data_3SRG
# 
_entry.id   3SRG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3SRG         
RCSB  RCSB066560   
WWPDB D_1000066560 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1V04 . unspecified 
PDB 3SRE . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3SRG 
_pdbx_database_status.recvd_initial_deposition_date   2011-07-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ben David, M.' 1 
'Elias, M.'     2 
'Silman, I.'    3 
'Sussman, J.L.' 4 
'Tawfik, D.S.'  5 
# 
_citation.id                        primary 
_citation.title                     'Catalytic versatility and backups in enzyme active sites: the case of serum paraoxonase 1.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            418 
_citation.page_first                181 
_citation.page_last                 196 
_citation.year                      2012 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22387469 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2012.02.042 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ben-David, M.' 1 
primary 'Elias, M.'     2 
primary 'Filippi, J.J.' 3 
primary 'Dunach, E.'    4 
primary 'Silman, I.'    5 
primary 'Sussman, J.L.' 6 
primary 'Tawfik, D.S.'  7 
# 
_cell.entry_id           3SRG 
_cell.length_a           93.544 
_cell.length_b           93.544 
_cell.length_c           144.621 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3SRG 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'serum paraoxonase'      39603.949 1   3.1.1.2 ? ? ? 
2 non-polymer syn 'CALCIUM ION'            40.078    3   ?       ? ? ? 
3 non-polymer syn 'QUINOLIN-2(1H)-ONE'     145.158   1   ?       ? ? ? 
4 non-polymer syn DODECYL-BETA-D-MALTOSIDE 510.615   1   ?       ? ? ? 
5 non-polymer syn 'BROMIDE ION'            79.904    1   ?       ? ? ? 
6 non-polymer syn 'CHLORIDE ION'           35.453    2   ?       ? ? ? 
7 water       nat water                    18.015    112 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PON1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAKLTALTLLGMGLALFDRQKSSFQTRFNVHREVTPVELPNCNLVKGIDNGSEDLEILPNGLAFISSGLKYPGIMSFDPD
KSGKILLMDLNEKEPAVSELEIIGNTLDISSFNPHGISTFIDDDNTVYLLVVNHPGSSSTVEVFKFQEEEKSLLHLKTIR
HKLLPSVNDIVAVGPEHFYATNDHYFIDPYLKSWEMHLGLAWSFVTYYSPNDVRVVAEGFDFANGINISPDGKYVYIAEL
LAHKIHVYEKHANWTLTPLRVLSFDTLVDNISVDPVTGDLWVGCHPNGMRIFFYDAENPPGSEVLRIQDILSEEPKVTVV
YAENGTVLQGSTVAAVYKGKLLIGTVFHKALYCDL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAKLTALTLLGMGLALFDRQKSSFQTRFNVHREVTPVELPNCNLVKGIDNGSEDLEILPNGLAFISSGLKYPGIMSFDPD
KSGKILLMDLNEKEPAVSELEIIGNTLDISSFNPHGISTFIDDDNTVYLLVVNHPGSSSTVEVFKFQEEEKSLLHLKTIR
HKLLPSVNDIVAVGPEHFYATNDHYFIDPYLKSWEMHLGLAWSFVTYYSPNDVRVVAEGFDFANGINISPDGKYVYIAEL
LAHKIHVYEKHANWTLTPLRVLSFDTLVDNISVDPVTGDLWVGCHPNGMRIFFYDAENPPGSEVLRIQDILSEEPKVTVV
YAENGTVLQGSTVAAVYKGKLLIGTVFHKALYCDL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   LYS n 
1 4   LEU n 
1 5   THR n 
1 6   ALA n 
1 7   LEU n 
1 8   THR n 
1 9   LEU n 
1 10  LEU n 
1 11  GLY n 
1 12  MET n 
1 13  GLY n 
1 14  LEU n 
1 15  ALA n 
1 16  LEU n 
1 17  PHE n 
1 18  ASP n 
1 19  ARG n 
1 20  GLN n 
1 21  LYS n 
1 22  SER n 
1 23  SER n 
1 24  PHE n 
1 25  GLN n 
1 26  THR n 
1 27  ARG n 
1 28  PHE n 
1 29  ASN n 
1 30  VAL n 
1 31  HIS n 
1 32  ARG n 
1 33  GLU n 
1 34  VAL n 
1 35  THR n 
1 36  PRO n 
1 37  VAL n 
1 38  GLU n 
1 39  LEU n 
1 40  PRO n 
1 41  ASN n 
1 42  CYS n 
1 43  ASN n 
1 44  LEU n 
1 45  VAL n 
1 46  LYS n 
1 47  GLY n 
1 48  ILE n 
1 49  ASP n 
1 50  ASN n 
1 51  GLY n 
1 52  SER n 
1 53  GLU n 
1 54  ASP n 
1 55  LEU n 
1 56  GLU n 
1 57  ILE n 
1 58  LEU n 
1 59  PRO n 
1 60  ASN n 
1 61  GLY n 
1 62  LEU n 
1 63  ALA n 
1 64  PHE n 
1 65  ILE n 
1 66  SER n 
1 67  SER n 
1 68  GLY n 
1 69  LEU n 
1 70  LYS n 
1 71  TYR n 
1 72  PRO n 
1 73  GLY n 
