  PHE A CD1   1 
ATOM   1025 C  CD2   . PHE A 1 123 ? -0.785  -14.094 -9.776  1.00 52.32  ? 123  PHE A CD2   1 
ATOM   1026 C  CE1   . PHE A 1 123 ? -0.335  -16.171 -11.571 1.00 53.19  ? 123  PHE A CE1   1 
ATOM   1027 C  CE2   . PHE A 1 123 ? 0.243   -13.991 -10.707 1.00 52.52  ? 123  PHE A CE2   1 
ATOM   1028 C  CZ    . PHE A 1 123 ? 0.467   -15.032 -11.612 1.00 52.95  ? 123  PHE A CZ    1 
ATOM   1029 N  N     . PRO A 1 124 ? 0.074   -16.017 -6.844  1.00 42.45  ? 124  PRO A N     1 
ATOM   1030 C  CA    . PRO A 1 124 ? 1.284   -15.476 -6.228  1.00 41.91  ? 124  PRO A CA    1 
ATOM   1031 C  C     . PRO A 1 124 ? 1.814   -14.278 -7.008  1.00 41.32  ? 124  PRO A C     1 
ATOM   1032 O  O     . PRO A 1 124 ? 2.482   -14.450 -8.025  1.00 42.82  ? 124  PRO A O     1 
ATOM   1033 C  CB    . PRO A 1 124 ? 2.269   -16.647 -6.299  1.00 39.39  ? 124  PRO A CB    1 
ATOM   1034 C  CG    . PRO A 1 124 ? 1.822   -17.445 -7.470  1.00 39.33  ? 124  PRO A CG    1 
ATOM   1035 C  CD    . PRO A 1 124 ? 0.326   -17.306 -7.517  1.00 41.97  ? 124  PRO A CD    1 
ATOM   1036 N  N     . GLU A 1 125 ? 1.504   -13.077 -6.534  1.00 42.00  ? 125  GLU A N     1 
ATOM   1037 C  CA    . GLU A 1 125 ? 1.915   -11.847 -7.208  1.00 43.24  ? 125  GLU A CA    1 
ATOM   1038 C  C     . GLU A 1 125 ? 3.432   -11.647 -7.171  1.00 40.45  ? 125  GLU A C     1 
ATOM   1039 O  O     . GLU A 1 125 ? 4.020   -11.595 -6.094  1.00 41.05  ? 125  GLU A O     1 
ATOM   1040 C  CB    . GLU A 1 125 ? 1.185   -10.635 -6.611  1.00 46.46  ? 125  GLU A CB    1 
ATOM   1041 C  CG    . GLU A 1 125 ? -0.169  -10.342 -7.260  1.00 52.31  ? 125  GLU A CG    1 
ATOM   1042 C  CD    . GLU A 1 125 ? -0.042  -9.864  -8.704  1.00 59.31  ? 125  GLU A CD    1 
ATOM   1043 O  OE1   . GLU A 1 125 ? 0.934   -9.141  -9.020  1.00 62.85  ? 125  GLU A OE1   1 
ATOM   1044 O  OE2   . GLU A 1 125 ? -0.921  -10.212 -9.525  1.00 60.22  ? 125  GLU A OE2   1 
ATOM   1045 N  N     . PRO A 1 126 ? 4.070   -11.552 -8.354  1.00 39.64  ? 126  PRO A N     1 
ATOM   1046 C  CA    . PRO A 1 126 ? 5.521   -11.346 -8.447  1.00 38.51  ? 126  PRO A CA    1 
ATOM   1047 C  C     . PRO A 1 126 ? 6.031   -10.130 -7.671  1.00 38.73  ? 126  PRO A C     1 
ATOM   1048 O  O     . PRO A 1 126 ? 7.077   -10.221 -7.028  1.00 39.53  ? 126  PRO A O     1 
ATOM   1049 C  CB    . PRO A 1 126 ? 5.751   -11.162 -9.946  1.00 37.99  ? 126  PRO A CB    1 
ATOM   1050 C  CG    . PRO A 1 126 ? 4.657   -11.948 -10.580 1.00 39.40  ? 126  PRO A CG    1 
ATOM   1051 C  CD    . PRO A 1 126 ? 3.464   -11.751 -9.687  1.00 39.04  ? 126  PRO A CD    1 
ATOM   1052 N  N     . SER A 1 127 ? 5.294   -9.021  -7.704  1.00 37.55  ? 127  SER A N     1 
ATOM   1053 C  CA    . SER A 1 127 ? 5.724   -7.791  -7.028  1.00 39.54  ? 127  SER A CA    1 
ATOM   1054 C  C     . SER A 1 127 ? 5.759   -7.911  -5.500  1.00 40.34  ? 127  SER A C     1 
ATOM   1055 O  O     . SER A 1 127 ? 6.469   -7.158  -4.836  1.00 42.22  ? 127  SER A O     1 
ATOM   1056 C  CB    . SER A 1 127 ? 4.862   -6.598  -7.451  1.00 39.79  ? 127  SER A CB    1 
ATOM   1057 O  OG    . SER A 1 127 ? 3.577   -6.673  -6.864  1.00 40.45  ? 127  SER A OG    1 
ATOM   1058 N  N     . GLN A 1 128 ? 4.995   -8.857  -4.952  1.00 40.42  ? 128  GLN A N     1 
ATOM   1059 C  CA    . GLN A 1 128 ? 4.995   -9.117  -3.512  1.00 40.58  ? 128  GLN A CA    1 
ATOM   1060 C  C     . GLN A 1 128 ? 5.938   -10.269 -3.139  1.00 37.57  ? 128  GLN A C     1 
ATOM   1061 O  O     . GLN A 1 128 ? 6.671   -10.178 -2.158  1.00 37.04  ? 128  GLN A O     1 
ATOM   1062 C  CB    . GLN A 1 128 ? 3.575   -9.406  -2.995  1.00 43.36  ? 128  GLN A CB    1 
ATOM   1063 C  CG    . GLN A 1 128 ? 2.519   -8.340  -3.330  1.00 49.62  ? 128  GLN A CG    1 
ATOM   1064 C  CD    . GLN A 1 128 ? 2.747   -6.999  -2.627  1.00 56.87  ? 128  GLN A CD    1 
ATOM   1065 O  OE1   . GLN A 1 128 ? 2.648   -5.936  -3.250  1.00 58.26  ? 128  GLN A OE1   1 
ATOM   1066 N  NE2   . GLN A 1 128 ? 3.041   -7.044  -1.324  1.00 57.22  ? 128  GLN A NE2   1 
ATOM   1067 N  N     . ALA A 1 129 ? 5.905   -11.345 -3.928  1.00 34.45  ? 129  ALA A N     1 
ATOM   1068 C  CA    . ALA A 1 129 ? 6.727   -12.546 -3.710  1.00 31.71  ? 129  ALA A CA    1 
ATOM   1069 C  C     . ALA A 1 129 ? 6.794   -12.997 -2.245  1.00 33.22  ? 129  ALA A C     1 
ATOM   1070 O  O     . ALA A 1 129 ? 7.879   -13.135 -1.671  1.00 34.32  ? 129  ALA A O     1 
ATOM   1071 C  CB    . ALA A 1 129 ? 8.132   -12.360 -4.299  1.00 27.96  ? 129  ALA A CB    1 
ATOM   1072 N  N     . LYS A 1 130 ? 5.628   -13.225 -1.647  1.00 34.10  ? 130  LYS A N     1 
ATOM   1073 C  CA    . LYS A 1 130 ? 5.556   -13.551 -0.224  1.00 36.40  ? 130  LYS A CA    1 
ATOM   1074 C  C     . LYS A 1 130 ? 5.574   -15.052 0.036   1.00 36.06  ? 130  LYS A C     1 
ATOM   1075 O  O     . LYS A 1 130 ? 5.654   -15.485 1.183   1.00 36.66  ? 130  LYS A O     1 
ATOM   1076 C  CB    . LYS A 1 130 ? 4.340   -12.888 0.442   1.00 37.87  ? 130  LYS A CB    1 
ATOM   1077 C  CG    . LYS A 1 130 ? 2.992   -13.210 -0.189  1.00 44.22  ? 130  LYS A CG    1 
ATOM   1078 C  CD    . LYS A 1 130 ? 1.863   -12.444 0.495   1.00 50.04  ? 130  LYS A CD    1 
ATOM   1079 C  CE    . LYS A 1 130 ? 0.495   -12.881 -0.024  1.00 53.40  ? 130  LYS A CE    1 
ATOM   1080 N  NZ    . LYS A 1 130 ? -0.628  -12.085 0.565   1.00 55.41  ? 130  LYS A NZ    1 
ATOM   1081 N  N     . HIS A 1 131 ? 5.515   -15.840 -1.033  1.00 34.81  ? 131  HIS A N     1 
ATOM   1082 C  CA    . HIS A 1 131 ? 5.541   -17.292 -0.909  1.00 34.01  ? 131  HIS A CA    1 
ATOM   1083 C  C     . HIS A 1 131 ? 6.865   -17.894 -1.382  1.00 32.49  ? 131  HIS A C     1 
ATOM   1084 O  O     . HIS A 1 131 ? 7.492   -17.380 -2.311  1.00 32.09  ? 131  HIS A O     1 
ATOM   1085 C  CB    . HIS A 1 131 ? 4.359   -17.914 -1.648  1.00 34.10  ? 131  HIS A CB    1 
ATOM   1086 C  CG    . HIS A 1 131 ? 3.033   -17.381 -1.206  1.00 37.62  ? 131  HIS A CG    1 
ATOM   1087 N  ND1   . HIS A 1 131 ? 2.308   -16.475 -1.951  1.00 38.13  ? 131  HIS A ND1   1 
ATOM   1088 C  CD2   . HIS A 1 131 ? 2.314   -17.603 -0.082  1.00 38.67  ? 131  HIS A CD2   1 
ATOM   1089 C  CE1   . HIS A 1 131 ? 1.192   -16.177 -1.313  1.00 36.30  ? 131  HIS A CE1   1 
ATOM   1090 N  NE2   . HIS A 1 131 ? 1.173   -16.845 -0.174  1.00 39.82  ? 131  HIS A NE2   1 
ATOM   1091 N  N     . PRO A 1 132 ? 7.309   -18.968 -0.713  1.00 31.35  ? 132  PRO A N     1 
ATOM   1092 C  CA    . PRO A 1 132 ? 8.538   -19.660 -1.087  1.00 28.80  ? 132  PRO A CA    1 
ATOM   1093 C  C     . PRO A 1 132 ? 8.531   -20.193 -2.521  1.00 28.93  ? 132  PRO A C     1 
ATOM   1094 O  O     . PRO A 1 132 ? 7.505   -20.675 -3.006  1.00 28.87  ? 132  PRO A O     1 
ATOM   1095 C  CB    . PRO A 1 132 ? 8.599   -20.822 -0.091  1.00 28.06  ? 132  PRO A CB    1 
ATOM   1096 C  CG    . PRO A 1 132 ? 7.872   -20.316 1.116   1.00 29.19  ? 132  PRO A CG    1 
ATOM   1097 C  CD    . PRO A 1 132 ? 6.790   -19.420 0.598   1.00 31.95  ? 132  PRO A CD    1 
ATOM   1098 N  N     . ILE A 1 133 ? 9.672   -20.077 -3.195  1.00 27.32  ? 133  ILE A N     1 
ATOM   1099 C  CA    . ILE A 1 133 ? 9.885   -20.769 -4.453  1.00 27.40  ? 133  ILE A CA    1 
ATOM   1100 C  C     . ILE A 1 133 ? 10.262  -22.209 -4.106  1.00 27.01  ? 133  ILE A C     1 
ATOM   1101 O  O     . ILE A 1 133 ? 11.266  -22.444 -3.429  1.00 26.82  ? 133  ILE A O     1 
ATOM   1102 C  CB    . ILE A 1 133 ? 11.017  -20.121 -5.269  1.00 26.55  ? 133  ILE A CB    1 
ATOM   1103 C  CG1   . ILE A 1 133 ? 10.633  -18.692 -5.665  1.00 26.13  ? 133  ILE A CG1   1 
ATOM   1104 C  CG2   . ILE A 1 133 ? 11.348  -20.984 -6.497  1.00 26.70  ? 133  ILE A CG2   1 
ATOM   1105 C  CD1   . ILE A 1 133 ? 11.768  -17.880 -6.219  1.00 22.83  ? 133  ILE A CD1   1 
ATOM   1106 N  N     . ASP A 1 134 ? 9.466   -23.170 -4.556  1.00 25.83  ? 134  ASP A N     1 
ATOM   1107 C  CA    . ASP A 1 134 ? 9.719   -24.562 -4.170  1.00 27.05  ? 134  ASP A CA    1 
ATOM   1108 C  C     . ASP A 1 134 ? 10.232  -25.470 -5.291  1.00 26.13  ? 134  ASP A C     1 
ATOM   1109 O  O     . ASP A 1 134 ? 10.399  -26.670 -5.093  1.00 28.96  ? 134  ASP A O     1 
ATOM   1110 C  CB    . ASP A 1 134 ? 8.504   -25.174 -3.448  1.00 28.49  ? 134  ASP A CB    1 
ATOM   1111 C  CG    . ASP A 1 134 ? 7.190   -24.928 -4.176  1.00 28.42  ? 134  ASP A CG    1 
ATOM   1112 O  OD1   . ASP A 1 134 ? 7.159   -25.017 -5.417  1.00 35.39  ? 134  ASP A OD1   1 
ATOM   1113 O  OD2   . ASP A 1 134 ? 6.177   -24.662 -3.498  1.00 28.71  ? 134  ASP A OD2   1 
ATOM   1114 N  N     . ALA A 1 135 ? 10.479  -24.900 -6.464  1.00 24.56  ? 135  ALA A N     1 
ATOM   1115 C  CA    . ALA A 1 135 ? 11.045  -25.658 -7.582  1.00 23.90  ? 135  ALA A CA    1 
ATOM   1116 C  C     . ALA A 1 135 ? 11.510  -24.734 -8.685  1.00 24.07  ? 135  ALA A C     1 
ATOM   1117 O  O     . ALA A 1 135 ? 10.807  -23.795 -9.073  1.00 22.20  ? 135  ALA A O     1 
ATOM   1118 C  CB    . ALA A 1 135 ? 10.045  -26.671 -8.142  1.00 19.33  ? 135  ALA A CB    1 
ATOM   1119 N  N     . ILE A 1 136 ? 12.712  -25.000 -9.179  1.00 23.95  ? 136  ILE A N     1 
ATOM   1120 C  CA    . ILE A 1 136 ? 13.187  -24.352 -10.390 1.00 22.53  ? 136  ILE A CA    1 
ATOM   1121 C  C     . ILE A 1 136 ? 13.749  -25.430 -11.282 1.00 22.83  ? 136  ILE A C     1 
ATOM   1122 O  O     . ILE A 1 136 ? 14.564  -26.237 -10.838 1.00 22.32  ? 136  ILE A O     1 
ATOM   1123 C  CB    . ILE A 1 136 ? 14.276  -23.288 -10.100 1.00 22.19  ? 136  ILE A CB    1 
ATOM   1124 C  CG1   . ILE A 1 136 ? 13.740  -22.224 -9.132  1.00 21.57  ? 136  ILE A CG1   1 
ATOM   1125 C  CG2   . ILE A 1 136 ? 14.793  -22.658 -11.406 1.00 19.20  ? 136  ILE A CG2   1 
ATOM   1126 C  CD1   . ILE A 1 136 ? 14.802  -21.290 -8.549  1.00 23.09  ? 136  ILE A CD1   1 
ATOM   1127 N  N     . THR A 1 137 ? 13.282  -25.462 -12.527 1.00 22.13  ? 137  THR A N     1 
ATOM   1128 C  CA    . THR A 1 137 ? 13.952  -26.223 -13.563 1.00 22.15  ? 137  THR A CA    1 
ATOM   1129 C  C     . THR A 1 137 ? 14.516  -25.242 -14.570 1.00 21.88  ? 137  THR A C     1 
ATOM   1130 O  O     . THR A 1 137 ? 13.791  -24.405 -15.107 1.00 19.81  ? 137  THR A O     1 
ATOM   1131 C  CB    . THR A 1 137 ? 13.025  -27.245 -14.238 1.00 21.89  ? 137  THR A CB    1 
ATOM   1132 O  OG1   . THR A 1 137 ? 12.614  -28.203 -13.259 1.00 22.27  ? 137  THR A OG1   1 
ATOM   1133 C  CG2   . THR A 1 137 ? 13.763  -27.974 -15.368 1.00 22.10  ? 137  THR A CG2   1 
ATOM   1134 N  N     . HIS A 1 138 ? 15.821  -25.358 -14.800 1.00 22.38  ? 138  HIS A N     1 
ATOM   1135 C  CA    . HIS A 1 138 ? 16.575  -24.442 -15.641 1.00 22.74  ? 138  HIS A CA    1 
ATOM   1136 C  C     . HIS A 1 138 ? 17.373  -25.285 -16.630 1.00 23.49  ? 138  HIS A C     1 
ATOM   1137 O  O     . HIS A 1 138 ? 18.319  -25.974 -16.238 1.00 24.95  ? 138  HIS A O     1 
ATOM   1138 C  CB    . HIS A 1 138 ? 17.492  -23.594 -14.745 1.00 21.48  ? 138  HIS A CB    1 
ATOM   1139 C  CG    . HIS A 1 138 ? 18.359  -22.614 -15.479 1.00 22.08  ? 138  HIS A CG    1 
ATOM   1140 N  ND1   . HIS A 1 138 ? 18.267  -21.250 -15.283 1.00 20.72  ? 138  HIS A ND1   1 
ATOM   1141 C  CD2   . HIS A 1 138 ? 19.357  -22.798 -16.378 1.00 20.90  ? 138  HIS A CD2   1 
ATOM   1142 C  CE1   . HIS A 1 138 ? 19.158  -20.637 -16.043 1.00 20.61  ? 138  HIS A CE1   1 
ATOM   1143 N  NE2   . HIS A 1 138 ? 19.839  -21.553 -16.711 1.00 22.44  ? 138  HIS A NE2   1 
ATOM   1144 N  N     . TYR A 1 139 ? 16.964  -25.260 -17.901 1.00 23.43  ? 139  TYR A N     1 
ATOM   1145 C  CA    . TYR A 1 139 ? 17.691  -25.960 -18.961 1.00 21.88  ? 139  TYR A CA    1 
ATOM   1146 C  C     . TYR A 1 139 ? 18.740  -25.028 -19.569 1.00 24.03  ? 139  TYR A C     1 
ATOM   1147 O  O     . TYR A 1 139 ? 18.462  -23.852 -19.849 1.00 23.23  ? 139  TYR A O     1 
ATOM   1148 C  CB    . TYR A 1 139 ? 16.740  -26.490 -20.046 1.00 19.85  ? 139  TYR A CB    1 
ATOM   1149 C  CG    . TYR A 1 139 ? 17.443  -27.047 -21.268 1.00 20.41  ? 139  TYR A CG    1 
ATOM   1150 C  CD1   . TYR A 1 139 ? 17.724  -26.238 -22.362 1.00 22.91  ? 139  TYR A CD1   1 
ATOM   1151 C  CD2   . TYR A 1 139 ? 17.836  -28.388 -21.325 1.00 23.40  ? 139  TYR A CD2   1 
ATOM   1152 C  CE1   . TYR A 1 139 ? 18.376  -26.740 -23.489 1.00 20.76  ? 139  TYR A CE1   1 
ATOM   1153 C  CE2   . TYR A 1 139 ? 18.484  -28.901 -22.443 1.00 23.23  ? 139  TYR A CE2   1 
ATOM   1154 C  CZ    . TYR A 1 139 ? 18.758  -28.068 -23.521 1.00 24.76  ? 139  TYR A CZ    1 
ATOM   1155 O  OH    . TYR A 1 139 ? 19.405  -28.565 -24.639 1.00 24.69  ? 139  TYR A OH    1 
ATOM   1156 N  N     . ASP A 1 140 ? 19.936  -25.574 -19.769 1.00 23.08  ? 140  ASP A N     1 
ATOM   1157 C  CA    . ASP A 1 140 ? 21.062  -24.866 -20.359 1.00 24.33  ? 140  ASP A CA    1 
ATOM   1158 C  C     . ASP A 1 140 ? 21.405  -25.512 -21.703 1.00 26.40  ? 140  ASP A C     1 
ATOM   1159 O  O     . ASP A 1 140 ? 21.636  -26.716 -21.765 1.00 25.51  ? 140  ASP A O     1 
ATOM   1160 C  CB    . ASP A 1 140 ? 22.261  -24.953 -19.418 1.00 24.05  ? 140  ASP A CB    1 
ATOM   1161 C  CG    . ASP A 1 140 ? 23.438  -24.146 -19.900 1.00 28.24  ? 140  ASP A CG    1 
ATOM   1162 O  OD1   . ASP A 1 140 ? 24.192  -24.647 -20.770 1.00 31.57  ? 140  ASP A OD1   1 
ATOM   1163 O  OD2   . ASP A 1 140 ? 23.625  -23.021 -19.386 1.00 30.97  ? 140  ASP A OD2   1 
ATOM   1164 N  N     . SER A 1 141 ? 21.447  -24.704 -22.762 1.00 26.20  ? 141  SER A N     1 
ATOM   1165 C  CA    . SER A 1 141 ? 21.638  -25.204 -24.126 1.00 28.58  ? 141  SER A CA    1 
ATOM   1166 C  C     . SER A 1 141 ? 23.071  -25.652 -24.405 1.00 29.33  ? 141  SER A C     1 
ATOM   1167 O  O     . SER A 1 141 ? 23.301  -26.522 -25.239 1.00 29.28  ? 141  SER A O     1 
ATOM   1168 C  CB    . SER A 1 141 ? 21.236  -24.137 -25.145 1.00 28.38  ? 141  SER A CB    1 
ATOM   1169 O  OG    . SER A 1 141 ? 22.140  -23.042 -25.101 1.00 30.32  ? 141  SER A OG    1 
ATOM   1170 N  N     . ILE A 1 142 ? 24.029  -25.043 -23.714 1.00 28.92  ? 142  ILE A N     1 
ATOM   1171 C  CA    . ILE A 1 142 ? 25.432  -25.406 -23.867 1.00 29.66  ? 142  ILE A CA    1 
ATOM   1172 C  C     . ILE A 1 142 ? 25.751  -26.736 -23.159 1.00 31.37  ? 142  ILE A C     1 
ATOM   1173 O  O     . ILE A 1 142 ? 26.432  -27.596 -23.720 1.00 31.13  ? 142  ILE A O     1 
ATOM   1174 C  CB    . ILE A 1 142 ? 26.357  -24.260 -23.397 1.00 29.94  ? 142  ILE A CB    1 
ATOM   1175 C  CG1   . ILE A 1 142 ? 26.226  -23.072 -24.360 1.00 26.61  ? 142  ILE A CG1   1 
ATOM   1176 C  CG2   . ILE A 1 142 ? 27.822  -24.744 -23.261 1.00 28.83  ? 142  ILE A CG2   1 
ATOM   1177 C  CD1   . ILE A 1 142 ? 27.167  -21.920 -24.075 1.00 30.97  ? 142  ILE A CD1   1 
ATOM   1178 N  N     . ASP A 1 143 ? 25.246  -26.907 -21.940 1.00 30.22  ? 143  ASP A N     1 
ATOM   1179 C  CA    . ASP A 1 143 ? 25.419  -28.172 -21.226 1.00 32.55  ? 143  ASP A CA    1 
ATOM   1180 C  C     . ASP A 1 143 ? 24.463  -29.239 -21.742 1.00 31.60  ? 143  ASP A C     1 
ATOM   1181 O  O     . ASP A 1 143 ? 24.744  -30.432 -21.607 1.00 29.23  ? 143  ASP A O     1 
ATOM   1182 C  CB    . ASP A 1 143 ? 25.210  -27.988 -19.718 1.00 34.07  ? 143  ASP A CB    1 
ATOM   1183 C  CG    . ASP A 1 143 ? 26.253  -27.085 -19.088 1.00 37.53  ? 143  ASP A CG    1 
ATOM   1184 O  OD1   . ASP A 1 143 ? 27.319  -26.866 -19.710 1.00 39.40  ? 143  ASP A OD1   1 
ATOM   1185 O  OD2   . ASP A 1 143 ? 26.007  -26.598 -17.965 1.00 37.52  ? 143  ASP A OD2   1 
ATOM   1186 N  N     . ASP A 1 144 ? 23.344  -28.798 -22.335 1.00 30.34  ? 144  ASP A N     1 
ATOM   1187 C  CA    . ASP A 1 144 ? 22.254  -29.691 -22.760 1.00 28.39  ? 144  ASP A CA    1 
ATOM   1188 C  C     . ASP A 1 144 ? 21.740  -30.469 -21.545 1.00 27.04  ? 144  ASP A C     1 
ATOM   1189 O  O     . ASP A 1 144 ? 21.588  -31.691 -21.586 1.00 29.11  ? 144  ASP A O     1 
ATOM   1190 C  CB    . ASP A 1 144 ? 22.728  -30.630 -23.896 1.00 31.24  ? 144  ASP A CB    1 
ATOM   1191 C  CG    . ASP A 1 144 ? 21.592  -31.429 -24.535 1.00 31.87  ? 144  ASP A CG    1 
ATOM   1192 O  OD1   . ASP A 1 144 ? 20.432  -30.972 -24.512 1.00 33.77  ? 144  ASP A OD1   1 
ATOM   1193 O  OD2   . ASP A 1 144 ? 21.869  -32.521 -25.075 1.00 37.02  ? 144  ASP A OD2   1 
ATOM   1194 N  N     . ARG A 1 145 ? 21.492  -29.750 -20.452 1.00 25.83  ? 145  ARG A N     1 
ATOM   1195 C  CA    . ARG A 1 145 ? 21.062  -30.371 -19.197 1.00 24.85  ? 145  ARG A CA    1 
ATOM   1196 C  C     . ARG A 1 145 ? 19.913  -29.598 -18.565 1.00 24.78  ? 145  ARG A C     1 
ATOM   1197 O  O     . ARG A 1 145 ? 19.854  -28.370 -18.675 1.00 23.01  ? 145  ARG A O     1 
ATOM   1198 C  CB    . ARG A 1 145 ? 22.223  -30.453 -18.201 1.00 25.69  ? 145  ARG A CB    1 
ATOM   1199 C  CG    . ARG A 1 145 ? 23.407  -31.340 -18.628 1.00 28.39  ? 145  ARG A CG    1 
ATOM   1200 C  CD    . ARG A 1 145 ? 23.048  -32.825 -18.618 1.00 27.45  ? 145  ARG A CD    1 
ATOM   1201 N  NE    . ARG A 1 145 ? 24.183  -33.687 -18.959 1.00 31.32  ? 145  ARG A NE    1 
ATOM   1202 C  CZ    . ARG A 1 145 ? 24.487  -34.081 -20.196 1.00 34.77  ? 145  ARG A CZ    1 
ATOM   1203 N  NH1   . ARG A 1 145 ? 23.751  -33.689 -21.233 1.00 30.72  ? 145  ARG A NH1   1 
ATOM   1204 N  NH2   . ARG A 1 145 ? 25.534  -34.871 -20.401 1.00 36.30  ? 145  ARG A NH2   1 
ATOM   1205 N  N     . PHE A 1 146 ? 19.000  -30.328 -17.925 1.00 22.37  ? 146  PHE A N     1 
ATOM   1206 C  CA    . PHE A 1 146 ? 17.961  -29.737 -17.082 1.00 23.85  ? 146  PHE A CA    1 
ATOM   1207 C  C     . PHE A 1 146 ? 18.453  -29.730 -15.633 1.00 24.57  ? 146  PHE A C     1 
ATOM   1208 O  O     . PHE A 1 146 ? 18.649  -30.791 -15.019 1.00 24.15  ? 146  PHE A O     1 
ATOM   1209 C  CB    . PHE A 1 146 ? 16.645  -30.533 -17.173 1.00 24.24  ? 146  PHE A CB    1 
ATOM   1210 C  CG    . PHE A 1 146 ? 16.052  -30.594 -18.563 1.00 25.93  ? 146  PHE A CG    1 
ATOM   1211 C  CD1   . PHE A 1 146 ? 16.543  -31.487 -19.507 1.00 23.25  ? 146  PHE A CD1   1 
ATOM   1212 C  CD2   . PHE A 1 146 ? 14.991  -29.766 -18.917 1.00 26.76  ? 146  PHE A CD2   1 
ATOM   1213 C  CE1   . PHE A 1 146 ? 16.006  -31.545 -20.789 1.00 25.69  ? 146  PHE A CE1   1 
ATOM   1214 C  CE2   . PHE A 1 146 ? 14.440  -29.814 -20.199 1.00 26.32  ? 146  PHE A CE2   1 
ATOM   1215 C  CZ    . PHE A 1 146 ? 14.947  -30.706 -21.135 1.00 26.54  ? 146  PHE A CZ    1 
ATOM   1216 N  N     . TYR A 1 147 ? 18.665  -28.541 -15.087 1.00 23.12  ? 147  TYR A N     1 
ATOM   1217 C  CA    . TYR A 1 147 ? 19.052  -28.427 -13.692 1.00 24.29  ? 147  TYR A CA    1 
ATOM   1218 C  C     . TYR A 1 147 ? 17.811  -28.186 -12.847 1.00 24.98  ? 147  TYR A C     1 
ATOM   1219 O  O     . TYR A 1 147 ? 17.130  -27.161 -12.994 1.00 24.45  ? 147  TYR A O     1 
ATOM   1220 C  CB    . TYR A 1 147 ? 20.077  -27.312 -13.497 1.00 25.51  ? 147  TYR A CB    1 
ATOM   1221 C  CG    . TYR A 1 147 ? 21.382  -27.548 -14.233 1.00 27.87  ? 147  TYR A CG    1 
ATOM   1222 C  CD1   . TYR A 1 147 ? 21.589  -27.037 -15.522 1.00 28.35  ? 147  TYR A CD1   1 
ATOM   1223 C  CD2   . TYR A 1 147 ? 22.409  -28.278 -13.640 1.00 24.69  ? 147  TYR A CD2   1 
ATOM   1224 C  CE1   . TYR A 1 147 ? 22.795  -27.243 -16.198 1.00 28.53  ? 147  TYR A CE1   1 
ATOM   1225 C  CE2   . TYR A 1 147 ? 23.613  -28.488 -14.296 1.00 30.10  ? 147  TYR A CE2   1 
ATOM   1226 C  CZ    . TYR A 1 147 ? 23.801  -27.975 -15.573 1.00 32.78  ? 147  TYR A CZ    1 
ATOM   1227 O  OH    . TYR A 1 147 ? 24.995  -28.200 -16.206 1.00 31.57  ? 147  TYR A OH    1 
ATOM   1228 N  N     . VAL A 1 148 ? 17.523  -29.143 -11.968 1.00 24.28  ? 148  VAL A N     1 
ATOM   1229 C  CA    . VAL A 1 148 ? 16.320  -29.110 -11.143 1.00 22.09  ? 148  VAL A CA    1 
ATOM   1230 C  C     . VAL A 1 148 ? 16.695  -28.716 -9.709  1.00 23.36  ? 148  VAL A C     1 
ATOM   1231 O  O     . VAL A 1 148 ? 17.565  -29.323 -9.088  1.00 21.44  ? 148  VAL A O     1 
ATOM   1232 C  CB    . VAL A 1 148 ? 15.552  -30.467 -11.185 1.00 21.68  ? 148  VAL A CB    1 
ATOM   1233 C  CG1   . VAL A 1 148 ? 14.203  -30.363 -10.465 1.00 20.56  ? 148  VAL A CG1   1 
ATOM   1234 C  CG2   . VAL A 1 148 ? 15.331  -30.923 -12.631 1.00 20.04  ? 148  VAL A CG2   1 
ATOM   1235 N  N     . PHE A 1 149 ? 16.048  -27.674 -9.204  1.00 24.03  ? 149  PHE A N     1 
ATOM   1236 C  CA    . PHE A 1 149 ? 16.264  -27.215 -7.839  1.00 24.71  ? 149  PHE A CA    1 
ATOM   1237 C  C     . PHE A 1 149 ? 14.958  -27.467 -7.110  1.00 26.35  ? 149  PHE A C     1 
ATOM   1238 O  O     . PHE A 1 149 ? 13.933  -26.884 -7.447  1.00 29.54  ? 149  PHE A O     1 
ATOM   1239 C  CB    . PHE A 1 149 ? 16.632  -25.725 -7.816  1.00 25.07  ? 149  PHE A CB    1 
ATOM   1240 C  CG    . PHE A 1 149 ? 17.935  -25.393 -8.530  1.00 24.01  ? 149  PHE A CG    1 
ATOM   1241 C  CD1   . PHE A 1 149 ? 18.019  -25.421 -9.926  1.00 24.50  ? 149  PHE A CD1   1 
ATOM   1242 C  CD2   . PHE A 1 149 ? 19.065  -25.026 -7.803  1.00 25.65  ? 149  PHE A CD2   1 
ATOM   1243 C  CE1   . PHE A 1 149 ? 19.212  -25.099 -10.586 1.00 24.37  ? 149  PHE A CE1   1 
ATOM   1244 C  CE2   . PHE A 1 149 ? 20.271  -24.705 -8.453  1.00 25.01  ? 149  PHE A CE2   1 
ATOM   1245 C  CZ    . PHE A 1 149 ? 20.339  -24.747 -9.846  1.00 27.78  ? 149  PHE A CZ    1 
ATOM   1246 N  N     . ASP A 1 150 ? 14.997  -28.345 -6.119  1.00 26.63  ? 150  ASP A N     1 
ATOM   1247 C  CA    . ASP A 1 150 ? 13.788  -28.829 -5.467  1.00 27.81  ? 150  ASP A CA    1 
ATOM   1248 C  C     . ASP A 1 150 ? 13.818  -28.546 -3.965  1.00 26.60  ? 150  ASP A C     1 
ATOM   1249 O  O     . ASP A 1 150 ? 14.724  -28.994 -3.270  1.00 27.18  ? 150  ASP A O     1 
ATOM   1250 C  CB    . ASP A 1 150 ? 13.645  -30.335 -5.729  1.00 26.45  ? 150  ASP A CB    1 
ATOM   1251 C  CG    . ASP A 1 150 ? 12.376  -30.922 -5.143  1.00 33.41  ? 150  ASP A CG    1 
ATOM   1252 O  OD1   . ASP A 1 150 ? 11.483  -30.155 -4.693  1.00 30.59  ? 150  ASP A OD1   1 
ATOM   1253 O  OD2   . ASP A 1 150 ? 12.276  -32.172 -5.146  1.00 34.82  ? 150  ASP A OD2   1 
ATOM   1254 N  N     . LEU A 1 151 ? 12.820  -27.808 -3.479  1.00 25.08  ? 151  LEU A N     1 
ATOM   1255 C  CA    . LEU A 1 151 ? 12.706  -27.499 -2.058  1.00 25.84  ? 151  LEU A CA    1 
ATOM   1256 C  C     . LEU A 1 151 ? 11.970  -28.605 -1.299  1.00 27.12  ? 151  LEU A C     1 
ATOM   1257 O  O     . LEU A 1 151 ? 10.810  -28.904 -1.586  1.00 26.93  ? 151  LEU A O     1 
ATOM   1258 C  CB    . LEU A 1 151 ? 11.999  -26.155 -1.856  1.00 24.91  ? 151  LEU A CB    1 
ATOM   1259 C  CG    . LEU A 1 151 ? 11.842  -25.656 -0.419  1.00 23.28  ? 151  LEU A CG    1 
ATOM   1260 C  CD1   . LEU A 1 151 ? 13.193  -25.643 0.275   1.00 23.19  ? 151  LEU A CD1   1 
ATOM   1261 C  CD2   . LEU A 1 151 ? 11.208  -24.270 -0.386  1.00 25.11  ? 151  LEU A CD2   1 
ATOM   1262 N  N     . LEU A 1 152 ? 12.650  -29.199 -0.324  1.00 30.29  ? 152  LEU A N     1 
ATOM   1263 C  CA    . LEU A 1 152 ? 12.074  -30.314 0.449   1.00 32.12  ? 152  LEU A CA    1 
ATOM   1264 C  C     . LEU A 1 152 ? 11.289  -29.847 1.663   1.00 31.18  ? 152  LEU A C     1 
ATOM   1265 O  O     . LEU A 1 152 ? 10.358  -30.523 2.103   1.00 28.08  ? 152  LEU A O     1 
ATOM   1266 C  CB    . LEU A 1 152 ? 13.150  -31.317 0.885   1.00 31.39  ? 152  LEU A CB    1 
ATOM   1267 C  CG    . LEU A 1 152 ? 13.888  -32.107 -0.198  1.00 32.17  ? 152  LEU A CG    1 
ATOM   1268 C  CD1   . LEU A 1 152 ? 14.437  -33.382 0.424   1.00 36.34  ? 152  LEU A CD1   1 
ATOM   1269 C  CD2   . LEU A 1 152 ? 12.993  -32.448 -1.383  1.00 33.36  ? 152  LEU A CD2   1 
ATOM   1270 N  N     . ASN A 1 153 ? 11.679  -28.695 2.196   1.00 31.14  ? 153  ASN A N     1 
ATOM   1271 C  CA    . ASN A 1 153 ? 11.086  -28.174 3.415   1.00 34.36  ? 153  ASN A CA    1 
ATOM   1272 C  C     . ASN A 1 153 ? 10.584  -26.755 3.217   1.00 35.02  ? 153  ASN A C     1 
ATOM   1273 O  O     . ASN A 1 153 ? 11.328  -25.869 2.789   1.00 34.77  ? 153  ASN A O     1 
ATOM   1274 C  CB    . ASN A 1 153 ? 12.079  -28.248 4.580   1.00 35.93  ? 153  ASN A CB    1 
ATOM   1275 C  CG    . ASN A 1 153 ? 12.585  -29.667 4.838   1.00 40.96  ? 153  ASN A CG    1 
ATOM   1276 O  OD1   . ASN A 1 153 ? 11.832  -30.639 4.767   1.00 45.14  ? 153  ASN A OD1   1 
ATOM   1277 N  ND2   . ASN A 1 153 ? 13.869  -29.785 5.137   1.00 44.71  ? 153  ASN A ND2   1 
ATOM   1278 N  N     . SER A 1 154 ? 9.312   -26.555 3.543   1.00 35.61  ? 154  SER A N     1 
ATOM   1279 C  CA    . SER A 1 154 ? 8.622   -25.298 3.306   1.00 35.19  ? 154  SER A CA    1 
ATOM   1280 C  C     . SER A 1 154 ? 7.607   -25.096 4.419   1.00 35.39  ? 154  SER A C     1 
ATOM   1281 O  O     . SER A 1 154 ? 7.202   -26.065 5.053   1.00 36.37  ? 154  SER A O     1 
ATOM   1282 C  CB    . SER A 1 154 ? 7.913   -25.365 1.948   1.00 35.18  ? 154  SER A CB    1 
ATOM   1283 O  OG    . SER A 1 154 ? 6.843   -24.444 1.862   1.00 35.25  ? 154  SER A OG    1 
ATOM   1284 N  N     . PRO A 1 155 ? 7.192   -23.840 4.669   1.00 37.69  ? 155  PRO A N     1 
ATOM   1285 C  CA    . PRO A 1 155 ? 6.056   -23.627 5.575   1.00 38.80  ? 155  PRO A CA    1 
ATOM   1286 C  C     . PRO A 1 155 ? 4.750   -24.247 5.062   1.00 39.84  ? 155  PRO A C     1 
ATOM   1287 O  O     . PRO A 1 155 ? 3.813   -24.407 5.842   1.00 42.54  ? 155  PRO A O     1 
ATOM   1288 C  CB    . PRO A 1 155 ? 5.936   -22.094 5.651   1.00 38.29  ? 155  PRO A CB    1 
ATOM   1289 C  CG    . PRO A 1 155 ? 6.709   -21.579 4.468   1.00 37.71  ? 155  PRO A CG    1 
ATOM   1290 C  CD    . PRO A 1 155 ? 7.822   -22.564 4.278   1.00 37.40  ? 155  PRO A CD    1 
ATOM   1291 N  N     . TYR A 1 156 ? 4.694   -24.607 3.779   1.00 39.44  ? 156  TYR A N     1 
ATOM   1292 C  CA    . TYR A 1 156 ? 3.500   -25.246 3.207   1.00 40.62  ? 156  TYR A CA    1 
ATOM   1293 C  C     . TYR A 1 156 ? 3.605   -26.766 3.060   1.00 41.30  ? 156  TYR A C     1 
ATOM   1294 O  O     . TYR A 1 156 ? 2.715   -27.403 2.483   1.00 41.59  ? 156  TYR A O     1 
ATOM   1295 C  CB    . TYR A 1 156 ? 3.087   -24.581 1.882   1.00 38.79  ? 156  TYR A CB    1 
ATOM   1296 C  CG    . TYR A 1 156 ? 2.895   -23.085 2.015   1.00 40.54  ? 156  TYR A CG    1 
ATOM   1297 C  CD1   . TYR A 1 156 ? 2.204   -22.544 3.106   1.00 42.90  ? 156  TYR A CD1   1 
ATOM   1298 C  CD2   . TYR A 1 156 ? 3.413   -22.206 1.066   1.00 38.71  ? 156  TYR A CD2   1 
ATOM   1299 C  CE1   . TYR A 1 156 ? 2.037   -21.166 3.247   1.00 44.13  ? 156  TYR A CE1   1 
ATOM   1300 C  CE2   . TYR A 1 156 ? 3.242   -20.822 1.195   1.00 40.91  ? 156  TYR A CE2   1 
ATOM   1301 C  CZ    . TYR A 1 156 ? 2.554   -20.315 2.288   1.00 43.25  ? 156  TYR A CZ    1 
ATOM   1302 O  OH    . TYR A 1 156 ? 2.385   -18.961 2.431   1.00 46.80  ? 156  TYR A OH    1 
ATOM   1303 N  N     . GLY A 1 157 ? 4.681   -27.342 3.596   1.00 41.03  ? 157  GLY A N     1 
ATOM   1304 C  CA    . GLY A 1 157 ? 4.837   -28.797 3.630   1.00 40.90  ? 157  GLY A CA    1 
ATOM   1305 C  C     . GLY A 1 157 ? 6.265   -29.298 3.499   1.00 40.19  ? 157  GLY A C     1 
ATOM   1306 O  O     . GLY A 1 157 ? 7.072   -28.737 2.749   1.00 40.43  ? 157  GLY A O     1 
ATOM   1307 N  N     . ASN A 1 158 ? 6.573   -30.348 4.253   1.00 39.09  ? 158  ASN A N     1 
ATOM   1308 C  CA    . ASN A 1 158 ? 7.827   -31.076 4.118   1.00 37.95  ? 158  ASN A CA    1 
ATOM   1309 C  C     . ASN A 1 158 ? 7.600   -32.321 3.262   1.00 37.79  ? 158  ASN A C     1 
ATOM   1310 O  O     . ASN A 1 158 ? 6.644   -33.075 3.490   1.00 37.39  ? 158  ASN A O     1 
ATOM   1311 C  CB    . ASN A 1 158 ? 8.393   -31.459 5.493   1.00 38.30  ? 158  ASN A CB    1 
ATOM   1312 C  CG    . ASN A 1 158 ? 8.715   -30.244 6.359   1.00 40.94  ? 158  ASN A CG    1 
ATOM   1313 O  OD1   . ASN A 1 158 ? 9.121   -29.194 5.859   1.00 40.16  ? 158  ASN A OD1   1 
ATOM   1314 N  ND2   . ASN A 1 158 ? 8.536   -30.387 7.669   1.00 41.86  ? 158  ASN A ND2   1 
ATOM   1315 N  N     . VAL A 1 159 ? 8.479   -32.530 2.284   1.00 36.22  ? 159  VAL A N     1 
ATOM   1316 C  CA    . VAL A 1 159 ? 8.293   -33.575 1.278   1.00 37.20  ? 159  VAL A CA    1 
ATOM   1317 C  C     . VAL A 1 159 ? 9.514   -34.490 1.118   1.00 37.12  ? 159  VAL A C     1 
ATOM   1318 O  O     . VAL A 1 159 ? 10.600  -34.180 1.603   1.00 36.49  ? 159  VAL A O     1 
ATOM   1319 C  CB    . VAL A 1 159 ? 7.895   -32.969 -0.105  1.00 36.48  ? 159  VAL A CB    1 
ATOM   1320 C  CG1   . VAL A 1 159 ? 6.554   -32.259 -0.015  1.00 38.69  ? 159  VAL A CG1   1 
ATOM   1321 C  CG2   . VAL A 1 159 ? 8.956   -32.015 -0.621  1.00 37.68  ? 159  VAL A CG2   1 
ATOM   1322 N  N     . GLU A 1 160 ? 9.315   -35.618 0.439   1.00 37.77  ? 160  GLU A N     1 
ATOM   1323 C  CA    . GLU A 1 160 ? 10.404  -36.526 0.080   1.00 37.87  ? 160  GLU A CA    1 
ATOM   1324 C  C     . GLU A 1 160 ? 11.071  -36.107 -1.239  1.00 35.47  ? 160  GLU A C     1 
ATOM   1325 O  O     . GLU A 1 160 ? 10.505  -35.329 -2.013  1.00 33.59  ? 160  GLU A O     1 
ATOM   1326 C  CB    . GLU A 1 160 ? 9.889   -37.969 -0.011  1.00 39.91  ? 160  GLU A CB    1 
ATOM   1327 C  CG    . GLU A 1 160 ? 9.409   -38.543 1.330   1.00 49.92  ? 160  GLU A CG    1 
ATOM   1328 C  CD    . GLU A 1 160 ? 10.527  -38.640 2.362   1.00 55.72  ? 160  GLU A CD    1 
ATOM   1329 O  OE1   . GLU A 1 160 ? 11.450  -39.461 2.166   1.00 59.95  ? 160  GLU A OE1   1 
ATOM   1330 O  OE2   . GLU A 1 160 ? 10.485  -37.896 3.369   1.00 57.83  ? 160  GLU A OE2   1 
ATOM   1331 N  N     . GLU A 1 161 ? 12.273  -36.623 -1.488  1.00 34.49  ? 161  GLU A N     1 
ATOM   1332 C  CA    . GLU A 1 161 ? 12.990  -36.330 -2.723  1.00 33.69  ? 161  GLU A CA    1 
ATOM   1333 C  C     . GLU A 1 161 ? 12.216  -36.849 -3.921  1.00 32.97  ? 161  GLU A C     1 
ATOM   1334 O  O     . GLU A 1 161 ? 11.493  -37.843 -3.835  1.00 30.68  ? 161  GLU A O     1 
ATOM   1335 C  CB    . GLU A 1 161 ? 14.389  -36.952 -2.715  1.00 35.61  ? 161  GLU A CB    1 
ATOM   1336 C  CG    . GLU A 1 161 ? 15.434  -36.172 -1.915  1.00 36.01  ? 161  GLU A CG    1 
ATOM   1337 C  CD    . GLU A 1 161 ? 16.819  -36.807 -1.953  1.00 40.83  ? 161  GLU A CD    1 
ATOM   1338 O  OE1   . GLU A 1 161 ? 17.177  -37.452 -2.966  1.00 41.10  ? 161  GLU A OE1   1 
ATOM   1339 O  OE2   . GLU A 1 161 ? 17.565  -36.650 -0.961  1.00 47.35  ? 161  GLU A OE2   1 
ATOM   1340 N  N     . TRP A 1 162 ? 12.362  -36.146 -5.036  1.00 32.17  ? 162  TRP A N     1 
ATOM   1341 C  CA    . TRP A 1 162 ? 11.826  -36.590 -6.305  1.00 31.00  ? 162  TRP A CA    1 
ATOM   1342 C  C     . TRP A 1 162 ? 12.600  -37.823 -6.728  1.00 31.20  ? 162  TRP A C     1 
ATOM   1343 O  O     . TRP A 1 162 ? 13.802  -37.915 -6.496  1.00 30.86  ? 162  TRP A O     1 
ATOM   1344 C  CB    . TRP A 1 162 ? 11.992  -35.472 -7.317  1.00 29.40  ? 162  TRP A CB    1 
ATOM   1345 C  CG    . TRP A 1 162 ? 11.687  -35.788 -8.744  1.00 27.81  ? 162  TRP A CG    1 
ATOM   1346 C  CD1   . TRP A 1 162 ? 10.455  -35.847 -9.330  1.00 27.06  ? 162  TRP A CD1   1 
ATOM   1347 C  CD2   . TRP A 1 162 ? 12.640  -36.018 -9.785  1.00 26.96  ? 162  TRP A CD2   1 
ATOM   1348 N  NE1   . TRP A 1 162 ? 10.584  -36.107 -10.676 1.00 25.60  ? 162  TRP A NE1   1 
ATOM   1349 C  CE2   . TRP A 1 162 ? 11.915  -36.223 -10.979 1.00 25.57  ? 162  TRP A CE2   1 
ATOM   1350 C  CE3   . TRP A 1 162 ? 14.040  -36.084 -9.823  1.00 26.30  ? 162  TRP A CE3   1 
ATOM   1351 C  CZ2   . TRP A 1 162 ? 12.543  -36.499 -12.197 1.00 26.69  ? 162  TRP A CZ2   1 
ATOM   1352 C  CZ3   . TRP A 1 162 ? 14.663  -36.336 -11.034 1.00 26.85  ? 162  TRP A CZ3   1 
ATOM   1353 C  CH2   . TRP A 1 162 ? 13.914  -36.538 -12.208 1.00 27.12  ? 162  TRP A CH2   1 
ATOM   1354 N  N     . SER A 1 163 ? 11.896  -38.774 -7.329  1.00 31.85  ? 163  SER A N     1 
ATOM   1355 C  CA    . SER A 1 163 ? 12.507  -40.003 -7.811  1.00 32.36  ? 163  SER A CA    1 
ATOM   1356 C  C     . SER A 1 163 ? 12.552  -40.016 -9.334  1.00 32.67  ? 163  SER A C     1 
ATOM   1357 O  O     . SER A 1 163 ? 11.508  -40.054 -9.990  1.00 33.70  ? 163  SER A O     1 
ATOM   1358 C  CB    . SER A 1 163 ? 11.733  -41.222 -7.299  1.00 31.66  ? 163  SER A CB    1 
ATOM   1359 O  OG    . SER A 1 163 ? 12.091  -42.373 -8.040  1.00 34.37  ? 163  SER A OG    1 
ATOM   1360 N  N     . ILE A 1 164 ? 13.762  -39.987 -9.884  1.00 32.36  ? 164  ILE A N     1 
ATOM   1361 C  CA    . ILE A 1 164 ? 13.965  -40.085 -11.329 1.00 34.43  ? 164  ILE A CA    1 
ATOM   1362 C  C     . ILE A 1 164 ? 13.471  -41.430 -11.880 1.00 34.35  ? 164  ILE A C     1 
ATOM   1363 O  O     . ILE A 1 164 ? 13.056  -41.511 -13.033 1.00 36.20  ? 164  ILE A O     1 
ATOM   1364 C  CB    . ILE A 1 164 ? 15.456  -39.797 -11.745 1.00 34.43  ? 164  ILE A CB    1 
ATOM   1365 C  CG1   . ILE A 1 164 ? 15.589  -39.647 -13.271 1.00 35.05  ? 164  ILE A CG1   1 
ATOM   1366 C  CG2   . ILE A 1 164 ? 16.414  -40.868 -11.193 1.00 36.18  ? 164  ILE A CG2   1 
ATOM   1367 C  CD1   . ILE A 1 164 ? 16.823  -38.869 -13.732 1.00 33.63  ? 164  ILE A CD1   1 
ATOM   1368 N  N     . GLU A 1 165 ? 13.496  -42.471 -11.051 1.00 33.92  ? 165  GLU A N     1 
ATOM   1369 C  CA    . GLU A 1 165 ? 13.029  -43.797 -11.472 1.00 34.78  ? 165  GLU A CA    1 
ATOM   1370 C  C     . GLU A 1 165 ? 11.529  -43.787 -11.727 1.00 32.19  ? 165  GLU A C     1 
ATOM   1371 O  O     . GLU A 1 165 ? 11.061  -44.309 -12.738 1.00 33.40  ? 165  GLU A O     1 
ATOM   1372 C  CB    . GLU A 1 165 ? 13.371  -44.879 -10.431 1.00 38.08  ? 165  GLU A CB    1 
ATOM   1373 C  CG    . GLU A 1 165 ? 14.864  -45.087 -10.168 1.00 45.99  ? 165  GLU A CG    1 
ATOM   1374 C  CD    . GLU A 1 165 ? 15.465  -44.060 -9.205  1.00 52.43  ? 165  GLU A CD    1 
ATOM   1375 O  OE1   . GLU A 1 165 ? 14.720  -43.190 -8.692  1.00 54.08  ? 165  GLU A OE1   1 
ATOM   1376 O  OE2   . GLU A 1 165 ? 16.692  -44.122 -8.964  1.00 54.18  ? 165  GLU A OE2   1 
ATOM   1377 N  N     . ILE A 1 166 ? 10.768  -43.196 -10.809 1.00 32.54  ? 166  ILE A N     1 
ATOM   1378 C  CA    . ILE A 1 166 ? 9.313   -43.130 -10.982 1.00 33.09  ? 166  ILE A CA    1 
ATOM   1379 C  C     . ILE A 1 166 ? 8.939   -42.142 -12.093 1.00 30.01  ? 166  ILE A C     1 
ATOM   1380 O  O     . ILE A 1 166 ? 7.993   -42.374 -12.845 1.00 30.54  ? 166  ILE A O     1 
ATOM   1381 C  CB    . ILE A 1 166 ? 8.580   -42.803 -9.661  1.00 33.55  ? 166  ILE A CB    1 
ATOM   1382 C  CG1   . ILE A 1 166 ? 8.847   -43.899 -8.625  1.00 32.44  ? 166  ILE A CG1   1 
ATOM   1383 C  CG2   . ILE A 1 166 ? 7.077   -42.651 -9.898  1.00 33.80  ? 166  ILE A CG2   1 
ATOM   1384 C  CD1   . ILE A 1 166 ? 8.333   -43.568 -7.229  1.00 32.59  ? 166  ILE A CD1   1 
ATOM   1385 N  N     . ALA A 1 167 ? 9.704   -41.061 -12.209 1.00 26.87  ? 167  ALA A N     1 
ATOM   1386 C  CA    . ALA A 1 167 ? 9.484   -40.078 -13.264 1.00 27.25  ? 167  ALA A CA    1 
ATOM   1387 C  C     . ALA A 1 167 ? 9.579   -40.709 -14.657 1.00 27.37  ? 167  ALA A C     1 
ATOM   1388 O  O     . ALA A 1 167 ? 8.821   -40.347 -15.557 1.00 27.16  ? 167  ALA A O     1 
ATOM   1389 C  CB    . ALA A 1 167 ? 10.463  -38.919 -13.127 1.00 24.96  ? 167  ALA A CB    1 
ATOM   1390 N  N     . ALA A 1 168 ? 10.493  -41.662 -14.820 1.00 28.60  ? 168  ALA A N     1 
ATOM   1391 C  CA    . ALA A 1 168 ? 10.705  -42.314 -16.115 1.00 31.86  ? 168  ALA A CA    1 
ATOM   1392 C  C     . ALA A 1 168 ? 9.621   -43.331 -16.465 1.00 32.47  ? 168  ALA A C     1 
ATOM   1393 O  O     . ALA A 1 168 ? 9.382   -43.595 -17.643 1.00 34.65  ? 168  ALA A O     1 
ATOM   1394 C  CB    . ALA A 1 168 ? 12.091  -42.971 -16.172 1.00 34.66  ? 168  ALA A CB    1 
ATOM   1395 N  N     . LYS A 1 169 ? 8.971   -43.895 -15.448 1.00 32.03  ? 169  LYS A N     1 
ATOM   1396 C  CA    . LYS A 1 169 ? 7.950   -44.931 -15.646 1.00 32.78  ? 169  LYS A CA    1 
ATOM   1397 C  C     . LYS A 1 169 ? 6.696   -44.389 -16.318 1.00 31.73  ? 169  LYS A C     1 
ATOM   1398 O  O     . LYS A 1 169 ? 6.382   -43.196 -16.204 1.00 29.41  ? 169  LYS A O     1 
ATOM   1399 C  CB    . LYS A 1 169 ? 7.565   -45.588 -14.314 1.00 34.18  ? 169  LYS A CB    1 
ATOM   1400 C  CG    . LYS A 1 169 ? 8.644   -46.450 -13.688 1.00 38.69  ? 169  LYS A CG    1 
ATOM   1401 C  CD    . LYS A 1 169 ? 8.074   -47.300 -12.562 1.00 45.70  ? 169  LYS A CD    1 
ATOM   1402 C  CE    . LYS A 1 169 ? 9.168   -47.868 -11.671 1.00 52.37  ? 169  LYS A CE    1 
ATOM   1403 N  NZ    . LYS A 1 169 ? 10.120  -48.749 -12.411 1.00 54.78  ? 169  LYS A NZ    1 
ATOM   1404 N  N     . LEU A 1 170 ? 5.977   -45.282 -17.001 1.00 32.62  ? 170  LEU A N     1 
ATOM   1405 C  CA    . LEU A 1 170 ? 4.710   -44.952 -17.661 1.00 33.72  ? 170  LEU A CA    1 
ATOM   1406 C  C     . LEU A 1 170 ? 3.643   -44.537 -16.655 1.00 34.22  ? 170  LEU A C     1 
ATOM   1407 O  O     . LEU A 1 170 ? 3.680   -44.961 -15.498 1.00 35.43  ? 170  LEU A O     1 
ATOM   1408 C  CB    . LEU A 1 170 ? 4.196   -46.163 -18.444 1.00 34.86  ? 170  LEU A CB    1 
ATOM   1409 C  CG    . LEU A 1 170 ? 5.157   -46.948 -19.344 1.00 37.39  ? 170  LEU A CG    1 
ATOM   1410 C  CD1   . LEU A 1 170 ? 4.530   -48.291 -19.718 1.00 40.19  ? 170  LEU A CD1   1 
ATOM   1411 C  CD2   . LEU A 1 170 ? 5.545   -46.149 -20.585 1.00 34.87  ? 170  LEU A CD2   1 
ATOM   1412 N  N     . GLN A 1 171 ? 2.685   -43.727 -17.097 1.00 33.59  ? 171  GLN A N     1 
ATOM   1413 C  CA    . GLN A 1 171 ? 1.549   -43.366 -16.251 1.00 37.06  ? 171  GLN A CA    1 
ATOM   1414 C  C     . GLN A 1 171 ? 0.772   -44.583 -15.749 1.00 36.77  ? 171  GLN A C     1 
ATOM   1415 O  O     . GLN A 1 171 ? 0.187   -44.543 -14.673 1.00 37.18  ? 171  GLN A O     1 
ATOM   1416 C  CB    . GLN A 1 171 ? 0.617   -42.377 -16.956 1.00 37.67  ? 171  GLN A CB    1 
ATOM   1417 C  CG    . GLN A 1 171 ? 1.176   -40.955 -16.984 1.00 47.27  ? 171  GLN A CG    1 
ATOM   1418 C  CD    . GLN A 1 171 ? 0.102   -39.891 -16.842 1.00 54.25  ? 171  GLN A CD    1 
ATOM   1419 O  OE1   . GLN A 1 171 ? -0.729  -39.943 -15.928 1.00 57.49  ? 171  GLN A OE1   1 
ATOM   1420 N  NE2   . GLN A 1 171 ? 0.123   -38.906 -17.740 1.00 55.40  ? 171  GLN A NE2   1 
ATOM   1421 N  N     . GLU A 1 172 ? 0.799   -45.663 -16.527 1.00 35.20  ? 172  GLU A N     1 
ATOM   1422 C  CA    . GLU A 1 172 ? 0.120   -46.906 -16.181 1.00 35.87  ? 172  GLU A CA    1 
ATOM   1423 C  C     . GLU A 1 172 ? 0.873   -47.706 -15.114 1.00 36.62  ? 172  GLU A C     1 
ATOM   1424 O  O     . GLU A 1 172 ? 0.341   -48.671 -14.559 1.00 34.62  ? 172  GLU A O     1 
ATOM   1425 C  CB    . GLU A 1 172 ? -0.094  -47.755 -17.442 1.00 38.36  ? 172  GLU A CB    1 
ATOM   1426 C  CG    . GLU A 1 172 ? -1.084  -47.158 -18.427 1.00 39.25  ? 172  GLU A CG    1 
ATOM   1427 C  CD    . GLU A 1 172 ? -0.461  -46.162 -19.406 1.00 46.68  ? 172  GLU A CD    1 
ATOM   1428 O  OE1   . GLU A 1 172 ? -1.229  -45.494 -20.137 1.00 49.13  ? 172  GLU A OE1   1 
ATOM   1429 O  OE2   . GLU A 1 172 ? 0.783   -46.047 -19.457 1.00 46.54  ? 172  GLU A OE2   1 
ATOM   1430 N  N     . GLN A 1 173 ? 2.111   -47.302 -14.833 1.00 36.63  ? 173  GLN A N     1 
ATOM   1431 C  CA    . GLN A 1 173 ? 2.894   -47.896 -13.747 1.00 37.03  ? 173  GLN A CA    1 
ATOM   1432 C  C     . GLN A 1 173 ? 2.897   -46.986 -12.531 1.00 35.94  ? 173  GLN A C     1 
ATOM   1433 O  O     . GLN A 1 173 ? 3.551   -47.281 -11.526 1.00 36.63  ? 173  GLN A O     1 
ATOM   1434 C  CB    . GLN A 1 173 ? 4.336   -48.144 -14.184 1.00 37.41  ? 173  GLN A CB    1 
ATOM   1435 C  CG    . GLN A 1 173 ? 4.520   -49.199 -15.256 1.00 39.29  ? 173  GLN A CG    1 
ATOM   1436 C  CD    . GLN A 1 173 ? 5.966   -49.298 -15.692 1.00 42.95  ? 173  GLN A CD    1 
ATOM   1437 O  OE1   . GLN A 1 173 ? 6.458   -48.453 -16.447 1.00 44.93  ? 173  GLN A OE1   1 
ATOM   1438 N  NE2   . GLN A 1 173 ? 6.662   -50.325 -15.209 1.00 42.50  ? 173  GLN A NE2   1 
ATOM   1439 N  N     . GLY A 1 174 ? 2.166   -45.880 -12.627 1.00 34.62  ? 174  GLY A N     1 
ATOM   1440 C  CA    . GLY A 1 174 ? 2.098   -44.903 -11.545 1.00 34.50  ? 174  GLY A CA    1 
ATOM   1441 C  C     . GLY A 1 174 ? 3.182   -43.850 -11.669 1.00 35.01  ? 174  GLY A C     1 
ATOM   1442 O  O     . GLY A 1 174 ? 3.379   -43.039 -10.757 1.00 32.32  ? 174  GLY A O     1 
ATOM   1443 N  N     . GLY A 1 175 ? 3.885   -43.872 -12.802 1.00 34.20  ? 175  GLY A N     1 
ATOM   1444 C  CA    . GLY A 1 175 ? 4.952   -42.923 -13.078 1.00 32.89  ? 175  GLY A CA    1 
ATOM   1445 C  C     . GLY A 1 175 ? 4.451   -41.669 -13.765 1.00 33.24  ? 175  GLY A C     1 
ATOM   1446 O  O     . GLY A 1 175 ? 3.247   -41.496 -13.956 1.00 32.57  ? 175  GLY A O     1 
ATOM   1447 N  N     . ASP A 1 176 ? 5.386   -40.800 -14.146 1.00 32.33  ? 176  ASP A N     1 
ATOM   1448 C  CA    . ASP A 1 176 ? 5.061   -39.479 -14.675 1.00 32.89  ? 176  ASP A CA    1 
ATOM   1449 C  C     . ASP A 1 176 ? 5.325   -39.378 -16.169 1.00 33.68  ? 176  ASP A C     1 
ATOM   1450 O  O     . ASP A 1 176 ? 5.026   -38.356 -16.786 1.00 33.14  ? 176  ASP A O     1 
ATOM   1451 C  CB    . ASP A 1 176 ? 5.864   -38.400 -13.938 1.00 31.95  ? 176  ASP A CB    1 
ATOM   1452 C  CG    . ASP A 1 176 ? 5.754   -38.518 -12.423 1.00 34.92  ? 176  ASP A CG    1 
ATOM   1453 O  OD1   . ASP A 1 176 ? 4.621   -38.670 -11.913 1.00 34.16  ? 176  ASP A OD1   1 
ATOM   1454 O  OD2   . ASP A 1 176 ? 6.803   -38.462 -11.744 1.00 35.37  ? 176  ASP A OD2   1 
ATOM   1455 N  N     . GLU A 1 177 ? 5.909   -40.431 -16.736 1.00 35.75  ? 177  GLU A N     1 
ATOM   1456 C  CA    . GLU A 1 177 ? 6.171   -40.508 -18.172 1.00 39.05  ? 177  GLU A CA    1 
ATOM   1457 C  C     . GLU A 1 177 ? 6.986   -39.301 -18.657 1.00 37.11  ? 177  GLU A C     1 
ATOM   1458 O  O     . GLU A 1 177 ? 6.649   -38.681 -19.668 1.00 38.00  ? 177  GLU A O     1 
ATOM   1459 C  CB    . GLU A 1 177 ? 4.844   -40.599 -18.930 1.00 40.40  ? 177  GLU A CB    1 
ATOM   1460 C  CG    . GLU A 1 177 ? 4.738   -41.726 -19.923 1.00 47.88  ? 177  GLU A CG    1 
ATOM   1461 C  CD    . GLU A 1 177 ? 3.304   -41.906 -20.406 1.00 54.14  ? 177  GLU A CD    1 
ATOM   1462 O  OE1   . GLU A 1 177 ? 2.818   -41.043 -21.177 1.00 56.79  ? 177  GLU A OE1   1 
ATOM   1463 O  OE2   . GLU A 1 177 ? 2.661   -42.900 -20.003 1.00 53.56  ? 177  GLU A OE2   1 
ATOM   1464 N  N     . VAL A 1 178 ? 8.035   -38.949 -17.914 1.00 35.83  ? 178  VAL A N     1 
ATOM   1465 C  CA    . VAL A 1 178 ? 9.013   -37.963 -18.389 1.00 33.84  ? 178  VAL A CA    1 
ATOM   1466 C  C     . VAL A 1 178 ? 9.745   -38.618 -19.569 1.00 33.57  ? 178  VAL A C     1 
ATOM   1467 O  O     . VAL A 1 178 ? 10.275  -39.720 -19.416 1.00 32.82  ? 178  VAL A O     1 
ATOM   1468 C  CB    . VAL A 1 178 ? 9.995   -37.530 -17.263 1.00 33.93  ? 178  VAL A CB    1 
ATOM   1469 C  CG1   . VAL A 1 178 ? 11.089  -36.614 -17.798 1.00 31.09  ? 178  VAL A CG1   1 
ATOM   1470 C  CG2   . VAL A 1 178 ? 9.245   -36.845 -16.135 1.00 30.10  ? 178  VAL A CG2   1 
ATOM   1471 N  N     . PRO A 1 179 ? 9.728   -37.969 -20.758 1.00 33.79  ? 179  PRO A N     1 
ATOM   1472 C  CA    . PRO A 1 179 ? 10.255  -38.554 -22.001 1.00 32.91  ? 179  PRO A CA    1 
ATOM   1473 C  C     . PRO A 1 179 ? 11.649  -39.151 -21.814 1.00 33.69  ? 179  PRO A C     1 
ATOM   1474 O  O     . PRO A 1 179 ? 12.525  -38.493 -21.248 1.00 34.92  ? 179  PRO A O     1 
ATOM   1475 C  CB    . PRO A 1 179 ? 10.323  -37.349 -22.937 1.00 33.12  ? 179  PRO A CB    1 
ATOM   1476 C  CG    . PRO A 1 179 ? 9.215   -36.478 -22.488 1.00 33.91  ? 179  PRO A CG    1 
ATOM   1477 C  CD    . PRO A 1 179 ? 9.235   -36.596 -20.982 1.00 34.19  ? 179  PRO A CD    1 
ATOM   1478 N  N     . SER A 1 180 ? 11.846  -40.383 -22.275 1.00 34.35  ? 180  SER A N     1 
ATOM   1479 C  CA    . SER A 1 180 ? 13.116  -41.099 -22.070 1.00 36.32  ? 180  SER A CA    1 
ATOM   1480 C  C     . SER A 1 180 ? 14.351  -40.385 -22.637 1.00 35.90  ? 180  SER A C     1 
ATOM   1481 O  O     . SER A 1 180 ? 15.457  -40.561 -22.126 1.00 35.24  ? 180  SER A O     1 
ATOM   1482 C  CB    . SER A 1 180 ? 13.035  -42.546 -22.597 1.00 39.39  ? 180  SER A CB    1 
ATOM   1483 O  OG    . SER A 1 180 ? 12.873  -42.594 -24.008 1.00 41.67  ? 180  SER A OG    1 
ATOM   1484 N  N     . GLU A 1 181 ? 14.162  -39.569 -23.672 1.00 36.24  ? 181  GLU A N     1 
ATOM   1485 C  CA    . GLU A 1 181 ? 15.282  -38.853 -24.287 1.00 36.14  ? 181  GLU A CA    1 
ATOM   1486 C  C     . GLU A 1 181 ? 15.844  -37.694 -23.442 1.00 34.66  ? 181  GLU A C     1 
ATOM   1487 O  O     . GLU A 1 181 ? 16.844  -37.082 -23.824 1.00 36.20  ? 181  GLU A O     1 
ATOM   1488 C  CB    . GLU A 1 181 ? 14.928  -38.381 -25.711 1.00 38.60  ? 181  GLU A CB    1 
ATOM   1489 C  CG    . GLU A 1 181 ? 13.966  -37.188 -25.802 1.00 40.93  ? 181  GLU A CG    1 
ATOM   1490 C  CD    . GLU A 1 181 ? 12.497  -37.595 -25.842 1.00 44.94  ? 181  GLU A CD    1 
ATOM   1491 O  OE1   . GLU A 1 181 ? 12.184  -38.784 -25.607 1.00 45.08  ? 181  GLU A OE1   1 
ATOM   1492 O  OE2   . GLU A 1 181 ? 11.649  -36.715 -26.115 1.00 44.17  ? 181  GLU A OE2   1 
ATOM   1493 N  N     . ILE A 1 182 ? 15.209  -37.378 -22.314 1.00 29.82  ? 182  ILE A N     1 
ATOM   1494 C  CA    . ILE A 1 182 ? 15.746  -36.334 -21.433 1.00 29.07  ? 182  ILE A CA    1 
ATOM   1495 C  C     . ILE A 1 182 ? 16.122  -36.841 -20.040 1.00 29.21  ? 182  ILE A C     1 
ATOM   1496 O  O     . ILE A 1 182 ? 16.780  -36.132 -19.275 1.00 30.27  ? 182  ILE A O     1 
ATOM   1497 C  CB    . ILE A 1 182 ? 14.835  -35.058 -21.335 1.00 27.86  ? 182  ILE A CB    1 
ATOM   1498 C  CG1   . ILE A 1 182 ? 13.608  -35.310 -20.452 1.00 27.03  ? 182  ILE A CG1   1 
ATOM   1499 C  CG2   . ILE A 1 182 ? 14.449  -34.532 -22.742 1.00 27.25  ? 182  ILE A CG2   1 
ATOM   1500 C  CD1   . ILE A 1 182 ? 12.956  -34.026 -19.939 1.00 28.41  ? 182  ILE A CD1   1 
ATOM   1501 N  N     . ILE A 1 183 ? 15.728  -38.072 -19.730 1.00 28.53  ? 183  ILE A N     1 
ATOM   1502 C  CA    . ILE A 1 183 ? 16.005  -38.667 -18.424 1.00 31.96  ? 183  ILE A CA    1 
ATOM   1503 C  C     . ILE A 1 183 ? 17.486  -38.591 -18.036 1.00 32.87  ? 183  ILE A C     1 
ATOM   1504 O  O     . ILE A 1 183 ? 17.817  -38.239 -16.901 1.00 33.86  ? 183  ILE A O     1 
ATOM   1505 C  CB    . ILE A 1 183 ? 15.487  -40.133 -18.344 1.00 33.76  ? 183  ILE A CB    1 
ATOM   1506 C  CG1   . ILE A 1 183 ? 13.959  -40.149 -18.184 1.00 35.09  ? 183  ILE A CG1   1 
ATOM   1507 C  CG2   . ILE A 1 183 ? 16.192  -40.923 -17.224 1.00 30.40  ? 183  ILE A CG2   1 
ATOM   1508 C  CD1   . ILE A 1 183 ? 13.425  -39.465 -16.926 1.00 38.04  ? 183  ILE A CD1   1 
ATOM   1509 N  N     . ASP A 1 184 ? 18.366  -38.904 -18.985 1.00 33.18  ? 184  ASP A N     1 
ATOM   1510 C  CA    . ASP A 1 184 ? 19.807  -38.888 -18.746 1.00 33.56  ? 184  ASP A CA    1 
ATOM   1511 C  C     . ASP A 1 184 ? 20.370  -37.465 -18.704 1.00 31.12  ? 184  ASP A C     1 
ATOM   1512 O  O     . ASP A 1 184 ? 21.543  -37.274 -18.401 1.00 31.28  ? 184  ASP A O     1 
ATOM   1513 C  CB    . ASP A 1 184 ? 20.537  -39.722 -19.815 1.00 36.51  ? 184  ASP A CB    1 
ATOM   1514 C  CG    . ASP A 1 184 ? 20.186  -41.214 -19.751 1.00 44.00  ? 184  ASP A CG    1 
ATOM   1515 O  OD1   . ASP A 1 184 ? 19.762  -41.697 -18.676 1.00 49.48  ? 184  ASP A OD1   1 
ATOM   1516 O  OD2   . ASP A 1 184 ? 20.335  -41.911 -20.777 1.00 47.04  ? 184  ASP A OD2   1 
ATOM   1517 N  N     . LYS A 1 185 ? 19.534  -36.476 -19.010 1.00 28.24  ? 185  LYS A N     1 
ATOM   1518 C  CA    . LYS A 1 185 ? 19.962  -35.073 -19.061 1.00 26.90  ? 185  LYS A CA    1 
ATOM   1519 C  C     . LYS A 1 185 ? 19.548  -34.266 -17.832 1.00 25.09  ? 185  LYS A C     1 
ATOM   1520 O  O     . LYS A 1 185 ? 19.712  -33.039 -17.804 1.00 24.19  ? 185  LYS A O     1 
ATOM   1521 C  CB    . LYS A 1 185 ? 19.426  -34.403 -20.331 1.00 24.20  ? 185  LYS A CB    1 
ATOM   1522 C  CG    . LYS A 1 185 ? 19.890  -35.090 -21.606 1.00 28.65  ? 185  LYS A CG    1 
ATOM   1523 C  CD    . LYS A 1 185 ? 19.451  -34.357 -22.855 1.00 27.31  ? 185  LYS A CD    1 
ATOM   1524 C  CE    . LYS A 1 185 ? 19.971  -35.083 -24.095 1.00 30.88  ? 185  LYS A CE    1 
ATOM   1525 N  NZ    . LYS A 1 185 ? 19.780  -34.278 -25.339 1.00 30.43  ? 185  LYS A NZ    1 
ATOM   1526 N  N     . ILE A 1 186 ? 18.998  -34.951 -16.831 1.00 24.95  ? 186  ILE A N     1 
ATOM   1527 C  CA    . ILE A 1 186 ? 18.512  -34.281 -15.621 1.00 26.91  ? 186  ILE A CA    1 
ATOM   1528 C  C     . ILE A 1 186 ? 19.557  -34.313 -14.512 1.00 27.73  ? 186  ILE A C     1 
ATOM   1529 O  O     . ILE A 1 186 ? 20.120  -35.367 -14.199 1.00 26.19  ? 186  ILE A O     1 
ATOM   1530 C  CB    . ILE A 1 186 ? 17.151  -34.851 -15.124 1.00 26.28  ? 186  ILE A CB    1 
ATOM   1531 C  CG1   . ILE A 1 186 ? 16.069  -34.658 -16.194 1.00 29.42  ? 186  ILE A CG1   1 
ATOM   1532 C  CG2   . ILE A 1 186 ? 16.712  -34.163 -13.835 1.00 23.85  ? 186  ILE A CG2   1 
ATOM   1533 C  CD1   . ILE A 1 186 ? 14.768  -35.412 -15.917 1.00 31.63  ? 186  ILE A CD1   1 
ATOM   1534 N  N     . ILE A 1 187 ? 19.826  -33.138 -13.951 1.00 27.29  ? 187  ILE A N     1 
ATOM   1535 C  CA    . ILE A 1 187 ? 20.732  -32.997 -12.826 1.00 26.89  ? 187  ILE A CA    1 
ATOM   1536 C  C     . ILE A 1 187 ? 19.889  -32.453 -11.691 1.00 27.32  ? 187  ILE A C     1 
ATOM   1537 O  O     . ILE A 1 187 ? 19.489  -31.278 -11.689 1.00 26.08  ? 187  ILE A O     1 
ATOM   1538 C  CB    . ILE A 1 187 ? 21.956  -32.098 -13.160 1.00 28.89  ? 187  ILE A CB    1 
ATOM   1539 C  CG1   . ILE A 1 187 ? 22.786  -32.753 -14.273 1.00 30.46  ? 187  ILE A CG1   1 
ATOM   1540 C  CG2   . ILE A 1 187 ? 22.830  -31.881 -11.916 1.00 28.05  ? 187  ILE A CG2   1 
ATOM   1541 C  CD1   . ILE A 1 187 ? 23.853  -31.882 -14.875 1.00 32.99  ? 187  ILE A CD1   1 
ATOM   1542 N  N     . TYR A 1 188 ? 19.609  -33.342 -10.741 1.00 25.32  ? 188  TYR A N     1 
ATOM   1543 C  CA    . TYR A 1 188 ? 18.651  -33.103 -9.690  1.00 24.94  ? 188  TYR A CA    1 
ATOM   1544 C  C     . TYR A 1 188 ? 19.357  -32.700 -8.393  1.00 27.87  ? 188  TYR A C     1 
ATOM   1545 O  O     . TYR A 1 188 ? 20.262  -33.401 -7.930  1.00 26.80  ? 188  TYR A O     1 
ATOM   1546 C  CB    . TYR A 1 188 ? 17.798  -34.364 -9.482  1.00 27.76  ? 188  TYR A CB    1 
ATOM   1547 C  CG    . TYR A 1 188 ? 16.846  -34.271 -8.304  1.00 29.49  ? 188  TYR A CG    1 
ATOM   1548 C  CD1   . TYR A 1 188 ? 15.726  -33.442 -8.360  1.00 27.00  ? 188  TYR A CD1   1 
ATOM   1549 C  CD2   . TYR A 1 188 ? 17.073  -35.002 -7.131  1.00 29.86  ? 188  TYR A CD2   1 
ATOM   1550 C  CE1   . TYR A 1 188 ? 14.851  -33.338 -7.286  1.00 27.77  ? 188  TYR A CE1   1 
ATOM   1551 C  CE2   . TYR A 1 188 ? 16.194  -34.911 -6.042  1.00 31.41  ? 188  TYR A CE2   1 
ATOM   1552 C  CZ    . TYR A 1 188 ? 15.084  -34.068 -6.130  1.00 28.30  ? 188  TYR A CZ    1 
ATOM   1553 O  OH    . TYR A 1 188 ? 14.202  -33.957 -5.076  1.00 22.87  ? 188  TYR A OH    1 
ATOM   1554 N  N     . MET A 1 189 ? 18.943  -31.571 -7.819  1.00 27.26  ? 189  MET A N     1 
ATOM   1555 C  CA    . MET A 1 189 ? 19.532  -31.061 -6.569  1.00 30.05  ? 189  MET A CA    1 
ATOM   1556 C  C     . MET A 1 189 ? 18.427  -30.686 -5.585  1.00 30.30  ? 189  MET A C     1 
ATOM   1557 O  O     . MET A 1 189 ? 17.767  -29.662 -5.773  1.00 28.96  ? 189  MET A O     1 
ATOM   1558 C  CB    . MET A 1 189 ? 20.417  -29.830 -6.827  1.00 30.35  ? 189  MET A CB    1 
ATOM   1559 C  CG    . MET A 1 189 ? 21.599  -30.068 -7.765  1.00 34.68  ? 189  MET A CG    1 
ATOM   1560 S  SD    . MET A 1 189 ? 22.178  -28.583 -8.625  1.00 38.86  ? 189  MET A SD    1 
ATOM   1561 C  CE    . MET A 1 189 ? 20.889  -28.379 -9.863  1.00 31.59  ? 189  MET A CE    1 
ATOM   1562 N  N     . PRO A 1 190 ? 18.209  -31.520 -4.545  1.00 30.85  ? 190  PRO A N     1 
ATOM   1563 C  CA    . PRO A 1 190 ? 17.250  -31.207 -3.485  1.00 31.63  ? 190  PRO A CA    1 
ATOM   1564 C  C     . PRO A 1 190 ? 17.845  -30.294 -2.411  1.00 33.07  ? 190  PRO A C     1 
ATOM   1565 O  O     . PRO A 1 190 ? 19.046  -30.327 -2.166  1.00 35.35  ? 190  PRO A O     1 
ATOM   1566 C  CB    . PRO A 1 190 ? 16.924  -32.578 -2.898  1.00 33.26  ? 190  PRO A CB    1 
ATOM   1567 C  CG    . PRO A 1 190 ? 18.169  -33.374 -3.104  1.00 34.97  ? 190  PRO A CG    1 
ATOM   1568 C  CD    . PRO A 1 190 ? 18.770  -32.878 -4.399  1.00 32.83  ? 190  PRO A CD    1 
ATOM   1569 N  N     . PHE A 1 191 ? 17.007  -29.489 -1.770  1.00 32.76  ? 191  PHE A N     1 
ATOM   1570 C  CA    . PHE A 1 191 ? 17.485  -28.537 -0.764  1.00 32.78  ? 191  PHE A CA    1 
ATOM   1571 C  C     . PHE A 1 191 ? 16.656  -28.611 0.501   1.00 34.21  ? 191  PHE A C     1 
ATOM   1572 O  O     . PHE A 1 191 ? 15.433  -28.760 0.445   1.00 31.60  ? 191  PHE A O     1 
ATOM   1573 C  CB    . PHE A 1 191 ? 17.477  -27.105 -1.326  1.00 31.12  ? 191  PHE A CB    1 
ATOM   1574 C  CG    . PHE A 1 191 ? 18.492  -26.880 -2.415  1.00 29.66  ? 191  PHE A CG    1 
ATOM   1575 C  CD1   . PHE A 1 191 ? 18.179  -27.153 -3.749  1.00 28.50  ? 191  PHE A CD1   1 
ATOM   1576 C  CD2   . PHE A 1 191 ? 19.769  -26.425 -2.107  1.00 28.93  ? 191  PHE A CD2   1 
ATOM   1577 C  CE1   . PHE A 1 191 ? 19.116  -26.965 -4.757  1.00 26.97  ? 191  PHE A CE1   1 
ATOM   1578 C  CE2   . PHE A 1 191 ? 20.719  -26.232 -3.112  1.00 29.57  ? 191  PHE A CE2   1 
ATOM   1579 C  CZ    . PHE A 1 191 ? 20.391  -26.501 -4.438  1.00 28.09  ? 191  PHE A CZ    1 
ATOM   1580 N  N     . ASP A 1 192 ? 17.334  -28.507 1.642   1.00 38.73  ? 192  ASP A N     1 
ATOM   1581 C  CA    . ASP A 1 192 ? 16.683  -28.532 2.950   1.00 41.13  ? 192  ASP A CA    1 
ATOM   1582 C  C     . ASP A 1 192 ? 15.935  -27.239 3.272   1.00 39.26  ? 192  ASP A C     1 
ATOM   1583 O  O     . ASP A 1 192 ? 15.018  -27.246 4.091   1.00 40.84  ? 192  ASP A O     1 
ATOM   1584 C  CB    . ASP A 1 192 ? 17.710  -28.816 4.056   1.00 46.53  ? 192  ASP A CB    1 
ATOM   1585 C  CG    . ASP A 1 192 ? 18.312  -30.206 3.951   1.00 54.00  ? 192  ASP A CG    1 
ATOM   1586 O  OD1   . ASP A 1 192 ? 17.547  -31.183 3.757   1.00 57.09  ? 192  ASP A OD1   1 
ATOM   1587 O  OD2   . ASP A 1 192 ? 19.553  -30.320 4.069   1.00 58.61  ? 192  ASP A OD2   1 
ATOM   1588 N  N     . ASN A 1 193 ? 16.342  -26.131 2.655   1.00 35.50  ? 193  ASN A N     1 
ATOM   1589 C  CA    . ASN A 1 193 ? 15.680  -24.845 2.884   1.00 33.48  ? 193  ASN A CA    1 
ATOM   1590 C  C     . ASN A 1 193 ? 15.764  -23.889 1.685   1.00 31.69  ? 193  ASN A C     1 
ATOM   1591 O  O     . ASN A 1 193 ? 16.632  -24.033 0.819   1.00 28.68  ? 193  ASN A O     1 
ATOM   1592 C  CB    . ASN A 1 193 ? 16.191  -24.176 4.170   1.00 34.39  ? 193  ASN A CB    1 
ATOM   1593 C  CG    . ASN A 1 193 ? 17.646  -23.756 4.072   1.00 39.16  ? 193  ASN A CG    1 
ATOM   1594 O  OD1   . ASN A 1 193 ? 17.951  -22.632 3.672   1.00 41.85  ? 193  ASN A OD1   1 
ATOM   1595 N  ND2   . ASN A 1 193 ? 18.552  -24.665 4.412   1.00 41.64  ? 193  ASN A ND2   1 
ATOM   1596 N  N     . GLU A 1 194 ? 14.852  -22.918 1.648   1.00 31.14  ? 194  GLU A N     1 
ATOM   1597 C  CA    . GLU A 1 194 ? 14.712  -22.013 0.508   1.00 29.85  ? 194  GLU A CA    1 
ATOM   1598 C  C     . GLU A 1 194 ? 15.941  -21.143 0.316   1.00 30.16  ? 194  GLU A C     1 
ATOM   1599 O  O     . GLU A 1 194 ? 16.357  -20.900 -0.818  1.00 29.22  ? 194  GLU A O     1 
ATOM   1600 C  CB    . GLU A 1 194 ? 13.465  -21.126 0.655   1.00 30.19  ? 194  GLU A CB    1 
ATOM   1601 C  CG    . GLU A 1 194 ? 13.051  -20.456 -0.650  1.00 28.13  ? 194  GLU A CG    1 
ATOM   1602 C  CD    . GLU A 1 194 ? 12.085  -19.298 -0.476  1.00 31.27  ? 194  GLU A CD    1 
ATOM   1603 O  OE1   . GLU A 1 194 ? 11.745  -18.669 -1.502  1.00 29.42  ? 194  GLU A OE1   1 
ATOM   1604 O  OE2   . GLU A 1 194 ? 11.656  -19.010 0.663   1.00 34.35  ? 194  GLU A OE2   1 
ATOM   1605 N  N     . LYS A 1 195 ? 16.511  -20.667 1.422   1.00 31.29  ? 195  LYS A N     1 
ATOM   1606 C  CA    . LYS A 1 195 ? 17.693  -19.811 1.372   1.00 32.87  ? 195  LYS A CA    1 
ATOM   1607 C  C     . LYS A 1 195 ? 18.841  -20.477 0.625   1.00 31.57  ? 195  LYS A C     1 
ATOM   1608 O  O     . LYS A 1 195 ? 19.434  -19.864 -0.269  1.00 29.32  ? 195  LYS A O     1 
ATOM   1609 C  CB    . LYS A 1 195 ? 18.139  -19.389 2.774   1.00 34.26  ? 195  LYS A CB    1 
ATOM   1610 C  CG    . LYS A 1 195 ? 17.184  -18.424 3.461   1.00 40.71  ? 195  LYS A CG    1 
ATOM   1611 C  CD    . LYS A 1 195 ? 17.880  -17.675 4.592   1.00 43.75  ? 195  LYS A CD    1 
ATOM   1612 C  CE    . LYS A 1 195 ? 16.878  -17.012 5.519   1.00 46.92  ? 195  LYS A CE    1 
ATOM   1613 N  NZ    . LYS A 1 195 ? 16.367  -17.989 6.534   1.00 49.95  ? 195  LYS A NZ    1 
ATOM   1614 N  N     . GLU A 1 196 ? 19.138  -21.730 0.979   1.00 32.14  ? 196  GLU A N     1 
ATOM   1615 C  CA    . GLU A 1 196 ? 20.221  -22.461 0.324   1.00 33.86  ? 196  GLU A CA    1 
ATOM   1616 C  C     . GLU A 1 196 ? 19.906  -22.757 -1.147  1.00 30.92  ? 196  GLU A C     1 
ATOM   1617 O  O     . GLU A 1 196 ? 20.794  -22.688 -1.994  1.00 33.17  ? 196  GLU A O     1 
ATOM   1618 C  CB    . GLU A 1 196 ? 20.675  -23.704 1.128   1.00 36.46  ? 196  GLU A CB    1 
ATOM   1619 C  CG    . GLU A 1 196 ? 19.756  -24.932 1.099   1.00 42.99  ? 196  GLU A CG    1 
ATOM   1620 C  CD    . GLU A 1 196 ? 20.315  -26.135 1.898   1.00 49.83  ? 196  GLU A CD    1 
ATOM   1621 O  OE1   . GLU A 1 196 ? 20.149  -27.301 1.442   1.00 45.64  ? 196  GLU A OE1   1 
ATOM   1622 O  OE2   . GLU A 1 196 ? 20.917  -25.913 2.980   1.00 50.57  ? 196  GLU A OE2   1 
ATOM   1623 N  N     . LEU A 1 197 ? 18.644  -23.045 -1.454  1.00 29.81  ? 197  LEU A N     1 
ATOM   1624 C  CA    . LEU A 1 197 ? 18.217  -23.242 -2.848  1.00 28.43  ? 197  LEU A CA    1 
ATOM   1625 C  C     . LEU A 1 197 ? 18.515  -21.976 -3.679  1.00 27.82  ? 197  LEU A C     1 
ATOM   1626 O  O     . LEU A 1 197 ? 19.119  -22.042 -4.756  1.00 26.07  ? 197  LEU A O     1 
ATOM   1627 C  CB    . LEU A 1 197 ? 16.723  -23.612 -2.910  1.00 26.22  ? 197  LEU A CB    1 
ATOM   1628 C  CG    . LEU A 1 197 ? 16.082  -24.023 -4.246  1.00 27.35  ? 197  LEU A CG    1 
ATOM   1629 C  CD1   . LEU A 1 197 ? 14.763  -24.744 -4.008  1.00 25.05  ? 197  LEU A CD1   1 
ATOM   1630 C  CD2   . LEU A 1 197 ? 15.858  -22.832 -5.186  1.00 26.01  ? 197  LEU A CD2   1 
ATOM   1631 N  N     . LEU A 1 198 ? 18.108  -20.825 -3.154  1.00 26.68  ? 198  LEU A N     1 
ATOM   1632 C  CA    . LEU A 1 198 ? 18.269  -19.570 -3.862  1.00 27.24  ? 198  LEU A CA    1 
ATOM   1633 C  C     . LEU A 1 198 ? 19.725  -19.140 -3.983  1.00 28.52  ? 198  LEU A C     1 
ATOM   1634 O  O     . LEU A 1 198 ? 20.127  -18.621 -5.025  1.00 28.52  ? 198  LEU A O     1 
ATOM   1635 C  CB    . LEU A 1 198 ? 17.413  -18.476 -3.226  1.00 27.56  ? 198  LEU A CB    1 
ATOM   1636 C  CG    . LEU A 1 198 ? 15.910  -18.593 -3.505  1.00 27.85  ? 198  LEU A CG    1 
ATOM   1637 C  CD1   . LEU A 1 198 ? 15.165  -17.487 -2.802  1.00 26.47  ? 198  LEU A CD1   1 
ATOM   1638 C  CD2   . LEU A 1 198 ? 15.609  -18.548 -5.007  1.00 27.60  ? 198  LEU A CD2   1 
ATOM   1639 N  N     . MET A 1 199 ? 20.511  -19.364 -2.932  1.00 30.17  ? 199  MET A N     1 
ATOM   1640 C  CA    . MET A 1 199 ? 21.932  -19.025 -2.951  1.00 31.43  ? 199  MET A CA    1 
ATOM   1641 C  C     . MET A 1 199 ? 22.676  -19.879 -3.971  1.00 30.84  ? 199  MET A C     1 
ATOM   1642 O  O     . MET A 1 199 ? 23.496  -19.366 -4.737  1.00 30.29  ? 199  MET A O     1 
ATOM   1643 C  CB    . MET A 1 199 ? 22.568  -19.175 -1.558  1.00 32.90  ? 199  MET A CB    1 
ATOM   1644 C  CG    . MET A 1 199 ? 22.235  -18.033 -0.608  1.00 34.53  ? 199  MET A CG    1 
ATOM   1645 S  SD    . MET A 1 199 ? 23.093  -18.109 0.977   1.00 40.48  ? 199  MET A SD    1 
ATOM   1646 C  CE    . MET A 1 199 ? 22.377  -19.574 1.732   1.00 34.70  ? 199  MET A CE    1 
ATOM   1647 N  N     . GLU A 1 200 ? 22.373  -21.176 -3.981  1.00 29.11  ? 200  GLU A N     1 
ATOM   1648 C  CA    . GLU A 1 200 ? 22.938  -22.086 -4.969  1.00 30.85  ? 200  GLU A CA    1 
ATOM   1649 C  C     . GLU A 1 200 ? 22.514  -21.708 -6.395  1.00 28.79  ? 200  GLU A C     1 
ATOM   1650 O  O     . GLU A 1 200 ? 23.344  -21.707 -7.307  1.00 28.55  ? 200  GLU A O     1 
ATOM   1651 C  CB    . GLU A 1 200 ? 22.573  -23.539 -4.647  1.00 32.99  ? 200  GLU A CB    1 
ATOM   1652 C  CG    . GLU A 1 200 ? 23.163  -24.571 -5.607  1.00 40.12  ? 200  GLU A CG    1 
ATOM   1653 C  CD    . GLU A 1 200 ? 24.686  -24.558 -5.653  1.00 50.14  ? 200  GLU A CD    1 
ATOM   1654 O  OE1   . GLU A 1 200 ? 25.325  -24.516 -4.571  1.00 52.18  ? 200  GLU A OE1   1 
ATOM   1655 O  OE2   . GLU A 1 200 ? 25.241  -24.594 -6.779  1.00 54.13  ? 200  GLU A OE2   1 
ATOM   1656 N  N     . TYR A 1 201 ? 21.241  -21.368 -6.583  1.00 26.62  ? 201  TYR A N     1 
ATOM   1657 C  CA    . TYR A 1 201 ? 20.768  -20.943 -7.905  1.00 26.08  ? 201  TYR A CA    1 
ATOM   1658 C  C     . TYR A 1 201 ? 21.558  -19.738 -8.422  1.00 26.69  ? 201  TYR A C     1 
ATOM   1659 O  O     . TYR A 1 201 ? 22.016  -19.733 -9.566  1.00 27.45  ? 201  TYR A O     1 
ATOM   1660 C  CB    . TYR A 1 201 ? 19.266  -20.650 -7.907  1.00 24.48  ? 201  TYR A CB    1 
ATOM   1661 C  CG    . TYR A 1 201 ? 18.711  -20.423 -9.299  1.00 26.19  ? 201  TYR A CG    1 
ATOM   1662 C  CD1   . TYR A 1 201 ? 18.810  -21.419 -10.279 1.00 24.09  ? 201  TYR A CD1   1 
ATOM   1663 C  CD2   . TYR A 1 201 ? 18.093  -19.213 -9.644  1.00 24.14  ? 201  TYR A CD2   1 
ATOM   1664 C  CE1   . TYR A 1 201 ? 18.319  -21.218 -11.563 1.00 22.26  ? 201  TYR A CE1   1 
ATOM   1665 C  CE2   . TYR A 1 201 ? 17.591  -19.008 -10.936 1.00 22.87  ? 201  TYR A CE2   1 
ATOM   1666 C  CZ    . TYR A 1 201 ? 17.705  -20.018 -11.884 1.00 24.72  ? 201  TYR A CZ    1 
ATOM   1667 O  OH    . TYR A 1 201 ? 17.209  -19.841 -13.157 1.00 25.13  ? 201  TYR A OH    1 
ATOM   1668 N  N     . LEU A 1 202 ? 21.741  -18.734 -7.572  1.00 24.32  ? 202  LEU A N     1 
ATOM   1669 C  CA    . LEU A 1 202 ? 22.516  -17.561 -7.954  1.00 27.71  ? 202  LEU A CA    1 
ATOM   1670 C  C     . LEU A 1 202 ? 23.964  -17.902 -8.321  1.00 28.21  ? 202  LEU A C     1 
ATOM   1671 O  O     . LEU A 1 202 ? 24.487  -17.380 -9.307  1.00 28.99  ? 202  LEU A O     1 
ATOM   1672 C  CB    . LEU A 1 202 ? 22.472  -16.494 -6.863  1.00 27.18  ? 202  LEU A CB    1 
ATOM   1673 C  CG    . LEU A 1 202 ? 21.156  -15.726 -6.749  1.00 29.85  ? 202  LEU A CG    1 
ATOM   1674 C  CD1   . LEU A 1 202 ? 21.195  -14.834 -5.513  1.00 29.61  ? 202  LEU A CD1   1 
ATOM   1675 C  CD2   . LEU A 1 202 ? 20.867  -14.906 -8.013  1.00 25.87  ? 202  LEU A CD2   1 
ATOM   1676 N  N     . ASN A 1 203 ? 24.600  -18.774 -7.537  1.00 28.10  ? 203  ASN A N     1 
ATOM   1677 C  CA    . ASN A 1 203 ? 25.950  -19.238 -7.863  1.00 29.47  ? 203  ASN A CA    1 
ATOM   1678 C  C     . ASN A 1 203 ? 25.994  -19.971 -9.202  1.00 28.88  ? 203  ASN A C     1 
ATOM   1679 O  O     . ASN A 1 203 ? 26.918  -19.782 -10.000 1.00 29.77  ? 203  ASN A O     1 
ATOM   1680 C  CB    . ASN A 1 203 ? 26.515  -20.123 -6.752  1.00 30.07  ? 203  ASN A CB    1 
ATOM   1681 C  CG    . ASN A 1 203 ? 26.994  -19.323 -5.554  1.00 33.58  ? 203  ASN A CG    1 
ATOM   1682 O  OD1   . ASN A 1 203 ? 27.002  -19.822 -4.433  1.00 36.73  ? 203  ASN A OD1   1 
ATOM   1683 N  ND2   . ASN A 1 203 ? 27.413  -18.085 -5.788  1.00 33.27  ? 203  ASN A ND2   1 
ATOM   1684 N  N     . PHE A 1 204 ? 24.977  -20.793 -9.435  1.00 26.00  ? 204  PHE A N     1 
ATOM   1685 C  CA    . PHE A 1 204 ? 24.801  -21.504 -10.697 1.00 26.72  ? 204  PHE A CA    1 
ATOM   1686 C  C     . PHE A 1 204 ? 24.617  -20.501 -11.848 1.00 24.94  ? 204  PHE A C     1 
ATOM   1687 O  O     . PHE A 1 204 ? 25.300  -20.591 -12.867 1.00 24.66  ? 204  PHE A O     1 
ATOM   1688 C  CB    . PHE A 1 204 ? 23.631  -22.490 -10.555 1.00 23.74  ? 204  PHE A CB    1 
ATOM   1689 C  CG    . PHE A 1 204 ? 23.040  -22.946 -11.847 1.00 27.85  ? 204  PHE A CG    1 
ATOM   1690 C  CD1   . PHE A 1 204 ? 23.521  -24.087 -12.481 1.00 29.27  ? 204  PHE A CD1   1 
ATOM   1691 C  CD2   . PHE A 1 204 ? 21.966  -22.260 -12.416 1.00 24.35  ? 204  PHE A CD2   1 
ATOM   1692 C  CE1   . PHE A 1 204 ? 22.959  -24.523 -13.670 1.00 27.08  ? 204  PHE A CE1   1 
ATOM   1693 C  CE2   . PHE A 1 204 ? 21.408  -22.690 -13.604 1.00 24.87  ? 204  PHE A CE2   1 
ATOM   1694 C  CZ    . PHE A 1 204 ? 21.908  -23.823 -14.234 1.00 24.65  ? 204  PHE A CZ    1 
ATOM   1695 N  N     . TRP A 1 205 ? 23.721  -19.537 -11.657 1.00 24.76  ? 205  TRP A N     1 
ATOM   1696 C  CA    . TRP A 1 205 ? 23.468  -18.468 -12.630 1.00 26.30  ? 205  TRP A CA    1 
ATOM   1697 C  C     . TRP A 1 205 ? 24.772  -17.756 -12.973 1.00 28.38  ? 205  TRP A C     1 
ATOM   1698 O  O     . TRP A 1 205 ? 25.040  -17.474 -14.137 1.00 27.91  ? 205  TRP A O     1 
ATOM   1699 C  CB    . TRP A 1 205 ? 22.455  -17.472 -12.055 1.00 24.35  ? 205  TRP A CB    1 
ATOM   1700 C  CG    . TRP A 1 205 ? 21.899  -16.426 -13.011 1.00 21.88  ? 205  TRP A CG    1 
ATOM   1701 C  CD1   . TRP A 1 205 ? 22.499  -15.254 -13.395 1.00 23.09  ? 205  TRP A CD1   1 
ATOM   1702 C  CD2   . TRP A 1 205 ? 20.611  -16.438 -13.645 1.00 20.14  ? 205  TRP A CD2   1 
ATOM   1703 N  NE1   . TRP A 1 205 ? 21.667  -14.546 -14.238 1.00 21.20  ? 205  TRP A NE1   1 
ATOM   1704 C  CE2   . TRP A 1 205 ? 20.505  -15.251 -14.406 1.00 21.84  ? 205  TRP A CE2   1 
ATOM   1705 C  CE3   . TRP A 1 205 ? 19.538  -17.344 -13.652 1.00 23.30  ? 205  TRP A CE3   1 
ATOM   1706 C  CZ2   . TRP A 1 205 ? 19.365  -14.943 -15.164 1.00 24.35  ? 205  TRP A CZ2   1 
ATOM   1707 C  CZ3   . TRP A 1 205 ? 18.404  -17.038 -14.414 1.00 23.51  ? 205  TRP A CZ3   1 
ATOM   1708 C  CH2   . TRP A 1 205 ? 18.327  -15.842 -15.148 1.00 22.37  ? 205  TRP A CH2   1 
ATOM   1709 N  N     . GLN A 1 206 ? 25.587  -17.507 -11.951 1.00 30.29  ? 206  GLN A N     1 
ATOM   1710 C  CA    . GLN A 1 206 ? 26.894  -16.876 -12.116 1.00 33.45  ? 206  GLN A CA    1 
ATOM   1711 C  C     . GLN A 1 206 ? 27.844  -17.675 -13.012 1.00 32.48  ? 206  GLN A C     1 
ATOM   1712 O  O     . GLN A 1 206 ? 28.534  -17.094 -13.848 1.00 31.10  ? 206  GLN A O     1 
ATOM   1713 C  CB    . GLN A 1 206 ? 27.548  -16.654 -10.751 1.00 36.56  ? 206  GLN A CB    1 
ATOM   1714 C  CG    . GLN A 1 206 ? 28.095  -15.255 -10.539 1.00 45.47  ? 206  GLN A CG    1 
ATOM   1715 C  CD    . GLN A 1 206 ? 27.005  -14.258 -10.146 1.00 50.89  ? 206  GLN A CD    1 
ATOM   1716 O  OE1   . GLN A 1 206 ? 26.080  -13.975 -10.922 1.00 51.33  ? 206  GLN A OE1   1 
ATOM   1717 N  NE2   . GLN A 1 206 ? 27.115  -13.719 -8.934  1.00 48.12  ? 206  GLN A NE2   1 
ATOM   1718 N  N     . GLN A 1 207 ? 27.893  -18.993 -12.828 1.00 32.30  ? 207  GLN A N     1 
ATOM   1719 C  CA    . GLN A 1 207 ? 28.739  -19.854 -13.668 1.00 35.56  ? 207  GLN A CA    1 
ATOM   1720 C  C     . GLN A 1 207 ? 28.170  -20.036 -15.068 1.00 33.76  ? 207  GLN A C     1 
ATOM   1721 O  O     . GLN A 1 207 ? 28.916  -20.190 -16.030 1.00 35.98  ? 207  GLN A O     1 
ATOM   1722 C  CB    . GLN A 1 207 ? 28.969  -21.227 -13.029 1.00 38.07  ? 207  GLN A CB    1 
ATOM   1723 C  CG    . GLN A 1 207 ? 30.283  -21.356 -12.257 1.00 52.25  ? 207  GLN A CG    1 
ATOM   1724 C  CD    . GLN A 1 207 ? 31.511  -21.433 -13.172 1.00 61.96  ? 207  GLN A CD    1 
ATOM   1725 O  OE1   . GLN A 1 207 ? 31.673  -22.388 -13.940 1.00 64.89  ? 207  GLN A OE1   1 
ATOM   1726 N  NE2   . GLN A 1 207 ? 32.384  -20.426 -13.085 1.00 63.62  ? 207  GLN A NE2   1 
ATOM   1727 N  N     . LYS A 1 208 ? 26.847  -20.029 -15.174 1.00 30.58  ? 208  LYS A N     1 
ATOM   1728 C  CA    . LYS A 1 208 ? 26.179  -20.328 -16.434 1.00 28.95  ? 208  LYS A CA    1 
ATOM   1729 C  C     . LYS A 1 208 ? 25.159  -19.241 -16.713 1.00 27.82  ? 208  LYS A C     1 
ATOM   1730 O  O     . LYS A 1 208 ? 23.956  -19.493 -16.716 1.00 29.40  ? 208  LYS A O     1 
ATOM   1731 C  CB    . LYS A 1 208 ? 25.507  -21.702 -16.367 1.00 27.48  ? 208  LYS A CB    1 
ATOM   1732 C  CG    . LYS A 1 208 ? 26.471  -22.837 -16.072 1.00 27.78  ? 208  LYS A CG    1 
ATOM   1733 C  CD    . LYS A 1 208 ? 25.739  -24.130 -15.754 1.00 31.09  ? 208  LYS A CD    1 
ATOM   1734 C  CE    . LYS A 1 208 ? 26.704  -25.173 -15.176 1.00 30.95  ? 208  LYS A CE    1 
ATOM   1735 N  NZ    . LYS A 1 208 ? 27.723  -25.589 -16.184 1.00 31.58  ? 208  LYS A NZ    1 
ATOM   1736 N  N     . THR A 1 209 ? 25.661  -18.027 -16.928 1.00 27.59  ? 209  THR A N     1 
ATOM   1737 C  CA    . THR A 1 209 ? 24.833  -16.849 -17.129 1.00 26.99  ? 209  THR A CA    1 
ATOM   1738 C  C     . THR A 1 209 ? 24.139  -16.895 -18.483 1.00 25.88  ? 209  THR A C     1 
ATOM   1739 O  O     . THR A 1 209 ? 24.796  -17.008 -19.513 1.00 26.41  ? 209  THR A O     1 
ATOM   1740 C  CB    . THR A 1 209 ? 25.662  -15.564 -17.025 1.00 27.26  ? 209  THR A CB    1 
ATOM   1741 O  OG1   . THR A 1 209 ? 26.495  -15.634 -15.862 1.00 29.88  ? 209  THR A OG1   1 
ATOM   1742 C  CG2   . THR A 1 209 ? 24.750  -14.329 -16.934 1.00 24.60  ? 209  THR A CG2   1 
ATOM   1743 N  N     . PRO A 1 210 ? 22.802  -16.816 -18.477 1.00 24.73  ? 210  PRO A N     1 
ATOM   1744 C  CA    . PRO A 1 210 ? 22.042  -16.796 -19.729 1.00 23.62  ? 210  PRO A CA    1 
ATOM   1745 C  C     . PRO A 1 210 ? 22.435  -15.621 -20.618 1.00 23.50  ? 210  PRO A C     1 
ATOM   1746 O  O     . PRO A 1 210 ? 22.728  -14.533 -20.121 1.00 23.39  ? 210  PRO A O     1 
ATOM   1747 C  CB    . PRO A 1 210 ? 20.602  -16.636 -19.259 1.00 21.38  ? 210  PRO A CB    1 
ATOM   1748 C  CG    . PRO A 1 210 ? 20.598  -17.258 -17.861 1.00 24.86  ? 210  PRO A CG    1 
ATOM   1749 C  CD    . PRO A 1 210 ? 21.929  -16.884 -17.285 1.00 25.34  ? 210  PRO A CD    1 
ATOM   1750 N  N     . VAL A 1 211 ? 22.473  -15.868 -21.920 1.00 21.88  ? 211  VAL A N     1 
ATOM   1751 C  CA    . VAL A 1 211 ? 22.565  -14.811 -22.907 1.00 22.56  ? 211  VAL A CA    1 
ATOM   1752 C  C     . VAL A 1 211 ? 21.152  -14.551 -23.401 1.00 24.59  ? 211  VAL A C     1 
ATOM   1753 O  O     . VAL A 1 211 ? 20.654  -13.423 -23.334 1.00 24.67  ? 211  VAL A O     1 
ATOM   1754 C  CB    . VAL A 1 211 ? 23.462  -15.226 -24.083 1.00 23.21  ? 211  VAL A CB    1 
ATOM   1755 C  CG1   . VAL A 1 211 ? 23.334  -14.229 -25.244 1.00 18.10  ? 211  VAL A CG1   1 
ATOM   1756 C  CG2   . VAL A 1 211 ? 24.910  -15.352 -23.605 1.00 19.47  ? 211  VAL A CG2   1 
ATOM   1757 N  N     . ILE A 1 212 ? 20.523  -15.610 -23.908 1.00 24.23  ? 212  ILE A N     1 
ATOM   1758 C  CA    . ILE A 1 212 ? 19.117  -15.582 -24.260 1.00 23.27  ? 212  ILE A CA    1 
ATOM   1759 C  C     . ILE A 1 212 ? 18.400  -16.272 -23.118 1.00 23.87  ? 212  ILE A C     1 
ATOM   1760 O  O     . ILE A 1 212 ? 18.725  -17.413 -22.770 1.00 23.94  ? 212  ILE A O     1 
ATOM   1761 C  CB    . ILE A 1 212 ? 18.815  -16.313 -25.592 1.00 22.44  ? 212  ILE A CB    1 
ATOM   1762 C  CG1   . ILE A 1 212 ? 19.705  -15.795 -26.739 1.00 22.42  ? 212  ILE A CG1   1 
ATOM   1763 C  CG2   . ILE A 1 212 ? 17.319  -16.215 -25.933 1.00 20.55  ? 212  ILE A CG2   1 
ATOM   1764 C  CD1   . ILE A 1 212 ? 19.445  -14.338 -27.194 1.00 19.81  ? 212  ILE A CD1   1 
ATOM   1765 N  N     . LEU A 1 213 ? 17.448  -15.565 -22.520 1.00 22.08  ? 213  LEU A N     1 
ATOM   1766 C  CA    . LEU A 1 213 ? 16.645  -16.131 -21.454 1.00 22.98  ? 213  LEU A CA    1 
ATOM   1767 C  C     . LEU A 1 213 ? 15.200  -16.279 -21.905 1.00 23.23  ? 213  LEU A C     1 
ATOM   1768 O  O     . LEU A 1 213 ? 14.545  -15.308 -22.256 1.00 24.80  ? 213  LEU A O     1 
ATOM   1769 C  CB    . LEU A 1 213 ? 16.738  -15.275 -20.189 1.00 20.98  ? 213  LEU A CB    1 
ATOM   1770 C  CG    . LEU A 1 213 ? 16.038  -15.806 -18.933 1.00 19.73  ? 213  LEU A CG    1 
ATOM   1771 C  CD1   . LEU A 1 213 ? 16.596  -17.163 -18.534 1.00 18.16  ? 213  LEU A CD1   1 
ATOM   1772 C  CD2   . LEU A 1 213 ? 16.196  -14.785 -17.792 1.00 17.73  ? 213  LEU A CD2   1 
ATOM   1773 N  N     . THR A 1 214 ? 14.703  -17.505 -21.893 1.00 23.83  ? 214  THR A N     1 
ATOM   1774 C  CA    . THR A 1 214 ? 13.365  -17.742 -22.391 1.00 22.90  ? 214  THR A CA    1 
ATOM   1775 C  C     . THR A 1 214 ? 12.602  -18.728 -21.512 1.00 24.07  ? 214  THR A C     1 
ATOM   1776 O  O     . THR A 1 214 ? 13.100  -19.144 -20.466 1.00 23.50  ? 214  THR A O     1 
ATOM   1777 C  CB    . THR A 1 214 ? 13.368  -18.116 -23.907 1.00 23.56  ? 214  THR A CB    1 
ATOM   1778 O  OG1   . THR A 1 214 ? 12.028  -18.126 -24.394 1.00 22.47  ? 214  THR A OG1   1 
ATOM   1779 C  CG2   . THR A 1 214 ? 14.024  -19.476 -24.177 1.00 22.54  ? 214  THR A CG2   1 
ATOM   1780 N  N     . GLY A 1 215 ? 11.385  -19.065 -21.935 1.00 24.94  ? 215  GLY A N     1 
ATOM   1781 C  CA    . GLY A 1 215 ? 10.455  -19.877 -21.155 1.00 25.39  ? 215  GLY A CA    1 
ATOM   1782 C  C     . GLY A 1 215 ? 9.037   -19.423 -21.441 1.00 26.74  ? 215  GLY A C     1 
ATOM   1783 O  O     . GLY A 1 215 ? 8.803   -18.647 -22.370 1.00 28.87  ? 215  GLY A O     1 
ATOM   1784 N  N     . TRP A 1 216 ? 8.082   -19.900 -20.653 1.00 26.14  ? 216  TRP A N     1 
ATOM   1785 C  CA    . TRP A 1 216 ? 6.692   -19.509 -20.849 1.00 26.09  ? 216  TRP A CA    1 
ATOM   1786 C  C     . TRP A 1 216 ? 6.249   -18.518 -19.764 1.00 24.65  ? 216  TRP A C     1 
ATOM   1787 O  O     . TRP A 1 216 ? 6.221   -18.859 -18.591 1.00 25.04  ? 216  TRP A O     1 
ATOM   1788 C  CB    . TRP A 1 216 ? 5.787   -20.747 -20.899 1.00 25.97  ? 216  TRP A CB    1 
ATOM   1789 C  CG    . TRP A 1 216 ? 4.469   -20.479 -21.589 1.00 30.54  ? 216  TRP A CG    1 
ATOM   1790 C  CD1   . TRP A 1 216 ? 3.272   -20.208 -20.989 1.00 30.48  ? 216  TRP A CD1   1 
ATOM   1791 C  CD2   . TRP A 1 216 ? 4.227   -20.438 -23.005 1.00 29.12  ? 216  TRP A CD2   1 
ATOM   1792 N  NE1   . TRP A 1 216 ? 2.300   -20.008 -21.942 1.00 34.07  ? 216  TRP A NE1   1 
ATOM   1793 C  CE2   . TRP A 1 216 ? 2.858   -20.141 -23.186 1.00 31.41  ? 216  TRP A CE2   1 
ATOM   1794 C  CE3   . TRP A 1 216 ? 5.033   -20.624 -24.136 1.00 31.00  ? 216  TRP A CE3   1 
ATOM   1795 C  CZ2   . TRP A 1 216 ? 2.273   -20.025 -24.454 1.00 32.15  ? 216  TRP A CZ2   1 
ATOM   1796 C  CZ3   . TRP A 1 216 ? 4.447   -20.507 -25.404 1.00 33.83  ? 216  TRP A CZ3   1 
ATOM   1797 C  CH2   . TRP A 1 216 ? 3.081   -20.213 -25.547 1.00 32.13  ? 216  TRP A CH2   1 
ATOM   1798 N  N     . ASN A 1 217 ? 5.931   -17.283 -20.161 1.00 25.97  ? 217  ASN A N     1 
ATOM   1799 C  CA    . ASN A 1 217 ? 5.599   -16.208 -19.205 1.00 25.55  ? 217  ASN A CA    1 
ATOM   1800 C  C     . ASN A 1 217 ? 6.719   -15.845 -18.234 1.00 24.70  ? 217  ASN A C     1 
ATOM   1801 O  O     . ASN A 1 217 ? 6.455   -15.373 -17.131 1.00 26.32  ? 217  ASN A O     1 
ATOM   1802 C  CB    . ASN A 1 217 ? 4.358   -16.564 -18.386 1.00 29.40  ? 217  ASN A CB    1 
ATOM   1803 C  CG    . ASN A 1 217 ? 3.089   -16.213 -19.084 1.00 34.41  ? 217  ASN A CG    1 
ATOM   1804 O  OD1   . ASN A 1 217 ? 2.890   -15.069 -19.495 1.00 38.23  ? 217  ASN A OD1   1 
ATOM   1805 N  ND2   . ASN A 1 217 ? 2.207   -17.197 -19.229 1.00 38.99  ? 217  ASN A ND2   1 
ATOM   1806 N  N     . VAL A 1 218 ? 7.964   -16.077 -18.623 1.00 23.50  ? 218  VAL A N     1 
ATOM   1807 C  CA    . VAL A 1 218 ? 9.073   -15.761 -17.736 1.00 26.22  ? 218  VAL A CA    1 
ATOM   1808 C  C     . VAL A 1 218 ? 9.215   -14.262 -17.492 1.00 27.49  ? 218  VAL A C     1 
ATOM   1809 O  O     . VAL A 1 218 ? 9.689   -13.857 -16.433 1.00 29.45  ? 218  VAL A O     1 
ATOM   1810 C  CB    . VAL A 1 218 ? 10.410  -16.374 -18.211 1.00 25.59  ? 218  VAL A CB    1 
ATOM   1811 C  CG1   . VAL A 1 218 ? 10.367  -17.897 -18.064 1.00 23.83  ? 218  VAL A CG1   1 
ATOM   1812 C  CG2   . VAL A 1 218 ? 10.733  -15.953 -19.657 1.00 25.42  ? 218  VAL A CG2   1 
ATOM   1813 N  N     . GLU A 1 219 ? 8.786   -13.443 -18.451 1.00 28.11  ? 219  GLU A N     1 
ATOM   1814 C  CA    . GLU A 1 219 ? 8.890   -11.989 -18.299 1.00 33.69  ? 219  GLU A CA    1 
ATOM   1815 C  C     . GLU A 1 219 ? 7.831   -11.437 -17.347 1.00 34.64  ? 219  GLU A C     1 
ATOM   1816 O  O     . GLU A 1 219 ? 8.106   -10.529 -16.567 1.00 34.87  ? 219  GLU A O     1 
ATOM   1817 C  CB    . GLU A 1 219 ? 8.818   -11.267 -19.649 1.00 34.73  ? 219  GLU A CB    1 
ATOM   1818 C  CG    . GLU A 1 219 ? 9.223   -9.793  -19.555 1.00 42.31  ? 219  GLU A CG    1 
ATOM   1819 C  CD    . GLU A 1 219 ? 9.012   -9.021  -20.845 1.00 48.20  ? 219  GLU A CD    1 
ATOM   1820 O  OE1   . GLU A 1 219 ? 10.016  -8.516  -21.390 1.00 47.92  ? 219  GLU A OE1   1 
ATOM   1821 O  OE2   . GLU A 1 219 ? 7.851   -8.913  -21.310 1.00 51.98  ? 219  GLU A OE2   1 
ATOM   1822 N  N     . SER A 1 220 ? 6.623   -11.989 -17.415 1.00 35.77  ? 220  SER A N     1 
ATOM   1823 C  CA    . SER A 1 220 ? 5.523   -11.510 -16.582 1.00 35.93  ? 220  SER A CA    1 
ATOM   1824 C  C     . SER A 1 220 ? 5.492   -12.181 -15.201 1.00 34.21  ? 220  SER A C     1 
ATOM   1825 O  O     . SER A 1 220 ? 4.992   -11.595 -14.239 1.00 34.65  ? 220  SER A O     1 
ATOM   1826 C  CB    . SER A 1 220 ? 4.178   -11.662 -17.315 1.00 35.75  ? 220  SER A CB    1 
ATOM   1827 O  OG    . SER A 1 220 ? 3.965   -12.995 -17.758 1.00 38.78  ? 220  SER A OG    1 
ATOM   1828 N  N     . PHE A 1 221 ? 6.038   -13.393 -15.102 1.00 30.64  ? 221  PHE A N     1 
ATOM   1829 C  CA    . PHE A 1 221 ? 5.996   -14.133 -13.846 1.00 29.90  ? 221  PHE A CA    1 
ATOM   1830 C  C     . PHE A 1 221 ? 7.348   -14.592 -13.285 1.00 29.53  ? 221  PHE A C     1 
ATOM   1831 O  O     . PHE A 1 221 ? 7.784   -14.081 -12.250 1.00 32.14  ? 221  PHE A O     1 
ATOM   1832 C  CB    . PHE A 1 221 ? 5.013   -15.312 -13.910 1.00 29.34  ? 221  PHE A CB    1 
ATOM   1833 C  CG    . PHE A 1 221 ? 4.939   -16.097 -12.629 1.00 31.81  ? 221  PHE A CG    1 
ATOM   1834 C  CD1   . PHE A 1 221 ? 5.496   -17.372 -12.545 1.00 28.52  ? 221  PHE A CD1   1 
ATOM   1835 C  CD2   . PHE A 1 221 ? 4.338   -15.547 -11.490 1.00 31.60  ? 221  PHE A CD2   1 
ATOM   1836 C  CE1   . PHE A 1 221 ? 5.446   -18.096 -11.356 1.00 28.83  ? 221  PHE A CE1   1 
ATOM   1837 C  CE2   . PHE A 1 221 ? 4.284   -16.263 -10.291 1.00 29.47  ? 221  PHE A CE2   1 
ATOM   1838 C  CZ    . PHE A 1 221 ? 4.837   -17.537 -10.225 1.00 33.52  ? 221  PHE A CZ    1 
ATOM   1839 N  N     . ALA A 1 222 ? 7.997   -15.552 -13.942 1.00 25.33  ? 222  ALA A N     1 
ATOM   1840 C  CA    . ALA A 1 222 ? 9.191   -16.196 -13.368 1.00 26.13  ? 222  ALA A CA    1 
ATOM   1841 C  C     . ALA A 1 222 ? 10.306  -15.220 -12.981 1.00 25.86  ? 222  ALA A C     1 
ATOM   1842 O  O     . ALA A 1 222 ? 10.774  -15.239 -11.850 1.00 25.23  ? 222  ALA A O     1 
ATOM   1843 C  CB    . ALA A 1 222 ? 9.734   -17.294 -14.293 1.00 21.96  ? 222  ALA A CB    1 
ATOM   1844 N  N     . ILE A 1 223 ? 10.728  -14.379 -13.922 1.00 24.26  ? 223  ILE A N     1 
ATOM   1845 C  CA    . ILE A 1 223 ? 11.827  -13.446 -13.670 1.00 25.67  ? 223  ILE A CA    1 
ATOM   1846 C  C     . ILE A 1 223 ? 11.517  -12.482 -12.515 1.00 24.81  ? 223  ILE A C     1 
ATOM   1847 O  O     . ILE A 1 223 ? 12.288  -12.421 -11.560 1.00 25.34  ? 223  ILE A O     1 
ATOM   1848 C  CB    . ILE A 1 223 ? 12.279  -12.694 -14.961 1.00 24.71  ? 223  ILE A CB    1 
ATOM   1849 C  CG1   . ILE A 1 223 ? 12.932  -13.677 -15.940 1.00 24.06  ? 223  ILE A CG1   1 
ATOM   1850 C  CG2   . ILE A 1 223 ? 13.233  -11.558 -14.623 1.00 24.35  ? 223  ILE A CG2   1 
ATOM   1851 C  CD1   . ILE A 1 223 ? 12.913  -13.210 -17.402 1.00 24.74  ? 223  ILE A CD1   1 
ATOM   1852 N  N     . PRO A 1 224 ? 10.380  -11.753 -12.581 1.00 25.29  ? 224  PRO A N     1 
ATOM   1853 C  CA    . PRO A 1 224 ? 10.073  -10.843 -11.470 1.00 24.66  ? 224  PRO A CA    1 
ATOM   1854 C  C     . PRO A 1 224 ? 9.812   -11.529 -10.126 1.00 26.23  ? 224  PRO A C     1 
ATOM   1855 O  O     . PRO A 1 224 ? 10.133  -10.954 -9.079  1.00 26.14  ? 224  PRO A O     1 
ATOM   1856 C  CB    . PRO A 1 224 ? 8.821   -10.087 -11.945 1.00 25.47  ? 224  PRO A CB    1 
ATOM   1857 C  CG    . PRO A 1 224 ? 8.295   -10.851 -13.111 1.00 26.58  ? 224  PRO A CG    1 
ATOM   1858 C  CD    . PRO A 1 224 ? 9.445   -11.581 -13.714 1.00 25.03  ? 224  PRO A CD    1 
ATOM   1859 N  N     . TYR A 1 225 ? 9.240   -12.735 -10.145 1.00 26.83  ? 225  TYR A N     1 
ATOM   1860 C  CA    . TYR A 1 225 ? 9.026   -13.470 -8.904  1.00 27.18  ? 225  TYR A CA    1 
ATOM   1861 C  C     . TYR A 1 225 ? 10.359  -13.834 -8.245  1.00 27.84  ? 225  TYR A C     1 
ATOM   1862 O  O     . TYR A 1 225 ? 10.548  -13.613 -7.045  1.00 28.03  ? 225  TYR A O     1 
ATOM   1863 C  CB    . TYR A 1 225 ? 8.160   -14.736 -9.082  1.00 27.28  ? 225  TYR A CB    1 
ATOM   1864 C  CG    . TYR A 1 225 ? 7.584   -15.134 -7.744  1.00 26.49  ? 225  TYR A CG    1 
ATOM   1865 C  CD1   . TYR A 1 225 ? 8.359   -15.825 -6.805  1.00 26.34  ? 225  TYR A CD1   1 
ATOM   1866 C  CD2   . TYR A 1 225 ? 6.301   -14.734 -7.375  1.00 27.33  ? 225  TYR A CD2   1 
ATOM   1867 C  CE1   . TYR A 1 225 ? 7.854   -16.137 -5.545  1.00 28.57  ? 225  TYR A CE1   1 
ATOM   1868 C  CE2   . TYR A 1 225 ? 5.784   -15.048 -6.129  1.00 29.15  ? 225  TYR A CE2   1 
ATOM   1869 C  CZ    . TYR A 1 225 ? 6.564   -15.747 -5.217  1.00 30.63  ? 225  TYR A CZ    1 
ATOM   1870 O  OH    . TYR A 1 225 ? 6.054   -16.051 -3.978  1.00 30.56  ? 225  TYR A OH    1 
ATOM   1871 N  N     . VAL A 1 226 ? 11.268  -14.392 -9.038  1.00 25.48  ? 226  VAL A N     1 
ATOM   1872 C  CA    . VAL A 1 226 ? 12.591  -14.758 -8.561  1.00 26.00  ? 226  VAL A CA    1 
ATOM   1873 C  C     . VAL A 1 226 ? 13.377  -13.526 -8.093  1.00 24.54  ? 226  VAL A C     1 
ATOM   1874 O  O     . VAL A 1 226 ? 14.005  -13.555 -7.040  1.00 22.37  ? 226  VAL A O     1 
ATOM   1875 C  CB    . VAL A 1 226 ? 13.377  -15.534 -9.641  1.00 24.91  ? 226  VAL A CB    1 
ATOM   1876 C  CG1   . VAL A 1 226 ? 14.846  -15.589 -9.294  1.00 28.07  ? 226  VAL A CG1   1 
ATOM   1877 C  CG2   . VAL A 1 226 ? 12.813  -16.938 -9.786  1.00 25.87  ? 226  VAL A CG2   1 
ATOM   1878 N  N     . TYR A 1 227 ? 13.330  -12.449 -8.872  1.00 24.73  ? 227  TYR A N     1 
ATOM   1879 C  CA    . TYR A 1 227 ? 14.034  -11.219 -8.509  1.00 25.74  ? 227  TYR A CA    1 
ATOM   1880 C  C     . TYR A 1 227 ? 13.534  -10.652 -7.175  1.00 26.37  ? 227  TYR A C     1 
ATOM   1881 O  O     . TYR A 1 227 ? 14.334  -10.300 -6.308  1.00 27.56  ? 227  TYR A O     1 
ATOM   1882 C  CB    . TYR A 1 227 ? 13.896  -10.176 -9.614  1.00 25.58  ? 227  TYR A CB    1 
ATOM   1883 C  CG    . TYR A 1 227 ? 14.596  -8.873  -9.313  1.00 27.68  ? 227  TYR A CG    1 
ATOM   1884 C  CD1   . TYR A 1 227 ? 15.944  -8.704  -9.613  1.00 28.95  ? 227  TYR A CD1   1 
ATOM   1885 C  CD2   . TYR A 1 227 ? 13.908  -7.807  -8.737  1.00 29.44  ? 227  TYR A CD2   1 
ATOM   1886 C  CE1   . TYR A 1 227 ? 16.591  -7.512  -9.340  1.00 32.49  ? 227  TYR A CE1   1 
ATOM   1887 C  CE2   . TYR A 1 227 ? 14.547  -6.604  -8.462  1.00 31.93  ? 227  TYR A CE2   1 
ATOM   1888 C  CZ    . TYR A 1 227 ? 15.889  -6.467  -8.770  1.00 32.37  ? 227  TYR A CZ    1 
ATOM   1889 O  OH    . TYR A 1 227 ? 16.534  -5.286  -8.510  1.00 35.32  ? 227  TYR A OH    1 
ATOM   1890 N  N     . ASN A 1 228 ? 12.214  -10.584 -7.015  1.00 26.11  ? 228  ASN A N     1 
ATOM   1891 C  CA    . ASN A 1 228 ? 11.605  -10.025 -5.808  1.00 25.81  ? 228  ASN A CA    1 
ATOM   1892 C  C     . ASN A 1 228 ? 11.711  -10.908 -4.571  1.00 28.19  ? 228  ASN A C     1 
ATOM   1893 O  O     . ASN A 1 228 ? 11.869  -10.397 -3.460  1.00 28.37  ? 228  ASN A O     1 
ATOM   1894 C  CB    . ASN A 1 228 ? 10.151  -9.634  -6.069  1.00 26.66  ? 228  ASN A CB    1 
ATOM   1895 C  CG    . ASN A 1 228 ? 10.029  -8.307  -6.801  1.00 26.69  ? 228  ASN A CG    1 
ATOM   1896 O  OD1   . ASN A 1 228 ? 10.446  -7.276  -6.294  1.00 32.05  ? 228  ASN A OD1   1 
ATOM   1897 N  ND2   . ASN A 1 228 ? 9.463   -8.335  -7.997  1.00 25.23  ? 228  ASN A ND2   1 
ATOM   1898 N  N     . ARG A 1 229 ? 11.625  -12.226 -4.762  1.00 27.84  ? 229  ARG A N     1 
ATOM   1899 C  CA    . ARG A 1 229 ? 11.764  -13.181 -3.658  1.00 27.96  ? 229  ARG A CA    1 
ATOM   1900 C  C     . ARG A 1 229 ? 13.167  -13.111 -3.064  1.00 27.85  ? 229  ARG A C     1 
ATOM   1901 O  O     . ARG A 1 229 ? 13.333  -13.065 -1.845  1.00 29.23  ? 229  ARG A O     1 
ATOM   1902 C  CB    . ARG A 1 229 ? 11.453  -14.610 -4.132  1.00 26.80  ? 229  ARG A CB    1 
ATOM   1903 C  CG    . ARG A 1 229 ? 11.483  -15.673 -3.043  1.00 26.88  ? 229  ARG A CG    1 
ATOM   1904 C  CD    . ARG A 1 229 ? 10.319  -15.500 -2.068  1.00 26.20  ? 229  ARG A CD    1 
ATOM   1905 N  NE    . ARG A 1 229 ? 10.414  -16.387 -0.910  1.00 25.28  ? 229  ARG A NE    1 
ATOM   1906 C  CZ    . ARG A 1 229 ? 9.730   -16.221 0.223   1.00 27.98  ? 229  ARG A CZ    1 
ATOM   1907 N  NH1   . ARG A 1 229 ? 8.900   -15.194 0.371   1.00 25.46  ? 229  ARG A NH1   1 
ATOM   1908 N  NH2   . ARG A 1 229 ? 9.888   -17.076 1.220   1.00 28.75  ? 229  ARG A NH2   1 
ATOM   1909 N  N     . ILE A 1 230 ? 14.171  -13.099 -3.938  1.00 28.20  ? 230  ILE A N     1 
ATOM   1910 C  CA    . ILE A 1 230 ? 15.567  -12.934 -3.528  1.00 26.94  ? 230  ILE A CA    1 
ATOM   1911 C  C     . ILE A 1 230 ? 15.778  -11.560 -2.882  1.00 26.33  ? 230  ILE A C     1 
ATOM   1912 O  O     . ILE A 1 230 ? 16.455  -11.454 -1.858  1.00 26.00  ? 230  ILE A O     1 
ATOM   1913 C  CB    . ILE A 1 230 ? 16.543  -13.187 -4.704  1.00 26.24  ? 230  ILE A CB    1 
ATOM   1914 C  CG1   . ILE A 1 230 ? 16.559  -14.681 -5.050  1.00 25.52  ? 230  ILE A CG1   1 
ATOM   1915 C  CG2   . ILE A 1 230 ? 17.958  -12.689 -4.373  1.00 25.08  ? 230  ILE A CG2   1 
ATOM   1916 C  CD1   . ILE A 1 230 ? 17.288  -15.031 -6.343  1.00 27.27  ? 230  ILE A CD1   1 
ATOM   1917 N  N     . LYS A 1 231 ? 15.173  -10.525 -3.465  1.00 28.16  ? 231  LYS A N     1 
ATOM   1918 C  CA    . LYS A 1 231 ? 15.203  -9.185  -2.880  1.00 30.60  ? 231  LYS A CA    1 
ATOM   1919 C  C     . LYS A 1 231 ? 14.610  -9.161  -1.460  1.00 32.06  ? 231  LYS A C     1 
ATOM   1920 O  O     . LYS A 1 231 ? 15.196  -8.575  -0.546  1.00 31.40  ? 231  LYS A O     1 
ATOM   1921 C  CB    . LYS A 1 231 ? 14.489  -8.180  -3.786  1.00 31.48  ? 231  LYS A CB    1 
ATOM   1922 C  CG    . LYS A 1 231 ? 14.673  -6.725  -3.354  1.00 37.11  ? 231  LYS A CG    1 
ATOM   1923 C  CD    . LYS A 1 231 ? 13.910  -5.742  -4.239  1.00 41.30  ? 231  LYS A CD    1 
ATOM   1924 C  CE    . LYS A 1 231 ? 12.413  -5.749  -3.937  1.00 47.10  ? 231  LYS A CE    1 
ATOM   1925 N  NZ    . LYS A 1 231 ? 11.751  -4.473  -4.327  1.00 50.62  ? 231  LYS A NZ    1 
ATOM   1926 N  N     . ASN A 1 232 ? 13.467  -9.819  -1.275  1.00 32.71  ? 232  ASN A N     1 
ATOM   1927 C  CA    . ASN A 1 232 ? 12.800  -9.857  0.033   1.00 35.57  ? 232  ASN A CA    1 
ATOM   1928 C  C     . ASN A 1 232 ? 13.574  -10.621 1.112   1.00 35.58  ? 232  ASN A C     1 
ATOM   1929 O  O     . ASN A 1 232 ? 13.478  -10.294 2.296   1.00 35.95  ? 232  ASN A O     1 
ATOM   1930 C  CB    . ASN A 1 232 ? 11.382  -10.427 -0.091  1.00 36.52  ? 232  ASN A CB    1 
ATOM   1931 C  CG    . ASN A 1 232 ? 10.425  -9.476  -0.802  1.00 36.16  ? 232  ASN A CG    1 
ATOM   1932 O  OD1   . ASN A 1 232 ? 10.734  -8.304  -1.014  1.00 40.37  ? 232  ASN A OD1   1 
ATOM   1933 N  ND2   . ASN A 1 232 ? 9.253   -9.984  -1.167  1.00 34.90  ? 232  ASN A ND2   1 
ATOM   1934 N  N     . ILE A 1 233 ? 14.339  -11.628 0.692   1.00 35.81  ? 233  ILE A N     1 
ATOM   1935 C  CA    . ILE A 1 233 ? 15.070  -12.501 1.613   1.00 33.65  ? 233  ILE A CA    1 
ATOM   1936 C  C     . ILE A 1 233 ? 16.488  -12.006 1.897   1.00 33.82  ? 233  ILE A C     1 
ATOM   1937 O  O     . ILE A 1 233 ? 16.944  -12.038 3.043   1.00 35.38  ? 233  ILE A O     1 
ATOM   1938 C  CB    . ILE A 1 233 ? 15.121  -13.959 1.092   1.00 33.25  ? 233  ILE A CB    1 
ATOM   1939 C  CG1   . ILE A 1 233 ? 13.716  -14.581 1.099   1.00 33.61  ? 233  ILE A CG1   1 
ATOM   1940 C  CG2   . ILE A 1 233 ? 16.100  -14.804 1.927   1.00 31.50  ? 233  ILE A CG2   1 
ATOM   1941 C  CD1   . ILE A 1 233 ? 13.616  -15.916 0.353   1.00 33.38  ? 233  ILE A CD1   1 
ATOM   1942 N  N     . PHE A 1 234 ? 17.175  -11.543 0.856   1.00 32.69  ? 234  PHE A N     1 
ATOM   1943 C  CA    . PHE A 1 234 ? 18.596  -11.214 0.958   1.00 32.31  ? 234  PHE A CA    1 
ATOM   1944 C  C     . PHE A 1 234 ? 18.911  -9.732  0.782   1.00 32.01  ? 234  PHE A C     1 
ATOM   1945 O  O     . PHE A 1 234 ? 19.966  -9.279  1.203   1.00 32.47  ? 234  PHE A O     1 
ATOM   1946 C  CB    . PHE A 1 234 ? 19.395  -12.017 -0.075  1.00 30.68  ? 234  PHE A CB    1 
ATOM   1947 C  CG    . PHE A 1 234 ? 19.364  -13.500 0.148   1.00 30.49  ? 234  PHE A CG    1 
ATOM   1948 C  CD1   . PHE A 1 234 ? 18.684  -14.333 -0.735  1.00 29.39  ? 234  PHE A CD1   1 
ATOM   1949 C  CD2   . PHE A 1 234 ? 20.020  -14.071 1.239   1.00 30.29  ? 234  PHE A CD2   1 
ATOM   1950 C  CE1   . PHE A 1 234 ? 18.658  -15.718 -0.539  1.00 28.50  ? 234  PHE A CE1   1 
ATOM   1951 C  CE2   . PHE A 1 234 ? 19.999  -15.453 1.438   1.00 30.55  ? 234  PHE A CE2   1 
ATOM   1952 C  CZ    . PHE A 1 234 ? 19.317  -16.273 0.550   1.00 29.26  ? 234  PHE A CZ    1 
ATOM   1953 N  N     . GLY A 1 235 ? 18.011  -8.987  0.147   1.00 32.08  ? 235  GLY A N     1 
ATOM   1954 C  CA    . GLY A 1 235 ? 18.262  -7.577  -0.167  1.00 34.14  ? 235  GLY A CA    1 
ATOM   1955 C  C     . GLY A 1 235 ? 18.476  -7.369  -1.655  1.00 34.71  ? 235  GLY A C     1 
ATOM   1956 O  O     . GLY A 1 235 ? 18.704  -8.333  -2.394  1.00 34.75  ? 235  GLY A O     1 
ATOM   1957 N  N     . GLU A 1 236 ? 18.406  -6.113  -2.089  1.00 36.26  ? 236  GLU A N     1 
ATOM   1958 C  CA    . GLU A 1 236 ? 18.510  -5.749  -3.506  1.00 39.97  ? 236  GLU A CA    1 
ATOM   1959 C  C     . GLU A 1 236 ? 19.800  -6.205  -4.191  1.00 40.55  ? 236  GLU A C     1 
ATOM   1960 O  O     . GLU A 1 236 ? 19.758  -6.718  -5.316  1.00 41.80  ? 236  GLU A O     1 
ATOM   1961 C  CB    . GLU A 1 236 ? 18.318  -4.240  -3.707  1.00 43.36  ? 236  GLU A CB    1 
ATOM   1962 C  CG    . GLU A 1 236 ? 16.978  -3.874  -4.353  1.00 52.06  ? 236  GLU A CG    1 
ATOM   1963 C  CD    . GLU A 1 236 ? 16.866  -2.400  -4.739  1.00 59.02  ? 236  GLU A CD    1 
ATOM   1964 O  OE1   . GLU A 1 236 ? 17.898  -1.774  -5.078  1.00 61.47  ? 236  GLU A OE1   1 
ATOM   1965 O  OE2   . GLU A 1 236 ? 15.732  -1.867  -4.712  1.00 61.73  ? 236  GLU A OE2   1 
ATOM   1966 N  N     . SER A 1 237 ? 20.937  -6.008  -3.522  1.00 38.73  ? 237  SER A N     1 
ATOM   1967 C  CA    . SER A 1 237 ? 22.244  -6.298  -4.120  1.00 36.41  ? 237  SER A CA    1 
ATOM   1968 C  C     . SER A 1 237 ? 22.381  -7.765  -4.528  1.00 34.41  ? 237  SER A C     1 
ATOM   1969 O  O     . SER A 1 237 ? 22.969  -8.072  -5.565  1.00 33.78  ? 237  SER A O     1 
ATOM   1970 C  CB    . SER A 1 237 ? 23.387  -5.894  -3.179  1.00 37.18  ? 237  SER A CB    1 
ATOM   1971 O  OG    . SER A 1 237 ? 23.635  -6.889  -2.191  1.00 37.63  ? 237  SER A OG    1 
ATOM   1972 N  N     . THR A 1 238 ? 21.855  -8.666  -3.701  1.00 30.93  ? 238  THR A N     1 
ATOM   1973 C  CA    . THR A 1 238 ? 21.866  -10.083 -4.037  1.00 30.27  ? 238  THR A CA    1 
ATOM   1974 C  C     . THR A 1 238 ? 20.954  -10.352 -5.247  1.00 29.66  ? 238  THR A C     1 
ATOM   1975 O  O     . THR A 1 238 ? 21.330  -11.107 -6.138  1.00 30.63  ? 238  THR A O     1 
ATOM   1976 C  CB    . THR A 1 238 ? 21.484  -10.954 -2.823  1.00 29.28  ? 238  THR A CB    1 
ATOM   1977 O  OG1   . THR A 1 238 ? 22.364  -10.652 -1.736  1.00 31.42  ? 238  THR A OG1   1 
ATOM   1978 C  CG2   . THR A 1 238 ? 21.609  -12.429 -3.134  1.00 26.50  ? 238  THR A CG2   1 
ATOM   1979 N  N     . ALA A 1 239 ? 19.789  -9.704  -5.295  1.00 27.96  ? 239  ALA A N     1 
ATOM   1980 C  CA    . ALA A 1 239 ? 18.842  -9.890  -6.405  1.00 29.43  ? 239  ALA A CA    1 
ATOM   1981 C  C     . ALA A 1 239 ? 19.414  -9.407  -7.728  1.00 29.57  ? 239  ALA A C     1 
ATOM   1982 O  O     . ALA A 1 239 ? 19.142  -9.992  -8.781  1.00 26.05  ? 239  ALA A O     1 
ATOM   1983 C  CB    . ALA A 1 239 ? 17.506  -9.203  -6.120  1.00 28.09  ? 239  ALA A CB    1 
ATOM   1984 N  N     . LYS A 1 240 ? 20.212  -8.341  -7.657  1.00 30.68  ? 240  LYS A N     1 
ATOM   1985 C  CA    . LYS A 1 240 ? 20.883  -7.775  -8.827  1.00 30.70  ? 240  LYS A CA    1 
ATOM   1986 C  C     . LYS A 1 240 ? 21.944  -8.697  -9.439  1.00 29.31  ? 240  LYS A C     1 
ATOM   1987 O  O     . LYS A 1 240 ? 22.451  -8.425  -10.531 1.00 31.57  ? 240  LYS A O     1 
ATOM   1988 C  CB    . LYS A 1 240 ? 21.468  -6.403  -8.494  1.00 30.83  ? 240  LYS A CB    1 
ATOM   1989 C  CG    . LYS A 1 240 ? 20.445  -5.282  -8.577  1.00 33.45  ? 240  LYS A CG    1 
ATOM   1990 C  CD    . LYS A 1 240 ? 20.775  -4.147  -7.629  1.00 38.03  ? 240  LYS A CD    1 
ATOM   1991 C  CE    . LYS A 1 240 ? 19.644  -3.135  -7.576  1.00 41.70  ? 240  LYS A CE    1 
ATOM   1992 N  NZ    . LYS A 1 240 ? 19.959  -1.907  -8.352  1.00 45.36  ? 240  LYS A NZ    1 
ATOM   1993 N  N     . ARG A 1 241 ? 22.255  -9.794  -8.757  1.00 28.67  ? 241  ARG A N     1 
ATOM   1994 C  CA    . ARG A 1 241 ? 23.200  -10.786 -9.279  1.00 27.24  ? 241  ARG A CA    1 
ATOM   1995 C  C     . ARG A 1 241 ? 22.674  -11.544 -10.502 1.00 27.44  ? 241  ARG A C     1 
ATOM   1996 O  O     . ARG A 1 241 ? 23.439  -12.224 -11.188 1.00 29.66  ? 241  ARG A O     1 
ATOM   1997 C  CB    . ARG A 1 241 ? 23.667  -11.747 -8.175  1.00 25.11  ? 241  ARG A CB    1 
ATOM   1998 C  CG    . ARG A 1 241 ? 24.715  -11.116 -7.229  1.00 24.63  ? 241  ARG A CG    1 
ATOM   1999 C  CD    . ARG A 1 241 ? 25.061  -12.038 -6.065  1.00 19.94  ? 241  ARG A CD    1 
ATOM   2000 N  NE    . ARG A 1 241 ? 25.582  -13.319 -6.536  1.00 23.18  ? 241  ARG A NE    1 
ATOM   2001 C  CZ    . ARG A 1 241 ? 25.549  -14.460 -5.854  1.00 25.50  ? 241  ARG A CZ    1 
ATOM   2002 N  NH1   . ARG A 1 241 ? 25.017  -14.501 -4.638  1.00 26.42  ? 241  ARG A NH1   1 
ATOM   2003 N  NH2   . ARG A 1 241 ? 26.061  -15.568 -6.395  1.00 22.42  ? 241  ARG A NH2   1 
ATOM   2004 N  N     . LEU A 1 242 ? 21.374  -11.415 -10.772 1.00 26.72  ? 242  LEU A N     1 
ATOM   2005 C  CA    . LEU A 1 242 ? 20.767  -11.963 -11.982 1.00 26.42  ? 242  LEU A CA    1 
ATOM   2006 C  C     . LEU A 1 242 ? 21.207  -11.182 -13.221 1.00 26.55  ? 242  LEU A C     1 
ATOM   2007 O  O     . LEU A 1 242 ? 21.109  -11.677 -14.341 1.00 24.57  ? 242  LEU A O     1 
ATOM   2008 C  CB    . LEU A 1 242 ? 19.237  -11.984 -11.868 1.00 25.57  ? 242  LEU A CB    1 
ATOM   2009 C  CG    . LEU A 1 242 ? 18.653  -12.924 -10.806 1.00 25.24  ? 242  LEU A CG    1 
ATOM   2010 C  CD1   . LEU A 1 242 ? 17.204  -12.580 -10.531 1.00 24.81  ? 242  LEU A CD1   1 
ATOM   2011 C  CD2   . LEU A 1 242 ? 18.795  -14.385 -11.239 1.00 21.50  ? 242  LEU A CD2   1 
ATOM   2012 N  N     . SER A 1 243 ? 21.676  -9.957  -13.015 1.00 26.37  ? 243  SER A N     1 
ATOM   2013 C  CA    . SER A 1 243 ? 22.345  -9.220  -14.076 1.00 27.26  ? 243  SER A CA    1 
ATOM   2014 C  C     . SER A 1 243 ? 23.857  -9.403  -13.946 1.00 28.56  ? 243  SER A C     1 
ATOM   2015 O  O     . SER A 1 243 ? 24.412  -9.176  -12.863 1.00 29.76  ? 243  SER A O     1 
ATOM   2016 C  CB    . SER A 1 243 ? 22.006  -7.732  -14.007 1.00 26.63  ? 243  SER A CB    1 
ATOM   2017 O  OG    . SER A 1 243 ? 22.955  -6.985  -14.751 1.00 27.87  ? 243  SER A OG    1 
ATOM   2018 N  N     . PRO A 1 244 ? 24.531  -9.795  -15.048 1.00 27.34  ? 244  PRO A N     1 
ATOM   2019 C  CA    . PRO A 1 244 ? 25.992  -9.971  -15.030 1.00 28.49  ? 244  PRO A CA    1 
ATOM   2020 C  C     . PRO A 1 244 ? 26.776  -8.673  -14.833 1.00 30.08  ? 244  PRO A C     1 
ATOM   2021 O  O     . PRO A 1 244 ? 27.973  -8.725  -14.577 1.00 33.88  ? 244  PRO A O     1 
ATOM   2022 C  CB    . PRO A 1 244 ? 26.302  -10.577 -16.404 1.00 28.01  ? 244  PRO A CB    1 
ATOM   2023 C  CG    . PRO A 1 244 ? 25.125  -10.228 -17.256 1.00 26.11  ? 244  PRO A CG    1 
ATOM   2024 C  CD    . PRO A 1 244 ? 23.943  -10.200 -16.339 1.00 25.18  ? 244  PRO A CD    1 
ATOM   2025 N  N     . HIS A 1 245 ? 26.112  -7.529  -14.962 1.00 30.02  ? 245  HIS A N     1 
ATOM   2026 C  CA    . HIS A 1 245 ? 26.739  -6.237  -14.678 1.00 30.62  ? 245  HIS A CA    1 
ATOM   2027 C  C     . HIS A 1 245 ? 26.142  -5.626  -13.414 1.00 32.46  ? 245  HIS A C     1 
ATOM   2028 O  O     . HIS A 1 245 ? 26.382  -4.459  -13.105 1.00 33.69  ? 245  HIS A O     1 
ATOM   2029 C  CB    . HIS A 1 245 ? 26.564  -5.274  -15.855 1.00 29.61  ? 245  HIS A CB    1 
ATOM   2030 C  CG    . HIS A 1 245 ? 26.795  -5.904  -17.194 1.00 27.42  ? 245  HIS A CG    1 
ATOM   2031 N  ND1   . HIS A 1 245 ? 27.976  -6.532  -17.530 1.00 29.34  ? 245  HIS A ND1   1 
ATOM   2032 C  CD2   . HIS A 1 245 ? 25.997  -5.994  -18.283 1.00 25.14  ? 245  HIS A CD2   1 
ATOM   2033 C  CE1   . HIS A 1 245 ? 27.890  -6.996  -18.766 1.00 28.03  ? 245  HIS A CE1   1 
ATOM   2034 N  NE2   . HIS A 1 245 ? 26.702  -6.674  -19.248 1.00 28.21  ? 245  HIS A NE2   1 
ATOM   2035 N  N     . ARG A 1 246 ? 25.367  -6.435  -12.690 1.00 33.19  ? 246  ARG A N     1 
ATOM   2036 C  CA    . ARG A 1 246 ? 24.695  -6.031  -11.439 1.00 35.17  ? 246  ARG A CA    1 
ATOM   2037 C  C     . ARG A 1 246 ? 23.873  -4.740  -11.558 1.00 35.00  ? 246  ARG A C     1 
ATOM   2038 O  O     . ARG A 1 246 ? 23.809  -3.940  -10.617 1.00 35.67  ? 246  ARG A O     1 
ATOM   2039 C  CB    . ARG A 1 246 ? 25.683  -5.938  -10.261 1.00 35.74  ? 246  ARG A CB    1 
ATOM   2040 C  CG    . ARG A 1 246 ? 26.731  -7.048  -10.189 1.00 39.54  ? 246  ARG A CG    1 
ATOM   2041 C  CD    . ARG A 1 246 ? 26.139  -8.408  -9.833  1.00 42.47  ? 246  ARG A CD    1 
ATOM   2042 N  NE    . ARG A 1 246 ? 27.194  -9.403  -9.637  1.00 49.16  ? 246  ARG A NE    1 
ATOM   2043 C  CZ    . ARG A 1 246 ? 27.518  -10.360 -10.504 1.00 51.31  ? 246  ARG A CZ    1 
ATOM   2044 N  NH1   . ARG A 1 246 ? 26.862  -10.488 -11.653 1.00 51.86  ? 246  ARG A NH1   1 
ATOM   2045 N  NH2   . ARG A 1 246 ? 28.503  -11.203 -10.214 1.00 51.28  ? 246  ARG A NH2   1 
ATOM   2046 N  N     . LYS A 1 247 ? 23.252  -4.534  -12.713 1.00 34.11  ? 247  LYS A N     1 
ATOM   2047 C  CA    . LYS A 1 247 ? 22.300  -3.435  -12.856 1.00 37.10  ? 247  LYS A CA    1 
ATOM   2048 C  C     . LYS A 1 247 ? 20.948  -3.950  -13.333 1.00 35.10  ? 247  LYS A C     1 
ATOM   2049 O  O     . LYS A 1 247 ? 20.868  -4.742  -14.266 1.00 34.23  ? 247  LYS A O     1 
ATOM   2050 C  CB    . LYS A 1 247 ? 22.821  -2.325  -13.780 1.00 37.04  ? 247  LYS A CB    1 
ATOM   2051 C  CG    . LYS A 1 247 ? 22.001  -1.028  -13.675 1.00 42.97  ? 247  LYS A CG    1 
ATOM   2052 C  CD    . LYS A 1 247 ? 22.314  -0.031  -14.784 1.00 45.19  ? 247  LYS A CD    1 
ATOM   2053 C  CE    . LYS A 1 247 ? 21.367  1.171   -14.750 1.00 47.94  ? 247  LYS A CE    1 
ATOM   2054 N  NZ    . LYS A 1 247 ? 21.593  2.048   -13.561 1.00 49.65  ? 247  LYS A NZ    1 
ATOM   2055 N  N     . THR A 1 248 ? 19.895  -3.512  -12.657 1.00 36.70  ? 248  THR A N     1 
ATOM   2056 C  CA    . THR A 1 248 ? 18.535  -3.836  -13.048 1.00 38.77  ? 248  THR A CA    1 
ATOM   2057 C  C     . THR A 1 248 ? 17.689  -2.569  -13.060 1.00 43.56  ? 248  THR A C     1 
ATOM   2058 O  O     . THR A 1 248 ? 18.090  -1.535  -12.514 1.00 43.06  ? 248  THR A O     1 
ATOM   2059 C  CB    . THR A 1 248 ? 17.880  -4.871  -12.102 1.00 37.85  ? 248  THR A CB    1 
ATOM   2060 O  OG1   . THR A 1 248 ? 17.784  -4.324  -10.783 1.00 36.41  ? 248  THR A OG1   1 
ATOM   2061 C  CG2   . THR A 1 248 ? 18.674  -6.179  -12.066 1.00 34.86  ? 248  THR A CG2   1 
ATOM   2062 N  N     . ARG A 1 249 ? 16.520  -2.660  -13.689 1.00 48.46  ? 249  ARG A N     1 
ATOM   2063 C  CA    . ARG A 1 249 ? 15.554  -1.574  -13.702 1.00 54.49  ? 249  ARG A CA    1 
ATOM   2064 C  C     . ARG A 1 249 ? 14.156  -2.158  -13.519 1.00 57.52  ? 249  ARG A C     1 
ATOM   2065 O  O     . ARG A 1 249 ? 13.793  -3.137  -14.178 1.00 56.57  ? 249  ARG A O     1 
ATOM   2066 C  CB    . ARG A 1 249 ? 15.647  -0.790  -15.017 1.00 56.44  ? 249  ARG A CB    1 
ATOM   2067 C  CG    . ARG A 1 249 ? 15.245  0.682   -14.919 1.00 63.16  ? 249  ARG A CG    1 
ATOM   2068 C  CD    . ARG A 1 249 ? 16.330  1.533   -14.233 1.00 70.72  ? 249  ARG A CD    1 
ATOM   2069 N  NE    . ARG A 1 249 ? 17.524  1.706   -15.066 1.00 74.36  ? 249  ARG A NE    1 
ATOM   2070 C  CZ    . ARG A 1 249 ? 17.775  2.775   -15.822 1.00 77.57  ? 249  ARG A CZ    1 
ATOM   2071 N  NH1   . ARG A 1 249 ? 16.920  3.792   -15.857 1.00 79.63  ? 249  ARG A NH1   1 
ATOM   2072 N  NH2   . ARG A 1 249 ? 18.888  2.832   -16.543 1.00 77.17  ? 249  ARG A NH2   1 
ATOM   2073 N  N     . VAL A 1 250 ? 13.388  -1.565  -12.608 1.00 62.55  ? 250  VAL A N     1 
ATOM   2074 C  CA    . VAL A 1 250 ? 12.003  -1.968  -12.362 1.00 68.09  ? 250  VAL A CA    1 
ATOM   2075 C  C     . VAL A 1 250 ? 11.087  -0.991  -13.102 1.00 73.61  ? 250  VAL A C     1 
ATOM   2076 O  O     . VAL A 1 250 ? 10.871  0.136   -12.646 1.00 73.34  ? 250  VAL A O     1 
ATOM   2077 C  CB    . VAL A 1 250 ? 11.672  -1.995  -10.840 1.00 68.31  ? 250  VAL A CB    1 
ATOM   2078 C  CG1   . VAL A 1 250 ? 10.310  -2.626  -10.590 1.00 68.60  ? 250  VAL A CG1   1 
ATOM   2079 C  CG2   . VAL A 1 250 ? 12.748  -2.741  -10.055 1.00 67.13  ? 250  VAL A CG2   1 
ATOM   2080 N  N     . LYS A 1 251 ? 10.559  -1.425  -14.248 1.00 80.44  ? 251  LYS A N     1 
ATOM   2081 C  CA    . LYS A 1 251 ? 9.854   -0.521  -15.167 1.00 87.58  ? 251  LYS A CA    1 
ATOM   2082 C  C     . LYS A 1 251 ? 8.475   -1.018  -15.621 1.00 91.21  ? 251  LYS A C     1 
ATOM   2083 O  O     . LYS A 1 251 ? 8.254   -2.222  -15.779 1.00 90.82  ? 251  LYS A O     1 
ATOM   2084 C  CB    . LYS A 1 251 ? 10.729  -0.216  -16.394 1.00 88.56  ? 251  LYS A CB    1 
ATOM   2085 C  CG    . LYS A 1 251 ? 10.463  1.149   -17.030 1.00 90.89  ? 251  LYS A CG    1 
ATOM   2086 C  CD    . LYS A 1 251 ? 10.662  1.123   -18.538 1.00 91.63  ? 251  LYS A CD    1 
ATOM   2087 C  CE    . LYS A 1 251 ? 10.041  2.355   -19.186 1.00 93.36  ? 251  LYS A CE    1 
ATOM   2088 N  NZ    . LYS A 1 251 ? 10.041  2.280   -20.674 1.00 93.44  ? 251  LYS A NZ    1 
ATOM   2089 N  N     . VAL A 1 252 ? 7.569   -0.063  -15.844 1.00 96.63  ? 252  VAL A N     1 
ATOM   2090 C  CA    . VAL A 1 252 ? 6.186   -0.321  -16.271 1.00 100.93 ? 252  VAL A CA    1 
ATOM   2091 C  C     . VAL A 1 252 ? 6.045   -0.609  -17.771 1.00 103.51 ? 252  VAL A C     1 
ATOM   2092 O  O     . VAL A 1 252 ? 6.775   -0.046  -18.593 1.00 103.69 ? 252  VAL A O     1 
ATOM   2093 C  CB    . VAL A 1 252 ? 5.228   0.864   -15.904 1.00 102.02 ? 252  VAL A CB    1 
ATOM   2094 C  CG1   . VAL A 1 252 ? 4.899   0.874   -14.413 1.00 102.14 ? 252  VAL A CG1   1 
ATOM   2095 C  CG2   . VAL A 1 252 ? 5.806   2.218   -16.351 1.00 102.74 ? 252  VAL A CG2   1 
ATOM   2096 N  N     . ILE A 1 253 ? 5.101   -1.488  -18.109 1.00 106.94 ? 253  ILE A N     1 
ATOM   2097 C  CA    . ILE A 1 253 ? 4.690   -1.726  -19.498 1.00 110.38 ? 253  ILE A CA    1 
ATOM   2098 C  C     . ILE A 1 253 ? 3.377   -0.980  -19.761 1.00 113.52 ? 253  ILE A C     1 
ATOM   2099 O  O     . ILE A 1 253 ? 2.376   -1.199  -19.069 1.00 114.22 ? 253  ILE A O     1 
ATOM   2100 C  CB    . ILE A 1 253 ? 4.532   -3.253  -19.817 1.00 109.60 ? 253  ILE A CB    1 
ATOM   2101 C  CG1   . ILE A 1 253 ? 5.886   -3.983  -19.762 1.00 109.24 ? 253  ILE A CG1   1 
ATOM   2102 C  CG2   . ILE A 1 253 ? 3.823   -3.484  -21.165 1.00 109.55 ? 253  ILE A CG2   1 
ATOM   2103 C  CD1   . ILE A 1 253 ? 6.880   -3.633  -20.880 1.00 108.91 ? 253  ILE A CD1   1 
ATOM   2104 N  N     . GLU A 1 254 ? 3.397   -0.092  -20.754 1.00 116.49 ? 254  GLU A N     1 
ATOM   2105 C  CA    . GLU A 1 254 ? 2.234   0.729   -21.095 1.00 119.59 ? 254  GLU A CA    1 
ATOM   2106 C  C     . GLU A 1 254 ? 1.754   0.476   -22.523 1.00 120.84 ? 254  GLU A C     1 
ATOM   2107 O  O     . GLU A 1 254 ? 2.522   0.623   -23.480 1.00 121.03 ? 254  GLU A O     1 
ATOM   2108 C  CB    . GLU A 1 254 ? 2.552   2.221   -20.926 1.00 120.63 ? 254  GLU A CB    1 
ATOM   2109 C  CG    . GLU A 1 254 ? 2.855   2.670   -19.500 1.00 121.92 ? 254  GLU A CG    1 
ATOM   2110 C  CD    . GLU A 1 254 ? 3.053   4.177   -19.386 1.00 123.55 ? 254  GLU A CD    1 
ATOM   2111 O  OE1   . GLU A 1 254 ? 3.755   4.762   -20.242 1.00 123.86 ? 254  GLU A OE1   1 
ATOM   2112 O  OE2   . GLU A 1 254 ? 2.509   4.778   -18.434 1.00 124.34 ? 254  GLU A OE2   1 
ATOM   2113 N  N     . ASN A 1 255 ? 0.487   0.087   -22.656 1.00 122.37 ? 255  ASN A N     1 
ATOM   2114 C  CA    . ASN A 1 255 ? -0.180  0.037   -23.959 1.00 123.61 ? 255  ASN A CA    1 
ATOM   2115 C  C     . ASN A 1 255 ? -1.366  1.006   -23.990 1.00 124.91 ? 255  ASN A C     1 
ATOM   2116 O  O     . ASN A 1 255 ? -1.494  1.816   -24.913 1.00 125.27 ? 255  ASN A O     1 
ATOM   2117 C  CB    . ASN A 1 255 ? -0.596  -1.398  -24.338 1.00 123.17 ? 255  ASN A CB    1 
ATOM   2118 C  CG    . ASN A 1 255 ? -1.644  -1.989  -23.398 1.00 123.50 ? 255  ASN A CG    1 
ATOM   2119 O  OD1   . ASN A 1 255 ? -1.517  -1.917  -22.173 1.00 123.44 ? 255  ASN A OD1   1 
ATOM   2120 N  ND2   . ASN A 1 255 ? -2.683  -2.584  -23.976 1.00 123.20 ? 255  ASN A ND2   1 
ATOM   2121 N  N     . MET A 1 256 ? -2.212  0.914   -22.965 1.00 125.51 ? 256  MET A N     1 
ATOM   2122 C  CA    . MET A 1 256 ? -3.316  1.842   -22.733 1.00 126.67 ? 256  MET A CA    1 
ATOM   2123 C  C     . MET A 1 256 ? -3.861  1.614   -21.317 1.00 126.59 ? 256  MET A C     1 
ATOM   2124 O  O     . MET A 1 256 ? -3.364  2.211   -20.362 1.00 126.86 ? 256  MET A O     1 
ATOM   2125 C  CB    . MET A 1 256 ? -4.407  1.704   -23.810 1.00 127.47 ? 256  MET A CB    1 
ATOM   2126 C  CG    . MET A 1 256 ? -5.391  2.878   -23.877 1.00 129.07 ? 256  MET A CG    1 
ATOM   2127 S  SD    . MET A 1 256 ? -5.822  3.419   -25.554 1.00 130.02 ? 256  MET A SD    1 
ATOM   2128 C  CE    . MET A 1 256 ? -6.405  1.903   -26.317 1.00 129.21 ? 256  MET A CE    1 
ATOM   2129 N  N     . TYR A 1 257 ? -4.844  0.725   -21.181 1.00 125.99 ? 257  TYR A N     1 
ATOM   2130 C  CA    . TYR A 1 257 ? -5.542  0.514   -19.907 1.00 125.36 ? 257  TYR A CA    1 
ATOM   2131 C  C     . TYR A 1 257 ? -4.741  -0.330  -18.910 1.00 123.15 ? 257  TYR A C     1 
ATOM   2132 O  O     . TYR A 1 257 ? -4.387  -1.478  -19.195 1.00 122.44 ? 257  TYR A O     1 
ATOM   2133 C  CB    . TYR A 1 257 ? -6.919  -0.115  -20.152 1.00 126.47 ? 257  TYR A CB    1 
ATOM   2134 C  CG    . TYR A 1 257 ? -7.611  0.376   -21.409 1.00 128.42 ? 257  TYR A CG    1 
ATOM   2135 C  CD1   . TYR A 1 257 ? -7.674  -0.427  -22.550 1.00 128.42 ? 257  TYR A CD1   1 
ATOM   2136 C  CD2   . TYR A 1 257 ? -8.196  1.645   -21.460 1.00 130.08 ? 257  TYR A CD2   1 
ATOM   2137 C  CE1   . TYR A 1 257 ? -8.306  0.017   -23.710 1.00 129.66 ? 257  TYR A CE1   1 
ATOM   2138 C  CE2   . TYR A 1 257 ? -8.834  2.098   -22.616 1.00 131.21 ? 257  TYR A CE2   1 
ATOM   2139 C  CZ    . TYR A 1 257 ? -8.885  1.279   -23.736 1.00 130.95 ? 257  TYR A CZ    1 
ATOM   2140 O  OH    . TYR A 1 257 ? -9.512  1.720   -24.880 1.00 131.15 ? 257  TYR A OH    1 
ATOM   2141 N  N     . GLY A 1 258 ? -4.465  0.252   -17.742 1.00 121.38 ? 258  GLY A N     1 
ATOM   2142 C  CA    . GLY A 1 258 ? -3.720  -0.426  -16.680 1.00 117.97 ? 258  GLY A CA    1 
ATOM   2143 C  C     . GLY A 1 258 ? -2.213  -0.421  -16.881 1.00 115.11 ? 258  GLY A C     1 
ATOM   2144 O  O     . GLY A 1 258 ? -1.711  0.102   -17.882 1.00 114.96 ? 258  GLY A O     1 
ATOM   2145 N  N     . SER A 1 259 ? -1.493  -1.004  -15.921 1.00 112.11 ? 259  SER A N     1 
ATOM   2146 C  CA    . SER A 1 259 ? -0.030  -1.105  -15.981 1.00 108.44 ? 259  SER A CA    1 
ATOM   2147 C  C     . SER A 1 259 ? 0.512   -2.294  -15.183 1.00 104.76 ? 259  SER A C     1 
ATOM   2148 O  O     . SER A 1 259 ? -0.065  -2.692  -14.167 1.00 104.64 ? 259  SER A O     1 
ATOM   2149 C  CB    . SER A 1 259 ? 0.630   0.196   -15.498 1.00 109.33 ? 259  SER A CB    1 
ATOM   2150 O  OG    . SER A 1 259 ? 0.307   0.471   -14.145 1.00 109.98 ? 259  SER A OG    1 
ATOM   2151 N  N     . ARG A 1 260 ? 1.620   -2.857  -15.662 1.00 100.32 ? 260  ARG A N     1 
ATOM   2152 C  CA    . ARG A 1 260 ? 2.342   -3.914  -14.949 1.00 96.02  ? 260  ARG A CA    1 
ATOM   2153 C  C     . ARG A 1 260 ? 3.857   -3.682  -15.020 1.00 91.65  ? 260  ARG A C     1 
ATOM   2154 O  O     . ARG A 1 260 ? 4.363   -3.151  -16.013 1.00 91.55  ? 260  ARG A O     1 
ATOM   2155 C  CB    . ARG A 1 260 ? 1.961   -5.309  -15.474 1.00 96.35  ? 260  ARG A CB    1 
ATOM   2156 C  CG    . ARG A 1 260 ? 2.282   -5.574  -16.945 1.00 96.87  ? 260  ARG A CG    1 
ATOM   2157 C  CD    . ARG A 1 260 ? 1.922   -6.999  -17.335 1.00 97.45  ? 260  ARG A CD    1 
ATOM   2158 N  NE    . ARG A 1 260 ? 2.434   -7.359  -18.657 1.00 98.14  ? 260  ARG A NE    1 
ATOM   2159 C  CZ    . ARG A 1 260 ? 3.583   -7.995  -18.876 1.00 98.51  ? 260  ARG A CZ    1 
ATOM   2160 N  NH1   . ARG A 1 260 ? 4.359   -8.352  -17.860 1.00 98.32  ? 260  ARG A NH1   1 
ATOM   2161 N  NH2   . ARG A 1 260 ? 3.960   -8.278  -20.117 1.00 98.30  ? 260  ARG A NH2   1 
ATOM   2162 N  N     . GLU A 1 261 ? 4.568   -4.073  -13.965 1.00 86.17  ? 261  GLU A N     1 
ATOM   2163 C  CA    . GLU A 1 261 ? 6.011   -3.828  -13.871 1.00 79.94  ? 261  GLU A CA    1 
ATOM   2164 C  C     . GLU A 1 261 ? 6.870   -5.060  -14.148 1.00 73.46  ? 261  GLU A C     1 
ATOM   2165 O  O     . GLU A 1 261 ? 6.719   -6.106  -13.505 1.00 72.62  ? 261  GLU A O     1 
ATOM   2166 C  CB    . GLU A 1 261 ? 6.376   -3.199  -12.522 1.00 81.47  ? 261  GLU A CB    1 
ATOM   2167 C  CG    . GLU A 1 261 ? 6.191   -1.682  -12.492 1.00 83.18  ? 261  GLU A CG    1 
ATOM   2168 C  CD    . GLU A 1 261 ? 6.295   -1.082  -11.099 1.00 83.86  ? 261  GLU A CD    1 
ATOM   2169 O  OE1   . GLU A 1 261 ? 6.845   -1.745  -10.190 1.00 84.65  ? 261  GLU A OE1   1 
ATOM   2170 O  OE2   . GLU A 1 261 ? 5.827   0.063   -10.917 1.00 82.84  ? 261  GLU A OE2   1 
ATOM   2171 N  N     . ILE A 1 262 ? 7.764   -4.916  -15.122 1.00 65.74  ? 262  ILE A N     1 
ATOM   2172 C  CA    . ILE A 1 262 ? 8.724   -5.960  -15.466 1.00 57.40  ? 262  ILE A CA    1 
ATOM   2173 C  C     . ILE A 1 262 ? 10.133  -5.553  -15.016 1.00 51.83  ? 262  ILE A C     1 
ATOM   2174 O  O     . ILE A 1 262 ? 10.403  -4.369  -14.765 1.00 49.16  ? 262  ILE A O     1 
ATOM   2175 C  CB    . ILE A 1 262 ? 8.693   -6.318  -16.989 1.00 57.81  ? 262  ILE A CB    1 
ATOM   2176 C  CG1   . ILE A 1 262 ? 9.332   -5.217  -17.843 1.00 59.52  ? 262  ILE A CG1   1 
ATOM   2177 C  CG2   . ILE A 1 262 ? 7.265   -6.602  -17.455 1.00 56.31  ? 262  ILE A CG2   1 
ATOM   2178 C  CD1   . ILE A 1 262 ? 9.848   -5.704  -19.200 1.00 60.21  ? 262  ILE A CD1   1 
ATOM   2179 N  N     . ILE A 1 263 ? 11.020  -6.537  -14.904 1.00 44.25  ? 263  ILE A N     1 
ATOM   2180 C  CA    . ILE A 1 263 ? 12.385  -6.284  -14.465 1.00 39.94  ? 263  ILE A CA    1 
ATOM   2181 C  C     . ILE A 1 263 ? 13.325  -6.384  -15.659 1.00 36.72  ? 263  ILE A C     1 
ATOM   2182 O  O     . ILE A 1 263 ? 13.380  -7.420  -16.324 1.00 35.24  ? 263  ILE A O     1 
ATOM   2183 C  CB    . ILE A 1 263 ? 12.833  -7.281  -13.349 1.00 38.80  ? 263  ILE A CB    1 
ATOM   2184 C  CG1   . ILE A 1 263 ? 11.812  -7.345  -12.205 1.00 38.20  ? 263  ILE A CG1   1 
ATOM   2185 C  CG2   . ILE A 1 263 ? 14.236  -6.948  -12.828 1.00 38.22  ? 263  ILE A CG2   1 
ATOM   2186 C  CD1   . ILE A 1 263 ? 11.515  -6.025  -11.525 1.00 34.86  ? 263  ILE A CD1   1 
ATOM   2187 N  N     . THR A 1 264 ? 14.051  -5.303  -15.931 1.00 32.97  ? 264  THR A N     1 
ATOM   2188 C  CA    . THR A 1 264 ? 15.075  -5.315  -16.966 1.00 31.64  ? 264  THR A CA    1 
ATOM   2189 C  C     . THR A 1 264 ? 16.393  -5.794  -16.358 1.00 31.57  ? 264  THR A C     1 
ATOM   2190 O  O     . THR A 1 264 ? 16.886  -5.207  -15.391 1.00 31.08  ? 264  THR A O     1 
ATOM   2191 C  CB    . THR A 1 264 ? 15.268  -3.927  -17.616 1.00 33.39  ? 264  THR A CB    1 
ATOM   2192 O  OG1   . THR A 1 264 ? 14.040  -3.499  -18.216 1.00 33.63  ? 264  THR A OG1   1 
ATOM   2193 C  CG2   . THR A 1 264 ? 16.364  -3.978  -18.692 1.00 30.74  ? 264  THR A CG2   1 
ATOM   2194 N  N     . LEU A 1 265 ? 16.942  -6.865  -16.925 1.00 27.52  ? 265  LEU A N     1 
ATOM   2195 C  CA    . LEU A 1 265 ? 18.216  -7.413  -16.490 1.00 26.32  ? 265  LEU A CA    1 
ATOM   2196 C  C     . LEU A 1 265 ? 19.274  -7.032  -17.504 1.00 27.38  ? 265  LEU A C     1 
ATOM   2197 O  O     . LEU A 1 265 ? 19.338  -7.614  -18.589 1.00 26.41  ? 265  LEU A O     1 
ATOM   2198 C  CB    . LEU A 1 265 ? 18.147  -8.936  -16.360 1.00 24.04  ? 265  LEU A CB    1 
ATOM   2199 C  CG    . LEU A 1 265 ? 17.066  -9.549  -15.468 1.00 25.87  ? 265  LEU A CG    1 
ATOM   2200 C  CD1   . LEU A 1 265 ? 17.005  -11.045 -15.669 1.00 26.80  ? 265  LEU A CD1   1 
ATOM   2201 C  CD2   . LEU A 1 265 ? 17.293  -9.210  -13.990 1.00 23.38  ? 265  LEU A CD2   1 
ATOM   2202 N  N     . PHE A 1 266 ? 20.093  -6.048  -17.145 1.00 26.41  ? 266  PHE A N     1 
ATOM   2203 C  CA    . PHE A 1 266 ? 21.176  -5.574  -18.003 1.00 29.52  ? 266  PHE A CA    1 
ATOM   2204 C  C     . PHE A 1 266 ? 22.185  -6.689  -18.286 1.00 28.62  ? 266  PHE A C     1 
ATOM   2205 O  O     . PHE A 1 266 ? 22.603  -7.408  -17.376 1.00 26.19  ? 266  PHE A O     1 
ATOM   2206 C  CB    . PHE A 1 266 ? 21.858  -4.353  -17.377 1.00 30.06  ? 266  PHE A CB    1 
ATOM   2207 C  CG    . PHE A 1 266 ? 21.082  -3.074  -17.551 1.00 34.33  ? 266  PHE A CG    1 
ATOM   2208 C  CD1   . PHE A 1 266 ? 19.886  -2.863  -16.868 1.00 35.54  ? 266  PHE A CD1   1 
ATOM   2209 C  CD2   . PHE A 1 266 ? 21.547  -2.078  -18.403 1.00 37.43  ? 266  PHE A CD2   1 
ATOM   2210 C  CE1   . PHE A 1 266 ? 19.156  -1.682  -17.036 1.00 37.08  ? 266  PHE A CE1   1 
ATOM   2211 C  CE2   . PHE A 1 266 ? 20.828  -0.887  -18.576 1.00 41.86  ? 266  PHE A CE2   1 
ATOM   2212 C  CZ    . PHE A 1 266 ? 19.628  -0.693  -17.886 1.00 40.76  ? 266  PHE A CZ    1 
ATOM   2213 N  N     . GLY A 1 267 ? 22.534  -6.845  -19.560 1.00 27.61  ? 267  GLY A N     1 
ATOM   2214 C  CA    . GLY A 1 267 ? 23.464  -7.885  -19.980 1.00 27.80  ? 267  GLY A CA    1 
ATOM   2215 C  C     . GLY A 1 267 ? 22.822  -9.239  -20.232 1.00 27.57  ? 267  GLY A C     1 
ATOM   2216 O  O     . GLY A 1 267 ? 23.527  -10.229 -20.436 1.00 28.52  ? 267  GLY A O     1 
ATOM   2217 N  N     . ILE A 1 268 ? 21.489  -9.286  -20.195 1.00 25.72  ? 268  ILE A N     1 
ATOM   2218 C  CA    . ILE A 1 268 ? 20.728  -10.466 -20.611 1.00 23.90  ? 268  ILE A CA    1 
ATOM   2219 C  C     . ILE A 1 268 ? 19.664  -10.077 -21.653 1.00 25.29  ? 268  ILE A C     1 
ATOM   2220 O  O     . ILE A 1 268 ? 19.071  -8.995  -21.581 1.00 25.01  ? 268  ILE A O     1 
ATOM   2221 C  CB    . ILE A 1 268 ? 20.113  -11.199 -19.398 1.00 25.20  ? 268  ILE A CB    1 
ATOM   2222 C  CG1   . ILE A 1 268 ? 21.239  -11.817 -18.555 1.00 24.66  ? 268  ILE A CG1   1 
ATOM   2223 C  CG2   . ILE A 1 268 ? 19.118  -12.296 -19.841 1.00 23.82  ? 268  ILE A CG2   1 
ATOM   2224 C  CD1   . ILE A 1 268 ? 20.842  -12.221 -17.199 1.00 24.48  ? 268  ILE A CD1   1 
ATOM   2225 N  N     . SER A 1 269 ? 19.450  -10.948 -22.635 1.00 21.59  ? 269  SER A N     1 
ATOM   2226 C  CA    . SER A 1 269 ? 18.410  -10.725 -23.625 1.00 23.19  ? 269  SER A CA    1 
ATOM   2227 C  C     . SER A 1 269 ? 17.264  -11.680 -23.345 1.00 23.55  ? 269  SER A C     1 
ATOM   2228 O  O     . SER A 1 269 ? 17.376  -12.891 -23.578 1.00 22.65  ? 269  SER A O     1 
ATOM   2229 C  CB    . SER A 1 269 ? 18.952  -10.917 -25.046 1.00 22.58  ? 269  SER A CB    1 
ATOM   2230 O  OG    . SER A 1 269 ? 19.906  -9.913  -25.346 1.00 22.45  ? 269  SER A OG    1 
ATOM   2231 N  N     . VAL A 1 270 ? 16.171  -11.121 -22.829 1.00 22.93  ? 270  VAL A N     1 
ATOM   2232 C  CA    . VAL A 1 270 ? 14.994  -11.892 -22.461 1.00 22.12  ? 270  VAL A CA    1 
ATOM   2233 C  C     . VAL A 1 270 ? 14.047  -12.002 -23.656 1.00 24.15  ? 270  VAL A C     1 
ATOM   2234 O  O     . VAL A 1 270 ? 13.555  -10.993 -24.160 1.00 23.30  ? 270  VAL A O     1 
ATOM   2235 C  CB    . VAL A 1 270 ? 14.255  -11.278 -21.241 1.00 22.28  ? 270  VAL A CB    1 
ATOM   2236 C  CG1   . VAL A 1 270 ? 12.981  -12.051 -20.961 1.00 21.72  ? 270  VAL A CG1   1 
ATOM   2237 C  CG2   . VAL A 1 270 ? 15.147  -11.295 -19.999 1.00 16.94  ? 270  VAL A CG2   1 
ATOM   2238 N  N     . LEU A 1 271 ? 13.823  -13.234 -24.116 1.00 23.46  ? 271  LEU A N     1 
ATOM   2239 C  CA    . LEU A 1 271 ? 12.859  -13.507 -25.176 1.00 24.37  ? 271  LEU A CA    1 
ATOM   2240 C  C     . LEU A 1 271 ? 11.834  -14.479 -24.631 1.00 24.52  ? 271  LEU A C     1 
ATOM   2241 O  O     . LEU A 1 271 ? 11.992  -15.696 -24.775 1.00 24.35  ? 271  LEU A O     1 
ATOM   2242 C  CB    . LEU A 1 271 ? 13.535  -14.114 -26.422 1.00 24.21  ? 271  LEU A CB    1 
ATOM   2243 C  CG    . LEU A 1 271 ? 14.698  -13.394 -27.128 1.00 27.29  ? 271  LEU A CG    1 
ATOM   2244 C  CD1   . LEU A 1 271 ? 15.336  -14.299 -28.175 1.00 24.78  ? 271  LEU A CD1   1 
ATOM   2245 C  CD2   . LEU A 1 271 ? 14.247  -12.096 -27.775 1.00 27.27  ? 271  LEU A CD2   1 
ATOM   2246 N  N     . ASP A 1 272 ? 10.790  -13.938 -24.002 1.00 25.35  ? 272  ASP A N     1 
ATOM   2247 C  CA    . ASP A 1 272 ? 9.703   -14.744 -23.429 1.00 24.68  ? 272  ASP A CA    1 
ATOM   2248 C  C     . ASP A 1 272 ? 9.048   -15.499 -24.584 1.00 22.19  ? 272  ASP A C     1 
ATOM   2249 O  O     . ASP A 1 272 ? 8.671   -14.886 -25.581 1.00 22.28  ? 272  ASP A O     1 
ATOM   2250 C  CB    . ASP A 1 272 ? 8.698   -13.815 -22.733 1.00 25.05  ? 272  ASP A CB    1 
ATOM   2251 C  CG    . ASP A 1 272 ? 7.696   -14.556 -21.839 1.00 28.56  ? 272  ASP A CG    1 
ATOM   2252 O  OD1   . ASP A 1 272 ? 7.392   -15.752 -22.065 1.00 31.71  ? 272  ASP A OD1   1 
ATOM   2253 O  OD2   . ASP A 1 272 ? 7.188   -13.908 -20.901 1.00 27.88  ? 272  ASP A OD2   1 
ATOM   2254 N  N     . TYR A 1 273 ? 8.937   -16.821 -24.480 1.00 23.01  ? 273  TYR A N     1 
ATOM   2255 C  CA    . TYR A 1 273 ? 8.428   -17.596 -25.620 1.00 21.75  ? 273  TYR A CA    1 
ATOM   2256 C  C     . TYR A 1 273 ? 6.988   -17.245 -25.997 1.00 24.55  ? 273  TYR A C     1 
ATOM   2257 O  O     . TYR A 1 273 ? 6.631   -17.294 -27.176 1.00 26.22  ? 273  TYR A O     1 
ATOM   2258 C  CB    . TYR A 1 273 ? 8.619   -19.107 -25.461 1.00 22.61  ? 273  TYR A CB    1 
ATOM   2259 C  CG    . TYR A 1 273 ? 8.929   -19.736 -26.794 1.00 22.86  ? 273  TYR A CG    1 
ATOM   2260 C  CD1   . TYR A 1 273 ? 7.906   -20.176 -27.644 1.00 22.83  ? 273  TYR A CD1   1 
ATOM   2261 C  CD2   . TYR A 1 273 ? 10.246  -19.828 -27.244 1.00 21.75  ? 273  TYR A CD2   1 
ATOM   2262 C  CE1   . TYR A 1 273 ? 8.200   -20.717 -28.898 1.00 22.08  ? 273  TYR A CE1   1 
ATOM   2263 C  CE2   . TYR A 1 273 ? 10.546  -20.368 -28.491 1.00 22.73  ? 273  TYR A CE2   1 
ATOM   2264 C  CZ    . TYR A 1 273 ? 9.519   -20.810 -29.312 1.00 23.74  ? 273  TYR A CZ    1 
ATOM   2265 O  OH    . TYR A 1 273 ? 9.824   -21.346 -30.548 1.00 27.05  ? 273  TYR A OH    1 
ATOM   2266 N  N     . ILE A 1 274 ? 6.171   -16.864 -25.014 1.00 23.64  ? 274  ILE A N     1 
ATOM   2267 C  CA    . ILE A 1 274 ? 4.805   -16.422 -25.302 1.00 25.22  ? 274  ILE A CA    1 
ATOM   2268 C  C     . ILE A 1 274 ? 4.793   -15.224 -26.281 1.00 24.12  ? 274  ILE A C     1 
ATOM   2269 O  O     . ILE A 1 274 ? 4.013   -15.199 -27.237 1.00 24.53  ? 274  ILE A O     1 
ATOM   2270 C  CB    . ILE A 1 274 ? 4.005   -16.123 -23.995 1.00 26.41  ? 274  ILE A CB    1 
ATOM   2271 C  CG1   . ILE A 1 274 ? 2.500   -16.189 -24.257 1.00 32.37  ? 274  ILE A CG1   1 
ATOM   2272 C  CG2   . ILE A 1 274 ? 4.402   -14.773 -23.390 1.00 29.54  ? 274  ILE A CG2   1 
ATOM   2273 C  CD1   . ILE A 1 274 ? 1.641   -16.247 -22.982 1.00 36.92  ? 274  ILE A CD1   1 
ATOM   2274 N  N     . ASP A 1 275 ? 5.681   -14.261 -26.051 1.00 21.87  ? 275  ASP A N     1 
ATOM   2275 C  CA    . ASP A 1 275 ? 5.799   -13.077 -26.901 1.00 23.25  ? 275  ASP A CA    1 
ATOM   2276 C  C     . ASP A 1 275 ? 6.388   -13.427 -28.266 1.00 24.00  ? 275  ASP A C     1 
ATOM   2277 O  O     . ASP A 1 275 ? 5.956   -12.884 -29.278 1.00 24.48  ? 275  ASP A O     1 
ATOM   2278 C  CB    . ASP A 1 275 ? 6.641   -11.994 -26.217 1.00 25.20  ? 275  ASP A CB    1 
ATOM   2279 C  CG    . ASP A 1 275 ? 6.025   -11.499 -24.909 1.00 27.51  ? 275  ASP A CG    1 
ATOM   2280 O  OD1   . ASP A 1 275 ? 4.787   -11.522 -24.770 1.00 29.28  ? 275  ASP A OD1   1 
ATOM   2281 O  OD2   . ASP A 1 275 ? 6.788   -11.088 -24.011 1.00 37.37  ? 275  ASP A OD2   1 
ATOM   2282 N  N     . LEU A 1 276 ? 7.373   -14.325 -28.290 1.00 22.58  ? 276  LEU A N     1 
ATOM   2283 C  CA    . LEU A 1 276 ? 7.885   -14.864 -29.553 1.00 23.92  ? 276  LEU A CA    1 
ATOM   2284 C  C     . LEU A 1 276 ? 6.753   -15.525 -30.341 1.00 24.53  ? 276  LEU A C     1 
ATOM   2285 O  O     . LEU A 1 276 ? 6.598   -15.290 -31.543 1.00 23.83  ? 276  LEU A O     1 
ATOM   2286 C  CB    . LEU A 1 276 ? 9.010   -15.883 -29.307 1.00 22.32  ? 276  LEU A CB    1 
ATOM   2287 C  CG    . LEU A 1 276 ? 10.407  -15.425 -28.850 1.00 24.16  ? 276  LEU A CG    1 
ATOM   2288 C  CD1   . LEU A 1 276 ? 11.251  -16.622 -28.463 1.00 18.81  ? 276  LEU A CD1   1 
ATOM   2289 C  CD2   . LEU A 1 276 ? 11.129  -14.622 -29.919 1.00 23.69  ? 276  LEU A CD2   1 
ATOM   2290 N  N     . TYR A 1 277 ? 5.962   -16.342 -29.648 1.00 24.58  ? 277  TYR A N     1 
ATOM   2291 C  CA    . TYR A 1 277 ? 4.866   -17.079 -30.261 1.00 24.83  ? 277  TYR A CA    1 
ATOM   2292 C  C     . TYR A 1 277 ? 3.798   -16.129 -30.794 1.00 25.05  ? 277  TYR A C     1 
ATOM   2293 O  O     . TYR A 1 277 ? 3.355   -16.263 -31.935 1.00 26.55  ? 277  TYR A O     1 
ATOM   2294 C  CB    . TYR A 1 277 ? 4.266   -18.084 -29.267 1.00 23.82  ? 277  TYR A CB    1 
ATOM   2295 C  CG    . TYR A 1 277 ? 3.294   -19.068 -29.881 1.00 25.32  ? 277  TYR A CG    1 
ATOM   2296 C  CD1   . TYR A 1 277 ? 3.723   -20.325 -30.315 1.00 24.01  ? 277  TYR A CD1   1 
ATOM   2297 C  CD2   . TYR A 1 277 ? 1.939   -18.747 -30.016 1.00 23.71  ? 277  TYR A CD2   1 
ATOM   2298 C  CE1   . TYR A 1 277 ? 2.830   -21.231 -30.877 1.00 21.10  ? 277  TYR A CE1   1 
ATOM   2299 C  CE2   . TYR A 1 277 ? 1.039   -19.641 -30.574 1.00 20.89  ? 277  TYR A CE2   1 
ATOM   2300 C  CZ    . TYR A 1 277 ? 1.486   -20.875 -30.999 1.00 23.24  ? 277  TYR A CZ    1 
ATOM   2301 O  OH    . TYR A 1 277 ? 0.583   -21.748 -31.539 1.00 21.67  ? 277  TYR A OH    1 
ATOM   2302 N  N     . LYS A 1 278 ? 3.397   -15.160 -29.978 1.00 24.98  ? 278  LYS A N     1 
ATOM   2303 C  CA    . LYS A 1 278 ? 2.386   -14.179 -30.401 1.00 24.33  ? 278  LYS A CA    1 
ATOM   2304 C  C     . LYS A 1 278 ? 2.801   -13.349 -31.624 1.00 24.45  ? 278  LYS A C     1 
ATOM   2305 O  O     . LYS A 1 278 ? 1.958   -12.952 -32.417 1.00 24.28  ? 278  LYS A O     1 
ATOM   2306 C  CB    . LYS A 1 278 ? 1.999   -13.257 -29.244 1.00 22.52  ? 278  LYS A CB    1 
ATOM   2307 C  CG    . LYS A 1 278 ? 1.084   -13.933 -28.220 1.00 28.69  ? 278  LYS A CG    1 
ATOM   2308 C  CD    . LYS A 1 278 ? 0.863   -13.080 -26.977 1.00 25.47  ? 278  LYS A CD    1 
ATOM   2309 C  CE    . LYS A 1 278 ? -0.267  -13.662 -26.127 1.00 28.97  ? 278  LYS A CE    1 
ATOM   2310 N  NZ    . LYS A 1 278 ? -0.527  -12.864 -24.898 1.00 30.72  ? 278  LYS A NZ    1 
ATOM   2311 N  N     . LYS A 1 279 ? 4.090   -13.064 -31.768 1.00 24.66  ? 279  LYS A N     1 
ATOM   2312 C  CA    . LYS A 1 279 ? 4.520   -12.222 -32.875 1.00 26.64  ? 279  LYS A CA    1 
ATOM   2313 C  C     . LYS A 1 279 ? 4.840   -13.020 -34.134 1.00 25.74  ? 279  LYS A C     1 
ATOM   2314 O  O     . LYS A 1 279 ? 4.560   -12.553 -35.243 1.00 27.00  ? 279  LYS A O     1 
ATOM   2315 C  CB    . LYS A 1 279 ? 5.709   -11.348 -32.474 1.00 29.20  ? 279  LYS A CB    1 
ATOM   2316 C  CG    . LYS A 1 279 ? 5.925   -10.159 -33.403 1.00 31.46  ? 279  LYS A CG    1 
ATOM   2317 C  CD    . LYS A 1 279 ? 7.276   -9.512  -33.167 1.00 37.84  ? 279  LYS A CD    1 
ATOM   2318 C  CE    . LYS A 1 279 ? 7.588   -8.466  -34.234 1.00 40.70  ? 279  LYS A CE    1 
ATOM   2319 N  NZ    . LYS A 1 279 ? 6.535   -7.408  -34.347 1.00 43.04  ? 279  LYS A NZ    1 
ATOM   2320 N  N     . PHE A 1 280 ? 5.392   -14.224 -33.968 1.00 22.53  ? 280  PHE A N     1 
ATOM   2321 C  CA    . PHE A 1 280 ? 5.943   -14.973 -35.105 1.00 24.70  ? 280  PHE A CA    1 
ATOM   2322 C  C     . PHE A 1 280 ? 5.150   -16.199 -35.579 1.00 25.51  ? 280  PHE A C     1 
ATOM   2323 O  O     . PHE A 1 280 ? 5.444   -16.753 -36.649 1.00 27.56  ? 280  PHE A O     1 
ATOM   2324 C  CB    . PHE A 1 280 ? 7.408   -15.368 -34.835 1.00 22.18  ? 280  PHE A CB    1 
ATOM   2325 C  CG    . PHE A 1 280 ? 8.325   -14.194 -34.557 1.00 22.13  ? 280  PHE A CG    1 
ATOM   2326 C  CD1   . PHE A 1 280 ? 9.229   -14.243 -33.507 1.00 19.53  ? 280  PHE A CD1   1 
ATOM   2327 C  CD2   . PHE A 1 280 ? 8.293   -13.048 -35.361 1.00 24.63  ? 280  PHE A CD2   1 
ATOM   2328 C  CE1   . PHE A 1 280 ? 10.083  -13.175 -33.250 1.00 22.49  ? 280  PHE A CE1   1 
ATOM   2329 C  CE2   . PHE A 1 280 ? 9.140   -11.975 -35.117 1.00 24.56  ? 280  PHE A CE2   1 
ATOM   2330 C  CZ    . PHE A 1 280 ? 10.036  -12.036 -34.055 1.00 26.28  ? 280  PHE A CZ    1 
ATOM   2331 N  N     . SER A 1 281 ? 4.155   -16.625 -34.809 1.00 22.39  ? 281  SER A N     1 
ATOM   2332 C  CA    . SER A 1 281 ? 3.447   -17.873 -35.135 1.00 24.11  ? 281  SER A CA    1 
ATOM   2333 C  C     . SER A 1 281 ? 2.337   -17.718 -36.175 1.00 24.83  ? 281  SER A C     1 
ATOM   2334 O  O     . SER A 1 281 ? 1.992   -18.691 -36.851 1.00 23.30  ? 281  SER A O     1 
ATOM   2335 C  CB    . SER A 1 281 ? 2.861   -18.520 -33.882 1.00 22.09  ? 281  SER A CB    1 
ATOM   2336 O  OG    . SER A 1 281 ? 1.716   -17.808 -33.470 1.00 24.42  ? 281  SER A OG    1 
ATOM   2337 N  N     . PHE A 1 282 ? 1.778   -16.510 -36.270 1.00 24.88  ? 282  PHE A N     1 
ATOM   2338 C  CA    . PHE A 1 282 ? 0.634   -16.205 -37.146 1.00 28.03  ? 282  PHE A CA    1 
ATOM   2339 C  C     . PHE A 1 282 ? -0.602  -17.047 -36.820 1.00 29.83  ? 282  PHE A C     1 
ATOM   2340 O  O     . PHE A 1 282 ? -1.276  -17.594 -37.706 1.00 27.95  ? 282  PHE A O     1 
ATOM   2341 C  CB    . PHE A 1 282 ? 1.025   -16.278 -38.628 1.00 28.04  ? 282  PHE A CB    1 
ATOM   2342 C  CG    . PHE A 1 282 ? 1.858   -15.119 -39.072 1.00 31.12  ? 282  PHE A CG    1 
ATOM   2343 C  CD1   . PHE A 1 282 ? 1.288   -14.074 -39.788 1.00 33.05  ? 282  PHE A CD1   1 
ATOM   2344 C  CD2   . PHE A 1 282 ? 3.208   -15.049 -38.743 1.00 31.28  ? 282  PHE A CD2   1 
ATOM   2345 C  CE1   . PHE A 1 282 ? 2.056   -12.990 -40.185 1.00 35.46  ? 282  PHE A CE1   1 
ATOM   2346 C  CE2   . PHE A 1 282 ? 3.979   -13.967 -39.136 1.00 30.05  ? 282  PHE A CE2   1 
ATOM   2347 C  CZ    . PHE A 1 282 ? 3.403   -12.937 -39.853 1.00 33.53  ? 282  PHE A CZ    1 
ATOM   2348 N  N     . THR A 1 283 ? -0.862  -17.152 -35.519 1.00 30.63  ? 283  THR A N     1 
ATOM   2349 C  CA    . THR A 1 283 ? -2.088  -17.731 -34.984 1.00 30.95  ? 283  THR A CA    1 
ATOM   2350 C  C     . THR A 1 283 ? -2.744  -16.681 -34.097 1.00 32.64  ? 283  THR A C     1 
ATOM   2351 O  O     . THR A 1 283 ? -2.099  -15.713 -33.688 1.00 31.64  ? 283  THR A O     1 
ATOM   2352 C  CB    . THR A 1 283 ? -1.791  -18.962 -34.104 1.00 30.87  ? 283  THR A CB    1 
ATOM   2353 O  OG1   . THR A 1 283 ? -1.031  -18.552 -32.958 1.00 28.18  ? 283  THR A OG1   1 
ATOM   2354 C  CG2   . THR A 1 283 ? -1.024  -20.045 -34.895 1.00 27.08  ? 283  THR A CG2   1 
ATOM   2355 N  N     . ASN A 1 284 ? -4.035  -16.850 -33.835 1.00 34.60  ? 284  ASN A N     1 
ATOM   2356 C  CA    . ASN A 1 284 ? -4.662  -16.216 -32.684 1.00 35.24  ? 284  ASN A CA    1 
ATOM   2357 C  C     . ASN A 1 284 ? -5.372  -17.341 -31.979 1.00 34.36  ? 284  ASN A C     1 
ATOM   2358 O  O     . ASN A 1 284 ? -6.244  -17.996 -32.556 1.00 34.88  ? 284  ASN A O     1 
ATOM   2359 C  CB    . ASN A 1 284 ? -5.633  -15.083 -33.060 1.00 38.84  ? 284  ASN A CB    1 
ATOM   2360 C  CG    . ASN A 1 284 ? -6.101  -14.251 -31.827 1.00 41.81  ? 284  ASN A CG    1 
ATOM   2361 O  OD1   . ASN A 1 284 ? -5.631  -14.454 -30.697 1.00 39.72  ? 284  ASN A OD1   1 
ATOM   2362 N  ND2   . ASN A 1 284 ? -7.026  -13.316 -32.057 1.00 36.95  ? 284  ASN A ND2   1 
ATOM   2363 N  N     . GLN A 1 285 ? -4.973  -17.573 -30.736 1.00 32.16  ? 285  GLN A N     1 
ATOM   2364 C  CA    . GLN A 1 285 ? -5.425  -18.732 -29.997 1.00 31.17  ? 285  GLN A CA    1 
ATOM   2365 C  C     . GLN A 1 285 ? -6.546  -18.384 -29.027 1.00 30.74  ? 285  GLN A C     1 
ATOM   2366 O  O     . GLN A 1 285 ? -6.637  -17.242 -28.573 1.00 34.15  ? 285  GLN A O     1 
ATOM   2367 C  CB    . GLN A 1 285 ? -4.241  -19.369 -29.264 1.00 29.71  ? 285  GLN A CB    1 
ATOM   2368 C  CG    . GLN A 1 285 ? -3.137  -19.881 -30.178 1.00 31.12  ? 285  GLN A CG    1 
ATOM   2369 C  CD    . GLN A 1 285 ? -3.532  -21.112 -30.979 1.00 33.92  ? 285  GLN A CD    1 
ATOM   2370 O  OE1   . GLN A 1 285 ? -4.701  -21.499 -31.016 1.00 35.81  ? 285  GLN A OE1   1 
ATOM   2371 N  NE2   . GLN A 1 285 ? -2.549  -21.732 -31.633 1.00 31.18  ? 285  GLN A NE2   1 
ATOM   2372 N  N     . PRO A 1 286 ? -7.420  -19.361 -28.721 1.00 29.77  ? 286  PRO A N     1 
ATOM   2373 C  CA    . PRO A 1 286 ? -8.420  -19.176 -27.654 1.00 28.65  ? 286  PRO A CA    1 
ATOM   2374 C  C     . PRO A 1 286 ? -7.799  -19.139 -26.256 1.00 28.49  ? 286  PRO A C     1 
ATOM   2375 O  O     . PRO A 1 286 ? -8.389  -18.588 -25.329 1.00 27.36  ? 286  PRO A O     1 
ATOM   2376 C  CB    . PRO A 1 286 ? -9.313  -20.408 -27.778 1.00 28.87  ? 286  PRO A CB    1 
ATOM   2377 C  CG    . PRO A 1 286 ? -9.025  -20.977 -29.123 1.00 30.97  ? 286  PRO A CG    1 
ATOM   2378 C  CD    . PRO A 1 286 ? -7.639  -20.603 -29.483 1.00 27.56  ? 286  PRO A CD    1 
ATOM   2379 N  N     . SER A 1 287 ? -6.616  -19.729 -26.113 1.00 30.08  ? 287  SER A N     1 
ATOM   2380 C  CA    . SER A 1 287 ? -5.928  -19.799 -24.826 1.00 29.18  ? 287  SER A CA    1 
ATOM   2381 C  C     . SER A 1 287 ? -4.420  -19.759 -25.032 1.00 29.01  ? 287  SER A C     1 
ATOM   2382 O  O     . SER A 1 287 ? -3.908  -20.241 -26.050 1.00 27.08  ? 287  SER A O     1 
ATOM   2383 C  CB    . SER A 1 287 ? -6.337  -21.081 -24.085 1.00 29.72  ? 287  SER A CB    1 
ATOM   2384 O  OG    . SER A 1 287 ? -5.620  -21.245 -22.879 1.00 31.52  ? 287  SER A OG    1 
ATOM   2385 N  N     . TYR A 1 288 ? -3.714  -19.182 -24.064 1.00 30.21  ? 288  TYR A N     1 
ATOM   2386 C  CA    . TYR A 1 288 ? -2.250  -19.131 -24.104 1.00 29.89  ? 288  TYR A CA    1 
ATOM   2387 C  C     . TYR A 1 288 ? -1.575  -19.848 -22.934 1.00 30.64  ? 288  TYR A C     1 
ATOM   2388 O  O     . TYR A 1 288 ? -0.396  -19.627 -22.654 1.00 32.67  ? 288  TYR A O     1 
ATOM   2389 C  CB    . TYR A 1 288 ? -1.748  -17.691 -24.287 1.00 28.64  ? 288  TYR A CB    1 
ATOM   2390 C  CG    . TYR A 1 288 ? -1.949  -17.213 -25.713 1.00 29.92  ? 288  TYR A CG    1 
ATOM   2391 C  CD1   . TYR A 1 288 ? -3.026  -16.397 -26.054 1.00 29.34  ? 288  TYR A CD1   1 
ATOM   2392 C  CD2   . TYR A 1 288 ? -1.079  -17.610 -26.727 1.00 24.75  ? 288  TYR A CD2   1 
ATOM   2393 C  CE1   . TYR A 1 288 ? -3.226  -15.975 -27.371 1.00 25.24  ? 288  TYR A CE1   1 
ATOM   2394 C  CE2   . TYR A 1 288 ? -1.274  -17.199 -28.041 1.00 26.65  ? 288  TYR A CE2   1 
ATOM   2395 C  CZ    . TYR A 1 288 ? -2.342  -16.382 -28.355 1.00 26.80  ? 288  TYR A CZ    1 
ATOM   2396 O  OH    . TYR A 1 288 ? -2.522  -15.979 -29.663 1.00 28.51  ? 288  TYR A OH    1 
ATOM   2397 N  N     . SER A 1 289 ? -2.320  -20.728 -22.272 1.00 31.48  ? 289  SER A N     1 
ATOM   2398 C  CA    . SER A 1 289 ? -1.723  -21.637 -21.305 1.00 32.60  ? 289  SER A CA    1 
ATOM   2399 C  C     . SER A 1 289 ? -0.805  -22.584 -22.067 1.00 32.97  ? 289  SER A C     1 
ATOM   2400 O  O     . SER A 1 289 ? -1.056  -22.885 -23.240 1.00 34.25  ? 289  SER A O     1 
ATOM   2401 C  CB    . SER A 1 289 ? -2.794  -22.430 -20.557 1.00 32.75  ? 289  SER A CB    1 
ATOM   2402 O  OG    . SER A 1 289 ? -3.195  -23.573 -21.294 1.00 36.03  ? 289  SER A OG    1 
ATOM   2403 N  N     . LEU A 1 290 ? 0.259   -23.040 -21.411 1.00 32.56  ? 290  LEU A N     1 
ATOM   2404 C  CA    . LEU A 1 290 ? 1.227   -23.918 -22.055 1.00 30.84  ? 290  LEU A CA    1 
ATOM   2405 C  C     . LEU A 1 290 ? 0.597   -25.244 -22.468 1.00 31.17  ? 290  LEU A C     1 
ATOM   2406 O  O     . LEU A 1 290 ? 0.979   -25.812 -23.496 1.00 31.70  ? 290  LEU A O     1 
ATOM   2407 C  CB    . LEU A 1 290 ? 2.439   -24.159 -21.154 1.00 31.14  ? 290  LEU A CB    1 
ATOM   2408 C  CG    . LEU A 1 290 ? 3.623   -24.876 -21.813 1.00 30.75  ? 290  LEU A CG    1 
ATOM   2409 C  CD1   . LEU A 1 290 ? 4.126   -24.110 -23.049 1.00 29.39  ? 290  LEU A CD1   1 
ATOM   2410 C  CD2   . LEU A 1 290 ? 4.744   -25.079 -20.802 1.00 30.08  ? 290  LEU A CD2   1 
ATOM   2411 N  N     . ASP A 1 291 ? -0.360  -25.718 -21.664 1.00 29.43  ? 291  ASP A N     1 
ATOM   2412 C  CA    . ASP A 1 291 ? -1.148  -26.919 -21.958 1.00 32.50  ? 291  ASP A CA    1 
ATOM   2413 C  C     . ASP A 1 291 ? -1.801  -26.791 -23.312 1.00 30.12  ? 291  ASP A C     1 
ATOM   2414 O  O     . ASP A 1 291 ? -1.761  -27.705 -24.124 1.00 27.81  ? 291  ASP A O     1 
ATOM   2415 C  CB    . ASP A 1 291 ? -2.286  -27.088 -20.942 1.00 35.97  ? 291  ASP A CB    1 
ATOM   2416 C  CG    . ASP A 1 291 ? -1.950  -28.043 -19.824 1.00 41.27  ? 291  ASP A CG    1 
ATOM   2417 O  OD1   . ASP A 1 291 ? -1.072  -28.917 -20.009 1.00 42.40  ? 291  ASP A OD1   1 
ATOM   2418 O  OD2   . ASP A 1 291 ? -2.592  -27.915 -18.753 1.00 46.60  ? 291  ASP A OD2   1 
ATOM   2419 N  N     . TYR A 1 292 ? -2.426  -25.641 -23.526 1.00 29.66  ? 292  TYR A N     1 
ATOM   2420 C  CA    . TYR A 1 292 ? -3.193  -25.406 -24.722 1.00 29.56  ? 292  TYR A CA    1 
ATOM   2421 C  C     . TYR A 1 292 ? -2.292  -25.303 -25.952 1.00 27.52  ? 292  TYR A C     1 
ATOM   2422 O  O     . TYR A 1 292 ? -2.564  -25.939 -26.972 1.00 24.87  ? 292  TYR A O     1 
ATOM   2423 C  CB    . TYR A 1 292 ? -4.046  -24.150 -24.570 1.00 30.94  ? 292  TYR A CB    1 
ATOM   2424 C  CG    . TYR A 1 292 ? -5.114  -24.093 -25.609 1.00 31.68  ? 292  TYR A CG    1 
ATOM   2425 C  CD1   . TYR A 1 292 ? -4.882  -23.495 -26.848 1.00 28.97  ? 292  TYR A CD1   1 
ATOM   2426 C  CD2   . TYR A 1 292 ? -6.357  -24.678 -25.371 1.00 30.77  ? 292  TYR A CD2   1 
ATOM   2427 C  CE1   . TYR A 1 292 ? -5.883  -23.471 -27.824 1.00 33.11  ? 292  TYR A CE1   1 
ATOM   2428 C  CE2   . TYR A 1 292 ? -7.349  -24.660 -26.332 1.00 33.63  ? 292  TYR A CE2   1 
ATOM   2429 C  CZ    . TYR A 1 292 ? -7.112  -24.054 -27.545 1.00 31.77  ? 292  TYR A CZ    1 
ATOM   2430 O  OH    . TYR A 1 292 ? -8.117  -24.048 -28.470 1.00 38.45  ? 292  TYR A OH    1 
ATOM   2431 N  N     . ILE A 1 293 ? -1.220  -24.516 -25.849 1.00 24.73  ? 293  ILE A N     1 
ATOM   2432 C  CA    . ILE A 1 293 ? -0.306  -24.324 -26.977 1.00 22.85  ? 293  ILE A CA    1 
ATOM   2433 C  C     . ILE A 1 293 ? 0.457   -25.616 -27.295 1.00 24.50  ? 293  ILE A C     1 
ATOM   2434 O  O     . ILE A 1 293 ? 0.643   -25.956 -28.471 1.00 24.68  ? 293  ILE A O     1 
ATOM   2435 C  CB    . ILE A 1 293 ? 0.660   -23.136 -26.741 1.00 21.61  ? 293  ILE A CB    1 
ATOM   2436 C  CG1   . ILE A 1 293 ? -0.120  -21.855 -26.388 1.00 22.51  ? 293  ILE A CG1   1 
ATOM   2437 C  CG2   . ILE A 1 293 ? 1.561   -22.901 -27.955 1.00 23.27  ? 293  ILE A CG2   1 
ATOM   2438 C  CD1   . ILE A 1 293 ? -0.993  -21.283 -27.503 1.00 22.84  ? 293  ILE A CD1   1 
ATOM   2439 N  N     . SER A 1 294 ? 0.874   -26.333 -26.251 1.00 25.26  ? 294  SER A N     1 
ATOM   2440 C  CA    . SER A 1 294 ? 1.527   -27.636 -26.403 1.00 28.08  ? 294  SER A CA    1 
ATOM   2441 C  C     . SER A 1 294 ? 0.673   -28.628 -27.167 1.00 27.44  ? 294  SER A C     1 
ATOM   2442 O  O     . SER A 1 294 ? 1.161   -29.307 -28.068 1.00 27.59  ? 294  SER A O     1 
ATOM   2443 C  CB    . SER A 1 294 ? 1.888   -28.243 -25.040 1.00 28.47  ? 294  SER A CB    1 
ATOM   2444 O  OG    . SER A 1 294 ? 3.021   -27.607 -24.500 1.00 31.70  ? 294  SER A OG    1 
ATOM   2445 N  N     . GLU A 1 295 ? -0.598  -28.723 -26.790 1.00 29.26  ? 295  GLU A N     1 
ATOM   2446 C  CA    . GLU A 1 295 ? -1.537  -29.616 -27.469 1.00 31.70  ? 295  GLU A CA    1 
ATOM   2447 C  C     . GLU A 1 295 ? -1.719  -29.208 -28.936 1.00 28.93  ? 295  GLU A C     1 
ATOM   2448 O  O     . GLU A 1 295 ? -1.779  -30.062 -29.827 1.00 26.97  ? 295  GLU A O     1 
ATOM   2449 C  CB    . GLU A 1 295 ? -2.877  -29.664 -26.714 1.00 34.95  ? 295  GLU A CB    1 
ATOM   2450 C  CG    . GLU A 1 295 ? -4.117  -30.025 -27.559 1.00 47.48  ? 295  GLU A CG    1 
ATOM   2451 C  CD    . GLU A 1 295 ? -4.301  -31.519 -27.781 1.00 56.73  ? 295  GLU A CD    1 
ATOM   2452 O  OE1   . GLU A 1 295 ? -3.338  -32.197 -28.215 1.00 60.55  ? 295  GLU A OE1   1 
ATOM   2453 O  OE2   . GLU A 1 295 ? -5.425  -32.017 -27.536 1.00 60.63  ? 295  GLU A OE2   1 
ATOM   2454 N  N     . PHE A 1 296 ? -1.790  -27.904 -29.182 1.00 26.44  ? 296  PHE A N     1 
ATOM   2455 C  CA    . PHE A 1 296 ? -1.982  -27.402 -30.539 1.00 27.05  ? 296  PHE A CA    1 
ATOM   2456 C  C     . PHE A 1 296 ? -0.753  -27.684 -31.409 1.00 25.47  ? 296  PHE A C     1 
ATOM   2457 O  O     . PHE A 1 296 ? -0.878  -28.188 -32.513 1.00 23.60  ? 296  PHE A O     1 
ATOM   2458 C  CB    . PHE A 1 296 ? -2.299  -25.903 -30.517 1.00 27.53  ? 296  PHE A CB    1 
ATOM   2459 C  CG    . PHE A 1 296 ? -2.525  -25.305 -31.883 1.00 30.98  ? 296  PHE A CG    1 
ATOM   2460 C  CD1   . PHE A 1 296 ? -3.805  -25.280 -32.447 1.00 33.25  ? 296  PHE A CD1   1 
ATOM   2461 C  CD2   . PHE A 1 296 ? -1.467  -24.757 -32.601 1.00 31.26  ? 296  PHE A CD2   1 
ATOM   2462 C  CE1   . PHE A 1 296 ? -4.020  -24.718 -33.710 1.00 35.39  ? 296  PHE A CE1   1 
ATOM   2463 C  CE2   . PHE A 1 296 ? -1.674  -24.190 -33.867 1.00 34.32  ? 296  PHE A CE2   1 
ATOM   2464 C  CZ    . PHE A 1 296 ? -2.948  -24.173 -34.421 1.00 33.80  ? 296  PHE A CZ    1 
ATOM   2465 N  N     . GLU A 1 297 ? 0.430   -27.370 -30.891 1.00 25.61  ? 297  GLU A N     1 
ATOM   2466 C  CA    . GLU A 1 297 ? 1.665   -27.457 -31.672 1.00 24.68  ? 297  GLU A CA    1 
ATOM   2467 C  C     . GLU A 1 297 ? 2.229   -28.870 -31.820 1.00 26.84  ? 297  GLU A C     1 
ATOM   2468 O  O     . GLU A 1 297 ? 2.790   -29.199 -32.863 1.00 27.47  ? 297  GLU A O     1 
ATOM   2469 C  CB    . GLU A 1 297 ? 2.736   -26.553 -31.070 1.00 21.74  ? 297  GLU A CB    1 
ATOM   2470 C  CG    . GLU A 1 297 ? 2.422   -25.063 -31.149 1.00 25.70  ? 297  GLU A CG    1 
ATOM   2471 C  CD    . GLU A 1 297 ? 2.461   -24.515 -32.568 1.00 25.39  ? 297  GLU A CD    1 
ATOM   2472 O  OE1   . GLU A 1 297 ? 3.312   -24.955 -33.373 1.00 27.18  ? 297  GLU A OE1   1 
ATOM   2473 O  OE2   . GLU A 1 297 ? 1.643   -23.629 -32.874 1.00 26.93  ? 297  GLU A OE2   1 
ATOM   2474 N  N     . LEU A 1 298 ? 2.086   -29.688 -30.778 1.00 26.08  ? 298  LEU A N     1 
ATOM   2475 C  CA    . LEU A 1 298 ? 2.820   -30.945 -30.670 1.00 28.17  ? 298  LEU A CA    1 
ATOM   2476 C  C     . LEU A 1 298 ? 1.919   -32.170 -30.591 1.00 30.56  ? 298  LEU A C     1 
ATOM   2477 O  O     . LEU A 1 298 ? 2.416   -33.296 -30.703 1.00 30.69  ? 298  LEU A O     1 
ATOM   2478 C  CB    . LEU A 1 298 ? 3.729   -30.930 -29.426 1.00 27.01  ? 298  LEU A CB    1 
ATOM   2479 C  CG    . LEU A 1 298 ? 4.686   -29.754 -29.197 1.00 24.43  ? 298  LEU A CG    1 
ATOM   2480 C  CD1   . LEU A 1 298 ? 5.180   -29.740 -27.755 1.00 17.09  ? 298  LEU A CD1   1 
ATOM   2481 C  CD2   . LEU A 1 298 ? 5.854   -29.788 -30.192 1.00 23.43  ? 298  LEU A CD2   1 
ATOM   2482 N  N     . ASN A 1 299 ? 0.613   -31.941 -30.397 1.00 31.80  ? 299  ASN A N     1 
ATOM   2483 C  CA    A ASN A 1 299 ? -0.379  -33.008 -30.207 0.50 35.05  ? 299  ASN A CA    1 
ATOM   2484 C  CA    B ASN A 1 299 ? -0.367  -33.017 -30.210 0.50 34.61  ? 299  ASN A CA    1 
ATOM   2485 C  C     . ASN A 1 299 ? -0.111  -33.843 -28.947 1.00 36.85  ? 299  ASN A C     1 
ATOM   2486 O  O     . ASN A 1 299 ? -0.366  -35.051 -28.916 1.00 39.83  ? 299  ASN A O     1 
ATOM   2487 C  CB    A ASN A 1 299 ? -0.504  -33.896 -31.462 0.50 35.23  ? 299  ASN A CB    1 
ATOM   2488 C  CB    B ASN A 1 299 ? -0.448  -33.921 -31.452 0.50 34.22  ? 299  ASN A CB    1 
ATOM   2489 C  CG    A ASN A 1 299 ? -1.780  -34.723 -31.474 0.50 36.97  ? 299  ASN A CG    1 
ATOM   2490 C  CG    B ASN A 1 299 ? -1.173  -33.262 -32.604 0.50 34.15  ? 299  ASN A CG    1 
ATOM   2491 O  OD1   A ASN A 1 299 ? -2.718  -34.450 -30.722 0.50 37.35  ? 299  ASN A OD1   1 
ATOM   2492 O  OD1   B ASN A 1 299 ? -2.392  -33.093 -32.566 0.50 33.88  ? 299  ASN A OD1   1 
ATOM   2493 N  ND2   A ASN A 1 299 ? -1.820  -35.743 -32.328 0.50 36.85  ? 299  ASN A ND2   1 
ATOM   2494 N  ND2   B ASN A 1 299 ? -0.429  -32.891 -33.643 0.50 33.30  ? 299  ASN A ND2   1 
ATOM   2495 N  N     . VAL A 1 300 ? 0.396   -33.190 -27.900 1.00 37.70  ? 300  VAL A N     1 
ATOM   2496 C  CA    . VAL A 1 300 ? 0.626   -33.865 -26.617 1.00 41.65  ? 300  VAL A CA    1 
ATOM   2497 C  C     . VAL A 1 300 ? -0.548  -33.641 -25.658 1.00 44.24  ? 300  VAL A C     1 
ATOM   2498 O  O     . VAL A 1 300 ? -1.140  -32.557 -25.631 1.00 44.50  ? 300  VAL A O     1 
ATOM   2499 C  CB    . VAL A 1 300 ? 1.960   -33.435 -25.930 1.00 40.58  ? 300  VAL A CB    1 
ATOM   2500 C  CG1   . VAL A 1 300 ? 3.159   -34.031 -26.651 1.00 40.08  ? 300  VAL A CG1   1 
ATOM   2501 C  CG2   . VAL A 1 300 ? 2.075   -31.910 -25.827 1.00 40.83  ? 300  VAL A CG2   1 
ATOM   2502 N  N     . GLY A 1 301 ? -0.880  -34.667 -24.879 1.00 46.61  ? 301  GLY A N     1 
ATOM   2503 C  CA    . GLY A 1 301 ? -1.981  -34.579 -23.922 1.00 50.87  ? 301  GLY A CA    1 
ATOM   2504 C  C     . GLY A 1 301 ? -1.671  -33.601 -22.805 1.00 53.11  ? 301  GLY A C     1 
ATOM   2505 O  O     . GLY A 1 301 ? -0.510  -33.434 -22.429 1.00 51.54  ? 301  GLY A O     1 
ATOM   2506 N  N     . LYS A 1 302 ? -2.707  -32.947 -22.280 1.00 57.19  ? 302  LYS A N     1 
ATOM   2507 C  CA    . LYS A 1 302 ? -2.554  -32.014 -21.151 1.00 60.54  ? 302  LYS A CA    1 
ATOM   2508 C  C     . LYS A 1 302 ? -1.899  -32.680 -19.927 1.00 61.54  ? 302  LYS A C     1 
ATOM   2509 O  O     . LYS A 1 302 ? -1.977  -33.903 -19.750 1.00 61.47  ? 302  LYS A O     1 
ATOM   2510 C  CB    . LYS A 1 302 ? -3.904  -31.375 -20.779 1.00 62.00  ? 302  LYS A CB    1 
ATOM   2511 C  CG    . LYS A 1 302 ? -4.915  -32.325 -20.111 1.00 67.15  ? 302  LYS A CG    1 
ATOM   2512 C  CD    . LYS A 1 302 ? -6.363  -31.847 -20.265 1.00 72.37  ? 302  LYS A CD    1 
ATOM   2513 C  CE    . LYS A 1 302 ? -6.938  -32.224 -21.633 1.00 74.85  ? 302  LYS A CE    1 
ATOM   2514 N  NZ    . LYS A 1 302 ? -8.366  -31.828 -21.788 1.00 75.80  ? 302  LYS A NZ    1 
ATOM   2515 N  N     . LEU A 1 303 ? -1.242  -31.874 -19.098 1.00 62.29  ? 303  LEU A N     1 
ATOM   2516 C  CA    . LEU A 1 303 ? -0.643  -32.381 -17.866 1.00 64.68  ? 303  LEU A CA    1 
ATOM   2517 C  C     . LEU A 1 303 ? -1.721  -32.637 -16.813 1.00 65.78  ? 303  LEU A C     1 
ATOM   2518 O  O     . LEU A 1 303 ? -2.348  -31.703 -16.306 1.00 66.26  ? 303  LEU A O     1 
ATOM   2519 C  CB    . LEU A 1 303 ? 0.458   -31.440 -17.363 1.00 64.66  ? 303  LEU A CB    1 
ATOM   2520 C  CG    . LEU A 1 303 ? 1.923   -31.800 -17.675 1.00 64.60  ? 303  LEU A CG    1 
ATOM   2521 C  CD1   . LEU A 1 303 ? 2.076   -32.743 -18.868 1.00 63.58  ? 303  LEU A CD1   1 
ATOM   2522 C  CD2   . LEU A 1 303 ? 2.753   -30.534 -17.891 1.00 63.24  ? 303  LEU A CD2   1 
ATOM   2523 N  N     . LYS A 1 304 ? -1.925  -33.917 -16.507 1.00 66.55  ? 304  LYS A N     1 
ATOM   2524 C  CA    . LYS A 1 304 ? -3.073  -34.382 -15.733 1.00 67.96  ? 304  LYS A CA    1 
ATOM   2525 C  C     . LYS A 1 304 ? -2.731  -34.559 -14.254 1.00 67.06  ? 304  LYS A C     1 
ATOM   2526 O  O     . LYS A 1 304 ? -1.826  -35.322 -13.911 1.00 66.41  ? 304  LYS A O     1 
ATOM   2527 C  CB    . LYS A 1 304 ? -3.582  -35.705 -16.328 1.00 69.32  ? 304  LYS A CB    1 
ATOM   2528 C  CG    . LYS A 1 304 ? -5.085  -35.960 -16.198 1.00 73.59  ? 304  LYS A CG    1 
ATOM   2529 C  CD    . LYS A 1 304 ? -5.422  -36.922 -15.057 1.00 76.22  ? 304  LYS A CD    1 
ATOM   2530 C  CE    . LYS A 1 304 ? -5.840  -36.185 -13.790 1.00 77.50  ? 304  LYS A CE    1 
ATOM   2531 N  NZ    . LYS A 1 304 ? -5.930  -37.093 -12.610 1.00 77.59  ? 304  LYS A NZ    1 
ATOM   2532 N  N     . TYR A 1 305 ? -3.460  -33.852 -13.389 1.00 66.91  ? 305  TYR A N     1 
ATOM   2533 C  CA    . TYR A 1 305 ? -3.328  -34.012 -11.935 1.00 66.51  ? 305  TYR A CA    1 
ATOM   2534 C  C     . TYR A 1 305 ? -4.644  -33.768 -11.189 1.00 65.93  ? 305  TYR A C     1 
ATOM   2535 O  O     . TYR A 1 305 ? -5.543  -33.103 -11.709 1.00 65.97  ? 305  TYR A O     1 
ATOM   2536 C  CB    . TYR A 1 305 ? -2.212  -33.117 -11.377 1.00 67.05  ? 305  TYR A CB    1 
ATOM   2537 C  CG    . TYR A 1 305 ? -2.408  -31.629 -11.598 1.00 68.15  ? 305  TYR A CG    1 
ATOM   2538 C  CD1   . TYR A 1 305 ? -3.105  -30.852 -10.672 1.00 68.53  ? 305  TYR A CD1   1 
ATOM   2539 C  CD2   . TYR A 1 305 ? -1.879  -30.996 -12.722 1.00 68.80  ? 305  TYR A CD2   1 
ATOM   2540 C  CE1   . TYR A 1 305 ? -3.284  -29.487 -10.863 1.00 69.84  ? 305  TYR A CE1   1 
ATOM   2541 C  CE2   . TYR A 1 305 ? -2.051  -29.625 -12.924 1.00 70.88  ? 305  TYR A CE2   1 
ATOM   2542 C  CZ    . TYR A 1 305 ? -2.755  -28.879 -11.988 1.00 70.87  ? 305  TYR A CZ    1 
ATOM   2543 O  OH    . TYR A 1 305 ? -2.929  -27.527 -12.175 1.00 71.93  ? 305  TYR A OH    1 
ATOM   2544 N  N     . ASP A 1 306 ? -4.738  -34.310 -9.973  1.00 65.42  ? 306  ASP A N     1 
ATOM   2545 C  CA    . ASP A 1 306 ? -5.929  -34.178 -9.119  1.00 65.20  ? 306  ASP A CA    1 
ATOM   2546 C  C     . ASP A 1 306 ? -5.813  -33.023 -8.123  1.00 62.86  ? 306  ASP A C     1 
ATOM   2547 O  O     . ASP A 1 306 ? -4.761  -32.822 -7.508  1.00 61.60  ? 306  ASP A O     1 
ATOM   2548 C  CB    . ASP A 1 306 ? -6.187  -35.479 -8.345  1.00 67.00  ? 306  ASP A CB    1 
ATOM   2549 C  CG    . ASP A 1 306 ? -6.637  -36.623 -9.243  1.00 71.03  ? 306  ASP A CG    1 
ATOM   2550 O  OD1   . ASP A 1 306 ? -5.870  -37.601 -9.382  1.00 70.81  ? 306  ASP A OD1   1 
ATOM   2551 O  OD2   . ASP A 1 306 ? -7.753  -36.547 -9.805  1.00 72.91  ? 306  ASP A OD2   1 
ATOM   2552 N  N     . GLY A 1 307 ? -6.904  -32.278 -7.962  1.00 61.11  ? 307  GLY A N     1 
ATOM   2553 C  CA    . GLY A 1 307 ? -6.970  -31.181 -6.993  1.00 59.15  ? 307  GLY A CA    1 
ATOM   2554 C  C     . GLY A 1 307 ? -6.334  -29.890 -7.480  1.00 56.49  ? 307  GLY A C     1 
ATOM   2555 O  O     . GLY A 1 307 ? -5.718  -29.863 -8.551  1.00 55.73  ? 307  GLY A O     1 
ATOM   2556 N  N     . PRO A 1 308 ? -6.478  -28.803 -6.698  1.00 55.18  ? 308  PRO A N     1 
ATOM   2557 C  CA    . PRO A 1 308 ? -5.888  -27.515 -7.075  1.00 53.87  ? 308  PRO A CA    1 
ATOM   2558 C  C     . PRO A 1 308 ? -4.363  -27.559 -7.051  1.00 52.51  ? 308  PRO A C     1 
ATOM   2559 O  O     . PRO A 1 308 ? -3.779  -28.282 -6.238  1.00 51.70  ? 308  PRO A O     1 
ATOM   2560 C  CB    . PRO A 1 308 ? -6.403  -26.560 -5.994  1.00 54.92  ? 308  PRO A CB    1 
ATOM   2561 C  CG    . PRO A 1 308 ? -6.701  -27.433 -4.820  1.00 55.48  ? 308  PRO A CG    1 
ATOM   2562 C  CD    . PRO A 1 308 ? -7.191  -28.726 -5.409  1.00 56.28  ? 308  PRO A CD    1 
ATOM   2563 N  N     . ILE A 1 309 ? -3.733  -26.791 -7.939  1.00 51.49  ? 309  ILE A N     1 
ATOM   2564 C  CA    . ILE A 1 309 ? -2.273  -26.678 -7.993  1.00 50.10  ? 309  ILE A CA    1 
ATOM   2565 C  C     . ILE A 1 309 ? -1.700  -26.249 -6.631  1.00 49.04  ? 309  ILE A C     1 
ATOM   2566 O  O     . ILE A 1 309 ? -0.565  -26.585 -6.291  1.00 47.19  ? 309  ILE A O     1 
ATOM   2567 C  CB    . ILE A 1 309 ? -1.813  -25.709 -9.126  1.00 50.80  ? 309  ILE A CB    1 
ATOM   2568 C  CG1   . ILE A 1 309 ? -0.281  -25.705 -9.256  1.00 50.85  ? 309  ILE A CG1   1 
ATOM   2569 C  CG2   . ILE A 1 309 ? -2.391  -24.294 -8.915  1.00 51.25  ? 309  ILE A CG2   1 
ATOM   2570 C  CD1   . ILE A 1 309 ? 0.255   -25.044 -10.519 1.00 55.07  ? 309  ILE A CD1   1 
ATOM   2571 N  N     . SER A 1 310 ? -2.513  -25.533 -5.855  1.00 48.94  ? 310  SER A N     1 
ATOM   2572 C  CA    . SER A 1 310 ? -2.138  -25.083 -4.519  1.00 47.81  ? 310  SER A CA    1 
ATOM   2573 C  C     . SER A 1 310 ? -1.944  -26.236 -3.536  1.00 46.47  ? 310  SER A C     1 
ATOM   2574 O  O     . SER A 1 310 ? -1.395  -26.040 -2.450  1.00 45.54  ? 310  SER A O     1 
ATOM   2575 C  CB    . SER A 1 310 ? -3.179  -24.100 -3.978  1.00 50.40  ? 310  SER A CB    1 
ATOM   2576 O  OG    . SER A 1 310 ? -4.413  -24.747 -3.712  1.00 55.64  ? 310  SER A OG    1 
ATOM   2577 N  N     . LYS A 1 311 ? -2.389  -27.432 -3.916  1.00 44.35  ? 311  LYS A N     1 
ATOM   2578 C  CA    . LYS A 1 311 ? -2.211  -28.616 -3.070  1.00 43.44  ? 311  LYS A CA    1 
ATOM   2579 C  C     . LYS A 1 311 ? -1.382  -29.733 -3.717  1.00 42.18  ? 311  LYS A C     1 
ATOM   2580 O  O     . LYS A 1 311 ? -1.136  -30.763 -3.082  1.00 42.85  ? 311  LYS A O     1 
ATOM   2581 C  CB    . LYS A 1 311 ? -3.566  -29.155 -2.603  1.00 45.10  ? 311  LYS A CB    1 
ATOM   2582 C  CG    . LYS A 1 311 ? -4.304  -28.225 -1.649  1.00 48.85  ? 311  LYS A CG    1 
ATOM   2583 C  CD    . LYS A 1 311 ? -5.665  -28.785 -1.286  1.00 55.88  ? 311  LYS A CD    1 
ATOM   2584 C  CE    . LYS A 1 311 ? -6.443  -27.843 -0.373  1.00 58.49  ? 311  LYS A CE    1 
ATOM   2585 N  NZ    . LYS A 1 311 ? -7.802  -28.389 -0.066  1.00 61.41  ? 311  LYS A NZ    1 
ATOM   2586 N  N     . LEU A 1 312 ? -0.932  -29.524 -4.956  1.00 38.05  ? 312  LEU A N     1 
ATOM   2587 C  CA    . LEU A 1 312 ? -0.214  -30.564 -5.698  1.00 37.10  ? 312  LEU A CA    1 
ATOM   2588 C  C     . LEU A 1 312 ? 1.121   -30.976 -5.084  1.00 36.03  ? 312  LEU A C     1 
ATOM   2589 O  O     . LEU A 1 312 ? 1.424   -32.168 -5.015  1.00 35.16  ? 312  LEU A O     1 
ATOM   2590 C  CB    . LEU A 1 312 ? -0.014  -30.173 -7.170  1.00 37.32  ? 312  LEU A CB    1 
ATOM   2591 C  CG    . LEU A 1 312 ? 0.458   -31.290 -8.113  1.00 39.38  ? 312  LEU A CG    1 
ATOM   2592 C  CD1   . LEU A 1 312 ? -0.386  -32.563 -7.974  1.00 39.99  ? 312  LEU A CD1   1 
ATOM   2593 C  CD2   . LEU A 1 312 ? 0.457   -30.817 -9.563  1.00 39.38  ? 312  LEU A CD2   1 
ATOM   2594 N  N     . ARG A 1 313 ? 1.923   -29.998 -4.661  1.00 33.69  ? 313  ARG A N     1 
ATOM   2595 C  CA    . ARG A 1 313 ? 3.189   -30.289 -3.994  1.00 34.15  ? 313  ARG A CA    1 
ATOM   2596 C  C     . ARG A 1 313 ? 2.962   -31.180 -2.771  1.00 35.49  ? 313  ARG A C     1 
ATOM   2597 O  O     . ARG A 1 313 ? 3.623   -32.208 -2.609  1.00 35.13  ? 313  ARG A O     1 
ATOM   2598 C  CB    . ARG A 1 313 ? 3.903   -28.999 -3.589  1.00 33.38  ? 313  ARG A CB    1 
ATOM   2599 C  CG    . ARG A 1 313 ? 5.266   -29.206 -2.950  1.00 33.17  ? 313  ARG A CG    1 
ATOM   2600 C  CD    . ARG A 1 313 ? 5.929   -27.868 -2.621  1.00 32.54  ? 313  ARG A CD    1 
ATOM   2601 N  NE    . ARG A 1 313 ? 7.148   -28.052 -1.832  1.00 31.73  ? 313  ARG A NE    1 
ATOM   2602 C  CZ    . ARG A 1 313 ? 7.179   -28.204 -0.510  1.00 32.08  ? 313  ARG A CZ    1 
ATOM   2603 N  NH1   . ARG A 1 313 ? 6.056   -28.191 0.201   1.00 30.13  ? 313  ARG A NH1   1 
ATOM   2604 N  NH2   . ARG A 1 313 ? 8.343   -28.377 0.104   1.00 33.93  ? 313  ARG A NH2   1 
ATOM   2605 N  N     . GLU A 1 314 ? 2.010   -30.778 -1.932  1.00 36.92  ? 314  GLU A N     1 
ATOM   2606 C  CA    . GLU A 1 314 ? 1.688   -31.473 -0.686  1.00 38.92  ? 314  GLU A CA    1 
ATOM   2607 C  C     . GLU A 1 314 ? 1.140   -32.886 -0.934  1.00 36.84  ? 314  GLU A C     1 
ATOM   2608 O  O     . GLU A 1 314 ? 1.545   -33.832 -0.266  1.00 36.98  ? 314  GLU A O     1 
ATOM   2609 C  CB    . GLU A 1 314 ? 0.698   -30.626 0.126   1.00 41.17  ? 314  GLU A CB    1 
ATOM   2610 C  CG    . GLU A 1 314 ? 0.316   -31.157 1.506   1.00 49.97  ? 314  GLU A CG    1 
ATOM   2611 C  CD    . GLU A 1 314 ? -0.559  -30.170 2.285   1.00 58.06  ? 314  GLU A CD    1 
ATOM   2612 O  OE1   . GLU A 1 314 ? -0.483  -30.156 3.536   1.00 62.21  ? 314  GLU A OE1   1 
ATOM   2613 O  OE2   . GLU A 1 314 ? -1.316  -29.399 1.648   1.00 60.69  ? 314  GLU A OE2   1 
ATOM   2614 N  N     . SER A 1 315 ? 0.236   -33.022 -1.900  1.00 34.93  ? 315  SER A N     1 
ATOM   2615 C  CA    . SER A 1 315 ? -0.413  -34.306 -2.165  1.00 36.00  ? 315  SER A CA    1 
ATOM   2616 C  C     . SER A 1 315 ? 0.411   -35.245 -3.042  1.00 35.77  ? 315  SER A C     1 
ATOM   2617 O  O     . SER A 1 315 ? 0.387   -36.461 -2.839  1.00 37.23  ? 315  SER A O     1 
ATOM   2618 C  CB    . SER A 1 315 ? -1.809  -34.111 -2.762  1.00 35.18  ? 315  SER A CB    1 
ATOM   2619 O  OG    . SER A 1 315 ? -1.763  -33.391 -3.977  1.00 37.09  ? 315  SER A OG    1 
ATOM   2620 N  N     . ASN A 1 316 ? 1.138   -34.680 -4.007  1.00 34.05  ? 316  ASN A N     1 
ATOM   2621 C  CA    . ASN A 1 316 ? 1.927   -35.470 -4.949  1.00 31.58  ? 316  ASN A CA    1 
ATOM   2622 C  C     . ASN A 1 316 ? 3.153   -34.712 -5.450  1.00 29.87  ? 316  ASN A C     1 
ATOM   2623 O  O     . ASN A 1 316 ? 3.190   -34.256 -6.600  1.00 28.82  ? 316  ASN A O     1 
ATOM   2624 C  CB    . ASN A 1 316 ? 1.056   -35.921 -6.129  1.00 31.14  ? 316  ASN A CB    1 
ATOM   2625 C  CG    . ASN A 1 316 ? 1.653   -37.106 -6.888  1.00 32.83  ? 316  ASN A CG    1 
ATOM   2626 O  OD1   . ASN A 1 316 ? 2.847   -37.404 -6.788  1.00 34.69  ? 316  ASN A OD1   1 
ATOM   2627 N  ND2   . ASN A 1 316 ? 0.816   -37.787 -7.648  1.00 30.49  ? 316  ASN A ND2   1 
ATOM   2628 N  N     . HIS A 1 317 ? 4.157   -34.603 -4.582  1.00 28.80  ? 317  HIS A N     1 
ATOM   2629 C  CA    . HIS A 1 317 ? 5.399   -33.895 -4.879  1.00 27.79  ? 317  HIS A CA    1 
ATOM   2630 C  C     . HIS A 1 317 ? 6.144   -34.506 -6.057  1.00 26.74  ? 317  HIS A C     1 
ATOM   2631 O  O     . HIS A 1 317 ? 6.776   -33.791 -6.830  1.00 27.51  ? 317  HIS A O     1 
ATOM   2632 C  CB    . HIS A 1 317 ? 6.307   -33.865 -3.640  1.00 29.24  ? 317  HIS A CB    1 
ATOM   2633 C  CG    . HIS A 1 317 ? 7.653   -33.255 -3.886  1.00 26.89  ? 317  HIS A CG    1 
ATOM   2634 N  ND1   . HIS A 1 317 ? 8.805   -34.007 -3.960  1.00 26.16  ? 317  HIS A ND1   1 
ATOM   2635 C  CD2   . HIS A 1 317 ? 8.031   -31.969 -4.085  1.00 26.07  ? 317  HIS A CD2   1 
ATOM   2636 C  CE1   . HIS A 1 317 ? 9.835   -33.210 -4.182  1.00 23.29  ? 317  HIS A CE1   1 
ATOM   2637 N  NE2   . HIS A 1 317 ? 9.392   -31.969 -4.265  1.00 22.46  ? 317  HIS A NE2   1 
ATOM   2638 N  N     . GLN A 1 318 ? 6.059   -35.827 -6.190  1.00 26.92  ? 318  GLN A N     1 
ATOM   2639 C  CA    . GLN A 1 318 ? 6.682   -36.534 -7.300  1.00 28.20  ? 318  GLN A CA    1 
ATOM   2640 C  C     . GLN A 1 318 ? 6.203   -35.990 -8.653  1.00 27.37  ? 318  GLN A C     1 
ATOM   2641 O  O     . GLN A 1 318 ? 7.013   -35.715 -9.533  1.00 30.04  ? 318  GLN A O     1 
ATOM   2642 C  CB    . GLN A 1 318 ? 6.431   -38.045 -7.190  1.00 28.17  ? 318  GLN A CB    1 
ATOM   2643 C  CG    . GLN A 1 318 ? 6.879   -38.858 -8.418  1.00 28.17  ? 318  GLN A CG    1 
ATOM   2644 C  CD    . GLN A 1 318 ? 8.388   -38.955 -8.571  1.00 27.29  ? 318  GLN A CD    1 
ATOM   2645 O  OE1   . GLN A 1 318 ? 9.120   -39.053 -7.586  1.00 26.69  ? 318  GLN A OE1   1 
ATOM   2646 N  NE2   . GLN A 1 318 ? 8.860   -38.943 -9.815  1.00 26.97  ? 318  GLN A NE2   1 
ATOM   2647 N  N     . ARG A 1 319 ? 4.893   -35.822 -8.799  1.00 28.24  ? 319  ARG A N     1 
ATOM   2648 C  CA    . ARG A 1 319 ? 4.303   -35.331 -10.044 1.00 29.02  ? 319  ARG A CA    1 
ATOM   2649 C  C     . ARG A 1 319 ? 4.516   -33.827 -10.217 1.00 27.32  ? 319  ARG A C     1 
ATOM   2650 O  O     . ARG A 1 319 ? 4.646   -33.336 -11.342 1.00 25.80  ? 319  ARG A O     1 
ATOM   2651 C  CB    . ARG A 1 319 ? 2.813   -35.685 -10.110 1.00 29.68  ? 319  ARG A CB    1 
ATOM   2652 C  CG    . ARG A 1 319 ? 2.177   -35.412 -11.460 1.00 34.42  ? 319  ARG A CG    1 
ATOM   2653 C  CD    . ARG A 1 319 ? 1.061   -36.386 -11.770 1.00 41.16  ? 319  ARG A CD    1 
ATOM   2654 N  NE    . ARG A 1 319 ? 1.559   -37.693 -12.195 1.00 44.24  ? 319  ARG A NE    1 
ATOM   2655 C  CZ    . ARG A 1 319 ? 0.789   -38.766 -12.356 1.00 49.52  ? 319  ARG A CZ    1 
ATOM   2656 N  NH1   . ARG A 1 319 ? -0.517  -38.691 -12.129 1.00 51.63  ? 319  ARG A NH1   1 
ATOM   2657 N  NH2   . ARG A 1 319 ? 1.319   -39.919 -12.737 1.00 49.77  ? 319  ARG A NH2   1 
ATOM   2658 N  N     . TYR A 1 320 ? 4.560   -33.117 -9.093  1.00 26.38  ? 320  TYR A N     1 
ATOM   2659 C  CA    . TYR A 1 320 ? 4.800   -31.675 -9.057  1.00 26.61  ? 320  TYR A CA    1 
ATOM   2660 C  C     . TYR A 1 320 ? 6.109   -31.322 -9.738  1.00 25.27  ? 320  TYR A C     1 
ATOM   2661 O  O     . TYR A 1 320 ? 6.155   -30.424 -10.577 1.00 24.09  ? 320  TYR A O     1 
ATOM   2662 C  CB    . TYR A 1 320 ? 4.847   -31.226 -7.600  1.00 27.37  ? 320  TYR A CB    1 
ATOM   2663 C  CG    . TYR A 1 320 ? 4.835   -29.737 -7.327  1.00 29.16  ? 320  TYR A CG    1 
ATOM   2664 C  CD1   . TYR A 1 320 ? 3.689   -28.972 -7.541  1.00 28.58  ? 320  TYR A CD1   1 
ATOM   2665 C  CD2   . TYR A 1 320 ? 5.948   -29.109 -6.768  1.00 29.97  ? 320  TYR A CD2   1 
ATOM   2666 C  CE1   . TYR A 1 320 ? 3.664   -27.605 -7.238  1.00 27.17  ? 320  TYR A CE1   1 
ATOM   2667 C  CE2   . TYR A 1 320 ? 5.932   -27.744 -6.459  1.00 30.71  ? 320  TYR A CE2   1 
ATOM   2668 C  CZ    . TYR A 1 320 ? 4.788   -27.000 -6.698  1.00 30.25  ? 320  TYR A CZ    1 
ATOM   2669 O  OH    . TYR A 1 320 ? 4.772   -25.653 -6.385  1.00 30.15  ? 320  TYR A OH    1 
ATOM   2670 N  N     . ILE A 1 321 ? 7.166   -32.048 -9.376  1.00 26.74  ? 321  ILE A N     1 
ATOM   2671 C  CA    . ILE A 1 321 ? 8.500   -31.830 -9.935  1.00 24.22  ? 321  ILE A CA    1 
ATOM   2672 C  C     . ILE A 1 321 ? 8.571   -32.286 -11.393 1.00 26.56  ? 321  ILE A C     1 
ATOM   2673 O  O     . ILE A 1 321 ? 9.048   -31.539 -12.258 1.00 26.06  ? 321  ILE A O     1 
ATOM   2674 C  CB    . ILE A 1 321 ? 9.596   -32.505 -9.067  1.00 24.47  ? 321  ILE A CB    1 
ATOM   2675 C  CG1   . ILE A 1 321 ? 9.604   -31.908 -7.650  1.00 23.59  ? 321  ILE A CG1   1 
ATOM   2676 C  CG2   . ILE A 1 321 ? 10.989  -32.385 -9.707  1.00 22.06  ? 321  ILE A CG2   1 
ATOM   2677 C  CD1   . ILE A 1 321 ? 9.736   -30.376 -7.582  1.00 23.15  ? 321  ILE A CD1   1 
ATOM   2678 N  N     . SER A 1 322 ? 8.079   -33.496 -11.670 1.00 25.98  ? 322  SER A N     1 
ATOM   2679 C  CA    . SER A 1 322 ? 8.068   -34.016 -13.040 1.00 26.45  ? 322  SER A CA    1 
ATOM   2680 C  C     . SER A 1 322 ? 7.343   -33.082 -14.016 1.00 26.29  ? 322  SER A C     1 
ATOM   2681 O  O     . SER A 1 322 ? 7.775   -32.920 -15.152 1.00 28.63  ? 322  SER A O     1 
ATOM   2682 C  CB    . SER A 1 322 ? 7.437   -35.409 -13.097 1.00 26.59  ? 322  SER A CB    1 
ATOM   2683 O  OG    . SER A 1 322 ? 8.265   -36.383 -12.491 1.00 28.07  ? 322  SER A OG    1 
ATOM   2684 N  N     . TYR A 1 323 ? 6.249   -32.470 -13.569 1.00 26.89  ? 323  TYR A N     1 
ATOM   2685 C  CA    . TYR A 1 323 ? 5.472   -31.574 -14.427 1.00 28.20  ? 323  TYR A CA    1 
ATOM   2686 C  C     . TYR A 1 323 ? 6.169   -30.242 -14.614 1.00 26.49  ? 323  TYR A C     1 
ATOM   2687 O  O     . TYR A 1 323 ? 5.962   -29.586 -15.622 1.00 28.45  ? 323  TYR A O     1 
ATOM   2688 C  CB    . TYR A 1 323 ? 4.045   -31.394 -13.895 1.00 29.67  ? 323  TYR A CB    1 
ATOM   2689 C  CG    . TYR A 1 323 ? 3.116   -32.560 -14.230 1.00 37.42  ? 323  TYR A CG    1 
ATOM   2690 C  CD1   . TYR A 1 323 ? 1.746   -32.490 -13.955 1.00 40.38  ? 323  TYR A CD1   1 
ATOM   2691 C  CD2   . TYR A 1 323 ? 3.603   -33.729 -14.837 1.00 38.78  ? 323  TYR A CD2   1 
ATOM   2692 C  CE1   . TYR A 1 323 ? 0.891   -33.554 -14.265 1.00 40.68  ? 323  TYR A CE1   1 
ATOM   2693 C  CE2   . TYR A 1 323 ? 2.753   -34.797 -15.149 1.00 40.30  ? 323  TYR A CE2   1 
ATOM   2694 C  CZ    . TYR A 1 323 ? 1.402   -34.698 -14.863 1.00 41.43  ? 323  TYR A CZ    1 
ATOM   2695 O  OH    . TYR A 1 323 ? 0.560   -35.748 -15.168 1.00 47.06  ? 323  TYR A OH    1 
ATOM   2696 N  N     . ASN A 1 324 ? 6.988   -29.849 -13.637 1.00 25.72  ? 324  ASN A N     1 
ATOM   2697 C  CA    . ASN A 1 324 ? 7.845   -28.674 -13.765 1.00 25.19  ? 324  ASN A CA    1 
ATOM   2698 C  C     . ASN A 1 324 ? 8.935   -28.922 -14.805 1.00 25.00  ? 324  ASN A C     1 
ATOM   2699 O  O     . ASN A 1 324 ? 9.227   -28.045 -15.610 1.00 23.70  ? 324  ASN A O     1 
ATOM   2700 C  CB    . ASN A 1 324 ? 8.455   -28.295 -12.408 1.00 24.52  ? 324  ASN A CB    1 
ATOM   2701 C  CG    . ASN A 1 324 ? 9.348   -27.058 -12.477 1.00 25.70  ? 324  ASN A CG    1 
ATOM   2702 O  OD1   . ASN A 1 324 ? 10.530  -27.123 -12.154 1.00 28.21  ? 324  ASN A OD1   1 
ATOM   2703 N  ND2   . ASN A 1 324 ? 8.783   -25.931 -12.877 1.00 24.88  ? 324  ASN A ND2   1 
ATOM   2704 N  N     . ILE A 1 325 ? 9.529   -30.118 -14.786 1.00 23.77  ? 325  ILE A N     1 
ATOM   2705 C  CA    . ILE A 1 325 ? 10.539  -30.502 -15.778 1.00 22.45  ? 325  ILE A CA    1 
ATOM   2706 C  C     . ILE A 1 325 ? 9.905   -30.591 -17.181 1.00 23.05  ? 325  ILE A C     1 
ATOM   2707 O  O     . ILE A 1 325 ? 10.459  -30.067 -18.148 1.00 23.57  ? 325  ILE A O     1 
ATOM   2708 C  CB    . ILE A 1 325 ? 11.239  -31.848 -15.417 1.00 22.17  ? 325  ILE A CB    1 
ATOM   2709 C  CG1   . ILE A 1 325 ? 12.009  -31.733 -14.096 1.00 21.78  ? 325  ILE A CG1   1 
ATOM   2710 C  CG2   . ILE A 1 325 ? 12.168  -32.315 -16.559 1.00 19.67  ? 325  ILE A CG2   1 
ATOM   2711 C  CD1   . ILE A 1 325 ? 12.378  -33.103 -13.475 1.00 20.95  ? 325  ILE A CD1   1 
ATOM   2712 N  N     . ILE A 1 326 ? 8.741   -31.237 -17.275 1.00 21.81  ? 326  ILE A N     1 
ATOM   2713 C  CA    . ILE A 1 326 ? 8.038   -31.396 -18.559 1.00 23.60  ? 326  ILE A CA    1 
ATOM   2714 C  C     . ILE A 1 326 ? 7.639   -30.053 -19.181 1.00 24.23  ? 326  ILE A C     1 
ATOM   2715 O  O     . ILE A 1 326 ? 7.767   -29.876 -20.389 1.00 27.02  ? 326  ILE A O     1 
ATOM   2716 C  CB    . ILE A 1 326 ? 6.821   -32.352 -18.438 1.00 22.73  ? 326  ILE A CB    1 
ATOM   2717 C  CG1   . ILE A 1 326 ? 7.314   -33.791 -18.207 1.00 19.51  ? 326  ILE A CG1   1 
ATOM   2718 C  CG2   . ILE A 1 326 ? 5.944   -32.299 -19.704 1.00 23.26  ? 326  ILE A CG2   1 
ATOM   2719 C  CD1   . ILE A 1 326 ? 6.223   -34.775 -17.778 1.00 20.96  ? 326  ILE A CD1   1 
ATOM   2720 N  N     . ALA A 1 327 ? 7.190   -29.111 -18.350 1.00 23.48  ? 327  ALA A N     1 
ATOM   2721 C  CA    . ALA A 1 327 ? 6.820   -27.768 -18.811 1.00 24.56  ? 327  ALA A CA    1 
ATOM   2722 C  C     . ALA A 1 327 ? 7.959   -27.082 -19.553 1.00 23.06  ? 327  ALA A C     1 
ATOM   2723 O  O     . ALA A 1 327 ? 7.748   -26.482 -20.605 1.00 26.83  ? 327  ALA A O     1 
ATOM   2724 C  CB    . ALA A 1 327 ? 6.354   -26.905 -17.641 1.00 23.63  ? 327  ALA A CB    1 
ATOM   2725 N  N     . VAL A 1 328 ? 9.164   -27.186 -19.004 1.00 22.94  ? 328  VAL A N     1 
ATOM   2726 C  CA    . VAL A 1 328 ? 10.374  -26.629 -19.620 1.00 22.50  ? 328  VAL A CA    1 
ATOM   2727 C  C     . VAL A 1 328 ? 10.683  -27.288 -20.960 1.00 20.94  ? 328  VAL A C     1 
ATOM   2728 O  O     . VAL A 1 328 ? 10.947  -26.604 -21.945 1.00 21.59  ? 328  VAL A O     1 
ATOM   2729 C  CB    . VAL A 1 328 ? 11.601  -26.774 -18.678 1.00 23.82  ? 328  VAL A CB    1 
ATOM   2730 C  CG1   . VAL A 1 328 ? 12.883  -26.342 -19.386 1.00 22.18  ? 328  VAL A CG1   1 
ATOM   2731 C  CG2   . VAL A 1 328 ? 11.388  -25.975 -17.388 1.00 22.39  ? 328  VAL A CG2   1 
ATOM   2732 N  N     . TYR A 1 329 ? 10.648  -28.616 -20.986 1.00 21.67  ? 329  TYR A N     1 
ATOM   2733 C  CA    . TYR A 1 329 ? 10.913  -29.386 -22.201 1.00 21.81  ? 329  TYR A CA    1 
ATOM   2734 C  C     . TYR A 1 329 ? 9.908   -29.078 -23.310 1.00 23.41  ? 329  TYR A C     1 
ATOM   2735 O  O     . TYR A 1 329 ? 10.265  -29.052 -24.492 1.00 24.29  ? 329  TYR A O     1 
ATOM   2736 C  CB    . TYR A 1 329 ? 10.899  -30.889 -21.886 1.00 21.91  ? 329  TYR A CB    1 
ATOM   2737 C  CG    . TYR A 1 329 ? 11.263  -31.786 -23.059 1.00 22.90  ? 329  TYR A CG    1 
ATOM   2738 C  CD1   . TYR A 1 329 ? 12.334  -31.478 -23.900 1.00 23.87  ? 329  TYR A CD1   1 
ATOM   2739 C  CD2   . TYR A 1 329 ? 10.549  -32.956 -23.305 1.00 27.13  ? 329  TYR A CD2   1 
ATOM   2740 C  CE1   . TYR A 1 329 ? 12.669  -32.310 -24.973 1.00 26.98  ? 329  TYR A CE1   1 
ATOM   2741 C  CE2   . TYR A 1 329 ? 10.874  -33.791 -24.364 1.00 28.24  ? 329  TYR A CE2   1 
ATOM   2742 C  CZ    . TYR A 1 329 ? 11.936  -33.464 -25.192 1.00 29.12  ? 329  TYR A CZ    1 
ATOM   2743 O  OH    . TYR A 1 329 ? 12.257  -34.296 -26.241 1.00 33.10  ? 329  TYR A OH    1 
ATOM   2744 N  N     . ARG A 1 330 ? 8.650   -28.856 -22.936 1.00 23.11  ? 330  ARG A N     1 
ATOM   2745 C  CA    . ARG A 1 330 ? 7.623   -28.572 -23.936 1.00 25.54  ? 330  ARG A CA    1 
ATOM   2746 C  C     . ARG A 1 330 ? 7.886   -27.282 -24.701 1.00 24.03  ? 330  ARG A C     1 
ATOM   2747 O  O     . ARG A 1 330 ? 7.599   -27.206 -25.893 1.00 28.45  ? 330  ARG A O     1 
ATOM   2748 C  CB    . ARG A 1 330 ? 6.217   -28.616 -23.332 1.00 25.97  ? 330  ARG A CB    1 
ATOM   2749 C  CG    . ARG A 1 330 ? 5.722   -30.039 -23.157 1.00 30.45  ? 330  ARG A CG    1 
ATOM   2750 C  CD    . ARG A 1 330 ? 4.345   -30.069 -22.579 1.00 39.49  ? 330  ARG A CD    1 
ATOM   2751 N  NE    . ARG A 1 330 ? 3.812   -31.427 -22.552 1.00 44.72  ? 330  ARG A NE    1 
ATOM   2752 C  CZ    . ARG A 1 330 ? 2.570   -31.740 -22.189 1.00 45.65  ? 330  ARG A CZ    1 
ATOM   2753 N  NH1   . ARG A 1 330 ? 1.709   -30.793 -21.817 1.00 41.50  ? 330  ARG A NH1   1 
ATOM   2754 N  NH2   . ARG A 1 330 ? 2.191   -33.010 -22.205 1.00 45.53  ? 330  ARG A NH2   1 
ATOM   2755 N  N     . VAL A 1 331 ? 8.460   -26.287 -24.035 1.00 21.80  ? 331  VAL A N     1 
ATOM   2756 C  CA    . VAL A 1 331 ? 8.875   -25.060 -24.719 1.00 22.40  ? 331  VAL A CA    1 
ATOM   2757 C  C     . VAL A 1 331 ? 10.040  -25.345 -25.677 1.00 22.73  ? 331  VAL A C     1 
ATOM   2758 O  O     . VAL A 1 331 ? 10.053  -24.844 -26.793 1.00 22.03  ? 331  VAL A O     1 
ATOM   2759 C  CB    . VAL A 1 331 ? 9.224   -23.924 -23.738 1.00 23.30  ? 331  VAL A CB    1 
ATOM   2760 C  CG1   . VAL A 1 331 ? 9.539   -22.645 -24.497 1.00 23.35  ? 331  VAL A CG1   1 
ATOM   2761 C  CG2   . VAL A 1 331 ? 8.069   -23.683 -22.780 1.00 24.48  ? 331  VAL A CG2   1 
ATOM   2762 N  N     . LEU A 1 332 ? 10.986  -26.183 -25.253 1.00 24.10  ? 332  LEU A N     1 
ATOM   2763 C  CA    . LEU A 1 332 ? 12.068  -26.645 -26.134 1.00 24.65  ? 332  LEU A CA    1 
ATOM   2764 C  C     . LEU A 1 332 ? 11.545  -27.358 -27.392 1.00 25.11  ? 332  LEU A C     1 
ATOM   2765 O  O     . LEU A 1 332 ? 12.043  -27.122 -28.491 1.00 26.96  ? 332  LEU A O     1 
ATOM   2766 C  CB    . LEU A 1 332 ? 13.042  -27.553 -25.369 1.00 24.43  ? 332  LEU A CB    1 
ATOM   2767 C  CG    . LEU A 1 332 ? 13.859  -26.912 -24.242 1.00 28.05  ? 332  LEU A CG    1 
ATOM   2768 C  CD1   . LEU A 1 332 ? 14.630  -27.981 -23.472 1.00 26.29  ? 332  LEU A CD1   1 
ATOM   2769 C  CD2   . LEU A 1 332 ? 14.810  -25.842 -24.791 1.00 25.05  ? 332  LEU A CD2   1 
ATOM   2770 N  N     . GLN A 1 333 ? 10.531  -28.208 -27.220 1.00 24.73  ? 333  GLN A N     1 
ATOM   2771 C  CA    . GLN A 1 333 ? 9.924   -28.941 -28.329 1.00 23.82  ? 333  GLN A CA    1 
ATOM   2772 C  C     . GLN A 1 333 ? 9.168   -28.034 -29.283 1.00 23.87  ? 333  GLN A C     1 
ATOM   2773 O  O     . GLN A 1 333 ? 9.201   -28.240 -30.493 1.00 23.34  ? 333  GLN A O     1 
ATOM   2774 C  CB    . GLN A 1 333 ? 8.977   -30.017 -27.812 1.00 23.16  ? 333  GLN A CB    1 
ATOM   2775 C  CG    . GLN A 1 333 ? 9.665   -31.170 -27.130 1.00 24.90  ? 333  GLN A CG    1 
ATOM   2776 C  CD    . GLN A 1 333 ? 8.673   -32.140 -26.526 1.00 25.94  ? 333  GLN A CD    1 
ATOM   2777 O  OE1   . GLN A 1 333 ? 8.480   -33.240 -27.038 1.00 31.34  ? 333  GLN A OE1   1 
ATOM   2778 N  NE2   . GLN A 1 333 ? 8.030   -31.732 -25.438 1.00 26.05  ? 333  GLN A NE2   1 
ATOM   2779 N  N     . ILE A 1 334 ? 8.467   -27.043 -28.742 1.00 24.27  ? 334  ILE A N     1 
ATOM   2780 C  CA    . ILE A 1 334 ? 7.804   -26.065 -29.591 1.00 24.83  ? 334  ILE A CA    1 
ATOM   2781 C  C     . ILE A 1 334 ? 8.869   -25.348 -30.430 1.00 25.85  ? 334  ILE A C     1 
ATOM   2782 O  O     . ILE A 1 334 ? 8.715   -25.203 -31.649 1.00 27.47  ? 334  ILE A O     1 
ATOM   2783 C  CB    . ILE A 1 334 ? 6.921   -25.066 -28.772 1.00 22.84  ? 334  ILE A CB    1 
ATOM   2784 C  CG1   . ILE A 1 334 ? 5.759   -25.809 -28.093 1.00 22.56  ? 334  ILE A CG1   1 
ATOM   2785 C  CG2   . ILE A 1 334 ? 6.382   -23.966 -29.676 1.00 23.42  ? 334  ILE A CG2   1 
ATOM   2786 C  CD1   . ILE A 1 334 ? 5.064   -25.014 -26.982 1.00 21.18  ? 334  ILE A CD1   1 
ATOM   2787 N  N     . ASP A 1 335 ? 9.961   -24.937 -29.785 1.00 25.11  ? 335  ASP A N     1 
ATOM   2788 C  CA    . ASP A 1 335 ? 11.025  -24.233 -30.493 1.00 26.00  ? 335  ASP A CA    1 
ATOM   2789 C  C     . ASP A 1 335 ? 11.772  -25.064 -31.532 1.00 23.88  ? 335  ASP A C     1 
ATOM   2790 O  O     . ASP A 1 335 ? 12.166  -24.528 -32.563 1.00 23.83  ? 335  ASP A O     1 
ATOM   2791 C  CB    . ASP A 1 335 ? 12.047  -23.582 -29.562 1.00 25.09  ? 335  ASP A CB    1 
ATOM   2792 C  CG    . ASP A 1 335 ? 12.914  -22.570 -30.308 1.00 30.54  ? 335  ASP A CG    1 
ATOM   2793 O  OD1   . ASP A 1 335 ? 12.343  -21.582 -30.822 1.00 30.58  ? 335  ASP A OD1   1 
ATOM   2794 O  OD2   . ASP A 1 335 ? 14.142  -22.778 -30.425 1.00 28.88  ? 335  ASP A OD2   1 
ATOM   2795 N  N     . ALA A 1 336 ? 11.990  -26.348 -31.250 1.00 21.25  ? 336  ALA A N     1 
ATOM   2796 C  CA    . ALA A 1 336 ? 12.585  -27.251 -32.235 1.00 21.89  ? 336  ALA A CA    1 
ATOM   2797 C  C     . ALA A 1 336 ? 11.705  -27.323 -33.481 1.00 23.55  ? 336  ALA A C     1 
ATOM   2798 O  O     . ALA A 1 336 ? 12.197  -27.525 -34.592 1.00 23.20  ? 336  ALA A O     1 
ATOM   2799 C  CB    . ALA A 1 336 ? 12.811  -28.646 -31.643 1.00 20.57  ? 336  ALA A CB    1 
ATOM   2800 N  N     . LYS A 1 337 ? 10.402  -27.137 -33.281 1.00 26.45  ? 337  LYS A N     1 
ATOM   2801 C  CA    . LYS A 1 337 ? 9.431   -27.110 -34.372 1.00 25.68  ? 337  LYS A CA    1 
ATOM   2802 C  C     . LYS A 1 337 ? 9.365   -25.733 -35.061 1.00 25.67  ? 337  LYS A C     1 
ATOM   2803 O  O     . LYS A 1 337 ? 9.616   -25.627 -36.273 1.00 26.50  ? 337  LYS A O     1 
ATOM   2804 C  CB    . LYS A 1 337 ? 8.053   -27.525 -33.858 1.00 24.32  ? 337  LYS A CB    1 
ATOM   2805 C  CG    . LYS A 1 337 ? 6.997   -27.530 -34.934 1.00 27.63  ? 337  LYS A CG    1 
ATOM   2806 C  CD    . LYS A 1 337 ? 5.622   -27.855 -34.400 1.00 28.38  ? 337  LYS A CD    1 
ATOM   2807 C  CE    . LYS A 1 337 ? 4.605   -27.795 -35.547 1.00 31.90  ? 337  LYS A CE    1 
ATOM   2808 N  NZ    . LYS A 1 337 ? 3.210   -27.510 -35.101 1.00 30.73  ? 337  LYS A NZ    1 
ATOM   2809 N  N     . ARG A 1 338 ? 9.040   -24.694 -34.287 1.00 23.38  ? 338  ARG A N     1 
ATOM   2810 C  CA    . ARG A 1 338 ? 8.810   -23.351 -34.825 1.00 20.98  ? 338  ARG A CA    1 
ATOM   2811 C  C     . ARG A 1 338 ? 10.085  -22.610 -35.186 1.00 22.27  ? 338  ARG A C     1 
ATOM   2812 O  O     . ARG A 1 338 ? 10.117  -21.886 -36.186 1.00 21.54  ? 338  ARG A O     1 
ATOM   2813 C  CB    . ARG A 1 338 ? 7.975   -22.497 -33.857 1.00 22.61  ? 338  ARG A CB    1 
ATOM   2814 C  CG    . ARG A 1 338 ? 6.492   -22.890 -33.759 1.00 19.36  ? 338  ARG A CG    1 
ATOM   2815 C  CD    . ARG A 1 338 ? 5.730   -22.713 -35.086 1.00 18.63  ? 338  ARG A CD    1 
ATOM   2816 N  NE    . ARG A 1 338 ? 4.292   -22.779 -34.858 1.00 19.79  ? 338  ARG A NE    1 
ATOM   2817 C  CZ    . ARG A 1 338 ? 3.377   -22.094 -35.539 1.00 22.21  ? 338  ARG A CZ    1 
ATOM   2818 N  NH1   . ARG A 1 338 ? 3.728   -21.279 -36.534 1.00 22.19  ? 338  ARG A NH1   1 
ATOM   2819 N  NH2   . ARG A 1 338 ? 2.097   -22.222 -35.215 1.00 20.05  ? 338  ARG A NH2   1 
ATOM   2820 N  N     . GLN A 1 339 ? 11.122  -22.770 -34.361 1.00 22.33  ? 339  GLN A N     1 
ATOM   2821 C  CA    . GLN A 1 339 ? 12.458  -22.198 -34.614 1.00 22.44  ? 339  GLN A CA    1 
ATOM   2822 C  C     . GLN A 1 339 ? 12.487  -20.667 -34.491 1.00 23.19  ? 339  GLN A C     1 
ATOM   2823 O  O     . GLN A 1 339 ? 13.163  -19.980 -35.264 1.00 22.96  ? 339  GLN A O     1 
ATOM   2824 C  CB    . GLN A 1 339 ? 13.041  -22.698 -35.955 1.00 21.88  ? 339  GLN A CB    1 
ATOM   2825 C  CG    . GLN A 1 339 ? 13.055  -24.245 -36.061 1.00 26.82  ? 339  GLN A CG    1 
ATOM   2826 C  CD    . GLN A 1 339 ? 13.727  -24.817 -37.318 1.00 32.68  ? 339  GLN A CD    1 
ATOM   2827 O  OE1   . GLN A 1 339 ? 13.690  -26.026 -37.543 1.00 37.20  ? 339  GLN A OE1   1 
ATOM   2828 N  NE2   . GLN A 1 339 ? 14.342  -23.962 -38.128 1.00 35.72  ? 339  GLN A NE2   1 
ATOM   2829 N  N     . PHE A 1 340 ? 11.760  -20.149 -33.499 1.00 23.65  ? 340  PHE A N     1 
ATOM   2830 C  CA    . PHE A 1 340 ? 11.691  -18.706 -33.261 1.00 24.29  ? 340  PHE A CA    1 
ATOM   2831 C  C     . PHE A 1 340 ? 12.970  -18.152 -32.653 1.00 23.36  ? 340  PHE A C     1 
ATOM   2832 O  O     . PHE A 1 340 ? 13.306  -16.990 -32.878 1.00 25.08  ? 340  PHE A O     1 
ATOM   2833 C  CB    . PHE A 1 340 ? 10.470  -18.314 -32.398 1.00 24.02  ? 340  PHE A CB    1 
ATOM   2834 C  CG    . PHE A 1 340 ? 9.134   -18.632 -33.029 1.00 25.89  ? 340  PHE A CG    1 
ATOM   2835 C  CD1   . PHE A 1 340 ? 8.959   -18.587 -34.411 1.00 24.91  ? 340  PHE A CD1   1 
ATOM   2836 C  CD2   . PHE A 1 340 ? 8.035   -18.955 -32.229 1.00 28.08  ? 340  PHE A CD2   1 
ATOM   2837 C  CE1   . PHE A 1 340 ? 7.715   -18.884 -34.989 1.00 24.87  ? 340  PHE A CE1   1 
ATOM   2838 C  CE2   . PHE A 1 340 ? 6.791   -19.249 -32.793 1.00 23.95  ? 340  PHE A CE2   1 
ATOM   2839 C  CZ    . PHE A 1 340 ? 6.635   -19.213 -34.180 1.00 25.47  ? 340  PHE A CZ    1 
ATOM   2840 N  N     . ILE A 1 341 ? 13.684  -18.966 -31.879 1.00 23.86  ? 341  ILE A N     1 
ATOM   2841 C  CA    . ILE A 1 341 ? 14.967  -18.517 -31.316 1.00 23.82  ? 341  ILE A CA    1 
ATOM   2842 C  C     . ILE A 1 341 ? 15.977  -18.301 -32.456 1.00 23.60  ? 341  ILE A C     1 
ATOM   2843 O  O     . ILE A 1 341 ? 16.616  -17.239 -32.543 1.00 21.90  ? 341  ILE A O     1 
ATOM   2844 C  CB    . ILE A 1 341 ? 15.524  -19.486 -30.227 1.00 24.91  ? 341  ILE A CB    1 
ATOM   2845 C  CG1   . ILE A 1 341 ? 14.531  -19.648 -29.061 1.00 25.58  ? 341  ILE A CG1   1 
ATOM   2846 C  CG2   . ILE A 1 341 ? 16.882  -19.002 -29.700 1.00 27.56  ? 341  ILE A CG2   1 
ATOM   2847 C  CD1   . ILE A 1 341 ? 14.302  -18.385 -28.246 1.00 31.49  ? 341  ILE A CD1   1 
ATOM   2848 N  N     . ASN A 1 342 ? 16.089  -19.300 -33.334 1.00 22.40  ? 342  ASN A N     1 
ATOM   2849 C  CA    . ASN A 1 342 ? 16.911  -19.214 -34.554 1.00 23.58  ? 342  ASN A CA    1 
ATOM   2850 C  C     . ASN A 1 342 ? 16.574  -17.977 -35.392 1.00 21.36  ? 342  ASN A C     1 
ATOM   2851 O  O     . ASN A 1 342 ? 17.468  -17.266 -35.840 1.00 19.20  ? 342  ASN A O     1 
ATOM   2852 C  CB    . ASN A 1 342 ? 16.747  -20.491 -35.398 1.00 25.11  ? 342  ASN A CB    1 
ATOM   2853 C  CG    . ASN A 1 342 ? 17.560  -20.462 -36.691 1.00 29.97  ? 342  ASN A CG    1 
ATOM   2854 O  OD1   . ASN A 1 342 ? 18.780  -20.631 -36.670 1.00 31.67  ? 342  ASN A OD1   1 
ATOM   2855 N  ND2   . ASN A 1 342 ? 16.876  -20.283 -37.826 1.00 28.44  ? 342  ASN A ND2   1 
ATOM   2856 N  N     . LEU A 1 343 ? 15.280  -17.726 -35.582 1.00 21.72  ? 343  LEU A N     1 
ATOM   2857 C  CA    . LEU A 1 343 ? 14.803  -16.542 -36.303 1.00 20.67  ? 343  LEU A CA    1 
ATOM   2858 C  C     . LEU A 1 343 ? 15.265  -15.249 -35.636 1.00 21.79  ? 343  LEU A C     1 
ATOM   2859 O  O     . LEU A 1 343 ? 15.747  -14.334 -36.305 1.00 25.21  ? 343  LEU A O     1 
ATOM   2860 C  CB    . LEU A 1 343 ? 13.273  -16.561 -36.419 1.00 20.18  ? 343  LEU A CB    1 
ATOM   2861 C  CG    . LEU A 1 343 ? 12.545  -15.295 -36.922 1.00 23.80  ? 343  LEU A CG    1 
ATOM   2862 C  CD1   . LEU A 1 343 ? 12.794  -15.048 -38.421 1.00 21.23  ? 343  LEU A CD1   1 
ATOM   2863 C  CD2   . LEU A 1 343 ? 11.050  -15.422 -36.634 1.00 22.61  ? 343  LEU A CD2   1 
ATOM   2864 N  N     . SER A 1 344 ? 15.110  -15.180 -34.317 1.00 20.87  ? 344  SER A N     1 
ATOM   2865 C  CA    . SER A 1 344 ? 15.480  -13.994 -33.552 1.00 21.20  ? 344  SER A CA    1 
ATOM   2866 C  C     . SER A 1 344 ? 16.957  -13.683 -33.681 1.00 19.33  ? 344  SER A C     1 
ATOM   2867 O  O     . SER A 1 344 ? 17.327  -12.537 -33.936 1.00 20.47  ? 344  SER A O     1 
ATOM   2868 C  CB    . SER A 1 344 ? 15.115  -14.167 -32.079 1.00 20.96  ? 344  SER A CB    1 
ATOM   2869 O  OG    . SER A 1 344 ? 13.715  -14.283 -31.937 1.00 21.83  ? 344  SER A OG    1 
ATOM   2870 N  N     . LEU A 1 345 ? 17.791  -14.708 -33.511 1.00 17.72  ? 345  LEU A N     1 
ATOM   2871 C  CA    . LEU A 1 345 ? 19.239  -14.566 -33.628 1.00 19.18  ? 345  LEU A CA    1 
ATOM   2872 C  C     . LEU A 1 345 ? 19.632  -14.093 -35.045 1.00 21.19  ? 345  LEU A C     1 
ATOM   2873 O  O     . LEU A 1 345 ? 20.378  -13.111 -35.191 1.00 22.62  ? 345  LEU A O     1 
ATOM   2874 C  CB    . LEU A 1 345 ? 19.940  -15.881 -33.250 1.00 20.52  ? 345  LEU A CB    1 
ATOM   2875 C  CG    . LEU A 1 345 ? 19.954  -16.339 -31.783 1.00 21.82  ? 345  LEU A CG    1 
ATOM   2876 C  CD1   . LEU A 1 345 ? 20.396  -17.806 -31.678 1.00 18.07  ? 345  LEU A CD1   1 
ATOM   2877 C  CD2   . LEU A 1 345 ? 20.828  -15.438 -30.889 1.00 18.53  ? 345  LEU A CD2   1 
ATOM   2878 N  N     . ASP A 1 346 ? 19.100  -14.761 -36.072 1.00 20.48  ? 346  ASP A N     1 
ATOM   2879 C  CA    . ASP A 1 346 ? 19.285  -14.340 -37.470 1.00 25.28  ? 346  ASP A CA    1 
ATOM   2880 C  C     . ASP A 1 346 ? 18.985  -12.856 -37.715 1.00 25.76  ? 346  ASP A C     1 
ATOM   2881 O  O     . ASP A 1 346 ? 19.818  -12.152 -38.272 1.00 26.74  ? 346  ASP A O     1 
ATOM   2882 C  CB    . ASP A 1 346 ? 18.424  -15.183 -38.418 1.00 27.06  ? 346  ASP A CB    1 
ATOM   2883 C  CG    . ASP A 1 346 ? 19.050  -16.525 -38.747 1.00 33.05  ? 346  ASP A CG    1 
ATOM   2884 O  OD1   . ASP A 1 346 ? 20.132  -16.839 -38.211 1.00 36.60  ? 346  ASP A OD1   1 
ATOM   2885 O  OD2   . ASP A 1 346 ? 18.458  -17.272 -39.552 1.00 37.37  ? 346  ASP A OD2   1 
ATOM   2886 N  N     . MET A 1 347 ? 17.797  -12.400 -37.307 1.00 26.89  ? 347  MET A N     1 
ATOM   2887 C  CA    . MET A 1 347 ? 17.361  -11.011 -37.525 1.00 26.71  ? 347  MET A CA    1 
ATOM   2888 C  C     . MET A 1 347 ? 18.195  -10.059 -36.690 1.00 24.98  ? 347  MET A C     1 
ATOM   2889 O  O     . MET A 1 347 ? 18.640  -9.022  -37.188 1.00 23.79  ? 347  MET A O     1 
ATOM   2890 C  CB    . MET A 1 347 ? 15.886  -10.817 -37.164 1.00 29.00  ? 347  MET A CB    1 
ATOM   2891 C  CG    . MET A 1 347 ? 14.868  -11.541 -38.040 1.00 39.43  ? 347  MET A CG    1 
ATOM   2892 S  SD    . MET A 1 347 ? 13.163  -11.381 -37.399 1.00 51.48  ? 347  MET A SD    1 
ATOM   2893 C  CE    . MET A 1 347 ? 12.999  -9.595  -37.216 1.00 41.52  ? 347  MET A CE    1 
ATOM   2894 N  N     . GLY A 1 348 ? 18.396  -10.420 -35.419 1.00 23.17  ? 348  GLY A N     1 
ATOM   2895 C  CA    . GLY A 1 348 ? 19.207  -9.636  -34.490 1.00 20.09  ? 348  GLY A CA    1 
ATOM   2896 C  C     . GLY A 1 348 ? 20.614  -9.365  -34.998 1.00 20.72  ? 348  GLY A C     1 
ATOM   2897 O  O     . GLY A 1 348 ? 21.062  -8.212  -35.047 1.00 21.89  ? 348  GLY A O     1 
ATOM   2898 N  N     . TYR A 1 349 ? 21.313  -10.421 -35.395 1.00 21.65  ? 349  TYR A N     1 
ATOM   2899 C  CA    . TYR A 1 349 ? 22.686  -10.258 -35.881 1.00 23.01  ? 349  TYR A CA    1 
ATOM   2900 C  C     . TYR A 1 349 ? 22.755  -9.549  -37.238 1.00 23.83  ? 349  TYR A C     1 
ATOM   2901 O  O     . TYR A 1 349 ? 23.679  -8.778  -37.490 1.00 25.60  ? 349  TYR A O     1 
ATOM   2902 C  CB    . TYR A 1 349 ? 23.445  -11.582 -35.883 1.00 20.04  ? 349  TYR A CB    1 
ATOM   2903 C  CG    . TYR A 1 349 ? 23.824  -12.041 -34.494 1.00 22.31  ? 349  TYR A CG    1 
ATOM   2904 C  CD1   . TYR A 1 349 ? 24.631  -11.256 -33.677 1.00 22.44  ? 349  TYR A CD1   1 
ATOM   2905 C  CD2   . TYR A 1 349 ? 23.369  -13.264 -33.994 1.00 18.43  ? 349  TYR A CD2   1 
ATOM   2906 C  CE1   . TYR A 1 349 ? 24.967  -11.671 -32.397 1.00 21.04  ? 349  TYR A CE1   1 
ATOM   2907 C  CE2   . TYR A 1 349 ? 23.705  -13.689 -32.723 1.00 17.72  ? 349  TYR A CE2   1 
ATOM   2908 C  CZ    . TYR A 1 349 ? 24.499  -12.894 -31.930 1.00 20.38  ? 349  TYR A CZ    1 
ATOM   2909 O  OH    . TYR A 1 349 ? 24.838  -13.328 -30.671 1.00 18.93  ? 349  TYR A OH    1 
ATOM   2910 N  N     . TYR A 1 350 ? 21.759  -9.783  -38.086 1.00 24.79  ? 350  TYR A N     1 
ATOM   2911 C  CA    . TYR A 1 350 ? 21.662  -9.091  -39.372 1.00 24.96  ? 350  TYR A CA    1 
ATOM   2912 C  C     . TYR A 1 350 ? 21.570  -7.556  -39.211 1.00 24.02  ? 350  TYR A C     1 
ATOM   2913 O  O     . TYR A 1 350 ? 22.255  -6.812  -39.913 1.00 22.31  ? 350  TYR A O     1 
ATOM   2914 C  CB    . TYR A 1 350 ? 20.471  -9.636  -40.175 1.00 26.10  ? 350  TYR A CB    1 
ATOM   2915 C  CG    . TYR A 1 350 ? 20.369  -9.076  -41.574 1.00 26.17  ? 350  TYR A CG    1 
ATOM   2916 C  CD1   . TYR A 1 350 ? 21.148  -9.587  -42.612 1.00 27.45  ? 350  TYR A CD1   1 
ATOM   2917 C  CD2   . TYR A 1 350 ? 19.501  -8.025  -41.854 1.00 22.49  ? 350  TYR A CD2   1 
ATOM   2918 C  CE1   . TYR A 1 350 ? 21.062  -9.055  -43.904 1.00 30.12  ? 350  TYR A CE1   1 
ATOM   2919 C  CE2   . TYR A 1 350 ? 19.406  -7.492  -43.130 1.00 27.23  ? 350  TYR A CE2   1 
ATOM   2920 C  CZ    . TYR A 1 350 ? 20.181  -8.007  -44.149 1.00 27.83  ? 350  TYR A CZ    1 
ATOM   2921 O  OH    . TYR A 1 350 ? 20.077  -7.460  -45.405 1.00 29.89  ? 350  TYR A OH    1 
ATOM   2922 N  N     . ALA A 1 351 ? 20.726  -7.100  -38.287 1.00 23.64  ? 351  ALA A N     1 
ATOM   2923 C  CA    . ALA A 1 351 ? 20.492  -5.667  -38.053 1.00 22.85  ? 351  ALA A CA    1 
ATOM   2924 C  C     . ALA A 1 351 ? 21.567  -5.037  -37.180 1.00 24.54  ? 351  ALA A C     1 
ATOM   2925 O  O     . ALA A 1 351 ? 21.748  -3.811  -37.188 1.00 23.68  ? 351  ALA A O     1 
ATOM   2926 C  CB    . ALA A 1 351 ? 19.125  -5.457  -37.409 1.00 23.35  ? 351  ALA A CB    1 
ATOM   2927 N  N     . LYS A 1 352 ? 22.260  -5.894  -36.427 1.00 25.99  ? 352  LYS A N     1 
ATOM   2928 C  CA    . LYS A 1 352 ? 23.213  -5.502  -35.384 1.00 26.63  ? 352  LYS A CA    1 
ATOM   2929 C  C     . LYS A 1 352 ? 22.523  -4.713  -34.273 1.00 24.43  ? 352  LYS A C     1 
ATOM   2930 O  O     . LYS A 1 352 ? 22.800  -3.529  -34.047 1.00 24.08  ? 352  LYS A O     1 
ATOM   2931 C  CB    . LYS A 1 352 ? 24.406  -4.747  -35.978 1.00 30.04  ? 352  LYS A CB    1 
ATOM   2932 C  CG    . LYS A 1 352 ? 25.250  -5.607  -36.895 1.00 30.32  ? 352  LYS A CG    1 
ATOM   2933 C  CD    . LYS A 1 352 ? 26.253  -4.777  -37.662 1.00 32.61  ? 352  LYS A CD    1 
ATOM   2934 C  CE    . LYS A 1 352 ? 26.966  -5.650  -38.669 1.00 32.28  ? 352  LYS A CE    1 
ATOM   2935 N  NZ    . LYS A 1 352 ? 27.817  -4.862  -39.573 1.00 29.28  ? 352  LYS A NZ    1 
ATOM   2936 N  N     . ILE A 1 353 ? 21.606  -5.398  -33.602 1.00 23.20  ? 353  ILE A N     1 
ATOM   2937 C  CA    . ILE A 1 353 ? 20.810  -4.846  -32.510 1.00 22.00  ? 353  ILE A CA    1 
ATOM   2938 C  C     . ILE A 1 353 ? 20.872  -5.805  -31.327 1.00 23.50  ? 353  ILE A C     1 
ATOM   2939 O  O     . ILE A 1 353 ? 21.302  -6.959  -31.474 1.00 22.15  ? 353  ILE A O     1 
ATOM   2940 C  CB    . ILE A 1 353 ? 19.317  -4.697  -32.922 1.00 21.97  ? 353  ILE A CB    1 
ATOM   2941 C  CG1   . ILE A 1 353 ? 18.766  -6.020  -33.486 1.00 22.43  ? 353  ILE A CG1   1 
ATOM   2942 C  CG2   . ILE A 1 353 ? 19.145  -3.573  -33.922 1.00 20.96  ? 353  ILE A CG2   1 
ATOM   2943 C  CD1   . ILE A 1 353 ? 17.293  -5.987  -33.859 1.00 19.42  ? 353  ILE A CD1   1 
ATOM   2944 N  N     . GLN A 1 354 ? 20.419  -5.341  -30.164 1.00 23.36  ? 354  GLN A N     1 
ATOM   2945 C  CA    . GLN A 1 354 ? 20.168  -6.242  -29.048 1.00 23.72  ? 354  GLN A CA    1 
ATOM   2946 C  C     . GLN A 1 354 ? 19.169  -7.271  -29.562 1.00 23.62  ? 354  GLN A C     1 
ATOM   2947 O  O     . GLN A 1 354 ? 18.214  -6.896  -30.247 1.00 24.32  ? 354  GLN A O     1 
ATOM   2948 C  CB    . GLN A 1 354 ? 19.567  -5.487  -27.866 1.00 23.21  ? 354  GLN A CB    1 
ATOM   2949 C  CG    . GLN A 1 354 ? 20.392  -4.319  -27.354 1.00 26.89  ? 354  GLN A CG    1 
ATOM   2950 C  CD    . GLN A 1 354 ? 19.852  -3.773  -26.047 1.00 32.52  ? 354  GLN A CD    1 
ATOM   2951 O  OE1   . GLN A 1 354 ? 20.461  -3.950  -24.990 1.00 33.05  ? 354  GLN A OE1   1 
ATOM   2952 N  NE2   . GLN A 1 354 ? 18.695  -3.120  -26.106 1.00 31.64  ? 354  GLN A NE2   1 
ATOM   2953 N  N     . ILE A 1 355 ? 19.377  -8.552  -29.253 1.00 22.77  ? 355  ILE A N     1 
ATOM   2954 C  CA    . ILE A 1 355 ? 18.482  -9.612  -29.764 1.00 24.36  ? 355  ILE A CA    1 
ATOM   2955 C  C     . ILE A 1 355 ? 17.016  -9.371  -29.400 1.00 24.32  ? 355  ILE A C     1 
ATOM   2956 O  O     . ILE A 1 355 ? 16.126  -9.611  -30.212 1.00 25.64  ? 355  ILE A O     1 
ATOM   2957 C  CB    . ILE A 1 355 ? 18.916  -11.050 -29.328 1.00 24.64  ? 355  ILE A CB    1 
ATOM   2958 C  CG1   . ILE A 1 355 ? 20.398  -11.301 -29.643 1.00 25.52  ? 355  ILE A CG1   1 
ATOM   2959 C  CG2   . ILE A 1 355 ? 18.036  -12.127 -30.003 1.00 20.74  ? 355  ILE A CG2   1 
ATOM   2960 C  CD1   . ILE A 1 355 ? 20.778  -11.107 -31.119 1.00 27.72  ? 355  ILE A CD1   1 
ATOM   2961 N  N     . GLN A 1 356 ? 16.766  -8.878  -28.191 1.00 24.20  ? 356  GLN A N     1 
ATOM   2962 C  CA    . GLN A 1 356 ? 15.398  -8.624  -27.763 1.00 23.33  ? 356  GLN A CA    1 
ATOM   2963 C  C     . GLN A 1 356 ? 14.713  -7.521  -28.586 1.00 23.13  ? 356  GLN A C     1 
ATOM   2964 O  O     . GLN A 1 356 ? 13.499  -7.383  -28.532 1.00 23.73  ? 356  GLN A O     1 
ATOM   2965 C  CB    . GLN A 1 356 ? 15.321  -8.339  -26.251 1.00 23.97  ? 356  GLN A CB    1 
ATOM   2966 C  CG    . GLN A 1 356 ? 15.967  -7.022  -25.773 1.00 22.63  ? 356  GLN A CG    1 
ATOM   2967 C  CD    . GLN A 1 356 ? 17.443  -7.173  -25.410 1.00 27.73  ? 356  GLN A CD    1 
ATOM   2968 O  OE1   . GLN A 1 356 ? 18.155  -8.029  -25.959 1.00 24.38  ? 356  GLN A OE1   1 
ATOM   2969 N  NE2   . GLN A 1 356 ? 17.915  -6.331  -24.483 1.00 22.83  ? 356  GLN A NE2   1 
ATOM   2970 N  N     . SER A 1 357 ? 15.479  -6.749  -29.359 1.00 22.10  ? 357  SER A N     1 
ATOM   2971 C  CA    . SER A 1 357 ? 14.865  -5.709  -30.194 1.00 20.99  ? 357  SER A CA    1 
ATOM   2972 C  C     . SER A 1 357 ? 14.188  -6.261  -31.462 1.00 20.98  ? 357  SER A C     1 
ATOM   2973 O  O     . SER A 1 357 ? 13.612  -5.482  -32.235 1.00 19.92  ? 357  SER A O     1 
ATOM   2974 C  CB    . SER A 1 357 ? 15.869  -4.621  -30.576 1.00 20.61  ? 357  SER A CB    1 
ATOM   2975 O  OG    . SER A 1 357 ? 16.422  -3.995  -29.437 1.00 21.90  ? 357  SER A OG    1 
ATOM   2976 N  N     . VAL A 1 358 ? 14.239  -7.582  -31.674 1.00 19.98  ? 358  VAL A N     1 
ATOM   2977 C  CA    . VAL A 1 358 ? 13.522  -8.210  -32.813 1.00 22.05  ? 358  VAL A CA    1 
ATOM   2978 C  C     . VAL A 1 358 ? 12.012  -8.007  -32.722 1.00 21.45  ? 358  VAL A C     1 
ATOM   2979 O  O     . VAL A 1 358 ? 11.324  -8.056  -33.735 1.00 24.27  ? 358  VAL A O     1 
ATOM   2980 C  CB    . VAL A 1 358 ? 13.812  -9.734  -32.992 1.00 22.37  ? 358  VAL A CB    1 
ATOM   2981 C  CG1   . VAL A 1 358 ? 15.272  -9.975  -33.349 1.00 22.19  ? 358  VAL A CG1   1 
ATOM   2982 C  CG2   . VAL A 1 358 ? 13.380  -10.548 -31.734 1.00 20.61  ? 358  VAL A CG2   1 
ATOM   2983 N  N     . PHE A 1 359 ? 11.507  -7.794  -31.507 1.00 21.21  ? 359  PHE A N     1 
ATOM   2984 C  CA    . PHE A 1 359 ? 10.091  -7.506  -31.284 1.00 21.97  ? 359  PHE A CA    1 
ATOM   2985 C  C     . PHE A 1 359 ? 9.674   -6.162  -31.883 1.00 22.96  ? 359  PHE A C     1 
ATOM   2986 O  O     . PHE A 1 359 ? 8.481   -5.903  -32.062 1.00 22.47  ? 359  PHE A O     1 
ATOM   2987 C  CB    . PHE A 1 359 ? 9.766   -7.508  -29.786 1.00 23.72  ? 359  PHE A CB    1 
ATOM   2988 C  CG    . PHE A 1 359 ? 9.784   -8.879  -29.161 1.00 25.06  ? 359  PHE A CG    1 
ATOM   2989 C  CD1   . PHE A 1 359 ? 8.871   -9.856  -29.565 1.00 21.31  ? 359  PHE A CD1   1 
ATOM   2990 C  CD2   . PHE A 1 359 ? 10.712  -9.193  -28.164 1.00 23.29  ? 359  PHE A CD2   1 
ATOM   2991 C  CE1   . PHE A 1 359 ? 8.875   -11.127 -28.990 1.00 19.75  ? 359  PHE A CE1   1 
ATOM   2992 C  CE2   . PHE A 1 359 ? 10.728  -10.469 -27.579 1.00 21.01  ? 359  PHE A CE2   1 
ATOM   2993 C  CZ    . PHE A 1 359 ? 9.810   -11.438 -27.996 1.00 19.44  ? 359  PHE A CZ    1 
ATOM   2994 N  N     . SER A 1 360 ? 10.662  -5.324  -32.201 1.00 21.37  ? 360  SER A N     1 
ATOM   2995 C  CA    . SER A 1 360 ? 10.418  -3.974  -32.686 1.00 20.00  ? 360  SER A CA    1 
ATOM   2996 C  C     . SER A 1 360 ? 10.996  -3.769  -34.096 1.00 22.04  ? 360  SER A C     1 
ATOM   2997 O  O     . SER A 1 360 ? 12.202  -3.521  -34.256 1.00 20.55  ? 360  SER A O     1 
ATOM   2998 C  CB    . SER A 1 360 ? 11.017  -2.963  -31.710 1.00 18.34  ? 360  SER A CB    1 
ATOM   2999 O  OG    . SER A 1 360 ? 11.138  -1.685  -32.315 1.00 21.47  ? 360  SER A OG    1 
ATOM   3000 N  N     . PRO A 1 361 ? 10.142  -3.881  -35.128 1.00 22.40  ? 361  PRO A N     1 
ATOM   3001 C  CA    . PRO A 1 361 ? 10.617  -3.667  -36.503 1.00 21.44  ? 361  PRO A CA    1 
ATOM   3002 C  C     . PRO A 1 361 ? 11.151  -2.250  -36.729 1.00 22.00  ? 361  PRO A C     1 
ATOM   3003 O  O     . PRO A 1 361 ? 12.043  -2.059  -37.561 1.00 21.64  ? 361  PRO A O     1 
ATOM   3004 C  CB    . PRO A 1 361 ? 9.370   -3.913  -37.358 1.00 21.21  ? 361  PRO A CB    1 
ATOM   3005 C  CG    . PRO A 1 361 ? 8.203   -3.723  -36.417 1.00 23.79  ? 361  PRO A CG    1 
ATOM   3006 C  CD    . PRO A 1 361 ? 8.705   -4.211  -35.080 1.00 23.42  ? 361  PRO A CD    1 
ATOM   3007 N  N     . ILE A 1 362 ? 10.620  -1.266  -36.004 1.00 24.17  ? 362  ILE A N     1 
ATOM   3008 C  CA    . ILE A 1 362 ? 11.137  0.108   -36.126 1.00 25.14  ? 362  ILE A CA    1 
ATOM   3009 C  C     . ILE A 1 362 ? 12.611  0.149   -35.712 1.00 25.19  ? 362  ILE A C     1 
ATOM   3010 O  O     . ILE A 1 362 ? 13.453  0.685   -36.434 1.00 26.83  ? 362  ILE A O     1 
ATOM   3011 C  CB    . ILE A 1 362 ? 10.269  1.147   -35.357 1.00 24.59  ? 362  ILE A CB    1 
ATOM   3012 C  CG1   . ILE A 1 362 ? 9.016   1.484   -36.173 1.00 24.70  ? 362  ILE A CG1   1 
ATOM   3013 C  CG2   . ILE A 1 362 ? 11.055  2.441   -35.063 1.00 26.81  ? 362  ILE A CG2   1 
ATOM   3014 C  CD1   . ILE A 1 362 ? 7.956   2.296   -35.435 1.00 22.21  ? 362  ILE A CD1   1 
ATOM   3015 N  N     . LYS A 1 363 ? 12.919  -0.445  -34.564 1.00 25.75  ? 363  LYS A N     1 
ATOM   3016 C  CA    . LYS A 1 363 ? 14.293  -0.527  -34.085 1.00 26.31  ? 363  LYS A CA    1 
ATOM   3017 C  C     . LYS A 1 363 ? 15.156  -1.328  -35.059 1.00 24.95  ? 363  LYS A C     1 
ATOM   3018 O  O     . LYS A 1 363 ? 16.293  -0.950  -35.344 1.00 23.49  ? 363  LYS A O     1 
ATOM   3019 C  CB    . LYS A 1 363 ? 14.347  -1.151  -32.675 1.00 26.24  ? 363  LYS A CB    1 
ATOM   3020 C  CG    . LYS A 1 363 ? 15.759  -1.295  -32.092 1.00 25.09  ? 363  LYS A CG    1 
ATOM   3021 C  CD    . LYS A 1 363 ? 16.516  0.036   -31.981 1.00 27.57  ? 363  LYS A CD    1 
ATOM   3022 C  CE    . LYS A 1 363 ? 15.938  0.949   -30.916 1.00 31.32  ? 363  LYS A CE    1 
ATOM   3023 N  NZ    . LYS A 1 363 ? 16.874  2.076   -30.574 1.00 30.85  ? 363  LYS A NZ    1 
ATOM   3024 N  N     . THR A 1 364 ? 14.601  -2.433  -35.556 1.00 23.09  ? 364  THR A N     1 
ATOM   3025 C  CA    . THR A 1 364 ? 15.296  -3.303  -36.494 1.00 23.25  ? 364  THR A CA    1 
ATOM   3026 C  C     . THR A 1 364 ? 15.662  -2.553  -37.777 1.00 23.04  ? 364  THR A C     1 
ATOM   3027 O  O     . THR A 1 364 ? 16.808  -2.581  -38.206 1.00 24.09  ? 364  THR A O     1 
ATOM   3028 C  CB    . THR A 1 364 ? 14.474  -4.590  -36.798 1.00 24.31  ? 364  THR A CB    1 
ATOM   3029 O  OG1   . THR A 1 364 ? 14.196  -5.283  -35.573 1.00 25.04  ? 364  THR A OG1   1 
ATOM   3030 C  CG2   . THR A 1 364 ? 15.242  -5.533  -37.717 1.00 24.52  ? 364  THR A CG2   1 
ATOM   3031 N  N     . TRP A 1 365 ? 14.699  -1.860  -38.373 1.00 23.27  ? 365  TRP A N     1 
ATOM   3032 C  CA    . TRP A 1 365 ? 14.973  -1.117  -39.598 1.00 21.77  ? 365  TRP A CA    1 
ATOM   3033 C  C     . TRP A 1 365 ? 15.814  0.128   -39.373 1.00 23.09  ? 365  TRP A C     1 
ATOM   3034 O  O     . TRP A 1 365 ? 16.567  0.541   -40.267 1.00 20.68  ? 365  TRP A O     1 
ATOM   3035 C  CB    . TRP A 1 365 ? 13.693  -0.793  -40.356 1.00 21.38  ? 365  TRP A CB    1 
ATOM   3036 C  CG    . TRP A 1 365 ? 13.157  -1.987  -41.093 1.00 23.63  ? 365  TRP A CG    1 
ATOM   3037 C  CD1   . TRP A 1 365 ? 12.010  -2.678  -40.813 1.00 21.97  ? 365  TRP A CD1   1 
ATOM   3038 C  CD2   . TRP A 1 365 ? 13.758  -2.642  -42.219 1.00 22.24  ? 365  TRP A CD2   1 
ATOM   3039 N  NE1   . TRP A 1 365 ? 11.853  -3.706  -41.708 1.00 24.19  ? 365  TRP A NE1   1 
ATOM   3040 C  CE2   . TRP A 1 365 ? 12.913  -3.714  -42.576 1.00 21.26  ? 365  TRP A CE2   1 
ATOM   3041 C  CE3   . TRP A 1 365 ? 14.929  -2.421  -42.966 1.00 22.87  ? 365  TRP A CE3   1 
ATOM   3042 C  CZ2   . TRP A 1 365 ? 13.194  -4.570  -43.653 1.00 22.84  ? 365  TRP A CZ2   1 
ATOM   3043 C  CZ3   . TRP A 1 365 ? 15.217  -3.273  -44.029 1.00 22.66  ? 365  TRP A CZ3   1 
ATOM   3044 C  CH2   . TRP A 1 365 ? 14.349  -4.336  -44.364 1.00 25.57  ? 365  TRP A CH2   1 
ATOM   3045 N  N     . ASP A 1 366 ? 15.712  0.720   -38.183 1.00 21.98  ? 366  ASP A N     1 
ATOM   3046 C  CA    . ASP A 1 366 ? 16.548  1.871   -37.880 1.00 23.09  ? 366  ASP A CA    1 
ATOM   3047 C  C     . ASP A 1 366 ? 18.023  1.476   -37.917 1.00 23.90  ? 366  ASP A C     1 
ATOM   3048 O  O     . ASP A 1 366 ? 18.842  2.200   -38.475 1.00 25.00  ? 366  ASP A O     1 
ATOM   3049 C  CB    . ASP A 1 366 ? 16.187  2.499   -36.532 1.00 25.18  ? 366  ASP A CB    1 
ATOM   3050 C  CG    . ASP A 1 366 ? 16.762  3.888   -36.370 1.00 26.94  ? 366  ASP A CG    1 
ATOM   3051 O  OD1   . ASP A 1 366 ? 16.787  4.649   -37.357 1.00 27.21  ? 366  ASP A OD1   1 
ATOM   3052 O  OD2   . ASP A 1 366 ? 17.204  4.222   -35.257 1.00 29.31  ? 366  ASP A OD2   1 
ATOM   3053 N  N     . ALA A 1 367 ? 18.345  0.310   -37.357 1.00 23.65  ? 367  ALA A N     1 
ATOM   3054 C  CA    . ALA A 1 367 ? 19.727  -0.173  -37.306 1.00 23.24  ? 367  ALA A CA    1 
ATOM   3055 C  C     . ALA A 1 367 ? 20.259  -0.697  -38.642 1.00 23.89  ? 367  ALA A C     1 
ATOM   3056 O  O     . ALA A 1 367 ? 21.434  -0.503  -38.959 1.00 26.41  ? 367  ALA A O     1 
ATOM   3057 C  CB    . ALA A 1 367 ? 19.870  -1.232  -36.244 1.00 23.06  ? 367  ALA A CB    1 
ATOM   3058 N  N     . ILE A 1 368 ? 19.414  -1.391  -39.402 1.00 24.97  ? 368  ILE A N     1 
ATOM   3059 C  CA    . ILE A 1 368 ? 19.778  -1.831  -40.751 1.00 23.35  ? 368  ILE A CA    1 
ATOM   3060 C  C     . ILE A 1 368 ? 20.141  -0.613  -41.622 1.00 24.85  ? 368  ILE A C     1 
ATOM   3061 O  O     . ILE A 1 368 ? 21.219  -0.554  -42.207 1.00 24.78  ? 368  ILE A O     1 
ATOM   3062 C  CB    . ILE A 1 368 ? 18.640  -2.659  -41.405 1.00 23.02  ? 368  ILE A CB    1 
ATOM   3063 C  CG1   . ILE A 1 368 ? 18.453  -3.988  -40.651 1.00 22.84  ? 368  ILE A CG1   1 
ATOM   3064 C  CG2   . ILE A 1 368 ? 18.935  -2.911  -42.896 1.00 21.37  ? 368  ILE A CG2   1 
ATOM   3065 C  CD1   . ILE A 1 368 ? 17.149  -4.733  -40.954 1.00 22.71  ? 368  ILE A CD1   1 
ATOM   3066 N  N     . ILE A 1 369 ? 19.246  0.369   -41.672 1.00 24.03  ? 369  ILE A N     1 
ATOM   3067 C  CA    . ILE A 1 369 ? 19.451  1.553   -42.501 1.00 22.89  ? 369  ILE A CA    1 
ATOM   3068 C  C     . ILE A 1 369 ? 20.686  2.354   -42.047 1.00 23.83  ? 369  ILE A C     1 
ATOM   3069 O  O     . ILE A 1 369 ? 21.476  2.813   -42.879 1.00 20.67  ? 369  ILE A O     1 
ATOM   3070 C  CB    . ILE A 1 369 ? 18.154  2.411   -42.590 1.00 21.84  ? 369  ILE A CB    1 
ATOM   3071 C  CG1   . ILE A 1 369 ? 17.066  1.614   -43.320 1.00 21.41  ? 369  ILE A CG1   1 
ATOM   3072 C  CG2   . ILE A 1 369 ? 18.413  3.738   -43.317 1.00 18.09  ? 369  ILE A CG2   1 
ATOM   3073 C  CD1   . ILE A 1 369 ? 15.645  2.105   -43.106 1.00 23.74  ? 369  ILE A CD1   1 
ATOM   3074 N  N     . PHE A 1 370 ? 20.874  2.471   -40.733 1.00 25.10  ? 370  PHE A N     1 
ATOM   3075 C  CA    . PHE A 1 370 ? 22.050  3.157   -40.191 1.00 23.64  ? 370  PHE A CA    1 
ATOM   3076 C  C     . PHE A 1 370 ? 23.358  2.481   -40.589 1.00 23.82  ? 370  PHE A C     1 
ATOM   3077 O  O     . PHE A 1 370 ? 24.282  3.168   -41.024 1.00 26.47  ? 370  PHE A O     1 
ATOM   3078 C  CB    . PHE A 1 370 ? 21.959  3.332   -38.668 1.00 23.14  ? 370  PHE A CB    1 
ATOM   3079 C  CG    . PHE A 1 370 ? 23.298  3.574   -37.994 1.00 20.98  ? 370  PHE A CG    1 
ATOM   3080 C  CD1   . PHE A 1 370 ? 23.811  2.642   -37.099 1.00 26.06  ? 370  PHE A CD1   1 
ATOM   3081 C  CD2   . PHE A 1 370 ? 24.031  4.727   -38.251 1.00 21.65  ? 370  PHE A CD2   1 
ATOM   3082 C  CE1   . PHE A 1 370 ? 25.040  2.848   -36.474 1.00 29.24  ? 370  PHE A CE1   1 
ATOM   3083 C  CE2   . PHE A 1 370 ? 25.260  4.947   -37.634 1.00 27.44  ? 370  PHE A CE2   1 
ATOM   3084 C  CZ    . PHE A 1 370 ? 25.769  4.006   -36.742 1.00 27.51  ? 370  PHE A CZ    1 
ATOM   3085 N  N     . ASN A 1 371 ? 23.442  1.156   -40.440 1.00 22.87  ? 371  ASN A N     1 
ATOM   3086 C  CA    . ASN A 1 371 ? 24.648  0.407   -40.859 1.00 24.66  ? 371  ASN A CA    1 
ATOM   3087 C  C     . ASN A 1 371 ? 24.930  0.488   -42.363 1.00 25.66  ? 371  ASN A C     1 
ATOM   3088 O  O     . ASN A 1 371 ? 26.089  0.596   -42.779 1.00 26.14  ? 371  ASN A O     1 
ATOM   3089 C  CB    . ASN A 1 371 ? 24.602  -1.055  -40.397 1.00 22.34  ? 371  ASN A CB    1 
ATOM   3090 C  CG    . ASN A 1 371 ? 24.985  -1.211  -38.930 1.00 27.25  ? 371  ASN A CG    1 
ATOM   3091 O  OD1   . ASN A 1 371 ? 26.164  -1.280  -38.596 1.00 29.83  ? 371  ASN A OD1   1 
ATOM   3092 N  ND2   . ASN A 1 371 ? 23.989  -1.264  -38.051 1.00 24.51  ? 371  ASN A ND2   1 
ATOM   3093 N  N     . SER A 1 372 ? 23.871  0.448   -43.167 1.00 24.77  ? 372  SER A N     1 
ATOM   3094 C  CA    . SER A 1 372 ? 23.994  0.578   -44.613 1.00 25.81  ? 372  SER A CA    1 
ATOM   3095 C  C     . SER A 1 372 ? 24.521  1.963   -44.987 1.00 27.96  ? 372  SER A C     1 
ATOM   3096 O  O     . SER A 1 372 ? 25.426  2.087   -45.811 1.00 28.19  ? 372  SER A O     1 
ATOM   3097 C  CB    . SER A 1 372 ? 22.639  0.331   -45.281 1.00 27.42  ? 372  SER A CB    1 
ATOM   3098 O  OG    . SER A 1 372 ? 22.737  0.391   -46.697 1.00 27.56  ? 372  SER A OG    1 
ATOM   3099 N  N     . LEU A 1 373 ? 23.963  3.002   -44.365 1.00 29.38  ? 373  LEU A N     1 
ATOM   3100 C  CA    . LEU A 1 373 ? 24.370  4.382   -44.650 1.00 29.46  ? 373  LEU A CA    1 
ATOM   3101 C  C     . LEU A 1 373 ? 25.782  4.694   -44.141 1.00 30.32  ? 373  LEU A C     1 
ATOM   3102 O  O     . LEU A 1 373 ? 26.559  5.357   -44.832 1.00 29.35  ? 373  LEU A O     1 
ATOM   3103 C  CB    . LEU A 1 373 ? 23.350  5.377   -44.081 1.00 27.45  ? 373  LEU A CB    1 
ATOM   3104 C  CG    . LEU A 1 373 ? 22.010  5.465   -44.816 1.00 27.93  ? 373  LEU A CG    1 
ATOM   3105 C  CD1   . LEU A 1 373 ? 21.045  6.374   -44.080 1.00 26.90  ? 373  LEU A CD1   1 
ATOM   3106 C  CD2   . LEU A 1 373 ? 22.175  5.925   -46.276 1.00 25.58  ? 373  LEU A CD2   1 
ATOM   3107 N  N     . LYS A 1 374 ? 26.105  4.205   -42.943 1.00 31.32  ? 374  LYS A N     1 
ATOM   3108 C  CA    . LYS A 1 374 ? 27.440  4.363   -42.351 1.00 32.37  ? 374  LYS A CA    1 
ATOM   3109 C  C     . LYS A 1 374 ? 28.558  3.812   -43.243 1.00 33.58  ? 374  LYS A C     1 
ATOM   3110 O  O     . LYS A 1 374 ? 29.642  4.408   -43.334 1.00 33.41  ? 374  LYS A O     1 
ATOM   3111 C  CB    . LYS A 1 374 ? 27.500  3.713   -40.966 1.00 32.01  ? 374  LYS A CB    1 
ATOM   3112 C  CG    . LYS A 1 374 ? 28.815  3.950   -40.227 1.00 32.48  ? 374  LYS A CG    1 
ATOM   3113 C  CD    . LYS A 1 374 ? 28.717  3.545   -38.768 1.00 32.05  ? 374  LYS A CD    1 
ATOM   3114 C  CE    . LYS A 1 374 ? 30.047  3.023   -38.267 1.00 32.69  ? 374  LYS A CE    1 
ATOM   3115 N  NZ    . LYS A 1 374 ? 30.280  1.635   -38.748 1.00 36.69  ? 374  LYS A NZ    1 
ATOM   3116 N  N     . GLU A 1 375 ? 28.285  2.687   -43.899 1.00 33.27  ? 375  GLU A N     1 
ATOM   3117 C  CA    . GLU A 1 375 ? 29.217  2.074   -44.851 1.00 37.39  ? 375  GLU A CA    1 
ATOM   3118 C  C     . GLU A 1 375 ? 29.680  3.039   -45.947 1.00 35.36  ? 375  GLU A C     1 
ATOM   3119 O  O     . GLU A 1 375 ? 30.801  2.927   -46.444 1.00 37.19  ? 375  GLU A O     1 
ATOM   3120 C  CB    . GLU A 1 375 ? 28.594  0.823   -45.485 1.00 39.56  ? 375  GLU A CB    1 
ATOM   3121 C  CG    . GLU A 1 375 ? 29.046  -0.499  -44.857 1.00 50.32  ? 375  GLU A CG    1 
ATOM   3122 C  CD    . GLU A 1 375 ? 30.315  -1.083  -45.506 1.00 58.86  ? 375  GLU A CD    1 
ATOM   3123 O  OE1   . GLU A 1 375 ? 30.686  -0.667  -46.633 1.00 60.76  ? 375  GLU A OE1   1 
ATOM   3124 O  OE2   . GLU A 1 375 ? 30.939  -1.974  -44.887 1.00 61.12  ? 375  GLU A OE2   1 
ATOM   3125 N  N     . GLN A 1 376 ? 28.821  3.986   -46.308 1.00 32.33  ? 376  GLN A N     1 
ATOM   3126 C  CA    . GLN A 1 376 ? 29.134  4.954   -47.354 1.00 33.70  ? 376  GLN A CA    1 
ATOM   3127 C  C     . GLN A 1 376 ? 29.521  6.317   -46.773 1.00 32.82  ? 376  GLN A C     1 
ATOM   3128 O  O     . GLN A 1 376 ? 29.538  7.316   -47.492 1.00 32.82  ? 376  GLN A O     1 
ATOM   3129 C  CB    . GLN A 1 376 ? 27.941  5.112   -48.304 1.00 35.42  ? 376  GLN A CB    1 
ATOM   3130 C  CG    . GLN A 1 376 ? 27.411  3.808   -48.906 1.00 38.66  ? 376  GLN A CG    1 
ATOM   3131 C  CD    . GLN A 1 376 ? 25.950  3.909   -49.306 1.00 43.14  ? 376  GLN A CD    1 
ATOM   3132 O  OE1   . GLN A 1 376 ? 25.090  3.235   -48.735 1.00 46.95  ? 376  GLN A OE1   1 
ATOM   3133 N  NE2   . GLN A 1 376 ? 25.658  4.766   -50.283 1.00 47.30  ? 376  GLN A NE2   1 
ATOM   3134 N  N     . ASN A 1 377 ? 29.831  6.344   -45.475 1.00 32.80  ? 377  ASN A N     1 
ATOM   3135 C  CA    . ASN A 1 377 ? 30.089  7.589   -44.728 1.00 32.31  ? 377  ASN A CA    1 
ATOM   3136 C  C     . ASN A 1 377 ? 28.911  8.574   -44.791 1.00 31.53  ? 377  ASN A C     1 
ATOM   3137 O  O     . ASN A 1 377 ? 29.084  9.798   -44.806 1.00 31.44  ? 377  ASN A O     1 
ATOM   3138 C  CB    . ASN A 1 377 ? 31.413  8.249   -45.165 1.00 33.26  ? 377  ASN A CB    1 
ATOM   3139 C  CG    . ASN A 1 377 ? 32.632  7.357   -44.923 1.00 35.25  ? 377  ASN A CG    1 
ATOM   3140 O  OD1   . ASN A 1 377 ? 32.740  6.677   -43.900 1.00 32.78  ? 377  ASN A OD1   1 
ATOM   3141 N  ND2   . ASN A 1 377 ? 33.563  7.370   -45.870 1.00 34.53  ? 377  ASN A ND2   1 
ATOM   3142 N  N     . LYS A 1 378 ? 27.702  8.029   -44.830 1.00 30.95  ? 378  LYS A N     1 
ATOM   3143 C  CA    . LYS A 1 378 ? 26.514  8.860   -44.786 1.00 30.80  ? 378  LYS A CA    1 
ATOM   3144 C  C     . LYS A 1 378 ? 25.983  8.957   -43.365 1.00 30.70  ? 378  LYS A C     1 
ATOM   3145 O  O     . LYS A 1 378 ? 26.197  8.061   -42.551 1.00 30.77  ? 378  LYS A O     1 
ATOM   3146 C  CB    . LYS A 1 378 ? 25.454  8.360   -45.764 1.00 32.87  ? 378  LYS A CB    1 
ATOM   3147 C  CG    . LYS A 1 378 ? 25.819  8.630   -47.217 1.00 32.82  ? 378  LYS A CG    1 
ATOM   3148 C  CD    . LYS A 1 378 ? 24.719  8.170   -48.168 1.00 37.74  ? 378  LYS A CD    1 
ATOM   3149 C  CE    . LYS A 1 378 ? 25.156  8.322   -49.627 1.00 40.27  ? 378  LYS A CE    1 
ATOM   3150 N  NZ    . LYS A 1 378 ? 24.011  8.121   -50.563 1.00 45.96  ? 378  LYS A NZ    1 
ATOM   3151 N  N     . VAL A 1 379 ? 25.304  10.064  -43.079 1.00 29.70  ? 379  VAL A N     1 
ATOM   3152 C  CA    . VAL A 1 379 ? 24.883  10.404  -41.727 1.00 28.32  ? 379  VAL A CA    1 
ATOM   3153 C  C     . VAL A 1 379 ? 23.354  10.436  -41.636 1.00 27.99  ? 379  VAL A C     1 
ATOM   3154 O  O     . VAL A 1 379 ? 22.695  11.113  -42.431 1.00 29.41  ? 379  VAL A O     1 
ATOM   3155 C  CB    . VAL A 1 379 ? 25.477  11.773  -41.316 1.00 29.44  ? 379  VAL A CB    1 
ATOM   3156 C  CG1   . VAL A 1 379 ? 24.974  12.198  -39.959 1.00 28.33  ? 379  VAL A CG1   1 
ATOM   3157 C  CG2   . VAL A 1 379 ? 27.008  11.719  -41.337 1.00 28.85  ? 379  VAL A CG2   1 
ATOM   3158 N  N     . ILE A 1 380 ? 22.796  9.717   -40.664 1.00 25.63  ? 380  ILE A N     1 
ATOM   3159 C  CA    . ILE A 1 380 ? 21.342  9.623   -40.516 1.00 24.19  ? 380  ILE A CA    1 
ATOM   3160 C  C     . ILE A 1 380 ? 20.752  10.909  -39.943 1.00 24.93  ? 380  ILE A C     1 
ATOM   3161 O  O     . ILE A 1 380 ? 21.416  11.593  -39.159 1.00 22.31  ? 380  ILE A O     1 
ATOM   3162 C  CB    . ILE A 1 380 ? 20.905  8.379   -39.664 1.00 24.75  ? 380  ILE A CB    1 
ATOM   3163 C  CG1   . ILE A 1 380 ? 21.309  8.524   -38.192 1.00 20.52  ? 380  ILE A CG1   1 
ATOM   3164 C  CG2   . ILE A 1 380 ? 21.458  7.081   -40.277 1.00 25.75  ? 380  ILE A CG2   1 
ATOM   3165 C  CD1   . ILE A 1 380 ? 21.024  7.274   -37.350 1.00 23.11  ? 380  ILE A CD1   1 
ATOM   3166 N  N     . PRO A 1 381 ? 19.504  11.245  -40.336 1.00 25.66  ? 381  PRO A N     1 
ATOM   3167 C  CA    . PRO A 1 381 ? 18.858  12.455  -39.808 1.00 26.61  ? 381  PRO A CA    1 
ATOM   3168 C  C     . PRO A 1 381 ? 18.395  12.233  -38.379 1.00 27.24  ? 381  PRO A C     1 
ATOM   3169 O  O     . PRO A 1 381 ? 18.238  11.085  -37.962 1.00 29.90  ? 381  PRO A O     1 
ATOM   3170 C  CB    . PRO A 1 381 ? 17.644  12.645  -40.732 1.00 25.88  ? 381  PRO A CB    1 
ATOM   3171 C  CG    . PRO A 1 381 ? 17.311  11.260  -41.209 1.00 27.64  ? 381  PRO A CG    1 
ATOM   3172 C  CD    . PRO A 1 381 ? 18.617  10.486  -41.242 1.00 24.41  ? 381  PRO A CD    1 
ATOM   3173 N  N     . GLN A 1 382 ? 18.169  13.315  -37.645 1.00 26.55  ? 382  GLN A N     1 
ATOM   3174 C  CA    . GLN A 1 382 ? 17.649  13.218  -36.293 1.00 30.26  ? 382  GLN A CA    1 
ATOM   3175 C  C     . GLN A 1 382 ? 16.183  12.821  -36.301 1.00 31.81  ? 382  GLN A C     1 
ATOM   3176 O  O     . GLN A 1 382 ? 15.418  13.266  -37.155 1.00 33.54  ? 382  GLN A O     1 
ATOM   3177 C  CB    . GLN A 1 382 ? 17.815  14.546  -35.548 1.00 30.97  ? 382  GLN A CB    1 
ATOM   3178 C  CG    . GLN A 1 382 ? 17.424  14.483  -34.068 1.00 31.16  ? 382  GLN A CG    1 
ATOM   3179 C  CD    . GLN A 1 382 ? 17.679  15.784  -33.314 1.00 34.62  ? 382  GLN A CD    1 
ATOM   3180 O  OE1   . GLN A 1 382 ? 17.555  16.883  -33.869 1.00 32.59  ? 382  GLN A OE1   1 
ATOM   3181 N  NE2   . GLN A 1 382 ? 18.032  15.660  -32.032 1.00 36.59  ? 382  GLN A NE2   1 
ATOM   3182 N  N     . GLY A 1 383 ? 15.802  11.985  -35.338 1.00 34.02  ? 383  GLY A N     1 
ATOM   3183 C  CA    . GLY A 1 383 ? 14.393  11.704  -35.072 1.00 34.51  ? 383  GLY A CA    1 
ATOM   3184 C  C     . GLY A 1 383 ? 13.625  12.973  -34.734 1.00 36.57  ? 383  GLY A C     1 
ATOM   3185 O  O     . GLY A 1 383 ? 14.086  13.802  -33.945 1.00 35.99  ? 383  GLY A O     1 
ATOM   3186 N  N     . ARG A 1 384 ? 12.461  13.130  -35.357 1.00 37.57  ? 384  ARG A N     1 
ATOM   3187 C  CA    . ARG A 1 384 ? 11.583  14.264  -35.098 1.00 40.81  ? 384  ARG A CA    1 
ATOM   3188 C  C     . ARG A 1 384 ? 10.252  13.838  -34.469 1.00 40.70  ? 384  ARG A C     1 
ATOM   3189 O  O     . ARG A 1 384 ? 9.900   12.648  -34.454 1.00 38.34  ? 384  ARG A O     1 
ATOM   3190 C  CB    . ARG A 1 384 ? 11.336  15.053  -36.384 1.00 41.91  ? 384  ARG A CB    1 
ATOM   3191 C  CG    . ARG A 1 384 ? 12.504  15.910  -36.800 1.00 48.49  ? 384  ARG A CG    1 
ATOM   3192 C  CD    . ARG A 1 384 ? 12.345  16.435  -38.221 1.00 56.89  ? 384  ARG A CD    1 
ATOM   3193 N  NE    . ARG A 1 384 ? 13.170  17.627  -38.452 1.00 65.67  ? 384  ARG A NE    1 
ATOM   3194 C  CZ    . ARG A 1 384 ? 14.480  17.615  -38.710 1.00 67.84  ? 384  ARG A CZ    1 
ATOM   3195 N  NH1   . ARG A 1 384 ? 15.153  16.466  -38.777 1.00 67.94  ? 384  ARG A NH1   1 
ATOM   3196 N  NH2   . ARG A 1 384 ? 15.123  18.762  -38.902 1.00 68.80  ? 384  ARG A NH2   1 
ATOM   3197 N  N     . SER A 1 385 ? 9.534   14.830  -33.947 1.00 39.62  ? 385  SER A N     1 
ATOM   3198 C  CA    . SER A 1 385 ? 8.222   14.646  -33.350 1.00 41.47  ? 385  SER A CA    1 
ATOM   3199 C  C     . SER A 1 385 ? 7.136   14.864  -34.402 1.00 40.00  ? 385  SER A C     1 
ATOM   3200 O  O     . SER A 1 385 ? 7.138   15.883  -35.107 1.00 38.54  ? 385  SER A O     1 
ATOM   3201 C  CB    . SER A 1 385 ? 8.040   15.634  -32.187 1.00 43.16  ? 385  SER A CB    1 
ATOM   3202 O  OG    . SER A 1 385 ? 6.871   15.350  -31.441 1.00 46.65  ? 385  SER A OG    1 
ATOM   3203 N  N     . HIS A 1 386 ? 6.213   13.909  -34.507 1.00 39.30  ? 386  HIS A N     1 
ATOM   3204 C  CA    . HIS A 1 386 ? 5.098   14.025  -35.460 1.00 39.06  ? 386  HIS A CA    1 
ATOM   3205 C  C     . HIS A 1 386 ? 3.760   13.674  -34.817 1.00 39.66  ? 386  HIS A C     1 
ATOM   3206 O  O     . HIS A 1 386 ? 3.676   12.699  -34.059 1.00 39.81  ? 386  HIS A O     1 
ATOM   3207 C  CB    . HIS A 1 386 ? 5.303   13.115  -36.676 1.00 38.03  ? 386  HIS A CB    1 
ATOM   3208 C  CG    . HIS A 1 386 ? 6.668   13.195  -37.284 1.00 37.76  ? 386  HIS A CG    1 
ATOM   3209 N  ND1   . HIS A 1 386 ? 7.048   14.213  -38.132 1.00 39.63  ? 386  HIS A ND1   1 
ATOM   3210 C  CD2   . HIS A 1 386 ? 7.735   12.368  -37.185 1.00 35.70  ? 386  HIS A CD2   1 
ATOM   3211 C  CE1   . HIS A 1 386 ? 8.295   14.015  -38.521 1.00 39.68  ? 386  HIS A CE1   1 
ATOM   3212 N  NE2   . HIS A 1 386 ? 8.736   12.903  -37.958 1.00 37.87  ? 386  HIS A NE2   1 
ATOM   3213 N  N     . PRO A 1 387 ? 2.703   14.451  -35.134 1.00 39.90  ? 387  PRO A N     1 
ATOM   3214 C  CA    . PRO A 1 387 ? 1.359   14.062  -34.710 1.00 40.02  ? 387  PRO A CA    1 
ATOM   3215 C  C     . PRO A 1 387 ? 0.841   12.895  -35.549 1.00 39.58  ? 387  PRO A C     1 
ATOM   3216 O  O     . PRO A 1 387 ? 1.065   12.861  -36.763 1.00 38.43  ? 387  PRO A O     1 
ATOM   3217 C  CB    . PRO A 1 387 ? 0.528   15.322  -34.980 1.00 38.65  ? 387  PRO A CB    1 
ATOM   3218 C  CG    . PRO A 1 387 ? 1.231   15.993  -36.107 1.00 39.42  ? 387  PRO A CG    1 
ATOM   3219 C  CD    . PRO A 1 387 ? 2.696   15.730  -35.876 1.00 39.90  ? 387  PRO A CD    1 
ATOM   3220 N  N     . VAL A 1 388 ? 0.170   11.948  -34.897 1.00 39.71  ? 388  VAL A N     1 
ATOM   3221 C  CA    . VAL A 1 388 ? -0.467  10.834  -35.587 1.00 41.18  ? 388  VAL A CA    1 
ATOM   3222 C  C     . VAL A 1 388 ? -1.558  11.362  -36.519 1.00 42.89  ? 388  VAL A C     1 
ATOM   3223 O  O     . VAL A 1 388 ? -2.400  12.161  -36.107 1.00 43.56  ? 388  VAL A O     1 
ATOM   3224 C  CB    . VAL A 1 388 ? -1.040  9.799   -34.587 1.00 42.02  ? 388  VAL A CB    1 
ATOM   3225 C  CG1   . VAL A 1 388 ? -1.742  8.650   -35.314 1.00 44.13  ? 388  VAL A CG1   1 
ATOM   3226 C  CG2   . VAL A 1 388 ? 0.073   9.245   -33.696 1.00 40.92  ? 388  VAL A CG2   1 
ATOM   3227 N  N     . GLN A 1 389 ? -1.502  10.935  -37.779 1.00 42.59  ? 389  GLN A N     1 
ATOM   3228 C  CA    . GLN A 1 389 ? -2.483  11.303  -38.806 1.00 43.13  ? 389  GLN A CA    1 
ATOM   3229 C  C     . GLN A 1 389 ? -2.928  10.069  -39.602 1.00 41.31  ? 389  GLN A C     1 
ATOM   3230 O  O     . GLN A 1 389 ? -2.099  9.222   -39.939 1.00 39.36  ? 389  GLN A O     1 
ATOM   3231 C  CB    . GLN A 1 389 ? -1.893  12.328  -39.778 1.00 43.32  ? 389  GLN A CB    1 
ATOM   3232 C  CG    . GLN A 1 389 ? -1.747  13.742  -39.237 1.00 50.91  ? 389  GLN A CG    1 
ATOM   3233 C  CD    . GLN A 1 389 ? -1.494  14.759  -40.346 1.00 55.85  ? 389  GLN A CD    1 
ATOM   3234 O  OE1   . GLN A 1 389 ? -0.579  14.602  -41.160 1.00 58.63  ? 389  GLN A OE1   1 
ATOM   3235 N  NE2   . GLN A 1 389 ? -2.310  15.809  -40.382 1.00 57.95  ? 389  GLN A NE2   1 
ATOM   3236 N  N     . PRO A 1 390 ? -4.231  9.971   -39.924 1.00 35.73  ? 390  PRO A N     1 
ATOM   3237 C  CA    . PRO A 1 390 ? -4.704  8.848   -40.743 1.00 34.49  ? 390  PRO A CA    1 
ATOM   3238 C  C     . PRO A 1 390 ? -4.268  8.998   -42.205 1.00 33.10  ? 390  PRO A C     1 
ATOM   3239 O  O     . PRO A 1 390 ? -4.020  10.116  -42.665 1.00 33.70  ? 390  PRO A O     1 
ATOM   3240 C  CB    . PRO A 1 390 ? -6.235  8.948   -40.637 1.00 36.56  ? 390  PRO A CB    1 
ATOM   3241 C  CG    . PRO A 1 390 ? -6.515  9.979   -39.550 1.00 38.80  ? 390  PRO A CG    1 
ATOM   3242 C  CD    . PRO A 1 390 ? -5.331  10.893  -39.582 1.00 37.93  ? 390  PRO A CD    1 
ATOM   3243 N  N     . TYR A 1 391 ? -4.160  7.879   -42.915 1.00 29.96  ? 391  TYR A N     1 
ATOM   3244 C  CA    . TYR A 1 391 ? -3.839  7.888   -44.346 1.00 29.17  ? 391  TYR A CA    1 
ATOM   3245 C  C     . TYR A 1 391 ? -4.487  6.665   -45.019 1.00 29.37  ? 391  TYR A C     1 
ATOM   3246 O  O     . TYR A 1 391 ? -4.789  5.685   -44.329 1.00 27.63  ? 391  TYR A O     1 
ATOM   3247 C  CB    . TYR A 1 391 ? -2.316  7.951   -44.580 1.00 28.31  ? 391  TYR A CB    1 
ATOM   3248 C  CG    . TYR A 1 391 ? -1.547  6.676   -44.268 1.00 26.72  ? 391  TYR A CG    1 
ATOM   3249 C  CD1   . TYR A 1 391 ? -1.105  6.403   -42.977 1.00 29.19  ? 391  TYR A CD1   1 
ATOM   3250 C  CD2   . TYR A 1 391 ? -1.249  5.756   -45.273 1.00 25.69  ? 391  TYR A CD2   1 
ATOM   3251 C  CE1   . TYR A 1 391 ? -0.394  5.239   -42.690 1.00 28.51  ? 391  TYR A CE1   1 
ATOM   3252 C  CE2   . TYR A 1 391 ? -0.542  4.594   -44.997 1.00 25.28  ? 391  TYR A CE2   1 
ATOM   3253 C  CZ    . TYR A 1 391 ? -0.118  4.342   -43.704 1.00 26.93  ? 391  TYR A CZ    1 
ATOM   3254 O  OH    . TYR A 1 391 ? 0.576   3.184   -43.425 1.00 28.00  ? 391  TYR A OH    1 
ATOM   3255 N  N     . PRO A 1 392 ? -4.714  6.720   -46.354 1.00 27.29  ? 392  PRO A N     1 
ATOM   3256 C  CA    . PRO A 1 392 ? -5.470  5.656   -47.038 1.00 26.38  ? 392  PRO A CA    1 
ATOM   3257 C  C     . PRO A 1 392 ? -4.669  4.398   -47.361 1.00 24.70  ? 392  PRO A C     1 
ATOM   3258 O  O     . PRO A 1 392 ? -3.460  4.470   -47.587 1.00 23.77  ? 392  PRO A O     1 
ATOM   3259 C  CB    . PRO A 1 392 ? -5.933  6.330   -48.332 1.00 26.13  ? 392  PRO A CB    1 
ATOM   3260 C  CG    . PRO A 1 392 ? -4.904  7.361   -48.606 1.00 27.06  ? 392  PRO A CG    1 
ATOM   3261 C  CD    . PRO A 1 392 ? -4.366  7.821   -47.272 1.00 27.74  ? 392  PRO A CD    1 
ATOM   3262 N  N     . GLY A 1 393 ? -5.368  3.264   -47.401 1.00 24.53  ? 393  GLY A N     1 
ATOM   3263 C  CA    . GLY A 1 393 ? -4.757  1.961   -47.625 1.00 23.56  ? 393  GLY A CA    1 
ATOM   3264 C  C     . GLY A 1 393 ? -5.151  1.327   -48.948 1.00 25.73  ? 393  GLY A C     1 
ATOM   3265 O  O     . GLY A 1 393 ? -5.188  1.989   -49.988 1.00 24.90  ? 393  GLY A O     1 
ATOM   3266 N  N     . ALA A 1 394 ? -5.455  0.036   -48.900 1.00 23.47  ? 394  ALA A N     1 
ATOM   3267 C  CA    . ALA A 1 394 ? -5.696  -0.752  -50.101 1.00 24.93  ? 394  ALA A CA    1 
ATOM   3268 C  C     . ALA A 1 394 ? -7.123  -0.632  -50.663 1.00 25.85  ? 394  ALA A C     1 
ATOM   3269 O  O     . ALA A 1 394 ? -8.048  -0.188  -49.973 1.00 26.15  ? 394  ALA A O     1 
ATOM   3270 C  CB    . ALA A 1 394 ? -5.367  -2.206  -49.824 1.00 22.33  ? 394  ALA A CB    1 
ATOM   3271 N  N     . PHE A 1 395 ? -7.283  -1.044  -51.918 1.00 23.71  ? 395  PHE A N     1 
ATOM   3272 C  CA    . PHE A 1 395 ? -8.595  -1.171  -52.523 1.00 25.21  ? 395  PHE A CA    1 
ATOM   3273 C  C     . PHE A 1 395 ? -9.131  -2.572  -52.281 1.00 26.28  ? 395  PHE A C     1 
ATOM   3274 O  O     . PHE A 1 395 ? -8.403  -3.559  -52.419 1.00 26.46  ? 395  PHE A O     1 
ATOM   3275 C  CB    . PHE A 1 395 ? -8.545  -0.872  -54.025 1.00 23.74  ? 395  PHE A CB    1 
ATOM   3276 C  CG    . PHE A 1 395 ? -9.862  -1.078  -54.735 1.00 27.56  ? 395  PHE A CG    1 
ATOM   3277 C  CD1   . PHE A 1 395 ? -10.861 -0.107  -54.674 1.00 27.95  ? 395  PHE A CD1   1 
ATOM   3278 C  CD2   . PHE A 1 395 ? -10.094 -2.234  -55.480 1.00 27.72  ? 395  PHE A CD2   1 
ATOM   3279 C  CE1   . PHE A 1 395 ? -12.078 -0.292  -55.329 1.00 31.75  ? 395  PHE A CE1   1 
ATOM   3280 C  CE2   . PHE A 1 395 ? -11.310 -2.431  -56.138 1.00 29.80  ? 395  PHE A CE2   1 
ATOM   3281 C  CZ    . PHE A 1 395 ? -12.303 -1.462  -56.062 1.00 32.30  ? 395  PHE A CZ    1 
ATOM   3282 N  N     . VAL A 1 396 ? -10.402 -2.638  -51.891 1.00 27.56  ? 396  VAL A N     1 
ATOM   3283 C  CA    . VAL A 1 396 ? -11.149 -3.893  -51.799 1.00 28.20  ? 396  VAL A CA    1 
ATOM   3284 C  C     . VAL A 1 396 ? -12.411 -3.767  -52.665 1.00 28.71  ? 396  VAL A C     1 
ATOM   3285 O  O     . VAL A 1 396 ? -13.192 -2.812  -52.524 1.00 28.89  ? 396  VAL A O     1 
ATOM   3286 C  CB    . VAL A 1 396 ? -11.500 -4.258  -50.329 1.00 27.71  ? 396  VAL A CB    1 
ATOM   3287 C  CG1   . VAL A 1 396 ? -12.108 -5.651  -50.247 1.00 25.28  ? 396  VAL A CG1   1 
ATOM   3288 C  CG2   . VAL A 1 396 ? -10.250 -4.187  -49.446 1.00 26.64  ? 396  VAL A CG2   1 
ATOM   3289 N  N     . LYS A 1 397 ? -12.571 -4.711  -53.592 1.00 29.64  ? 397  LYS A N     1 
ATOM   3290 C  CA    . LYS A 1 397 ? -13.704 -4.731  -54.519 1.00 28.88  ? 397  LYS A CA    1 
ATOM   3291 C  C     . LYS A 1 397 ? -14.917 -5.359  -53.839 1.00 29.13  ? 397  LYS A C     1 
ATOM   3292 O  O     . LYS A 1 397 ? -14.784 -6.376  -53.158 1.00 29.84  ? 397  LYS A O     1 
ATOM   3293 C  CB    . LYS A 1 397 ? -13.345 -5.525  -55.782 1.00 28.74  ? 397  LYS A CB    1 
ATOM   3294 C  CG    . LYS A 1 397 ? -14.455 -5.567  -56.845 1.00 32.50  ? 397  LYS A CG    1 
ATOM   3295 C  CD    . LYS A 1 397 ? -14.098 -6.463  -58.025 1.00 30.82  ? 397  LYS A CD    1 
ATOM   3296 C  CE    . LYS A 1 397 ? -15.297 -6.695  -58.953 1.00 31.57  ? 397  LYS A CE    1 
ATOM   3297 N  NZ    . LYS A 1 397 ? -15.659 -5.479  -59.733 1.00 30.77  ? 397  LYS A NZ    1 
ATOM   3298 N  N     . GLU A 1 398 ? -16.087 -4.747  -54.025 1.00 29.63  ? 398  GLU A N     1 
ATOM   3299 C  CA    . GLU A 1 398 ? -17.356 -5.295  -53.537 1.00 31.08  ? 398  GLU A CA    1 
ATOM   3300 C  C     . GLU A 1 398 ? -17.806 -6.488  -54.400 1.00 29.71  ? 398  GLU A C     1 
ATOM   3301 O  O     . GLU A 1 398 ? -18.207 -6.306  -55.550 1.00 32.15  ? 398  GLU A O     1 
ATOM   3302 C  CB    . GLU A 1 398 ? -18.440 -4.196  -53.513 1.00 31.79  ? 398  GLU A CB    1 
ATOM   3303 C  CG    . GLU A 1 398 ? -19.738 -4.581  -52.776 1.00 34.27  ? 398  GLU A CG    1 
ATOM   3304 C  CD    . GLU A 1 398 ? -19.581 -4.620  -51.251 1.00 36.68  ? 398  GLU A CD    1 
ATOM   3305 O  OE1   . GLU A 1 398 ? -19.360 -3.551  -50.636 1.00 35.94  ? 398  GLU A OE1   1 
ATOM   3306 O  OE2   . GLU A 1 398 ? -19.683 -5.721  -50.666 1.00 35.14  ? 398  GLU A OE2   1 
ATOM   3307 N  N     . PRO A 1 399 ? -17.743 -7.717  -53.851 1.00 28.25  ? 399  PRO A N     1 
ATOM   3308 C  CA    . PRO A 1 399 ? -18.191 -8.853  -54.665 1.00 26.93  ? 399  PRO A CA    1 
ATOM   3309 C  C     . PRO A 1 399 ? -19.719 -8.961  -54.723 1.00 28.59  ? 399  PRO A C     1 
ATOM   3310 O  O     . PRO A 1 399 ? -20.413 -8.490  -53.817 1.00 28.37  ? 399  PRO A O     1 
ATOM   3311 C  CB    . PRO A 1 399 ? -17.616 -10.055 -53.918 1.00 25.33  ? 399  PRO A CB    1 
ATOM   3312 C  CG    . PRO A 1 399 ? -17.639 -9.620  -52.480 1.00 25.76  ? 399  PRO A CG    1 
ATOM   3313 C  CD    . PRO A 1 399 ? -17.372 -8.129  -52.482 1.00 24.60  ? 399  PRO A CD    1 
ATOM   3314 N  N     . ILE A 1 400 ? -20.233 -9.575  -55.786 1.00 29.11  ? 400  ILE A N     1 
ATOM   3315 C  CA    . ILE A 1 400 ? -21.647 -9.931  -55.860 1.00 29.87  ? 400  ILE A CA    1 
ATOM   3316 C  C     . ILE A 1 400 ? -21.847 -11.233 -55.075 1.00 29.27  ? 400  ILE A C     1 
ATOM   3317 O  O     . ILE A 1 400 ? -21.312 -12.276 -55.459 1.00 28.56  ? 400  ILE A O     1 
ATOM   3318 C  CB    . ILE A 1 400 ? -22.125 -10.091 -57.326 1.00 30.76  ? 400  ILE A CB    1 
ATOM   3319 C  CG1   . ILE A 1 400 ? -21.952 -8.770  -58.089 1.00 33.64  ? 400  ILE A CG1   1 
ATOM   3320 C  CG2   . ILE A 1 400 ? -23.585 -10.583 -57.379 1.00 30.51  ? 400  ILE A CG2   1 
ATOM   3321 C  CD1   . ILE A 1 400 ? -22.012 -8.912  -59.615 1.00 37.58  ? 400  ILE A CD1   1 
ATOM   3322 N  N     . PRO A 1 401 ? -22.605 -11.178 -53.962 1.00 29.57  ? 401  PRO A N     1 
ATOM   3323 C  CA    . PRO A 1 401 ? -22.756 -12.402 -53.167 1.00 28.90  ? 401  PRO A CA    1 
ATOM   3324 C  C     . PRO A 1 401 ? -23.385 -13.480 -54.027 1.00 27.98  ? 401  PRO A C     1 
ATOM   3325 O  O     . PRO A 1 401 ? -24.418 -13.245 -54.649 1.00 30.74  ? 401  PRO A O     1 
ATOM   3326 C  CB    . PRO A 1 401 ? -23.695 -11.983 -52.030 1.00 26.50  ? 401  PRO A CB    1 
ATOM   3327 C  CG    . PRO A 1 401 ? -23.594 -10.495 -51.969 1.00 31.41  ? 401  PRO A CG    1 
ATOM   3328 C  CD    . PRO A 1 401 ? -23.369 -10.054 -53.391 1.00 30.41  ? 401  PRO A CD    1 
ATOM   3329 N  N     . ASN A 1 402 ? -22.745 -14.641 -54.090 1.00 26.41  ? 402  ASN A N     1 
ATOM   3330 C  CA    . ASN A 1 402 ? -23.168 -15.686 -55.016 1.00 27.48  ? 402  ASN A CA    1 
ATOM   3331 C  C     . ASN A 1 402 ? -22.323 -16.930 -54.815 1.00 26.85  ? 402  ASN A C     1 
ATOM   3332 O  O     . ASN A 1 402 ? -21.285 -16.877 -54.162 1.00 24.79  ? 402  ASN A O     1 
ATOM   3333 C  CB    . ASN A 1 402 ? -23.032 -15.194 -56.469 1.00 27.39  ? 402  ASN A CB    1 
ATOM   3334 C  CG    . ASN A 1 402 ? -24.028 -15.864 -57.435 1.00 33.99  ? 402  ASN A CG    1 
ATOM   3335 O  OD1   . ASN A 1 402 ? -24.654 -16.882 -57.120 1.00 38.39  ? 402  ASN A OD1   1 
ATOM   3336 N  ND2   . ASN A 1 402 ? -24.167 -15.284 -58.621 1.00 30.78  ? 402  ASN A ND2   1 
ATOM   3337 N  N     . ARG A 1 403 ? -22.786 -18.051 -55.359 1.00 27.11  ? 403  ARG A N     1 
ATOM   3338 C  CA    . ARG A 1 403 ? -21.921 -19.194 -55.585 1.00 29.85  ? 403  ARG A CA    1 
ATOM   3339 C  C     . ARG A 1 403 ? -21.072 -18.881 -56.816 1.00 31.38  ? 403  ARG A C     1 
ATOM   3340 O  O     . ARG A 1 403 ? -21.507 -18.137 -57.700 1.00 32.00  ? 403  ARG A O     1 
ATOM   3341 C  CB    . ARG A 1 403 ? -22.740 -20.466 -55.816 1.00 31.45  ? 403  ARG A CB    1 
ATOM   3342 C  CG    . ARG A 1 403 ? -23.602 -20.441 -57.077 1.00 33.66  ? 403  ARG A CG    1 
ATOM   3343 C  CD    . ARG A 1 403 ? -24.368 -21.729 -57.242 1.00 36.76  ? 403  ARG A CD    1 
ATOM   3344 N  NE    . ARG A 1 403 ? -25.464 -21.827 -56.286 1.00 37.68  ? 403  ARG A NE    1 
ATOM   3345 C  CZ    . ARG A 1 403 ? -26.326 -22.838 -56.233 1.00 39.20  ? 403  ARG A CZ    1 
ATOM   3346 N  NH1   . ARG A 1 403 ? -26.219 -23.859 -57.075 1.00 39.64  ? 403  ARG A NH1   1 
ATOM   3347 N  NH2   . ARG A 1 403 ? -27.298 -22.828 -55.334 1.00 38.85  ? 403  ARG A NH2   1 
ATOM   3348 N  N     . TYR A 1 404 ? -19.857 -19.425 -56.848 1.00 31.14  ? 404  TYR A N     1 
ATOM   3349 C  CA    . TYR A 1 404 ? -18.968 -19.319 -58.003 1.00 29.51  ? 404  TYR A CA    1 
ATOM   3350 C  C     . TYR A 1 404 ? -18.315 -20.676 -58.232 1.00 30.75  ? 404  TYR A C     1 
ATOM   3351 O  O     . TYR A 1 404 ? -17.592 -21.180 -57.366 1.00 28.91  ? 404  TYR A O     1 
ATOM   3352 C  CB    . TYR A 1 404 ? -17.913 -18.233 -57.780 1.00 27.49  ? 404  TYR A CB    1 
ATOM   3353 C  CG    . TYR A 1 404 ? -18.485 -16.832 -57.748 1.00 26.87  ? 404  TYR A CG    1 
ATOM   3354 C  CD1   . TYR A 1 404 ? -18.696 -16.113 -58.930 1.00 26.03  ? 404  TYR A CD1   1 
ATOM   3355 C  CD2   . TYR A 1 404 ? -18.821 -16.227 -56.538 1.00 26.83  ? 404  TYR A CD2   1 
ATOM   3356 C  CE1   . TYR A 1 404 ? -19.225 -14.828 -58.905 1.00 26.61  ? 404  TYR A CE1   1 
ATOM   3357 C  CE2   . TYR A 1 404 ? -19.346 -14.937 -56.500 1.00 28.37  ? 404  TYR A CE2   1 
ATOM   3358 C  CZ    . TYR A 1 404 ? -19.545 -14.246 -57.684 1.00 28.37  ? 404  TYR A CZ    1 
ATOM   3359 O  OH    . TYR A 1 404 ? -20.071 -12.978 -57.641 1.00 28.56  ? 404  TYR A OH    1 
ATOM   3360 N  N     . LYS A 1 405 ? -18.586 -21.260 -59.399 1.00 30.71  ? 405  LYS A N     1 
ATOM   3361 C  CA    . LYS A 1 405 ? -18.244 -22.652 -59.674 1.00 31.03  ? 405  LYS A CA    1 
ATOM   3362 C  C     . LYS A 1 405 ? -16.743 -22.855 -59.927 1.00 31.31  ? 405  LYS A C     1 