1 74  ILE n 
1 75  MET n 
1 76  SER n 
1 77  PHE n 
1 78  ASP n 
1 79  PRO n 
1 80  ASP n 
1 81  LYS n 
1 82  SER n 
1 83  GLY n 
1 84  LYS n 
1 85  ILE n 
1 86  LEU n 
1 87  LEU n 
1 88  MET n 
1 89  ASP n 
1 90  LEU n 
1 91  ASN n 
1 92  GLU n 
1 93  LYS n 
1 94  GLU n 
1 95  PRO n 
1 96  ALA n 
1 97  VAL n 
1 98  SER n 
1 99  GLU n 
1 100 LEU n 
1 101 GLU n 
1 102 ILE n 
1 103 ILE n 
1 104 GLY n 
1 105 ASN n 
1 106 THR n 
1 107 LEU n 
1 108 ASP n 
1 109 ILE n 
1 110 SER n 
1 111 SER n 
1 112 PHE n 
1 113 ASN n 
1 114 PRO n 
1 115 HIS n 
1 116 GLY n 
1 117 ILE n 
1 118 SER n 
1 119 THR n 
1 120 PHE n 
1 121 ILE n 
1 122 ASP n 
1 123 ASP n 
1 124 ASP n 
1 125 ASN n 
1 126 THR n 
1 127 VAL n 
1 128 TYR n 
1 129 LEU n 
1 130 LEU n 
1 131 VAL n 
1 132 VAL n 
1 133 ASN n 
1 134 HIS n 
1 135 PRO n 
1 136 GLY n 
1 137 SER n 
1 138 SER n 
1 139 SER n 
1 140 THR n 
1 141 VAL n 
1 142 GLU n 
1 143 VAL n 
1 144 PHE n 
1 145 LYS n 
1 146 PHE n 
1 147 GLN n 
1 148 GLU n 
1 149 GLU n 
1 150 GLU n 
1 151 LYS n 
1 152 SER n 
1 153 LEU n 
1 154 LEU n 
1 155 HIS n 
1 156 LEU n 
1 157 LYS n 
1 158 THR n 
1 159 ILE n 
1 160 ARG n 
1 161 HIS n 
1 162 LYS n 
1 163 LEU n 
1 164 LEU n 
1 165 PRO n 
1 166 SER n 
1 167 VAL n 
1 168 ASN n 
1 169 ASP n 
1 170 ILE n 
1 171 VAL n 
1 172 ALA n 
1 173 VAL n 
1 174 GLY n 
1 175 PRO n 
1 176 GLU n 
1 177 HIS n 
1 178 PHE n 
1 179 TYR n 
1 180 ALA n 
1 181 THR n 
1 182 ASN n 
1 183 ASP n 
1 184 HIS n 
1 185 TYR n 
1 186 PHE n 
1 187 ILE n 
1 188 ASP n 
1 189 PRO n 
1 190 TYR n 
1 191 LEU n 
1 192 LYS n 
1 193 SER n 
1 194 TRP n 
1 195 GLU n 
1 196 MET n 
1 197 HIS n 
1 198 LEU n 
1 199 GLY n 
1 200 LEU n 
1 201 ALA n 
1 202 TRP n 
1 203 SER n 
1 204 PHE n 
1 205 VAL n 
1 206 THR n 
1 207 TYR n 
1 208 TYR n 
1 209 SER n 
1 210 PRO n 
1 211 ASN n 
1 212 ASP n 
1 213 VAL n 
1 214 ARG n 
1 215 VAL n 
1 216 VAL n 
1 217 ALA n 
1 218 GLU n 
1 219 GLY n 
1 220 PHE n 
1 221 ASP n 
1 222 PHE n 
1 223 ALA n 
1 224 ASN n 
1 225 GLY n 
1 226 ILE n 
1 227 ASN n 
1 228 ILE n 
1 229 SER n 
1 230 PRO n 
1 231 ASP n 
1 232 GLY n 
1 233 LYS n 
1 234 TYR n 
1 235 VAL n 
1 236 TYR n 
1 237 ILE n 
1 238 ALA n 
1 239 GLU n 
1 240 LEU n 
1 241 LEU n 
1 242 ALA n 
1 243 HIS n 
1 244 LYS n 
1 245 ILE n 
1 246 HIS n 
1 247 VAL n 
1 248 TYR n 
1 249 GLU n 
1 250 LYS n 
1 251 HIS n 
1 252 ALA n 
1 253 ASN n 
1 254 TRP n 
1 255 THR n 
1 256 LEU n 
1 257 THR n 
1 258 PRO n 
1 259 LEU n 
1 260 ARG n 
1 261 VAL n 
1 262 LEU n 
1 263 SER n 
1 264 PHE n 
1 265 ASP n 
1 266 THR n 
1 267 LEU n 
1 268 VAL n 
1 269 ASP n 
1 270 ASN n 
1 271 ILE n 
1 272 SER n 
1 273 VAL n 
1 274 ASP n 
1 275 PRO n 
1 276 VAL n 
1 277 THR n 
1 278 GLY n 
1 279 ASP n 
1 280 LEU n 
1 281 TRP n 
1 282 VAL n 
1 283 GLY n 
1 284 CYS n 
1 285 HIS n 
1 286 PRO n 
1 287 ASN n 
1 288 GLY n 
1 289 MET n 
1 290 ARG n 
1 291 ILE n 
1 292 PHE n 
1 293 PHE n 
1 294 TYR n 
1 295 ASP n 
1 296 ALA n 
1 297 GLU n 
1 298 ASN n 
1 299 PRO n 
1 300 PRO n 
1 301 GLY n 
1 302 SER n 
1 303 GLU n 
1 304 VAL n 
1 305 LEU n 
1 306 ARG n 
1 307 ILE n 
1 308 GLN n 
1 309 ASP n 
1 310 ILE n 
1 311 LEU n 
1 312 SER n 
1 313 GLU n 
1 314 GLU n 
1 315 PRO n 
1 316 LYS n 
1 317 VAL n 
1 318 THR n 
1 319 VAL n 
1 320 VAL n 
1 321 TYR n 
1 322 ALA n 
1 323 GLU n 
1 324 ASN n 
1 325 GLY n 
1 326 THR n 
1 327 VAL n 
1 328 LEU n 
1 329 GLN n 
1 330 GLY n 
1 331 SER n 
1 332 THR n 
1 333 VAL n 
1 334 ALA n 
1 335 ALA n 
1 336 VAL n 
1 337 TYR n 
1 338 LYS n 
1 339 GLY n 
1 340 LYS n 
1 341 LEU n 
1 342 LEU n 
1 343 ILE n 
1 344 GLY n 
1 345 THR n 
1 346 VAL n 
1 347 PHE n 
1 348 HIS n 
1 349 LYS n 
1 350 ALA n 
1 351 LEU n 
1 352 TYR n 
1 353 CYS n 
1 354 ASP n 