ATOM   3363 O  O     . LYS A 1 405 ? -16.069 -23.561 -59.174 1.00 31.58  ? 405  LYS A O     1 
ATOM   3364 C  CB    . LYS A 1 405 ? -19.082 -23.164 -60.846 1.00 31.53  ? 405  LYS A CB    1 
ATOM   3365 C  CG    . LYS A 1 405 ? -19.124 -24.680 -60.990 1.00 36.79  ? 405  LYS A CG    1 
ATOM   3366 C  CD    . LYS A 1 405 ? -19.957 -25.078 -62.201 1.00 39.09  ? 405  LYS A CD    1 
ATOM   3367 C  CE    . LYS A 1 405 ? -20.090 -26.591 -62.335 1.00 44.19  ? 405  LYS A CE    1 
ATOM   3368 N  NZ    . LYS A 1 405 ? -20.895 -26.987 -63.538 1.00 46.15  ? 405  LYS A NZ    1 
ATOM   3369 N  N     . TYR A 1 406 ? -16.230 -22.232 -60.983 1.00 31.70  ? 406  TYR A N     1 
ATOM   3370 C  CA    . TYR A 1 406 ? -14.819 -22.314 -61.324 1.00 32.49  ? 406  TYR A CA    1 
ATOM   3371 C  C     . TYR A 1 406 ? -14.151 -20.972 -61.077 1.00 32.81  ? 406  TYR A C     1 
ATOM   3372 O  O     . TYR A 1 406 ? -14.611 -19.939 -61.568 1.00 34.39  ? 406  TYR A O     1 
ATOM   3373 C  CB    . TYR A 1 406 ? -14.637 -22.758 -62.784 1.00 31.69  ? 406  TYR A CB    1 
ATOM   3374 C  CG    . TYR A 1 406 ? -15.094 -24.182 -63.036 1.00 33.38  ? 406  TYR A CG    1 
ATOM   3375 C  CD1   . TYR A 1 406 ? -16.295 -24.445 -63.699 1.00 35.46  ? 406  TYR A CD1   1 
ATOM   3376 C  CD2   . TYR A 1 406 ? -14.332 -25.266 -62.600 1.00 31.77  ? 406  TYR A CD2   1 
ATOM   3377 C  CE1   . TYR A 1 406 ? -16.724 -25.758 -63.925 1.00 36.68  ? 406  TYR A CE1   1 
ATOM   3378 C  CE2   . TYR A 1 406 ? -14.747 -26.579 -62.826 1.00 34.40  ? 406  TYR A CE2   1 
ATOM   3379 C  CZ    . TYR A 1 406 ? -15.943 -26.818 -63.486 1.00 36.02  ? 406  TYR A CZ    1 
ATOM   3380 O  OH    . TYR A 1 406 ? -16.357 -28.117 -63.700 1.00 38.14  ? 406  TYR A OH    1 
ATOM   3381 N  N     . VAL A 1 407 ? -13.063 -20.994 -60.312 1.00 33.06  ? 407  VAL A N     1 
ATOM   3382 C  CA    . VAL A 1 407 ? -12.350 -19.770 -59.940 1.00 31.09  ? 407  VAL A CA    1 
ATOM   3383 C  C     . VAL A 1 407 ? -10.840 -19.959 -60.046 1.00 32.02  ? 407  VAL A C     1 
ATOM   3384 O  O     . VAL A 1 407 ? -10.292 -20.944 -59.539 1.00 30.83  ? 407  VAL A O     1 
ATOM   3385 C  CB    . VAL A 1 407 ? -12.704 -19.312 -58.492 1.00 28.24  ? 407  VAL A CB    1 
ATOM   3386 C  CG1   . VAL A 1 407 ? -11.960 -18.030 -58.125 1.00 27.51  ? 407  VAL A CG1   1 
ATOM   3387 C  CG2   . VAL A 1 407 ? -14.185 -19.099 -58.340 1.00 24.64  ? 407  VAL A CG2   1 
ATOM   3388 N  N     . MET A 1 408 ? -10.185 -19.006 -60.710 1.00 32.01  ? 408  MET A N     1 
ATOM   3389 C  CA    . MET A 1 408 ? -8.728  -18.908 -60.726 1.00 32.87  ? 408  MET A CA    1 
ATOM   3390 C  C     . MET A 1 408 ? -8.324  -17.606 -60.060 1.00 31.23  ? 408  MET A C     1 
ATOM   3391 O  O     . MET A 1 408 ? -8.822  -16.532 -60.426 1.00 30.15  ? 408  MET A O     1 
ATOM   3392 C  CB    . MET A 1 408 ? -8.178  -18.869 -62.153 1.00 33.76  ? 408  MET A CB    1 
ATOM   3393 C  CG    . MET A 1 408 ? -8.624  -19.975 -63.072 1.00 43.48  ? 408  MET A CG    1 
ATOM   3394 S  SD    . MET A 1 408 ? -7.502  -20.073 -64.484 1.00 52.38  ? 408  MET A SD    1 
ATOM   3395 C  CE    . MET A 1 408 ? -6.129  -20.871 -63.653 1.00 45.86  ? 408  MET A CE    1 
ATOM   3396 N  N     . SER A 1 409 ? -7.404  -17.680 -59.109 1.00 28.72  ? 409  SER A N     1 
ATOM   3397 C  CA    . SER A 1 409 ? -6.894  -16.458 -58.500 1.00 27.71  ? 409  SER A CA    1 
ATOM   3398 C  C     . SER A 1 409 ? -5.479  -16.147 -58.971 1.00 29.41  ? 409  SER A C     1 
ATOM   3399 O  O     . SER A 1 409 ? -4.713  -17.049 -59.333 1.00 29.89  ? 409  SER A O     1 
ATOM   3400 C  CB    . SER A 1 409 ? -6.972  -16.511 -56.969 1.00 23.82  ? 409  SER A CB    1 
ATOM   3401 O  OG    . SER A 1 409 ? -6.049  -17.440 -56.440 1.00 19.83  ? 409  SER A OG    1 
ATOM   3402 N  N     . PHE A 1 410 ? -5.161  -14.856 -58.982 1.00 28.83  ? 410  PHE A N     1 
ATOM   3403 C  CA    . PHE A 1 410 ? -3.827  -14.366 -59.282 1.00 28.92  ? 410  PHE A CA    1 
ATOM   3404 C  C     . PHE A 1 410 ? -3.387  -13.415 -58.172 1.00 30.99  ? 410  PHE A C     1 
ATOM   3405 O  O     . PHE A 1 410 ? -4.205  -12.706 -57.580 1.00 30.91  ? 410  PHE A O     1 
ATOM   3406 C  CB    . PHE A 1 410 ? -3.804  -13.667 -60.643 1.00 28.22  ? 410  PHE A CB    1 
ATOM   3407 C  CG    . PHE A 1 410 ? -4.099  -14.587 -61.805 1.00 28.23  ? 410  PHE A CG    1 
ATOM   3408 C  CD1   . PHE A 1 410 ? -5.406  -14.989 -62.083 1.00 28.20  ? 410  PHE A CD1   1 
ATOM   3409 C  CD2   . PHE A 1 410 ? -3.066  -15.053 -62.621 1.00 28.64  ? 410  PHE A CD2   1 
ATOM   3410 C  CE1   . PHE A 1 410 ? -5.681  -15.847 -63.147 1.00 30.33  ? 410  PHE A CE1   1 
ATOM   3411 C  CE2   . PHE A 1 410 ? -3.330  -15.908 -63.692 1.00 30.44  ? 410  PHE A CE2   1 
ATOM   3412 C  CZ    . PHE A 1 410 ? -4.638  -16.302 -63.960 1.00 31.64  ? 410  PHE A CZ    1 
ATOM   3413 N  N     . ASP A 1 411 ? -2.089  -13.408 -57.893 1.00 31.69  ? 411  ASP A N     1 
ATOM   3414 C  CA    . ASP A 1 411 ? -1.545  -12.632 -56.793 1.00 32.80  ? 411  ASP A CA    1 
ATOM   3415 C  C     . ASP A 1 411 ? -0.194  -12.008 -57.153 1.00 32.63  ? 411  ASP A C     1 
ATOM   3416 O  O     . ASP A 1 411 ? 0.650   -12.646 -57.778 1.00 32.72  ? 411  ASP A O     1 
ATOM   3417 C  CB    . ASP A 1 411 ? -1.393  -13.526 -55.559 1.00 35.80  ? 411  ASP A CB    1 
ATOM   3418 C  CG    . ASP A 1 411 ? -0.625  -12.858 -54.459 1.00 38.73  ? 411  ASP A CG    1 
ATOM   3419 O  OD1   . ASP A 1 411 ? 0.536   -13.241 -54.222 1.00 43.48  ? 411  ASP A OD1   1 
ATOM   3420 O  OD2   . ASP A 1 411 ? -1.160  -11.911 -53.851 1.00 45.39  ? 411  ASP A OD2   1 
ATOM   3421 N  N     . LEU A 1 412 ? -0.002  -10.758 -56.747 1.00 30.62  ? 412  LEU A N     1 
ATOM   3422 C  CA    . LEU A 1 412 ? 1.273   -10.083 -56.910 1.00 30.35  ? 412  LEU A CA    1 
ATOM   3423 C  C     . LEU A 1 412 ? 2.250   -10.504 -55.822 1.00 29.99  ? 412  LEU A C     1 
ATOM   3424 O  O     . LEU A 1 412 ? 1.905   -10.507 -54.638 1.00 29.14  ? 412  LEU A O     1 
ATOM   3425 C  CB    . LEU A 1 412 ? 1.070   -8.570  -56.887 1.00 30.74  ? 412  LEU A CB    1 
ATOM   3426 C  CG    . LEU A 1 412 ? 0.543   -7.992  -58.201 1.00 31.43  ? 412  LEU A CG    1 
ATOM   3427 C  CD1   . LEU A 1 412 ? -0.292  -6.750  -57.953 1.00 29.91  ? 412  LEU A CD1   1 
ATOM   3428 C  CD2   . LEU A 1 412 ? 1.706   -7.699  -59.142 1.00 27.91  ? 412  LEU A CD2   1 
ATOM   3429 N  N     . THR A 1 413 ? 3.460   -10.877 -56.239 1.00 29.11  ? 413  THR A N     1 
ATOM   3430 C  CA    . THR A 1 413 ? 4.539   -11.246 -55.331 1.00 28.48  ? 413  THR A CA    1 
ATOM   3431 C  C     . THR A 1 413 ? 4.981   -10.041 -54.504 1.00 29.30  ? 413  THR A C     1 
ATOM   3432 O  O     . THR A 1 413 ? 5.341   -8.995  -55.060 1.00 28.44  ? 413  THR A O     1 
ATOM   3433 C  CB    . THR A 1 413 ? 5.754   -11.773 -56.124 1.00 30.10  ? 413  THR A CB    1 
ATOM   3434 O  OG1   . THR A 1 413 ? 5.386   -12.972 -56.817 1.00 34.81  ? 413  THR A OG1   1 
ATOM   3435 C  CG2   . THR A 1 413 ? 6.946   -12.063 -55.201 1.00 25.00  ? 413  THR A CG2   1 
ATOM   3436 N  N     . SER A 1 414 ? 4.949   -10.200 -53.181 1.00 29.04  ? 414  SER A N     1 
ATOM   3437 C  CA    . SER A 1 414 ? 5.457   -9.194  -52.234 1.00 27.63  ? 414  SER A CA    1 
ATOM   3438 C  C     . SER A 1 414 ? 5.172   -7.760  -52.683 1.00 24.60  ? 414  SER A C     1 
ATOM   3439 O  O     . SER A 1 414 ? 6.091   -6.999  -53.014 1.00 24.94  ? 414  SER A O     1 
ATOM   3440 C  CB    . SER A 1 414 ? 6.953   -9.407  -52.003 1.00 27.41  ? 414  SER A CB    1 
ATOM   3441 O  OG    . SER A 1 414 ? 7.401   -8.655  -50.892 1.00 37.45  ? 414  SER A OG    1 
ATOM   3442 N  N     . LEU A 1 415 ? 3.893   -7.399  -52.690 1.00 23.63  ? 415  LEU A N     1 
ATOM   3443 C  CA    . LEU A 1 415 ? 3.445   -6.184  -53.376 1.00 23.07  ? 415  LEU A CA    1 
ATOM   3444 C  C     . LEU A 1 415 ? 4.056   -4.880  -52.863 1.00 21.08  ? 415  LEU A C     1 
ATOM   3445 O  O     . LEU A 1 415 ? 4.711   -4.175  -53.624 1.00 20.35  ? 415  LEU A O     1 
ATOM   3446 C  CB    . LEU A 1 415 ? 1.915   -6.077  -53.427 1.00 21.50  ? 415  LEU A CB    1 
ATOM   3447 C  CG    . LEU A 1 415 ? 1.459   -4.800  -54.155 1.00 24.01  ? 415  LEU A CG    1 
ATOM   3448 C  CD1   . LEU A 1 415 ? 1.815   -4.850  -55.645 1.00 20.99  ? 415  LEU A CD1   1 
ATOM   3449 C  CD2   . LEU A 1 415 ? -0.012  -4.493  -53.963 1.00 20.75  ? 415  LEU A CD2   1 
ATOM   3450 N  N     . TYR A 1 416 ? 3.838   -4.547  -51.595 1.00 19.34  ? 416  TYR A N     1 
ATOM   3451 C  CA    . TYR A 1 416 ? 4.294   -3.245  -51.107 1.00 19.95  ? 416  TYR A CA    1 
ATOM   3452 C  C     . TYR A 1 416 ? 5.818   -3.071  -51.184 1.00 20.24  ? 416  TYR A C     1 
ATOM   3453 O  O     . TYR A 1 416 ? 6.277   -1.997  -51.554 1.00 19.78  ? 416  TYR A O     1 
ATOM   3454 C  CB    . TYR A 1 416 ? 3.736   -2.923  -49.710 1.00 19.44  ? 416  TYR A CB    1 
ATOM   3455 C  CG    . TYR A 1 416 ? 2.282   -2.475  -49.704 1.00 18.94  ? 416  TYR A CG    1 
ATOM   3456 C  CD1   . TYR A 1 416 ? 1.458   -2.673  -50.817 1.00 18.33  ? 416  TYR A CD1   1 
ATOM   3457 C  CD2   . TYR A 1 416 ? 1.719   -1.889  -48.567 1.00 19.33  ? 416  TYR A CD2   1 
ATOM   3458 C  CE1   . TYR A 1 416 ? 0.127   -2.282  -50.809 1.00 18.16  ? 416  TYR A CE1   1 
ATOM   3459 C  CE2   . TYR A 1 416 ? 0.383   -1.506  -48.542 1.00 21.55  ? 416  TYR A CE2   1 
ATOM   3460 C  CZ    . TYR A 1 416 ? -0.404  -1.704  -49.666 1.00 20.32  ? 416  TYR A CZ    1 
ATOM   3461 O  OH    . TYR A 1 416 ? -1.723  -1.326  -49.650 1.00 21.78  ? 416  TYR A OH    1 
ATOM   3462 N  N     . PRO A 1 417 ? 6.600   -4.127  -50.856 1.00 22.22  ? 417  PRO A N     1 
ATOM   3463 C  CA    . PRO A 1 417 ? 8.050   -4.004  -51.031 1.00 22.15  ? 417  PRO A CA    1 
ATOM   3464 C  C     . PRO A 1 417 ? 8.461   -3.882  -52.498 1.00 23.48  ? 417  PRO A C     1 
ATOM   3465 O  O     . PRO A 1 417 ? 9.420   -3.158  -52.803 1.00 22.25  ? 417  PRO A O     1 
ATOM   3466 C  CB    . PRO A 1 417 ? 8.591   -5.307  -50.419 1.00 21.85  ? 417  PRO A CB    1 
ATOM   3467 C  CG    . PRO A 1 417 ? 7.544   -5.693  -49.408 1.00 20.83  ? 417  PRO A CG    1 
ATOM   3468 C  CD    . PRO A 1 417 ? 6.256   -5.355  -50.107 1.00 21.83  ? 417  PRO A CD    1 
ATOM   3469 N  N     . SER A 1 418 ? 7.744   -4.573  -53.387 1.00 21.46  ? 418  SER A N     1 
ATOM   3470 C  CA    . SER A 1 418 ? 7.981   -4.447  -54.826 1.00 22.05  ? 418  SER A CA    1 
ATOM   3471 C  C     . SER A 1 418 ? 7.589   -3.075  -55.379 1.00 23.19  ? 418  SER A C     1 
ATOM   3472 O  O     . SER A 1 418 ? 8.187   -2.611  -56.351 1.00 22.15  ? 418  SER A O     1 
ATOM   3473 C  CB    . SER A 1 418 ? 7.263   -5.553  -55.601 1.00 21.91  ? 418  SER A CB    1 
ATOM   3474 O  OG    . SER A 1 418 ? 7.694   -6.826  -55.141 1.00 24.92  ? 418  SER A OG    1 
ATOM   3475 N  N     . ILE A 1 419 ? 6.586   -2.429  -54.775 1.00 23.08  ? 419  ILE A N     1 
ATOM   3476 C  CA    . ILE A 1 419 ? 6.223   -1.065  -55.182 1.00 22.36  ? 419  ILE A CA    1 
ATOM   3477 C  C     . ILE A 1 419 ? 7.358   -0.126  -54.768 1.00 22.72  ? 419  ILE A C     1 
ATOM   3478 O  O     . ILE A 1 419 ? 7.765   0.746   -55.535 1.00 22.92  ? 419  ILE A O     1 
ATOM   3479 C  CB    . ILE A 1 419 ? 4.870   -0.583  -54.584 1.00 21.14  ? 419  ILE A CB    1 
ATOM   3480 C  CG1   . ILE A 1 419 ? 3.684   -1.369  -55.165 1.00 18.83  ? 419  ILE A CG1   1 
ATOM   3481 C  CG2   . ILE A 1 419 ? 4.667   0.910   -54.850 1.00 20.01  ? 419  ILE A CG2   1 
ATOM   3482 C  CD1   . ILE A 1 419 ? 2.351   -1.161  -54.390 1.00 16.95  ? 419  ILE A CD1   1 
ATOM   3483 N  N     . ILE A 1 420 ? 7.881   -0.345  -53.563 1.00 21.51  ? 420  ILE A N     1 
ATOM   3484 C  CA    . ILE A 1 420 ? 9.008   0.421   -53.054 1.00 21.80  ? 420  ILE A CA    1 
ATOM   3485 C  C     . ILE A 1 420 ? 10.204  0.329   -54.004 1.00 24.19  ? 420  ILE A C     1 
ATOM   3486 O  O     . ILE A 1 420 ? 10.825  1.350   -54.328 1.00 24.42  ? 420  ILE A O     1 
ATOM   3487 C  CB    . ILE A 1 420 ? 9.398   -0.020  -51.616 1.00 20.59  ? 420  ILE A CB    1 
ATOM   3488 C  CG1   . ILE A 1 420 ? 8.336   0.469   -50.619 1.00 19.98  ? 420  ILE A CG1   1 
ATOM   3489 C  CG2   . ILE A 1 420 ? 10.790  0.517   -51.243 1.00 19.51  ? 420  ILE A CG2   1 
ATOM   3490 C  CD1   . ILE A 1 420 ? 8.411   -0.144  -49.222 1.00 13.79  ? 420  ILE A CD1   1 
ATOM   3491 N  N     . ARG A 1 421 ? 10.507  -0.888  -54.456 1.00 22.13  ? 421  ARG A N     1 
ATOM   3492 C  CA    . ARG A 1 421 ? 11.634  -1.114  -55.360 1.00 24.48  ? 421  ARG A CA    1 
ATOM   3493 C  C     . ARG A 1 421 ? 11.357  -0.557  -56.763 1.00 25.15  ? 421  ARG A C     1 
ATOM   3494 O  O     . ARG A 1 421 ? 12.203  0.133   -57.324 1.00 27.86  ? 421  ARG A O     1 
ATOM   3495 C  CB    . ARG A 1 421 ? 11.992  -2.603  -55.421 1.00 21.59  ? 421  ARG A CB    1 
ATOM   3496 C  CG    . ARG A 1 421 ? 12.388  -3.220  -54.071 1.00 23.33  ? 421  ARG A CG    1 
ATOM   3497 C  CD    . ARG A 1 421 ? 12.377  -4.737  -54.145 1.00 23.01  ? 421  ARG A CD    1 
ATOM   3498 N  NE    . ARG A 1 421 ? 13.317  -5.234  -55.149 1.00 23.40  ? 421  ARG A NE    1 
ATOM   3499 C  CZ    . ARG A 1 421 ? 13.195  -6.390  -55.797 1.00 28.06  ? 421  ARG A CZ    1 
ATOM   3500 N  NH1   . ARG A 1 421 ? 12.159  -7.207  -55.559 1.00 19.54  ? 421  ARG A NH1   1 
ATOM   3501 N  NH2   . ARG A 1 421 ? 14.114  -6.725  -56.694 1.00 23.29  ? 421  ARG A NH2   1 
ATOM   3502 N  N     . GLN A 1 422 ? 10.170  -0.843  -57.306 1.00 24.84  ? 422  GLN A N     1 
ATOM   3503 C  CA    . GLN A 1 422 ? 9.761   -0.379  -58.642 1.00 23.56  ? 422  GLN A CA    1 
ATOM   3504 C  C     . GLN A 1 422 ? 9.711   1.147   -58.759 1.00 24.10  ? 422  GLN A C     1 
ATOM   3505 O  O     . GLN A 1 422 ? 10.204  1.720   -59.731 1.00 25.36  ? 422  GLN A O     1 
ATOM   3506 C  CB    . GLN A 1 422 ? 8.399   -0.967  -59.027 1.00 22.03  ? 422  GLN A CB    1 
ATOM   3507 C  CG    . GLN A 1 422 ? 7.721   -0.277  -60.223 1.00 24.49  ? 422  GLN A CG    1 
ATOM   3508 C  CD    . GLN A 1 422 ? 6.854   -1.221  -61.053 1.00 26.99  ? 422  GLN A CD    1 
ATOM   3509 O  OE1   . GLN A 1 422 ? 6.959   -2.444  -60.935 1.00 29.45  ? 422  GLN A OE1   1 
ATOM   3510 N  NE2   . GLN A 1 422 ? 5.998   -0.651  -61.903 1.00 20.71  ? 422  GLN A NE2   1 
ATOM   3511 N  N     . VAL A 1 423 ? 9.106   1.797   -57.774 1.00 22.31  ? 423  VAL A N     1 
ATOM   3512 C  CA    . VAL A 1 423 ? 8.952   3.252   -57.814 1.00 23.63  ? 423  VAL A CA    1 
ATOM   3513 C  C     . VAL A 1 423 ? 10.220  3.970   -57.334 1.00 23.62  ? 423  VAL A C     1 
ATOM   3514 O  O     . VAL A 1 423 ? 10.458  5.112   -57.722 1.00 24.01  ? 423  VAL A O     1 
ATOM   3515 C  CB    . VAL A 1 423 ? 7.694   3.727   -57.028 1.00 21.58  ? 423  VAL A CB    1 
ATOM   3516 C  CG1   . VAL A 1 423 ? 7.523   5.239   -57.115 1.00 22.65  ? 423  VAL A CG1   1 
ATOM   3517 C  CG2   . VAL A 1 423 ? 6.442   3.031   -57.559 1.00 22.54  ? 423  VAL A CG2   1 
ATOM   3518 N  N     . ASN A 1 424 ? 11.035  3.273   -56.533 1.00 22.54  ? 424  ASN A N     1 
ATOM   3519 C  CA    . ASN A 1 424 ? 12.220  3.835   -55.874 1.00 23.14  ? 424  ASN A CA    1 
ATOM   3520 C  C     . ASN A 1 424 ? 11.832  4.806   -54.753 1.00 24.49  ? 424  ASN A C     1 
ATOM   3521 O  O     . ASN A 1 424 ? 12.285  5.952   -54.713 1.00 24.54  ? 424  ASN A O     1 
ATOM   3522 C  CB    . ASN A 1 424 ? 13.203  4.470   -56.883 1.00 24.62  ? 424  ASN A CB    1 
ATOM   3523 C  CG    . ASN A 1 424 ? 14.624  4.594   -56.331 1.00 28.17  ? 424  ASN A CG    1 
ATOM   3524 O  OD1   . ASN A 1 424 ? 15.077  3.764   -55.535 1.00 30.28  ? 424  ASN A OD1   1 
ATOM   3525 N  ND2   . ASN A 1 424 ? 15.331  5.634   -56.755 1.00 28.88  ? 424  ASN A ND2   1 
ATOM   3526 N  N     . ILE A 1 425 ? 11.002  4.317   -53.831 1.00 25.38  ? 425  ILE A N     1 
ATOM   3527 C  CA    . ILE A 1 425 ? 10.473  5.123   -52.730 1.00 24.93  ? 425  ILE A CA    1 
ATOM   3528 C  C     . ILE A 1 425 ? 11.404  5.058   -51.523 1.00 26.09  ? 425  ILE A C     1 
ATOM   3529 O  O     . ILE A 1 425 ? 11.596  4.001   -50.921 1.00 25.75  ? 425  ILE A O     1 
ATOM   3530 C  CB    . ILE A 1 425 ? 9.015   4.703   -52.362 1.00 24.83  ? 425  ILE A CB    1 
ATOM   3531 C  CG1   . ILE A 1 425 ? 8.080   4.946   -53.551 1.00 24.71  ? 425  ILE A CG1   1 
ATOM   3532 C  CG2   . ILE A 1 425 ? 8.499   5.473   -51.148 1.00 22.06  ? 425  ILE A CG2   1 
ATOM   3533 C  CD1   . ILE A 1 425 ? 6.781   4.155   -53.505 1.00 24.77  ? 425  ILE A CD1   1 
ATOM   3534 N  N     . SER A 1 426 ? 11.973  6.211   -51.179 1.00 26.12  ? 426  SER A N     1 
ATOM   3535 C  CA    . SER A 1 426 ? 12.952  6.325   -50.101 1.00 26.27  ? 426  SER A CA    1 
ATOM   3536 C  C     . SER A 1 426 ? 12.922  7.786   -49.648 1.00 27.25  ? 426  SER A C     1 
ATOM   3537 O  O     . SER A 1 426 ? 12.468  8.647   -50.405 1.00 28.64  ? 426  SER A O     1 
ATOM   3538 C  CB    . SER A 1 426 ? 14.348  5.944   -50.609 1.00 25.86  ? 426  SER A CB    1 
ATOM   3539 O  OG    . SER A 1 426 ? 15.202  5.517   -49.554 1.00 27.72  ? 426  SER A OG    1 
ATOM   3540 N  N     . PRO A 1 427 ? 13.363  8.071   -48.407 1.00 25.91  ? 427  PRO A N     1 
ATOM   3541 C  CA    . PRO A 1 427 ? 13.427  9.453   -47.939 1.00 26.13  ? 427  PRO A CA    1 
ATOM   3542 C  C     . PRO A 1 427 ? 14.324  10.341  -48.801 1.00 26.92  ? 427  PRO A C     1 
ATOM   3543 O  O     . PRO A 1 427 ? 14.007  11.504  -49.015 1.00 28.63  ? 427  PRO A O     1 
ATOM   3544 C  CB    . PRO A 1 427 ? 14.019  9.321   -46.525 1.00 27.07  ? 427  PRO A CB    1 
ATOM   3545 C  CG    . PRO A 1 427 ? 14.544  7.910   -46.436 1.00 28.09  ? 427  PRO A CG    1 
ATOM   3546 C  CD    . PRO A 1 427 ? 13.636  7.124   -47.314 1.00 26.93  ? 427  PRO A CD    1 
ATOM   3547 N  N     . GLU A 1 428 ? 15.434  9.800   -49.297 1.00 27.90  ? 428  GLU A N     1 
ATOM   3548 C  CA    . GLU A 1 428 ? 16.388  10.628  -50.021 1.00 27.83  ? 428  GLU A CA    1 
ATOM   3549 C  C     . GLU A 1 428 ? 16.145  10.667  -51.538 1.00 28.13  ? 428  GLU A C     1 
ATOM   3550 O  O     . GLU A 1 428 ? 16.837  11.400  -52.261 1.00 28.87  ? 428  GLU A O     1 
ATOM   3551 C  CB    . GLU A 1 428 ? 17.837  10.242  -49.667 1.00 27.92  ? 428  GLU A CB    1 
ATOM   3552 C  CG    . GLU A 1 428 ? 18.422  9.056   -50.423 1.00 26.03  ? 428  GLU A CG    1 
ATOM   3553 C  CD    . GLU A 1 428 ? 17.956  7.719   -49.882 1.00 30.05  ? 428  GLU A CD    1 
ATOM   3554 O  OE1   . GLU A 1 428 ? 16.826  7.643   -49.352 1.00 28.98  ? 428  GLU A OE1   1 
ATOM   3555 O  OE2   . GLU A 1 428 ? 18.726  6.740   -49.993 1.00 33.43  ? 428  GLU A OE2   1 
ATOM   3556 N  N     . THR A 1 429 ? 15.157  9.902   -52.011 1.00 26.25  ? 429  THR A N     1 
ATOM   3557 C  CA    . THR A 1 429 ? 14.847  9.866   -53.451 1.00 26.95  ? 429  THR A CA    1 
ATOM   3558 C  C     . THR A 1 429 ? 13.673  10.749  -53.879 1.00 26.23  ? 429  THR A C     1 
ATOM   3559 O  O     . THR A 1 429 ? 13.346  10.804  -55.057 1.00 27.38  ? 429  THR A O     1 
ATOM   3560 C  CB    . THR A 1 429 ? 14.643  8.433   -53.999 1.00 25.41  ? 429  THR A CB    1 
ATOM   3561 O  OG1   . THR A 1 429 ? 13.592  7.787   -53.274 1.00 28.04  ? 429  THR A OG1   1 
ATOM   3562 C  CG2   . THR A 1 429 ? 15.923  7.635   -53.875 1.00 22.07  ? 429  THR A CG2   1 
ATOM   3563 N  N     . ILE A 1 430 ? 13.048  11.441  -52.933 1.00 28.97  ? 430  ILE A N     1 
ATOM   3564 C  CA    . ILE A 1 430 ? 11.946  12.344  -53.267 1.00 28.56  ? 430  ILE A CA    1 
ATOM   3565 C  C     . ILE A 1 430 ? 12.445  13.437  -54.203 1.00 29.47  ? 430  ILE A C     1 
ATOM   3566 O  O     . ILE A 1 430 ? 13.404  14.141  -53.884 1.00 31.34  ? 430  ILE A O     1 
ATOM   3567 C  CB    . ILE A 1 430 ? 11.296  12.951  -52.009 1.00 28.90  ? 430  ILE A CB    1 
ATOM   3568 C  CG1   . ILE A 1 430 ? 10.598  11.846  -51.197 1.00 27.80  ? 430  ILE A CG1   1 
ATOM   3569 C  CG2   . ILE A 1 430 ? 10.304  14.038  -52.399 1.00 27.03  ? 430  ILE A CG2   1 
ATOM   3570 C  CD1   . ILE A 1 430 ? 10.189  12.256  -49.784 1.00 23.12  ? 430  ILE A CD1   1 
ATOM   3571 N  N     . ALA A 1 431 ? 11.797  13.555  -55.362 1.00 30.27  ? 431  ALA A N     1 
ATOM   3572 C  CA    . ALA A 1 431 ? 12.213  14.488  -56.415 1.00 31.01  ? 431  ALA A CA    1 
ATOM   3573 C  C     . ALA A 1 431 ? 11.289  15.693  -56.534 1.00 31.58  ? 431  ALA A C     1 
ATOM   3574 O  O     . ALA A 1 431 ? 11.686  16.741  -57.041 1.00 33.96  ? 431  ALA A O     1 
ATOM   3575 C  CB    . ALA A 1 431 ? 12.308  13.762  -57.755 1.00 30.66  ? 431  ALA A CB    1 
ATOM   3576 N  N     . GLY A 1 432 ? 10.055  15.535  -56.069 1.00 31.85  ? 432  GLY A N     1 
ATOM   3577 C  CA    . GLY A 1 432 ? 9.050   16.590  -56.174 1.00 29.68  ? 432  GLY A CA    1 
ATOM   3578 C  C     . GLY A 1 432 ? 7.661   16.004  -56.294 1.00 29.64  ? 432  GLY A C     1 
ATOM   3579 O  O     . GLY A 1 432 ? 7.438   14.847  -55.923 1.00 27.43  ? 432  GLY A O     1 
ATOM   3580 N  N     . THR A 1 433 ? 6.733   16.807  -56.813 1.00 30.01  ? 433  THR A N     1 
ATOM   3581 C  CA    . THR A 1 433 ? 5.334   16.410  -56.978 1.00 30.10  ? 433  THR A CA    1 
ATOM   3582 C  C     . THR A 1 433 ? 4.809   16.767  -58.365 1.00 30.98  ? 433  THR A C     1 
ATOM   3583 O  O     . THR A 1 433 ? 5.325   17.678  -59.016 1.00 30.39  ? 433  THR A O     1 
ATOM   3584 C  CB    . THR A 1 433 ? 4.395   17.072  -55.915 1.00 31.67  ? 433  THR A CB    1 
ATOM   3585 O  OG1   . THR A 1 433 ? 4.413   18.503  -56.049 1.00 28.19  ? 433  THR A OG1   1 
ATOM   3586 C  CG2   . THR A 1 433 ? 4.811   16.692  -54.504 1.00 29.11  ? 433  THR A CG2   1 
ATOM   3587 N  N     . PHE A 1 434 ? 3.787   16.038  -58.811 1.00 31.15  ? 434  PHE A N     1 
ATOM   3588 C  CA    . PHE A 1 434 ? 3.041   16.402  -60.017 1.00 34.02  ? 434  PHE A CA    1 
ATOM   3589 C  C     . PHE A 1 434 ? 1.578   16.658  -59.667 1.00 34.97  ? 434  PHE A C     1 
ATOM   3590 O  O     . PHE A 1 434 ? 1.121   16.303  -58.576 1.00 34.48  ? 434  PHE A O     1 
ATOM   3591 C  CB    . PHE A 1 434 ? 3.178   15.340  -61.131 1.00 31.85  ? 434  PHE A CB    1 
ATOM   3592 C  CG    . PHE A 1 434 ? 2.591   13.993  -60.782 1.00 31.18  ? 434  PHE A CG    1 
ATOM   3593 C  CD1   . PHE A 1 434 ? 3.369   13.019  -60.163 1.00 26.57  ? 434  PHE A CD1   1 
ATOM   3594 C  CD2   . PHE A 1 434 ? 1.269   13.687  -61.102 1.00 30.40  ? 434  PHE A CD2   1 
ATOM   3595 C  CE1   . PHE A 1 434 ? 2.837   11.770  -59.849 1.00 28.01  ? 434  PHE A CE1   1 
ATOM   3596 C  CE2   . PHE A 1 434 ? 0.726   12.441  -60.786 1.00 27.60  ? 434  PHE A CE2   1 
ATOM   3597 C  CZ    . PHE A 1 434 ? 1.514   11.478  -60.163 1.00 26.04  ? 434  PHE A CZ    1 
ATOM   3598 N  N     . LYS A 1 435 ? 0.855   17.283  -60.592 1.00 37.25  ? 435  LYS A N     1 
ATOM   3599 C  CA    . LYS A 1 435 ? -0.561  17.578  -60.404 1.00 38.50  ? 435  LYS A CA    1 
ATOM   3600 C  C     . LYS A 1 435 ? -1.374  16.306  -60.633 1.00 38.36  ? 435  LYS A C     1 
ATOM   3601 O  O     . LYS A 1 435 ? -1.301  15.704  -61.707 1.00 39.95  ? 435  LYS A O     1 
ATOM   3602 C  CB    . LYS A 1 435 ? -0.998  18.695  -61.353 1.00 38.05  ? 435  LYS A CB    1 
ATOM   3603 C  CG    . LYS A 1 435 ? -2.334  19.336  -61.006 1.00 43.19  ? 435  LYS A CG    1 
ATOM   3604 C  CD    . LYS A 1 435 ? -2.418  20.793  -61.503 1.00 49.61  ? 435  LYS A CD    1 
ATOM   3605 C  CE    . LYS A 1 435 ? -2.619  20.896  -63.017 1.00 47.22  ? 435  LYS A CE    1 
ATOM   3606 N  NZ    . LYS A 1 435 ? -2.939  22.288  -63.434 1.00 48.32  ? 435  LYS A NZ    1 
ATOM   3607 N  N     . VAL A 1 436 ? -2.146  15.908  -59.622 1.00 37.51  ? 436  VAL A N     1 
ATOM   3608 C  CA    . VAL A 1 436 ? -2.838  14.614  -59.638 1.00 37.56  ? 436  VAL A CA    1 
ATOM   3609 C  C     . VAL A 1 436 ? -4.224  14.667  -60.269 1.00 37.89  ? 436  VAL A C     1 
ATOM   3610 O  O     . VAL A 1 436 ? -5.034  15.540  -59.954 1.00 40.41  ? 436  VAL A O     1 
ATOM   3611 C  CB    . VAL A 1 436 ? -2.952  13.971  -58.220 1.00 37.45  ? 436  VAL A CB    1 
ATOM   3612 C  CG1   . VAL A 1 436 ? -1.598  13.818  -57.601 1.00 37.54  ? 436  VAL A CG1   1 
ATOM   3613 C  CG2   . VAL A 1 436 ? -3.854  14.799  -57.299 1.00 41.20  ? 436  VAL A CG2   1 
ATOM   3614 N  N     . ALA A 1 437 ? -4.475  13.718  -61.163 1.00 37.15  ? 437  ALA A N     1 
ATOM   3615 C  CA    . ALA A 1 437 ? -5.795  13.481  -61.719 1.00 37.81  ? 437  ALA A CA    1 
ATOM   3616 C  C     . ALA A 1 437 ? -6.506  12.458  -60.817 1.00 39.39  ? 437  ALA A C     1 
ATOM   3617 O  O     . ALA A 1 437 ? -5.851  11.800  -60.015 1.00 37.55  ? 437  ALA A O     1 
ATOM   3618 C  CB    . ALA A 1 437 ? -5.660  12.951  -63.124 1.00 36.89  ? 437  ALA A CB    1 
ATOM   3619 N  N     . PRO A 1 438 ? -7.846  12.336  -60.925 1.00 40.62  ? 438  PRO A N     1 
ATOM   3620 C  CA    . PRO A 1 438 ? -8.529  11.302  -60.146 1.00 41.60  ? 438  PRO A CA    1 
ATOM   3621 C  C     . PRO A 1 438 ? -8.015  9.911   -60.477 1.00 41.69  ? 438  PRO A C     1 
ATOM   3622 O  O     . PRO A 1 438 ? -7.691  9.633   -61.634 1.00 41.11  ? 438  PRO A O     1 
ATOM   3623 C  CB    . PRO A 1 438 ? -9.989  11.446  -60.573 1.00 42.83  ? 438  PRO A CB    1 
ATOM   3624 C  CG    . PRO A 1 438 ? -10.117 12.893  -60.935 1.00 43.01  ? 438  PRO A CG    1 
ATOM   3625 C  CD    . PRO A 1 438 ? -8.802  13.251  -61.579 1.00 42.71  ? 438  PRO A CD    1 
ATOM   3626 N  N     . LEU A 1 439 ? -7.942  9.058   -59.454 1.00 40.34  ? 439  LEU A N     1 
ATOM   3627 C  CA    . LEU A 1 439 ? -7.372  7.720   -59.569 1.00 39.71  ? 439  LEU A CA    1 
ATOM   3628 C  C     . LEU A 1 439 ? -7.945  6.895   -60.720 1.00 41.23  ? 439  LEU A C     1 
ATOM   3629 O  O     . LEU A 1 439 ? -7.204  6.174   -61.396 1.00 41.71  ? 439  LEU A O     1 
ATOM   3630 C  CB    . LEU A 1 439 ? -7.527  6.957   -58.248 1.00 39.75  ? 439  LEU A CB    1 
ATOM   3631 C  CG    . LEU A 1 439 ? -6.818  5.600   -58.161 1.00 39.31  ? 439  LEU A CG    1 
ATOM   3632 C  CD1   . LEU A 1 439 ? -5.299  5.759   -58.079 1.00 36.90  ? 439  LEU A CD1   1 
ATOM   3633 C  CD2   . LEU A 1 439 ? -7.347  4.798   -56.985 1.00 38.50  ? 439  LEU A CD2   1 
ATOM   3634 N  N     . HIS A 1 440 ? -9.254  6.994   -60.944 1.00 42.79  ? 440  HIS A N     1 
ATOM   3635 C  CA    . HIS A 1 440 ? -9.881  6.267   -62.056 1.00 45.31  ? 440  HIS A CA    1 
ATOM   3636 C  C     . HIS A 1 440 ? -9.320  6.661   -63.424 1.00 43.30  ? 440  HIS A C     1 
ATOM   3637 O  O     . HIS A 1 440 ? -9.312  5.849   -64.351 1.00 43.52  ? 440  HIS A O     1 
ATOM   3638 C  CB    . HIS A 1 440 ? -11.418 6.341   -62.011 1.00 48.69  ? 440  HIS A CB    1 
ATOM   3639 C  CG    . HIS A 1 440 ? -12.051 5.135   -61.381 1.00 55.84  ? 440  HIS A CG    1 
ATOM   3640 N  ND1   . HIS A 1 440 ? -12.362 5.067   -60.037 1.00 59.70  ? 440  HIS A ND1   1 
ATOM   3641 C  CD2   . HIS A 1 440 ? -12.396 3.933   -61.906 1.00 58.65  ? 440  HIS A CD2   1 
ATOM   3642 C  CE1   . HIS A 1 440 ? -12.885 3.884   -59.767 1.00 60.45  ? 440  HIS A CE1   1 
ATOM   3643 N  NE2   . HIS A 1 440 ? -12.915 3.176   -60.883 1.00 60.09  ? 440  HIS A NE2   1 
ATOM   3644 N  N     . ASP A 1 441 ? -8.828  7.896   -63.526 1.00 41.86  ? 441  ASP A N     1 
ATOM   3645 C  CA    . ASP A 1 441 ? -8.173  8.383   -64.741 1.00 42.09  ? 441  ASP A CA    1 
ATOM   3646 C  C     . ASP A 1 441 ? -6.854  7.667   -65.023 1.00 39.89  ? 441  ASP A C     1 
ATOM   3647 O  O     . ASP A 1 441 ? -6.528  7.399   -66.186 1.00 41.58  ? 441  ASP A O     1 
ATOM   3648 C  CB    . ASP A 1 441 ? -7.954  9.897   -64.674 1.00 43.17  ? 441  ASP A CB    1 
ATOM   3649 C  CG    . ASP A 1 441 ? -9.249  10.684  -64.797 1.00 46.74  ? 441  ASP A CG    1 
ATOM   3650 O  OD1   . ASP A 1 441 ? -10.324 10.076  -64.991 1.00 48.28  ? 441  ASP A OD1   1 
ATOM   3651 O  OD2   . ASP A 1 441 ? -9.187  11.925  -64.699 1.00 50.38  ? 441  ASP A OD2   1 
ATOM   3652 N  N     . TYR A 1 442 ? -6.101  7.362   -63.965 1.00 35.89  ? 442  TYR A N     1 
ATOM   3653 C  CA    . TYR A 1 442 ? -4.889  6.556   -64.105 1.00 32.64  ? 442  TYR A CA    1 
ATOM   3654 C  C     . TYR A 1 442 ? -5.227  5.093   -64.390 1.00 32.85  ? 442  TYR A C     1 
ATOM   3655 O  O     . TYR A 1 442 ? -4.608  4.473   -65.253 1.00 33.72  ? 442  TYR A O     1 
ATOM   3656 C  CB    . TYR A 1 442 ? -3.964  6.707   -62.889 1.00 30.64  ? 442  TYR A CB    1 
ATOM   3657 C  CG    . TYR A 1 442 ? -3.481  8.128   -62.688 1.00 28.52  ? 442  TYR A CG    1 
ATOM   3658 C  CD1   . TYR A 1 442 ? -2.589  8.719   -63.589 1.00 31.99  ? 442  TYR A CD1   1 
ATOM   3659 C  CD2   . TYR A 1 442 ? -3.933  8.892   -61.614 1.00 28.55  ? 442  TYR A CD2   1 
ATOM   3660 C  CE1   . TYR A 1 442 ? -2.156  10.038  -63.421 1.00 28.42  ? 442  TYR A CE1   1 
ATOM   3661 C  CE2   . TYR A 1 442 ? -3.503  10.211  -61.436 1.00 29.78  ? 442  TYR A CE2   1 
ATOM   3662 C  CZ    . TYR A 1 442 ? -2.617  10.770  -62.342 1.00 28.64  ? 442  TYR A CZ    1 
ATOM   3663 O  OH    . TYR A 1 442 ? -2.198  12.066  -62.167 1.00 32.55  ? 442  TYR A OH    1 
ATOM   3664 N  N     . ILE A 1 443 ? -6.226  4.557   -63.686 1.00 33.26  ? 443  ILE A N     1 
ATOM   3665 C  CA    . ILE A 1 443 ? -6.676  3.178   -63.890 1.00 31.50  ? 443  ILE A CA    1 
ATOM   3666 C  C     . ILE A 1 443 ? -7.097  2.936   -65.339 1.00 33.84  ? 443  ILE A C     1 
ATOM   3667 O  O     . ILE A 1 443 ? -6.797  1.886   -65.911 1.00 32.63  ? 443  ILE A O     1 
ATOM   3668 C  CB    . ILE A 1 443 ? -7.824  2.790   -62.915 1.00 31.46  ? 443  ILE A CB    1 
ATOM   3669 C  CG1   . ILE A 1 443 ? -7.310  2.785   -61.466 1.00 32.16  ? 443  ILE A CG1   1 
ATOM   3670 C  CG2   . ILE A 1 443 ? -8.402  1.412   -63.273 1.00 27.92  ? 443  ILE A CG2   1 
ATOM   3671 C  CD1   . ILE A 1 443 ? -8.383  3.012   -60.399 1.00 30.79  ? 443  ILE A CD1   1 
ATOM   3672 N  N     . ASN A 1 444 ? -7.772  3.921   -65.927 1.00 37.32  ? 444  ASN A N     1 
ATOM   3673 C  CA    . ASN A 1 444 ? -8.280  3.806   -67.293 1.00 41.79  ? 444  ASN A CA    1 
ATOM   3674 C  C     . ASN A 1 444 ? -7.363  4.390   -68.365 1.00 42.57  ? 444  ASN A C     1 
ATOM   3675 O  O     . ASN A 1 444 ? -7.746  4.496   -69.535 1.00 44.86  ? 444  ASN A O     1 
ATOM   3676 C  CB    . ASN A 1 444 ? -9.702  4.378   -67.386 1.00 44.17  ? 444  ASN A CB    1 
ATOM   3677 C  CG    . ASN A 1 444 ? -10.701 3.562   -66.577 1.00 47.89  ? 444  ASN A CG    1 
ATOM   3678 O  OD1   . ASN A 1 444 ? -10.960 2.398   -66.890 1.00 48.61  ? 444  ASN A OD1   1 
ATOM   3679 N  ND2   . ASN A 1 444 ? -11.240 4.159   -65.513 1.00 46.91  ? 444  ASN A ND2   1 
ATOM   3680 N  N     . ALA A 1 445 ? -6.152  4.766   -67.957 1.00 41.92  ? 445  ALA A N     1 
ATOM   3681 C  CA    . ALA A 1 445 ? -5.120  5.245   -68.881 1.00 42.29  ? 445  ALA A CA    1 
ATOM   3682 C  C     . ALA A 1 445 ? -5.526  6.494   -69.684 1.00 43.93  ? 445  ALA A C     1 
ATOM   3683 O  O     . ALA A 1 445 ? -5.114  6.659   -70.837 1.00 44.25  ? 445  ALA A O     1 
ATOM   3684 C  CB    . ALA A 1 445 ? -4.667  4.106   -69.822 1.00 41.74  ? 445  ALA A CB    1 
ATOM   3685 N  N     . VAL A 1 446 ? -6.326  7.368   -69.074 1.00 44.59  ? 446  VAL A N     1 
ATOM   3686 C  CA    . VAL A 1 446 ? -6.752  8.610   -69.742 1.00 46.11  ? 446  VAL A CA    1 
ATOM   3687 C  C     . VAL A 1 446 ? -6.093  9.874   -69.179 1.00 45.27  ? 446  VAL A C     1 
ATOM   3688 O  O     . VAL A 1 446 ? -6.069  10.914  -69.843 1.00 46.72  ? 446  VAL A O     1 
ATOM   3689 C  CB    . VAL A 1 446 ? -8.298  8.770   -69.783 1.00 47.93  ? 446  VAL A CB    1 
ATOM   3690 C  CG1   . VAL A 1 446 ? -8.922  7.695   -70.664 1.00 47.52  ? 446  VAL A CG1   1 
ATOM   3691 C  CG2   . VAL A 1 446 ? -8.901  8.744   -68.376 1.00 48.67  ? 446  VAL A CG2   1 
ATOM   3692 N  N     . ALA A 1 447 ? -5.559  9.786   -67.964 1.00 42.62  ? 447  ALA A N     1 
ATOM   3693 C  CA    . ALA A 1 447 ? -4.835  10.912  -67.383 1.00 41.82  ? 447  ALA A CA    1 
ATOM   3694 C  C     . ALA A 1 447 ? -3.509  11.142  -68.106 1.00 41.50  ? 447  ALA A C     1 
ATOM   3695 O  O     . ALA A 1 447 ? -2.921  10.205  -68.665 1.00 37.93  ? 447  ALA A O     1 
ATOM   3696 C  CB    . ALA A 1 447 ? -4.604  10.697  -65.904 1.00 39.00  ? 447  ALA A CB    1 
ATOM   3697 N  N     . GLU A 1 448 ? -3.058  12.397  -68.105 1.00 42.92  ? 448  GLU A N     1 
ATOM   3698 C  CA    . GLU A 1 448 ? -1.777  12.756  -68.704 1.00 44.76  ? 448  GLU A CA    1 
ATOM   3699 C  C     . GLU A 1 448 ? -0.624  12.074  -67.964 1.00 42.02  ? 448  GLU A C     1 
ATOM   3700 O  O     . GLU A 1 448 ? -0.709  11.816  -66.755 1.00 38.56  ? 448  GLU A O     1 
ATOM   3701 C  CB    . GLU A 1 448 ? -1.587  14.280  -68.766 1.00 47.20  ? 448  GLU A CB    1 
ATOM   3702 C  CG    . GLU A 1 448 ? -1.399  14.995  -67.420 1.00 50.99  ? 448  GLU A CG    1 
ATOM   3703 C  CD    . GLU A 1 448 ? -1.213  16.514  -67.568 1.00 57.93  ? 448  GLU A CD    1 
ATOM   3704 O  OE1   . GLU A 1 448 ? -1.002  16.993  -68.712 1.00 58.29  ? 448  GLU A OE1   1 
ATOM   3705 O  OE2   . GLU A 1 448 ? -1.272  17.228  -66.537 1.00 56.48  ? 448  GLU A OE2   1 
ATOM   3706 N  N     . ARG A 1 449 ? 0.437   11.767  -68.706 1.00 40.69  ? 449  ARG A N     1 
ATOM   3707 C  CA    . ARG A 1 449 ? 1.623   11.138  -68.137 1.00 39.12  ? 449  ARG A CA    1 
ATOM   3708 C  C     . ARG A 1 449 ? 2.206   12.048  -67.041 1.00 36.23  ? 449  ARG A C     1 
ATOM   3709 O  O     . ARG A 1 449 ? 2.467   13.227  -67.292 1.00 37.19  ? 449  ARG A O     1 
ATOM   3710 C  CB    . ARG A 1 449 ? 2.646   10.855  -69.246 1.00 40.30  ? 449  ARG A CB    1 
ATOM   3711 C  CG    . ARG A 1 449 ? 3.641   9.767   -68.901 1.00 42.41  ? 449  ARG A CG    1 
ATOM   3712 C  CD    . ARG A 1 449 ? 4.287   9.154   -70.144 1.00 45.92  ? 449  ARG A CD    1 
ATOM   3713 N  NE    . ARG A 1 449 ? 5.221   8.090   -69.767 1.00 45.88  ? 449  ARG A NE    1 
ATOM   3714 C  CZ    . ARG A 1 449 ? 6.542   8.229   -69.702 1.00 43.78  ? 449  ARG A CZ    1 
ATOM   3715 N  NH1   . ARG A 1 449 ? 7.110   9.382   -70.013 1.00 46.99  ? 449  ARG A NH1   1 
ATOM   3716 N  NH2   . ARG A 1 449 ? 7.304   7.205   -69.340 1.00 44.11  ? 449  ARG A NH2   1 
ATOM   3717 N  N     . PRO A 1 450 ? 2.384   11.511  -65.818 1.00 34.20  ? 450  PRO A N     1 
ATOM   3718 C  CA    . PRO A 1 450 ? 2.863   12.325  -64.690 1.00 33.01  ? 450  PRO A CA    1 
ATOM   3719 C  C     . PRO A 1 450 ? 4.222   12.983  -64.923 1.00 32.85  ? 450  PRO A C     1 
ATOM   3720 O  O     . PRO A 1 450 ? 4.383   14.175  -64.640 1.00 33.97  ? 450  PRO A O     1 
ATOM   3721 C  CB    . PRO A 1 450 ? 2.944   11.315  -63.540 1.00 31.21  ? 450  PRO A CB    1 
ATOM   3722 C  CG    . PRO A 1 450 ? 1.939   10.285  -63.887 1.00 31.45  ? 450  PRO A CG    1 
ATOM   3723 C  CD    . PRO A 1 450 ? 1.998   10.155  -65.381 1.00 31.46  ? 450  PRO A CD    1 
ATOM   3724 N  N     . SER A 1 451 ? 5.185   12.223  -65.442 1.00 31.70  ? 451  SER A N     1 
ATOM   3725 C  CA    . SER A 1 451 ? 6.543   12.733  -65.634 1.00 31.53  ? 451  SER A CA    1 
ATOM   3726 C  C     . SER A 1 451 ? 7.274   12.021  -66.758 1.00 32.60  ? 451  SER A C     1 
ATOM   3727 O  O     . SER A 1 451 ? 7.106   10.811  -66.957 1.00 31.58  ? 451  SER A O     1 
ATOM   3728 C  CB    . SER A 1 451 ? 7.370   12.605  -64.346 1.00 29.67  ? 451  SER A CB    1 
ATOM   3729 O  OG    . SER A 1 451 ? 8.682   13.120  -64.532 1.00 27.06  ? 451  SER A OG    1 
ATOM   3730 N  N     . ASP A 1 452 ? 8.091   12.792  -67.469 1.00 32.20  ? 452  ASP A N     1 
ATOM   3731 C  CA    . ASP A 1 452 ? 9.022   12.271  -68.467 1.00 34.46  ? 452  ASP A CA    1 
ATOM   3732 C  C     . ASP A 1 452 ? 10.453  12.191  -67.908 1.00 30.79  ? 452  ASP A C     1 
ATOM   3733 O  O     . ASP A 1 452 ? 11.396  11.900  -68.633 1.00 31.47  ? 452  ASP A O     1 
ATOM   3734 C  CB    . ASP A 1 452 ? 8.989   13.147  -69.725 1.00 36.57  ? 452  ASP A CB    1 
ATOM   3735 C  CG    . ASP A 1 452 ? 7.727   12.954  -70.553 1.00 44.27  ? 452  ASP A CG    1 
ATOM   3736 O  OD1   . ASP A 1 452 ? 7.265   11.802  -70.694 1.00 49.22  ? 452  ASP A OD1   1 
ATOM   3737 O  OD2   . ASP A 1 452 ? 7.206   13.956  -71.089 1.00 49.14  ? 452  ASP A OD2   1 
ATOM   3738 N  N     . VAL A 1 453 ? 10.604  12.440  -66.610 1.00 30.39  ? 453  VAL A N     1 
ATOM   3739 C  CA    . VAL A 1 453 ? 11.925  12.491  -65.971 1.00 28.71  ? 453  VAL A CA    1 
ATOM   3740 C  C     . VAL A 1 453 ? 12.020  11.549  -64.770 1.00 27.88  ? 453  VAL A C     1 
ATOM   3741 O  O     . VAL A 1 453 ? 12.996  10.809  -64.632 1.00 29.82  ? 453  VAL A O     1 
ATOM   3742 C  CB    . VAL A 1 453 ? 12.280  13.932  -65.517 1.00 28.54  ? 453  VAL A CB    1 
ATOM   3743 C  CG1   . VAL A 1 453 ? 13.626  13.968  -64.785 1.00 29.93  ? 453  VAL A CG1   1 
ATOM   3744 C  CG2   . VAL A 1 453 ? 12.307  14.882  -66.707 1.00 29.70  ? 453  VAL A CG2   1 
ATOM   3745 N  N     . TYR A 1 454 ? 11.000  11.575  -63.914 1.00 25.93  ? 454  TYR A N     1 
ATOM   3746 C  CA    . TYR A 1 454 ? 11.045  10.890  -62.627 1.00 25.07  ? 454  TYR A CA    1 
ATOM   3747 C  C     . TYR A 1 454 ? 10.076  9.729   -62.556 1.00 24.74  ? 454  TYR A C     1 
ATOM   3748 O  O     . TYR A 1 454 ? 9.194   9.600   -63.404 1.00 24.83  ? 454  TYR A O     1 
ATOM   3749 C  CB    . TYR A 1 454 ? 10.743  11.876  -61.500 1.00 24.00  ? 454  TYR A CB    1 
ATOM   3750 C  CG    . TYR A 1 454 ? 11.694  13.045  -61.455 1.00 23.07  ? 454  TYR A CG    1 
ATOM   3751 C  CD1   . TYR A 1 454 ? 13.053  12.852  -61.206 1.00 22.89  ? 454  TYR A CD1   1 
ATOM   3752 C  CD2   . TYR A 1 454 ? 11.237  14.347  -61.664 1.00 23.78  ? 454  TYR A CD2   1 
ATOM   3753 C  CE1   . TYR A 1 454 ? 13.940  13.932  -61.158 1.00 27.96  ? 454  TYR A CE1   1 
ATOM   3754 C  CE2   . TYR A 1 454 ? 12.113  15.433  -61.617 1.00 28.75  ? 454  TYR A CE2   1 
ATOM   3755 C  CZ    . TYR A 1 454 ? 13.456  15.219  -61.361 1.00 29.85  ? 454  TYR A CZ    1 
ATOM   3756 O  OH    . TYR A 1 454 ? 14.318  16.292  -61.318 1.00 38.21  ? 454  TYR A OH    1 
ATOM   3757 N  N     . SER A 1 455 ? 10.259  8.889   -61.540 1.00 24.23  ? 455  SER A N     1 
ATOM   3758 C  CA    . SER A 1 455 ? 9.419   7.720   -61.326 1.00 26.36  ? 455  SER A CA    1 
ATOM   3759 C  C     . SER A 1 455 ? 8.254   8.086   -60.399 1.00 26.56  ? 455  SER A C     1 
ATOM   3760 O  O     . SER A 1 455 ? 8.461   8.659   -59.326 1.00 26.64  ? 455  SER A O     1 
ATOM   3761 C  CB    . SER A 1 455 ? 10.251  6.567   -60.751 1.00 25.79  ? 455  SER A CB    1 
ATOM   3762 O  OG    . SER A 1 455 ? 9.416   5.531   -60.251 1.00 26.42  ? 455  SER A OG    1 
ATOM   3763 N  N     . CYS A 1 456 ? 7.035   7.748   -60.811 1.00 25.98  ? 456  CYS A N     1 
ATOM   3764 C  CA    . CYS A 1 456 ? 5.846   8.299   -60.161 1.00 26.22  ? 456  CYS A CA    1 
ATOM   3765 C  C     . CYS A 1 456 ? 4.897   7.306   -59.498 1.00 25.32  ? 456  CYS A C     1 
ATOM   3766 O  O     . CYS A 1 456 ? 4.870   6.119   -59.831 1.00 24.86  ? 456  CYS A O     1 
ATOM   3767 C  CB    . CYS A 1 456 ? 5.062   9.151   -61.159 1.00 26.47  ? 456  CYS A CB    1 
ATOM   3768 S  SG    . CYS A 1 456 ? 6.067   10.375  -61.983 1.00 31.29  ? 456  CYS A SG    1 
ATOM   3769 N  N     . SER A 1 457 ? 4.125   7.829   -58.549 1.00 25.65  ? 457  SER A N     1 
ATOM   3770 C  CA    . SER A 1 457 ? 2.970   7.149   -57.979 1.00 25.47  ? 457  SER A CA    1 
ATOM   3771 C  C     . SER A 1 457 ? 1.771   8.075   -58.133 1.00 25.45  ? 457  SER A C     1 
ATOM   3772 O  O     . SER A 1 457 ? 1.915   9.283   -57.968 1.00 27.47  ? 457  SER A O     1 
ATOM   3773 C  CB    . SER A 1 457 ? 3.202   6.842   -56.499 1.00 24.80  ? 457  SER A CB    1 
ATOM   3774 O  OG    . SER A 1 457 ? 1.980   6.510   -55.852 1.00 28.24  ? 457  SER A OG    1 
ATOM   3775 N  N     . PRO A 1 458 ? 0.580   7.513   -58.435 1.00 26.13  ? 458  PRO A N     1 
ATOM   3776 C  CA    . PRO A 1 458 ? -0.662  8.273   -58.643 1.00 26.61  ? 458  PRO A CA    1 
ATOM   3777 C  C     . PRO A 1 458 ? -1.125  9.135   -57.456 1.00 27.70  ? 458  PRO A C     1 
ATOM   3778 O  O     . PRO A 1 458 ? -2.149  9.816   -57.563 1.00 29.05  ? 458  PRO A O     1 
ATOM   3779 C  CB    . PRO A 1 458 ? -1.701  7.175   -58.937 1.00 25.59  ? 458  PRO A CB    1 
ATOM   3780 C  CG    . PRO A 1 458 ? -1.113  5.944   -58.386 1.00 27.49  ? 458  PRO A CG    1 
ATOM   3781 C  CD    . PRO A 1 458 ? 0.350   6.070   -58.624 1.00 25.78  ? 458  PRO A CD    1 
ATOM   3782 N  N     . ASN A 1 459 ? -0.390  9.117   -56.344 1.00 25.74  ? 459  ASN A N     1 
ATOM   3783 C  CA    . ASN A 1 459 ? -0.682  10.048  -55.253 1.00 24.92  ? 459  ASN A CA    1 
ATOM   3784 C  C     . ASN A 1 459 ? -0.072  11.430  -55.497 1.00 24.64  ? 459  ASN A C     1 
ATOM   3785 O  O     . ASN A 1 459 ? -0.363  12.381  -54.765 1.00 23.59  ? 459  ASN A O     1 
ATOM   3786 C  CB    . ASN A 1 459 ? -0.256  9.480   -53.891 1.00 25.11  ? 459  ASN A CB    1 
ATOM   3787 C  CG    . ASN A 1 459 ? 1.235   9.603   -53.633 1.00 25.57  ? 459  ASN A CG    1 
ATOM   3788 O  OD1   . ASN A 1 459 ? 2.058   9.429   -54.536 1.00 28.58  ? 459  ASN A OD1   1 
ATOM   3789 N  ND2   . ASN A 1 459 ? 1.592   9.882   -52.382 1.00 25.33  ? 459  ASN A ND2   1 
ATOM   3790 N  N     . GLY A 1 460 ? 0.760   11.537  -56.534 1.00 23.38  ? 460  GLY A N     1 
ATOM   3791 C  CA    . GLY A 1 460 ? 1.409   12.810  -56.881 1.00 23.20  ? 460  GLY A CA    1 
ATOM   3792 C  C     . GLY A 1 460 ? 2.892   12.884  -56.585 1.00 22.88  ? 460  GLY A C     1 
ATOM   3793 O  O     . GLY A 1 460 ? 3.521   13.904  -56.836 1.00 23.49  ? 460  GLY A O     1 
ATOM   3794 N  N     . MET A 1 461 ? 3.461   11.808  -56.054 1.00 23.69  ? 461  MET A N     1 
ATOM   3795 C  CA    . MET A 1 461 ? 4.877   11.811  -55.688 1.00 25.06  ? 461  MET A CA    1 
ATOM   3796 C  C     . MET A 1 461 ? 5.797   11.378  -56.831 1.00 26.69  ? 461  MET A C     1 
ATOM   3797 O  O     . MET A 1 461 ? 5.439   10.516  -57.646 1.00 27.49  ? 461  MET A O     1 
ATOM   3798 C  CB    . MET A 1 461 ? 5.111   10.962  -54.435 1.00 25.86  ? 461  MET A CB    1 
ATOM   3799 C  CG    . MET A 1 461 ? 4.517   11.575  -53.156 1.00 26.57  ? 461  MET A CG    1 
ATOM   3800 S  SD    . MET A 1 461 ? 5.324   13.126  -52.668 1.00 29.82  ? 461  MET A SD    1 
ATOM   3801 C  CE    . MET A 1 461 ? 6.925   12.515  -52.132 1.00 31.65  ? 461  MET A CE    1 
ATOM   3802 N  N     . MET A 1 462 ? 6.973   12.000  -56.888 1.00 26.67  ? 462  MET A N     1 
ATOM   3803 C  CA    . MET A 1 462 ? 7.974   11.720  -57.915 1.00 27.37  ? 462  MET A CA    1 
ATOM   3804 C  C     . MET A 1 462 ? 9.296   11.342  -57.264 1.00 27.56  ? 462  MET A C     1 
ATOM   3805 O  O     . MET A 1 462 ? 9.651   11.879  -56.208 1.00 27.26  ? 462  MET A O     1 
ATOM   3806 C  CB    . MET A 1 462 ? 8.182   12.937  -58.813 1.00 29.48  ? 462  MET A CB    1 
ATOM   3807 C  CG    . MET A 1 462 ? 6.928   13.418  -59.530 1.00 31.11  ? 462  MET A CG    1 
ATOM   3808 S  SD    . MET A 1 462 ? 7.279   14.560  -60.880 1.00 32.96  ? 462  MET A SD    1 
ATOM   3809 C  CE    . MET A 1 462 ? 8.034   15.944  -60.023 1.00 34.21  ? 462  MET A CE    1 
ATOM   3810 N  N     . TYR A 1 463 ? 10.022  10.418  -57.891 1.00 26.08  ? 463  TYR A N     1 
ATOM   3811 C  CA    . TYR A 1 463 ? 11.258  9.889   -57.309 1.00 26.81  ? 463  TYR A CA    1 
ATOM   3812 C  C     . TYR A 1 463 ? 12.393  9.821   -58.321 1.00 27.85  ? 463  TYR A C     1 
ATOM   3813 O  O     . TYR A 1 463 ? 12.148  9.606   -59.514 1.00 26.36  ? 463  TYR A O     1 
ATOM   3814 C  CB    . TYR A 1 463 ? 11.010  8.505   -56.692 1.00 24.80  ? 463  TYR A CB    1 
ATOM   3815 C  CG    . TYR A 1 463 ? 9.960   8.519   -55.607 1.00 25.11  ? 463  TYR A CG    1 
ATOM   3816 C  CD1   . TYR A 1 463 ? 8.610   8.318   -55.918 1.00 25.56  ? 463  TYR A CD1   1 
ATOM   3817 C  CD2   . TYR A 1 463 ? 10.304  8.758   -54.278 1.00 22.34  ? 463  TYR A CD2   1 
ATOM   3818 C  CE1   . TYR A 1 463 ? 7.634   8.341   -54.938 1.00 23.48  ? 463  TYR A CE1   1 
ATOM   3819 C  CE2   . TYR A 1 463 ? 9.327   8.782   -53.280 1.00 25.48  ? 463  TYR A CE2   1 
ATOM   3820 C  CZ    . TYR A 1 463 ? 7.996   8.573   -53.627 1.00 24.35  ? 463  TYR A CZ    1 
ATOM   3821 O  OH    . TYR A 1 463 ? 7.020   8.596   -52.672 1.00 24.61  ? 463  TYR A OH    1 
ATOM   3822 N  N     . TYR A 1 464 ? 13.628  9.998   -57.838 1.00 27.88  ? 464  TYR A N     1 
ATOM   3823 C  CA    . TYR A 1 464 ? 14.811  9.932   -58.701 1.00 27.18  ? 464  TYR A CA    1 
ATOM   3824 C  C     . TYR A 1 464 ? 14.948  8.547   -59.330 1.00 26.92  ? 464  TYR A C     1 
ATOM   3825 O  O     . TYR A 1 464 ? 14.559  7.532   -58.731 1.00 24.53  ? 464  TYR A O     1 
ATOM   3826 C  CB    . TYR A 1 464 ? 16.093  10.273  -57.927 1.00 27.68  ? 464  TYR A CB    1 
ATOM   3827 C  CG    . TYR A 1 464 ? 16.152  11.667  -57.336 1.00 31.94  ? 464  TYR A CG    1 
ATOM   3828 C  CD1   . TYR A 1 464 ? 16.581  11.867  -56.023 1.00 34.68  ? 464  TYR A CD1   1 
ATOM   3829 C  CD2   . TYR A 1 464 ? 15.784  12.789  -58.083 1.00 34.38  ? 464  TYR A CD2   1 
ATOM   3830 C  CE1   . TYR A 1 464 ? 16.639  13.148  -55.466 1.00 36.13  ? 464  TYR A CE1   1 
ATOM   3831 C  CE2   . TYR A 1 464 ? 15.843  14.072  -57.539 1.00 36.01  ? 464  TYR A CE2   1 
ATOM   3832 C  CZ    . TYR A 1 464 ? 16.269  14.244  -56.229 1.00 37.83  ? 464  TYR A CZ    1 
ATOM   3833 O  OH    . TYR A 1 464 ? 16.323  15.510  -55.684 1.00 39.98  ? 464  TYR A OH    1 
ATOM   3834 N  N     . LYS A 1 465 ? 15.502  8.515   -60.535 1.00 26.43  ? 465  LYS A N     1 
ATOM   3835 C  CA    . LYS A 1 465 ? 15.690  7.271   -61.274 1.00 29.18  ? 465  LYS A CA    1 
ATOM   3836 C  C     . LYS A 1 465 ? 17.167  6.921   -61.477 1.00 31.30  ? 465  LYS A C     1 
ATOM   3837 O  O     . LYS A 1 465 ? 17.484  5.840   -61.982 1.00 28.76  ? 465  LYS A O     1 
ATOM   3838 C  CB    . LYS A 1 465 ? 15.010  7.351   -62.635 1.00 28.48  ? 465  LYS A CB    1 
ATOM   3839 C  CG    . LYS A 1 465 ? 13.502  7.404   -62.590 1.00 30.21  ? 465  LYS A CG    1 
ATOM   3840 C  CD    . LYS A 1 465 ? 12.908  7.311   -63.997 1.00 27.91  ? 465  LYS A CD    1 
ATOM   3841 C  CE    . LYS A 1 465 ? 12.889  5.872   -64.484 1.00 26.79  ? 465  LYS A CE    1 
ATOM   3842 N  NZ    . LYS A 1 465 ? 12.038  5.715   -65.686 1.00 32.68  ? 465  LYS A NZ    1 
ATOM   3843 N  N     . ASP A 1 466 ? 18.060  7.827   -61.083 1.00 31.76  ? 466  ASP A N     1 
ATOM   3844 C  CA    . ASP A 1 466 ? 19.485  7.640   -61.334 1.00 36.03  ? 466  ASP A CA    1 
ATOM   3845 C  C     . ASP A 1 466 ? 20.124  6.586   -60.434 1.00 36.74  ? 466  ASP A C     1 
ATOM   3846 O  O     . ASP A 1 466 ? 21.089  5.939   -60.829 1.00 39.29  ? 466  ASP A O     1 
ATOM   3847 C  CB    . ASP A 1 466 ? 20.241  8.971   -61.228 1.00 36.07  ? 466  ASP A CB    1 
ATOM   3848 C  CG    . ASP A 1 466 ? 20.343  9.479   -59.805 1.00 40.52  ? 466  ASP A CG    1 
ATOM   3849 O  OD1   . ASP A 1 466 ? 19.290  9.721   -59.173 1.00 42.61  ? 466  ASP A OD1   1 
ATOM   3850 O  OD2   . ASP A 1 466 ? 21.484  9.644   -59.319 1.00 44.62  ? 466  ASP A OD2   1 
ATOM   3851 N  N     . ARG A 1 467 ? 19.578  6.415   -59.234 1.00 37.56  ? 467  ARG A N     1 
ATOM   3852 C  CA    . ARG A 1 467 ? 20.188  5.565   -58.218 1.00 38.84  ? 467  ARG A CA    1 
ATOM   3853 C  C     . ARG A 1 467 ? 19.142  5.032   -57.241 1.00 37.09  ? 467  ARG A C     1 
ATOM   3854 O  O     . ARG A 1 467 ? 18.156  5.710   -56.935 1.00 35.44  ? 467  ARG A O     1 
ATOM   3855 C  CB    . ARG A 1 467 ? 21.280  6.337   -57.455 1.00 41.10  ? 467  ARG A CB    1 
ATOM   3856 C  CG    . ARG A 1 467 ? 20.767  7.582   -56.716 1.00 48.20  ? 467  ARG A CG    1 
ATOM   3857 C  CD    . ARG A 1 467 ? 21.887  8.452   -56.143 1.00 56.89  ? 467  ARG A CD    1 
ATOM   3858 N  NE    . ARG A 1 467 ? 21.554  9.877   -56.247 1.00 64.60  ? 467  ARG A NE    1 
ATOM   3859 C  CZ    . ARG A 1 467 ? 20.963  10.602  -55.296 1.00 68.50  ? 467  ARG A CZ    1 
ATOM   3860 N  NH1   . ARG A 1 467 ? 20.634  10.055  -54.127 1.00 67.87  ? 467  ARG A NH1   1 
ATOM   3861 N  NH2   . ARG A 1 467 ? 20.704  11.887  -55.516 1.00 68.52  ? 467  ARG A NH2   1 
ATOM   3862 N  N     . ASP A 1 468 ? 19.373  3.813   -56.758 1.00 36.12  ? 468  ASP A N     1 
ATOM   3863 C  CA    . ASP A 1 468 ? 18.523  3.193   -55.750 1.00 33.26  ? 468  ASP A CA    1 
ATOM   3864 C  C     . ASP A 1 468 ? 18.654  3.916   -54.420 1.00 30.38  ? 468  ASP A C     1 
ATOM   3865 O  O     . ASP A 1 468 ? 19.765  4.201   -53.963 1.00 30.25  ? 468  ASP A O     1 
ATOM   3866 C  CB    . ASP A 1 468 ? 18.913  1.727   -55.563 1.00 36.78  ? 468  ASP A CB    1 
ATOM   3867 C  CG    . ASP A 1 468 ? 18.543  0.858   -56.756 1.00 42.70  ? 468  ASP A CG    1 
ATOM   3868 O  OD1   . ASP A 1 468 ? 17.370  0.889   -57.193 1.00 42.78  ? 468  ASP A OD1   1 
ATOM   3869 O  OD2   . ASP A 1 468 ? 19.431  0.125   -57.248 1.00 49.35  ? 468  ASP A OD2   1 
ATOM   3870 N  N     . GLY A 1 469 ? 17.515  4.222   -53.808 1.00 32.69  ? 469  GLY A N     1 
ATOM   3871 C  CA    . GLY A 1 469 ? 17.482  4.695   -52.428 1.00 28.83  ? 469  GLY A CA    1 
ATOM   3872 C  C     . GLY A 1 469 ? 17.838  3.592   -51.447 1.00 28.62  ? 469  GLY A C     1 
ATOM   3873 O  O     . GLY A 1 469 ? 17.748  2.395   -51.773 1.00 25.83  ? 469  GLY A O     1 
ATOM   3874 N  N     . VAL A 1 470 ? 18.237  3.996   -50.243 1.00 26.36  ? 470  VAL A N     1 
ATOM   3875 C  CA    . VAL A 1 470 ? 18.624  3.061   -49.187 1.00 24.34  ? 470  VAL A CA    1 
ATOM   3876 C  C     . VAL A 1 470 ? 17.467  2.146   -48.753 1.00 25.42  ? 470  VAL A C     1 
ATOM   3877 O  O     . VAL A 1 470 ? 17.689  0.996   -48.372 1.00 27.98  ? 470  VAL A O     1 
ATOM   3878 C  CB    . VAL A 1 470 ? 19.243  3.811   -47.968 1.00 25.56  ? 470  VAL A CB    1 
ATOM   3879 C  CG1   . VAL A 1 470 ? 18.251  4.792   -47.341 1.00 20.82  ? 470  VAL A CG1   1 
ATOM   3880 C  CG2   . VAL A 1 470 ? 19.787  2.829   -46.923 1.00 25.40  ? 470  VAL A CG2   1 
ATOM   3881 N  N     . VAL A 1 471 ? 16.236  2.649   -48.817 1.00 25.52  ? 471  VAL A N     1 
ATOM   3882 C  CA    . VAL A 1 471 ? 15.068  1.826   -48.498 1.00 23.00  ? 471  VAL A CA    1 
ATOM   3883 C  C     . VAL A 1 471 ? 14.850  0.714   -49.541 1.00 21.92  ? 471  VAL A C     1 
ATOM   3884 O  O     . VAL A 1 471 ? 14.781  -0.448  -49.162 1.00 23.56  ? 471  VAL A O     1 
ATOM   3885 C  CB    . VAL A 1 471 ? 13.797  2.683   -48.215 1.00 23.81  ? 471  VAL A CB    1 
ATOM   3886 C  CG1   . VAL A 1 471 ? 12.542  1.838   -48.243 1.00 22.10  ? 471  VAL A CG1   1 
ATOM   3887 C  CG2   . VAL A 1 471 ? 13.923  3.387   -46.854 1.00 25.56  ? 471  VAL A CG2   1 
ATOM   3888 N  N     . PRO A 1 472 ? 14.766  1.051   -50.853 1.00 21.59  ? 472  PRO A N     1 
ATOM   3889 C  CA    . PRO A 1 472 ? 14.721  -0.043  -51.838 1.00 23.23  ? 472  PRO A CA    1 
ATOM   3890 C  C     . PRO A 1 472 ? 15.893  -1.021  -51.712 1.00 25.71  ? 472  PRO A C     1 
ATOM   3891 O  O     . PRO A 1 472 ? 15.701  -2.240  -51.788 1.00 27.14  ? 472  PRO A O     1 
ATOM   3892 C  CB    . PRO A 1 472 ? 14.794  0.689   -53.184 1.00 20.70  ? 472  PRO A CB    1 
ATOM   3893 C  CG    . PRO A 1 472 ? 14.144  2.009   -52.912 1.00 20.33  ? 472  PRO A CG    1 
ATOM   3894 C  CD    . PRO A 1 472 ? 14.450  2.354   -51.475 1.00 20.90  ? 472  PRO A CD    1 
ATOM   3895 N  N     . THR A 1 473 ? 17.090  -0.487  -51.503 1.00 26.11  ? 473  THR A N     1 
ATOM   3896 C  CA    . THR A 1 473 ? 18.295  -1.304  -51.427 1.00 26.99  ? 473  THR A CA    1 
ATOM   3897 C  C     . THR A 1 473 ? 18.238  -2.319  -50.285 1.00 25.83  ? 473  THR A C     1 
ATOM   3898 O  O     . THR A 1 473 ? 18.507  -3.497  -50.494 1.00 26.37  ? 473  THR A O     1 
ATOM   3899 C  CB    . THR A 1 473 ? 19.543  -0.416  -51.330 1.00 27.07  ? 473  THR A CB    1 
ATOM   3900 O  OG1   . THR A 1 473 ? 19.708  0.272   -52.574 1.00 32.58  ? 473  THR A OG1   1 
ATOM   3901 C  CG2   . THR A 1 473 ? 20.797  -1.244  -51.048 1.00 28.90  ? 473  THR A CG2   1 
ATOM   3902 N  N     . GLU A 1 474 ? 17.874  -1.860  -49.094 1.00 23.88  ? 474  GLU A N     1 
ATOM   3903 C  CA    . GLU A 1 474 ? 17.865  -2.727  -47.923 1.00 24.72  ? 474  GLU A CA    1 
ATOM   3904 C  C     . GLU A 1 474 ? 16.674  -3.667  -47.877 1.00 23.43  ? 474  GLU A C     1 
ATOM   3905 O  O     . GLU A 1 474 ? 16.803  -4.796  -47.419 1.00 22.44  ? 474  GLU A O     1 
ATOM   3906 C  CB    . GLU A 1 474 ? 17.966  -1.909  -46.634 1.00 26.42  ? 474  GLU A CB    1 
ATOM   3907 C  CG    . GLU A 1 474 ? 19.333  -1.233  -46.443 1.00 28.98  ? 474  GLU A CG    1 
ATOM   3908 C  CD    . GLU A 1 474 ? 20.510  -2.199  -46.579 1.00 32.45  ? 474  GLU A CD    1 
ATOM   3909 O  OE1   . GLU A 1 474 ? 21.495  -1.832  -47.261 1.00 36.92  ? 474  GLU A OE1   1 
ATOM   3910 O  OE2   . GLU A 1 474 ? 20.457  -3.319  -46.017 1.00 30.88  ? 474  GLU A OE2   1 
ATOM   3911 N  N     . ILE A 1 475 ? 15.524  -3.207  -48.370 1.00 23.47  ? 475  ILE A N     1 
ATOM   3912 C  CA    . ILE A 1 475 ? 14.339  -4.054  -48.455 1.00 23.13  ? 475  ILE A CA    1 
ATOM   3913 C  C     . ILE A 1 475 ? 14.539  -5.211  -49.463 1.00 23.41  ? 475  ILE A C     1 
ATOM   3914 O  O     . ILE A 1 475 ? 13.990  -6.292  -49.263 1.00 22.72  ? 475  ILE A O     1 
ATOM   3915 C  CB    . ILE A 1 475 ? 13.038  -3.223  -48.734 1.00 24.33  ? 475  ILE A CB    1 
ATOM   3916 C  CG1   . ILE A 1 475 ? 11.816  -3.881  -48.092 1.00 23.93  ? 475  ILE A CG1   1 
ATOM   3917 C  CG2   . ILE A 1 475 ? 12.804  -3.012  -50.227 1.00 21.76  ? 475  ILE A CG2   1 
ATOM   3918 C  CD1   . ILE A 1 475 ? 10.546  -3.037  -48.168 1.00 23.31  ? 475  ILE A CD1   1 
ATOM   3919 N  N     . THR A 1 476 ? 15.337  -4.974  -50.512 1.00 22.26  ? 476  THR A N     1 
ATOM   3920 C  CA    . THR A 1 476 ? 15.648  -5.978  -51.549 1.00 24.40  ? 476  THR A CA    1 
ATOM   3921 C  C     . THR A 1 476 ? 16.442  -7.167  -50.982 1.00 26.29  ? 476  THR A C     1 
ATOM   3922 O  O     . THR A 1 476 ? 16.165  -8.328  -51.311 1.00 25.27  ? 476  THR A O     1 
ATOM   3923 C  CB    . THR A 1 476 ? 16.440  -5.350  -52.740 1.00 26.27  ? 476  THR A CB    1 
ATOM   3924 O  OG1   . THR A 1 476 ? 15.628  -4.378  -53.416 1.00 23.57  ? 476  THR A OG1   1 
ATOM   3925 C  CG2   . THR A 1 476 ? 16.883  -6.423  -53.754 1.00 28.75  ? 476  THR A CG2   1 
ATOM   3926 N  N     . LYS A 1 477 ? 17.425  -6.868  -50.133 1.00 27.07  ? 477  LYS A N     1 
ATOM   3927 C  CA    . LYS A 1 477 ? 18.250  -7.903  -49.500 1.00 28.38  ? 477  LYS A CA    1 
ATOM   3928 C  C     . LYS A 1 477 ? 17.416  -8.867  -48.656 1.00 27.06  ? 477  LYS A C     1 
ATOM   3929 O  O     . LYS A 1 477 ? 17.587  -10.081 -48.748 1.00 28.20  ? 477  LYS A O     1 
ATOM   3930 C  CB    . LYS A 1 477 ? 19.370  -7.271  -48.657 1.00 29.12  ? 477  LYS A CB    1 
ATOM   3931 C  CG    . LYS A 1 477 ? 20.453  -6.570  -49.483 1.00 31.59  ? 477  LYS A CG    1 
ATOM   3932 C  CD    . LYS A 1 477 ? 21.386  -5.728  -48.617 1.00 32.86  ? 477  LYS A CD    1 
ATOM   3933 C  CE    . LYS A 1 477 ? 22.334  -4.910  -49.481 1.00 41.05  ? 477  LYS A CE    1 
ATOM   3934 N  NZ    . LYS A 1 477 ? 23.180  -3.976  -48.683 1.00 43.22  ? 477  LYS A NZ    1 
ATOM   3935 N  N     . VAL A 1 478 ? 16.513  -8.328  -47.840 1.00 27.00  ? 478  VAL A N     1 
ATOM   3936 C  CA    . VAL A 1 478 ? 15.682  -9.167  -46.972 1.00 25.73  ? 478  VAL A CA    1 
ATOM   3937 C  C     . VAL A 1 478 ? 14.629  -9.887  -47.806 1.00 26.45  ? 478  VAL A C     1 
ATOM   3938 O  O     . VAL A 1 478 ? 14.357  -11.072 -47.574 1.00 29.07  ? 478  VAL A O     1 
ATOM   3939 C  CB    . VAL A 1 478 ? 15.046  -8.370  -45.791 1.00 25.78  ? 478  VAL A CB    1 
ATOM   3940 C  CG1   . VAL A 1 478 ? 14.158  -9.271  -44.928 1.00 25.22  ? 478  VAL A CG1   1 
ATOM   3941 C  CG2   . VAL A 1 478 ? 16.132  -7.739  -44.921 1.00 21.73  ? 478  VAL A CG2   1 
ATOM   3942 N  N     . PHE A 1 479 ? 14.058  -9.190  -48.789 1.00 25.36  ? 479  PHE A N     1 
ATOM   3943 C  CA    . PHE A 1 479 ? 13.154  -9.830  -49.744 1.00 25.99  ? 479  PHE A CA    1 
ATOM   3944 C  C     . PHE A 1 479 ? 13.776  -11.061 -50.430 1.00 28.23  ? 479  PHE A C     1 
ATOM   3945 O  O     . PHE A 1 479 ? 13.102  -12.079 -50.588 1.00 26.62  ? 479  PHE A O     1 
ATOM   3946 C  CB    . PHE A 1 479 ? 12.643  -8.862  -50.818 1.00 25.63  ? 479  PHE A CB    1 
ATOM   3947 C  CG    . PHE A 1 479 ? 11.962  -9.567  -51.969 1.00 29.32  ? 479  PHE A CG    1 
ATOM   3948 C  CD1   . PHE A 1 479 ? 10.691  -10.124 -51.810 1.00 29.93  ? 479  PHE A CD1   1 
ATOM   3949 C  CD2   . PHE A 1 479 ? 12.612  -9.725  -53.189 1.00 26.86  ? 479  PHE A CD2   1 
ATOM   3950 C  CE1   . PHE A 1 479 ? 10.071  -10.804 -52.866 1.00 36.34  ? 479  PHE A CE1   1 
ATOM   3951 C  CE2   . PHE A 1 479 ? 11.996  -10.405 -54.255 1.00 28.96  ? 479  PHE A CE2   1 
ATOM   3952 C  CZ    . PHE A 1 479 ? 10.729  -10.939 -54.097 1.00 31.21  ? 479  PHE A CZ    1 
ATOM   3953 N  N     . ASN A 1 480 ? 15.037  -10.941 -50.861 1.00 28.23  ? 480  ASN A N     1 
ATOM   3954 C  CA    . ASN A 1 480 ? 15.754  -12.056 -51.488 1.00 31.72  ? 480  ASN A CA    1 
ATOM   3955 C  C     . ASN A 1 480 ? 16.004  -13.238 -50.538 1.00 30.98  ? 480  ASN A C     1 
ATOM   3956 O  O     . ASN A 1 480 ? 15.982  -14.385 -50.965 1.00 32.10  ? 480  ASN A O     1 
ATOM   3957 C  CB    . ASN A 1 480 ? 17.071  -11.588 -52.126 1.00 31.52  ? 480  ASN A CB    1 
ATOM   3958 C  CG    . ASN A 1 480 ? 16.862  -10.865 -53.460 1.00 34.73  ? 480  ASN A CG    1 
ATOM   3959 O  OD1   . ASN A 1 480 ? 15.866  -11.077 -54.155 1.00 35.32  ? 480  ASN A OD1   1 
ATOM   3960 N  ND2   . ASN A 1 480 ? 17.817  -10.011 -53.822 1.00 32.35  ? 480  ASN A ND2   1 
ATOM   3961 N  N     . GLN A 1 481 ? 16.250  -12.952 -49.263 1.00 30.21  ? 481  GLN A N     1 
ATOM   3962 C  CA    . GLN A 1 481 ? 16.316  -13.992 -48.234 1.00 31.25  ? 481  GLN A CA    1 
ATOM   3963 C  C     . GLN A 1 481 ? 14.957  -14.665 -48.075 1.00 29.58  ? 481  GLN A C     1 
ATOM   3964 O  O     . GLN A 1 481 ? 14.868  -15.890 -47.982 1.00 29.40  ? 481  GLN A O     1 
ATOM   3965 C  CB    . GLN A 1 481 ? 16.716  -13.408 -46.886 1.00 30.23  ? 481  GLN A CB    1 
ATOM   3966 C  CG    . GLN A 1 481 ? 18.099  -12.809 -46.813 1.00 35.41  ? 481  GLN A CG    1 
ATOM   3967 C  CD    . GLN A 1 481 ? 18.331  -12.097 -45.489 1.00 39.17  ? 481  GLN A CD    1 
ATOM   3968 O  OE1   . GLN A 1 481 ? 17.544  -12.241 -44.546 1.00 39.24  ? 481  GLN A OE1   1 
ATOM   3969 N  NE2   . GLN A 1 481 ? 19.405  -11.315 -45.414 1.00 41.14  ? 481  GLN A NE2   1 
ATOM   3970 N  N     . ARG A 1 482 ? 13.901  -13.855 -48.038 1.00 28.84  ? 482  ARG A N     1 
ATOM   3971 C  CA    . ARG A 1 482 ? 12.543  -14.374 -47.918 1.00 26.79  ? 482  ARG A CA    1 
ATOM   3972 C  C     . ARG A 1 482 ? 12.272  -15.376 -49.031 1.00 27.07  ? 482  ARG A C     1 
ATOM   3973 O  O     . ARG A 1 482 ? 11.797  -16.489 -48.771 1.00 25.39  ? 482  ARG A O     1 
ATOM   3974 C  CB    . ARG A 1 482 ? 11.518  -13.238 -47.938 1.00 25.03  ? 482  ARG A CB    1 
ATOM   3975 C  CG    . ARG A 1 482 ? 10.080  -13.671 -47.640 1.00 25.43  ? 482  ARG A CG    1 
ATOM   3976 C  CD    . ARG A 1 482 ? 9.275   -13.868 -48.914 1.00 27.27  ? 482  ARG A CD    1 
ATOM   3977 N  NE    . ARG A 1 482 ? 7.949   -14.424 -48.652 1.00 24.17  ? 482  ARG A NE    1 
ATOM   3978 C  CZ    . ARG A 1 482 ? 6.856   -14.107 -49.341 1.00 26.21  ? 482  ARG A CZ    1 
ATOM   3979 N  NH1   . ARG A 1 482 ? 6.917   -13.211 -50.327 1.00 27.11  ? 482  ARG A NH1   1 
ATOM   3980 N  NH2   . ARG A 1 482 ? 5.691   -14.669 -49.033 1.00 24.13  ? 482  ARG A NH2   1 
ATOM   3981 N  N     . LYS A 1 483 ? 12.620  -14.981 -50.253 1.00 27.04  ? 483  LYS A N     1 
ATOM   3982 C  CA    . LYS A 1 483 ? 12.344  -15.759 -51.459 1.00 29.71  ? 483  LYS A CA    1 
ATOM   3983 C  C     . LYS A 1 483 ? 13.008  -17.139 -51.437 1.00 29.81  ? 483  LYS A C     1 
ATOM   3984 O  O     . LYS A 1 483 ? 12.401  -18.131 -51.846 1.00 30.48  ? 483  LYS A O     1 
ATOM   3985 C  CB    . LYS A 1 483 ? 12.748  -14.963 -52.714 1.00 30.52  ? 483  LYS A CB    1 
ATOM   3986 C  CG    . LYS A 1 483 ? 12.352  -15.630 -54.035 1.00 37.38  ? 483  LYS A CG    1 
ATOM   3987 C  CD    . LYS A 1 483 ? 12.731  -14.785 -55.251 1.00 45.57  ? 483  LYS A CD    1 
ATOM   3988 C  CE    . LYS A 1 483 ? 12.300  -15.472 -56.547 1.00 50.27  ? 483  LYS A CE    1 
ATOM   3989 N  NZ    . LYS A 1 483 ? 12.512  -14.610 -57.751 1.00 54.79  ? 483  LYS A NZ    1 
ATOM   3990 N  N     . GLU A 1 484 ? 14.245  -17.198 -50.951 1.00 30.84  ? 484  GLU A N     1 
ATOM   3991 C  CA    . GLU A 1 484 ? 14.957  -18.462 -50.807 1.00 33.41  ? 484  GLU A CA    1 
ATOM   3992 C  C     . GLU A 1 484 ? 14.189  -19.411 -49.876 1.00 33.06  ? 484  GLU A C     1 
ATOM   3993 O  O     . GLU A 1 484 ? 13.926  -20.565 -50.228 1.00 33.86  ? 484  GLU A O     1 
ATOM   3994 C  CB    . GLU A 1 484 ? 16.371  -18.215 -50.269 1.00 35.42  ? 484  GLU A CB    1 
ATOM   3995 C  CG    . GLU A 1 484 ? 17.282  -19.452 -50.273 1.00 40.22  ? 484  GLU A CG    1 
ATOM   3996 C  CD    . GLU A 1 484 ? 18.589  -19.240 -49.508 1.00 48.96  ? 484  GLU A CD    1 
ATOM   3997 O  OE1   . GLU A 1 484 ? 18.791  -18.144 -48.937 1.00 51.34  ? 484  GLU A OE1   1 
ATOM   3998 O  OE2   . GLU A 1 484 ? 19.420  -20.174 -49.473 1.00 50.71  ? 484  GLU A OE2   1 
ATOM   3999 N  N     . HIS A 1 485 ? 13.815  -18.911 -48.700 1.00 30.33  ? 485  HIS A N     1 
ATOM   4000 C  CA    . HIS A 1 485 ? 13.129  -19.733 -47.702 1.00 27.06  ? 485  HIS A CA    1 
ATOM   4001 C  C     . HIS A 1 485 ? 11.734  -20.167 -48.145 1.00 26.77  ? 485  HIS A C     1 
ATOM   4002 O  O     . HIS A 1 485 ? 11.319  -21.310 -47.878 1.00 24.92  ? 485  HIS A O     1 
ATOM   4003 C  CB    . HIS A 1 485 ? 13.093  -19.021 -46.356 1.00 27.50  ? 485  HIS A CB    1 
ATOM   4004 C  CG    . HIS A 1 485 ? 14.442  -18.877 -45.722 1.00 28.11  ? 485  HIS A CG    1 
ATOM   4005 N  ND1   . HIS A 1 485 ? 15.100  -19.933 -45.128 1.00 32.37  ? 485  HIS A ND1   1 
ATOM   4006 C  CD2   . HIS A 1 485 ? 15.253  -17.802 -45.582 1.00 28.59  ? 485  HIS A CD2   1 
ATOM   4007 C  CE1   . HIS A 1 485 ? 16.260  -19.517 -44.654 1.00 30.03  ? 485  HIS A CE1   1 
ATOM   4008 N  NE2   . HIS A 1 485 ? 16.378  -18.228 -44.918 1.00 33.89  ? 485  HIS A NE2   1 
ATOM   4009 N  N     . LYS A 1 486 ? 11.027  -19.280 -48.847 1.00 23.69  ? 486  LYS A N     1 
ATOM   4010 C  CA    . LYS A 1 486 ? 9.729   -19.647 -49.403 1.00 25.21  ? 486  LYS A CA    1 
ATOM   4011 C  C     . LYS A 1 486 ? 9.871   -20.817 -50.381 1.00 23.37  ? 486  LYS A C     1 
ATOM   4012 O  O     . LYS A 1 486 ? 9.067   -21.741 -50.352 1.00 25.36  ? 486  LYS A O     1 
ATOM   4013 C  CB    . LYS A 1 486 ? 9.000   -18.461 -50.053 1.00 24.46  ? 486  LYS A CB    1 
ATOM   4014 C  CG    . LYS A 1 486 ? 7.536   -18.784 -50.352 1.00 26.50  ? 486  LYS A CG    1 
ATOM   4015 C  CD    . LYS A 1 486 ? 6.799   -17.709 -51.141 1.00 29.41  ? 486  LYS A CD    1 
ATOM   4016 C  CE    . LYS A 1 486 ? 5.320   -18.098 -51.281 1.00 30.88  ? 486  LYS A CE    1 
ATOM   4017 N  NZ    . LYS A 1 486 ? 4.438   -17.096 -51.980 1.00 28.61  ? 486  LYS A NZ    1 
ATOM   4018 N  N     . GLY A 1 487 ? 10.905  -20.776 -51.218 1.00 25.38  ? 487  GLY A N     1 
ATOM   4019 C  CA    . GLY A 1 487 ? 11.217  -21.874 -52.141 1.00 25.79  ? 487  GLY A CA    1 
ATOM   4020 C  C     . GLY A 1 487 ? 11.397  -23.201 -51.418 1.00 26.57  ? 487  GLY A C     1 
ATOM   4021 O  O     . GLY A 1 487 ? 10.830  -24.214 -51.824 1.00 29.07  ? 487  GLY A O     1 
ATOM   4022 N  N     . TYR A 1 488 ? 12.174  -23.190 -50.336 1.00 26.67  ? 488  TYR A N     1 
ATOM   4023 C  CA    . TYR A 1 488 ? 12.340  -24.372 -49.484 1.00 26.89  ? 488  TYR A CA    1 
ATOM   4024 C  C     . TYR A 1 488 ? 11.019  -24.839 -48.910 1.00 25.23  ? 488  TYR A C     1 
ATOM   4025 O  O     . TYR A 1 488 ? 10.753  -26.049 -48.877 1.00 26.09  ? 488  TYR A O     1 
ATOM   4026 C  CB    . TYR A 1 488 ? 13.330  -24.128 -48.333 1.00 26.09  ? 488  TYR A CB    1 
ATOM   4027 C  CG    . TYR A 1 488 ? 14.728  -23.736 -48.763 1.00 29.14  ? 488  TYR A CG    1 
ATOM   4028 C  CD1   . TYR A 1 488 ? 15.290  -24.229 -49.945 1.00 31.66  ? 488  TYR A CD1   1 
ATOM   4029 C  CD2   . TYR A 1 488 ? 15.498  -22.882 -47.973 1.00 32.23  ? 488  TYR A CD2   1 
ATOM   4030 C  CE1   . TYR A 1 488 ? 16.580  -23.865 -50.336 1.00 33.96  ? 488  TYR A CE1   1 
ATOM   4031 C  CE2   . TYR A 1 488 ? 16.786  -22.512 -48.352 1.00 34.11  ? 488  TYR A CE2   1 
ATOM   4032 C  CZ    . TYR A 1 488 ? 17.321  -23.006 -49.529 1.00 35.25  ? 488  TYR A CZ    1 
ATOM   4033 O  OH    . TYR A 1 488 ? 18.595  -22.641 -49.896 1.00 39.32  ? 488  TYR A OH    1 
ATOM   4034 N  N     . MET A 1 489 ? 10.199  -23.887 -48.458 1.00 24.28  ? 489  MET A N     1 
ATOM   4035 C  CA    . MET A 1 489 ? 8.914   -24.214 -47.842 1.00 25.58  ? 489  MET A CA    1 
ATOM   4036 C  C     . MET A 1 489 ? 7.964   -24.906 -48.821 1.00 26.46  ? 489  MET A C     1 
ATOM   4037 O  O     . MET A 1 489 ? 7.352   -25.919 -48.481 1.00 26.30  ? 489  MET A O     1 
ATOM   4038 C  CB    . MET A 1 489 ? 8.244   -22.974 -47.249 1.00 26.12  ? 489  MET A CB    1 
ATOM   4039 C  CG    . MET A 1 489 ? 6.864   -23.258 -46.652 1.00 26.86  ? 489  MET A CG    1 
ATOM   4040 S  SD    . MET A 1 489 ? 5.852   -21.792 -46.394 1.00 39.31  ? 489  MET A SD    1 
ATOM   4041 C  CE    . MET A 1 489 ? 5.257   -21.413 -48.042 1.00 28.21  ? 489  MET A CE    1 
ATOM   4042 N  N     . LEU A 1 490 ? 7.843   -24.348 -50.023 1.00 26.37  ? 490  LEU A N     1 
ATOM   4043 C  CA    . LEU A 1 490 ? 6.947   -24.894 -51.040 1.00 28.33  ? 490  LEU A CA    1 
ATOM   4044 C  C     . LEU A 1 490 ? 7.383   -26.268 -51.554 1.00 27.77  ? 490  LEU A C     1 
ATOM   4045 O  O     . LEU A 1 490 ? 6.538   -27.133 -51.805 1.00 27.35  ? 490  LEU A O     1 
ATOM   4046 C  CB    . LEU A 1 490 ? 6.772   -23.914 -52.205 1.00 28.00  ? 490  LEU A CB    1 
ATOM   4047 C  CG    . LEU A 1 490 ? 5.938   -22.652 -51.955 1.00 31.78  ? 490  LEU A CG    1 
ATOM   4048 C  CD1   . LEU A 1 490 ? 5.866   -21.801 -53.216 1.00 32.42  ? 490  LEU A CD1   1 
ATOM   4049 C  CD2   . LEU A 1 490 ? 4.531   -22.990 -51.478 1.00 32.99  ? 490  LEU A CD2   1 
ATOM   4050 N  N     . ALA A 1 491 ? 8.692   -26.468 -51.704 1.00 27.18  ? 491  ALA A N     1 
ATOM   4051 C  CA    . ALA A 1 491 ? 9.216   -27.772 -52.112 1.00 28.63  ? 491  ALA A CA    1 
ATOM   4052 C  C     . ALA A 1 491 ? 8.916   -28.834 -51.053 1.00 28.74  ? 491  ALA A C     1 
ATOM   4053 O  O     . ALA A 1 491 ? 8.568   -29.964 -51.393 1.00 30.11  ? 491  ALA A O     1 
ATOM   4054 C  CB    . ALA A 1 491 ? 10.710  -27.695 -52.396 1.00 28.04  ? 491  ALA A CB    1 
ATOM   4055 N  N     . ALA A 1 492 ? 9.034   -28.464 -49.775 1.00 28.02  ? 492  ALA A N     1 
ATOM   4056 C  CA    . ALA A 1 492 ? 8.674   -29.358 -48.663 1.00 29.94  ? 492  ALA A CA    1 
ATOM   4057 C  C     . ALA A 1 492 ? 7.189   -29.725 -48.683 1.00 29.88  ? 492  ALA A C     1 
ATOM   4058 O  O     . ALA A 1 492 ? 6.804   -30.865 -48.386 1.00 31.08  ? 492  ALA A O     1 
ATOM   4059 C  CB    . ALA A 1 492 ? 9.056   -28.731 -47.325 1.00 29.08  ? 492  ALA A CB    1 
ATOM   4060 N  N     . GLN A 1 493 ? 6.369   -28.745 -49.039 1.00 27.38  ? 493  GLN A N     1 
ATOM   4061 C  CA    . GLN A 1 493 ? 4.929   -28.916 -49.178 1.00 28.56  ? 493  GLN A CA    1 
ATOM   4062 C  C     . GLN A 1 493 ? 4.581   -29.838 -50.368 1.00 28.87  ? 493  GLN A C     1 
ATOM   4063 O  O     . GLN A 1 493 ? 3.745   -30.744 -50.249 1.00 27.59  ? 493  GLN A O     1 
ATOM   4064 C  CB    . GLN A 1 493 ? 4.293   -27.526 -49.318 1.00 28.04  ? 493  GLN A CB    1 
ATOM   4065 C  CG    . GLN A 1 493 ? 2.783   -27.458 -49.496 1.00 32.21  ? 493  GLN A CG    1 
ATOM   4066 C  CD    . GLN A 1 493 ? 2.300   -26.014 -49.581 1.00 37.49  ? 493  GLN A CD    1 
ATOM   4067 O  OE1   . GLN A 1 493 ? 1.852   -25.559 -50.634 1.00 38.30  ? 493  GLN A OE1   1 
ATOM   4068 N  NE2   . GLN A 1 493 ? 2.423   -25.278 -48.476 1.00 35.64  ? 493  GLN A NE2   1 
ATOM   4069 N  N     . ARG A 1 494 ? 5.226   -29.606 -51.507 1.00 28.02  ? 494  ARG A N     1 
ATOM   4070 C  CA    . ARG A 1 494 ? 5.042   -30.466 -52.679 1.00 30.39  ? 494  ARG A CA    1 
ATOM   4071 C  C     . ARG A 1 494 ? 5.484   -31.901 -52.392 1.00 30.96  ? 494  ARG A C     1 
ATOM   4072 O  O     . ARG A 1 494 ? 4.814   -32.846 -52.796 1.00 33.16  ? 494  ARG A O     1 
ATOM   4073 C  CB    . ARG A 1 494 ? 5.801   -29.924 -53.892 1.00 28.06  ? 494  ARG A CB    1 
ATOM   4074 C  CG    . ARG A 1 494 ? 5.203   -28.672 -54.507 1.00 29.06  ? 494  ARG A CG    1 
ATOM   4075 C  CD    . ARG A 1 494 ? 5.877   -28.364 -55.846 1.00 31.05  ? 494  ARG A CD    1 
ATOM   4076 N  NE    . ARG A 1 494 ? 7.302   -28.061 -55.695 1.00 25.12  ? 494  ARG A NE    1 
ATOM   4077 C  CZ    . ARG A 1 494 ? 7.794   -26.844 -55.475 1.00 29.46  ? 494  ARG A CZ    1 
ATOM   4078 N  NH1   . ARG A 1 494 ? 6.985   -25.795 -55.388 1.00 25.41  ? 494  ARG A NH1   1 
ATOM   4079 N  NH2   . ARG A 1 494 ? 9.104   -26.672 -55.362 1.00 29.18  ? 494  ARG A NH2   1 
ATOM   4080 N  N     . ASN A 1 495 ? 6.614   -32.044 -51.702 1.00 30.63  ? 495  ASN A N     1 
ATOM   4081 C  CA    . ASN A 1 495 ? 7.119   -33.345 -51.272 1.00 30.80  ? 495  ASN A CA    1 
ATOM   4082 C  C     . ASN A 1 495 ? 6.163   -34.058 -50.323 1.00 31.65  ? 495  ASN A C     1 
ATOM   4083 O  O     . ASN A 1 495 ? 6.024   -35.291 -50.380 1.00 30.97  ? 495  ASN A O     1 
ATOM   4084 C  CB    . ASN A 1 495 ? 8.506   -33.204 -50.626 1.00 30.93  ? 495  ASN A CB    1 
ATOM   4085 C  CG    . ASN A 1 495 ? 9.601   -32.930 -51.644 1.00 30.77  ? 495  ASN A CG    1 
ATOM   4086 O  OD1   . ASN A 1 495 ? 9.479   -33.288 -52.815 1.00 31.45  ? 495  ASN A OD1   1 
ATOM   4087 N  ND2   . ASN A 1 495 ? 10.676  -32.287 -51.201 1.00 33.42  ? 495  ASN A ND2   1 
ATOM   4088 N  N     . GLY A 1 496 ? 5.521   -33.278 -49.450 1.00 31.48  ? 496  GLY A N     1 
ATOM   4089 C  CA    . GLY A 1 496 ? 4.497   -33.790 -48.539 1.00 31.07  ? 496  GLY A CA    1 
ATOM   4090 C  C     . GLY A 1 496 ? 3.352   -34.462 -49.282 1.00 33.68  ? 496  GLY A C     1 
ATOM   4091 O  O     . GLY A 1 496 ? 2.903   -35.544 -48.894 1.00 36.41  ? 496  GLY A O     1 
ATOM   4092 N  N     . GLU A 1 497 ? 2.901   -33.831 -50.368 1.00 33.00  ? 497  GLU A N     1 
ATOM   4093 C  CA    . GLU A 1 497 ? 1.796   -34.351 -51.183 1.00 34.48  ? 497  GLU A CA    1 
ATOM   4094 C  C     . GLU A 1 497 ? 2.157   -35.639 -51.928 1.00 35.43  ? 497  GLU A C     1 
ATOM   4095 O  O     . GLU A 1 497 ? 1.296   -36.488 -52.154 1.00 34.88  ? 497  GLU A O     1 
ATOM   4096 C  CB    . GLU A 1 497 ? 1.276   -33.284 -52.152 1.00 33.59  ? 497  GLU A CB    1 
ATOM   4097 C  CG    . GLU A 1 497 ? 0.698   -32.035 -51.467 1.00 33.55  ? 497  GLU A CG    1 
ATOM   4098 C  CD    . GLU A 1 497 ? -0.415  -32.334 -50.442 1.00 35.23  ? 497  GLU A CD    1 
ATOM   4099 O  OE1   . GLU A 1 497 ? -1.295  -33.179 -50.714 1.00 32.82  ? 497  GLU A OE1   1 
ATOM   4100 O  OE2   . GLU A 1 497 ? -0.413  -31.703 -49.363 1.00 33.92  ? 497  GLU A OE2   1 
ATOM   4101 N  N     . ILE A 1 498 ? 3.429   -35.781 -52.296 1.00 35.67  ? 498  ILE A N     1 
ATOM   4102 C  CA    . ILE A 1 498 ? 3.918   -37.020 -52.902 1.00 38.18  ? 498  ILE A CA    1 
ATOM   4103 C  C     . ILE A 1 498 ? 3.869   -38.183 -51.899 1.00 38.30  ? 498  ILE A C     1 
ATOM   4104 O  O     . ILE A 1 498 ? 3.527   -39.311 -52.259 1.00 41.89  ? 498  ILE A O     1 
ATOM   4105 C  CB    . ILE A 1 498 ? 5.343   -36.851 -53.491 1.00 37.82  ? 498  ILE A CB    1 
ATOM   4106 C  CG1   . ILE A 1 498 ? 5.329   -35.828 -54.633 1.00 37.19  ? 498  ILE A CG1   1 
ATOM   4107 C  CG2   . ILE A 1 498 ? 5.887   -38.192 -53.991 1.00 34.69  ? 498  ILE A CG2   1 
ATOM   4108 C  CD1   . ILE A 1 498 ? 6.707   -35.349 -55.051 1.00 35.39  ? 498  ILE A CD1   1 
ATOM   4109 N  N     . ILE A 1 499 ? 4.207   -37.901 -50.645 1.00 36.56  ? 499  ILE A N     1 
ATOM   4110 C  CA    . ILE A 1 499 ? 4.119   -38.899 -49.588 1.00 37.29  ? 499  ILE A CA    1 
ATOM   4111 C  C     . ILE A 1 499 ? 2.656   -39.251 -49.273 1.00 40.08  ? 499  ILE A C     1 
ATOM   4112 O  O     . ILE A 1 499 ? 2.330   -40.429 -49.093 1.00 40.13  ? 499  ILE A O     1 
ATOM   4113 C  CB    . ILE A 1 499 ? 4.882   -38.464 -48.315 1.00 35.61  ? 499  ILE A CB    1 
ATOM   4114 C  CG1   . ILE A 1 499 ? 6.365   -38.238 -48.637 1.00 34.42  ? 499  ILE A CG1   1 
ATOM   4115 C  CG2   . ILE A 1 499 ? 4.734   -39.505 -47.216 1.00 34.93  ? 499  ILE A CG2   1 
ATOM   4116 C  CD1   . ILE A 1 499 ? 7.083   -37.321 -47.650 1.00 33.20  ? 499  ILE A CD1   1 
ATOM   4117 N  N     . LYS A 1 500 ? 1.783   -38.240 -49.213 1.00 40.13  ? 500  LYS A N     1 
ATOM   4118 C  CA    . LYS A 1 500 ? 0.341   -38.483 -49.038 1.00 41.92  ? 500  LYS A CA    1 
ATOM   4119 C  C     . LYS A 1 500 ? -0.231  -39.393 -50.140 1.00 44.08  ? 500  LYS A C     1 
ATOM   4120 O  O     . LYS A 1 500 ? -0.932  -40.361 -49.840 1.00 46.29  ? 500  LYS A O     1 
ATOM   4121 C  CB    . LYS A 1 500 ? -0.447  -37.172 -48.965 1.00 40.68  ? 500  LYS A CB    1 
ATOM   4122 C  CG    . LYS A 1 500 ? -0.226  -36.361 -47.699 1.00 39.19  ? 500  LYS A CG    1 
ATOM   4123 C  CD    . LYS A 1 500 ? -1.059  -35.082 -47.714 1.00 37.97  ? 500  LYS A CD    1 
ATOM   4124 C  CE    . LYS A 1 500 ? -0.530  -34.054 -46.718 1.00 36.66  ? 500  LYS A CE    1 
ATOM   4125 N  NZ    . LYS A 1 500 ? -1.247  -32.740 -46.817 1.00 35.30  ? 500  LYS A NZ    1 
ATOM   4126 N  N     . GLU A 1 501 ? 0.088   -39.091 -51.402 1.00 44.89  ? 501  GLU A N     1 
ATOM   4127 C  CA    . GLU A 1 501 ? -0.346  -39.906 -52.548 1.00 47.96  ? 501  GLU A CA    1 
ATOM   4128 C  C     . GLU A 1 501 ? 0.094   -41.359 -52.415 1.00 47.91  ? 501  GLU A C     1 
ATOM   4129 O  O     . GLU A 1 501 ? -0.685  -42.273 -52.675 1.00 48.52  ? 501  GLU A O     1 
ATOM   4130 C  CB    . GLU A 1 501 ? 0.179   -39.336 -53.875 1.00 49.23  ? 501  GLU A CB    1 
ATOM   4131 C  CG    . GLU A 1 501 ? -0.580  -38.118 -54.418 1.00 54.79  ? 501  GLU A CG    1 
ATOM   4132 C  CD    . GLU A 1 501 ? -1.876  -38.469 -55.150 1.00 60.99  ? 501  GLU A CD    1 
ATOM   4133 O  OE1   . GLU A 1 501 ? -2.159  -39.671 -55.366 1.00 62.63  ? 501  GLU A OE1   1 
ATOM   4134 O  OE2   . GLU A 1 501 ? -2.613  -37.525 -55.516 1.00 62.95  ? 501  GLU A OE2   1 
ATOM   4135 N  N     . ALA A 1 502 ? 1.342   -41.557 -52.000 1.00 48.07  ? 502  ALA A N     1 
ATOM   4136 C  CA    . ALA A 1 502 ? 1.915   -42.891 -51.838 1.00 49.27  ? 502  ALA A CA    1 
ATOM   4137 C  C     . ALA A 1 502 ? 1.262   -43.677 -50.698 1.00 51.81  ? 502  ALA A C     1 
ATOM   4138 O  O     . ALA A 1 502 ? 1.131   -44.904 -50.776 1.00 52.63  ? 502  ALA A O     1 
ATOM   4139 C  CB    . ALA A 1 502 ? 3.408   -42.794 -51.626 1.00 46.97  ? 502  ALA A CB    1 
ATOM   4140 N  N     . LEU A 1 503 ? 0.845   -42.966 -49.651 1.00 52.75  ? 503  LEU A N     1 
ATOM   4141 C  CA    . LEU A 1 503 ? 0.211   -43.582 -48.484 1.00 54.27  ? 503  LEU A CA    1 
ATOM   4142 C  C     . LEU A 1 503 ? -1.094  -44.318 -48.787 1.00 56.97  ? 503  LEU A C     1 
ATOM   4143 O  O     . LEU A 1 503 ? -1.566  -45.094 -47.958 1.00 57.87  ? 503  LEU A O     1 
ATOM   4144 C  CB    . LEU A 1 503 ? -0.019  -42.543 -47.383 1.00 53.08  ? 503  LEU A CB    1 
ATOM   4145 C  CG    . LEU A 1 503 ? 1.110   -42.382 -46.363 1.00 51.90  ? 503  LEU A CG    1 
ATOM   4146 C  CD1   . LEU A 1 503 ? 1.010   -41.039 -45.650 1.00 50.43  ? 503  LEU A CD1   1 
ATOM   4147 C  CD2   . LEU A 1 503 ? 1.103   -43.534 -45.365 1.00 51.41  ? 503  LEU A CD2   1 
ATOM   4148 N  N     . HIS A 1 504 ? -1.672  -44.070 -49.962 1.00 59.37  ? 504  HIS A N     1 
ATOM   4149 C  CA    . HIS A 1 504 ? -2.885  -44.770 -50.383 1.00 63.98  ? 504  HIS A CA    1 
ATOM   4150 C  C     . HIS A 1 504 ? -2.589  -46.230 -50.706 1.00 65.36  ? 504  HIS A C     1 
ATOM   4151 O  O     . HIS A 1 504 ? -3.458  -47.090 -50.567 1.00 66.76  ? 504  HIS A O     1 
ATOM   4152 C  CB    . HIS A 1 504 ? -3.546  -44.080 -51.580 1.00 65.15  ? 504  HIS A CB    1 
ATOM   4153 C  CG    . HIS A 1 504 ? -3.995  -42.678 -51.300 1.00 67.97  ? 504  HIS A CG    1 
ATOM   4154 N  ND1   . HIS A 1 504 ? -4.453  -42.272 -50.064 1.00 70.42  ? 504  HIS A ND1   1 
ATOM   4155 C  CD2   . HIS A 1 504 ? -4.073  -41.591 -52.104 1.00 68.56  ? 504  HIS A CD2   1 
ATOM   4156 C  CE1   . HIS A 1 504 ? -4.779  -40.993 -50.115 1.00 70.21  ? 504  HIS A CE1   1 
ATOM   4157 N  NE2   . HIS A 1 504 ? -4.559  -40.556 -51.342 1.00 69.82  ? 504  HIS A NE2   1 
ATOM   4158 N  N     . ASN A 1 505 ? -1.354  -46.495 -51.128 1.00 65.95  ? 505  ASN A N     1 
ATOM   4159 C  CA    . ASN A 1 505 ? -0.883  -47.854 -51.389 1.00 67.44  ? 505  ASN A CA    1 
ATOM   4160 C  C     . ASN A 1 505 ? 0.419   -48.163 -50.642 1.00 66.21  ? 505  ASN A C     1 
ATOM   4161 O  O     . ASN A 1 505 ? 1.489   -48.219 -51.257 1.00 65.61  ? 505  ASN A O     1 
ATOM   4162 C  CB    . ASN A 1 505 ? -0.705  -48.083 -52.896 1.00 68.58  ? 505  ASN A CB    1 
ATOM   4163 C  CG    . ASN A 1 505 ? -2.028  -48.118 -53.644 1.00 72.60  ? 505  ASN A CG    1 
ATOM   4164 O  OD1   . ASN A 1 505 ? -2.402  -47.153 -54.315 1.00 73.60  ? 505  ASN A OD1   1 
ATOM   4165 N  ND2   . ASN A 1 505 ? -2.748  -49.232 -53.525 1.00 74.14  ? 505  ASN A ND2   1 
ATOM   4166 N  N     . PRO A 1 506 ? 0.336   -48.358 -49.309 1.00 65.99  ? 506  PRO A N     1 
ATOM   4167 C  CA    . PRO A 1 506 ? 1.553   -48.663 -48.562 1.00 65.52  ? 506  PRO A CA    1 
ATOM   4168 C  C     . PRO A 1 506 ? 1.941   -50.136 -48.663 1.00 67.15  ? 506  PRO A C     1 
ATOM   4169 O  O     . PRO A 1 506 ? 1.115   -51.018 -48.414 1.00 69.39  ? 506  PRO A O     1 
ATOM   4170 C  CB    . PRO A 1 506 ? 1.190   -48.287 -47.123 1.00 65.08  ? 506  PRO A CB    1 
ATOM   4171 C  CG    . PRO A 1 506 ? -0.297  -48.400 -47.047 1.00 66.21  ? 506  PRO A CG    1 
ATOM   4172 C  CD    . PRO A 1 506 ? -0.852  -48.277 -48.437 1.00 66.78  ? 506  PRO A CD    1 
ATOM   4173 N  N     . ASN A 1 507 ? 3.191   -50.390 -49.039 1.00 67.70  ? 507  ASN A N     1 
ATOM   4174 C  CA    . ASN A 1 507 ? 3.710   -51.751 -49.148 1.00 69.35  ? 507  ASN A CA    1 
ATOM   4175 C  C     . ASN A 1 507 ? 3.912   -52.369 -47.771 1.00 71.24  ? 507  ASN A C     1 
ATOM   4176 O  O     . ASN A 1 507 ? 4.120   -51.658 -46.788 1.00 70.70  ? 507  ASN A O     1 
ATOM   4177 C  CB    . ASN A 1 507 ? 5.021   -51.771 -49.940 1.00 68.01  ? 507  ASN A CB    1 
ATOM   4178 C  CG    . ASN A 1 507 ? 4.881   -51.153 -51.324 1.00 67.33  ? 507  ASN A CG    1 
ATOM   4179 O  OD1   . ASN A 1 507 ? 4.252   -50.101 -51.493 1.00 63.30  ? 507  ASN A OD1   1 
ATOM   4180 N  ND2   . ASN A 1 507 ? 5.478   -51.800 -52.323 1.00 64.47  ? 507  ASN A ND2   1 
ATOM   4181 N  N     . LEU A 1 508 ? 3.832   -53.693 -47.695 1.00 73.42  ? 508  LEU A N     1 
ATOM   4182 C  CA    . LEU A 1 508 ? 3.997   -54.372 -46.417 1.00 75.03  ? 508  LEU A CA    1 
ATOM   4183 C  C     . LEU A 1 508 ? 5.400   -54.944 -46.275 1.00 75.54  ? 508  LEU A C     1 
ATOM   4184 O  O     . LEU A 1 508 ? 5.750   -55.940 -46.915 1.00 77.05  ? 508  LEU A O     1 
ATOM   4185 C  CB    . LEU A 1 508 ? 2.926   -55.445 -46.223 1.00 76.39  ? 508  LEU A CB    1 
ATOM   4186 C  CG    . LEU A 1 508 ? 1.545   -54.984 -45.746 1.00 77.54  ? 508  LEU A CG    1 
ATOM   4187 C  CD1   . LEU A 1 508 ? 0.576   -56.152 -45.805 1.00 78.27  ? 508  LEU A CD1   1 
ATOM   4188 C  CD2   . LEU A 1 508 ? 1.590   -54.383 -44.335 1.00 75.93  ? 508  LEU A CD2   1 
ATOM   4189 N  N     . SER A 1 509 ? 6.197   -54.284 -45.437 1.00 75.19  ? 509  SER A N     1 
ATOM   4190 C  CA    . SER A 1 509 ? 7.603   -54.625 -45.230 1.00 75.26  ? 509  SER A CA    1 
ATOM   4191 C  C     . SER A 1 509 ? 8.173   -53.863 -44.038 1.00 74.75  ? 509  SER A C     1 
ATOM   4192 O  O     . SER A 1 509 ? 7.556   -52.915 -43.539 1.00 75.21  ? 509  SER A O     1 
ATOM   4193 C  CB    . SER A 1 509 ? 8.425   -54.299 -46.482 1.00 74.55  ? 509  SER A CB    1 
ATOM   4194 O  OG    . SER A 1 509 ? 8.316   -52.926 -46.814 1.00 74.18  ? 509  SER A OG    1 
ATOM   4195 N  N     . VAL A 1 510 ? 9.349   -54.290 -43.585 1.00 74.36  ? 510  VAL A N     1 
ATOM   4196 C  CA    . VAL A 1 510 ? 10.106  -53.544 -42.585 1.00 73.89  ? 510  VAL A CA    1 
ATOM   4197 C  C     . VAL A 1 510 ? 11.233  -52.804 -43.299 1.00 72.11  ? 510  VAL A C     1 
ATOM   4198 O  O     . VAL A 1 510 ? 12.148  -53.419 -43.856 1.00 71.92  ? 510  VAL A O     1 
ATOM   4199 C  CB    . VAL A 1 510 ? 10.651  -54.448 -41.445 1.00 75.93  ? 510  VAL A CB    1 
ATOM   4200 C  CG1   . VAL A 1 510 ? 11.521  -53.641 -40.478 1.00 76.75  ? 510  VAL A CG1   1 
ATOM   4201 C  CG2   . VAL A 1 510 ? 9.502   -55.106 -40.690 1.00 77.45  ? 510  VAL A CG2   1 
ATOM   4202 N  N     . ASP A 1 511 ? 11.136  -51.477 -43.289 1.00 69.23  ? 511  ASP A N     1 
ATOM   4203 C  CA    . ASP A 1 511 ? 12.094  -50.608 -43.961 1.00 66.77  ? 511  ASP A CA    1 
ATOM   4204 C  C     . ASP A 1 511 ? 12.319  -49.336 -43.151 1.00 64.88  ? 511  ASP A C     1 
ATOM   4205 O  O     . ASP A 1 511 ? 11.694  -49.137 -42.104 1.00 65.67  ? 511  ASP A O     1 
ATOM   4206 C  CB    . ASP A 1 511 ? 11.607  -50.268 -45.377 1.00 66.08  ? 511  ASP A CB    1 
ATOM   4207 C  CG    . ASP A 1 511 ? 10.128  -49.906 -45.424 1.00 64.62  ? 511  ASP A CG    1 
ATOM   4208 O  OD1   . ASP A 1 511 ? 9.596   -49.373 -44.427 1.00 64.53  ? 511  ASP A OD1   1 
ATOM   4209 O  OD2   . ASP A 1 511 ? 9.494   -50.154 -46.470 1.00 64.22  ? 511  ASP A OD2   1 
ATOM   4210 N  N     . GLU A 1 512 ? 13.214  -48.484 -43.637 1.00 61.89  ? 512  GLU A N     1 
ATOM   4211 C  CA    . GLU A 1 512 ? 13.522  -47.224 -42.972 1.00 59.82  ? 512  GLU A CA    1 
ATOM   4212 C  C     . GLU A 1 512 ? 13.171  -46.026 -43.858 1.00 56.39  ? 512  GLU A C     1 
ATOM   4213 O  O     . GLU A 1 512 ? 13.226  -46.131 -45.087 1.00 55.17  ? 512  GLU A O     1 
ATOM   4214 C  CB    . GLU A 1 512 ? 14.998  -47.184 -42.558 1.00 61.65  ? 512  GLU A CB    1 
ATOM   4215 C  CG    . GLU A 1 512 ? 15.323  -47.997 -41.297 1.00 66.83  ? 512  GLU A CG    1 
ATOM   4216 C  CD    . GLU A 1 512 ? 14.742  -47.389 -40.020 1.00 69.62  ? 512  GLU A CD    1 
ATOM   4217 O  OE1   . GLU A 1 512 ? 14.021  -48.107 -39.291 1.00 69.30  ? 512  GLU A OE1   1 
ATOM   4218 O  OE2   . GLU A 1 512 ? 15.002  -46.193 -39.747 1.00 70.34  ? 512  GLU A OE2   1 
ATOM   4219 N  N     . PRO A 1 513 ? 12.792  -44.887 -43.239 1.00 54.40  ? 513  PRO A N     1 
ATOM   4220 C  CA    . PRO A 1 513 ? 12.553  -43.672 -44.012 1.00 52.43  ? 513  PRO A CA    1 
ATOM   4221 C  C     . PRO A 1 513 ? 13.810  -43.276 -44.775 1.00 52.35  ? 513  PRO A C     1 
ATOM   4222 O  O     . PRO A 1 513 ? 14.918  -43.450 -44.264 1.00 54.98  ? 513  PRO A O     1 
ATOM   4223 C  CB    . PRO A 1 513 ? 12.234  -42.627 -42.936 1.00 51.89  ? 513  PRO A CB    1 
ATOM   4224 C  CG    . PRO A 1 513 ? 12.752  -43.197 -41.667 1.00 52.94  ? 513  PRO A CG    1 
ATOM   4225 C  CD    . PRO A 1 513 ? 12.566  -44.662 -41.801 1.00 53.78  ? 513  PRO A CD    1 
ATOM   4226 N  N     . LEU A 1 514 ? 13.634  -42.777 -45.995 1.00 50.45  ? 514  LEU A N     1 
ATOM   4227 C  CA    . LEU A 1 514 ? 14.750  -42.338 -46.827 1.00 50.34  ? 514  LEU A CA    1 
ATOM   4228 C  C     . LEU A 1 514 ? 15.427  -41.125 -46.211 1.00 49.69  ? 514  LEU A C     1 
ATOM   4229 O  O     . LEU A 1 514 ? 14.755  -40.231 -45.702 1.00 48.40  ? 514  LEU A O     1 
ATOM   4230 C  CB    . LEU A 1 514 ? 14.252  -41.975 -48.227 1.00 50.01  ? 514  LEU A CB    1 
ATOM   4231 C  CG    . LEU A 1 514 ? 14.144  -43.014 -49.343 1.00 51.30  ? 514  LEU A CG    1 
ATOM   4232 C  CD1   . LEU A 1 514 ? 13.734  -44.408 -48.862 1.00 51.59  ? 514  LEU A CD1   1 
ATOM   4233 C  CD2   . LEU A 1 514 ? 13.172  -42.490 -50.384 1.00 51.93  ? 514  LEU A CD2   1 
ATOM   4234 N  N     . ASP A 1 515 ? 16.755  -41.106 -46.256 1.00 50.80  ? 515  ASP A N     1 
ATOM   4235 C  CA    . ASP A 1 515 ? 17.524  -39.964 -45.782 1.00 51.00  ? 515  ASP A CA    1 
ATOM   4236 C  C     . ASP A 1 515 ? 17.577  -38.923 -46.895 1.00 48.97  ? 515  ASP A C     1 
ATOM   4237 O  O     . ASP A 1 515 ? 18.433  -38.993 -47.785 1.00 49.63  ? 515  ASP A O     1 
ATOM   4238 C  CB    . ASP A 1 515 ? 18.934  -40.397 -45.361 1.00 54.82  ? 515  ASP A CB    1 
ATOM   4239 C  CG    . ASP A 1 515 ? 19.751  -39.254 -44.763 1.00 60.18  ? 515  ASP A CG    1 
ATOM   4240 O  OD1   . ASP A 1 515 ? 20.990  -39.266 -44.941 1.00 62.25  ? 515  ASP A OD1   1 
ATOM   4241 O  OD2   . ASP A 1 515 ? 19.164  -38.350 -44.119 1.00 60.96  ? 515  ASP A OD2   1 
ATOM   4242 N  N     . VAL A 1 516 ? 16.649  -37.970 -46.842 1.00 44.29  ? 516  VAL A N     1 
ATOM   4243 C  CA    . VAL A 1 516 ? 16.506  -36.967 -47.893 1.00 41.32  ? 516  VAL A CA    1 
ATOM   4244 C  C     . VAL A 1 516 ? 16.449  -35.534 -47.361 1.00 40.03  ? 516  VAL A C     1 
ATOM   4245 O  O     . VAL A 1 516 ? 16.042  -35.286 -46.220 1.00 39.33  ? 516  VAL A O     1 
ATOM   4246 C  CB    . VAL A 1 516 ? 15.253  -37.232 -48.769 1.00 41.14  ? 516  VAL A CB    1 
ATOM   4247 C  CG1   . VAL A 1 516 ? 15.448  -38.475 -49.619 1.00 43.26  ? 516  VAL A CG1   1 
ATOM   4248 C  CG2   . VAL A 1 516 ? 13.995  -37.358 -47.905 1.00 40.18  ? 516  VAL A CG2   1 
ATOM   4249 N  N     . ASP A 1 517 ? 16.861  -34.594 -48.207 1.00 38.33  ? 517  ASP A N     1 
ATOM   4250 C  CA    . ASP A 1 517 ? 16.716  -33.173 -47.920 1.00 35.49  ? 517  ASP A CA    1 
ATOM   4251 C  C     . ASP A 1 517 ? 15.350  -32.725 -48.440 1.00 33.40  ? 517  ASP A C     1 
ATOM   4252 O  O     . ASP A 1 517 ? 15.137  -32.592 -49.650 1.00 32.22  ? 517  ASP A O     1 
ATOM   4253 C  CB    . ASP A 1 517 ? 17.857  -32.367 -48.563 1.00 34.38  ? 517  ASP A CB    1 
ATOM   4254 C  CG    . ASP A 1 517 ? 17.931  -30.937 -48.047 1.00 34.89  ? 517  ASP A CG    1 
ATOM   4255 O  OD1   . ASP A 1 517 ? 19.046  -30.381 -47.998 1.00 39.51  ? 517  ASP A OD1   1 
ATOM   4256 O  OD2   . ASP A 1 517 ? 16.884  -30.363 -47.676 1.00 34.05  ? 517  ASP A OD2   1 
ATOM   4257 N  N     . TYR A 1 518 ? 14.422  -32.505 -47.517 1.00 31.54  ? 518  TYR A N     1 
ATOM   4258 C  CA    . TYR A 1 518 ? 13.044  -32.167 -47.873 1.00 30.47  ? 518  TYR A CA    1 
ATOM   4259 C  C     . TYR A 1 518 ? 12.874  -30.765 -48.482 1.00 30.07  ? 518  TYR A C     1 
ATOM   4260 O  O     . TYR A 1 518 ? 11.821  -30.463 -49.032 1.00 29.87  ? 518  TYR A O     1 
ATOM   4261 C  CB    . TYR A 1 518 ? 12.123  -32.346 -46.663 1.00 29.95  ? 518  TYR A CB    1 
ATOM   4262 C  CG    . TYR A 1 518 ? 11.992  -33.779 -46.199 1.00 28.56  ? 518  TYR A CG    1 
ATOM   4263 C  CD1   . TYR A 1 518 ? 12.820  -34.288 -45.206 1.00 31.65  ? 518  TYR A CD1   1 
ATOM   4264 C  CD2   . TYR A 1 518 ? 11.042  -34.625 -46.755 1.00 27.28  ? 518  TYR A CD2   1 
ATOM   4265 C  CE1   . TYR A 1 518 ? 12.701  -35.610 -44.777 1.00 32.70  ? 518  TYR A CE1   1 
ATOM   4266 C  CE2   . TYR A 1 518 ? 10.915  -35.940 -46.334 1.00 27.42  ? 518  TYR A CE2   1 
ATOM   4267 C  CZ    . TYR A 1 518 ? 11.746  -36.425 -45.349 1.00 30.99  ? 518  TYR A CZ    1 
ATOM   4268 O  OH    . TYR A 1 518 ? 11.624  -37.733 -44.932 1.00 37.29  ? 518  TYR A OH    1 
ATOM   4269 N  N     . ARG A 1 519 ? 13.915  -29.935 -48.406 1.00 29.42  ? 519  ARG A N     1 
ATOM   4270 C  CA    . ARG A 1 519 ? 13.880  -28.571 -48.953 1.00 31.06  ? 519  ARG A CA    1 
ATOM   4271 C  C     . ARG A 1 519 ? 13.972  -28.531 -50.476 1.00 31.70  ? 519  ARG A C     1 
ATOM   4272 O  O     . ARG A 1 519 ? 13.844  -27.460 -51.076 1.00 32.76  ? 519  ARG A O     1 
ATOM   4273 C  CB    . ARG A 1 519 ? 15.011  -27.711 -48.362 1.00 32.11  ? 519  ARG A CB    1 
ATOM   4274 C  CG    . ARG A 1 519 ? 14.936  -27.473 -46.835 1.00 34.08  ? 519  ARG A CG    1 
ATOM   4275 C  CD    . ARG A 1 519 ? 16.181  -26.740 -46.326 1.00 34.90  ? 519  ARG A CD    1 
ATOM   4276 N  NE    . ARG A 1 519 ? 17.405  -27.482 -46.642 1.00 38.83  ? 519  ARG A NE    1 
ATOM   4277 C  CZ    . ARG A 1 519 ? 18.629  -26.960 -46.684 1.00 40.65  ? 519  ARG A CZ    1 
ATOM   4278 N  NH1   . ARG A 1 519 ? 18.830  -25.666 -46.436 1.00 38.74  ? 519  ARG A NH1   1 
ATOM   4279 N  NH2   . ARG A 1 519 ? 19.656  -27.741 -46.986 1.00 39.94  ? 519  ARG A NH2   1 
ATOM   4280 N  N     . PHE A 1 520 ? 14.206  -29.686 -51.097 1.00 31.90  ? 520  PHE A N     1 
ATOM   4281 C  CA    . PHE A 1 520 ? 14.344  -29.774 -52.554 1.00 34.14  ? 520  PHE A CA    1 
ATOM   4282 C  C     . PHE A 1 520 ? 13.411  -30.833 -53.114 1.00 33.65  ? 520  PHE A C     1 
ATOM   4283 O  O     . PHE A 1 520 ? 13.240  -31.899 -52.511 1.00 32.70  ? 520  PHE A O     1 
ATOM   4284 C  CB    . PHE A 1 520 ? 15.799  -30.066 -52.962 1.00 36.33  ? 520  PHE A CB    1 
ATOM   4285 C  CG    . PHE A 1 520 ? 16.773  -29.020 -52.491 1.00 40.10  ? 520  PHE A CG    1 
ATOM   4286 C  CD1   . PHE A 1 520 ? 17.009  -27.872 -53.256 1.00 41.49  ? 520  PHE A CD1   1 
ATOM   4287 C  CD2   . PHE A 1 520 ? 17.429  -29.159 -51.266 1.00 37.87  ? 520  PHE A CD2   1 
ATOM   4288 C  CE1   . PHE A 1 520 ? 17.893  -26.879 -52.812 1.00 40.61  ? 520  PHE A CE1   1 
ATOM   4289 C  CE2   . PHE A 1 520 ? 18.315  -28.175 -50.812 1.00 40.19  ? 520  PHE A CE2   1 
ATOM   4290 C  CZ    . PHE A 1 520 ? 18.550  -27.034 -51.589 1.00 39.42  ? 520  PHE A CZ    1 
ATOM   4291 N  N     . ASP A 1 521 ? 12.808  -30.526 -54.261 1.00 32.83  ? 521  ASP A N     1 
ATOM   4292 C  CA    . ASP A 1 521 ? 11.857  -31.426 -54.922 1.00 32.86  ? 521  ASP A CA    1 
ATOM   4293 C  C     . ASP A 1 521 ? 12.417  -32.843 -55.059 1.00 31.73  ? 521  ASP A C     1 
ATOM   4294 O  O     . ASP A 1 521 ? 13.573  -33.026 -55.450 1.00 32.87  ? 521  ASP A O     1 
ATOM   4295 C  CB    . ASP A 1 521 ? 11.449  -30.853 -56.285 1.00 35.02  ? 521  ASP A CB    1 
ATOM   4296 C  CG    . ASP A 1 521 ? 10.543  -29.633 -56.153 1.00 38.12  ? 521  ASP A CG    1 
ATOM   4297 O  OD1   . ASP A 1 521 ? 9.380   -29.800 -55.731 1.00 40.90  ? 521  ASP A OD1   1 
ATOM   4298 O  OD2   . ASP A 1 521 ? 10.987  -28.507 -56.461 1.00 40.18  ? 521  ASP A OD2   1 
ATOM   4299 N  N     . PHE A 1 522 ? 11.613  -33.845 -54.708 1.00 30.16  ? 522  PHE A N     1 
ATOM   4300 C  CA    . PHE A 1 522 ? 12.081  -35.228 -54.787 1.00 31.86  ? 522  PHE A CA    1 
ATOM   4301 C  C     . PHE A 1 522 ? 12.448  -35.589 -56.225 1.00 32.13  ? 522  PHE A C     1 
ATOM   4302 O  O     . PHE A 1 522 ? 11.681  -35.326 -57.148 1.00 32.27  ? 522  PHE A O     1 
ATOM   4303 C  CB    . PHE A 1 522 ? 11.037  -36.218 -54.251 1.00 30.52  ? 522  PHE A CB    1 
ATOM   4304 C  CG    . PHE A 1 522 ? 10.872  -36.194 -52.753 1.00 30.84  ? 522  PHE A CG    1 
ATOM   4305 C  CD1   . PHE A 1 522 ? 11.905  -35.767 -51.921 1.00 30.10  ? 522  PHE A CD1   1 
ATOM   4306 C  CD2   . PHE A 1 522 ? 9.685   -36.634 -52.172 1.00 30.02  ? 522  PHE A CD2   1 
ATOM   4307 C  CE1   . PHE A 1 522 ? 11.748  -35.758 -50.533 1.00 31.10  ? 522  PHE A CE1   1 
ATOM   4308 C  CE2   . PHE A 1 522 ? 9.517   -36.630 -50.790 1.00 28.53  ? 522  PHE A CE2   1 
ATOM   4309 C  CZ    . PHE A 1 522 ? 10.547  -36.193 -49.967 1.00 30.06  ? 522  PHE A CZ    1 
ATOM   4310 N  N     . SER A 1 523 ? 13.631  -36.174 -56.397 1.00 34.16  ? 523  SER A N     1 
ATOM   4311 C  CA    . SER A 1 523 ? 14.069  -36.724 -57.682 1.00 36.46  ? 523  SER A CA    1 
ATOM   4312 C  C     . SER A 1 523 ? 13.207  -37.925 -58.089 1.00 37.66  ? 523  SER A C     1 
ATOM   4313 O  O     . SER A 1 523 ? 12.361  -38.377 -57.316 1.00 37.68  ? 523  SER A O     1 
ATOM   4314 C  CB    . SER A 1 523 ? 15.542  -37.140 -57.598 1.00 36.54  ? 523  SER A CB    1 
ATOM   4315 O  OG    . SER A 1 523 ? 15.708  -38.274 -56.760 1.00 38.12  ? 523  SER A OG    1 
ATOM   4316 N  N     . ASP A 1 524 ? 13.426  -38.435 -59.298 1.00 40.95  ? 524  ASP A N     1 
ATOM   4317 C  CA    . ASP A 1 524 ? 12.714  -39.624 -59.777 1.00 44.38  ? 524  ASP A CA    1 
ATOM   4318 C  C     . ASP A 1 524 ? 13.064  -40.896 -58.997 1.00 44.63  ? 524  ASP A C     1 
ATOM   4319 O  O     . ASP A 1 524 ? 12.167  -41.665 -58.648 1.00 44.76  ? 524  ASP A O     1 
ATOM   4320 C  CB    . ASP A 1 524 ? 12.928  -39.826 -61.282 1.00 46.03  ? 524  ASP A CB    1 
ATOM   4321 C  CG    . ASP A 1 524 ? 12.214  -38.768 -62.125 1.00 50.42  ? 524  ASP A CG    1 
ATOM   4322 O  OD1   . ASP A 1 524 ? 11.342  -38.042 -61.593 1.00 50.07  ? 524  ASP A OD1   1 
ATOM   4323 O  OD2   . ASP A 1 524 ? 12.526  -38.663 -63.331 1.00 53.13  ? 524  ASP A OD2   1 
ATOM   4324 N  N     . GLU A 1 525 ? 14.355  -41.105 -58.720 1.00 46.01  ? 525  GLU A N     1 
ATOM   4325 C  CA    . GLU A 1 525 ? 14.812  -42.266 -57.935 1.00 46.57  ? 525  GLU A CA    1 
ATOM   4326 C  C     . GLU A 1 525 ? 14.224  -42.265 -56.521 1.00 45.37  ? 525  GLU A C     1 
ATOM   4327 O  O     . GLU A 1 525 ? 13.912  -43.327 -55.972 1.00 45.42  ? 525  GLU A O     1 
ATOM   4328 C  CB    . GLU A 1 525 ? 16.350  -42.375 -57.900 1.00 48.34  ? 525  GLU A CB    1 
ATOM   4329 C  CG    . GLU A 1 525 ? 17.094  -41.236 -57.172 1.00 51.32  ? 525  GLU A CG    1 
ATOM   4330 C  CD    . GLU A 1 525 ? 18.590  -41.173 -57.507 1.00 56.35  ? 525  GLU A CD    1 
ATOM   4331 O  OE1   . GLU A 1 525 ? 19.039  -40.153 -58.099 1.00 52.98  ? 525  GLU A OE1   1 
ATOM   4332 O  OE2   . GLU A 1 525 ? 19.315  -42.143 -57.178 1.00 57.27  ? 525  GLU A OE2   1 
ATOM   4333 N  N     . ILE A 1 526 ? 14.061  -41.070 -55.950 1.00 43.18  ? 526  ILE A N     1 
ATOM   4334 C  CA    . ILE A 1 526 ? 13.418  -40.919 -54.646 1.00 41.53  ? 526  ILE A CA    1 
ATOM   4335 C  C     . ILE A 1 526 ? 11.921  -41.232 -54.730 1.00 41.10  ? 526  ILE A C     1 
ATOM   4336 O  O     . ILE A 1 526 ? 11.395  -41.994 -53.906 1.00 39.61  ? 526  ILE A O     1 
ATOM   4337 C  CB    . ILE A 1 526 ? 13.668  -39.516 -54.038 1.00 41.32  ? 526  ILE A CB    1 
ATOM   4338 C  CG1   . ILE A 1 526 ? 15.122  -39.403 -53.556 1.00 41.96  ? 526  ILE A CG1   1 
ATOM   4339 C  CG2   . ILE A 1 526 ? 12.708  -39.245 -52.883 1.00 40.79  ? 526  ILE A CG2   1 
ATOM   4340 C  CD1   . ILE A 1 526 ? 15.624  -37.963 -53.381 1.00 41.77  ? 526  ILE A CD1   1 
ATOM   4341 N  N     . LYS A 1 527 ? 11.245  -40.661 -55.728 1.00 41.30  ? 527  LYS A N     1 
ATOM   4342 C  CA    . LYS A 1 527 ? 9.821   -40.933 -55.953 1.00 43.39  ? 527  LYS A CA    1 
ATOM   4343 C  C     . LYS A 1 527 ? 9.513   -42.428 -56.079 1.00 45.27  ? 527  LYS A C     1 
ATOM   4344 O  O     . LYS A 1 527 ? 8.500   -42.899 -55.564 1.00 45.38  ? 527  LYS A O     1 
ATOM   4345 C  CB    . LYS A 1 527 ? 9.298   -40.179 -57.178 1.00 43.25  ? 527  LYS A CB    1 
ATOM   4346 C  CG    . LYS A 1 527 ? 8.649   -38.840 -56.851 1.00 45.98  ? 527  LYS A CG    1 
ATOM   4347 C  CD    . LYS A 1 527 ? 8.215   -38.084 -58.107 1.00 48.19  ? 527  LYS A CD    1 
ATOM   4348 C  CE    . LYS A 1 527 ? 9.367   -37.284 -58.698 1.00 49.47  ? 527  LYS A CE    1 
ATOM   4349 N  NZ    . LYS A 1 527 ? 8.885   -36.208 -59.599 1.00 50.00  ? 527  LYS A NZ    1 
ATOM   4350 N  N     . GLU A 1 528 ? 10.393  -43.168 -56.752 1.00 48.16  ? 528  GLU A N     1 
ATOM   4351 C  CA    . GLU A 1 528 ? 10.177  -44.601 -56.964 1.00 50.67  ? 528  GLU A CA    1 
ATOM   4352 C  C     . GLU A 1 528 ? 10.383  -45.413 -55.689 1.00 49.13  ? 528  GLU A C     1 
ATOM   4353 O  O     . GLU A 1 528 ? 9.650   -46.372 -55.446 1.00 48.79  ? 528  GLU A O     1 
ATOM   4354 C  CB    . GLU A 1 528 ? 11.047  -45.136 -58.105 1.00 53.42  ? 528  GLU A CB    1 
ATOM   4355 C  CG    . GLU A 1 528 ? 10.710  -44.555 -59.485 1.00 60.20  ? 528  GLU A CG    1 
ATOM   4356 C  CD    . GLU A 1 528 ? 9.296   -44.885 -59.952 1.00 65.36  ? 528  GLU A CD    1 
ATOM   4357 O  OE1   . GLU A 1 528 ? 8.465   -43.949 -60.040 1.00 67.43  ? 528  GLU A OE1   1 
ATOM   4358 O  OE2   . GLU A 1 528 ? 9.015   -46.075 -60.226 1.00 66.35  ? 528  GLU A OE2   1 
ATOM   4359 N  N     . LYS A 1 529 ? 11.368  -45.021 -54.881 1.00 48.95  ? 529  LYS A N     1 
ATOM   4360 C  CA    . LYS A 1 529 ? 11.624  -45.668 -53.592 1.00 50.61  ? 529  LYS A CA    1 
ATOM   4361 C  C     . LYS A 1 529 ? 10.470  -45.466 -52.609 1.00 49.95  ? 529  LYS A C     1 
ATOM   4362 O  O     . LYS A 1 529 ? 10.116  -46.384 -51.867 1.00 49.81  ? 529  LYS A O     1 
ATOM   4363 C  CB    . LYS A 1 529 ? 12.929  -45.166 -52.969 1.00 51.66  ? 529  LYS A CB    1 
ATOM   4364 C  CG    . LYS A 1 529 ? 14.188  -45.857 -53.472 1.00 53.97  ? 529  LYS A CG    1 
ATOM   4365 C  CD    . LYS A 1 529 ? 15.431  -45.253 -52.820 1.00 55.44  ? 529  LYS A CD    1 
ATOM   4366 C  CE    . LYS A 1 529 ? 16.700  -45.631 -53.566 1.00 57.66  ? 529  LYS A CE    1 
ATOM   4367 N  NZ    . LYS A 1 529 ? 17.826  -44.697 -53.269 1.00 57.94  ? 529  LYS A NZ    1 
ATOM   4368 N  N     . ILE A 1 530 ? 9.899   -44.262 -52.613 1.00 49.80  ? 530  ILE A N     1 
ATOM   4369 C  CA    . ILE A 1 530 ? 8.737   -43.928 -51.786 1.00 50.32  ? 530  ILE A CA    1 
ATOM   4370 C  C     . ILE A 1 530 ? 7.538   -44.833 -52.101 1.00 52.17  ? 530  ILE A C     1 
ATOM   4371 O  O     . ILE A 1 530 ? 6.837   -45.283 -51.190 1.00 51.88  ? 530  ILE A O     1 
ATOM   4372 C  CB    . ILE A 1 530 ? 8.362   -42.427 -51.923 1.00 49.59  ? 530  ILE A CB    1 
ATOM   4373 C  CG1   . ILE A 1 530 ? 9.364   -41.560 -51.159 1.00 48.42  ? 530  ILE A CG1   1 
ATOM   4374 C  CG2   . ILE A 1 530 ? 6.947   -42.145 -51.406 1.00 49.19  ? 530  ILE A CG2   1 
ATOM   4375 C  CD1   . ILE A 1 530 ? 9.275   -40.087 -51.489 1.00 44.71  ? 530  ILE A CD1   1 
ATOM   4376 N  N     . LYS A 1 531 ? 7.331   -45.110 -53.388 1.00 54.22  ? 531  LYS A N     1 
ATOM   4377 C  CA    . LYS A 1 531 ? 6.268   -46.009 -53.853 1.00 57.01  ? 531  LYS A CA    1 
ATOM   4378 C  C     . LYS A 1 531 ? 6.394   -47.458 -53.352 1.00 57.10  ? 531  LYS A C     1 
ATOM   4379 O  O     . LYS A 1 531 ? 5.439   -48.234 -53.451 1.00 57.77  ? 531  LYS A O     1 
ATOM   4380 C  CB    . LYS A 1 531 ? 6.188   -45.997 -55.384 1.00 58.47  ? 531  LYS A CB    1 
ATOM   4381 C  CG    . LYS A 1 531 ? 5.635   -44.704 -55.967 1.00 61.89  ? 531  LYS A CG    1 
ATOM   4382 C  CD    . LYS A 1 531 ? 5.231   -44.886 -57.421 1.00 65.59  ? 531  LYS A CD    1 
ATOM   4383 C  CE    . LYS A 1 531 ? 4.452   -43.681 -57.928 1.00 69.27  ? 531  LYS A CE    1 
ATOM   4384 N  NZ    . LYS A 1 531 ? 3.917   -43.897 -59.308 1.00 73.75  ? 531  LYS A NZ    1 
ATOM   4385 N  N     . LYS A 1 532 ? 7.560   -47.814 -52.815 1.00 55.45  ? 532  LYS A N     1 
ATOM   4386 C  CA    . LYS A 1 532 ? 7.805   -49.170 -52.324 1.00 54.91  ? 532  LYS A CA    1 
ATOM   4387 C  C     . LYS A 1 532 ? 7.895   -49.240 -50.796 1.00 53.87  ? 532  LYS A C     1 
ATOM   4388 O  O     . LYS A 1 532 ? 8.227   -50.285 -50.233 1.00 53.85  ? 532  LYS A O     1 
ATOM   4389 C  CB    . LYS A 1 532 ? 9.067   -49.761 -52.977 1.00 56.23  ? 532  LYS A CB    1 
ATOM   4390 C  CG    . LYS A 1 532 ? 8.929   -50.022 -54.480 1.00 59.35  ? 532  LYS A CG    1 
ATOM   4391 C  CD    . LYS A 1 532 ? 10.216  -50.578 -55.093 1.00 63.75  ? 532  LYS A CD    1 
ATOM   4392 C  CE    . LYS A 1 532 ? 10.050  -50.835 -56.594 1.00 65.24  ? 532  LYS A CE    1 
ATOM   4393 N  NZ    . LYS A 1 532 ? 11.276  -51.384 -57.242 1.00 64.72  ? 532  LYS A NZ    1 
ATOM   4394 N  N     . LEU A 1 533 ? 7.577   -48.132 -50.127 1.00 53.01  ? 533  LEU A N     1 
ATOM   4395 C  CA    . LEU A 1 533 ? 7.725   -48.036 -48.671 1.00 51.92  ? 533  LEU A CA    1 
ATOM   4396 C  C     . LEU A 1 533 ? 6.464   -48.369 -47.873 1.00 51.41  ? 533  LEU A C     1 
ATOM   4397 O  O     . LEU A 1 533 ? 5.340   -48.232 -48.361 1.00 51.62  ? 533  LEU A O     1 
ATOM   4398 C  CB    . LEU A 1 533 ? 8.241   -46.649 -48.265 1.00 50.87  ? 533  LEU A CB    1 
ATOM   4399 C  CG    . LEU A 1 533 ? 9.697   -46.299 -48.582 1.00 50.59  ? 533  LEU A CG    1 
ATOM   4400 C  CD1   . LEU A 1 533 ? 9.929   -44.825 -48.313 1.00 50.05  ? 533  LEU A CD1   1 
ATOM   4401 C  CD2   . LEU A 1 533 ? 10.678  -47.158 -47.786 1.00 48.28  ? 533  LEU A CD2   1 
ATOM   4402 N  N     . SER A 1 534 ? 6.684   -48.799 -46.633 1.00 51.44  ? 534  SER A N     1 
ATOM   4403 C  CA    . SER A 1 534 ? 5.622   -49.135 -45.698 1.00 51.99  ? 534  SER A CA    1 
ATOM   4404 C  C     . SER A 1 534 ? 4.954   -47.884 -45.146 1.00 52.84  ? 534  SER A C     1 
ATOM   4405 O  O     . SER A 1 534 ? 5.529   -46.792 -45.191 1.00 51.21  ? 534  SER A O     1 
ATOM   4406 C  CB    . SER A 1 534 ? 6.189   -49.957 -44.541 1.00 53.16  ? 534  SER A CB    1 
ATOM   4407 O  OG    . SER A 1 534 ? 7.112   -49.194 -43.783 1.00 53.08  ? 534  SER A OG    1 
ATOM   4408 N  N     . ALA A 1 535 ? 3.746   -48.058 -44.614 1.00 53.17  ? 535  ALA A N     1 
ATOM   4409 C  CA    . ALA A 1 535 ? 3.000   -46.970 -43.994 1.00 52.59  ? 535  ALA A CA    1 
ATOM   4410 C  C     . ALA A 1 535 ? 3.784   -46.308 -42.863 1.00 51.90  ? 535  ALA A C     1 
ATOM   4411 O  O     . ALA A 1 535 ? 3.724   -45.091 -42.699 1.00 52.27  ? 535  ALA A O     1 
ATOM   4412 C  CB    . ALA A 1 535 ? 1.650   -47.468 -43.493 1.00 53.80  ? 535  ALA A CB    1 
ATOM   4413 N  N     . LYS A 1 536 ? 4.524   -47.113 -42.102 1.00 52.14  ? 536  LYS A N     1 
ATOM   4414 C  CA    . LYS A 1 536 ? 5.306   -46.623 -40.965 1.00 52.12  ? 536  LYS A CA    1 
ATOM   4415 C  C     . LYS A 1 536 ? 6.413   -45.661 -41.401 1.00 49.66  ? 536  LYS A C     1 
ATOM   4416 O  O     . LYS A 1 536 ? 6.563   -44.581 -40.826 1.00 47.45  ? 536  LYS A O     1 
ATOM   4417 C  CB    . LYS A 1 536 ? 5.895   -47.792 -40.170 1.00 53.95  ? 536  LYS A CB    1 
ATOM   4418 C  CG    . LYS A 1 536 ? 6.583   -47.376 -38.873 1.00 59.49  ? 536  LYS A CG    1 
ATOM   4419 C  CD    . LYS A 1 536 ? 7.170   -48.569 -38.128 1.00 61.97  ? 536  LYS A CD    1 
ATOM   4420 C  CE    . LYS A 1 536 ? 7.986   -48.107 -36.928 1.00 64.62  ? 536  LYS A CE    1 
ATOM   4421 N  NZ    . LYS A 1 536 ? 8.357   -49.241 -36.030 1.00 69.05  ? 536  LYS A NZ    1 
ATOM   4422 N  N     . SER A 1 537 ? 7.181   -46.065 -42.414 1.00 48.15  ? 537  SER A N     1 
ATOM   4423 C  CA    . SER A 1 537 ? 8.258   -45.238 -42.952 1.00 44.59  ? 537  SER A CA    1 
ATOM   4424 C  C     . SER A 1 537 ? 7.724   -43.997 -43.666 1.00 41.78  ? 537  SER A C     1 
ATOM   4425 O  O     . SER A 1 537 ? 8.299   -42.914 -43.544 1.00 39.14  ? 537  SER A O     1 
ATOM   4426 C  CB    . SER A 1 537 ? 9.150   -46.054 -43.884 1.00 45.46  ? 537  SER A CB    1 
ATOM   4427 O  OG    . SER A 1 537 ? 9.900   -47.004 -43.148 1.00 50.39  ? 537  SER A OG    1 
ATOM   4428 N  N     . LEU A 1 538 ? 6.625   -44.161 -44.399 1.00 39.85  ? 538  LEU A N     1 
ATOM   4429 C  CA    . LEU A 1 538 ? 5.995   -43.046 -45.109 1.00 39.49  ? 538  LEU A CA    1 
ATOM   4430 C  C     . LEU A 1 538 ? 5.475   -41.998 -44.142 1.00 40.35  ? 538  LEU A C     1 
ATOM   4431 O  O     . LEU A 1 538 ? 5.634   -40.801 -44.380 1.00 40.56  ? 538  LEU A O     1 
ATOM   4432 C  CB    . LEU A 1 538 ? 4.864   -43.532 -46.015 1.00 38.21  ? 538  LEU A CB    1 
ATOM   4433 C  CG    . LEU A 1 538 ? 5.281   -44.337 -47.253 1.00 40.82  ? 538  LEU A CG    1 
ATOM   4434 C  CD1   . LEU A 1 538 ? 4.067   -44.961 -47.925 1.00 41.58  ? 538  LEU A CD1   1 
ATOM   4435 C  CD2   . LEU A 1 538 ? 6.085   -43.489 -48.245 1.00 36.83  ? 538  LEU A CD2   1 
ATOM   4436 N  N     . ASN A 1 539 ? 4.870   -42.455 -43.048 1.00 40.57  ? 539  ASN A N     1 
ATOM   4437 C  CA    . ASN A 1 539 ? 4.365   -41.557 -42.017 1.00 43.10  ? 539  ASN A CA    1 
ATOM   4438 C  C     . ASN A 1 539 ? 5.460   -40.739 -41.356 1.00 41.96  ? 539  ASN A C     1 
ATOM   4439 O  O     . ASN A 1 539 ? 5.294   -39.536 -41.151 1.00 41.48  ? 539  ASN A O     1 
ATOM   4440 C  CB    . ASN A 1 539 ? 3.556   -42.316 -40.965 1.00 44.63  ? 539  ASN A CB    1 
ATOM   4441 C  CG    . ASN A 1 539 ? 2.125   -42.550 -41.395 1.00 45.63  ? 539  ASN A CG    1 
ATOM   4442 O  OD1   . ASN A 1 539 ? 1.591   -43.649 -41.239 1.00 50.72  ? 539  ASN A OD1   1 
ATOM   4443 N  ND2   . ASN A 1 539 ? 1.496   -41.518 -41.947 1.00 40.54  ? 539  ASN A ND2   1 
ATOM   4444 N  N     . GLU A 1 540 ? 6.577   -41.393 -41.045 1.00 41.26  ? 540  GLU A N     1 
ATOM   4445 C  CA    . GLU A 1 540 ? 7.733   -40.702 -40.490 1.00 41.56  ? 540  GLU A CA    1 
ATOM   4446 C  C     . GLU A 1 540 ? 8.294   -39.675 -41.487 1.00 39.14  ? 540  GLU A C     1 
ATOM   4447 O  O     . GLU A 1 540 ? 8.680   -38.569 -41.095 1.00 37.36  ? 540  GLU A O     1 
ATOM   4448 C  CB    . GLU A 1 540 ? 8.805   -41.703 -40.039 1.00 42.61  ? 540  GLU A CB    1 
ATOM   4449 C  CG    . GLU A 1 540 ? 10.063  -41.079 -39.405 1.00 50.47  ? 540  GLU A CG    1 
ATOM   4450 C  CD    . GLU A 1 540 ? 9.768   -40.091 -38.270 1.00 56.91  ? 540  GLU A CD    1 
ATOM   4451 O  OE1   . GLU A 1 540 ? 8.776   -40.283 -37.530 1.00 60.74  ? 540  GLU A OE1   1 
ATOM   4452 O  OE2   . GLU A 1 540 ? 10.541  -39.119 -38.113 1.00 58.17  ? 540  GLU A OE2   1 
ATOM   4453 N  N     . MET A 1 541 ? 8.317   -40.040 -42.769 1.00 35.65  ? 541  MET A N     1 
ATOM   4454 C  CA    . MET A 1 541 ? 8.755   -39.127 -43.824 1.00 34.01  ? 541  MET A CA    1 
ATOM   4455 C  C     . MET A 1 541 ? 7.811   -37.931 -43.961 1.00 33.19  ? 541  MET A C     1 
ATOM   4456 O  O     . MET A 1 541 ? 8.257   -36.801 -44.173 1.00 31.51  ? 541  MET A O     1 
ATOM   4457 C  CB    . MET A 1 541 ? 8.894   -39.856 -45.163 1.00 34.15  ? 541  MET A CB    1 
ATOM   4458 C  CG    . MET A 1 541 ? 10.062  -40.836 -45.227 1.00 31.70  ? 541  MET A CG    1 
ATOM   4459 S  SD    . MET A 1 541 ? 10.391  -41.464 -46.887 1.00 33.40  ? 541  MET A SD    1 
ATOM   4460 C  CE    . MET A 1 541 ? 10.888  -39.964 -47.753 1.00 31.23  ? 541  MET A CE    1 
ATOM   4461 N  N     . LEU A 1 542 ? 6.511   -38.191 -43.831 1.00 31.89  ? 542  LEU A N     1 
ATOM   4462 C  CA    . LEU A 1 542 ? 5.509   -37.143 -43.923 1.00 30.95  ? 542  LEU A CA    1 
ATOM   4463 C  C     . LEU A 1 542 ? 5.676   -36.169 -42.765 1.00 31.13  ? 542  LEU A C     1 
ATOM   4464 O  O     . LEU A 1 542 ? 5.611   -34.957 -42.968 1.00 29.12  ? 542  LEU A O     1 
ATOM   4465 C  CB    . LEU A 1 542 ? 4.088   -37.725 -43.968 1.00 30.03  ? 542  LEU A CB    1 
ATOM   4466 C  CG    . LEU A 1 542 ? 2.895   -36.759 -44.007 1.00 32.22  ? 542  LEU A CG    1 
ATOM   4467 C  CD1   . LEU A 1 542 ? 3.016   -35.703 -45.126 1.00 28.43  ? 542  LEU A CD1   1 
ATOM   4468 C  CD2   . LEU A 1 542 ? 1.570   -37.525 -44.112 1.00 33.23  ? 542  LEU A CD2   1 
ATOM   4469 N  N     . PHE A 1 543 ? 5.896   -36.711 -41.563 1.00 32.65  ? 543  PHE A N     1 
ATOM   4470 C  CA    . PHE A 1 543 ? 6.184   -35.911 -40.378 1.00 32.96  ? 543  PHE A CA    1 
ATOM   4471 C  C     . PHE A 1 543 ? 7.394   -35.011 -40.607 1.00 33.26  ? 543  PHE A C     1 
ATOM   4472 O  O     . PHE A 1 543 ? 7.361   -33.823 -40.275 1.00 33.94  ? 543  PHE A O     1 
ATOM   4473 C  CB    . PHE A 1 543 ? 6.391   -36.805 -39.141 1.00 36.26  ? 543  PHE A CB    1 
ATOM   4474 C  CG    . PHE A 1 543 ? 6.716   -36.035 -37.878 1.00 37.48  ? 543  PHE A CG    1 
ATOM   4475 C  CD1   . PHE A 1 543 ? 5.713   -35.375 -37.169 1.00 39.61  ? 543  PHE A CD1   1 
ATOM   4476 C  CD2   . PHE A 1 543 ? 8.027   -35.963 -37.405 1.00 39.27  ? 543  PHE A CD2   1 
ATOM   4477 C  CE1   . PHE A 1 543 ? 6.010   -34.648 -36.004 1.00 41.06  ? 543  PHE A CE1   1 
ATOM   4478 C  CE2   . PHE A 1 543 ? 8.338   -35.244 -36.242 1.00 37.99  ? 543  PHE A CE2   1 
ATOM   4479 C  CZ    . PHE A 1 543 ? 7.325   -34.587 -35.541 1.00 39.48  ? 543  PHE A CZ    1 
ATOM   4480 N  N     . ARG A 1 544 ? 8.449   -35.576 -41.192 1.00 33.09  ? 544  ARG A N     1 
ATOM   4481 C  CA    . ARG A 1 544 ? 9.680   -34.829 -41.471 1.00 32.90  ? 544  ARG A CA    1 
ATOM   4482 C  C     . ARG A 1 544 ? 9.503   -33.763 -42.556 1.00 32.71  ? 544  ARG A C     1 
ATOM   4483 O  O     . ARG A 1 544 ? 9.997   -32.638 -42.414 1.00 32.85  ? 544  ARG A O     1 
ATOM   4484 C  CB    . ARG A 1 544 ? 10.830  -35.782 -41.810 1.00 32.70  ? 544  ARG A CB    1 
ATOM   4485 C  CG    . ARG A 1 544 ? 11.355  -36.564 -40.606 1.00 34.23  ? 544  ARG A CG    1 
ATOM   4486 C  CD    . ARG A 1 544 ? 12.241  -37.728 -41.044 1.00 36.65  ? 544  ARG A CD    1 
ATOM   4487 N  NE    . ARG A 1 544 ? 12.558  -38.617 -39.929 1.00 38.24  ? 544  ARG A NE    1 
ATOM   4488 C  CZ    . ARG A 1 544 ? 13.445  -39.610 -39.970 1.00 41.74  ? 544  ARG A CZ    1 
ATOM   4489 N  NH1   . ARG A 1 544 ? 14.137  -39.869 -41.074 1.00 40.49  ? 544  ARG A NH1   1 
ATOM   4490 N  NH2   . ARG A 1 544 ? 13.642  -40.349 -38.892 1.00 42.59  ? 544  ARG A NH2   1 
ATOM   4491 N  N     . ALA A 1 545 ? 8.794   -34.119 -43.627 1.00 31.21  ? 545  ALA A N     1 
ATOM   4492 C  CA    . ALA A 1 545 ? 8.428   -33.168 -44.676 1.00 29.47  ? 545  ALA A CA    1 
ATOM   4493 C  C     . ALA A 1 545 ? 7.690   -31.982 -44.070 1.00 28.74  ? 545  ALA A C     1 
ATOM   4494 O  O     . ALA A 1 545 ? 8.005   -30.829 -44.367 1.00 26.53  ? 545  ALA A O     1 
ATOM   4495 C  CB    . ALA A 1 545 ? 7.557   -33.844 -45.736 1.00 27.85  ? 545  ALA A CB    1 
ATOM   4496 N  N     . GLN A 1 546 ? 6.715   -32.284 -43.216 1.00 29.24  ? 546  GLN A N     1 
ATOM   4497 C  CA    . GLN A 1 546 ? 5.887   -31.265 -42.572 1.00 30.49  ? 546  GLN A CA    1 
ATOM   4498 C  C     . GLN A 1 546 ? 6.662   -30.407 -41.576 1.00 28.96  ? 546  GLN A C     1 
ATOM   4499 O  O     . GLN A 1 546 ? 6.377   -29.215 -41.445 1.00 30.38  ? 546  GLN A O     1 
ATOM   4500 C  CB    . GLN A 1 546 ? 4.655   -31.897 -41.912 1.00 31.60  ? 546  GLN A CB    1 
ATOM   4501 C  CG    . GLN A 1 546 ? 3.636   -32.444 -42.927 1.00 34.85  ? 546  GLN A CG    1 
ATOM   4502 C  CD    . GLN A 1 546 ? 2.487   -33.228 -42.292 1.00 40.00  ? 546  GLN A CD    1 
ATOM   4503 O  OE1   . GLN A 1 546 ? 1.420   -33.362 -42.891 1.00 41.56  ? 546  GLN A OE1   1 
ATOM   4504 N  NE2   . GLN A 1 546 ? 2.703   -33.752 -41.084 1.00 38.06  ? 546  GLN A NE2   1 
ATOM   4505 N  N     . ARG A 1 547 ? 7.636   -31.002 -40.883 1.00 27.02  ? 547  ARG A N     1 
ATOM   4506 C  CA    . ARG A 1 547 ? 8.531   -30.224 -40.020 1.00 25.95  ? 547  ARG A CA    1 
ATOM   4507 C  C     . ARG A 1 547 ? 9.429   -29.294 -40.841 1.00 25.90  ? 547  ARG A C     1 
ATOM   4508 O  O     . ARG A 1 547 ? 9.620   -28.132 -40.482 1.00 26.04  ? 547  ARG A O     1 
ATOM   4509 C  CB    . ARG A 1 547 ? 9.360   -31.126 -39.096 1.00 25.61  ? 547  ARG A CB    1 
ATOM   4510 C  CG    . ARG A 1 547 ? 8.597   -31.636 -37.872 1.00 27.00  ? 547  ARG A CG    1 
ATOM   4511 C  CD    . ARG A 1 547 ? 8.157   -30.473 -36.984 1.00 30.12  ? 547  ARG A CD    1 
ATOM   4512 N  NE    . ARG A 1 547 ? 7.348   -30.886 -35.842 1.00 33.43  ? 547  ARG A NE    1 
ATOM   4513 C  CZ    . ARG A 1 547 ? 7.850   -31.224 -34.657 1.00 37.98  ? 547  ARG A CZ    1 
ATOM   4514 N  NH1   . ARG A 1 547 ? 9.166   -31.218 -34.462 1.00 39.02  ? 547  ARG A NH1   1 
ATOM   4515 N  NH2   . ARG A 1 547 ? 7.041   -31.572 -33.666 1.00 35.96  ? 547  ARG A NH2   1 
ATOM   4516 N  N     . THR A 1 548 ? 9.953   -29.801 -41.953 1.00 25.64  ? 548  THR A N     1 
ATOM   4517 C  CA    . THR A 1 548 ? 10.718  -28.975 -42.890 1.00 27.77  ? 548  THR A CA    1 
ATOM   4518 C  C     . THR A 1 548 ? 9.874   -27.816 -43.435 1.00 26.64  ? 548  THR A C     1 
ATOM   4519 O  O     . THR A 1 548 ? 10.342  -26.676 -43.476 1.00 26.82  ? 548  THR A O     1 
ATOM   4520 C  CB    . THR A 1 548 ? 11.315  -29.807 -44.053 1.00 28.45  ? 548  THR A CB    1 
ATOM   4521 O  OG1   . THR A 1 548 ? 12.146  -30.843 -43.519 1.00 29.82  ? 548  THR A OG1   1 
ATOM   4522 C  CG2   . THR A 1 548 ? 12.160  -28.928 -44.966 1.00 27.22  ? 548  THR A CG2   1 
ATOM   4523 N  N     . GLU A 1 549 ? 8.629   -28.105 -43.818 1.00 26.75  ? 549  GLU A N     1 
ATOM   4524 C  CA    . GLU A 1 549 ? 7.707   -27.063 -44.285 1.00 26.58  ? 549  GLU A CA    1 
ATOM   4525 C  C     . GLU A 1 549 ? 7.476   -25.959 -43.250 1.00 26.15  ? 549  GLU A C     1 
ATOM   4526 O  O     . GLU A 1 549 ? 7.477   -24.784 -43.602 1.00 25.71  ? 549  GLU A O     1 
ATOM   4527 C  CB    . GLU A 1 549 ? 6.369   -27.662 -44.731 1.00 27.81  ? 549  GLU A CB    1 
ATOM   4528 C  CG    . GLU A 1 549 ? 5.364   -26.614 -45.229 1.00 31.21  ? 549  GLU A CG    1 
ATOM   4529 C  CD    . GLU A 1 549 ? 4.038   -27.209 -45.667 1.00 36.90  ? 549  GLU A CD    1 
ATOM   4530 O  OE1   . GLU A 1 549 ? 3.960   -28.449 -45.861 1.00 40.35  ? 549  GLU A OE1   1 
ATOM   4531 O  OE2   . GLU A 1 549 ? 3.074   -26.428 -45.825 1.00 37.05  ? 549  GLU A OE2   1 
ATOM   4532 N  N     . VAL A 1 550 ? 7.280   -26.346 -41.986 1.00 25.77  ? 550  VAL A N     1 
ATOM   4533 C  CA    . VAL A 1 550 ? 7.064   -25.391 -40.887 1.00 26.71  ? 550  VAL A CA    1 
ATOM   4534 C  C     . VAL A 1 550 ? 8.282   -24.486 -40.659 1.00 27.36  ? 550  VAL A C     1 
ATOM   4535 O  O     . VAL A 1 550 ? 8.135   -23.273 -40.477 1.00 28.62  ? 550  VAL A O     1 
ATOM   4536 C  CB    . VAL A 1 550 ? 6.680   -26.109 -39.558 1.00 26.04  ? 550  VAL A CB    1 
ATOM   4537 C  CG1   . VAL A 1 550 ? 6.775   -25.142 -38.361 1.00 26.51  ? 550  VAL A CG1   1 
ATOM   4538 C  CG2   . VAL A 1 550 ? 5.274   -26.712 -39.651 1.00 24.70  ? 550  VAL A CG2   1 
ATOM   4539 N  N     . ALA A 1 551 ? 9.473   -25.087 -40.650 1.00 27.06  ? 551  ALA A N     1 
ATOM   4540 C  CA    . ALA A 1 551 ? 10.731  -24.342 -40.535 1.00 28.03  ? 551  ALA A CA    1 
ATOM   4541 C  C     . ALA A 1 551 ? 10.840  -23.306 -41.658 1.00 28.93  ? 551  ALA A C     1 
ATOM   4542 O  O     . ALA A 1 551 ? 11.192  -22.139 -41.418 1.00 26.99  ? 551  ALA A O     1 
ATOM   4543 C  CB    . ALA A 1 551 ? 11.923  -25.300 -40.575 1.00 27.50  ? 551  ALA A CB    1 
ATOM   4544 N  N     . GLY A 1 552 ? 10.529  -23.742 -42.880 1.00 26.73  ? 552  GLY A N     1 
ATOM   4545 C  CA    . GLY A 1 552 ? 10.518  -22.850 -44.038 1.00 26.90  ? 552  GLY A CA    1 
ATOM   4546 C  C     . GLY A 1 552 ? 9.498   -21.740 -43.862 1.00 26.79  ? 552  GLY A C     1 
ATOM   4547 O  O     . GLY A 1 552 ? 9.775   -20.562 -44.158 1.00 25.95  ? 552  GLY A O     1 
ATOM   4548 N  N     . MET A 1 553 ? 8.321   -22.118 -43.364 1.00 23.95  ? 553  MET A N     1 
ATOM   4549 C  CA    . MET A 1 553 ? 7.255   -21.165 -43.086 1.00 23.98  ? 553  MET A CA    1 
ATOM   4550 C  C     . MET A 1 553 ? 7.710   -20.084 -42.112 1.00 23.15  ? 553  MET A C     1 
ATOM   4551 O  O     . MET A 1 553 ? 7.465   -18.907 -42.351 1.00 24.80  ? 553  MET A O     1 
ATOM   4552 C  CB    . MET A 1 553 ? 5.998   -21.869 -42.557 1.00 26.64  ? 553  MET A CB    1 
ATOM   4553 C  CG    . MET A 1 553 ? 4.848   -20.915 -42.181 1.00 34.28  ? 553  MET A CG    1 
ATOM   4554 S  SD    . MET A 1 553 ? 4.186   -20.008 -43.600 1.00 42.80  ? 553  MET A SD    1 
ATOM   4555 C  CE    . MET A 1 553 ? 2.873   -21.094 -44.152 1.00 43.95  ? 553  MET A CE    1 
ATOM   4556 N  N     . THR A 1 554 ? 8.370   -20.476 -41.026 1.00 21.70  ? 554  THR A N     1 
ATOM   4557 C  CA    . THR A 1 554 ? 8.827   -19.497 -40.036 1.00 21.98  ? 554  THR A CA    1 
ATOM   4558 C  C     . THR A 1 554 ? 9.802   -18.510 -40.669 1.00 23.00  ? 554  THR A C     1 
ATOM   4559 O  O     . THR A 1 554 ? 9.637   -17.291 -40.537 1.00 22.19  ? 554  THR A O     1 
ATOM   4560 C  CB    . THR A 1 554 ? 9.484   -20.161 -38.811 1.00 21.95  ? 554  THR A CB    1 
ATOM   4561 O  OG1   . THR A 1 554 ? 8.519   -20.971 -38.127 1.00 24.73  ? 554  THR A OG1   1 
ATOM   4562 C  CG2   . THR A 1 554 ? 10.008  -19.108 -37.849 1.00 22.83  ? 554  THR A CG2   1 
ATOM   4563 N  N     . ALA A 1 555 ? 10.796  -19.048 -41.374 1.00 22.39  ? 555  ALA A N     1 
ATOM   4564 C  CA    . ALA A 1 555 ? 11.840  -18.233 -41.973 1.00 23.72  ? 555  ALA A CA    1 
ATOM   4565 C  C     . ALA A 1 555 ? 11.282  -17.248 -43.005 1.00 24.76  ? 555  ALA A C     1 
ATOM   4566 O  O     . ALA A 1 555 ? 11.634  -16.066 -42.995 1.00 25.80  ? 555  ALA A O     1 
ATOM   4567 C  CB    . ALA A 1 555 ? 12.915  -19.122 -42.595 1.00 23.44  ? 555  ALA A CB    1 
ATOM   4568 N  N     . GLN A 1 556 ? 10.396  -17.731 -43.873 1.00 22.63  ? 556  GLN A N     1 
ATOM   4569 C  CA    . GLN A 1 556 ? 9.864   -16.904 -44.951 1.00 21.89  ? 556  GLN A CA    1 
ATOM   4570 C  C     . GLN A 1 556 ? 8.804   -15.905 -44.485 1.00 23.98  ? 556  GLN A C     1 
ATOM   4571 O  O     . GLN A 1 556 ? 8.871   -14.732 -44.851 1.00 25.46  ? 556  GLN A O     1 
ATOM   4572 C  CB    . GLN A 1 556 ? 9.365   -17.761 -46.134 1.00 19.75  ? 556  GLN A CB    1 
ATOM   4573 C  CG    . GLN A 1 556 ? 8.009   -18.466 -45.941 1.00 19.82  ? 556  GLN A CG    1 
ATOM   4574 C  CD    . GLN A 1 556 ? 6.811   -17.600 -46.327 1.00 24.06  ? 556  GLN A CD    1 
ATOM   4575 O  OE1   . GLN A 1 556 ? 6.957   -16.560 -46.979 1.00 23.51  ? 556  GLN A OE1   1 
ATOM   4576 N  NE2   . GLN A 1 556 ? 5.620   -18.029 -45.923 1.00 18.26  ? 556  GLN A NE2   1 
ATOM   4577 N  N     . ILE A 1 557 ? 7.839   -16.352 -43.673 1.00 25.00  ? 557  ILE A N     1 
ATOM   4578 C  CA    . ILE A 1 557 ? 6.704   -15.490 -43.338 1.00 25.03  ? 557  ILE A CA    1 
ATOM   4579 C  C     . ILE A 1 557 ? 7.112   -14.312 -42.462 1.00 24.96  ? 557  ILE A C     1 
ATOM   4580 O  O     . ILE A 1 557 ? 6.519   -13.230 -42.538 1.00 25.33  ? 557  ILE A O     1 
ATOM   4581 C  CB    . ILE A 1 557 ? 5.483   -16.258 -42.742 1.00 25.99  ? 557  ILE A CB    1 
ATOM   4582 C  CG1   . ILE A 1 557 ? 4.204   -15.406 -42.894 1.00 26.78  ? 557  ILE A CG1   1 
ATOM   4583 C  CG2   . ILE A 1 557 ? 5.736   -16.691 -41.284 1.00 24.23  ? 557  ILE A CG2   1 
ATOM   4584 C  CD1   . ILE A 1 557 ? 2.902   -16.164 -42.668 1.00 30.66  ? 557  ILE A CD1   1 
ATOM   4585 N  N     . ASN A 1 558 ? 8.139   -14.521 -41.649 1.00 22.80  ? 558  ASN A N     1 
ATOM   4586 C  CA    . ASN A 1 558 ? 8.598   -13.478 -40.753 1.00 22.94  ? 558  ASN A CA    1 
ATOM   4587 C  C     . ASN A 1 558 ? 9.568   -12.521 -41.432 1.00 22.27  ? 558  ASN A C     1 
ATOM   4588 O  O     . ASN A 1 558 ? 9.699   -11.374 -41.016 1.00 22.08  ? 558  ASN A O     1 
ATOM   4589 C  CB    . ASN A 1 558 ? 9.142   -14.088 -39.467 1.00 22.06  ? 558  ASN A CB    1 
ATOM   4590 C  CG    . ASN A 1 558 ? 8.034   -14.641 -38.600 1.00 24.31  ? 558  ASN A CG    1 
ATOM   4591 O  OD1   . ASN A 1 558 ? 7.221   -13.877 -38.079 1.00 21.65  ? 558  ASN A OD1   1 
ATOM   4592 N  ND2   . ASN A 1 558 ? 7.966   -15.974 -38.471 1.00 20.18  ? 558  ASN A ND2   1 
ATOM   4593 N  N     . ARG A 1 559 ? 10.211  -12.979 -42.505 1.00 21.89  ? 559  ARG A N     1 
ATOM   4594 C  CA    . ARG A 1 559 ? 10.973  -12.065 -43.361 1.00 22.35  ? 559  ARG A CA    1 
ATOM   4595 C  C     . ARG A 1 559 ? 10.020  -11.206 -44.190 1.00 23.29  ? 559  ARG A C     1 
ATOM   4596 O  O     . ARG A 1 559 ? 10.261  -10.008 -44.379 1.00 23.11  ? 559  ARG A O     1 
ATOM   4597 C  CB    . ARG A 1 559 ? 11.999  -12.812 -44.219 1.00 22.13  ? 559  ARG A CB    1 
ATOM   4598 C  CG    . ARG A 1 559 ? 13.290  -13.113 -43.446 1.00 23.16  ? 559  ARG A CG    1 
ATOM   4599 C  CD    . ARG A 1 559 ? 14.148  -14.191 -44.111 1.00 26.66  ? 559  ARG A CD    1 
ATOM   4600 N  NE    . ARG A 1 559 ? 15.387  -14.412 -43.362 1.00 23.43  ? 559  ARG A NE    1 
ATOM   4601 C  CZ    . ARG A 1 559 ? 15.519  -15.262 -42.342 1.00 26.96  ? 559  ARG A CZ    1 
ATOM   4602 N  NH1   . ARG A 1 559 ? 14.490  -16.002 -41.937 1.00 22.23  ? 559  ARG A NH1   1 
ATOM   4603 N  NH2   . ARG A 1 559 ? 16.691  -15.376 -41.724 1.00 24.50  ? 559  ARG A NH2   1 
ATOM   4604 N  N     . LYS A 1 560 ? 8.919   -11.815 -44.643 1.00 21.94  ? 560  LYS A N     1 
ATOM   4605 C  CA    . LYS A 1 560 ? 7.814   -11.067 -45.250 1.00 20.37  ? 560  LYS A CA    1 
ATOM   4606 C  C     . LYS A 1 560 ? 7.249   -10.026 -44.265 1.00 18.72  ? 560  LYS A C     1 
ATOM   4607 O  O     . LYS A 1 560 ? 7.053   -8.868  -44.625 1.00 17.04  ? 560  LYS A O     1 
ATOM   4608 C  CB    . LYS A 1 560 ? 6.716   -12.024 -45.737 1.00 20.16  ? 560  LYS A CB    1 
ATOM   4609 C  CG    . LYS A 1 560 ? 5.421   -11.338 -46.169 1.00 23.32  ? 560  LYS A CG    1 
ATOM   4610 C  CD    . LYS A 1 560 ? 4.330   -12.347 -46.528 1.00 22.10  ? 560  LYS A CD    1 
ATOM   4611 C  CE    . LYS A 1 560 ? 2.987   -11.641 -46.736 1.00 26.79  ? 560  LYS A CE    1 
ATOM   4612 N  NZ    . LYS A 1 560 ? 1.888   -12.559 -47.212 1.00 26.44  ? 560  LYS A NZ    1 
ATOM   4613 N  N     . LEU A 1 561 ? 7.011   -10.433 -43.020 1.00 17.27  ? 561  LEU A N     1 
ATOM   4614 C  CA    . LEU A 1 561 ? 6.487   -9.508  -42.013 1.00 21.01  ? 561  LEU A CA    1 
ATOM   4615 C  C     . LEU A 1 561 ? 7.434   -8.323  -41.800 1.00 21.46  ? 561  LEU A C     1 
ATOM   4616 O  O     . LEU A 1 561 ? 6.984   -7.176  -41.720 1.00 22.58  ? 561  LEU A O     1 
ATOM   4617 C  CB    . LEU A 1 561 ? 6.183   -10.225 -40.684 1.00 20.16  ? 561  LEU A CB    1 
ATOM   4618 C  CG    . LEU A 1 561 ? 5.719   -9.363  -39.495 1.00 26.59  ? 561  LEU A CG    1 
ATOM   4619 C  CD1   . LEU A 1 561 ? 4.384   -8.660  -39.763 1.00 25.16  ? 561  LEU A CD1   1 
ATOM   4620 C  CD2   . LEU A 1 561 ? 5.630   -10.206 -38.214 1.00 28.08  ? 561  LEU A CD2   1 
ATOM   4621 N  N     . LEU A 1 562 ? 8.734   -8.607  -41.733 1.00 19.96  ? 562  LEU A N     1 
ATOM   4622 C  CA    . LEU A 1 562 ? 9.750   -7.567  -41.572 1.00 21.30  ? 562  LEU A CA    1 
ATOM   4623 C  C     . LEU A 1 562 ? 9.767   -6.548  -42.722 1.00 21.65  ? 562  LEU A C     1 
ATOM   4624 O  O     . LEU A 1 562 ? 9.825   -5.336  -42.482 1.00 22.84  ? 562  LEU A O     1 
ATOM   4625 C  CB    . LEU A 1 562 ? 11.146  -8.189  -41.367 1.00 21.32  ? 562  LEU A CB    1 
ATOM   4626 C  CG    . LEU A 1 562 ? 12.275  -7.250  -40.911 1.00 25.22  ? 562  LEU A CG    1 
ATOM   4627 C  CD1   . LEU A 1 562 ? 11.963  -6.563  -39.564 1.00 25.55  ? 562  LEU A CD1   1 
ATOM   4628 C  CD2   . LEU A 1 562 ? 13.601  -7.994  -40.823 1.00 24.02  ? 562  LEU A CD2   1 
ATOM   4629 N  N     . ILE A 1 563 ? 9.716   -7.021  -43.964 1.00 19.23  ? 563  ILE A N     1 
ATOM   4630 C  CA    . ILE A 1 563 ? 9.723   -6.089  -45.092 1.00 22.51  ? 563  ILE A CA    1 
ATOM   4631 C  C     . ILE A 1 563 ? 8.410   -5.310  -45.226 1.00 23.83  ? 563  ILE A C     1 
ATOM   4632 O  O     . ILE A 1 563 ? 8.416   -4.110  -45.521 1.00 22.68  ? 563  ILE A O     1 
ATOM   4633 C  CB    . ILE A 1 563 ? 10.193  -6.723  -46.443 1.00 24.36  ? 563  ILE A CB    1 
ATOM   4634 C  CG1   . ILE A 1 563 ? 9.323   -7.902  -46.881 1.00 19.36  ? 563  ILE A CG1   1 
ATOM   4635 C  CG2   . ILE A 1 563 ? 11.661  -7.137  -46.356 1.00 20.98  ? 563  ILE A CG2   1 
ATOM   4636 C  CD1   . ILE A 1 563 ? 9.782   -8.500  -48.195 1.00 18.61  ? 563  ILE A CD1   1 
ATOM   4637 N  N     . ASN A 1 564 ? 7.293   -5.984  -44.969 1.00 22.57  ? 564  ASN A N     1 
ATOM   4638 C  CA    . ASN A 1 564 ? 6.017   -5.295  -44.875 1.00 21.20  ? 564  ASN A CA    1 
ATOM   4639 C  C     . ASN A 1 564 ? 5.961   -4.276  -43.726 1.00 22.48  ? 564  ASN A C     1 
ATOM   4640 O  O     . ASN A 1 564 ? 5.271   -3.265  -43.830 1.00 22.08  ? 564  ASN A O     1 
ATOM   4641 C  CB    . ASN A 1 564 ? 4.887   -6.301  -44.768 1.00 22.05  ? 564  ASN A CB    1 
ATOM   4642 C  CG    . ASN A 1 564 ? 4.590   -6.975  -46.092 1.00 23.29  ? 564  ASN A CG    1 
ATOM   4643 O  OD1   . ASN A 1 564 ? 5.005   -6.501  -47.150 1.00 23.67  ? 564  ASN A OD1   1 
ATOM   4644 N  ND2   . ASN A 1 564 ? 3.871   -8.086  -46.040 1.00 20.46  ? 564  ASN A ND2   1 
ATOM   4645 N  N     . SER A 1 565 ? 6.712   -4.535  -42.651 1.00 21.81  ? 565  SER A N     1 
ATOM   4646 C  CA    . SER A 1 565 ? 6.775   -3.627  -41.506 1.00 21.84  ? 565  SER A CA    1 
ATOM   4647 C  C     . SER A 1 565 ? 7.589   -2.375  -41.789 1.00 21.45  ? 565  SER A C     1 
ATOM   4648 O  O     . SER A 1 565 ? 7.420   -1.366  -41.101 1.00 23.87  ? 565  SER A O     1 
ATOM   4649 C  CB    . SER A 1 565 ? 7.336   -4.338  -40.278 1.00 22.43  ? 565  SER A CB    1 
ATOM   4650 O  OG    . SER A 1 565 ? 6.465   -5.375  -39.871 1.00 26.50  ? 565  SER A OG    1 
ATOM   4651 N  N     . LEU A 1 566 ? 8.475   -2.446  -42.784 1.00 21.21  ? 566  LEU A N     1 
ATOM   4652 C  CA    . LEU A 1 566 ? 9.207   -1.272  -43.246 1.00 22.43  ? 566  LEU A CA    1 
ATOM   4653 C  C     . LEU A 1 566 ? 8.265   -0.315  -43.958 1.00 22.37  ? 566  LEU A C     1 
ATOM   4654 O  O     . LEU A 1 566 ? 8.330   0.888   -43.723 1.00 23.74  ? 566  LEU A O     1 
ATOM   4655 C  CB    . LEU A 1 566 ? 10.404  -1.631  -44.146 1.00 20.74  ? 566  LEU A CB    1 
ATOM   4656 C  CG    . LEU A 1 566 ? 11.202  -0.439  -44.714 1.00 21.82  ? 566  LEU A CG    1 
ATOM   4657 C  CD1   . LEU A 1 566 ? 11.724  0.507   -43.619 1.00 15.48  ? 566  LEU A CD1   1 
ATOM   4658 C  CD2   . LEU A 1 566 ? 12.351  -0.894  -45.602 1.00 23.39  ? 566  LEU A CD2   1 
ATOM   4659 N  N     . TYR A 1 567 ? 7.400   -0.843  -44.826 1.00 22.33  ? 567  TYR A N     1 
ATOM   4660 C  CA    . TYR A 1 567 ? 6.294   -0.035  -45.346 1.00 23.47  ? 567  TYR A CA    1 
ATOM   4661 C  C     . TYR A 1 567 ? 5.502   0.562   -44.171 1.00 23.11  ? 567  TYR A C     1 
ATOM   4662 O  O     . TYR A 1 567 ? 5.253   1.764   -44.134 1.00 22.64  ? 567  TYR A O     1 
ATOM   4663 C  CB    . TYR A 1 567 ? 5.354   -0.822  -46.281 1.00 21.49  ? 567  TYR A CB    1 
ATOM   4664 C  CG    . TYR A 1 567 ? 3.934   -0.334  -46.126 1.00 20.79  ? 567  TYR A CG    1 
ATOM   4665 C  CD1   . TYR A 1 567 ? 3.006   -1.066  -45.384 1.00 20.35  ? 567  TYR A CD1   1 
ATOM   4666 C  CD2   . TYR A 1 567 ? 3.545   0.908   -46.634 1.00 21.72  ? 567  TYR A CD2   1 
ATOM   4667 C  CE1   . TYR A 1 567 ? 1.711   -0.593  -45.183 1.00 24.13  ? 567  TYR A CE1   1 
ATOM   4668 C  CE2   . TYR A 1 567 ? 2.255   1.393   -46.435 1.00 22.87  ? 567  TYR A CE2   1 
ATOM   4669 C  CZ    . TYR A 1 567 ? 1.346   0.638   -45.711 1.00 24.22  ? 567  TYR A CZ    1 
ATOM   4670 O  OH    . TYR A 1 567 ? 0.070   1.110   -45.520 1.00 27.10  ? 567  TYR A OH    1 
ATOM   4671 N  N     . GLY A 1 568 ? 5.118   -0.281  -43.214 1.00 22.65  ? 568  GLY A N     1 
ATOM   4672 C  CA    . GLY A 1 568 ? 4.356   0.176   -42.047 1.00 23.12  ? 568  GLY A CA    1 
ATOM   4673 C  C     . GLY A 1 568 ? 5.066   1.245   -41.233 1.00 24.74  ? 568  GLY A C     1 
ATOM   4674 O  O     . GLY A 1 568 ? 4.439   2.196   -40.749 1.00 23.60  ? 568  GLY A O     1 
ATOM   4675 N  N     . ALA A 1 569 ? 6.381   1.093   -41.091 1.00 24.61  ? 569  ALA A N     1 
ATOM   4676 C  CA    . ALA A 1 569 ? 7.177   2.025   -40.314 1.00 24.93  ? 569  ALA A CA    1 
ATOM   4677 C  C     . ALA A 1 569 ? 7.090   3.430   -40.900 1.00 26.71  ? 569  ALA A C     1 
ATOM   4678 O  O     . ALA A 1 569 ? 6.989   4.408   -40.160 1.00 28.36  ? 569  ALA A O     1 
ATOM   4679 C  CB    . ALA A 1 569 ? 8.614   1.552   -40.226 1.00 25.68  ? 569  ALA A CB    1 
ATOM   4680 N  N     . LEU A 1 570 ? 7.070   3.522   -42.230 1.00 26.57  ? 570  LEU A N     1 
ATOM   4681 C  CA    . LEU A 1 570 ? 6.943   4.806   -42.924 1.00 24.83  ? 570  LEU A CA    1 
ATOM   4682 C  C     . LEU A 1 570 ? 5.675   5.551   -42.517 1.00 24.67  ? 570  LEU A C     1 
ATOM   4683 O  O     . LEU A 1 570 ? 5.574   6.769   -42.713 1.00 24.05  ? 570  LEU A O     1 
ATOM   4684 C  CB    . LEU A 1 570 ? 6.962   4.610   -44.448 1.00 23.98  ? 570  LEU A CB    1 
ATOM   4685 C  CG    . LEU A 1 570 ? 8.239   4.068   -45.103 1.00 22.80  ? 570  LEU A CG    1 
ATOM   4686 C  CD1   . LEU A 1 570 ? 7.970   3.729   -46.558 1.00 19.43  ? 570  LEU A CD1   1 
ATOM   4687 C  CD2   . LEU A 1 570 ? 9.414   5.041   -44.994 1.00 20.39  ? 570  LEU A CD2   1 
ATOM   4688 N  N     . GLY A 1 571 ? 4.717   4.808   -41.961 1.00 24.07  ? 571  GLY A N     1 
ATOM   4689 C  CA    . GLY A 1 571 ? 3.474   5.383   -41.442 1.00 24.15  ? 571  GLY A CA    1 
ATOM   4690 C  C     . GLY A 1 571 ? 3.340   5.387   -39.922 1.00 23.89  ? 571  GLY A C     1 
ATOM   4691 O  O     . GLY A 1 571 ? 2.241   5.587   -39.403 1.00 22.98  ? 571  GLY A O     1 
ATOM   4692 N  N     . ASN A 1 572 ? 4.448   5.160   -39.209 1.00 24.40  ? 572  ASN A N     1 
ATOM   4693 C  CA    . ASN A 1 572 ? 4.479   5.304   -37.744 1.00 24.25  ? 572  ASN A CA    1 
ATOM   4694 C  C     . ASN A 1 572 ? 5.352   6.480   -37.285 1.00 24.16  ? 572  ASN A C     1 
ATOM   4695 O  O     . ASN A 1 572 ? 6.518   6.562   -37.666 1.00 24.78  ? 572  ASN A O     1 
ATOM   4696 C  CB    . ASN A 1 572 ? 4.948   4.015   -37.073 1.00 23.88  ? 572  ASN A CB    1 
ATOM   4697 C  CG    . ASN A 1 572 ? 5.018   4.143   -35.552 1.00 28.05  ? 572  ASN A CG    1 
ATOM   4698 O  OD1   . ASN A 1 572 ? 5.843   4.887   -35.015 1.00 30.96  ? 572  ASN A OD1   1 
ATOM   4699 N  ND2   . ASN A 1 572 ? 4.141   3.431   -34.858 1.00 26.67  ? 572  ASN A ND2   1 
ATOM   4700 N  N     . VAL A 1 573 ? 4.792   7.369   -36.455 1.00 25.93  ? 573  VAL A N     1 
ATOM   4701 C  CA    . VAL A 1 573 ? 5.467   8.631   -36.062 1.00 26.92  ? 573  VAL A CA    1 
ATOM   4702 C  C     . VAL A 1 573 ? 6.834   8.452   -35.372 1.00 28.02  ? 573  VAL A C     1 
ATOM   4703 O  O     . VAL A 1 573 ? 7.688   9.332   -35.452 1.00 31.30  ? 573  VAL A O     1 
ATOM   4704 C  CB    . VAL A 1 573 ? 4.546   9.593   -35.221 1.00 27.75  ? 573  VAL A CB    1 
ATOM   4705 C  CG1   . VAL A 1 573 ? 3.324   10.051  -36.043 1.00 26.44  ? 573  VAL A CG1   1 
ATOM   4706 C  CG2   . VAL A 1 573 ? 4.115   8.967   -33.873 1.00 24.96  ? 573  VAL A CG2   1 
ATOM   4707 N  N     . TRP A 1 574 ? 7.036   7.303   -34.730 1.00 28.50  ? 574  TRP A N     1 
ATOM   4708 C  CA    . TRP A 1 574 ? 8.294   6.981   -34.042 1.00 31.22  ? 574  TRP A CA    1 
ATOM   4709 C  C     . TRP A 1 574 ? 9.459   6.552   -34.952 1.00 28.37  ? 574  TRP A C     1 
ATOM   4710 O  O     . TRP A 1 574 ? 10.606  6.539   -34.514 1.00 28.40  ? 574  TRP A O     1 
ATOM   4711 C  CB    . TRP A 1 574 ? 8.040   5.943   -32.935 1.00 34.42  ? 574  TRP A CB    1 
ATOM   4712 C  CG    . TRP A 1 574 ? 7.035   6.448   -31.952 1.00 41.76  ? 574  TRP A CG    1 
ATOM   4713 C  CD1   . TRP A 1 574 ? 5.710   6.123   -31.893 1.00 43.98  ? 574  TRP A CD1   1 
ATOM   4714 C  CD2   . TRP A 1 574 ? 7.259   7.419   -30.921 1.00 44.97  ? 574  TRP A CD2   1 
ATOM   4715 N  NE1   . TRP A 1 574 ? 5.099   6.815   -30.874 1.00 47.85  ? 574  TRP A NE1   1 
ATOM   4716 C  CE2   . TRP A 1 574 ? 6.026   7.619   -30.263 1.00 47.56  ? 574  TRP A CE2   1 
ATOM   4717 C  CE3   . TRP A 1 574 ? 8.385   8.130   -30.482 1.00 48.25  ? 574  TRP A CE3   1 
ATOM   4718 C  CZ2   . TRP A 1 574 ? 5.886   8.500   -29.181 1.00 51.56  ? 574  TRP A CZ2   1 
ATOM   4719 C  CZ3   . TRP A 1 574 ? 8.247   9.010   -29.404 1.00 51.35  ? 574  TRP A CZ3   1 
ATOM   4720 C  CH2   . TRP A 1 574 ? 7.004   9.187   -28.769 1.00 52.22  ? 574  TRP A CH2   1 
ATOM   4721 N  N     . PHE A 1 575 ? 9.172   6.230   -36.212 1.00 25.76  ? 575  PHE A N     1 
ATOM   4722 C  CA    . PHE A 1 575 ? 10.213  5.861   -37.177 1.00 24.81  ? 575  PHE A CA    1 
ATOM   4723 C  C     . PHE A 1 575 ? 11.015  7.090   -37.619 1.00 26.30  ? 575  PHE A C     1 
ATOM   4724 O  O     . PHE A 1 575 ? 10.441  8.118   -37.961 1.00 28.66  ? 575  PHE A O     1 
ATOM   4725 C  CB    . PHE A 1 575 ? 9.578   5.179   -38.386 1.00 22.84  ? 575  PHE A CB    1 
ATOM   4726 C  CG    . PHE A 1 575 ? 10.556  4.472   -39.292 1.00 20.44  ? 575  PHE A CG    1 
ATOM   4727 C  CD1   . PHE A 1 575 ? 11.589  3.700   -38.775 1.00 22.63  ? 575  PHE A CD1   1 
ATOM   4728 C  CD2   . PHE A 1 575 ? 10.409  4.544   -40.671 1.00 20.47  ? 575  PHE A CD2   1 
ATOM   4729 C  CE1   . PHE A 1 575 ? 12.481  3.025   -39.624 1.00 22.65  ? 575  PHE A CE1   1 
ATOM   4730 C  CE2   . PHE A 1 575 ? 11.287  3.869   -41.527 1.00 21.36  ? 575  PHE A CE2   1 
ATOM   4731 C  CZ    . PHE A 1 575 ? 12.323  3.111   -41.001 1.00 20.54  ? 575  PHE A CZ    1 
ATOM   4732 N  N     . ARG A 1 576 ? 12.341  6.976   -37.597 1.00 25.10  ? 576  ARG A N     1 
ATOM   4733 C  CA    . ARG A 1 576 ? 13.239  8.039   -38.048 1.00 25.26  ? 576  ARG A CA    1 
ATOM   4734 C  C     . ARG A 1 576 ? 12.859  8.558   -39.454 1.00 27.12  ? 576  ARG A C     1 
ATOM   4735 O  O     . ARG A 1 576 ? 12.967  9.753   -39.734 1.00 25.92  ? 576  ARG A O     1 
ATOM   4736 C  CB    . ARG A 1 576 ? 14.682  7.519   -38.044 1.00 24.96  ? 576  ARG A CB    1 
ATOM   4737 C  CG    . ARG A 1 576 ? 15.768  8.592   -38.159 1.00 23.72  ? 576  ARG A CG    1 
ATOM   4738 C  CD    . ARG A 1 576 ? 17.178  7.985   -38.148 1.00 20.32  ? 576  ARG A CD    1 
ATOM   4739 N  NE    . ARG A 1 576 ? 17.474  7.237   -36.916 1.00 23.31  ? 576  ARG A NE    1 
ATOM   4740 C  CZ    . ARG A 1 576 ? 17.915  7.772   -35.781 1.00 23.91  ? 576  ARG A CZ    1 
ATOM   4741 N  NH1   . ARG A 1 576 ? 18.127  9.081   -35.689 1.00 22.51  ? 576  ARG A NH1   1 
ATOM   4742 N  NH2   . ARG A 1 576 ? 18.149  6.993   -34.728 1.00 23.59  ? 576  ARG A NH2   1 
ATOM   4743 N  N     . TYR A 1 577 ? 12.390  7.658   -40.316 1.00 25.53  ? 577  TYR A N     1 
ATOM   4744 C  CA    . TYR A 1 577 ? 12.081  8.005   -41.708 1.00 26.00  ? 577  TYR A CA    1 
ATOM   4745 C  C     . TYR A 1 577 ? 10.580  8.052   -42.002 1.00 26.00  ? 577  TYR A C     1 
ATOM   4746 O  O     . TYR A 1 577 ? 10.158  7.891   -43.149 1.00 26.96  ? 577  TYR A O     1 
ATOM   4747 C  CB    . TYR A 1 577 ? 12.815  7.059   -42.668 1.00 26.04  ? 577  TYR A CB    1 
ATOM   4748 C  CG    . TYR A 1 577 ? 14.274  6.914   -42.320 1.00 26.45  ? 577  TYR A CG    1 
ATOM   4749 C  CD1   . TYR A 1 577 ? 14.739  5.788   -41.632 1.00 26.97  ? 577  TYR A CD1   1 
ATOM   4750 C  CD2   . TYR A 1 577 ? 15.188  7.913   -42.650 1.00 25.63  ? 577  TYR A CD2   1 
ATOM   4751 C  CE1   . TYR A 1 577 ? 16.082  5.663   -41.292 1.00 27.22  ? 577  TYR A CE1   1 
ATOM   4752 C  CE2   . TYR A 1 577 ? 16.530  7.795   -42.316 1.00 26.05  ? 577  TYR A CE2   1 
ATOM   4753 C  CZ    . TYR A 1 577 ? 16.968  6.675   -41.639 1.00 26.54  ? 577  TYR A CZ    1 
ATOM   4754 O  OH    . TYR A 1 577 ? 18.296  6.564   -41.318 1.00 27.00  ? 577  TYR A OH    1 
ATOM   4755 N  N     . TYR A 1 578 ? 9.788   8.262   -40.950 1.00 24.24  ? 578  TYR A N     1 
ATOM   4756 C  CA    . TYR A 1 578 ? 8.366   8.517   -41.066 1.00 23.89  ? 578  TYR A CA    1 
ATOM   4757 C  C     . TYR A 1 578 ? 8.089   9.567   -42.126 1.00 24.28  ? 578  TYR A C     1 
ATOM   4758 O  O     . TYR A 1 578 ? 8.623   10.670  -42.077 1.00 23.00  ? 578  TYR A O     1 
ATOM   4759 C  CB    . TYR A 1 578 ? 7.826   9.025   -39.727 1.00 25.82  ? 578  TYR A CB    1 
ATOM   4760 C  CG    . TYR A 1 578 ? 6.383   9.490   -39.756 1.00 24.57  ? 578  TYR A CG    1 
ATOM   4761 C  CD1   . TYR A 1 578 ? 6.069   10.850  -39.737 1.00 24.20  ? 578  TYR A CD1   1 
ATOM   4762 C  CD2   . TYR A 1 578 ? 5.331   8.565   -39.794 1.00 24.13  ? 578  TYR A CD2   1 
ATOM   4763 C  CE1   . TYR A 1 578 ? 4.737   11.286  -39.753 1.00 26.30  ? 578  TYR A CE1   1 
ATOM   4764 C  CE2   . TYR A 1 578 ? 4.001   8.983   -39.804 1.00 26.07  ? 578  TYR A CE2   1 
ATOM   4765 C  CZ    . TYR A 1 578 ? 3.713   10.347  -39.785 1.00 27.36  ? 578  TYR A CZ    1 
ATOM   4766 O  OH    . TYR A 1 578 ? 2.405   10.764  -39.788 1.00 30.15  ? 578  TYR A OH    1 
ATOM   4767 N  N     . ASP A 1 579 ? 7.247   9.217   -43.084 1.00 24.68  ? 579  ASP A N     1 
ATOM   4768 C  CA    . ASP A 1 579 ? 6.839   10.160  -44.105 1.00 25.49  ? 579  ASP A CA    1 
ATOM   4769 C  C     . ASP A 1 579 ? 5.559   9.664   -44.750 1.00 25.39  ? 579  ASP A C     1 
ATOM   4770 O  O     . ASP A 1 579 ? 5.555   8.640   -45.444 1.00 22.10  ? 579  ASP A O     1 
ATOM   4771 C  CB    . ASP A 1 579 ? 7.937   10.355  -45.153 1.00 25.59  ? 579  ASP A CB    1 
ATOM   4772 C  CG    . ASP A 1 579 ? 7.729   11.608  -45.993 1.00 27.51  ? 579  ASP A CG    1 
ATOM   4773 O  OD1   . ASP A 1 579 ? 8.737   12.207  -46.442 1.00 27.68  ? 579  ASP A OD1   1 
ATOM   4774 O  OD2   . ASP A 1 579 ? 6.556   11.997  -46.197 1.00 25.82  ? 579  ASP A OD2   1 
ATOM   4775 N  N     . LEU A 1 580 ? 4.477   10.401  -44.507 1.00 25.54  ? 580  LEU A N     1 
ATOM   4776 C  CA    . LEU A 1 580 ? 3.158   10.041  -45.027 1.00 25.93  ? 580  LEU A CA    1 
ATOM   4777 C  C     . LEU A 1 580 ? 3.030   10.169  -46.549 1.00 25.73  ? 580  LEU A C     1 
ATOM   4778 O  O     . LEU A 1 580 ? 2.184   9.513   -47.156 1.00 25.35  ? 580  LEU A O     1 
ATOM   4779 C  CB    . LEU A 1 580 ? 2.056   10.820  -44.303 1.00 27.09  ? 580  LEU A CB    1 
ATOM   4780 C  CG    . LEU A 1 580 ? 1.108   10.048  -43.366 1.00 30.52  ? 580  LEU A CG    1 
ATOM   4781 C  CD1   . LEU A 1 580 ? 1.687   8.757   -42.756 1.00 23.16  ? 580  LEU A CD1   1 
ATOM   4782 C  CD2   . LEU A 1 580 ? 0.569   10.960  -42.285 1.00 29.34  ? 580  LEU A CD2   1 
ATOM   4783 N  N     . ARG A 1 581 ? 3.877   10.993  -47.159 1.00 25.11  ? 581  ARG A N     1 
ATOM   4784 C  CA    . ARG A 1 581 ? 3.966   11.061  -48.628 1.00 25.00  ? 581  ARG A CA    1 
ATOM   4785 C  C     . ARG A 1 581 ? 4.458   9.726   -49.204 1.00 25.39  ? 581  ARG A C     1 
ATOM   4786 O  O     . ARG A 1 581 ? 3.975   9.271   -50.251 1.00 25.18  ? 581  ARG A O     1 
ATOM   4787 C  CB    . ARG A 1 581 ? 4.908   12.183  -49.077 1.00 23.29  ? 581  ARG A CB    1 
ATOM   4788 C  CG    . ARG A 1 581 ? 4.548   13.593  -48.581 1.00 27.30  ? 581  ARG A CG    1 
ATOM   4789 C  CD    . ARG A 1 581 ? 5.655   14.606  -48.921 1.00 29.69  ? 581  ARG A CD    1 
ATOM   4790 N  NE    . ARG A 1 581 ? 6.885   14.363  -48.155 1.00 30.45  ? 581  ARG A NE    1 
ATOM   4791 C  CZ    . ARG A 1 581 ? 8.009   15.065  -48.286 1.00 30.40  ? 581  ARG A CZ    1 
ATOM   4792 N  NH1   . ARG A 1 581 ? 8.075   16.069  -49.154 1.00 30.81  ? 581  ARG A NH1   1 
ATOM   4793 N  NH2   . ARG A 1 581 ? 9.070   14.766  -47.548 1.00 24.54  ? 581  ARG A NH2   1 
ATOM   4794 N  N     . ASN A 1 582 ? 5.419   9.104   -48.523 1.00 23.41  ? 582  ASN A N     1 
ATOM   4795 C  CA    . ASN A 1 582 ? 5.942   7.805   -48.954 1.00 25.61  ? 582  ASN A CA    1 
ATOM   4796 C  C     . ASN A 1 582 ? 4.986   6.634   -48.679 1.00 24.30  ? 582  ASN A C     1 
ATOM   4797 O  O     . ASN A 1 582 ? 4.773   5.783   -49.553 1.00 24.49  ? 582  ASN A O     1 
ATOM   4798 C  CB    . ASN A 1 582 ? 7.342   7.545   -48.364 1.00 25.80  ? 582  ASN A CB    1 
ATOM   4799 C  CG    . ASN A 1 582 ? 8.439   8.381   -49.042 1.00 27.63  ? 582  ASN A CG    1 
ATOM   4800 O  OD1   . ASN A 1 582 ? 8.242   8.945   -50.126 1.00 24.11  ? 582  ASN A OD1   1 
ATOM   4801 N  ND2   . ASN A 1 582 ? 9.601   8.457   -48.400 1.00 24.43  ? 582  ASN A ND2   1 
ATOM   4802 N  N     . ALA A 1 583 ? 4.397   6.596   -47.482 1.00 23.31  ? 583  ALA A N     1 
ATOM   4803 C  CA    . ALA A 1 583 ? 3.449   5.526   -47.138 1.00 21.17  ? 583  ALA A CA    1 
ATOM   4804 C  C     . ALA A 1 583 ? 2.238   5.552   -48.081 1.00 23.39  ? 583  ALA A C     1 
ATOM   4805 O  O     . ALA A 1 583 ? 1.796   4.506   -48.576 1.00 24.12  ? 583  ALA A O     1 
ATOM   4806 C  CB    . ALA A 1 583 ? 3.012   5.628   -45.669 1.00 17.37  ? 583  ALA A CB    1 
ATOM   4807 N  N     . THR A 1 584 ? 1.739   6.761   -48.349 1.00 22.07  ? 584  THR A N     1 
ATOM   4808 C  CA    . THR A 1 584 ? 0.593   6.971   -49.233 1.00 22.46  ? 584  THR A CA    1 
ATOM   4809 C  C     . THR A 1 584 ? 0.932   6.693   -50.703 1.00 23.41  ? 584  THR A C     1 
ATOM   4810 O  O     . THR A 1 584 ? 0.096   6.162   -51.442 1.00 23.96  ? 584  THR A O     1 
ATOM   4811 C  CB    . THR A 1 584 ? -0.002  8.396   -49.053 1.00 24.06  ? 584  THR A CB    1 
ATOM   4812 O  OG1   . THR A 1 584 ? -0.312  8.607   -47.663 1.00 26.22  ? 584  THR A OG1   1 
ATOM   4813 C  CG2   . THR A 1 584 ? -1.273  8.568   -49.873 1.00 24.44  ? 584  THR A CG2   1 
ATOM   4814 N  N     . ALA A 1 585 ? 2.151   7.026   -51.122 1.00 21.53  ? 585  ALA A N     1 
ATOM   4815 C  CA    . ALA A 1 585 ? 2.599   6.678   -52.475 1.00 23.27  ? 585  ALA A CA    1 
ATOM   4816 C  C     . ALA A 1 585 ? 2.531   5.168   -52.715 1.00 22.47  ? 585  ALA A C     1 
ATOM   4817 O  O     . ALA A 1 585 ? 2.117   4.730   -53.783 1.00 24.36  ? 585  ALA A O     1 
ATOM   4818 C  CB    . ALA A 1 585 ? 4.012   7.209   -52.746 1.00 20.37  ? 585  ALA A CB    1 
ATOM   4819 N  N     . ILE A 1 586 ? 2.943   4.387   -51.721 1.00 21.11  ? 586  ILE A N     1 
ATOM   4820 C  CA    . ILE A 1 586 ? 2.869   2.925   -51.798 1.00 21.43  ? 586  ILE A CA    1 
ATOM   4821 C  C     . ILE A 1 586 ? 1.424   2.423   -51.904 1.00 22.35  ? 586  ILE A C     1 
ATOM   4822 O  O     . ILE A 1 586 ? 1.106   1.658   -52.814 1.00 24.52  ? 586  ILE A O     1 
ATOM   4823 C  CB    . ILE A 1 586 ? 3.562   2.254   -50.579 1.00 21.40  ? 586  ILE A CB    1 
ATOM   4824 C  CG1   . ILE A 1 586 ? 5.062   2.589   -50.574 1.00 20.33  ? 586  ILE A CG1   1 
ATOM   4825 C  CG2   . ILE A 1 586 ? 3.318   0.731   -50.576 1.00 16.62  ? 586  ILE A CG2   1 
ATOM   4826 C  CD1   . ILE A 1 586 ? 5.686   2.521   -49.191 1.00 16.20  ? 586  ILE A CD1   1 
ATOM   4827 N  N     . THR A 1 587 ? 0.558   2.854   -50.980 1.00 24.23  ? 587  THR A N     1 
ATOM   4828 C  CA    . THR A 1 587 ? -0.827  2.353   -50.927 1.00 23.39  ? 587  THR A CA    1 
ATOM   4829 C  C     . THR A 1 587 ? -1.666  2.803   -52.127 1.00 24.01  ? 587  THR A C     1 
ATOM   4830 O  O     . THR A 1 587 ? -2.492  2.036   -52.646 1.00 24.05  ? 587  THR A O     1 
ATOM   4831 C  CB    . THR A 1 587 ? -1.561  2.712   -49.598 1.00 25.73  ? 587  THR A CB    1 
ATOM   4832 O  OG1   . THR A 1 587 ? -1.789  4.125   -49.509 1.00 22.60  ? 587  THR A OG1   1 
ATOM   4833 C  CG2   . THR A 1 587 ? -0.775  2.234   -48.384 1.00 22.95  ? 587  THR A CG2   1 
ATOM   4834 N  N     . THR A 1 588 ? -1.431  4.031   -52.584 1.00 23.41  ? 588  THR A N     1 
ATOM   4835 C  CA    . THR A 1 588 ? -2.145  4.558   -53.742 1.00 22.92  ? 588  THR A CA    1 
ATOM   4836 C  C     . THR A 1 588 ? -1.736  3.825   -55.033 1.00 23.15  ? 588  THR A C     1 
ATOM   4837 O  O     . THR A 1 588 ? -2.601  3.404   -55.796 1.00 24.45  ? 588  THR A O     1 
ATOM   4838 C  CB    . THR A 1 588 ? -2.001  6.082   -53.842 1.00 22.86  ? 588  THR A CB    1 
ATOM   4839 O  OG1   . THR A 1 588 ? -2.294  6.650   -52.558 1.00 27.03  ? 588  THR A OG1   1 
ATOM   4840 C  CG2   . THR A 1 588 ? -2.981  6.658   -54.864 1.00 24.88  ? 588  THR A CG2   1 
ATOM   4841 N  N     . PHE A 1 589 ? -0.433  3.651   -55.249 1.00 22.67  ? 589  PHE A N     1 
ATOM   4842 C  CA    . PHE A 1 589 ? 0.084   2.849   -56.371 1.00 22.10  ? 589  PHE A CA    1 
ATOM   4843 C  C     . PHE A 1 589 ? -0.569  1.464   -56.346 1.00 22.87  ? 589  PHE A C     1 
ATOM   4844 O  O     . PHE A 1 589 ? -0.968  0.941   -57.385 1.00 23.19  ? 589  PHE A O     1 
ATOM   4845 C  CB    . PHE A 1 589 ? 1.616   2.722   -56.277 1.00 21.08  ? 589  PHE A CB    1 
ATOM   4846 C  CG    . PHE A 1 589 ? 2.278   2.166   -57.525 1.00 19.08  ? 589  PHE A CG    1 
ATOM   4847 C  CD1   . PHE A 1 589 ? 2.362   0.792   -57.740 1.00 17.53  ? 589  PHE A CD1   1 
ATOM   4848 C  CD2   . PHE A 1 589 ? 2.851   3.021   -58.462 1.00 19.71  ? 589  PHE A CD2   1 
ATOM   4849 C  CE1   . PHE A 1 589 ? 2.984   0.273   -58.892 1.00 17.12  ? 589  PHE A CE1   1 
ATOM   4850 C  CE2   . PHE A 1 589 ? 3.471   2.515   -59.616 1.00 23.02  ? 589  PHE A CE2   1 
ATOM   4851 C  CZ    . PHE A 1 589 ? 3.539   1.137   -59.826 1.00 17.79  ? 589  PHE A CZ    1 
ATOM   4852 N  N     . GLY A 1 590 ? -0.696  0.893   -55.149 1.00 24.39  ? 590  GLY A N     1 
ATOM   4853 C  CA    . GLY A 1 590 ? -1.344  -0.413  -54.955 1.00 25.54  ? 590  GLY A CA    1 
ATOM   4854 C  C     . GLY A 1 590 ? -2.779  -0.453  -55.459 1.00 25.62  ? 590  GLY A C     1 
ATOM   4855 O  O     . GLY A 1 590 ? -3.179  -1.393  -56.164 1.00 23.30  ? 590  GLY A O     1 
ATOM   4856 N  N     . GLN A 1 591 ? -3.544  0.577   -55.109 1.00 25.18  ? 591  GLN A N     1 
ATOM   4857 C  CA    . GLN A 1 591 ? -4.940  0.689   -55.521 1.00 26.05  ? 591  GLN A CA    1 
ATOM   4858 C  C     . GLN A 1 591 ? -5.043  0.779   -57.032 1.00 26.49  ? 591  GLN A C     1 
ATOM   4859 O  O     . GLN A 1 591 ? -5.924  0.174   -57.627 1.00 26.82  ? 591  GLN A O     1 
ATOM   4860 C  CB    . GLN A 1 591 ? -5.606  1.917   -54.888 1.00 28.29  ? 591  GLN A CB    1 
ATOM   4861 C  CG    . GLN A 1 591 ? -5.915  1.787   -53.391 1.00 30.58  ? 591  GLN A CG    1 
ATOM   4862 C  CD    . GLN A 1 591 ? -7.031  2.730   -52.929 1.00 34.81  ? 591  GLN A CD    1 
ATOM   4863 O  OE1   . GLN A 1 591 ? -7.664  3.411   -53.737 1.00 40.39  ? 591  GLN A OE1   1 
ATOM   4864 N  NE2   . GLN A 1 591 ? -7.280  2.758   -51.629 1.00 35.38  ? 591  GLN A NE2   1 
ATOM   4865 N  N     . MET A 1 592 ? -4.131  1.541   -57.637 1.00 27.81  ? 592  MET A N     1 
ATOM   4866 C  CA    . MET A 1 592 ? -4.031  1.656   -59.087 1.00 28.56  ? 592  MET A CA    1 
ATOM   4867 C  C     . MET A 1 592 ? -3.665  0.324   -59.738 1.00 27.91  ? 592  MET A C     1 
ATOM   4868 O  O     . MET A 1 592 ? -4.296  -0.076  -60.707 1.00 28.98  ? 592  MET A O     1 
ATOM   4869 C  CB    . MET A 1 592 ? -3.000  2.721   -59.484 1.00 29.28  ? 592  MET A CB    1 
ATOM   4870 C  CG    . MET A 1 592 ? -2.807  2.836   -61.000 1.00 28.92  ? 592  MET A CG    1 
ATOM   4871 S  SD    . MET A 1 592 ? -1.495  3.957   -61.513 1.00 30.39  ? 592  MET A SD    1 
ATOM   4872 C  CE    . MET A 1 592 ? -0.049  3.158   -60.819 1.00 34.31  ? 592  MET A CE    1 
ATOM   4873 N  N     . ALA A 1 593 ? -2.651  -0.350  -59.200 1.00 26.43  ? 593  ALA A N     1 
ATOM   4874 C  CA    . ALA A 1 593 ? -2.119  -1.571  -59.810 1.00 28.51  ? 593  ALA A CA    1 
ATOM   4875 C  C     . ALA A 1 593 ? -3.183  -2.666  -59.888 1.00 29.32  ? 593  ALA A C     1 
ATOM   4876 O  O     . ALA A 1 593 ? -3.315  -3.338  -60.913 1.00 28.64  ? 593  ALA A O     1 
ATOM   4877 C  CB    . ALA A 1 593 ? -0.895  -2.070  -59.040 1.00 25.10  ? 593  ALA A CB    1 
ATOM   4878 N  N     . LEU A 1 594 ? -3.946  -2.813  -58.803 1.00 28.78  ? 594  LEU A N     1 
ATOM   4879 C  CA    . LEU A 1 594 ? -5.019  -3.800  -58.716 1.00 29.25  ? 594  LEU A CA    1 
ATOM   4880 C  C     . LEU A 1 594 ? -6.147  -3.520  -59.718 1.00 29.40  ? 594  LEU A C     1 
ATOM   4881 O  O     . LEU A 1 594 ? -6.528  -4.397  -60.499 1.00 30.65  ? 594  LEU A O     1 
ATOM   4882 C  CB    . LEU A 1 594 ? -5.577  -3.858  -57.281 1.00 27.72  ? 594  LEU A CB    1 
ATOM   4883 C  CG    . LEU A 1 594 ? -6.648  -4.922  -57.023 1.00 31.41  ? 594  LEU A CG    1 
ATOM   4884 C  CD1   . LEU A 1 594 ? -6.087  -6.312  -57.324 1.00 30.07  ? 594  LEU A CD1   1 
ATOM   4885 C  CD2   . LEU A 1 594 ? -7.179  -4.841  -55.600 1.00 28.97  ? 594  LEU A CD2   1 
ATOM   4886 N  N     . GLN A 1 595 ? -6.669  -2.298  -59.686 1.00 28.41  ? 595  GLN A N     1 
ATOM   4887 C  CA    . GLN A 1 595 ? -7.755  -1.894  -60.568 1.00 30.99  ? 595  GLN A CA    1 
ATOM   4888 C  C     . GLN A 1 595 ? -7.322  -1.778  -62.036 1.00 30.96  ? 595  GLN A C     1 
ATOM   4889 O  O     . GLN A 1 595 ? -8.109  -2.062  -62.932 1.00 33.05  ? 595  GLN A O     1 
ATOM   4890 C  CB    . GLN A 1 595 ? -8.423  -0.621  -60.046 1.00 29.26  ? 595  GLN A CB    1 
ATOM   4891 C  CG    . GLN A 1 595 ? -9.252  -0.887  -58.789 1.00 31.30  ? 595  GLN A CG    1 
ATOM   4892 C  CD    . GLN A 1 595 ? -9.576  0.370   -58.005 1.00 32.98  ? 595  GLN A CD    1 
ATOM   4893 O  OE1   . GLN A 1 595 ? -10.667 0.927   -58.125 1.00 34.66  ? 595  GLN A OE1   1 
ATOM   4894 N  NE2   . GLN A 1 595 ? -8.625  0.824   -57.197 1.00 34.01  ? 595  GLN A NE2   1 
ATOM   4895 N  N     . TRP A 1 596 ? -6.071  -1.385  -62.269 1.00 30.46  ? 596  TRP A N     1 
ATOM   4896 C  CA    . TRP A 1 596 ? -5.486  -1.388  -63.615 1.00 29.19  ? 596  TRP A CA    1 
ATOM   4897 C  C     . TRP A 1 596 ? -5.483  -2.801  -64.208 1.00 30.41  ? 596  TRP A C     1 
ATOM   4898 O  O     . TRP A 1 596 ? -5.863  -2.996  -65.357 1.00 31.10  ? 596  TRP A O     1 
ATOM   4899 C  CB    . TRP A 1 596 ? -4.059  -0.820  -63.587 1.00 25.46  ? 596  TRP A CB    1 
ATOM   4900 C  CG    . TRP A 1 596 ? -3.299  -0.957  -64.872 1.00 25.56  ? 596  TRP A CG    1 
ATOM   4901 C  CD1   . TRP A 1 596 ? -2.739  -2.097  -65.372 1.00 27.35  ? 596  TRP A CD1   1 
ATOM   4902 C  CD2   . TRP A 1 596 ? -2.990  0.085   -65.810 1.00 24.98  ? 596  TRP A CD2   1 
ATOM   4903 N  NE1   . TRP A 1 596 ? -2.116  -1.840  -66.566 1.00 26.57  ? 596  TRP A NE1   1 
ATOM   4904 C  CE2   . TRP A 1 596 ? -2.249  -0.509  -66.862 1.00 28.53  ? 596  TRP A CE2   1 
ATOM   4905 C  CE3   . TRP A 1 596 ? -3.269  1.460   -65.868 1.00 26.36  ? 596  TRP A CE3   1 
ATOM   4906 C  CZ2   . TRP A 1 596 ? -1.781  0.227   -67.974 1.00 26.27  ? 596  TRP A CZ2   1 
ATOM   4907 C  CZ3   . TRP A 1 596 ? -2.805  2.196   -66.981 1.00 29.88  ? 596  TRP A CZ3   1 
ATOM   4908 C  CH2   . TRP A 1 596 ? -2.065  1.570   -68.012 1.00 25.68  ? 596  TRP A CH2   1 
ATOM   4909 N  N     . ILE A 1 597 ? -5.051  -3.782  -63.420 1.00 30.15  ? 597  ILE A N     1 
ATOM   4910 C  CA    . ILE A 1 597 ? -4.952  -5.144  -63.922 1.00 30.60  ? 597  ILE A CA    1 
ATOM   4911 C  C     . ILE A 1 597 ? -6.304  -5.867  -64.010 1.00 33.31  ? 597  ILE A C     1 
ATOM   4912 O  O     . ILE A 1 597 ? -6.442  -6.826  -64.770 1.00 33.88  ? 597  ILE A O     1 
ATOM   4913 C  CB    . ILE A 1 597 ? -3.877  -5.963  -63.160 1.00 29.36  ? 597  ILE A CB    1 
ATOM   4914 C  CG1   . ILE A 1 597 ? -3.145  -6.899  -64.124 1.00 25.04  ? 597  ILE A CG1   1 
ATOM   4915 C  CG2   . ILE A 1 597 ? -4.452  -6.678  -61.925 1.00 27.39  ? 597  ILE A CG2   1 
ATOM   4916 C  CD1   . ILE A 1 597 ? -2.407  -6.176  -65.217 1.00 22.76  ? 597  ILE A CD1   1 
ATOM   4917 N  N     . GLU A 1 598 ? -7.286  -5.400  -63.235 1.00 34.37  ? 598  GLU A N     1 
ATOM   4918 C  CA    . GLU A 1 598 ? -8.662  -5.879  -63.330 1.00 33.76  ? 598  GLU A CA    1 
ATOM   4919 C  C     . GLU A 1 598 ? -9.191  -5.513  -64.708 1.00 35.62  ? 598  GLU A C     1 
ATOM   4920 O  O     . GLU A 1 598 ? -9.726  -6.367  -65.419 1.00 35.21  ? 598  GLU A O     1 
ATOM   4921 C  CB    . GLU A 1 598 ? -9.537  -5.252  -62.233 1.00 35.08  ? 598  GLU A CB    1 
ATOM   4922 C  CG    . GLU A 1 598 ? -11.024 -5.636  -62.285 1.00 36.01  ? 598  GLU A CG    1 
ATOM   4923 C  CD    . GLU A 1 598 ? -11.904 -4.865  -61.294 1.00 39.83  ? 598  GLU A CD    1 
ATOM   4924 O  OE1   . GLU A 1 598 ? -11.456 -3.847  -60.714 1.00 39.55  ? 598  GLU A OE1   1 
ATOM   4925 O  OE2   . GLU A 1 598 ? -13.066 -5.284  -61.097 1.00 41.99  ? 598  GLU A OE2   1 
ATOM   4926 N  N     . ARG A 1 599 ? -9.019  -4.245  -65.084 1.00 35.47  ? 599  ARG A N     1 
ATOM   4927 C  CA    . ARG A 1 599 ? -9.414  -3.768  -66.407 1.00 37.40  ? 599  ARG A CA    1 
ATOM   4928 C  C     . ARG A 1 599 ? -8.766  -4.592  -67.528 1.00 38.28  ? 599  ARG A C     1 
ATOM   4929 O  O     . ARG A 1 599 ? -9.451  -5.008  -68.462 1.00 40.68  ? 599  ARG A O     1 
ATOM   4930 C  CB    . ARG A 1 599 ? -9.107  -2.273  -66.572 1.00 36.69  ? 599  ARG A CB    1 
ATOM   4931 C  CG    . ARG A 1 599 ? -9.469  -1.744  -67.954 1.00 39.77  ? 599  ARG A CG    1 
ATOM   4932 C  CD    . ARG A 1 599 ? -9.343  -0.230  -68.069 1.00 39.09  ? 599  ARG A CD    1 
ATOM   4933 N  NE    . ARG A 1 599 ? -7.984  0.257   -67.839 1.00 38.10  ? 599  ARG A NE    1 
ATOM   4934 C  CZ    . ARG A 1 599 ? -6.989  0.196   -68.720 1.00 37.82  ? 599  ARG A CZ    1 
ATOM   4935 N  NH1   . ARG A 1 599 ? -7.172  -0.352  -69.913 1.00 37.40  ? 599  ARG A NH1   1 
ATOM   4936 N  NH2   . ARG A 1 599 ? -5.799  0.684   -68.397 1.00 39.03  ? 599  ARG A NH2   1 
ATOM   4937 N  N     . LYS A 1 600 ? -7.460  -4.843  -67.410 1.00 37.02  ? 600  LYS A N     1 
ATOM   4938 C  CA    . LYS A 1 600 ? -6.708  -5.593  -68.422 1.00 36.12  ? 600  LYS A CA    1 
ATOM   4939 C  C     . LYS A 1 600 ? -7.148  -7.049  -68.547 1.00 35.16  ? 600  LYS A C     1 
ATOM   4940 O  O     . LYS A 1 600 ? -7.310  -7.559  -69.653 1.00 35.85  ? 600  LYS A O     1 
ATOM   4941 C  CB    . LYS A 1 600 ? -5.195  -5.516  -68.158 1.00 35.21  ? 600  LYS A CB    1 
ATOM   4942 C  CG    . LYS A 1 600 ? -4.583  -4.136  -68.356 1.00 35.55  ? 600  LYS A CG    1 
ATOM   4943 C  CD    . LYS A 1 600 ? -4.438  -3.783  -69.833 1.00 40.56  ? 600  LYS A CD    1 
ATOM   4944 C  CE    . LYS A 1 600 ? -3.714  -2.458  -70.015 1.00 40.63  ? 600  LYS A CE    1 
ATOM   4945 N  NZ    . LYS A 1 600 ? -3.322  -2.247  -71.439 1.00 41.84  ? 600  LYS A NZ    1 
ATOM   4946 N  N     . VAL A 1 601 ? -7.332  -7.714  -67.411 1.00 35.12  ? 601  VAL A N     1 
ATOM   4947 C  CA    . VAL A 1 601 ? -7.730  -9.117  -67.396 1.00 34.40  ? 601  VAL A CA    1 
ATOM   4948 C  C     . VAL A 1 601 ? -9.126  -9.269  -67.998 1.00 36.80  ? 601  VAL A C     1 
ATOM   4949 O  O     . VAL A 1 601 ? -9.360  -10.170 -68.811 1.00 37.33  ? 601  VAL A O     1 
ATOM   4950 C  CB    . VAL A 1 601 ? -7.642  -9.724  -65.972 1.00 32.98  ? 601  VAL A CB    1 
ATOM   4951 C  CG1   . VAL A 1 601 ? -8.390  -11.044 -65.887 1.00 30.52  ? 601  VAL A CG1   1 
ATOM   4952 C  CG2   . VAL A 1 601 ? -6.181  -9.926  -65.581 1.00 32.87  ? 601  VAL A CG2   1 
ATOM   4953 N  N     . ASN A 1 602 ? -10.037 -8.375  -67.613 1.00 37.76  ? 602  ASN A N     1 
ATOM   4954 C  CA    . ASN A 1 602 ? -11.374 -8.336  -68.202 1.00 39.44  ? 602  ASN A CA    1 
ATOM   4955 C  C     . ASN A 1 602 ? -11.319 -8.126  -69.707 1.00 42.13  ? 602  ASN A C     1 
ATOM   4956 O  O     . ASN A 1 602 ? -11.905 -8.904  -70.462 1.00 47.01  ? 602  ASN A O     1 
ATOM   4957 C  CB    . ASN A 1 602 ? -12.254 -7.273  -67.531 1.00 37.65  ? 602  ASN A CB    1 
ATOM   4958 C  CG    . ASN A 1 602 ? -12.880 -7.763  -66.232 1.00 35.70  ? 602  ASN A CG    1 
ATOM   4959 O  OD1   . ASN A 1 602 ? -13.015 -8.972  -66.009 1.00 33.58  ? 602  ASN A OD1   1 
ATOM   4960 N  ND2   . ASN A 1 602 ? -13.278 -6.825  -65.374 1.00 25.55  ? 602  ASN A ND2   1 
ATOM   4961 N  N     . GLU A 1 603 ? -10.592 -7.094  -70.136 1.00 42.72  ? 603  GLU A N     1 
ATOM   4962 C  CA    . GLU A 1 603 ? -10.430 -6.785  -71.562 1.00 42.82  ? 603  GLU A CA    1 
ATOM   4963 C  C     . GLU A 1 603 ? -9.860  -7.971  -72.334 1.00 42.48  ? 603  GLU A C     1 
ATOM   4964 O  O     . GLU A 1 603 ? -10.328 -8.280  -73.427 1.00 45.35  ? 603  GLU A O     1 
ATOM   4965 C  CB    . GLU A 1 603 ? -9.538  -5.552  -71.767 1.00 42.64  ? 603  GLU A CB    1 
ATOM   4966 C  CG    . GLU A 1 603 ? -10.177 -4.215  -71.387 1.00 44.14  ? 603  GLU A CG    1 
ATOM   4967 C  CD    . GLU A 1 603 ? -9.241  -3.012  -71.593 1.00 46.69  ? 603  GLU A CD    1 
ATOM   4968 O  OE1   . GLU A 1 603 ? -8.058  -3.204  -71.956 1.00 42.67  ? 603  GLU A OE1   1 
ATOM   4969 O  OE2   . GLU A 1 603 ? -9.696  -1.864  -71.396 1.00 47.60  ? 603  GLU A OE2   1 
ATOM   4970 N  N     . TYR A 1 604 ? -8.854  -8.632  -71.762 1.00 41.15  ? 604  TYR A N     1 
ATOM   4971 C  CA    . TYR A 1 604 ? -8.245  -9.803  -72.391 1.00 40.25  ? 604  TYR A CA    1 
ATOM   4972 C  C     . TYR A 1 604 ? -9.240  -10.960 -72.525 1.00 41.96  ? 604  TYR A C     1 
ATOM   4973 O  O     . TYR A 1 604 ? -9.407  -11.513 -73.613 1.00 43.50  ? 604  TYR A O     1 
ATOM   4974 C  CB    . TYR A 1 604 ? -6.994  -10.258 -71.630 1.00 40.00  ? 604  TYR A CB    1 
ATOM   4975 C  CG    . TYR A 1 604 ? -6.376  -11.535 -72.167 1.00 40.59  ? 604  TYR A CG    1 
ATOM   4976 C  CD1   . TYR A 1 604 ? -6.529  -12.751 -71.488 1.00 40.01  ? 604  TYR A CD1   1 
ATOM   4977 C  CD2   . TYR A 1 604 ? -5.646  -11.531 -73.358 1.00 40.98  ? 604  TYR A CD2   1 
ATOM   4978 C  CE1   . TYR A 1 604 ? -5.966  -13.931 -71.984 1.00 39.99  ? 604  TYR A CE1   1 
ATOM   4979 C  CE2   . TYR A 1 604 ? -5.082  -12.703 -73.865 1.00 42.15  ? 604  TYR A CE2   1 
ATOM   4980 C  CZ    . TYR A 1 604 ? -5.246  -13.896 -73.175 1.00 44.13  ? 604  TYR A CZ    1 
ATOM   4981 O  OH    . TYR A 1 604 ? -4.684  -15.047 -73.681 1.00 45.61  ? 604  TYR A OH    1 
ATOM   4982 N  N     . LEU A 1 605 ? -9.902  -11.320 -71.426 1.00 40.29  ? 605  LEU A N     1 
ATOM   4983 C  CA    . LEU A 1 605 ? -10.793 -12.477 -71.433 1.00 41.03  ? 605  LEU A CA    1 
ATOM   4984 C  C     . LEU A 1 605 ? -12.053 -12.284 -72.301 1.00 43.36  ? 605  LEU A C     1 
ATOM   4985 O  O     . LEU A 1 605 ? -12.542 -13.239 -72.904 1.00 42.65  ? 605  LEU A O     1 
ATOM   4986 C  CB    . LEU A 1 605 ? -11.134 -12.924 -70.005 1.00 37.71  ? 605  LEU A CB    1 
ATOM   4987 C  CG    . LEU A 1 605 ? -10.035 -13.687 -69.248 1.00 35.22  ? 605  LEU A CG    1 
ATOM   4988 C  CD1   . LEU A 1 605 ? -10.473 -14.007 -67.833 1.00 34.91  ? 605  LEU A CD1   1 
ATOM   4989 C  CD2   . LEU A 1 605 ? -9.605  -14.970 -69.950 1.00 35.29  ? 605  LEU A CD2   1 
ATOM   4990 N  N     . ASN A 1 606 ? -12.558 -11.052 -72.362 1.00 45.22  ? 606  ASN A N     1 
ATOM   4991 C  CA    . ASN A 1 606 ? -13.653 -10.699 -73.263 1.00 50.24  ? 606  ASN A CA    1 
ATOM   4992 C  C     . ASN A 1 606 ? -13.271 -10.895 -74.726 1.00 54.87  ? 606  ASN A C     1 
ATOM   4993 O  O     . ASN A 1 606 ? -14.116 -11.224 -75.560 1.00 55.78  ? 606  ASN A O     1 
ATOM   4994 C  CB    . ASN A 1 606 ? -14.088 -9.250  -73.037 1.00 50.42  ? 606  ASN A CB    1 
ATOM   4995 C  CG    . ASN A 1 606 ? -15.164 -9.122  -71.977 1.00 50.29  ? 606  ASN A CG    1 
ATOM   4996 O  OD1   . ASN A 1 606 ? -16.301 -9.544  -72.186 1.00 47.95  ? 606  ASN A OD1   1 
ATOM   4997 N  ND2   . ASN A 1 606 ? -14.815 -8.522  -70.836 1.00 46.72  ? 606  ASN A ND2   1 
ATOM   4998 N  N     . GLU A 1 607 ? -11.989 -10.684 -75.015 1.00 58.91  ? 607  GLU A N     1 
ATOM   4999 C  CA    . GLU A 1 607 ? -11.410 -10.876 -76.340 1.00 63.51  ? 607  GLU A CA    1 
ATOM   5000 C  C     . GLU A 1 607 ? -11.238 -12.366 -76.649 1.00 64.86  ? 607  GLU A C     1 
ATOM   5001 O  O     . GLU A 1 607 ? -11.505 -12.805 -77.768 1.00 68.02  ? 607  GLU A O     1 
ATOM   5002 C  CB    . GLU A 1 607 ? -10.075 -10.122 -76.419 1.00 64.79  ? 607  GLU A CB    1 
ATOM   5003 C  CG    . GLU A 1 607 ? -9.115  -10.515 -77.543 1.00 70.62  ? 607  GLU A CG    1 
ATOM   5004 C  CD    . GLU A 1 607 ? -7.665  -10.145 -77.221 1.00 75.14  ? 607  GLU A CD    1 
ATOM   5005 O  OE1   . GLU A 1 607 ? -6.758  -10.924 -77.588 1.00 78.04  ? 607  GLU A OE1   1 
ATOM   5006 O  OE2   . GLU A 1 607 ? -7.427  -9.086  -76.591 1.00 74.74  ? 607  GLU A OE2   1 
ATOM   5007 N  N     . VAL A 1 608 ? -10.799 -13.134 -75.655 1.00 65.38  ? 608  VAL A N     1 
ATOM   5008 C  CA    . VAL A 1 608 ? -10.635 -14.587 -75.790 1.00 67.34  ? 608  VAL A CA    1 
ATOM   5009 C  C     . VAL A 1 608 ? -11.968 -15.302 -76.063 1.00 69.07  ? 608  VAL A C     1 
ATOM   5010 O  O     . VAL A 1 608 ? -12.031 -16.206 -76.901 1.00 69.49  ? 608  VAL A O     1 
ATOM   5011 C  CB    . VAL A 1 608 ? -9.961  -15.197 -74.530 1.00 66.03  ? 608  VAL A CB    1 
ATOM   5012 C  CG1   . VAL A 1 608 ? -9.980  -16.719 -74.571 1.00 66.27  ? 608  VAL A CG1   1 
ATOM   5013 C  CG2   . VAL A 1 608 ? -8.536  -14.701 -74.397 1.00 66.08  ? 608  VAL A CG2   1 
ATOM   5014 N  N     . CYS A 1 609 ? -13.022 -14.878 -75.363 1.00 69.45  ? 609  CYS A N     1 
ATOM   5015 C  CA    . CYS A 1 609 ? -14.329 -15.545 -75.408 1.00 70.15  ? 609  CYS A CA    1 
ATOM   5016 C  C     . CYS A 1 609 ? -15.305 -14.936 -76.420 1.00 71.58  ? 609  CYS A C     1 
ATOM   5017 O  O     . CYS A 1 609 ? -16.301 -15.563 -76.782 1.00 72.06  ? 609  CYS A O     1 
ATOM   5018 C  CB    . CYS A 1 609 ? -14.959 -15.562 -74.010 1.00 69.67  ? 609  CYS A CB    1 
ATOM   5019 S  SG    . CYS A 1 609 ? -13.929 -16.346 -72.739 1.00 66.59  ? 609  CYS A SG    1 
ATOM   5020 N  N     . GLY A 1 610 ? -15.018 -13.713 -76.859 1.00 71.81  ? 610  GLY A N     1 
ATOM   5021 C  CA    . GLY A 1 610 ? -15.801 -13.047 -77.897 1.00 73.14  ? 610  GLY A CA    1 
ATOM   5022 C  C     . GLY A 1 610 ? -16.974 -12.211 -77.412 1.00 73.82  ? 610  GLY A C     1 
ATOM   5023 O  O     . GLY A 1 610 ? -17.963 -12.053 -78.137 1.00 74.17  ? 610  GLY A O     1 
ATOM   5024 N  N     . THR A 1 611 ? -16.865 -11.666 -76.199 1.00 72.51  ? 611  THR A N     1 
ATOM   5025 C  CA    . THR A 1 611 ? -17.935 -10.848 -75.612 1.00 72.58  ? 611  THR A CA    1 
ATOM   5026 C  C     . THR A 1 611 ? -17.545 -9.377  -75.431 1.00 72.99  ? 611  THR A C     1 
ATOM   5027 O  O     . THR A 1 611 ? -16.466 -8.952  -75.856 1.00 71.75  ? 611  THR A O     1 
ATOM   5028 C  CB    . THR A 1 611 ? -18.431 -11.428 -74.270 1.00 71.64  ? 611  THR A CB    1 
ATOM   5029 O  OG1   . THR A 1 611 ? -17.310 -11.834 -73.474 1.00 71.74  ? 611  THR A OG1   1 
ATOM   5030 C  CG2   . THR A 1 611 ? -19.341 -12.627 -74.507 1.00 72.82  ? 611  THR A CG2   1 
ATOM   5031 N  N     . GLU A 1 612 ? -18.443 -8.608  -74.811 1.00 73.95  ? 612  GLU A N     1 
ATOM   5032 C  CA    . GLU A 1 612 ? -18.213 -7.191  -74.514 1.00 74.79  ? 612  GLU A CA    1 
ATOM   5033 C  C     . GLU A 1 612 ? -18.888 -6.807  -73.195 1.00 72.59  ? 612  GLU A C     1 
ATOM   5034 O  O     . GLU A 1 612 ? -20.074 -7.079  -72.992 1.00 73.11  ? 612  GLU A O     1 
ATOM   5035 C  CB    . GLU A 1 612 ? -18.728 -6.302  -75.657 1.00 77.69  ? 612  GLU A CB    1 
ATOM   5036 C  CG    . GLU A 1 612 ? -18.484 -4.798  -75.466 1.00 81.66  ? 612  GLU A CG    1 
ATOM   5037 C  CD    . GLU A 1 612 ? -19.201 -3.931  -76.505 1.00 87.99  ? 612  GLU A CD    1 
ATOM   5038 O  OE1   . GLU A 1 612 ? -19.149 -4.256  -77.715 1.00 89.45  ? 612  GLU A OE1   1 
ATOM   5039 O  OE2   . GLU A 1 612 ? -19.809 -2.911  -76.110 1.00 89.57  ? 612  GLU A OE2   1 
ATOM   5040 N  N     . GLY A 1 613 ? -18.122 -6.183  -72.303 1.00 69.38  ? 613  GLY A N     1 
ATOM   5041 C  CA    . GLY A 1 613 ? -18.655 -5.684  -71.037 1.00 66.34  ? 613  GLY A CA    1 
ATOM   5042 C  C     . GLY A 1 613 ? -18.830 -6.709  -69.925 1.00 63.09  ? 613  GLY A C     1 
ATOM   5043 O  O     . GLY A 1 613 ? -19.251 -6.356  -68.819 1.00 62.96  ? 613  GLY A O     1 
ATOM   5044 N  N     . GLU A 1 614 ? -18.511 -7.972  -70.206 1.00 59.65  ? 614  GLU A N     1 
ATOM   5045 C  CA    . GLU A 1 614 ? -18.608 -9.025  -69.193 1.00 57.78  ? 614  GLU A CA    1 
ATOM   5046 C  C     . GLU A 1 614 ? -17.498 -8.955  -68.144 1.00 53.53  ? 614  GLU A C     1 
ATOM   5047 O  O     . GLU A 1 614 ? -16.318 -8.798  -68.472 1.00 51.68  ? 614  GLU A O     1 
ATOM   5048 C  CB    . GLU A 1 614 ? -18.655 -10.410 -69.834 1.00 59.13  ? 614  GLU A CB    1 
ATOM   5049 C  CG    . GLU A 1 614 ? -20.019 -10.744 -70.434 1.00 66.53  ? 614  GLU A CG    1 
ATOM   5050 C  CD    . GLU A 1 614 ? -20.495 -12.149 -70.087 1.00 71.07  ? 614  GLU A CD    1 
ATOM   5051 O  OE1   . GLU A 1 614 ? -21.184 -12.763 -70.933 1.00 75.91  ? 614  GLU A OE1   1 
ATOM   5052 O  OE2   . GLU A 1 614 ? -20.187 -12.636 -68.971 1.00 70.58  ? 614  GLU A OE2   1 
ATOM   5053 N  N     . ALA A 1 615 ? -17.895 -9.063  -66.881 1.00 49.34  ? 615  ALA A N     1 
ATOM   5054 C  CA    . ALA A 1 615 ? -16.955 -9.006  -65.772 1.00 47.28  ? 615  ALA A CA    1 
ATOM   5055 C  C     . ALA A 1 615 ? -16.463 -10.403 -65.415 1.00 44.87  ? 615  ALA A C     1 
ATOM   5056 O  O     . ALA A 1 615 ? -17.212 -11.215 -64.881 1.00 46.99  ? 615  ALA A O     1 
ATOM   5057 C  CB    . ALA A 1 615 ? -17.594 -8.331  -64.563 1.00 46.07  ? 615  ALA A CB    1 
ATOM   5058 N  N     . PHE A 1 616 ? -15.202 -10.679 -65.729 1.00 42.08  ? 616  PHE A N     1 
ATOM   5059 C  CA    . PHE A 1 616 ? -14.577 -11.944 -65.366 1.00 37.92  ? 616  PHE A CA    1 
ATOM   5060 C  C     . PHE A 1 616 ? -13.982 -11.878 -63.963 1.00 34.17  ? 616  PHE A C     1 
ATOM   5061 O  O     . PHE A 1 616 ? -14.028 -12.862 -63.229 1.00 32.39  ? 616  PHE A O     1 
ATOM   5062 C  CB    . PHE A 1 616 ? -13.492 -12.328 -66.372 1.00 37.64  ? 616  PHE A CB    1 
ATOM   5063 C  CG    . PHE A 1 616 ? -14.023 -12.839 -67.680 1.00 39.00  ? 616  PHE A CG    1 
ATOM   5064 C  CD1   . PHE A 1 616 ? -14.186 -14.208 -67.893 1.00 39.16  ? 616  PHE A CD1   1 
ATOM   5065 C  CD2   . PHE A 1 616 ? -14.343 -11.958 -68.709 1.00 38.36  ? 616  PHE A CD2   1 
ATOM   5066 C  CE1   . PHE A 1 616 ? -14.666 -14.692 -69.118 1.00 39.66  ? 616  PHE A CE1   1 
ATOM   5067 C  CE2   . PHE A 1 616 ? -14.824 -12.433 -69.931 1.00 41.09  ? 616  PHE A CE2   1 
ATOM   5068 C  CZ    . PHE A 1 616 ? -14.985 -13.803 -70.132 1.00 38.10  ? 616  PHE A CZ    1 
ATOM   5069 N  N     . VAL A 1 617 ? -13.413 -10.728 -63.606 1.00 31.74  ? 617  VAL A N     1 
ATOM   5070 C  CA    . VAL A 1 617 ? -12.903 -10.509 -62.252 1.00 32.13  ? 617  VAL A CA    1 
ATOM   5071 C  C     . VAL A 1 617 ? -14.097 -10.278 -61.329 1.00 30.91  ? 617  VAL A C     1 
ATOM   5072 O  O     . VAL A 1 617 ? -14.846 -9.319  -61.509 1.00 33.22  ? 617  VAL A O     1 
ATOM   5073 C  CB    . VAL A 1 617 ? -11.929 -9.305  -62.175 1.00 32.19  ? 617  VAL A CB    1 
ATOM   5074 C  CG1   . VAL A 1 617 ? -11.324 -9.184  -60.767 1.00 30.10  ? 617  VAL A CG1   1 
ATOM   5075 C  CG2   . VAL A 1 617 ? -10.825 -9.438  -63.204 1.00 30.07  ? 617  VAL A CG2   1 
ATOM   5076 N  N     . LEU A 1 618 ? -14.291 -11.178 -60.371 1.00 28.69  ? 618  LEU A N     1 
ATOM   5077 C  CA    . LEU A 1 618 ? -15.433 -11.094 -59.451 1.00 28.55  ? 618  LEU A CA    1 
ATOM   5078 C  C     . LEU A 1 618 ? -15.060 -10.391 -58.152 1.00 28.35  ? 618  LEU A C     1 
ATOM   5079 O  O     . LEU A 1 618 ? -15.913 -9.850  -57.447 1.00 29.08  ? 618  LEU A O     1 
ATOM   5080 C  CB    . LEU A 1 618 ? -15.988 -12.493 -59.155 1.00 27.30  ? 618  LEU A CB    1 
ATOM   5081 C  CG    . LEU A 1 618 ? -15.078 -13.493 -58.429 1.00 28.70  ? 618  LEU A CG    1 
ATOM   5082 C  CD1   . LEU A 1 618 ? -15.582 -13.747 -57.023 1.00 28.92  ? 618  LEU A CD1   1 
ATOM   5083 C  CD2   . LEU A 1 618 ? -15.006 -14.812 -59.193 1.00 31.56  ? 618  LEU A CD2   1 
ATOM   5084 N  N     . TYR A 1 619 ? -13.772 -10.416 -57.837 1.00 28.63  ? 619  TYR A N     1 
ATOM   5085 C  CA    . TYR A 1 619 ? -13.296 -9.940  -56.559 1.00 25.95  ? 619  TYR A CA    1 
ATOM   5086 C  C     . TYR A 1 619 ? -11.827 -9.625  -56.612 1.00 25.13  ? 619  TYR A C     1 
ATOM   5087 O  O     . TYR A 1 619 ? -11.087 -10.150 -57.449 1.00 24.88  ? 619  TYR A O     1 
ATOM   5088 C  CB    . TYR A 1 619 ? -13.529 -11.009 -55.485 1.00 25.85  ? 619  TYR A CB    1 
ATOM   5089 C  CG    . TYR A 1 619 ? -13.169 -10.565 -54.081 1.00 22.60  ? 619  TYR A CG    1 
ATOM   5090 C  CD1   . TYR A 1 619 ? -12.138 -11.184 -53.370 1.00 19.17  ? 619  TYR A CD1   1 
ATOM   5091 C  CD2   . TYR A 1 619 ? -13.866 -9.525  -53.466 1.00 22.49  ? 619  TYR A CD2   1 
ATOM   5092 C  CE1   . TYR A 1 619 ? -11.812 -10.775 -52.067 1.00 19.91  ? 619  TYR A CE1   1 
ATOM   5093 C  CE2   . TYR A 1 619 ? -13.550 -9.110  -52.177 1.00 22.09  ? 619  TYR A CE2   1 
ATOM   5094 C  CZ    . TYR A 1 619 ? -12.529 -9.733  -51.488 1.00 20.23  ? 619  TYR A CZ    1 
ATOM   5095 O  OH    . TYR A 1 619 ? -12.254 -9.308  -50.214 1.00 23.92  ? 619  TYR A OH    1 
ATOM   5096 N  N     . GLY A 1 620 ? -11.410 -8.783  -55.678 1.00 24.57  ? 620  GLY A N     1 
ATOM   5097 C  CA    . GLY A 1 620 ? -10.010 -8.523  -55.444 1.00 24.33  ? 620  GLY A CA    1 
ATOM   5098 C  C     . GLY A 1 620 ? -9.824  -7.754  -54.157 1.00 25.48  ? 620  GLY A C     1 
ATOM   5099 O  O     . GLY A 1 620 ? -10.679 -6.948  -53.777 1.00 25.76  ? 620  GLY A O     1 
ATOM   5100 N  N     . ASP A 1 621 ? -8.696  -8.001  -53.496 1.00 25.31  ? 621  ASP A N     1 
ATOM   5101 C  CA    . ASP A 1 621 ? -8.359  -7.333  -52.252 1.00 26.56  ? 621  ASP A CA    1 
ATOM   5102 C  C     . ASP A 1 621 ? -6.868  -7.000  -52.229 1.00 26.33  ? 621  ASP A C     1 
ATOM   5103 O  O     . ASP A 1 621 ? -6.031  -7.906  -52.160 1.00 23.91  ? 621  ASP A O     1 
ATOM   5104 C  CB    . ASP A 1 621 ? -8.728  -8.233  -51.066 1.00 27.29  ? 621  ASP A CB    1 
ATOM   5105 C  CG    . ASP A 1 621 ? -8.375  -7.618  -49.715 1.00 29.40  ? 621  ASP A CG    1 
ATOM   5106 O  OD1   . ASP A 1 621 ? -7.647  -6.603  -49.662 1.00 29.16  ? 621  ASP A OD1   1 
ATOM   5107 O  OD2   . ASP A 1 621 ? -8.829  -8.171  -48.694 1.00 27.72  ? 621  ASP A OD2   1 
ATOM   5108 N  N     . THR A 1 622 ? -6.554  -5.701  -52.275 1.00 25.48  ? 622  THR A N     1 
ATOM   5109 C  CA    . THR A 1 622 ? -5.163  -5.188  -52.189 1.00 24.47  ? 622  THR A CA    1 
ATOM   5110 C  C     . THR A 1 622 ? -4.288  -5.505  -53.410 1.00 25.78  ? 622  THR A C     1 
ATOM   5111 O  O     . THR A 1 622 ? -3.900  -4.591  -54.144 1.00 27.88  ? 622  THR A O     1 
ATOM   5112 C  CB    . THR A 1 622 ? -4.452  -5.644  -50.892 1.00 23.00  ? 622  THR A CB    1 
ATOM   5113 O  OG1   . THR A 1 622 ? -5.257  -5.278  -49.761 1.00 24.10  ? 622  THR A OG1   1 
ATOM   5114 C  CG2   . THR A 1 622 ? -3.066  -5.000  -50.763 1.00 21.62  ? 622  THR A CG2   1 
ATOM   5115 N  N     . ASP A 1 623 ? -3.996  -6.787  -53.626 1.00 25.70  ? 623  ASP A N     1 
ATOM   5116 C  CA    . ASP A 1 623 ? -3.019  -7.207  -54.627 1.00 28.82  ? 623  ASP A CA    1 
ATOM   5117 C  C     . ASP A 1 623 ? -3.410  -8.476  -55.378 1.00 29.47  ? 623  ASP A C     1 
ATOM   5118 O  O     . ASP A 1 623 ? -2.630  -8.990  -56.179 1.00 27.54  ? 623  ASP A O     1 
ATOM   5119 C  CB    . ASP A 1 623 ? -1.667  -7.456  -53.954 1.00 31.08  ? 623  ASP A CB    1 
ATOM   5120 C  CG    . ASP A 1 623 ? -1.682  -8.668  -53.038 1.00 32.94  ? 623  ASP A CG    1 
ATOM   5121 O  OD1   . ASP A 1 623 ? -0.628  -9.325  -52.913 1.00 36.54  ? 623  ASP A OD1   1 
ATOM   5122 O  OD2   . ASP A 1 623 ? -2.733  -8.964  -52.434 1.00 33.83  ? 623  ASP A OD2   1 
ATOM   5123 N  N     . SER A 1 624 ? -4.599  -8.995  -55.104 1.00 28.52  ? 624  SER A N     1 
ATOM   5124 C  CA    . SER A 1 624 ? -5.011  -10.251 -55.703 1.00 30.86  ? 624  SER A CA    1 
ATOM   5125 C  C     . SER A 1 624 ? -6.328  -10.080 -56.433 1.00 31.47  ? 624  SER A C     1 
ATOM   5126 O  O     . SER A 1 624 ? -7.168  -9.277  -56.015 1.00 32.33  ? 624  SER A O     1 
ATOM   5127 C  CB    . SER A 1 624 ? -5.164  -11.313 -54.625 1.00 30.90  ? 624  SER A CB    1 
ATOM   5128 O  OG    . SER A 1 624 ? -6.279  -10.995 -53.812 1.00 38.83  ? 624  SER A OG    1 
ATOM   5129 N  N     . ILE A 1 625 ? -6.499  -10.823 -57.525 1.00 29.19  ? 625  ILE A N     1 
ATOM   5130 C  CA    . ILE A 1 625 ? -7.770  -10.855 -58.234 1.00 28.59  ? 625  ILE A CA    1 
ATOM   5131 C  C     . ILE A 1 625 ? -8.315  -12.280 -58.308 1.00 28.57  ? 625  ILE A C     1 
ATOM   5132 O  O     . ILE A 1 625 ? -7.555  -13.249 -58.344 1.00 25.68  ? 625  ILE A O     1 
ATOM   5133 C  CB    . ILE A 1 625 ? -7.691  -10.229 -59.660 1.00 31.19  ? 625  ILE A CB    1 
ATOM   5134 C  CG1   . ILE A 1 625 ? -6.681  -10.971 -60.545 1.00 28.55  ? 625  ILE A CG1   1 
ATOM   5135 C  CG2   . ILE A 1 625 ? -7.369  -8.728  -59.583 1.00 31.98  ? 625  ILE A CG2   1 
ATOM   5136 C  CD1   . ILE A 1 625 ? -6.750  -10.596 -62.008 1.00 27.24  ? 625  ILE A CD1   1 
ATOM   5137 N  N     . TYR A 1 626 ? -9.639  -12.387 -58.333 1.00 28.02  ? 626  TYR A N     1 
ATOM   5138 C  CA    . TYR A 1 626 ? -10.316 -13.667 -58.433 1.00 26.96  ? 626  TYR A CA    1 
ATOM   5139 C  C     . TYR A 1 626 ? -11.137 -13.684 -59.704 1.00 28.14  ? 626  TYR A C     1 
ATOM   5140 O  O     . TYR A 1 626 ? -12.039 -12.867 -59.888 1.00 29.29  ? 626  TYR A O     1 
ATOM   5141 C  CB    . TYR A 1 626 ? -11.180 -13.909 -57.194 1.00 25.00  ? 626  TYR A CB    1 
ATOM   5142 C  CG    . TYR A 1 626 ? -10.344 -14.158 -55.971 1.00 23.85  ? 626  TYR A CG    1 
ATOM   5143 C  CD1   . TYR A 1 626 ? -9.755  -13.097 -55.275 1.00 23.69  ? 626  TYR A CD1   1 
ATOM   5144 C  CD2   . TYR A 1 626 ? -10.109 -15.454 -55.521 1.00 24.54  ? 626  TYR A CD2   1 
ATOM   5145 C  CE1   . TYR A 1 626 ? -8.964  -13.321 -54.160 1.00 20.19  ? 626  TYR A CE1   1 
ATOM   5146 C  CE2   . TYR A 1 626 ? -9.329  -15.686 -54.409 1.00 24.59  ? 626  TYR A CE2   1 
ATOM   5147 C  CZ    . TYR A 1 626 ? -8.759  -14.614 -53.733 1.00 25.00  ? 626  TYR A CZ    1 
ATOM   5148 O  OH    . TYR A 1 626 ? -7.976  -14.843 -52.624 1.00 30.36  ? 626  TYR A OH    1 
ATOM   5149 N  N     . VAL A 1 627 ? -10.791 -14.618 -60.584 1.00 29.60  ? 627  VAL A N     1 
ATOM   5150 C  CA    . VAL A 1 627 ? -11.320 -14.669 -61.935 1.00 28.97  ? 627  VAL A CA    1 
ATOM   5151 C  C     . VAL A 1 627 ? -12.252 -15.861 -62.077 1.00 30.37  ? 627  VAL A C     1 
ATOM   5152 O  O     . VAL A 1 627 ? -11.881 -16.993 -61.762 1.00 29.56  ? 627  VAL A O     1 
ATOM   5153 C  CB    . VAL A 1 627 ? -10.174 -14.778 -62.965 1.00 30.84  ? 627  VAL A CB    1 
ATOM   5154 C  CG1   . VAL A 1 627 ? -10.710 -14.690 -64.386 1.00 31.95  ? 627  VAL A CG1   1 
ATOM   5155 C  CG2   . VAL A 1 627 ? -9.121  -13.683 -62.718 1.00 31.78  ? 627  VAL A CG2   1 
ATOM   5156 N  N     . SER A 1 628 ? -13.468 -15.585 -62.537 1.00 31.41  ? 628  SER A N     1 
ATOM   5157 C  CA    . SER A 1 628 ? -14.450 -16.609 -62.857 1.00 33.87  ? 628  SER A CA    1 
ATOM   5158 C  C     . SER A 1 628 ? -14.052 -17.342 -64.137 1.00 34.71  ? 628  SER A C     1 
ATOM   5159 O  O     . SER A 1 628 ? -13.848 -16.716 -65.182 1.00 36.71  ? 628  SER A O     1 
ATOM   5160 C  CB    . SER A 1 628 ? -15.831 -15.966 -63.021 1.00 35.12  ? 628  SER A CB    1 
ATOM   5161 O  OG    . SER A 1 628 ? -16.792 -16.914 -63.426 1.00 35.66  ? 628  SER A OG    1 
ATOM   5162 N  N     . ALA A 1 629 ? -13.949 -18.667 -64.047 1.00 34.93  ? 629  ALA A N     1 
ATOM   5163 C  CA    . ALA A 1 629 ? -13.465 -19.487 -65.158 1.00 34.97  ? 629  ALA A CA    1 
ATOM   5164 C  C     . ALA A 1 629 ? -14.543 -20.363 -65.811 1.00 35.72  ? 629  ALA A C     1 
ATOM   5165 O  O     . ALA A 1 629 ? -14.230 -21.190 -66.676 1.00 36.00  ? 629  ALA A O     1 
ATOM   5166 C  CB    . ALA A 1 629 ? -12.284 -20.340 -64.700 1.00 34.44  ? 629  ALA A CB    1 
ATOM   5167 N  N     . ASP A 1 630 ? -15.802 -20.174 -65.411 1.00 35.20  ? 630  ASP A N     1 
ATOM   5168 C  CA    . ASP A 1 630 ? -16.918 -20.960 -65.951 1.00 36.41  ? 630  ASP A CA    1 
ATOM   5169 C  C     . ASP A 1 630 ? -16.878 -21.034 -67.468 1.00 37.60  ? 630  ASP A C     1 
ATOM   5170 O  O     . ASP A 1 630 ? -16.987 -22.121 -68.048 1.00 36.74  ? 630  ASP A O     1 
ATOM   5171 C  CB    . ASP A 1 630 ? -18.271 -20.371 -65.529 1.00 37.37  ? 630  ASP A CB    1 
ATOM   5172 C  CG    . ASP A 1 630 ? -18.554 -20.532 -64.049 1.00 38.77  ? 630  ASP A CG    1 
ATOM   5173 O  OD1   . ASP A 1 630 ? -17.607 -20.796 -63.273 1.00 35.88  ? 630  ASP A OD1   1 
ATOM   5174 O  OD2   . ASP A 1 630 ? -19.738 -20.387 -63.667 1.00 41.11  ? 630  ASP A OD2   1 
ATOM   5175 N  N     . LYS A 1 631 ? -16.728 -19.869 -68.096 1.00 35.38  ? 631  LYS A N     1 
ATOM   5176 C  CA    . LYS A 1 631 ? -16.766 -19.757 -69.551 1.00 36.73  ? 631  LYS A CA    1 
ATOM   5177 C  C     . LYS A 1 631 ? -15.580 -20.439 -70.230 1.00 37.14  ? 631  LYS A C     1 
ATOM   5178 O  O     . LYS A 1 631 ? -15.709 -20.921 -71.348 1.00 39.59  ? 631  LYS A O     1 
ATOM   5179 C  CB    . LYS A 1 631 ? -16.842 -18.289 -69.976 1.00 36.64  ? 631  LYS A CB    1 
ATOM   5180 C  CG    . LYS A 1 631 ? -18.160 -17.623 -69.645 1.00 38.59  ? 631  LYS A CG    1 
ATOM   5181 C  CD    . LYS A 1 631 ? -18.134 -16.156 -70.035 1.00 41.94  ? 631  LYS A CD    1 
ATOM   5182 C  CE    . LYS A 1 631 ? -19.534 -15.576 -70.052 1.00 45.98  ? 631  LYS A CE    1 
ATOM   5183 N  NZ    . LYS A 1 631 ? -20.125 -15.477 -68.682 1.00 49.36  ? 631  LYS A NZ    1 
ATOM   5184 N  N     . ILE A 1 632 ? -14.432 -20.479 -69.552 1.00 37.52  ? 632  ILE A N     1 
ATOM   5185 C  CA    . ILE A 1 632 ? -13.242 -21.146 -70.099 1.00 37.19  ? 632  ILE A CA    1 
ATOM   5186 C  C     . ILE A 1 632 ? -13.477 -22.651 -70.098 1.00 37.85  ? 632  ILE A C     1 
ATOM   5187 O  O     . ILE A 1 632 ? -13.240 -23.323 -71.102 1.00 37.55  ? 632  ILE A O     1 
ATOM   5188 C  CB    . ILE A 1 632 ? -11.936 -20.787 -69.323 1.00 35.48  ? 632  ILE A CB    1 
ATOM   5189 C  CG1   . ILE A 1 632 ? -11.771 -19.267 -69.188 1.00 33.83  ? 632  ILE A CG1   1 
ATOM   5190 C  CG2   . ILE A 1 632 ? -10.700 -21.423 -69.987 1.00 31.91  ? 632  ILE A CG2   1 
ATOM   5191 C  CD1   . ILE A 1 632 ? -11.729 -18.512 -70.500 1.00 39.25  ? 632  ILE A CD1   1 
ATOM   5192 N  N     . ILE A 1 633 ? -13.963 -23.165 -68.969 1.00 37.57  ? 633  ILE A N     1 
ATOM   5193 C  CA    . ILE A 1 633 ? -14.351 -24.563 -68.875 1.00 38.54  ? 633  ILE A CA    1 
ATOM   5194 C  C     . ILE A 1 633 ? -15.423 -24.888 -69.922 1.00 40.77  ? 633  ILE A C     1 
ATOM   5195 O  O     . ILE A 1 633 ? -15.324 -25.900 -70.616 1.00 40.85  ? 633  ILE A O     1 
ATOM   5196 C  CB    . ILE A 1 633 ? -14.842 -24.932 -67.450 1.00 37.58  ? 633  ILE A CB    1 
ATOM   5197 C  CG1   . ILE A 1 633 ? -13.684 -24.882 -66.436 1.00 36.17  ? 633  ILE A CG1   1 
ATOM   5198 C  CG2   . ILE A 1 633 ? -15.533 -26.299 -67.441 1.00 36.49  ? 633  ILE A CG2   1 
ATOM   5199 C  CD1   . ILE A 1 633 ? -12.510 -25.804 -66.762 1.00 35.21  ? 633  ILE A CD1   1 
ATOM   5200 N  N     . ASP A 1 634 ? -16.419 -24.010 -70.042 1.00 42.32  ? 634  ASP A N     1 
ATOM   5201 C  CA    . ASP A 1 634 ? -17.559 -24.224 -70.937 1.00 46.21  ? 634  ASP A CA    1 
ATOM   5202 C  C     . ASP A 1 634 ? -17.199 -24.163 -72.418 1.00 47.74  ? 634  ASP A C     1 
ATOM   5203 O  O     . ASP A 1 634 ? -17.886 -24.763 -73.244 1.00 48.81  ? 634  ASP A O     1 
ATOM   5204 C  CB    . ASP A 1 634 ? -18.683 -23.227 -70.642 1.00 46.76  ? 634  ASP A CB    1 
ATOM   5205 C  CG    . ASP A 1 634 ? -19.434 -23.543 -69.357 1.00 49.12  ? 634  ASP A CG    1 
ATOM   5206 O  OD1   . ASP A 1 634 ? -19.164 -24.586 -68.720 1.00 45.93  ? 634  ASP A OD1   1 
ATOM   5207 O  OD2   . ASP A 1 634 ? -20.308 -22.732 -68.984 1.00 53.64  ? 634  ASP A OD2   1 
ATOM   5208 N  N     . LYS A 1 635 ? -16.135 -23.434 -72.751 1.00 47.67  ? 635  LYS A N     1 
ATOM   5209 C  CA    . LYS A 1 635 ? -15.689 -23.329 -74.140 1.00 50.20  ? 635  LYS A CA    1 
ATOM   5210 C  C     . LYS A 1 635 ? -15.132 -24.640 -74.703 1.00 50.44  ? 635  LYS A C     1 
ATOM   5211 O  O     . LYS A 1 635 ? -15.144 -24.848 -75.917 1.00 50.57  ? 635  LYS A O     1 
ATOM   5212 C  CB    . LYS A 1 635 ? -14.686 -22.190 -74.326 1.00 50.74  ? 635  LYS A CB    1 
ATOM   5213 C  CG    . LYS A 1 635 ? -15.191 -21.088 -75.241 1.00 57.88  ? 635  LYS A CG    1 
ATOM   5214 C  CD    . LYS A 1 635 ? -14.086 -20.617 -76.175 1.00 63.71  ? 635  LYS A CD    1 
ATOM   5215 C  CE    . LYS A 1 635 ? -14.630 -20.136 -77.524 1.00 68.90  ? 635  LYS A CE    1 
ATOM   5216 N  NZ    . LYS A 1 635 ? -15.091 -18.718 -77.496 1.00 71.28  ? 635  LYS A NZ    1 
ATOM   5217 N  N     . VAL A 1 636 ? -14.644 -25.515 -73.825 1.00 50.05  ? 636  VAL A N     1 
ATOM   5218 C  CA    . VAL A 1 636 ? -14.230 -26.853 -74.249 1.00 51.72  ? 636  VAL A CA    1 
ATOM   5219 C  C     . VAL A 1 636 ? -15.349 -27.854 -73.970 1.00 53.07  ? 636  VAL A C     1 
ATOM   5220 O  O     . VAL A 1 636 ? -15.542 -28.804 -74.732 1.00 54.50  ? 636  VAL A O     1 
ATOM   5221 C  CB    . VAL A 1 636 ? -12.859 -27.310 -73.637 1.00 51.02  ? 636  VAL A CB    1 
ATOM   5222 C  CG1   . VAL A 1 636 ? -12.055 -26.127 -73.128 1.00 48.93  ? 636  VAL A CG1   1 
ATOM   5223 C  CG2   . VAL A 1 636 ? -13.032 -28.354 -72.553 1.00 50.88  ? 636  VAL A CG2   1 
ATOM   5224 N  N     . GLY A 1 637 ? -16.096 -27.614 -72.892 1.00 52.16  ? 637  GLY A N     1 
ATOM   5225 C  CA    . GLY A 1 637 ? -17.199 -28.481 -72.489 1.00 53.76  ? 637  GLY A CA    1 
ATOM   5226 C  C     . GLY A 1 637 ? -16.752 -29.462 -71.426 1.00 53.67  ? 637  GLY A C     1 
ATOM   5227 O  O     . GLY A 1 637 ? -15.738 -30.132 -71.596 1.00 53.58  ? 637  GLY A O     1 
ATOM   5228 N  N     . GLU A 1 638 ? -17.509 -29.548 -70.332 1.00 54.05  ? 638  GLU A N     1 
ATOM   5229 C  CA    . GLU A 1 638 ? -17.165 -30.434 -69.211 1.00 55.22  ? 638  GLU A CA    1 
ATOM   5230 C  C     . GLU A 1 638 ? -17.021 -31.907 -69.603 1.00 56.79  ? 638  GLU A C     1 
ATOM   5231 O  O     . GLU A 1 638 ? -16.278 -32.652 -68.959 1.00 56.81  ? 638  GLU A O     1 
ATOM   5232 C  CB    . GLU A 1 638 ? -18.185 -30.300 -68.075 1.00 55.70  ? 638  GLU A CB    1 
ATOM   5233 C  CG    . GLU A 1 638 ? -17.929 -29.140 -67.118 1.00 56.00  ? 638  GLU A CG    1 
ATOM   5234 C  CD    . GLU A 1 638 ? -18.987 -29.023 -66.027 1.00 60.02  ? 638  GLU A CD    1 
ATOM   5235 O  OE1   . GLU A 1 638 ? -18.712 -28.388 -64.982 1.00 56.00  ? 638  GLU A OE1   1 
ATOM   5236 O  OE2   . GLU A 1 638 ? -20.099 -29.567 -66.211 1.00 64.78  ? 638  GLU A OE2   1 
ATOM   5237 N  N     . SER A 1 639 ? -17.720 -32.312 -70.663 1.00 57.85  ? 639  SER A N     1 
ATOM   5238 C  CA    . SER A 1 639 ? -17.764 -33.707 -71.108 1.00 58.05  ? 639  SER A CA    1 
ATOM   5239 C  C     . SER A 1 639 ? -16.427 -34.210 -71.649 1.00 58.15  ? 639  SER A C     1 
ATOM   5240 O  O     . SER A 1 639 ? -16.181 -35.417 -71.682 1.00 58.07  ? 639  SER A O     1 
ATOM   5241 C  CB    . SER A 1 639 ? -18.853 -33.888 -72.170 1.00 60.16  ? 639  SER A CB    1 
ATOM   5242 O  OG    . SER A 1 639 ? -20.135 -33.597 -71.639 1.00 60.30  ? 639  SER A OG    1 
ATOM   5243 N  N     . LYS A 1 640 ? -15.574 -33.279 -72.068 1.00 57.52  ? 640  LYS A N     1 
ATOM   5244 C  CA    . LYS A 1 640 ? -14.271 -33.605 -72.651 1.00 57.88  ? 640  LYS A CA    1 
ATOM   5245 C  C     . LYS A 1 640 ? -13.193 -33.952 -71.620 1.00 55.65  ? 640  LYS A C     1 
ATOM   5246 O  O     . LYS A 1 640 ? -12.111 -34.414 -71.995 1.00 56.04  ? 640  LYS A O     1 
ATOM   5247 C  CB    . LYS A 1 640 ? -13.785 -32.458 -73.554 1.00 61.02  ? 640  LYS A CB    1 
ATOM   5248 C  CG    . LYS A 1 640 ? -13.990 -32.659 -75.070 1.00 65.68  ? 640  LYS A CG    1 
ATOM   5249 C  CD    . LYS A 1 640 ? -15.423 -33.069 -75.454 1.00 72.68  ? 640  LYS A CD    1 
ATOM   5250 C  CE    . LYS A 1 640 ? -16.431 -31.930 -75.285 1.00 74.28  ? 640  LYS A CE    1 
ATOM   5251 N  NZ    . LYS A 1 640 ? -16.304 -30.897 -76.358 1.00 75.88  ? 640  LYS A NZ    1 
ATOM   5252 N  N     . PHE A 1 641 ? -13.482 -33.734 -70.333 1.00 51.81  ? 641  PHE A N     1 
ATOM   5253 C  CA    . PHE A 1 641 ? -12.508 -34.006 -69.265 1.00 48.41  ? 641  PHE A CA    1 
ATOM   5254 C  C     . PHE A 1 641 ? -12.637 -35.412 -68.680 1.00 48.68  ? 641  PHE A C     1 
ATOM   5255 O  O     . PHE A 1 641 ? -13.739 -35.884 -68.410 1.00 47.06  ? 641  PHE A O     1 
ATOM   5256 C  CB    . PHE A 1 641 ? -12.586 -32.952 -68.153 1.00 44.22  ? 641  PHE A CB    1 
ATOM   5257 C  CG    . PHE A 1 641 ? -12.236 -31.562 -68.610 1.00 40.14  ? 641  PHE A CG    1 
ATOM   5258 C  CD1   . PHE A 1 641 ? -13.221 -30.586 -68.722 1.00 37.85  ? 641  PHE A CD1   1 
ATOM   5259 C  CD2   . PHE A 1 641 ? -10.925 -31.231 -68.943 1.00 38.85  ? 641  PHE A CD2   1 
ATOM   5260 C  CE1   . PHE A 1 641 ? -12.906 -29.300 -69.152 1.00 37.23  ? 641  PHE A CE1   1 
ATOM   5261 C  CE2   . PHE A 1 641 ? -10.595 -29.942 -69.376 1.00 35.01  ? 641  PHE A CE2   1 
ATOM   5262 C  CZ    . PHE A 1 641 ? -11.588 -28.976 -69.477 1.00 34.46  ? 641  PHE A CZ    1 
ATOM   5263 N  N     . ARG A 1 642 ? -11.495 -36.068 -68.492 1.00 49.84  ? 642  ARG A N     1 
ATOM   5264 C  CA    . ARG A 1 642 ? -11.442 -37.434 -67.973 1.00 50.81  ? 642  ARG A CA    1 
ATOM   5265 C  C     . ARG A 1 642 ? -11.817 -37.466 -66.498 1.00 48.34  ? 642  ARG A C     1 
ATOM   5266 O  O     . ARG A 1 642 ? -12.584 -38.332 -66.064 1.00 47.83  ? 642  ARG A O     1 
ATOM   5267 C  CB    . ARG A 1 642 ? -10.033 -38.011 -68.143 1.00 53.23  ? 642  ARG A CB    1 
ATOM   5268 C  CG    . ARG A 1 642 ? -9.622  -38.336 -69.570 1.00 58.92  ? 642  ARG A CG    1 
ATOM   5269 C  CD    . ARG A 1 642 ? -8.116  -38.560 -69.635 1.00 62.31  ? 642  ARG A CD    1 
ATOM   5270 N  NE    . ARG A 1 642 ? -7.393  -37.356 -70.046 1.00 67.18  ? 642  ARG A NE    1 
ATOM   5271 C  CZ    . ARG A 1 642 ? -6.260  -36.921 -69.496 1.00 68.46  ? 642  ARG A CZ    1 
ATOM   5272 N  NH1   . ARG A 1 642 ? -5.709  -37.568 -68.475 1.00 69.23  ? 642  ARG A NH1   1 
ATOM   5273 N  NH2   . ARG A 1 642 ? -5.680  -35.821 -69.959 1.00 67.13  ? 642  ARG A NH2   1 
ATOM   5274 N  N     . ASP A 1 643 ? -11.253 -36.519 -65.744 1.00 45.33  ? 643  ASP A N     1 
ATOM   5275 C  CA    . ASP A 1 643 ? -11.442 -36.395 -64.300 1.00 42.70  ? 643  ASP A CA    1 
ATOM   5276 C  C     . ASP A 1 643 ? -11.103 -34.967 -63.841 1.00 41.61  ? 643  ASP A C     1 
ATOM   5277 O  O     . ASP A 1 643 ? -10.723 -34.119 -64.655 1.00 41.42  ? 643  ASP A O     1 
ATOM   5278 C  CB    . ASP A 1 643 ? -10.583 -37.426 -63.547 1.00 42.36  ? 643  ASP A CB    1 
ATOM   5279 C  CG    . ASP A 1 643 ? -9.129  -37.439 -64.009 1.00 45.89  ? 643  ASP A CG    1 
ATOM   5280 O  OD1   . ASP A 1 643 ? -8.560  -36.364 -64.300 1.00 45.89  ? 643  ASP A OD1   1 
ATOM   5281 O  OD2   . ASP A 1 643 ? -8.544  -38.538 -64.082 1.00 52.71  ? 643  ASP A OD2   1 
ATOM   5282 N  N     . THR A 1 644 ? -11.224 -34.716 -62.538 1.00 38.62  ? 644  THR A N     1 
ATOM   5283 C  CA    . THR A 1 644 ? -10.977 -33.394 -61.977 1.00 36.43  ? 644  THR A CA    1 
ATOM   5284 C  C     . THR A 1 644 ? -9.570  -32.901 -62.329 1.00 37.82  ? 644  THR A C     1 
ATOM   5285 O  O     . THR A 1 644 ? -9.402  -31.781 -62.834 1.00 36.51  ? 644  THR A O     1 
ATOM   5286 C  CB    . THR A 1 644 ? -11.181 -33.376 -60.438 1.00 34.63  ? 644  THR A CB    1 
ATOM   5287 O  OG1   . THR A 1 644 ? -12.470 -33.913 -60.105 1.00 30.22  ? 644  THR A OG1   1 
ATOM   5288 C  CG2   . THR A 1 644 ? -11.083 -31.956 -59.900 1.00 32.83  ? 644  THR A CG2   1 
ATOM   5289 N  N     . ASN A 1 645 ? -8.568  -33.747 -62.093 1.00 37.38  ? 645  ASN A N     1 
ATOM   5290 C  CA    . ASN A 1 645 ? -7.182  -33.350 -62.320 1.00 37.44  ? 645  ASN A CA    1 
ATOM   5291 C  C     . ASN A 1 645 ? -6.941  -32.873 -63.752 1.00 37.45  ? 645  ASN A C     1 
ATOM   5292 O  O     . ASN A 1 645 ? -6.057  -32.053 -63.992 1.00 38.20  ? 645  ASN A O     1 
ATOM   5293 C  CB    . ASN A 1 645 ? -6.211  -34.470 -61.933 1.00 38.86  ? 645  ASN A CB    1 
ATOM   5294 C  CG    . ASN A 1 645 ? -4.806  -33.955 -61.665 1.00 40.42  ? 645  ASN A CG    1 
ATOM   5295 O  OD1   . ASN A 1 645 ? -4.599  -33.095 -60.807 1.00 39.98  ? 645  ASN A OD1   1 
ATOM   5296 N  ND2   . ASN A 1 645 ? -3.831  -34.479 -62.405 1.00 40.66  ? 645  ASN A ND2   1 
ATOM   5297 N  N     . HIS A 1 646 ? -7.756  -33.371 -64.684 1.00 38.54  ? 646  HIS A N     1 
ATOM   5298 C  CA    . HIS A 1 646 ? -7.691  -32.983 -66.093 1.00 38.38  ? 646  HIS A CA    1 
ATOM   5299 C  C     . HIS A 1 646 ? -8.105  -31.524 -66.345 1.00 37.30  ? 646  HIS A C     1 
ATOM   5300 O  O     . HIS A 1 646 ? -7.339  -30.776 -66.950 1.00 37.35  ? 646  HIS A O     1 
ATOM   5301 C  CB    . HIS A 1 646 ? -8.493  -33.959 -66.956 1.00 40.25  ? 646  HIS A CB    1 
ATOM   5302 C  CG    . HIS A 1 646 ? -8.290  -33.785 -68.429 1.00 41.20  ? 646  HIS A CG    1 
ATOM   5303 N  ND1   . HIS A 1 646 ? -9.095  -34.402 -69.363 1.00 42.95  ? 646  HIS A ND1   1 
ATOM   5304 C  CD2   . HIS A 1 646 ? -7.388  -33.059 -69.131 1.00 43.39  ? 646  HIS A CD2   1 
ATOM   5305 C  CE1   . HIS A 1 646 ? -8.695  -34.067 -70.576 1.00 41.16  ? 646  HIS A CE1   1 
ATOM   5306 N  NE2   . HIS A 1 646 ? -7.662  -33.252 -70.464 1.00 42.52  ? 646  HIS A NE2   1 
ATOM   5307 N  N     . TRP A 1 647 ? -9.281  -31.104 -65.874 1.00 36.37  ? 647  TRP A N     1 
ATOM   5308 C  CA    . TRP A 1 647 ? -9.643  -29.677 -65.993 1.00 35.94  ? 647  TRP A CA    1 
ATOM   5309 C  C     . TRP A 1 647 ? -8.723  -28.761 -65.174 1.00 35.62  ? 647  TRP A C     1 
ATOM   5310 O  O     . TRP A 1 647 ? -8.491  -27.613 -65.560 1.00 37.26  ? 647  TRP A O     1 
ATOM   5311 C  CB    . TRP A 1 647 ? -11.140 -29.394 -65.733 1.00 36.32  ? 647  TRP A CB    1 
ATOM   5312 C  CG    . TRP A 1 647 ? -11.641 -29.546 -64.295 1.00 33.66  ? 647  TRP A CG    1 
ATOM   5313 C  CD1   . TRP A 1 647 ? -12.379 -30.582 -63.793 1.00 34.54  ? 647  TRP A CD1   1 
ATOM   5314 C  CD2   . TRP A 1 647 ? -11.475 -28.615 -63.210 1.00 32.32  ? 647  TRP A CD2   1 
ATOM   5315 N  NE1   . TRP A 1 647 ? -12.662 -30.370 -62.463 1.00 35.21  ? 647  TRP A NE1   1 
ATOM   5316 C  CE2   . TRP A 1 647 ? -12.120 -29.171 -62.080 1.00 32.77  ? 647  TRP A CE2   1 
ATOM   5317 C  CE3   . TRP A 1 647 ? -10.835 -27.373 -63.081 1.00 31.76  ? 647  TRP A CE3   1 
ATOM   5318 C  CZ2   . TRP A 1 647 ? -12.142 -28.532 -60.842 1.00 31.50  ? 647  TRP A CZ2   1 
ATOM   5319 C  CZ3   . TRP A 1 647 ? -10.859 -26.734 -61.847 1.00 29.45  ? 647  TRP A CZ3   1 
ATOM   5320 C  CH2   . TRP A 1 647 ? -11.505 -27.315 -60.744 1.00 30.56  ? 647  TRP A CH2   1 
ATOM   5321 N  N     . VAL A 1 648 ? -8.189  -29.277 -64.064 1.00 34.53  ? 648  VAL A N     1 
ATOM   5322 C  CA    . VAL A 1 648 ? -7.229  -28.525 -63.250 1.00 33.02  ? 648  VAL A CA    1 
ATOM   5323 C  C     . VAL A 1 648 ? -5.931  -28.270 -64.027 1.00 34.85  ? 648  VAL A C     1 
ATOM   5324 O  O     . VAL A 1 648 ? -5.433  -27.137 -64.041 1.00 34.98  ? 648  VAL A O     1 
ATOM   5325 C  CB    . VAL A 1 648 ? -6.967  -29.196 -61.878 1.00 31.17  ? 648  VAL A CB    1 
ATOM   5326 C  CG1   . VAL A 1 648 ? -5.854  -28.483 -61.131 1.00 26.79  ? 648  VAL A CG1   1 
ATOM   5327 C  CG2   . VAL A 1 648 ? -8.242  -29.187 -61.034 1.00 29.98  ? 648  VAL A CG2   1 
ATOM   5328 N  N     . ASP A 1 649 ? -5.406  -29.311 -64.680 1.00 35.73  ? 649  ASP A N     1 
ATOM   5329 C  CA    . ASP A 1 649 ? -4.264  -29.178 -65.603 1.00 39.32  ? 649  ASP A CA    1 
ATOM   5330 C  C     . ASP A 1 649 ? -4.564  -28.201 -66.732 1.00 37.64  ? 649  ASP A C     1 
ATOM   5331 O  O     . ASP A 1 649 ? -3.705  -27.408 -67.118 1.00 36.53  ? 649  ASP A O     1 
ATOM   5332 C  CB    . ASP A 1 649 ? -3.870  -30.539 -66.225 1.00 42.47  ? 649  ASP A CB    1 
ATOM   5333 C  CG    . ASP A 1 649 ? -2.998  -31.390 -65.305 1.00 46.45  ? 649  ASP A CG    1 
ATOM   5334 O  OD1   . ASP A 1 649 ? -2.362  -30.844 -64.374 1.00 50.38  ? 649  ASP A OD1   1 
ATOM   5335 O  OD2   . ASP A 1 649 ? -2.944  -32.617 -65.523 1.00 49.06  ? 649  ASP A OD2   1 
ATOM   5336 N  N     . PHE A 1 650 ? -5.780  -28.273 -67.268 1.00 37.94  ? 650  PHE A N     1 
ATOM   5337 C  CA    . PHE A 1 650 ? -6.176  -27.385 -68.357 1.00 39.17  ? 650  PHE A CA    1 
ATOM   5338 C  C     . PHE A 1 650 ? -6.120  -25.912 -67.935 1.00 37.58  ? 650  PHE A C     1 
ATOM   5339 O  O     . PHE A 1 650 ? -5.504  -25.092 -68.621 1.00 35.72  ? 650  PHE A O     1 
ATOM   5340 C  CB    . PHE A 1 650 ? -7.555  -27.767 -68.914 1.00 38.76  ? 650  PHE A CB    1 
ATOM   5341 C  CG    . PHE A 1 650 ? -8.147  -26.727 -69.815 1.00 41.26  ? 650  PHE A CG    1 
ATOM   5342 C  CD1   . PHE A 1 650 ? -7.656  -26.541 -71.103 1.00 43.97  ? 650  PHE A CD1   1 
ATOM   5343 C  CD2   . PHE A 1 650 ? -9.188  -25.918 -69.372 1.00 42.29  ? 650  PHE A CD2   1 
ATOM   5344 C  CE1   . PHE A 1 650 ? -8.197  -25.571 -71.941 1.00 46.52  ? 650  PHE A CE1   1 
ATOM   5345 C  CE2   . PHE A 1 650 ? -9.737  -24.946 -70.203 1.00 44.35  ? 650  PHE A CE2   1 
ATOM   5346 C  CZ    . PHE A 1 650 ? -9.238  -24.772 -71.490 1.00 44.45  ? 650  PHE A CZ    1 
ATOM   5347 N  N     . LEU A 1 651 ? -6.747  -25.594 -66.801 1.00 38.37  ? 651  LEU A N     1 
ATOM   5348 C  CA    . LEU A 1 651 ? -6.733  -24.234 -66.244 1.00 38.24  ? 651  LEU A CA    1 
ATOM   5349 C  C     . LEU A 1 651 ? -5.330  -23.771 -65.854 1.00 38.52  ? 651  LEU A C     1 
ATOM   5350 O  O     . LEU A 1 651 ? -4.961  -22.621 -66.113 1.00 38.47  ? 651  LEU A O     1 
ATOM   5351 C  CB    . LEU A 1 651 ? -7.689  -24.112 -65.044 1.00 36.90  ? 651  LEU A CB    1 
ATOM   5352 C  CG    . LEU A 1 651 ? -9.193  -24.178 -65.326 1.00 39.17  ? 651  LEU A CG    1 
ATOM   5353 C  CD1   . LEU A 1 651 ? -9.979  -23.886 -64.058 1.00 37.46  ? 651  LEU A CD1   1 
ATOM   5354 C  CD2   . LEU A 1 651 ? -9.611  -23.219 -66.450 1.00 38.49  ? 651  LEU A CD2   1 
ATOM   5355 N  N     . ASP A 1 652 ? -4.564  -24.672 -65.238 1.00 39.24  ? 652  ASP A N     1 
ATOM   5356 C  CA    . ASP A 1 652 ? -3.161  -24.430 -64.880 1.00 39.63  ? 652  ASP A CA    1 
ATOM   5357 C  C     . ASP A 1 652 ? -2.342  -24.016 -66.104 1.00 40.98  ? 652  ASP A C     1 
ATOM   5358 O  O     . ASP A 1 652 ? -1.590  -23.033 -66.057 1.00 39.17  ? 652  ASP A O     1 
ATOM   5359 C  CB    . ASP A 1 652 ? -2.559  -25.685 -64.223 1.00 40.91  ? 652  ASP A CB    1 
ATOM   5360 C  CG    . ASP A 1 652 ? -1.060  -25.569 -63.968 1.00 45.46  ? 652  ASP A CG    1 
ATOM   5361 O  OD1   . ASP A 1 652 ? -0.628  -24.649 -63.240 1.00 42.70  ? 652  ASP A OD1   1 
ATOM   5362 O  OD2   . ASP A 1 652 ? -0.306  -26.413 -64.501 1.00 51.64  ? 652  ASP A OD2   1 
ATOM   5363 N  N     . LYS A 1 653 ? -2.499  -24.768 -67.195 1.00 41.14  ? 653  LYS A N     1 
ATOM   5364 C  CA    . LYS A 1 653 ? -1.826  -24.460 -68.457 1.00 43.72  ? 653  LYS A CA    1 
ATOM   5365 C  C     . LYS A 1 653 ? -2.369  -23.163 -69.078 1.00 42.91  ? 653  LYS A C     1 
ATOM   5366 O  O     . LYS A 1 653 ? -1.600  -22.330 -69.543 1.00 42.94  ? 653  LYS A O     1 
ATOM   5367 C  CB    . LYS A 1 653 ? -1.934  -25.638 -69.430 1.00 45.02  ? 653  LYS A CB    1 
ATOM   5368 C  CG    . LYS A 1 653 ? -0.831  -25.683 -70.477 1.00 50.85  ? 653  LYS A CG    1 
ATOM   5369 C  CD    . LYS A 1 653 ? -0.842  -26.990 -71.289 1.00 54.00  ? 653  LYS A CD    1 
ATOM   5370 C  CE    . LYS A 1 653 ? 0.231   -26.961 -72.390 1.00 58.50  ? 653  LYS A CE    1 
ATOM   5371 N  NZ    . LYS A 1 653 ? 0.260   -28.192 -73.246 1.00 59.04  ? 653  LYS A NZ    1 
ATOM   5372 N  N     . PHE A 1 654 ? -3.689  -22.986 -69.054 1.00 42.90  ? 654  PHE A N     1 
ATOM   5373 C  CA    . PHE A 1 654 ? -4.306  -21.749 -69.535 1.00 42.99  ? 654  PHE A CA    1 
ATOM   5374 C  C     . PHE A 1 654 ? -3.791  -20.501 -68.790 1.00 42.72  ? 654  PHE A C     1 
ATOM   5375 O  O     . PHE A 1 654 ? -3.445  -19.498 -69.418 1.00 41.22  ? 654  PHE A O     1 
ATOM   5376 C  CB    . PHE A 1 654 ? -5.833  -21.833 -69.448 1.00 42.25  ? 654  PHE A CB    1 
ATOM   5377 C  CG    . PHE A 1 654 ? -6.542  -20.695 -70.127 1.00 44.08  ? 654  PHE A CG    1 
ATOM   5378 C  CD1   . PHE A 1 654 ? -6.889  -19.548 -69.419 1.00 44.58  ? 654  PHE A CD1   1 
ATOM   5379 C  CD2   . PHE A 1 654 ? -6.858  -20.766 -71.474 1.00 45.82  ? 654  PHE A CD2   1 
ATOM   5380 C  CE1   . PHE A 1 654 ? -7.540  -18.495 -70.043 1.00 44.65  ? 654  PHE A CE1   1 
ATOM   5381 C  CE2   . PHE A 1 654 ? -7.509  -19.715 -72.106 1.00 48.83  ? 654  PHE A CE2   1 
ATOM   5382 C  CZ    . PHE A 1 654 ? -7.850  -18.578 -71.386 1.00 46.60  ? 654  PHE A CZ    1 
ATOM   5383 N  N     . ALA A 1 655 ? -3.737  -20.569 -67.461 1.00 41.39  ? 655  ALA A N     1 
ATOM   5384 C  CA    . ALA A 1 655 ? -3.261  -19.436 -66.661 1.00 42.14  ? 655  ALA A CA    1 
ATOM   5385 C  C     . ALA A 1 655 ? -1.798  -19.118 -66.937 1.00 42.47  ? 655  ALA A C     1 
ATOM   5386 O  O     . ALA A 1 655 ? -1.430  -17.954 -67.098 1.00 42.71  ? 655  ALA A O     1 
ATOM   5387 C  CB    . ALA A 1 655 ? -3.473  -19.691 -65.186 1.00 40.34  ? 655  ALA A CB    1 
ATOM   5388 N  N     . ARG A 1 656 ? -0.977  -20.160 -67.016 1.00 43.76  ? 656  ARG A N     1 
ATOM   5389 C  CA    . ARG A 1 656 ? 0.458   -19.996 -67.198 1.00 45.90  ? 656  ARG A CA    1 
ATOM   5390 C  C     . ARG A 1 656 ? 0.854   -19.599 -68.626 1.00 47.07  ? 656  ARG A C     1 
ATOM   5391 O  O     . ARG A 1 656 ? 1.762   -18.788 -68.809 1.00 47.89  ? 656  ARG A O     1 
ATOM   5392 C  CB    . ARG A 1 656 ? 1.193   -21.261 -66.750 1.00 47.99  ? 656  ARG A CB    1 
ATOM   5393 C  CG    . ARG A 1 656 ? 2.678   -21.069 -66.450 1.00 54.63  ? 656  ARG A CG    1 
ATOM   5394 C  CD    . ARG A 1 656 ? 3.305   -22.312 -65.807 1.00 59.58  ? 656  ARG A CD    1 
ATOM   5395 N  NE    . ARG A 1 656 ? 3.263   -23.483 -66.685 1.00 63.58  ? 656  ARG A NE    1 
ATOM   5396 C  CZ    . ARG A 1 656 ? 2.442   -24.519 -66.523 1.00 64.13  ? 656  ARG A CZ    1 
ATOM   5397 N  NH1   . ARG A 1 656 ? 1.590   -24.548 -65.508 1.00 65.81  ? 656  ARG A NH1   1 
ATOM   5398 N  NH2   . ARG A 1 656 ? 2.476   -25.531 -67.376 1.00 66.26  ? 656  ARG A NH2   1 
ATOM   5399 N  N     . GLU A 1 657 ? 0.176   -20.151 -69.631 1.00 47.49  ? 657  GLU A N     1 
ATOM   5400 C  CA    . GLU A 1 657 ? 0.558   -19.906 -71.031 1.00 48.71  ? 657  GLU A CA    1 
ATOM   5401 C  C     . GLU A 1 657 ? -0.162  -18.728 -71.699 1.00 47.44  ? 657  GLU A C     1 
ATOM   5402 O  O     . GLU A 1 657 ? 0.368   -18.129 -72.631 1.00 47.71  ? 657  GLU A O     1 
ATOM   5403 C  CB    . GLU A 1 657 ? 0.395   -21.175 -71.879 1.00 51.82  ? 657  GLU A CB    1 
ATOM   5404 C  CG    . GLU A 1 657 ? 1.350   -22.306 -71.506 1.00 54.99  ? 657  GLU A CG    1 
ATOM   5405 C  CD    . GLU A 1 657 ? 1.287   -23.485 -72.464 1.00 60.81  ? 657  GLU A CD    1 
ATOM   5406 O  OE1   . GLU A 1 657 ? 0.239   -23.687 -73.122 1.00 62.30  ? 657  GLU A OE1   1 
ATOM   5407 O  OE2   . GLU A 1 657 ? 2.295   -24.220 -72.556 1.00 62.08  ? 657  GLU A OE2   1 
ATOM   5408 N  N     . ARG A 1 658 ? -1.359  -18.397 -71.224 1.00 45.91  ? 658  ARG A N     1 
ATOM   5409 C  CA    . ARG A 1 658 ? -2.164  -17.348 -71.851 1.00 46.07  ? 658  ARG A CA    1 
ATOM   5410 C  C     . ARG A 1 658 ? -2.314  -16.119 -70.962 1.00 45.60  ? 658  ARG A C     1 
ATOM   5411 O  O     . ARG A 1 658 ? -1.921  -15.016 -71.344 1.00 46.47  ? 658  ARG A O     1 
ATOM   5412 C  CB    . ARG A 1 658 ? -3.545  -17.888 -72.239 1.00 46.09  ? 658  ARG A CB    1 
ATOM   5413 C  CG    . ARG A 1 658 ? -3.503  -19.070 -73.199 1.00 50.82  ? 658  ARG A CG    1 
ATOM   5414 C  CD    . ARG A 1 658 ? -3.466  -18.622 -74.656 1.00 55.98  ? 658  ARG A CD    1 
ATOM   5415 N  NE    . ARG A 1 658 ? -3.091  -19.719 -75.547 1.00 61.91  ? 658  ARG A NE    1 
ATOM   5416 C  CZ    . ARG A 1 658 ? -1.918  -19.820 -76.168 1.00 63.49  ? 658  ARG A CZ    1 
ATOM   5417 N  NH1   . ARG A 1 658 ? -0.990  -18.880 -76.015 1.00 64.48  ? 658  ARG A NH1   1 
ATOM   5418 N  NH2   . ARG A 1 658 ? -1.673  -20.860 -76.953 1.00 63.45  ? 658  ARG A NH2   1 
ATOM   5419 N  N     . MET A 1 659 ? -2.873  -16.318 -69.773 1.00 42.72  ? 659  MET A N     1 
ATOM   5420 C  CA    . MET A 1 659 ? -3.211  -15.208 -68.884 1.00 41.89  ? 659  MET A CA    1 
ATOM   5421 C  C     . MET A 1 659 ? -2.010  -14.462 -68.295 1.00 41.06  ? 659  MET A C     1 
ATOM   5422 O  O     . MET A 1 659 ? -1.977  -13.225 -68.309 1.00 40.05  ? 659  MET A O     1 
ATOM   5423 C  CB    . MET A 1 659 ? -4.143  -15.683 -67.779 1.00 40.69  ? 659  MET A CB    1 
ATOM   5424 C  CG    . MET A 1 659 ? -5.491  -16.115 -68.306 1.00 42.48  ? 659  MET A CG    1 
ATOM   5425 S  SD    . MET A 1 659 ? -6.654  -16.452 -66.996 1.00 45.52  ? 659  MET A SD    1 
ATOM   5426 C  CE    . MET A 1 659 ? -6.983  -14.786 -66.415 1.00 44.27  ? 659  MET A CE    1 
ATOM   5427 N  N     . GLU A 1 660 ? -1.031  -15.208 -67.790 1.00 40.64  ? 660  GLU A N     1 
ATOM   5428 C  CA    . GLU A 1 660 ? 0.156   -14.599 -67.193 1.00 40.78  ? 660  GLU A CA    1 
ATOM   5429 C  C     . GLU A 1 660 ? 0.933   -13.700 -68.171 1.00 41.14  ? 660  GLU A C     1 
ATOM   5430 O  O     . GLU A 1 660 ? 1.271   -12.573 -67.801 1.00 39.75  ? 660  GLU A O     1 
ATOM   5431 C  CB    . GLU A 1 660 ? 1.045   -15.645 -66.496 1.00 41.01  ? 660  GLU A CB    1 
ATOM   5432 C  CG    . GLU A 1 660 ? 0.498   -16.076 -65.118 1.00 44.27  ? 660  GLU A CG    1 
ATOM   5433 C  CD    . GLU A 1 660 ? 1.351   -17.120 -64.387 1.00 46.57  ? 660  GLU A CD    1 
ATOM   5434 O  OE1   . GLU A 1 660 ? 2.545   -17.300 -64.719 1.00 50.36  ? 660  GLU A OE1   1 
ATOM   5435 O  OE2   . GLU A 1 660 ? 0.818   -17.762 -63.458 1.00 45.66  ? 660  GLU A OE2   1 
ATOM   5436 N  N     . PRO A 1 661 ? 1.191   -14.170 -69.418 1.00 41.69  ? 661  PRO A N     1 
ATOM   5437 C  CA    . PRO A 1 661 ? 1.832   -13.284 -70.411 1.00 43.10  ? 661  PRO A CA    1 
ATOM   5438 C  C     . PRO A 1 661 ? 1.057   -11.990 -70.686 1.00 42.73  ? 661  PRO A C     1 
ATOM   5439 O  O     . PRO A 1 661 ? 1.668   -10.925 -70.835 1.00 43.44  ? 661  PRO A O     1 
ATOM   5440 C  CB    . PRO A 1 661 ? 1.882   -14.147 -71.681 1.00 43.16  ? 661  PRO A CB    1 
ATOM   5441 C  CG    . PRO A 1 661 ? 1.930   -15.532 -71.183 1.00 43.30  ? 661  PRO A CG    1 
ATOM   5442 C  CD    . PRO A 1 661 ? 1.100   -15.557 -69.919 1.00 42.58  ? 661  PRO A CD    1 
ATOM   5443 N  N     . ALA A 1 662 ? -0.268  -12.086 -70.756 1.00 41.83  ? 662  ALA A N     1 
ATOM   5444 C  CA    . ALA A 1 662 ? -1.114  -10.909 -70.944 1.00 41.39  ? 662  ALA A CA    1 
ATOM   5445 C  C     . ALA A 1 662 ? -1.049  -9.981  -69.736 1.00 39.93  ? 662  ALA A C     1 
ATOM   5446 O  O     . ALA A 1 662 ? -0.983  -8.758  -69.890 1.00 40.03  ? 662  ALA A O     1 
ATOM   5447 C  CB    . ALA A 1 662 ? -2.554  -11.320 -71.233 1.00 41.70  ? 662  ALA A CB    1 
ATOM   5448 N  N     . ILE A 1 663 ? -1.063  -10.578 -68.541 1.00 38.31  ? 663  ILE A N     1 
ATOM   5449 C  CA    . ILE A 1 663 ? -0.968  -9.847  -67.280 1.00 34.35  ? 663  ILE A CA    1 
ATOM   5450 C  C     . ILE A 1 663 ? 0.340   -9.057  -67.223 1.00 34.67  ? 663  ILE A C     1 
ATOM   5451 O  O     . ILE A 1 663 ? 0.346   -7.875  -66.861 1.00 35.11  ? 663  ILE A O     1 
ATOM   5452 C  CB    . ILE A 1 663 ? -1.140  -10.811 -66.060 1.00 34.65  ? 663  ILE A CB    1 
ATOM   5453 C  CG1   . ILE A 1 663 ? -2.624  -11.143 -65.876 1.00 33.08  ? 663  ILE A CG1   1 
ATOM   5454 C  CG2   . ILE A 1 663 ? -0.545  -10.220 -64.765 1.00 29.75  ? 663  ILE A CG2   1 
ATOM   5455 C  CD1   . ILE A 1 663 ? -2.908  -12.225 -64.856 1.00 32.65  ? 663  ILE A CD1   1 
ATOM   5456 N  N     . ASP A 1 664 ? 1.435   -9.708  -67.610 1.00 35.81  ? 664  ASP A N     1 
ATOM   5457 C  CA    . ASP A 1 664 ? 2.749   -9.072  -67.667 1.00 37.26  ? 664  ASP A CA    1 
ATOM   5458 C  C     . ASP A 1 664 ? 2.772   -7.871  -68.623 1.00 36.24  ? 664  ASP A C     1 
ATOM   5459 O  O     . ASP A 1 664 ? 3.307   -6.814  -68.278 1.00 35.84  ? 664  ASP A O     1 
ATOM   5460 C  CB    . ASP A 1 664 ? 3.833   -10.096 -68.041 1.00 39.62  ? 664  ASP A CB    1 
ATOM   5461 C  CG    . ASP A 1 664 ? 4.005   -11.187 -66.980 1.00 47.09  ? 664  ASP A CG    1 
ATOM   5462 O  OD1   . ASP A 1 664 ? 4.330   -12.338 -67.351 1.00 52.96  ? 664  ASP A OD1   1 
ATOM   5463 O  OD2   . ASP A 1 664 ? 3.813   -10.905 -65.775 1.00 48.77  ? 664  ASP A OD2   1 
ATOM   5464 N  N     . ARG A 1 665 ? 2.178   -8.027  -69.805 1.00 34.44  ? 665  ARG A N     1 
ATOM   5465 C  CA    . ARG A 1 665 ? 2.127   -6.935  -70.785 1.00 34.97  ? 665  ARG A CA    1 
ATOM   5466 C  C     . ARG A 1 665 ? 1.391   -5.728  -70.207 1.00 33.10  ? 665  ARG A C     1 
ATOM   5467 O  O     . ARG A 1 665 ? 1.854   -4.591  -70.330 1.00 34.15  ? 665  ARG A O     1 
ATOM   5468 C  CB    . ARG A 1 665 ? 1.476   -7.383  -72.104 1.00 35.95  ? 665  ARG A CB    1 
ATOM   5469 C  CG    . ARG A 1 665 ? 2.307   -8.371  -72.910 1.00 41.09  ? 665  ARG A CG    1 
ATOM   5470 C  CD    . ARG A 1 665 ? 1.770   -8.571  -74.342 1.00 46.82  ? 665  ARG A CD    1 
ATOM   5471 N  NE    . ARG A 1 665 ? 0.432   -9.168  -74.378 1.00 49.82  ? 665  ARG A NE    1 
ATOM   5472 C  CZ    . ARG A 1 665 ? 0.179   -10.479 -74.334 1.00 52.73  ? 665  ARG A CZ    1 
ATOM   5473 N  NH1   . ARG A 1 665 ? 1.171   -11.363 -74.252 1.00 50.94  ? 665  ARG A NH1   1 
ATOM   5474 N  NH2   . ARG A 1 665 ? -1.078  -10.909 -74.373 1.00 50.06  ? 665  ARG A NH2   1 
ATOM   5475 N  N     . GLY A 1 666 ? 0.250   -5.984  -69.571 1.00 29.44  ? 666  GLY A N     1 
ATOM   5476 C  CA    . GLY A 1 666 ? -0.519  -4.936  -68.917 1.00 28.76  ? 666  GLY A CA    1 
ATOM   5477 C  C     . GLY A 1 666 ? 0.253   -4.222  -67.816 1.00 29.42  ? 666  GLY A C     1 
ATOM   5478 O  O     . GLY A 1 666 ? 0.106   -3.015  -67.626 1.00 31.79  ? 666  GLY A O     1 
ATOM   5479 N  N     . PHE A 1 667 ? 1.082   -4.956  -67.081 1.00 28.43  ? 667  PHE A N     1 
ATOM   5480 C  CA    . PHE A 1 667 ? 1.868   -4.321  -66.023 1.00 27.34  ? 667  PHE A CA    1 
ATOM   5481 C  C     . PHE A 1 667 ? 3.110   -3.591  -66.544 1.00 29.43  ? 667  PHE A C     1 
ATOM   5482 O  O     . PHE A 1 667 ? 3.500   -2.573  -65.968 1.00 27.60  ? 667  PHE A O     1 
ATOM   5483 C  CB    . PHE A 1 667 ? 2.224   -5.308  -64.912 1.00 23.77  ? 667  PHE A CB    1 
ATOM   5484 C  CG    . PHE A 1 667 ? 1.179   -5.399  -63.819 1.00 23.92  ? 667  PHE A CG    1 
ATOM   5485 C  CD1   . PHE A 1 667 ? 0.709   -4.244  -63.181 1.00 20.99  ? 667  PHE A CD1   1 
ATOM   5486 C  CD2   . PHE A 1 667 ? 0.690   -6.638  -63.407 1.00 21.04  ? 667  PHE A CD2   1 
ATOM   5487 C  CE1   . PHE A 1 667 ? -0.239  -4.320  -62.160 1.00 20.48  ? 667  PHE A CE1   1 
ATOM   5488 C  CE2   . PHE A 1 667 ? -0.251  -6.728  -62.380 1.00 18.78  ? 667  PHE A CE2   1 
ATOM   5489 C  CZ    . PHE A 1 667 ? -0.719  -5.558  -61.759 1.00 22.21  ? 667  PHE A CZ    1 
ATOM   5490 N  N     . ARG A 1 668 ? 3.717   -4.100  -67.622 1.00 29.42  ? 668  ARG A N     1 
ATOM   5491 C  CA    . ARG A 1 668 ? 4.839   -3.403  -68.263 1.00 34.26  ? 668  ARG A CA    1 
ATOM   5492 C  C     . ARG A 1 668 ? 4.382   -2.046  -68.805 1.00 35.27  ? 668  ARG A C     1 
ATOM   5493 O  O     . ARG A 1 668 ? 5.107   -1.056  -68.707 1.00 36.10  ? 668  ARG A O     1 
ATOM   5494 C  CB    . ARG A 1 668 ? 5.471   -4.234  -69.394 1.00 35.60  ? 668  ARG A CB    1 
ATOM   5495 C  CG    . ARG A 1 668 ? 6.142   -5.523  -68.939 1.00 40.78  ? 668  ARG A CG    1 
ATOM   5496 C  CD    . ARG A 1 668 ? 7.221   -6.014  -69.902 1.00 44.89  ? 668  ARG A CD    1 
ATOM   5497 N  NE    . ARG A 1 668 ? 6.758   -6.153  -71.283 1.00 53.43  ? 668  ARG A NE    1 
ATOM   5498 C  CZ    . ARG A 1 668 ? 6.202   -7.250  -71.799 1.00 56.66  ? 668  ARG A CZ    1 
ATOM   5499 N  NH1   . ARG A 1 668 ? 6.015   -8.335  -71.048 1.00 55.34  ? 668  ARG A NH1   1 
ATOM   5500 N  NH2   . ARG A 1 668 ? 5.827   -7.255  -73.074 1.00 54.35  ? 668  ARG A NH2   1 
ATOM   5501 N  N     . GLU A 1 669 ? 3.177   -2.013  -69.372 1.00 35.81  ? 669  GLU A N     1 
ATOM   5502 C  CA    . GLU A 1 669 ? 2.570   -0.765  -69.845 1.00 37.66  ? 669  GLU A CA    1 
ATOM   5503 C  C     . GLU A 1 669 ? 2.348   0.216   -68.685 1.00 35.69  ? 669  GLU A C     1 
ATOM   5504 O  O     . GLU A 1 669 ? 2.557   1.420   -68.838 1.00 35.13  ? 669  GLU A O     1 
ATOM   5505 C  CB    . GLU A 1 669 ? 1.253   -1.043  -70.590 1.00 38.34  ? 669  GLU A CB    1 
ATOM   5506 C  CG    . GLU A 1 669 ? 0.621   0.186   -71.259 1.00 44.08  ? 669  GLU A CG    1 
ATOM   5507 C  CD    . GLU A 1 669 ? -0.738  -0.111  -71.892 1.00 48.88  ? 669  GLU A CD    1 
ATOM   5508 O  OE1   . GLU A 1 669 ? -0.818  -1.022  -72.744 1.00 53.77  ? 669  GLU A OE1   1 
ATOM   5509 O  OE2   . GLU A 1 669 ? -1.726  0.573   -71.547 1.00 50.11  ? 669  GLU A OE2   1 
ATOM   5510 N  N     . MET A 1 670 ? 1.937   -0.305  -67.529 1.00 32.57  ? 670  MET A N     1 
ATOM   5511 C  CA    . MET A 1 670 ? 1.696   0.539   -66.363 1.00 31.37  ? 670  MET A CA    1 
ATOM   5512 C  C     . MET A 1 670 ? 2.999   1.145   -65.838 1.00 31.06  ? 670  MET A C     1 
ATOM   5513 O  O     . MET A 1 670 ? 3.043   2.325   -65.462 1.00 30.21  ? 670  MET A O     1 
ATOM   5514 C  CB    . MET A 1 670 ? 0.988   -0.249  -65.259 1.00 31.57  ? 670  MET A CB    1 
ATOM   5515 C  CG    . MET A 1 670 ? 0.439   0.626   -64.149 1.00 31.97  ? 670  MET A CG    1 
ATOM   5516 S  SD    . MET A 1 670 ? -0.153  -0.334  -62.758 1.00 31.82  ? 670  MET A SD    1 
ATOM   5517 C  CE    . MET A 1 670 ? 1.375   -0.778  -61.947 1.00 29.53  ? 670  MET A CE    1 
ATOM   5518 N  N     . CYS A 1 671 ? 4.051   0.330   -65.819 1.00 31.28  ? 671  CYS A N     1 
ATOM   5519 C  CA    . CYS A 1 671 ? 5.382   0.780   -65.434 1.00 32.57  ? 671  CYS A CA    1 
ATOM   5520 C  C     . CYS A 1 671 ? 5.844   1.963   -66.315 1.00 32.28  ? 671  CYS A C     1 
ATOM   5521 O  O     . CYS A 1 671 ? 6.319   2.981   -65.801 1.00 32.09  ? 671  CYS A O     1 
ATOM   5522 C  CB    . CYS A 1 671 ? 6.374   -0.387  -65.502 1.00 31.40  ? 671  CYS A CB    1 
ATOM   5523 S  SG    . CYS A 1 671 ? 8.100   0.047   -65.162 1.00 36.49  ? 671  CYS A SG    1 
ATOM   5524 N  N     . GLU A 1 672 ? 5.686   1.826   -67.628 1.00 32.63  ? 672  GLU A N     1 
ATOM   5525 C  CA    . GLU A 1 672 ? 6.058   2.892   -68.570 1.00 34.70  ? 672  GLU A CA    1 
ATOM   5526 C  C     . GLU A 1 672 ? 5.238   4.160   -68.344 1.00 32.54  ? 672  GLU A C     1 
ATOM   5527 O  O     . GLU A 1 672 ? 5.779   5.263   -68.343 1.00 32.50  ? 672  GLU A O     1 
ATOM   5528 C  CB    . GLU A 1 672 ? 5.918   2.417   -70.017 1.00 38.02  ? 672  GLU A CB    1 
ATOM   5529 C  CG    . GLU A 1 672 ? 6.914   1.331   -70.415 1.00 46.64  ? 672  GLU A CG    1 
ATOM   5530 C  CD    . GLU A 1 672 ? 7.158   1.268   -71.919 1.00 57.13  ? 672  GLU A CD    1 
ATOM   5531 O  OE1   . GLU A 1 672 ? 7.176   0.144   -72.471 1.00 59.88  ? 672  GLU A OE1   1 
ATOM   5532 O  OE2   . GLU A 1 672 ? 7.335   2.339   -72.550 1.00 59.92  ? 672  GLU A OE2   1 
ATOM   5533 N  N     . TYR A 1 673 ? 3.937   3.981   -68.134 1.00 30.96  ? 673  TYR A N     1 
ATOM   5534 C  CA    . TYR A 1 673 ? 3.004   5.068   -67.843 1.00 30.17  ? 673  TYR A CA    1 
ATOM   5535 C  C     . TYR A 1 673 ? 3.450   5.898   -66.641 1.00 30.28  ? 673  TYR A C     1 
ATOM   5536 O  O     . TYR A 1 673 ? 3.450   7.128   -66.691 1.00 31.73  ? 673  TYR A O     1 
ATOM   5537 C  CB    . TYR A 1 673 ? 1.612   4.474   -67.612 1.00 28.95  ? 673  TYR A CB    1 
ATOM   5538 C  CG    . TYR A 1 673 ? 0.468   5.453   -67.481 1.00 32.15  ? 673  TYR A CG    1 
ATOM   5539 C  CD1   . TYR A 1 673 ? 0.450   6.648   -68.198 1.00 34.71  ? 673  TYR A CD1   1 
ATOM   5540 C  CD2   . TYR A 1 673 ? -0.630  5.154   -66.669 1.00 31.52  ? 673  TYR A CD2   1 
ATOM   5541 C  CE1   . TYR A 1 673 ? -0.611  7.538   -68.088 1.00 35.49  ? 673  TYR A CE1   1 
ATOM   5542 C  CE2   . TYR A 1 673 ? -1.709  6.033   -66.563 1.00 33.92  ? 673  TYR A CE2   1 
ATOM   5543 C  CZ    . TYR A 1 673 ? -1.687  7.225   -67.280 1.00 35.14  ? 673  TYR A CZ    1 
ATOM   5544 O  OH    . TYR A 1 673 ? -2.737  8.108   -67.185 1.00 37.54  ? 673  TYR A OH    1 
ATOM   5545 N  N     . MET A 1 674 ? 3.848   5.216   -65.573 1.00 29.06  ? 674  MET A N     1 
ATOM   5546 C  CA    . MET A 1 674 ? 4.298   5.875   -64.354 1.00 29.03  ? 674  MET A CA    1 
ATOM   5547 C  C     . MET A 1 674 ? 5.779   6.255   -64.386 1.00 28.34  ? 674  MET A C     1 
ATOM   5548 O  O     . MET A 1 674 ? 6.279   6.886   -63.444 1.00 27.82  ? 674  MET A O     1 
ATOM   5549 C  CB    . MET A 1 674 ? 3.982   5.002   -63.126 1.00 27.90  ? 674  MET A CB    1 
ATOM   5550 C  CG    . MET A 1 674 ? 2.490   4.940   -62.787 1.00 30.38  ? 674  MET A CG    1 
ATOM   5551 S  SD    . MET A 1 674 ? 1.822   6.498   -62.126 1.00 34.47  ? 674  MET A SD    1 
ATOM   5552 C  CE    . MET A 1 674 ? 0.569   6.828   -63.359 1.00 33.19  ? 674  MET A CE    1 
ATOM   5553 N  N     . ASN A 1 675 ? 6.468   5.885   -65.471 1.00 28.31  ? 675  ASN A N     1 
ATOM   5554 C  CA    . ASN A 1 675 ? 7.911   6.132   -65.632 1.00 26.61  ? 675  ASN A CA    1 
ATOM   5555 C  C     . ASN A 1 675 ? 8.744   5.541   -64.484 1.00 27.12  ? 675  ASN A C     1 
ATOM   5556 O  O     . ASN A 1 675 ? 9.743   6.121   -64.051 1.00 24.84  ? 675  ASN A O     1 
ATOM   5557 C  CB    . ASN A 1 675 ? 8.214   7.634   -65.807 1.00 23.99  ? 675  ASN A CB    1 
ATOM   5558 C  CG    . ASN A 1 675 ? 9.582   7.885   -66.446 1.00 26.65  ? 675  ASN A CG    1 
ATOM   5559 O  OD1   . ASN A 1 675 ? 10.019  7.130   -67.315 1.00 24.52  ? 675  ASN A OD1   1 
ATOM   5560 N  ND2   . ASN A 1 675 ? 10.255  8.949   -66.021 1.00 23.11  ? 675  ASN A ND2   1 
ATOM   5561 N  N     . ASN A 1 676 ? 8.322   4.383   -63.990 1.00 26.69  ? 676  ASN A N     1 
ATOM   5562 C  CA    . ASN A 1 676 ? 8.999   3.756   -62.861 1.00 26.18  ? 676  ASN A CA    1 
ATOM   5563 C  C     . ASN A 1 676 ? 10.391  3.263   -63.217 1.00 27.77  ? 676  ASN A C     1 
ATOM   5564 O  O     . ASN A 1 676 ? 10.714  3.081   -64.400 1.00 26.55  ? 676  ASN A O     1 
ATOM   5565 C  CB    . ASN A 1 676 ? 8.148   2.634   -62.273 1.00 25.39  ? 676  ASN A CB    1 
ATOM   5566 C  CG    . ASN A 1 676 ? 6.825   3.134   -61.727 1.00 23.51  ? 676  ASN A CG    1 
ATOM   5567 O  OD1   . ASN A 1 676 ? 5.798   2.490   -61.907 1.00 27.59  ? 676  ASN A OD1   1 
ATOM   5568 N  ND2   . ASN A 1 676 ? 6.844   4.286   -61.054 1.00 20.98  ? 676  ASN A ND2   1 
ATOM   5569 N  N     . LYS A 1 677 ? 11.212  3.074   -62.188 1.00 28.23  ? 677  LYS A N     1 
ATOM   5570 C  CA    . LYS A 1 677 ? 12.623  2.739   -62.366 1.00 29.62  ? 677  LYS A CA    1 
ATOM   5571 C  C     . LYS A 1 677 ? 12.846  1.305   -62.858 1.00 29.54  ? 677  LYS A C     1 
ATOM   5572 O  O     . LYS A 1 677 ? 13.781  1.049   -63.611 1.00 30.73  ? 677  LYS A O     1 
ATOM   5573 C  CB    . LYS A 1 677 ? 13.384  2.984   -61.055 1.00 31.10  ? 677  LYS A CB    1 
ATOM   5574 C  CG    . LYS A 1 677 ? 14.898  2.854   -61.159 1.00 34.16  ? 677  LYS A CG    1 
ATOM   5575 C  CD    . LYS A 1 677 ? 15.579  3.204   -59.838 1.00 37.50  ? 677  LYS A CD    1 
ATOM   5576 C  CE    . LYS A 1 677 ? 17.078  2.935   -59.895 1.00 40.33  ? 677  LYS A CE    1 
ATOM   5577 N  NZ    . LYS A 1 677 ? 17.368  1.466   -59.948 1.00 44.08  ? 677  LYS A NZ    1 
ATOM   5578 N  N     . GLN A 1 678 ? 11.991  0.377   -62.432 1.00 29.43  ? 678  GLN A N     1 
ATOM   5579 C  CA    . GLN A 1 678 ? 12.177  -1.047  -62.732 1.00 29.85  ? 678  GLN A CA    1 
ATOM   5580 C  C     . GLN A 1 678 ? 10.827  -1.759  -62.666 1.00 30.20  ? 678  GLN A C     1 
ATOM   5581 O  O     . GLN A 1 678 ? 10.053  -1.533  -61.738 1.00 30.10  ? 678  GLN A O     1 
ATOM   5582 C  CB    . GLN A 1 678 ? 13.160  -1.654  -61.718 1.00 30.24  ? 678  GLN A CB    1 
ATOM   5583 C  CG    . GLN A 1 678 ? 13.725  -3.029  -62.065 1.00 34.15  ? 678  GLN A CG    1 
ATOM   5584 C  CD    . GLN A 1 678 ? 14.527  -3.642  -60.912 1.00 34.37  ? 678  GLN A CD    1 
ATOM   5585 O  OE1   . GLN A 1 678 ? 14.769  -2.998  -59.893 1.00 35.23  ? 678  GLN A OE1   1 
ATOM   5586 N  NE2   . GLN A 1 678 ? 14.933  -4.894  -61.074 1.00 35.58  ? 678  GLN A NE2   1 
ATOM   5587 N  N     . HIS A 1 679 ? 10.534  -2.602  -63.654 1.00 29.39  ? 679  HIS A N     1 
ATOM   5588 C  CA    . HIS A 1 679 ? 9.287   -3.379  -63.652 1.00 28.24  ? 679  HIS A CA    1 
ATOM   5589 C  C     . HIS A 1 679 ? 9.361   -4.558  -62.668 1.00 27.76  ? 679  HIS A C     1 
ATOM   5590 O  O     . HIS A 1 679 ? 10.172  -5.476  -62.830 1.00 26.28  ? 679  HIS A O     1 
ATOM   5591 C  CB    . HIS A 1 679 ? 8.915   -3.853  -65.069 1.00 28.54  ? 679  HIS A CB    1 
ATOM   5592 C  CG    . HIS A 1 679 ? 7.965   -5.012  -65.085 1.00 27.89  ? 679  HIS A CG    1 
ATOM   5593 N  ND1   . HIS A 1 679 ? 6.683   -4.930  -64.585 1.00 24.27  ? 679  HIS A ND1   1 
ATOM   5594 C  CD2   . HIS A 1 679 ? 8.117   -6.283  -65.526 1.00 26.61  ? 679  HIS A CD2   1 
ATOM   5595 C  CE1   . HIS A 1 679 ? 6.087   -6.101  -64.713 1.00 23.56  ? 679  HIS A CE1   1 
ATOM   5596 N  NE2   . HIS A 1 679 ? 6.933   -6.939  -65.287 1.00 28.18  ? 679  HIS A NE2   1 
ATOM   5597 N  N     . LEU A 1 680 ? 8.524   -4.510  -61.636 1.00 28.33  ? 680  LEU A N     1 
ATOM   5598 C  CA    . LEU A 1 680 ? 8.532   -5.537  -60.594 1.00 26.94  ? 680  LEU A CA    1 
ATOM   5599 C  C     . LEU A 1 680 ? 7.134   -5.972  -60.166 1.00 26.39  ? 680  LEU A C     1 
ATOM   5600 O  O     . LEU A 1 680 ? 6.958   -6.613  -59.124 1.00 25.70  ? 680  LEU A O     1 
ATOM   5601 C  CB    . LEU A 1 680 ? 9.351   -5.071  -59.391 1.00 26.59  ? 680  LEU A CB    1 
ATOM   5602 C  CG    . LEU A 1 680 ? 10.862  -4.967  -59.613 1.00 28.84  ? 680  LEU A CG    1 
ATOM   5603 C  CD1   . LEU A 1 680 ? 11.503  -4.131  -58.504 1.00 23.32  ? 680  LEU A CD1   1 
ATOM   5604 C  CD2   . LEU A 1 680 ? 11.511  -6.368  -59.728 1.00 26.96  ? 680  LEU A CD2   1 
ATOM   5605 N  N     . MET A 1 681 ? 6.136   -5.629  -60.972 1.00 27.46  ? 681  MET A N     1 
ATOM   5606 C  CA    . MET A 1 681 ? 4.783   -6.103  -60.712 1.00 28.81  ? 681  MET A CA    1 
ATOM   5607 C  C     . MET A 1 681 ? 4.632   -7.502  -61.311 1.00 29.36  ? 681  MET A C     1 
ATOM   5608 O  O     . MET A 1 681 ? 4.282   -7.655  -62.485 1.00 30.94  ? 681  MET A O     1 
ATOM   5609 C  CB    . MET A 1 681 ? 3.737   -5.118  -61.253 1.00 28.57  ? 681  MET A CB    1 
ATOM   5610 C  CG    . MET A 1 681 ? 3.763   -3.721  -60.599 1.00 26.28  ? 681  MET A CG    1 
ATOM   5611 S  SD    . MET A 1 681 ? 3.263   -3.699  -58.853 1.00 27.86  ? 681  MET A SD    1 
ATOM   5612 C  CE    . MET A 1 681 ? 4.849   -3.569  -58.031 1.00 22.43  ? 681  MET A CE    1 
ATOM   5613 N  N     . PHE A 1 682 ? 4.926   -8.517  -60.497 1.00 30.40  ? 682  PHE A N     1 
ATOM   5614 C  CA    . PHE A 1 682 ? 4.897   -9.912  -60.940 1.00 30.95  ? 682  PHE A CA    1 
ATOM   5615 C  C     . PHE A 1 682 ? 3.676   -10.637 -60.379 1.00 31.01  ? 682  PHE A C     1 
ATOM   5616 O  O     . PHE A 1 682 ? 3.674   -11.060 -59.226 1.00 28.53  ? 682  PHE A O     1 
ATOM   5617 C  CB    . PHE A 1 682 ? 6.186   -10.652 -60.535 1.00 32.47  ? 682  PHE A CB    1 
ATOM   5618 C  CG    . PHE A 1 682 ? 7.460   -10.053 -61.101 1.00 33.09  ? 682  PHE A CG    1 
ATOM   5619 C  CD1   . PHE A 1 682 ? 7.493   -9.498  -62.384 1.00 33.08  ? 682  PHE A CD1   1 
ATOM   5620 C  CD2   . PHE A 1 682 ? 8.639   -10.079 -60.356 1.00 33.60  ? 682  PHE A CD2   1 
ATOM   5621 C  CE1   . PHE A 1 682 ? 8.672   -8.956  -62.907 1.00 33.69  ? 682  PHE A CE1   1 
ATOM   5622 C  CE2   . PHE A 1 682 ? 9.825   -9.544  -60.868 1.00 34.99  ? 682  PHE A CE2   1 
ATOM   5623 C  CZ    . PHE A 1 682 ? 9.842   -8.983  -62.152 1.00 35.15  ? 682  PHE A CZ    1 
ATOM   5624 N  N     . MET A 1 683 ? 2.636   -10.778 -61.199 1.00 32.62  ? 683  MET A N     1 
ATOM   5625 C  CA    . MET A 1 683 ? 1.397   -11.419 -60.764 1.00 32.28  ? 683  MET A CA    1 
ATOM   5626 C  C     . MET A 1 683 ? 1.255   -12.854 -61.290 1.00 34.95  ? 683  MET A C     1 
ATOM   5627 O  O     . MET A 1 683 ? 0.938   -13.079 -62.458 1.00 35.02  ? 683  MET A O     1 
ATOM   5628 C  CB    . MET A 1 683 ? 0.194   -10.557 -61.146 1.00 31.04  ? 683  MET A CB    1 
ATOM   5629 C  CG    . MET A 1 683 ? -1.144  -11.172 -60.812 1.00 28.98  ? 683  MET A CG    1 
ATOM   5630 S  SD    . MET A 1 683 ? -2.542  -10.118 -61.229 1.00 28.07  ? 683  MET A SD    1 
ATOM   5631 C  CE    . MET A 1 683 ? -2.901  -9.401  -59.620 1.00 24.00  ? 683  MET A CE    1 
ATOM   5632 N  N     . ASP A 1 684 ? 1.495   -13.816 -60.406 1.00 36.96  ? 684  ASP A N     1 
ATOM   5633 C  CA    . ASP A 1 684 ? 1.425   -15.235 -60.747 1.00 40.01  ? 684  ASP A CA    1 
ATOM   5634 C  C     . ASP A 1 684 ? 0.069   -15.801 -60.376 1.00 39.42  ? 684  ASP A C     1 
ATOM   5635 O  O     . ASP A 1 684 ? -0.629  -15.252 -59.517 1.00 40.41  ? 684  ASP A O     1 
ATOM   5636 C  CB    . ASP A 1 684 ? 2.494   -16.024 -59.981 1.00 42.43  ? 684  ASP A CB    1 
ATOM   5637 C  CG    . ASP A 1 684 ? 3.897   -15.814 -60.526 1.00 50.63  ? 684  ASP A CG    1 
ATOM   5638 O  OD1   . ASP A 1 684 ? 4.043   -15.200 -61.609 1.00 53.25  ? 684  ASP A OD1   1 
ATOM   5639 O  OD2   . ASP A 1 684 ? 4.857   -16.277 -59.864 1.00 54.71  ? 684  ASP A OD2   1 
ATOM   5640 N  N     . ARG A 1 685 ? -0.288  -16.918 -60.998 1.00 37.64  ? 685  ARG A N     1 
ATOM   5641 C  CA    . ARG A 1 685 ? -1.481  -17.654 -60.607 1.00 36.05  ? 685  ARG A CA    1 
ATOM   5642 C  C     . ARG A 1 685 ? -1.287  -18.222 -59.202 1.00 34.62  ? 685  ARG A C     1 
ATOM   5643 O  O     . ARG A 1 685 ? -0.212  -18.729 -58.880 1.00 34.26  ? 685  ARG A O     1 
ATOM   5644 C  CB    . ARG A 1 685 ? -1.769  -18.773 -61.612 1.00 34.90  ? 685  ARG A CB    1 
ATOM   5645 C  CG    . ARG A 1 685 ? -3.153  -19.407 -61.478 1.00 33.63  ? 685  ARG A CG    1 
ATOM   5646 C  CD    . ARG A 1 685 ? -3.145  -20.588 -60.512 1.00 35.24  ? 685  ARG A CD    1 
ATOM   5647 N  NE    . ARG A 1 685 ? -2.324  -21.691 -61.006 1.00 31.47  ? 685  ARG A NE    1 
ATOM   5648 C  CZ    . ARG A 1 685 ? -1.989  -22.757 -60.291 1.00 30.27  ? 685  ARG A CZ    1 
ATOM   5649 N  NH1   . ARG A 1 685 ? -2.397  -22.884 -59.027 1.00 29.64  ? 685  ARG A NH1   1 
ATOM   5650 N  NH2   . ARG A 1 685 ? -1.237  -23.696 -60.839 1.00 24.57  ? 685  ARG A NH2   1 
ATOM   5651 N  N     . GLU A 1 686 ? -2.323  -18.120 -58.372 1.00 33.50  ? 686  GLU A N     1 
ATOM   5652 C  CA    . GLU A 1 686 ? -2.294  -18.687 -57.029 1.00 35.09  ? 686  GLU A CA    1 
ATOM   5653 C  C     . GLU A 1 686 ? -3.183  -19.926 -56.897 1.00 34.53  ? 686  GLU A C     1 
ATOM   5654 O  O     . GLU A 1 686 ? -2.668  -21.037 -56.776 1.00 34.64  ? 686  GLU A O     1 
ATOM   5655 C  CB    . GLU A 1 686 ? -2.658  -17.640 -55.975 1.00 37.22  ? 686  GLU A CB    1 
ATOM   5656 C  CG    . GLU A 1 686 ? -1.469  -17.153 -55.154 1.00 48.03  ? 686  GLU A CG    1 
ATOM   5657 C  CD    . GLU A 1 686 ? -1.852  -16.810 -53.715 1.00 54.39  ? 686  GLU A CD    1 
ATOM   5658 O  OE1   . GLU A 1 686 ? -1.155  -15.984 -53.076 1.00 55.97  ? 686  GLU A OE1   1 
ATOM   5659 O  OE2   . GLU A 1 686 ? -2.859  -17.370 -53.225 1.00 59.70  ? 686  GLU A OE2   1 
ATOM   5660 N  N     . ALA A 1 687 ? -4.506  -19.745 -56.934 1.00 32.00  ? 687  ALA A N     1 
ATOM   5661 C  CA    . ALA A 1 687 ? -5.435  -20.864 -56.724 1.00 29.97  ? 687  ALA A CA    1 
ATOM   5662 C  C     . ALA A 1 687 ? -6.253  -21.294 -57.945 1.00 28.79  ? 687  ALA A C     1 
ATOM   5663 O  O     . ALA A 1 687 ? -6.650  -20.476 -58.785 1.00 28.64  ? 687  ALA A O     1 
ATOM   5664 C  CB    . ALA A 1 687 ? -6.353  -20.588 -55.534 1.00 31.02  ? 687  ALA A CB    1 
ATOM   5665 N  N     . ILE A 1 688 ? -6.475  -22.602 -58.038 1.00 28.39  ? 688  ILE A N     1 
ATOM   5666 C  CA    . ILE A 1 688 ? -7.440  -23.169 -58.963 1.00 29.78  ? 688  ILE A CA    1 
ATOM   5667 C  C     . ILE A 1 688 ? -8.540  -23.841 -58.148 1.00 31.73  ? 688  ILE A C     1 
ATOM   5668 O  O     . ILE A 1 688 ? -8.292  -24.787 -57.395 1.00 32.80  ? 688  ILE A O     1 
ATOM   5669 C  CB    . ILE A 1 688 ? -6.784  -24.155 -59.945 1.00 31.23  ? 688  ILE A CB    1 
ATOM   5670 C  CG1   . ILE A 1 688 ? -5.779  -23.411 -60.836 1.00 33.03  ? 688  ILE A CG1   1 
ATOM   5671 C  CG2   . ILE A 1 688 ? -7.841  -24.828 -60.809 1.00 30.97  ? 688  ILE A CG2   1 
ATOM   5672 C  CD1   . ILE A 1 688 ? -4.995  -24.300 -61.764 1.00 36.69  ? 688  ILE A CD1   1 
ATOM   5673 N  N     . ALA A 1 689 ? -9.757  -23.327 -58.285 1.00 31.25  ? 689  ALA A N     1 
ATOM   5674 C  CA    . ALA A 1 689 ? -10.874 -23.804 -57.484 1.00 28.76  ? 689  ALA A CA    1 
ATOM   5675 C  C     . ALA A 1 689 ? -12.034 -24.270 -58.345 1.00 29.10  ? 689  ALA A C     1 
ATOM   5676 O  O     . ALA A 1 689 ? -12.284 -23.735 -59.436 1.00 30.18  ? 689  ALA A O     1 
ATOM   5677 C  CB    . ALA A 1 689 ? -11.322 -22.730 -56.501 1.00 26.55  ? 689  ALA A CB    1 
ATOM   5678 N  N     . GLY A 1 690 ? -12.730 -25.284 -57.849 1.00 29.70  ? 690  GLY A N     1 
ATOM   5679 C  CA    . GLY A 1 690 ? -13.905 -25.820 -58.518 1.00 31.06  ? 690  GLY A CA    1 
ATOM   5680 C  C     . GLY A 1 690 ? -14.463 -27.016 -57.779 1.00 31.78  ? 690  GLY A C     1 
ATOM   5681 O  O     . GLY A 1 690 ? -13.841 -27.500 -56.833 1.00 30.54  ? 690  GLY A O     1 
ATOM   5682 N  N     . PRO A 1 691 ? -15.645 -27.503 -58.204 1.00 33.45  ? 691  PRO A N     1 
ATOM   5683 C  CA    . PRO A 1 691 ? -16.221 -28.713 -57.616 1.00 33.57  ? 691  PRO A CA    1 
ATOM   5684 C  C     . PRO A 1 691 ? -15.574 -29.979 -58.179 1.00 33.65  ? 691  PRO A C     1 
ATOM   5685 O  O     . PRO A 1 691 ? -15.013 -29.946 -59.279 1.00 34.84  ? 691  PRO A O     1 
ATOM   5686 C  CB    . PRO A 1 691 ? -17.694 -28.653 -58.044 1.00 35.04  ? 691  PRO A CB    1 
ATOM   5687 C  CG    . PRO A 1 691 ? -17.821 -27.474 -58.992 1.00 36.78  ? 691  PRO A CG    1 
ATOM   5688 C  CD    . PRO A 1 691 ? -16.454 -27.001 -59.329 1.00 33.14  ? 691  PRO A CD    1 
ATOM   5689 N  N     . PRO A 1 692 ? -15.650 -31.101 -57.439 1.00 34.61  ? 692  PRO A N     1 
ATOM   5690 C  CA    . PRO A 1 692 ? -15.189 -32.361 -58.050 1.00 34.11  ? 692  PRO A CA    1 
ATOM   5691 C  C     . PRO A 1 692 ? -16.016 -32.673 -59.293 1.00 35.82  ? 692  PRO A C     1 
ATOM   5692 O  O     . PRO A 1 692 ? -17.229 -32.449 -59.287 1.00 34.88  ? 692  PRO A O     1 
ATOM   5693 C  CB    . PRO A 1 692 ? -15.442 -33.401 -56.949 1.00 32.75  ? 692  PRO A CB    1 
ATOM   5694 C  CG    . PRO A 1 692 ? -15.452 -32.589 -55.656 1.00 33.07  ? 692  PRO A CG    1 
ATOM   5695 C  CD    . PRO A 1 692 ? -16.080 -31.281 -56.038 1.00 31.72  ? 692  PRO A CD    1 
ATOM   5696 N  N     . LEU A 1 693 ? -15.362 -33.155 -60.353 1.00 37.87  ? 693  LEU A N     1 
ATOM   5697 C  CA    . LEU A 1 693 ? -16.029 -33.443 -61.624 1.00 37.90  ? 693  LEU A CA    1 
ATOM   5698 C  C     . LEU A 1 693 ? -17.125 -34.486 -61.445 1.00 38.39  ? 693  LEU A C     1 
ATOM   5699 O  O     . LEU A 1 693 ? -16.882 -35.553 -60.887 1.00 39.83  ? 693  LEU A O     1 
ATOM   5700 C  CB    . LEU A 1 693 ? -15.026 -33.952 -62.663 1.00 39.68  ? 693  LEU A CB    1 
ATOM   5701 C  CG    . LEU A 1 693 ? -15.105 -33.501 -64.132 1.00 40.61  ? 693  LEU A CG    1 