1 355 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'artificial gene' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     32630 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Origami DE3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PET32 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET32 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   
'From shuffled genes of Homo sapiens, Oryctolagus cuniculus, Mus musculus, and Rattus rattus paraoxonase' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    3SRG 
_struct_ref.pdbx_db_accession          3SRG 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   
;MAKLTALTLLGMGLALFDRQKSSFQTRFNVHREVTPVELPNCNLVKGIDNGSEDLEILPNGLAFISSGLKYPGIMSFDPD
KSGKILLMDLNEKEPAVSELEIIGNTLDISSFNPHGISTFIDDDNTVYLLVVNHPGSSSTVEVFKFQEEEKSLLHLKTIR
HKLLPSVNDIVAVGPEHFYATNDHYFIDPYLKSWEMHLGLAWSFVTYYSPNDVRVVAEGFDFANGINISPDGKYVYIAEL
LAHKIHVYEKHANWTLTPLRVLSFDTLVDNISVDPVTGDLWVGCHPNGMRIFFYDAENPPGSEVLRIQDILSEEPKVTVV
YAENGTVLQGSTVAAVYKGKLLIGTVFHKALYCDL
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3SRG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 355 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             3SRG 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  355 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       355 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ?              'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ?              'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ?              'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ?              'C4 H7 N O4'     133.103 
BR  non-polymer         . 'BROMIDE ION'            ?              'Br -1'          79.904  
CA  non-polymer         . 'CALCIUM ION'            ?              'Ca 2'           40.078  
CL  non-polymer         . 'CHLORIDE ION'           ?              'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE                 ?              'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                ?              'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ?              'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ?              'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ?              'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ?              'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ?              'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ?              'C6 H13 N O2'    131.173 
LMT D-saccharide        . DODECYL-BETA-D-MALTOSIDE ?              'C24 H46 O11'    510.615 
LYS 'L-peptide linking' y LYSINE                   ?              'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ?              'C5 H11 N O2 S'  149.211 
OCH non-polymer         . 'QUINOLIN-2(1H)-ONE'     2-OXOQUINOLINE 'C9 H7 N O'      145.158 
PHE 'L-peptide linking' y PHENYLALANINE            ?              'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                  ?              'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ?              'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ?              'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ?              'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ?              'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ?              'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3SRG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.99 
_exptl_crystal.density_percent_sol   69.21 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'20% PEG3350, 0.2 M sodium bromide, 0.1 M Bis-tris propane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 292K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2009-12-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.979 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3SRG 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             46.77 