ATOM   5702 C  CD1   . LEU A 1 693 ? -14.840 -34.679 -65.063 1.00 41.35  ? 693  LEU A CD1   1 
ATOM   5703 C  CD2   . LEU A 1 693 ? -16.418 -32.815 -64.501 1.00 40.09  ? 693  LEU A CD2   1 
ATOM   5704 N  N     . GLY A 1 694 ? -18.326 -34.168 -61.919 1.00 37.75  ? 694  GLY A N     1 
ATOM   5705 C  CA    . GLY A 1 694 ? -19.458 -35.090 -61.841 1.00 39.78  ? 694  GLY A CA    1 
ATOM   5706 C  C     . GLY A 1 694 ? -20.280 -34.979 -60.570 1.00 39.51  ? 694  GLY A C     1 
ATOM   5707 O  O     . GLY A 1 694 ? -21.260 -35.704 -60.396 1.00 39.83  ? 694  GLY A O     1 
ATOM   5708 N  N     . SER A 1 695 ? -19.887 -34.063 -59.684 1.00 38.36  ? 695  SER A N     1 
ATOM   5709 C  CA    . SER A 1 695 ? -20.569 -33.871 -58.405 1.00 37.08  ? 695  SER A CA    1 
ATOM   5710 C  C     . SER A 1 695 ? -21.547 -32.697 -58.456 1.00 36.22  ? 695  SER A C     1 
ATOM   5711 O  O     . SER A 1 695 ? -21.607 -31.974 -59.444 1.00 35.67  ? 695  SER A O     1 
ATOM   5712 C  CB    . SER A 1 695 ? -19.542 -33.636 -57.295 1.00 36.33  ? 695  SER A CB    1 
ATOM   5713 O  OG    . SER A 1 695 ? -18.923 -32.366 -57.456 1.00 36.89  ? 695  SER A OG    1 
ATOM   5714 N  N     . LYS A 1 696 ? -22.287 -32.503 -57.369 1.00 37.05  ? 696  LYS A N     1 
ATOM   5715 C  CA    . LYS A 1 696 ? -23.230 -31.395 -57.255 1.00 38.49  ? 696  LYS A CA    1 
ATOM   5716 C  C     . LYS A 1 696 ? -22.702 -30.261 -56.360 1.00 37.65  ? 696  LYS A C     1 
ATOM   5717 O  O     . LYS A 1 696 ? -23.452 -29.347 -55.988 1.00 37.37  ? 696  LYS A O     1 
ATOM   5718 C  CB    . LYS A 1 696 ? -24.583 -31.908 -56.745 1.00 40.81  ? 696  LYS A CB    1 
ATOM   5719 C  CG    . LYS A 1 696 ? -25.301 -32.824 -57.731 1.00 43.57  ? 696  LYS A CG    1 
ATOM   5720 C  CD    . LYS A 1 696 ? -26.397 -33.631 -57.050 1.00 49.93  ? 696  LYS A CD    1 
ATOM   5721 C  CE    . LYS A 1 696 ? -27.129 -34.521 -58.053 1.00 51.78  ? 696  LYS A CE    1 
ATOM   5722 N  NZ    . LYS A 1 696 ? -27.944 -35.567 -57.368 1.00 56.46  ? 696  LYS A NZ    1 
ATOM   5723 N  N     . GLY A 1 697 ? -21.413 -30.315 -56.028 1.00 33.51  ? 697  GLY A N     1 
ATOM   5724 C  CA    . GLY A 1 697 ? -20.774 -29.251 -55.246 1.00 34.52  ? 697  GLY A CA    1 
ATOM   5725 C  C     . GLY A 1 697 ? -20.781 -27.926 -55.997 1.00 33.28  ? 697  GLY A C     1 
ATOM   5726 O  O     . GLY A 1 697 ? -20.777 -27.903 -57.228 1.00 32.96  ? 697  GLY A O     1 
ATOM   5727 N  N     . ILE A 1 698 ? -20.822 -26.821 -55.264 1.00 31.43  ? 698  ILE A N     1 
ATOM   5728 C  CA    . ILE A 1 698 ? -20.924 -25.506 -55.902 1.00 31.76  ? 698  ILE A CA    1 
ATOM   5729 C  C     . ILE A 1 698 ? -19.555 -24.883 -56.179 1.00 31.46  ? 698  ILE A C     1 
ATOM   5730 O  O     . ILE A 1 698 ? -19.460 -23.917 -56.936 1.00 33.28  ? 698  ILE A O     1 
ATOM   5731 C  CB    . ILE A 1 698 ? -21.847 -24.528 -55.121 1.00 31.13  ? 698  ILE A CB    1 
ATOM   5732 C  CG1   . ILE A 1 698 ? -21.299 -24.257 -53.713 1.00 30.66  ? 698  ILE A CG1   1 
ATOM   5733 C  CG2   . ILE A 1 698 ? -23.274 -25.071 -55.070 1.00 31.48  ? 698  ILE A CG2   1 
ATOM   5734 C  CD1   . ILE A 1 698 ? -21.994 -23.116 -52.995 1.00 29.60  ? 698  ILE A CD1   1 
ATOM   5735 N  N     . GLY A 1 699 ? -18.506 -25.443 -55.571 1.00 30.46  ? 699  GLY A N     1 
ATOM   5736 C  CA    . GLY A 1 699 ? -17.127 -25.024 -55.843 1.00 29.44  ? 699  GLY A CA    1 
ATOM   5737 C  C     . GLY A 1 699 ? -16.630 -23.912 -54.931 1.00 30.51  ? 699  GLY A C     1 
ATOM   5738 O  O     . GLY A 1 699 ? -15.578 -24.037 -54.303 1.00 29.88  ? 699  GLY A O     1 
ATOM   5739 N  N     . GLY A 1 700 ? -17.379 -22.815 -54.873 1.00 29.48  ? 700  GLY A N     1 
ATOM   5740 C  CA    . GLY A 1 700 ? -17.013 -21.671 -54.051 1.00 27.66  ? 700  GLY A CA    1 
ATOM   5741 C  C     . GLY A 1 700 ? -18.179 -20.723 -53.862 1.00 27.45  ? 700  GLY A C     1 
ATOM   5742 O  O     . GLY A 1 700 ? -19.207 -20.851 -54.534 1.00 28.95  ? 700  GLY A O     1 
ATOM   5743 N  N     . PHE A 1 701 ? -18.025 -19.785 -52.932 1.00 25.53  ? 701  PHE A N     1 
ATOM   5744 C  CA    . PHE A 1 701 ? -18.984 -18.694 -52.758 1.00 25.64  ? 701  PHE A CA    1 
ATOM   5745 C  C     . PHE A 1 701 ? -18.368 -17.492 -52.045 1.00 24.63  ? 701  PHE A C     1 
ATOM   5746 O  O     . PHE A 1 701 ? -17.380 -17.629 -51.337 1.00 25.42  ? 701  PHE A O     1 
ATOM   5747 C  CB    . PHE A 1 701 ? -20.261 -19.154 -52.029 1.00 22.47  ? 701  PHE A CB    1 
ATOM   5748 C  CG    . PHE A 1 701 ? -20.052 -19.515 -50.574 1.00 23.29  ? 701  PHE A CG    1 
ATOM   5749 C  CD1   . PHE A 1 701 ? -19.789 -20.829 -50.202 1.00 19.48  ? 701  PHE A CD1   1 
ATOM   5750 C  CD2   . PHE A 1 701 ? -20.149 -18.548 -49.577 1.00 24.91  ? 701  PHE A CD2   1 
ATOM   5751 C  CE1   . PHE A 1 701 ? -19.614 -21.171 -48.859 1.00 24.12  ? 701  PHE A CE1   1 
ATOM   5752 C  CE2   . PHE A 1 701 ? -19.966 -18.881 -48.231 1.00 23.64  ? 701  PHE A CE2   1 
ATOM   5753 C  CZ    . PHE A 1 701 ? -19.698 -20.196 -47.876 1.00 20.44  ? 701  PHE A CZ    1 
ATOM   5754 N  N     . TRP A 1 702 ? -18.976 -16.327 -52.247 1.00 24.46  ? 702  TRP A N     1 
ATOM   5755 C  CA    . TRP A 1 702 ? -18.630 -15.097 -51.547 1.00 25.27  ? 702  TRP A CA    1 
ATOM   5756 C  C     . TRP A 1 702 ? -19.878 -14.596 -50.837 1.00 25.33  ? 702  TRP A C     1 
ATOM   5757 O  O     . TRP A 1 702 ? -20.950 -14.594 -51.435 1.00 28.87  ? 702  TRP A O     1 
ATOM   5758 C  CB    . TRP A 1 702 ? -18.173 -14.035 -52.560 1.00 24.37  ? 702  TRP A CB    1 
ATOM   5759 C  CG    . TRP A 1 702 ? -16.701 -13.915 -52.722 1.00 24.33  ? 702  TRP A CG    1 
ATOM   5760 C  CD1   . TRP A 1 702 ? -15.902 -12.943 -52.193 1.00 24.83  ? 702  TRP A CD1   1 
ATOM   5761 C  CD2   . TRP A 1 702 ? -15.835 -14.789 -53.462 1.00 27.76  ? 702  TRP A CD2   1 
ATOM   5762 N  NE1   . TRP A 1 702 ? -14.592 -13.156 -52.551 1.00 28.07  ? 702  TRP A NE1   1 
ATOM   5763 C  CE2   . TRP A 1 702 ? -14.519 -14.282 -53.328 1.00 26.36  ? 702  TRP A CE2   1 
ATOM   5764 C  CE3   . TRP A 1 702 ? -16.040 -15.954 -54.217 1.00 27.66  ? 702  TRP A CE3   1 
ATOM   5765 C  CZ2   . TRP A 1 702 ? -13.410 -14.895 -53.930 1.00 26.76  ? 702  TRP A CZ2   1 
ATOM   5766 C  CZ3   . TRP A 1 702 ? -14.936 -16.566 -54.814 1.00 31.32  ? 702  TRP A CZ3   1 
ATOM   5767 C  CH2   . TRP A 1 702 ? -13.636 -16.031 -54.667 1.00 27.99  ? 702  TRP A CH2   1 
ATOM   5768 N  N     . THR A 1 703 ? -19.760 -14.166 -49.581 1.00 24.68  ? 703  THR A N     1 
ATOM   5769 C  CA    . THR A 1 703 ? -20.879 -13.472 -48.925 1.00 23.67  ? 703  THR A CA    1 
ATOM   5770 C  C     . THR A 1 703 ? -20.724 -11.947 -48.961 1.00 24.43  ? 703  THR A C     1 
ATOM   5771 O  O     . THR A 1 703 ? -21.695 -11.203 -48.794 1.00 25.47  ? 703  THR A O     1 
ATOM   5772 C  CB    . THR A 1 703 ? -21.132 -13.935 -47.443 1.00 23.87  ? 703  THR A CB    1 
ATOM   5773 O  OG1   . THR A 1 703 ? -20.362 -13.142 -46.538 1.00 23.66  ? 703  THR A OG1   1 
ATOM   5774 C  CG2   . THR A 1 703 ? -20.796 -15.402 -47.232 1.00 24.97  ? 703  THR A CG2   1 
ATOM   5775 N  N     . GLY A 1 704 ? -19.498 -11.482 -49.157 1.00 26.22  ? 704  GLY A N     1 
ATOM   5776 C  CA    . GLY A 1 704 ? -19.198 -10.045 -49.129 1.00 25.87  ? 704  GLY A CA    1 
ATOM   5777 C  C     . GLY A 1 704 ? -17.700 -9.835  -49.096 1.00 24.34  ? 704  GLY A C     1 
ATOM   5778 O  O     . GLY A 1 704 ? -16.938 -10.790 -49.266 1.00 20.90  ? 704  GLY A O     1 
ATOM   5779 N  N     . LYS A 1 705 ? -17.269 -8.592  -48.892 1.00 24.07  ? 705  LYS A N     1 
ATOM   5780 C  CA    . LYS A 1 705 ? -15.836 -8.306  -48.806 1.00 24.65  ? 705  LYS A CA    1 
ATOM   5781 C  C     . LYS A 1 705 ? -15.207 -9.155  -47.703 1.00 24.47  ? 705  LYS A C     1 
ATOM   5782 O  O     . LYS A 1 705 ? -15.788 -9.314  -46.632 1.00 26.47  ? 705  LYS A O     1 
ATOM   5783 C  CB    . LYS A 1 705 ? -15.579 -6.826  -48.527 1.00 23.86  ? 705  LYS A CB    1 
ATOM   5784 C  CG    . LYS A 1 705 ? -15.872 -5.911  -49.704 1.00 24.40  ? 705  LYS A CG    1 
ATOM   5785 C  CD    . LYS A 1 705 ? -15.586 -4.469  -49.333 1.00 26.08  ? 705  LYS A CD    1 
ATOM   5786 C  CE    . LYS A 1 705 ? -15.912 -3.521  -50.474 1.00 25.55  ? 705  LYS A CE    1 
ATOM   5787 N  NZ    . LYS A 1 705 ? -15.742 -2.125  -50.016 1.00 27.39  ? 705  LYS A NZ    1 
ATOM   5788 N  N     . LYS A 1 706 ? -14.046 -9.729  -48.004 1.00 24.70  ? 706  LYS A N     1 
ATOM   5789 C  CA    . LYS A 1 706 ? -13.230 -10.473 -47.041 1.00 24.68  ? 706  LYS A CA    1 
ATOM   5790 C  C     . LYS A 1 706 ? -13.903 -11.737 -46.481 1.00 24.02  ? 706  LYS A C     1 
ATOM   5791 O  O     . LYS A 1 706 ? -13.445 -12.297 -45.488 1.00 23.96  ? 706  LYS A O     1 
ATOM   5792 C  CB    . LYS A 1 706 ? -12.736 -9.525  -45.928 1.00 26.61  ? 706  LYS A CB    1 
ATOM   5793 C  CG    . LYS A 1 706 ? -11.779 -8.432  -46.455 1.00 27.71  ? 706  LYS A CG    1 
ATOM   5794 C  CD    . LYS A 1 706 ? -11.176 -7.584  -45.360 1.00 29.50  ? 706  LYS A CD    1 
ATOM   5795 C  CE    . LYS A 1 706 ? -10.164 -6.581  -45.915 1.00 33.65  ? 706  LYS A CE    1 
ATOM   5796 N  NZ    . LYS A 1 706 ? -8.883  -7.239  -46.336 1.00 30.62  ? 706  LYS A NZ    1 
ATOM   5797 N  N     . ARG A 1 707 ? -14.972 -12.186 -47.138 1.00 25.77  ? 707  ARG A N     1 
ATOM   5798 C  CA    . ARG A 1 707 ? -15.757 -13.335 -46.683 1.00 24.44  ? 707  ARG A CA    1 
ATOM   5799 C  C     . ARG A 1 707 ? -16.073 -14.279 -47.829 1.00 23.55  ? 707  ARG A C     1 
ATOM   5800 O  O     . ARG A 1 707 ? -16.995 -14.028 -48.616 1.00 22.81  ? 707  ARG A O     1 
ATOM   5801 C  CB    . ARG A 1 707 ? -17.059 -12.873 -46.008 1.00 23.73  ? 707  ARG A CB    1 
ATOM   5802 C  CG    . ARG A 1 707 ? -16.852 -12.257 -44.624 1.00 24.47  ? 707  ARG A CG    1 
ATOM   5803 C  CD    . ARG A 1 707 ? -18.160 -11.863 -43.961 1.00 23.10  ? 707  ARG A CD    1 
ATOM   5804 N  NE    . ARG A 1 707 ? -19.025 -13.013 -43.685 1.00 30.40  ? 707  ARG A NE    1 
ATOM   5805 C  CZ    . ARG A 1 707 ? -19.030 -13.714 -42.548 1.00 31.25  ? 707  ARG A CZ    1 
ATOM   5806 N  NH1   . ARG A 1 707 ? -18.216 -13.399 -41.541 1.00 27.24  ? 707  ARG A NH1   1 
ATOM   5807 N  NH2   . ARG A 1 707 ? -19.868 -14.731 -42.411 1.00 29.56  ? 707  ARG A NH2   1 
ATOM   5808 N  N     . TYR A 1 708 ? -15.305 -15.362 -47.927 1.00 22.23  ? 708  TYR A N     1 
ATOM   5809 C  CA    . TYR A 1 708 ? -15.482 -16.326 -49.015 1.00 23.74  ? 708  TYR A CA    1 
ATOM   5810 C  C     . TYR A 1 708 ? -14.904 -17.702 -48.689 1.00 23.11  ? 708  TYR A C     1 
ATOM   5811 O  O     . TYR A 1 708 ? -14.126 -17.856 -47.745 1.00 21.60  ? 708  TYR A O     1 
ATOM   5812 C  CB    . TYR A 1 708 ? -14.878 -15.792 -50.328 1.00 23.21  ? 708  TYR A CB    1 
ATOM   5813 C  CG    . TYR A 1 708 ? -13.383 -15.529 -50.265 1.00 23.17  ? 708  TYR A CG    1 
ATOM   5814 C  CD1   . TYR A 1 708 ? -12.889 -14.298 -49.832 1.00 23.55  ? 708  TYR A CD1   1 
ATOM   5815 C  CD2   . TYR A 1 708 ? -12.465 -16.511 -50.640 1.00 19.44  ? 708  TYR A CD2   1 
ATOM   5816 C  CE1   . TYR A 1 708 ? -11.522 -14.056 -49.766 1.00 21.52  ? 708  TYR A CE1   1 
ATOM   5817 C  CE2   . TYR A 1 708 ? -11.102 -16.278 -50.579 1.00 22.05  ? 708  TYR A CE2   1 
ATOM   5818 C  CZ    . TYR A 1 708 ? -10.637 -15.043 -50.142 1.00 23.55  ? 708  TYR A CZ    1 
ATOM   5819 O  OH    . TYR A 1 708 ? -9.280  -14.804 -50.080 1.00 28.32  ? 708  TYR A OH    1 
ATOM   5820 N  N     . ALA A 1 709 ? -15.300 -18.691 -49.487 1.00 23.70  ? 709  ALA A N     1 
ATOM   5821 C  CA    . ALA A 1 709 ? -14.817 -20.061 -49.359 1.00 24.55  ? 709  ALA A CA    1 
ATOM   5822 C  C     . ALA A 1 709 ? -14.636 -20.662 -50.744 1.00 25.53  ? 709  ALA A C     1 
ATOM   5823 O  O     . ALA A 1 709 ? -15.469 -20.456 -51.630 1.00 27.87  ? 709  ALA A O     1 
ATOM   5824 C  CB    . ALA A 1 709 ? -15.791 -20.901 -48.530 1.00 25.32  ? 709  ALA A CB    1 
ATOM   5825 N  N     . LEU A 1 710 ? -13.539 -21.391 -50.924 1.00 26.31  ? 710  LEU A N     1 
ATOM   5826 C  CA    . LEU A 1 710 ? -13.211 -22.028 -52.195 1.00 26.86  ? 710  LEU A CA    1 
ATOM   5827 C  C     . LEU A 1 710 ? -12.717 -23.451 -51.987 1.00 27.28  ? 710  LEU A C     1 
ATOM   5828 O  O     . LEU A 1 710 ? -12.006 -23.741 -51.020 1.00 27.77  ? 710  LEU A O     1 
ATOM   5829 C  CB    . LEU A 1 710 ? -12.132 -21.237 -52.932 1.00 25.67  ? 710  LEU A CB    1 
ATOM   5830 C  CG    . LEU A 1 710 ? -12.457 -19.854 -53.497 1.00 29.04  ? 710  LEU A CG    1 
ATOM   5831 C  CD1   . LEU A 1 710 ? -11.171 -19.162 -53.899 1.00 29.32  ? 710  LEU A CD1   1 
ATOM   5832 C  CD2   . LEU A 1 710 ? -13.423 -19.932 -54.687 1.00 29.98  ? 710  LEU A CD2   1 
ATOM   5833 N  N     . ASN A 1 711 ? -13.088 -24.333 -52.909 1.00 25.93  ? 711  ASN A N     1 
ATOM   5834 C  CA    . ASN A 1 711 ? -12.555 -25.684 -52.921 1.00 27.19  ? 711  ASN A CA    1 
ATOM   5835 C  C     . ASN A 1 711 ? -11.340 -25.761 -53.856 1.00 28.29  ? 711  ASN A C     1 
ATOM   5836 O  O     . ASN A 1 711 ? -11.495 -25.844 -55.073 1.00 28.78  ? 711  ASN A O     1 
ATOM   5837 C  CB    . ASN A 1 711 ? -13.641 -26.681 -53.324 1.00 27.58  ? 711  ASN A CB    1 
ATOM   5838 C  CG    . ASN A 1 711 ? -13.200 -28.106 -53.162 1.00 30.48  ? 711  ASN A CG    1 
ATOM   5839 O  OD1   . ASN A 1 711 ? -12.707 -28.491 -52.104 1.00 32.58  ? 711  ASN A OD1   1 
ATOM   5840 N  ND2   . ASN A 1 711 ? -13.361 -28.903 -54.214 1.00 29.30  ? 711  ASN A ND2   1 
ATOM   5841 N  N     . VAL A 1 712 ? -10.139 -25.727 -53.271 1.00 25.71  ? 712  VAL A N     1 
ATOM   5842 C  CA    . VAL A 1 712 ? -8.893  -25.548 -54.023 1.00 27.10  ? 712  VAL A CA    1 
ATOM   5843 C  C     . VAL A 1 712 ? -8.213  -26.880 -54.329 1.00 28.91  ? 712  VAL A C     1 
ATOM   5844 O  O     . VAL A 1 712 ? -8.081  -27.732 -53.448 1.00 29.43  ? 712  VAL A O     1 
ATOM   5845 C  CB    . VAL A 1 712 ? -7.901  -24.609 -53.272 1.00 25.84  ? 712  VAL A CB    1 
ATOM   5846 C  CG1   . VAL A 1 712 ? -6.572  -24.533 -53.981 1.00 23.56  ? 712  VAL A CG1   1 
ATOM   5847 C  CG2   . VAL A 1 712 ? -8.491  -23.208 -53.098 1.00 25.22  ? 712  VAL A CG2   1 
ATOM   5848 N  N     . TRP A 1 713 ? -7.785  -27.036 -55.584 1.00 28.15  ? 713  TRP A N     1 
ATOM   5849 C  CA    . TRP A 1 713 ? -7.105  -28.241 -56.055 1.00 29.64  ? 713  TRP A CA    1 
ATOM   5850 C  C     . TRP A 1 713 ? -5.608  -28.015 -56.223 1.00 29.71  ? 713  TRP A C     1 
ATOM   5851 O  O     . TRP A 1 713 ? -4.810  -28.965 -56.158 1.00 28.99  ? 713  TRP A O     1 
ATOM   5852 C  CB    . TRP A 1 713 ? -7.712  -28.714 -57.384 1.00 28.39  ? 713  TRP A CB    1 
ATOM   5853 C  CG    . TRP A 1 713 ? -9.166  -29.057 -57.254 1.00 29.51  ? 713  TRP A CG    1 
ATOM   5854 C  CD1   . TRP A 1 713 ? -10.227 -28.217 -57.448 1.00 28.97  ? 713  TRP A CD1   1 
ATOM   5855 C  CD2   . TRP A 1 713 ? -9.719  -30.322 -56.875 1.00 27.25  ? 713  TRP A CD2   1 
ATOM   5856 N  NE1   . TRP A 1 713 ? -11.405 -28.881 -57.219 1.00 28.44  ? 713  TRP A NE1   1 
ATOM   5857 C  CE2   . TRP A 1 713 ? -11.125 -30.175 -56.863 1.00 28.06  ? 713  TRP A CE2   1 
ATOM   5858 C  CE3   . TRP A 1 713 ? -9.164  -31.567 -56.543 1.00 29.96  ? 713  TRP A CE3   1 
ATOM   5859 C  CZ2   . TRP A 1 713 ? -11.992 -31.229 -56.538 1.00 26.97  ? 713  TRP A CZ2   1 
ATOM   5860 C  CZ3   . TRP A 1 713 ? -10.025 -32.618 -56.220 1.00 32.86  ? 713  TRP A CZ3   1 
ATOM   5861 C  CH2   . TRP A 1 713 ? -11.427 -32.440 -56.225 1.00 31.07  ? 713  TRP A CH2   1 
ATOM   5862 N  N     . ASP A 1 714 ? -5.241  -26.755 -56.447 1.00 28.88  ? 714  ASP A N     1 
ATOM   5863 C  CA    . ASP A 1 714 ? -3.863  -26.381 -56.691 1.00 30.10  ? 714  ASP A CA    1 
ATOM   5864 C  C     . ASP A 1 714 ? -3.583  -24.969 -56.169 1.00 31.29  ? 714  ASP A C     1 
ATOM   5865 O  O     . ASP A 1 714 ? -4.249  -24.001 -56.550 1.00 30.78  ? 714  ASP A O     1 
ATOM   5866 C  CB    . ASP A 1 714 ? -3.524  -26.516 -58.183 1.00 29.22  ? 714  ASP A CB    1 
ATOM   5867 C  CG    . ASP A 1 714 ? -2.023  -26.483 -58.454 1.00 31.98  ? 714  ASP A CG    1 
ATOM   5868 O  OD1   . ASP A 1 714 ? -1.388  -25.433 -58.227 1.00 31.66  ? 714  ASP A OD1   1 
ATOM   5869 O  OD2   . ASP A 1 714 ? -1.479  -27.504 -58.913 1.00 32.77  ? 714  ASP A OD2   1 
ATOM   5870 N  N     . MET A 1 715 ? -2.597  -24.879 -55.284 1.00 30.71  ? 715  MET A N     1 
ATOM   5871 C  CA    . MET A 1 715 ? -2.195  -23.622 -54.675 1.00 32.82  ? 715  MET A CA    1 
ATOM   5872 C  C     . MET A 1 715 ? -0.716  -23.377 -54.954 1.00 34.06  ? 715  MET A C     1 
ATOM   5873 O  O     . MET A 1 715 ? 0.143   -24.151 -54.520 1.00 33.46  ? 715  MET A O     1 
ATOM   5874 C  CB    . MET A 1 715 ? -2.466  -23.645 -53.164 1.00 33.88  ? 715  MET A CB    1 
ATOM   5875 C  CG    . MET A 1 715 ? -2.148  -22.343 -52.443 1.00 36.48  ? 715  MET A CG    1 
ATOM   5876 S  SD    . MET A 1 715 ? -3.102  -20.944 -53.074 1.00 44.95  ? 715  MET A SD    1 
ATOM   5877 C  CE    . MET A 1 715 ? -4.634  -21.143 -52.177 1.00 41.88  ? 715  MET A CE    1 
ATOM   5878 N  N     . GLU A 1 716 ? -0.444  -22.292 -55.682 1.00 33.93  ? 716  GLU A N     1 
ATOM   5879 C  CA    . GLU A 1 716 ? 0.899   -21.908 -56.154 1.00 36.28  ? 716  GLU A CA    1 
ATOM   5880 C  C     . GLU A 1 716 ? 1.848   -23.072 -56.498 1.00 34.35  ? 716  GLU A C     1 
ATOM   5881 O  O     . GLU A 1 716 ? 2.995   -23.116 -56.051 1.00 34.53  ? 716  GLU A O     1 
ATOM   5882 C  CB    . GLU A 1 716 ? 1.555   -20.865 -55.223 1.00 36.93  ? 716  GLU A CB    1 
ATOM   5883 C  CG    . GLU A 1 716 ? 1.718   -21.289 -53.775 1.00 41.46  ? 716  GLU A CG    1 
ATOM   5884 C  CD    . GLU A 1 716 ? 1.835   -20.112 -52.796 1.00 44.83  ? 716  GLU A CD    1 
ATOM   5885 O  OE1   . GLU A 1 716 ? 1.458   -20.305 -51.618 1.00 42.59  ? 716  GLU A OE1   1 
ATOM   5886 O  OE2   . GLU A 1 716 ? 2.297   -19.013 -53.192 1.00 45.98  ? 716  GLU A OE2   1 
ATOM   5887 N  N     . GLY A 1 717 ? 1.354   -24.002 -57.308 1.00 32.11  ? 717  GLY A N     1 
ATOM   5888 C  CA    . GLY A 1 717 ? 2.176   -25.093 -57.808 1.00 30.75  ? 717  GLY A CA    1 
ATOM   5889 C  C     . GLY A 1 717 ? 2.077   -26.379 -57.014 1.00 29.73  ? 717  GLY A C     1 
ATOM   5890 O  O     . GLY A 1 717 ? 2.604   -27.406 -57.443 1.00 29.77  ? 717  GLY A O     1 
ATOM   5891 N  N     . THR A 1 718 ? 1.417   -26.327 -55.857 1.00 28.44  ? 718  THR A N     1 
ATOM   5892 C  CA    . THR A 1 718 ? 1.167   -27.525 -55.060 1.00 28.55  ? 718  THR A CA    1 
ATOM   5893 C  C     . THR A 1 718 ? -0.146  -28.161 -55.504 1.00 30.07  ? 718  THR A C     1 
ATOM   5894 O  O     . THR A 1 718 ? -1.219  -27.604 -55.285 1.00 30.91  ? 718  THR A O     1 
ATOM   5895 C  CB    . THR A 1 718 ? 1.114   -27.229 -53.534 1.00 29.22  ? 718  THR A CB    1 
ATOM   5896 O  OG1   . THR A 1 718 ? 2.312   -26.560 -53.125 1.00 30.74  ? 718  THR A OG1   1 
ATOM   5897 C  CG2   . THR A 1 718 ? 0.967   -28.529 -52.724 1.00 25.55  ? 718  THR A CG2   1 
ATOM   5898 N  N     . ARG A 1 719 ? -0.050  -29.319 -56.142 1.00 29.76  ? 719  ARG A N     1 
ATOM   5899 C  CA    . ARG A 1 719 ? -1.220  -30.091 -56.520 1.00 33.11  ? 719  ARG A CA    1 
ATOM   5900 C  C     . ARG A 1 719 ? -1.556  -31.012 -55.355 1.00 33.76  ? 719  ARG A C     1 
ATOM   5901 O  O     . ARG A 1 719 ? -0.790  -31.927 -55.050 1.00 36.68  ? 719  ARG A O     1 
ATOM   5902 C  CB    . ARG A 1 719 ? -0.935  -30.903 -57.797 1.00 33.77  ? 719  ARG A CB    1 
ATOM   5903 C  CG    . ARG A 1 719 ? -2.151  -31.608 -58.398 1.00 33.59  ? 719  ARG A CG    1 
ATOM   5904 C  CD    . ARG A 1 719 ? -3.180  -30.602 -58.944 1.00 35.14  ? 719  ARG A CD    1 
ATOM   5905 N  NE    . ARG A 1 719 ? -2.589  -29.699 -59.927 1.00 32.48  ? 719  ARG A NE    1 
ATOM   5906 C  CZ    . ARG A 1 719 ? -2.534  -29.941 -61.235 1.00 35.81  ? 719  ARG A CZ    1 
ATOM   5907 N  NH1   . ARG A 1 719 ? -3.045  -31.063 -61.734 1.00 34.83  ? 719  ARG A NH1   1 
ATOM   5908 N  NH2   . ARG A 1 719 ? -1.971  -29.055 -62.045 1.00 31.57  ? 719  ARG A NH2   1 
ATOM   5909 N  N     . TYR A 1 720 ? -2.682  -30.757 -54.691 1.00 33.47  ? 720  TYR A N     1 
ATOM   5910 C  CA    . TYR A 1 720 ? -3.047  -31.501 -53.481 1.00 34.66  ? 720  TYR A CA    1 
ATOM   5911 C  C     . TYR A 1 720 ? -3.513  -32.920 -53.784 1.00 35.41  ? 720  TYR A C     1 
ATOM   5912 O  O     . TYR A 1 720 ? -4.203  -33.148 -54.772 1.00 36.74  ? 720  TYR A O     1 
ATOM   5913 C  CB    . TYR A 1 720 ? -4.159  -30.790 -52.708 1.00 34.17  ? 720  TYR A CB    1 
ATOM   5914 C  CG    . TYR A 1 720 ? -3.829  -29.409 -52.197 1.00 35.06  ? 720  TYR A CG    1 
ATOM   5915 C  CD1   . TYR A 1 720 ? -2.840  -29.209 -51.233 1.00 37.28  ? 720  TYR A CD1   1 
ATOM   5916 C  CD2   . TYR A 1 720 ? -4.536  -28.302 -52.652 1.00 34.75  ? 720  TYR A CD2   1 
ATOM   5917 C  CE1   . TYR A 1 720 ? -2.545  -27.933 -50.762 1.00 36.25  ? 720  TYR A CE1   1 
ATOM   5918 C  CE2   . TYR A 1 720 ? -4.257  -27.027 -52.182 1.00 37.70  ? 720  TYR A CE2   1 
ATOM   5919 C  CZ    . TYR A 1 720 ? -3.264  -26.846 -51.241 1.00 37.90  ? 720  TYR A CZ    1 
ATOM   5920 O  OH    . TYR A 1 720 ? -3.000  -25.574 -50.782 1.00 38.24  ? 720  TYR A OH    1 
ATOM   5921 N  N     . ALA A 1 721 ? -3.134  -33.865 -52.927 1.00 34.73  ? 721  ALA A N     1 
ATOM   5922 C  CA    . ALA A 1 721 ? -3.655  -35.226 -53.009 1.00 37.49  ? 721  ALA A CA    1 
ATOM   5923 C  C     . ALA A 1 721 ? -5.166  -35.217 -52.739 1.00 38.58  ? 721  ALA A C     1 
ATOM   5924 O  O     . ALA A 1 721 ? -5.924  -35.941 -53.389 1.00 39.17  ? 721  ALA A O     1 
ATOM   5925 C  CB    . ALA A 1 721 ? -2.929  -36.143 -52.020 1.00 36.80  ? 721  ALA A CB    1 
ATOM   5926 N  N     . GLU A 1 722 ? -5.581  -34.392 -51.777 1.00 37.19  ? 722  GLU A N     1 
ATOM   5927 C  CA    . GLU A 1 722 ? -6.994  -34.180 -51.458 1.00 38.62  ? 722  GLU A CA    1 
ATOM   5928 C  C     . GLU A 1 722 ? -7.314  -32.690 -51.556 1.00 36.31  ? 722  GLU A C     1 
ATOM   5929 O  O     . GLU A 1 722 ? -6.521  -31.862 -51.096 1.00 35.04  ? 722  GLU A O     1 
ATOM   5930 C  CB    . GLU A 1 722 ? -7.323  -34.674 -50.043 1.00 39.56  ? 722  GLU A CB    1 
ATOM   5931 C  CG    . GLU A 1 722 ? -7.038  -36.149 -49.791 1.00 46.21  ? 722  GLU A CG    1 
ATOM   5932 C  CD    . GLU A 1 722 ? -7.994  -37.075 -50.523 1.00 53.11  ? 722  GLU A CD    1 
ATOM   5933 O  OE1   . GLU A 1 722 ? -9.167  -36.691 -50.720 1.00 56.69  ? 722  GLU A OE1   1 
ATOM   5934 O  OE2   . GLU A 1 722 ? -7.570  -38.192 -50.897 1.00 58.12  ? 722  GLU A OE2   1 
ATOM   5935 N  N     . PRO A 1 723 ? -8.477  -32.339 -52.138 1.00 33.43  ? 723  PRO A N     1 
ATOM   5936 C  CA    . PRO A 1 723 ? -8.853  -30.924 -52.239 1.00 31.56  ? 723  PRO A CA    1 
ATOM   5937 C  C     . PRO A 1 723 ? -8.838  -30.251 -50.870 1.00 32.19  ? 723  PRO A C     1 
ATOM   5938 O  O     . PRO A 1 723 ? -9.132  -30.893 -49.859 1.00 30.82  ? 723  PRO A O     1 
ATOM   5939 C  CB    . PRO A 1 723 ? -10.281 -30.971 -52.798 1.00 30.73  ? 723  PRO A CB    1 
ATOM   5940 C  CG    . PRO A 1 723 ? -10.758 -32.383 -52.529 1.00 33.16  ? 723  PRO A CG    1 
ATOM   5941 C  CD    . PRO A 1 723 ? -9.537  -33.230 -52.643 1.00 32.76  ? 723  PRO A CD    1 
ATOM   5942 N  N     . LYS A 1 724 ? -8.490  -28.969 -50.842 1.00 33.19  ? 724  LYS A N     1 
ATOM   5943 C  CA    . LYS A 1 724 ? -8.324  -28.247 -49.589 1.00 35.81  ? 724  LYS A CA    1 
ATOM   5944 C  C     . LYS A 1 724 ? -9.178  -26.983 -49.588 1.00 35.26  ? 724  LYS A C     1 
ATOM   5945 O  O     . LYS A 1 724 ? -9.229  -26.254 -50.585 1.00 34.94  ? 724  LYS A O     1 
ATOM   5946 C  CB    . LYS A 1 724 ? -6.841  -27.917 -49.373 1.00 36.75  ? 724  LYS A CB    1 
ATOM   5947 C  CG    . LYS A 1 724 ? -6.509  -27.185 -48.076 1.00 45.72  ? 724  LYS A CG    1 
ATOM   5948 C  CD    . LYS A 1 724 ? -4.998  -27.199 -47.790 1.00 52.14  ? 724  LYS A CD    1 
ATOM   5949 C  CE    . LYS A 1 724 ? -4.560  -26.035 -46.893 1.00 56.43  ? 724  LYS A CE    1 
ATOM   5950 N  NZ    . LYS A 1 724 ? -5.191  -26.056 -45.539 1.00 57.92  ? 724  LYS A NZ    1 
ATOM   5951 N  N     . LEU A 1 725 ? -9.847  -26.728 -48.468 1.00 32.57  ? 725  LEU A N     1 
ATOM   5952 C  CA    . LEU A 1 725 ? -10.710 -25.560 -48.356 1.00 31.47  ? 725  LEU A CA    1 
ATOM   5953 C  C     . LEU A 1 725 ? -9.914  -24.299 -48.063 1.00 30.40  ? 725  LEU A C     1 
ATOM   5954 O  O     . LEU A 1 725 ? -9.192  -24.219 -47.071 1.00 30.25  ? 725  LEU A O     1 
ATOM   5955 C  CB    . LEU A 1 725 ? -11.792 -25.771 -47.288 1.00 30.29  ? 725  LEU A CB    1 
ATOM   5956 C  CG    . LEU A 1 725 ? -12.695 -27.002 -47.461 1.00 30.11  ? 725  LEU A CG    1 
ATOM   5957 C  CD1   . LEU A 1 725 ? -13.719 -27.109 -46.336 1.00 30.47  ? 725  LEU A CD1   1 
ATOM   5958 C  CD2   . LEU A 1 725 ? -13.385 -26.998 -48.817 1.00 27.63  ? 725  LEU A CD2   1 
ATOM   5959 N  N     . LYS A 1 726 ? -10.025 -23.321 -48.951 1.00 29.12  ? 726  LYS A N     1 
ATOM   5960 C  CA    . LYS A 1 726 ? -9.535  -22.001 -48.630 1.00 29.29  ? 726  LYS A CA    1 
ATOM   5961 C  C     . LYS A 1 726 ? -10.727 -21.182 -48.148 1.00 27.60  ? 726  LYS A C     1 
ATOM   5962 O  O     . LYS A 1 726 ? -11.615 -20.830 -48.935 1.00 28.04  ? 726  LYS A O     1 
ATOM   5963 C  CB    . LYS A 1 726 ? -8.849  -21.332 -49.819 1.00 28.24  ? 726  LYS A CB    1 
ATOM   5964 C  CG    . LYS A 1 726 ? -8.058  -20.104 -49.384 1.00 32.39  ? 726  LYS A CG    1 
ATOM   5965 C  CD    . LYS A 1 726 ? -7.864  -19.080 -50.487 1.00 34.20  ? 726  LYS A CD    1 
ATOM   5966 C  CE    . LYS A 1 726 ? -7.083  -17.884 -49.942 1.00 37.60  ? 726  LYS A CE    1 
ATOM   5967 N  NZ    . LYS A 1 726 ? -7.002  -16.750 -50.900 1.00 38.67  ? 726  LYS A NZ    1 
ATOM   5968 N  N     . ILE A 1 727 ? -10.753 -20.910 -46.848 1.00 24.49  ? 727  ILE A N     1 
ATOM   5969 C  CA    . ILE A 1 727 ? -11.831 -20.138 -46.248 1.00 22.69  ? 727  ILE A CA    1 
ATOM   5970 C  C     . ILE A 1 727 ? -11.250 -18.880 -45.634 1.00 23.60  ? 727  ILE A C     1 
ATOM   5971 O  O     . ILE A 1 727 ? -10.319 -18.955 -44.835 1.00 25.47  ? 727  ILE A O     1 
ATOM   5972 C  CB    . ILE A 1 727 ? -12.578 -20.936 -45.169 1.00 21.32  ? 727  ILE A CB    1 
ATOM   5973 C  CG1   . ILE A 1 727 ? -13.068 -22.284 -45.725 1.00 21.01  ? 727  ILE A CG1   1 
ATOM   5974 C  CG2   . ILE A 1 727 ? -13.748 -20.115 -44.621 1.00 20.39  ? 727  ILE A CG2   1 
ATOM   5975 C  CD1   . ILE A 1 727 ? -13.610 -23.233 -44.662 1.00 17.60  ? 727  ILE A CD1   1 
ATOM   5976 N  N     . MET A 1 728 ? -11.793 -17.727 -46.008 1.00 23.68  ? 728  MET A N     1 
ATOM   5977 C  CA    . MET A 1 728 ? -11.357 -16.463 -45.417 1.00 24.90  ? 728  MET A CA    1 
ATOM   5978 C  C     . MET A 1 728 ? -12.520 -15.674 -44.831 1.00 24.91  ? 728  MET A C     1 
ATOM   5979 O  O     . MET A 1 728 ? -13.578 -15.542 -45.457 1.00 25.14  ? 728  MET A O     1 
ATOM   5980 C  CB    . MET A 1 728 ? -10.611 -15.585 -46.440 1.00 27.11  ? 728  MET A CB    1 
ATOM   5981 C  CG    . MET A 1 728 ? -9.389  -16.224 -47.108 1.00 34.18  ? 728  MET A CG    1 
ATOM   5982 S  SD    . MET A 1 728 ? -8.129  -16.906 -45.998 1.00 45.59  ? 728  MET A SD    1 
ATOM   5983 C  CE    . MET A 1 728 ? -7.728  -15.497 -45.000 1.00 32.97  ? 728  MET A CE    1 
ATOM   5984 N  N     . GLY A 1 729 ? -12.313 -15.145 -43.630 1.00 24.75  ? 729  GLY A N     1 
ATOM   5985 C  CA    . GLY A 1 729 ? -13.256 -14.213 -43.018 1.00 24.18  ? 729  GLY A CA    1 
ATOM   5986 C  C     . GLY A 1 729 ? -14.416 -14.865 -42.306 1.00 25.13  ? 729  GLY A C     1 
ATOM   5987 O  O     . GLY A 1 729 ? -14.914 -14.332 -41.321 1.00 25.87  ? 729  GLY A O     1 
ATOM   5988 N  N     . LEU A 1 730 ? -14.843 -16.023 -42.800 1.00 24.75  ? 730  LEU A N     1 
ATOM   5989 C  CA    . LEU A 1 730 ? -15.992 -16.722 -42.242 1.00 24.80  ? 730  LEU A CA    1 
ATOM   5990 C  C     . LEU A 1 730 ? -15.710 -17.240 -40.838 1.00 26.56  ? 730  LEU A C     1 
ATOM   5991 O  O     . LEU A 1 730 ? -14.549 -17.365 -40.419 1.00 25.41  ? 730  LEU A O     1 
ATOM   5992 C  CB    . LEU A 1 730 ? -16.439 -17.877 -43.154 1.00 25.55  ? 730  LEU A CB    1 
ATOM   5993 C  CG    . LEU A 1 730 ? -16.623 -17.580 -44.646 1.00 22.96  ? 730  LEU A CG    1 
ATOM   5994 C  CD1   . LEU A 1 730 ? -17.188 -18.810 -45.335 1.00 17.89  ? 730  LEU A CD1   1 
ATOM   5995 C  CD2   . LEU A 1 730 ? -17.500 -16.351 -44.883 1.00 21.11  ? 730  LEU A CD2   1 
ATOM   5996 N  N     . GLU A 1 731 ? -16.792 -17.552 -40.131 1.00 25.98  ? 731  GLU A N     1 
ATOM   5997 C  CA    . GLU A 1 731 ? -16.756 -17.882 -38.722 1.00 26.01  ? 731  GLU A CA    1 
ATOM   5998 C  C     . GLU A 1 731 ? -15.862 -19.077 -38.387 1.00 26.65  ? 731  GLU A C     1 
ATOM   5999 O  O     . GLU A 1 731 ? -15.349 -19.177 -37.277 1.00 28.40  ? 731  GLU A O     1 
ATOM   6000 C  CB    . GLU A 1 731 ? -18.179 -18.083 -38.209 1.00 25.70  ? 731  GLU A CB    1 
ATOM   6001 C  CG    . GLU A 1 731 ? -18.892 -16.773 -37.874 1.00 32.04  ? 731  GLU A CG    1 
ATOM   6002 C  CD    . GLU A 1 731 ? -19.477 -16.025 -39.086 1.00 34.66  ? 731  GLU A CD    1 
ATOM   6003 O  OE1   . GLU A 1 731 ? -19.247 -16.428 -40.258 1.00 29.35  ? 731  GLU A OE1   1 
ATOM   6004 O  OE2   . GLU A 1 731 ? -20.184 -15.018 -38.848 1.00 34.06  ? 731  GLU A OE2   1 
ATOM   6005 N  N     . THR A 1 732 ? -15.665 -19.966 -39.353 1.00 24.65  ? 732  THR A N     1 
ATOM   6006 C  CA    . THR A 1 732 ? -14.736 -21.076 -39.198 1.00 25.43  ? 732  THR A CA    1 
ATOM   6007 C  C     . THR A 1 732 ? -13.318 -20.612 -38.863 1.00 26.10  ? 732  THR A C     1 
ATOM   6008 O  O     . THR A 1 732 ? -12.545 -21.374 -38.290 1.00 27.71  ? 732  THR A O     1 
ATOM   6009 C  CB    . THR A 1 732 ? -14.655 -21.905 -40.490 1.00 25.60  ? 732  THR A CB    1 
ATOM   6010 O  OG1   . THR A 1 732 ? -14.432 -21.022 -41.596 1.00 25.11  ? 732  THR A OG1   1 
ATOM   6011 C  CG2   . THR A 1 732 ? -15.928 -22.663 -40.716 1.00 23.26  ? 732  THR A CG2   1 
ATOM   6012 N  N     . GLN A 1 733 ? -12.988 -19.369 -39.219 1.00 25.75  ? 733  GLN A N     1 
ATOM   6013 C  CA    . GLN A 1 733 ? -11.611 -18.854 -39.140 1.00 25.20  ? 733  GLN A CA    1 
ATOM   6014 C  C     . GLN A 1 733 ? -11.362 -17.995 -37.908 1.00 25.77  ? 733  GLN A C     1 
ATOM   6015 O  O     . GLN A 1 733 ? -10.227 -17.622 -37.626 1.00 26.12  ? 733  GLN A O     1 
ATOM   6016 C  CB    . GLN A 1 733 ? -11.250 -18.054 -40.406 1.00 24.83  ? 733  GLN A CB    1 
ATOM   6017 C  CG    . GLN A 1 733 ? -11.533 -18.776 -41.739 1.00 22.85  ? 733  GLN A CG    1 
ATOM   6018 C  CD    . GLN A 1 733 ? -10.984 -20.191 -41.763 1.00 27.60  ? 733  GLN A CD    1 
ATOM   6019 O  OE1   . GLN A 1 733 ? -11.743 -21.164 -41.700 1.00 27.64  ? 733  GLN A OE1   1 
ATOM   6020 N  NE2   . GLN A 1 733 ? -9.656  -20.316 -41.826 1.00 24.52  ? 733  GLN A NE2   1 
ATOM   6021 N  N     . LYS A 1 734 ? -12.421 -17.688 -37.172 1.00 26.69  ? 734  LYS A N     1 
ATOM   6022 C  CA    . LYS A 1 734 ? -12.318 -16.780 -36.035 1.00 28.70  ? 734  LYS A CA    1 
ATOM   6023 C  C     . LYS A 1 734 ? -12.074 -17.528 -34.729 1.00 28.19  ? 734  LYS A C     1 
ATOM   6024 O  O     . LYS A 1 734 ? -12.758 -18.503 -34.433 1.00 29.96  ? 734  LYS A O     1 
ATOM   6025 C  CB    . LYS A 1 734 ? -13.586 -15.943 -35.929 1.00 30.18  ? 734  LYS A CB    1 
ATOM   6026 C  CG    . LYS A 1 734 ? -13.725 -14.889 -37.016 1.00 36.43  ? 734  LYS A CG    1 
ATOM   6027 C  CD    . LYS A 1 734 ? -15.171 -14.382 -37.135 1.00 44.71  ? 734  LYS A CD    1 
ATOM   6028 C  CE    . LYS A 1 734 ? -15.580 -13.446 -35.998 1.00 48.06  ? 734  LYS A CE    1 
ATOM   6029 N  NZ    . LYS A 1 734 ? -14.957 -12.093 -36.121 1.00 53.79  ? 734  LYS A NZ    1 
ATOM   6030 N  N     . SER A 1 735 ? -11.107 -17.060 -33.944 1.00 28.26  ? 735  SER A N     1 
ATOM   6031 C  CA    . SER A 1 735 ? -10.792 -17.675 -32.652 1.00 27.98  ? 735  SER A CA    1 
ATOM   6032 C  C     . SER A 1 735 ? -11.921 -17.511 -31.637 1.00 28.92  ? 735  SER A C     1 
ATOM   6033 O  O     . SER A 1 735 ? -11.963 -18.210 -30.626 1.00 28.99  ? 735  SER A O     1 
ATOM   6034 C  CB    . SER A 1 735 ? -9.486  -17.125 -32.087 1.00 27.62  ? 735  SER A CB    1 
ATOM   6035 O  OG    . SER A 1 735 ? -9.592  -15.740 -31.822 1.00 25.78  ? 735  SER A OG    1 
ATOM   6036 N  N     . SER A 1 736 ? -12.834 -16.589 -31.928 1.00 27.51  ? 736  SER A N     1 
ATOM   6037 C  CA    . SER A 1 736 ? -13.984 -16.308 -31.075 1.00 27.46  ? 736  SER A CA    1 
ATOM   6038 C  C     . SER A 1 736 ? -15.150 -17.287 -31.265 1.00 24.98  ? 736  SER A C     1 
ATOM   6039 O  O     . SER A 1 736 ? -16.040 -17.365 -30.426 1.00 29.02  ? 736  SER A O     1 
ATOM   6040 C  CB    . SER A 1 736 ? -14.469 -14.889 -31.341 1.00 25.76  ? 736  SER A CB    1 
ATOM   6041 O  OG    . SER A 1 736 ? -14.705 -14.729 -32.720 1.00 26.41  ? 736  SER A OG    1 
ATOM   6042 N  N     . THR A 1 737 ? -15.147 -18.011 -32.375 1.00 22.59  ? 737  THR A N     1 
ATOM   6043 C  CA    . THR A 1 737 ? -16.164 -19.001 -32.664 1.00 22.46  ? 737  THR A CA    1 
ATOM   6044 C  C     . THR A 1 737 ? -15.857 -20.296 -31.899 1.00 25.00  ? 737  THR A C     1 
ATOM   6045 O  O     . THR A 1 737 ? -14.720 -20.768 -31.923 1.00 25.17  ? 737  THR A O     1 
ATOM   6046 C  CB    . THR A 1 737 ? -16.182 -19.294 -34.167 1.00 23.18  ? 737  THR A CB    1 
ATOM   6047 O  OG1   . THR A 1 737 ? -16.494 -18.092 -34.879 1.00 24.16  ? 737  THR A OG1   1 
ATOM   6048 C  CG2   . THR A 1 737 ? -17.189 -20.371 -34.524 1.00 20.06  ? 737  THR A CG2   1 
ATOM   6049 N  N     . PRO A 1 738 ? -16.871 -20.880 -31.223 1.00 20.55  ? 738  PRO A N     1 
ATOM   6050 C  CA    . PRO A 1 738 ? -16.663 -22.127 -30.482 1.00 21.93  ? 738  PRO A CA    1 
ATOM   6051 C  C     . PRO A 1 738 ? -16.016 -23.213 -31.340 1.00 22.21  ? 738  PRO A C     1 
ATOM   6052 O  O     . PRO A 1 738 ? -16.303 -23.321 -32.526 1.00 21.98  ? 738  PRO A O     1 
ATOM   6053 C  CB    . PRO A 1 738 ? -18.083 -22.528 -30.072 1.00 23.42  ? 738  PRO A CB    1 
ATOM   6054 C  CG    . PRO A 1 738 ? -18.808 -21.222 -29.953 1.00 21.10  ? 738  PRO A CG    1 
ATOM   6055 C  CD    . PRO A 1 738 ? -18.260 -20.395 -31.091 1.00 19.52  ? 738  PRO A CD    1 
ATOM   6056 N  N     . LYS A 1 739 ? -15.132 -23.997 -30.739 1.00 26.27  ? 739  LYS A N     1 
ATOM   6057 C  CA    . LYS A 1 739 ? -14.414 -25.041 -31.467 1.00 31.01  ? 739  LYS A CA    1 
ATOM   6058 C  C     . LYS A 1 739 ? -15.325 -26.005 -32.229 1.00 30.35  ? 739  LYS A C     1 
ATOM   6059 O  O     . LYS A 1 739 ? -15.074 -26.308 -33.398 1.00 30.24  ? 739  LYS A O     1 
ATOM   6060 C  CB    . LYS A 1 739 ? -13.461 -25.798 -30.530 1.00 33.78  ? 739  LYS A CB    1 
ATOM   6061 C  CG    . LYS A 1 739 ? -12.115 -25.109 -30.373 1.00 39.60  ? 739  LYS A CG    1 
ATOM   6062 C  CD    . LYS A 1 739 ? -11.322 -25.147 -31.684 1.00 46.13  ? 739  LYS A CD    1 
ATOM   6063 C  CE    . LYS A 1 739 ? -10.220 -24.094 -31.714 1.00 50.98  ? 739  LYS A CE    1 
ATOM   6064 N  NZ    . LYS A 1 739 ? -9.108  -24.415 -30.764 1.00 53.32  ? 739  LYS A NZ    1 
ATOM   6065 N  N     . ALA A 1 740 ? -16.384 -26.467 -31.570 1.00 29.57  ? 740  ALA A N     1 
ATOM   6066 C  CA    . ALA A 1 740 ? -17.306 -27.426 -32.173 1.00 30.92  ? 740  ALA A CA    1 
ATOM   6067 C  C     . ALA A 1 740 ? -18.104 -26.791 -33.305 1.00 28.91  ? 740  ALA A C     1 
ATOM   6068 O  O     . ALA A 1 740 ? -18.463 -27.458 -34.267 1.00 32.55  ? 740  ALA A O     1 
ATOM   6069 C  CB    . ALA A 1 740 ? -18.234 -28.019 -31.114 1.00 29.60  ? 740  ALA A CB    1 
ATOM   6070 N  N     . VAL A 1 741 ? -18.371 -25.499 -33.173 1.00 27.95  ? 741  VAL A N     1 
ATOM   6071 C  CA    . VAL A 1 741 ? -19.041 -24.720 -34.200 1.00 25.65  ? 741  VAL A CA    1 
ATOM   6072 C  C     . VAL A 1 741 ? -18.134 -24.463 -35.410 1.00 25.80  ? 741  VAL A C     1 
ATOM   6073 O  O     . VAL A 1 741 ? -18.600 -24.518 -36.551 1.00 24.80  ? 741  VAL A O     1 
ATOM   6074 C  CB    . VAL A 1 741 ? -19.571 -23.379 -33.637 1.00 26.26  ? 741  VAL A CB    1 
ATOM   6075 C  CG1   . VAL A 1 741 ? -20.227 -22.559 -34.738 1.00 21.93  ? 741  VAL A CG1   1 
ATOM   6076 C  CG2   . VAL A 1 741 ? -20.550 -23.640 -32.510 1.00 27.86  ? 741  VAL A CG2   1 
ATOM   6077 N  N     . GLN A 1 742 ? -16.853 -24.184 -35.170 1.00 23.42  ? 742  GLN A N     1 
ATOM   6078 C  CA    . GLN A 1 742 ? -15.900 -24.052 -36.270 1.00 24.95  ? 742  GLN A CA    1 
ATOM   6079 C  C     . GLN A 1 742 ? -15.902 -25.332 -37.102 1.00 25.63  ? 742  GLN A C     1 
ATOM   6080 O  O     . GLN A 1 742 ? -15.964 -25.285 -38.332 1.00 25.41  ? 742  GLN A O     1 
ATOM   6081 C  CB    . GLN A 1 742 ? -14.475 -23.795 -35.772 1.00 26.11  ? 742  GLN A CB    1 
ATOM   6082 C  CG    . GLN A 1 742 ? -14.249 -22.517 -34.974 1.00 25.93  ? 742  GLN A CG    1 
ATOM   6083 C  CD    . GLN A 1 742 ? -12.810 -22.407 -34.503 1.00 25.52  ? 742  GLN A CD    1 
ATOM   6084 O  OE1   . GLN A 1 742 ? -12.128 -23.415 -34.329 1.00 26.95  ? 742  GLN A OE1   1 
ATOM   6085 N  NE2   . GLN A 1 742 ? -12.336 -21.184 -34.319 1.00 23.59  ? 742  GLN A NE2   1 
ATOM   6086 N  N     . LYS A 1 743 ? -15.846 -26.466 -36.410 1.00 25.01  ? 743  LYS A N     1 
ATOM   6087 C  CA    . LYS A 1 743 ? -15.761 -27.778 -37.037 1.00 26.98  ? 743  LYS A CA    1 
ATOM   6088 C  C     . LYS A 1 743 ? -17.008 -28.073 -37.876 1.00 27.76  ? 743  LYS A C     1 
ATOM   6089 O  O     . LYS A 1 743 ? -16.897 -28.500 -39.026 1.00 27.60  ? 743  LYS A O     1 
ATOM   6090 C  CB    . LYS A 1 743 ? -15.574 -28.833 -35.947 1.00 28.46  ? 743  LYS A CB    1 
ATOM   6091 C  CG    . LYS A 1 743 ? -15.154 -30.208 -36.410 1.00 33.92  ? 743  LYS A CG    1 
ATOM   6092 C  CD    . LYS A 1 743 ? -14.846 -31.082 -35.189 1.00 38.83  ? 743  LYS A CD    1 
ATOM   6093 C  CE    . LYS A 1 743 ? -15.095 -32.560 -35.460 1.00 41.80  ? 743  LYS A CE    1 
ATOM   6094 N  NZ    . LYS A 1 743 ? -14.179 -33.105 -36.494 1.00 42.61  ? 743  LYS A NZ    1 
ATOM   6095 N  N     . ALA A 1 744 ? -18.183 -27.822 -37.298 1.00 25.12  ? 744  ALA A N     1 
ATOM   6096 C  CA    . ALA A 1 744 ? -19.458 -28.098 -37.960 1.00 25.77  ? 744  ALA A CA    1 
ATOM   6097 C  C     . ALA A 1 744 ? -19.719 -27.198 -39.164 1.00 24.99  ? 744  ALA A C     1 
ATOM   6098 O  O     . ALA A 1 744 ? -20.130 -27.687 -40.227 1.00 25.43  ? 744  ALA A O     1 
ATOM   6099 C  CB    . ALA A 1 744 ? -20.600 -28.006 -36.967 1.00 25.65  ? 744  ALA A CB    1 
ATOM   6100 N  N     . LEU A 1 745 ? -19.469 -25.897 -39.000 1.00 21.32  ? 745  LEU A N     1 
ATOM   6101 C  CA    . LEU A 1 745 ? -19.584 -24.944 -40.101 1.00 22.63  ? 745  LEU A CA    1 
ATOM   6102 C  C     . LEU A 1 745 ? -18.622 -25.301 -41.244 1.00 24.46  ? 745  LEU A C     1 
ATOM   6103 O  O     . LEU A 1 745 ? -18.992 -25.236 -42.418 1.00 28.12  ? 745  LEU A O     1 
ATOM   6104 C  CB    . LEU A 1 745 ? -19.365 -23.497 -39.614 1.00 22.00  ? 745  LEU A CB    1 
ATOM   6105 C  CG    . LEU A 1 745 ? -20.444 -22.804 -38.760 1.00 21.02  ? 745  LEU A CG    1 
ATOM   6106 C  CD1   . LEU A 1 745 ? -19.969 -21.432 -38.293 1.00 18.01  ? 745  LEU A CD1   1 
ATOM   6107 C  CD2   . LEU A 1 745 ? -21.783 -22.678 -39.513 1.00 16.16  ? 745  LEU A CD2   1 
ATOM   6108 N  N     . LYS A 1 746 ? -17.407 -25.714 -40.899 1.00 25.22  ? 746  LYS A N     1 
ATOM   6109 C  CA    . LYS A 1 746 ? -16.436 -26.151 -41.899 1.00 27.30  ? 746  LYS A CA    1 
ATOM   6110 C  C     . LYS A 1 746 ? -16.932 -27.358 -42.700 1.00 28.53  ? 746  LYS A C     1 
ATOM   6111 O  O     . LYS A 1 746 ? -16.750 -27.408 -43.923 1.00 29.49  ? 746  LYS A O     1 
ATOM   6112 C  CB    . LYS A 1 746 ? -15.064 -26.439 -41.278 1.00 29.80  ? 746  LYS A CB    1 
ATOM   6113 C  CG    . LYS A 1 746 ? -13.986 -26.682 -42.333 1.00 28.84  ? 746  LYS A CG    1 
ATOM   6114 C  CD    . LYS A 1 746 ? -12.588 -26.753 -41.767 1.00 31.17  ? 746  LYS A CD    1 
ATOM   6115 C  CE    . LYS A 1 746 ? -11.597 -27.058 -42.894 1.00 36.56  ? 746  LYS A CE    1 
ATOM   6116 N  NZ    . LYS A 1 746 ? -10.191 -26.709 -42.558 1.00 39.23  ? 746  LYS A NZ    1 
ATOM   6117 N  N     . GLU A 1 747 ? -17.566 -28.312 -42.021 1.00 26.03  ? 747  GLU A N     1 
ATOM   6118 C  CA    . GLU A 1 747 ? -18.109 -29.490 -42.700 1.00 27.87  ? 747  GLU A CA    1 
ATOM   6119 C  C     . GLU A 1 747 ? -19.327 -29.121 -43.570 1.00 28.78  ? 747  GLU A C     1 
ATOM   6120 O  O     . GLU A 1 747 ? -19.520 -29.696 -44.635 1.00 30.03  ? 747  GLU A O     1 
ATOM   6121 C  CB    . GLU A 1 747 ? -18.420 -30.615 -41.693 1.00 27.76  ? 747  GLU A CB    1 
ATOM   6122 C  CG    . GLU A 1 747 ? -19.014 -31.900 -42.277 1.00 27.66  ? 747  GLU A CG    1 
ATOM   6123 C  CD    . GLU A 1 747 ? -18.103 -32.626 -43.272 1.00 29.46  ? 747  GLU A CD    1 
ATOM   6124 O  OE1   . GLU A 1 747 ? -18.592 -33.553 -43.950 1.00 33.87  ? 747  GLU A OE1   1 
ATOM   6125 O  OE2   . GLU A 1 747 ? -16.908 -32.285 -43.393 1.00 31.33  ? 747  GLU A OE2   1 
ATOM   6126 N  N     . CYS A 1 748 ? -20.126 -28.154 -43.121 1.00 28.63  ? 748  CYS A N     1 
ATOM   6127 C  CA    . CYS A 1 748 ? -21.242 -27.640 -43.916 1.00 29.56  ? 748  CYS A CA    1 
ATOM   6128 C  C     . CYS A 1 748 ? -20.741 -27.019 -45.223 1.00 28.34  ? 748  CYS A C     1 
ATOM   6129 O  O     . CYS A 1 748 ? -21.243 -27.333 -46.303 1.00 30.30  ? 748  CYS A O     1 
ATOM   6130 C  CB    . CYS A 1 748 ? -22.052 -26.607 -43.121 1.00 29.39  ? 748  CYS A CB    1 
ATOM   6131 S  SG    . CYS A 1 748 ? -23.099 -27.305 -41.817 1.00 32.47  ? 748  CYS A SG    1 
ATOM   6132 N  N     . ILE A 1 749 ? -19.748 -26.141 -45.104 1.00 26.10  ? 749  ILE A N     1 
ATOM   6133 C  CA    . ILE A 1 749 ? -19.059 -25.557 -46.250 1.00 24.29  ? 749  ILE A CA    1 
ATOM   6134 C  C     . ILE A 1 749 ? -18.405 -26.624 -47.130 1.00 24.91  ? 749  ILE A C     1 
ATOM   6135 O  O     . ILE A 1 749 ? -18.509 -26.558 -48.358 1.00 27.52  ? 749  ILE A O     1 
ATOM   6136 C  CB    . ILE A 1 749 ? -17.994 -24.525 -45.803 1.00 23.44  ? 749  ILE A CB    1 
ATOM   6137 C  CG1   . ILE A 1 749 ? -18.662 -23.309 -45.158 1.00 22.35  ? 749  ILE A CG1   1 
ATOM   6138 C  CG2   . ILE A 1 749 ? -17.129 -24.101 -46.976 1.00 22.44  ? 749  ILE A CG2   1 
ATOM   6139 C  CD1   . ILE A 1 749 ? -17.689 -22.383 -44.420 1.00 24.16  ? 749  ILE A CD1   1 
ATOM   6140 N  N     . ARG A 1 750 ? -17.739 -27.602 -46.515 1.00 25.83  ? 750  ARG A N     1 
ATOM   6141 C  CA    . ARG A 1 750 ? -17.151 -28.708 -47.278 1.00 27.44  ? 750  ARG A CA    1 
ATOM   6142 C  C     . ARG A 1 750 ? -18.221 -29.353 -48.155 1.00 27.67  ? 750  ARG A C     1 
ATOM   6143 O  O     . ARG A 1 750 ? -18.056 -29.454 -49.373 1.00 28.89  ? 750  ARG A O     1 
ATOM   6144 C  CB    . ARG A 1 750 ? -16.483 -29.759 -46.371 1.00 27.49  ? 750  ARG A CB    1 
ATOM   6145 C  CG    . ARG A 1 750 ? -15.612 -30.750 -47.163 1.00 26.87  ? 750  ARG A CG    1 
ATOM   6146 C  CD    . ARG A 1 750 ? -15.302 -32.046 -46.406 1.00 30.25  ? 750  ARG A CD    1 
ATOM   6147 N  NE    . ARG A 1 750 ? -16.486 -32.874 -46.161 1.00 30.43  ? 750  ARG A NE    1 
ATOM   6148 C  CZ    . ARG A 1 750 ? -17.096 -33.635 -47.073 1.00 33.62  ? 750  ARG A CZ    1 
ATOM   6149 N  NH1   . ARG A 1 750 ? -16.654 -33.693 -48.329 1.00 28.90  ? 750  ARG A NH1   1 
ATOM   6150 N  NH2   . ARG A 1 750 ? -18.163 -34.344 -46.725 1.00 31.54  ? 750  ARG A NH2   1 
ATOM   6151 N  N     . ARG A 1 751 ? -19.333 -29.738 -47.536 1.00 28.30  ? 751  ARG A N     1 
ATOM   6152 C  CA    . ARG A 1 751 ? -20.448 -30.377 -48.244 1.00 29.92  ? 751  ARG A CA    1 
ATOM   6153 C  C     . ARG A 1 751 ? -21.074 -29.523 -49.348 1.00 29.79  ? 751  ARG A C     1 
ATOM   6154 O  O     . ARG A 1 751 ? -21.345 -30.035 -50.437 1.00 31.81  ? 751  ARG A O     1 
ATOM   6155 C  CB    . ARG A 1 751 ? -21.508 -30.846 -47.248 1.00 30.91  ? 751  ARG A CB    1 
ATOM   6156 C  CG    . ARG A 1 751 ? -21.046 -32.040 -46.436 1.00 30.16  ? 751  ARG A CG    1 
ATOM   6157 C  CD    . ARG A 1 751 ? -21.839 -32.225 -45.159 1.00 30.31  ? 751  ARG A CD    1 
ATOM   6158 N  NE    . ARG A 1 751 ? -21.496 -33.503 -44.535 1.00 30.34  ? 751  ARG A NE    1 
ATOM   6159 C  CZ    . ARG A 1 751 ? -22.206 -34.623 -44.669 1.00 33.09  ? 751  ARG A CZ    1 
ATOM   6160 N  NH1   . ARG A 1 751 ? -23.330 -34.629 -45.382 1.00 31.95  ? 751  ARG A NH1   1 
ATOM   6161 N  NH2   . ARG A 1 751 ? -21.799 -35.739 -44.077 1.00 28.13  ? 751  ARG A NH2   1 
ATOM   6162 N  N     . MET A 1 752 ? -21.297 -28.235 -49.069 1.00 27.39  ? 752  MET A N     1 
ATOM   6163 C  CA    . MET A 1 752 ? -21.774 -27.269 -50.077 1.00 27.28  ? 752  MET A CA    1 
ATOM   6164 C  C     . MET A 1 752 ? -20.881 -27.247 -51.323 1.00 28.73  ? 752  MET A C     1 
ATOM   6165 O  O     . MET A 1 752 ? -21.363 -27.335 -52.451 1.00 29.74  ? 752  MET A O     1 
ATOM   6166 C  CB    . MET A 1 752 ? -21.821 -25.847 -49.490 1.00 26.24  ? 752  MET A CB    1 
ATOM   6167 C  CG    . MET A 1 752 ? -22.971 -25.579 -48.538 1.00 28.47  ? 752  MET A CG    1 
ATOM   6168 S  SD    . MET A 1 752 ? -22.772 -24.062 -47.571 1.00 32.98  ? 752  MET A SD    1 
ATOM   6169 C  CE    . MET A 1 752 ? -23.140 -22.809 -48.789 1.00 26.86  ? 752  MET A CE    1 
ATOM   6170 N  N     . LEU A 1 753 ? -19.575 -27.138 -51.101 1.00 28.86  ? 753  LEU A N     1 
ATOM   6171 C  CA    . LEU A 1 753 ? -18.623 -26.933 -52.186 1.00 29.24  ? 753  LEU A CA    1 
ATOM   6172 C  C     . LEU A 1 753 ? -18.249 -28.221 -52.922 1.00 30.81  ? 753  LEU A C     1 
ATOM   6173 O  O     . LEU A 1 753 ? -17.901 -28.183 -54.106 1.00 33.14  ? 753  LEU A O     1 
ATOM   6174 C  CB    . LEU A 1 753 ? -17.354 -26.238 -51.663 1.00 27.02  ? 753  LEU A CB    1 
ATOM   6175 C  CG    . LEU A 1 753 ? -17.431 -24.971 -50.790 1.00 25.76  ? 753  LEU A CG    1 
ATOM   6176 C  CD1   . LEU A 1 753 ? -16.072 -24.283 -50.711 1.00 24.60  ? 753  LEU A CD1   1 
ATOM   6177 C  CD2   . LEU A 1 753 ? -18.479 -23.987 -51.252 1.00 24.33  ? 753  LEU A CD2   1 
ATOM   6178 N  N     . GLN A 1 754 ? -18.315 -29.352 -52.226 1.00 28.83  ? 754  GLN A N     1 
ATOM   6179 C  CA    . GLN A 1 754 ? -17.833 -30.614 -52.776 1.00 30.03  ? 754  GLN A CA    1 
ATOM   6180 C  C     . GLN A 1 754 ? -18.960 -31.565 -53.163 1.00 33.15  ? 754  GLN A C     1 
ATOM   6181 O  O     . GLN A 1 754 ? -18.799 -32.391 -54.070 1.00 32.60  ? 754  GLN A O     1 
ATOM   6182 C  CB    . GLN A 1 754 ? -16.883 -31.302 -51.793 1.00 30.80  ? 754  GLN A CB    1 
ATOM   6183 C  CG    . GLN A 1 754 ? -15.487 -30.669 -51.702 1.00 31.53  ? 754  GLN A CG    1 
ATOM   6184 C  CD    . GLN A 1 754 ? -14.578 -31.368 -50.697 1.00 32.13  ? 754  GLN A CD    1 
ATOM   6185 O  OE1   . GLN A 1 754 ? -14.814 -32.510 -50.314 1.00 36.78  ? 754  GLN A OE1   1 
ATOM   6186 N  NE2   . GLN A 1 754 ? -13.536 -30.677 -50.265 1.00 30.37  ? 754  GLN A NE2   1 
ATOM   6187 N  N     . GLU A 1 755 ? -20.100 -31.442 -52.487 1.00 33.63  ? 755  GLU A N     1 
ATOM   6188 C  CA    . GLU A 1 755 ? -21.141 -32.462 -52.570 1.00 36.50  ? 755  GLU A CA    1 
ATOM   6189 C  C     . GLU A 1 755 ? -22.520 -31.928 -52.946 1.00 35.98  ? 755  GLU A C     1 
ATOM   6190 O  O     . GLU A 1 755 ? -23.254 -32.591 -53.672 1.00 39.73  ? 755  GLU A O     1 
ATOM   6191 C  CB    . GLU A 1 755 ? -21.181 -33.282 -51.272 1.00 35.52  ? 755  GLU A CB    1 
ATOM   6192 C  CG    . GLU A 1 755 ? -19.957 -34.200 -51.106 1.00 39.24  ? 755  GLU A CG    1 
ATOM   6193 C  CD    . GLU A 1 755 ? -19.835 -34.822 -49.721 1.00 41.09  ? 755  GLU A CD    1 
ATOM   6194 O  OE1   . GLU A 1 755 ? -18.794 -35.457 -49.442 1.00 43.41  ? 755  GLU A OE1   1 
ATOM   6195 O  OE2   . GLU A 1 755 ? -20.773 -34.691 -48.913 1.00 41.05  ? 755  GLU A OE2   1 
ATOM   6196 N  N     . GLY A 1 756 ? -22.876 -30.745 -52.458 1.00 35.20  ? 756  GLY A N     1 
ATOM   6197 C  CA    . GLY A 1 756 ? -24.119 -30.108 -52.882 1.00 35.55  ? 756  GLY A CA    1 
ATOM   6198 C  C     . GLY A 1 756 ? -25.134 -29.866 -51.788 1.00 37.00  ? 756  GLY A C     1 
ATOM   6199 O  O     . GLY A 1 756 ? -24.860 -30.100 -50.602 1.00 36.84  ? 756  GLY A O     1 
ATOM   6200 N  N     . GLU A 1 757 ? -26.314 -29.407 -52.205 1.00 36.76  ? 757  GLU A N     1 
ATOM   6201 C  CA    . GLU A 1 757 ? -27.378 -28.981 -51.300 1.00 36.52  ? 757  GLU A CA    1 
ATOM   6202 C  C     . GLU A 1 757 ? -27.938 -30.117 -50.439 1.00 37.25  ? 757  GLU A C     1 
ATOM   6203 O  O     . GLU A 1 757 ? -28.142 -29.944 -49.232 1.00 34.47  ? 757  GLU A O     1 
ATOM   6204 C  CB    . GLU A 1 757 ? -28.505 -28.311 -52.097 1.00 37.96  ? 757  GLU A CB    1 
ATOM   6205 C  CG    . GLU A 1 757 ? -29.644 -27.736 -51.235 1.00 40.39  ? 757  GLU A CG    1 
ATOM   6206 C  CD    . GLU A 1 757 ? -30.654 -26.932 -52.040 1.00 44.07  ? 757  GLU A CD    1 
ATOM   6207 O  OE1   . GLU A 1 757 ? -31.092 -27.409 -53.109 1.00 48.64  ? 757  GLU A OE1   1 
ATOM   6208 O  OE2   . GLU A 1 757 ? -31.015 -25.824 -51.600 1.00 44.02  ? 757  GLU A OE2   1 
ATOM   6209 N  N     . GLU A 1 758 ? -28.188 -31.270 -51.061 1.00 39.04  ? 758  GLU A N     1 
ATOM   6210 C  CA    . GLU A 1 758 ? -28.765 -32.411 -50.352 1.00 41.38  ? 758  GLU A CA    1 
ATOM   6211 C  C     . GLU A 1 758 ? -27.851 -32.883 -49.217 1.00 39.43  ? 758  GLU A C     1 
ATOM   6212 O  O     . GLU A 1 758 ? -28.316 -33.125 -48.099 1.00 37.66  ? 758  GLU A O     1 
ATOM   6213 C  CB    . GLU A 1 758 ? -29.092 -33.553 -51.324 1.00 46.00  ? 758  GLU A CB    1 
ATOM   6214 C  CG    . GLU A 1 758 ? -29.856 -34.719 -50.696 1.00 54.86  ? 758  GLU A CG    1 
ATOM   6215 C  CD    . GLU A 1 758 ? -30.364 -35.728 -51.718 1.00 63.98  ? 758  GLU A CD    1 
ATOM   6216 O  OE1   . GLU A 1 758 ? -30.372 -36.940 -51.403 1.00 68.55  ? 758  GLU A OE1   1 
ATOM   6217 O  OE2   . GLU A 1 758 ? -30.764 -35.321 -52.832 1.00 68.23  ? 758  GLU A OE2   1 
ATOM   6218 N  N     . SER A 1 759 ? -26.553 -32.981 -49.504 1.00 37.84  ? 759  SER A N     1 
ATOM   6219 C  CA    . SER A 1 759 ? -25.571 -33.430 -48.519 1.00 36.84  ? 759  SER A CA    1 
ATOM   6220 C  C     . SER A 1 759 ? -25.507 -32.489 -47.322 1.00 33.63  ? 759  SER A C     1 
ATOM   6221 O  O     . SER A 1 759 ? -25.384 -32.921 -46.171 1.00 30.63  ? 759  SER A O     1 
ATOM   6222 C  CB    . SER A 1 759 ? -24.193 -33.549 -49.154 1.00 37.12  ? 759  SER A CB    1 
ATOM   6223 O  OG    . SER A 1 759 ? -23.233 -33.889 -48.173 1.00 37.77  ? 759  SER A OG    1 
ATOM   6224 N  N     . LEU A 1 760 ? -25.613 -31.201 -47.619 1.00 32.56  ? 760  LEU A N     1 
ATOM   6225 C  CA    . LEU A 1 760 ? -25.594 -30.148 -46.617 1.00 32.89  ? 760  LEU A CA    1 
ATOM   6226 C  C     . LEU A 1 760 ? -26.801 -30.232 -45.671 1.00 32.76  ? 760  LEU A C     1 
ATOM   6227 O  O     . LEU A 1 760 ? -26.658 -30.037 -44.460 1.00 31.72  ? 760  LEU A O     1 
ATOM   6228 C  CB    . LEU A 1 760 ? -25.491 -28.786 -47.321 1.00 31.23  ? 760  LEU A CB    1 
ATOM   6229 C  CG    . LEU A 1 760 ? -25.510 -27.408 -46.639 1.00 32.33  ? 760  LEU A CG    1 
ATOM   6230 C  CD1   . LEU A 1 760 ? -26.861 -26.768 -46.775 1.00 31.81  ? 760  LEU A CD1   1 
ATOM   6231 C  CD2   . LEU A 1 760 ? -25.038 -27.392 -45.192 1.00 29.62  ? 760  LEU A CD2   1 
ATOM   6232 N  N     . GLN A 1 761 ? -27.974 -30.545 -46.219 1.00 33.74  ? 761  GLN A N     1 
ATOM   6233 C  CA    . GLN A 1 761 ? -29.197 -30.674 -45.417 1.00 34.70  ? 761  GLN A CA    1 
ATOM   6234 C  C     . GLN A 1 761 ? -29.171 -31.891 -44.493 1.00 36.55  ? 761  GLN A C     1 
ATOM   6235 O  O     . GLN A 1 761 ? -29.685 -31.824 -43.374 1.00 38.02  ? 761  GLN A O     1 
ATOM   6236 C  CB    . GLN A 1 761 ? -30.439 -30.725 -46.306 1.00 35.83  ? 761  GLN A CB    1 
ATOM   6237 C  CG    . GLN A 1 761 ? -30.724 -29.444 -47.075 1.00 33.97  ? 761  GLN A CG    1 
ATOM   6238 C  CD    . GLN A 1 761 ? -31.655 -29.677 -48.259 1.00 35.33  ? 761  GLN A CD    1 
ATOM   6239 O  OE1   . GLN A 1 761 ? -31.988 -28.750 -48.998 1.00 35.17  ? 761  GLN A OE1   1 
ATOM   6240 N  NE2   . GLN A 1 761 ? -32.075 -30.918 -48.442 1.00 32.89  ? 761  GLN A NE2   1 
ATOM   6241 N  N     . GLU A 1 762 ? -28.582 -32.991 -44.966 1.00 36.83  ? 762  GLU A N     1 
ATOM   6242 C  CA    . GLU A 1 762 ? -28.335 -34.178 -44.138 1.00 40.54  ? 762  GLU A CA    1 
ATOM   6243 C  C     . GLU A 1 762 ? -27.497 -33.847 -42.904 1.00 38.98  ? 762  GLU A C     1 
ATOM   6244 O  O     . GLU A 1 762 ? -27.846 -34.221 -41.777 1.00 37.63  ? 762  GLU A O     1 
ATOM   6245 C  CB    . GLU A 1 762 ? -27.596 -35.246 -44.942 1.00 43.53  ? 762  GLU A CB    1 
ATOM   6246 C  CG    . GLU A 1 762 ? -28.418 -36.450 -45.336 1.00 52.83  ? 762  GLU A CG    1 
ATOM   6247 C  CD    . GLU A 1 762 ? -27.546 -37.654 -45.684 1.00 60.02  ? 762  GLU A CD    1 
ATOM   6248 O  OE1   . GLU A 1 762 ? -26.301 -37.558 -45.551 1.00 61.29  ? 762  GLU A OE1   1 
ATOM   6249 O  OE2   . GLU A 1 762 ? -28.106 -38.699 -46.085 1.00 63.58  ? 762  GLU A OE2   1 
ATOM   6250 N  N     . TYR A 1 763 ? -26.392 -33.142 -43.125 1.00 37.60  ? 763  TYR A N     1 
ATOM   6251 C  CA    . TYR A 1 763 ? -25.479 -32.821 -42.042 1.00 36.95  ? 763  TYR A CA    1 
ATOM   6252 C  C     . TYR A 1 763 ? -26.091 -31.870 -41.031 1.00 36.59  ? 763  TYR A C     1 
ATOM   6253 O  O     . TYR A 1 763 ? -25.971 -32.100 -39.829 1.00 35.97  ? 763  TYR A O     1 
ATOM   6254 C  CB    . TYR A 1 763 ? -24.150 -32.266 -42.556 1.00 36.32  ? 763  TYR A CB    1 
ATOM   6255 C  CG    . TYR A 1 763 ? -23.089 -32.278 -41.482 1.00 36.84  ? 763  TYR A CG    1 
ATOM   6256 C  CD1   . TYR A 1 763 ? -22.734 -31.111 -40.798 1.00 37.04  ? 763  TYR A CD1   1 
ATOM   6257 C  CD2   . TYR A 1 763 ? -22.474 -33.470 -41.117 1.00 37.00  ? 763  TYR A CD2   1 
ATOM   6258 C  CE1   . TYR A 1 763 ? -21.768 -31.138 -39.787 1.00 36.87  ? 763  TYR A CE1   1 
ATOM   6259 C  CE2   . TYR A 1 763 ? -21.521 -33.508 -40.120 1.00 38.56  ? 763  TYR A CE2   1 
ATOM   6260 C  CZ    . TYR A 1 763 ? -21.172 -32.350 -39.460 1.00 36.96  ? 763  TYR A CZ    1 
ATOM   6261 O  OH    . TYR A 1 763 ? -20.216 -32.428 -38.482 1.00 39.68  ? 763  TYR A OH    1 
ATOM   6262 N  N     . PHE A 1 764 ? -26.745 -30.813 -41.521 1.00 35.70  ? 764  PHE A N     1 
ATOM   6263 C  CA    . PHE A 1 764 ? -27.371 -29.822 -40.650 1.00 35.51  ? 764  PHE A CA    1 
ATOM   6264 C  C     . PHE A 1 764 ? -28.370 -30.476 -39.713 1.00 37.48  ? 764  PHE A C     1 
ATOM   6265 O  O     . PHE A 1 764 ? -28.306 -30.282 -38.494 1.00 37.22  ? 764  PHE A O     1 
ATOM   6266 C  CB    . PHE A 1 764 ? -28.079 -28.734 -41.460 1.00 34.85  ? 764  PHE A CB    1 
ATOM   6267 C  CG    . PHE A 1 764 ? -28.957 -27.833 -40.628 1.00 34.58  ? 764  PHE A CG    1 
ATOM   6268 C  CD1   . PHE A 1 764 ? -28.410 -26.752 -39.940 1.00 33.61  ? 764  PHE A CD1   1 
ATOM   6269 C  CD2   . PHE A 1 764 ? -30.330 -28.067 -40.531 1.00 35.34  ? 764  PHE A CD2   1 
ATOM   6270 C  CE1   . PHE A 1 764 ? -29.214 -25.912 -39.166 1.00 34.76  ? 764  PHE A CE1   1 
ATOM   6271 C  CE2   . PHE A 1 764 ? -31.142 -27.235 -39.765 1.00 36.49  ? 764  PHE A CE2   1 
ATOM   6272 C  CZ    . PHE A 1 764 ? -30.580 -26.155 -39.075 1.00 36.79  ? 764  PHE A CZ    1 
ATOM   6273 N  N     . LYS A 1 765 ? -29.295 -31.236 -40.300 1.00 39.32  ? 765  LYS A N     1 
ATOM   6274 C  CA    . LYS A 1 765 ? -30.321 -31.948 -39.558 1.00 42.10  ? 765  LYS A CA    1 
ATOM   6275 C  C     . LYS A 1 765 ? -29.683 -32.748 -38.423 1.00 42.90  ? 765  LYS A C     1 
ATOM   6276 O  O     . LYS A 1 765 ? -30.152 -32.697 -37.279 1.00 42.05  ? 765  LYS A O     1 
ATOM   6277 C  CB    . LYS A 1 765 ? -31.100 -32.879 -40.490 1.00 45.04  ? 765  LYS A CB    1 
ATOM   6278 C  CG    . LYS A 1 765 ? -32.429 -33.387 -39.930 1.00 51.21  ? 765  LYS A CG    1 
ATOM   6279 C  CD    . LYS A 1 765 ? -32.886 -34.674 -40.629 1.00 57.97  ? 765  LYS A CD    1 
ATOM   6280 C  CE    . LYS A 1 765 ? -33.227 -34.446 -42.102 1.00 62.23  ? 765  LYS A CE    1 
ATOM   6281 N  NZ    . LYS A 1 765 ? -33.063 -35.687 -42.926 1.00 64.88  ? 765  LYS A NZ    1 
ATOM   6282 N  N     . GLU A 1 766 ? -28.604 -33.462 -38.740 1.00 42.09  ? 766  GLU A N     1 
ATOM   6283 C  CA    . GLU A 1 766 ? -27.932 -34.288 -37.748 1.00 43.80  ? 766  GLU A CA    1 
ATOM   6284 C  C     . GLU A 1 766 ? -27.252 -33.449 -36.671 1.00 42.44  ? 766  GLU A C     1 
ATOM   6285 O  O     . GLU A 1 766 ? -27.346 -33.772 -35.489 1.00 42.14  ? 766  GLU A O     1 
ATOM   6286 C  CB    . GLU A 1 766 ? -26.938 -35.248 -38.400 1.00 45.95  ? 766  GLU A CB    1 
ATOM   6287 C  CG    . GLU A 1 766 ? -26.704 -36.516 -37.588 1.00 49.58  ? 766  GLU A CG    1 
ATOM   6288 C  CD    . GLU A 1 766 ? -27.978 -37.319 -37.368 1.00 53.84  ? 766  GLU A CD    1 
ATOM   6289 O  OE1   . GLU A 1 766 ? -28.665 -37.655 -38.358 1.00 55.35  ? 766  GLU A OE1   1 
ATOM   6290 O  OE2   . GLU A 1 766 ? -28.293 -37.621 -36.198 1.00 58.54  ? 766  GLU A OE2   1 
ATOM   6291 N  N     . PHE A 1 767 ? -26.602 -32.357 -37.071 1.00 39.94  ? 767  PHE A N     1 
ATOM   6292 C  CA    . PHE A 1 767 ? -25.940 -31.484 -36.101 1.00 39.65  ? 767  PHE A CA    1 
ATOM   6293 C  C     . PHE A 1 767 ? -26.923 -30.848 -35.114 1.00 39.79  ? 767  PHE A C     1 
ATOM   6294 O  O     . PHE A 1 767 ? -26.661 -30.813 -33.912 1.00 39.13  ? 767  PHE A O     1 
ATOM   6295 C  CB    . PHE A 1 767 ? -25.068 -30.412 -36.776 1.00 37.13  ? 767  PHE A CB    1 
ATOM   6296 C  CG    . PHE A 1 767 ? -24.201 -29.656 -35.806 1.00 37.24  ? 767  PHE A CG    1 
ATOM   6297 C  CD1   . PHE A 1 767 ? -24.531 -28.361 -35.422 1.00 37.39  ? 767  PHE A CD1   1 
ATOM   6298 C  CD2   . PHE A 1 767 ? -23.079 -30.261 -35.236 1.00 35.12  ? 767  PHE A CD2   1 
ATOM   6299 C  CE1   . PHE A 1 767 ? -23.742 -27.662 -34.507 1.00 37.65  ? 767  PHE A CE1   1 
ATOM   6300 C  CE2   . PHE A 1 767 ? -22.290 -29.580 -34.315 1.00 36.69  ? 767  PHE A CE2   1 
ATOM   6301 C  CZ    . PHE A 1 767 ? -22.619 -28.273 -33.951 1.00 39.10  ? 767  PHE A CZ    1 
ATOM   6302 N  N     . GLU A 1 768 ? -28.051 -30.366 -35.632 1.00 41.05  ? 768  GLU A N     1 
ATOM   6303 C  CA    . GLU A 1 768 ? -29.132 -29.814 -34.811 1.00 40.73  ? 768  GLU A CA    1 
ATOM   6304 C  C     . GLU A 1 768 ? -29.623 -30.817 -33.758 1.00 40.91  ? 768  GLU A C     1 
ATOM   6305 O  O     . GLU A 1 768 ? -29.942 -30.434 -32.632 1.00 40.89  ? 768  GLU A O     1 
ATOM   6306 C  CB    . GLU A 1 768 ? -30.287 -29.364 -35.715 1.00 42.65  ? 768  GLU A CB    1 
ATOM   6307 C  CG    . GLU A 1 768 ? -31.405 -28.572 -35.029 1.00 47.32  ? 768  GLU A CG    1 
ATOM   6308 C  CD    . GLU A 1 768 ? -32.436 -28.035 -36.018 1.00 49.77  ? 768  GLU A CD    1 
ATOM   6309 O  OE1   . GLU A 1 768 ? -32.499 -26.799 -36.202 1.00 51.73  ? 768  GLU A OE1   1 
ATOM   6310 O  OE2   . GLU A 1 768 ? -33.174 -28.845 -36.621 1.00 49.20  ? 768  GLU A OE2   1 
ATOM   6311 N  N     . LYS A 1 769 ? -29.668 -32.096 -34.127 1.00 41.12  ? 769  LYS A N     1 
ATOM   6312 C  CA    . LYS A 1 769 ? -30.160 -33.152 -33.243 1.00 43.53  ? 769  LYS A CA    1 
ATOM   6313 C  C     . LYS A 1 769 ? -29.201 -33.483 -32.104 1.00 43.61  ? 769  LYS A C     1 
ATOM   6314 O  O     . LYS A 1 769 ? -29.635 -33.735 -30.982 1.00 44.23  ? 769  LYS A O     1 
ATOM   6315 C  CB    . LYS A 1 769 ? -30.428 -34.437 -34.034 1.00 46.60  ? 769  LYS A CB    1 
ATOM   6316 C  CG    . LYS A 1 769 ? -31.799 -34.549 -34.661 1.00 48.63  ? 769  LYS A CG    1 
ATOM   6317 C  CD    . LYS A 1 769 ? -31.984 -35.946 -35.242 1.00 54.11  ? 769  LYS A CD    1 
ATOM   6318 C  CE    . LYS A 1 769 ? -33.180 -36.022 -36.184 1.00 55.40  ? 769  LYS A CE    1 
ATOM   6319 N  NZ    . LYS A 1 769 ? -33.352 -37.400 -36.728 1.00 55.73  ? 769  LYS A NZ    1 
ATOM   6320 N  N     . GLU A 1 770 ? -27.901 -33.494 -32.403 1.00 42.26  ? 770  GLU A N     1 
ATOM   6321 C  CA    . GLU A 1 770 ? -26.900 -33.996 -31.465 1.00 41.76  ? 770  GLU A CA    1 
ATOM   6322 C  C     . GLU A 1 770 ? -26.186 -32.882 -30.688 1.00 40.40  ? 770  GLU A C     1 
ATOM   6323 O  O     . GLU A 1 770 ? -25.503 -33.148 -29.698 1.00 40.22  ? 770  GLU A O     1 
ATOM   6324 C  CB    . GLU A 1 770 ? -25.886 -34.898 -32.186 1.00 42.84  ? 770  GLU A CB    1 
ATOM   6325 C  CG    . GLU A 1 770 ? -26.475 -35.870 -33.233 1.00 43.75  ? 770  GLU A CG    1 
ATOM   6326 C  CD    . GLU A 1 770 ? -27.399 -36.951 -32.662 1.00 47.88  ? 770  GLU A CD    1 
ATOM   6327 O  OE1   . GLU A 1 770 ? -28.194 -37.515 -33.449 1.00 49.96  ? 770  GLU A OE1   1 
ATOM   6328 O  OE2   . GLU A 1 770 ? -27.340 -37.249 -31.450 1.00 45.25  ? 770  GLU A OE2   1 
ATOM   6329 N  N     . PHE A 1 771 ? -26.386 -31.642 -31.129 1.00 37.89  ? 771  PHE A N     1 
ATOM   6330 C  CA    . PHE A 1 771 ? -25.774 -30.439 -30.545 1.00 38.79  ? 771  PHE A CA    1 
ATOM   6331 C  C     . PHE A 1 771 ? -25.671 -30.408 -29.009 1.00 38.66  ? 771  PHE A C     1 
ATOM   6332 O  O     . PHE A 1 771 ? -24.627 -30.058 -28.460 1.00 37.76  ? 771  PHE A O     1 
ATOM   6333 C  CB    . PHE A 1 771 ? -26.527 -29.198 -31.055 1.00 39.81  ? 771  PHE A CB    1 
ATOM   6334 C  CG    . PHE A 1 771 ? -26.007 -27.896 -30.528 1.00 42.68  ? 771  PHE A CG    1 
ATOM   6335 C  CD1   . PHE A 1 771 ? -26.663 -27.242 -29.493 1.00 45.97  ? 771  PHE A CD1   1 
ATOM   6336 C  CD2   . PHE A 1 771 ? -24.875 -27.302 -31.091 1.00 50.20  ? 771  PHE A CD2   1 
ATOM   6337 C  CE1   . PHE A 1 771 ? -26.194 -26.028 -29.004 1.00 49.58  ? 771  PHE A CE1   1 
ATOM   6338 C  CE2   . PHE A 1 771 ? -24.392 -26.080 -30.615 1.00 50.88  ? 771  PHE A CE2   1 
ATOM   6339 C  CZ    . PHE A 1 771 ? -25.055 -25.442 -29.563 1.00 52.80  ? 771  PHE A CZ    1 
ATOM   6340 N  N     . ARG A 1 772 ? -26.748 -30.774 -28.324 1.00 39.88  ? 772  ARG A N     1 
ATOM   6341 C  CA    . ARG A 1 772 ? -26.810 -30.665 -26.860 1.00 41.63  ? 772  ARG A CA    1 
ATOM   6342 C  C     . ARG A 1 772 ? -25.872 -31.608 -26.095 1.00 40.65  ? 772  ARG A C     1 
ATOM   6343 O  O     . ARG A 1 772 ? -25.714 -31.481 -24.883 1.00 43.38  ? 772  ARG A O     1 
ATOM   6344 C  CB    . ARG A 1 772 ? -28.262 -30.786 -26.377 1.00 43.94  ? 772  ARG A CB    1 
ATOM   6345 C  CG    . ARG A 1 772 ? -29.097 -29.565 -26.745 1.00 48.53  ? 772  ARG A CG    1 
ATOM   6346 C  CD    . ARG A 1 772 ? -30.549 -29.900 -27.080 1.00 57.24  ? 772  ARG A CD    1 
ATOM   6347 N  NE    . ARG A 1 772 ? -31.110 -28.916 -28.012 1.00 59.92  ? 772  ARG A NE    1 
ATOM   6348 C  CZ    . ARG A 1 772 ? -31.727 -27.790 -27.649 1.00 63.51  ? 772  ARG A CZ    1 
ATOM   6349 N  NH1   . ARG A 1 772 ? -31.886 -27.493 -26.361 1.00 63.97  ? 772  ARG A NH1   1 
ATOM   6350 N  NH2   . ARG A 1 772 ? -32.192 -26.958 -28.579 1.00 60.74  ? 772  ARG A NH2   1 
ATOM   6351 N  N     . GLN A 1 773 ? -25.237 -32.533 -26.808 1.00 39.26  ? 773  GLN A N     1 
ATOM   6352 C  CA    . GLN A 1 773 ? -24.297 -33.477 -26.203 1.00 39.87  ? 773  GLN A CA    1 
ATOM   6353 C  C     . GLN A 1 773 ? -22.861 -32.956 -26.224 1.00 37.17  ? 773  GLN A C     1 
ATOM   6354 O  O     . GLN A 1 773 ? -21.962 -33.581 -25.656 1.00 36.50  ? 773  GLN A O     1 
ATOM   6355 C  CB    . GLN A 1 773 ? -24.336 -34.823 -26.931 1.00 41.29  ? 773  GLN A CB    1 
ATOM   6356 C  CG    . GLN A 1 773 ? -25.705 -35.453 -27.057 1.00 47.64  ? 773  GLN A CG    1 
ATOM   6357 C  CD    . GLN A 1 773 ? -25.774 -36.481 -28.185 1.00 52.69  ? 773  GLN A CD    1 
ATOM   6358 O  OE1   . GLN A 1 773 ? -26.751 -36.522 -28.937 1.00 51.91  ? 773  GLN A OE1   1 
ATOM   6359 N  NE2   . GLN A 1 773 ? -24.733 -37.310 -28.310 1.00 51.77  ? 773  GLN A NE2   1 
ATOM   6360 N  N     . LEU A 1 774 ? -22.642 -31.831 -26.900 1.00 34.11  ? 774  LEU A N     1 
ATOM   6361 C  CA    . LEU A 1 774 ? -21.300 -31.265 -27.009 1.00 33.50  ? 774  LEU A CA    1 
ATOM   6362 C  C     . LEU A 1 774 ? -20.803 -30.776 -25.655 1.00 34.48  ? 774  LEU A C     1 
ATOM   6363 O  O     . LEU A 1 774 ? -21.567 -30.197 -24.879 1.00 34.67  ? 774  LEU A O     1 
ATOM   6364 C  CB    . LEU A 1 774 ? -21.252 -30.147 -28.053 1.00 29.70  ? 774  LEU A CB    1 
ATOM   6365 C  CG    . LEU A 1 774 ? -21.475 -30.597 -29.503 1.00 30.28  ? 774  LEU A CG    1 
ATOM   6366 C  CD1   . LEU A 1 774 ? -21.733 -29.418 -30.418 1.00 25.42  ? 774  LEU A CD1   1 
ATOM   6367 C  CD2   . LEU A 1 774 ? -20.323 -31.460 -30.022 1.00 28.10  ? 774  LEU A CD2   1 
ATOM   6368 N  N     . ASN A 1 775 ? -19.532 -31.060 -25.373 1.00 35.06  ? 775  ASN A N     1 
ATOM   6369 C  CA    . ASN A 1 775 ? -18.854 -30.600 -24.164 1.00 34.92  ? 775  ASN A CA    1 
ATOM   6370 C  C     . ASN A 1 775 ? -18.930 -29.071 -24.094 1.00 32.72  ? 775  ASN A C     1 
ATOM   6371 O  O     . ASN A 1 775 ? -18.808 -28.391 -25.122 1.00 29.13  ? 775  ASN A O     1 
ATOM   6372 C  CB    . ASN A 1 775 ? -17.399 -31.077 -24.185 1.00 36.99  ? 775  ASN A CB    1 
ATOM   6373 C  CG    . ASN A 1 775 ? -16.589 -30.564 -23.007 1.00 42.34  ? 775  ASN A CG    1 
ATOM   6374 O  OD1   . ASN A 1 775 ? -15.854 -29.583 -23.129 1.00 46.19  ? 775  ASN A OD1   1 
ATOM   6375 N  ND2   . ASN A 1 775 ? -16.712 -31.228 -21.865 1.00 42.51  ? 775  ASN A ND2   1 
ATOM   6376 N  N     . TYR A 1 776 ? -19.150 -28.543 -22.895 1.00 30.36  ? 776  TYR A N     1 
ATOM   6377 C  CA    . TYR A 1 776 ? -19.370 -27.107 -22.710 1.00 31.39  ? 776  TYR A CA    1 
ATOM   6378 C  C     . TYR A 1 776 ? -18.233 -26.210 -23.232 1.00 29.50  ? 776  TYR A C     1 
ATOM   6379 O  O     . TYR A 1 776 ? -18.488 -25.121 -23.736 1.00 30.87  ? 776  TYR A O     1 
ATOM   6380 C  CB    . TYR A 1 776 ? -19.694 -26.789 -21.245 1.00 31.88  ? 776  TYR A CB    1 
ATOM   6381 C  CG    . TYR A 1 776 ? -18.513 -26.835 -20.303 1.00 33.62  ? 776  TYR A CG    1 
ATOM   6382 C  CD1   . TYR A 1 776 ? -17.953 -25.657 -19.808 1.00 34.17  ? 776  TYR A CD1   1 
ATOM   6383 C  CD2   . TYR A 1 776 ? -17.963 -28.053 -19.894 1.00 37.22  ? 776  TYR A CD2   1 
ATOM   6384 C  CE1   . TYR A 1 776 ? -16.879 -25.683 -18.936 1.00 35.10  ? 776  TYR A CE1   1 
ATOM   6385 C  CE2   . TYR A 1 776 ? -16.885 -28.095 -19.018 1.00 39.47  ? 776  TYR A CE2   1 
ATOM   6386 C  CZ    . TYR A 1 776 ? -16.349 -26.905 -18.545 1.00 40.04  ? 776  TYR A CZ    1 
ATOM   6387 O  OH    . TYR A 1 776 ? -15.285 -26.935 -17.684 1.00 41.03  ? 776  TYR A OH    1 
ATOM   6388 N  N     . ILE A 1 777 ? -16.992 -26.667 -23.108 1.00 31.18  ? 777  ILE A N     1 
ATOM   6389 C  CA    . ILE A 1 777 ? -15.833 -25.906 -23.596 1.00 32.22  ? 777  ILE A CA    1 
ATOM   6390 C  C     . ILE A 1 777 ? -15.845 -25.814 -25.129 1.00 30.36  ? 777  ILE A C     1 
ATOM   6391 O  O     . ILE A 1 777 ? -15.618 -24.745 -25.699 1.00 29.48  ? 777  ILE A O     1 
ATOM   6392 C  CB    . ILE A 1 777 ? -14.501 -26.481 -23.037 1.00 34.50  ? 777  ILE A CB    1 
ATOM   6393 C  CG1   . ILE A 1 777 ? -14.366 -26.114 -21.555 1.00 36.05  ? 777  ILE A CG1   1 
ATOM   6394 C  CG2   . ILE A 1 777 ? -13.287 -25.962 -23.819 1.00 35.47  ? 777  ILE A CG2   1 
ATOM   6395 C  CD1   . ILE A 1 777 ? -13.310 -26.896 -20.809 1.00 43.93  ? 777  ILE A CD1   1 
ATOM   6396 N  N     . SER A 1 778 ? -16.172 -26.923 -25.784 1.00 30.49  ? 778  SER A N     1 
ATOM   6397 C  CA    . SER A 1 778 ? -16.234 -26.964 -27.243 1.00 29.64  ? 778  SER A CA    1 
ATOM   6398 C  C     . SER A 1 778 ? -17.323 -26.060 -27.827 1.00 28.28  ? 778  SER A C     1 
ATOM   6399 O  O     . SER A 1 778 ? -17.280 -25.749 -29.015 1.00 27.36  ? 778  SER A O     1 
ATOM   6400 C  CB    . SER A 1 778 ? -16.393 -28.401 -27.748 1.00 30.55  ? 778  SER A CB    1 
ATOM   6401 O  OG    . SER A 1 778 ? -17.748 -28.808 -27.703 1.00 31.35  ? 778  SER A OG    1 
ATOM   6402 N  N     . ILE A 1 779 ? -18.284 -25.631 -27.003 1.00 28.55  ? 779  ILE A N     1 
ATOM   6403 C  CA    . ILE A 1 779 ? -19.362 -24.742 -27.482 1.00 28.96  ? 779  ILE A CA    1 
ATOM   6404 C  C     . ILE A 1 779 ? -19.367 -23.330 -26.863 1.00 27.57  ? 779  ILE A C     1 
ATOM   6405 O  O     . ILE A 1 779 ? -20.247 -22.508 -27.161 1.00 26.92  ? 779  ILE A O     1 
ATOM   6406 C  CB    . ILE A 1 779 ? -20.768 -25.394 -27.379 1.00 31.31  ? 779  ILE A CB    1 
ATOM   6407 C  CG1   . ILE A 1 779 ? -21.043 -25.901 -25.958 1.00 34.85  ? 779  ILE A CG1   1 
ATOM   6408 C  CG2   . ILE A 1 779 ? -20.895 -26.509 -28.392 1.00 34.73  ? 779  ILE A CG2   1 
ATOM   6409 C  CD1   . ILE A 1 779 ? -22.346 -26.683 -25.819 1.00 40.13  ? 779  ILE A CD1   1 
ATOM   6410 N  N     . ALA A 1 780 ? -18.385 -23.055 -26.012 1.00 25.44  ? 780  ALA A N     1 
ATOM   6411 C  CA    . ALA A 1 780 ? -18.202 -21.715 -25.461 1.00 25.82  ? 780  ALA A CA    1 
ATOM   6412 C  C     . ALA A 1 780 ? -17.578 -20.793 -26.495 1.00 23.53  ? 780  ALA A C     1 
ATOM   6413 O  O     . ALA A 1 780 ? -16.694 -21.209 -27.244 1.00 24.37  ? 780  ALA A O     1 
ATOM   6414 C  CB    . ALA A 1 780 ? -17.332 -21.772 -24.217 1.00 25.70  ? 780  ALA A CB    1 
ATOM   6415 N  N     . SER A 1 781 ? -18.037 -19.544 -26.531 1.00 21.72  ? 781  SER A N     1 
ATOM   6416 C  CA    . SER A 1 781 ? -17.417 -18.519 -27.364 1.00 22.01  ? 781  SER A CA    1 
ATOM   6417 C  C     . SER A 1 781 ? -16.133 -18.064 -26.685 1.00 23.72  ? 781  SER A C     1 
ATOM   6418 O  O     . SER A 1 781 ? -15.902 -18.395 -25.523 1.00 22.82  ? 781  SER A O     1 
ATOM   6419 C  CB    . SER A 1 781 ? -18.357 -17.326 -27.535 1.00 22.90  ? 781  SER A CB    1 
ATOM   6420 O  OG    . SER A 1 781 ? -19.483 -17.691 -28.309 1.00 31.68  ? 781  SER A OG    1 
ATOM   6421 N  N     . VAL A 1 782 ? -15.296 -17.319 -27.406 1.00 23.49  ? 782  VAL A N     1 
ATOM   6422 C  CA    . VAL A 1 782 ? -14.074 -16.775 -26.831 1.00 25.43  ? 782  VAL A CA    1 
ATOM   6423 C  C     . VAL A 1 782 ? -13.993 -15.278 -27.100 1.00 28.29  ? 782  VAL A C     1 
ATOM   6424 O  O     . VAL A 1 782 ? -14.359 -14.818 -28.173 1.00 29.68  ? 782  VAL A O     1 
ATOM   6425 C  CB    . VAL A 1 782 ? -12.802 -17.460 -27.391 1.00 26.46  ? 782  VAL A CB    1 
ATOM   6426 C  CG1   . VAL A 1 782 ? -11.562 -16.952 -26.657 1.00 28.24  ? 782  VAL A CG1   1 
ATOM   6427 C  CG2   . VAL A 1 782 ? -12.892 -18.983 -27.276 1.00 22.56  ? 782  VAL A CG2   1 
ATOM   6428 N  N     . SER A 1 783 ? -13.529 -14.521 -26.113 1.00 30.95  ? 783  SER A N     1 
ATOM   6429 C  CA    . SER A 1 783 ? -13.294 -13.096 -26.295 1.00 32.59  ? 783  SER A CA    1 
ATOM   6430 C  C     . SER A 1 783 ? -12.128 -12.618 -25.424 1.00 34.33  ? 783  SER A C     1 
ATOM   6431 O  O     . SER A 1 783 ? -11.682 -13.337 -24.527 1.00 34.60  ? 783  SER A O     1 
ATOM   6432 C  CB    . SER A 1 783 ? -14.565 -12.298 -25.991 1.00 31.73  ? 783  SER A CB    1 
ATOM   6433 O  OG    . SER A 1 783 ? -14.426 -10.972 -26.463 1.00 33.86  ? 783  SER A OG    1 
ATOM   6434 N  N     . SER A 1 784 ? -11.641 -11.407 -25.701 1.00 34.93  ? 784  SER A N     1 
ATOM   6435 C  CA    . SER A 1 784 ? -10.576 -10.788 -24.912 1.00 34.40  ? 784  SER A CA    1 
ATOM   6436 C  C     . SER A 1 784 ? -11.153 -9.917  -23.808 1.00 36.06  ? 784  SER A C     1 
ATOM   6437 O  O     . SER A 1 784 ? -12.088 -9.156  -24.039 1.00 38.71  ? 784  SER A O     1 
ATOM   6438 C  CB    . SER A 1 784 ? -9.664  -9.948  -25.804 1.00 32.87  ? 784  SER A CB    1 
ATOM   6439 O  OG    . SER A 1 784 ? -8.754  -10.765 -26.503 1.00 31.90  ? 784  SER A OG    1 
ATOM   6440 N  N     . ALA A 1 785 ? -10.571 -10.010 -22.619 1.00 36.77  ? 785  ALA A N     1 
ATOM   6441 C  CA    . ALA A 1 785 ? -11.105 -9.337  -21.434 1.00 38.75  ? 785  ALA A CA    1 
ATOM   6442 C  C     . ALA A 1 785 ? -10.542 -7.928  -21.241 1.00 39.10  ? 785  ALA A C     1 
ATOM   6443 O  O     . ALA A 1 785 ? -9.768  -7.683  -20.318 1.00 40.25  ? 785  ALA A O     1 
ATOM   6444 C  CB    . ALA A 1 785 ? -10.862 -10.188 -20.193 1.00 37.63  ? 785  ALA A CB    1 
ATOM   6445 N  N     . ASN A 1 786 ? -10.948 -7.004  -22.107 1.00 40.71  ? 786  ASN A N     1 
ATOM   6446 C  CA    . ASN A 1 786 ? -10.472 -5.623  -22.037 1.00 43.22  ? 786  ASN A CA    1 
ATOM   6447 C  C     . ASN A 1 786 ? -11.438 -4.682  -21.337 1.00 45.72  ? 786  ASN A C     1 
ATOM   6448 O  O     . ASN A 1 786 ? -12.652 -4.785  -21.513 1.00 45.91  ? 786  ASN A O     1 
ATOM   6449 C  CB    . ASN A 1 786 ? -10.171 -5.083  -23.437 1.00 43.02  ? 786  ASN A CB    1 
ATOM   6450 C  CG    . ASN A 1 786 ? -8.967  -5.746  -24.073 1.00 41.18  ? 786  ASN A CG    1 
ATOM   6451 O  OD1   . ASN A 1 786 ? -7.961  -6.001  -23.412 1.00 43.14  ? 786  ASN A OD1   1 
ATOM   6452 N  ND2   . ASN A 1 786 ? -9.060  -6.016  -25.365 1.00 38.92  ? 786  ASN A ND2   1 
ATOM   6453 N  N     . ASN A 1 787 ? -10.881 -3.763  -20.550 1.00 49.22  ? 787  ASN A N     1 
ATOM   6454 C  CA    . ASN A 1 787 ? -11.639 -2.686  -19.907 1.00 51.20  ? 787  ASN A CA    1 
ATOM   6455 C  C     . ASN A 1 787 ? -12.687 -3.125  -18.893 1.00 50.84  ? 787  ASN A C     1 
ATOM   6456 O  O     . ASN A 1 787 ? -13.735 -2.490  -18.776 1.00 50.79  ? 787  ASN A O     1 
ATOM   6457 C  CB    . ASN A 1 787 ? -12.303 -1.797  -20.963 1.00 53.23  ? 787  ASN A CB    1 
ATOM   6458 C  CG    . ASN A 1 787 ? -11.352 -0.809  -21.563 1.00 56.73  ? 787  ASN A CG    1 
ATOM   6459 O  OD1   . ASN A 1 787 ? -10.665 -0.083  -20.845 1.00 61.80  ? 787  ASN A OD1   1 
ATOM   6460 N  ND2   . ASN A 1 787 ? -11.313 -0.758  -22.887 1.00 54.78  ? 787  ASN A ND2   1 
ATOM   6461 N  N     . ILE A 1 788 ? -12.404 -4.195  -18.157 1.00 50.17  ? 788  ILE A N     1 
ATOM   6462 C  CA    . ILE A 1 788 ? -13.335 -4.677  -17.136 1.00 51.75  ? 788  ILE A CA    1 
ATOM   6463 C  C     . ILE A 1 788 ? -13.756 -3.549  -16.182 1.00 53.60  ? 788  ILE A C     1 
ATOM   6464 O  O     . ILE A 1 788 ? -14.948 -3.328  -15.972 1.00 55.70  ? 788  ILE A O     1 
ATOM   6465 C  CB    . ILE A 1 788 ? -12.761 -5.875  -16.336 1.00 51.85  ? 788  ILE A CB    1 
ATOM   6466 C  CG1   . ILE A 1 788 ? -12.321 -6.999  -17.283 1.00 49.71  ? 788  ILE A CG1   1 
ATOM   6467 C  CG2   . ILE A 1 788 ? -13.784 -6.386  -15.316 1.00 52.24  ? 788  ILE A CG2   1 
ATOM   6468 C  CD1   . ILE A 1 788 ? -11.462 -8.067  -16.612 1.00 51.14  ? 788  ILE A CD1   1 
ATOM   6469 N  N     . ALA A 1 789 ? -12.778 -2.825  -15.641 1.00 54.49  ? 789  ALA A N     1 
ATOM   6470 C  CA    . ALA A 1 789 ? -13.035 -1.759  -14.666 1.00 56.49  ? 789  ALA A CA    1 
ATOM   6471 C  C     . ALA A 1 789 ? -13.878 -0.604  -15.216 1.00 56.84  ? 789  ALA A C     1 
ATOM   6472 O  O     . ALA A 1 789 ? -14.663 -0.009  -14.479 1.00 57.72  ? 789  ALA A O     1 
ATOM   6473 C  CB    . ALA A 1 789 ? -11.721 -1.238  -14.077 1.00 57.18  ? 789  ALA A CB    1 
ATOM   6474 N  N     . LYS A 1 790 ? -13.714 -0.299  -16.503 1.00 55.98  ? 790  LYS A N     1 
ATOM   6475 C  CA    . LYS A 1 790 ? -14.467 0.772   -17.169 1.00 56.79  ? 790  LYS A CA    1 
ATOM   6476 C  C     . LYS A 1 790 ? -15.983 0.571   -17.064 1.00 56.54  ? 790  LYS A C     1 
ATOM   6477 O  O     . LYS A 1 790 ? -16.726 1.524   -16.809 1.00 56.45  ? 790  LYS A O     1 
ATOM   6478 C  CB    . LYS A 1 790 ? -14.045 0.877   -18.641 1.00 57.10  ? 790  LYS A CB    1 
ATOM   6479 C  CG    . LYS A 1 790 ? -14.730 1.972   -19.452 1.00 57.22  ? 790  LYS A CG    1 
ATOM   6480 C  CD    . LYS A 1 790 ? -14.434 1.797   -20.936 1.00 58.69  ? 790  LYS A CD    1 
ATOM   6481 C  CE    . LYS A 1 790 ? -15.030 2.916   -21.779 1.00 60.03  ? 790  LYS A CE    1 
ATOM   6482 N  NZ    . LYS A 1 790 ? -14.281 4.193   -21.602 1.00 62.87  ? 790  LYS A NZ    1 
ATOM   6483 N  N     . TYR A 1 791 ? -16.424 -0.673  -17.249 1.00 54.18  ? 791  TYR A N     1 
ATOM   6484 C  CA    . TYR A 1 791 ? -17.844 -1.021  -17.227 1.00 53.54  ? 791  TYR A CA    1 
ATOM   6485 C  C     . TYR A 1 791 ? -18.290 -1.649  -15.904 1.00 55.58  ? 791  TYR A C     1 
ATOM   6486 O  O     . TYR A 1 791 ? -19.382 -2.224  -15.818 1.00 55.07  ? 791  TYR A O     1 
ATOM   6487 C  CB    . TYR A 1 791 ? -18.172 -1.963  -18.389 1.00 51.60  ? 791  TYR A CB    1 
ATOM   6488 C  CG    . TYR A 1 791 ? -17.920 -1.362  -19.751 1.00 49.61  ? 791  TYR A CG    1 
ATOM   6489 C  CD1   . TYR A 1 791 ? -16.771 -1.677  -20.468 1.00 45.85  ? 791  TYR A CD1   1 
ATOM   6490 C  CD2   . TYR A 1 791 ? -18.830 -0.466  -20.319 1.00 50.47  ? 791  TYR A CD2   1 
ATOM   6491 C  CE1   . TYR A 1 791 ? -16.536 -1.122  -21.727 1.00 47.77  ? 791  TYR A CE1   1 
ATOM   6492 C  CE2   . TYR A 1 791 ? -18.606 0.093   -21.575 1.00 50.65  ? 791  TYR A CE2   1 
ATOM   6493 C  CZ    . TYR A 1 791 ? -17.457 -0.240  -22.272 1.00 48.69  ? 791  TYR A CZ    1 
ATOM   6494 O  OH    . TYR A 1 791 ? -17.228 0.311   -23.512 1.00 49.29  ? 791  TYR A OH    1 
ATOM   6495 N  N     . ASP A 1 792 ? -17.449 -1.537  -14.878 1.00 57.60  ? 792  ASP A N     1 
ATOM   6496 C  CA    . ASP A 1 792 ? -17.780 -2.078  -13.563 1.00 60.31  ? 792  ASP A CA    1 
ATOM   6497 C  C     . ASP A 1 792 ? -18.391 -1.012  -12.648 1.00 62.79  ? 792  ASP A C     1 
ATOM   6498 O  O     . ASP A 1 792 ? -17.689 -0.141  -12.116 1.00 64.09  ? 792  ASP A O     1 
ATOM   6499 C  CB    . ASP A 1 792 ? -16.558 -2.749  -12.909 1.00 60.47  ? 792  ASP A CB    1 
ATOM   6500 C  CG    . ASP A 1 792 ? -16.918 -3.550  -11.654 1.00 61.72  ? 792  ASP A CG    1 
ATOM   6501 O  OD1   . ASP A 1 792 ? -17.709 -3.061  -10.816 1.00 63.62  ? 792  ASP A OD1   1 
ATOM   6502 O  OD2   . ASP A 1 792 ? -16.394 -4.672  -11.497 1.00 61.35  ? 792  ASP A OD2   1 
ATOM   6503 N  N     . VAL A 1 793 ? -19.709 -1.096  -12.490 1.00 63.51  ? 793  VAL A N     1 
ATOM   6504 C  CA    . VAL A 1 793 ? -20.444 -0.283  -11.531 1.00 65.29  ? 793  VAL A CA    1 
ATOM   6505 C  C     . VAL A 1 793 ? -20.903 -1.205  -10.396 1.00 65.81  ? 793  VAL A C     1 
ATOM   6506 O  O     . VAL A 1 793 ? -21.903 -1.916  -10.526 1.00 65.66  ? 793  VAL A O     1 
ATOM   6507 C  CB    . VAL A 1 793 ? -21.648 0.447   -12.200 1.00 66.25  ? 793  VAL A CB    1 
ATOM   6508 C  CG1   . VAL A 1 793 ? -22.445 1.257   -11.178 1.00 69.06  ? 793  VAL A CG1   1 
ATOM   6509 C  CG2   . VAL A 1 793 ? -21.169 1.356   -13.329 1.00 65.96  ? 793  VAL A CG2   1 
ATOM   6510 N  N     . GLY A 1 794 ? -20.139 -1.208  -9.302  1.00 67.17  ? 794  GLY A N     1 
ATOM   6511 C  CA    . GLY A 1 794 ? -20.442 -2.011  -8.108  1.00 68.17  ? 794  GLY A CA    1 
ATOM   6512 C  C     . GLY A 1 794 ? -20.734 -3.486  -8.352  1.00 66.59  ? 794  GLY A C     1 
ATOM   6513 O  O     . GLY A 1 794 ? -21.672 -4.044  -7.776  1.00 67.11  ? 794  GLY A O     1 
ATOM   6514 N  N     . GLY A 1 795 ? -19.934 -4.114  -9.211  1.00 64.19  ? 795  GLY A N     1 
ATOM   6515 C  CA    . GLY A 1 795 ? -20.100 -5.531  -9.544  1.00 61.78  ? 795  GLY A CA    1 
ATOM   6516 C  C     . GLY A 1 795 ? -21.210 -5.805  -10.544 1.00 59.62  ? 795  GLY A C     1 
ATOM   6517 O  O     . GLY A 1 795 ? -21.564 -6.962  -10.794 1.00 57.53  ? 795  GLY A O     1 
ATOM   6518 N  N     . PHE A 1 796 ? -21.755 -4.737  -11.119 1.00 59.14  ? 796  PHE A N     1 
ATOM   6519 C  CA    . PHE A 1 796 ? -22.865 -4.837  -12.058 1.00 57.42  ? 796  PHE A CA    1 
ATOM   6520 C  C     . PHE A 1 796 ? -22.575 -4.070  -13.351 1.00 54.97  ? 796  PHE A C     1 
ATOM   6521 O  O     . PHE A 1 796 ? -21.825 -3.090  -13.329 1.00 56.10  ? 796  PHE A O     1 
ATOM   6522 C  CB    . PHE A 1 796 ? -24.160 -4.354  -11.401 1.00 58.53  ? 796  PHE A CB    1 
ATOM   6523 C  CG    . PHE A 1 796 ? -24.785 -5.367  -10.479 1.00 61.44  ? 796  PHE A CG    1 
ATOM   6524 C  CD1   . PHE A 1 796 ? -25.456 -6.478  -10.993 1.00 61.03  ? 796  PHE A CD1   1 
ATOM   6525 C  CD2   . PHE A 1 796 ? -24.711 -5.211  -9.098  1.00 63.26  ? 796  PHE A CD2   1 
ATOM   6526 C  CE1   . PHE A 1 796 ? -26.037 -7.421  -10.145 1.00 62.26  ? 796  PHE A CE1   1 
ATOM   6527 C  CE2   . PHE A 1 796 ? -25.289 -6.148  -8.241  1.00 65.04  ? 796  PHE A CE2   1 
ATOM   6528 C  CZ    . PHE A 1 796 ? -25.952 -7.256  -8.767  1.00 64.08  ? 796  PHE A CZ    1 
ATOM   6529 N  N     . PRO A 1 797 ? -23.164 -4.516  -14.483 1.00 51.69  ? 797  PRO A N     1 
ATOM   6530 C  CA    . PRO A 1 797 ? -22.844 -3.898  -15.773 1.00 49.60  ? 797  PRO A CA    1 
ATOM   6531 C  C     . PRO A 1 797 ? -23.267 -2.430  -15.847 1.00 49.52  ? 797  PRO A C     1 
ATOM   6532 O  O     . PRO A 1 797 ? -24.411 -2.098  -15.543 1.00 49.90  ? 797  PRO A O     1 
ATOM   6533 C  CB    . PRO A 1 797 ? -23.644 -4.742  -16.780 1.00 47.87  ? 797  PRO A CB    1 
ATOM   6534 C  CG    . PRO A 1 797 ? -23.968 -6.014  -16.059 1.00 48.86  ? 797  PRO A CG    1 
ATOM   6535 C  CD    . PRO A 1 797 ? -24.144 -5.609  -14.634 1.00 50.32  ? 797  PRO A CD    1 
ATOM   6536 N  N     . GLY A 1 798 ? -22.329 -1.570  -16.234 1.00 48.39  ? 798  GLY A N     1 
ATOM   6537 C  CA    . GLY A 1 798 ? -22.609 -0.165  -16.479 1.00 48.74  ? 798  GLY A CA    1 
ATOM   6538 C  C     . GLY A 1 798 ? -23.178 0.065   -17.870 1.00 47.99  ? 798  GLY A C     1 
ATOM   6539 O  O     . GLY A 1 798 ? -23.486 -0.896  -18.582 1.00 45.24  ? 798  GLY A O     1 
ATOM   6540 N  N     . PRO A 1 799 ? -23.331 1.346   -18.266 1.00 49.28  ? 799  PRO A N     1 
ATOM   6541 C  CA    . PRO A 1 799 ? -23.870 1.680   -19.586 1.00 48.97  ? 799  PRO A CA    1 
ATOM   6542 C  C     . PRO A 1 799 ? -22.968 1.172   -20.712 1.00 46.69  ? 799  PRO A C     1 
ATOM   6543 O  O     . PRO A 1 799 ? -21.743 1.268   -20.613 1.00 46.19  ? 799  PRO A O     1 
ATOM   6544 C  CB    . PRO A 1 799 ? -23.903 3.216   -19.581 1.00 49.93  ? 799  PRO A CB    1 
ATOM   6545 C  CG    . PRO A 1 799 ? -23.883 3.600   -18.134 1.00 52.72  ? 799  PRO A CG    1 
ATOM   6546 C  CD    . PRO A 1 799 ? -23.032 2.556   -17.477 1.00 51.84  ? 799  PRO A CD    1 
ATOM   6547 N  N     . LYS A 1 800 ? -23.587 0.626   -21.757 1.00 45.13  ? 800  LYS A N     1 
ATOM   6548 C  CA    . LYS A 1 800 ? -22.889 0.144   -22.964 1.00 44.39  ? 800  LYS A CA    1 
ATOM   6549 C  C     . LYS A 1 800 ? -21.989 -1.072  -22.711 1.00 41.47  ? 800  LYS A C     1 
ATOM   6550 O  O     . LYS A 1 800 ? -21.120 -1.383  -23.530 1.00 41.52  ? 800  LYS A O     1 
ATOM   6551 C  CB    . LYS A 1 800 ? -22.104 1.281   -23.646 1.00 46.39  ? 800  LYS A CB    1 
ATOM   6552 C  CG    . LYS A 1 800 ? -22.983 2.434   -24.123 1.00 51.32  ? 800  LYS A CG    1 
ATOM   6553 C  CD    . LYS A 1 800 ? -22.202 3.721   -24.331 1.00 57.22  ? 800  LYS A CD    1 
ATOM   6554 C  CE    . LYS A 1 800 ? -23.126 4.820   -24.862 1.00 62.84  ? 800  LYS A CE    1 
ATOM   6555 N  NZ    . LYS A 1 800 ? -22.612 6.200   -24.611 1.00 65.02  ? 800  LYS A NZ    1 
ATOM   6556 N  N     . CYS A 1 801 ? -22.221 -1.766  -21.596 1.00 39.85  ? 801  CYS A N     1 
ATOM   6557 C  CA    . CYS A 1 801 ? -21.390 -2.901  -21.200 1.00 40.48  ? 801  CYS A CA    1 
ATOM   6558 C  C     . CYS A 1 801 ? -21.429 -4.032  -22.233 1.00 38.48  ? 801  CYS A C     1 
ATOM   6559 O  O     . CYS A 1 801 ? -22.497 -4.589  -22.506 1.00 36.80  ? 801  CYS A O     1 
ATOM   6560 C  CB    . CYS A 1 801 ? -21.779 -3.429  -19.815 1.00 41.24  ? 801  CYS A CB    1 
ATOM   6561 S  SG    . CYS A 1 801 ? -20.739 -4.818  -19.248 1.00 42.71  ? 801  CYS A SG    1 
ATOM   6562 N  N     . PRO A 1 802 ? -20.257 -4.358  -22.816 1.00 36.78  ? 802  PRO A N     1 
ATOM   6563 C  CA    . PRO A 1 802 ? -20.153 -5.433  -23.807 1.00 33.92  ? 802  PRO A CA    1 
ATOM   6564 C  C     . PRO A 1 802 ? -20.567 -6.779  -23.228 1.00 31.11  ? 802  PRO A C     1 
ATOM   6565 O  O     . PRO A 1 802 ? -20.316 -7.062  -22.046 1.00 30.15  ? 802  PRO A O     1 
ATOM   6566 C  CB    . PRO A 1 802 ? -18.666 -5.442  -24.177 1.00 31.99  ? 802  PRO A CB    1 
ATOM   6567 C  CG    . PRO A 1 802 ? -18.176 -4.077  -23.817 1.00 37.72  ? 802  PRO A CG    1 
ATOM   6568 C  CD    . PRO A 1 802 ? -18.958 -3.698  -22.590 1.00 37.60  ? 802  PRO A CD    1 
ATOM   6569 N  N     . PHE A 1 803 ? -21.199 -7.587  -24.073 1.00 28.92  ? 803  PHE A N     1 
ATOM   6570 C  CA    . PHE A 1 803 ? -21.709 -8.899  -23.700 1.00 29.87  ? 803  PHE A CA    1 
ATOM   6571 C  C     . PHE A 1 803 ? -20.704 -9.755  -22.936 1.00 30.50  ? 803  PHE A C     1 
ATOM   6572 O  O     . PHE A 1 803 ? -21.060 -10.362 -21.921 1.00 30.73  ? 803  PHE A O     1 
ATOM   6573 C  CB    . PHE A 1 803 ? -22.172 -9.639  -24.947 1.00 30.72  ? 803  PHE A CB    1 
ATOM   6574 C  CG    . PHE A 1 803 ? -22.922 -10.910 -24.664 1.00 31.91  ? 803  PHE A CG    1 
ATOM   6575 C  CD1   . PHE A 1 803 ? -24.278 -10.877 -24.349 1.00 32.58  ? 803  PHE A CD1   1 
ATOM   6576 C  CD2   . PHE A 1 803 ? -22.279 -12.143 -24.753 1.00 29.59  ? 803  PHE A CD2   1 
ATOM   6577 C  CE1   . PHE A 1 803 ? -24.982 -12.056 -24.104 1.00 33.19  ? 803  PHE A CE1   1 
ATOM   6578 C  CE2   . PHE A 1 803 ? -22.971 -13.330 -24.513 1.00 28.95  ? 803  PHE A CE2   1 
ATOM   6579 C  CZ    . PHE A 1 803 ? -24.325 -13.286 -24.190 1.00 33.05  ? 803  PHE A CZ    1 
ATOM   6580 N  N     . HIS A 1 804 ? -19.458 -9.800  -23.412 1.00 28.22  ? 804  HIS A N     1 
ATOM   6581 C  CA    . HIS A 1 804 ? -18.436 -10.648 -22.783 1.00 29.53  ? 804  HIS A CA    1 
ATOM   6582 C  C     . HIS A 1 804 ? -17.966 -10.102 -21.434 1.00 31.89  ? 804  HIS A C     1 
ATOM   6583 O  O     . HIS A 1 804 ? -17.590 -10.872 -20.547 1.00 33.67  ? 804  HIS A O     1 
ATOM   6584 C  CB    . HIS A 1 804 ? -17.257 -10.932 -23.736 1.00 27.49  ? 804  HIS A CB    1 
ATOM   6585 C  CG    . HIS A 1 804 ? -16.437 -9.725  -24.083 1.00 27.39  ? 804  HIS A CG    1 
ATOM   6586 N  ND1   . HIS A 1 804 ? -16.896 -8.721  -24.911 1.00 27.68  ? 804  HIS A ND1   1 
ATOM   6587 C  CD2   . HIS A 1 804 ? -15.179 -9.369  -23.725 1.00 26.68  ? 804  HIS A CD2   1 
ATOM   6588 C  CE1   . HIS A 1 804 ? -15.965 -7.790  -25.030 1.00 27.65  ? 804  HIS A CE1   1 
ATOM   6589 N  NE2   . HIS A 1 804 ? -14.911 -8.161  -24.325 1.00 27.88  ? 804  HIS A NE2   1 
ATOM   6590 N  N     . ILE A 1 805 ? -18.016 -8.778  -21.278 1.00 33.82  ? 805  ILE A N     1 
ATOM   6591 C  CA    . ILE A 1 805 ? -17.660 -8.124  -20.014 1.00 33.16  ? 805  ILE A CA    1 
ATOM   6592 C  C     . ILE A 1 805 ? -18.760 -8.321  -18.974 1.00 35.19  ? 805  ILE A C     1 
ATOM   6593 O  O     . ILE A 1 805 ? -18.480 -8.424  -17.780 1.00 38.97  ? 805  ILE A O     1 
ATOM   6594 C  CB    . ILE A 1 805 ? -17.346 -6.610  -20.204 1.00 32.73  ? 805  ILE A CB    1 
ATOM   6595 C  CG1   . ILE A 1 805 ? -16.238 -6.403  -21.254 1.00 30.56  ? 805  ILE A CG1   1 
ATOM   6596 C  CG2   . ILE A 1 805 ? -16.941 -5.972  -18.888 1.00 31.16  ? 805  ILE A CG2   1 
ATOM   6597 C  CD1   . ILE A 1 805 ? -14.878 -7.007  -20.889 1.00 26.32  ? 805  ILE A CD1   1 
ATOM   6598 N  N     . ARG A 1 806 ? -20.007 -8.372  -19.435 1.00 36.84  ? 806  ARG A N     1 
ATOM   6599 C  CA    . ARG A 1 806 ? -21.150 -8.715  -18.587 1.00 37.01  ? 806  ARG A CA    1 
ATOM   6600 C  C     . ARG A 1 806 ? -20.926 -10.104 -17.973 1.00 37.26  ? 806  ARG A C     1 
ATOM   6601 O  O     . ARG A 1 806 ? -21.129 -10.303 -16.775 1.00 36.59  ? 806  ARG A O     1 
ATOM   6602 C  CB    . ARG A 1 806 ? -22.449 -8.684  -19.406 1.00 35.35  ? 806  ARG A CB    1 
ATOM   6603 C  CG    . ARG A 1 806 ? -23.718 -8.995  -18.609 1.00 39.59  ? 806  ARG A CG    1 
ATOM   6604 C  CD    . ARG A 1 806 ? -24.985 -8.919  -19.475 1.00 38.42  ? 806  ARG A CD    1 
ATOM   6605 N  NE    . ARG A 1 806 ? -25.319 -7.547  -19.871 1.00 37.69  ? 806  ARG A NE    1 
ATOM   6606 C  CZ    . ARG A 1 806 ? -26.078 -6.710  -19.161 1.00 41.06  ? 806  ARG A CZ    1 
ATOM   6607 N  NH1   . ARG A 1 806 ? -26.606 -7.082  -17.995 1.00 38.52  ? 806  ARG A NH1   1 
ATOM   6608 N  NH2   . ARG A 1 806 ? -26.308 -5.488  -19.620 1.00 39.49  ? 806  ARG A NH2   1 
ATOM   6609 N  N     . GLY A 1 807 ? -20.484 -11.045 -18.808 1.00 35.86  ? 807  GLY A N     1 
ATOM   6610 C  CA    . GLY A 1 807 ? -20.201 -12.411 -18.382 1.00 34.49  ? 807  GLY A CA    1 
ATOM   6611 C  C     . GLY A 1 807 ? -19.103 -12.486 -17.343 1.00 35.25  ? 807  GLY A C     1 
ATOM   6612 O  O     . GLY A 1 807 ? -19.171 -13.300 -16.419 1.00 37.03  ? 807  GLY A O     1 
ATOM   6613 N  N     . ILE A 1 808 ? -18.090 -11.636 -17.490 1.00 35.10  ? 808  ILE A N     1 
ATOM   6614 C  CA    . ILE A 1 808 ? -16.999 -11.576 -16.521 1.00 36.42  ? 808  ILE A CA    1 
ATOM   6615 C  C     . ILE A 1 808 ? -17.504 -11.029 -15.190 1.00 38.77  ? 808  ILE A C     1 
ATOM   6616 O  O     . ILE A 1 808 ? -17.177 -11.570 -14.130 1.00 42.12  ? 808  ILE A O     1 
ATOM   6617 C  CB    . ILE A 1 808 ? -15.808 -10.732 -17.029 1.00 36.96  ? 808  ILE A CB    1 
ATOM   6618 C  CG1   . ILE A 1 808 ? -15.089 -11.457 -18.168 1.00 32.75  ? 808  ILE A CG1   1 
ATOM   6619 C  CG2   . ILE A 1 808 ? -14.822 -10.426 -15.885 1.00 33.42  ? 808  ILE A CG2   1 
ATOM   6620 C  CD1   . ILE A 1 808 ? -14.247 -10.544 -19.030 1.00 34.31  ? 808  ILE A CD1   1 
ATOM   6621 N  N     . LEU A 1 809 ? -18.306 -9.968  -15.250 1.00 39.34  ? 809  LEU A N     1 
ATOM   6622 C  CA    . LEU A 1 809 ? -18.881 -9.375  -14.045 1.00 40.93  ? 809  LEU A CA    1 
ATOM   6623 C  C     . LEU A 1 809 ? -19.776 -10.365 -13.308 1.00 41.35  ? 809  LEU A C     1 
ATOM   6624 O  O     . LEU A 1 809 ? -19.765 -10.408 -12.076 1.00 43.51  ? 809  LEU A O     1 
ATOM   6625 C  CB    . LEU A 1 809 ? -19.638 -8.085  -14.373 1.00 40.78  ? 809  LEU A CB    1 
ATOM   6626 C  CG    . LEU A 1 809 ? -18.749 -6.918  -14.811 1.00 42.13  ? 809  LEU A CG    1 
ATOM   6627 C  CD1   . LEU A 1 809 ? -19.580 -5.759  -15.310 1.00 40.41  ? 809  LEU A CD1   1 
ATOM   6628 C  CD2   . LEU A 1 809 ? -17.841 -6.469  -13.681 1.00 43.82  ? 809  LEU A CD2   1 
ATOM   6629 N  N     . THR A 1 810 ? -20.525 -11.168 -14.069 1.00 40.42  ? 810  THR A N     1 
ATOM   6630 C  CA    . THR A 1 810 ? -21.349 -12.240 -13.510 1.00 41.96  ? 810  THR A CA    1 
ATOM   6631 C  C     . THR A 1 810 ? -20.463 -13.223 -12.748 1.00 42.91  ? 810  THR A C     1 
ATOM   6632 O  O     . THR A 1 810 ? -20.707 -13.509 -11.575 1.00 45.74  ? 810  THR A O     1 
ATOM   6633 C  CB    . THR A 1 810 ? -22.142 -12.998 -14.605 1.00 41.87  ? 810  THR A CB    1 
ATOM   6634 O  OG1   . THR A 1 810 ? -22.871 -12.069 -15.418 1.00 42.39  ? 810  THR A OG1   1 
ATOM   6635 C  CG2   . THR A 1 810 ? -23.123 -13.986 -13.975 1.00 40.53  ? 810  THR A CG2   1 
ATOM   6636 N  N     . TYR A 1 811 ? -19.432 -13.717 -13.430 1.00 42.10  ? 811  TYR A N     1 
ATOM   6637 C  CA    . TYR A 1 811 ? -18.414 -14.576 -12.836 1.00 41.20  ? 811  TYR A CA    1 
ATOM   6638 C  C     . TYR A 1 811 ? -17.816 -13.993 -11.559 1.00 42.22  ? 811  TYR A C     1 
ATOM   6639 O  O     . TYR A 1 811 ? -17.723 -14.693 -10.550 1.00 42.44  ? 811  TYR A O     1 
ATOM   6640 C  CB    . TYR A 1 811 ? -17.300 -14.852 -13.848 1.00 39.07  ? 811  TYR A CB    1 
ATOM   6641 C  CG    . TYR A 1 811 ? -16.175 -15.728 -13.332 1.00 38.90  ? 811  TYR A CG    1 
ATOM   6642 C  CD1   . TYR A 1 811 ? -16.303 -17.114 -13.302 1.00 38.73  ? 811  TYR A CD1   1 
ATOM   6643 C  CD2   . TYR A 1 811 ? -14.978 -15.170 -12.887 1.00 36.46  ? 811  TYR A CD2   1 
ATOM   6644 C  CE1   . TYR A 1 811 ? -15.275 -17.923 -12.827 1.00 37.75  ? 811  TYR A CE1   1 
ATOM   6645 C  CE2   . TYR A 1 811 ? -13.949 -15.966 -12.415 1.00 37.92  ? 811  TYR A CE2   1 
ATOM   6646 C  CZ    . TYR A 1 811 ? -14.102 -17.343 -12.390 1.00 38.15  ? 811  TYR A CZ    1 
ATOM   6647 O  OH    . TYR A 1 811 ? -13.079 -18.141 -11.923 1.00 40.01  ? 811  TYR A OH    1 
ATOM   6648 N  N     . ASN A 1 812 ? -17.399 -12.727 -11.604 1.00 43.07  ? 812  ASN A N     1 
ATOM   6649 C  CA    . ASN A 1 812 ? -16.787 -12.092 -10.433 1.00 45.59  ? 812  ASN A CA    1 
ATOM   6650 C  C     . ASN A 1 812 ? -17.718 -12.114 -9.220  1.00 48.65  ? 812  ASN A C     1 
ATOM   6651 O  O     . ASN A 1 812 ? -17.278 -12.414 -8.111  1.00 50.70  ? 812  ASN A O     1 
ATOM   6652 C  CB    . ASN A 1 812 ? -16.313 -10.665 -10.740 1.00 45.66  ? 812  ASN A CB    1 
ATOM   6653 C  CG    . ASN A 1 812 ? -15.122 -10.625 -11.696 1.00 45.60  ? 812  ASN A CG    1 
ATOM   6654 O  OD1   . ASN A 1 812 ? -14.512 -11.651 -12.007 1.00 47.25  ? 812  ASN A OD1   1 
ATOM   6655 N  ND2   . ASN A 1 812 ? -14.787 -9.429  -12.165 1.00 43.24  ? 812  ASN A ND2   1 
ATOM   6656 N  N     . ARG A 1 813 ? -19.002 -11.828 -9.443  1.00 50.03  ? 813  ARG A N     1 
ATOM   6657 C  CA    . ARG A 1 813 ? -20.012 -11.905 -8.379  1.00 52.16  ? 813  ARG A CA    1 
ATOM   6658 C  C     . ARG A 1 813 ? -20.180 -13.322 -7.839  1.00 53.00  ? 813  ARG A C     1 
ATOM   6659 O  O     . ARG A 1 813 ? -20.412 -13.510 -6.644  1.00 55.81  ? 813  ARG A O     1 
ATOM   6660 C  CB    . ARG A 1 813 ? -21.370 -11.399 -8.863  1.00 51.42  ? 813  ARG A CB    1 
ATOM   6661 C  CG    . ARG A 1 813 ? -21.486 -9.894  -9.000  1.00 51.72  ? 813  ARG A CG    1 
ATOM   6662 C  CD    . ARG A 1 813 ? -22.949 -9.453  -9.095  1.00 51.41  ? 813  ARG A CD    1 
ATOM   6663 N  NE    . ARG A 1 813 ? -23.739 -10.248 -10.039 1.00 51.11  ? 813  ARG A NE    1 
ATOM   6664 C  CZ    . ARG A 1 813 ? -23.764 -10.062 -11.359 1.00 51.34  ? 813  ARG A CZ    1 
ATOM   6665 N  NH1   . ARG A 1 813 ? -23.028 -9.111  -11.926 1.00 49.40  ? 813  ARG A NH1   1 
ATOM   6666 N  NH2   . ARG A 1 813 ? -24.527 -10.840 -12.120 1.00 49.21  ? 813  ARG A NH2   1 
ATOM   6667 N  N     . ALA A 1 814 ? -20.077 -14.306 -8.728  1.00 50.91  ? 814  ALA A N     1 
ATOM   6668 C  CA    . ALA A 1 814 ? -20.230 -15.708 -8.355  1.00 52.06  ? 814  ALA A CA    1 
ATOM   6669 C  C     . ALA A 1 814 ? -19.063 -16.210 -7.495  1.00 54.23  ? 814  ALA A C     1 
ATOM   6670 O  O     . ALA A 1 814 ? -19.267 -17.008 -6.574  1.00 55.20  ? 814  ALA A O     1 
ATOM   6671 C  CB    . ALA A 1 814 ? -20.396 -16.570 -9.600  1.00 49.56  ? 814  ALA A CB    1 
ATOM   6672 N  N     . ILE A 1 815 ? -17.854 -15.728 -7.786  1.00 54.16  ? 815  ILE A N     1 
ATOM   6673 C  CA    . ILE A 1 815 ? -16.647 -16.172 -7.075  1.00 57.61  ? 815  ILE A CA    1 
ATOM   6674 C  C     . ILE A 1 815 ? -16.187 -15.234 -5.949  1.00 61.21  ? 815  ILE A C     1 
ATOM   6675 O  O     . ILE A 1 815 ? -15.229 -15.546 -5.232  1.00 61.47  ? 815  ILE A O     1 
ATOM   6676 C  CB    . ILE A 1 815 ? -15.451 -16.417 -8.038  1.00 55.52  ? 815  ILE A CB    1 
ATOM   6677 C  CG1   . ILE A 1 815 ? -14.948 -15.093 -8.628  1.00 53.85  ? 815  ILE A CG1   1 
ATOM   6678 C  CG2   . ILE A 1 815 ? -15.819 -17.446 -9.115  1.00 55.45  ? 815  ILE A CG2   1 
ATOM   6679 C  CD1   . ILE A 1 815 ? -13.481 -15.102 -9.025  1.00 52.20  ? 815  ILE A CD1   1 
ATOM   6680 N  N     . LYS A 1 816 ? -16.864 -14.093 -5.812  1.00 64.14  ? 816  LYS A N     1 
ATOM   6681 C  CA    . LYS A 1 816 ? -16.525 -13.078 -4.813  1.00 68.37  ? 816  LYS A CA    1 
ATOM   6682 C  C     . LYS A 1 816 ? -16.363 -13.688 -3.419  1.00 70.89  ? 816  LYS A C     1 
ATOM   6683 O  O     . LYS A 1 816 ? -17.206 -14.470 -2.969  1.00 70.69  ? 816  LYS A O     1 
ATOM   6684 C  CB    . LYS A 1 816 ? -17.588 -11.971 -4.796  1.00 69.61  ? 816  LYS A CB    1 
ATOM   6685 C  CG    . LYS A 1 816 ? -17.353 -10.857 -3.773  1.00 74.85  ? 816  LYS A CG    1 
ATOM   6686 C  CD    . LYS A 1 816 ? -18.574 -9.947  -3.671  1.00 78.64  ? 816  LYS A CD    1 
ATOM   6687 C  CE    . LYS A 1 816 ? -18.642 -9.214  -2.333  1.00 83.23  ? 816  LYS A CE    1 
ATOM   6688 N  NZ    . LYS A 1 816 ? -17.669 -8.088  -2.226  1.00 85.69  ? 816  LYS A NZ    1 
ATOM   6689 N  N     . GLY A 1 817 ? -15.260 -13.336 -2.762  1.00 72.87  ? 817  GLY A N     1 
ATOM   6690 C  CA    . GLY A 1 817 ? -14.980 -13.796 -1.406  1.00 77.37  ? 817  GLY A CA    1 
ATOM   6691 C  C     . GLY A 1 817 ? -14.300 -15.152 -1.339  1.00 78.71  ? 817  GLY A C     1 
ATOM   6692 O  O     . GLY A 1 817 ? -14.171 -15.728 -0.256  1.00 80.97  ? 817  GLY A O     1 
ATOM   6693 N  N     . ASN A 1 818 ? -13.878 -15.664 -2.495  1.00 77.90  ? 818  ASN A N     1 
ATOM   6694 C  CA    . ASN A 1 818 ? -13.133 -16.923 -2.570  1.00 79.15  ? 818  ASN A CA    1 
ATOM   6695 C  C     . ASN A 1 818 ? -11.748 -16.709 -3.166  1.00 78.21  ? 818  ASN A C     1 
ATOM   6696 O  O     . ASN A 1 818 ? -11.612 -16.389 -4.350  1.00 76.17  ? 818  ASN A O     1 
ATOM   6697 C  CB    . ASN A 1 818 ? -13.899 -17.986 -3.368  1.00 78.58  ? 818  ASN A CB    1 
ATOM   6698 C  CG    . ASN A 1 818 ? -15.246 -18.333 -2.748  1.00 82.62  ? 818  ASN A CG    1 
ATOM   6699 O  OD1   . ASN A 1 818 ? -15.344 -18.616 -1.550  1.00 83.75  ? 818  ASN A OD1   1 
ATOM   6700 N  ND2   . ASN A 1 818 ? -16.293 -18.321 -3.570  1.00 82.74  ? 818  ASN A ND2   1 
ATOM   6701 N  N     . ILE A 1 819 ? -10.726 -16.884 -2.332  1.00 79.43  ? 819  ILE A N     1 
ATOM   6702 C  CA    . ILE A 1 819 ? -9.332  -16.670 -2.737  1.00 80.01  ? 819  ILE A CA    1 
ATOM   6703 C  C     . ILE A 1 819 ? -8.812  -17.697 -3.750  1.00 77.69  ? 819  ILE A C     1 
ATOM   6704 O  O     . ILE A 1 819 ? -7.950  -17.380 -4.569  1.00 76.89  ? 819  ILE A O     1 
ATOM   6705 C  CB    . ILE A 1 819 ? -8.375  -16.593 -1.509  1.00 83.01  ? 819  ILE A CB    1 
ATOM   6706 C  CG1   . ILE A 1 819 ? -8.843  -17.509 -0.365  1.00 85.10  ? 819  ILE A CG1   1 
ATOM   6707 C  CG2   . ILE A 1 819 ? -8.270  -15.160 -1.007  1.00 84.76  ? 819  ILE A CG2   1 
ATOM   6708 C  CD1   . ILE A 1 819 ? -8.329  -18.938 -0.434  1.00 85.75  ? 819  ILE A CD1   1 
ATOM   6709 N  N     . ASP A 1 820 ? -9.362  -18.909 -3.698  1.00 77.22  ? 820  ASP A N     1 
ATOM   6710 C  CA    . ASP A 1 820 ? -8.903  -20.039 -4.518  1.00 75.02  ? 820  ASP A CA    1 
ATOM   6711 C  C     . ASP A 1 820 ? -9.356  -20.024 -5.985  1.00 70.50  ? 820  ASP A C     1 
ATOM   6712 O  O     . ASP A 1 820 ? -8.699  -20.622 -6.840  1.00 69.37  ? 820  ASP A O     1 
ATOM   6713 C  CB    . ASP A 1 820 ? -9.278  -21.377 -3.856  1.00 78.19  ? 820  ASP A CB    1 
ATOM   6714 C  CG    . ASP A 1 820 ? -10.576 -21.301 -3.052  1.00 83.69  ? 820  ASP A CG    1 
ATOM   6715 O  OD1   . ASP A 1 820 ? -11.592 -20.782 -3.573  1.00 84.46  ? 820  ASP A OD1   1 
ATOM   6716 O  OD2   . ASP A 1 820 ? -10.577 -21.770 -1.890  1.00 87.34  ? 820  ASP A OD2   1 
ATOM   6717 N  N     . ALA A 1 821 ? -10.472 -19.352 -6.270  1.00 65.95  ? 821  ALA A N     1 
ATOM   6718 C  CA    . ALA A 1 821 ? -11.027 -19.307 -7.621  1.00 60.32  ? 821  ALA A CA    1 
ATOM   6719 C  C     . ALA A 1 821 ? -10.167 -18.452 -8.547  1.00 56.88  ? 821  ALA A C     1 
ATOM   6720 O  O     . ALA A 1 821 ? -9.735  -17.369 -8.153  1.00 56.89  ? 821  ALA A O     1 
ATOM   6721 C  CB    . ALA A 1 821 ? -12.449 -18.782 -7.592  1.00 60.33  ? 821  ALA A CB    1 
ATOM   6722 N  N     . PRO A 1 822 ? -9.907  -18.945 -9.775  1.00 53.26  ? 822  PRO A N     1 
ATOM   6723 C  CA    . PRO A 1 822 ? -9.155  -18.195 -10.779 1.00 51.62  ? 822  PRO A CA    1 
ATOM   6724 C  C     . PRO A 1 822 ? -9.767  -16.828 -11.052 1.00 51.17  ? 822  PRO A C     1 
ATOM   6725 O  O     . PRO A 1 822 ? -10.944 -16.735 -11.396 1.00 50.33  ? 822  PRO A O     1 
ATOM   6726 C  CB    . PRO A 1 822 ? -9.272  -19.068 -12.031 1.00 48.42  ? 822  PRO A CB    1 
ATOM   6727 C  CG    . PRO A 1 822 ? -9.472  -20.429 -11.532 1.00 49.65  ? 822  PRO A CG    1 
ATOM   6728 C  CD    . PRO A 1 822 ? -10.238 -20.304 -10.245 1.00 53.07  ? 822  PRO A CD    1 
ATOM   6729 N  N     . GLN A 1 823 ? -8.971  -15.779 -10.880 1.00 52.06  ? 823  GLN A N     1 
ATOM   6730 C  CA    . GLN A 1 823 ? -9.382  -14.435 -11.253 1.00 53.35  ? 823  GLN A CA    1 
ATOM   6731 C  C     . GLN A 1 823 ? -9.241  -14.251 -12.762 1.00 52.18  ? 823  GLN A C     1 
ATOM   6732 O  O     . GLN A 1 823 ? -8.342  -14.827 -13.384 1.00 52.19  ? 823  GLN A O     1 
ATOM   6733 C  CB    . GLN A 1 823 ? -8.537  -13.390 -10.524 1.00 55.65  ? 823  GLN A CB    1 
ATOM   6734 C  CG    . GLN A 1 823 ? -8.719  -13.370 -9.006  1.00 61.88  ? 823  GLN A CG    1 
ATOM   6735 C  CD    . GLN A 1 823 ? -10.028 -12.732 -8.562  1.00 64.55  ? 823  GLN A CD    1 
ATOM   6736 O  OE1   . GLN A 1 823 ? -10.784 -13.320 -7.786  1.00 67.93  ? 823  GLN A OE1   1 
ATOM   6737 N  NE2   . GLN A 1 823 ? -10.297 -11.522 -9.044  1.00 64.17  ? 823  GLN A NE2   1 
ATOM   6738 N  N     . VAL A 1 824 ? -10.147 -13.463 -13.342 1.00 50.22  ? 824  VAL A N     1 
ATOM   6739 C  CA    . VAL A 1 824 ? -10.057 -13.052 -14.738 1.00 47.63  ? 824  VAL A CA    1 
ATOM   6740 C  C     . VAL A 1 824 ? -9.027  -11.927 -14.853 1.00 48.09  ? 824  VAL A C     1 
ATOM   6741 O  O     . VAL A 1 824 ? -9.154  -10.896 -14.192 1.00 49.46  ? 824  VAL A O     1 
ATOM   6742 C  CB    . VAL A 1 824 ? -11.430 -12.568 -15.283 1.00 46.20  ? 824  VAL A CB    1 
ATOM   6743 C  CG1   . VAL A 1 824 ? -11.293 -12.004 -16.703 1.00 43.55  ? 824  VAL A CG1   1 
ATOM   6744 C  CG2   . VAL A 1 824 ? -12.445 -13.698 -15.261 1.00 44.54  ? 824  VAL A CG2   1 
ATOM   6745 N  N     . VAL A 1 825 ? -8.015  -12.136 -15.692 1.00 46.93  ? 825  VAL A N     1 
ATOM   6746 C  CA    . VAL A 1 825 ? -6.947  -11.154 -15.880 1.00 47.87  ? 825  VAL A CA    1 
ATOM   6747 C  C     . VAL A 1 825 ? -7.272  -10.171 -17.005 1.00 46.97  ? 825  VAL A C     1 
ATOM   6748 O  O     . VAL A 1 825 ? -7.616  -10.578 -18.116 1.00 46.11  ? 825  VAL A O     1 
ATOM   6749 C  CB    . VAL A 1 825 ? -5.577  -11.831 -16.155 1.00 47.95  ? 825  VAL A CB    1 
ATOM   6750 C  CG1   . VAL A 1 825 ? -4.463  -10.788 -16.206 1.00 48.41  ? 825  VAL A CG1   1 
ATOM   6751 C  CG2   . VAL A 1 825 ? -5.264  -12.883 -15.090 1.00 49.42  ? 825  VAL A CG2   1 
ATOM   6752 N  N     . GLU A 1 826 ? -7.157  -8.880  -16.701 1.00 47.91  ? 826  GLU A N     1 
ATOM   6753 C  CA    . GLU A 1 826 ? -7.376  -7.808  -17.672 1.00 47.70  ? 826  GLU A CA    1 
ATOM   6754 C  C     . GLU A 1 826 ? -6.555  -8.019  -18.949 1.00 46.22  ? 826  GLU A C     1 
ATOM   6755 O  O     . GLU A 1 826 ? -5.331  -8.131  -18.904 1.00 46.19  ? 826  GLU A O     1 
ATOM   6756 C  CB    . GLU A 1 826 ? -7.054  -6.449  -17.036 1.00 49.52  ? 826  GLU A CB    1 
ATOM   6757 C  CG    . GLU A 1 826 ? -6.920  -5.273  -18.007 1.00 52.48  ? 826  GLU A CG    1 
ATOM   6758 C  CD    . GLU A 1 826 ? -8.249  -4.826  -18.617 1.00 54.90  ? 826  GLU A CD    1 
ATOM   6759 O  OE1   . GLU A 1 826 ? -8.221  -4.277  -19.740 1.00 55.92  ? 826  GLU A OE1   1 
ATOM   6760 O  OE2   . GLU A 1 826 ? -9.313  -5.015  -17.985 1.00 54.55  ? 826  GLU A OE2   1 
ATOM   6761 N  N     . GLY A 1 827 ? -7.245  -8.081  -20.083 1.00 43.92  ? 827  GLY A N     1 
ATOM   6762 C  CA    . GLY A 1 827 ? -6.588  -8.223  -21.374 1.00 42.90  ? 827  GLY A CA    1 
ATOM   6763 C  C     . GLY A 1 827 ? -6.358  -9.653  -21.828 1.00 42.50  ? 827  GLY A C     1 
ATOM   6764 O  O     . GLY A 1 827 ? -5.861  -9.873  -22.930 1.00 42.37  ? 827  GLY A O     1 
ATOM   6765 N  N     . GLU A 1 828 ? -6.710  -10.627 -20.989 1.00 42.40  ? 828  GLU A N     1 
ATOM   6766 C  CA    . GLU A 1 828 ? -6.553  -12.035 -21.359 1.00 41.83  ? 828  GLU A CA    1 
ATOM   6767 C  C     . GLU A 1 828 ? -7.843  -12.643 -21.926 1.00 38.09  ? 828  GLU A C     1 
ATOM   6768 O  O     . GLU A 1 828 ? -8.876  -11.987 -21.972 1.00 37.03  ? 828  GLU A O     1 
ATOM   6769 C  CB    . GLU A 1 828 ? -5.951  -12.854 -20.205 1.00 45.19  ? 828  GLU A CB    1 
ATOM   6770 C  CG    . GLU A 1 828 ? -4.406  -12.759 -20.175 1.00 56.82  ? 828  GLU A CG    1 
ATOM   6771 C  CD    . GLU A 1 828 ? -3.728  -13.655 -19.133 1.00 65.64  ? 828  GLU A CD    1 
ATOM   6772 O  OE1   . GLU A 1 828 ? -2.637  -13.270 -18.651 1.00 68.98  ? 828  GLU A OE1   1 
ATOM   6773 O  OE2   . GLU A 1 828 ? -4.267  -14.737 -18.799 1.00 68.37  ? 828  GLU A OE2   1 
ATOM   6774 N  N     . LYS A 1 829 ? -7.772  -13.886 -22.386 1.00 36.25  ? 829  LYS A N     1 
ATOM   6775 C  CA    . LYS A 1 829 ? -8.913  -14.523 -23.041 1.00 35.15  ? 829  LYS A CA    1 
ATOM   6776 C  C     . LYS A 1 829 ? -9.888  -15.147 -22.047 1.00 33.24  ? 829  LYS A C     1 
ATOM   6777 O  O     . LYS A 1 829 ? -9.493  -15.633 -20.984 1.00 30.79  ? 829  LYS A O     1 
ATOM   6778 C  CB    . LYS A 1 829 ? -8.438  -15.573 -24.053 1.00 36.41  ? 829  LYS A CB    1 
ATOM   6779 C  CG    . LYS A 1 829 ? -7.563  -15.023 -25.186 1.00 38.26  ? 829  LYS A CG    1 
ATOM   6780 C  CD    . LYS A 1 829 ? -8.379  -14.607 -26.406 1.00 38.49  ? 829  LYS A CD    1 
ATOM   6781 C  CE    . LYS A 1 829 ? -7.483  -13.964 -27.458 1.00 38.33  ? 829  LYS A CE    1 
ATOM   6782 N  NZ    . LYS A 1 829 ? -7.958  -14.266 -28.832 1.00 42.48  ? 829  LYS A NZ    1 
ATOM   6783 N  N     . VAL A 1 830 ? -11.167 -15.119 -22.403 1.00 31.71  ? 830  VAL A N     1 
ATOM   6784 C  CA    . VAL A 1 830 ? -12.207 -15.758 -21.604 1.00 30.08  ? 830  VAL A CA    1 
ATOM   6785 C  C     . VAL A 1 830 ? -13.141 -16.579 -22.478 1.00 29.43  ? 830  VAL A C     1 
ATOM   6786 O  O     . VAL A 1 830 ? -13.432 -16.199 -23.614 1.00 28.63  ? 830  VAL A O     1 
ATOM   6787 C  CB    . VAL A 1 830 ? -13.045 -14.739 -20.793 1.00 29.96  ? 830  VAL A CB    1 
ATOM   6788 C  CG1   . VAL A 1 830 ? -12.291 -14.283 -19.560 1.00 25.81  ? 830  VAL A CG1   1 
ATOM   6789 C  CG2   . VAL A 1 830 ? -13.462 -13.549 -21.664 1.00 31.33  ? 830  VAL A CG2   1 
ATOM   6790 N  N     . TYR A 1 831 ? -13.584 -17.715 -21.944 1.00 29.38  ? 831  TYR A N     1 
ATOM   6791 C  CA    . TYR A 1 831 ? -14.704 -18.458 -22.511 1.00 27.84  ? 831  TYR A CA    1 
ATOM   6792 C  C     . TYR A 1 831 ? -16.008 -17.796 -22.070 1.00 27.50  ? 831  TYR A C     1 
ATOM   6793 O  O     . TYR A 1 831 ? -16.093 -17.291 -20.950 1.00 27.35  ? 831  TYR A O     1 
ATOM   6794 C  CB    . TYR A 1 831 ? -14.693 -19.902 -22.024 1.00 28.39  ? 831  TYR A CB    1 
ATOM   6795 C  CG    . TYR A 1 831 ? -13.625 -20.798 -22.626 1.00 28.36  ? 831  TYR A CG    1 
ATOM   6796 C  CD1   . TYR A 1 831 ? -13.435 -20.865 -24.004 1.00 25.19  ? 831  TYR A CD1   1 
ATOM   6797 C  CD2   . TYR A 1 831 ? -12.838 -21.617 -21.807 1.00 29.24  ? 831  TYR A CD2   1 
ATOM   6798 C  CE1   . TYR A 1 831 ? -12.473 -21.695 -24.557 1.00 28.74  ? 831  TYR A CE1   1 
ATOM   6799 C  CE2   . TYR A 1 831 ? -11.872 -22.456 -22.346 1.00 32.27  ? 831  TYR A CE2   1 
ATOM   6800 C  CZ    . TYR A 1 831 ? -11.690 -22.491 -23.727 1.00 34.16  ? 831  TYR A CZ    1 
ATOM   6801 O  OH    . TYR A 1 831 ? -10.736 -23.326 -24.281 1.00 34.69  ? 831  TYR A OH    1 
ATOM   6802 N  N     . VAL A 1 832 ? -17.014 -17.807 -22.945 1.00 26.81  ? 832  VAL A N     1 
ATOM   6803 C  CA    . VAL A 1 832 ? -18.298 -17.145 -22.694 1.00 26.01  ? 832  VAL A CA    1 
ATOM   6804 C  C     . VAL A 1 832 ? -19.467 -18.093 -22.996 1.00 27.87  ? 832  VAL A C     1 
ATOM   6805 O  O     . VAL A 1 832 ? -19.527 -18.701 -24.072 1.00 26.40  ? 832  VAL A O     1 
ATOM   6806 C  CB    . VAL A 1 832 ? -18.478 -15.862 -23.580 1.00 27.17  ? 832  VAL A CB    1 
ATOM   6807 C  CG1   . VAL A 1 832 ? -19.818 -15.203 -23.299 1.00 26.27  ? 832  VAL A CG1   1 
ATOM   6808 C  CG2   . VAL A 1 832 ? -17.343 -14.847 -23.366 1.00 24.59  ? 832  VAL A CG2   1 
ATOM   6809 N  N     . LEU A 1 833 ? -20.403 -18.204 -22.055 1.00 28.55  ? 833  LEU A N     1 
ATOM   6810 C  CA    . LEU A 1 833 ? -21.616 -18.997 -22.278 1.00 29.43  ? 833  LEU A CA    1 
ATOM   6811 C  C     . LEU A 1 833 ? -22.900 -18.214 -21.999 1.00 31.01  ? 833  LEU A C     1 
ATOM   6812 O  O     . LEU A 1 833 ? -22.989 -17.490 -21.001 1.00 33.46  ? 833  LEU A O     1 
ATOM   6813 C  CB    . LEU A 1 833 ? -21.600 -20.296 -21.448 1.00 26.11  ? 833  LEU A CB    1 
ATOM   6814 C  CG    . LEU A 1 833 ? -20.786 -21.477 -21.992 1.00 27.30  ? 833  LEU A CG    1 
ATOM   6815 C  CD1   . LEU A 1 833 ? -20.734 -22.618 -20.983 1.00 25.01  ? 833  LEU A CD1   1 
ATOM   6816 C  CD2   . LEU A 1 833 ? -21.350 -21.970 -23.332 1.00 27.28  ? 833  LEU A CD2   1 
ATOM   6817 N  N     . PRO A 1 834 ? -23.908 -18.377 -22.873 1.00 32.19  ? 834  PRO A N     1 
ATOM   6818 C  CA    . PRO A 1 834 ? -25.231 -17.826 -22.577 1.00 32.92  ? 834  PRO A CA    1 
ATOM   6819 C  C     . PRO A 1 834 ? -25.906 -18.585 -21.441 1.00 34.71  ? 834  PRO A C     1 
ATOM   6820 O  O     . PRO A 1 834 ? -25.707 -19.800 -21.293 1.00 34.90  ? 834  PRO A O     1 
ATOM   6821 C  CB    . PRO A 1 834 ? -26.002 -18.018 -23.888 1.00 32.74  ? 834  PRO A CB    1 
ATOM   6822 C  CG    . PRO A 1 834 ? -25.280 -19.132 -24.611 1.00 31.82  ? 834  PRO A CG    1 
ATOM   6823 C  CD    . PRO A 1 834 ? -23.843 -19.012 -24.208 1.00 30.99  ? 834  PRO A CD    1 
ATOM   6824 N  N     . LEU A 1 835 ? -26.690 -17.859 -20.646 1.00 34.86  ? 835  LEU A N     1 
ATOM   6825 C  CA    . LEU A 1 835 ? -27.402 -18.421 -19.504 1.00 36.22  ? 835  LEU A CA    1 
ATOM   6826 C  C     . LEU A 1 835 ? -28.914 -18.263 -19.655 1.00 37.20  ? 835  LEU A C     1 
ATOM   6827 O  O     . LEU A 1 835 ? -29.401 -17.174 -19.989 1.00 37.01  ? 835  LEU A O     1 
ATOM   6828 C  CB    . LEU A 1 835 ? -26.914 -17.756 -18.208 1.00 37.69  ? 835  LEU A CB    1 
ATOM   6829 C  CG    . LEU A 1 835 ? -25.973 -18.491 -17.236 1.00 38.01  ? 835  LEU A CG    1 
ATOM   6830 C  CD1   . LEU A 1 835 ? -25.130 -19.599 -17.871 1.00 35.86  ? 835  LEU A CD1   1 
ATOM   6831 C  CD2   . LEU A 1 835 ? -25.092 -17.506 -16.477 1.00 38.39  ? 835  LEU A CD2   1 
ATOM   6832 N  N     . ARG A 1 836 ? -29.645 -19.354 -19.417 1.00 37.85  ? 836  ARG A N     1 
ATOM   6833 C  CA    . ARG A 1 836 ? -31.114 -19.355 -19.498 1.00 39.23  ? 836  ARG A CA    1 
ATOM   6834 C  C     . ARG A 1 836 ? -31.738 -18.442 -18.450 1.00 40.78  ? 836  ARG A C     1 
ATOM   6835 O  O     . ARG A 1 836 ? -31.198 -18.285 -17.354 1.00 39.22  ? 836  ARG A O     1 
ATOM   6836 C  CB    . ARG A 1 836 ? -31.685 -20.761 -19.317 1.00 39.39  ? 836  ARG A CB    1 
ATOM   6837 C  CG    . ARG A 1 836 ? -31.346 -21.735 -20.416 1.00 38.28  ? 836  ARG A CG    1 
ATOM   6838 C  CD    . ARG A 1 836 ? -32.357 -22.862 -20.478 1.00 40.29  ? 836  ARG A CD    1 
ATOM   6839 N  NE    . ARG A 1 836 ? -32.544 -23.531 -19.190 1.00 43.46  ? 836  ARG A NE    1 
ATOM   6840 C  CZ    . ARG A 1 836 ? -31.780 -24.523 -18.751 1.00 44.20  ? 836  ARG A CZ    1 
ATOM   6841 N  NH1   . ARG A 1 836 ? -30.766 -24.958 -19.488 1.00 43.96  ? 836  ARG A NH1   1 
ATOM   6842 N  NH2   . ARG A 1 836 ? -32.025 -25.078 -17.575 1.00 42.51  ? 836  ARG A NH2   1 
ATOM   6843 N  N     . GLU A 1 837 ? -32.879 -17.855 -18.801 1.00 40.74  ? 837  GLU A N     1 
ATOM   6844 C  CA    . GLU A 1 837 ? -33.628 -16.974 -17.910 1.00 45.93  ? 837  GLU A CA    1 
ATOM   6845 C  C     . GLU A 1 837 ? -33.966 -17.648 -16.569 1.00 46.89  ? 837  GLU A C     1 
ATOM   6846 O  O     . GLU A 1 837 ? -34.417 -18.796 -16.537 1.00 46.84  ? 837  GLU A O     1 
ATOM   6847 C  CB    . GLU A 1 837 ? -34.905 -16.505 -18.613 1.00 47.22  ? 837  GLU A CB    1 
ATOM   6848 C  CG    . GLU A 1 837 ? -35.603 -15.322 -17.954 1.00 57.93  ? 837  GLU A CG    1 
ATOM   6849 C  CD    . GLU A 1 837 ? -36.427 -14.508 -18.944 1.00 62.01  ? 837  GLU A CD    1 
ATOM   6850 O  OE1   . GLU A 1 837 ? -37.667 -14.456 -18.795 1.00 63.45  ? 837  GLU A OE1   1 
ATOM   6851 O  OE2   . GLU A 1 837 ? -35.829 -13.930 -19.878 1.00 64.60  ? 837  GLU A OE2   1 
ATOM   6852 N  N     . GLY A 1 838 ? -33.730 -16.929 -15.473 1.00 46.92  ? 838  GLY A N     1 
ATOM   6853 C  CA    . GLY A 1 838 ? -34.091 -17.410 -14.137 1.00 50.20  ? 838  GLY A CA    1 
ATOM   6854 C  C     . GLY A 1 838 ? -33.004 -18.220 -13.455 1.00 50.95  ? 838  GLY A C     1 
ATOM   6855 O  O     . GLY A 1 838 ? -33.240 -18.840 -12.416 1.00 53.79  ? 838  GLY A O     1 
ATOM   6856 N  N     . ASN A 1 839 ? -31.812 -18.210 -14.048 1.00 47.82  ? 839  ASN A N     1 
ATOM   6857 C  CA    . ASN A 1 839 ? -30.630 -18.859 -13.487 1.00 45.62  ? 839  ASN A CA    1 
ATOM   6858 C  C     . ASN A 1 839 ? -30.164 -18.157 -12.206 1.00 46.40  ? 839  ASN A C     1 
ATOM   6859 O  O     . ASN A 1 839 ? -30.455 -16.976 -12.016 1.00 47.01  ? 839  ASN A O     1 
ATOM   6860 C  CB    . ASN A 1 839 ? -29.507 -18.867 -14.530 1.00 41.67  ? 839  ASN A CB    1 
ATOM   6861 C  CG    . ASN A 1 839 ? -29.011 -17.471 -14.860 1.00 38.44  ? 839  ASN A CG    1 
ATOM   6862 O  OD1   . ASN A 1 839 ? -28.130 -16.942 -14.186 1.00 38.57  ? 839  ASN A OD1   1 
ATOM   6863 N  ND2   . ASN A 1 839 ? -29.578 -16.868 -15.899 1.00 31.17  ? 839  ASN A ND2   1 
ATOM   6864 N  N     . PRO A 1 840 ? -29.434 -18.877 -11.331 1.00 47.95  ? 840  PRO A N     1 
ATOM   6865 C  CA    . PRO A 1 840 ? -28.979 -18.346 -10.040 1.00 49.23  ? 840  PRO A CA    1 
ATOM   6866 C  C     . PRO A 1 840 ? -27.822 -17.340 -10.114 1.00 48.69  ? 840  PRO A C     1 
ATOM   6867 O  O     . PRO A 1 840 ? -27.476 -16.722 -9.100  1.00 48.92  ? 840  PRO A O     1 
ATOM   6868 C  CB    . PRO A 1 840 ? -28.527 -19.606 -9.296  1.00 50.62  ? 840  PRO A CB    1 
ATOM   6869 C  CG    . PRO A 1 840 ? -28.108 -20.534 -10.377 1.00 48.10  ? 840  PRO A CG    1 
ATOM   6870 C  CD    . PRO A 1 840 ? -29.107 -20.309 -11.464 1.00 47.37  ? 840  PRO A CD    1 
ATOM   6871 N  N     . PHE A 1 841 ? -27.235 -17.176 -11.295 1.00 46.94  ? 841  PHE A N     1 
ATOM   6872 C  CA    . PHE A 1 841 ? -26.148 -16.212 -11.485 1.00 46.06  ? 841  PHE A CA    1 
ATOM   6873 C  C     . PHE A 1 841 ? -26.694 -14.798 -11.675 1.00 46.94  ? 841  PHE A C     1 
ATOM   6874 O  O     . PHE A 1 841 ? -25.945 -13.817 -11.612 1.00 46.58  ? 841  PHE A O     1 
ATOM   6875 C  CB    . PHE A 1 841 ? -25.254 -16.622 -12.659 1.00 42.27  ? 841  PHE A CB    1 
ATOM   6876 C  CG    . PHE A 1 841 ? -24.584 -17.957 -12.470 1.00 41.44  ? 841  PHE A CG    1 
ATOM   6877 C  CD1   . PHE A 1 841 ? -23.474 -18.083 -11.637 1.00 43.43  ? 841  PHE A CD1   1 
ATOM   6878 C  CD2   . PHE A 1 841 ? -25.070 -19.090 -13.114 1.00 38.76  ? 841  PHE A CD2   1 
ATOM   6879 C  CE1   . PHE A 1 841 ? -22.852 -19.322 -11.450 1.00 42.99  ? 841  PHE A CE1   1 
ATOM   6880 C  CE2   . PHE A 1 841 ? -24.460 -20.331 -12.940 1.00 40.59  ? 841  PHE A CE2   1 
ATOM   6881 C  CZ    . PHE A 1 841 ? -23.346 -20.448 -12.105 1.00 41.86  ? 841  PHE A CZ    1 
ATOM   6882 N  N     . GLY A 1 842 ? -28.003 -14.712 -11.903 1.00 46.70  ? 842  GLY A N     1 
ATOM   6883 C  CA    . GLY A 1 842 ? -28.704 -13.435 -12.001 1.00 49.61  ? 842  GLY A CA    1 
ATOM   6884 C  C     . GLY A 1 842 ? -28.385 -12.596 -13.227 1.00 50.16  ? 842  GLY A C     1 
ATOM   6885 O  O     . GLY A 1 842 ? -28.540 -11.373 -13.186 1.00 52.21  ? 842  GLY A O     1 
ATOM   6886 N  N     . ASP A 1 843 ? -27.938 -13.240 -14.310 1.00 48.24  ? 843  ASP A N     1 
ATOM   6887 C  CA    . ASP A 1 843 ? -27.695 -12.551 -15.588 1.00 47.07  ? 843  ASP A CA    1 
ATOM   6888 C  C     . ASP A 1 843 ? -27.750 -13.477 -16.810 1.00 46.12  ? 843  ASP A C     1 
ATOM   6889 O  O     . ASP A 1 843 ? -27.908 -14.692 -16.668 1.00 47.13  ? 843  ASP A O     1 
ATOM   6890 C  CB    . ASP A 1 843 ? -26.368 -11.790 -15.563 1.00 46.18  ? 843  ASP A CB    1 
ATOM   6891 C  CG    . ASP A 1 843 ? -26.472 -10.424 -16.217 1.00 47.07  ? 843  ASP A CG    1 
ATOM   6892 O  OD1   . ASP A 1 843 ? -27.249 -10.269 -17.187 1.00 44.40  ? 843  ASP A OD1   1 
ATOM   6893 O  OD2   . ASP A 1 843 ? -25.774 -9.499  -15.747 1.00 52.96  ? 843  ASP A OD2   1 
ATOM   6894 N  N     . LYS A 1 844 ? -27.607 -12.898 -18.004 1.00 44.07  ? 844  LYS A N     1 
ATOM   6895 C  CA    . LYS A 1 844 ? -27.797 -13.649 -19.251 1.00 41.97  ? 844  LYS A CA    1 
ATOM   6896 C  C     . LYS A 1 844 ? -26.559 -14.396 -19.778 1.00 38.86  ? 844  LYS A C     1 
ATOM   6897 O  O     . LYS A 1 844 ? -26.657 -15.162 -20.741 1.00 34.37  ? 844  LYS A O     1 
ATOM   6898 C  CB    . LYS A 1 844 ? -28.404 -12.759 -20.342 1.00 43.09  ? 844  LYS A CB    1 
ATOM   6899 C  CG    . LYS A 1 844 ? -27.447 -11.743 -20.960 1.00 43.79  ? 844  LYS A CG    1 
ATOM   6900 C  CD    . LYS A 1 844 ? -28.179 -10.901 -21.996 1.00 44.79  ? 844  LYS A CD    1 
ATOM   6901 C  CE    . LYS A 1 844 ? -27.404 -9.638  -22.347 1.00 45.31  ? 844  LYS A CE    1 
ATOM   6902 N  NZ    . LYS A 1 844 ? -27.996 -8.948  -23.534 1.00 42.11  ? 844  LYS A NZ    1 
ATOM   6903 N  N     . CYS A 1 845 ? -25.405 -14.168 -19.154 1.00 38.25  ? 845  CYS A N     1 
ATOM   6904 C  CA    . CYS A 1 845 ? -24.177 -14.860 -19.547 1.00 36.96  ? 845  CYS A CA    1 
ATOM   6905 C  C     . CYS A 1 845 ? -23.145 -14.903 -18.437 1.00 36.75  ? 845  CYS A C     1 
ATOM   6906 O  O     . CYS A 1 845 ? -23.199 -14.119 -17.493 1.00 37.67  ? 845  CYS A O     1 
ATOM   6907 C  CB    . CYS A 1 845 ? -23.555 -14.227 -20.798 1.00 36.06  ? 845  CYS A CB    1 
ATOM   6908 S  SG    . CYS A 1 845 ? -23.146 -12.487 -20.604 1.00 38.49  ? 845  CYS A SG    1 
ATOM   6909 N  N     . ILE A 1 846 ? -22.206 -15.834 -18.574 1.00 34.98  ? 846  ILE A N     1 
ATOM   6910 C  CA    . ILE A 1 846 ? -21.089 -15.977 -17.659 1.00 33.38  ? 846  ILE A CA    1 
ATOM   6911 C  C     . ILE A 1 846 ? -19.816 -16.253 -18.466 1.00 32.99  ? 846  ILE A C     1 
ATOM   6912 O  O     . ILE A 1 846 ? -19.846 -16.982 -19.458 1.00 34.59  ? 846  ILE A O     1 
ATOM   6913 C  CB    . ILE A 1 846 ? -21.361 -17.081 -16.578 1.00 33.88  ? 846  ILE A CB    1 
ATOM   6914 C  CG1   . ILE A 1 846 ? -20.368 -16.953 -15.410 1.00 34.33  ? 846  ILE A CG1   1 
ATOM   6915 C  CG2   . ILE A 1 846 ? -21.395 -18.488 -17.212 1.00 29.23  ? 846  ILE A CG2   1 
ATOM   6916 C  CD1   . ILE A 1 846 ? -20.665 -17.830 -14.202 1.00 35.16  ? 846  ILE A CD1   1 
ATOM   6917 N  N     . ALA A 1 847 ? -18.714 -15.635 -18.051 1.00 33.65  ? 847  ALA A N     1 
ATOM   6918 C  CA    . ALA A 1 847 ? -17.411 -15.833 -18.679 1.00 33.49  ? 847  ALA A CA    1 
ATOM   6919 C  C     . ALA A 1 847 ? -16.389 -16.261 -17.629 1.00 34.62  ? 847  ALA A C     1 
ATOM   6920 O  O     . ALA A 1 847 ? -16.496 -15.873 -16.469 1.00 35.20  ? 847  ALA A O     1 
ATOM   6921 C  CB    . ALA A 1 847 ? -16.956 -14.549 -19.372 1.00 31.73  ? 847  ALA A CB    1 
ATOM   6922 N  N     . TRP A 1 848 ? -15.410 -17.063 -18.041 1.00 33.75  ? 848  TRP A N     1 
ATOM   6923 C  CA    . TRP A 1 848 ? -14.315 -17.488 -17.164 1.00 33.27  ? 848  TRP A CA    1 
ATOM   6924 C  C     . TRP A 1 848 ? -12.995 -17.614 -17.947 1.00 32.38  ? 848  TRP A C     1 
ATOM   6925 O  O     . TRP A 1 848 ? -13.030 -17.752 -19.163 1.00 32.37  ? 848  TRP A O     1 
ATOM   6926 C  CB    . TRP A 1 848 ? -14.676 -18.796 -16.454 1.00 33.88  ? 848  TRP A CB    1 
ATOM   6927 C  CG    . TRP A 1 848 ? -14.666 -20.033 -17.320 1.00 32.19  ? 848  TRP A CG    1 
ATOM   6928 C  CD1   . TRP A 1 848 ? -13.681 -20.982 -17.378 1.00 30.18  ? 848  TRP A CD1   1 
ATOM   6929 C  CD2   . TRP A 1 848 ? -15.692 -20.466 -18.227 1.00 30.05  ? 848  TRP A CD2   1 
ATOM   6930 N  NE1   . TRP A 1 848 ? -14.027 -21.973 -18.271 1.00 27.83  ? 848  TRP A NE1   1 
ATOM   6931 C  CE2   . TRP A 1 848 ? -15.254 -21.681 -18.805 1.00 27.48  ? 848  TRP A CE2   1 
ATOM   6932 C  CE3   . TRP A 1 848 ? -16.936 -19.946 -18.610 1.00 30.97  ? 848  TRP A CE3   1 
ATOM   6933 C  CZ2   . TRP A 1 848 ? -16.019 -22.384 -19.738 1.00 27.71  ? 848  TRP A CZ2   1 
ATOM   6934 C  CZ3   . TRP A 1 848 ? -17.692 -20.646 -19.545 1.00 27.86  ? 848  TRP A CZ3   1 
ATOM   6935 C  CH2   . TRP A 1 848 ? -17.229 -21.854 -20.095 1.00 26.75  ? 848  TRP A CH2   1 
ATOM   6936 N  N     . PRO A 1 849 ? -11.830 -17.548 -17.259 1.00 33.78  ? 849  PRO A N     1 
ATOM   6937 C  CA    . PRO A 1 849 ? -10.544 -17.619 -17.966 1.00 35.16  ? 849  PRO A CA    1 
ATOM   6938 C  C     . PRO A 1 849 ? -10.448 -18.804 -18.927 1.00 36.22  ? 849  PRO A C     1 
ATOM   6939 O  O     . PRO A 1 849 ? -10.805 -19.926 -18.576 1.00 38.16  ? 849  PRO A O     1 
ATOM   6940 C  CB    . PRO A 1 849 ? -9.527  -17.757 -16.832 1.00 34.68  ? 849  PRO A CB    1 
ATOM   6941 C  CG    . PRO A 1 849 ? -10.149 -17.009 -15.708 1.00 34.85  ? 849  PRO A CG    1 
ATOM   6942 C  CD    . PRO A 1 849 ? -11.639 -17.283 -15.819 1.00 35.76  ? 849  PRO A CD    1 
ATOM   6943 N  N     . SER A 1 850 ? -9.985  -18.536 -20.142 1.00 35.23  ? 850  SER A N     1 
ATOM   6944 C  CA    . SER A 1 850 ? -9.898  -19.562 -21.172 1.00 35.92  ? 850  SER A CA    1 
ATOM   6945 C  C     . SER A 1 850 ? -8.783  -20.577 -20.903 1.00 37.47  ? 850  SER A C     1 
ATOM   6946 O  O     . SER A 1 850 ? -7.870  -20.322 -20.114 1.00 36.81  ? 850  SER A O     1 
ATOM   6947 C  CB    . SER A 1 850 ? -9.709  -18.917 -22.540 1.00 33.26  ? 850  SER A CB    1 
ATOM   6948 O  OG    . SER A 1 850 ? -8.413  -18.365 -22.657 1.00 33.93  ? 850  SER A OG    1 
ATOM   6949 N  N     . GLY A 1 851 ? -8.879  -21.726 -21.571 1.00 41.15  ? 851  GLY A N     1 
ATOM   6950 C  CA    . GLY A 1 851 ? -7.911  -22.820 -21.435 1.00 45.22  ? 851  GLY A CA    1 
ATOM   6951 C  C     . GLY A 1 851 ? -8.172  -23.708 -20.238 1.00 49.30  ? 851  GLY A C     1 
ATOM   6952 O  O     . GLY A 1 851 ? -7.515  -24.737 -20.059 1.00 52.59  ? 851  GLY A O     1 
ATOM   6953 N  N     . THR A 1 852 ? -9.141  -23.312 -19.419 1.00 50.86  ? 852  THR A N     1 
ATOM   6954 C  CA    . THR A 1 852 ? -9.399  -23.989 -18.155 1.00 51.82  ? 852  THR A CA    1 
ATOM   6955 C  C     . THR A 1 852 ? -10.833 -24.494 -18.077 1.00 53.07  ? 852  THR A C     1 
ATOM   6956 O  O     . THR A 1 852 ? -11.747 -23.945 -18.713 1.00 49.83  ? 852  THR A O     1 
ATOM   6957 C  CB    . THR A 1 852 ? -9.144  -23.063 -16.931 1.00 49.75  ? 852  THR A CB    1 
ATOM   6958 O  OG1   . THR A 1 852 ? -10.030 -21.947 -16.996 1.00 47.43  ? 852  THR A OG1   1 
ATOM   6959 C  CG2   . THR A 1 852 ? -7.702  -22.550 -16.894 1.00 50.44  ? 852  THR A CG2   1 
ATOM   6960 N  N     . GLU A 1 853 ? -10.999 -25.566 -17.306 1.00 54.86  ? 853  GLU A N     1 
ATOM   6961 C  CA    . GLU A 1 853 ? -12.285 -25.934 -16.753 1.00 55.18  ? 853  GLU A CA    1 
ATOM   6962 C  C     . GLU A 1 853 ? -12.654 -24.816 -15.782 1.00 54.60  ? 853  GLU A C     1 
ATOM   6963 O  O     . GLU A 1 853 ? -11.794 -24.284 -15.061 1.00 53.22  ? 853  GLU A O     1 
ATOM   6964 C  CB    . GLU A 1 853 ? -12.191 -27.270 -15.999 1.00 57.74  ? 853  GLU A CB    1 
ATOM   6965 C  CG    . GLU A 1 853 ? -11.802 -28.483 -16.858 1.00 61.26  ? 853  GLU A CG    1 
ATOM   6966 C  CD    . GLU A 1 853 ? -12.986 -29.114 -17.593 1.00 63.70  ? 853  GLU A CD    1 
ATOM   6967 O  OE1   . GLU A 1 853 ? -14.104 -29.159 -17.029 1.00 63.48  ? 853  GLU A OE1   1 
ATOM   6968 O  OE2   . GLU A 1 853 ? -12.794 -29.582 -18.736 1.00 64.67  ? 853  GLU A OE2   1 
ATOM   6969 N  N     . ILE A 1 854 ? -13.928 -24.447 -15.788 1.00 54.46  ? 854  ILE A N     1 
ATOM   6970 C  CA    . ILE A 1 854 ? -14.453 -23.465 -14.857 1.00 55.65  ? 854  ILE A CA    1 
ATOM   6971 C  C     . ILE A 1 854 ? -14.403 -24.049 -13.437 1.00 56.83  ? 854  ILE A C     1 
ATOM   6972 O  O     . ILE A 1 854 ? -14.645 -25.244 -13.252 1.00 58.45  ? 854  ILE A O     1 
ATOM   6973 C  CB    . ILE A 1 854 ? -15.881 -23.007 -15.286 1.00 56.05  ? 854  ILE A CB    1 
ATOM   6974 C  CG1   . ILE A 1 854 ? -16.373 -21.841 -14.423 1.00 57.62  ? 854  ILE A CG1   1 
ATOM   6975 C  CG2   . ILE A 1 854 ? -16.874 -24.185 -15.310 1.00 57.01  ? 854  ILE A CG2   1 
ATOM   6976 C  CD1   . ILE A 1 854 ? -17.451 -21.011 -15.085 1.00 57.91  ? 854  ILE A CD1   1 
ATOM   6977 N  N     . THR A 1 855 ? -14.046 -23.218 -12.456 1.00 56.69  ? 855  THR A N     1 
ATOM   6978 C  CA    . THR A 1 855 ? -13.947 -23.648 -11.049 1.00 58.87  ? 855  THR A CA    1 
ATOM   6979 C  C     . THR A 1 855 ? -15.132 -24.510 -10.597 1.00 60.38  ? 855  THR A C     1 
ATOM   6980 O  O     . THR A 1 855 ? -16.284 -24.202 -10.903 1.00 58.20  ? 855  THR A O     1 
ATOM   6981 C  CB    . THR A 1 855 ? -13.739 -22.452 -10.074 1.00 58.65  ? 855  THR A CB    1 
ATOM   6982 O  OG1   . THR A 1 855 ? -13.732 -22.928 -8.723  1.00 59.78  ? 855  THR A OG1   1 
ATOM   6983 C  CG2   . THR A 1 855 ? -14.827 -21.392 -10.226 1.00 57.72  ? 855  THR A CG2   1 
ATOM   6984 N  N     . ASP A 1 856 ? -14.829 -25.591 -9.877  1.00 64.46  ? 856  ASP A N     1 
ATOM   6985 C  CA    . ASP A 1 856 ? -15.836 -26.584 -9.462  1.00 68.04  ? 856  ASP A CA    1 
ATOM   6986 C  C     . ASP A 1 856 ? -16.955 -26.023 -8.577  1.00 69.26  ? 856  ASP A C     1 
ATOM   6987 O  O     . ASP A 1 856 ? -18.006 -26.655 -8.421  1.00 69.43  ? 856  ASP A O     1 
ATOM   6988 C  CB    . ASP A 1 856 ? -15.171 -27.794 -8.789  1.00 71.36  ? 856  ASP A CB    1 
ATOM   6989 C  CG    . ASP A 1 856 ? -14.491 -28.726 -9.789  1.00 74.12  ? 856  ASP A CG    1 
ATOM   6990 O  OD1   . ASP A 1 856 ? -13.443 -29.312 -9.437  1.00 76.70  ? 856  ASP A OD1   1 
ATOM   6991 O  OD2   . ASP A 1 856 ? -14.999 -28.876 -10.925 1.00 75.83  ? 856  ASP A OD2   1 
ATOM   6992 N  N     . LEU A 1 857 ? -16.726 -24.837 -8.014  1.00 69.74  ? 857  LEU A N     1 
ATOM   6993 C  CA    . LEU A 1 857 ? -17.755 -24.103 -7.273  1.00 71.81  ? 857  LEU A CA    1 
ATOM   6994 C  C     . LEU A 1 857 ? -19.017 -23.853 -8.111  1.00 70.18  ? 857  LEU A C     1 
ATOM   6995 O  O     . LEU A 1 857 ? -20.139 -24.014 -7.619  1.00 72.28  ? 857  LEU A O     1 
ATOM   6996 C  CB    . LEU A 1 857 ? -17.198 -22.763 -6.763  1.00 72.97  ? 857  LEU A CB    1 
ATOM   6997 C  CG    . LEU A 1 857 ? -16.319 -22.749 -5.503  1.00 77.27  ? 857  LEU A CG    1 
ATOM   6998 C  CD1   . LEU A 1 857 ? -15.499 -21.460 -5.423  1.00 76.69  ? 857  LEU A CD1   1 
ATOM   6999 C  CD2   . LEU A 1 857 ? -17.149 -22.945 -4.232  1.00 79.43  ? 857  LEU A CD2   1 
ATOM   7000 N  N     . ILE A 1 858 ? -18.824 -23.476 -9.374  1.00 65.66  ? 858  ILE A N     1 
ATOM   7001 C  CA    . ILE A 1 858 ? -19.928 -23.029 -10.229 1.00 62.22  ? 858  ILE A CA    1 
ATOM   7002 C  C     . ILE A 1 858 ? -20.163 -23.904 -11.468 1.00 59.00  ? 858  ILE A C     1 
ATOM   7003 O  O     . ILE A 1 858 ? -21.144 -23.709 -12.189 1.00 58.06  ? 858  ILE A O     1 
ATOM   7004 C  CB    . ILE A 1 858 ? -19.760 -21.538 -10.637 1.00 60.87  ? 858  ILE A CB    1 
ATOM   7005 C  CG1   . ILE A 1 858 ? -18.401 -21.305 -11.303 1.00 60.04  ? 858  ILE A CG1   1 
ATOM   7006 C  CG2   . ILE A 1 858 ? -19.935 -20.630 -9.419  1.00 63.49  ? 858  ILE A CG2   1 
ATOM   7007 C  CD1   . ILE A 1 858 ? -18.180 -19.887 -11.784 1.00 61.03  ? 858  ILE A CD1   1 
ATOM   7008 N  N     . LYS A 1 859 ? -19.276 -24.870 -11.699 1.00 57.19  ? 859  LYS A N     1 
ATOM   7009 C  CA    . LYS A 1 859 ? -19.358 -25.737 -12.882 1.00 54.80  ? 859  LYS A CA    1 
ATOM   7010 C  C     . LYS A 1 859 ? -20.725 -26.404 -13.048 1.00 54.09  ? 859  LYS A C     1 
ATOM   7011 O  O     . LYS A 1 859 ? -21.331 -26.309 -14.117 1.00 53.12  ? 859  LYS A O     1 
ATOM   7012 C  CB    . LYS A 1 859 ? -18.245 -26.793 -12.881 1.00 54.84  ? 859  LYS A CB    1 
ATOM   7013 C  CG    . LYS A 1 859 ? -18.149 -27.564 -14.187 1.00 53.17  ? 859  LYS A CG    1 
ATOM   7014 C  CD    . LYS A 1 859 ? -17.114 -28.667 -14.139 1.00 53.35  ? 859  LYS A CD    1 
ATOM   7015 C  CE    . LYS A 1 859 ? -17.168 -29.476 -15.429 1.00 54.10  ? 859  LYS A CE    1 
ATOM   7016 N  NZ    . LYS A 1 859 ? -16.061 -30.459 -15.545 1.00 54.99  ? 859  LYS A NZ    1 
ATOM   7017 N  N     . ASP A 1 860 ? -21.193 -27.068 -11.990 1.00 53.88  ? 860  ASP A N     1 
ATOM   7018 C  CA    . ASP A 1 860 ? -22.472 -27.786 -11.994 1.00 53.63  ? 860  ASP A CA    1 
ATOM   7019 C  C     . ASP A 1 860 ? -23.641 -26.893 -12.383 1.00 50.36  ? 860  ASP A C     1 
ATOM   7020 O  O     . ASP A 1 860 ? -24.520 -27.310 -13.137 1.00 48.55  ? 860  ASP A O     1 
ATOM   7021 C  CB    . ASP A 1 860 ? -22.742 -28.433 -10.624 1.00 58.35  ? 860  ASP A CB    1 
ATOM   7022 C  CG    . ASP A 1 860 ? -22.173 -29.843 -10.511 1.00 63.99  ? 860  ASP A CG    1 
ATOM   7023 O  OD1   . ASP A 1 860 ? -21.627 -30.360 -11.510 1.00 67.62  ? 860  ASP A OD1   1 
ATOM   7024 O  OD2   . ASP A 1 860 ? -22.276 -30.442 -9.416  1.00 70.41  ? 860  ASP A OD2   1 
ATOM   7025 N  N     . ASP A 1 861 ? -23.636 -25.666 -11.872 1.00 48.98  ? 861  ASP A N     1 
ATOM   7026 C  CA    . ASP A 1 861 ? -24.695 -24.699 -12.155 1.00 49.51  ? 861  ASP A CA    1 
ATOM   7027 C  C     . ASP A 1 861 ? -24.592 -24.069 -13.541 1.00 47.65  ? 861  ASP A C     1 
ATOM   7028 O  O     . ASP A 1 861 ? -25.603 -23.661 -14.109 1.00 47.53  ? 861  ASP A O     1 
ATOM   7029 C  CB    . ASP A 1 861 ? -24.732 -23.614 -11.081 1.00 51.12  ? 861  ASP A CB    1 
ATOM   7030 C  CG    . ASP A 1 861 ? -25.263 -24.129 -9.755  1.00 55.34  ? 861  ASP A CG    1 
ATOM   7031 O  OD1   . ASP A 1 861 ? -24.579 -23.950 -8.724  1.00 57.54  ? 861  ASP A OD1   1 
ATOM   7032 O  OD2   . ASP A 1 861 ? -26.364 -24.719 -9.752  1.00 55.56  ? 861  ASP A OD2   1 
ATOM   7033 N  N     . VAL A 1 862 ? -23.380 -23.981 -14.083 1.00 45.81  ? 862  VAL A N     1 
ATOM   7034 C  CA    . VAL A 1 862 ? -23.205 -23.454 -15.437 1.00 44.06  ? 862  VAL A CA    1 
ATOM   7035 C  C     . VAL A 1 862 ? -23.719 -24.474 -16.451 1.00 44.08  ? 862  VAL A C     1 
ATOM   7036 O  O     . VAL A 1 862 ? -24.487 -24.121 -17.345 1.00 42.45  ? 862  VAL A O     1 
ATOM   7037 C  CB    . VAL A 1 862 ? -21.739 -23.029 -15.729 1.00 42.87  ? 862  VAL A CB    1 
ATOM   7038 C  CG1   . VAL A 1 862 ? -21.533 -22.751 -17.213 1.00 41.19  ? 862  VAL A CG1   1 
ATOM   7039 C  CG2   . VAL A 1 862 ? -21.374 -21.790 -14.921 1.00 42.01  ? 862  VAL A CG2   1 
ATOM   7040 N  N     . LEU A 1 863 ? -23.324 -25.737 -16.281 1.00 45.25  ? 863  LEU A N     1 
ATOM   7041 C  CA    . LEU A 1 863 ? -23.738 -26.823 -17.186 1.00 46.31  ? 863  LEU A CA    1 
ATOM   7042 C  C     . LEU A 1 863 ? -25.246 -27.064 -17.186 1.00 45.88  ? 863  LEU A C     1 
ATOM   7043 O  O     . LEU A 1 863 ? -25.806 -27.521 -18.185 1.00 44.82  ? 863  LEU A O     1 
ATOM   7044 C  CB    . LEU A 1 863 ? -23.027 -28.143 -16.841 1.00 48.64  ? 863  LEU A CB    1 
ATOM   7045 C  CG    . LEU A 1 863 ? -21.498 -28.273 -16.815 1.00 50.76  ? 863  LEU A CG    1 
ATOM   7046 C  CD1   . LEU A 1 863 ? -21.082 -29.717 -17.100 1.00 54.07  ? 863  LEU A CD1   1 
ATOM   7047 C  CD2   . LEU A 1 863 ? -20.828 -27.339 -17.789 1.00 46.92  ? 863  LEU A CD2   1 
ATOM   7048 N  N     . HIS A 1 864 ? -25.884 -26.778 -16.055 1.00 46.55  ? 864  HIS A N     1 
ATOM   7049 C  CA    . HIS A 1 864 ? -27.322 -26.963 -15.902 1.00 49.10  ? 864  HIS A CA    1 
ATOM   7050 C  C     . HIS A 1 864 ? -28.103 -25.785 -16.488 1.00 47.11  ? 864  HIS A C     1 
ATOM   7051 O  O     . HIS A 1 864 ? -29.209 -25.966 -16.998 1.00 46.37  ? 864  HIS A O     1 
ATOM   7052 C  CB    . HIS A 1 864 ? -27.682 -27.173 -14.422 1.00 52.05  ? 864  HIS A CB    1 
ATOM   7053 C  CG    . HIS A 1 864 ? -29.143 -27.394 -14.177 1.00 56.75  ? 864  HIS A CG    1 
ATOM   7054 N  ND1   . HIS A 1 864 ? -30.009 -26.367 -13.864 1.00 58.28  ? 864  HIS A ND1   1 
ATOM   7055 C  CD2   . HIS A 1 864 ? -29.891 -28.523 -14.202 1.00 60.55  ? 864  HIS A CD2   1 
ATOM   7056 C  CE1   . HIS A 1 864 ? -31.227 -26.854 -13.705 1.00 61.67  ? 864  HIS A CE1   1 
ATOM   7057 N  NE2   . HIS A 1 864 ? -31.183 -28.159 -13.906 1.00 63.34  ? 864  HIS A NE2   1 
ATOM   7058 N  N     . TRP A 1 865 ? -27.523 -24.588 -16.409 1.00 45.38  ? 865  TRP A N     1 
ATOM   7059 C  CA    . TRP A 1 865 ? -28.184 -23.375 -16.897 1.00 44.84  ? 865  TRP A CA    1 
ATOM   7060 C  C     . TRP A 1 865 ? -27.668 -22.846 -18.247 1.00 43.12  ? 865  TRP A C     1 
ATOM   7061 O  O     . TRP A 1 865 ? -28.126 -21.804 -18.719 1.00 44.32  ? 865  TRP A O     1 
ATOM   7062 C  CB    . TRP A 1 865 ? -28.159 -22.281 -15.822 1.00 43.85  ? 865  TRP A CB    1 
ATOM   7063 C  CG    . TRP A 1 865 ? -29.046 -22.603 -14.659 1.00 44.51  ? 865  TRP A CG    1 
ATOM   7064 C  CD1   . TRP A 1 865 ? -28.670 -23.173 -13.466 1.00 44.43  ? 865  TRP A CD1   1 
ATOM   7065 C  CD2   . TRP A 1 865 ? -30.461 -22.398 -14.575 1.00 45.02  ? 865  TRP A CD2   1 
ATOM   7066 N  NE1   . TRP A 1 865 ? -29.760 -23.327 -12.653 1.00 44.58  ? 865  TRP A NE1   1 
ATOM   7067 C  CE2   . TRP A 1 865 ? -30.874 -22.861 -13.303 1.00 47.40  ? 865  TRP A CE2   1 
ATOM   7068 C  CE3   . TRP A 1 865 ? -31.423 -21.869 -15.448 1.00 46.50  ? 865  TRP A CE3   1 
ATOM   7069 C  CZ2   . TRP A 1 865 ? -32.209 -22.806 -12.881 1.00 46.68  ? 865  TRP A CZ2   1 
ATOM   7070 C  CZ3   . TRP A 1 865 ? -32.751 -21.816 -15.027 1.00 45.73  ? 865  TRP A CZ3   1 
ATOM   7071 C  CH2   . TRP A 1 865 ? -33.129 -22.282 -13.752 1.00 47.34  ? 865  TRP A CH2   1 
ATOM   7072 N  N     . MET A 1 866 ? -26.724 -23.563 -18.859 1.00 42.88  ? 866  MET A N     1 
ATOM   7073 C  CA    . MET A 1 866 ? -26.244 -23.260 -20.215 1.00 40.23  ? 866  MET A CA    1 
ATOM   7074 C  C     . MET A 1 866 ? -27.409 -23.156 -21.177 1.00 38.80  ? 866  MET A C     1 
ATOM   7075 O  O     . MET A 1 866 ? -28.243 -24.063 -21.232 1.00 39.63  ? 866  MET A O     1 
ATOM   7076 C  CB    . MET A 1 866 ? -25.389 -24.413 -20.736 1.00 41.93  ? 866  MET A CB    1 
ATOM   7077 C  CG    . MET A 1 866 ? -23.929 -24.391 -20.402 1.00 41.34  ? 866  MET A CG    1 
ATOM   7078 S  SD    . MET A 1 866 ? -23.193 -25.898 -21.059 1.00 41.18  ? 866  MET A SD    1 
ATOM   7079 C  CE    . MET A 1 866 ? -23.208 -25.533 -22.807 1.00 40.17  ? 866  MET A CE    1 
ATOM   7080 N  N     . ASP A 1 867 ? -27.452 -22.075 -21.958 1.00 37.60  ? 867  ASP A N     1 
ATOM   7081 C  CA    . ASP A 1 867 ? -28.515 -21.898 -22.958 1.00 35.03  ? 867  ASP A CA    1 
ATOM   7082 C  C     . ASP A 1 867 ? -28.102 -22.423 -24.335 1.00 32.80  ? 867  ASP A C     1 
ATOM   7083 O  O     . ASP A 1 867 ? -27.569 -21.675 -25.167 1.00 29.31  ? 867  ASP A O     1 
ATOM   7084 C  CB    . ASP A 1 867 ? -28.958 -20.435 -23.042 1.00 32.97  ? 867  ASP A CB    1 
ATOM   7085 C  CG    . ASP A 1 867 ? -30.305 -20.267 -23.723 1.00 33.83  ? 867  ASP A CG    1 
ATOM   7086 O  OD1   . ASP A 1 867 ? -30.695 -21.125 -24.550 1.00 34.10  ? 867  ASP A OD1   1 
ATOM   7087 O  OD2   . ASP A 1 867 ? -30.986 -19.264 -23.425 1.00 36.54  ? 867  ASP A OD2   1 
ATOM   7088 N  N     . TYR A 1 868 ? -28.359 -23.711 -24.559 1.00 32.00  ? 868  TYR A N     1 
ATOM   7089 C  CA    . TYR A 1 868 ? -28.062 -24.373 -25.833 1.00 32.32  ? 868  TYR A CA    1 
ATOM   7090 C  C     . TYR A 1 868 ? -28.814 -23.774 -27.022 1.00 32.10  ? 868  TYR A C     1 
ATOM   7091 O  O     . TYR A 1 868 ? -28.249 -23.665 -28.109 1.00 30.21  ? 868  TYR A O     1 
ATOM   7092 C  CB    . TYR A 1 868 ? -28.377 -25.867 -25.753 1.00 34.21  ? 868  TYR A CB    1 
ATOM   7093 C  CG    . TYR A 1 868 ? -27.464 -26.670 -24.850 1.00 36.54  ? 868  TYR A CG    1 
ATOM   7094 C  CD1   . TYR A 1 868 ? -26.316 -27.284 -25.349 1.00 37.63  ? 868  TYR A CD1   1 
ATOM   7095 C  CD2   . TYR A 1 868 ? -27.767 -26.838 -23.502 1.00 41.34  ? 868  TYR A CD2   1 
ATOM   7096 C  CE1   . TYR A 1 868 ? -25.483 -28.040 -24.517 1.00 40.84  ? 868  TYR A CE1   1 
ATOM   7097 C  CE2   . TYR A 1 868 ? -26.946 -27.587 -22.663 1.00 45.41  ? 868  TYR A CE2   1 
ATOM   7098 C  CZ    . TYR A 1 868 ? -25.808 -28.183 -23.173 1.00 43.95  ? 868  TYR A CZ    1 
ATOM   7099 O  OH    . TYR A 1 868 ? -25.008 -28.918 -22.329 1.00 46.71  ? 868  TYR A OH    1 
ATOM   7100 N  N     . THR A 1 869 ? -30.083 -23.401 -26.823 1.00 33.07  ? 869  THR A N     1 
ATOM   7101 C  CA    . THR A 1 869 ? -30.906 -22.816 -27.898 1.00 31.61  ? 869  THR A CA    1 
ATOM   7102 C  C     . THR A 1 869 ? -30.306 -21.498 -28.410 1.00 30.31  ? 869  THR A C     1 
ATOM   7103 O  O     . THR A 1 869 ? -30.200 -21.289 -29.621 1.00 29.16  ? 869  THR A O     1 
ATOM   7104 C  CB    . THR A 1 869 ? -32.379 -22.593 -27.463 1.00 33.93  ? 869  THR A CB    1 
ATOM   7105 O  OG1   . THR A 1 869 ? -32.957 -23.836 -27.045 1.00 37.00  ? 869  THR A OG1   1 
ATOM   7106 C  CG2   . THR A 1 869 ? -33.213 -22.010 -28.618 1.00 31.20  ? 869  THR A CG2   1 
ATOM   7107 N  N     . VAL A 1 870 ? -29.902 -20.627 -27.488 1.00 30.12  ? 870  VAL A N     1 
ATOM   7108 C  CA    . VAL A 1 870 ? -29.270 -19.357 -27.859 1.00 33.02  ? 870  VAL A CA    1 
ATOM   7109 C  C     . VAL A 1 870 ? -27.923 -19.610 -28.543 1.00 34.76  ? 870  VAL A C     1 
ATOM   7110 O  O     . VAL A 1 870 ? -27.610 -19.009 -29.575 1.00 34.02  ? 870  VAL A O     1 
ATOM   7111 C  CB    . VAL A 1 870 ? -29.138 -18.405 -26.652 1.00 32.87  ? 870  VAL A CB    1 
ATOM   7112 C  CG1   . VAL A 1 870 ? -28.154 -17.274 -26.950 1.00 31.53  ? 870  VAL A CG1   1 
ATOM   7113 C  CG2   . VAL A 1 870 ? -30.518 -17.828 -26.296 1.00 32.63  ? 870  VAL A CG2   1 
ATOM   7114 N  N     . LEU A 1 871 ? -27.153 -20.527 -27.969 1.00 35.41  ? 871  LEU A N     1 
ATOM   7115 C  CA    . LEU A 1 871 ? -25.881 -20.952 -28.520 1.00 35.73  ? 871  LEU A CA    1 
ATOM   7116 C  C     . LEU A 1 871 ? -26.015 -21.425 -29.969 1.00 36.39  ? 871  LEU A C     1 
ATOM   7117 O  O     . LEU A 1 871 ? -25.280 -20.975 -30.845 1.00 36.65  ? 871  LEU A O     1 
ATOM   7118 C  CB    . LEU A 1 871 ? -25.339 -22.088 -27.662 1.00 38.35  ? 871  LEU A CB    1 
ATOM   7119 C  CG    . LEU A 1 871 ? -23.851 -22.122 -27.357 1.00 40.85  ? 871  LEU A CG    1 
ATOM   7120 C  CD1   . LEU A 1 871 ? -23.642 -23.006 -26.139 1.00 40.75  ? 871  LEU A CD1   1 
ATOM   7121 C  CD2   . LEU A 1 871 ? -23.051 -22.613 -28.577 1.00 44.21  ? 871  LEU A CD2   1 
ATOM   7122 N  N     . LEU A 1 872 ? -26.952 -22.338 -30.212 1.00 38.10  ? 872  LEU A N     1 
ATOM   7123 C  CA    . LEU A 1 872 ? -27.169 -22.887 -31.543 1.00 38.17  ? 872  LEU A CA    1 
ATOM   7124 C  C     . LEU A 1 872 ? -27.577 -21.798 -32.529 1.00 39.34  ? 872  LEU A C     1 
ATOM   7125 O  O     . LEU A 1 872 ? -26.992 -21.687 -33.604 1.00 41.50  ? 872  LEU A O     1 
ATOM   7126 C  CB    . LEU A 1 872 ? -28.216 -24.006 -31.513 1.00 37.69  ? 872  LEU A CB    1 
ATOM   7127 C  CG    . LEU A 1 872 ? -28.593 -24.618 -32.871 1.00 40.93  ? 872  LEU A CG    1 
ATOM   7128 C  CD1   . LEU A 1 872 ? -27.442 -25.452 -33.448 1.00 41.63  ? 872  LEU A CD1   1 
ATOM   7129 C  CD2   . LEU A 1 872 ? -29.862 -25.448 -32.770 1.00 42.54  ? 872  LEU A CD2   1 
ATOM   7130 N  N     . GLU A 1 873 ? -28.565 -20.991 -32.151 1.00 40.17  ? 873  GLU A N     1 
ATOM   7131 C  CA    . GLU A 1 873 ? -29.061 -19.917 -33.011 1.00 42.15  ? 873  GLU A CA    1 
ATOM   7132 C  C     . GLU A 1 873 ? -28.030 -18.844 -33.364 1.00 40.87  ? 873  GLU A C     1 
ATOM   7133 O  O     . GLU A 1 873 ? -27.996 -18.370 -34.501 1.00 41.19  ? 873  GLU A O     1 
ATOM   7134 C  CB    . GLU A 1 873 ? -30.319 -19.274 -32.409 1.00 44.46  ? 873  GLU A CB    1 
ATOM   7135 C  CG    . GLU A 1 873 ? -31.574 -20.140 -32.545 1.00 51.29  ? 873  GLU A CG    1 
ATOM   7136 C  CD    . GLU A 1 873 ? -32.048 -20.299 -33.991 1.00 56.87  ? 873  GLU A CD    1 
ATOM   7137 O  OE1   . GLU A 1 873 ? -32.827 -21.243 -34.256 1.00 57.99  ? 873  GLU A OE1   1 
ATOM   7138 O  OE2   . GLU A 1 873 ? -31.644 -19.483 -34.857 1.00 59.00  ? 873  GLU A OE2   1 
ATOM   7139 N  N     . LYS A 1 874 ? -27.188 -18.474 -32.404 1.00 39.37  ? 874  LYS A N     1 
ATOM   7140 C  CA    . LYS A 1 874 ? -26.263 -17.354 -32.590 1.00 39.31  ? 874  LYS A CA    1 
ATOM   7141 C  C     . LYS A 1 874 ? -24.951 -17.706 -33.281 1.00 38.38  ? 874  LYS A C     1 
ATOM   7142 O  O     . LYS A 1 874 ? -24.494 -16.961 -34.149 1.00 39.67  ? 874  LYS A O     1 
ATOM   7143 C  CB    . LYS A 1 874 ? -25.980 -16.654 -31.254 1.00 40.68  ? 874  LYS A CB    1 
ATOM   7144 C  CG    . LYS A 1 874 ? -26.864 -15.440 -30.990 1.00 43.19  ? 874  LYS A CG    1 
ATOM   7145 C  CD    . LYS A 1 874 ? -26.872 -14.998 -29.527 1.00 44.00  ? 874  LYS A CD    1 
ATOM   7146 C  CE    . LYS A 1 874 ? -25.488 -15.040 -28.880 1.00 44.07  ? 874  LYS A CE    1 
ATOM   7147 N  NZ    . LYS A 1 874 ? -25.522 -14.457 -27.505 1.00 44.96  ? 874  LYS A NZ    1 
ATOM   7148 N  N     . THR A 1 875 ? -24.340 -18.824 -32.898 1.00 36.01  ? 875  THR A N     1 
ATOM   7149 C  CA    . THR A 1 875 ? -22.994 -19.137 -33.379 1.00 34.70  ? 875  THR A CA    1 
ATOM   7150 C  C     . THR A 1 875 ? -23.002 -20.094 -34.558 1.00 32.97  ? 875  THR A C     1 
ATOM   7151 O  O     . THR A 1 875 ? -22.013 -20.198 -35.290 1.00 31.58  ? 875  THR A O     1 
ATOM   7152 C  CB    . THR A 1 875 ? -22.073 -19.704 -32.262 1.00 34.52  ? 875  THR A CB    1 
ATOM   7153 O  OG1   . THR A 1 875 ? -22.366 -21.091 -32.044 1.00 36.20  ? 875  THR A OG1   1 
ATOM   7154 C  CG2   . THR A 1 875 ? -22.246 -18.923 -30.960 1.00 34.57  ? 875  THR A CG2   1 
ATOM   7155 N  N     . PHE A 1 876 ? -24.116 -20.791 -34.740 1.00 32.31  ? 876  PHE A N     1 
ATOM   7156 C  CA    . PHE A 1 876 ? -24.203 -21.773 -35.806 1.00 31.77  ? 876  PHE A CA    1 
ATOM   7157 C  C     . PHE A 1 876 ? -25.216 -21.404 -36.888 1.00 32.14  ? 876  PHE A C     1 
ATOM   7158 O  O     . PHE A 1 876 ? -24.835 -21.194 -38.040 1.00 31.94  ? 876  PHE A O     1 
ATOM   7159 C  CB    . PHE A 1 876 ? -24.487 -23.164 -35.242 1.00 30.59  ? 876  PHE A CB    1 
ATOM   7160 C  CG    . PHE A 1 876 ? -24.481 -24.234 -36.276 1.00 29.87  ? 876  PHE A CG    1 
ATOM   7161 C  CD1   . PHE A 1 876 ? -23.287 -24.655 -36.846 1.00 26.34  ? 876  PHE A CD1   1 
ATOM   7162 C  CD2   . PHE A 1 876 ? -25.669 -24.816 -36.694 1.00 28.95  ? 876  PHE A CD2   1 
ATOM   7163 C  CE1   . PHE A 1 876 ? -23.282 -25.641 -37.822 1.00 31.04  ? 876  PHE A CE1   1 
ATOM   7164 C  CE2   . PHE A 1 876 ? -25.669 -25.807 -37.665 1.00 31.28  ? 876  PHE A CE2   1 
ATOM   7165 C  CZ    . PHE A 1 876 ? -24.478 -26.221 -38.228 1.00 30.94  ? 876  PHE A CZ    1 
ATOM   7166 N  N     . ILE A 1 877 ? -26.497 -21.327 -36.524 1.00 32.55  ? 877  ILE A N     1 
ATOM   7167 C  CA    . ILE A 1 877 ? -27.560 -21.144 -37.519 1.00 32.56  ? 877  ILE A CA    1 
ATOM   7168 C  C     . ILE A 1 877 ? -27.467 -19.804 -38.261 1.00 32.06  ? 877  ILE A C     1 
ATOM   7169 O  O     . ILE A 1 877 ? -27.562 -19.766 -39.489 1.00 32.93  ? 877  ILE A O     1 
ATOM   7170 C  CB    . ILE A 1 877 ? -28.980 -21.409 -36.933 1.00 33.85  ? 877  ILE A CB    1 
ATOM   7171 C  CG1   . ILE A 1 877 ? -29.113 -22.886 -36.528 1.00 35.46  ? 877  ILE A CG1   1 
ATOM   7172 C  CG2   . ILE A 1 877 ? -30.080 -21.048 -37.954 1.00 32.56  ? 877  ILE A CG2   1 
ATOM   7173 C  CD1   . ILE A 1 877 ? -30.465 -23.272 -35.930 1.00 39.97  ? 877  ILE A CD1   1 
ATOM   7174 N  N     . LYS A 1 878 ? -27.251 -18.717 -37.530 1.00 31.63  ? 878  LYS A N     1 
ATOM   7175 C  CA    . LYS A 1 878 ? -27.150 -17.408 -38.171 1.00 34.48  ? 878  LYS A CA    1 
ATOM   7176 C  C     . LYS A 1 878 ? -26.028 -17.343 -39.231 1.00 32.39  ? 878  LYS A C     1 
ATOM   7177 O  O     . LYS A 1 878 ? -26.284 -16.911 -40.354 1.00 33.03  ? 878  LYS A O     1 
ATOM   7178 C  CB    . LYS A 1 878 ? -27.036 -16.267 -37.148 1.00 35.80  ? 878  LYS A CB    1 
ATOM   7179 C  CG    . LYS A 1 878 ? -27.883 -15.067 -37.530 1.00 41.18  ? 878  LYS A CG    1 
ATOM   7180 C  CD    . LYS A 1 878 ? -27.322 -13.757 -37.016 1.00 48.75  ? 878  LYS A CD    1 
ATOM   7181 C  CE    . LYS A 1 878 ? -27.921 -12.581 -37.800 1.00 51.31  ? 878  LYS A CE    1 
ATOM   7182 N  NZ    . LYS A 1 878 ? -27.575 -11.256 -37.216 1.00 51.88  ? 878  LYS A NZ    1 
ATOM   7183 N  N     . PRO A 1 879 ? -24.793 -17.778 -38.884 1.00 32.05  ? 879  PRO A N     1 
ATOM   7184 C  CA    . PRO A 1 879 ? -23.724 -17.800 -39.885 1.00 30.72  ? 879  PRO A CA    1 
ATOM   7185 C  C     . PRO A 1 879 ? -24.008 -18.722 -41.069 1.00 29.41  ? 879  PRO A C     1 
ATOM   7186 O  O     . PRO A 1 879 ? -23.776 -18.330 -42.208 1.00 28.12  ? 879  PRO A O     1 
ATOM   7187 C  CB    . PRO A 1 879 ? -22.520 -18.316 -39.097 1.00 30.64  ? 879  PRO A CB    1 
ATOM   7188 C  CG    . PRO A 1 879 ? -22.804 -17.944 -37.704 1.00 30.68  ? 879  PRO A CG    1 
ATOM   7189 C  CD    . PRO A 1 879 ? -24.267 -18.099 -37.540 1.00 31.94  ? 879  PRO A CD    1 
ATOM   7190 N  N     . LEU A 1 880 ? -24.498 -19.933 -40.802 1.00 29.48  ? 880  LEU A N     1 
ATOM   7191 C  CA    . LEU A 1 880 ? -24.875 -20.861 -41.879 1.00 30.53  ? 880  LEU A CA    1 
ATOM   7192 C  C     . LEU A 1 880 ? -25.947 -20.285 -42.829 1.00 30.01  ? 880  LEU A C     1 
ATOM   7193 O  O     . LEU A 1 880 ? -25.841 -20.436 -44.051 1.00 30.75  ? 880  LEU A O     1 
ATOM   7194 C  CB    . LEU A 1 880 ? -25.318 -22.212 -41.304 1.00 30.41  ? 880  LEU A CB    1 
ATOM   7195 C  CG    . LEU A 1 880 ? -25.730 -23.312 -42.289 1.00 30.39  ? 880  LEU A CG    1 
ATOM   7196 C  CD1   . LEU A 1 880 ? -24.540 -23.783 -43.107 1.00 33.80  ? 880  LEU A CD1   1 
ATOM   7197 C  CD2   . LEU A 1 880 ? -26.345 -24.480 -41.554 1.00 26.34  ? 880  LEU A CD2   1 
ATOM   7198 N  N     . GLU A 1 881 ? -26.964 -19.631 -42.268 1.00 31.44  ? 881  GLU A N     1 
ATOM   7199 C  CA    . GLU A 1 881 ? -27.990 -18.945 -43.069 1.00 34.32  ? 881  GLU A CA    1 
ATOM   7200 C  C     . GLU A 1 881 ? -27.322 -17.894 -43.954 1.00 32.37  ? 881  GLU A C     1 
ATOM   7201 O  O     . GLU A 1 881 ? -27.685 -17.728 -45.118 1.00 32.54  ? 881  GLU A O     1 
ATOM   7202 C  CB    . GLU A 1 881 ? -29.032 -18.271 -42.167 1.00 37.02  ? 881  GLU A CB    1 
ATOM   7203 C  CG    . GLU A 1 881 ? -30.492 -18.391 -42.636 1.00 48.10  ? 881  GLU A CG    1 
ATOM   7204 C  CD    . GLU A 1 881 ? -30.809 -17.627 -43.919 1.00 55.65  ? 881  GLU A CD    1 
ATOM   7205 O  OE1   . GLU A 1 881 ? -31.406 -18.233 -44.839 1.00 61.83  ? 881  GLU A OE1   1 
ATOM   7206 O  OE2   . GLU A 1 881 ? -30.477 -16.424 -44.016 1.00 60.83  ? 881  GLU A OE2   1 
ATOM   7207 N  N     . GLY A 1 882 ? -26.338 -17.197 -43.386 1.00 30.76  ? 882  GLY A N     1 
ATOM   7208 C  CA    . GLY A 1 882 ? -25.506 -16.258 -44.131 1.00 28.70  ? 882  GLY A CA    1 
ATOM   7209 C  C     . GLY A 1 882 ? -24.789 -16.909 -45.302 1.00 27.60  ? 882  GLY A C     1 
ATOM   7210 O  O     . GLY A 1 882 ? -24.782 -16.352 -46.402 1.00 26.58  ? 882  GLY A O     1 
ATOM   7211 N  N     . PHE A 1 883 ? -24.187 -18.080 -45.069 1.00 25.35  ? 883  PHE A N     1 
ATOM   7212 C  CA    . PHE A 1 883 ? -23.481 -18.814 -46.128 1.00 24.68  ? 883  PHE A CA    1 
ATOM   7213 C  C     . PHE A 1 883 ? -24.445 -19.227 -47.218 1.00 26.09  ? 883  PHE A C     1 
ATOM   7214 O  O     . PHE A 1 883 ? -24.179 -19.009 -48.398 1.00 26.35  ? 883  PHE A O     1 
ATOM   7215 C  CB    . PHE A 1 883 ? -22.780 -20.094 -45.621 1.00 22.09  ? 883  PHE A CB    1 
ATOM   7216 C  CG    . PHE A 1 883 ? -21.815 -19.879 -44.484 1.00 20.96  ? 883  PHE A CG    1 
ATOM   7217 C  CD1   . PHE A 1 883 ? -21.289 -18.617 -44.200 1.00 20.31  ? 883  PHE A CD1   1 
ATOM   7218 C  CD2   . PHE A 1 883 ? -21.406 -20.963 -43.712 1.00 21.53  ? 883  PHE A CD2   1 
ATOM   7219 C  CE1   . PHE A 1 883 ? -20.397 -18.430 -43.143 1.00 20.10  ? 883  PHE A CE1   1 
ATOM   7220 C  CE2   . PHE A 1 883 ? -20.504 -20.794 -42.660 1.00 23.62  ? 883  PHE A CE2   1 
ATOM   7221 C  CZ    . PHE A 1 883 ? -20.001 -19.523 -42.368 1.00 18.31  ? 883  PHE A CZ    1 
ATOM   7222 N  N     . THR A 1 884 ? -25.564 -19.820 -46.803 1.00 25.41  ? 884  THR A N     1 
ATOM   7223 C  CA    . THR A 1 884 ? -26.479 -20.491 -47.719 1.00 24.43  ? 884  THR A CA    1 
ATOM   7224 C  C     . THR A 1 884 ? -27.288 -19.515 -48.577 1.00 27.48  ? 884  THR A C     1 
ATOM   7225 O  O     . THR A 1 884 ? -27.509 -19.775 -49.765 1.00 28.39  ? 884  THR A O     1 
ATOM   7226 C  CB    . THR A 1 884 ? -27.404 -21.499 -46.988 1.00 23.36  ? 884  THR A CB    1 
ATOM   7227 O  OG1   . THR A 1 884 ? -28.067 -20.850 -45.900 1.00 23.30  ? 884  THR A OG1   1 
ATOM   7228 C  CG2   . THR A 1 884 ? -26.596 -22.666 -46.441 1.00 22.07  ? 884  THR A CG2   1 
ATOM   7229 N  N     . SER A 1 885 ? -27.715 -18.397 -47.993 1.00 28.11  ? 885  SER A N     1 
ATOM   7230 C  CA    . SER A 1 885 ? -28.380 -17.348 -48.773 1.00 31.57  ? 885  SER A CA    1 
ATOM   7231 C  C     . SER A 1 885 ? -27.420 -16.744 -49.803 1.00 33.47  ? 885  SER A C     1 
ATOM   7232 O  O     . SER A 1 885 ? -27.806 -16.500 -50.945 1.00 34.54  ? 885  SER A O     1 
ATOM   7233 C  CB    . SER A 1 885 ? -28.985 -16.262 -47.878 1.00 32.09  ? 885  SER A CB    1 
ATOM   7234 O  OG    . SER A 1 885 ? -28.031 -15.758 -46.965 1.00 35.60  ? 885  SER A OG    1 
ATOM   7235 N  N     . ALA A 1 886 ? -26.164 -16.539 -49.412 1.00 32.74  ? 886  ALA A N     1 
ATOM   7236 C  CA    . ALA A 1 886 ? -25.149 -16.078 -50.359 1.00 33.01  ? 886  ALA A CA    1 
ATOM   7237 C  C     . ALA A 1 886 ? -24.961 -17.091 -51.490 1.00 31.77  ? 886  ALA A C     1 
ATOM   7238 O  O     . ALA A 1 886 ? -24.851 -16.710 -52.649 1.00 32.89  ? 886  ALA A O     1 
ATOM   7239 C  CB    . ALA A 1 886 ? -23.824 -15.809 -49.652 1.00 31.71  ? 886  ALA A CB    1 
ATOM   7240 N  N     . ALA A 1 887 ? -24.938 -18.376 -51.144 1.00 31.60  ? 887  ALA A N     1 
ATOM   7241 C  CA    . ALA A 1 887 ? -24.739 -19.445 -52.131 1.00 32.13  ? 887  ALA A CA    1 
ATOM   7242 C  C     . ALA A 1 887 ? -26.021 -19.875 -52.857 1.00 33.77  ? 887  ALA A C     1 
ATOM   7243 O  O     . ALA A 1 887 ? -25.968 -20.729 -53.746 1.00 34.56  ? 887  ALA A O     1 
ATOM   7244 C  CB    . ALA A 1 887 ? -24.083 -20.636 -51.478 1.00 29.97  ? 887  ALA A CB    1 
ATOM   7245 N  N     . LYS A 1 888 ? -27.158 -19.281 -52.476 1.00 35.70  ? 888  LYS A N     1 
ATOM   7246 C  CA    . LYS A 1 888 ? -28.488 -19.593 -53.042 1.00 37.33  ? 888  LYS A CA    1 
ATOM   7247 C  C     . LYS A 1 888 ? -28.858 -21.059 -52.812 1.00 37.33  ? 888  LYS A C     1 
ATOM   7248 O  O     . LYS A 1 888 ? -29.352 -21.747 -53.716 1.00 38.81  ? 888  LYS A O     1 
ATOM   7249 C  CB    . LYS A 1 888 ? -28.586 -19.242 -54.534 1.00 37.08  ? 888  LYS A CB    1 
ATOM   7250 C  CG    . LYS A 1 888 ? -27.812 -18.012 -54.968 1.00 43.37  ? 888  LYS A CG    1 
ATOM   7251 C  CD    . LYS A 1 888 ? -28.679 -16.783 -55.136 1.00 48.18  ? 888  LYS A CD    1 
ATOM   7252 C  CE    . LYS A 1 888 ? -27.898 -15.706 -55.880 1.00 50.56  ? 888  LYS A CE    1 
ATOM   7253 N  NZ    . LYS A 1 888 ? -28.736 -14.540 -56.259 1.00 55.80  ? 888  LYS A NZ    1 
ATOM   7254 N  N     . LEU A 1 889 ? -28.600 -21.518 -51.594 1.00 36.54  ? 889  LEU A N     1 
ATOM   7255 C  CA    . LEU A 1 889 ? -28.912 -22.875 -51.161 1.00 37.99  ? 889  LEU A CA    1 
ATOM   7256 C  C     . LEU A 1 889 ? -29.875 -22.817 -49.990 1.00 37.55  ? 889  LEU A C     1 
ATOM   7257 O  O     . LEU A 1 889 ? -29.977 -21.798 -49.306 1.00 36.76  ? 889  LEU A O     1 
ATOM   7258 C  CB    . LEU A 1 889 ? -27.631 -23.595 -50.713 1.00 37.27  ? 889  LEU A CB    1 
ATOM   7259 C  CG    . LEU A 1 889 ? -26.882 -24.617 -51.581 1.00 39.23  ? 889  LEU A CG    1 
ATOM   7260 C  CD1   . LEU A 1 889 ? -27.436 -24.792 -52.987 1.00 44.45  ? 889  LEU A CD1   1 
ATOM   7261 C  CD2   . LEU A 1 889 ? -25.401 -24.286 -51.629 1.00 37.93  ? 889  LEU A CD2   1 
ATOM   7262 N  N     . ASP A 1 890 ? -30.579 -23.919 -49.762 1.00 37.76  ? 890  ASP A N     1 
ATOM   7263 C  CA    . ASP A 1 890 ? -31.372 -24.076 -48.558 1.00 38.40  ? 890  ASP A CA    1 
ATOM   7264 C  C     . ASP A 1 890 ? -30.733 -25.131 -47.655 1.00 36.87  ? 890  ASP A C     1 
ATOM   7265 O  O     . ASP A 1 890 ? -30.328 -26.199 -48.122 1.00 34.00  ? 890  ASP A O     1 
ATOM   7266 C  CB    . ASP A 1 890 ? -32.829 -24.411 -48.914 1.00 41.11  ? 890  ASP A CB    1 
ATOM   7267 C  CG    . ASP A 1 890 ? -33.646 -23.166 -49.280 1.00 45.76  ? 890  ASP A CG    1 
ATOM   7268 O  OD1   . ASP A 1 890 ? -33.624 -22.177 -48.506 1.00 50.02  ? 890  ASP A OD1   1 
ATOM   7269 O  OD2   . ASP A 1 890 ? -34.318 -23.173 -50.334 1.00 48.43  ? 890  ASP A OD2   1 
ATOM   7270 N  N     . TYR A 1 891 ? -30.601 -24.815 -46.369 1.00 36.47  ? 891  TYR A N     1 
ATOM   7271 C  CA    . TYR A 1 891 ? -30.041 -25.776 -45.426 1.00 36.55  ? 891  TYR A CA    1 
ATOM   7272 C  C     . TYR A 1 891 ? -31.138 -26.663 -44.842 1.00 38.67  ? 891  TYR A C     1 
ATOM   7273 O  O     . TYR A 1 891 ? -30.861 -27.618 -44.122 1.00 38.48  ? 891  TYR A O     1 
ATOM   7274 C  CB    . TYR A 1 891 ? -29.201 -25.088 -44.334 1.00 37.58  ? 891  TYR A CB    1 
ATOM   7275 C  CG    . TYR A 1 891 ? -29.970 -24.155 -43.425 1.00 37.03  ? 891  TYR A CG    1 
ATOM   7276 C  CD1   . TYR A 1 891 ? -30.065 -22.798 -43.710 1.00 38.57  ? 891  TYR A CD1   1 
ATOM   7277 C  CD2   . TYR A 1 891 ? -30.589 -24.630 -42.274 1.00 37.77  ? 891  TYR A CD2   1 
ATOM   7278 C  CE1   . TYR A 1 891 ? -30.771 -21.940 -42.880 1.00 41.17  ? 891  TYR A CE1   1 
ATOM   7279 C  CE2   . TYR A 1 891 ? -31.298 -23.778 -41.437 1.00 40.07  ? 891  TYR A CE2   1 
ATOM   7280 C  CZ    . TYR A 1 891 ? -31.381 -22.437 -41.742 1.00 39.86  ? 891  TYR A CZ    1 
ATOM   7281 O  OH    . TYR A 1 891 ? -32.083 -21.593 -40.915 1.00 39.74  ? 891  TYR A OH    1 
ATOM   7282 N  N     . GLU A 1 892 ? -32.383 -26.333 -45.166 1.00 41.46  ? 892  GLU A N     1 
ATOM   7283 C  CA    . GLU A 1 892 ? -33.534 -27.153 -44.810 1.00 44.52  ? 892  GLU A CA    1 
ATOM   7284 C  C     . GLU A 1 892 ? -34.327 -27.451 -46.070 1.00 45.72  ? 892  GLU A C     1 
ATOM   7285 O  O     . GLU A 1 892 ? -34.604 -26.547 -46.861 1.00 45.23  ? 892  GLU A O     1 
ATOM   7286 C  CB    . GLU A 1 892 ? -34.407 -26.446 -43.770 1.00 45.03  ? 892  GLU A CB    1 
ATOM   7287 C  CG    . GLU A 1 892 ? -33.744 -26.330 -42.405 1.00 46.52  ? 892  GLU A CG    1 
ATOM   7288 C  CD    . GLU A 1 892 ? -34.681 -25.840 -41.319 1.00 49.37  ? 892  GLU A CD    1 
ATOM   7289 O  OE1   . GLU A 1 892 ? -34.844 -26.568 -40.317 1.00 50.29  ? 892  GLU A OE1   1 
ATOM   7290 O  OE2   . GLU A 1 892 ? -35.251 -24.735 -41.462 1.00 50.07  ? 892  GLU A OE2   1 
ATOM   7291 N  N     . LYS A 1 893 ? -34.675 -28.719 -46.267 1.00 48.55  ? 893  LYS A N     1 
ATOM   7292 C  CA    . LYS A 1 893 ? -35.383 -29.122 -47.476 1.00 52.76  ? 893  LYS A CA    1 
ATOM   7293 C  C     . LYS A 1 893 ? -36.762 -28.475 -47.553 1.00 53.89  ? 893  LYS A C     1 
ATOM   7294 O  O     . LYS A 1 893 ? -37.624 -28.718 -46.705 1.00 55.81  ? 893  LYS A O     1 
ATOM   7295 C  CB    . LYS A 1 893 ? -35.503 -30.644 -47.579 1.00 54.60  ? 893  LYS A CB    1 
ATOM   7296 C  CG    . LYS A 1 893 ? -35.872 -31.109 -48.980 1.00 57.53  ? 893  LYS A CG    1 
ATOM   7297 C  CD    . LYS A 1 893 ? -36.292 -32.568 -49.009 1.00 62.67  ? 893  LYS A CD    1 
ATOM   7298 C  CE    . LYS A 1 893 ? -36.672 -32.986 -50.421 1.00 64.81  ? 893  LYS A CE    1 
ATOM   7299 N  NZ    . LYS A 1 893 ? -37.339 -34.314 -50.442 1.00 68.21  ? 893  LYS A NZ    1 
ATOM   7300 N  N     . LYS A 1 894 ? -36.949 -27.640 -48.568 1.00 54.94  ? 894  LYS A N     1 
ATOM   7301 C  CA    . LYS A 1 894 ? -38.242 -27.015 -48.835 1.00 57.04  ? 894  LYS A CA    1 
ATOM   7302 C  C     . LYS A 1 894 ? -39.238 -28.070 -49.317 1.00 57.49  ? 894  LYS A C     1 
ATOM   7303 O  O     . LYS A 1 894 ? -38.842 -29.083 -49.903 1.00 58.10  ? 894  LYS A O     1 
ATOM   7304 C  CB    . LYS A 1 894 ? -38.098 -25.898 -49.876 1.00 57.25  ? 894  LYS A CB    1 
ATOM   7305 C  CG    . LYS A 1 894 ? -37.250 -26.281 -51.085 1.00 60.82  ? 894  LYS A CG    1 
ATOM   7306 C  CD    . LYS A 1 894 ? -37.712 -25.562 -52.342 1.00 66.19  ? 894  LYS A CD    1 
ATOM   7307 C  CE    . LYS A 1 894 ? -37.063 -26.160 -53.588 1.00 68.68  ? 894  LYS A CE    1 
ATOM   7308 N  NZ    . LYS A 1 894 ? -37.835 -25.842 -54.823 1.00 69.59  ? 894  LYS A NZ    1 
ATOM   7309 N  N     . ALA A 1 895 ? -40.522 -27.837 -49.058 1.00 56.51  ? 895  ALA A N     1 
ATOM   7310 C  CA    . ALA A 1 895 ? -41.574 -28.745 -49.508 1.00 57.63  ? 895  ALA A CA    1 
ATOM   7311 C  C     . ALA A 1 895 ? -41.670 -28.777 -51.035 1.00 57.61  ? 895  ALA A C     1 
ATOM   7312 O  O     . ALA A 1 895 ? -41.387 -27.777 -51.706 1.00 57.60  ? 895  ALA A O     1 
ATOM   7313 C  CB    . ALA A 1 895 ? -42.909 -28.354 -48.894 1.00 58.19  ? 895  ALA A CB    1 
ATOM   7314 N  N     . SER A 1 896 ? -42.048 -29.931 -51.578 1.00 58.01  ? 896  SER A N     1 
ATOM   7315 C  CA    . SER A 1 896 ? -42.294 -30.064 -53.018 1.00 59.42  ? 896  SER A CA    1 
ATOM   7316 C  C     . SER A 1 896 ? -43.549 -30.893 -53.313 1.00 59.64  ? 896  SER A C     1 
ATOM   7317 O  O     . SER A 1 896 ? -44.094 -31.557 -52.425 1.00 58.76  ? 896  SER A O     1 
ATOM   7318 C  CB    . SER A 1 896 ? -41.068 -30.651 -53.737 1.00 59.30  ? 896  SER A CB    1 
ATOM   7319 O  OG    . SER A 1 896 ? -41.044 -32.066 -53.653 1.00 61.25  ? 896  SER A OG    1 
ATOM   7320 N  N     . LEU A 1 897 ? -43.992 -30.851 -54.568 1.00 60.21  ? 897  LEU A N     1 
ATOM   7321 C  CA    . LEU A 1 897 ? -45.159 -31.609 -55.028 1.00 60.89  ? 897  LEU A CA    1 
ATOM   7322 C  C     . LEU A 1 897 ? -45.053 -33.118 -54.787 1.00 61.08  ? 897  LEU A C     1 
ATOM   7323 O  O     . LEU A 1 897 ? -46.068 -33.804 -54.679 1.00 61.36  ? 897  LEU A O     1 
ATOM   7324 C  CB    . LEU A 1 897 ? -45.425 -31.321 -56.510 1.00 61.79  ? 897  LEU A CB    1 
ATOM   7325 C  CG    . LEU A 1 897 ? -46.462 -30.262 -56.925 1.00 61.55  ? 897  LEU A CG    1 
ATOM   7326 C  CD1   . LEU A 1 897 ? -46.550 -29.059 -55.982 1.00 58.10  ? 897  LEU A CD1   1 
ATOM   7327 C  CD2   . LEU A 1 897 ? -46.183 -29.807 -58.357 1.00 62.36  ? 897  LEU A CD2   1 
ATOM   7328 N  N     . PHE A 1 898 ? -43.824 -33.619 -54.685 1.00 61.08  ? 898  PHE A N     1 
ATOM   7329 C  CA    . PHE A 1 898 ? -43.566 -35.036 -54.421 1.00 63.42  ? 898  PHE A CA    1 
ATOM   7330 C  C     . PHE A 1 898 ? -44.001 -35.526 -53.035 1.00 65.25  ? 898  PHE A C     1 
ATOM   7331 O  O     . PHE A 1 898 ? -44.244 -36.726 -52.854 1.00 65.73  ? 898  PHE A O     1 
ATOM   7332 C  CB    . PHE A 1 898 ? -42.093 -35.369 -54.674 1.00 63.58  ? 898  PHE A CB    1 
ATOM   7333 C  CG    . PHE A 1 898 ? -41.761 -35.535 -56.126 1.00 64.17  ? 898  PHE A CG    1 
ATOM   7334 C  CD1   . PHE A 1 898 ? -41.833 -36.790 -56.726 1.00 66.79  ? 898  PHE A CD1   1 
ATOM   7335 C  CD2   . PHE A 1 898 ? -41.402 -34.437 -56.901 1.00 63.03  ? 898  PHE A CD2   1 
ATOM   7336 C  CE1   . PHE A 1 898 ? -41.540 -36.957 -58.075 1.00 67.22  ? 898  PHE A CE1   1 
ATOM   7337 C  CE2   . PHE A 1 898 ? -41.108 -34.591 -58.252 1.00 67.07  ? 898  PHE A CE2   1 
ATOM   7338 C  CZ    . PHE A 1 898 ? -41.177 -35.858 -58.840 1.00 67.18  ? 898  PHE A CZ    1 
ATOM   7339 N  N     . ASP A 1 899 ? -44.108 -34.600 -52.077 1.00 64.86  ? 899  ASP A N     1 
ATOM   7340 C  CA    . ASP A 1 899 ? -44.611 -34.898 -50.729 1.00 67.36  ? 899  ASP A CA    1 
ATOM   7341 C  C     . ASP A 1 899 ? -46.092 -35.292 -50.746 1.00 71.38  ? 899  ASP A C     1 
ATOM   7342 O  O     . ASP A 1 899 ? -46.859 -34.890 -49.870 1.00 72.53  ? 899  ASP A O     1 
ATOM   7343 C  CB    . ASP A 1 899 ? -44.429 -33.686 -49.803 1.00 64.64  ? 899  ASP A CB    1 
ATOM   7344 C  CG    . ASP A 1 899 ? -42.979 -33.279 -49.636 1.00 62.60  ? 899  ASP A CG    1 
ATOM   7345 O  OD1   . ASP A 1 899 ? -42.724 -32.060 -49.521 1.00 59.76  ? 899  ASP A OD1   1 
ATOM   7346 O  OD2   . ASP A 1 899 ? -42.097 -34.168 -49.613 1.00 62.81  ? 899  ASP A OD2   1 
ATOM   7347 N  N     . MET A 1 900 ? -46.488 -36.085 -51.735 1.00 75.08  ? 900  MET A N     1 
ATOM   7348 C  CA    . MET A 1 900 ? -47.896 -36.374 -51.958 1.00 79.22  ? 900  MET A CA    1 
ATOM   7349 C  C     . MET A 1 900 ? -48.115 -37.844 -52.296 1.00 82.66  ? 900  MET A C     1 
ATOM   7350 O  O     . MET A 1 900 ? -49.248 -38.276 -52.503 1.00 85.02  ? 900  MET A O     1 
ATOM   7351 C  CB    . MET A 1 900 ? -48.416 -35.480 -53.082 1.00 78.86  ? 900  MET A CB    1 
ATOM   7352 C  CG    . MET A 1 900 ? -49.610 -34.637 -52.700 1.00 80.06  ? 900  MET A CG    1 
ATOM   7353 S  SD    . MET A 1 900 ? -49.415 -32.936 -53.267 1.00 78.60  ? 900  MET A SD    1 
ATOM   7354 C  CE    . MET A 1 900 ? -51.017 -32.257 -52.833 1.00 80.40  ? 900  MET A CE    1 
ATOM   7355 N  N     . PHE A 1 901 ? -47.024 -38.605 -52.326 1.00 85.55  ? 901  PHE A N     1 
ATOM   7356 C  CA    . PHE A 1 901 ? -47.047 -39.998 -52.766 1.00 90.82  ? 901  PHE A CA    1 
ATOM   7357 C  C     . PHE A 1 901 ? -46.418 -40.949 -51.742 1.00 94.40  ? 901  PHE A C     1 
ATOM   7358 O  O     . PHE A 1 901 ? -45.771 -40.509 -50.786 1.00 92.54  ? 901  PHE A O     1 
ATOM   7359 C  CB    . PHE A 1 901 ? -46.314 -40.135 -54.109 1.00 89.97  ? 901  PHE A CB    1 
ATOM   7360 C  CG    . PHE A 1 901 ? -46.936 -39.349 -55.235 1.00 88.32  ? 901  PHE A CG    1 
ATOM   7361 C  CD1   . PHE A 1 901 ? -47.904 -39.926 -56.053 1.00 89.12  ? 901  PHE A CD1   1 
ATOM   7362 C  CD2   . PHE A 1 901 ? -46.542 -38.037 -55.488 1.00 85.24  ? 901  PHE A CD2   1 
ATOM   7363 C  CE1   . PHE A 1 901 ? -48.477 -39.210 -57.096 1.00 88.27  ? 901  PHE A CE1   1 
ATOM   7364 C  CE2   . PHE A 1 901 ? -47.110 -37.312 -56.527 1.00 84.35  ? 901  PHE A CE2   1 
ATOM   7365 C  CZ    . PHE A 1 901 ? -48.079 -37.900 -57.334 1.00 86.54  ? 901  PHE A CZ    1 
ATOM   7366 N  N     . ASP A 1 902 ? -46.620 -42.252 -51.966 1.00 60.44  ? 902  ASP A N     1 
ATOM   7367 C  CA    . ASP A 1 902 ? -45.986 -43.338 -51.197 1.00 63.86  ? 902  ASP A CA    1 
ATOM   7368 C  C     . ASP A 1 902 ? -46.351 -43.307 -49.709 1.00 64.47  ? 902  ASP A C     1 
ATOM   7369 O  O     . ASP A 1 902 ? -46.372 -44.344 -49.042 1.00 64.47  ? 902  ASP A O     1 
ATOM   7370 C  CB    . ASP A 1 902 ? -44.454 -43.339 -51.395 1.00 65.73  ? 902  ASP A CB    1 
ATOM   7371 C  CG    . ASP A 1 902 ? -43.806 -44.683 -51.046 1.00 70.05  ? 902  ASP A CG    1 
ATOM   7372 O  OD1   . ASP A 1 902 ? -44.216 -45.720 -51.620 1.00 70.81  ? 902  ASP A OD1   1 
ATOM   7373 O  OD2   . ASP A 1 902 ? -42.871 -44.697 -50.209 1.00 71.27  ? 902  ASP A OD2   1 
ATOM   7374 P  P     . DC  B 2 1   ? 10.359  0.903   -27.800 1.00 78.81  ? 3    DC  T P     1 
ATOM   7375 O  OP1   . DC  B 2 1   ? 10.641  2.327   -28.116 1.00 76.98  ? 3    DC  T OP1   1 
ATOM   7376 O  OP2   . DC  B 2 1   ? 9.808   0.549   -26.468 1.00 79.07  ? 3    DC  T OP2   1 
ATOM   7377 O  "O5'" . DC  B 2 1   ? 9.375   0.277   -28.911 1.00 73.65  ? 3    DC  T "O5'" 1 
ATOM   7378 C  "C5'" . DC  B 2 1   ? 8.225   1.032   -29.293 1.00 65.77  ? 3    DC  T "C5'" 1 
ATOM   7379 C  "C4'" . DC  B 2 1   ? 7.346   0.446   -30.397 1.00 58.21  ? 3    DC  T "C4'" 1 
ATOM   7380 O  "O4'" . DC  B 2 1   ? 6.011   0.985   -30.240 1.00 59.26  ? 3    DC  T "O4'" 1 
ATOM   7381 C  "C3'" . DC  B 2 1   ? 7.641   0.871   -31.830 1.00 49.71  ? 3    DC  T "C3'" 1 
ATOM   7382 O  "O3'" . DC  B 2 1   ? 6.857   0.101   -32.762 1.00 34.78  ? 3    DC  T "O3'" 1 
ATOM   7383 C  "C2'" . DC  B 2 1   ? 7.171   2.328   -31.802 1.00 52.23  ? 3    DC  T "C2'" 1 
ATOM   7384 C  "C1'" . DC  B 2 1   ? 5.944   2.249   -30.888 1.00 58.28  ? 3    DC  T "C1'" 1 
ATOM   7385 N  N1    . DC  B 2 1   ? 5.845   3.287   -29.798 1.00 62.82  ? 3    DC  T N1    1 
ATOM   7386 C  C2    . DC  B 2 1   ? 4.587   3.572   -29.232 1.00 63.96  ? 3    DC  T C2    1 
ATOM   7387 O  O2    . DC  B 2 1   ? 3.576   2.981   -29.644 1.00 63.46  ? 3    DC  T O2    1 
ATOM   7388 N  N3    . DC  B 2 1   ? 4.512   4.503   -28.241 1.00 65.16  ? 3    DC  T N3    1 
ATOM   7389 C  C4    . DC  B 2 1   ? 5.615   5.130   -27.812 1.00 65.73  ? 3    DC  T C4    1 
ATOM   7390 N  N4    . DC  B 2 1   ? 5.489   6.037   -26.835 1.00 65.12  ? 3    DC  T N4    1 
ATOM   7391 C  C5    . DC  B 2 1   ? 6.902   4.852   -28.368 1.00 64.97  ? 3    DC  T C5    1 
ATOM   7392 C  C6    . DC  B 2 1   ? 6.965   3.939   -29.345 1.00 63.73  ? 3    DC  T C6    1 
HETATM 7393 P  P     . 2PR B 2 2   ? 7.307   -1.303  -33.382 1.00 25.94  ? 4    2PR T P     1 
HETATM 7394 O  OP1   . 2PR B 2 2   ? 9.092   -1.025  -33.227 1.00 29.18  ? 4    2PR T OP1   1 
HETATM 7395 O  OP2   . 2PR B 2 2   ? 6.343   -2.295  -32.202 1.00 32.52  ? 4    2PR T OP2   1 
HETATM 7396 O  "O5'" . 2PR B 2 2   ? 6.537   -0.926  -34.860 1.00 31.79  ? 4    2PR T "O5'" 1 
HETATM 7397 C  "C5'" . 2PR B 2 2   ? 5.141   -1.074  -35.049 1.00 25.20  ? 4    2PR T "C5'" 1 
HETATM 7398 C  "C4'" . 2PR B 2 2   ? 4.995   -0.604  -36.480 1.00 27.76  ? 4    2PR T "C4'" 1 
HETATM 7399 O  "O4'" . 2PR B 2 2   ? 5.662   -1.506  -37.361 1.00 27.71  ? 4    2PR T "O4'" 1 
HETATM 7400 C  "C3'" . 2PR B 2 2   ? 3.564   -0.506  -36.934 1.00 26.44  ? 4    2PR T "C3'" 1 
HETATM 7401 O  "O3'" . 2PR B 2 2   ? 3.092   0.809   -36.637 1.00 27.12  ? 4    2PR T "O3'" 1 
HETATM 7402 C  "C2'" . 2PR B 2 2   ? 3.712   -0.715  -38.417 1.00 28.80  ? 4    2PR T "C2'" 1 
HETATM 7403 C  "C1'" . 2PR B 2 2   ? 4.879   -1.681  -38.533 1.00 28.15  ? 4    2PR T "C1'" 1 
HETATM 7404 N  N9    . 2PR B 2 2   ? 4.302   -3.048  -38.593 1.00 23.67  ? 4    2PR T N9    1 
HETATM 7405 C  C8    . 2PR B 2 2   ? 4.343   -4.013  -37.653 1.00 21.69  ? 4    2PR T C8    1 
HETATM 7406 N  N7    . 2PR B 2 2   ? 3.664   -5.089  -38.119 1.00 25.84  ? 4    2PR T N7    1 
HETATM 7407 C  C5    . 2PR B 2 2   ? 3.207   -4.789  -39.365 1.00 22.88  ? 4    2PR T C5    1 
HETATM 7408 C  C6    . 2PR B 2 2   ? 2.471   -5.480  -40.325 1.00 21.60  ? 4    2PR T C6    1 
HETATM 7409 N  N1    . 2PR B 2 2   ? 2.159   -4.875  -41.489 1.00 21.13  ? 4    2PR T N1    1 
HETATM 7410 C  C2    . 2PR B 2 2   ? 2.566   -3.603  -41.737 1.00 24.30  ? 4    2PR T C2    1 
HETATM 7411 N  N2    . 2PR B 2 2   ? 2.251   -3.007  -42.911 1.00 24.46  ? 4    2PR T N2    1 
HETATM 7412 N  N3    . 2PR B 2 2   ? 3.296   -2.911  -40.825 1.00 20.35  ? 4    2PR T N3    1 
HETATM 7413 C  C4    . 2PR B 2 2   ? 3.611   -3.490  -39.643 1.00 22.18  ? 4    2PR T C4    1 
ATOM   7414 P  P     . DT  B 2 3   ? 1.536   1.085   -36.484 1.00 24.12  ? 5    DT  T P     1 
ATOM   7415 O  OP1   . DT  B 2 3   ? 1.379   2.423   -35.876 1.00 28.58  ? 5    DT  T OP1   1 
ATOM   7416 O  OP2   . DT  B 2 3   ? 0.892   -0.092  -35.873 1.00 26.83  ? 5    DT  T OP2   1 
ATOM   7417 O  "O5'" . DT  B 2 3   ? 1.019   1.144   -38.001 1.00 24.59  ? 5    DT  T "O5'" 1 
ATOM   7418 C  "C5'" . DT  B 2 3   ? 1.476   2.110   -38.973 1.00 24.83  ? 5    DT  T "C5'" 1 
ATOM   7419 C  "C4'" . DT  B 2 3   ? 0.802   1.847   -40.316 1.00 20.60  ? 5    DT  T "C4'" 1 
ATOM   7420 O  "O4'" . DT  B 2 3   ? 1.203   0.534   -40.780 1.00 24.37  ? 5    DT  T "O4'" 1 
ATOM   7421 C  "C3'" . DT  B 2 3   ? -0.716  1.763   -40.257 1.00 22.45  ? 5    DT  T "C3'" 1 
ATOM   7422 O  "O3'" . DT  B 2 3   ? -1.305  3.052   -40.409 1.00 24.45  ? 5    DT  T "O3'" 1 
ATOM   7423 C  "C2'" . DT  B 2 3   ? -1.065  0.853   -41.426 1.00 20.67  ? 5    DT  T "C2'" 1 
ATOM   7424 C  "C1'" . DT  B 2 3   ? 0.126   -0.086  -41.467 1.00 23.08  ? 5    DT  T "C1'" 1 
ATOM   7425 N  N1    . DT  B 2 3   ? -0.182  -1.435  -40.901 1.00 22.80  ? 5    DT  T N1    1 
ATOM   7426 C  C2    . DT  B 2 3   ? -0.818  -2.321  -41.737 1.00 20.54  ? 5    DT  T C2    1 
ATOM   7427 O  O2    . DT  B 2 3   ? -1.126  -2.055  -42.880 1.00 23.44  ? 5    DT  T O2    1 
ATOM   7428 N  N3    . DT  B 2 3   ? -1.071  -3.552  -41.193 1.00 22.70  ? 5    DT  T N3    1 
ATOM   7429 C  C4    . DT  B 2 3   ? -0.768  -3.977  -39.912 1.00 23.76  ? 5    DT  T C4    1 
ATOM   7430 O  O4    . DT  B 2 3   ? -1.054  -5.109  -39.534 1.00 25.69  ? 5    DT  T O4    1 
ATOM   7431 C  C5    . DT  B 2 3   ? -0.109  -3.003  -39.065 1.00 24.13  ? 5    DT  T C5    1 
ATOM   7432 C  C7    . DT  B 2 3   ? 0.255   -3.372  -37.648 1.00 19.12  ? 5    DT  T C7    1 
ATOM   7433 C  C6    . DT  B 2 3   ? 0.153   -1.785  -39.593 1.00 22.77  ? 5    DT  T C6    1 
ATOM   7434 P  P     . DC  B 2 4   ? -2.863  3.242   -40.142 1.00 26.54  ? 6    DC  T P     1 
ATOM   7435 O  OP1   . DC  B 2 4   ? -3.124  4.696   -40.079 1.00 26.93  ? 6    DC  T OP1   1 
ATOM   7436 O  OP2   . DC  B 2 4   ? -3.260  2.356   -39.020 1.00 26.09  ? 6    DC  T OP2   1 
ATOM   7437 O  "O5'" . DC  B 2 4   ? -3.569  2.634   -41.444 1.00 27.26  ? 6    DC  T "O5'" 1 
ATOM   7438 C  "C5'" . DC  B 2 4   ? -3.378  3.150   -42.767 1.00 27.71  ? 6    DC  T "C5'" 1 
ATOM   7439 C  "C4'" . DC  B 2 4   ? -4.312  2.440   -43.745 1.00 25.06  ? 6    DC  T "C4'" 1 
ATOM   7440 O  "O4'" . DC  B 2 4   ? -4.141  0.996   -43.677 1.00 26.32  ? 6    DC  T "O4'" 1 
ATOM   7441 C  "C3'" . DC  B 2 4   ? -5.797  2.656   -43.511 1.00 24.93  ? 6    DC  T "C3'" 1 
ATOM   7442 O  "O3'" . DC  B 2 4   ? -6.431  2.573   -44.769 1.00 25.59  ? 6    DC  T "O3'" 1 
ATOM   7443 C  "C2'" . DC  B 2 4   ? -6.171  1.491   -42.591 1.00 25.35  ? 6    DC  T "C2'" 1 
ATOM   7444 C  "C1'" . DC  B 2 4   ? -5.321  0.376   -43.190 1.00 23.32  ? 6    DC  T "C1'" 1 
ATOM   7445 N  N1    . DC  B 2 4   ? -4.982  -0.737  -42.249 1.00 23.57  ? 6    DC  T N1    1 
ATOM   7446 C  C2    . DC  B 2 4   ? -5.240  -2.069  -42.640 1.00 23.59  ? 6    DC  T C2    1 
ATOM   7447 O  O2    . DC  B 2 4   ? -5.744  -2.325  -43.748 1.00 26.44  ? 6    DC  T O2    1 
ATOM   7448 N  N3    . DC  B 2 4   ? -4.930  -3.071  -41.779 1.00 21.63  ? 6    DC  T N3    1 
ATOM   7449 C  C4    . DC  B 2 4   ? -4.388  -2.808  -40.577 1.00 23.65  ? 6    DC  T C4    1 
ATOM   7450 N  N4    . DC  B 2 4   ? -4.113  -3.862  -39.789 1.00 21.25  ? 6    DC  T N4    1 
ATOM   7451 C  C5    . DC  B 2 4   ? -4.105  -1.465  -40.155 1.00 19.86  ? 6    DC  T C5    1 
ATOM   7452 C  C6    . DC  B 2 4   ? -4.418  -0.476  -41.019 1.00 22.68  ? 6    DC  T C6    1 
ATOM   7453 P  P     . DG  B 2 5   ? -7.987  2.846   -45.011 1.00 27.85  ? 7    DG  T P     1 
ATOM   7454 O  OP1   . DG  B 2 5   ? -8.111  3.523   -46.316 1.00 28.77  ? 7    DG  T OP1   1 
ATOM   7455 O  OP2   . DG  B 2 5   ? -8.583  3.482   -43.818 1.00 32.72  ? 7    DG  T OP2   1 
ATOM   7456 O  "O5'" . DG  B 2 5   ? -8.568  1.364   -45.139 1.00 31.26  ? 7    DG  T "O5'" 1 
ATOM   7457 C  "C5'" . DG  B 2 5   ? -8.172  0.557   -46.251 1.00 31.19  ? 7    DG  T "C5'" 1 
ATOM   7458 C  "C4'" . DG  B 2 5   ? -9.123  -0.604  -46.488 1.00 31.48  ? 7    DG  T "C4'" 1 
ATOM   7459 O  "O4'" . DG  B 2 5   ? -8.861  -1.694  -45.557 1.00 31.80  ? 7    DG  T "O4'" 1 
ATOM   7460 C  "C3'" . DG  B 2 5   ? -10.600 -0.300  -46.328 1.00 34.29  ? 7    DG  T "C3'" 1 
ATOM   7461 O  "O3'" . DG  B 2 5   ? -11.300 -1.104  -47.282 1.00 35.38  ? 7    DG  T "O3'" 1 
ATOM   7462 C  "C2'" . DG  B 2 5   ? -10.880 -0.687  -44.866 1.00 31.19  ? 7    DG  T "C2'" 1 
ATOM   7463 C  "C1'" . DG  B 2 5   ? -9.941  -1.872  -44.655 1.00 27.49  ? 7    DG  T "C1'" 1 
ATOM   7464 N  N9    . DG  B 2 5   ? -9.353  -2.017  -43.318 1.00 29.54  ? 7    DG  T N9    1 
ATOM   7465 C  C8    . DG  B 2 5   ? -8.754  -1.047  -42.542 1.00 29.73  ? 7    DG  T C8    1 
ATOM   7466 N  N7    . DG  B 2 5   ? -8.300  -1.488  -41.397 1.00 29.66  ? 7    DG  T N7    1 
ATOM   7467 C  C5    . DG  B 2 5   ? -8.599  -2.847  -41.419 1.00 26.99  ? 7    DG  T C5    1 
ATOM   7468 C  C6    . DG  B 2 5   ? -8.362  -3.859  -40.458 1.00 23.63  ? 7    DG  T C6    1 
ATOM   7469 O  O6    . DG  B 2 5   ? -7.813  -3.738  -39.359 1.00 27.55  ? 7    DG  T O6    1 
ATOM   7470 N  N1    . DG  B 2 5   ? -8.832  -5.114  -40.860 1.00 21.72  ? 7    DG  T N1    1 
ATOM   7471 C  C2    . DG  B 2 5   ? -9.475  -5.344  -42.058 1.00 25.51  ? 7    DG  T C2    1 
ATOM   7472 N  N2    . DG  B 2 5   ? -9.876  -6.603  -42.326 1.00 24.49  ? 7    DG  T N2    1 
ATOM   7473 N  N3    . DG  B 2 5   ? -9.700  -4.395  -42.961 1.00 26.15  ? 7    DG  T N3    1 
ATOM   7474 C  C4    . DG  B 2 5   ? -9.250  -3.180  -42.585 1.00 25.20  ? 7    DG  T C4    1 
ATOM   7475 P  P     . DC  B 2 6   ? -12.889 -1.020  -47.455 1.00 34.81  ? 8    DC  T P     1 
ATOM   7476 O  OP1   . DC  B 2 6   ? -13.178 -1.495  -48.829 1.00 33.66  ? 8    DC  T OP1   1 
ATOM   7477 O  OP2   . DC  B 2 6   ? -13.389 0.298   -47.001 1.00 32.37  ? 8    DC  T OP2   1 
ATOM   7478 O  "O5'" . DC  B 2 6   ? -13.392 -2.076  -46.365 1.00 33.69  ? 8    DC  T "O5'" 1 
ATOM   7479 C  "C5'" . DC  B 2 6   ? -13.219 -3.471  -46.559 1.00 33.82  ? 8    DC  T "C5'" 1 
ATOM   7480 C  "C4'" . DC  B 2 6   ? -13.863 -4.207  -45.406 1.00 31.55  ? 8    DC  T "C4'" 1 
ATOM   7481 O  "O4'" . DC  B 2 6   ? -13.020 -4.062  -44.237 1.00 31.62  ? 8    DC  T "O4'" 1 
ATOM   7482 C  "C3'" . DC  B 2 6   ? -15.238 -3.675  -45.004 1.00 32.66  ? 8    DC  T "C3'" 1 
ATOM   7483 O  "O3'" . DC  B 2 6   ? -16.145 -4.766  -44.901 1.00 31.69  ? 8    DC  T "O3'" 1 
ATOM   7484 C  "C2'" . DC  B 2 6   ? -15.000 -3.001  -43.654 1.00 30.69  ? 8    DC  T "C2'" 1 
ATOM   7485 C  "C1'" . DC  B 2 6   ? -13.876 -3.890  -43.130 1.00 31.71  ? 8    DC  T "C1'" 1 
ATOM   7486 N  N1    . DC  B 2 6   ? -13.085 -3.393  -41.951 1.00 30.04  ? 8    DC  T N1    1 
ATOM   7487 C  C2    . DC  B 2 6   ? -12.594 -4.344  -41.033 1.00 28.91  ? 8    DC  T C2    1 
ATOM   7488 O  O2    . DC  B 2 6   ? -12.821 -5.549  -41.219 1.00 24.55  ? 8    DC  T O2    1 
ATOM   7489 N  N3    . DC  B 2 6   ? -11.871 -3.913  -39.967 1.00 25.04  ? 8    DC  T N3    1 
ATOM   7490 C  C4    . DC  B 2 6   ? -11.651 -2.604  -39.791 1.00 29.67  ? 8    DC  T C4    1 
ATOM   7491 N  N4    . DC  B 2 6   ? -10.942 -2.234  -38.718 1.00 27.36  ? 8    DC  T N4    1 
ATOM   7492 C  C5    . DC  B 2 6   ? -12.143 -1.617  -40.711 1.00 30.05  ? 8    DC  T C5    1 
ATOM   7493 C  C6    . DC  B 2 6   ? -12.850 -2.053  -41.768 1.00 27.29  ? 8    DC  T C6    1 
ATOM   7494 P  P     . DC  B 2 7   ? -17.710 -4.599  -45.192 1.00 30.29  ? 9    DC  T P     1 
ATOM   7495 O  OP1   . DC  B 2 7   ? -17.946 -4.728  -46.644 1.00 31.51  ? 9    DC  T OP1   1 
ATOM   7496 O  OP2   . DC  B 2 7   ? -18.266 -3.429  -44.483 1.00 30.25  ? 9    DC  T OP2   1 
ATOM   7497 O  "O5'" . DC  B 2 7   ? -18.234 -5.919  -44.475 1.00 28.74  ? 9    DC  T "O5'" 1 
ATOM   7498 C  "C5'" . DC  B 2 7   ? -17.641 -7.169  -44.782 1.00 29.53  ? 9    DC  T "C5'" 1 
ATOM   7499 C  "C4'" . DC  B 2 7   ? -17.375 -7.960  -43.510 1.00 30.16  ? 9    DC  T "C4'" 1 
ATOM   7500 O  "O4'" . DC  B 2 7   ? -16.299 -7.381  -42.738 1.00 29.63  ? 9    DC  T "O4'" 1 
ATOM   7501 C  "C3'" . DC  B 2 7   ? -18.544 -7.987  -42.553 1.00 29.62  ? 9    DC  T "C3'" 1 
ATOM   7502 O  "O3'" . DC  B 2 7   ? -19.428 -9.006  -42.980 1.00 31.23  ? 9    DC  T "O3'" 1 
ATOM   7503 C  "C2'" . DC  B 2 7   ? -17.875 -8.297  -41.219 1.00 31.71  ? 9    DC  T "C2'" 1 
ATOM   7504 C  "C1'" . DC  B 2 7   ? -16.483 -7.704  -41.371 1.00 29.60  ? 9    DC  T "C1'" 1 
ATOM   7505 N  N1    . DC  B 2 7   ? -16.172 -6.478  -40.535 1.00 29.56  ? 9    DC  T N1    1 
ATOM   7506 C  C2    . DC  B 2 7   ? -15.598 -6.635  -39.262 1.00 29.75  ? 9    DC  T C2    1 
ATOM   7507 O  O2    . DC  B 2 7   ? -15.392 -7.772  -38.807 1.00 32.54  ? 9    DC  T O2    1 
ATOM   7508 N  N3    . DC  B 2 7   ? -15.294 -5.525  -38.537 1.00 30.18  ? 9    DC  T N3    1 
ATOM   7509 C  C4    . DC  B 2 7   ? -15.519 -4.308  -39.037 1.00 29.14  ? 9    DC  T C4    1 
ATOM   7510 N  N4    . DC  B 2 7   ? -15.191 -3.268  -38.267 1.00 29.29  ? 9    DC  T N4    1 
ATOM   7511 C  C5    . DC  B 2 7   ? -16.100 -4.118  -40.332 1.00 27.94  ? 9    DC  T C5    1 
ATOM   7512 C  C6    . DC  B 2 7   ? -16.404 -5.220  -41.038 1.00 27.49  ? 9    DC  T C6    1 
ATOM   7513 P  P     . DG  B 2 8   ? -20.908 -9.143  -42.397 1.00 34.43  ? 10   DG  T P     1 
ATOM   7514 O  OP1   . DG  B 2 8   ? -21.567 -10.263 -43.110 1.00 36.59  ? 10   DG  T OP1   1 
ATOM   7515 O  OP2   . DG  B 2 8   ? -21.545 -7.812  -42.347 1.00 33.13  ? 10   DG  T OP2   1 
ATOM   7516 O  "O5'" . DG  B 2 8   ? -20.601 -9.567  -40.883 1.00 35.48  ? 10   DG  T "O5'" 1 
ATOM   7517 C  "C5'" . DG  B 2 8   ? -20.184 -10.874 -40.528 1.00 31.52  ? 10   DG  T "C5'" 1 
ATOM   7518 C  "C4'" . DG  B 2 8   ? -20.337 -11.028 -39.022 1.00 34.02  ? 10   DG  T "C4'" 1 
ATOM   7519 O  "O4'" . DG  B 2 8   ? -19.480 -10.082 -38.331 1.00 33.73  ? 10   DG  T "O4'" 1 
ATOM   7520 C  "C3'" . DG  B 2 8   ? -21.748 -10.805 -38.487 1.00 33.40  ? 10   DG  T "C3'" 1 
ATOM   7521 O  "O3'" . DG  B 2 8   ? -22.029 -11.858 -37.575 1.00 34.22  ? 10   DG  T "O3'" 1 
ATOM   7522 C  "C2'" . DG  B 2 8   ? -21.697 -9.420  -37.834 1.00 31.58  ? 10   DG  T "C2'" 1 
ATOM   7523 C  "C1'" . DG  B 2 8   ? -20.228 -9.246  -37.472 1.00 30.93  ? 10   DG  T "C1'" 1 
ATOM   7524 N  N9    . DG  B 2 8   ? -19.727 -7.873  -37.610 1.00 30.59  ? 10   DG  T N9    1 
ATOM   7525 C  C8    . DG  B 2 8   ? -19.887 -7.028  -38.679 1.00 26.89  ? 10   DG  T C8    1 
ATOM   7526 N  N7    . DG  B 2 8   ? -19.322 -5.861  -38.508 1.00 28.23  ? 10   DG  T N7    1 
ATOM   7527 C  C5    . DG  B 2 8   ? -18.746 -5.934  -37.249 1.00 26.99  ? 10   DG  T C5    1 
ATOM   7528 C  C6    . DG  B 2 8   ? -18.000 -4.973  -36.518 1.00 29.13  ? 10   DG  T C6    1 
ATOM   7529 O  O6    . DG  B 2 8   ? -17.693 -3.824  -36.864 1.00 29.20  ? 10   DG  T O6    1 
ATOM   7530 N  N1    . DG  B 2 8   ? -17.599 -5.449  -35.265 1.00 29.32  ? 10   DG  T N1    1 
ATOM   7531 C  C2    . DG  B 2 8   ? -17.895 -6.709  -34.784 1.00 29.79  ? 10   DG  T C2    1 
ATOM   7532 N  N2    . DG  B 2 8   ? -17.455 -7.029  -33.552 1.00 26.89  ? 10   DG  T N2    1 
ATOM   7533 N  N3    . DG  B 2 8   ? -18.592 -7.608  -35.470 1.00 28.86  ? 10   DG  T N3    1 
ATOM   7534 C  C4    . DG  B 2 8   ? -18.986 -7.164  -36.685 1.00 27.75  ? 10   DG  T C4    1 
ATOM   7535 P  P     . DC  B 2 9   ? -23.318 -11.906 -36.631 1.00 34.02  ? 11   DC  T P     1 
ATOM   7536 O  OP1   . DC  B 2 9   ? -23.570 -13.343 -36.386 1.00 37.88  ? 11   DC  T OP1   1 
ATOM   7537 O  OP2   . DC  B 2 9   ? -24.398 -11.072 -37.212 1.00 35.24  ? 11   DC  T OP2   1 
ATOM   7538 O  "O5'" . DC  B 2 9   ? -22.812 -11.195 -35.291 1.00 32.99  ? 11   DC  T "O5'" 1 
ATOM   7539 C  "C5'" . DC  B 2 9   ? -21.915 -11.868 -34.401 1.00 33.62  ? 11   DC  T "C5'" 1 
ATOM   7540 C  "C4'" . DC  B 2 9   ? -21.924 -11.244 -33.015 1.00 37.19  ? 11   DC  T "C4'" 1 
ATOM   7541 O  "O4'" . DC  B 2 9   ? -21.272 -9.949  -33.037 1.00 40.15  ? 11   DC  T "O4'" 1 
ATOM   7542 C  "C3'" . DC  B 2 9   ? -23.302 -11.005 -32.404 1.00 40.54  ? 11   DC  T "C3'" 1 
ATOM   7543 O  "O3'" . DC  B 2 9   ? -23.264 -11.459 -31.044 1.00 44.68  ? 11   DC  T "O3'" 1 
ATOM   7544 C  "C2'" . DC  B 2 9   ? -23.529 -9.498  -32.551 1.00 38.08  ? 11   DC  T "C2'" 1 
ATOM   7545 C  "C1'" . DC  B 2 9   ? -22.113 -8.930  -32.532 1.00 38.53  ? 11   DC  T "C1'" 1 
ATOM   7546 N  N1    . DC  B 2 9   ? -21.868 -7.709  -33.390 1.00 40.14  ? 11   DC  T N1    1 
ATOM   7547 C  C2    . DC  B 2 9   ? -21.132 -6.610  -32.891 1.00 40.62  ? 11   DC  T C2    1 
ATOM   7548 O  O2    . DC  B 2 9   ? -20.689 -6.630  -31.734 1.00 42.38  ? 11   DC  T O2    1 
ATOM   7549 N  N3    . DC  B 2 9   ? -20.919 -5.533  -33.698 1.00 38.19  ? 11   DC  T N3    1 
ATOM   7550 C  C4    . DC  B 2 9   ? -21.397 -5.524  -34.947 1.00 37.56  ? 11   DC  T C4    1 
ATOM   7551 N  N4    . DC  B 2 9   ? -21.170 -4.446  -35.703 1.00 35.49  ? 11   DC  T N4    1 
ATOM   7552 C  C5    . DC  B 2 9   ? -22.142 -6.623  -35.474 1.00 37.16  ? 11   DC  T C5    1 
ATOM   7553 C  C6    . DC  B 2 9   ? -22.344 -7.680  -34.673 1.00 38.59  ? 11   DC  T C6    1 
ATOM   7554 P  P     . DC  B 2 10  ? -24.515 -11.337 -30.054 1.00 44.28  ? 12   DC  T P     1 
ATOM   7555 O  OP1   . DC  B 2 10  ? -24.231 -12.237 -28.913 1.00 47.62  ? 12   DC  T OP1   1 
ATOM   7556 O  OP2   . DC  B 2 10  ? -25.758 -11.481 -30.834 1.00 45.74  ? 12   DC  T OP2   1 
ATOM   7557 O  "O5'" . DC  B 2 10  ? -24.430 -9.821  -29.542 1.00 42.15  ? 12   DC  T "O5'" 1 
ATOM   7558 C  "C5'" . DC  B 2 10  ? -23.347 -9.441  -28.706 1.00 37.74  ? 12   DC  T "C5'" 1 
ATOM   7559 C  "C4'" . DC  B 2 10  ? -23.440 -7.975  -28.351 1.00 38.06  ? 12   DC  T "C4'" 1 
ATOM   7560 O  "O4'" . DC  B 2 10  ? -23.091 -7.179  -29.503 1.00 38.60  ? 12   DC  T "O4'" 1 
ATOM   7561 C  "C3'" . DC  B 2 10  ? -24.830 -7.517  -27.926 1.00 39.24  ? 12   DC  T "C3'" 1 
ATOM   7562 O  "O3'" . DC  B 2 10  ? -24.789 -7.285  -26.533 1.00 37.85  ? 12   DC  T "O3'" 1 
ATOM   7563 C  "C2'" . DC  B 2 10  ? -25.086 -6.240  -28.726 1.00 37.91  ? 12   DC  T "C2'" 1 
ATOM   7564 C  "C1'" . DC  B 2 10  ? -23.750 -5.941  -29.398 1.00 38.85  ? 12   DC  T "C1'" 1 
ATOM   7565 N  N1    . DC  B 2 10  ? -23.852 -5.349  -30.776 1.00 37.51  ? 12   DC  T N1    1 
ATOM   7566 C  C2    . DC  B 2 10  ? -23.251 -4.105  -31.046 1.00 36.69  ? 12   DC  T C2    1 
ATOM   7567 O  O2    . DC  B 2 10  ? -22.649 -3.511  -30.141 1.00 35.53  ? 12   DC  T O2    1 
ATOM   7568 N  N3    . DC  B 2 10  ? -23.349 -3.588  -32.303 1.00 36.08  ? 12   DC  T N3    1 
ATOM   7569 C  C4    . DC  B 2 10  ? -24.008 -4.260  -33.260 1.00 37.44  ? 12   DC  T C4    1 
ATOM   7570 N  N4    . DC  B 2 10  ? -24.078 -3.718  -34.482 1.00 38.76  ? 12   DC  T N4    1 
ATOM   7571 C  C5    . DC  B 2 10  ? -24.627 -5.523  -33.006 1.00 36.77  ? 12   DC  T C5    1 
ATOM   7572 C  C6    . DC  B 2 10  ? -24.519 -6.024  -31.766 1.00 36.75  ? 12   DC  T C6    1 
ATOM   7573 P  P     . DG  B 2 11  ? -26.068 -6.819  -25.697 1.00 37.82  ? 13   DG  T P     1 
ATOM   7574 O  OP1   . DG  B 2 11  ? -25.871 -7.316  -24.317 1.00 37.84  ? 13   DG  T OP1   1 
ATOM   7575 O  OP2   . DG  B 2 11  ? -27.303 -7.147  -26.447 1.00 36.52  ? 13   DG  T OP2   1 
ATOM   7576 O  "O5'" . DG  B 2 11  ? -25.915 -5.234  -25.685 1.00 35.39  ? 13   DG  T "O5'" 1 
ATOM   7577 C  "C5'" . DG  B 2 11  ? -24.744 -4.628  -25.149 1.00 34.84  ? 13   DG  T "C5'" 1 
ATOM   7578 C  "C4'" . DG  B 2 11  ? -24.926 -3.121  -25.081 1.00 37.26  ? 13   DG  T "C4'" 1 
ATOM   7579 O  "O4'" . DG  B 2 11  ? -24.843 -2.557  -26.414 1.00 35.32  ? 13   DG  T "O4'" 1 
ATOM   7580 C  "C3'" . DG  B 2 11  ? -26.252 -2.625  -24.511 1.00 36.43  ? 13   DG  T "C3'" 1 
ATOM   7581 O  "O3'" . DG  B 2 11  ? -25.968 -1.462  -23.734 1.00 39.36  ? 13   DG  T "O3'" 1 
ATOM   7582 C  "C2'" . DG  B 2 11  ? -27.100 -2.353  -25.757 1.00 36.41  ? 13   DG  T "C2'" 1 
ATOM   7583 C  "C1'" . DG  B 2 11  ? -26.043 -1.901  -26.760 1.00 35.21  ? 13   DG  T "C1'" 1 
ATOM   7584 N  N9    . DG  B 2 11  ? -26.249 -2.249  -28.163 1.00 37.09  ? 13   DG  T N9    1 
ATOM   7585 C  C8    . DG  B 2 11  ? -26.715 -3.426  -28.705 1.00 36.19  ? 13   DG  T C8    1 
ATOM   7586 N  N7    . DG  B 2 11  ? -26.754 -3.423  -30.015 1.00 35.36  ? 13   DG  T N7    1 
ATOM   7587 C  C5    . DG  B 2 11  ? -26.273 -2.166  -30.362 1.00 36.06  ? 13   DG  T C5    1 
ATOM   7588 C  C6    . DG  B 2 11  ? -26.084 -1.565  -31.632 1.00 35.11  ? 13   DG  T C6    1 
ATOM   7589 O  O6    . DG  B 2 11  ? -26.314 -2.056  -32.738 1.00 37.79  ? 13   DG  T O6    1 
ATOM   7590 N  N1    . DG  B 2 11  ? -25.588 -0.263  -31.540 1.00 33.97  ? 13   DG  T N1    1 
ATOM   7591 C  C2    . DG  B 2 11  ? -25.302 0.380   -30.351 1.00 34.59  ? 13   DG  T C2    1 
ATOM   7592 N  N2    . DG  B 2 11  ? -24.823 1.629   -30.421 1.00 34.02  ? 13   DG  T N2    1 
ATOM   7593 N  N3    . DG  B 2 11  ? -25.471 -0.170  -29.158 1.00 34.25  ? 13   DG  T N3    1 
ATOM   7594 C  C4    . DG  B 2 11  ? -25.958 -1.435  -29.235 1.00 36.19  ? 13   DG  T C4    1 
ATOM   7595 P  P     . DC  B 2 12  ? -27.106 -0.615  -23.003 1.00 42.75  ? 14   DC  T P     1 
ATOM   7596 O  OP1   . DC  B 2 12  ? -26.493 0.097   -21.859 1.00 46.32  ? 14   DC  T OP1   1 
ATOM   7597 O  OP2   . DC  B 2 12  ? -28.268 -1.500  -22.764 1.00 40.96  ? 14   DC  T OP2   1 
ATOM   7598 O  "O5'" . DC  B 2 12  ? -27.506 0.443   -24.132 1.00 42.88  ? 14   DC  T "O5'" 1 
ATOM   7599 C  "C5'" . DC  B 2 12  ? -26.635 1.480   -24.550 1.00 40.65  ? 14   DC  T "C5'" 1 
ATOM   7600 C  "C4'" . DC  B 2 12  ? -27.270 2.253   -25.698 1.00 42.89  ? 14   DC  T "C4'" 1 
ATOM   7601 O  "O4'" . DC  B 2 12  ? -27.433 1.392   -26.847 1.00 40.51  ? 14   DC  T "O4'" 1 
ATOM   7602 C  "C3'" . DC  B 2 12  ? -28.662 2.820   -25.438 1.00 44.20  ? 14   DC  T "C3'" 1 
ATOM   7603 O  "O3'" . DC  B 2 12  ? -28.569 4.228   -25.499 1.00 47.68  ? 14   DC  T "O3'" 1 
ATOM   7604 C  "C2'" . DC  B 2 12  ? -29.546 2.272   -26.563 1.00 42.67  ? 14   DC  T "C2'" 1 
ATOM   7605 C  "C1'" . DC  B 2 12  ? -28.521 1.867   -27.612 1.00 41.76  ? 14   DC  T "C1'" 1 
ATOM   7606 N  N1    . DC  B 2 12  ? -28.898 0.766   -28.582 1.00 41.59  ? 14   DC  T N1    1 
ATOM   7607 C  C2    . DC  B 2 12  ? -28.759 0.964   -29.971 1.00 39.94  ? 14   DC  T C2    1 
ATOM   7608 O  O2    . DC  B 2 12  ? -28.360 2.046   -30.418 1.00 41.24  ? 14   DC  T O2    1 
ATOM   7609 N  N3    . DC  B 2 12  ? -29.078 -0.049  -30.815 1.00 40.93  ? 14   DC  T N3    1 
ATOM   7610 C  C4    . DC  B 2 12  ? -29.517 -1.215  -30.330 1.00 43.92  ? 14   DC  T C4    1 
ATOM   7611 N  N4    . DC  B 2 12  ? -29.826 -2.171  -31.211 1.00 44.57  ? 14   DC  T N4    1 
ATOM   7612 C  C5    . DC  B 2 12  ? -29.663 -1.448  -28.926 1.00 43.33  ? 14   DC  T C5    1 
ATOM   7613 C  C6    . DC  B 2 12  ? -29.339 -0.442  -28.102 1.00 42.16  ? 14   DC  T C6    1 
ATOM   7614 P  P     . DG  B 2 13  ? -29.669 5.184   -24.841 1.00 49.83  ? 15   DG  T P     1 
ATOM   7615 O  OP1   . DG  B 2 13  ? -28.921 6.309   -24.232 1.00 50.71  ? 15   DG  T OP1   1 
ATOM   7616 O  OP2   . DG  B 2 13  ? -30.620 4.387   -24.028 1.00 46.21  ? 15   DG  T OP2   1 
ATOM   7617 O  "O5'" . DG  B 2 13  ? -30.470 5.706   -26.114 1.00 47.08  ? 15   DG  T "O5'" 1 
ATOM   7618 C  "C5'" . DG  B 2 13  ? -29.819 6.342   -27.206 1.00 48.17  ? 15   DG  T "C5'" 1 
ATOM   7619 C  "C4'" . DG  B 2 13  ? -30.763 6.311   -28.389 1.00 45.88  ? 15   DG  T "C4'" 1 
ATOM   7620 O  "O4'" . DG  B 2 13  ? -30.762 4.967   -28.919 1.00 43.79  ? 15   DG  T "O4'" 1 
ATOM   7621 C  "C3'" . DG  B 2 13  ? -32.217 6.615   -28.026 1.00 47.72  ? 15   DG  T "C3'" 1 
ATOM   7622 O  "O3'" . DG  B 2 13  ? -32.727 7.656   -28.852 1.00 49.23  ? 15   DG  T "O3'" 1 
ATOM   7623 C  "C2'" . DG  B 2 13  ? -32.955 5.291   -28.235 1.00 46.69  ? 15   DG  T "C2'" 1 
ATOM   7624 C  "C1'" . DG  B 2 13  ? -32.079 4.683   -29.324 1.00 45.92  ? 15   DG  T "C1'" 1 
ATOM   7625 N  N9    . DG  B 2 13  ? -32.220 3.246   -29.534 1.00 43.10  ? 15   DG  T N9    1 
ATOM   7626 C  C8    . DG  B 2 13  ? -32.464 2.260   -28.604 1.00 43.96  ? 15   DG  T C8    1 
ATOM   7627 N  N7    . DG  B 2 13  ? -32.529 1.062   -29.117 1.00 40.82  ? 15   DG  T N7    1 
ATOM   7628 C  C5    . DG  B 2 13  ? -32.315 1.269   -30.475 1.00 40.23  ? 15   DG  T C5    1 
ATOM   7629 C  C6    . DG  B 2 13  ? -32.279 0.347   -31.548 1.00 39.38  ? 15   DG  T C6    1 
ATOM   7630 O  O6    . DG  B 2 13  ? -32.433 -0.877  -31.490 1.00 42.80  ? 15   DG  T O6    1 
ATOM   7631 N  N1    . DG  B 2 13  ? -32.041 0.973   -32.775 1.00 38.47  ? 15   DG  T N1    1 
ATOM   7632 C  C2    . DG  B 2 13  ? -31.855 2.335   -32.937 1.00 39.26  ? 15   DG  T C2    1 
ATOM   7633 N  N2    . DG  B 2 13  ? -31.623 2.788   -34.180 1.00 37.45  ? 15   DG  T N2    1 
ATOM   7634 N  N3    . DG  B 2 13  ? -31.887 3.208   -31.937 1.00 37.26  ? 15   DG  T N3    1 
ATOM   7635 C  C4    . DG  B 2 13  ? -32.124 2.608   -30.745 1.00 40.68  ? 15   DG  T C4    1 
ATOM   7636 P  P     . DC  B 2 14  ? -34.032 8.470   -28.413 1.00 51.09  ? 16   DC  T P     1 
ATOM   7637 O  OP1   . DC  B 2 14  ? -34.090 9.698   -29.242 1.00 53.30  ? 16   DC  T OP1   1 
ATOM   7638 O  OP2   . DC  B 2 14  ? -34.070 8.587   -26.936 1.00 51.14  ? 16   DC  T OP2   1 
ATOM   7639 O  "O5'" . DC  B 2 14  ? -35.210 7.465   -28.842 1.00 51.04  ? 16   DC  T "O5'" 1 
ATOM   7640 C  "C5'" . DC  B 2 14  ? -35.869 7.581   -30.105 1.00 49.61  ? 16   DC  T "C5'" 1 
ATOM   7641 C  "C4'" . DC  B 2 14  ? -35.068 6.968   -31.246 1.00 47.71  ? 16   DC  T "C4'" 1 
ATOM   7642 O  "O4'" . DC  B 2 14  ? -34.723 5.591   -30.938 1.00 46.93  ? 16   DC  T "O4'" 1 
ATOM   7643 C  "C3'" . DC  B 2 14  ? -35.795 6.933   -32.588 1.00 47.74  ? 16   DC  T "C3'" 1 
ATOM   7644 O  "O3'" . DC  B 2 14  ? -34.915 7.375   -33.618 1.00 46.75  ? 16   DC  T "O3'" 1 
ATOM   7645 C  "C2'" . DC  B 2 14  ? -36.163 5.461   -32.759 1.00 45.99  ? 16   DC  T "C2'" 1 
ATOM   7646 C  "C1'" . DC  B 2 14  ? -35.006 4.771   -32.051 1.00 43.77  ? 16   DC  T "C1'" 1 
ATOM   7647 N  N1    . DC  B 2 14  ? -35.274 3.355   -31.600 1.00 41.07  ? 16   DC  T N1    1 
ATOM   7648 C  C2    . DC  B 2 14  ? -35.264 2.305   -32.538 1.00 38.83  ? 16   DC  T C2    1 
ATOM   7649 O  O2    . DC  B 2 14  ? -35.043 2.549   -33.730 1.00 37.50  ? 16   DC  T O2    1 
ATOM   7650 N  N3    . DC  B 2 14  ? -35.502 1.035   -32.112 1.00 38.75  ? 16   DC  T N3    1 
ATOM   7651 C  C4    . DC  B 2 14  ? -35.732 0.787   -30.817 1.00 38.52  ? 16   DC  T C4    1 
ATOM   7652 N  N4    . DC  B 2 14  ? -35.962 -0.480  -30.445 1.00 35.70  ? 16   DC  T N4    1 
ATOM   7653 C  C5    . DC  B 2 14  ? -35.746 1.841   -29.850 1.00 38.69  ? 16   DC  T C5    1 
ATOM   7654 C  C6    . DC  B 2 14  ? -35.517 3.089   -30.280 1.00 39.26  ? 16   DC  T C6    1 
ATOM   7655 P  P     . DG  B 2 15  ? -35.459 8.134   -34.917 1.00 47.20  ? 17   DG  T P     1 
ATOM   7656 O  OP1   . DG  B 2 15  ? -34.297 8.308   -35.818 1.00 46.04  ? 17   DG  T OP1   1 
ATOM   7657 O  OP2   . DG  B 2 15  ? -36.238 9.314   -34.470 1.00 46.54  ? 17   DG  T OP2   1 
ATOM   7658 O  "O5'" . DG  B 2 15  ? -36.518 7.121   -35.566 1.00 47.82  ? 17   DG  T "O5'" 1 
ATOM   7659 C  "C5'" . DG  B 2 15  ? -36.300 6.479   -36.822 1.00 45.14  ? 17   DG  T "C5'" 1 
ATOM   7660 C  "C4'" . DG  B 2 15  ? -37.341 5.399   -37.077 1.00 42.06  ? 17   DG  T "C4'" 1 
ATOM   7661 O  "O4'" . DG  B 2 15  ? -37.337 4.427   -36.007 1.00 42.43  ? 17   DG  T "O4'" 1 
ATOM   7662 C  "C3'" . DG  B 2 15  ? -38.782 5.881   -37.163 1.00 43.71  ? 17   DG  T "C3'" 1 
ATOM   7663 O  "O3'" . DG  B 2 15  ? -39.016 6.226   -38.521 1.00 41.52  ? 17   DG  T "O3'" 1 
ATOM   7664 C  "C2'" . DG  B 2 15  ? -39.601 4.659   -36.741 1.00 42.60  ? 17   DG  T "C2'" 1 
ATOM   7665 C  "C1'" . DG  B 2 15  ? -38.631 3.857   -35.875 1.00 42.05  ? 17   DG  T "C1'" 1 
ATOM   7666 N  N9    . DG  B 2 15  ? -38.934 3.823   -34.444 1.00 39.33  ? 17   DG  T N9    1 
ATOM   7667 C  C8    . DG  B 2 15  ? -39.275 4.873   -33.619 1.00 40.13  ? 17   DG  T C8    1 
ATOM   7668 N  N7    . DG  B 2 15  ? -39.463 4.514   -32.375 1.00 39.39  ? 17   DG  T N7    1 
ATOM   7669 C  C5    . DG  B 2 15  ? -39.230 3.146   -32.374 1.00 37.35  ? 17   DG  T C5    1 
ATOM   7670 C  C6    . DG  B 2 15  ? -39.282 2.201   -31.316 1.00 39.86  ? 17   DG  T C6    1 
ATOM   7671 O  O6    . DG  B 2 15  ? -39.553 2.393   -30.115 1.00 40.62  ? 17   DG  T O6    1 
ATOM   7672 N  N1    . DG  B 2 15  ? -38.974 0.913   -31.761 1.00 38.92  ? 17   DG  T N1    1 
ATOM   7673 C  C2    . DG  B 2 15  ? -38.653 0.578   -33.058 1.00 38.18  ? 17   DG  T C2    1 
ATOM   7674 N  N2    . DG  B 2 15  ? -38.383 -0.716  -33.311 1.00 40.65  ? 17   DG  T N2    1 
ATOM   7675 N  N3    . DG  B 2 15  ? -38.601 1.457   -34.046 1.00 34.62  ? 17   DG  T N3    1 
ATOM   7676 C  C4    . DG  B 2 15  ? -38.899 2.711   -33.638 1.00 36.29  ? 17   DG  T C4    1 
ATOM   7677 P  P     . DG  B 2 16  ? -40.384 6.844   -39.037 1.00 36.88  ? 18   DG  T P     1 
ATOM   7678 O  OP1   . DG  B 2 16  ? -41.327 5.741   -39.303 1.00 39.01  ? 18   DG  T OP1   1 
ATOM   7679 O  OP2   . DG  B 2 16  ? -40.054 7.799   -40.121 1.00 41.62  ? 18   DG  T OP2   1 
ATOM   7680 O  "O5'" . DG  B 2 16  ? -40.899 7.702   -37.788 1.00 39.27  ? 18   DG  T "O5'" 1 
ATOM   7681 C  "C5'" . DG  B 2 16  ? -42.262 8.068   -37.688 1.00 28.55  ? 18   DG  T "C5'" 1 
ATOM   7682 C  "C4'" . DG  B 2 16  ? -42.783 7.721   -36.304 1.00 31.52  ? 18   DG  T "C4'" 1 
ATOM   7683 O  "O4'" . DG  B 2 16  ? -44.139 8.227   -36.179 1.00 30.19  ? 18   DG  T "O4'" 1 
ATOM   7684 C  "C3'" . DG  B 2 16  ? -42.876 6.228   -35.980 1.00 30.44  ? 18   DG  T "C3'" 1 
ATOM   7685 O  "O3'" . DG  B 2 16  ? -42.514 6.016   -34.616 1.00 32.66  ? 18   DG  T "O3'" 1 
ATOM   7686 C  "C2'" . DG  B 2 16  ? -44.349 5.903   -36.244 1.00 29.47  ? 18   DG  T "C2'" 1 
ATOM   7687 C  "C1'" . DG  B 2 16  ? -44.996 7.187   -35.754 1.00 27.36  ? 18   DG  T "C1'" 1 
ATOM   7688 N  N9    . DG  B 2 16  ? -46.310 7.516   -36.282 1.00 26.76  ? 18   DG  T N9    1 
ATOM   7689 C  C8    . DG  B 2 16  ? -47.405 7.817   -35.520 1.00 27.02  ? 18   DG  T C8    1 
ATOM   7690 N  N7    . DG  B 2 16  ? -48.450 8.109   -36.227 1.00 27.46  ? 18   DG  T N7    1 
ATOM   7691 C  C5    . DG  B 2 16  ? -48.021 7.999   -37.542 1.00 27.79  ? 18   DG  T C5    1 
ATOM   7692 C  C6    . DG  B 2 16  ? -48.737 8.205   -38.746 1.00 27.18  ? 18   DG  T C6    1 
ATOM   7693 O  O6    . DG  B 2 16  ? -49.919 8.532   -38.877 1.00 29.97  ? 18   DG  T O6    1 
ATOM   7694 N  N1    . DG  B 2 16  ? -47.947 7.999   -39.873 1.00 29.04  ? 18   DG  T N1    1 
ATOM   7695 C  C2    . DG  B 2 16  ? -46.616 7.643   -39.841 1.00 30.50  ? 18   DG  T C2    1 
ATOM   7696 N  N2    . DG  B 2 16  ? -46.026 7.492   -41.038 1.00 33.27  ? 18   DG  T N2    1 
ATOM   7697 N  N3    . DG  B 2 16  ? -45.924 7.448   -38.716 1.00 28.26  ? 18   DG  T N3    1 
ATOM   7698 C  C4    . DG  B 2 16  ? -46.694 7.642   -37.602 1.00 27.31  ? 18   DG  T C4    1 
ATOM   7699 O  "O5'" . DC  C 3 1   ? -35.460 -12.763 -36.260 1.00 110.22 ? 103  DC  P "O5'" 1 
ATOM   7700 C  "C5'" . DC  C 3 1   ? -35.992 -11.930 -35.227 1.00 111.51 ? 103  DC  P "C5'" 1 
ATOM   7701 C  "C4'" . DC  C 3 1   ? -36.446 -10.578 -35.763 1.00 111.37 ? 103  DC  P "C4'" 1 
ATOM   7702 O  "O4'" . DC  C 3 1   ? -37.052 -9.777  -34.706 1.00 112.73 ? 103  DC  P "O4'" 1 
ATOM   7703 C  "C3'" . DC  C 3 1   ? -35.335 -9.712  -36.354 1.00 110.35 ? 103  DC  P "C3'" 1 
ATOM   7704 O  "O3'" . DC  C 3 1   ? -35.767 -9.150  -37.588 1.00 107.88 ? 103  DC  P "O3'" 1 
ATOM   7705 C  "C2'" . DC  C 3 1   ? -35.143 -8.634  -35.293 1.00 111.95 ? 103  DC  P "C2'" 1 
ATOM   7706 C  "C1'" . DC  C 3 1   ? -36.594 -8.448  -34.867 1.00 113.58 ? 103  DC  P "C1'" 1 
ATOM   7707 N  N1    . DC  C 3 1   ? -36.809 -7.594  -33.633 1.00 115.43 ? 103  DC  P N1    1 
ATOM   7708 C  C2    . DC  C 3 1   ? -38.109 -7.178  -33.270 1.00 116.11 ? 103  DC  P C2    1 
ATOM   7709 O  O2    . DC  C 3 1   ? -39.092 -7.521  -33.946 1.00 114.99 ? 103  DC  P O2    1 
ATOM   7710 N  N3    . DC  C 3 1   ? -38.260 -6.400  -32.159 1.00 116.50 ? 103  DC  P N3    1 
ATOM   7711 C  C4    . DC  C 3 1   ? -37.196 -6.031  -31.435 1.00 116.30 ? 103  DC  P C4    1 
ATOM   7712 N  N4    . DC  C 3 1   ? -37.406 -5.268  -30.357 1.00 115.61 ? 103  DC  P N4    1 
ATOM   7713 C  C5    . DC  C 3 1   ? -35.869 -6.435  -31.786 1.00 116.36 ? 103  DC  P C5    1 
ATOM   7714 C  C6    . DC  C 3 1   ? -35.728 -7.204  -32.877 1.00 115.99 ? 103  DC  P C6    1 
ATOM   7715 P  P     . DG  C 3 2   ? -34.718 -8.491  -38.604 1.00 106.58 ? 104  DG  P P     1 
ATOM   7716 O  OP1   . DG  C 3 2   ? -33.969 -9.597  -39.245 1.00 105.73 ? 104  DG  P OP1   1 
ATOM   7717 O  OP2   . DG  C 3 2   ? -33.985 -7.419  -37.889 1.00 106.73 ? 104  DG  P OP2   1 
ATOM   7718 O  "O5'" . DG  C 3 2   ? -35.649 -7.786  -39.704 1.00 104.13 ? 104  DG  P "O5'" 1 
ATOM   7719 C  "C5'" . DG  C 3 2   ? -36.840 -7.088  -39.328 1.00 100.08 ? 104  DG  P "C5'" 1 
ATOM   7720 C  "C4'" . DG  C 3 2   ? -36.773 -5.578  -39.530 1.00 97.23  ? 104  DG  P "C4'" 1 
ATOM   7721 O  "O4'" . DG  C 3 2   ? -37.414 -4.947  -38.391 1.00 96.37  ? 104  DG  P "O4'" 1 
ATOM   7722 C  "C3'" . DG  C 3 2   ? -35.390 -4.938  -39.626 1.00 95.80  ? 104  DG  P "C3'" 1 
ATOM   7723 O  "O3'" . DG  C 3 2   ? -34.994 -4.848  -40.997 1.00 94.55  ? 104  DG  P "O3'" 1 
ATOM   7724 C  "C2'" . DG  C 3 2   ? -35.592 -3.554  -39.015 1.00 95.06  ? 104  DG  P "C2'" 1 
ATOM   7725 C  "C1'" . DG  C 3 2   ? -36.776 -3.724  -38.070 1.00 93.42  ? 104  DG  P "C1'" 1 
ATOM   7726 N  N9    . DG  C 3 2   ? -36.406 -3.722  -36.652 1.00 89.34  ? 104  DG  P N9    1 
ATOM   7727 C  C8    . DG  C 3 2   ? -36.335 -4.808  -35.812 1.00 87.75  ? 104  DG  P C8    1 
ATOM   7728 N  N7    . DG  C 3 2   ? -35.984 -4.502  -34.595 1.00 86.12  ? 104  DG  P N7    1 
ATOM   7729 C  C5    . DG  C 3 2   ? -35.809 -3.126  -34.620 1.00 84.49  ? 104  DG  P C5    1 
ATOM   7730 C  C6    . DG  C 3 2   ? -35.428 -2.233  -33.587 1.00 81.18  ? 104  DG  P C6    1 
ATOM   7731 O  O6    . DG  C 3 2   ? -35.165 -2.505  -32.408 1.00 78.81  ? 104  DG  P O6    1 
ATOM   7732 N  N1    . DG  C 3 2   ? -35.366 -0.910  -34.029 1.00 79.42  ? 104  DG  P N1    1 
ATOM   7733 C  C2    . DG  C 3 2   ? -35.642 -0.505  -35.317 1.00 80.93  ? 104  DG  P C2    1 
ATOM   7734 N  N2    . DG  C 3 2   ? -35.534 0.805   -35.575 1.00 78.54  ? 104  DG  P N2    1 
ATOM   7735 N  N3    . DG  C 3 2   ? -36.001 -1.333  -36.294 1.00 84.26  ? 104  DG  P N3    1 
ATOM   7736 C  C4    . DG  C 3 2   ? -36.066 -2.627  -35.881 1.00 86.46  ? 104  DG  P C4    1 
ATOM   7737 P  P     . DC  C 3 3   ? -33.463 -4.663  -41.445 1.00 92.79  ? 105  DC  P P     1 
ATOM   7738 O  OP1   . DC  C 3 3   ? -33.430 -4.721  -42.926 1.00 91.96  ? 105  DC  P OP1   1 
ATOM   7739 O  OP2   . DC  C 3 3   ? -32.617 -5.583  -40.651 1.00 92.09  ? 105  DC  P OP2   1 
ATOM   7740 O  "O5'" . DC  C 3 3   ? -33.114 -3.176  -40.971 1.00 91.09  ? 105  DC  P "O5'" 1 
ATOM   7741 C  "C5'" . DC  C 3 3   ? -33.734 -2.046  -41.582 1.00 87.41  ? 105  DC  P "C5'" 1 
ATOM   7742 C  "C4'" . DC  C 3 3   ? -33.257 -0.758  -40.935 1.00 84.16  ? 105  DC  P "C4'" 1 
ATOM   7743 O  "O4'" . DC  C 3 3   ? -33.831 -0.604  -39.612 1.00 82.04  ? 105  DC  P "O4'" 1 
ATOM   7744 C  "C3'" . DC  C 3 3   ? -31.756 -0.668  -40.706 1.00 81.61  ? 105  DC  P "C3'" 1 
ATOM   7745 O  "O3'" . DC  C 3 3   ? -31.114 -0.408  -41.969 1.00 81.26  ? 105  DC  P "O3'" 1 
ATOM   7746 C  "C2'" . DC  C 3 3   ? -31.715 0.459   -39.678 1.00 80.41  ? 105  DC  P "C2'" 1 
ATOM   7747 C  "C1'" . DC  C 3 3   ? -32.929 0.139   -38.806 1.00 80.03  ? 105  DC  P "C1'" 1 
ATOM   7748 N  N1    . DC  C 3 3   ? -32.620 -0.614  -37.519 1.00 77.07  ? 105  DC  P N1    1 
ATOM   7749 C  C2    . DC  C 3 3   ? -32.293 0.092   -36.341 1.00 73.84  ? 105  DC  P C2    1 
ATOM   7750 O  O2    . DC  C 3 3   ? -32.248 1.329   -36.349 1.00 72.15  ? 105  DC  P O2    1 
ATOM   7751 N  N3    . DC  C 3 3   ? -32.028 -0.609  -35.204 1.00 72.28  ? 105  DC  P N3    1 
ATOM   7752 C  C4    . DC  C 3 3   ? -32.079 -1.946  -35.203 1.00 72.44  ? 105  DC  P C4    1 
ATOM   7753 N  N4    . DC  C 3 3   ? -31.812 -2.588  -34.061 1.00 69.73  ? 105  DC  P N4    1 
ATOM   7754 C  C5    . DC  C 3 3   ? -32.408 -2.684  -36.381 1.00 73.84  ? 105  DC  P C5    1 
ATOM   7755 C  C6    . DC  C 3 3   ? -32.666 -1.986  -37.496 1.00 75.51  ? 105  DC  P C6    1 
ATOM   7756 P  P     . DG  C 3 4   ? -29.713 0.352   -42.162 1.00 79.83  ? 106  DG  P P     1 
ATOM   7757 O  OP1   . DG  C 3 4   ? -29.356 0.272   -43.598 1.00 80.90  ? 106  DG  P OP1   1 
ATOM   7758 O  OP2   . DG  C 3 4   ? -28.757 -0.144  -41.148 1.00 80.83  ? 106  DG  P OP2   1 
ATOM   7759 O  "O5'" . DG  C 3 4   ? -30.099 1.866   -41.812 1.00 77.79  ? 106  DG  P "O5'" 1 
ATOM   7760 C  "C5'" . DG  C 3 4   ? -29.136 2.895   -41.936 1.00 73.07  ? 106  DG  P "C5'" 1 
ATOM   7761 C  "C4'" . DG  C 3 4   ? -28.691 3.449   -40.592 1.00 68.84  ? 106  DG  P "C4'" 1 
ATOM   7762 O  "O4'" . DG  C 3 4   ? -29.185 2.676   -39.467 1.00 64.99  ? 106  DG  P "O4'" 1 
ATOM   7763 C  "C3'" . DG  C 3 4   ? -27.178 3.496   -40.437 1.00 68.34  ? 106  DG  P "C3'" 1 
ATOM   7764 O  "O3'" . DG  C 3 4   ? -26.820 4.845   -40.196 1.00 71.57  ? 106  DG  P "O3'" 1 
ATOM   7765 C  "C2'" . DG  C 3 4   ? -26.868 2.584   -39.248 1.00 63.85  ? 106  DG  P "C2'" 1 
ATOM   7766 C  "C1'" . DG  C 3 4   ? -28.178 2.629   -38.474 1.00 60.20  ? 106  DG  P "C1'" 1 
ATOM   7767 N  N9    . DG  C 3 4   ? -28.422 1.472   -37.608 1.00 53.50  ? 106  DG  P N9    1 
ATOM   7768 C  C8    . DG  C 3 4   ? -28.682 0.179   -38.004 1.00 50.48  ? 106  DG  P C8    1 
ATOM   7769 N  N7    . DG  C 3 4   ? -28.869 -0.653  -37.017 1.00 48.39  ? 106  DG  P N7    1 
ATOM   7770 C  C5    . DG  C 3 4   ? -28.723 0.144   -35.886 1.00 48.51  ? 106  DG  P C5    1 
ATOM   7771 C  C6    . DG  C 3 4   ? -28.818 -0.199  -34.516 1.00 45.36  ? 106  DG  P C6    1 
ATOM   7772 O  O6    . DG  C 3 4   ? -29.059 -1.311  -34.043 1.00 45.73  ? 106  DG  P O6    1 
ATOM   7773 N  N1    . DG  C 3 4   ? -28.605 0.890   -33.666 1.00 45.31  ? 106  DG  P N1    1 
ATOM   7774 C  C2    . DG  C 3 4   ? -28.335 2.168   -34.103 1.00 47.72  ? 106  DG  P C2    1 
ATOM   7775 N  N2    . DG  C 3 4   ? -28.162 3.102   -33.154 1.00 43.12  ? 106  DG  P N2    1 
ATOM   7776 N  N3    . DG  C 3 4   ? -28.245 2.505   -35.393 1.00 48.84  ? 106  DG  P N3    1 
ATOM   7777 C  C4    . DG  C 3 4   ? -28.449 1.452   -36.228 1.00 49.46  ? 106  DG  P C4    1 
ATOM   7778 P  P     . DC  C 3 5   ? -25.319 5.347   -40.406 1.00 74.10  ? 107  DC  P P     1 
ATOM   7779 O  OP1   . DC  C 3 5   ? -25.377 6.680   -41.052 1.00 74.15  ? 107  DC  P OP1   1 
ATOM   7780 O  OP2   . DC  C 3 5   ? -24.533 4.247   -41.023 1.00 73.36  ? 107  DC  P OP2   1 
ATOM   7781 O  "O5'" . DC  C 3 5   ? -24.820 5.507   -38.894 1.00 71.37  ? 107  DC  P "O5'" 1 
ATOM   7782 C  "C5'" . DC  C 3 5   ? -25.361 6.509   -38.036 1.00 66.84  ? 107  DC  P "C5'" 1 
ATOM   7783 C  "C4'" . DC  C 3 5   ? -24.766 6.370   -36.645 1.00 64.89  ? 107  DC  P "C4'" 1 
ATOM   7784 O  "O4'" . DC  C 3 5   ? -25.263 5.159   -36.015 1.00 61.73  ? 107  DC  P "O4'" 1 
ATOM   7785 C  "C3'" . DC  C 3 5   ? -23.243 6.275   -36.601 1.00 64.28  ? 107  DC  P "C3'" 1 
ATOM   7786 O  "O3'" . DC  C 3 5   ? -22.756 7.194   -35.629 1.00 67.63  ? 107  DC  P "O3'" 1 
ATOM   7787 C  "C2'" . DC  C 3 5   ? -22.961 4.817   -36.228 1.00 60.27  ? 107  DC  P "C2'" 1 
ATOM   7788 C  "C1'" . DC  C 3 5   ? -24.193 4.474   -35.396 1.00 56.60  ? 107  DC  P "C1'" 1 
ATOM   7789 N  N1    . DC  C 3 5   ? -24.559 3.014   -35.319 1.00 49.88  ? 107  DC  P N1    1 
ATOM   7790 C  C2    . DC  C 3 5   ? -24.796 2.412   -34.065 1.00 45.31  ? 107  DC  P C2    1 
ATOM   7791 O  O2    . DC  C 3 5   ? -24.694 3.075   -33.023 1.00 44.96  ? 107  DC  P O2    1 
ATOM   7792 N  N3    . DC  C 3 5   ? -25.133 1.095   -34.029 1.00 41.53  ? 107  DC  P N3    1 
ATOM   7793 C  C4    . DC  C 3 5   ? -25.240 0.388   -35.161 1.00 40.19  ? 107  DC  P C4    1 
ATOM   7794 N  N4    . DC  C 3 5   ? -25.576 -0.902  -35.059 1.00 37.51  ? 107  DC  P N4    1 
ATOM   7795 C  C5    . DC  C 3 5   ? -25.008 0.975   -36.445 1.00 40.41  ? 107  DC  P C5    1 
ATOM   7796 C  C6    . DC  C 3 5   ? -24.676 2.276   -36.471 1.00 45.39  ? 107  DC  P C6    1 
ATOM   7797 P  P     . DG  C 3 6   ? -21.208 7.608   -35.582 1.00 70.65  ? 108  DG  P P     1 
ATOM   7798 O  OP1   . DG  C 3 6   ? -21.148 9.047   -35.222 1.00 70.38  ? 108  DG  P OP1   1 
ATOM   7799 O  OP2   . DG  C 3 6   ? -20.537 7.115   -36.811 1.00 68.45  ? 108  DG  P OP2   1 
ATOM   7800 O  "O5'" . DG  C 3 6   ? -20.674 6.736   -34.355 1.00 65.81  ? 108  DG  P "O5'" 1 
ATOM   7801 C  "C5'" . DG  C 3 6   ? -21.072 7.070   -33.030 1.00 63.09  ? 108  DG  P "C5'" 1 
ATOM   7802 C  "C4'" . DG  C 3 6   ? -20.601 6.013   -32.049 1.00 59.54  ? 108  DG  P "C4'" 1 
ATOM   7803 O  "O4'" . DG  C 3 6   ? -21.241 4.749   -32.360 1.00 54.90  ? 108  DG  P "O4'" 1 
ATOM   7804 C  "C3'" . DG  C 3 6   ? -19.095 5.758   -32.058 1.00 58.41  ? 108  DG  P "C3'" 1 
ATOM   7805 O  "O3'" . DG  C 3 6   ? -18.622 5.827   -30.708 1.00 60.54  ? 108  DG  P "O3'" 1 
ATOM   7806 C  "C2'" . DG  C 3 6   ? -18.964 4.374   -32.698 1.00 54.77  ? 108  DG  P "C2'" 1 
ATOM   7807 C  "C1'" . DG  C 3 6   ? -20.285 3.718   -32.308 1.00 52.38  ? 108  DG  P "C1'" 1 
ATOM   7808 N  N9    . DG  C 3 6   ? -20.748 2.651   -33.192 1.00 49.21  ? 108  DG  P N9    1 
ATOM   7809 C  C8    . DG  C 3 6   ? -20.791 2.664   -34.565 1.00 47.67  ? 108  DG  P C8    1 
ATOM   7810 N  N7    . DG  C 3 6   ? -21.265 1.565   -35.086 1.00 46.44  ? 108  DG  P N7    1 
ATOM   7811 C  C5    . DG  C 3 6   ? -21.555 0.769   -33.986 1.00 43.98  ? 108  DG  P C5    1 
ATOM   7812 C  C6    . DG  C 3 6   ? -22.098 -0.536  -33.927 1.00 42.99  ? 108  DG  P C6    1 
ATOM   7813 O  O6    . DG  C 3 6   ? -22.431 -1.271  -34.866 1.00 42.97  ? 108  DG  P O6    1 
ATOM   7814 N  N1    . DG  C 3 6   ? -22.240 -0.983  -32.613 1.00 42.87  ? 108  DG  P N1    1 
ATOM   7815 C  C2    . DG  C 3 6   ? -21.898 -0.254  -31.498 1.00 44.48  ? 108  DG  P C2    1 
ATOM   7816 N  N2    . DG  C 3 6   ? -22.104 -0.845  -30.313 1.00 43.43  ? 108  DG  P N2    1 
ATOM   7817 N  N3    . DG  C 3 6   ? -21.390 0.975   -31.541 1.00 45.90  ? 108  DG  P N3    1 
ATOM   7818 C  C4    . DG  C 3 6   ? -21.246 1.423   -32.814 1.00 45.63  ? 108  DG  P C4    1 
ATOM   7819 P  P     . DG  C 3 7   ? -17.080 5.619   -30.306 1.00 64.11  ? 109  DG  P P     1 
ATOM   7820 O  OP1   . DG  C 3 7   ? -16.786 6.587   -29.221 1.00 61.16  ? 109  DG  P OP1   1 
ATOM   7821 O  OP2   . DG  C 3 7   ? -16.256 5.607   -31.538 1.00 62.26  ? 109  DG  P OP2   1 
ATOM   7822 O  "O5'" . DG  C 3 7   ? -17.063 4.127   -29.714 1.00 60.06  ? 109  DG  P "O5'" 1 
ATOM   7823 C  "C5'" . DG  C 3 7   ? -17.961 3.745   -28.660 1.00 59.09  ? 109  DG  P "C5'" 1 
ATOM   7824 C  "C4'" . DG  C 3 7   ? -17.699 2.338   -28.134 1.00 57.63  ? 109  DG  P "C4'" 1 
ATOM   7825 O  "O4'" . DG  C 3 7   ? -18.405 1.331   -28.916 1.00 55.49  ? 109  DG  P "O4'" 1 
ATOM   7826 C  "C3'" . DG  C 3 7   ? -16.235 1.917   -28.117 1.00 57.75  ? 109  DG  P "C3'" 1 
ATOM   7827 O  "O3'" . DG  C 3 7   ? -15.962 1.275   -26.873 1.00 59.94  ? 109  DG  P "O3'" 1 
ATOM   7828 C  "C2'" . DG  C 3 7   ? -16.110 0.988   -29.327 1.00 55.65  ? 109  DG  P "C2'" 1 
ATOM   7829 C  "C1'" . DG  C 3 7   ? -17.501 0.362   -29.422 1.00 53.02  ? 109  DG  P "C1'" 1 
ATOM   7830 N  N9    . DG  C 3 7   ? -17.896 -0.001  -30.789 1.00 48.30  ? 109  DG  P N9    1 
ATOM   7831 C  C8    . DG  C 3 7   ? -17.751 0.772   -31.919 1.00 48.18  ? 109  DG  P C8    1 
ATOM   7832 N  N7    . DG  C 3 7   ? -18.191 0.196   -33.008 1.00 47.10  ? 109  DG  P N7    1 
ATOM   7833 C  C5    . DG  C 3 7   ? -18.661 -1.037  -32.588 1.00 42.97  ? 109  DG  P C5    1 
ATOM   7834 C  C6    . DG  C 3 7   ? -19.250 -2.089  -33.335 1.00 41.89  ? 109  DG  P C6    1 
ATOM   7835 O  O6    . DG  C 3 7   ? -19.490 -2.139  -34.554 1.00 43.49  ? 109  DG  P O6    1 
ATOM   7836 N  N1    . DG  C 3 7   ? -19.583 -3.171  -32.526 1.00 38.54  ? 109  DG  P N1    1 
ATOM   7837 C  C2    . DG  C 3 7   ? -19.370 -3.228  -31.169 1.00 41.78  ? 109  DG  P C2    1 
ATOM   7838 N  N2    . DG  C 3 7   ? -19.760 -4.354  -30.561 1.00 41.25  ? 109  DG  P N2    1 
ATOM   7839 N  N3    . DG  C 3 7   ? -18.818 -2.251  -30.454 1.00 44.82  ? 109  DG  P N3    1 
ATOM   7840 C  C4    . DG  C 3 7   ? -18.483 -1.179  -31.223 1.00 46.17  ? 109  DG  P C4    1 
ATOM   7841 P  P     . DC  C 3 8   ? -14.499 0.734   -26.503 1.00 61.23  ? 110  DC  P P     1 
ATOM   7842 O  OP1   . DC  C 3 8   ? -14.457 0.672   -25.024 1.00 62.31  ? 110  DC  P OP1   1 
ATOM   7843 O  OP2   . DC  C 3 8   ? -13.473 1.497   -27.259 1.00 60.36  ? 110  DC  P OP2   1 
ATOM   7844 O  "O5'" . DC  C 3 8   ? -14.495 -0.752  -27.099 1.00 57.95  ? 110  DC  P "O5'" 1 
ATOM   7845 C  "C5'" . DC  C 3 8   ? -15.517 -1.679  -26.733 1.00 54.21  ? 110  DC  P "C5'" 1 
ATOM   7846 C  "C4'" . DC  C 3 8   ? -15.443 -2.924  -27.600 1.00 49.39  ? 110  DC  P "C4'" 1 
ATOM   7847 O  "O4'" . DC  C 3 8   ? -15.832 -2.622  -28.955 1.00 47.77  ? 110  DC  P "O4'" 1 
ATOM   7848 C  "C3'" . DC  C 3 8   ? -14.053 -3.539  -27.717 1.00 47.21  ? 110  DC  P "C3'" 1 
ATOM   7849 O  "O3'" . DC  C 3 8   ? -14.025 -4.620  -26.781 1.00 43.57  ? 110  DC  P "O3'" 1 
ATOM   7850 C  "C2'" . DC  C 3 8   ? -13.922 -3.931  -29.201 1.00 45.68  ? 110  DC  P "C2'" 1 
ATOM   7851 C  "C1'" . DC  C 3 8   ? -15.316 -3.654  -29.766 1.00 43.22  ? 110  DC  P "C1'" 1 
ATOM   7852 N  N1    . DC  C 3 8   ? -15.452 -3.233  -31.220 1.00 39.53  ? 110  DC  P N1    1 
ATOM   7853 C  C2    . DC  C 3 8   ? -16.070 -4.094  -32.157 1.00 37.28  ? 110  DC  P C2    1 
ATOM   7854 O  O2    . DC  C 3 8   ? -16.482 -5.209  -31.809 1.00 35.36  ? 110  DC  P O2    1 
ATOM   7855 N  N3    . DC  C 3 8   ? -16.196 -3.687  -33.448 1.00 36.09  ? 110  DC  P N3    1 
ATOM   7856 C  C4    . DC  C 3 8   ? -15.744 -2.487  -33.825 1.00 37.38  ? 110  DC  P C4    1 
ATOM   7857 N  N4    . DC  C 3 8   ? -15.892 -2.133  -35.112 1.00 35.22  ? 110  DC  P N4    1 
ATOM   7858 C  C5    . DC  C 3 8   ? -15.118 -1.598  -32.894 1.00 36.22  ? 110  DC  P C5    1 
ATOM   7859 C  C6    . DC  C 3 8   ? -15.007 -2.000  -31.620 1.00 36.33  ? 110  DC  P C6    1 
ATOM   7860 P  P     . DG  C 3 9   ? -12.725 -5.495  -26.474 1.00 44.80  ? 111  DG  P P     1 
ATOM   7861 O  OP1   . DG  C 3 9   ? -13.010 -6.259  -25.238 1.00 42.37  ? 111  DG  P OP1   1 
ATOM   7862 O  OP2   . DG  C 3 9   ? -11.528 -4.627  -26.571 1.00 45.32  ? 111  DG  P OP2   1 
ATOM   7863 O  "O5'" . DG  C 3 9   ? -12.673 -6.510  -27.722 1.00 42.75  ? 111  DG  P "O5'" 1 
ATOM   7864 C  "C5'" . DG  C 3 9   ? -13.797 -7.341  -27.998 1.00 39.42  ? 111  DG  P "C5'" 1 
ATOM   7865 C  "C4'" . DG  C 3 9   ? -13.577 -8.206  -29.226 1.00 38.27  ? 111  DG  P "C4'" 1 
ATOM   7866 O  "O4'" . DG  C 3 9   ? -13.806 -7.457  -30.446 1.00 35.96  ? 111  DG  P "O4'" 1 
ATOM   7867 C  "C3'" . DG  C 3 9   ? -12.183 -8.790  -29.351 1.00 37.27  ? 111  DG  P "C3'" 1 
ATOM   7868 O  "O3'" . DG  C 3 9   ? -12.381 -10.165 -29.562 1.00 38.88  ? 111  DG  P "O3'" 1 
ATOM   7869 C  "C2'" . DG  C 3 9   ? -11.566 -8.063  -30.551 1.00 34.84  ? 111  DG  P "C2'" 1 
ATOM   7870 C  "C1'" . DG  C 3 9   ? -12.800 -7.753  -31.387 1.00 33.53  ? 111  DG  P "C1'" 1 
ATOM   7871 N  N9    . DG  C 3 9   ? -12.751 -6.591  -32.277 1.00 33.34  ? 111  DG  P N9    1 
ATOM   7872 C  C8    . DG  C 3 9   ? -12.206 -5.350  -32.035 1.00 29.30  ? 111  DG  P C8    1 
ATOM   7873 N  N7    . DG  C 3 9   ? -12.361 -4.521  -33.038 1.00 34.32  ? 111  DG  P N7    1 
ATOM   7874 C  C5    . DG  C 3 9   ? -13.063 -5.243  -34.006 1.00 31.64  ? 111  DG  P C5    1 
ATOM   7875 C  C6    . DG  C 3 9   ? -13.523 -4.879  -35.306 1.00 32.43  ? 111  DG  P C6    1 
ATOM   7876 O  O6    . DG  C 3 9   ? -13.402 -3.798  -35.911 1.00 33.57  ? 111  DG  P O6    1 
ATOM   7877 N  N1    . DG  C 3 9   ? -14.188 -5.931  -35.943 1.00 32.19  ? 111  DG  P N1    1 
ATOM   7878 C  C2    . DG  C 3 9   ? -14.389 -7.182  -35.396 1.00 32.02  ? 111  DG  P C2    1 
ATOM   7879 N  N2    . DG  C 3 9   ? -15.055 -8.076  -36.152 1.00 23.95  ? 111  DG  P N2    1 
ATOM   7880 N  N3    . DG  C 3 9   ? -13.969 -7.525  -34.178 1.00 28.71  ? 111  DG  P N3    1 
ATOM   7881 C  C4    . DG  C 3 9   ? -13.311 -6.521  -33.544 1.00 31.83  ? 111  DG  P C4    1 
ATOM   7882 P  P     . DG  C 3 10  ? -11.156 -11.181 -29.628 1.00 41.24  ? 112  DG  P P     1 
ATOM   7883 O  OP1   . DG  C 3 10  ? -11.650 -12.478 -29.108 1.00 40.78  ? 112  DG  P OP1   1 
ATOM   7884 O  OP2   . DG  C 3 10  ? -9.933  -10.541 -29.089 1.00 39.37  ? 112  DG  P OP2   1 
ATOM   7885 O  "O5'" . DG  C 3 10  ? -10.933 -11.304 -31.203 1.00 39.18  ? 112  DG  P "O5'" 1 
ATOM   7886 C  "C5'" . DG  C 3 10  ? -11.991 -11.716 -32.073 1.00 37.07  ? 112  DG  P "C5'" 1 
ATOM   7887 C  "C4'" . DG  C 3 10  ? -11.550 -11.488 -33.510 1.00 36.59  ? 112  DG  P "C4'" 1 
ATOM   7888 O  "O4'" . DG  C 3 10  ? -11.640 -10.079 -33.835 1.00 30.62  ? 112  DG  P "O4'" 1 
ATOM   7889 C  "C3'" . DG  C 3 10  ? -10.103 -11.886 -33.795 1.00 34.93  ? 112  DG  P "C3'" 1 
ATOM   7890 O  "O3'" . DG  C 3 10  ? -10.107 -12.974 -34.701 1.00 37.74  ? 112  DG  P "O3'" 1 
ATOM   7891 C  "C2'" . DG  C 3 10  ? -9.481  -10.632 -34.400 1.00 35.09  ? 112  DG  P "C2'" 1 
ATOM   7892 C  "C1'" . DG  C 3 10  ? -10.715 -9.860  -34.855 1.00 32.75  ? 112  DG  P "C1'" 1 
ATOM   7893 N  N9    . DG  C 3 10  ? -10.490 -8.432  -35.064 1.00 33.09  ? 112  DG  P N9    1 
ATOM   7894 C  C8    . DG  C 3 10  ? -9.842  -7.543  -34.237 1.00 33.84  ? 112  DG  P C8    1 
ATOM   7895 N  N7    . DG  C 3 10  ? -9.786  -6.326  -34.722 1.00 37.40  ? 112  DG  P N7    1 
ATOM   7896 C  C5    . DG  C 3 10  ? -10.430 -6.419  -35.956 1.00 34.88  ? 112  DG  P C5    1 
ATOM   7897 C  C6    . DG  C 3 10  ? -10.683 -5.436  -36.951 1.00 33.06  ? 112  DG  P C6    1 
ATOM   7898 O  O6    . DG  C 3 10  ? -10.373 -4.245  -36.944 1.00 33.38  ? 112  DG  P O6    1 
ATOM   7899 N  N1    . DG  C 3 10  ? -11.371 -5.946  -38.051 1.00 33.10  ? 112  DG  P N1    1 
ATOM   7900 C  C2    . DG  C 3 10  ? -11.762 -7.260  -38.177 1.00 34.95  ? 112  DG  P C2    1 
ATOM   7901 N  N2    . DG  C 3 10  ? -12.407 -7.586  -39.304 1.00 34.15  ? 112  DG  P N2    1 
ATOM   7902 N  N3    . DG  C 3 10  ? -11.531 -8.195  -37.257 1.00 34.33  ? 112  DG  P N3    1 
ATOM   7903 C  C4    . DG  C 3 10  ? -10.863 -7.711  -36.178 1.00 32.61  ? 112  DG  P C4    1 
ATOM   7904 P  P     . DC  C 3 11  ? -8.841  -13.926 -34.882 1.00 38.69  ? 113  DC  P P     1 
ATOM   7905 O  OP1   . DC  C 3 11  ? -9.122  -15.225 -34.277 1.00 41.14  ? 113  DC  P OP1   1 
ATOM   7906 O  OP2   . DC  C 3 11  ? -7.594  -13.169 -34.638 1.00 42.21  ? 113  DC  P OP2   1 
ATOM   7907 O  "O5'" . DC  C 3 11  ? -8.826  -14.190 -36.427 1.00 44.81  ? 113  DC  P "O5'" 1 
ATOM   7908 C  "C5'" . DC  C 3 11  ? -8.457  -13.083 -37.147 1.00 43.76  ? 113  DC  P "C5'" 1 
ATOM   7909 C  "C4'" . DC  C 3 11  ? -9.473  -12.911 -38.230 1.00 39.91  ? 113  DC  P "C4'" 1 
ATOM   7910 O  "O4'" . DC  C 3 11  ? -9.924  -11.538 -38.227 1.00 41.54  ? 113  DC  P "O4'" 1 
ATOM   7911 C  "C3'" . DC  C 3 11  ? -8.778  -13.145 -39.541 1.00 38.95  ? 113  DC  P "C3'" 1 
ATOM   7912 O  "O3'" . DC  C 3 11  ? -9.669  -13.739 -40.465 1.00 34.64  ? 113  DC  P "O3'" 1 
ATOM   7913 C  "C2'" . DC  C 3 11  ? -8.293  -11.747 -39.925 1.00 38.03  ? 113  DC  P "C2'" 1 
ATOM   7914 C  "C1'" . DC  C 3 11  ? -9.330  -10.825 -39.289 1.00 38.08  ? 113  DC  P "C1'" 1 
ATOM   7915 N  N1    . DC  C 3 11  ? -8.745  -9.543  -38.781 1.00 33.79  ? 113  DC  P N1    1 
ATOM   7916 C  C2    . DC  C 3 11  ? -9.015  -8.364  -39.491 1.00 35.12  ? 113  DC  P C2    1 
ATOM   7917 O  O2    . DC  C 3 11  ? -9.739  -8.421  -40.495 1.00 39.64  ? 113  DC  P O2    1 
ATOM   7918 N  N3    . DC  C 3 11  ? -8.492  -7.186  -39.055 1.00 32.79  ? 113  DC  P N3    1 
ATOM   7919 C  C4    . DC  C 3 11  ? -7.726  -7.163  -37.963 1.00 31.21  ? 113  DC  P C4    1 
ATOM   7920 N  N4    . DC  C 3 11  ? -7.237  -5.978  -37.580 1.00 26.57  ? 113  DC  P N4    1 
ATOM   7921 C  C5    . DC  C 3 11  ? -7.428  -8.360  -37.225 1.00 34.06  ? 113  DC  P C5    1 
ATOM   7922 C  C6    . DC  C 3 11  ? -7.950  -9.519  -37.666 1.00 31.89  ? 113  DC  P C6    1 
ATOM   7923 P  P     . DG  C 3 12  ? -8.976  -14.441 -41.707 1.00 37.61  ? 114  DG  P P     1 
ATOM   7924 O  OP1   . DG  C 3 12  ? -9.968  -15.367 -42.299 1.00 43.12  ? 114  DG  P OP1   1 
ATOM   7925 O  OP2   . DG  C 3 12  ? -7.642  -14.925 -41.303 1.00 36.81  ? 114  DG  P OP2   1 
ATOM   7926 O  "O5'" . DG  C 3 12  ? -8.735  -13.219 -42.699 1.00 31.85  ? 114  DG  P "O5'" 1 
ATOM   7927 C  "C5'" . DG  C 3 12  ? -9.858  -12.537 -43.226 1.00 34.72  ? 114  DG  P "C5'" 1 
ATOM   7928 C  "C4'" . DG  C 3 12  ? -9.421  -11.719 -44.422 1.00 34.49  ? 114  DG  P "C4'" 1 
ATOM   7929 O  "O4'" . DG  C 3 12  ? -8.989  -10.415 -43.967 1.00 33.84  ? 114  DG  P "O4'" 1 
ATOM   7930 C  "C3'" . DG  C 3 12  ? -8.266  -12.317 -45.212 1.00 33.05  ? 114  DG  P "C3'" 1 
ATOM   7931 O  "O3'" . DG  C 3 12  ? -8.652  -12.259 -46.584 1.00 35.40  ? 114  DG  P "O3'" 1 
ATOM   7932 C  "C2'" . DG  C 3 12  ? -7.056  -11.472 -44.808 1.00 33.35  ? 114  DG  P "C2'" 1 
ATOM   7933 C  "C1'" . DG  C 3 12  ? -7.673  -10.140 -44.389 1.00 31.36  ? 114  DG  P "C1'" 1 
ATOM   7934 N  N9    . DG  C 3 12  ? -7.007  -9.475  -43.270 1.00 28.37  ? 114  DG  P N9    1 
ATOM   7935 C  C8    . DG  C 3 12  ? -6.530  -10.074 -42.128 1.00 27.69  ? 114  DG  P C8    1 
ATOM   7936 N  N7    . DG  C 3 12  ? -5.983  -9.239  -41.290 1.00 25.72  ? 114  DG  P N7    1 
ATOM   7937 C  C5    . DG  C 3 12  ? -6.102  -8.004  -41.910 1.00 25.22  ? 114  DG  P C5    1 
ATOM   7938 C  C6    . DG  C 3 12  ? -5.684  -6.719  -41.474 1.00 26.17  ? 114  DG  P C6    1 
ATOM   7939 O  O6    . DG  C 3 12  ? -5.111  -6.440  -40.419 1.00 24.65  ? 114  DG  P O6    1 
ATOM   7940 N  N1    . DG  C 3 12  ? -5.984  -5.705  -42.393 1.00 23.39  ? 114  DG  P N1    1 
ATOM   7941 C  C2    . DG  C 3 12  ? -6.616  -5.931  -43.597 1.00 25.03  ? 114  DG  P C2    1 
ATOM   7942 N  N2    . DG  C 3 12  ? -6.837  -4.854  -44.361 1.00 19.73  ? 114  DG  P N2    1 
ATOM   7943 N  N3    . DG  C 3 12  ? -7.016  -7.135  -44.012 1.00 26.65  ? 114  DG  P N3    1 
ATOM   7944 C  C4    . DG  C 3 12  ? -6.731  -8.126  -43.129 1.00 25.04  ? 114  DG  P C4    1 
HETATM 7945 P  P     . 2DA C 3 13  ? -7.679  -12.489 -47.830 1.00 36.24  ? 115  2DA P P     1 
HETATM 7946 O  OP1   . 2DA C 3 13  ? -8.541  -12.490 -49.081 1.00 37.04  ? 115  2DA P OP1   1 
HETATM 7947 O  OP2   . 2DA C 3 13  ? -6.758  -13.646 -47.544 1.00 33.83  ? 115  2DA P OP2   1 
HETATM 7948 O  "O5'" . 2DA C 3 13  ? -6.882  -11.095 -47.829 1.00 36.11  ? 115  2DA P "O5'" 1 
HETATM 7949 C  "C5'" . 2DA C 3 13  ? -5.529  -10.947 -48.226 1.00 31.63  ? 115  2DA P "C5'" 1 
HETATM 7950 C  "C4'" . 2DA C 3 13  ? -5.302  -9.444  -48.278 1.00 28.77  ? 115  2DA P "C4'" 1 
HETATM 7951 O  "O4'" . 2DA C 3 13  ? -5.552  -8.857  -46.997 1.00 27.49  ? 115  2DA P "O4'" 1 
HETATM 7952 C  "C3'" . 2DA C 3 13  ? -3.862  -9.127  -48.628 1.00 26.82  ? 115  2DA P "C3'" 1 
HETATM 7953 C  "C2'" . 2DA C 3 13  ? -3.567  -7.868  -47.834 1.00 28.08  ? 115  2DA P "C2'" 1 
HETATM 7954 C  "C1'" . 2DA C 3 13  ? -4.629  -7.795  -46.752 1.00 25.18  ? 115  2DA P "C1'" 1 
HETATM 7955 N  N9    . 2DA C 3 13  ? -3.998  -7.944  -45.414 1.00 26.25  ? 115  2DA P N9    1 
HETATM 7956 C  C8    . 2DA C 3 13  ? -3.838  -9.090  -44.718 1.00 21.89  ? 115  2DA P C8    1 
HETATM 7957 N  N7    . 2DA C 3 13  ? -3.230  -8.808  -43.541 1.00 22.28  ? 115  2DA P N7    1 
HETATM 7958 C  C5    . 2DA C 3 13  ? -3.005  -7.470  -43.512 1.00 23.26  ? 115  2DA P C5    1 
HETATM 7959 C  C6    . 2DA C 3 13  ? -2.420  -6.609  -42.579 1.00 24.78  ? 115  2DA P C6    1 
HETATM 7960 N  N6    . 2DA C 3 13  ? -1.930  -7.095  -41.397 1.00 18.85  ? 115  2DA P N6    1 
HETATM 7961 N  N1    . 2DA C 3 13  ? -2.352  -5.276  -42.871 1.00 22.09  ? 115  2DA P N1    1 
HETATM 7962 C  C2    . 2DA C 3 13  ? -2.839  -4.785  -44.023 1.00 23.03  ? 115  2DA P C2    1 
HETATM 7963 N  N3    . 2DA C 3 13  ? -3.395  -5.597  -44.939 1.00 23.27  ? 115  2DA P N3    1 
HETATM 7964 C  C4    . 2DA C 3 13  ? -3.491  -6.935  -44.699 1.00 23.96  ? 115  2DA P C4    1 
HETATM 7965 P  PA    . TTP D 4 .   ? -0.175  -10.420 -49.140 1.00 45.82  ? 903  TTP A PA    1 
HETATM 7966 O  O1A   . TTP D 4 .   ? -0.733  -11.303 -48.057 1.00 48.65  ? 903  TTP A O1A   1 
HETATM 7967 O  O2A   . TTP D 4 .   ? -0.765  -10.805 -50.473 1.00 51.41  ? 903  TTP A O2A   1 
HETATM 7968 O  O3A   . TTP D 4 .   ? 1.420   -10.591 -49.142 1.00 49.55  ? 903  TTP A O3A   1 
HETATM 7969 P  PB    . TTP D 4 .   ? 2.570   -10.094 -50.158 1.00 45.11  ? 903  TTP A PB    1 
HETATM 7970 O  O1B   . TTP D 4 .   ? 3.292   -8.932  -49.533 1.00 43.32  ? 903  TTP A O1B   1 
HETATM 7971 O  O2B   . TTP D 4 .   ? 2.099   -9.806  -51.561 1.00 44.04  ? 903  TTP A O2B   1 
HETATM 7972 O  O3B   . TTP D 4 .   ? 3.511   -11.387 -50.074 1.00 45.32  ? 903  TTP A O3B   1 
HETATM 7973 P  PG    . TTP D 4 .   ? 3.295   -12.720 -50.959 1.00 43.14  ? 903  TTP A PG    1 
HETATM 7974 O  O1G   . TTP D 4 .   ? 2.031   -12.667 -51.747 1.00 39.30  ? 903  TTP A O1G   1 
HETATM 7975 O  O2G   . TTP D 4 .   ? 4.458   -12.745 -51.917 1.00 42.46  ? 903  TTP A O2G   1 
HETATM 7976 O  O3G   . TTP D 4 .   ? 3.339   -13.940 -50.067 1.00 43.79  ? 903  TTP A O3G   1 
HETATM 7977 O  "O5'" . TTP D 4 .   ? -0.407  -8.868  -48.772 1.00 46.30  ? 903  TTP A "O5'" 1 
HETATM 7978 C  "C5'" . TTP D 4 .   ? -0.435  -7.895  -49.808 1.00 40.53  ? 903  TTP A "C5'" 1 
HETATM 7979 C  "C4'" . TTP D 4 .   ? 0.035   -6.555  -49.279 1.00 42.06  ? 903  TTP A "C4'" 1 
HETATM 7980 O  "O4'" . TTP D 4 .   ? -0.742  -6.192  -48.133 1.00 44.98  ? 903  TTP A "O4'" 1 
HETATM 7981 C  "C3'" . TTP D 4 .   ? 1.471   -6.577  -48.785 1.00 42.62  ? 903  TTP A "C3'" 1 
HETATM 7982 O  "O3'" . TTP D 4 .   ? 2.439   -6.392  -49.825 1.00 44.48  ? 903  TTP A "O3'" 1 
HETATM 7983 C  "C2'" . TTP D 4 .   ? 1.469   -5.443  -47.779 1.00 42.43  ? 903  TTP A "C2'" 1 
HETATM 7984 C  "C1'" . TTP D 4 .   ? 0.068   -5.521  -47.161 1.00 41.68  ? 903  TTP A "C1'" 1 
HETATM 7985 N  N1    . TTP D 4 .   ? 0.243   -6.281  -45.916 1.00 41.26  ? 903  TTP A N1    1 
HETATM 7986 C  C2    . TTP D 4 .   ? 0.734   -5.578  -44.792 1.00 38.84  ? 903  TTP A C2    1 
HETATM 7987 O  O2    . TTP D 4 .   ? 0.956   -4.350  -44.878 1.00 39.10  ? 903  TTP A O2    1 
HETATM 7988 N  N3    . TTP D 4 .   ? 0.958   -6.205  -43.632 1.00 40.95  ? 903  TTP A N3    1 
HETATM 7989 C  C4    . TTP D 4 .   ? 0.729   -7.514  -43.490 1.00 40.11  ? 903  TTP A C4    1 
HETATM 7990 O  O4    . TTP D 4 .   ? 0.951   -8.072  -42.391 1.00 42.73  ? 903  TTP A O4    1 
HETATM 7991 C  C5    . TTP D 4 .   ? 0.223   -8.288  -44.647 1.00 38.89  ? 903  TTP A C5    1 
HETATM 7992 C  C5M   . TTP D 4 .   ? -0.047  -9.774  -44.520 1.00 36.88  ? 903  TTP A C5M   1 
HETATM 7993 C  C6    . TTP D 4 .   ? 0.002   -7.607  -45.839 1.00 39.21  ? 903  TTP A C6    1 
HETATM 7994 CA CA    . CA  E 5 .   ? 0.708   -11.110 -52.747 1.00 27.75  ? 904  CA  A CA    1 
HETATM 7995 CA CA    . CA  F 5 .   ? -2.891  -11.671 -51.544 1.00 53.52  ? 905  CA  A CA    1 
HETATM 7996 CA CA    . CA  G 5 .   ? 3.254   -48.457 -52.863 1.00 56.40  ? 906  CA  A CA    1 
HETATM 7997 CA CA    . CA  H 5 .   ? 2.432   -16.065 -55.222 1.00 75.70  ? 907  CA  A CA    1 
HETATM 7998 CA CA    . CA  I 5 .   ? 3.395   -24.675 -13.046 1.00 59.86  ? 908  CA  A CA    1 
HETATM 7999 O  O     . HOH J 6 .   ? -18.817 -8.411  -10.512 1.00 30.02  ? 909  HOH A O     1 
HETATM 8000 O  O     . HOH J 6 .   ? 10.704  8.322   -45.907 1.00 13.37  ? 910  HOH A O     1 
HETATM 8001 O  O     . HOH J 6 .   ? -4.573  -4.204  -47.252 1.00 13.14  ? 911  HOH A O     1 
HETATM 8002 O  O     . HOH J 6 .   ? 29.241  7.077   -32.414 1.00 14.80  ? 912  HOH A O     1 
HETATM 8003 O  O     . HOH J 6 .   ? 15.133  -21.936 -32.856 1.00 13.25  ? 913  HOH A O     1 
HETATM 8004 O  O     . HOH J 6 .   ? -28.659 -34.346 -26.358 1.00 33.98  ? 914  HOH A O     1 
HETATM 8005 O  O     . HOH J 6 .   ? 25.395  21.330  -44.644 1.00 21.10  ? 915  HOH A O     1 
HETATM 8006 O  O     . HOH J 6 .   ? -27.749 -31.820 -53.866 1.00 20.39  ? 916  HOH A O     1 
HETATM 8007 O  O     . HOH J 6 .   ? 9.470   -6.206  -2.426  1.00 40.60  ? 917  HOH A O     1 
HETATM 8008 O  O     . HOH J 6 .   ? 13.400  4.917   -36.038 1.00 24.57  ? 918  HOH A O     1 
HETATM 8009 O  O     . HOH J 6 .   ? 5.273   -33.685 -23.296 1.00 26.63  ? 919  HOH A O     1 
HETATM 8010 O  O     . HOH J 6 .   ? 22.154  -21.112 -18.127 1.00 12.09  ? 920  HOH A O     1 
HETATM 8011 O  O     . HOH J 6 .   ? 7.772   -4.723  -9.008  1.00 40.76  ? 921  HOH A O     1 
HETATM 8012 O  O     . HOH J 6 .   ? 24.592  -11.474 -40.178 1.00 16.09  ? 922  HOH A O     1 
HETATM 8013 O  O     . HOH J 6 .   ? 5.069   9.191   -65.680 1.00 23.84  ? 923  HOH A O     1 
HETATM 8014 O  O     . HOH J 6 .   ? -21.009 -7.736  -51.269 1.00 12.88  ? 924  HOH A O     1 
HETATM 8015 O  O     . HOH J 6 .   ? 21.940  -6.882  -25.693 1.00 14.05  ? 925  HOH A O     1 
HETATM 8016 O  O     . HOH J 6 .   ? 4.927   -2.685  -63.644 1.00 25.57  ? 926  HOH A O     1 
HETATM 8017 O  O     . HOH J 6 .   ? -14.890 -23.180 -27.859 1.00 11.73  ? 927  HOH A O     1 
HETATM 8018 O  O     . HOH J 6 .   ? -0.699  -16.130 -31.293 1.00 19.79  ? 928  HOH A O     1 
HETATM 8019 O  O     . HOH J 6 .   ? -14.561 -7.032  -62.713 1.00 21.03  ? 929  HOH A O     1 
HETATM 8020 O  O     . HOH J 6 .   ? 25.215  -20.863 -35.931 1.00 25.01  ? 930  HOH A O     1 
HETATM 8021 O  O     . HOH J 6 .   ? 4.622   -29.923 -38.759 1.00 29.79  ? 931  HOH A O     1 
HETATM 8022 O  O     . HOH J 6 .   ? 18.896  -2.766  -29.985 1.00 13.87  ? 932  HOH A O     1 
HETATM 8023 O  O     . HOH J 6 .   ? 9.419   -30.781 -31.504 1.00 18.59  ? 933  HOH A O     1 
HETATM 8024 O  O     . HOH J 6 .   ? 28.752  -17.126 -16.871 1.00 29.10  ? 934  HOH A O     1 
HETATM 8025 O  O     . HOH J 6 .   ? -9.643  -28.570 -45.871 1.00 14.62  ? 935  HOH A O     1 
HETATM 8026 O  O     . HOH J 6 .   ? 19.005  22.184  -38.561 1.00 21.55  ? 936  HOH A O     1 
HETATM 8027 O  O     . HOH J 6 .   ? 0.460   9.124   -38.581 1.00 13.55  ? 937  HOH A O     1 
HETATM 8028 O  O     . HOH J 6 .   ? 10.241  -10.978 -23.900 1.00 18.84  ? 938  HOH A O     1 
HETATM 8029 O  O     . HOH J 6 .   ? 20.440  12.603  -43.135 1.00 28.01  ? 939  HOH A O     1 
HETATM 8030 O  O     . HOH J 6 .   ? -14.981 -30.828 -42.740 1.00 17.79  ? 940  HOH A O     1 
HETATM 8031 O  O     . HOH J 6 .   ? -16.987 -18.418 -61.222 1.00 21.79  ? 941  HOH A O     1 
HETATM 8032 O  O     . HOH J 6 .   ? -12.733 -20.756 -13.298 1.00 24.69  ? 942  HOH A O     1 
HETATM 8033 O  O     . HOH J 6 .   ? 0.741   -21.881 -18.525 1.00 16.02  ? 943  HOH A O     1 
HETATM 8034 O  O     . HOH J 6 .   ? -18.735 -30.259 -34.202 1.00 14.67  ? 944  HOH A O     1 
HETATM 8035 O  O     . HOH J 6 .   ? 21.085  -4.931  -0.348  1.00 19.97  ? 945  HOH A O     1 
HETATM 8036 O  O     . HOH J 6 .   ? -12.291 -26.267 -34.784 1.00 16.37  ? 946  HOH A O     1 
HETATM 8037 O  O     . HOH J 6 .   ? -2.751  -1.120  -47.273 1.00 25.56  ? 947  HOH A O     1 
HETATM 8038 O  O     . HOH J 6 .   ? 33.239  16.060  -24.863 1.00 27.73  ? 948  HOH A O     1 
HETATM 8039 O  O     . HOH J 6 .   ? 29.944  -19.410 -21.841 1.00 23.76  ? 949  HOH A O     1 
HETATM 8040 O  O     . HOH J 6 .   ? -10.127 -10.361 -48.811 1.00 21.90  ? 950  HOH A O     1 