_reflns.d_resolution_high            2.19 
_reflns.number_obs                   33798 
_reflns.number_all                   33798 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.113 
_reflns.pdbx_Rsym_value              0.094 
_reflns.pdbx_netI_over_sigmaI        30.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              14.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.19 
_reflns_shell.d_res_low              2.24 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.621 
_reflns_shell.pdbx_Rsym_value        0.598 
_reflns_shell.meanI_over_sigI_obs    5.95 
_reflns_shell.pdbx_redundancy        14.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3SRG 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     32016 
_refine.ls_number_reflns_all                     32016 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.77 
_refine.ls_d_res_high                            2.19 
_refine.ls_percent_reflns_obs                    99.55 
_refine.ls_R_factor_obs                          0.18432 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18209 
_refine.ls_R_factor_R_free                       0.22695 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1705 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.919 
_refine.B_iso_mean                               30.583 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 3SRE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.147 
_refine.pdbx_overall_ESU_R_Free                  0.148 
_refine.overall_SU_ML                            0.082 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.107 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2605 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         41 
_refine_hist.number_atoms_solvent             112 
_refine_hist.number_atoms_total               2758 
_refine_hist.d_res_high                       2.19 
_refine_hist.d_res_low                        46.77 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.030  0.022  ? 2713 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.196  1.967  ? 3714 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       8.917  5.000  ? 336  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.484 24.655 ? 116  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.580 15.000 ? 401  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       27.776 15.000 ? 7    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.209  0.200  ? 431  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.012  0.021  ? 2063 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.571  1.500  ? 1682 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.679  2.000  ? 2732 'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.879  3.000  ? 1031 'X-RAY DIFFRACTION' ? 
r_scangle_it                 6.046  4.500  ? 982  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.19 
_refine_ls_shell.d_res_low                        2.244 
_refine_ls_shell.number_reflns_R_work             2186 
_refine_ls_shell.R_factor_R_work                  0.213 
_refine_ls_shell.percent_reflns_obs               94.31 
_refine_ls_shell.R_factor_R_free                  0.251 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             119 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    3SRG 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  3SRG 
_struct.title                     'Serum paraoxonase-1 by directed evolution at pH 6.5 in complex with 2-hydroxyquinoline' 
_struct.pdbx_descriptor           'serum paraoxonase (E.C.3.1.1.2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3SRG 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'directed evolution, 6-blades-propeller fold, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 2 ? 