HETATM 8041 O  O     . HOH J 6 .   ? 26.042  -6.652  -21.932 1.00 14.40  ? 951  HOH A O     1 
HETATM 8042 O  O     . HOH J 6 .   ? 6.585   -9.478  -66.113 1.00 32.86  ? 952  HOH A O     1 
HETATM 8043 O  O     . HOH J 6 .   ? 16.326  -1.632  -55.514 1.00 28.39  ? 953  HOH A O     1 
HETATM 8044 O  O     . HOH J 6 .   ? 7.029   11.429  -32.507 1.00 36.20  ? 954  HOH A O     1 
HETATM 8045 O  O     . HOH J 6 .   ? -12.419 -22.291 -28.254 1.00 4.18   ? 955  HOH A O     1 
HETATM 8046 O  O     . HOH J 6 .   ? -9.084  -26.436 -15.788 1.00 35.66  ? 956  HOH A O     1 
HETATM 8047 O  O     A HOH J 6 .   ? 13.358  -25.058 -44.458 0.50 2.00   ? 957  HOH A O     1 
HETATM 8048 O  O     B HOH J 6 .   ? 14.197  -22.917 -44.277 0.50 3.55   ? 957  HOH A O     1 
HETATM 8049 O  O     . HOH J 6 .   ? -20.248 -19.566 -61.293 1.00 18.74  ? 958  HOH A O     1 
HETATM 8050 O  O     . HOH J 6 .   ? 22.891  -4.137  -39.953 1.00 15.63  ? 959  HOH A O     1 
HETATM 8051 O  O     . HOH J 6 .   ? 28.778  -2.247  -39.312 1.00 14.83  ? 960  HOH A O     1 
HETATM 8052 O  O     . HOH J 6 .   ? 5.208   -22.766 -13.273 1.00 31.36  ? 961  HOH A O     1 
HETATM 8053 O  O     . HOH J 6 .   ? 2.786   -9.498  -63.838 1.00 16.87  ? 962  HOH A O     1 
HETATM 8054 O  O     . HOH J 6 .   ? 21.487  1.828   -57.845 1.00 25.22  ? 963  HOH A O     1 
HETATM 8055 O  O     . HOH J 6 .   ? -10.729 -20.369 -15.140 1.00 43.45  ? 964  HOH A O     1 
HETATM 8056 O  O     . HOH J 6 .   ? -32.801 -23.277 -45.424 1.00 43.40  ? 965  HOH A O     1 
HETATM 8057 O  O     . HOH J 6 .   ? 4.877   -7.930  -57.526 1.00 5.57   ? 966  HOH A O     1 
HETATM 8058 O  O     . HOH J 6 .   ? -3.978  -34.807 -27.642 1.00 42.99  ? 967  HOH A O     1 
HETATM 8059 O  O     . HOH J 6 .   ? -28.392 -26.258 -19.913 1.00 36.74  ? 968  HOH A O     1 
HETATM 8060 O  O     . HOH J 6 .   ? 1.394   -26.860 -4.336  1.00 15.30  ? 969  HOH A O     1 
HETATM 8061 O  O     . HOH J 6 .   ? 23.241  -23.133 -27.548 1.00 19.26  ? 970  HOH A O     1 
HETATM 8062 O  O     . HOH J 6 .   ? -15.813 -30.042 -61.961 1.00 14.84  ? 971  HOH A O     1 
HETATM 8063 O  O     . HOH J 6 .   ? 21.789  -8.364  -0.631  1.00 20.52  ? 972  HOH A O     1 
HETATM 8064 O  O     . HOH J 6 .   ? 16.607  -39.737 -59.979 1.00 20.40  ? 973  HOH A O     1 
HETATM 8065 O  O     . HOH J 6 .   ? 4.679   -10.447 -29.209 1.00 21.61  ? 974  HOH A O     1 
HETATM 8066 O  O     . HOH J 6 .   ? 5.094   -31.147 -45.923 1.00 14.93  ? 975  HOH A O     1 
HETATM 8067 O  O     . HOH J 6 .   ? 19.730  -37.784 -15.122 1.00 35.91  ? 976  HOH A O     1 
HETATM 8068 O  O     . HOH J 6 .   ? -31.379 -24.700 -23.679 1.00 11.51  ? 977  HOH A O     1 
HETATM 8069 O  O     . HOH J 6 .   ? 5.441   -21.498 -1.674  1.00 15.69  ? 978  HOH A O     1 
HETATM 8070 O  O     . HOH J 6 .   ? 33.834  -19.618 -22.520 1.00 23.22  ? 979  HOH A O     1 
HETATM 8071 O  O     . HOH J 6 .   ? 13.138  18.528  -60.674 1.00 23.55  ? 980  HOH A O     1 
HETATM 8072 O  O     . HOH J 6 .   ? -16.229 -2.201  -55.894 1.00 13.93  ? 981  HOH A O     1 
HETATM 8073 O  O     . HOH J 6 .   ? 37.875  -8.183  -29.319 1.00 27.01  ? 982  HOH A O     1 
HETATM 8074 O  O     . HOH J 6 .   ? 20.411  -1.119  -10.678 1.00 20.88  ? 983  HOH A O     1 
HETATM 8075 O  O     . HOH J 6 .   ? -4.559  13.360  -41.688 1.00 39.16  ? 984  HOH A O     1 
HETATM 8076 O  O     . HOH J 6 .   ? 19.826  -11.256 -49.743 1.00 17.23  ? 985  HOH A O     1 
HETATM 8077 O  O     . HOH J 6 .   ? 37.179  -4.687  -19.847 1.00 20.35  ? 986  HOH A O     1 
HETATM 8078 O  O     . HOH J 6 .   ? 3.423   -9.399  -43.644 1.00 9.75   ? 987  HOH A O     1 
HETATM 8079 O  O     . HOH J 6 .   ? 5.242   -4.609  -33.991 1.00 19.49  ? 988  HOH A O     1 
HETATM 8080 O  O     . HOH J 6 .   ? 12.637  -23.293 3.195   1.00 15.36  ? 989  HOH A O     1 
HETATM 8081 O  O     . HOH J 6 .   ? -4.262  4.460   -51.035 1.00 19.77  ? 990  HOH A O     1 
HETATM 8082 O  O     . HOH J 6 .   ? 3.748   -11.816 -43.021 1.00 10.83  ? 991  HOH A O     1 
HETATM 8083 O  O     . HOH J 6 .   ? -5.482  -31.516 -56.520 1.00 9.11   ? 992  HOH A O     1 
HETATM 8084 O  O     . HOH J 6 .   ? 18.775  -5.053  -45.548 1.00 20.12  ? 993  HOH A O     1 
HETATM 8085 O  O     . HOH J 6 .   ? 6.936   -6.672  -37.234 1.00 16.14  ? 994  HOH A O     1 
HETATM 8086 O  O     . HOH J 6 .   ? 26.003  -18.596 -42.078 1.00 35.96  ? 995  HOH A O     1 
HETATM 8087 O  O     . HOH J 6 .   ? 14.652  -0.464  -18.613 1.00 34.01  ? 996  HOH A O     1 
HETATM 8088 O  O     . HOH J 6 .   ? 18.532  4.794   -39.232 1.00 23.07  ? 997  HOH A O     1 
HETATM 8089 O  O     . HOH J 6 .   ? 30.282  -6.598  -15.956 1.00 17.21  ? 998  HOH A O     1 
HETATM 8090 O  O     . HOH J 6 .   ? 26.908  -13.413 -13.993 1.00 27.13  ? 999  HOH A O     1 
HETATM 8091 O  O     . HOH J 6 .   ? -4.355  14.248  -66.496 1.00 31.58  ? 1000 HOH A O     1 
HETATM 8092 O  O     . HOH J 6 .   ? 17.982  10.975  -33.399 1.00 25.76  ? 1001 HOH A O     1 
HETATM 8093 O  O     . HOH J 6 .   ? -6.302  -31.209 -30.553 1.00 43.79  ? 1002 HOH A O     1 
HETATM 8094 O  O     . HOH J 6 .   ? 14.969  14.064  -51.569 1.00 22.39  ? 1003 HOH A O     1 
HETATM 8095 O  O     . HOH J 6 .   ? 4.294   12.981  -42.950 1.00 17.39  ? 1004 HOH A O     1 
HETATM 8096 O  O     . HOH J 6 .   ? 6.132   -36.398 -0.332  1.00 14.59  ? 1005 HOH A O     1 
HETATM 8097 O  O     . HOH J 6 .   ? -31.473 -29.861 -43.088 1.00 24.10  ? 1006 HOH A O     1 
HETATM 8098 O  O     . HOH J 6 .   ? 18.450  17.926  -30.345 1.00 19.96  ? 1007 HOH A O     1 
HETATM 8099 O  O     . HOH J 6 .   ? -18.690 -10.082 -57.971 1.00 19.23  ? 1008 HOH A O     1 
HETATM 8100 O  O     . HOH J 6 .   ? 10.179  -7.313  -53.561 1.00 18.50  ? 1009 HOH A O     1 
HETATM 8101 O  O     . HOH J 6 .   ? 22.556  -4.423  -44.640 1.00 28.21  ? 1010 HOH A O     1 
HETATM 8102 O  O     . HOH J 6 .   ? -21.620 -23.294 -58.493 1.00 19.33  ? 1011 HOH A O     1 
HETATM 8103 O  O     . HOH J 6 .   ? 21.345  22.254  -39.518 1.00 23.68  ? 1012 HOH A O     1 
HETATM 8104 O  O     . HOH J 6 .   ? 1.010   -28.061 -1.943  1.00 14.74  ? 1013 HOH A O     1 
HETATM 8105 O  O     . HOH J 6 .   ? 6.789   -18.232 -16.120 1.00 19.76  ? 1014 HOH A O     1 
HETATM 8106 O  O     . HOH J 6 .   ? -1.942  -0.317  -44.789 1.00 11.49  ? 1015 HOH A O     1 
HETATM 8107 O  O     . HOH J 6 .   ? -20.290 -30.515 -20.909 1.00 13.32  ? 1016 HOH A O     1 
HETATM 8108 O  O     . HOH J 6 .   ? -27.812 -13.945 -25.682 1.00 23.47  ? 1017 HOH A O     1 
HETATM 8109 O  O     . HOH J 6 .   ? 10.710  17.167  -33.068 1.00 32.29  ? 1018 HOH A O     1 
HETATM 8110 O  O     . HOH J 6 .   ? 5.748   -27.957 7.658   1.00 28.31  ? 1019 HOH A O     1 
HETATM 8111 O  O     . HOH J 6 .   ? 8.420   -48.188 -57.826 1.00 38.56  ? 1020 HOH A O     1 
HETATM 8112 O  O     . HOH J 6 .   ? 0.390   12.513  -71.464 1.00 18.71  ? 1021 HOH A O     1 
HETATM 8113 O  O     . HOH J 6 .   ? 12.650  -47.278 -59.915 1.00 25.98  ? 1022 HOH A O     1 
HETATM 8114 O  O     . HOH J 6 .   ? 4.644   -15.250 -64.017 1.00 30.56  ? 1023 HOH A O     1 
HETATM 8115 O  O     . HOH J 6 .   ? 2.053   6.640   -35.707 1.00 12.75  ? 1024 HOH A O     1 
HETATM 8116 O  O     . HOH J 6 .   ? 8.466   15.882  -64.207 1.00 14.38  ? 1025 HOH A O     1 
HETATM 8117 O  O     . HOH J 6 .   ? -12.260 -20.736 -30.457 1.00 6.83   ? 1026 HOH A O     1 
HETATM 8118 O  O     . HOH J 6 .   ? 5.826   -21.355 -38.605 1.00 7.83   ? 1027 HOH A O     1 
HETATM 8119 O  O     . HOH J 6 .   ? 15.408  -3.245  -7.444  1.00 43.58  ? 1028 HOH A O     1 
HETATM 8120 O  O     . HOH J 6 .   ? 5.048   -18.809 -38.594 1.00 13.50  ? 1029 HOH A O     1 
HETATM 8121 O  O     . HOH J 6 .   ? -3.639  -30.950 -5.873  1.00 16.71  ? 1030 HOH A O     1 
HETATM 8122 O  O     . HOH J 6 .   ? 9.407   -33.915 -57.427 1.00 11.57  ? 1031 HOH A O     1 
HETATM 8123 O  O     . HOH J 6 .   ? -9.476  -19.502 -35.139 1.00 15.75  ? 1032 HOH A O     1 
HETATM 8124 O  O     . HOH J 6 .   ? 21.819  -27.368 -27.040 1.00 27.63  ? 1033 HOH A O     1 
HETATM 8125 O  O     . HOH J 6 .   ? -25.320 -3.964  -21.651 1.00 17.42  ? 1034 HOH A O     1 
HETATM 8126 O  O     . HOH J 6 .   ? -7.376  8.393   -44.794 1.00 28.60  ? 1035 HOH A O     1 
HETATM 8127 O  O     . HOH J 6 .   ? 3.532   -32.805 -55.421 1.00 19.25  ? 1036 HOH A O     1 
HETATM 8128 O  O     . HOH J 6 .   ? 1.404   -28.924 -46.452 1.00 26.65  ? 1037 HOH A O     1 
HETATM 8129 O  O     . HOH J 6 .   ? -19.394 -31.747 -62.781 1.00 41.32  ? 1038 HOH A O     1 
HETATM 8130 O  O     . HOH J 6 .   ? -10.912 -1.644  -62.470 1.00 22.54  ? 1039 HOH A O     1 
HETATM 8131 O  O     . HOH J 6 .   ? -22.692 -15.845 -42.413 1.00 26.62  ? 1040 HOH A O     1 
HETATM 8132 O  O     . HOH J 6 .   ? 27.381  -17.756 -20.145 1.00 19.43  ? 1041 HOH A O     1 
HETATM 8133 O  O     . HOH J 6 .   ? 4.445   -51.783 -13.426 1.00 22.75  ? 1042 HOH A O     1 
HETATM 8134 O  O     . HOH J 6 .   ? 19.526  18.475  -45.356 1.00 29.96  ? 1043 HOH A O     1 
HETATM 8135 O  O     . HOH J 6 .   ? 19.143  15.107  -42.368 1.00 19.16  ? 1044 HOH A O     1 
HETATM 8136 O  O     . HOH J 6 .   ? 17.174  6.122   -31.349 1.00 19.59  ? 1045 HOH A O     1 
HETATM 8137 O  O     . HOH J 6 .   ? 27.321  -17.553 -24.315 1.00 18.34  ? 1046 HOH A O     1 
HETATM 8138 O  O     . HOH J 6 .   ? 21.729  -9.202  -27.236 1.00 17.93  ? 1047 HOH A O     1 
HETATM 8139 O  O     . HOH J 6 .   ? 28.632  -24.578 -19.374 1.00 22.71  ? 1048 HOH A O     1 
HETATM 8140 O  O     . HOH J 6 .   ? -12.131 -24.007 -38.869 1.00 16.67  ? 1049 HOH A O     1 
HETATM 8141 O  O     . HOH J 6 .   ? 17.681  19.434  -32.428 1.00 26.60  ? 1050 HOH A O     1 
HETATM 8142 O  O     . HOH J 6 .   ? -3.115  -16.961 -19.803 1.00 29.79  ? 1051 HOH A O     1 
HETATM 8143 O  O     . HOH J 6 .   ? 19.912  -4.608  -52.743 1.00 17.79  ? 1052 HOH A O     1 
HETATM 8144 O  O     . HOH J 6 .   ? -22.418 -34.660 -55.669 1.00 24.34  ? 1053 HOH A O     1 
HETATM 8145 O  O     . HOH J 6 .   ? 16.275  -8.421  -22.064 1.00 17.83  ? 1054 HOH A O     1 
HETATM 8146 O  O     . HOH J 6 .   ? 17.477  -23.393 -24.145 1.00 26.08  ? 1055 HOH A O     1 
HETATM 8147 O  O     . HOH J 6 .   ? -6.453  -36.452 -65.819 1.00 28.84  ? 1056 HOH A O     1 
HETATM 8148 O  O     . HOH J 6 .   ? 13.180  -21.863 -39.594 1.00 17.80  ? 1057 HOH A O     1 
HETATM 8149 O  O     . HOH J 6 .   ? 24.286  -12.534 -13.927 1.00 34.61  ? 1058 HOH A O     1 
HETATM 8150 O  O     . HOH J 6 .   ? 14.760  3.343   -28.974 1.00 25.96  ? 1059 HOH A O     1 
HETATM 8151 O  O     . HOH J 6 .   ? -25.072 -24.922 -6.226  1.00 22.42  ? 1060 HOH A O     1 
HETATM 8152 O  O     . HOH J 6 .   ? -18.537 -31.067 -37.047 1.00 35.35  ? 1061 HOH A O     1 
HETATM 8153 O  O     . HOH J 6 .   ? -14.534 -29.557 -31.466 1.00 31.41  ? 1062 HOH A O     1 
HETATM 8154 O  O     . HOH J 6 .   ? -21.285 -10.881 -45.868 1.00 18.32  ? 1063 HOH A O     1 
HETATM 8155 O  O     . HOH J 6 .   ? 20.548  -7.100  -23.398 1.00 16.02  ? 1064 HOH A O     1 
HETATM 8156 O  O     . HOH J 6 .   ? 5.849   -8.865  -48.828 1.00 21.07  ? 1065 HOH A O     1 
HETATM 8157 O  O     . HOH J 6 .   ? 19.665  -19.723 -39.433 1.00 38.61  ? 1066 HOH A O     1 
HETATM 8158 O  O     . HOH J 6 .   ? 28.584  -9.147  -7.493  1.00 30.46  ? 1067 HOH A O     1 
HETATM 8159 O  O     . HOH J 6 .   ? 10.397  -27.748 -37.920 1.00 17.26  ? 1068 HOH A O     1 
HETATM 8160 O  O     . HOH J 6 .   ? -30.226 -16.928 -22.480 1.00 19.90  ? 1069 HOH A O     1 
HETATM 8161 O  O     . HOH J 6 .   ? 24.025  -1.304  -35.223 1.00 18.25  ? 1070 HOH A O     1 
HETATM 8162 O  O     . HOH J 6 .   ? -11.606 -30.164 -46.388 1.00 22.14  ? 1071 HOH A O     1 
HETATM 8163 O  O     . HOH J 6 .   ? 3.738   -5.090  -11.625 1.00 36.14  ? 1072 HOH A O     1 
HETATM 8164 O  O     . HOH J 6 .   ? -1.968  17.360  -56.969 1.00 14.56  ? 1073 HOH A O     1 
HETATM 8165 O  O     . HOH J 6 .   ? -6.746  -23.382 -31.601 1.00 30.11  ? 1074 HOH A O     1 
HETATM 8166 O  O     . HOH J 6 .   ? 23.196  20.684  -37.753 1.00 19.67  ? 1075 HOH A O     1 
HETATM 8167 O  O     . HOH J 6 .   ? 4.426   -14.917 -55.390 1.00 50.10  ? 1076 HOH A O     1 
HETATM 8168 O  O     . HOH J 6 .   ? -18.678 -8.874  -7.718  1.00 29.60  ? 1077 HOH A O     1 
HETATM 8169 O  O     . HOH J 6 .   ? 9.145   -28.692 -3.847  1.00 21.01  ? 1078 HOH A O     1 
HETATM 8170 O  O     . HOH J 6 .   ? 9.270   -26.950 7.206   1.00 18.72  ? 1079 HOH A O     1 
HETATM 8171 O  O     . HOH J 6 .   ? 10.928  10.343  -35.273 1.00 47.35  ? 1080 HOH A O     1 
HETATM 8172 O  O     . HOH J 6 .   ? 22.203  -28.574 -0.876  1.00 33.62  ? 1081 HOH A O     1 
HETATM 8173 O  O     . HOH J 6 .   ? -20.751 -6.800  -26.798 1.00 19.77  ? 1082 HOH A O     1 
HETATM 8174 O  O     . HOH J 6 .   ? 3.889   -35.227 -1.660  1.00 15.00  ? 1083 HOH A O     1 
HETATM 8175 O  O     . HOH J 6 .   ? 13.897  -48.137 -46.680 1.00 40.52  ? 1084 HOH A O     1 
HETATM 8176 O  O     . HOH J 6 .   ? 1.196   14.462  -53.721 1.00 22.44  ? 1085 HOH A O     1 
HETATM 8177 O  O     . HOH J 6 .   ? -36.206 -24.145 -46.348 1.00 32.55  ? 1086 HOH A O     1 
HETATM 8178 O  O     . HOH J 6 .   ? 2.919   6.104   -71.104 1.00 25.52  ? 1087 HOH A O     1 
HETATM 8179 O  O     . HOH J 6 .   ? 17.733  -39.880 -21.535 1.00 40.48  ? 1088 HOH A O     1 
HETATM 8180 O  O     . HOH J 6 .   ? 35.446  -3.204  -28.078 1.00 28.96  ? 1089 HOH A O     1 
HETATM 8181 O  O     . HOH J 6 .   ? 4.165   -28.543 -11.381 1.00 28.45  ? 1090 HOH A O     1 
HETATM 8182 O  O     . HOH J 6 .   ? -24.993 -13.743 -46.547 1.00 18.14  ? 1091 HOH A O     1 
HETATM 8183 O  O     . HOH J 6 .   ? 10.518  8.766   -70.047 1.00 32.70  ? 1092 HOH A O     1 
HETATM 8184 O  O     . HOH J 6 .   ? -10.145 1.395   -49.872 1.00 22.35  ? 1093 HOH A O     1 
HETATM 8185 O  O     . HOH J 6 .   ? -22.365 -14.292 -40.193 1.00 17.08  ? 1094 HOH A O     1 
HETATM 8186 O  O     . HOH J 6 .   ? 2.796   -16.030 -46.595 1.00 22.41  ? 1095 HOH A O     1 
HETATM 8187 O  O     . HOH J 6 .   ? -15.036 -30.045 -40.026 1.00 15.61  ? 1096 HOH A O     1 
HETATM 8188 O  O     . HOH J 6 .   ? 0.247   -9.724  -40.617 1.00 26.63  ? 1097 HOH A O     1 
HETATM 8189 O  O     . HOH J 6 .   ? 11.629  11.122  -43.144 1.00 31.31  ? 1098 HOH A O     1 
HETATM 8190 O  O     . HOH J 6 .   ? 2.553   -30.539 -56.526 1.00 13.99  ? 1099 HOH A O     1 
HETATM 8191 O  O     . HOH J 6 .   ? 30.024  -20.123 -24.991 1.00 20.11  ? 1100 HOH A O     1 
HETATM 8192 O  O     . HOH J 6 .   ? -27.615 -14.563 -40.773 1.00 24.57  ? 1101 HOH A O     1 
HETATM 8193 O  O     . HOH J 6 .   ? 12.661  12.873  -46.935 1.00 17.21  ? 1102 HOH A O     1 
HETATM 8194 O  O     . HOH J 6 .   ? 32.625  4.951   -17.772 1.00 24.15  ? 1103 HOH A O     1 
HETATM 8195 O  O     . HOH J 6 .   ? 11.349  -6.947  -36.058 1.00 16.53  ? 1104 HOH A O     1 
HETATM 8196 O  O     . HOH J 6 .   ? 1.892   -30.960 -48.343 1.00 24.82  ? 1105 HOH A O     1 
HETATM 8197 O  O     . HOH J 6 .   ? 2.677   -4.313  -34.422 1.00 15.46  ? 1106 HOH A O     1 
HETATM 8198 O  O     . HOH J 6 .   ? 13.747  -26.145 -53.326 1.00 28.62  ? 1107 HOH A O     1 
HETATM 8199 O  O     . HOH J 6 .   ? -0.150  -24.679 -18.572 1.00 32.61  ? 1108 HOH A O     1 
HETATM 8200 O  O     . HOH J 6 .   ? 14.043  -38.458 -43.803 1.00 26.16  ? 1109 HOH A O     1 
HETATM 8201 O  O     . HOH J 6 .   ? -3.548  -31.028 -31.678 1.00 45.04  ? 1110 HOH A O     1 
HETATM 8202 O  O     . HOH J 6 .   ? 16.056  26.879  -35.529 1.00 35.86  ? 1111 HOH A O     1 
HETATM 8203 O  O     . HOH J 6 .   ? 6.217   -24.121 -0.759  1.00 20.50  ? 1112 HOH A O     1 
HETATM 8204 O  O     . HOH J 6 .   ? -32.152 -37.487 -53.668 1.00 31.02  ? 1113 HOH A O     1 
HETATM 8205 O  O     . HOH J 6 .   ? -16.908 -31.437 -28.427 1.00 29.35  ? 1114 HOH A O     1 
HETATM 8206 O  O     . HOH J 6 .   ? -5.738  -17.439 -53.536 1.00 18.66  ? 1115 HOH A O     1 
HETATM 8207 O  O     . HOH J 6 .   ? -9.313  9.689   -56.840 1.00 23.66  ? 1116 HOH A O     1 
HETATM 8208 O  O     . HOH J 6 .   ? 24.729  -17.073 -3.741  1.00 26.46  ? 1117 HOH A O     1 
HETATM 8209 O  O     . HOH J 6 .   ? -15.294 -1.141  -53.214 1.00 24.18  ? 1118 HOH A O     1 
HETATM 8210 O  O     . HOH J 6 .   ? -19.210 -1.129  -51.698 1.00 31.67  ? 1119 HOH A O     1 
HETATM 8211 O  O     . HOH J 6 .   ? 2.533   -24.457 -37.779 1.00 23.39  ? 1120 HOH A O     1 
HETATM 8212 O  O     . HOH J 6 .   ? -9.558  -29.417 -29.395 1.00 26.43  ? 1121 HOH A O     1 
HETATM 8213 O  O     . HOH J 6 .   ? 16.045  -39.022 -8.318  1.00 17.78  ? 1122 HOH A O     1 
HETATM 8214 O  O     . HOH J 6 .   ? 25.743  -16.508 -39.365 1.00 30.97  ? 1123 HOH A O     1 
HETATM 8215 O  O     . HOH J 6 .   ? 3.684   -40.404 -10.236 1.00 24.39  ? 1124 HOH A O     1 
HETATM 8216 O  O     . HOH J 6 .   ? 3.941   -22.971 -39.572 1.00 16.48  ? 1125 HOH A O     1 
HETATM 8217 O  O     . HOH J 6 .   ? 1.958   -6.704  -12.187 1.00 38.34  ? 1126 HOH A O     1 
HETATM 8218 O  O     . HOH J 6 .   ? -4.873  -2.072  -53.289 1.00 19.73  ? 1127 HOH A O     1 
HETATM 8219 O  O     . HOH J 6 .   ? -2.794  -0.602  -52.083 1.00 14.74  ? 1128 HOH A O     1 
HETATM 8220 O  O     . HOH J 6 .   ? 16.834  -32.221 -25.081 1.00 27.62  ? 1129 HOH A O     1 
HETATM 8221 O  O     . HOH J 6 .   ? 18.857  -22.098 -31.869 1.00 32.16  ? 1130 HOH A O     1 
HETATM 8222 O  O     . HOH J 6 .   ? -0.936  -30.353 -23.726 1.00 37.15  ? 1131 HOH A O     1 
HETATM 8223 O  O     . HOH J 6 .   ? 17.043  -23.794 -44.707 1.00 29.60  ? 1132 HOH A O     1 
HETATM 8224 O  O     . HOH J 6 .   ? 19.110  -21.745 -44.874 1.00 36.07  ? 1133 HOH A O     1 
HETATM 8225 O  O     . HOH J 6 .   ? 15.052  -17.883 -39.940 1.00 19.37  ? 1134 HOH A O     1 
HETATM 8226 O  O     . HOH J 6 .   ? 13.901  -19.695 -38.044 1.00 20.99  ? 1135 HOH A O     1 
HETATM 8227 O  O     . HOH J 6 .   ? 19.990  -13.662 -42.065 1.00 30.07  ? 1136 HOH A O     1 
HETATM 8228 O  O     . HOH J 6 .   ? 17.833  -12.329 -41.363 1.00 33.25  ? 1137 HOH A O     1 
HETATM 8229 O  O     . HOH J 6 .   ? 8.857   -14.818 -52.738 1.00 8.76   ? 1138 HOH A O     1 
HETATM 8230 O  O     . HOH J 6 .   ? 13.995  -31.225 -28.679 1.00 38.32  ? 1139 HOH A O     1 
HETATM 8231 O  O     . HOH J 6 .   ? 26.827  7.927   -32.033 1.00 15.01  ? 1140 HOH A O     1 
HETATM 8232 O  O     A HOH J 6 .   ? 11.786  2.656   -67.658 0.50 2.00   ? 1141 HOH A O     1 
HETATM 8233 O  O     B HOH J 6 .   ? 9.952   2.340   -66.977 0.50 3.42   ? 1141 HOH A O     1 
HETATM 8234 O  O     . HOH J 6 .   ? 9.525   -7.630  -68.359 1.00 32.68  ? 1142 HOH A O     1 
HETATM 8235 O  O     . HOH J 6 .   ? -25.803 -33.004 -52.491 1.00 23.48  ? 1143 HOH A O     1 
HETATM 8236 O  O     . HOH J 6 .   ? 11.105  11.035  -45.924 1.00 22.03  ? 1144 HOH A O     1 
HETATM 8237 O  O     . HOH J 6 .   ? -11.957 -1.153  -70.625 1.00 17.44  ? 1145 HOH A O     1 
HETATM 8238 O  O     . HOH J 6 .   ? -5.996  -1.550  -72.267 1.00 17.03  ? 1146 HOH A O     1 
HETATM 8239 O  O     . HOH J 6 .   ? -1.778  -4.487  -72.205 1.00 23.15  ? 1147 HOH A O     1 
HETATM 8240 O  O     . HOH J 6 .   ? -6.314  -4.979  -72.896 1.00 16.33  ? 1148 HOH A O     1 
HETATM 8241 O  O     . HOH J 6 .   ? -15.500 -6.270  -69.116 1.00 37.11  ? 1149 HOH A O     1 
HETATM 8242 O  O     . HOH J 6 .   ? -13.371 -5.333  -70.232 1.00 26.46  ? 1150 HOH A O     1 
HETATM 8243 O  O     . HOH J 6 .   ? 23.978  9.247   -22.472 1.00 19.41  ? 1151 HOH A O     1 
HETATM 8244 O  O     . HOH J 6 .   ? 16.987  15.660  -60.391 1.00 41.10  ? 1152 HOH A O     1 
HETATM 8245 O  O     . HOH J 6 .   ? -23.260 -12.817 -68.564 1.00 24.62  ? 1153 HOH A O     1 
HETATM 8246 O  O     . HOH J 6 .   ? -10.655 -23.768 -27.018 1.00 17.66  ? 1154 HOH A O     1 
HETATM 8247 O  O     . HOH J 6 .   ? -10.673 -26.487 -26.734 1.00 22.81  ? 1155 HOH A O     1 
HETATM 8248 O  O     . HOH J 6 .   ? -12.971 -27.854 -27.311 1.00 20.95  ? 1156 HOH A O     1 
HETATM 8249 O  O     . HOH J 6 .   ? 9.424   -10.566 -38.523 1.00 18.01  ? 1157 HOH A O     1 
HETATM 8250 O  O     . HOH J 6 .   ? 8.301   15.682  -67.130 1.00 14.79  ? 1158 HOH A O     1 
HETATM 8251 O  O     . HOH J 6 .   ? 9.893   18.079  -63.156 1.00 20.79  ? 1159 HOH A O     1 
HETATM 8252 O  O     . HOH J 6 .   ? 5.871   16.292  -63.852 1.00 9.97   ? 1160 HOH A O     1 
HETATM 8253 O  O     . HOH J 6 .   ? 5.506   18.193  -61.821 1.00 12.67  ? 1161 HOH A O     1 
HETATM 8254 O  O     . HOH J 6 .   ? 20.171  12.047  -34.168 1.00 25.22  ? 1162 HOH A O     1 
HETATM 8255 O  O     . HOH J 6 .   ? 3.342   -13.346 -3.733  1.00 23.42  ? 1163 HOH A O     1 
HETATM 8256 O  O     . HOH J 6 .   ? 10.360  -47.441 -40.296 1.00 15.47  ? 1164 HOH A O     1 
HETATM 8257 O  O     . HOH J 6 .   ? 22.373  -13.002 -39.430 1.00 21.21  ? 1165 HOH A O     1 
HETATM 8258 O  O     . HOH J 6 .   ? -9.061  -24.164 -36.509 1.00 34.21  ? 1166 HOH A O     1 
HETATM 8259 O  O     . HOH J 6 .   ? -3.943  -27.308 -35.924 1.00 39.49  ? 1167 HOH A O     1 
HETATM 8260 O  O     . HOH J 6 .   ? 11.287  13.203  -30.721 1.00 35.69  ? 1168 HOH A O     1 
HETATM 8261 O  O     . HOH J 6 .   ? 11.251  11.390  -37.729 1.00 23.95  ? 1169 HOH A O     1 
HETATM 8262 O  O     . HOH J 6 .   ? 9.929   14.644  -43.748 1.00 25.70  ? 1170 HOH A O     1 
HETATM 8263 O  O     . HOH J 6 .   ? 17.832  14.142  -52.205 1.00 32.55  ? 1171 HOH A O     1 
HETATM 8264 O  O     . HOH J 6 .   ? 7.338   -8.050  -26.509 1.00 29.78  ? 1172 HOH A O     1 
HETATM 8265 O  O     . HOH J 6 .   ? 9.386   -8.130  -37.658 1.00 25.99  ? 1173 HOH A O     1 
HETATM 8266 O  O     . HOH K 6 .   ? -11.773 -0.362  -50.976 1.00 12.89  ? 19   HOH T O     1 
HETATM 8267 O  O     . HOH K 6 .   ? 3.055   3.786   -32.191 1.00 24.57  ? 20   HOH T O     1 
HETATM 8268 O  O     . HOH K 6 .   ? -19.119 -6.534  -48.199 1.00 21.65  ? 41   HOH T O     1 
HETATM 8269 O  O     . HOH K 6 .   ? -17.982 -10.333 -34.924 1.00 15.29  ? 64   HOH T O     1 
HETATM 8270 O  O     . HOH K 6 .   ? -5.456  5.548   -40.886 1.00 18.28  ? 71   HOH T O     1 
HETATM 8271 O  O     . HOH K 6 .   ? -41.487 7.986   -32.815 1.00 3.18   ? 75   HOH T O     1 
HETATM 8272 O  O     . HOH K 6 .   ? -24.346 -14.682 -38.626 1.00 34.01  ? 200  HOH T O     1 
HETATM 8273 O  O     . HOH K 6 .   ? -39.611 -1.189  -30.246 1.00 10.60  ? 205  HOH T O     1 
HETATM 8274 O  O     . HOH K 6 .   ? -26.593 -12.865 -33.094 1.00 23.37  ? 220  HOH T O     1 
HETATM 8275 O  O     . HOH K 6 .   ? -18.672 -2.733  -48.200 1.00 24.81  ? 224  HOH T O     1 
HETATM 8276 O  O     . HOH K 6 .   ? -21.483 -2.119  -47.039 1.00 32.19  ? 231  HOH T O     1 
HETATM 8277 O  O     . HOH K 6 .   ? -22.791 -4.202  -48.690 1.00 32.06  ? 232  HOH T O     1 
HETATM 8278 O  O     . HOH K 6 .   ? -5.119  -1.851  -46.424 1.00 18.12  ? 237  HOH T O     1 
HETATM 8279 O  O     . HOH K 6 .   ? 7.350   -3.686  -30.490 1.00 24.09  ? 284  HOH T O     1 
HETATM 8280 O  O     . HOH L 6 .   ? -8.408  -17.636 -42.503 1.00 16.44  ? 12   HOH P O     1 
HETATM 8281 O  O     . HOH L 6 .   ? -17.762 1.208   -35.114 1.00 25.99  ? 84   HOH P O     1 
HETATM 8282 O  O     . HOH L 6 .   ? -10.331 -4.395  -29.156 1.00 26.34  ? 188  HOH P O     1 
HETATM 8283 O  O     . HOH L 6 .   ? -7.423  -4.967  -47.062 1.00 26.45  ? 195  HOH P O     1 
HETATM 8284 O  O     . HOH L 6 .   ? -7.355  -12.257 -51.412 1.00 24.85  ? 248  HOH P O     1 
HETATM 8285 O  O     . HOH L 6 .   ? -20.598 -0.535  -38.806 1.00 39.45  ? 250  HOH P O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.7096 0.6676 0.7486 0.0674  0.0610  0.0713  1   MET A N     
2    C CA    . MET A 1   ? 0.7171 0.6652 0.7328 0.0627  0.0590  0.0627  1   MET A CA    
3    C C     . MET A 1   ? 0.6742 0.6309 0.6920 0.0573  0.0509  0.0612  1   MET A C     
4    O O     . MET A 1   ? 0.6297 0.5995 0.6644 0.0560  0.0445  0.0659  1   MET A O     
5    C CB    . MET A 1   ? 0.7467 0.6881 0.7477 0.0607  0.0534  0.0578  1   MET A CB    
6    C CG    . MET A 1   ? 0.8172 0.7690 0.8267 0.0580  0.0416  0.0594  1   MET A CG    
7    S SD    . MET A 1   ? 0.8850 0.8284 0.8756 0.0547  0.0352  0.0529  1   MET A SD    
8    C CE    . MET A 1   ? 0.8805 0.8193 0.8550 0.0491  0.0329  0.0459  1   MET A CE    
9    N N     . LYS A 2   ? 0.6654 0.6142 0.6660 0.0539  0.0511  0.0551  2   LYS A N     
10   C CA    . LYS A 2   ? 0.6299 0.5849 0.6301 0.0487  0.0439  0.0531  2   LYS A CA    
11   C C     . LYS A 2   ? 0.5801 0.5400 0.5785 0.0446  0.0324  0.0509  2   LYS A C     
12   O O     . LYS A 2   ? 0.5733 0.5263 0.5596 0.0438  0.0303  0.0471  2   LYS A O     
13   C CB    . LYS A 2   ? 0.6662 0.6109 0.6489 0.0464  0.0474  0.0479  2   LYS A CB    
14   C CG    . LYS A 2   ? 0.7322 0.6765 0.7193 0.0480  0.0554  0.0504  2   LYS A CG    
15   C CD    . LYS A 2   ? 0.7760 0.7349 0.7809 0.0462  0.0502  0.0544  2   LYS A CD    
16   C CE    . LYS A 2   ? 0.7940 0.7531 0.8051 0.0480  0.0586  0.0575  2   LYS A CE    
17   N NZ    . LYS A 2   ? 0.8077 0.7618 0.8056 0.0440  0.0576  0.0531  2   LYS A NZ    
18   N N     . GLU A 3   ? 0.5197 0.4904 0.5297 0.0419  0.0252  0.0536  3   GLU A N     
19   C CA    . GLU A 3   ? 0.4915 0.4654 0.4989 0.0376  0.0149  0.0518  3   GLU A CA    
20   C C     . GLU A 3   ? 0.4604 0.4278 0.4513 0.0339  0.0124  0.0452  3   GLU A C     
21   O O     . GLU A 3   ? 0.4478 0.4123 0.4332 0.0330  0.0157  0.0431  3   GLU A O     
22   C CB    . GLU A 3   ? 0.4834 0.4681 0.5048 0.0349  0.0083  0.0563  3   GLU A CB    
23   C CG    . GLU A 3   ? 0.5191 0.5119 0.5600 0.0382  0.0098  0.0641  3   GLU A CG    
24   C CD    . GLU A 3   ? 0.5521 0.5546 0.6055 0.0344  0.0000  0.0690  3   GLU A CD    
25   O OE1   . GLU A 3   ? 0.5991 0.6081 0.6680 0.0363  -0.0016 0.0759  3   GLU A OE1   
26   O OE2   . GLU A 3   ? 0.5553 0.5583 0.6030 0.0293  -0.0063 0.0664  3   GLU A OE2   
27   N N     . PHE A 4   ? 0.4123 0.3773 0.3960 0.0318  0.0069  0.0425  4   PHE A N     
28   C CA    . PHE A 4   ? 0.3766 0.3373 0.3482 0.0281  0.0037  0.0375  4   PHE A CA    
29   C C     . PHE A 4   ? 0.3513 0.3136 0.3217 0.0251  -0.0038 0.0368  4   PHE A C     
30   O O     . PHE A 4   ? 0.3281 0.2913 0.3015 0.0260  -0.0064 0.0389  4   PHE A O     
31   C CB    . PHE A 4   ? 0.3640 0.3151 0.3225 0.0289  0.0076  0.0337  4   PHE A CB    
32   C CG    . PHE A 4   ? 0.3714 0.3183 0.3269 0.0309  0.0082  0.0337  4   PHE A CG    
33   C CD1   . PHE A 4   ? 0.3506 0.2960 0.3106 0.0352  0.0136  0.0365  4   PHE A CD1   
34   C CD2   . PHE A 4   ? 0.3310 0.2748 0.2792 0.0288  0.0039  0.0309  4   PHE A CD2   
35   C CE1   . PHE A 4   ? 0.3563 0.2972 0.3132 0.0373  0.0143  0.0366  4   PHE A CE1   
36   C CE2   . PHE A 4   ? 0.3373 0.2768 0.2823 0.0306  0.0045  0.0309  4   PHE A CE2   
37   C CZ    . PHE A 4   ? 0.3482 0.2863 0.2973 0.0347  0.0094  0.0336  4   PHE A CZ    
38   N N     . TYR A 5   ? 0.3495 0.3112 0.3148 0.0216  -0.0069 0.0341  5   TYR A N     
39   C CA    . TYR A 5   ? 0.3409 0.3014 0.3022 0.0187  -0.0126 0.0330  5   TYR A CA    
40   C C     . TYR A 5   ? 0.3160 0.2701 0.2682 0.0190  -0.0123 0.0302  5   TYR A C     
41   O O     . TYR A 5   ? 0.3163 0.2665 0.2638 0.0205  -0.0084 0.0284  5   TYR A O     
42   C CB    . TYR A 5   ? 0.3338 0.2943 0.2923 0.0153  -0.0145 0.0311  5   TYR A CB    
43   C CG    . TYR A 5   ? 0.3436 0.3001 0.2949 0.0149  -0.0116 0.0276  5   TYR A CG    
44   C CD1   . TYR A 5   ? 0.3255 0.2828 0.2776 0.0156  -0.0081 0.0275  5   TYR A CD1   
45   C CD2   . TYR A 5   ? 0.3400 0.2916 0.2840 0.0137  -0.0126 0.0251  5   TYR A CD2   
46   C CE1   . TYR A 5   ? 0.3724 0.3258 0.3180 0.0146  -0.0068 0.0251  5   TYR A CE1   
47   C CE2   . TYR A 5   ? 0.3708 0.3198 0.3105 0.0130  -0.0108 0.0230  5   TYR A CE2   
48   C CZ    . TYR A 5   ? 0.3640 0.3139 0.3044 0.0132  -0.0085 0.0231  5   TYR A CZ    
49   O OH    . TYR A 5   ? 0.3780 0.3250 0.3141 0.0119  -0.0079 0.0218  5   TYR A OH    
50   N N     . LEU A 6   ? 0.3369 0.2890 0.2860 0.0171  -0.0166 0.0301  6   LEU A N     
51   C CA    . LEU A 6   ? 0.3301 0.2759 0.2706 0.0170  -0.0164 0.0276  6   LEU A CA    
52   C C     . LEU A 6   ? 0.3205 0.2629 0.2550 0.0139  -0.0177 0.0251  6   LEU A C     
53   O O     . LEU A 6   ? 0.3143 0.2538 0.2446 0.0137  -0.0153 0.0228  6   LEU A O     
54   C CB    . LEU A 6   ? 0.3235 0.2677 0.2638 0.0176  -0.0192 0.0296  6   LEU A CB    
55   C CG    . LEU A 6   ? 0.3567 0.3032 0.3032 0.0213  -0.0172 0.0325  6   LEU A CG    
56   C CD1   . LEU A 6   ? 0.3489 0.2952 0.2971 0.0211  -0.0219 0.0356  6   LEU A CD1   
57   C CD2   . LEU A 6   ? 0.3408 0.2823 0.2816 0.0236  -0.0122 0.0301  6   LEU A CD2   
58   N N     . THR A 7   ? 0.3339 0.2763 0.2683 0.0114  -0.0214 0.0261  7   THR A N     
59   C CA    . THR A 7   ? 0.3325 0.2704 0.2608 0.0087  -0.0218 0.0241  7   THR A CA    
60   C C     . THR A 7   ? 0.3517 0.2917 0.2826 0.0062  -0.0247 0.0254  7   THR A C     
61   O O     . THR A 7   ? 0.3882 0.3325 0.3249 0.0059  -0.0280 0.0284  7   THR A O     
62   C CB    . THR A 7   ? 0.3470 0.2768 0.2662 0.0073  -0.0231 0.0232  7   THR A CB    
63   O OG1   . THR A 7   ? 0.3808 0.3097 0.2993 0.0055  -0.0284 0.0257  7   THR A OG1   
64   C CG2   . THR A 7   ? 0.2766 0.2039 0.1933 0.0095  -0.0207 0.0223  7   THR A CG2   
65   N N     . VAL A 8   ? 0.3254 0.2623 0.2526 0.0045  -0.0234 0.0236  8   VAL A N     
66   C CA    . VAL A 8   ? 0.3531 0.2904 0.2811 0.0017  -0.0260 0.0245  8   VAL A CA    
67   C C     . VAL A 8   ? 0.3874 0.3155 0.3058 -0.0006 -0.0248 0.0224  8   VAL A C     
68   O O     . VAL A 8   ? 0.4188 0.3442 0.3350 0.0007  -0.0205 0.0205  8   VAL A O     
69   C CB    . VAL A 8   ? 0.3600 0.3048 0.2964 0.0026  -0.0242 0.0252  8   VAL A CB    
70   C CG1   . VAL A 8   ? 0.3789 0.3224 0.3138 0.0035  -0.0199 0.0229  8   VAL A CG1   
71   C CG2   . VAL A 8   ? 0.3355 0.2817 0.2742 -0.0004 -0.0275 0.0269  8   VAL A CG2   
72   N N     . GLU A 9   ? 0.3995 0.3223 0.3123 -0.0042 -0.0285 0.0231  9   GLU A N     
73   C CA    . GLU A 9   ? 0.4264 0.3381 0.3282 -0.0066 -0.0267 0.0211  9   GLU A CA    
74   C C     . GLU A 9   ? 0.4210 0.3302 0.3206 -0.0105 -0.0303 0.0221  9   GLU A C     
75   O O     . GLU A 9   ? 0.4385 0.3520 0.3421 -0.0126 -0.0361 0.0248  9   GLU A O     
76   C CB    . GLU A 9   ? 0.4308 0.3314 0.3203 -0.0080 -0.0275 0.0204  9   GLU A CB    
77   C CG    . GLU A 9   ? 0.4753 0.3772 0.3661 -0.0046 -0.0245 0.0197  9   GLU A CG    
78   C CD    . GLU A 9   ? 0.4704 0.3696 0.3606 -0.0024 -0.0174 0.0177  9   GLU A CD    
79   O OE1   . GLU A 9   ? 0.4496 0.3467 0.3398 -0.0027 -0.0142 0.0169  9   GLU A OE1   
80   O OE2   . GLU A 9   ? 0.4897 0.3889 0.3802 -0.0003 -0.0151 0.0172  9   GLU A OE2   
81   N N     . GLN A 10  ? 0.4184 0.3206 0.3121 -0.0115 -0.0266 0.0203  10  GLN A N     
82   C CA    . GLN A 10  ? 0.4366 0.3318 0.3236 -0.0159 -0.0297 0.0207  10  GLN A CA    
83   C C     . GLN A 10  ? 0.4780 0.3562 0.3471 -0.0193 -0.0300 0.0194  10  GLN A C     
84   O O     . GLN A 10  ? 0.5101 0.3797 0.3719 -0.0175 -0.0236 0.0172  10  GLN A O     
85   C CB    . GLN A 10  ? 0.4301 0.3258 0.3199 -0.0152 -0.0251 0.0197  10  GLN A CB    
86   C CG    . GLN A 10  ? 0.4618 0.3507 0.3451 -0.0200 -0.0284 0.0202  10  GLN A CG    
87   C CD    . GLN A 10  ? 0.5244 0.4110 0.4083 -0.0193 -0.0232 0.0190  10  GLN A CD    
88   O OE1   . GLN A 10  ? 0.4958 0.3898 0.3889 -0.0152 -0.0185 0.0187  10  GLN A OE1   
89   N NE2   . GLN A 10  ? 0.5523 0.4279 0.4259 -0.0236 -0.0246 0.0187  10  GLN A NE2   
90   N N     . ILE A 11  ? 0.5159 0.3888 0.3780 -0.0243 -0.0375 0.0212  11  ILE A N     
91   C CA    . ILE A 11  ? 0.5491 0.4028 0.3907 -0.0289 -0.0385 0.0200  11  ILE A CA    
92   C C     . ILE A 11  ? 0.5618 0.4088 0.3966 -0.0351 -0.0442 0.0212  11  ILE A C     
93   O O     . ILE A 11  ? 0.5383 0.3901 0.3770 -0.0390 -0.0534 0.0246  11  ILE A O     
94   C CB    . ILE A 11  ? 0.5758 0.4246 0.4100 -0.0303 -0.0430 0.0211  11  ILE A CB    
95   C CG1   . ILE A 11  ? 0.6082 0.4615 0.4474 -0.0244 -0.0365 0.0195  11  ILE A CG1   
96   C CG2   . ILE A 11  ? 0.6031 0.4296 0.4132 -0.0359 -0.0446 0.0199  11  ILE A CG2   
97   C CD1   . ILE A 11  ? 0.6379 0.4934 0.4772 -0.0243 -0.0413 0.0214  11  ILE A CD1   
98   N N     . GLY A 12  ? 0.5847 0.4206 0.4102 -0.0359 -0.0386 0.0187  12  GLY A N     
99   C CA    . GLY A 12  ? 0.5942 0.4229 0.4128 -0.0415 -0.0427 0.0194  12  GLY A CA    
100  C C     . GLY A 12  ? 0.5719 0.4193 0.4103 -0.0410 -0.0468 0.0222  12  GLY A C     
101  O O     . GLY A 12  ? 0.5770 0.4362 0.4292 -0.0358 -0.0413 0.0216  12  GLY A O     
102  N N     . ASP A 13  ? 0.5586 0.4082 0.3985 -0.0465 -0.0568 0.0257  13  ASP A N     
103  C CA    . ASP A 13  ? 0.5343 0.4008 0.3930 -0.0466 -0.0608 0.0291  13  ASP A CA    
104  C C     . ASP A 13  ? 0.5143 0.3977 0.3903 -0.0438 -0.0647 0.0327  13  ASP A C     
105  O O     . ASP A 13  ? 0.4918 0.3883 0.3834 -0.0444 -0.0689 0.0367  13  ASP A O     
106  C CB    . ASP A 13  ? 0.5585 0.4175 0.4104 -0.0546 -0.0688 0.0315  13  ASP A CB    
107  C CG    . ASP A 13  ? 0.5747 0.4204 0.4141 -0.0563 -0.0635 0.0282  13  ASP A CG    
108  O OD1   . ASP A 13  ? 0.6655 0.4954 0.4886 -0.0636 -0.0685 0.0284  13  ASP A OD1   
109  O OD2   . ASP A 13  ? 0.6026 0.4531 0.4483 -0.0506 -0.0546 0.0257  13  ASP A OD2   
110  N N     . SER A 14  ? 0.5253 0.4078 0.3988 -0.0404 -0.0626 0.0316  14  SER A N     
111  C CA    . SER A 14  ? 0.5041 0.4008 0.3927 -0.0372 -0.0651 0.0348  14  SER A CA    
112  C C     . SER A 14  ? 0.4866 0.3912 0.3830 -0.0297 -0.0565 0.0322  14  SER A C     
113  O O     . SER A 14  ? 0.4613 0.3577 0.3480 -0.0275 -0.0501 0.0282  14  SER A O     
114  C CB    . SER A 14  ? 0.5458 0.4349 0.4252 -0.0406 -0.0721 0.0369  14  SER A CB    
115  O OG    . SER A 14  ? 0.5814 0.4694 0.4611 -0.0475 -0.0826 0.0417  14  SER A OG    
116  N N     . ILE A 15  ? 0.4566 0.3767 0.3704 -0.0259 -0.0561 0.0347  15  ILE A N     
117  C CA    . ILE A 15  ? 0.4272 0.3539 0.3474 -0.0197 -0.0501 0.0332  15  ILE A CA    
118  C C     . ILE A 15  ? 0.4345 0.3618 0.3551 -0.0192 -0.0540 0.0354  15  ILE A C     
119  O O     . ILE A 15  ? 0.4447 0.3772 0.3729 -0.0214 -0.0605 0.0401  15  ILE A O     
120  C CB    . ILE A 15  ? 0.4158 0.3563 0.3521 -0.0159 -0.0467 0.0346  15  ILE A CB    
121  C CG1   . ILE A 15  ? 0.3986 0.3381 0.3338 -0.0158 -0.0421 0.0321  15  ILE A CG1   
122  C CG2   . ILE A 15  ? 0.4084 0.3547 0.3504 -0.0104 -0.0421 0.0339  15  ILE A CG2   
123  C CD1   . ILE A 15  ? 0.3944 0.3255 0.3194 -0.0140 -0.0364 0.0277  15  ILE A CD1   
124  N N     . PHE A 16  ? 0.4273 0.3492 0.3405 -0.0166 -0.0501 0.0326  16  PHE A N     
125  C CA    . PHE A 16  ? 0.4020 0.3252 0.3165 -0.0152 -0.0526 0.0345  16  PHE A CA    
126  C C     . PHE A 16  ? 0.3993 0.3318 0.3241 -0.0091 -0.0466 0.0337  16  PHE A C     
127  O O     . PHE A 16  ? 0.3899 0.3201 0.3110 -0.0066 -0.0404 0.0300  16  PHE A O     
128  C CB    . PHE A 16  ? 0.4192 0.3280 0.3165 -0.0171 -0.0529 0.0322  16  PHE A CB    
129  C CG    . PHE A 16  ? 0.4848 0.3824 0.3697 -0.0238 -0.0603 0.0337  16  PHE A CG    
130  C CD1   . PHE A 16  ? 0.5089 0.4048 0.3922 -0.0266 -0.0683 0.0377  16  PHE A CD1   
131  C CD2   . PHE A 16  ? 0.4905 0.3781 0.3645 -0.0275 -0.0596 0.0316  16  PHE A CD2   
132  C CE1   . PHE A 16  ? 0.5232 0.4071 0.3932 -0.0337 -0.0763 0.0395  16  PHE A CE1   
133  C CE2   . PHE A 16  ? 0.5412 0.4160 0.4011 -0.0344 -0.0666 0.0329  16  PHE A CE2   
134  C CZ    . PHE A 16  ? 0.5513 0.4240 0.4086 -0.0379 -0.0754 0.0369  16  PHE A CZ    
135  N N     . GLU A 17  ? 0.3859 0.3279 0.3233 -0.0070 -0.0484 0.0376  17  GLU A N     
136  C CA    . GLU A 17  ? 0.3729 0.3220 0.3186 -0.0016 -0.0426 0.0371  17  GLU A CA    
137  C C     . GLU A 17  ? 0.3844 0.3349 0.3332 0.0008  -0.0438 0.0395  17  GLU A C     
138  O O     . GLU A 17  ? 0.4118 0.3657 0.3672 -0.0005 -0.0495 0.0443  17  GLU A O     
139  C CB    . GLU A 17  ? 0.3591 0.3182 0.3181 0.0000  -0.0405 0.0393  17  GLU A CB    
140  C CG    . GLU A 17  ? 0.3611 0.3240 0.3244 0.0051  -0.0333 0.0379  17  GLU A CG    
141  C CD    . GLU A 17  ? 0.3631 0.3348 0.3397 0.0073  -0.0307 0.0412  17  GLU A CD    
142  O OE1   . GLU A 17  ? 0.3600 0.3327 0.3379 0.0110  -0.0246 0.0400  17  GLU A OE1   
143  O OE2   . GLU A 17  ? 0.3538 0.3307 0.3392 0.0052  -0.0346 0.0453  17  GLU A OE2   
144  N N     . ARG A 18  ? 0.3657 0.3136 0.3104 0.0042  -0.0389 0.0366  18  ARG A N     
145  C CA    . ARG A 18  ? 0.3236 0.2736 0.2726 0.0075  -0.0382 0.0387  18  ARG A CA    
146  C C     . ARG A 18  ? 0.3359 0.2922 0.2936 0.0119  -0.0318 0.0386  18  ARG A C     
147  O O     . ARG A 18  ? 0.3131 0.2684 0.2675 0.0123  -0.0275 0.0352  18  ARG A O     
148  C CB    . ARG A 18  ? 0.3226 0.2641 0.2601 0.0079  -0.0369 0.0357  18  ARG A CB    
149  C CG    . ARG A 18  ? 0.3386 0.2710 0.2644 0.0035  -0.0422 0.0354  18  ARG A CG    
150  C CD    . ARG A 18  ? 0.3679 0.2911 0.2817 0.0040  -0.0390 0.0318  18  ARG A CD    
151  N NE    . ARG A 18  ? 0.3486 0.2723 0.2642 0.0070  -0.0385 0.0331  18  ARG A NE    
152  C CZ    . ARG A 18  ? 0.3393 0.2578 0.2484 0.0087  -0.0344 0.0304  18  ARG A CZ    
153  N NH1   . ARG A 18  ? 0.3251 0.2383 0.2268 0.0078  -0.0305 0.0266  18  ARG A NH1   
154  N NH2   . ARG A 18  ? 0.3124 0.2311 0.2232 0.0113  -0.0342 0.0318  18  ARG A NH2   
155  N N     . TYR A 19  ? 0.3424 0.3043 0.3107 0.0149  -0.0311 0.0428  19  TYR A N     
156  C CA    . TYR A 19  ? 0.3353 0.3013 0.3108 0.0189  -0.0243 0.0432  19  TYR A CA    
157  C C     . TYR A 19  ? 0.3596 0.3276 0.3426 0.0231  -0.0221 0.0469  19  TYR A C     
158  O O     . TYR A 19  ? 0.3612 0.3299 0.3473 0.0227  -0.0270 0.0504  19  TYR A O     
159  C CB    . TYR A 19  ? 0.3537 0.3264 0.3386 0.0180  -0.0241 0.0455  19  TYR A CB    
160  C CG    . TYR A 19  ? 0.3590 0.3391 0.3575 0.0172  -0.0290 0.0521  19  TYR A CG    
161  C CD1   . TYR A 19  ? 0.3779 0.3573 0.3747 0.0123  -0.0377 0.0539  19  TYR A CD1   
162  C CD2   . TYR A 19  ? 0.3850 0.3720 0.3983 0.0210  -0.0249 0.0570  19  TYR A CD2   
163  C CE1   . TYR A 19  ? 0.3896 0.3759 0.3996 0.0106  -0.0436 0.0608  19  TYR A CE1   
164  C CE2   . TYR A 19  ? 0.3368 0.3319 0.3655 0.0202  -0.0297 0.0643  19  TYR A CE2   
165  C CZ    . TYR A 19  ? 0.3523 0.3474 0.3797 0.0147  -0.0397 0.0663  19  TYR A CZ    
166  O OH    . TYR A 19  ? 0.3846 0.3878 0.4277 0.0131  -0.0457 0.0741  19  TYR A OH    
167  N N     . ILE A 20  ? 0.3524 0.3201 0.3373 0.0271  -0.0145 0.0463  20  ILE A N     
168  C CA    . ILE A 20  ? 0.3672 0.3360 0.3598 0.0318  -0.0103 0.0500  20  ILE A CA    
169  C C     . ILE A 20  ? 0.3919 0.3684 0.3996 0.0339  -0.0070 0.0550  20  ILE A C     
170  O O     . ILE A 20  ? 0.3692 0.3455 0.3759 0.0341  -0.0023 0.0532  20  ILE A O     
171  C CB    . ILE A 20  ? 0.3670 0.3274 0.3492 0.0347  -0.0030 0.0459  20  ILE A CB    
172  C CG1   . ILE A 20  ? 0.3286 0.2821 0.2978 0.0327  -0.0061 0.0417  20  ILE A CG1   
173  C CG2   . ILE A 20  ? 0.3468 0.3068 0.3367 0.0402  0.0033  0.0499  20  ILE A CG2   
174  C CD1   . ILE A 20  ? 0.3676 0.3209 0.3387 0.0331  -0.0106 0.0445  20  ILE A CD1   
175  N N     . ASP A 21  ? 0.4019 0.3851 0.4242 0.0353  -0.0097 0.0617  21  ASP A N     
176  C CA    . ASP A 21  ? 0.4127 0.4046 0.4525 0.0371  -0.0071 0.0678  21  ASP A CA    
177  C C     . ASP A 21  ? 0.4383 0.4279 0.4827 0.0434  0.0045  0.0692  21  ASP A C     
178  O O     . ASP A 21  ? 0.4149 0.3956 0.4481 0.0461  0.0097  0.0655  21  ASP A O     
179  C CB    . ASP A 21  ? 0.4030 0.4036 0.4586 0.0355  -0.0154 0.0756  21  ASP A CB    
180  C CG    . ASP A 21  ? 0.4079 0.4084 0.4698 0.0393  -0.0152 0.0800  21  ASP A CG    
181  O OD1   . ASP A 21  ? 0.3966 0.3908 0.4530 0.0441  -0.0070 0.0777  21  ASP A OD1   
182  O OD2   . ASP A 21  ? 0.3939 0.4001 0.4660 0.0372  -0.0237 0.0862  21  ASP A OD2   
183  N N     . SER A 22  ? 0.4586 0.4554 0.5192 0.0457  0.0088  0.0748  22  SER A N     
184  C CA    . SER A 22  ? 0.4949 0.4886 0.5604 0.0519  0.0213  0.0768  22  SER A CA    
185  C C     . SER A 22  ? 0.5175 0.5078 0.5863 0.0571  0.0256  0.0798  22  SER A C     
186  O O     . SER A 22  ? 0.5341 0.5174 0.6011 0.0623  0.0370  0.0799  22  SER A O     
187  C CB    . SER A 22  ? 0.4933 0.4970 0.5789 0.0532  0.0246  0.0838  22  SER A CB    
188  O OG    . SER A 22  ? 0.5478 0.5631 0.6530 0.0521  0.0165  0.0918  22  SER A OG    
189  N N     . ASN A 23  ? 0.5316 0.5253 0.6039 0.0556  0.0168  0.0822  23  ASN A N     
190  C CA    . ASN A 23  ? 0.5489 0.5394 0.6245 0.0603  0.0198  0.0853  23  ASN A CA    
191  C C     . ASN A 23  ? 0.5527 0.5320 0.6073 0.0592  0.0184  0.0782  23  ASN A C     
192  O O     . ASN A 23  ? 0.5736 0.5485 0.6279 0.0629  0.0211  0.0798  23  ASN A O     
193  C CB    . ASN A 23  ? 0.5572 0.5589 0.6527 0.0599  0.0112  0.0944  23  ASN A CB    
194  C CG    . ASN A 23  ? 0.5670 0.5802 0.6873 0.0623  0.0144  0.1033  23  ASN A CG    
195  O OD1   . ASN A 23  ? 0.5679 0.5795 0.6962 0.0686  0.0266  0.1061  23  ASN A OD1   
196  N ND2   . ASN A 23  ? 0.5739 0.5976 0.7060 0.0572  0.0038  0.1079  23  ASN A ND2   
197  N N     . GLY A 24  ? 0.5277 0.5024 0.5656 0.0543  0.0144  0.0708  24  GLY A N     
198  C CA    . GLY A 24  ? 0.5008 0.4656 0.5199 0.0527  0.0129  0.0643  24  GLY A CA    
199  C C     . GLY A 24  ? 0.4839 0.4509 0.5011 0.0488  0.0021  0.0647  24  GLY A C     
200  O O     . GLY A 24  ? 0.4716 0.4311 0.4761 0.0481  0.0008  0.0608  24  GLY A O     
201  N N     . ARG A 25  ? 0.4596 0.4359 0.4888 0.0461  -0.0056 0.0696  25  ARG A N     
202  C CA    . ARG A 25  ? 0.4544 0.4311 0.4800 0.0415  -0.0164 0.0703  25  ARG A CA    
203  C C     . ARG A 25  ? 0.4153 0.3894 0.4282 0.0357  -0.0213 0.0646  25  ARG A C     
204  O O     . ARG A 25  ? 0.3962 0.3739 0.4118 0.0342  -0.0201 0.0637  25  ARG A O     
205  C CB    . ARG A 25  ? 0.4644 0.4511 0.5086 0.0408  -0.0234 0.0793  25  ARG A CB    
206  C CG    . ARG A 25  ? 0.5042 0.4923 0.5590 0.0450  -0.0232 0.0858  25  ARG A CG    
207  C CD    . ARG A 25  ? 0.4957 0.4881 0.5667 0.0520  -0.0127 0.0907  25  ARG A CD    
208  N NE    . ARG A 25  ? 0.4792 0.4758 0.5656 0.0558  -0.0140 0.0992  25  ARG A NE    
209  C CZ    . ARG A 25  ? 0.4256 0.4337 0.5342 0.0556  -0.0194 0.1091  25  ARG A CZ    
210  N NH1   . ARG A 25  ? 0.3962 0.4125 0.5137 0.0516  -0.0241 0.1115  25  ARG A NH1   
211  N NH2   . ARG A 25  ? 0.3918 0.4032 0.5143 0.0593  -0.0205 0.1170  25  ARG A NH2   
212  N N     . GLU A 26  ? 0.4076 0.3750 0.4069 0.0325  -0.0263 0.0610  26  GLU A N     
213  C CA    . GLU A 26  ? 0.4085 0.3727 0.3966 0.0270  -0.0312 0.0567  26  GLU A CA    
214  C C     . GLU A 26  ? 0.4133 0.3822 0.4078 0.0224  -0.0405 0.0614  26  GLU A C     
215  O O     . GLU A 26  ? 0.3964 0.3665 0.3959 0.0217  -0.0465 0.0667  26  GLU A O     
216  C CB    . GLU A 26  ? 0.4166 0.3710 0.3882 0.0254  -0.0322 0.0517  26  GLU A CB    
217  C CG    . GLU A 26  ? 0.4109 0.3605 0.3706 0.0202  -0.0357 0.0475  26  GLU A CG    
218  C CD    . GLU A 26  ? 0.4550 0.3949 0.3996 0.0191  -0.0350 0.0429  26  GLU A CD    
219  O OE1   . GLU A 26  ? 0.4321 0.3690 0.3742 0.0222  -0.0309 0.0416  26  GLU A OE1   
220  O OE2   . GLU A 26  ? 0.4410 0.3756 0.3760 0.0150  -0.0382 0.0406  26  GLU A OE2   
221  N N     . ARG A 27  ? 0.4097 0.3805 0.4034 0.0191  -0.0419 0.0598  27  ARG A N     
222  C CA    . ARG A 27  ? 0.4261 0.3994 0.4230 0.0137  -0.0509 0.0636  27  ARG A CA    
223  C C     . ARG A 27  ? 0.4214 0.3875 0.4031 0.0088  -0.0528 0.0580  27  ARG A C     
224  O O     . ARG A 27  ? 0.4303 0.3922 0.4032 0.0101  -0.0468 0.0520  27  ARG A O     
225  C CB    . ARG A 27  ? 0.4701 0.4546 0.4857 0.0145  -0.0505 0.0692  27  ARG A CB    
226  C CG    . ARG A 27  ? 0.5549 0.5470 0.5879 0.0205  -0.0455 0.0749  27  ARG A CG    
227  C CD    . ARG A 27  ? 0.6670 0.6641 0.7123 0.0194  -0.0535 0.0833  27  ARG A CD    
228  N NE    . ARG A 27  ? 0.7942 0.8028 0.8629 0.0231  -0.0504 0.0911  27  ARG A NE    
229  C CZ    . ARG A 27  ? 0.8359 0.8530 0.9184 0.0199  -0.0553 0.0966  27  ARG A CZ    
230  N NH1   . ARG A 27  ? 0.8117 0.8262 0.8855 0.0126  -0.0639 0.0950  27  ARG A NH1   
231  N NH2   . ARG A 27  ? 0.8507 0.8785 0.9560 0.0239  -0.0510 0.1041  27  ARG A NH2   
232  N N     . THR A 28  ? 0.4236 0.3878 0.4028 0.0030  -0.0614 0.0604  28  THR A N     
233  C CA    . THR A 28  ? 0.4660 0.4226 0.4316 -0.0017 -0.0630 0.0559  28  THR A CA    
234  C C     . THR A 28  ? 0.4721 0.4338 0.4458 -0.0062 -0.0691 0.0602  28  THR A C     
235  O O     . THR A 28  ? 0.4893 0.4566 0.4741 -0.0079 -0.0760 0.0671  28  THR A O     
236  C CB    . THR A 28  ? 0.5022 0.4455 0.4492 -0.0057 -0.0674 0.0536  28  THR A CB    
237  O OG1   . THR A 28  ? 0.5708 0.5110 0.5138 -0.0018 -0.0637 0.0519  28  THR A OG1   
238  C CG2   . THR A 28  ? 0.4769 0.4106 0.4085 -0.0086 -0.0648 0.0475  28  THR A CG2   
239  N N     . ARG A 29  ? 0.4532 0.4133 0.4224 -0.0081 -0.0669 0.0566  29  ARG A N     
240  C CA    . ARG A 29  ? 0.4653 0.4284 0.4398 -0.0130 -0.0727 0.0601  29  ARG A CA    
241  C C     . ARG A 29  ? 0.4904 0.4434 0.4491 -0.0173 -0.0725 0.0549  29  ARG A C     
242  O O     . ARG A 29  ? 0.4906 0.4382 0.4397 -0.0149 -0.0655 0.0489  29  ARG A O     
243  C CB    . ARG A 29  ? 0.4500 0.4268 0.4446 -0.0097 -0.0689 0.0638  29  ARG A CB    
244  C CG    . ARG A 29  ? 0.4208 0.3993 0.4151 -0.0050 -0.0585 0.0586  29  ARG A CG    
245  C CD    . ARG A 29  ? 0.3929 0.3832 0.4058 -0.0015 -0.0542 0.0627  29  ARG A CD    
246  N NE    . ARG A 29  ? 0.3755 0.3658 0.3865 0.0032  -0.0443 0.0582  29  ARG A NE    
247  C CZ    . ARG A 29  ? 0.3990 0.3959 0.4218 0.0080  -0.0376 0.0605  29  ARG A CZ    
248  N NH1   . ARG A 29  ? 0.4171 0.4225 0.4570 0.0094  -0.0387 0.0677  29  ARG A NH1   
249  N NH2   . ARG A 29  ? 0.3753 0.3697 0.3928 0.0113  -0.0295 0.0561  29  ARG A NH2   
250  N N     . GLU A 30  ? 0.5194 0.4693 0.4757 -0.0237 -0.0804 0.0577  30  GLU A N     
251  C CA    . GLU A 30  ? 0.5395 0.4791 0.4813 -0.0281 -0.0804 0.0536  30  GLU A CA    
252  C C     . GLU A 30  ? 0.5382 0.4869 0.4930 -0.0297 -0.0814 0.0565  30  GLU A C     
253  O O     . GLU A 30  ? 0.5518 0.5069 0.5180 -0.0330 -0.0889 0.0630  30  GLU A O     
254  C CB    . GLU A 30  ? 0.5667 0.4917 0.4910 -0.0353 -0.0891 0.0543  30  GLU A CB    
255  C CG    . GLU A 30  ? 0.6208 0.5312 0.5265 -0.0398 -0.0879 0.0496  30  GLU A CG    
256  C CD    . GLU A 30  ? 0.6563 0.5506 0.5436 -0.0481 -0.0973 0.0510  30  GLU A CD    
257  O OE1   . GLU A 30  ? 0.6808 0.5729 0.5661 -0.0502 -0.1042 0.0547  30  GLU A OE1   
258  O OE2   . GLU A 30  ? 0.6662 0.5488 0.5399 -0.0529 -0.0977 0.0486  30  GLU A OE2   
259  N N     . VAL A 31  ? 0.5161 0.4657 0.4703 -0.0272 -0.0739 0.0522  31  VAL A N     
260  C CA    . VAL A 31  ? 0.5031 0.4609 0.4690 -0.0282 -0.0736 0.0544  31  VAL A CA    
261  C C     . VAL A 31  ? 0.4893 0.4365 0.4414 -0.0327 -0.0738 0.0507  31  VAL A C     
262  O O     . VAL A 31  ? 0.4680 0.4062 0.4069 -0.0312 -0.0682 0.0451  31  VAL A O     
263  C CB    . VAL A 31  ? 0.5032 0.4717 0.4818 -0.0214 -0.0645 0.0535  31  VAL A CB    
264  C CG1   . VAL A 31  ? 0.5335 0.5117 0.5268 -0.0223 -0.0647 0.0574  31  VAL A CG1   
265  C CG2   . VAL A 31  ? 0.5337 0.5088 0.5213 -0.0161 -0.0621 0.0556  31  VAL A CG2   
266  N N     . GLU A 32  ? 0.4976 0.4455 0.4531 -0.0384 -0.0803 0.0545  32  GLU A N     
267  C CA    . GLU A 32  ? 0.5259 0.4637 0.4692 -0.0429 -0.0804 0.0514  32  GLU A CA    
268  C C     . GLU A 32  ? 0.5044 0.4506 0.4575 -0.0390 -0.0728 0.0499  32  GLU A C     
269  O O     . GLU A 32  ? 0.4975 0.4494 0.4598 -0.0417 -0.0752 0.0531  32  GLU A O     
270  C CB    . GLU A 32  ? 0.5602 0.4939 0.5016 -0.0515 -0.0913 0.0562  32  GLU A CB    
271  C CG    . GLU A 32  ? 0.6595 0.5813 0.5868 -0.0567 -0.0998 0.0576  32  GLU A CG    
272  C CD    . GLU A 32  ? 0.7387 0.6571 0.6653 -0.0661 -0.1121 0.0634  32  GLU A CD    
273  O OE1   . GLU A 32  ? 0.7672 0.6786 0.6865 -0.0709 -0.1134 0.0623  32  GLU A OE1   
274  O OE2   . GLU A 32  ? 0.7599 0.6824 0.6934 -0.0688 -0.1210 0.0694  32  GLU A OE2   
275  N N     . TYR A 33  ? 0.4739 0.4204 0.4249 -0.0330 -0.0641 0.0453  33  TYR A N     
276  C CA    . TYR A 33  ? 0.4427 0.3972 0.4026 -0.0287 -0.0569 0.0441  33  TYR A CA    
277  C C     . TYR A 33  ? 0.4353 0.3850 0.3906 -0.0322 -0.0566 0.0429  33  TYR A C     
278  O O     . TYR A 33  ? 0.4555 0.3923 0.3955 -0.0352 -0.0571 0.0398  33  TYR A O     
279  C CB    . TYR A 33  ? 0.4076 0.3604 0.3628 -0.0229 -0.0492 0.0395  33  TYR A CB    
280  C CG    . TYR A 33  ? 0.3755 0.3352 0.3381 -0.0187 -0.0423 0.0383  33  TYR A CG    
281  C CD1   . TYR A 33  ? 0.3968 0.3678 0.3738 -0.0162 -0.0406 0.0417  33  TYR A CD1   
282  C CD2   . TYR A 33  ? 0.3557 0.3099 0.3105 -0.0171 -0.0373 0.0342  33  TYR A CD2   
283  C CE1   . TYR A 33  ? 0.3443 0.3192 0.3252 -0.0128 -0.0343 0.0405  33  TYR A CE1   
284  C CE2   . TYR A 33  ? 0.3606 0.3200 0.3209 -0.0139 -0.0319 0.0335  33  TYR A CE2   
285  C CZ    . TYR A 33  ? 0.3200 0.2890 0.2921 -0.0119 -0.0306 0.0364  33  TYR A CZ    
286  O OH    . TYR A 33  ? 0.3121 0.2840 0.2867 -0.0092 -0.0254 0.0356  33  TYR A OH    
287  N N     . LYS A 34  ? 0.4214 0.3807 0.3896 -0.0316 -0.0552 0.0455  34  LYS A N     
288  C CA    . LYS A 34  ? 0.4531 0.4091 0.4186 -0.0346 -0.0545 0.0447  34  LYS A CA    
289  C C     . LYS A 34  ? 0.4262 0.3849 0.3932 -0.0293 -0.0460 0.0415  34  LYS A C     
290  O O     . LYS A 34  ? 0.4313 0.4001 0.4104 -0.0261 -0.0425 0.0434  34  LYS A O     
291  C CB    . LYS A 34  ? 0.4501 0.4146 0.4292 -0.0383 -0.0593 0.0504  34  LYS A CB    
292  C CG    . LYS A 34  ? 0.5033 0.4686 0.4858 -0.0432 -0.0689 0.0553  34  LYS A CG    
293  C CD    . LYS A 34  ? 0.5731 0.5297 0.5477 -0.0517 -0.0767 0.0569  34  LYS A CD    
294  C CE    . LYS A 34  ? 0.6201 0.5866 0.6103 -0.0541 -0.0782 0.0617  34  LYS A CE    
295  N NZ    . LYS A 34  ? 0.6910 0.6565 0.6841 -0.0626 -0.0896 0.0677  34  LYS A NZ    
296  N N     . PRO A 35  ? 0.4100 0.3588 0.3644 -0.0285 -0.0423 0.0370  35  PRO A N     
297  C CA    . PRO A 35  ? 0.3739 0.3249 0.3296 -0.0238 -0.0353 0.0346  35  PRO A CA    
298  C C     . PRO A 35  ? 0.3821 0.3348 0.3414 -0.0250 -0.0337 0.0354  35  PRO A C     
299  O O     . PRO A 35  ? 0.3521 0.3007 0.3088 -0.0298 -0.0374 0.0365  35  PRO A O     
300  C CB    . PRO A 35  ? 0.3768 0.3167 0.3195 -0.0231 -0.0327 0.0307  35  PRO A CB    
301  C CG    . PRO A 35  ? 0.3866 0.3154 0.3184 -0.0284 -0.0373 0.0306  35  PRO A CG    
302  C CD    . PRO A 35  ? 0.4196 0.3539 0.3581 -0.0324 -0.0445 0.0346  35  PRO A CD    
303  N N     . SER A 36  ? 0.3745 0.3323 0.3386 -0.0211 -0.0285 0.0348  36  SER A N     
304  C CA    . SER A 36  ? 0.4131 0.3709 0.3785 -0.0217 -0.0261 0.0350  36  SER A CA    
305  C C     . SER A 36  ? 0.4167 0.3690 0.3756 -0.0191 -0.0218 0.0321  36  SER A C     
306  O O     . SER A 36  ? 0.4159 0.3687 0.3736 -0.0157 -0.0195 0.0308  36  SER A O     
307  C CB    . SER A 36  ? 0.4026 0.3703 0.3791 -0.0198 -0.0238 0.0376  36  SER A CB    
308  O OG    . SER A 36  ? 0.4133 0.3866 0.3985 -0.0226 -0.0275 0.0414  36  SER A OG    
309  N N     . LEU A 37  ? 0.4278 0.3745 0.3828 -0.0210 -0.0209 0.0317  37  LEU A N     
310  C CA    . LEU A 37  ? 0.4192 0.3625 0.3716 -0.0185 -0.0167 0.0304  37  LEU A CA    
311  C C     . LEU A 37  ? 0.4130 0.3584 0.3691 -0.0195 -0.0156 0.0320  37  LEU A C     
312  O O     . LEU A 37  ? 0.4298 0.3790 0.3902 -0.0222 -0.0178 0.0338  37  LEU A O     
313  C CB    . LEU A 37  ? 0.4070 0.3392 0.3501 -0.0191 -0.0153 0.0284  37  LEU A CB    
314  C CG    . LEU A 37  ? 0.4113 0.3407 0.3502 -0.0176 -0.0153 0.0269  37  LEU A CG    
315  C CD1   . LEU A 37  ? 0.4362 0.3523 0.3643 -0.0189 -0.0134 0.0251  37  LEU A CD1   
316  C CD2   . LEU A 37  ? 0.3937 0.3288 0.3374 -0.0132 -0.0127 0.0268  37  LEU A CD2   
317  N N     . PHE A 38  ? 0.4076 0.3511 0.3629 -0.0175 -0.0124 0.0318  38  PHE A N     
318  C CA    . PHE A 38  ? 0.3940 0.3399 0.3527 -0.0181 -0.0112 0.0334  38  PHE A CA    
319  C C     . PHE A 38  ? 0.4198 0.3585 0.3747 -0.0182 -0.0091 0.0333  38  PHE A C     
320  O O     . PHE A 38  ? 0.4309 0.3645 0.3827 -0.0164 -0.0072 0.0324  38  PHE A O     
321  C CB    . PHE A 38  ? 0.3680 0.3202 0.3307 -0.0152 -0.0095 0.0344  38  PHE A CB    
322  C CG    . PHE A 38  ? 0.3643 0.3228 0.3309 -0.0145 -0.0102 0.0349  38  PHE A CG    
323  C CD1   . PHE A 38  ? 0.4111 0.3702 0.3765 -0.0128 -0.0110 0.0336  38  PHE A CD1   
324  C CD2   . PHE A 38  ? 0.3282 0.2919 0.3002 -0.0153 -0.0095 0.0369  38  PHE A CD2   
325  C CE1   . PHE A 38  ? 0.3773 0.3419 0.3468 -0.0118 -0.0112 0.0343  38  PHE A CE1   
326  C CE2   . PHE A 38  ? 0.3466 0.3157 0.3234 -0.0141 -0.0090 0.0379  38  PHE A CE2   
327  C CZ    . PHE A 38  ? 0.3852 0.3547 0.3607 -0.0123 -0.0100 0.0366  38  PHE A CZ    
328  N N     . ALA A 39  ? 0.4180 0.3563 0.3740 -0.0203 -0.0090 0.0346  39  ALA A N     
329  C CA    . ALA A 39  ? 0.4344 0.3666 0.3880 -0.0202 -0.0067 0.0351  39  ALA A CA    
330  C C     . ALA A 39  ? 0.4377 0.3745 0.3955 -0.0198 -0.0058 0.0372  39  ALA A C     
331  O O     . ALA A 39  ? 0.4390 0.3814 0.4004 -0.0212 -0.0067 0.0382  39  ALA A O     
332  C CB    . ALA A 39  ? 0.4254 0.3489 0.3731 -0.0240 -0.0073 0.0344  39  ALA A CB    
333  N N     . HIS A 40  ? 0.4474 0.3815 0.4049 -0.0179 -0.0038 0.0383  40  HIS A N     
334  C CA    . HIS A 40  ? 0.4734 0.4094 0.4327 -0.0182 -0.0032 0.0405  40  HIS A CA    
335  C C     . HIS A 40  ? 0.4943 0.4286 0.4533 -0.0217 -0.0033 0.0409  40  HIS A C     
336  O O     . HIS A 40  ? 0.4905 0.4185 0.4461 -0.0238 -0.0035 0.0399  40  HIS A O     
337  C CB    . HIS A 40  ? 0.4706 0.4028 0.4299 -0.0161 -0.0017 0.0422  40  HIS A CB    
338  C CG    . HIS A 40  ? 0.4800 0.4151 0.4413 -0.0133 -0.0025 0.0431  40  HIS A CG    
339  N ND1   . HIS A 40  ? 0.4962 0.4285 0.4593 -0.0110 -0.0015 0.0438  40  HIS A ND1   
340  C CD2   . HIS A 40  ? 0.4825 0.4222 0.4438 -0.0127 -0.0040 0.0437  40  HIS A CD2   
341  C CE1   . HIS A 40  ? 0.4857 0.4219 0.4510 -0.0094 -0.0032 0.0451  40  HIS A CE1   
342  N NE2   . HIS A 40  ? 0.4897 0.4297 0.4528 -0.0106 -0.0049 0.0448  40  HIS A NE2   
343  N N     . CYS A 41  ? 0.5457 0.4846 0.5075 -0.0227 -0.0031 0.0425  41  CYS A N     
344  C CA    . CYS A 41  ? 0.6319 0.5700 0.5949 -0.0263 -0.0031 0.0436  41  CYS A CA    
345  C C     . CYS A 41  ? 0.6737 0.6106 0.6363 -0.0261 -0.0010 0.0457  41  CYS A C     
346  O O     . CYS A 41  ? 0.6743 0.6113 0.6355 -0.0235 -0.0002 0.0465  41  CYS A O     
347  C CB    . CYS A 41  ? 0.6236 0.5685 0.5920 -0.0283 -0.0044 0.0442  41  CYS A CB    
348  S SG    . CYS A 41  ? 0.6623 0.6150 0.6348 -0.0254 -0.0020 0.0454  41  CYS A SG    
349  N N     . PRO A 42  ? 0.7368 0.6720 0.7003 -0.0293 -0.0007 0.0469  42  PRO A N     
350  C CA    . PRO A 42  ? 0.7726 0.7061 0.7351 -0.0293 0.0014  0.0491  42  PRO A CA    
351  C C     . PRO A 42  ? 0.8120 0.7505 0.7757 -0.0279 0.0033  0.0504  42  PRO A C     
352  O O     . PRO A 42  ? 0.8053 0.7495 0.7730 -0.0280 0.0038  0.0504  42  PRO A O     
353  C CB    . PRO A 42  ? 0.7785 0.7102 0.7426 -0.0336 0.0013  0.0500  42  PRO A CB    
354  C CG    . PRO A 42  ? 0.7836 0.7119 0.7461 -0.0358 -0.0014 0.0481  42  PRO A CG    
355  C CD    . PRO A 42  ? 0.7473 0.6804 0.7113 -0.0335 -0.0027 0.0466  42  PRO A CD    
356  N N     . GLU A 43  ? 0.8728 0.8080 0.8325 -0.0267 0.0045  0.0520  43  GLU A N     
357  C CA    . GLU A 43  ? 0.9334 0.8697 0.8903 -0.0257 0.0066  0.0532  43  GLU A CA    
358  C C     . GLU A 43  ? 0.9485 0.8882 0.9092 -0.0274 0.0100  0.0544  43  GLU A C     
359  O O     . GLU A 43  ? 0.9404 0.8820 0.9002 -0.0261 0.0127  0.0548  43  GLU A O     
360  C CB    . GLU A 43  ? 0.9670 0.8973 0.9178 -0.0253 0.0065  0.0553  43  GLU A CB    
361  C CG    . GLU A 43  ? 1.0078 0.9353 0.9573 -0.0235 0.0033  0.0555  43  GLU A CG    
362  C CD    . GLU A 43  ? 1.0477 0.9772 0.9957 -0.0214 0.0014  0.0546  43  GLU A CD    
363  O OE1   . GLU A 43  ? 1.0526 0.9827 0.9966 -0.0214 0.0024  0.0545  43  GLU A OE1   
364  O OE2   . GLU A 43  ? 1.0631 0.9929 1.0137 -0.0198 -0.0007 0.0542  43  GLU A OE2   
365  N N     . SER A 44  ? 0.9755 0.9154 0.9404 -0.0302 0.0102  0.0554  44  SER A N     
366  C CA    . SER A 44  ? 0.9966 0.9401 0.9672 -0.0322 0.0135  0.0576  44  SER A CA    
367  C C     . SER A 44  ? 0.9875 0.9389 0.9675 -0.0327 0.0135  0.0579  44  SER A C     
368  O O     . SER A 44  ? 1.0048 0.9601 0.9904 -0.0327 0.0176  0.0602  44  SER A O     
369  C CB    . SER A 44  ? 1.0056 0.9462 0.9776 -0.0357 0.0132  0.0590  44  SER A CB    
370  O OG    . SER A 44  ? 1.0348 0.9742 1.0081 -0.0377 0.0090  0.0575  44  SER A OG    
371  N N     . GLN A 45  ? 0.9629 0.9162 0.9448 -0.0330 0.0092  0.0559  45  GLN A N     
372  C CA    . GLN A 45  ? 0.9371 0.8978 0.9283 -0.0338 0.0079  0.0567  45  GLN A CA    
373  C C     . GLN A 45  ? 0.9092 0.8737 0.9013 -0.0300 0.0107  0.0565  45  GLN A C     
374  O O     . GLN A 45  ? 0.9030 0.8638 0.8870 -0.0271 0.0110  0.0543  45  GLN A O     
375  C CB    . GLN A 45  ? 0.9372 0.8969 0.9283 -0.0362 0.0021  0.0550  45  GLN A CB    
376  C CG    . GLN A 45  ? 0.9562 0.9142 0.9419 -0.0332 0.0002  0.0518  45  GLN A CG    
377  C CD    . GLN A 45  ? 0.9786 0.9377 0.9664 -0.0354 -0.0046 0.0510  45  GLN A CD    
378  O OE1   . GLN A 45  ? 0.9599 0.9248 0.9527 -0.0341 -0.0052 0.0513  45  GLN A OE1   
379  N NE2   . GLN A 45  ? 0.9683 0.9209 0.9516 -0.0389 -0.0077 0.0500  45  GLN A NE2   
380  N N     . ALA A 46  ? 0.8700 0.8415 0.8725 -0.0301 0.0129  0.0591  46  ALA A N     
381  C CA    . ALA A 46  ? 0.8271 0.8015 0.8312 -0.0263 0.0172  0.0595  46  ALA A CA    
382  C C     . ALA A 46  ? 0.7904 0.7674 0.7952 -0.0249 0.0134  0.0575  46  ALA A C     
383  O O     . ALA A 46  ? 0.7824 0.7640 0.7944 -0.0271 0.0087  0.0582  46  ALA A O     
384  C CB    . ALA A 46  ? 0.8390 0.8196 0.8554 -0.0265 0.0225  0.0640  46  ALA A CB    
385  N N     . THR A 47  ? 0.7275 0.7010 0.7239 -0.0214 0.0150  0.0551  47  THR A N     
386  C CA    . THR A 47  ? 0.6641 0.6396 0.6604 -0.0196 0.0123  0.0532  47  THR A CA    
387  C C     . THR A 47  ? 0.6263 0.5993 0.6170 -0.0158 0.0170  0.0524  47  THR A C     
388  O O     . THR A 47  ? 0.6338 0.6011 0.6170 -0.0149 0.0214  0.0526  47  THR A O     
389  C CB    . THR A 47  ? 0.6750 0.6465 0.6644 -0.0205 0.0066  0.0499  47  THR A CB    
390  O OG1   . THR A 47  ? 0.6156 0.5895 0.6062 -0.0192 0.0039  0.0484  47  THR A OG1   
391  C CG2   . THR A 47  ? 0.6599 0.6244 0.6384 -0.0191 0.0074  0.0482  47  THR A CG2   
392  N N     . LYS A 48  ? 0.5611 0.5369 0.5540 -0.0139 0.0159  0.0515  48  LYS A N     
393  C CA    . LYS A 48  ? 0.5307 0.5025 0.5164 -0.0106 0.0196  0.0502  48  LYS A CA    
394  C C     . LYS A 48  ? 0.4973 0.4656 0.4745 -0.0100 0.0149  0.0467  48  LYS A C     
395  O O     . LYS A 48  ? 0.4634 0.4277 0.4335 -0.0079 0.0168  0.0455  48  LYS A O     
396  C CB    . LYS A 48  ? 0.5286 0.5057 0.5237 -0.0083 0.0237  0.0525  48  LYS A CB    
397  C CG    . LYS A 48  ? 0.5476 0.5316 0.5514 -0.0085 0.0185  0.0525  48  LYS A CG    
398  C CD    . LYS A 48  ? 0.5326 0.5210 0.5452 -0.0054 0.0230  0.0551  48  LYS A CD    
399  C CE    . LYS A 48  ? 0.5079 0.5029 0.5291 -0.0060 0.0170  0.0558  48  LYS A CE    
400  N NZ    . LYS A 48  ? 0.5163 0.5158 0.5471 -0.0026 0.0214  0.0588  48  LYS A NZ    
401  N N     . TYR A 49  ? 0.4611 0.4302 0.4388 -0.0119 0.0094  0.0454  49  TYR A N     
402  C CA    . TYR A 49  ? 0.4345 0.4006 0.4060 -0.0112 0.0056  0.0427  49  TYR A CA    
403  C C     . TYR A 49  ? 0.4323 0.3928 0.3966 -0.0121 0.0042  0.0423  49  TYR A C     
404  O O     . TYR A 49  ? 0.4013 0.3612 0.3672 -0.0140 0.0035  0.0432  49  TYR A O     
405  C CB    . TYR A 49  ? 0.4125 0.3817 0.3887 -0.0123 0.0012  0.0418  49  TYR A CB    
406  C CG    . TYR A 49  ? 0.4187 0.3939 0.4032 -0.0121 0.0011  0.0431  49  TYR A CG    
407  C CD1   . TYR A 49  ? 0.3878 0.3673 0.3809 -0.0148 -0.0003 0.0456  49  TYR A CD1   
408  C CD2   . TYR A 49  ? 0.4000 0.3765 0.3845 -0.0096 0.0019  0.0424  49  TYR A CD2   
409  C CE1   . TYR A 49  ? 0.3993 0.3850 0.4018 -0.0148 -0.0013 0.0478  49  TYR A CE1   
410  C CE2   . TYR A 49  ? 0.3854 0.3676 0.3787 -0.0092 0.0017  0.0444  49  TYR A CE2   
411  C CZ    . TYR A 49  ? 0.4253 0.4125 0.4281 -0.0118 -0.0001 0.0473  49  TYR A CZ    
412  O OH    . TYR A 49  ? 0.4404 0.4340 0.4537 -0.0116 -0.0012 0.0502  49  TYR A OH    
413  N N     . PHE A 50  ? 0.4316 0.3881 0.3887 -0.0109 0.0035  0.0414  50  PHE A N     
414  C CA    . PHE A 50  ? 0.4224 0.3740 0.3740 -0.0117 0.0015  0.0419  50  PHE A CA    
415  C C     . PHE A 50  ? 0.4265 0.3771 0.3763 -0.0108 -0.0020 0.0409  50  PHE A C     
416  O O     . PHE A 50  ? 0.3906 0.3417 0.3388 -0.0096 -0.0020 0.0397  50  PHE A O     
417  C CB    . PHE A 50  ? 0.4376 0.3836 0.3810 -0.0122 0.0039  0.0433  50  PHE A CB    
418  C CG    . PHE A 50  ? 0.4483 0.3946 0.3934 -0.0130 0.0081  0.0447  50  PHE A CG    
419  C CD1   . PHE A 50  ? 0.4403 0.3886 0.3881 -0.0119 0.0129  0.0451  50  PHE A CD1   
420  C CD2   . PHE A 50  ? 0.4579 0.4025 0.4031 -0.0147 0.0075  0.0462  50  PHE A CD2   
421  C CE1   . PHE A 50  ? 0.4658 0.4148 0.4170 -0.0127 0.0173  0.0471  50  PHE A CE1   
422  C CE2   . PHE A 50  ? 0.4558 0.4006 0.4030 -0.0157 0.0115  0.0478  50  PHE A CE2   
423  C CZ    . PHE A 50  ? 0.4385 0.3857 0.3891 -0.0147 0.0165  0.0483  50  PHE A CZ    
424  N N     . ASP A 51  ? 0.4103 0.3594 0.3611 -0.0112 -0.0044 0.0417  51  ASP A N     
425  C CA    . ASP A 51  ? 0.4016 0.3500 0.3524 -0.0103 -0.0072 0.0417  51  ASP A CA    
426  C C     . ASP A 51  ? 0.4182 0.3629 0.3622 -0.0110 -0.0089 0.0432  51  ASP A C     
427  O O     . ASP A 51  ? 0.4560 0.3972 0.3939 -0.0121 -0.0075 0.0439  51  ASP A O     
428  C CB    . ASP A 51  ? 0.3800 0.3277 0.3354 -0.0101 -0.0082 0.0427  51  ASP A CB    
429  C CG    . ASP A 51  ? 0.4028 0.3475 0.3573 -0.0111 -0.0092 0.0457  51  ASP A CG    
430  O OD1   . ASP A 51  ? 0.3823 0.3248 0.3313 -0.0123 -0.0099 0.0471  51  ASP A OD1   
431  O OD2   . ASP A 51  ? 0.4753 0.4190 0.4340 -0.0107 -0.0089 0.0468  51  ASP A OD2   
432  N N     . ILE A 52  ? 0.4197 0.3640 0.3639 -0.0106 -0.0119 0.0438  52  ILE A N     
433  C CA    . ILE A 52  ? 0.4232 0.3629 0.3596 -0.0121 -0.0146 0.0452  52  ILE A CA    
434  C C     . ILE A 52  ? 0.4466 0.3816 0.3783 -0.0143 -0.0168 0.0485  52  ILE A C     
435  O O     . ILE A 52  ? 0.4429 0.3715 0.3643 -0.0163 -0.0185 0.0495  52  ILE A O     
436  C CB    . ILE A 52  ? 0.4104 0.3512 0.3495 -0.0118 -0.0182 0.0459  52  ILE A CB    
437  C CG1   . ILE A 52  ? 0.3683 0.3117 0.3168 -0.0113 -0.0204 0.0488  52  ILE A CG1   
438  C CG2   . ILE A 52  ? 0.4197 0.3636 0.3608 -0.0099 -0.0160 0.0426  52  ILE A CG2   
439  C CD1   . ILE A 52  ? 0.3801 0.3249 0.3331 -0.0113 -0.0239 0.0508  52  ILE A CD1   
440  N N     . TYR A 53  ? 0.4574 0.3942 0.3953 -0.0140 -0.0167 0.0501  53  TYR A N     
441  C CA    . TYR A 53  ? 0.4658 0.3984 0.4004 -0.0159 -0.0189 0.0536  53  TYR A CA    
442  C C     . TYR A 53  ? 0.4959 0.4255 0.4248 -0.0168 -0.0151 0.0528  53  TYR A C     
443  O O     . TYR A 53  ? 0.5028 0.4285 0.4284 -0.0183 -0.0162 0.0554  53  TYR A O     
444  C CB    . TYR A 53  ? 0.4670 0.4024 0.4120 -0.0149 -0.0205 0.0564  53  TYR A CB    
445  C CG    . TYR A 53  ? 0.4754 0.4144 0.4286 -0.0135 -0.0227 0.0575  53  TYR A CG    
446  C CD1   . TYR A 53  ? 0.4716 0.4143 0.4325 -0.0110 -0.0194 0.0554  53  TYR A CD1   
447  C CD2   . TYR A 53  ? 0.4612 0.3989 0.4137 -0.0152 -0.0282 0.0610  53  TYR A CD2   
448  C CE1   . TYR A 53  ? 0.4653 0.4105 0.4336 -0.0095 -0.0204 0.0566  53  TYR A CE1   
449  C CE2   . TYR A 53  ? 0.4855 0.4271 0.4470 -0.0139 -0.0299 0.0627  53  TYR A CE2   
450  C CZ    . TYR A 53  ? 0.4698 0.4152 0.4394 -0.0108 -0.0255 0.0604  53  TYR A CZ    
451  O OH    . TYR A 53  ? 0.4913 0.4397 0.4696 -0.0095 -0.0263 0.0622  53  TYR A OH    
452  N N     . GLY A 54  ? 0.4926 0.4242 0.4211 -0.0157 -0.0105 0.0496  54  GLY A N     
453  C CA    . GLY A 54  ? 0.4891 0.4189 0.4144 -0.0163 -0.0060 0.0492  54  GLY A CA    
454  C C     . GLY A 54  ? 0.5123 0.4460 0.4458 -0.0161 -0.0043 0.0493  54  GLY A C     
455  O O     . GLY A 54  ? 0.4989 0.4308 0.4305 -0.0171 -0.0013 0.0501  54  GLY A O     
456  N N     . LYS A 55  ? 0.5172 0.4550 0.4587 -0.0150 -0.0058 0.0487  55  LYS A N     
457  C CA    . LYS A 55  ? 0.5345 0.4742 0.4820 -0.0153 -0.0043 0.0484  55  LYS A CA    
458  C C     . LYS A 55  ? 0.5101 0.4541 0.4615 -0.0152 -0.0019 0.0461  55  LYS A C     
459  O O     . LYS A 55  ? 0.5047 0.4514 0.4576 -0.0140 -0.0024 0.0443  55  LYS A O     
460  C CB    . LYS A 55  ? 0.5572 0.4967 0.5098 -0.0143 -0.0062 0.0491  55  LYS A CB    
461  C CG    . LYS A 55  ? 0.6412 0.5774 0.5930 -0.0144 -0.0088 0.0528  55  LYS A CG    
462  C CD    . LYS A 55  ? 0.7316 0.6668 0.6898 -0.0133 -0.0084 0.0542  55  LYS A CD    
463  C CE    . LYS A 55  ? 0.7793 0.7115 0.7370 -0.0145 -0.0063 0.0549  55  LYS A CE    
464  N NZ    . LYS A 55  ? 0.8030 0.7322 0.7566 -0.0158 -0.0079 0.0582  55  LYS A NZ    
465  N N     . PRO A 56  ? 0.4974 0.4421 0.4509 -0.0167 0.0003  0.0465  56  PRO A N     
466  C CA    . PRO A 56  ? 0.4824 0.4318 0.4412 -0.0173 0.0018  0.0456  56  PRO A CA    
467  C C     . PRO A 56  ? 0.4733 0.4242 0.4360 -0.0176 -0.0006 0.0439  56  PRO A C     
468  O O     . PRO A 56  ? 0.4618 0.4091 0.4238 -0.0181 -0.0017 0.0438  56  PRO A O     
469  C CB    . PRO A 56  ? 0.4854 0.4343 0.4460 -0.0194 0.0040  0.0473  56  PRO A CB    
470  C CG    . PRO A 56  ? 0.4856 0.4294 0.4425 -0.0199 0.0028  0.0484  56  PRO A CG    
471  C CD    . PRO A 56  ? 0.4938 0.4350 0.4455 -0.0182 0.0011  0.0486  56  PRO A CD    
472  N N     . CYS A 57  ? 0.4458 0.4007 0.4116 -0.0172 -0.0009 0.0428  57  CYS A N     
473  C CA    . CYS A 57  ? 0.4582 0.4133 0.4257 -0.0178 -0.0034 0.0412  57  CYS A CA    
474  C C     . CYS A 57  ? 0.4603 0.4197 0.4335 -0.0201 -0.0042 0.0419  57  CYS A C     
475  O O     . CYS A 57  ? 0.4852 0.4495 0.4630 -0.0197 -0.0023 0.0435  57  CYS A O     
476  C CB    . CYS A 57  ? 0.4612 0.4170 0.4270 -0.0154 -0.0043 0.0396  57  CYS A CB    
477  S SG    . CYS A 57  ? 0.5045 0.4558 0.4662 -0.0134 -0.0047 0.0395  57  CYS A SG    
478  N N     . THR A 58  ? 0.4453 0.4023 0.4181 -0.0225 -0.0070 0.0412  58  THR A N     
479  C CA    . THR A 58  ? 0.4400 0.4007 0.4182 -0.0254 -0.0096 0.0424  58  THR A CA    
480  C C     . THR A 58  ? 0.4153 0.3757 0.3919 -0.0249 -0.0123 0.0408  58  THR A C     
481  O O     . THR A 58  ? 0.4189 0.3733 0.3886 -0.0240 -0.0126 0.0384  58  THR A O     
482  C CB    . THR A 58  ? 0.4595 0.4159 0.4369 -0.0301 -0.0119 0.0432  58  THR A CB    
483  O OG1   . THR A 58  ? 0.5008 0.4603 0.4830 -0.0336 -0.0161 0.0448  58  THR A OG1   
484  C CG2   . THR A 58  ? 0.4523 0.3986 0.4202 -0.0306 -0.0123 0.0408  58  THR A CG2   
485  N N     . ARG A 59  ? 0.4070 0.3739 0.3905 -0.0253 -0.0139 0.0425  59  ARG A N     
486  C CA    . ARG A 59  ? 0.4158 0.3827 0.3981 -0.0251 -0.0169 0.0415  59  ARG A CA    
487  C C     . ARG A 59  ? 0.4343 0.3960 0.4131 -0.0300 -0.0221 0.0415  59  ARG A C     
488  O O     . ARG A 59  ? 0.4330 0.3959 0.4159 -0.0340 -0.0246 0.0440  59  ARG A O     
489  C CB    . ARG A 59  ? 0.3909 0.3666 0.3826 -0.0232 -0.0163 0.0438  59  ARG A CB    
490  C CG    . ARG A 59  ? 0.4393 0.4154 0.4305 -0.0232 -0.0199 0.0433  59  ARG A CG    
491  C CD    . ARG A 59  ? 0.4360 0.4188 0.4340 -0.0195 -0.0175 0.0447  59  ARG A CD    
492  N NE    . ARG A 59  ? 0.4694 0.4603 0.4804 -0.0205 -0.0177 0.0493  59  ARG A NE    
493  C CZ    . ARG A 59  ? 0.4331 0.4290 0.4519 -0.0213 -0.0213 0.0523  59  ARG A CZ    
494  N NH1   . ARG A 59  ? 0.3917 0.3844 0.4050 -0.0214 -0.0251 0.0505  59  ARG A NH1   
495  N NH2   . ARG A 59  ? 0.4289 0.4329 0.4619 -0.0220 -0.0210 0.0575  59  ARG A NH2   
496  N N     . LYS A 60  ? 0.4490 0.4038 0.4192 -0.0300 -0.0236 0.0389  60  LYS A N     
497  C CA    . LYS A 60  ? 0.4693 0.4164 0.4327 -0.0348 -0.0286 0.0386  60  LYS A CA    
498  C C     . LYS A 60  ? 0.4699 0.4186 0.4334 -0.0348 -0.0321 0.0388  60  LYS A C     
499  O O     . LYS A 60  ? 0.4712 0.4171 0.4295 -0.0316 -0.0301 0.0363  60  LYS A O     
500  C CB    . LYS A 60  ? 0.5144 0.4486 0.4651 -0.0353 -0.0265 0.0355  60  LYS A CB    
501  C CG    . LYS A 60  ? 0.5796 0.5111 0.5300 -0.0363 -0.0240 0.0359  60  LYS A CG    
502  C CD    . LYS A 60  ? 0.6381 0.5554 0.5760 -0.0374 -0.0220 0.0335  60  LYS A CD    
503  C CE    . LYS A 60  ? 0.7204 0.6353 0.6587 -0.0378 -0.0191 0.0342  60  LYS A CE    
504  N NZ    . LYS A 60  ? 0.7232 0.6352 0.6606 -0.0439 -0.0231 0.0359  60  LYS A NZ    
505  N N     . LEU A 61  ? 0.4714 0.4252 0.4420 -0.0385 -0.0375 0.0424  61  LEU A N     
506  C CA    . LEU A 61  ? 0.4876 0.4442 0.4605 -0.0390 -0.0418 0.0438  61  LEU A CA    
507  C C     . LEU A 61  ? 0.5008 0.4447 0.4602 -0.0445 -0.0476 0.0427  61  LEU A C     
508  O O     . LEU A 61  ? 0.5042 0.4428 0.4603 -0.0504 -0.0518 0.0441  61  LEU A O     
509  C CB    . LEU A 61  ? 0.4871 0.4558 0.4765 -0.0404 -0.0449 0.0494  61  LEU A CB    
510  C CG    . LEU A 61  ? 0.5286 0.5065 0.5282 -0.0374 -0.0458 0.0521  61  LEU A CG    
511  C CD1   . LEU A 61  ? 0.5373 0.5225 0.5500 -0.0420 -0.0526 0.0586  61  LEU A CD1   
512  C CD2   . LEU A 61  ? 0.4380 0.4097 0.4275 -0.0360 -0.0471 0.0491  61  LEU A CD2   
513  N N     . PHE A 62  ? 0.4534 0.3914 0.4041 -0.0431 -0.0477 0.0402  62  PHE A N     
514  C CA    . PHE A 62  ? 0.4711 0.3942 0.4056 -0.0480 -0.0519 0.0386  62  PHE A CA    
515  C C     . PHE A 62  ? 0.4832 0.4074 0.4186 -0.0516 -0.0599 0.0416  62  PHE A C     
516  O O     . PHE A 62  ? 0.4688 0.4036 0.4148 -0.0480 -0.0600 0.0435  62  PHE A O     
517  C CB    . PHE A 62  ? 0.4619 0.3743 0.3832 -0.0444 -0.0457 0.0337  62  PHE A CB    
518  C CG    . PHE A 62  ? 0.4470 0.3565 0.3668 -0.0417 -0.0389 0.0315  62  PHE A CG    
519  C CD1   . PHE A 62  ? 0.4024 0.3212 0.3312 -0.0355 -0.0332 0.0309  62  PHE A CD1   
520  C CD2   . PHE A 62  ? 0.4323 0.3288 0.3408 -0.0457 -0.0386 0.0304  62  PHE A CD2   
521  C CE1   . PHE A 62  ? 0.4279 0.3443 0.3561 -0.0333 -0.0277 0.0296  62  PHE A CE1   
522  C CE2   . PHE A 62  ? 0.4667 0.3609 0.3750 -0.0429 -0.0323 0.0289  62  PHE A CE2   
523  C CZ    . PHE A 62  ? 0.3797 0.2844 0.2984 -0.0367 -0.0271 0.0288  62  PHE A CZ    
524  N N     . ALA A 63  ? 0.4841 0.3960 0.4072 -0.0589 -0.0667 0.0423  63  ALA A N     
525  C CA    . ALA A 63  ? 0.5060 0.4170 0.4284 -0.0638 -0.0760 0.0459  63  ALA A CA    
526  C C     . ALA A 63  ? 0.5175 0.4251 0.4331 -0.0603 -0.0746 0.0437  63  ALA A C     
527  O O     . ALA A 63  ? 0.5422 0.4554 0.4639 -0.0614 -0.0806 0.0473  63  ALA A O     
528  C CB    . ALA A 63  ? 0.5315 0.4262 0.4376 -0.0732 -0.0836 0.0466  63  ALA A CB    
529  N N     . ASN A 64  ? 0.5231 0.4219 0.4272 -0.0561 -0.0666 0.0383  64  ASN A N     
530  C CA    . ASN A 64  ? 0.5169 0.4117 0.4141 -0.0524 -0.0639 0.0358  64  ASN A CA    
531  C C     . ASN A 64  ? 0.5002 0.3914 0.3930 -0.0463 -0.0534 0.0311  64  ASN A C     
532  O O     . ASN A 64  ? 0.4952 0.3842 0.3873 -0.0456 -0.0490 0.0296  64  ASN A O     
533  C CB    . ASN A 64  ? 0.5288 0.4060 0.4063 -0.0587 -0.0698 0.0354  64  ASN A CB    
534  C CG    . ASN A 64  ? 0.5900 0.4482 0.4485 -0.0640 -0.0692 0.0329  64  ASN A CG    
535  O OD1   . ASN A 64  ? 0.6200 0.4715 0.4723 -0.0605 -0.0604 0.0290  64  ASN A OD1   
536  N ND2   . ASN A 64  ? 0.5777 0.4265 0.4269 -0.0726 -0.0787 0.0356  64  ASN A ND2   
537  N N     . MET A 65  ? 0.4828 0.3733 0.3731 -0.0421 -0.0500 0.0291  65  MET A N     
538  C CA    . MET A 65  ? 0.4960 0.3850 0.3850 -0.0363 -0.0407 0.0256  65  MET A CA    
539  C C     . MET A 65  ? 0.5182 0.3896 0.3909 -0.0376 -0.0357 0.0226  65  MET A C     
540  O O     . MET A 65  ? 0.5264 0.3980 0.4017 -0.0337 -0.0285 0.0210  65  MET A O     
541  C CB    . MET A 65  ? 0.4544 0.3472 0.3456 -0.0319 -0.0387 0.0248  65  MET A CB    
542  C CG    . MET A 65  ? 0.4516 0.3620 0.3601 -0.0283 -0.0398 0.0272  65  MET A CG    
543  S SD    . MET A 65  ? 0.4596 0.3734 0.3697 -0.0236 -0.0376 0.0263  65  MET A SD    
544  C CE    . MET A 65  ? 0.4261 0.3323 0.3271 -0.0285 -0.0456 0.0281  65  MET A CE    
545  N N     . ARG A 66  ? 0.5442 0.3994 0.3998 -0.0433 -0.0394 0.0220  66  ARG A N     
546  C CA    . ARG A 66  ? 0.6146 0.4504 0.4528 -0.0450 -0.0340 0.0193  66  ARG A CA    
547  C C     . ARG A 66  ? 0.5829 0.4184 0.4237 -0.0464 -0.0326 0.0195  66  ARG A C     
548  O O     . ARG A 66  ? 0.5936 0.4213 0.4300 -0.0437 -0.0245 0.0176  66  ARG A O     
549  C CB    . ARG A 66  ? 0.6737 0.4894 0.4897 -0.0515 -0.0383 0.0186  66  ARG A CB    
550  C CG    . ARG A 66  ? 0.8108 0.6184 0.6176 -0.0488 -0.0341 0.0166  66  ARG A CG    
551  C CD    . ARG A 66  ? 0.9279 0.7165 0.7127 -0.0557 -0.0399 0.0165  66  ARG A CD    
552  N NE    . ARG A 66  ? 0.9521 0.7371 0.7315 -0.0529 -0.0374 0.0154  66  ARG A NE    
553  C CZ    . ARG A 66  ? 1.0145 0.7851 0.7764 -0.0580 -0.0426 0.0156  66  ARG A CZ    
554  N NH1   . ARG A 66  ? 1.0402 0.7983 0.7876 -0.0666 -0.0515 0.0170  66  ARG A NH1   
555  N NH2   . ARG A 66  ? 1.0415 0.8099 0.7999 -0.0548 -0.0394 0.0146  66  ARG A NH2   
556  N N     . ASP A 67  ? 0.5597 0.4040 0.4087 -0.0504 -0.0402 0.0224  67  ASP A N     
557  C CA    . ASP A 67  ? 0.5859 0.4314 0.4387 -0.0518 -0.0391 0.0230  67  ASP A CA    
558  C C     . ASP A 67  ? 0.5477 0.4048 0.4143 -0.0445 -0.0313 0.0224  67  ASP A C     
559  O O     . ASP A 67  ? 0.5614 0.4115 0.4243 -0.0432 -0.0254 0.0210  67  ASP A O     
560  C CB    . ASP A 67  ? 0.5901 0.4459 0.4531 -0.0568 -0.0483 0.0270  67  ASP A CB    
561  C CG    . ASP A 67  ? 0.6351 0.4760 0.4824 -0.0660 -0.0566 0.0282  67  ASP A CG    
562  O OD1   . ASP A 67  ? 0.6843 0.5041 0.5102 -0.0687 -0.0542 0.0252  67  ASP A OD1   
563  O OD2   . ASP A 67  ? 0.6787 0.5282 0.5350 -0.0707 -0.0656 0.0324  67  ASP A OD2   
564  N N     . ALA A 68  ? 0.4971 0.3706 0.3786 -0.0399 -0.0314 0.0235  68  ALA A N     
565  C CA    . ALA A 68  ? 0.4831 0.3675 0.3770 -0.0337 -0.0254 0.0234  68  ALA A CA    
566  C C     . ALA A 68  ? 0.4920 0.3669 0.3793 -0.0299 -0.0172 0.0210  68  ALA A C     
567  O O     . ALA A 68  ? 0.4739 0.3499 0.3656 -0.0274 -0.0125 0.0211  68  ALA A O     
568  C CB    . ALA A 68  ? 0.4484 0.3480 0.3550 -0.0301 -0.0268 0.0246  68  ALA A CB    
569  N N     . SER A 69  ? 0.4883 0.3536 0.3655 -0.0295 -0.0154 0.0193  69  SER A N     
570  C CA    . SER A 69  ? 0.5215 0.3766 0.3927 -0.0260 -0.0069 0.0177  69  SER A CA    
571  C C     . SER A 69  ? 0.5441 0.3837 0.4043 -0.0278 -0.0024 0.0168  69  SER A C     
572  O O     . SER A 69  ? 0.5230 0.3612 0.3872 -0.0239 0.0048  0.0170  69  SER A O     
573  C CB    . SER A 69  ? 0.5367 0.3829 0.3976 -0.0259 -0.0059 0.0162  69  SER A CB    
574  O OG    . SER A 69  ? 0.5724 0.4324 0.4444 -0.0227 -0.0077 0.0170  69  SER A OG    
575  N N     . GLN A 70  ? 0.5732 0.4007 0.4196 -0.0341 -0.0068 0.0162  70  GLN A N     
576  C CA    . GLN A 70  ? 0.6030 0.4134 0.4364 -0.0368 -0.0030 0.0152  70  GLN A CA    
577  C C     . GLN A 70  ? 0.5712 0.3904 0.4161 -0.0356 -0.0020 0.0167  70  GLN A C     
578  O O     . GLN A 70  ? 0.5637 0.3721 0.4032 -0.0346 0.0045  0.0162  70  GLN A O     
579  C CB    . GLN A 70  ? 0.6250 0.4200 0.4398 -0.0450 -0.0096 0.0145  70  GLN A CB    
580  C CG    . GLN A 70  ? 0.7599 0.5392 0.5571 -0.0469 -0.0090 0.0127  70  GLN A CG    
581  C CD    . GLN A 70  ? 0.8471 0.6157 0.6389 -0.0411 0.0031  0.0108  70  GLN A CD    
582  O OE1   . GLN A 70  ? 0.8879 0.6636 0.6863 -0.0367 0.0056  0.0108  70  GLN A OE1   
583  N NE2   . GLN A 70  ? 0.8885 0.6402 0.6692 -0.0409 0.0111  0.0097  70  GLN A NE2   
584  N N     . TRP A 71  ? 0.5389 0.3768 0.3992 -0.0356 -0.0080 0.0187  71  TRP A N     
585  C CA    . TRP A 71  ? 0.5161 0.3631 0.3876 -0.0345 -0.0074 0.0203  71  TRP A CA    
586  C C     . TRP A 71  ? 0.4987 0.3508 0.3796 -0.0277 0.0001  0.0208  71  TRP A C     
587  O O     . TRP A 71  ? 0.4895 0.3389 0.3722 -0.0265 0.0041  0.0215  71  TRP A O     
588  C CB    . TRP A 71  ? 0.4906 0.3553 0.3757 -0.0358 -0.0146 0.0225  71  TRP A CB    
589  C CG    . TRP A 71  ? 0.4586 0.3321 0.3543 -0.0347 -0.0137 0.0243  71  TRP A CG    
590  C CD1   . TRP A 71  ? 0.4635 0.3317 0.3559 -0.0387 -0.0149 0.0249  71  TRP A CD1   
591  C CD2   . TRP A 71  ? 0.3974 0.2854 0.3074 -0.0298 -0.0115 0.0256  71  TRP A CD2   
592  N NE1   . TRP A 71  ? 0.4583 0.3372 0.3625 -0.0362 -0.0133 0.0266  71  TRP A NE1   
593  C CE2   . TRP A 71  ? 0.4098 0.3003 0.3242 -0.0309 -0.0114 0.0271  71  TRP A CE2   
594  C CE3   . TRP A 71  ? 0.4102 0.3078 0.3283 -0.0250 -0.0100 0.0258  71  TRP A CE3   
595  C CZ2   . TRP A 71  ? 0.4072 0.3090 0.3329 -0.0273 -0.0096 0.0287  71  TRP A CZ2   
596  C CZ3   . TRP A 71  ? 0.3874 0.2959 0.3163 -0.0218 -0.0087 0.0274  71  TRP A CZ3   
597  C CH2   . TRP A 71  ? 0.4091 0.3193 0.3413 -0.0230 -0.0085 0.0288  71  TRP A CH2   
598  N N     . ILE A 72  ? 0.5065 0.3660 0.3937 -0.0236 0.0015  0.0208  72  ILE A N     
599  C CA    . ILE A 72  ? 0.5332 0.3977 0.4300 -0.0177 0.0076  0.0219  72  ILE A CA    
600  C C     . ILE A 72  ? 0.5712 0.4200 0.4602 -0.0161 0.0159  0.0216  72  ILE A C     
601  O O     . ILE A 72  ? 0.5619 0.4127 0.4586 -0.0129 0.0203  0.0235  72  ILE A O     
602  C CB    . ILE A 72  ? 0.5222 0.3943 0.4244 -0.0146 0.0074  0.0218  72  ILE A CB    
603  C CG1   . ILE A 72  ? 0.5212 0.4095 0.4335 -0.0149 0.0010  0.0228  72  ILE A CG1   
604  C CG2   . ILE A 72  ? 0.5424 0.4160 0.4526 -0.0093 0.0140  0.0234  72  ILE A CG2   
605  C CD1   . ILE A 72  ? 0.5529 0.4475 0.4685 -0.0128 -0.0002 0.0224  72  ILE A CD1   
606  N N     . LYS A 73  ? 0.6114 0.4438 0.4844 -0.0184 0.0182  0.0194  73  LYS A N     
607  C CA    . LYS A 73  ? 0.6621 0.4763 0.5249 -0.0170 0.0273  0.0188  73  LYS A CA    
608  C C     . LYS A 73  ? 0.6547 0.4611 0.5132 -0.0191 0.0287  0.0192  73  LYS A C     
609  O O     . LYS A 73  ? 0.6554 0.4553 0.5159 -0.0155 0.0368  0.0205  73  LYS A O     
610  C CB    . LYS A 73  ? 0.6945 0.4905 0.5380 -0.0198 0.0293  0.0162  73  LYS A CB    
611  C CG    . LYS A 73  ? 0.8116 0.6102 0.6587 -0.0157 0.0331  0.0162  73  LYS A CG    
612  C CD    . LYS A 73  ? 0.9125 0.6922 0.7386 -0.0190 0.0344  0.0135  73  LYS A CD    
613  C CE    . LYS A 73  ? 0.9559 0.7366 0.7854 -0.0146 0.0397  0.0138  73  LYS A CE    
614  N NZ    . LYS A 73  ? 0.9739 0.7471 0.8073 -0.0089 0.0523  0.0153  73  LYS A NZ    
615  N N     . ARG A 74  ? 0.6577 0.4652 0.5116 -0.0249 0.0209  0.0185  74  ARG A N     
616  C CA    . ARG A 74  ? 0.6841 0.4851 0.5344 -0.0274 0.0214  0.0189  74  ARG A CA    
617  C C     . ARG A 74  ? 0.6576 0.4731 0.5257 -0.0231 0.0229  0.0218  74  ARG A C     
618  O O     . ARG A 74  ? 0.6955 0.5035 0.5624 -0.0222 0.0279  0.0227  74  ARG A O     
619  C CB    . ARG A 74  ? 0.6945 0.4940 0.5371 -0.0351 0.0121  0.0182  74  ARG A CB    
620  C CG    . ARG A 74  ? 0.7514 0.5311 0.5721 -0.0409 0.0104  0.0158  74  ARG A CG    
621  C CD    . ARG A 74  ? 0.8070 0.5847 0.6212 -0.0492 0.0006  0.0161  74  ARG A CD    
622  N NE    . ARG A 74  ? 0.8707 0.6427 0.6738 -0.0543 -0.0063 0.0153  74  ARG A NE    
623  C CZ    . ARG A 74  ? 0.8502 0.6383 0.6640 -0.0560 -0.0151 0.0171  74  ARG A CZ    
624  N NH1   . ARG A 74  ? 0.7780 0.5881 0.6129 -0.0532 -0.0177 0.0194  74  ARG A NH1   
625  N NH2   . ARG A 74  ? 0.8747 0.6559 0.6776 -0.0607 -0.0212 0.0168  74  ARG A NH2   
626  N N     . MET A 75  ? 0.6251 0.4601 0.5087 -0.0207 0.0187  0.0233  75  MET A N     
627  C CA    . MET A 75  ? 0.6004 0.4487 0.4995 -0.0172 0.0191  0.0262  75  MET A CA    
628  C C     . MET A 75  ? 0.6302 0.4759 0.5357 -0.0113 0.0272  0.0283  75  MET A C     
629  O O     . MET A 75  ? 0.6325 0.4820 0.5466 -0.0091 0.0292  0.0310  75  MET A O     
630  C CB    . MET A 75  ? 0.5436 0.4106 0.4546 -0.0165 0.0129  0.0271  75  MET A CB    
631  C CG    . MET A 75  ? 0.5030 0.3757 0.4131 -0.0215 0.0055  0.0266  75  MET A CG    
632  S SD    . MET A 75  ? 0.4972 0.3693 0.4083 -0.0245 0.0043  0.0280  75  MET A SD    
633  C CE    . MET A 75  ? 0.3795 0.2690 0.3064 -0.0207 0.0034  0.0308  75  MET A CE    
634  N N     . GLU A 76  ? 0.6527 0.4923 0.5548 -0.0090 0.0318  0.0275  76  GLU A N     
635  C CA    . GLU A 76  ? 0.6794 0.5151 0.5881 -0.0035 0.0405  0.0301  76  GLU A CA    
636  C C     . GLU A 76  ? 0.6809 0.4988 0.5801 -0.0034 0.0481  0.0302  76  GLU A C     
637  O O     . GLU A 76  ? 0.6764 0.4954 0.5853 0.0003  0.0528  0.0336  76  GLU A O     
638  C CB    . GLU A 76  ? 0.6975 0.5303 0.6043 -0.0013 0.0439  0.0293  76  GLU A CB    
639  C CG    . GLU A 76  ? 0.7700 0.6014 0.6873 0.0048  0.0529  0.0330  76  GLU A CG    
640  C CD    . GLU A 76  ? 0.8398 0.6672 0.7547 0.0067  0.0571  0.0323  76  GLU A CD    
641  O OE1   . GLU A 76  ? 0.8532 0.6733 0.7722 0.0111  0.0668  0.0348  76  GLU A OE1   
642  O OE2   . GLU A 76  ? 0.8479 0.6792 0.7574 0.0040  0.0512  0.0295  76  GLU A OE2   
643  N N     . ASP A 77  ? 0.6894 0.4901 0.5691 -0.0077 0.0489  0.0265  77  ASP A N     
644  C CA    . ASP A 77  ? 0.7158 0.4960 0.5822 -0.0086 0.0561  0.0258  77  ASP A CA    
645  C C     . ASP A 77  ? 0.7073 0.4909 0.5782 -0.0099 0.0538  0.0274  77  ASP A C     
646  O O     . ASP A 77  ? 0.7221 0.4928 0.5890 -0.0083 0.0614  0.0285  77  ASP A O     
647  C CB    . ASP A 77  ? 0.7375 0.4981 0.5795 -0.0148 0.0551  0.0215  77  ASP A CB    
648  C CG    . ASP A 77  ? 0.7764 0.5294 0.6103 -0.0138 0.0585  0.0198  77  ASP A CG    
649  O OD1   . ASP A 77  ? 0.7835 0.5414 0.6288 -0.0076 0.0652  0.0220  77  ASP A OD1   
650  O OD2   . ASP A 77  ? 0.7917 0.5335 0.6076 -0.0195 0.0542  0.0166  77  ASP A OD2   
651  N N     . ILE A 78  ? 0.6752 0.4748 0.5537 -0.0129 0.0441  0.0276  78  ILE A N     
652  C CA    . ILE A 78  ? 0.6616 0.4661 0.5456 -0.0141 0.0416  0.0293  78  ILE A CA    
653  C C     . ILE A 78  ? 0.6399 0.4577 0.5430 -0.0082 0.0438  0.0338  78  ILE A C     
654  O O     . ILE A 78  ? 0.6530 0.4677 0.5594 -0.0067 0.0472  0.0362  78  ILE A O     
655  C CB    . ILE A 78  ? 0.6492 0.4641 0.5332 -0.0198 0.0312  0.0281  78  ILE A CB    
656  C CG1   . ILE A 78  ? 0.6663 0.4665 0.5316 -0.0267 0.0281  0.0248  78  ILE A CG1   
657  C CG2   . ILE A 78  ? 0.6499 0.4718 0.5420 -0.0202 0.0293  0.0305  78  ILE A CG2   
658  C CD1   . ILE A 78  ? 0.6242 0.4353 0.4915 -0.0322 0.0177  0.0244  78  ILE A CD1   
659  N N     . GLY A 79  ? 0.6221 0.4540 0.5370 -0.0052 0.0416  0.0352  79  GLY A N     
660  C CA    . GLY A 79  ? 0.6092 0.4538 0.5418 -0.0005 0.0421  0.0400  79  GLY A CA    
661  C C     . GLY A 79  ? 0.5932 0.4551 0.5346 -0.0020 0.0334  0.0409  79  GLY A C     
662  O O     . GLY A 79  ? 0.6081 0.4779 0.5603 0.0000  0.0323  0.0448  79  GLY A O     
663  N N     . LEU A 80  ? 0.5812 0.4481 0.5176 -0.0056 0.0274  0.0378  80  LEU A N     
664  C CA    . LEU A 80  ? 0.5603 0.4416 0.5031 -0.0072 0.0203  0.0383  80  LEU A CA    
665  C C     . LEU A 80  ? 0.5431 0.4336 0.4891 -0.0066 0.0168  0.0373  80  LEU A C     
666  O O     . LEU A 80  ? 0.5492 0.4345 0.4889 -0.0070 0.0179  0.0349  80  LEU A O     
667  C CB    . LEU A 80  ? 0.5513 0.4310 0.4868 -0.0122 0.0163  0.0362  80  LEU A CB    
668  C CG    . LEU A 80  ? 0.5434 0.4170 0.4768 -0.0137 0.0180  0.0374  80  LEU A CG    
669  C CD1   . LEU A 80  ? 0.4891 0.3573 0.4129 -0.0194 0.0146  0.0349  80  LEU A CD1   
670  C CD2   . LEU A 80  ? 0.4951 0.3794 0.4388 -0.0122 0.0158  0.0407  80  LEU A CD2   
671  N N     . GLU A 81  ? 0.5035 0.4061 0.4576 -0.0059 0.0127  0.0392  81  GLU A N     
672  C CA    . GLU A 81  ? 0.4947 0.4055 0.4515 -0.0054 0.0094  0.0384  81  GLU A CA    
673  C C     . GLU A 81  ? 0.4883 0.4004 0.4387 -0.0086 0.0059  0.0351  81  GLU A C     
674  O O     . GLU A 81  ? 0.4807 0.3944 0.4294 -0.0115 0.0034  0.0346  81  GLU A O     
675  C CB    . GLU A 81  ? 0.4931 0.4140 0.4576 -0.0045 0.0060  0.0412  81  GLU A CB    
676  C CG    . GLU A 81  ? 0.5199 0.4478 0.4868 -0.0037 0.0032  0.0407  81  GLU A CG    
677  C CD    . GLU A 81  ? 0.5205 0.4554 0.4921 -0.0035 -0.0003 0.0435  81  GLU A CD    
678  O OE1   . GLU A 81  ? 0.5353 0.4701 0.5084 -0.0041 -0.0009 0.0458  81  GLU A OE1   
679  O OE2   . GLU A 81  ? 0.5194 0.4588 0.4921 -0.0032 -0.0026 0.0435  81  GLU A OE2   
680  N N     . ALA A 82  ? 0.4649 0.3763 0.4128 -0.0081 0.0059  0.0333  82  ALA A N     
681  C CA    . ALA A 82  ? 0.4374 0.3512 0.3812 -0.0106 0.0021  0.0310  82  ALA A CA    
682  C C     . ALA A 82  ? 0.4279 0.3520 0.3776 -0.0089 -0.0004 0.0314  82  ALA A C     
683  O O     . ALA A 82  ? 0.4398 0.3641 0.3908 -0.0066 0.0008  0.0314  82  ALA A O     
684  C CB    . ALA A 82  ? 0.4364 0.3402 0.3712 -0.0117 0.0036  0.0287  82  ALA A CB    
685  N N     . LEU A 83  ? 0.3916 0.3232 0.3444 -0.0100 -0.0033 0.0321  83  LEU A N     
686  C CA    . LEU A 83  ? 0.3757 0.3149 0.3324 -0.0084 -0.0049 0.0327  83  LEU A CA    
687  C C     . LEU A 83  ? 0.3813 0.3237 0.3368 -0.0089 -0.0069 0.0311  83  LEU A C     
688  O O     . LEU A 83  ? 0.3826 0.3231 0.3355 -0.0112 -0.0083 0.0301  83  LEU A O     
689  C CB    . LEU A 83  ? 0.3478 0.2916 0.3072 -0.0089 -0.0058 0.0344  83  LEU A CB    
690  C CG    . LEU A 83  ? 0.3707 0.3125 0.3319 -0.0084 -0.0047 0.0368  83  LEU A CG    
691  C CD1   . LEU A 83  ? 0.3302 0.2677 0.2897 -0.0104 -0.0036 0.0368  83  LEU A CD1   
692  C CD2   . LEU A 83  ? 0.3341 0.2799 0.2963 -0.0083 -0.0061 0.0386  83  LEU A CD2   
693  N N     . GLY A 84  ? 0.3498 0.2965 0.3071 -0.0071 -0.0075 0.0311  84  GLY A N     
694  C CA    . GLY A 84  ? 0.3210 0.2712 0.2781 -0.0071 -0.0090 0.0301  84  GLY A CA    
695  C C     . GLY A 84  ? 0.3315 0.2796 0.2866 -0.0057 -0.0089 0.0288  84  GLY A C     
696  O O     . GLY A 84  ? 0.3318 0.2754 0.2859 -0.0049 -0.0071 0.0287  84  GLY A O     
697  N N     . MET A 85  ? 0.3294 0.2805 0.2844 -0.0054 -0.0102 0.0281  85  MET A N     
698  C CA    . MET A 85  ? 0.3375 0.2867 0.2903 -0.0041 -0.0101 0.0269  85  MET A CA    
699  C C     . MET A 85  ? 0.3548 0.2976 0.3027 -0.0056 -0.0103 0.0256  85  MET A C     
700  O O     . MET A 85  ? 0.3814 0.3242 0.3276 -0.0074 -0.0128 0.0254  85  MET A O     
701  C CB    . MET A 85  ? 0.3135 0.2673 0.2675 -0.0031 -0.0112 0.0267  85  MET A CB    
702  C CG    . MET A 85  ? 0.3323 0.2842 0.2839 -0.0019 -0.0113 0.0255  85  MET A CG    
703  S SD    . MET A 85  ? 0.3946 0.3433 0.3460 -0.0005 -0.0092 0.0256  85  MET A SD    
704  C CE    . MET A 85  ? 0.3269 0.2799 0.2805 0.0003  -0.0100 0.0269  85  MET A CE    
705  N N     . ASP A 86  ? 0.3988 0.3356 0.3441 -0.0048 -0.0076 0.0252  86  ASP A N     
706  C CA    . ASP A 86  ? 0.4242 0.3515 0.3620 -0.0061 -0.0064 0.0239  86  ASP A CA    
707  C C     . ASP A 86  ? 0.4351 0.3602 0.3689 -0.0055 -0.0068 0.0226  86  ASP A C     
708  O O     . ASP A 86  ? 0.4366 0.3530 0.3619 -0.0073 -0.0068 0.0214  86  ASP A O     
709  C CB    . ASP A 86  ? 0.4561 0.3769 0.3933 -0.0048 -0.0016 0.0244  86  ASP A CB    
710  C CG    . ASP A 86  ? 0.5246 0.4497 0.4691 -0.0016 0.0006  0.0260  86  ASP A CG    
711  O OD1   . ASP A 86  ? 0.5769 0.4966 0.5206 -0.0001 0.0046  0.0261  86  ASP A OD1   
712  O OD2   . ASP A 86  ? 0.5405 0.4737 0.4912 -0.0010 -0.0015 0.0274  86  ASP A OD2   
713  N N     . ASP A 87  ? 0.4193 0.3508 0.3578 -0.0034 -0.0073 0.0230  87  ASP A N     
714  C CA    . ASP A 87  ? 0.4071 0.3376 0.3424 -0.0030 -0.0083 0.0220  87  ASP A CA    
715  C C     . ASP A 87  ? 0.4008 0.3363 0.3372 -0.0043 -0.0126 0.0223  87  ASP A C     
716  O O     . ASP A 87  ? 0.3783 0.3212 0.3202 -0.0030 -0.0135 0.0231  87  ASP A O     
717  C CB    . ASP A 87  ? 0.4289 0.3628 0.3683 -0.0004 -0.0067 0.0224  87  ASP A CB    
718  C CG    . ASP A 87  ? 0.4658 0.3970 0.4010 0.0001  -0.0069 0.0213  87  ASP A CG    
719  O OD1   . ASP A 87  ? 0.4465 0.3753 0.3768 -0.0014 -0.0093 0.0205  87  ASP A OD1   
720  O OD2   . ASP A 87  ? 0.4974 0.4291 0.4348 0.0018  -0.0050 0.0216  87  ASP A OD2   
721  N N     . PHE A 88  ? 0.3816 0.3122 0.3125 -0.0072 -0.0152 0.0221  88  PHE A N     
722  C CA    . PHE A 88  ? 0.3878 0.3235 0.3220 -0.0091 -0.0198 0.0236  88  PHE A CA    
723  C C     . PHE A 88  ? 0.4035 0.3450 0.3417 -0.0074 -0.0214 0.0244  88  PHE A C     
724  O O     . PHE A 88  ? 0.4115 0.3603 0.3568 -0.0073 -0.0233 0.0264  88  PHE A O     
725  C CB    . PHE A 88  ? 0.3963 0.3240 0.3228 -0.0135 -0.0233 0.0237  88  PHE A CB    
726  C CG    . PHE A 88  ? 0.3876 0.3087 0.3097 -0.0154 -0.0215 0.0231  88  PHE A CG    
727  C CD1   . PHE A 88  ? 0.3656 0.2927 0.2949 -0.0150 -0.0204 0.0241  88  PHE A CD1   
728  C CD2   . PHE A 88  ? 0.4067 0.3140 0.3162 -0.0177 -0.0204 0.0215  88  PHE A CD2   
729  C CE1   . PHE A 88  ? 0.3733 0.2940 0.2986 -0.0166 -0.0186 0.0237  88  PHE A CE1   
730  C CE2   . PHE A 88  ? 0.4307 0.3306 0.3355 -0.0193 -0.0179 0.0210  88  PHE A CE2   
731  C CZ    . PHE A 88  ? 0.4336 0.3406 0.3468 -0.0187 -0.0172 0.0221  88  PHE A CZ    
732  N N     . LYS A 89  ? 0.3678 0.3059 0.3018 -0.0058 -0.0201 0.0231  89  LYS A N     
733  C CA    . LYS A 89  ? 0.4033 0.3461 0.3406 -0.0038 -0.0211 0.0237  89  LYS A CA    
734  C C     . LYS A 89  ? 0.3779 0.3277 0.3219 -0.0008 -0.0185 0.0241  89  LYS A C     
735  O O     . LYS A 89  ? 0.4085 0.3629 0.3566 0.0006  -0.0190 0.0253  89  LYS A O     
736  C CB    . LYS A 89  ? 0.4140 0.3503 0.3442 -0.0034 -0.0208 0.0224  89  LYS A CB    
737  C CG    . LYS A 89  ? 0.4055 0.3383 0.3333 -0.0015 -0.0163 0.0207  89  LYS A CG    
738  C CD    . LYS A 89  ? 0.4396 0.3632 0.3583 -0.0022 -0.0157 0.0195  89  LYS A CD    
739  C CE    . LYS A 89  ? 0.4314 0.3515 0.3493 -0.0003 -0.0106 0.0186  89  LYS A CE    
740  N NZ    . LYS A 89  ? 0.3654 0.2811 0.2824 -0.0008 -0.0073 0.0184  89  LYS A NZ    
741  N N     . LEU A 90  ? 0.3536 0.3032 0.2980 -0.0001 -0.0158 0.0234  90  LEU A N     
742  C CA    . LEU A 90  ? 0.3682 0.3224 0.3165 0.0016  -0.0140 0.0239  90  LEU A CA    
743  C C     . LEU A 90  ? 0.3667 0.3257 0.3199 0.0011  -0.0143 0.0256  90  LEU A C     
744  O O     . LEU A 90  ? 0.3739 0.3360 0.3297 0.0027  -0.0128 0.0264  90  LEU A O     
745  C CB    . LEU A 90  ? 0.3558 0.3083 0.3035 0.0018  -0.0121 0.0236  90  LEU A CB    
746  C CG    . LEU A 90  ? 0.3890 0.3379 0.3345 0.0026  -0.0110 0.0228  90  LEU A CG    
747  C CD1   . LEU A 90  ? 0.3717 0.3208 0.3198 0.0026  -0.0099 0.0239  90  LEU A CD1   
748  C CD2   . LEU A 90  ? 0.3715 0.3207 0.3156 0.0039  -0.0112 0.0223  90  LEU A CD2   
749  N N     . ALA A 91  ? 0.3638 0.3224 0.3179 -0.0011 -0.0157 0.0262  91  ALA A N     
750  C CA    . ALA A 91  ? 0.3274 0.2907 0.2872 -0.0020 -0.0161 0.0282  91  ALA A CA    
751  C C     . ALA A 91  ? 0.3197 0.2873 0.2848 -0.0017 -0.0180 0.0303  91  ALA A C     
752  O O     . ALA A 91  ? 0.2882 0.2610 0.2600 -0.0005 -0.0164 0.0325  91  ALA A O     
753  C CB    . ALA A 91  ? 0.3165 0.2774 0.2753 -0.0049 -0.0176 0.0284  91  ALA A CB    
754  N N     . TYR A 92  ? 0.3400 0.3049 0.3022 -0.0028 -0.0213 0.0302  92  TYR A N     
755  C CA    . TYR A 92  ? 0.3447 0.3135 0.3125 -0.0026 -0.0238 0.0328  92  TYR A CA    
756  C C     . TYR A 92  ? 0.3523 0.3243 0.3235 0.0015  -0.0201 0.0332  92  TYR A C     
757  O O     . TYR A 92  ? 0.3615 0.3392 0.3414 0.0030  -0.0190 0.0362  92  TYR A O     
758  C CB    . TYR A 92  ? 0.3670 0.3304 0.3285 -0.0046 -0.0281 0.0323  92  TYR A CB    
759  C CG    . TYR A 92  ? 0.3976 0.3650 0.3649 -0.0040 -0.0310 0.0354  92  TYR A CG    
760  C CD1   . TYR A 92  ? 0.4200 0.3863 0.3852 -0.0011 -0.0295 0.0346  92  TYR A CD1   
761  C CD2   . TYR A 92  ? 0.4277 0.4001 0.4036 -0.0063 -0.0354 0.0398  92  TYR A CD2   
762  C CE1   . TYR A 92  ? 0.4452 0.4151 0.4166 -0.0001 -0.0321 0.0379  92  TYR A CE1   
763  C CE2   . TYR A 92  ? 0.4414 0.4182 0.4248 -0.0056 -0.0384 0.0436  92  TYR A CE2   
764  C CZ    . TYR A 92  ? 0.4566 0.4320 0.4376 -0.0023 -0.0366 0.0427  92  TYR A CZ    
765  O OH    . TYR A 92  ? 0.4678 0.4476 0.4569 -0.0014 -0.0394 0.0470  92  TYR A OH    
766  N N     . LEU A 93  ? 0.3561 0.3240 0.3205 0.0032  -0.0178 0.0303  93  LEU A N     
767  C CA    . LEU A 93  ? 0.3500 0.3184 0.3147 0.0065  -0.0143 0.0302  93  LEU A CA    
768  C C     . LEU A 93  ? 0.3513 0.3220 0.3192 0.0080  -0.0101 0.0312  93  LEU A C     
769  O O     . LEU A 93  ? 0.3512 0.3233 0.3224 0.0105  -0.0068 0.0327  93  LEU A O     
770  C CB    . LEU A 93  ? 0.3357 0.2986 0.2923 0.0071  -0.0133 0.0272  93  LEU A CB    
771  C CG    . LEU A 93  ? 0.3261 0.2859 0.2789 0.0071  -0.0154 0.0264  93  LEU A CG    
772  C CD1   . LEU A 93  ? 0.2831 0.2385 0.2299 0.0078  -0.0136 0.0241  93  LEU A CD1   
773  C CD2   . LEU A 93  ? 0.2999 0.2621 0.2569 0.0090  -0.0157 0.0285  93  LEU A CD2   
774  N N     . SER A 94  ? 0.3600 0.3300 0.3263 0.0064  -0.0097 0.0304  94  SER A N     
775  C CA    . SER A 94  ? 0.3697 0.3404 0.3371 0.0072  -0.0058 0.0313  94  SER A CA    
776  C C     . SER A 94  ? 0.3690 0.3454 0.3463 0.0077  -0.0044 0.0348  94  SER A C     
777  O O     . SER A 94  ? 0.3606 0.3371 0.3399 0.0101  0.0006  0.0362  94  SER A O     
778  C CB    . SER A 94  ? 0.3523 0.3211 0.3162 0.0051  -0.0064 0.0301  94  SER A CB    
779  O OG    . SER A 94  ? 0.3675 0.3352 0.3301 0.0056  -0.0027 0.0308  94  SER A OG    
780  N N     . ASP A 95  ? 0.3593 0.3396 0.3426 0.0054  -0.0086 0.0365  95  ASP A N     
781  C CA    . ASP A 95  ? 0.3463 0.3332 0.3415 0.0053  -0.0087 0.0409  95  ASP A CA    
782  C C     . ASP A 95  ? 0.3709 0.3610 0.3731 0.0082  -0.0074 0.0437  95  ASP A C     
783  O O     . ASP A 95  ? 0.3955 0.3899 0.4073 0.0105  -0.0032 0.0473  95  ASP A O     
784  C CB    . ASP A 95  ? 0.3213 0.3101 0.3195 0.0011  -0.0150 0.0422  95  ASP A CB    
785  C CG    . ASP A 95  ? 0.3482 0.3355 0.3436 -0.0015 -0.0149 0.0411  95  ASP A CG    
786  O OD1   . ASP A 95  ? 0.3016 0.2855 0.2922 -0.0049 -0.0192 0.0398  95  ASP A OD1   
787  O OD2   . ASP A 95  ? 0.3077 0.2960 0.3048 -0.0001 -0.0101 0.0416  95  ASP A OD2   
788  N N     . THR A 96  ? 0.3543 0.3420 0.3522 0.0084  -0.0106 0.0424  96  THR A N     
789  C CA    . THR A 96  ? 0.3515 0.3421 0.3563 0.0110  -0.0103 0.0454  96  THR A CA    
790  C C     . THR A 96  ? 0.3509 0.3383 0.3531 0.0155  -0.0028 0.0446  96  THR A C     
791  O O     . THR A 96  ? 0.3854 0.3761 0.3966 0.0187  0.0007  0.0483  96  THR A O     
792  C CB    . THR A 96  ? 0.3428 0.3309 0.3428 0.0092  -0.0166 0.0444  96  THR A CB    
793  O OG1   . THR A 96  ? 0.3251 0.3125 0.3230 0.0045  -0.0227 0.0442  96  THR A OG1   
794  C CG2   . THR A 96  ? 0.3314 0.3238 0.3409 0.0109  -0.0182 0.0489  96  THR A CG2   
795  N N     . TYR A 97  ? 0.3600 0.3406 0.3500 0.0157  -0.0004 0.0402  97  TYR A N     
796  C CA    . TYR A 97  ? 0.3787 0.3534 0.3625 0.0190  0.0061  0.0389  97  TYR A CA    
797  C C     . TYR A 97  ? 0.4007 0.3713 0.3785 0.0186  0.0105  0.0376  97  TYR A C     
798  O O     . TYR A 97  ? 0.4186 0.3828 0.3849 0.0173  0.0103  0.0342  97  TYR A O     
799  C CB    . TYR A 97  ? 0.3405 0.3093 0.3142 0.0191  0.0043  0.0355  97  TYR A CB    
800  C CG    . TYR A 97  ? 0.3276 0.2998 0.3065 0.0193  -0.0001 0.0371  97  TYR A CG    
801  C CD1   . TYR A 97  ? 0.3160 0.2893 0.2937 0.0160  -0.0066 0.0362  97  TYR A CD1   
802  C CD2   . TYR A 97  ? 0.3467 0.3201 0.3317 0.0227  0.0025  0.0400  97  TYR A CD2   
803  C CE1   . TYR A 97  ? 0.2995 0.2744 0.2802 0.0156  -0.0111 0.0379  97  TYR A CE1   
804  C CE2   . TYR A 97  ? 0.3542 0.3306 0.3442 0.0226  -0.0022 0.0421  97  TYR A CE2   
805  C CZ    . TYR A 97  ? 0.3313 0.3082 0.3185 0.0188  -0.0093 0.0410  97  TYR A CZ    
806  O OH    . TYR A 97  ? 0.3035 0.2817 0.2935 0.0182  -0.0143 0.0431  97  TYR A OH    
807  N N     . ASN A 98  ? 0.4175 0.3921 0.4038 0.0193  0.0141  0.0408  98  ASN A N     
808  C CA    . ASN A 98  ? 0.4682 0.4390 0.4495 0.0187  0.0183  0.0402  98  ASN A CA    
809  C C     . ASN A 98  ? 0.4852 0.4471 0.4584 0.0218  0.0266  0.0398  98  ASN A C     
810  O O     . ASN A 98  ? 0.5157 0.4758 0.4905 0.0232  0.0332  0.0418  98  ASN A O     
811  C CB    . ASN A 98  ? 0.4852 0.4637 0.4791 0.0179  0.0187  0.0440  98  ASN A CB    
812  C CG    . ASN A 98  ? 0.5500 0.5251 0.5380 0.0161  0.0208  0.0429  98  ASN A CG    
813  O OD1   . ASN A 98  ? 0.6129 0.5804 0.5877 0.0150  0.0208  0.0395  98  ASN A OD1   
814  N ND2   . ASN A 98  ? 0.5503 0.5312 0.5489 0.0155  0.0224  0.0463  98  ASN A ND2   
815  N N     . TYR A 99  ? 0.4807 0.4360 0.4444 0.0226  0.0265  0.0373  99  TYR A N     
816  C CA    . TYR A 99  ? 0.4870 0.4312 0.4396 0.0249  0.0337  0.0363  99  TYR A CA    
817  C C     . TYR A 99  ? 0.4962 0.4331 0.4355 0.0231  0.0298  0.0325  99  TYR A C     
818  O O     . TYR A 99  ? 0.4698 0.4116 0.4113 0.0211  0.0226  0.0312  99  TYR A O     
819  C CB    . TYR A 99  ? 0.4851 0.4307 0.4469 0.0297  0.0403  0.0398  99  TYR A CB    
820  C CG    . TYR A 99  ? 0.4996 0.4539 0.4731 0.0307  0.0352  0.0416  99  TYR A CG    
821  C CD1   . TYR A 99  ? 0.4802 0.4467 0.4710 0.0306  0.0317  0.0457  99  TYR A CD1   
822  C CD2   . TYR A 99  ? 0.5156 0.4652 0.4820 0.0314  0.0335  0.0394  99  TYR A CD2   
823  C CE1   . TYR A 99  ? 0.4616 0.4347 0.4615 0.0310  0.0263  0.0477  99  TYR A CE1   
824  C CE2   . TYR A 99  ? 0.4614 0.4179 0.4372 0.0323  0.0289  0.0412  99  TYR A CE2   
825  C CZ    . TYR A 99  ? 0.4887 0.4566 0.4808 0.0319  0.0251  0.0454  99  TYR A CZ    
826  O OH    . TYR A 99  ? 0.4577 0.4314 0.4577 0.0321  0.0197  0.0475  99  TYR A OH    
827  N N     . GLU A 100 ? 0.4960 0.4203 0.4212 0.0237  0.0347  0.0309  100 GLU A N     
828  C CA    . GLU A 100 ? 0.5317 0.4484 0.4448 0.0219  0.0313  0.0279  100 GLU A CA    
829  C C     . GLU A 100 ? 0.5081 0.4283 0.4276 0.0248  0.0311  0.0285  100 GLU A C     
830  O O     . GLU A 100 ? 0.5324 0.4507 0.4554 0.0287  0.0377  0.0305  100 GLU A O     
831  C CB    . GLU A 100 ? 0.5582 0.4587 0.4527 0.0211  0.0365  0.0264  100 GLU A CB    
832  C CG    . GLU A 100 ? 0.6805 0.5729 0.5622 0.0181  0.0318  0.0236  100 GLU A CG    
833  C CD    . GLU A 100 ? 0.7948 0.6688 0.6564 0.0171  0.0370  0.0223  100 GLU A CD    
834  O OE1   . GLU A 100 ? 0.8476 0.7133 0.6958 0.0123  0.0324  0.0209  100 GLU A OE1   
835  O OE2   . GLU A 100 ? 0.8367 0.7038 0.6957 0.0210  0.0455  0.0230  100 GLU A OE2   
836  N N     . ILE A 101 ? 0.4808 0.4053 0.4019 0.0228  0.0239  0.0270  101 ILE A N     
837  C CA    . ILE A 101 ? 0.4557 0.3835 0.3825 0.0250  0.0228  0.0276  101 ILE A CA    
838  C C     . ILE A 101 ? 0.4796 0.3961 0.3950 0.0264  0.0266  0.0262  101 ILE A C     
839  O O     . ILE A 101 ? 0.4801 0.3883 0.3827 0.0234  0.0247  0.0236  101 ILE A O     
840  C CB    . ILE A 101 ? 0.4347 0.3689 0.3650 0.0225  0.0148  0.0264  101 ILE A CB    
841  C CG1   . ILE A 101 ? 0.4415 0.3859 0.3831 0.0215  0.0114  0.0281  101 ILE A CG1   
842  C CG2   . ILE A 101 ? 0.4243 0.3588 0.3565 0.0243  0.0136  0.0266  101 ILE A CG2   
843  C CD1   . ILE A 101 ? 0.4183 0.3661 0.3604 0.0186  0.0049  0.0267  101 ILE A CD1   
844  N N     . LYS A 102 ? 0.4983 0.4146 0.4192 0.0307  0.0320  0.0285  102 LYS A N     
845  C CA    . LYS A 102 ? 0.5417 0.4487 0.4544 0.0326  0.0353  0.0275  102 LYS A CA    
846  C C     . LYS A 102 ? 0.5179 0.4328 0.4400 0.0337  0.0305  0.0285  102 LYS A C     
847  O O     . LYS A 102 ? 0.5305 0.4545 0.4669 0.0363  0.0306  0.0321  102 LYS A O     
848  C CB    . LYS A 102 ? 0.6035 0.5033 0.5155 0.0372  0.0458  0.0298  102 LYS A CB    
849  C CG    . LYS A 102 ? 0.7315 0.6135 0.6231 0.0360  0.0517  0.0272  102 LYS A CG    
850  C CD    . LYS A 102 ? 0.7997 0.6789 0.6824 0.0313  0.0485  0.0252  102 LYS A CD    
851  C CE    . LYS A 102 ? 0.8622 0.7246 0.7225 0.0272  0.0479  0.0219  102 LYS A CE    
852  N NZ    . LYS A 102 ? 0.8985 0.7607 0.7524 0.0217  0.0414  0.0205  102 LYS A NZ    
853  N N     . TYR A 103 ? 0.4904 0.4016 0.4045 0.0312  0.0260  0.0258  103 TYR A N     
854  C CA    . TYR A 103 ? 0.4617 0.3785 0.3821 0.0318  0.0215  0.0264  103 TYR A CA    
855  C C     . TYR A 103 ? 0.4625 0.3704 0.3760 0.0341  0.0251  0.0260  103 TYR A C     
856  O O     . TYR A 103 ? 0.4658 0.3619 0.3666 0.0337  0.0294  0.0241  103 TYR A O     
857  C CB    . TYR A 103 ? 0.4200 0.3403 0.3388 0.0275  0.0140  0.0242  103 TYR A CB    
858  C CG    . TYR A 103 ? 0.4498 0.3615 0.3558 0.0244  0.0126  0.0212  103 TYR A CG    
859  C CD1   . TYR A 103 ? 0.4225 0.3294 0.3206 0.0213  0.0123  0.0198  103 TYR A CD1   
860  C CD2   . TYR A 103 ? 0.4231 0.3314 0.3254 0.0242  0.0109  0.0202  103 TYR A CD2   
861  C CE1   . TYR A 103 ? 0.4201 0.3195 0.3077 0.0177  0.0098  0.0179  103 TYR A CE1   
862  C CE2   . TYR A 103 ? 0.4338 0.3347 0.3258 0.0209  0.0092  0.0181  103 TYR A CE2   
863  C CZ    . TYR A 103 ? 0.4424 0.3391 0.3276 0.0175  0.0083  0.0172  103 TYR A CZ    
864  O OH    . TYR A 103 ? 0.4346 0.3245 0.3109 0.0136  0.0054  0.0160  103 TYR A OH    
865  N N     . ASP A 104 ? 0.4416 0.3542 0.3627 0.0362  0.0232  0.0278  104 ASP A N     
866  C CA    . ASP A 104 ? 0.4552 0.3602 0.3713 0.0387  0.0263  0.0278  104 ASP A CA    
867  C C     . ASP A 104 ? 0.4399 0.3466 0.3543 0.0363  0.0197  0.0263  104 ASP A C     
868  O O     . ASP A 104 ? 0.4573 0.3717 0.3811 0.0371  0.0159  0.0286  104 ASP A O     
869  C CB    . ASP A 104 ? 0.4485 0.3570 0.3765 0.0441  0.0310  0.0325  104 ASP A CB    
870  C CG    . ASP A 104 ? 0.5148 0.4157 0.4389 0.0473  0.0346  0.0331  104 ASP A CG    
871  O OD1   . ASP A 104 ? 0.5425 0.4352 0.4541 0.0450  0.0330  0.0297  104 ASP A OD1   
872  O OD2   . ASP A 104 ? 0.4997 0.4030 0.4344 0.0522  0.0390  0.0375  104 ASP A OD2   
873  N N     . HIS A 105 ? 0.4424 0.3412 0.3446 0.0332  0.0185  0.0230  105 HIS A N     
874  C CA    . HIS A 105 ? 0.4658 0.3656 0.3661 0.0306  0.0130  0.0215  105 HIS A CA    
875  C C     . HIS A 105 ? 0.4554 0.3558 0.3594 0.0333  0.0126  0.0232  105 HIS A C     
876  O O     . HIS A 105 ? 0.4498 0.3535 0.3553 0.0317  0.0079  0.0230  105 HIS A O     
877  C CB    . HIS A 105 ? 0.4709 0.3616 0.3587 0.0269  0.0123  0.0185  105 HIS A CB    
878  C CG    . HIS A 105 ? 0.5065 0.3853 0.3841 0.0282  0.0167  0.0179  105 HIS A CG    
879  N ND1   . HIS A 105 ? 0.5289 0.4039 0.4033 0.0282  0.0158  0.0174  105 HIS A ND1   
880  C CD2   . HIS A 105 ? 0.5541 0.4226 0.4228 0.0293  0.0226  0.0175  105 HIS A CD2   
881  C CE1   . HIS A 105 ? 0.5863 0.4494 0.4506 0.0294  0.0206  0.0168  105 HIS A CE1   
882  N NE2   . HIS A 105 ? 0.5663 0.4246 0.4263 0.0300  0.0250  0.0167  105 HIS A NE2   
883  N N     . THR A 106 ? 0.4007 0.4305 0.3622 0.0264  0.0243  0.0103  106 THR A N     
884  C CA    . THR A 106 ? 0.4089 0.4415 0.3778 0.0312  0.0219  0.0096  106 THR A CA    
885  C C     . THR A 106 ? 0.3802 0.4222 0.3603 0.0288  0.0185  0.0123  106 THR A C     
886  O O     . THR A 106 ? 0.3692 0.4121 0.3545 0.0316  0.0147  0.0124  106 THR A O     
887  C CB    . THR A 106 ? 0.4076 0.4440 0.3795 0.0378  0.0268  0.0074  106 THR A CB    
888  O OG1   . THR A 106 ? 0.4448 0.4948 0.4258 0.0372  0.0316  0.0085  106 THR A OG1   
889  C CG2   . THR A 106 ? 0.4535 0.4793 0.4126 0.0394  0.0301  0.0046  106 THR A CG2   
890  N N     . LYS A 107 ? 0.3728 0.4207 0.3556 0.0231  0.0195  0.0146  107 LYS A N     
891  C CA    . LYS A 107 ? 0.3751 0.4308 0.3668 0.0192  0.0159  0.0173  107 LYS A CA    
892  C C     . LYS A 107 ? 0.3668 0.4132 0.3521 0.0144  0.0105  0.0184  107 LYS A C     
893  O O     . LYS A 107 ? 0.3781 0.4278 0.3685 0.0111  0.0065  0.0203  107 LYS A O     
894  C CB    . LYS A 107 ? 0.3974 0.4650 0.3956 0.0149  0.0200  0.0192  107 LYS A CB    
895  C CG    . LYS A 107 ? 0.4545 0.5332 0.4597 0.0195  0.0266  0.0180  107 LYS A CG    
896  C CD    . LYS A 107 ? 0.4729 0.5608 0.4903 0.0256  0.0248  0.0176  107 LYS A CD    
897  C CE    . LYS A 107 ? 0.5445 0.6460 0.5711 0.0302  0.0318  0.0166  107 LYS A CE    
898  N NZ    . LYS A 107 ? 0.5742 0.6870 0.6149 0.0359  0.0293  0.0169  107 LYS A NZ    
899  N N     . ILE A 108 ? 0.3531 0.3881 0.3272 0.0141  0.0104  0.0172  108 ILE A N     
900  C CA    . ILE A 108 ? 0.3315 0.3576 0.2993 0.0105  0.0060  0.0178  108 ILE A CA    
901  C C     . ILE A 108 ? 0.3281 0.3478 0.2937 0.0135  0.0022  0.0162  108 ILE A C     
902  O O     . ILE A 108 ? 0.3415 0.3567 0.3028 0.0173  0.0032  0.0141  108 ILE A O     
903  C CB    . ILE A 108 ? 0.3330 0.3510 0.2905 0.0085  0.0076  0.0177  108 ILE A CB    
904  C CG1   . ILE A 108 ? 0.3132 0.3364 0.2712 0.0051  0.0117  0.0195  108 ILE A CG1   
905  C CG2   . ILE A 108 ? 0.3570 0.3664 0.3089 0.0058  0.0032  0.0183  108 ILE A CG2   
906  C CD1   . ILE A 108 ? 0.3289 0.3440 0.2762 0.0032  0.0131  0.0198  108 ILE A CD1   
907  N N     . ARG A 109 ? 0.3271 0.3458 0.2946 0.0112  -0.0023 0.0172  109 ARG A N     
908  C CA    . ARG A 109 ? 0.2837 0.2964 0.2486 0.0132  -0.0059 0.0160  109 ARG A CA    
909  C C     . ARG A 109 ? 0.2822 0.2851 0.2377 0.0122  -0.0068 0.0147  109 ARG A C     
910  O O     . ARG A 109 ? 0.2799 0.2792 0.2326 0.0088  -0.0086 0.0155  109 ARG A O     
911  C CB    . ARG A 109 ? 0.2772 0.2925 0.2470 0.0109  -0.0103 0.0175  109 ARG A CB    
912  C CG    . ARG A 109 ? 0.2752 0.2849 0.2423 0.0130  -0.0139 0.0165  109 ARG A CG    
913  C CD    . ARG A 109 ? 0.2361 0.2484 0.2074 0.0104  -0.0186 0.0182  109 ARG A CD    
914  N NE    . ARG A 109 ? 0.2999 0.3240 0.2821 0.0114  -0.0186 0.0200  109 ARG A NE    
915  C CZ    . ARG A 109 ? 0.3582 0.3867 0.3461 0.0163  -0.0195 0.0201  109 ARG A CZ    
916  N NH1   . ARG A 109 ? 0.3160 0.3364 0.2982 0.0199  -0.0207 0.0186  109 ARG A NH1   
917  N NH2   . ARG A 109 ? 0.3323 0.3733 0.3314 0.0175  -0.0192 0.0217  109 ARG A NH2   
918  N N     . VAL A 110 ? 0.2894 0.2881 0.2403 0.0153  -0.0056 0.0127  110 VAL A N     
919  C CA    . VAL A 110 ? 0.3001 0.2916 0.2436 0.0147  -0.0065 0.0113  110 VAL A CA    
920  C C     . VAL A 110 ? 0.3434 0.3309 0.2851 0.0154  -0.0092 0.0101  110 VAL A C     
921  O O     . VAL A 110 ? 0.3417 0.3288 0.2839 0.0179  -0.0092 0.0093  110 VAL A O     
922  C CB    . VAL A 110 ? 0.2930 0.2825 0.2315 0.0164  -0.0037 0.0100  110 VAL A CB    
923  C CG1   . VAL A 110 ? 0.2651 0.2492 0.1977 0.0157  -0.0052 0.0089  110 VAL A CG1   
924  C CG2   . VAL A 110 ? 0.2995 0.2921 0.2383 0.0154  -0.0007 0.0113  110 VAL A CG2   
925  N N     . ALA A 111 ? 0.3306 0.3143 0.2695 0.0132  -0.0114 0.0100  111 ALA A N     
926  C CA    . ALA A 111 ? 0.3260 0.3057 0.2622 0.0129  -0.0136 0.0089  111 ALA A CA    
927  C C     . ALA A 111 ? 0.3302 0.3061 0.2609 0.0128  -0.0131 0.0071  111 ALA A C     
928  O O     . ALA A 111 ? 0.3177 0.2929 0.2469 0.0122  -0.0127 0.0070  111 ALA A O     
929  C CB    . ALA A 111 ? 0.3156 0.2942 0.2526 0.0103  -0.0164 0.0100  111 ALA A CB    
930  N N     . ASN A 112 ? 0.3442 0.3177 0.2721 0.0134  -0.0133 0.0057  112 ASN A N     
931  C CA    A ASN A 112 ? 0.3493 0.3208 0.2728 0.0126  -0.0129 0.0039  112 ASN A CA    
932  C CA    B ASN A 112 ? 0.3495 0.3210 0.2731 0.0126  -0.0129 0.0039  112 ASN A CA    
933  C C     . ASN A 112 ? 0.3491 0.3172 0.2699 0.0108  -0.0145 0.0033  112 ASN A C     
934  O O     . ASN A 112 ? 0.3637 0.3292 0.2832 0.0109  -0.0156 0.0035  112 ASN A O     
935  C CB    A ASN A 112 ? 0.3598 0.3306 0.2808 0.0136  -0.0116 0.0028  112 ASN A CB    
936  C CB    B ASN A 112 ? 0.3572 0.3282 0.2784 0.0137  -0.0116 0.0029  112 ASN A CB    
937  C CG    A ASN A 112 ? 0.3618 0.3351 0.2831 0.0147  -0.0100 0.0030  112 ASN A CG    
938  C CG    B ASN A 112 ? 0.3688 0.3402 0.2869 0.0125  -0.0111 0.0013  112 ASN A CG    
939  O OD1   A ASN A 112 ? 0.4209 0.3946 0.3396 0.0142  -0.0097 0.0019  112 ASN A OD1   
940  O OD1   B ASN A 112 ? 0.3373 0.3083 0.2539 0.0108  -0.0117 0.0004  112 ASN A OD1   
941  N ND2   A ASN A 112 ? 0.3744 0.3499 0.2989 0.0159  -0.0090 0.0044  112 ASN A ND2   
942  N ND2   B ASN A 112 ? 0.4089 0.3816 0.3259 0.0133  -0.0101 0.0011  112 ASN A ND2   
943  N N     . PHE A 113 ? 0.3478 0.3151 0.2669 0.0094  -0.0146 0.0024  113 PHE A N     
944  C CA    . PHE A 113 ? 0.3722 0.3360 0.2874 0.0071  -0.0156 0.0017  113 PHE A CA    
945  C C     . PHE A 113 ? 0.3785 0.3430 0.2911 0.0059  -0.0140 -0.0004 113 PHE A C     
946  O O     . PHE A 113 ? 0.3779 0.3457 0.2924 0.0073  -0.0128 -0.0010 113 PHE A O     
947  C CB    . PHE A 113 ? 0.3704 0.3318 0.2858 0.0060  -0.0177 0.0030  113 PHE A CB    
948  C CG    . PHE A 113 ? 0.3572 0.3175 0.2714 0.0052  -0.0173 0.0023  113 PHE A CG    
949  C CD1   . PHE A 113 ? 0.4133 0.3756 0.3299 0.0068  -0.0162 0.0025  113 PHE A CD1   
950  C CD2   . PHE A 113 ? 0.3567 0.3125 0.2661 0.0029  -0.0182 0.0015  113 PHE A CD2   
951  C CE1   . PHE A 113 ? 0.4356 0.3949 0.3500 0.0066  -0.0160 0.0018  113 PHE A CE1   
952  C CE2   . PHE A 113 ? 0.3992 0.3524 0.3062 0.0025  -0.0175 0.0005  113 PHE A CE2   
953  C CZ    . PHE A 113 ? 0.3668 0.3216 0.2765 0.0047  -0.0165 0.0006  113 PHE A CZ    
954  N N     . ASP A 114 ? 0.3850 0.3466 0.2930 0.0034  -0.0141 -0.0012 114 ASP A N     
955  C CA    . ASP A 114 ? 0.4054 0.3684 0.3111 0.0018  -0.0122 -0.0033 114 ASP A CA    
956  C C     . ASP A 114 ? 0.3984 0.3561 0.2982 -0.0014 -0.0128 -0.0036 114 ASP A C     
957  O O     . ASP A 114 ? 0.4232 0.3760 0.3200 -0.0027 -0.0150 -0.0022 114 ASP A O     
958  C CB    . ASP A 114 ? 0.3986 0.3659 0.3045 0.0008  -0.0106 -0.0046 114 ASP A CB    
959  C CG    . ASP A 114 ? 0.5313 0.5044 0.4389 0.0009  -0.0082 -0.0066 114 ASP A CG    
960  O OD1   . ASP A 114 ? 0.5646 0.5370 0.4725 0.0023  -0.0075 -0.0073 114 ASP A OD1   
961  O OD2   . ASP A 114 ? 0.6054 0.5837 0.5140 -0.0004 -0.0071 -0.0077 114 ASP A OD2   
962  N N     . ILE A 115 ? 0.4052 0.3635 0.3029 -0.0024 -0.0107 -0.0054 115 ILE A N     
963  C CA    . ILE A 115 ? 0.4024 0.3552 0.2930 -0.0057 -0.0107 -0.0060 115 ILE A CA    
964  C C     . ILE A 115 ? 0.3984 0.3542 0.2861 -0.0085 -0.0074 -0.0082 115 ILE A C     
965  O O     . ILE A 115 ? 0.3904 0.3537 0.2829 -0.0073 -0.0052 -0.0095 115 ILE A O     
966  C CB    . ILE A 115 ? 0.4203 0.3694 0.3091 -0.0051 -0.0111 -0.0064 115 ILE A CB    
967  C CG1   . ILE A 115 ? 0.3920 0.3451 0.2827 -0.0027 -0.0076 -0.0090 115 ILE A CG1   
968  C CG2   . ILE A 115 ? 0.3916 0.3392 0.2841 -0.0032 -0.0143 -0.0040 115 ILE A CG2   
969  C CD1   . ILE A 115 ? 0.3150 0.2618 0.2008 -0.0027 -0.0073 -0.0100 115 ILE A CD1   
970  N N     . GLU A 116 ? 0.3650 0.3151 0.2447 -0.0127 -0.0073 -0.0085 116 GLU A N     
971  C CA    . GLU A 116 ? 0.3745 0.3271 0.2503 -0.0163 -0.0036 -0.0106 116 GLU A CA    
972  C C     . GLU A 116 ? 0.4029 0.3510 0.2722 -0.0178 -0.0019 -0.0121 116 GLU A C     
973  O O     . GLU A 116 ? 0.4298 0.3694 0.2935 -0.0188 -0.0049 -0.0108 116 GLU A O     
974  C CB    . GLU A 116 ? 0.3994 0.3477 0.2689 -0.0212 -0.0046 -0.0095 116 GLU A CB    
975  C CG    . GLU A 116 ? 0.4579 0.4087 0.3317 -0.0202 -0.0062 -0.0084 116 GLU A CG    
976  C CD    . GLU A 116 ? 0.5353 0.4972 0.4162 -0.0193 -0.0033 -0.0101 116 GLU A CD    
977  O OE1   . GLU A 116 ? 0.5887 0.5569 0.4703 -0.0210 0.0004  -0.0123 116 GLU A OE1   
978  O OE2   . GLU A 116 ? 0.5858 0.5506 0.4719 -0.0167 -0.0046 -0.0094 116 GLU A OE2   
979  N N     . VAL A 117 ? 0.4114 0.3656 0.2815 -0.0179 0.0029  -0.0151 117 VAL A N     
980  C CA    . VAL A 117 ? 0.4215 0.3718 0.2847 -0.0192 0.0058  -0.0173 117 VAL A CA    
981  C C     . VAL A 117 ? 0.4192 0.3758 0.2804 -0.0229 0.0112  -0.0198 117 VAL A C     
982  O O     . VAL A 117 ? 0.4227 0.3906 0.2920 -0.0205 0.0146  -0.0216 117 VAL A O     
983  C CB    . VAL A 117 ? 0.4118 0.3636 0.2794 -0.0135 0.0071  -0.0190 117 VAL A CB    
984  C CG1   . VAL A 117 ? 0.3788 0.3240 0.2372 -0.0148 0.0100  -0.0215 117 VAL A CG1   
985  C CG2   . VAL A 117 ? 0.4050 0.3526 0.2761 -0.0102 0.0023  -0.0165 117 VAL A CG2   
986  N N     . THR A 118 ? 0.4398 0.3893 0.2900 -0.0290 0.0118  -0.0196 118 THR A N     