J N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 19  ? PHE A 28  ? ARG A 19  PHE A 28  1 ? 10 
HELX_P HELX_P2 2 ASP A 108 ? PHE A 112 ? ASP A 108 PHE A 112 5 ? 5  
HELX_P HELX_P3 3 ASP A 188 ? LEU A 198 ? ASP A 188 LEU A 198 1 ? 11 
HELX_P HELX_P4 4 ASN A 287 ? PHE A 293 ? ASN A 287 PHE A 293 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 42  SG  ? ? ? 1_555 A CYS 353 SG ? ? A CYS 42   A CYS 353  1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc1  metalc ? ? A ASN 224 OD1 ? ? ? 1_555 C CA  .   CA ? ? A ASN 224  A CA  1357 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc2  metalc ? ? A ASN 270 OD1 ? ? ? 1_555 C CA  .   CA ? ? A ASN 270  A CA  1357 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc3  metalc ? ? A ASP 54  OD2 ? ? ? 1_555 B CA  .   CA ? ? A ASP 54   A CA  1356 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc4  metalc ? ? B CA  .   CA  ? ? ? 1_555 J HOH .   O  ? ? A CA  1356 A HOH 378  1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc5  metalc ? ? A ASP 169 OD1 ? ? ? 1_555 B CA  .   CA ? ? A ASP 169  A CA  1356 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc6  metalc ? ? A ASP 269 OD2 ? ? ? 1_555 C CA  .   CA ? ? A ASP 269  A CA  1357 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc7  metalc ? ? C CA  .   CA  ? ? ? 1_555 D OCH .   O1 ? ? A CA  1357 A OCH 1358 1_555 ? ? ? ? ? ? ? 2.396 ? 
metalc8  metalc ? ? A GLU 53  OE2 ? ? ? 1_555 C CA  .   CA ? ? A GLU 53   A CA  1357 1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc9  metalc ? ? A ILE 117 O   ? ? ? 1_555 B CA  .   CA ? ? A ILE 117  A CA  1356 1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc10 metalc ? ? A ASP 169 OD2 ? ? ? 1_555 B CA  .   CA ? ? A ASP 169  A CA  1356 1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc11 metalc ? ? C CA  .   CA  ? ? ? 1_555 J HOH .   O  ? ? A CA  1357 A HOH 359  1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc12 metalc ? ? B CA  .   CA  ? ? ? 1_555 J HOH .   O  ? ? A CA  1356 A HOH 361  1_555 ? ? ? ? ? ? ? 2.519 ? 
metalc13 metalc ? ? A ASN 168 OD1 ? ? ? 1_555 C CA  .   CA ? ? A ASN 168  A CA  1357 1_555 ? ? ? ? ? ? ? 2.602 ? 
metalc14 metalc ? ? B CA  .   CA  ? ? ? 1_555 J HOH .   O  ? ? A CA  1356 A HOH 360  1_555 ? ? ? ? ? ? ? 2.625 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 5 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 42  ? LEU A 44  ? CYS A 42  LEU A 44  
A 2 LEU A 351 ? ASP A 354 ? LEU A 351 ASP A 354 
A 3 LYS A 340 ? THR A 345 ? LYS A 340 THR A 345 
A 4 SER A 331 ? TYR A 337 ? SER A 331 TYR A 337 
B 1 ASP A 54  ? ILE A 57  ? ASP A 54  ILE A 57  
B 2 LEU A 62  ? SER A 67  ? LEU A 62  SER A 67  
B 3 LYS A 84  ? ASP A 89  ? LYS A 84  ASP A 89  
B 4 SER A 98  ? GLU A 99  ? SER A 98  GLU A 99  
C 1 GLU A 101 ? ILE A 103 ? GLU A 101 ILE A 103 
C 2 SER A 152 ? ILE A 159 ? SER A 152 ILE A 159 
C 3 THR A 140 ? GLN A 147 ? THR A 140 GLN A 147 
C 4 VAL A 127 ? ASN A 133 ? VAL A 127 ASN A 133 
C 5 PRO A 114 ? ILE A 121 ? PRO A 114 ILE A 121 
D 1 VAL A 167 ? GLY A 174 ? VAL A 167 GLY A 174 
D 2 HIS A 177 ? ASN A 182 ? HIS A 177 ASN A 182 
D 3 SER A 203 ? TYR A 208 ? SER A 203 TYR A 208 
D 4 ARG A 214 ? PHE A 220 ? ARG A 214 PHE A 220 