987  C CA    . THR A 118 ? 0.4731 0.4280 0.3197 -0.0338 0.0174  -0.0220 118 THR A CA    
988  C C     . THR A 118 ? 0.5152 0.4730 0.3611 -0.0312 0.0229  -0.0257 118 THR A C     
989  O O     . THR A 118 ? 0.5094 0.4572 0.3477 -0.0305 0.0220  -0.0262 118 THR A O     
990  C CB    . THR A 118 ? 0.4877 0.4322 0.3207 -0.0417 0.0162  -0.0203 118 THR A CB    
991  O OG1   . THR A 118 ? 0.4828 0.4252 0.3168 -0.0435 0.0119  -0.0173 118 THR A OG1   
992  C CG2   . THR A 118 ? 0.4570 0.4061 0.2844 -0.0476 0.0228  -0.0229 118 THR A CG2   
993  N N     . SER A 119 ? 0.5555 0.5270 0.4094 -0.0296 0.0284  -0.0285 119 SER A N     
994  C CA    . SER A 119 ? 0.6181 0.5938 0.4727 -0.0259 0.0343  -0.0325 119 SER A CA    
995  C C     . SER A 119 ? 0.6523 0.6416 0.5100 -0.0290 0.0414  -0.0354 119 SER A C     
996  O O     . SER A 119 ? 0.6337 0.6374 0.5034 -0.0276 0.0424  -0.0355 119 SER A O     
997  C CB    . SER A 119 ? 0.6139 0.5942 0.4793 -0.0167 0.0332  -0.0332 119 SER A CB    
998  O OG    . SER A 119 ? 0.6572 0.6413 0.5235 -0.0122 0.0390  -0.0373 119 SER A OG    
999  N N     . PRO A 120 ? 0.7030 0.6879 0.5497 -0.0335 0.0465  -0.0377 120 PRO A N     
1000 C CA    . PRO A 120 ? 0.7312 0.7294 0.5799 -0.0373 0.0543  -0.0406 120 PRO A CA    
1001 C C     . PRO A 120 ? 0.7509 0.7618 0.6094 -0.0295 0.0607  -0.0451 120 PRO A C     
1002 O O     . PRO A 120 ? 0.7739 0.8001 0.6384 -0.0313 0.0672  -0.0475 120 PRO A O     
1003 C CB    . PRO A 120 ? 0.7476 0.7332 0.5783 -0.0451 0.0567  -0.0411 120 PRO A CB    
1004 C CG    . PRO A 120 ? 0.7459 0.7145 0.5676 -0.0416 0.0525  -0.0406 120 PRO A CG    
1005 C CD    . PRO A 120 ? 0.7288 0.6959 0.5595 -0.0365 0.0448  -0.0373 120 PRO A CD    
1006 N N     . ASP A 121 ? 0.7559 0.7604 0.6159 -0.0211 0.0589  -0.0460 121 ASP A N     
1007 C CA    . ASP A 121 ? 0.7705 0.7835 0.6377 -0.0126 0.0647  -0.0503 121 ASP A CA    
1008 C C     . ASP A 121 ? 0.7591 0.7786 0.6404 -0.0032 0.0608  -0.0495 121 ASP A C     
1009 O O     . ASP A 121 ? 0.7689 0.7834 0.6505 0.0049  0.0614  -0.0515 121 ASP A O     
1010 C CB    . ASP A 121 ? 0.8174 0.8151 0.6705 -0.0109 0.0675  -0.0533 121 ASP A CB    
1011 C CG    . ASP A 121 ? 0.8676 0.8457 0.7113 -0.0110 0.0598  -0.0503 121 ASP A CG    
1012 O OD1   . ASP A 121 ? 0.9052 0.8756 0.7424 -0.0180 0.0546  -0.0466 121 ASP A OD1   
1013 O OD2   . ASP A 121 ? 0.9042 0.8746 0.7468 -0.0040 0.0589  -0.0517 121 ASP A OD2   
1014 N N     . GLY A 122 ? 0.7391 0.7686 0.6307 -0.0045 0.0568  -0.0465 122 GLY A N     
1015 C CA    . GLY A 122 ? 0.7073 0.7448 0.6125 0.0036  0.0533  -0.0455 122 GLY A CA    
1016 C C     . GLY A 122 ? 0.6886 0.7138 0.5915 0.0045  0.0452  -0.0415 122 GLY A C     
1017 O O     . GLY A 122 ? 0.6900 0.7027 0.5829 -0.0016 0.0418  -0.0391 122 GLY A O     
1018 N N     . PHE A 123 ? 0.6645 0.6936 0.5770 0.0121  0.0421  -0.0407 123 PHE A N     
1019 C CA    . PHE A 123 ? 0.6477 0.6669 0.5593 0.0133  0.0350  -0.0370 123 PHE A CA    
1020 C C     . PHE A 123 ? 0.6224 0.6228 0.5219 0.0135  0.0332  -0.0368 123 PHE A C     
1021 O O     . PHE A 123 ? 0.6302 0.6255 0.5259 0.0181  0.0363  -0.0397 123 PHE A O     
1022 C CB    . PHE A 123 ? 0.6546 0.6813 0.5776 0.0215  0.0326  -0.0363 123 PHE A CB    
1023 C CG    . PHE A 123 ? 0.6669 0.6847 0.5891 0.0224  0.0259  -0.0326 123 PHE A CG    
1024 C CD1   . PHE A 123 ? 0.6618 0.6838 0.5875 0.0183  0.0221  -0.0296 123 PHE A CD1   
1025 C CD2   . PHE A 123 ? 0.6886 0.6933 0.6058 0.0270  0.0237  -0.0322 123 PHE A CD2   
1026 C CE1   . PHE A 123 ? 0.6939 0.7082 0.6188 0.0192  0.0167  -0.0263 123 PHE A CE1   
1027 C CE2   . PHE A 123 ? 0.6939 0.6913 0.6104 0.0272  0.0182  -0.0287 123 PHE A CE2   
1028 C CZ    . PHE A 123 ? 0.6961 0.6989 0.6169 0.0235  0.0149  -0.0258 123 PHE A CZ    
1029 N N     . PRO A 124 ? 0.5764 0.5668 0.4698 0.0085  0.0283  -0.0335 124 PRO A N     
1030 C CA    . PRO A 124 ? 0.5787 0.5524 0.4612 0.0075  0.0256  -0.0327 124 PRO A CA    
1031 C C     . PRO A 124 ? 0.5722 0.5403 0.4573 0.0139  0.0224  -0.0318 124 PRO A C     
1032 O O     . PRO A 124 ? 0.5899 0.5578 0.4793 0.0143  0.0177  -0.0286 124 PRO A O     
1033 C CB    . PRO A 124 ? 0.5496 0.5186 0.4284 0.0009  0.0210  -0.0291 124 PRO A CB    
1034 C CG    . PRO A 124 ? 0.5417 0.5222 0.4306 0.0010  0.0196  -0.0273 124 PRO A CG    
1035 C CD    . PRO A 124 ? 0.5680 0.5624 0.4643 0.0035  0.0248  -0.0303 124 PRO A CD    
1036 N N     . GLU A 125 ? 0.5838 0.5467 0.4654 0.0189  0.0253  -0.0348 125 GLU A N     
1037 C CA    . GLU A 125 ? 0.6015 0.5573 0.4839 0.0250  0.0225  -0.0342 125 GLU A CA    
1038 C C     . GLU A 125 ? 0.5735 0.5153 0.4481 0.0212  0.0172  -0.0312 125 GLU A C     
1039 O O     . GLU A 125 ? 0.5881 0.5195 0.4521 0.0169  0.0172  -0.0320 125 GLU A O     
1040 C CB    . GLU A 125 ? 0.6448 0.5966 0.5237 0.0313  0.0272  -0.0384 125 GLU A CB    
1041 C CG    . GLU A 125 ? 0.7101 0.6763 0.6010 0.0390  0.0303  -0.0403 125 GLU A CG    
1042 C CD    . GLU A 125 ? 0.7955 0.7636 0.6943 0.0442  0.0256  -0.0374 125 GLU A CD    
1043 O OE1   . GLU A 125 ? 0.8469 0.8014 0.7397 0.0448  0.0215  -0.0355 125 GLU A OE1   
1044 O OE2   . GLU A 125 ? 0.7982 0.7813 0.7087 0.0473  0.0257  -0.0370 125 GLU A OE2   
1045 N N     . PRO A 126 ? 0.5614 0.5034 0.4414 0.0224  0.0126  -0.0278 126 PRO A N     
1046 C CA    . PRO A 126 ? 0.5524 0.4837 0.4272 0.0188  0.0076  -0.0248 126 PRO A CA    
1047 C C     . PRO A 126 ? 0.5638 0.4801 0.4278 0.0191  0.0073  -0.0263 126 PRO A C     
1048 O O     . PRO A 126 ? 0.5792 0.4868 0.4358 0.0136  0.0045  -0.0250 126 PRO A O     
1049 C CB    . PRO A 126 ? 0.5416 0.4771 0.4246 0.0220  0.0044  -0.0219 126 PRO A CB    
1050 C CG    . PRO A 126 ? 0.5515 0.5015 0.4440 0.0241  0.0064  -0.0224 126 PRO A CG    
1051 C CD    . PRO A 126 ? 0.5460 0.4997 0.4375 0.0264  0.0117  -0.0265 126 PRO A CD    
1052 N N     . SER A 127 ? 0.5504 0.4632 0.4132 0.0254  0.0100  -0.0290 127 SER A N     
1053 C CA    . SER A 127 ? 0.5849 0.4814 0.4360 0.0260  0.0098  -0.0307 127 SER A CA    
1054 C C     . SER A 127 ? 0.6013 0.4903 0.4410 0.0217  0.0124  -0.0336 127 SER A C     
1055 O O     . SER A 127 ? 0.6340 0.5082 0.4621 0.0191  0.0108  -0.0342 127 SER A O     
1056 C CB    . SER A 127 ? 0.5889 0.4824 0.4408 0.0348  0.0121  -0.0331 127 SER A CB    
1057 O OG    . SER A 127 ? 0.5941 0.4947 0.4479 0.0392  0.0181  -0.0373 127 SER A OG    
1058 N N     . GLN A 128 ? 0.5982 0.4971 0.4403 0.0203  0.0164  -0.0354 128 GLN A N     
1059 C CA    . GLN A 128 ? 0.6063 0.4986 0.4369 0.0154  0.0191  -0.0379 128 GLN A CA    
1060 C C     . GLN A 128 ? 0.5691 0.4614 0.3971 0.0069  0.0150  -0.0345 128 GLN A C     
1061 O O     . GLN A 128 ? 0.5701 0.4510 0.3863 0.0017  0.0131  -0.0346 128 GLN A O     
1062 C CB    . GLN A 128 ? 0.6375 0.5396 0.4704 0.0183  0.0266  -0.0420 128 GLN A CB    
1063 C CG    . GLN A 128 ? 0.7146 0.6190 0.5517 0.0279  0.0310  -0.0456 128 GLN A CG    
1064 C CD    . GLN A 128 ? 0.8170 0.7032 0.6406 0.0307  0.0322  -0.0487 128 GLN A CD    
1065 O OE1   . GLN A 128 ? 0.8361 0.7168 0.6609 0.0375  0.0313  -0.0492 128 GLN A OE1   
1066 N NE2   . GLN A 128 ? 0.8295 0.7053 0.6391 0.0252  0.0341  -0.0509 128 GLN A NE2   
1067 N N     . ALA A 129 ? 0.5218 0.4264 0.3605 0.0059  0.0134  -0.0317 129 ALA A N     
1068 C CA    . ALA A 129 ? 0.4873 0.3926 0.3249 -0.0008 0.0095  -0.0284 129 ALA A CA    
1069 C C     . ALA A 129 ? 0.5130 0.4112 0.3380 -0.0068 0.0108  -0.0298 129 ALA A C     
1070 O O     . ALA A 129 ? 0.5326 0.4217 0.3499 -0.0118 0.0061  -0.0277 129 ALA A O     
1071 C CB    . ALA A 129 ? 0.4410 0.3414 0.2800 -0.0025 0.0028  -0.0244 129 ALA A CB    
1072 N N     . LYS A 130 ? 0.5234 0.4261 0.3463 -0.0064 0.0171  -0.0332 130 LYS A N     
1073 C CA    . LYS A 130 ? 0.5595 0.4547 0.3688 -0.0120 0.0194  -0.0350 130 LYS A CA    
1074 C C     . LYS A 130 ? 0.5539 0.4537 0.3627 -0.0181 0.0183  -0.0327 130 LYS A C     
1075 O O     . LYS A 130 ? 0.5679 0.4606 0.3645 -0.0238 0.0190  -0.0332 130 LYS A O     
1076 C CB    . LYS A 130 ? 0.5794 0.4753 0.3844 -0.0088 0.0275  -0.0405 130 LYS A CB    
1077 C CG    . LYS A 130 ? 0.6499 0.5628 0.4675 -0.0044 0.0332  -0.0423 130 LYS A CG    
1078 C CD    . LYS A 130 ? 0.7244 0.6385 0.5385 -0.0003 0.0415  -0.0479 130 LYS A CD    
1079 C CE    . LYS A 130 ? 0.7559 0.6894 0.5835 0.0031  0.0471  -0.0496 130 LYS A CE    
1080 N NZ    . LYS A 130 ? 0.7807 0.7176 0.6072 0.0085  0.0555  -0.0552 130 LYS A NZ    
1081 N N     . HIS A 131 ? 0.5305 0.4409 0.3512 -0.0170 0.0164  -0.0301 131 HIS A N     
1082 C CA    . HIS A 131 ? 0.5196 0.4332 0.3397 -0.0224 0.0150  -0.0277 131 HIS A CA    
1083 C C     . HIS A 131 ? 0.5010 0.4107 0.3229 -0.0241 0.0073  -0.0230 131 HIS A C     
1084 O O     . HIS A 131 ? 0.4927 0.4039 0.3225 -0.0202 0.0039  -0.0214 131 HIS A O     
1085 C CB    . HIS A 131 ? 0.5123 0.4405 0.3429 -0.0208 0.0192  -0.0286 131 HIS A CB    
1086 C CG    . HIS A 131 ? 0.5545 0.4894 0.3854 -0.0187 0.0271  -0.0332 131 HIS A CG    
1087 N ND1   . HIS A 131 ? 0.5546 0.4982 0.3958 -0.0114 0.0300  -0.0354 131 HIS A ND1   
1088 C CD2   . HIS A 131 ? 0.5710 0.5051 0.3931 -0.0228 0.0327  -0.0360 131 HIS A CD2   
1089 C CE1   . HIS A 131 ? 0.5301 0.4791 0.3700 -0.0104 0.0372  -0.0395 131 HIS A CE1   
1090 N NE2   . HIS A 131 ? 0.5803 0.5240 0.4087 -0.0175 0.0393  -0.0401 131 HIS A NE2   
1091 N N     . PRO A 132 ? 0.4909 0.3953 0.3051 -0.0298 0.0044  -0.0208 132 PRO A N     
1092 C CA    . PRO A 132 ? 0.4590 0.3602 0.2751 -0.0309 -0.0028 -0.0165 132 PRO A CA    
1093 C C     . PRO A 132 ? 0.4529 0.3640 0.2825 -0.0273 -0.0039 -0.0147 132 PRO A C     
1094 O O     . PRO A 132 ? 0.4477 0.3671 0.2822 -0.0267 0.0001  -0.0159 132 PRO A O     
1095 C CB    . PRO A 132 ? 0.4556 0.3501 0.2605 -0.0373 -0.0041 -0.0151 132 PRO A CB    
1096 C CG    . PRO A 132 ? 0.4755 0.3649 0.2686 -0.0405 0.0010  -0.0185 132 PRO A CG    
1097 C CD    . PRO A 132 ? 0.5048 0.4035 0.3058 -0.0356 0.0077  -0.0224 132 PRO A CD    
1098 N N     . ILE A 133 ? 0.4308 0.3413 0.2661 -0.0250 -0.0091 -0.0118 133 ILE A N     
1099 C CA    . ILE A 133 ? 0.4259 0.3435 0.2715 -0.0223 -0.0108 -0.0097 133 ILE A CA    
1100 C C     . ILE A 133 ? 0.4240 0.3374 0.2647 -0.0259 -0.0139 -0.0073 133 ILE A C     
1101 O O     . ILE A 133 ? 0.4261 0.3320 0.2610 -0.0279 -0.0187 -0.0050 133 ILE A O     
1102 C CB    . ILE A 133 ? 0.4124 0.3310 0.2654 -0.0189 -0.0148 -0.0076 133 ILE A CB    
1103 C CG1   . ILE A 133 ? 0.4052 0.3259 0.2617 -0.0154 -0.0121 -0.0098 133 ILE A CG1   
1104 C CG2   . ILE A 133 ? 0.4093 0.3340 0.2712 -0.0164 -0.0165 -0.0055 133 ILE A CG2   
1105 C CD1   . ILE A 133 ? 0.3624 0.2818 0.2232 -0.0137 -0.0158 -0.0078 133 ILE A CD1   
1106 N N     . ASP A 134 ? 0.4071 0.3248 0.2494 -0.0267 -0.0116 -0.0076 134 ASP A N     
1107 C CA    . ASP A 134 ? 0.4269 0.3385 0.2625 -0.0304 -0.0143 -0.0055 134 ASP A CA    
1108 C C     . ASP A 134 ? 0.4124 0.3260 0.2546 -0.0276 -0.0172 -0.0033 134 ASP A C     
1109 O O     . ASP A 134 ? 0.4521 0.3597 0.2886 -0.0300 -0.0194 -0.0016 134 ASP A O     
1110 C CB    . ASP A 134 ? 0.4482 0.3589 0.2755 -0.0357 -0.0099 -0.0073 134 ASP A CB    
1111 C CG    . ASP A 134 ? 0.4409 0.3632 0.2759 -0.0346 -0.0041 -0.0102 134 ASP A CG    
1112 O OD1   . ASP A 134 ? 0.5236 0.4528 0.3684 -0.0309 -0.0046 -0.0098 134 ASP A OD1   
1113 O OD2   . ASP A 134 ? 0.4450 0.3699 0.2761 -0.0374 0.0010  -0.0128 134 ASP A OD2   
1114 N N     . ALA A 135 ? 0.3864 0.3074 0.2395 -0.0227 -0.0171 -0.0033 135 ALA A N     
1115 C CA    . ALA A 135 ? 0.3753 0.2982 0.2346 -0.0196 -0.0193 -0.0015 135 ALA A CA    
1116 C C     . ALA A 135 ? 0.3716 0.3016 0.2415 -0.0147 -0.0193 -0.0014 135 ALA A C     
1117 O O     . ALA A 135 ? 0.3445 0.2803 0.2185 -0.0133 -0.0161 -0.0033 135 ALA A O     
1118 C CB    . ALA A 135 ? 0.3171 0.2420 0.1754 -0.0214 -0.0168 -0.0024 135 ALA A CB    
1119 N N     . ILE A 136 ? 0.3689 0.2982 0.2429 -0.0119 -0.0229 0.0009  136 ILE A N     
1120 C CA    . ILE A 136 ? 0.3454 0.2815 0.2291 -0.0077 -0.0226 0.0013  136 ILE A CA    
1121 C C     . ILE A 136 ? 0.3481 0.2844 0.2348 -0.0052 -0.0239 0.0027  136 ILE A C     
1122 O O     . ILE A 136 ? 0.3443 0.2755 0.2284 -0.0050 -0.0273 0.0045  136 ILE A O     
1123 C CB    . ILE A 136 ? 0.3401 0.2763 0.2267 -0.0069 -0.0251 0.0026  136 ILE A CB    
1124 C CG1   . ILE A 136 ? 0.3349 0.2684 0.2163 -0.0094 -0.0238 0.0010  136 ILE A CG1   
1125 C CG2   . ILE A 136 ? 0.2968 0.2398 0.1928 -0.0033 -0.0245 0.0033  136 ILE A CG2   
1126 C CD1   . ILE A 136 ? 0.3552 0.2860 0.2363 -0.0104 -0.0271 0.0023  136 ILE A CD1   
1127 N N     . THR A 137 ? 0.3359 0.2775 0.2275 -0.0030 -0.0214 0.0017  137 THR A N     
1128 C CA    . THR A 137 ? 0.3348 0.2770 0.2299 0.0002  -0.0221 0.0027  137 THR A CA    
1129 C C     . THR A 137 ? 0.3263 0.2754 0.2296 0.0034  -0.0212 0.0032  137 THR A C     
1130 O O     . THR A 137 ? 0.2979 0.2514 0.2035 0.0034  -0.0189 0.0020  137 THR A O     
1131 C CB    . THR A 137 ? 0.3331 0.2740 0.2248 -0.0006 -0.0202 0.0014  137 THR A CB    
1132 O OG1   . THR A 137 ? 0.3433 0.2766 0.2263 -0.0043 -0.0213 0.0014  137 THR A OG1   
1133 C CG2   . THR A 137 ? 0.3349 0.2754 0.2293 0.0032  -0.0206 0.0021  137 THR A CG2   
1134 N N     . HIS A 138 ? 0.3308 0.2810 0.2386 0.0060  -0.0232 0.0050  138 HIS A N     
1135 C CA    . HIS A 138 ? 0.3307 0.2873 0.2460 0.0081  -0.0225 0.0059  138 HIS A CA    
1136 C C     . HIS A 138 ? 0.3383 0.2969 0.2575 0.0119  -0.0221 0.0066  138 HIS A C     
1137 O O     . HIS A 138 ? 0.3567 0.3140 0.2772 0.0136  -0.0245 0.0079  138 HIS A O     
1138 C CB    . HIS A 138 ? 0.3138 0.2711 0.2313 0.0067  -0.0254 0.0075  138 HIS A CB    
1139 C CG    . HIS A 138 ? 0.3169 0.2805 0.2416 0.0077  -0.0250 0.0088  138 HIS A CG    
1140 N ND1   . HIS A 138 ? 0.2995 0.2635 0.2242 0.0055  -0.0249 0.0088  138 HIS A ND1   
1141 C CD2   . HIS A 138 ? 0.2977 0.2671 0.2293 0.0104  -0.0245 0.0100  138 HIS A CD2   
1142 C CE1   . HIS A 138 ? 0.2943 0.2637 0.2251 0.0061  -0.0245 0.0102  138 HIS A CE1   
1143 N NE2   . HIS A 138 ? 0.3145 0.2881 0.2501 0.0089  -0.0241 0.0110  138 HIS A NE2   
1144 N N     . TYR A 139 ? 0.3361 0.2974 0.2566 0.0133  -0.0191 0.0056  139 TYR A N     
1145 C CA    . TYR A 139 ? 0.3150 0.2780 0.2384 0.0170  -0.0177 0.0057  139 TYR A CA    
1146 C C     . TYR A 139 ? 0.3371 0.3077 0.2684 0.0183  -0.0168 0.0072  139 TYR A C     
1147 O O     . TYR A 139 ? 0.3254 0.2990 0.2581 0.0165  -0.0159 0.0073  139 TYR A O     
1148 C CB    . TYR A 139 ? 0.2912 0.2524 0.2104 0.0172  -0.0151 0.0039  139 TYR A CB    
1149 C CG    . TYR A 139 ? 0.2973 0.2598 0.2183 0.0209  -0.0129 0.0037  139 TYR A CG    
1150 C CD1   . TYR A 139 ? 0.3258 0.2941 0.2507 0.0217  -0.0104 0.0039  139 TYR A CD1   
1151 C CD2   . TYR A 139 ? 0.3381 0.2951 0.2561 0.0237  -0.0131 0.0031  139 TYR A CD2   
1152 C CE1   . TYR A 139 ? 0.2978 0.2673 0.2236 0.0249  -0.0077 0.0035  139 TYR A CE1   
1153 C CE2   . TYR A 139 ? 0.3353 0.2929 0.2543 0.0276  -0.0105 0.0025  139 TYR A CE2   
1154 C CZ    . TYR A 139 ? 0.3510 0.3154 0.2742 0.0281  -0.0076 0.0026  139 TYR A CZ    
1155 O OH    . TYR A 139 ? 0.3498 0.3150 0.2733 0.0317  -0.0044 0.0017  139 TYR A OH    
1156 N N     . ASP A 140 ? 0.3223 0.2959 0.2586 0.0216  -0.0171 0.0082  140 ASP A N     
1157 C CA    . ASP A 140 ? 0.3325 0.3147 0.2770 0.0226  -0.0159 0.0096  140 ASP A CA    
1158 C C     . ASP A 140 ? 0.3575 0.3420 0.3034 0.0264  -0.0121 0.0087  140 ASP A C     
1159 O O     . ASP A 140 ? 0.3479 0.3290 0.2923 0.0301  -0.0120 0.0079  140 ASP A O     
1160 C CB    . ASP A 140 ? 0.3257 0.3117 0.2764 0.0234  -0.0194 0.0116  140 ASP A CB    
1161 C CG    . ASP A 140 ? 0.3721 0.3686 0.3322 0.0233  -0.0184 0.0133  140 ASP A CG    
1162 O OD1   . ASP A 140 ? 0.4106 0.4128 0.3761 0.0271  -0.0156 0.0133  140 ASP A OD1   
1163 O OD2   . ASP A 140 ? 0.4053 0.4042 0.3672 0.0192  -0.0201 0.0147  140 ASP A OD2   
1164 N N     . SER A 141 ? 0.3530 0.3420 0.3006 0.0255  -0.0089 0.0087  141 SER A N     
1165 C CA    . SER A 141 ? 0.3830 0.3732 0.3299 0.0284  -0.0047 0.0076  141 SER A CA    
1166 C C     . SER A 141 ? 0.3874 0.3848 0.3423 0.0324  -0.0030 0.0082  141 SER A C     
1167 O O     . SER A 141 ? 0.3876 0.3840 0.3411 0.0363  0.0002  0.0067  141 SER A O     
1168 C CB    . SER A 141 ? 0.3803 0.3725 0.3255 0.0257  -0.0021 0.0078  141 SER A CB    
1169 O OG    . SER A 141 ? 0.4002 0.3998 0.3521 0.0236  -0.0019 0.0099  141 SER A OG    
1170 N N     . ILE A 142 ? 0.3768 0.3819 0.3402 0.0314  -0.0050 0.0104  142 ILE A N     
1171 C CA    . ILE A 142 ? 0.3796 0.3943 0.3530 0.0353  -0.0038 0.0113  142 ILE A CA    
1172 C C     . ILE A 142 ? 0.4024 0.4134 0.3763 0.0406  -0.0064 0.0109  142 ILE A C     
1173 O O     . ILE A 142 ? 0.3973 0.4109 0.3746 0.0463  -0.0038 0.0099  142 ILE A O     
1174 C CB    . ILE A 142 ? 0.3766 0.4017 0.3592 0.0315  -0.0055 0.0140  142 ILE A CB    
1175 C CG1   . ILE A 142 ? 0.3338 0.3620 0.3153 0.0271  -0.0020 0.0145  142 ILE A CG1   
1176 C CG2   . ILE A 142 ? 0.3546 0.3914 0.3494 0.0356  -0.0056 0.0152  142 ILE A CG2   
1177 C CD1   . ILE A 142 ? 0.3831 0.4209 0.3726 0.0225  -0.0031 0.0171  142 ILE A CD1   
1178 N N     . ASP A 143 ? 0.3914 0.3955 0.3612 0.0388  -0.0115 0.0115  143 ASP A N     
1179 C CA    . ASP A 143 ? 0.4238 0.4216 0.3916 0.0432  -0.0146 0.0113  143 ASP A CA    
1180 C C     . ASP A 143 ? 0.4194 0.4051 0.3762 0.0452  -0.0126 0.0087  143 ASP A C     
1181 O O     . ASP A 143 ? 0.3921 0.3719 0.3466 0.0503  -0.0135 0.0081  143 ASP A O     
1182 C CB    . ASP A 143 ? 0.4451 0.4388 0.4107 0.0399  -0.0206 0.0130  143 ASP A CB    
1183 C CG    . ASP A 143 ? 0.4818 0.4864 0.4576 0.0378  -0.0236 0.0157  143 ASP A CG    
1184 O OD1   . ASP A 143 ? 0.4981 0.5145 0.4844 0.0402  -0.0215 0.0165  143 ASP A OD1   
1185 O OD2   . ASP A 143 ? 0.4838 0.4853 0.4567 0.0335  -0.0280 0.0169  143 ASP A OD2   
1186 N N     . ASP A 144 ? 0.4071 0.3888 0.3568 0.0412  -0.0103 0.0073  144 ASP A N     
1187 C CA    . ASP A 144 ? 0.3899 0.3602 0.3283 0.0411  -0.0091 0.0049  144 ASP A CA    
1188 C C     . ASP A 144 ? 0.3784 0.3388 0.3101 0.0401  -0.0136 0.0052  144 ASP A C     
1189 O O     . ASP A 144 ? 0.4102 0.3610 0.3351 0.0428  -0.0139 0.0040  144 ASP A O     
1190 C CB    . ASP A 144 ? 0.4272 0.3956 0.3643 0.0467  -0.0051 0.0030  144 ASP A CB    
1191 C CG    . ASP A 144 ? 0.4433 0.3999 0.3677 0.0455  -0.0037 0.0005  144 ASP A CG    
1192 O OD1   . ASP A 144 ? 0.4700 0.4241 0.3891 0.0401  -0.0044 0.0001  144 ASP A OD1   
1193 O OD2   . ASP A 144 ? 0.5122 0.4622 0.4321 0.0502  -0.0018 -0.0013 144 ASP A OD2   
1194 N N     . ARG A 145 ? 0.3624 0.3241 0.2951 0.0359  -0.0169 0.0067  145 ARG A N     
1195 C CA    . ARG A 145 ? 0.3552 0.3080 0.2812 0.0341  -0.0211 0.0072  145 ARG A CA    
1196 C C     . ARG A 145 ? 0.3563 0.3075 0.2777 0.0277  -0.0219 0.0070  145 ARG A C     
1197 O O     . ARG A 145 ? 0.3299 0.2882 0.2560 0.0253  -0.0209 0.0074  145 ARG A O     
1198 C CB    . ARG A 145 ? 0.3628 0.3184 0.2948 0.0366  -0.0254 0.0097  145 ARG A CB    
1199 C CG    . ARG A 145 ? 0.3946 0.3521 0.3321 0.0441  -0.0253 0.0100  145 ARG A CG    
1200 C CD    . ARG A 145 ? 0.3907 0.3343 0.3180 0.0473  -0.0260 0.0088  145 ARG A CD    
1201 N NE    . ARG A 145 ? 0.4378 0.3821 0.3700 0.0555  -0.0260 0.0090  145 ARG A NE    
1202 C CZ    . ARG A 145 ? 0.4805 0.4264 0.4143 0.0604  -0.0212 0.0069  145 ARG A CZ    
1203 N NH1   . ARG A 145 ? 0.4301 0.3766 0.3605 0.0573  -0.0164 0.0048  145 ARG A NH1   
1204 N NH2   . ARG A 145 ? 0.4980 0.4447 0.4366 0.0687  -0.0211 0.0070  145 ARG A NH2   
1205 N N     . PHE A 146 ? 0.3322 0.2738 0.2441 0.0250  -0.0233 0.0063  146 PHE A N     
1206 C CA    . PHE A 146 ? 0.3529 0.2930 0.2603 0.0193  -0.0241 0.0060  146 PHE A CA    
1207 C C     . PHE A 146 ? 0.3635 0.3006 0.2697 0.0180  -0.0284 0.0079  146 PHE A C     
1208 O O     . PHE A 146 ? 0.3628 0.2915 0.2632 0.0189  -0.0311 0.0087  146 PHE A O     
1209 C CB    . PHE A 146 ? 0.3636 0.2960 0.2613 0.0160  -0.0229 0.0042  146 PHE A CB    
1210 C CG    . PHE A 146 ? 0.3844 0.3189 0.2819 0.0164  -0.0194 0.0024  146 PHE A CG    
1211 C CD1   . PHE A 146 ? 0.3522 0.2831 0.2482 0.0204  -0.0182 0.0017  146 PHE A CD1   
1212 C CD2   . PHE A 146 ? 0.3930 0.3327 0.2911 0.0131  -0.0175 0.0013  146 PHE A CD2   
1213 C CE1   . PHE A 146 ? 0.3833 0.3152 0.2776 0.0203  -0.0153 -0.0001 146 PHE A CE1   
1214 C CE2   . PHE A 146 ? 0.3871 0.3286 0.2845 0.0133  -0.0150 -0.0001 146 PHE A CE2   
1215 C CZ    . PHE A 146 ? 0.3921 0.3293 0.2870 0.0165  -0.0139 -0.0008 146 PHE A CZ    
1216 N N     . TYR A 147 ? 0.3418 0.2846 0.2523 0.0158  -0.0293 0.0088  147 TYR A N     
1217 C CA    . TYR A 147 ? 0.3584 0.2980 0.2664 0.0137  -0.0335 0.0105  147 TYR A CA    
1218 C C     . TYR A 147 ? 0.3719 0.3062 0.2711 0.0082  -0.0329 0.0092  147 TYR A C     
1219 O O     . TYR A 147 ? 0.3634 0.3019 0.2639 0.0059  -0.0303 0.0079  147 TYR A O     
1220 C CB    . TYR A 147 ? 0.3684 0.3162 0.2849 0.0139  -0.0352 0.0122  147 TYR A CB    
1221 C CG    . TYR A 147 ? 0.3925 0.3476 0.3189 0.0190  -0.0357 0.0135  147 TYR A CG    
1222 C CD1   . TYR A 147 ? 0.3936 0.3567 0.3270 0.0209  -0.0317 0.0128  147 TYR A CD1   
1223 C CD2   . TYR A 147 ? 0.3517 0.3060 0.2804 0.0221  -0.0401 0.0156  147 TYR A CD2   
1224 C CE1   . TYR A 147 ? 0.3901 0.3610 0.3330 0.0255  -0.0313 0.0139  147 TYR A CE1   
1225 C CE2   . TYR A 147 ? 0.4140 0.3766 0.3530 0.0273  -0.0402 0.0168  147 TYR A CE2   
1226 C CZ    . TYR A 147 ? 0.4427 0.4140 0.3889 0.0289  -0.0354 0.0157  147 TYR A CZ    
1227 O OH    . TYR A 147 ? 0.4207 0.4013 0.3774 0.0340  -0.0347 0.0167  147 TYR A OH    
1228 N N     . VAL A 148 ? 0.3691 0.2940 0.2593 0.0063  -0.0351 0.0096  148 VAL A N     
1229 C CA    . VAL A 148 ? 0.3463 0.2660 0.2273 0.0007  -0.0339 0.0084  148 VAL A CA    
1230 C C     . VAL A 148 ? 0.3651 0.2810 0.2416 -0.0023 -0.0375 0.0098  148 VAL A C     
1231 O O     . VAL A 148 ? 0.3432 0.2539 0.2173 -0.0011 -0.0421 0.0121  148 VAL A O     
1232 C CB    . VAL A 148 ? 0.3470 0.2579 0.2187 -0.0010 -0.0333 0.0077  148 VAL A CB    
1233 C CG1   . VAL A 148 ? 0.3364 0.2447 0.2001 -0.0074 -0.0310 0.0061  148 VAL A CG1   
1234 C CG2   . VAL A 148 ? 0.3242 0.2377 0.1995 0.0020  -0.0305 0.0063  148 VAL A CG2   
1235 N N     . PHE A 149 ? 0.3733 0.2914 0.2482 -0.0059 -0.0355 0.0084  149 PHE A N     
1236 C CA    . PHE A 149 ? 0.3856 0.2990 0.2543 -0.0095 -0.0383 0.0093  149 PHE A CA    
1237 C C     . PHE A 149 ? 0.4117 0.3196 0.2699 -0.0145 -0.0354 0.0074  149 PHE A C     
1238 O O     . PHE A 149 ? 0.4500 0.3626 0.3096 -0.0157 -0.0307 0.0049  149 PHE A O     
1239 C CB    . PHE A 149 ? 0.3862 0.3057 0.2606 -0.0096 -0.0380 0.0089  149 PHE A CB    
1240 C CG    . PHE A 149 ? 0.3669 0.2932 0.2521 -0.0056 -0.0405 0.0109  149 PHE A CG    
1241 C CD1   . PHE A 149 ? 0.3678 0.3013 0.2618 -0.0017 -0.0377 0.0105  149 PHE A CD1   
1242 C CD2   . PHE A 149 ? 0.3873 0.3135 0.2737 -0.0064 -0.0456 0.0132  149 PHE A CD2   
1243 C CE1   . PHE A 149 ? 0.3605 0.3012 0.2644 0.0015  -0.0393 0.0122  149 PHE A CE1   
1244 C CE2   . PHE A 149 ? 0.3727 0.3072 0.2702 -0.0033 -0.0476 0.0151  149 PHE A CE2   
1245 C CZ    . PHE A 149 ? 0.4025 0.3443 0.3087 0.0006  -0.0441 0.0145  149 PHE A CZ    
1246 N N     . ASP A 150 ? 0.4220 0.3201 0.2698 -0.0176 -0.0382 0.0087  150 ASP A N     
1247 C CA    . ASP A 150 ? 0.4425 0.3349 0.2795 -0.0230 -0.0353 0.0072  150 ASP A CA    
1248 C C     . ASP A 150 ? 0.4333 0.3182 0.2594 -0.0279 -0.0371 0.0077  150 ASP A C     
1249 O O     . ASP A 150 ? 0.4447 0.3222 0.2657 -0.0280 -0.0428 0.0104  150 ASP A O     
1250 C CB    . ASP A 150 ? 0.4295 0.3146 0.2609 -0.0233 -0.0365 0.0082  150 ASP A CB    
1251 C CG    . ASP A 150 ? 0.5231 0.4028 0.3433 -0.0299 -0.0332 0.0069  150 ASP A CG    
1252 O OD1   . ASP A 150 ? 0.4864 0.3706 0.3053 -0.0335 -0.0290 0.0046  150 ASP A OD1   
1253 O OD2   . ASP A 150 ? 0.5465 0.4173 0.3591 -0.0315 -0.0348 0.0080  150 ASP A OD2   
1254 N N     . LEU A 151 ? 0.4145 0.3015 0.2370 -0.0315 -0.0324 0.0050  151 LEU A N     
1255 C CA    . LEU A 151 ? 0.4307 0.3101 0.2412 -0.0366 -0.0330 0.0048  151 LEU A CA    
1256 C C     . LEU A 151 ? 0.4543 0.3248 0.2515 -0.0424 -0.0320 0.0050  151 LEU A C     
1257 O O     . LEU A 151 ? 0.4509 0.3250 0.2474 -0.0448 -0.0266 0.0029  151 LEU A O     
1258 C CB    . LEU A 151 ? 0.4165 0.3015 0.2286 -0.0373 -0.0279 0.0014  151 LEU A CB    
1259 C CG    . LEU A 151 ? 0.4028 0.2799 0.2021 -0.0423 -0.0275 0.0005  151 LEU A CG    
1260 C CD1   . LEU A 151 ? 0.4057 0.2750 0.2003 -0.0428 -0.0351 0.0037  151 LEU A CD1   
1261 C CD2   . LEU A 151 ? 0.4232 0.3057 0.2252 -0.0414 -0.0222 -0.0031 151 LEU A CD2   
1262 N N     . LEU A 152 ? 0.5020 0.3609 0.2881 -0.0450 -0.0374 0.0078  152 LEU A N     
1263 C CA    . LEU A 152 ? 0.5338 0.3818 0.3050 -0.0511 -0.0373 0.0087  152 LEU A CA    
1264 C C     . LEU A 152 ? 0.5272 0.3712 0.2862 -0.0579 -0.0334 0.0067  152 LEU A C     
1265 O O     . LEU A 152 ? 0.4928 0.3324 0.2417 -0.0638 -0.0299 0.0060  152 LEU A O     
1266 C CB    . LEU A 152 ? 0.5310 0.3668 0.2950 -0.0504 -0.0455 0.0130  152 LEU A CB    
1267 C CG    . LEU A 152 ? 0.5375 0.3744 0.3105 -0.0438 -0.0492 0.0150  152 LEU A CG    
1268 C CD1   . LEU A 152 ? 0.5995 0.4210 0.3601 -0.0448 -0.0556 0.0187  152 LEU A CD1   
1269 C CD2   . LEU A 152 ? 0.5479 0.3917 0.3278 -0.0428 -0.0435 0.0127  152 LEU A CD2   
1270 N N     . ASN A 153 ? 0.5262 0.3715 0.2854 -0.0574 -0.0339 0.0058  153 ASN A N     
1271 C CA    . ASN A 153 ? 0.5730 0.4131 0.3193 -0.0633 -0.0305 0.0038  153 ASN A CA    
1272 C C     . ASN A 153 ? 0.5757 0.4253 0.3294 -0.0611 -0.0247 -0.0003 153 ASN A C     
1273 O O     . ASN A 153 ? 0.5682 0.4219 0.3309 -0.0564 -0.0273 -0.0002 153 ASN A O     
1274 C CB    . ASN A 153 ? 0.6016 0.4286 0.3350 -0.0662 -0.0377 0.0067  153 ASN A CB    
1275 C CG    . ASN A 153 ? 0.6719 0.4878 0.3967 -0.0678 -0.0441 0.0110  153 ASN A CG    
1276 O OD1   . ASN A 153 ? 0.7279 0.5404 0.4470 -0.0711 -0.0413 0.0111  153 ASN A OD1   
1277 N ND2   . ASN A 153 ? 0.7216 0.5317 0.4455 -0.0656 -0.0529 0.0147  153 ASN A ND2   
1278 N N     . SER A 154 ? 0.5835 0.4365 0.3331 -0.0645 -0.0168 -0.0038 154 SER A N     
1279 C CA    . SER A 154 ? 0.5727 0.4350 0.3294 -0.0617 -0.0104 -0.0081 154 SER A CA    
1280 C C     . SER A 154 ? 0.5804 0.4397 0.3245 -0.0674 -0.0037 -0.0113 154 SER A C     
1281 O O     . SER A 154 ? 0.5985 0.4520 0.3314 -0.0737 -0.0027 -0.0104 154 SER A O     
1282 C CB    . SER A 154 ? 0.5626 0.4389 0.3351 -0.0572 -0.0065 -0.0094 154 SER A CB    
1283 O OG    . SER A 154 ? 0.5589 0.4445 0.3361 -0.0557 0.0010  -0.0137 154 SER A OG    
1284 N N     . PRO A 155 ? 0.6081 0.4707 0.3531 -0.0653 0.0013  -0.0152 155 PRO A N     
1285 C CA    . PRO A 155 ? 0.6254 0.4882 0.3608 -0.0697 0.0095  -0.0191 155 PRO A CA    
1286 C C     . PRO A 155 ? 0.6320 0.5073 0.3745 -0.0710 0.0164  -0.0208 155 PRO A C     
1287 O O     . PRO A 155 ? 0.6689 0.5448 0.4027 -0.0761 0.0231  -0.0233 155 PRO A O     
1288 C CB    . PRO A 155 ? 0.6173 0.4821 0.3555 -0.0649 0.0131  -0.0230 155 PRO A CB    
1289 C CG    . PRO A 155 ? 0.6033 0.4732 0.3565 -0.0578 0.0081  -0.0213 155 PRO A CG    
1290 C CD    . PRO A 155 ? 0.6015 0.4656 0.3540 -0.0595 -0.0006 -0.0161 155 PRO A CD    
1291 N N     . TYR A 156 ? 0.6187 0.5039 0.3761 -0.0668 0.0148  -0.0195 156 TYR A N     
1292 C CA    . TYR A 156 ? 0.6271 0.5245 0.3917 -0.0686 0.0203  -0.0208 156 TYR A CA    
1293 C C     . TYR A 156 ? 0.6390 0.5315 0.3986 -0.0741 0.0167  -0.0172 156 TYR A C     
1294 O O     . TYR A 156 ? 0.6377 0.5395 0.4031 -0.0763 0.0200  -0.0177 156 TYR A O     
1295 C CB    . TYR A 156 ? 0.5925 0.5051 0.3762 -0.0608 0.0221  -0.0224 156 TYR A CB    
1296 C CG    . TYR A 156 ? 0.6121 0.5284 0.3998 -0.0551 0.0258  -0.0260 156 TYR A CG    
1297 C CD1   . TYR A 156 ? 0.6454 0.5605 0.4242 -0.0575 0.0325  -0.0297 156 TYR A CD1   
1298 C CD2   . TYR A 156 ? 0.5840 0.5037 0.3831 -0.0473 0.0228  -0.0258 156 TYR A CD2   
1299 C CE1   . TYR A 156 ? 0.6598 0.5762 0.4408 -0.0517 0.0359  -0.0333 156 TYR A CE1   
1300 C CE2   . TYR A 156 ? 0.6108 0.5316 0.4120 -0.0420 0.0259  -0.0290 156 TYR A CE2   
1301 C CZ    . TYR A 156 ? 0.6442 0.5629 0.4363 -0.0440 0.0324  -0.0328 156 TYR A CZ    
1302 O OH    . TYR A 156 ? 0.6890 0.6071 0.4820 -0.0384 0.0355  -0.0363 156 TYR A OH    
1303 N N     . GLY A 157 ? 0.6444 0.5218 0.3928 -0.0765 0.0097  -0.0135 157 GLY A N     
1304 C CA    . GLY A 157 ? 0.6482 0.5172 0.3886 -0.0818 0.0059  -0.0100 157 GLY A CA    
1305 C C     . GLY A 157 ? 0.6440 0.5013 0.3818 -0.0791 -0.0038 -0.0056 157 GLY A C     
1306 O O     . GLY A 157 ? 0.6420 0.5030 0.3912 -0.0719 -0.0077 -0.0049 157 GLY A O     
1307 N N     . ASN A 158 ? 0.6400 0.4830 0.3624 -0.0849 -0.0077 -0.0025 158 ASN A N     
1308 C CA    . ASN A 158 ? 0.6301 0.4620 0.3498 -0.0824 -0.0170 0.0020  158 ASN A CA    
1309 C C     . ASN A 158 ? 0.6277 0.4586 0.3496 -0.0828 -0.0182 0.0037  158 ASN A C     
1310 O O     . ASN A 158 ? 0.6260 0.4549 0.3397 -0.0899 -0.0142 0.0032  158 ASN A O     
1311 C CB    . ASN A 158 ? 0.6467 0.4615 0.3470 -0.0878 -0.0217 0.0047  158 ASN A CB    
1312 C CG    . ASN A 158 ? 0.6818 0.4956 0.3781 -0.0878 -0.0213 0.0031  158 ASN A CG    
1313 O OD1   . ASN A 158 ? 0.6650 0.4872 0.3737 -0.0816 -0.0216 0.0016  158 ASN A OD1   
1314 N ND2   . ASN A 158 ? 0.7036 0.5057 0.3811 -0.0951 -0.0208 0.0034  158 ASN A ND2   
1315 N N     . VAL A 159 ? 0.6039 0.4360 0.3363 -0.0757 -0.0234 0.0056  159 VAL A N     
1316 C CA    . VAL A 159 ? 0.6152 0.4471 0.3512 -0.0747 -0.0242 0.0066  159 VAL A CA    
1317 C C     . VAL A 159 ? 0.6195 0.4388 0.3520 -0.0708 -0.0327 0.0107  159 VAL A C     
1318 O O     . VAL A 159 ? 0.6135 0.4279 0.3449 -0.0674 -0.0384 0.0128  159 VAL A O     
1319 C CB    . VAL A 159 ? 0.5942 0.4430 0.3490 -0.0691 -0.0203 0.0039  159 VAL A CB    
1320 C CG1   . VAL A 159 ? 0.6166 0.4781 0.3751 -0.0727 -0.0121 0.0000  159 VAL A CG1   
1321 C CG2   . VAL A 159 ? 0.6032 0.4578 0.3705 -0.0606 -0.0236 0.0042  159 VAL A CG2   
1322 N N     . GLU A 160 ? 0.6301 0.4444 0.3606 -0.0713 -0.0336 0.0117  160 GLU A N     
1323 C CA    . GLU A 160 ? 0.6357 0.4389 0.3645 -0.0660 -0.0408 0.0150  160 GLU A CA    
1324 C C     . GLU A 160 ? 0.5954 0.4098 0.3424 -0.0564 -0.0417 0.0143  160 GLU A C     
1325 O O     . GLU A 160 ? 0.5627 0.3917 0.3219 -0.0549 -0.0365 0.0113  160 GLU A O     
1326 C CB    . GLU A 160 ? 0.6703 0.4602 0.3861 -0.0712 -0.0414 0.0163  160 GLU A CB    
1327 C CG    . GLU A 160 ? 0.8086 0.5843 0.5040 -0.0809 -0.0416 0.0179  160 GLU A CG    
1328 C CD    . GLU A 160 ? 0.8897 0.6521 0.5753 -0.0791 -0.0492 0.0216  160 GLU A CD    
1329 O OE1   . GLU A 160 ? 0.9482 0.6990 0.6307 -0.0740 -0.0562 0.0247  160 GLU A OE1   
1330 O OE2   . GLU A 160 ? 0.9177 0.6812 0.5984 -0.0826 -0.0484 0.0213  160 GLU A OE2   
1331 N N     . GLU A 161 ? 0.5848 0.3923 0.3334 -0.0498 -0.0482 0.0171  161 GLU A N     
1332 C CA    . GLU A 161 ? 0.5660 0.3833 0.3307 -0.0409 -0.0489 0.0166  161 GLU A CA    
1333 C C     . GLU A 161 ? 0.5546 0.3752 0.3228 -0.0410 -0.0446 0.0144  161 GLU A C     
1334 O O     . GLU A 161 ? 0.5328 0.3435 0.2895 -0.0465 -0.0437 0.0145  161 GLU A O     
1335 C CB    . GLU A 161 ? 0.5931 0.4020 0.3580 -0.0338 -0.0564 0.0200  161 GLU A CB    
1336 C CG    . GLU A 161 ? 0.5961 0.4076 0.3644 -0.0313 -0.0613 0.0220  161 GLU A CG    
1337 C CD    . GLU A 161 ? 0.6584 0.4640 0.4290 -0.0237 -0.0690 0.0255  161 GLU A CD    
1338 O OE1   . GLU A 161 ? 0.6597 0.4653 0.4364 -0.0174 -0.0692 0.0254  161 GLU A OE1   
1339 O OE2   . GLU A 161 ? 0.7438 0.5450 0.5103 -0.0239 -0.0749 0.0283  161 GLU A OE2   
1340 N N     . TRP A 162 ? 0.5348 0.3690 0.3183 -0.0354 -0.0421 0.0126  162 TRP A N     
1341 C CA    . TRP A 162 ? 0.5175 0.3551 0.3053 -0.0343 -0.0390 0.0107  162 TRP A CA    
1342 C C     . TRP A 162 ? 0.5260 0.3507 0.3087 -0.0298 -0.0433 0.0126  162 TRP A C     
1343 O O     . TRP A 162 ? 0.5224 0.3432 0.3071 -0.0237 -0.0481 0.0148  162 TRP A O     
1344 C CB    . TRP A 162 ? 0.4862 0.3402 0.2907 -0.0289 -0.0362 0.0088  162 TRP A CB    
1345 C CG    . TRP A 162 ? 0.4627 0.3211 0.2730 -0.0263 -0.0337 0.0071  162 TRP A CG    
1346 C CD1   . TRP A 162 ? 0.4515 0.3150 0.2618 -0.0309 -0.0294 0.0048  162 TRP A CD1   
1347 C CD2   . TRP A 162 ? 0.4493 0.3083 0.2668 -0.0185 -0.0353 0.0075  162 TRP A CD2   
1348 N NE1   . TRP A 162 ? 0.4303 0.2964 0.2461 -0.0267 -0.0286 0.0038  162 TRP A NE1   
1349 C CE2   . TRP A 162 ? 0.4295 0.2926 0.2494 -0.0191 -0.0318 0.0053  162 TRP A CE2   
1350 C CE3   . TRP A 162 ? 0.4401 0.2971 0.2622 -0.0112 -0.0392 0.0095  162 TRP A CE3   
1351 C CZ2   . TRP A 162 ? 0.4416 0.3054 0.2669 -0.0127 -0.0318 0.0048  162 TRP A CZ2   
1352 C CZ3   . TRP A 162 ? 0.4439 0.3033 0.2729 -0.0045 -0.0388 0.0089  162 TRP A CZ3   
1353 C CH2   . TRP A 162 ? 0.4462 0.3083 0.2761 -0.0053 -0.0349 0.0065  162 TRP A CH2   
1354 N N     . SER A 163 ? 0.5388 0.3566 0.3145 -0.0329 -0.0416 0.0116  163 SER A N     
1355 C CA    . SER A 163 ? 0.5524 0.3559 0.3214 -0.0286 -0.0451 0.0128  163 SER A CA    
1356 C C     . SER A 163 ? 0.5508 0.3612 0.3292 -0.0234 -0.0425 0.0105  163 SER A C     
1357 O O     . SER A 163 ? 0.5626 0.3773 0.3407 -0.0283 -0.0385 0.0083  163 SER A O     
1358 C CB    . SER A 163 ? 0.5555 0.3417 0.3058 -0.0367 -0.0459 0.0135  163 SER A CB    
1359 O OG    . SER A 163 ? 0.5964 0.3691 0.3403 -0.0328 -0.0480 0.0138  163 SER A OG    
1360 N N     . ILE A 164 ? 0.5437 0.3555 0.3303 -0.0138 -0.0447 0.0112  164 ILE A N     
1361 C CA    . ILE A 164 ? 0.5659 0.3823 0.3599 -0.0083 -0.0423 0.0092  164 ILE A CA    
1362 C C     . ILE A 164 ? 0.5746 0.3752 0.3552 -0.0105 -0.0422 0.0083  164 ILE A C     
1363 O O     . ILE A 164 ? 0.5961 0.4001 0.3791 -0.0103 -0.0390 0.0059  164 ILE A O     
1364 C CB    . ILE A 164 ? 0.5602 0.3820 0.3660 0.0026  -0.0443 0.0102  164 ILE A CB    
1365 C CG1   . ILE A 164 ? 0.5626 0.3922 0.3770 0.0076  -0.0405 0.0078  164 ILE A CG1   
1366 C CG2   . ILE A 164 ? 0.5902 0.3964 0.3880 0.0078  -0.0499 0.0127  164 ILE A CG2   
1367 C CD1   . ILE A 164 ? 0.5351 0.3775 0.3650 0.0161  -0.0405 0.0083  164 ILE A CD1   
1368 N N     . GLU A 165 ? 0.5803 0.3627 0.3459 -0.0131 -0.0459 0.0102  165 GLU A N     
1369 C CA    . GLU A 165 ? 0.6023 0.3667 0.3527 -0.0160 -0.0463 0.0095  165 GLU A CA    
1370 C C     . GLU A 165 ? 0.5699 0.3379 0.3155 -0.0270 -0.0423 0.0075  165 GLU A C     
1371 O O     . GLU A 165 ? 0.5876 0.3519 0.3295 -0.0284 -0.0405 0.0054  165 GLU A O     
1372 C CB    . GLU A 165 ? 0.6568 0.3995 0.3907 -0.0170 -0.0517 0.0125  165 GLU A CB    
1373 C CG    . GLU A 165 ? 0.7575 0.4950 0.4950 -0.0057 -0.0567 0.0148  165 GLU A CG    
1374 C CD    . GLU A 165 ? 0.8315 0.5814 0.5792 -0.0041 -0.0589 0.0170  165 GLU A CD    
1375 O OE1   . GLU A 165 ? 0.8478 0.6087 0.5984 -0.0116 -0.0563 0.0166  165 GLU A OE1   
1376 O OE2   . GLU A 165 ? 0.8524 0.6012 0.6052 0.0048  -0.0633 0.0191  165 GLU A OE2   
1377 N N     . ILE A 166 ? 0.5718 0.3472 0.3173 -0.0349 -0.0410 0.0080  166 ILE A N     
1378 C CA    . ILE A 166 ? 0.5775 0.3592 0.3204 -0.0453 -0.0370 0.0061  166 ILE A CA    
1379 C C     . ILE A 166 ? 0.5267 0.3283 0.2854 -0.0430 -0.0330 0.0035  166 ILE A C     
1380 O O     . ILE A 166 ? 0.5328 0.3374 0.2901 -0.0483 -0.0306 0.0015  166 ILE A O     
1381 C CB    . ILE A 166 ? 0.5841 0.3684 0.3222 -0.0542 -0.0360 0.0072  166 ILE A CB    
1382 C CG1   . ILE A 166 ? 0.5837 0.3458 0.3032 -0.0577 -0.0402 0.0100  166 ILE A CG1   
1383 C CG2   . ILE A 166 ? 0.5837 0.3783 0.3222 -0.0642 -0.0314 0.0050  166 ILE A CG2   
1384 C CD1   . ILE A 166 ? 0.5873 0.3504 0.3008 -0.0657 -0.0395 0.0113  166 ILE A CD1   
1385 N N     . ALA A 167 ? 0.4777 0.2923 0.2509 -0.0354 -0.0326 0.0035  167 ALA A N     
1386 C CA    . ALA A 167 ? 0.4719 0.3039 0.2595 -0.0324 -0.0293 0.0014  167 ALA A CA    
1387 C C     . ALA A 167 ? 0.4755 0.3029 0.2615 -0.0293 -0.0288 -0.0002 167 ALA A C     
1388 O O     . ALA A 167 ? 0.4679 0.3052 0.2589 -0.0317 -0.0262 -0.0021 167 ALA A O     
1389 C CB    . ALA A 167 ? 0.4346 0.2780 0.2358 -0.0247 -0.0296 0.0022  167 ALA A CB    
1390 N N     . ALA A 168 ? 0.4987 0.3107 0.2773 -0.0240 -0.0315 0.0006  168 ALA A N     
1391 C CA    . ALA A 168 ? 0.5432 0.3486 0.3187 -0.0202 -0.0309 -0.0012 168 ALA A CA    
1392 C C     . ALA A 168 ? 0.5596 0.3534 0.3208 -0.0289 -0.0306 -0.0025 168 ALA A C     
1393 O O     . ALA A 168 ? 0.5880 0.3809 0.3477 -0.0286 -0.0292 -0.0046 168 ALA A O     
1394 C CB    . ALA A 168 ? 0.5837 0.3767 0.3566 -0.0104 -0.0335 -0.0002 168 ALA A CB    
1395 N N     . LYS A 169 ? 0.5607 0.3456 0.3107 -0.0373 -0.0320 -0.0012 169 LYS A N     
1396 C CA    . LYS A 169 ? 0.5792 0.3519 0.3142 -0.0471 -0.0321 -0.0021 169 LYS A CA    
1397 C C     . LYS A 169 ? 0.5585 0.3473 0.2998 -0.0544 -0.0290 -0.0041 169 LYS A C     
1398 O O     . LYS A 169 ? 0.5176 0.3265 0.2734 -0.0541 -0.0268 -0.0043 169 LYS A O     
1399 C CB    . LYS A 169 ? 0.6057 0.3658 0.3271 -0.0551 -0.0342 0.0001  169 LYS A CB    
1400 C CG    . LYS A 169 ? 0.6735 0.4126 0.3838 -0.0493 -0.0384 0.0023  169 LYS A CG    
1401 C CD    . LYS A 169 ? 0.7736 0.4965 0.4662 -0.0593 -0.0405 0.0044  169 LYS A CD    
1402 C CE    . LYS A 169 ? 0.8669 0.5722 0.5507 -0.0531 -0.0453 0.0074  169 LYS A CE    
1403 N NZ    . LYS A 169 ? 0.9052 0.5934 0.5828 -0.0435 -0.0480 0.0070  169 LYS A NZ    
1404 N N     . LEU A 170 ? 0.5766 0.3560 0.3067 -0.0612 -0.0292 -0.0055 170 LEU A N     
1405 C CA    . LEU A 170 ? 0.5844 0.3777 0.3189 -0.0693 -0.0272 -0.0072 170 LEU A CA    
1406 C C     . LEU A 170 ? 0.5855 0.3912 0.3233 -0.0788 -0.0256 -0.0063 170 LEU A C     
1407 O O     . LEU A 170 ? 0.6070 0.4032 0.3362 -0.0826 -0.0265 -0.0046 170 LEU A O     
1408 C CB    . LEU A 170 ? 0.6094 0.3868 0.3282 -0.0759 -0.0285 -0.0085 170 LEU A CB    
1409 C CG    . LEU A 170 ? 0.6509 0.4095 0.3602 -0.0681 -0.0300 -0.0097 170 LEU A CG    
1410 C CD1   . LEU A 170 ? 0.6998 0.4381 0.3889 -0.0772 -0.0318 -0.0107 170 LEU A CD1   
1411 C CD2   . LEU A 170 ? 0.6104 0.3820 0.3323 -0.0601 -0.0282 -0.0115 170 LEU A CD2   
1412 N N     . GLN A 171 ? 0.5668 0.3931 0.3165 -0.0824 -0.0233 -0.0076 171 GLN A N     
1413 C CA    . GLN A 171 ? 0.6050 0.4447 0.3584 -0.0916 -0.0211 -0.0073 171 GLN A CA    
1414 C C     . GLN A 171 ? 0.6113 0.4377 0.3480 -0.1043 -0.0219 -0.0068 171 GLN A C     
1415 O O     . GLN A 171 ? 0.6158 0.4462 0.3507 -0.1114 -0.0203 -0.0058 171 GLN A O     
1416 C CB    . GLN A 171 ? 0.5993 0.4634 0.3685 -0.0928 -0.0190 -0.0089 171 GLN A CB    
1417 C CG    . GLN A 171 ? 0.7102 0.5896 0.4961 -0.0824 -0.0175 -0.0090 171 GLN A CG    
1418 C CD    . GLN A 171 ? 0.7859 0.6892 0.5862 -0.0850 -0.0146 -0.0098 171 GLN A CD    
1419 O OE1   . GLN A 171 ? 0.8253 0.7344 0.6247 -0.0926 -0.0126 -0.0097 171 GLN A OE1   
1420 N NE2   . GLN A 171 ? 0.7916 0.7085 0.6048 -0.0785 -0.0143 -0.0107 171 GLN A NE2   
1421 N N     . GLU A 172 ? 0.6014 0.4111 0.3248 -0.1071 -0.0244 -0.0073 172 GLU A N     
1422 C CA    . GLU A 172 ? 0.6213 0.4151 0.3264 -0.1196 -0.0256 -0.0068 172 GLU A CA    
1423 C C     . GLU A 172 ? 0.6438 0.4143 0.3333 -0.1191 -0.0276 -0.0045 172 GLU A C     
1424 O O     . GLU A 172 ? 0.6286 0.3850 0.3019 -0.1299 -0.0285 -0.0035 172 GLU A O     
1425 C CB    . GLU A 172 ? 0.6601 0.4424 0.3552 -0.1227 -0.0278 -0.0084 172 GLU A CB    
1426 C CG    . GLU A 172 ? 0.6600 0.4641 0.3673 -0.1267 -0.0267 -0.0102 172 GLU A CG    
1427 C CD    . GLU A 172 ? 0.7450 0.5613 0.4674 -0.1143 -0.0262 -0.0114 172 GLU A CD    
1428 O OE1   . GLU A 172 ? 0.7656 0.6014 0.4998 -0.1162 -0.0255 -0.0125 172 GLU A OE1   
1429 O OE2   . GLU A 172 ? 0.7464 0.5532 0.4688 -0.1029 -0.0266 -0.0112 172 GLU A OE2   
1430 N N     . GLN A 173 ? 0.6438 0.4103 0.3378 -0.1068 -0.0286 -0.0036 173 GLN A N     
1431 C CA    . GLN A 173 ? 0.6596 0.4065 0.3411 -0.1049 -0.0310 -0.0011 173 GLN A CA    
1432 C C     . GLN A 173 ? 0.6384 0.3985 0.3287 -0.1047 -0.0292 0.0003  173 GLN A C     
1433 O O     . GLN A 173 ? 0.6544 0.4012 0.3362 -0.1029 -0.0314 0.0026  173 GLN A O     
1434 C CB    . GLN A 173 ? 0.6695 0.4024 0.3495 -0.0913 -0.0339 -0.0009 173 GLN A CB    
1435 C CG    . GLN A 173 ? 0.7038 0.4180 0.3711 -0.0903 -0.0358 -0.0023 173 GLN A CG    
1436 C CD    . GLN A 173 ? 0.7528 0.4572 0.4219 -0.0755 -0.0376 -0.0024 173 GLN A CD    
1437 O OE1   . GLN A 173 ? 0.7678 0.4871 0.4524 -0.0667 -0.0359 -0.0038 173 GLN A OE1   
1438 N NE2   . GLN A 173 ? 0.7608 0.4401 0.4140 -0.0726 -0.0412 -0.0008 173 GLN A NE2   
1439 N N     . GLY A 174 ? 0.6076 0.3932 0.3144 -0.1063 -0.0254 -0.0011 174 GLY A N     
1440 C CA    . GLY A 174 ? 0.5986 0.3978 0.3143 -0.1058 -0.0230 -0.0003 174 GLY A CA    
1441 C C     . GLY A 174 ? 0.5975 0.4052 0.3275 -0.0925 -0.0234 -0.0004 174 GLY A C     
1442 O O     . GLY A 174 ? 0.5588 0.3744 0.2948 -0.0905 -0.0222 0.0004  174 GLY A O     
1443 N N     . GLY A 175 ? 0.5865 0.3920 0.3210 -0.0840 -0.0250 -0.0012 175 GLY A N     
1444 C CA    . GLY A 175 ? 0.5627 0.3764 0.3107 -0.0718 -0.0253 -0.0012 175 GLY A CA    
1445 C C     . GLY A 175 ? 0.5533 0.3905 0.3190 -0.0696 -0.0221 -0.0031 175 GLY A C     
1446 O O     . GLY A 175 ? 0.5400 0.3888 0.3088 -0.0770 -0.0197 -0.0044 175 GLY A O     
1447 N N     . ASP A 176 ? 0.5355 0.3799 0.3130 -0.0593 -0.0223 -0.0032 176 ASP A N     
1448 C CA    . ASP A 176 ? 0.5303 0.3954 0.3240 -0.0561 -0.0197 -0.0045 176 ASP A CA    
1449 C C     . ASP A 176 ? 0.5375 0.4057 0.3367 -0.0508 -0.0198 -0.0058 176 ASP A C     
1450 O O     . ASP A 176 ? 0.5213 0.4053 0.3327 -0.0482 -0.0180 -0.0068 176 ASP A O     
1451 C CB    . ASP A 176 ? 0.5132 0.3849 0.3159 -0.0496 -0.0195 -0.0035 176 ASP A CB    
1452 C CG    . ASP A 176 ? 0.5550 0.4214 0.3505 -0.0545 -0.0197 -0.0021 176 ASP A CG    
1453 O OD1   . ASP A 176 ? 0.5454 0.4155 0.3370 -0.0631 -0.0175 -0.0028 176 ASP A OD1   
1454 O OD2   . ASP A 176 ? 0.5638 0.4228 0.3574 -0.0498 -0.0222 -0.0004 176 ASP A OD2   
1455 N N     . GLU A 177 ? 0.5723 0.4245 0.3616 -0.0488 -0.0218 -0.0058 177 GLU A N     
1456 C CA    . GLU A 177 ? 0.6134 0.4657 0.4047 -0.0444 -0.0217 -0.0072 177 GLU A CA    
1457 C C     . GLU A 177 ? 0.5798 0.4446 0.3856 -0.0351 -0.0206 -0.0072 177 GLU A C     
1458 O O     . GLU A 177 ? 0.5851 0.4606 0.3982 -0.0339 -0.0192 -0.0084 177 GLU A O     
1459 C CB    . GLU A 177 ? 0.6281 0.4879 0.4189 -0.0522 -0.0207 -0.0088 177 GLU A CB    
1460 C CG    . GLU A 177 ? 0.7316 0.5774 0.5101 -0.0546 -0.0220 -0.0101 177 GLU A CG    
1461 C CD    . GLU A 177 ? 0.8091 0.6623 0.5859 -0.0648 -0.0218 -0.0113 177 GLU A CD    
1462 O OE1   . GLU A 177 ? 0.8336 0.7030 0.6213 -0.0639 -0.0209 -0.0121 177 GLU A OE1   
1463 O OE2   . GLU A 177 ? 0.8092 0.6521 0.5736 -0.0738 -0.0229 -0.0112 177 GLU A OE2   
1464 N N     . VAL A 178 ? 0.5628 0.4262 0.3724 -0.0291 -0.0214 -0.0057 178 VAL A N     
1465 C CA    . VAL A 178 ? 0.5304 0.4030 0.3522 -0.0204 -0.0206 -0.0054 178 VAL A CA    
1466 C C     . VAL A 178 ? 0.5311 0.3953 0.3493 -0.0149 -0.0206 -0.0064 178 VAL A C     
1467 O O     . VAL A 178 ? 0.5300 0.3788 0.3383 -0.0133 -0.0223 -0.0061 178 VAL A O     
1468 C CB    . VAL A 178 ? 0.5303 0.4027 0.3561 -0.0162 -0.0221 -0.0034 178 VAL A CB    
1469 C CG1   . VAL A 178 ? 0.4875 0.3686 0.3251 -0.0079 -0.0215 -0.0030 178 VAL A CG1   
1470 C CG2   . VAL A 178 ? 0.4786 0.3585 0.3066 -0.0217 -0.0216 -0.0029 178 VAL A CG2   
1471 N N     . PRO A 179 ? 0.5283 0.4019 0.3536 -0.0122 -0.0187 -0.0076 179 PRO A N     
1472 C CA    . PRO A 179 ? 0.5210 0.3875 0.3420 -0.0079 -0.0178 -0.0090 179 PRO A CA    
1473 C C     . PRO A 179 ? 0.5349 0.3911 0.3539 -0.0001 -0.0185 -0.0084 179 PRO A C     
1474 O O     . PRO A 179 ? 0.5452 0.4081 0.3735 0.0049  -0.0189 -0.0068 179 PRO A O     
1475 C CB    . PRO A 179 ? 0.5150 0.3962 0.3472 -0.0049 -0.0157 -0.0094 179 PRO A CB    
1476 C CG    . PRO A 179 ? 0.5190 0.4125 0.3571 -0.0105 -0.0158 -0.0090 179 PRO A CG    
1477 C CD    . PRO A 179 ? 0.5236 0.4145 0.3608 -0.0127 -0.0171 -0.0076 179 PRO A CD    
1478 N N     . SER A 180 ? 0.5526 0.3929 0.3596 0.0011  -0.0190 -0.0096 180 SER A N     
1479 C CA    . SER A 180 ? 0.5822 0.4114 0.3864 0.0092  -0.0199 -0.0092 180 SER A CA    
1480 C C     . SER A 180 ? 0.5692 0.4087 0.3860 0.0185  -0.0177 -0.0091 180 SER A C     
1481 O O     . SER A 180 ? 0.5602 0.3978 0.3809 0.0253  -0.0188 -0.0078 180 SER A O     
1482 C CB    . SER A 180 ? 0.6333 0.4421 0.4211 0.0091  -0.0203 -0.0110 180 SER A CB    
1483 O OG    . SER A 180 ? 0.6630 0.4719 0.4483 0.0098  -0.0175 -0.0136 180 SER A OG    
1484 N N     . GLU A 181 ? 0.5675 0.4185 0.3909 0.0184  -0.0147 -0.0102 181 GLU A N     
1485 C CA    . GLU A 181 ? 0.5590 0.4203 0.3937 0.0260  -0.0120 -0.0101 181 GLU A CA    
1486 C C     . GLU A 181 ? 0.5309 0.4065 0.3797 0.0276  -0.0130 -0.0076 181 GLU A C     
1487 O O     . GLU A 181 ? 0.5440 0.4287 0.4028 0.0333  -0.0111 -0.0071 181 GLU A O     
1488 C CB    . GLU A 181 ? 0.5882 0.4553 0.4232 0.0251  -0.0086 -0.0120 181 GLU A CB    
1489 C CG    . GLU A 181 ? 0.6111 0.4916 0.4525 0.0191  -0.0087 -0.0113 181 GLU A CG    
1490 C CD    . GLU A 181 ? 0.6664 0.5424 0.4987 0.0106  -0.0103 -0.0122 181 GLU A CD    
1491 O OE1   . GLU A 181 ? 0.6768 0.5386 0.4973 0.0081  -0.0118 -0.0131 181 GLU A OE1   
1492 O OE2   . GLU A 181 ? 0.6515 0.5382 0.4885 0.0064  -0.0103 -0.0120 181 GLU A OE2   
1493 N N     . ILE A 182 ? 0.4688 0.3462 0.3180 0.0223  -0.0156 -0.0061 182 ILE A N     
1494 C CA    . ILE A 182 ? 0.4518 0.3404 0.3122 0.0234  -0.0168 -0.0038 182 ILE A CA    
1495 C C     . ILE A 182 ? 0.4569 0.3384 0.3145 0.0236  -0.0207 -0.0019 182 ILE A C     
1496 O O     . ILE A 182 ? 0.4651 0.3540 0.3310 0.0253  -0.0224 0.0001  182 ILE A O     
1497 C CB    . ILE A 182 ? 0.4305 0.3312 0.2968 0.0179  -0.0161 -0.0036 182 ILE A CB    
1498 C CG1   . ILE A 182 ? 0.4237 0.3204 0.2830 0.0105  -0.0177 -0.0036 182 ILE A CG1   
1499 C CG2   . ILE A 182 ? 0.4199 0.3271 0.2884 0.0177  -0.0129 -0.0051 182 ILE A CG2   
1500 C CD1   . ILE A 182 ? 0.4349 0.3434 0.3013 0.0068  -0.0174 -0.0030 182 ILE A CD1   
1501 N N     . ILE A 183 ? 0.4576 0.3239 0.3025 0.0217  -0.0225 -0.0023 183 ILE A N     
1502 C CA    . ILE A 183 ? 0.5059 0.3628 0.3454 0.0213  -0.0266 -0.0002 183 ILE A CA    
1503 C C     . ILE A 183 ? 0.5138 0.3735 0.3616 0.0296  -0.0287 0.0017  183 ILE A C     
1504 O O     . ILE A 183 ? 0.5247 0.3865 0.3752 0.0289  -0.0320 0.0040  183 ILE A O     
1505 C CB    . ILE A 183 ? 0.5409 0.3783 0.3637 0.0187  -0.0281 -0.0010 183 ILE A CB    
1506 C CG1   . ILE A 183 ? 0.5606 0.3968 0.3758 0.0083  -0.0273 -0.0019 183 ILE A CG1   
1507 C CG2   . ILE A 183 ? 0.5045 0.3295 0.3213 0.0216  -0.0327 0.0014  183 ILE A CG2   
1508 C CD1   . ILE A 183 ? 0.5952 0.4376 0.4125 0.0023  -0.0286 -0.0002 183 ILE A CD1   
1509 N N     . ASP A 184 ? 0.5163 0.3765 0.3680 0.0373  -0.0268 0.0006  184 ASP A N     
1510 C CA    . ASP A 184 ? 0.5164 0.3812 0.3775 0.0457  -0.0285 0.0023  184 ASP A CA    
1511 C C     . ASP A 184 ? 0.4739 0.3579 0.3507 0.0461  -0.0276 0.0035  184 ASP A C     
1512 O O     . ASP A 184 ? 0.4704 0.3613 0.3569 0.0518  -0.0294 0.0053  184 ASP A O     
1513 C CB    . ASP A 184 ? 0.5558 0.4153 0.4159 0.0541  -0.0259 0.0004  184 ASP A CB    
1514 C CG    . ASP A 184 ? 0.6635 0.5012 0.5070 0.0548  -0.0276 -0.0007 184 ASP A CG    
1515 O OD1   . ASP A 184 ? 0.7395 0.5664 0.5739 0.0507  -0.0320 0.0011  184 ASP A OD1   
1516 O OD2   . ASP A 184 ? 0.7062 0.5365 0.5445 0.0592  -0.0246 -0.0032 184 ASP A OD2   
1517 N N     . LYS A 185 ? 0.4339 0.3262 0.3130 0.0400  -0.0251 0.0028  185 LYS A N     
1518 C CA    . LYS A 185 ? 0.4071 0.3158 0.2993 0.0396  -0.0240 0.0038  185 LYS A CA    
1519 C C     . LYS A 185 ? 0.3828 0.2946 0.2758 0.0339  -0.0269 0.0055  185 LYS A C     
1520 O O     . LYS A 185 ? 0.3647 0.2880 0.2662 0.0323  -0.0262 0.0062  185 LYS A O     
1521 C CB    . LYS A 185 ? 0.3698 0.2855 0.2642 0.0379  -0.0191 0.0018  185 LYS A CB    
1522 C CG    . LYS A 185 ? 0.4275 0.3405 0.3206 0.0434  -0.0156 -0.0002 185 LYS A CG    
1523 C CD    . LYS A 185 ? 0.4075 0.3276 0.3025 0.0415  -0.0112 -0.0017 185 LYS A CD    
1524 C CE    . LYS A 185 ? 0.4549 0.3713 0.3472 0.0469  -0.0074 -0.0039 185 LYS A CE    
1525 N NZ    . LYS A 185 ? 0.4457 0.3699 0.3405 0.0455  -0.0032 -0.0050 185 LYS A NZ    
1526 N N     . ILE A 186 ? 0.3881 0.2888 0.2710 0.0305  -0.0301 0.0061  186 ILE A N     
1527 C CA    . ILE A 186 ? 0.4130 0.3149 0.2944 0.0246  -0.0324 0.0074  186 ILE A CA    
1528 C C     . ILE A 186 ? 0.4228 0.3241 0.3068 0.0270  -0.0374 0.0102  186 ILE A C     
1529 O O     . ILE A 186 ? 0.4079 0.2999 0.2874 0.0309  -0.0406 0.0113  186 ILE A O     
1530 C CB    . ILE A 186 ? 0.4128 0.3045 0.2813 0.0177  -0.0323 0.0064  186 ILE A CB    
1531 C CG1   . ILE A 186 ? 0.4517 0.3469 0.3193 0.0147  -0.0279 0.0039  186 ILE A CG1   
1532 C CG2   . ILE A 186 ? 0.3821 0.2753 0.2487 0.0121  -0.0341 0.0075  186 ILE A CG2   
1533 C CD1   . ILE A 186 ? 0.4868 0.3728 0.3424 0.0080  -0.0276 0.0028  186 ILE A CD1   
1534 N N     . ILE A 187 ? 0.4117 0.3223 0.3027 0.0248  -0.0384 0.0114  187 ILE A N     
1535 C CA    . ILE A 187 ? 0.4059 0.3168 0.2990 0.0256  -0.0437 0.0141  187 ILE A CA    
1536 C C     . ILE A 187 ? 0.4150 0.3224 0.3007 0.0182  -0.0448 0.0143  187 ILE A C     
1537 O O     . ILE A 187 ? 0.3956 0.3105 0.2849 0.0147  -0.0426 0.0134  187 ILE A O     
1538 C CB    . ILE A 187 ? 0.4215 0.3467 0.3293 0.0293  -0.0441 0.0154  187 ILE A CB    
1539 C CG1   . ILE A 187 ? 0.4380 0.3667 0.3528 0.0370  -0.0423 0.0150  187 ILE A CG1   
1540 C CG2   . ILE A 187 ? 0.4100 0.3361 0.3198 0.0290  -0.0504 0.0184  187 ILE A CG2   
1541 C CD1   . ILE A 187 ? 0.4599 0.4042 0.3894 0.0400  -0.0409 0.0157  187 ILE A CD1   
1542 N N     . TYR A 188 ? 0.3977 0.2925 0.2718 0.0160  -0.0481 0.0153  188 TYR A N     
1543 C CA    . TYR A 188 ? 0.3981 0.2872 0.2622 0.0086  -0.0484 0.0151  188 TYR A CA    
1544 C C     . TYR A 188 ? 0.4362 0.3240 0.2989 0.0071  -0.0537 0.0177  188 TYR A C     
1545 O O     . TYR A 188 ? 0.4248 0.3074 0.2863 0.0105  -0.0591 0.0202  188 TYR A O     
1546 C CB    . TYR A 188 ? 0.4431 0.3182 0.2934 0.0056  -0.0482 0.0146  188 TYR A CB    
1547 C CG    . TYR A 188 ? 0.4710 0.3396 0.3098 -0.0024 -0.0483 0.0145  188 TYR A CG    
1548 C CD1   . TYR A 188 ? 0.4371 0.3123 0.2764 -0.0076 -0.0434 0.0121  188 TYR A CD1   
1549 C CD2   . TYR A 188 ? 0.4839 0.3397 0.3111 -0.0046 -0.0531 0.0169  188 TYR A CD2   
1550 C CE1   . TYR A 188 ? 0.4518 0.3222 0.2811 -0.0147 -0.0426 0.0117  188 TYR A CE1   
1551 C CE2   . TYR A 188 ? 0.5093 0.3591 0.3249 -0.0125 -0.0525 0.0167  188 TYR A CE2   
1552 C CZ    . TYR A 188 ? 0.4668 0.3245 0.2839 -0.0175 -0.0469 0.0140  188 TYR A CZ    
1553 O OH    . TYR A 188 ? 0.4031 0.2562 0.2096 -0.0250 -0.0454 0.0134  188 TYR A OH    
1554 N N     . MET A 189 ? 0.4269 0.3192 0.2895 0.0021  -0.0525 0.0170  189 MET A N     
1555 C CA    . MET A 189 ? 0.4636 0.3543 0.3236 -0.0005 -0.0575 0.0191  189 MET A CA    
1556 C C     . MET A 189 ? 0.4728 0.3575 0.3211 -0.0080 -0.0556 0.0177  189 MET A C     
1557 O O     . MET A 189 ? 0.4527 0.3437 0.3037 -0.0104 -0.0511 0.0154  189 MET A O     
1558 C CB    . MET A 189 ? 0.4592 0.3623 0.3317 0.0013  -0.0582 0.0196  189 MET A CB    
1559 C CG    . MET A 189 ? 0.5067 0.4185 0.3924 0.0084  -0.0596 0.0210  189 MET A CG    
1560 S SD    . MET A 189 ? 0.5494 0.4772 0.4499 0.0092  -0.0569 0.0204  189 MET A SD    
1561 C CE    . MET A 189 ? 0.4568 0.3864 0.3571 0.0088  -0.0488 0.0168  189 MET A CE    
1562 N N     . PRO A 190 ? 0.4884 0.3604 0.3232 -0.0114 -0.0587 0.0191  190 PRO A N     
1563 C CA    . PRO A 190 ? 0.5045 0.3704 0.3271 -0.0189 -0.0568 0.0179  190 PRO A CA    
1564 C C     . PRO A 190 ? 0.5235 0.3893 0.3438 -0.0215 -0.0606 0.0192  190 PRO A C     
1565 O O     . PRO A 190 ? 0.5510 0.4172 0.3751 -0.0186 -0.0669 0.0220  190 PRO A O     
1566 C CB    . PRO A 190 ? 0.5346 0.3861 0.3430 -0.0215 -0.0591 0.0194  190 PRO A CB    
1567 C CG    . PRO A 190 ? 0.5562 0.4043 0.3682 -0.0151 -0.0655 0.0226  190 PRO A CG    
1568 C CD    . PRO A 190 ? 0.5188 0.3806 0.3481 -0.0084 -0.0635 0.0217  190 PRO A CD    
1569 N N     . PHE A 191 ? 0.5218 0.3870 0.3357 -0.0270 -0.0569 0.0169  191 PHE A N     
1570 C CA    . PHE A 191 ? 0.5239 0.3876 0.3339 -0.0301 -0.0600 0.0175  191 PHE A CA    
1571 C C     . PHE A 191 ? 0.5512 0.4044 0.3444 -0.0373 -0.0586 0.0166  191 PHE A C     
1572 O O     . PHE A 191 ? 0.5199 0.3724 0.3082 -0.0402 -0.0523 0.0139  191 PHE A O     
1573 C CB    . PHE A 191 ? 0.4959 0.3704 0.3163 -0.0289 -0.0565 0.0152  191 PHE A CB    
1574 C CG    . PHE A 191 ? 0.4686 0.3534 0.3048 -0.0229 -0.0585 0.0166  191 PHE A CG    
1575 C CD1   . PHE A 191 ? 0.4484 0.3404 0.2941 -0.0185 -0.0543 0.0154  191 PHE A CD1   
1576 C CD2   . PHE A 191 ? 0.4569 0.3445 0.2979 -0.0221 -0.0646 0.0192  191 PHE A CD2   
1577 C CE1   . PHE A 191 ? 0.4213 0.3227 0.2806 -0.0133 -0.0555 0.0165  191 PHE A CE1   
1578 C CE2   . PHE A 191 ? 0.4564 0.3547 0.3123 -0.0170 -0.0659 0.0205  191 PHE A CE2   
1579 C CZ    . PHE A 191 ? 0.4324 0.3375 0.2972 -0.0125 -0.0610 0.0191  191 PHE A CZ    
1580 N N     . ASP A 192 ? 0.6141 0.4594 0.3982 -0.0403 -0.0646 0.0188  192 ASP A N     
1581 C CA    . ASP A 192 ? 0.6542 0.4882 0.4204 -0.0476 -0.0637 0.0181  192 ASP A CA    
1582 C C     . ASP A 192 ? 0.6301 0.4674 0.3941 -0.0509 -0.0575 0.0142  192 ASP A C     
1583 O O     . ASP A 192 ? 0.6567 0.4874 0.4076 -0.0564 -0.0534 0.0122  192 ASP A O     
1584 C CB    . ASP A 192 ? 0.7292 0.5533 0.4856 -0.0497 -0.0729 0.0221  192 ASP A CB    
1585 C CG    . ASP A 192 ? 0.8263 0.6441 0.5814 -0.0466 -0.0791 0.0260  192 ASP A CG    
1586 O OD1   . ASP A 192 ? 0.8694 0.6814 0.6184 -0.0476 -0.0759 0.0256  192 ASP A OD1   
1587 O OD2   . ASP A 192 ? 0.8828 0.7012 0.6427 -0.0432 -0.0872 0.0295  192 ASP A OD2   
1588 N N     . ASN A 193 ? 0.5754 0.4221 0.3514 -0.0475 -0.0569 0.0130  193 ASN A N     
1589 C CA    . ASN A 193 ? 0.5497 0.3985 0.3239 -0.0495 -0.0512 0.0091  193 ASN A CA    
1590 C C     . ASN A 193 ? 0.5177 0.3784 0.3078 -0.0443 -0.0483 0.0075  193 ASN A C     
1591 O O     . ASN A 193 ? 0.4734 0.3408 0.2757 -0.0399 -0.0518 0.0097  193 ASN A O     
1592 C CB    . ASN A 193 ? 0.5686 0.4080 0.3302 -0.0544 -0.0553 0.0096  193 ASN A CB    
1593 C CG    . ASN A 193 ? 0.6257 0.4676 0.3945 -0.0526 -0.0635 0.0128  193 ASN A CG    
1594 O OD1   . ASN A 193 ? 0.6555 0.5030 0.4317 -0.0513 -0.0627 0.0115  193 ASN A OD1   
1595 N ND2   . ASN A 193 ? 0.6590 0.4972 0.4261 -0.0525 -0.0713 0.0170  193 ASN A ND2   
1596 N N     . GLU A 194 ? 0.5103 0.3733 0.2997 -0.0448 -0.0417 0.0035  194 GLU A N     
1597 C CA    . GLU A 194 ? 0.4862 0.3591 0.2888 -0.0400 -0.0382 0.0018  194 GLU A CA    
1598 C C     . GLU A 194 ? 0.4877 0.3621 0.2961 -0.0389 -0.0434 0.0036  194 GLU A C     
1599 O O     . GLU A 194 ? 0.4685 0.3516 0.2901 -0.0347 -0.0436 0.0044  194 GLU A O     
1600 C CB    . GLU A 194 ? 0.4914 0.3651 0.2906 -0.0404 -0.0305 -0.0028 194 GLU A CB    
1601 C CG    . GLU A 194 ? 0.4574 0.3413 0.2700 -0.0350 -0.0265 -0.0045 194 GLU A CG    
1602 C CD    . GLU A 194 ? 0.4980 0.3820 0.3081 -0.0341 -0.0203 -0.0087 194 GLU A CD    
1603 O OE1   . GLU A 194 ? 0.4689 0.3601 0.2889 -0.0294 -0.0176 -0.0099 194 GLU A OE1   
1604 O OE2   . GLU A 194 ? 0.5437 0.4200 0.3414 -0.0377 -0.0181 -0.0109 194 GLU A OE2   
1605 N N     . LYS A 195 ? 0.5082 0.3742 0.3064 -0.0432 -0.0476 0.0042  195 LYS A N     
1606 C CA    . LYS A 195 ? 0.5265 0.3935 0.3290 -0.0437 -0.0530 0.0061  195 LYS A CA    
1607 C C     . LYS A 195 ? 0.5030 0.3782 0.3184 -0.0405 -0.0587 0.0102  195 LYS A C     
1608 O O     . LYS A 195 ? 0.4679 0.3512 0.2949 -0.0379 -0.0592 0.0109  195 LYS A O     
1609 C CB    . LYS A 195 ? 0.5527 0.4084 0.3405 -0.0498 -0.0576 0.0064  195 LYS A CB    
1610 C CG    . LYS A 195 ? 0.6413 0.4887 0.4166 -0.0525 -0.0518 0.0019  195 LYS A CG    
1611 C CD    . LYS A 195 ? 0.6878 0.5244 0.4502 -0.0583 -0.0569 0.0023  195 LYS A CD    
1612 C CE    . LYS A 195 ? 0.7370 0.5627 0.4833 -0.0613 -0.0510 -0.0024 195 LYS A CE    
1613 N NZ    . LYS A 195 ? 0.7822 0.6006 0.5150 -0.0651 -0.0503 -0.0023 195 LYS A NZ    
1614 N N     . GLU A 196 ? 0.5119 0.3847 0.3247 -0.0405 -0.0626 0.0128  196 GLU A N     
1615 C CA    . GLU A 196 ? 0.5271 0.4074 0.3519 -0.0365 -0.0679 0.0165  196 GLU A CA    
1616 C C     . GLU A 196 ? 0.4821 0.3723 0.3202 -0.0307 -0.0629 0.0156  196 GLU A C     
1617 O O     . GLU A 196 ? 0.5033 0.4027 0.3543 -0.0271 -0.0650 0.0175  196 GLU A O     
1618 C CB    . GLU A 196 ? 0.5647 0.4381 0.3823 -0.0374 -0.0741 0.0197  196 GLU A CB    
1619 C CG    . GLU A 196 ? 0.6513 0.5194 0.4627 -0.0365 -0.0708 0.0191  196 GLU A CG    
1620 C CD    . GLU A 196 ? 0.7435 0.6029 0.5467 -0.0373 -0.0779 0.0228  196 GLU A CD    
1621 O OE1   . GLU A 196 ? 0.6905 0.5486 0.4950 -0.0340 -0.0776 0.0238  196 GLU A OE1   
1622 O OE2   . GLU A 196 ? 0.7579 0.6109 0.5525 -0.0412 -0.0841 0.0248  196 GLU A OE2   
1623 N N     . LEU A 197 ? 0.4696 0.3586 0.3046 -0.0301 -0.0563 0.0128  197 LEU A N     
1624 C CA    . LEU A 197 ? 0.4455 0.3432 0.2916 -0.0252 -0.0516 0.0117  197 LEU A CA    
1625 C C     . LEU A 197 ? 0.4319 0.3374 0.2878 -0.0235 -0.0498 0.0108  197 LEU A C     
1626 O O     . LEU A 197 ? 0.4030 0.3169 0.2705 -0.0196 -0.0501 0.0121  197 LEU A O     
1627 C CB    . LEU A 197 ? 0.4201 0.3156 0.2605 -0.0261 -0.0451 0.0086  197 LEU A CB    
1628 C CG    . LEU A 197 ? 0.4290 0.3319 0.2782 -0.0221 -0.0405 0.0074  197 LEU A CG    
1629 C CD1   . LEU A 197 ? 0.4035 0.3031 0.2452 -0.0245 -0.0361 0.0053  197 LEU A CD1   
1630 C CD2   . LEU A 197 ? 0.4065 0.3173 0.2645 -0.0195 -0.0368 0.0056  197 LEU A CD2   
1631 N N     . LEU A 198 ? 0.4208 0.3224 0.2706 -0.0265 -0.0479 0.0087  198 LEU A N     
1632 C CA    . LEU A 198 ? 0.4241 0.3304 0.2805 -0.0253 -0.0461 0.0078  198 LEU A CA    
1633 C C     . LEU A 198 ? 0.4368 0.3470 0.2998 -0.0261 -0.0518 0.0108  198 LEU A C     
1634 O O     . LEU A 198 ? 0.4310 0.3486 0.3039 -0.0239 -0.0507 0.0114  198 LEU A O     
1635 C CB    . LEU A 198 ? 0.4337 0.3330 0.2806 -0.0278 -0.0425 0.0044  198 LEU A CB    
1636 C CG    . LEU A 198 ? 0.4376 0.3377 0.2827 -0.0257 -0.0354 0.0010  198 LEU A CG    
1637 C CD1   . LEU A 198 ? 0.4255 0.3187 0.2615 -0.0274 -0.0319 -0.0024 198 LEU A CD1   
1638 C CD2   . LEU A 198 ? 0.4273 0.3368 0.2845 -0.0208 -0.0323 0.0008  198 LEU A CD2   
1639 N N     . MET A 199 ? 0.4611 0.3668 0.3186 -0.0297 -0.0579 0.0130  199 MET A N     
1640 C CA    . MET A 199 ? 0.4729 0.3839 0.3375 -0.0310 -0.0640 0.0162  199 MET A CA    
1641 C C     . MET A 199 ? 0.4569 0.3792 0.3357 -0.0260 -0.0651 0.0187  199 MET A C     
1642 O O     . MET A 199 ? 0.4432 0.3746 0.3329 -0.0251 -0.0659 0.0201  199 MET A O     
1643 C CB    . MET A 199 ? 0.4971 0.4009 0.3522 -0.0359 -0.0710 0.0181  199 MET A CB    
1644 C CG    . MET A 199 ? 0.5256 0.4189 0.3675 -0.0416 -0.0709 0.0160  199 MET A CG    
1645 S SD    . MET A 199 ? 0.6078 0.4924 0.4379 -0.0482 -0.0800 0.0185  199 MET A SD    
1646 C CE    . MET A 199 ? 0.5405 0.4175 0.3604 -0.0473 -0.0799 0.0186  199 MET A CE    
1647 N N     . GLU A 200 ? 0.4356 0.3567 0.3136 -0.0228 -0.0649 0.0191  200 GLU A N     
1648 C CA    . GLU A 200 ? 0.4508 0.3808 0.3407 -0.0171 -0.0651 0.0208  200 GLU A CA    
1649 C C     . GLU A 200 ? 0.4194 0.3566 0.3178 -0.0138 -0.0587 0.0190  200 GLU A C     
1650 O O     . GLU A 200 ? 0.4091 0.3563 0.3193 -0.0108 -0.0589 0.0204  200 GLU A O     
1651 C CB    . GLU A 200 ? 0.4817 0.4057 0.3661 -0.0148 -0.0660 0.0212  200 GLU A CB    
1652 C CG    . GLU A 200 ? 0.5662 0.4972 0.4612 -0.0084 -0.0663 0.0227  200 GLU A CG    
1653 C CD    . GLU A 200 ? 0.6863 0.6265 0.5924 -0.0063 -0.0721 0.0260  200 GLU A CD    
1654 O OE1   . GLU A 200 ? 0.7143 0.6517 0.6167 -0.0092 -0.0787 0.0283  200 GLU A OE1   
1655 O OE2   . GLU A 200 ? 0.7290 0.6799 0.6477 -0.0019 -0.0699 0.0264  200 GLU A OE2   
1656 N N     . TYR A 201 ? 0.3954 0.3282 0.2878 -0.0144 -0.0532 0.0159  201 TYR A N     
1657 C CA    . TYR A 201 ? 0.3843 0.3231 0.2835 -0.0115 -0.0478 0.0143  201 TYR A CA    
1658 C C     . TYR A 201 ? 0.3878 0.3325 0.2940 -0.0127 -0.0483 0.0153  201 TYR A C     
1659 O O     . TYR A 201 ? 0.3914 0.3445 0.3072 -0.0099 -0.0466 0.0161  201 TYR A O     
1660 C CB    . TYR A 201 ? 0.3681 0.3019 0.2602 -0.0121 -0.0425 0.0109  201 TYR A CB    
1661 C CG    . TYR A 201 ? 0.3856 0.3252 0.2842 -0.0087 -0.0376 0.0096  201 TYR A CG    
1662 C CD1   . TYR A 201 ? 0.3553 0.3000 0.2600 -0.0049 -0.0364 0.0102  201 TYR A CD1   
1663 C CD2   . TYR A 201 ? 0.3601 0.2994 0.2579 -0.0091 -0.0345 0.0078  201 TYR A CD2   
1664 C CE1   . TYR A 201 ? 0.3289 0.2784 0.2384 -0.0022 -0.0324 0.0091  201 TYR A CE1   
1665 C CE2   . TYR A 201 ? 0.3404 0.2848 0.2437 -0.0059 -0.0307 0.0070  201 TYR A CE2   
1666 C CZ    . TYR A 201 ? 0.3603 0.3099 0.2692 -0.0028 -0.0297 0.0077  201 TYR A CZ    
1667 O OH    . TYR A 201 ? 0.3627 0.3165 0.2757 -0.0002 -0.0264 0.0069  201 TYR A OH    
1668 N N     . LEU A 202 ? 0.3613 0.3010 0.2616 -0.0173 -0.0506 0.0152  202 LEU A N     
1669 C CA    . LEU A 202 ? 0.4013 0.3450 0.3064 -0.0198 -0.0517 0.0163  202 LEU A CA    
1670 C C     . LEU A 202 ? 0.4002 0.3547 0.3170 -0.0193 -0.0556 0.0197  202 LEU A C     
1671 O O     . LEU A 202 ? 0.4046 0.3669 0.3298 -0.0189 -0.0539 0.0206  202 LEU A O     
1672 C CB    . LEU A 202 ? 0.4012 0.3356 0.2959 -0.0254 -0.0540 0.0156  202 LEU A CB    
1673 C CG    . LEU A 202 ? 0.4412 0.3665 0.3264 -0.0254 -0.0491 0.0120  202 LEU A CG    
1674 C CD1   . LEU A 202 ? 0.4458 0.3603 0.3191 -0.0308 -0.0517 0.0110  202 LEU A CD1   
1675 C CD2   . LEU A 202 ? 0.3879 0.3166 0.2784 -0.0231 -0.0450 0.0112  202 LEU A CD2   
1676 N N     . ASN A 203 ? 0.3985 0.3537 0.3157 -0.0192 -0.0607 0.0216  203 ASN A N     
1677 C CA    . ASN A 203 ? 0.4076 0.3746 0.3373 -0.0174 -0.0644 0.0248  203 ASN A CA    
1678 C C     . ASN A 203 ? 0.3940 0.3696 0.3338 -0.0111 -0.0600 0.0246  203 ASN A C     
1679 O O     . ASN A 203 ? 0.3976 0.3847 0.3489 -0.0100 -0.0596 0.0262  203 ASN A O     
1680 C CB    . ASN A 203 ? 0.4166 0.3816 0.3441 -0.0175 -0.0711 0.0270  203 ASN A CB    
1681 C CG    . ASN A 203 ? 0.4649 0.4253 0.3857 -0.0244 -0.0771 0.0282  203 ASN A CG    
1682 O OD1   . ASN A 203 ? 0.5100 0.4631 0.4226 -0.0259 -0.0819 0.0291  203 ASN A OD1   
1683 N ND2   . ASN A 203 ? 0.4590 0.4227 0.3823 -0.0289 -0.0771 0.0284  203 ASN A ND2   
1684 N N     . PHE A 204 ? 0.3612 0.3310 0.2958 -0.0075 -0.0564 0.0226  204 PHE A N     
1685 C CA    . PHE A 204 ? 0.3664 0.3414 0.3074 -0.0019 -0.0518 0.0218  204 PHE A CA    
1686 C C     . PHE A 204 ? 0.3409 0.3207 0.2860 -0.0025 -0.0469 0.0208  204 PHE A C     
1687 O O     . PHE A 204 ? 0.3310 0.3202 0.2857 0.0000  -0.0449 0.0216  204 PHE A O     
1688 C CB    . PHE A 204 ? 0.3346 0.3006 0.2669 0.0003  -0.0496 0.0197  204 PHE A CB    
1689 C CG    . PHE A 204 ? 0.3850 0.3531 0.3199 0.0044  -0.0441 0.0180  204 PHE A CG    
1690 C CD1   . PHE A 204 ? 0.4001 0.3717 0.3403 0.0097  -0.0437 0.0185  204 PHE A CD1   
1691 C CD2   . PHE A 204 ? 0.3426 0.3086 0.2739 0.0031  -0.0395 0.0157  204 PHE A CD2   
1692 C CE1   . PHE A 204 ? 0.3719 0.3441 0.3128 0.0129  -0.0388 0.0167  204 PHE A CE1   
1693 C CE2   . PHE A 204 ? 0.3481 0.3158 0.2810 0.0064  -0.0351 0.0143  204 PHE A CE2   
1694 C CZ    . PHE A 204 ? 0.3429 0.3135 0.2802 0.0109  -0.0347 0.0147  204 PHE A CZ    
1695 N N     . TRP A 205 ? 0.3436 0.3164 0.2808 -0.0059 -0.0450 0.0190  205 TRP A N     
1696 C CA    . TRP A 205 ? 0.3620 0.3366 0.3007 -0.0069 -0.0411 0.0183  205 TRP A CA    
1697 C C     . TRP A 205 ? 0.3825 0.3659 0.3297 -0.0095 -0.0428 0.0208  205 TRP A C     
1698 O O     . TRP A 205 ? 0.3724 0.3623 0.3256 -0.0084 -0.0395 0.0212  205 TRP A O     
1699 C CB    . TRP A 205 ? 0.3441 0.3087 0.2725 -0.0100 -0.0402 0.0163  205 TRP A CB    
1700 C CG    . TRP A 205 ? 0.3135 0.2770 0.2410 -0.0100 -0.0363 0.0152  205 TRP A CG    
1701 C CD1   . TRP A 205 ? 0.3279 0.2925 0.2570 -0.0132 -0.0366 0.0165  205 TRP A CD1   
1702 C CD2   . TRP A 205 ? 0.2935 0.2539 0.2177 -0.0070 -0.0320 0.0129  205 TRP A CD2   
1703 N NE1   . TRP A 205 ? 0.3060 0.2672 0.2322 -0.0119 -0.0329 0.0152  205 TRP A NE1   
1704 C CE2   . TRP A 205 ? 0.3156 0.2750 0.2394 -0.0079 -0.0302 0.0130  205 TRP A CE2   
1705 C CE3   . TRP A 205 ? 0.3351 0.2937 0.2565 -0.0040 -0.0299 0.0109  205 TRP A CE3   
1706 C CZ2   . TRP A 205 ? 0.3491 0.3059 0.2702 -0.0051 -0.0267 0.0113  205 TRP A CZ2   
1707 C CZ3   . TRP A 205 ? 0.3387 0.2962 0.2583 -0.0018 -0.0262 0.0091  205 TRP A CZ3   
1708 C CH2   . TRP A 205 ? 0.3246 0.2813 0.2442 -0.0020 -0.0248 0.0093  205 TRP A CH2   
1709 N N     . GLN A 206 ? 0.4065 0.3904 0.3539 -0.0133 -0.0482 0.0226  206 GLN A N     
1710 C CA    . GLN A 206 ? 0.4404 0.4339 0.3964 -0.0169 -0.0507 0.0252  206 GLN A CA    
1711 C C     . GLN A 206 ? 0.4188 0.4266 0.3885 -0.0126 -0.0494 0.0269  206 GLN A C     
1712 O O     . GLN A 206 ? 0.3959 0.4126 0.3732 -0.0143 -0.0474 0.0281  206 GLN A O     
1713 C CB    . GLN A 206 ? 0.4814 0.4729 0.4348 -0.0218 -0.0575 0.0269  206 GLN A CB    
1714 C CG    . GLN A 206 ? 0.5951 0.5859 0.5468 -0.0293 -0.0597 0.0281  206 GLN A CG    
1715 C CD    . GLN A 206 ? 0.6737 0.6491 0.6109 -0.0323 -0.0580 0.0255  206 GLN A CD    
1716 O OE1   . GLN A 206 ? 0.6817 0.6527 0.6157 -0.0296 -0.0527 0.0235  206 GLN A OE1   
1717 N NE2   . GLN A 206 ? 0.6444 0.6113 0.5727 -0.0377 -0.0626 0.0256  206 GLN A NE2   
1718 N N     . GLN A 207 ? 0.4153 0.4246 0.3876 -0.0072 -0.0505 0.0268  207 GLN A N     
1719 C CA    . GLN A 207 ? 0.4483 0.4700 0.4329 -0.0017 -0.0488 0.0278  207 GLN A CA    
1720 C C     . GLN A 207 ? 0.4251 0.4475 0.4103 0.0020  -0.0417 0.0259  207 GLN A C     
1721 O O     . GLN A 207 ? 0.4462 0.4796 0.4411 0.0044  -0.0387 0.0266  207 GLN A O     
1722 C CB    . GLN A 207 ? 0.4799 0.5008 0.4657 0.0035  -0.0524 0.0284  207 GLN A CB    
1723 C CG    . GLN A 207 ? 0.6534 0.6837 0.6482 0.0028  -0.0591 0.0316  207 GLN A CG    
1724 C CD    . GLN A 207 ? 0.7648 0.8131 0.7761 0.0056  -0.0573 0.0331  207 GLN A CD    
1725 O OE1   . GLN A 207 ? 0.7986 0.8515 0.8156 0.0129  -0.0539 0.0324  207 GLN A OE1   
1726 N NE2   . GLN A 207 ? 0.7801 0.8385 0.7985 -0.0003 -0.0593 0.0352  207 GLN A NE2   
1727 N N     . LYS A 208 ? 0.3920 0.4032 0.3667 0.0024  -0.0391 0.0235  208 LYS A N     
1728 C CA    . LYS A 208 ? 0.3720 0.3825 0.3456 0.0059  -0.0332 0.0216  208 LYS A CA    
1729 C C     . LYS A 208 ? 0.3627 0.3659 0.3283 0.0024  -0.0308 0.0203  208 LYS A C     
1730 O O     . LYS A 208 ? 0.3881 0.3831 0.3460 0.0037  -0.0293 0.0182  208 LYS A O     
1731 C CB    . LYS A 208 ? 0.3567 0.3612 0.3261 0.0110  -0.0327 0.0199  208 LYS A CB    
1732 C CG    . LYS A 208 ? 0.3565 0.3662 0.3327 0.0156  -0.0353 0.0212  208 LYS A CG    
1733 C CD    . LYS A 208 ? 0.4041 0.4042 0.3729 0.0194  -0.0359 0.0198  208 LYS A CD    
1734 C CE    . LYS A 208 ? 0.3999 0.4025 0.3737 0.0238  -0.0401 0.0215  208 LYS A CE    
1735 N NZ    . LYS A 208 ? 0.4003 0.4142 0.3855 0.0292  -0.0374 0.0219  208 LYS A NZ    
1736 N N     . THR A 209 ? 0.3582 0.3644 0.3258 -0.0021 -0.0308 0.0216  209 THR A N     
1737 C CA    . THR A 209 ? 0.3557 0.3541 0.3155 -0.0053 -0.0293 0.0207  209 THR A CA    
1738 C C     . THR A 209 ? 0.3424 0.3403 0.3007 -0.0025 -0.0243 0.0195  209 THR A C     
1739 O O     . THR A 209 ? 0.3444 0.3502 0.3088 -0.0015 -0.0215 0.0204  209 THR A O     
1740 C CB    . THR A 209 ? 0.3580 0.3586 0.3193 -0.0115 -0.0310 0.0228  209 THR A CB    
1741 O OG1   . THR A 209 ? 0.3894 0.3925 0.3535 -0.0143 -0.0362 0.0243  209 THR A OG1   
1742 C CG2   . THR A 209 ? 0.3316 0.3206 0.2825 -0.0145 -0.0306 0.0217  209 THR A CG2   
1743 N N     . PRO A 210 ? 0.3333 0.3226 0.2836 -0.0011 -0.0231 0.0174  210 PRO A N     
1744 C CA    . PRO A 210 ? 0.3203 0.3087 0.2684 0.0013  -0.0192 0.0164  210 PRO A CA    
1745 C C     . PRO A 210 ? 0.3185 0.3079 0.2667 -0.0016 -0.0176 0.0179  210 PRO A C     
1746 O O     . PRO A 210 ? 0.3189 0.3050 0.2648 -0.0058 -0.0196 0.0190  210 PRO A O     
1747 C CB    . PRO A 210 ? 0.2975 0.2772 0.2377 0.0021  -0.0194 0.0142  210 PRO A CB    
1748 C CG    . PRO A 210 ? 0.3429 0.3201 0.2817 0.0017  -0.0224 0.0136  210 PRO A CG    
1749 C CD    . PRO A 210 ? 0.3462 0.3272 0.2894 -0.0015 -0.0254 0.0158  210 PRO A CD    
1750 N N     . VAL A 211 ? 0.2962 0.2893 0.2459 0.0002  -0.0140 0.0180  211 VAL A N     
1751 C CA    . VAL A 211 ? 0.3060 0.2980 0.2532 -0.0023 -0.0121 0.0194  211 VAL A CA    
1752 C C     . VAL A 211 ? 0.3370 0.3209 0.2763 -0.0001 -0.0113 0.0179  211 VAL A C     
1753 O O     . VAL A 211 ? 0.3425 0.3191 0.2760 -0.0018 -0.0125 0.0183  211 VAL A O     
1754 C CB    . VAL A 211 ? 0.3094 0.3103 0.2620 -0.0019 -0.0084 0.0204  211 VAL A CB    
1755 C CG1   . VAL A 211 ? 0.2474 0.2453 0.1949 -0.0045 -0.0060 0.0217  211 VAL A CG1   
1756 C CG2   . VAL A 211 ? 0.2556 0.2665 0.2176 -0.0041 -0.0092 0.0221  211 VAL A CG2   
1757 N N     . ILE A 212 ? 0.3321 0.3173 0.2712 0.0039  -0.0097 0.0162  212 ILE A N     
1758 C CA    . ILE A 212 ? 0.3238 0.3035 0.2570 0.0062  -0.0096 0.0147  212 ILE A CA    
1759 C C     . ILE A 212 ? 0.3321 0.3099 0.2649 0.0078  -0.0114 0.0127  212 ILE A C     
1760 O O     . ILE A 212 ? 0.3309 0.3119 0.2668 0.0091  -0.0113 0.0120  212 ILE A O     
1761 C CB    . ILE A 212 ? 0.3130 0.2948 0.2449 0.0085  -0.0068 0.0141  212 ILE A CB    
1762 C CG1   . ILE A 212 ? 0.3117 0.2962 0.2439 0.0066  -0.0042 0.0161  212 ILE A CG1   
1763 C CG2   . ILE A 212 ? 0.2925 0.2695 0.2189 0.0105  -0.0075 0.0128  212 ILE A CG2   
1764 C CD1   . ILE A 212 ? 0.2826 0.2612 0.2091 0.0040  -0.0050 0.0179  212 ILE A CD1   
1765 N N     . LEU A 213 ? 0.3128 0.2849 0.2413 0.0078  -0.0128 0.0118  213 LEU A N     
1766 C CA    . LEU A 213 ? 0.3252 0.2955 0.2525 0.0088  -0.0139 0.0098  213 LEU A CA    
1767 C C     . LEU A 213 ? 0.3296 0.2989 0.2540 0.0113  -0.0131 0.0081  213 LEU A C     
1768 O O     . LEU A 213 ? 0.3513 0.3177 0.2732 0.0121  -0.0133 0.0081  213 LEU A O     
1769 C CB    . LEU A 213 ? 0.3023 0.2677 0.2272 0.0067  -0.0159 0.0097  213 LEU A CB    
1770 C CG    . LEU A 213 ? 0.2879 0.2512 0.2106 0.0069  -0.0167 0.0076  213 LEU A CG    
1771 C CD1   . LEU A 213 ? 0.2659 0.2326 0.1914 0.0067  -0.0173 0.0078  213 LEU A CD1   
1772 C CD2   . LEU A 213 ? 0.2660 0.2230 0.1847 0.0045  -0.0184 0.0075  213 LEU A CD2   
1773 N N     . THR A 214 ? 0.3363 0.3080 0.2612 0.0123  -0.0125 0.0067  214 THR A N     
1774 C CA    . THR A 214 ? 0.3248 0.2973 0.2479 0.0139  -0.0120 0.0052  214 THR A CA    
1775 C C     . THR A 214 ? 0.3396 0.3128 0.2620 0.0135  -0.0121 0.0033  214 THR A C     
1776 O O     . THR A 214 ? 0.3330 0.3046 0.2553 0.0121  -0.0127 0.0031  214 THR A O     
1777 C CB    . THR A 214 ? 0.3327 0.3073 0.2553 0.0149  -0.0109 0.0059  214 THR A CB    
1778 O OG1   . THR A 214 ? 0.3190 0.2948 0.2400 0.0161  -0.0113 0.0048  214 THR A OG1   
1779 C CG2   . THR A 214 ? 0.3189 0.2952 0.2424 0.0148  -0.0098 0.0056  214 THR A CG2   
1780 N N     . GLY A 215 ? 0.3502 0.3257 0.2718 0.0142  -0.0117 0.0020  215 GLY A N     
1781 C CA    . GLY A 215 ? 0.3558 0.3325 0.2764 0.0130  -0.0115 0.0001  215 GLY A CA    
1782 C C     . GLY A 215 ? 0.3712 0.3519 0.2927 0.0142  -0.0113 -0.0011 215 GLY A C     
1783 O O     . GLY A 215 ? 0.3976 0.3794 0.3199 0.0164  -0.0118 -0.0003 215 GLY A O     
1784 N N     . TRP A 216 ? 0.3628 0.3461 0.2841 0.0129  -0.0106 -0.0029 216 TRP A N     
1785 C CA    . TRP A 216 ? 0.3593 0.3487 0.2831 0.0142  -0.0103 -0.0042 216 TRP A CA    
1786 C C     . TRP A 216 ? 0.3409 0.3302 0.2655 0.0158  -0.0092 -0.0054 216 TRP A C     
1787 O O     . TRP A 216 ? 0.3469 0.3348 0.2696 0.0136  -0.0080 -0.0066 216 TRP A O     
1788 C CB    . TRP A 216 ? 0.3563 0.3506 0.2800 0.0112  -0.0100 -0.0054 216 TRP A CB    
1789 C CG    . TRP A 216 ? 0.4101 0.4127 0.3375 0.0125  -0.0105 -0.0061 216 TRP A CG    
1790 C CD1   . TRP A 216 ? 0.4056 0.4157 0.3369 0.0128  -0.0094 -0.0078 216 TRP A CD1   
1791 C CD2   . TRP A 216 ? 0.3910 0.3961 0.3192 0.0137  -0.0124 -0.0050 216 TRP A CD2   
1792 N NE1   . TRP A 216 ? 0.4470 0.4650 0.3824 0.0144  -0.0109 -0.0077 216 TRP A NE1   
1793 C CE2   . TRP A 216 ? 0.4154 0.4298 0.3483 0.0148  -0.0131 -0.0059 216 TRP A CE2   
1794 C CE3   . TRP A 216 ? 0.4175 0.4181 0.3425 0.0139  -0.0136 -0.0034 216 TRP A CE3   
1795 C CZ2   . TRP A 216 ? 0.4228 0.4418 0.3571 0.0159  -0.0156 -0.0049 216 TRP A CZ2   
1796 C CZ3   . TRP A 216 ? 0.4521 0.4561 0.3772 0.0147  -0.0155 -0.0027 216 TRP A CZ3   
1797 C CH2   . TRP A 216 ? 0.4262 0.4390 0.3558 0.0156  -0.0169 -0.0033 216 TRP A CH2   
1798 N N     . ASN A 217 ? 0.3570 0.3464 0.2832 0.0197  -0.0097 -0.0052 217 ASN A N     
1799 C CA    . ASN A 217 ? 0.3526 0.3398 0.2784 0.0221  -0.0086 -0.0066 217 ASN A CA    
1800 C C     . ASN A 217 ? 0.3463 0.3247 0.2676 0.0203  -0.0084 -0.0063 217 ASN A C     
1801 O O     . ASN A 217 ? 0.3684 0.3443 0.2875 0.0206  -0.0070 -0.0080 217 ASN A O     
1802 C CB    . ASN A 217 ? 0.3982 0.3925 0.3263 0.0218  -0.0063 -0.0092 217 ASN A CB    
1803 C CG    . ASN A 217 ? 0.4567 0.4600 0.3905 0.0255  -0.0065 -0.0099 217 ASN A CG    
1804 O OD1   . ASN A 217 ? 0.5053 0.5071 0.4403 0.0304  -0.0074 -0.0095 217 ASN A OD1   
1805 N ND2   . ASN A 217 ? 0.5106 0.5232 0.4478 0.0230  -0.0059 -0.0108 217 ASN A ND2   
1806 N N     . VAL A 218 ? 0.3330 0.3073 0.2528 0.0184  -0.0099 -0.0041 218 VAL A N     
1807 C CA    . VAL A 218 ? 0.3709 0.3382 0.2873 0.0163  -0.0105 -0.0035 218 VAL A CA    
1808 C C     . VAL A 218 ? 0.3901 0.3509 0.3037 0.0182  -0.0108 -0.0035 218 VAL A C     
1809 O O     . VAL A 218 ? 0.4182 0.3731 0.3278 0.0164  -0.0109 -0.0041 218 VAL A O     
1810 C CB    . VAL A 218 ? 0.3631 0.3293 0.2800 0.0140  -0.0119 -0.0012 218 VAL A CB    
1811 C CG1   . VAL A 218 ? 0.3395 0.3089 0.2569 0.0120  -0.0116 -0.0016 218 VAL A CG1   
1812 C CG2   . VAL A 218 ? 0.3599 0.3272 0.2787 0.0157  -0.0125 0.0007  218 VAL A CG2   
1813 N N     . GLU A 219 ? 0.3975 0.3583 0.3121 0.0217  -0.0113 -0.0029 219 GLU A N     
1814 C CA    . GLU A 219 ? 0.4723 0.4249 0.3830 0.0238  -0.0119 -0.0028 219 GLU A CA    
1815 C C     . GLU A 219 ? 0.4852 0.4365 0.3943 0.0269  -0.0100 -0.0058 219 GLU A C     
1816 O O     . GLU A 219 ? 0.4930 0.4355 0.3966 0.0270  -0.0099 -0.0067 219 GLU A O     
1817 C CB    . GLU A 219 ? 0.4858 0.4371 0.3968 0.0265  -0.0133 -0.0008 219 GLU A CB    
1818 C CG    . GLU A 219 ? 0.5875 0.5276 0.4925 0.0276  -0.0144 0.0000  219 GLU A CG    
1819 C CD    . GLU A 219 ? 0.6634 0.6007 0.5672 0.0305  -0.0161 0.0021  219 GLU A CD    
1820 O OE1   . GLU A 219 ? 0.6630 0.5943 0.5632 0.0277  -0.0174 0.0047  219 GLU A OE1   
1821 O OE2   . GLU A 219 ? 0.7091 0.6504 0.6154 0.0354  -0.0163 0.0013  219 GLU A OE2   
1822 N N     . SER A 220 ? 0.4950 0.4553 0.4087 0.0292  -0.0084 -0.0076 220 SER A N     
1823 C CA    . SER A 220 ? 0.4966 0.4582 0.4103 0.0327  -0.0059 -0.0107 220 SER A CA    
1824 C C     . SER A 220 ? 0.4755 0.4375 0.3866 0.0290  -0.0034 -0.0130 220 SER A C     
1825 O O     . SER A 220 ? 0.4833 0.4421 0.3912 0.0308  -0.0010 -0.0156 220 SER A O     
1826 C CB    . SER A 220 ? 0.4884 0.4610 0.4092 0.0371  -0.0054 -0.0115 220 SER A CB    
1827 O OG    . SER A 220 ? 0.5220 0.5042 0.4473 0.0337  -0.0056 -0.0109 220 SER A OG    
1828 N N     . PHE A 221 ? 0.4292 0.3940 0.3408 0.0239  -0.0040 -0.0119 221 PHE A N     
1829 C CA    . PHE A 221 ? 0.4211 0.3856 0.3292 0.0199  -0.0021 -0.0135 221 PHE A CA    
1830 C C     . PHE A 221 ? 0.4204 0.3779 0.3236 0.0150  -0.0043 -0.0117 221 PHE A C     
1831 O O     . PHE A 221 ? 0.4583 0.4079 0.3551 0.0133  -0.0042 -0.0126 221 PHE A O     
1832 C CB    . PHE A 221 ? 0.4090 0.3843 0.3216 0.0184  -0.0003 -0.0145 221 PHE A CB    
1833 C CG    . PHE A 221 ? 0.4423 0.4163 0.3500 0.0137  0.0017  -0.0160 221 PHE A CG    
1834 C CD1   . PHE A 221 ? 0.4014 0.3749 0.3073 0.0088  0.0003  -0.0144 221 PHE A CD1   
1835 C CD2   . PHE A 221 ? 0.4416 0.4138 0.3454 0.0143  0.0051  -0.0189 221 PHE A CD2   
1836 C CE1   . PHE A 221 ? 0.4082 0.3791 0.3082 0.0042  0.0016  -0.0154 221 PHE A CE1   
1837 C CE2   . PHE A 221 ? 0.4172 0.3874 0.3150 0.0093  0.0070  -0.0201 221 PHE A CE2   
1838 C CZ    . PHE A 221 ? 0.4695 0.4388 0.3652 0.0041  0.0050  -0.0181 221 PHE A CZ    
1839 N N     . ALA A 222 ? 0.3654 0.3256 0.2713 0.0127  -0.0063 -0.0094 222 ALA A N     
1840 C CA    . ALA A 222 ? 0.3782 0.3337 0.2808 0.0086  -0.0084 -0.0078 222 ALA A CA    
1841 C C     . ALA A 222 ? 0.3787 0.3262 0.2776 0.0076  -0.0106 -0.0066 222 ALA A C     
1842 O O     . ALA A 222 ? 0.3745 0.3163 0.2679 0.0046  -0.0114 -0.0069 222 ALA A O     
1843 C CB    . ALA A 222 ? 0.3227 0.2823 0.2293 0.0077  -0.0100 -0.0057 222 ALA A CB    
1844 N N     . ILE A 223 ? 0.3581 0.3045 0.2593 0.0096  -0.0117 -0.0051 223 ILE A N     
1845 C CA    . ILE A 223 ? 0.3794 0.3185 0.2773 0.0077  -0.0140 -0.0037 223 ILE A CA    
1846 C C     . ILE A 223 ? 0.3740 0.3044 0.2642 0.0074  -0.0132 -0.0059 223 ILE A C     
1847 O O     . ILE A 223 ? 0.3844 0.3091 0.2695 0.0035  -0.0151 -0.0056 223 ILE A O     
1848 C CB    . ILE A 223 ? 0.3663 0.3054 0.2671 0.0093  -0.0150 -0.0016 223 ILE A CB    
1849 C CG1   . ILE A 223 ? 0.3537 0.3000 0.2606 0.0086  -0.0157 0.0007  223 ILE A CG1   
1850 C CG2   . ILE A 223 ? 0.3662 0.2967 0.2622 0.0068  -0.0170 -0.0004 223 ILE A CG2   
1851 C CD1   . ILE A 223 ? 0.3607 0.3089 0.2703 0.0109  -0.0155 0.0022  223 ILE A CD1   
1852 N N     . PRO A 224 ? 0.3809 0.3102 0.2699 0.0116  -0.0107 -0.0083 224 PRO A N     
1853 C CA    . PRO A 224 ? 0.3787 0.2988 0.2595 0.0118  -0.0094 -0.0109 224 PRO A CA    
1854 C C     . PRO A 224 ? 0.4005 0.3199 0.2764 0.0088  -0.0078 -0.0130 224 PRO A C     
1855 O O     . PRO A 224 ? 0.4054 0.3153 0.2726 0.0065  -0.0081 -0.0143 224 PRO A O     
1856 C CB    . PRO A 224 ? 0.3880 0.3093 0.2704 0.0183  -0.0066 -0.0131 224 PRO A CB    
1857 C CG    . PRO A 224 ? 0.3951 0.3281 0.2867 0.0206  -0.0064 -0.0119 224 PRO A CG    
1858 C CD    . PRO A 224 ? 0.3737 0.3091 0.2683 0.0166  -0.0093 -0.0085 224 PRO A CD    
1859 N N     . TYR A 225 ? 0.4035 0.3319 0.2839 0.0084  -0.0062 -0.0134 225 TYR A N     
1860 C CA    . TYR A 225 ? 0.4103 0.3375 0.2851 0.0047  -0.0048 -0.0149 225 TYR A CA    
1861 C C     . TYR A 225 ? 0.4223 0.3432 0.2922 -0.0006 -0.0090 -0.0126 225 TYR A C     
1862 O O     . TYR A 225 ? 0.4303 0.3434 0.2912 -0.0037 -0.0091 -0.0138 225 TYR A O     
1863 C CB    . TYR A 225 ? 0.4065 0.3438 0.2862 0.0044  -0.0026 -0.0154 225 TYR A CB    
1864 C CG    . TYR A 225 ? 0.3996 0.3347 0.2720 0.0013  0.0003  -0.0179 225 TYR A CG    
1865 C CD1   . TYR A 225 ? 0.4022 0.3311 0.2674 -0.0042 -0.0020 -0.0166 225 TYR A CD1   
1866 C CD2   . TYR A 225 ? 0.4092 0.3479 0.2813 0.0039  0.0054  -0.0214 225 TYR A CD2   
1867 C CE1   . TYR A 225 ? 0.4345 0.3600 0.2911 -0.0076 0.0007  -0.0188 225 TYR A CE1   
1868 C CE2   . TYR A 225 ? 0.4355 0.3720 0.3000 0.0007  0.0088  -0.0239 225 TYR A CE2   
1869 C CZ    . TYR A 225 ? 0.4594 0.3887 0.3155 -0.0054 0.0065  -0.0225 225 TYR A CZ    
1870 O OH    . TYR A 225 ? 0.4626 0.3889 0.3098 -0.0091 0.0098  -0.0248 225 TYR A OH    
1871 N N     . VAL A 226 ? 0.3892 0.3140 0.2651 -0.0015 -0.0123 -0.0094 226 VAL A N     
1872 C CA    . VAL A 226 ? 0.3976 0.3189 0.2713 -0.0057 -0.0167 -0.0068 226 VAL A CA    
1873 C C     . VAL A 226 ? 0.3840 0.2964 0.2520 -0.0077 -0.0190 -0.0065 226 VAL A C     
1874 O O     . VAL A 226 ? 0.3608 0.2671 0.2221 -0.0119 -0.0217 -0.0061 226 VAL A O     
1875 C CB    . VAL A 226 ? 0.3785 0.3070 0.2610 -0.0050 -0.0190 -0.0037 226 VAL A CB    
1876 C CG1   . VAL A 226 ? 0.4193 0.3455 0.3017 -0.0084 -0.0237 -0.0009 226 VAL A CG1   
1877 C CG2   . VAL A 226 ? 0.3881 0.3220 0.2730 -0.0047 -0.0177 -0.0039 226 VAL A CG2   
1878 N N     . TYR A 227 ? 0.3862 0.2972 0.2562 -0.0052 -0.0184 -0.0065 227 TYR A N     
1879 C CA    . TYR A 227 ? 0.4044 0.3056 0.2679 -0.0076 -0.0207 -0.0062 227 TYR A CA    
1880 C C     . TYR A 227 ? 0.4199 0.3106 0.2716 -0.0089 -0.0192 -0.0094 227 TYR A C     
1881 O O     . TYR A 227 ? 0.4402 0.3229 0.2843 -0.0138 -0.0224 -0.0089 227 TYR A O     
1882 C CB    . TYR A 227 ? 0.4019 0.3019 0.2680 -0.0043 -0.0199 -0.0058 227 TYR A CB    
1883 C CG    . TYR A 227 ? 0.4350 0.3235 0.2934 -0.0073 -0.0223 -0.0054 227 TYR A CG    
1884 C CD1   . TYR A 227 ? 0.4501 0.3391 0.3107 -0.0120 -0.0263 -0.0020 227 TYR A CD1   
1885 C CD2   . TYR A 227 ? 0.4642 0.3412 0.3130 -0.0055 -0.0203 -0.0085 227 TYR A CD2   
1886 C CE1   . TYR A 227 ? 0.5010 0.3793 0.3541 -0.0159 -0.0287 -0.0015 227 TYR A CE1   
1887 C CE2   . TYR A 227 ? 0.5030 0.3674 0.3430 -0.0087 -0.0226 -0.0083 227 TYR A CE2   
1888 C CZ    . TYR A 227 ? 0.5077 0.3727 0.3497 -0.0144 -0.0270 -0.0046 227 TYR A CZ    
1889 O OH    . TYR A 227 ? 0.5522 0.4046 0.3851 -0.0187 -0.0296 -0.0042 227 TYR A OH    
1890 N N     . ASN A 228 ? 0.4168 0.3082 0.2670 -0.0048 -0.0144 -0.0128 228 ASN A N     
1891 C CA    . ASN A 228 ? 0.4199 0.3018 0.2588 -0.0052 -0.0117 -0.0165 228 ASN A CA    
1892 C C     . ASN A 228 ? 0.4529 0.3331 0.2851 -0.0100 -0.0121 -0.0170 228 ASN A C     
1893 O O     . ASN A 228 ? 0.4628 0.3321 0.2832 -0.0132 -0.0123 -0.0188 228 ASN A O     
1894 C CB    . ASN A 228 ? 0.4292 0.3139 0.2699 0.0013  -0.0061 -0.0200 228 ASN A CB    
1895 C CG    . ASN A 228 ? 0.4317 0.3105 0.2721 0.0059  -0.0060 -0.0205 228 ASN A CG    
1896 O OD1   . ASN A 228 ? 0.5071 0.3728 0.3378 0.0045  -0.0071 -0.0214 228 ASN A OD1   
1897 N ND2   . ASN A 228 ? 0.4070 0.2944 0.2572 0.0110  -0.0050 -0.0197 228 ASN A ND2   
1898 N N     . ARG A 229 ? 0.4431 0.3329 0.2817 -0.0108 -0.0122 -0.0155 229 ARG A N     
1899 C CA    . ARG A 229 ? 0.4476 0.3353 0.2795 -0.0156 -0.0132 -0.0153 229 ARG A CA    
1900 C C     . ARG A 229 ? 0.4503 0.3310 0.2769 -0.0210 -0.0195 -0.0126 229 ARG A C     
1901 O O     . ARG A 229 ? 0.4746 0.3464 0.2897 -0.0252 -0.0206 -0.0135 229 ARG A O     
1902 C CB    . ARG A 229 ? 0.4269 0.3249 0.2665 -0.0153 -0.0127 -0.0138 229 ARG A CB    
1903 C CG    . ARG A 229 ? 0.4315 0.3265 0.2634 -0.0201 -0.0135 -0.0135 229 ARG A CG    
1904 C CD    . ARG A 229 ? 0.4271 0.3186 0.2498 -0.0209 -0.0078 -0.0175 229 ARG A CD    
1905 N NE    . ARG A 229 ? 0.4207 0.3068 0.2331 -0.0266 -0.0088 -0.0171 229 ARG A NE    
1906 C CZ    . ARG A 229 ? 0.4607 0.3408 0.2615 -0.0292 -0.0048 -0.0202 229 ARG A CZ    
1907 N NH1   . ARG A 229 ? 0.4299 0.3089 0.2285 -0.0261 0.0008  -0.0243 229 ARG A NH1   
1908 N NH2   . ARG A 229 ? 0.4757 0.3501 0.2664 -0.0348 -0.0062 -0.0192 229 ARG A NH2   
1909 N N     . ILE A 230 ? 0.4504 0.3356 0.2856 -0.0209 -0.0237 -0.0091 230 ILE A N     
1910 C CA    . ILE A 230 ? 0.4365 0.3176 0.2693 -0.0257 -0.0301 -0.0062 230 ILE A CA    
1911 C C     . ILE A 230 ? 0.4365 0.3054 0.2586 -0.0284 -0.0309 -0.0079 230 ILE A C     
1912 O O     . ILE A 230 ? 0.4379 0.2992 0.2510 -0.0338 -0.0349 -0.0072 230 ILE A O     
1913 C CB    . ILE A 230 ? 0.4202 0.3108 0.2659 -0.0246 -0.0333 -0.0024 230 ILE A CB    
1914 C CG1   . ILE A 230 ? 0.4056 0.3052 0.2587 -0.0230 -0.0337 -0.0007 230 ILE A CG1   
1915 C CG2   . ILE A 230 ? 0.4069 0.2946 0.2514 -0.0297 -0.0395 0.0004  230 ILE A CG2   
1916 C CD1   . ILE A 230 ? 0.4201 0.3299 0.2862 -0.0206 -0.0351 0.0022  230 ILE A CD1   
1917 N N     . LYS A 231 ? 0.4606 0.3267 0.2827 -0.0247 -0.0273 -0.0100 231 LYS A N     
1918 C CA    . LYS A 231 ? 0.5000 0.3522 0.3103 -0.0264 -0.0273 -0.0123 231 LYS A CA    
1919 C C     . LYS A 231 ? 0.5266 0.3689 0.3227 -0.0286 -0.0250 -0.0158 231 LYS A C     
1920 O O     . LYS A 231 ? 0.5261 0.3566 0.3102 -0.0337 -0.0281 -0.0162 231 LYS A O     
1921 C CB    . LYS A 231 ? 0.5110 0.3615 0.3237 -0.0207 -0.0234 -0.0141 231 LYS A CB    
1922 C CG    . LYS A 231 ? 0.5917 0.4262 0.3920 -0.0224 -0.0241 -0.0160 231 LYS A CG    
1923 C CD    . LYS A 231 ? 0.6454 0.4767 0.4471 -0.0158 -0.0205 -0.0177 231 LYS A CD    
1924 C CE    . LYS A 231 ? 0.7194 0.5510 0.5192 -0.0091 -0.0138 -0.0223 231 LYS A CE    
1925 N NZ    . LYS A 231 ? 0.7686 0.5908 0.5640 -0.0031 -0.0111 -0.0248 231 LYS A NZ    
1926 N N     . ASN A 232 ? 0.5330 0.3801 0.3298 -0.0251 -0.0196 -0.0183 232 ASN A N     
1927 C CA    . ASN A 232 ? 0.5764 0.4153 0.3598 -0.0271 -0.0162 -0.0219 232 ASN A CA    
1928 C C     . ASN A 232 ? 0.5808 0.4154 0.3559 -0.0342 -0.0210 -0.0199 232 ASN A C     
1929 O O     . ASN A 232 ? 0.5943 0.4173 0.3544 -0.0380 -0.0204 -0.0223 232 ASN A O     
1930 C CB    . ASN A 232 ? 0.5842 0.4315 0.3719 -0.0222 -0.0090 -0.0248 232 ASN A CB    
1931 C CG    . ASN A 232 ? 0.5778 0.4264 0.3698 -0.0148 -0.0038 -0.0279 232 ASN A CG    
1932 O OD1   . ASN A 232 ? 0.6353 0.4750 0.4235 -0.0134 -0.0050 -0.0285 232 ASN A OD1   
1933 N ND2   . ASN A 232 ? 0.5555 0.4151 0.3552 -0.0103 0.0016  -0.0297 232 ASN A ND2   
1934 N N     . ILE A 233 ? 0.5775 0.4211 0.3619 -0.0359 -0.0258 -0.0156 233 ILE A N     
1935 C CA    . ILE A 233 ? 0.5531 0.3940 0.3314 -0.0417 -0.0311 -0.0131 233 ILE A CA    
1936 C C     . ILE A 233 ? 0.5580 0.3936 0.3334 -0.0469 -0.0390 -0.0100 233 ILE A C     
1937 O O     . ILE A 233 ? 0.5850 0.4113 0.3480 -0.0526 -0.0429 -0.0097 233 ILE A O     
1938 C CB    . ILE A 233 ? 0.5406 0.3932 0.3296 -0.0403 -0.0322 -0.0101 233 ILE A CB    
1939 C CG1   . ILE A 233 ? 0.5439 0.4004 0.3327 -0.0375 -0.0249 -0.0130 233 ILE A CG1   
1940 C CG2   . ILE A 233 ? 0.5213 0.3706 0.3050 -0.0456 -0.0393 -0.0066 233 ILE A CG2   
1941 C CD1   . ILE A 233 ? 0.5337 0.4012 0.3335 -0.0355 -0.0253 -0.0105 233 ILE A CD1   
1942 N N     . PHE A 234 ? 0.5379 0.3796 0.3246 -0.0453 -0.0415 -0.0078 234 PHE A N     
1943 C CA    . PHE A 234 ? 0.5330 0.3738 0.3207 -0.0504 -0.0492 -0.0042 234 PHE A CA    
1944 C C     . PHE A 234 ? 0.5336 0.3661 0.3165 -0.0524 -0.0498 -0.0053 234 PHE A C     
1945 O O     . PHE A 234 ? 0.5422 0.3704 0.3211 -0.0585 -0.0561 -0.0032 234 PHE A O     
1946 C CB    . PHE A 234 ? 0.5016 0.3574 0.3066 -0.0484 -0.0525 0.0001  234 PHE A CB    
1947 C CG    . PHE A 234 ? 0.4959 0.3579 0.3044 -0.0472 -0.0538 0.0019  234 PHE A CG    
1948 C CD1   . PHE A 234 ? 0.4757 0.3470 0.2940 -0.0416 -0.0493 0.0017  234 PHE A CD1   
1949 C CD2   . PHE A 234 ? 0.4974 0.3550 0.2985 -0.0521 -0.0598 0.0040  234 PHE A CD2   
1950 C CE1   . PHE A 234 ? 0.4626 0.3377 0.2828 -0.0408 -0.0506 0.0033  234 PHE A CE1   
1951 C CE2   . PHE A 234 ? 0.4987 0.3603 0.3018 -0.0508 -0.0613 0.0059  234 PHE A CE2   
1952 C CZ    . PHE A 234 ? 0.4765 0.3463 0.2889 -0.0453 -0.0566 0.0055  234 PHE A CZ    
1953 N N     . GLY A 235 ? 0.5351 0.3653 0.3185 -0.0474 -0.0437 -0.0083 235 GLY A N     
1954 C CA    . GLY A 235 ? 0.5657 0.3868 0.3445 -0.0485 -0.0441 -0.0092 235 GLY A CA    
1955 C C     . GLY A 235 ? 0.5648 0.3959 0.3581 -0.0448 -0.0435 -0.0069 235 GLY A C     
1956 O O     . GLY A 235 ? 0.5559 0.4013 0.3630 -0.0425 -0.0440 -0.0042 235 GLY A O     
1957 N N     . GLU A 236 ? 0.5888 0.4112 0.3777 -0.0443 -0.0424 -0.0080 236 GLU A N     
1958 C CA    . GLU A 236 ? 0.6299 0.4590 0.4298 -0.0410 -0.0414 -0.0061 236 GLU A CA    
1959 C C     . GLU A 236 ? 0.6289 0.4705 0.4413 -0.0449 -0.0463 -0.0011 236 GLU A C     
1960 O O     . GLU A 236 ? 0.6362 0.4902 0.4616 -0.0409 -0.0445 0.0006  236 GLU A O     
1961 C CB    . GLU A 236 ? 0.6812 0.4953 0.4711 -0.0410 -0.0403 -0.0080 236 GLU A CB    
1962 C CG    . GLU A 236 ? 0.7916 0.6040 0.5824 -0.0320 -0.0339 -0.0110 236 GLU A CG    
1963 C CD    . GLU A 236 ? 0.8878 0.6852 0.6696 -0.0311 -0.0335 -0.0121 236 GLU A CD    
1964 O OE1   . GLU A 236 ? 0.9206 0.7139 0.7009 -0.0371 -0.0378 -0.0092 236 GLU A OE1   
1965 O OE2   . GLU A 236 ? 0.9265 0.7162 0.7028 -0.0243 -0.0288 -0.0159 236 GLU A OE2   
1966 N N     . SER A 237 ? 0.6080 0.4469 0.4165 -0.0527 -0.0524 0.0010  237 SER A N     
1967 C CA    . SER A 237 ? 0.5705 0.4219 0.3911 -0.0568 -0.0571 0.0057  237 SER A CA    
1968 C C     . SER A 237 ? 0.5347 0.4031 0.3698 -0.0529 -0.0569 0.0078  237 SER A C     
1969 O O     . SER A 237 ? 0.5181 0.3991 0.3665 -0.0518 -0.0572 0.0106  237 SER A O     
1970 C CB    . SER A 237 ? 0.5842 0.4305 0.3980 -0.0662 -0.0642 0.0076  237 SER A CB    
1971 O OG    . SER A 237 ? 0.5889 0.4387 0.4020 -0.0677 -0.0677 0.0083  237 SER A OG    
1972 N N     . THR A 238 ? 0.4919 0.3597 0.3235 -0.0510 -0.0565 0.0063  238 THR A N     
1973 C CA    . THR A 238 ? 0.4753 0.3563 0.3183 -0.0470 -0.0561 0.0079  238 THR A CA    
1974 C C     . THR A 238 ? 0.4629 0.3503 0.3139 -0.0397 -0.0499 0.0067  238 THR A C     
1975 O O     . THR A 238 ? 0.4668 0.3665 0.3303 -0.0370 -0.0497 0.0089  238 THR A O     
1976 C CB    . THR A 238 ? 0.4669 0.3436 0.3019 -0.0475 -0.0572 0.0068  238 THR A CB    
1977 O OG1   . THR A 238 ? 0.4988 0.3692 0.3257 -0.0546 -0.0637 0.0082  238 THR A OG1   
1978 C CG2   . THR A 238 ? 0.4242 0.3127 0.2698 -0.0439 -0.0577 0.0088  238 THR A CG2   
1979 N N     . ALA A 239 ? 0.4465 0.3256 0.2903 -0.0365 -0.0449 0.0032  239 ALA A N     
1980 C CA    . ALA A 239 ? 0.4610 0.3457 0.3117 -0.0298 -0.0395 0.0020  239 ALA A CA    
1981 C C     . ALA A 239 ? 0.4578 0.3484 0.3172 -0.0292 -0.0397 0.0044  239 ALA A C     
1982 O O     . ALA A 239 ? 0.4069 0.3070 0.2759 -0.0248 -0.0372 0.0052  239 ALA A O     
1983 C CB    . ALA A 239 ? 0.4502 0.3254 0.2918 -0.0262 -0.0347 -0.0022 239 ALA A CB    
1984 N N     . LYS A 240 ? 0.4753 0.3597 0.3306 -0.0342 -0.0427 0.0057  240 LYS A N     
1985 C CA    . LYS A 240 ? 0.4719 0.3607 0.3338 -0.0354 -0.0431 0.0083  240 LYS A CA    
1986 C C     . LYS A 240 ? 0.4445 0.3490 0.3201 -0.0364 -0.0451 0.0119  240 LYS A C     
1987 O O     . LYS A 240 ? 0.4688 0.3795 0.3514 -0.0368 -0.0444 0.0140  240 LYS A O     
1988 C CB    . LYS A 240 ? 0.4807 0.3576 0.3331 -0.0417 -0.0459 0.0088  240 LYS A CB    
1989 C CG    . LYS A 240 ? 0.5225 0.3846 0.3638 -0.0387 -0.0427 0.0057  240 LYS A CG    
1990 C CD    . LYS A 240 ? 0.5909 0.4365 0.4175 -0.0447 -0.0456 0.0047  240 LYS A CD    
1991 C CE    . LYS A 240 ? 0.6466 0.4764 0.4615 -0.0402 -0.0420 0.0010  240 LYS A CE    
1992 N NZ    . LYS A 240 ? 0.6977 0.5181 0.5078 -0.0423 -0.0427 0.0024  240 LYS A NZ    
1993 N N     . ARG A 241 ? 0.4332 0.3438 0.3123 -0.0365 -0.0474 0.0125  241 ARG A N     
1994 C CA    . ARG A 241 ? 0.4058 0.3312 0.2981 -0.0360 -0.0491 0.0155  241 ARG A CA    
1995 C C     . ARG A 241 ? 0.4025 0.3365 0.3035 -0.0295 -0.0445 0.0153  241 ARG A C     
1996 O O     . ARG A 241 ? 0.4231 0.3689 0.3350 -0.0283 -0.0448 0.0175  241 ARG A O     
1997 C CB    . ARG A 241 ? 0.3779 0.3057 0.2704 -0.0373 -0.0535 0.0164  241 ARG A CB    
1998 C CG    . ARG A 241 ? 0.3743 0.2989 0.2626 -0.0449 -0.0597 0.0182  241 ARG A CG    
1999 C CD    . ARG A 241 ? 0.3154 0.2405 0.2019 -0.0461 -0.0646 0.0190  241 ARG A CD    
2000 N NE    . ARG A 241 ? 0.3476 0.2862 0.2470 -0.0418 -0.0654 0.0212  241 ARG A NE    
2001 C CZ    . ARG A 241 ? 0.3770 0.3161 0.2758 -0.0397 -0.0678 0.0217  241 ARG A CZ    
2002 N NH1   . ARG A 241 ? 0.3969 0.3244 0.2826 -0.0420 -0.0696 0.0202  241 ARG A NH1   
2003 N NH2   . ARG A 241 ? 0.3302 0.2808 0.2407 -0.0352 -0.0684 0.0236  241 ARG A NH2   
2004 N N     . LEU A 242 ? 0.3970 0.3252 0.2930 -0.0252 -0.0403 0.0125  242 LEU A N     
2005 C CA    . LEU A 242 ? 0.3889 0.3236 0.2913 -0.0198 -0.0362 0.0121  242 LEU A CA    
2006 C C     . LEU A 242 ? 0.3883 0.3258 0.2946 -0.0204 -0.0349 0.0138  242 LEU A C     
2007 O O     . LEU A 242 ? 0.3586 0.3034 0.2715 -0.0171 -0.0322 0.0144  242 LEU A O     
2008 C CB    . LEU A 242 ? 0.3821 0.3109 0.2785 -0.0155 -0.0325 0.0088  242 LEU A CB    
2009 C CG    . LEU A 242 ? 0.3796 0.3069 0.2723 -0.0148 -0.0326 0.0070  242 LEU A CG    
2010 C CD1   . LEU A 242 ? 0.3786 0.2996 0.2645 -0.0119 -0.0290 0.0036  242 LEU A CD1   
2011 C CD2   . LEU A 242 ? 0.3267 0.2632 0.2271 -0.0122 -0.0324 0.0080  242 LEU A CD2   
2012 N N     . SER A 243 ? 0.3900 0.3206 0.2911 -0.0252 -0.0367 0.0146  243 SER A N     
2013 C CA    . SER A 243 ? 0.3994 0.3326 0.3037 -0.0277 -0.0362 0.0170  243 SER A CA    
2014 C C     . SER A 243 ? 0.4101 0.3529 0.3220 -0.0331 -0.0395 0.0200  243 SER A C     
2015 O O     . SER A 243 ? 0.4274 0.3672 0.3362 -0.0378 -0.0436 0.0205  243 SER A O     
2016 C CB    . SER A 243 ? 0.3998 0.3189 0.2931 -0.0303 -0.0364 0.0163  243 SER A CB    
2017 O OG    . SER A 243 ? 0.4144 0.3351 0.3095 -0.0354 -0.0371 0.0192  243 SER A OG    
2018 N N     . PRO A 244 ? 0.3873 0.3420 0.3094 -0.0325 -0.0376 0.0221  244 PRO A N     
2019 C CA    . PRO A 244 ? 0.3947 0.3613 0.3263 -0.0371 -0.0402 0.0251  244 PRO A CA    
2020 C C     . PRO A 244 ? 0.4177 0.3801 0.3452 -0.0456 -0.0429 0.0270  244 PRO A C     
2021 O O     . PRO A 244 ? 0.4600 0.4322 0.3949 -0.0505 -0.0460 0.0294  244 PRO A O     
2022 C CB    . PRO A 244 ? 0.3813 0.3600 0.3228 -0.0337 -0.0361 0.0262  244 PRO A CB    
2023 C CG    . PRO A 244 ? 0.3624 0.3327 0.2970 -0.0299 -0.0321 0.0245  244 PRO A CG    
2024 C CD    . PRO A 244 ? 0.3576 0.3162 0.2830 -0.0272 -0.0330 0.0217  244 PRO A CD    
2025 N N     . HIS A 245 ? 0.4255 0.3735 0.3414 -0.0472 -0.0420 0.0260  245 HIS A N     
2026 C CA    . HIS A 245 ? 0.4381 0.3782 0.3470 -0.0558 -0.0449 0.0275  245 HIS A CA    
2027 C C     . HIS A 245 ? 0.4714 0.3950 0.3668 -0.0573 -0.0478 0.0252  245 HIS A C     
2028 O O     . HIS A 245 ? 0.4942 0.4060 0.3797 -0.0637 -0.0501 0.0256  245 HIS A O     
2029 C CB    . HIS A 245 ? 0.4289 0.3630 0.3332 -0.0572 -0.0419 0.0286  245 HIS A CB    
2030 C CG    . HIS A 245 ? 0.3933 0.3407 0.3079 -0.0541 -0.0377 0.0300  245 HIS A CG    
2031 N ND1   . HIS A 245 ? 0.4072 0.3724 0.3352 -0.0565 -0.0375 0.0323  245 HIS A ND1   
2032 C CD2   . HIS A 245 ? 0.3655 0.3110 0.2788 -0.0486 -0.0335 0.0293  245 HIS A CD2   
2033 C CE1   . HIS A 245 ? 0.3861 0.3590 0.3197 -0.0526 -0.0329 0.0327  245 HIS A CE1   
2034 N NE2   . HIS A 245 ? 0.3955 0.3564 0.3200 -0.0482 -0.0306 0.0310  245 HIS A NE2   
2035 N N     . ARG A 246 ? 0.4817 0.4038 0.3758 -0.0517 -0.0476 0.0226  246 ARG A N     
2036 C CA    . ARG A 246 ? 0.5159 0.4232 0.3971 -0.0522 -0.0494 0.0198  246 ARG A CA    
2037 C C     . ARG A 246 ? 0.5242 0.4137 0.3918 -0.0519 -0.0476 0.0179  246 ARG A C     
2038 O O     . ARG A 246 ? 0.5415 0.4169 0.3968 -0.0558 -0.0500 0.0164  246 ARG A O     
2039 C CB    . ARG A 246 ? 0.5239 0.4309 0.4030 -0.0597 -0.0553 0.0211  246 ARG A CB    
2040 C CG    . ARG A 246 ? 0.5613 0.4865 0.4547 -0.0605 -0.0582 0.0238  246 ARG A CG    
2041 C CD    . ARG A 246 ? 0.5952 0.5256 0.4927 -0.0534 -0.0570 0.0223  246 ARG A CD    
2042 N NE    . ARG A 246 ? 0.6709 0.6164 0.5805 -0.0541 -0.0606 0.0250  246 ARG A NE    
2043 C CZ    . ARG A 246 ? 0.6889 0.6489 0.6119 -0.0493 -0.0585 0.0263  246 ARG A CZ    
2044 N NH1   . ARG A 246 ? 0.6945 0.6559 0.6200 -0.0441 -0.0527 0.0253  246 ARG A NH1   
2045 N NH2   . ARG A 246 ? 0.6807 0.6534 0.6142 -0.0494 -0.0622 0.0286  246 ARG A NH2   
2046 N N     . LYS A 247 ? 0.5127 0.4019 0.3817 -0.0472 -0.0437 0.0178  247 LYS A N     
2047 C CA    . LYS A 247 ? 0.5602 0.4326 0.4168 -0.0447 -0.0419 0.0157  247 LYS A CA    
2048 C C     . LYS A 247 ? 0.5337 0.4076 0.3924 -0.0351 -0.0377 0.0133  247 LYS A C     
2049 O O     . LYS A 247 ? 0.5152 0.4014 0.3840 -0.0315 -0.0355 0.0144  247 LYS A O     
2050 C CB    . LYS A 247 ? 0.5627 0.4290 0.4155 -0.0494 -0.0423 0.0183  247 LYS A CB    
2051 C CG    . LYS A 247 ? 0.6502 0.4951 0.4873 -0.0478 -0.0419 0.0163  247 LYS A CG    
2052 C CD    . LYS A 247 ? 0.6820 0.5200 0.5147 -0.0510 -0.0418 0.0190  247 LYS A CD    
2053 C CE    . LYS A 247 ? 0.7293 0.5454 0.5466 -0.0473 -0.0413 0.0169  247 LYS A CE    
2054 N NZ    . LYS A 247 ? 0.7614 0.5604 0.5647 -0.0526 -0.0443 0.0152  247 LYS A NZ    
2055 N N     . THR A 248 ? 0.5611 0.4229 0.4102 -0.0311 -0.0365 0.0098  248 THR A N     
2056 C CA    . THR A 248 ? 0.5865 0.4495 0.4372 -0.0222 -0.0326 0.0073  248 THR A CA    
2057 C C     . THR A 248 ? 0.6567 0.5029 0.4956 -0.0188 -0.0316 0.0053  248 THR A C     
2058 O O     . THR A 248 ? 0.6588 0.4907 0.4866 -0.0233 -0.0337 0.0050  248 THR A O     
2059 C CB    . THR A 248 ? 0.5722 0.4406 0.4251 -0.0190 -0.0312 0.0045  248 THR A CB    
2060 O OG1   . THR A 248 ? 0.5620 0.4180 0.4035 -0.0214 -0.0324 0.0021  248 THR A OG1   
2061 C CG2   . THR A 248 ? 0.5259 0.4093 0.3895 -0.0214 -0.0326 0.0066  248 THR A CG2   
2062 N N     . ARG A 249 ? 0.7174 0.5653 0.5587 -0.0108 -0.0286 0.0038  249 ARG A N     
2063 C CA    . ARG A 249 ? 0.8017 0.6352 0.6334 -0.0053 -0.0274 0.0015  249 ARG A CA    
2064 C C     . ARG A 249 ? 0.8366 0.6763 0.6726 0.0032  -0.0238 -0.0019 249 ARG A C     
2065 O O     . ARG A 249 ? 0.8161 0.6703 0.6629 0.0062  -0.0225 -0.0011 249 ARG A O     
2066 C CB    . ARG A 249 ? 0.8286 0.6571 0.6587 -0.0045 -0.0282 0.0044  249 ARG A CB    
2067 C CG    . ARG A 249 ? 0.9254 0.7331 0.7414 -0.0024 -0.0289 0.0032  249 ARG A CG    
2068 C CD    . ARG A 249 ? 1.0295 0.8232 0.8342 -0.0115 -0.0320 0.0041  249 ARG A CD    
2069 N NE    . ARG A 249 ? 1.0742 0.8705 0.8808 -0.0196 -0.0343 0.0087  249 ARG A NE    
2070 C CZ    . ARG A 249 ? 1.1220 0.9054 0.9200 -0.0219 -0.0358 0.0111  249 ARG A CZ    
2071 N NH1   . ARG A 249 ? 1.1578 0.9234 0.9443 -0.0161 -0.0357 0.0093  249 ARG A NH1   
2072 N NH2   . ARG A 249 ? 1.1144 0.9027 0.9152 -0.0299 -0.0374 0.0153  249 ARG A NH2   
2073 N N     . VAL A 250 ? 0.9067 0.7357 0.7341 0.0069  -0.0222 -0.0057 250 VAL A N     
2074 C CA    . VAL A 250 ? 0.9738 0.8086 0.8049 0.0150  -0.0184 -0.0092 250 VAL A CA    
2075 C C     . VAL A 250 ? 1.0471 0.8742 0.8754 0.0229  -0.0176 -0.0099 250 VAL A C     
2076 O O     . VAL A 250 ? 1.0531 0.8637 0.8699 0.0251  -0.0175 -0.0119 250 VAL A O     
2077 C CB    . VAL A 250 ? 0.9809 0.8100 0.8047 0.0145  -0.0163 -0.0134 250 VAL A CB    
2078 C CG1   . VAL A 250 ? 0.9791 0.8182 0.8090 0.0216  -0.0118 -0.0167 250 VAL A CG1   
2079 C CG2   . VAL A 250 ? 0.9648 0.7975 0.7885 0.0058  -0.0185 -0.0121 250 VAL A CG2   
2080 N N     . LYS A 251 ? 1.1267 0.9650 0.9646 0.0273  -0.0173 -0.0082 251 LYS A N     
2081 C CA    . LYS A 251 ? 1.2201 1.0517 1.0558 0.0343  -0.0179 -0.0077 251 LYS A CA    
2082 C C     . LYS A 251 ? 1.2585 1.1030 1.1040 0.0431  -0.0156 -0.0093 251 LYS A C     
2083 O O     . LYS A 251 ? 1.2445 1.1056 1.1005 0.0423  -0.0144 -0.0091 251 LYS A O     
2084 C CB    . LYS A 251 ? 1.2336 1.0627 1.0687 0.0301  -0.0212 -0.0028 251 LYS A CB    
2085 C CG    . LYS A 251 ? 1.2718 1.0842 1.0972 0.0342  -0.0231 -0.0018 251 LYS A CG    
2086 C CD    . LYS A 251 ? 1.2788 1.0951 1.1076 0.0339  -0.0252 0.0026  251 LYS A CD    
2087 C CE    . LYS A 251 ? 1.3087 1.1098 1.1289 0.0404  -0.0272 0.0034  251 LYS A CE    
2088 N NZ    . LYS A 251 ? 1.3074 1.1126 1.1303 0.0409  -0.0293 0.0075  251 LYS A NZ    
2089 N N     . VAL A 252 ? 1.3312 1.1674 1.1729 0.0514  -0.0154 -0.0107 252 VAL A N     
2090 C CA    . VAL A 252 ? 1.3787 1.2265 1.2297 0.0606  -0.0138 -0.0122 252 VAL A CA    
2091 C C     . VAL A 252 ? 1.4062 1.2624 1.2642 0.0621  -0.0167 -0.0083 252 VAL A C     
2092 O O     . VAL A 252 ? 1.4136 1.2603 1.2657 0.0592  -0.0199 -0.0047 252 VAL A O     
2093 C CB    . VAL A 252 ? 1.3987 1.2345 1.2432 0.0703  -0.0126 -0.0154 252 VAL A CB    
2094 C CG1   . VAL A 252 ? 1.4023 1.2354 1.2429 0.0712  -0.0082 -0.0205 252 VAL A CG1   
2095 C CG2   . VAL A 252 ? 1.4197 1.2333 1.2508 0.0704  -0.0162 -0.0132 252 VAL A CG2   
2096 N N     . ILE A 253 ? 1.4399 1.3138 1.3097 0.0659  -0.0154 -0.0091 253 ILE A N     
2097 C CA    . ILE A 253 ? 1.4786 1.3607 1.3548 0.0687  -0.0181 -0.0060 253 ILE A CA    
2098 C C     . ILE A 253 ? 1.5177 1.3995 1.3959 0.0797  -0.0187 -0.0074 253 ILE A C     
2099 O O     . ILE A 253 ? 1.5215 1.4124 1.4060 0.0850  -0.0156 -0.0111 253 ILE A O     
2100 C CB    . ILE A 253 ? 1.4582 1.3602 1.3459 0.0651  -0.0172 -0.0056 253 ILE A CB    
2101 C CG1   . ILE A 253 ? 1.4542 1.3563 1.3403 0.0553  -0.0172 -0.0037 253 ILE A CG1   
2102 C CG2   . ILE A 253 ? 1.4524 1.3635 1.3465 0.0690  -0.0199 -0.0033 253 ILE A CG2   
2103 C CD1   . ILE A 253 ? 1.4538 1.3489 1.3352 0.0512  -0.0204 0.0007  253 ILE A CD1   
2104 N N     . GLU A 254 ? 1.5607 1.4320 1.4334 0.0831  -0.0227 -0.0044 254 GLU A N     
2105 C CA    . GLU A 254 ? 1.6004 1.4694 1.4742 0.0943  -0.0242 -0.0051 254 GLU A CA    
2106 C C     . GLU A 254 ? 1.6113 1.4890 1.4909 0.0970  -0.0284 -0.0015 254 GLU A C     
2107 O O     . GLU A 254 ? 1.6182 1.4886 1.4917 0.0922  -0.0317 0.0027  254 GLU A O     
2108 C CB    . GLU A 254 ? 1.6266 1.4710 1.4858 0.0977  -0.0259 -0.0049 254 GLU A CB    
2109 C CG    . GLU A 254 ? 1.6493 1.4824 1.5007 0.0966  -0.0221 -0.0089 254 GLU A CG    
2110 C CD    . GLU A 254 ? 1.6837 1.4911 1.5195 0.1005  -0.0241 -0.0089 254 GLU A CD    
2111 O OE1   . GLU A 254 ? 1.6951 1.4892 1.5220 0.0970  -0.0282 -0.0047 254 GLU A OE1   
2112 O OE2   . GLU A 254 ? 1.6977 1.4973 1.5293 0.1069  -0.0212 -0.0132 254 GLU A OE2   
2113 N N     . ASN A 255 ? 1.6215 1.5153 1.5128 0.1041  -0.0282 -0.0030 255 ASN A N     
2114 C CA    . ASN A 255 ? 1.6331 1.5342 1.5294 0.1084  -0.0330 0.0002  255 ASN A CA    
2115 C C     . ASN A 255 ? 1.6496 1.5486 1.5480 0.1213  -0.0349 -0.0010 255 ASN A C     
2116 O O     . ASN A 255 ? 1.6595 1.5481 1.5521 0.1261  -0.0400 0.0023  255 ASN A O     
2117 C CB    . ASN A 255 ? 1.6156 1.5396 1.5247 0.1044  -0.0325 0.0002  255 ASN A CB    
2118 C CG    . ASN A 255 ? 1.6099 1.5514 1.5312 0.1080  -0.0283 -0.0042 255 ASN A CG    
2119 O OD1   . ASN A 255 ? 1.6106 1.5493 1.5304 0.1075  -0.0236 -0.0078 255 ASN A OD1   
2120 N ND2   . ASN A 255 ? 1.5961 1.5559 1.5292 0.1112  -0.0301 -0.0039 255 ASN A ND2   
2121 N N     . MET A 256 ? 1.6511 1.5599 1.5576 0.1270  -0.0306 -0.0057 256 MET A N     
2122 C CA    . MET A 256 ? 1.6654 1.5728 1.5747 0.1401  -0.0309 -0.0079 256 MET A CA    
2123 C C     . MET A 256 ? 1.6594 1.5756 1.5749 0.1427  -0.0238 -0.0138 256 MET A C     
2124 O O     . MET A 256 ? 1.6714 1.5720 1.5767 0.1423  -0.0204 -0.0165 256 MET A O     
2125 C CB    . MET A 256 ? 1.6668 1.5893 1.5873 0.1473  -0.0358 -0.0056 256 MET A CB    
2126 C CG    . MET A 256 ? 1.6886 1.6055 1.6099 0.1620  -0.0382 -0.0064 256 MET A CG    
2127 S SD    . MET A 256 ? 1.7022 1.6157 1.6224 0.1683  -0.0480 -0.0004 256 MET A SD    
2128 C CE    . MET A 256 ? 1.6762 1.6202 1.6131 0.1625  -0.0499 0.0012  256 MET A CE    
2129 N N     . TYR A 257 ? 1.6383 1.5792 1.5696 0.1444  -0.0216 -0.0158 257 TYR A N     
2130 C CA    . TYR A 257 ? 1.6243 1.5760 1.5626 0.1476  -0.0146 -0.0214 257 TYR A CA    
2131 C C     . TYR A 257 ? 1.5977 1.5494 1.5320 0.1363  -0.0094 -0.0235 257 TYR A C     
2132 O O     . TYR A 257 ? 1.5835 1.5463 1.5223 0.1269  -0.0098 -0.0217 257 TYR A O     
2133 C CB    . TYR A 257 ? 1.6231 1.6023 1.5801 0.1530  -0.0142 -0.0225 257 TYR A CB    
2134 C CG    . TYR A 257 ? 1.6445 1.6277 1.6072 0.1615  -0.0212 -0.0190 257 TYR A CG    
2135 C CD1   . TYR A 257 ? 1.6384 1.6338 1.6073 0.1563  -0.0265 -0.0148 257 TYR A CD1   
2136 C CD2   . TYR A 257 ? 1.6694 1.6429 1.6301 0.1749  -0.0230 -0.0197 257 TYR A CD2   
2137 C CE1   . TYR A 257 ? 1.6516 1.6502 1.6247 0.1637  -0.0336 -0.0113 257 TYR A CE1   
2138 C CE2   . TYR A 257 ? 1.6810 1.6577 1.6466 0.1831  -0.0302 -0.0161 257 TYR A CE2   
2139 C CZ    . TYR A 257 ? 1.6715 1.6610 1.6431 0.1771  -0.0357 -0.0118 257 TYR A CZ    
2140 O OH    . TYR A 257 ? 1.6718 1.6640 1.6473 0.1848  -0.0434 -0.0081 257 TYR A OH    
2141 N N     . GLY A 258 ? 1.5827 1.5212 1.5080 0.1373  -0.0047 -0.0273 258 GLY A N     
2142 C CA    . GLY A 258 ? 1.5419 1.4785 1.4619 0.1273  -0.0001 -0.0294 258 GLY A CA    
2143 C C     . GLY A 258 ? 1.5155 1.4351 1.4229 0.1174  -0.0031 -0.0260 258 GLY A C     
2144 O O     . GLY A 258 ? 1.5189 1.4279 1.4211 0.1175  -0.0085 -0.0220 258 GLY A O     
2145 N N     . SER A 259 ? 1.4799 1.3974 1.3825 0.1086  0.0002  -0.0276 259 SER A N     
2146 C CA    . SER A 259 ? 1.4413 1.3454 1.3336 0.0986  -0.0023 -0.0247 259 SER A CA    
2147 C C     . SER A 259 ? 1.3917 1.3036 1.2852 0.0888  0.0006  -0.0255 259 SER A C     
2148 O O     . SER A 259 ? 1.3868 1.3061 1.2829 0.0892  0.0055  -0.0294 259 SER A O     
2149 C CB    . SER A 259 ? 1.4661 1.3453 1.3426 0.0998  -0.0029 -0.0255 259 SER A CB    
2150 O OG    . SER A 259 ? 1.4776 1.3521 1.3491 0.1019  0.0024  -0.0305 259 SER A OG    
2151 N N     . ARG A 260 ? 1.3368 1.2469 1.2282 0.0801  -0.0025 -0.0219 260 ARG A N     
2152 C CA    . ARG A 260 ? 1.2811 1.1954 1.1720 0.0708  -0.0009 -0.0221 260 ARG A CA    
2153 C C     . ARG A 260 ? 1.2334 1.1338 1.1149 0.0632  -0.0040 -0.0191 260 ARG A C     
2154 O O     . ARG A 260 ? 1.2353 1.1290 1.1144 0.0633  -0.0078 -0.0158 260 ARG A O     
2155 C CB    . ARG A 260 ? 1.2748 1.2086 1.1775 0.0677  -0.0008 -0.0208 260 ARG A CB    
2156 C CG    . ARG A 260 ? 1.2789 1.2163 1.1856 0.0666  -0.0053 -0.0165 260 ARG A CG    
2157 C CD    . ARG A 260 ? 1.2773 1.2320 1.1936 0.0629  -0.0050 -0.0158 260 ARG A CD    
2158 N NE    . ARG A 260 ? 1.2848 1.2412 1.2028 0.0604  -0.0089 -0.0119 260 ARG A NE    
2159 C CZ    . ARG A 260 ? 1.2914 1.2451 1.2066 0.0533  -0.0101 -0.0096 260 ARG A CZ    
2160 N NH1   . ARG A 260 ? 1.2918 1.2412 1.2028 0.0480  -0.0083 -0.0106 260 ARG A NH1   
2161 N NH2   . ARG A 260 ? 1.2878 1.2432 1.2041 0.0517  -0.0130 -0.0064 260 ARG A NH2   
2162 N N     . GLU A 261 ? 1.1670 1.0637 1.0433 0.0566  -0.0025 -0.0203 261 GLU A N     
2163 C CA    . GLU A 261 ? 1.0948 0.9795 0.9629 0.0492  -0.0055 -0.0177 261 GLU A CA    
2164 C C     . GLU A 261 ? 1.0078 0.9021 0.8813 0.0416  -0.0071 -0.0149 261 GLU A C     
2165 O O     . GLU A 261 ? 0.9929 0.8963 0.8701 0.0388  -0.0051 -0.0162 261 GLU A O     
2166 C CB    . GLU A 261 ? 1.1228 0.9935 0.9792 0.0469  -0.0040 -0.0206 261 GLU A CB    
2167 C CG    . GLU A 261 ? 1.1537 1.0068 0.9999 0.0522  -0.0045 -0.0219 261 GLU A CG    
2168 C CD    . GLU A 261 ? 1.1710 1.0102 1.0049 0.0511  -0.0021 -0.0257 261 GLU A CD    
2169 O OE1   . GLU A 261 ? 1.1814 1.0222 1.0129 0.0441  -0.0015 -0.0263 261 GLU A OE1   
2170 O OE2   . GLU A 261 ? 1.1653 0.9910 0.9911 0.0573  -0.0012 -0.0281 261 GLU A OE2   
2171 N N     . ILE A 262 ? 0.9109 0.8027 0.7844 0.0386  -0.0105 -0.0110 262 ILE A N     
2172 C CA    . ILE A 262 ? 0.8012 0.7006 0.6792 0.0320  -0.0120 -0.0083 262 ILE A CA    
2173 C C     . ILE A 262 ? 0.7364 0.6257 0.6073 0.0252  -0.0142 -0.0065 262 ILE A C     
2174 O O     . ILE A 262 ? 0.7101 0.5855 0.5721 0.0251  -0.0153 -0.0067 262 ILE A O     
2175 C CB    . ILE A 262 ? 0.8014 0.7087 0.6862 0.0333  -0.0136 -0.0052 262 ILE A CB    
2176 C CG1   . ILE A 262 ? 0.8286 0.7251 0.7076 0.0329  -0.0162 -0.0023 262 ILE A CG1   
2177 C CG2   . ILE A 262 ? 0.7770 0.6941 0.6685 0.0399  -0.0122 -0.0067 262 ILE A CG2   
2178 C CD1   . ILE A 262 ? 0.8338 0.7367 0.7173 0.0307  -0.0178 0.0013  262 ILE A CD1   
2179 N N     . ILE A 263 ? 0.6367 0.5329 0.5116 0.0195  -0.0151 -0.0049 263 ILE A N     
2180 C CA    . ILE A 263 ? 0.5858 0.4756 0.4561 0.0126  -0.0176 -0.0030 263 ILE A CA    
2181 C C     . ILE A 263 ? 0.5421 0.4361 0.4169 0.0097  -0.0196 0.0009  263 ILE A C     
2182 O O     . ILE A 263 ? 0.5169 0.4224 0.3998 0.0100  -0.0191 0.0021  263 ILE A O     
2183 C CB    . ILE A 263 ? 0.5695 0.4639 0.4408 0.0083  -0.0177 -0.0038 263 ILE A CB    
2184 C CG1   . ILE A 263 ? 0.5642 0.4561 0.4311 0.0108  -0.0150 -0.0078 263 ILE A CG1   
2185 C CG2   . ILE A 263 ? 0.5657 0.4540 0.4325 0.0012  -0.0210 -0.0018 263 ILE A CG2   
2186 C CD1   . ILE A 263 ? 0.5304 0.4077 0.3865 0.0124  -0.0144 -0.0103 263 ILE A CD1   
2187 N N     . THR A 264 ? 0.5001 0.3840 0.3687 0.0067  -0.0215 0.0028  264 THR A N     
2188 C CA    . THR A 264 ? 0.4809 0.3685 0.3529 0.0027  -0.0230 0.0066  264 THR A CA    
2189 C C     . THR A 264 ? 0.4777 0.3695 0.3522 -0.0043 -0.0247 0.0081  264 THR A C     
2190 O O     . THR A 264 ? 0.4766 0.3600 0.3445 -0.0085 -0.0265 0.0076  264 THR A O     
2191 C CB    . THR A 264 ? 0.5099 0.3848 0.3738 0.0019  -0.0243 0.0084  264 THR A CB    
2192 O OG1   . THR A 264 ? 0.5149 0.3861 0.3769 0.0092  -0.0233 0.0073  264 THR A OG1   
2193 C CG2   . THR A 264 ? 0.4737 0.3534 0.3409 -0.0032 -0.0252 0.0123  264 THR A CG2   
2194 N N     . LEU A 265 ? 0.4191 0.3237 0.3028 -0.0054 -0.0243 0.0098  265 LEU A N     
2195 C CA    . LEU A 265 ? 0.4002 0.3112 0.2885 -0.0110 -0.0261 0.0115  265 LEU A CA    
2196 C C     . LEU A 265 ? 0.4117 0.3258 0.3027 -0.0151 -0.0266 0.0149  265 LEU A C     
2197 O O     . LEU A 265 ? 0.3944 0.3171 0.2917 -0.0132 -0.0247 0.0161  265 LEU A O     
2198 C CB    . LEU A 265 ? 0.3646 0.2876 0.2612 -0.0088 -0.0252 0.0109  265 LEU A CB    
2199 C CG    . LEU A 265 ? 0.3888 0.3109 0.2835 -0.0053 -0.0241 0.0077  265 LEU A CG    
2200 C CD1   . LEU A 265 ? 0.3944 0.3273 0.2966 -0.0034 -0.0231 0.0077  265 LEU A CD1   
2201 C CD2   . LEU A 265 ? 0.3620 0.2765 0.2499 -0.0087 -0.0261 0.0065  265 LEU A CD2   
2202 N N     . PHE A 266 ? 0.4036 0.3105 0.2894 -0.0211 -0.0289 0.0164  266 PHE A N     
2203 C CA    . PHE A 266 ? 0.4414 0.3511 0.3292 -0.0266 -0.0293 0.0198  266 PHE A CA    
2204 C C     . PHE A 266 ? 0.4204 0.3468 0.3205 -0.0283 -0.0289 0.0215  266 PHE A C     
2205 O O     . PHE A 266 ? 0.3861 0.3184 0.2908 -0.0291 -0.0306 0.0210  266 PHE A O     
2206 C CB    . PHE A 266 ? 0.4548 0.3532 0.3340 -0.0338 -0.0323 0.0208  266 PHE A CB    
2207 C CG    . PHE A 266 ? 0.5190 0.3998 0.3854 -0.0324 -0.0324 0.0200  266 PHE A CG    
2208 C CD1   . PHE A 266 ? 0.5399 0.4109 0.3995 -0.0265 -0.0319 0.0165  266 PHE A CD1   
2209 C CD2   . PHE A 266 ? 0.5624 0.4363 0.4234 -0.0368 -0.0327 0.0227  266 PHE A CD2   
2210 C CE1   . PHE A 266 ? 0.5688 0.4233 0.4169 -0.0240 -0.0320 0.0157  266 PHE A CE1   
2211 C CE2   . PHE A 266 ? 0.6289 0.4847 0.4770 -0.0350 -0.0332 0.0221  266 PHE A CE2   
2212 C CZ    . PHE A 266 ? 0.6202 0.4663 0.4622 -0.0280 -0.0329 0.0185  266 PHE A CZ    
2213 N N     . GLY A 267 ? 0.4035 0.3370 0.3084 -0.0282 -0.0265 0.0234  267 GLY A N     
2214 C CA    . GLY A 267 ? 0.3968 0.3462 0.3133 -0.0288 -0.0252 0.0248  267 GLY A CA    
2215 C C     . GLY A 267 ? 0.3894 0.3462 0.3117 -0.0218 -0.0230 0.0230  267 GLY A C     
2216 O O     . GLY A 267 ? 0.3944 0.3632 0.3259 -0.0210 -0.0221 0.0236  267 GLY A O     
2217 N N     . ILE A 268 ? 0.3702 0.3199 0.2871 -0.0167 -0.0223 0.0206  268 ILE A N     
2218 C CA    . ILE A 268 ? 0.3440 0.2993 0.2646 -0.0108 -0.0201 0.0189  268 ILE A CA    
2219 C C     . ILE A 268 ? 0.3650 0.3152 0.2806 -0.0073 -0.0183 0.0185  268 ILE A C     
2220 O O     . ILE A 268 ? 0.3674 0.3074 0.2756 -0.0072 -0.0193 0.0183  268 ILE A O     
2221 C CB    . ILE A 268 ? 0.3609 0.3152 0.2813 -0.0084 -0.0215 0.0165  268 ILE A CB    
2222 C CG1   . ILE A 268 ? 0.3500 0.3108 0.2762 -0.0112 -0.0236 0.0175  268 ILE A CG1   
2223 C CG2   . ILE A 268 ? 0.3416 0.2995 0.2638 -0.0030 -0.0193 0.0146  268 ILE A CG2   
2224 C CD1   . ILE A 268 ? 0.3499 0.3070 0.2732 -0.0108 -0.0258 0.0157  268 ILE A CD1   
2225 N N     . SER A 269 ? 0.3147 0.2716 0.2340 -0.0043 -0.0159 0.0183  269 SER A N     
2226 C CA    . SER A 269 ? 0.3377 0.2909 0.2526 -0.0009 -0.0148 0.0180  269 SER A CA    
2227 C C     . SER A 269 ? 0.3410 0.2964 0.2573 0.0038  -0.0146 0.0153  269 SER A C     
2228 O O     . SER A 269 ? 0.3257 0.2882 0.2465 0.0051  -0.0133 0.0146  269 SER A O     
2229 C CB    . SER A 269 ? 0.3279 0.2858 0.2441 -0.0018 -0.0124 0.0198  269 SER A CB    
2230 O OG    . SER A 269 ? 0.3278 0.2832 0.2418 -0.0069 -0.0124 0.0224  269 SER A OG    
2231 N N     . VAL A 270 ? 0.3367 0.2858 0.2487 0.0062  -0.0157 0.0138  270 VAL A N     
2232 C CA    . VAL A 270 ? 0.3252 0.2768 0.2384 0.0100  -0.0154 0.0112  270 VAL A CA    
2233 C C     . VAL A 270 ? 0.3507 0.3038 0.2631 0.0133  -0.0148 0.0112  270 VAL A C     
2234 O O     . VAL A 270 ? 0.3432 0.2908 0.2513 0.0148  -0.0157 0.0120  270 VAL A O     
2235 C CB    . VAL A 2