E 1 ALA A 223 ? ILE A 228 ? ALA A 223 ILE A 228 
E 2 TYR A 234 ? GLU A 239 ? TYR A 234 GLU A 239 
E 3 LYS A 244 ? LYS A 250 ? LYS A 244 LYS A 250 
E 4 LEU A 256 ? SER A 263 ? LEU A 256 SER A 263 
F 1 LEU A 267 ? VAL A 273 ? LEU A 267 VAL A 273 
F 2 LEU A 280 ? HIS A 285 ? LEU A 280 HIS A 285 
F 3 SER A 302 ? GLN A 308 ? SER A 302 GLN A 308 
F 4 LYS A 316 ? GLU A 323 ? LYS A 316 GLU A 323 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASN A 43  ? N ASN A 43  O TYR A 352 ? O TYR A 352 
A 2 3 O CYS A 353 ? O CYS A 353 N LEU A 341 ? N LEU A 341 
A 3 4 O LEU A 342 ? O LEU A 342 N ALA A 335 ? N ALA A 335 
B 1 2 N GLU A 56  ? N GLU A 56  O PHE A 64  ? O PHE A 64  
B 2 3 N ALA A 63  ? N ALA A 63  O MET A 88  ? O MET A 88  
B 3 4 N LEU A 87  ? N LEU A 87  O SER A 98  ? O SER A 98  
C 1 2 N ILE A 103 ? N ILE A 103 O LEU A 153 ? O LEU A 153 
C 2 3 O SER A 152 ? O SER A 152 N GLN A 147 ? N GLN A 147 
C 3 4 O GLU A 142 ? O GLU A 142 N VAL A 131 ? N VAL A 131 
C 4 5 O VAL A 132 ? O VAL A 132 N GLY A 116 ? N GLY A 116 
D 1 2 N VAL A 173 ? N VAL A 173 O HIS A 177 ? O HIS A 177 
D 2 3 N PHE A 178 ? N PHE A 178 O TYR A 208 ? O TYR A 208 
D 3 4 N VAL A 205 ? N VAL A 205 O VAL A 216 ? O VAL A 216 
E 1 2 N GLY A 225 ? N GLY A 225 O ALA A 238 ? O ALA A 238 
E 2 3 N GLU A 239 ? N GLU A 239 O LYS A 244 ? O LYS A 244 
E 3 4 N VAL A 247 ? N VAL A 247 O ARG A 260 ? O ARG A 260 
F 1 2 N SER A 272 ? N SER A 272 O TRP A 281 ? O TRP A 281 
F 2 3 N LEU A 280 ? N LEU A 280 O ILE A 307 ? O ILE A 307 
F 3 4 N GLN A 308 ? N GLN A 308 O LYS A 316 ? O LYS A 316 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA A 1356'  
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA A 1357'  
AC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE OCH A 1358' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE LMT A 356'  
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 1361'  
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 1362'  
AC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CA A 1363'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 ASP A 54  ? ASP A 54   . ? 1_555 ? 
2  AC1 7 ILE A 117 ? ILE A 117  . ? 1_555 ? 
3  AC1 7 ASP A 169 ? ASP A 169  . ? 1_555 ? 
4  AC1 7 ILE A 170 ? ILE A 170  . ? 1_555 ? 
5  AC1 7 HOH J .   ? HOH A 360  . ? 1_555 ? 
6  AC1 7 HOH J .   ? HOH A 361  . ? 1_555 ? 
7  AC1 7 HOH J .   ? HOH A 378  . ? 1_555 ? 
8  AC2 7 GLU A 53  ? GLU A 53   . ? 1_555 ? 
9  AC2 7 ASN A 168 ? ASN A 168  . ? 1_555 ? 
10 AC2 7 ASN A 224 ? ASN A 224  . ? 1_555 ? 
11 AC2 7 ASP A 269 ? ASP A 269  . ? 1_555 ? 
12 AC2 7 ASN A 270 ? ASN A 270  . ? 1_555 ? 
13 AC2 7 HOH J .   ? HOH A 359  . ? 1_555 ? 
14 AC2 7 OCH D .   ? OCH A 1358 . ? 1_555 ? 
15 AC3 8 GLU A 53  ? GLU A 53   . ? 1_555 ? 
16 AC3 8 HIS A 115 ? HIS A 115  . ? 1_555 ? 
17 AC3 8 ASN A 168 ? ASN A 168  . ? 1_555 ? 
18 AC3 8 ASN A 224 ? ASN A 224  . ? 1_555 ? 
19 AC3 8 ASP A 269 ? ASP A 269  . ? 1_555 ? 
20 AC3 8 HIS A 285 ? HIS A 285  . ? 1_555 ? 
21 AC3 8 PHE A 292 ? PHE A 292  . ? 1_555 ? 
22 AC3 8 CA  C .   ? CA  A 1357 . ? 1_555 ? 
23 AC4 5 GLN A 20  ? GLN A 20   . ? 1_555 ? 
24 AC4 5 LEU A 198 ? LEU A 198  . ? 1_555 ? 
25 AC4 5 LEU A 200 ? LEU A 200  . ? 1_555 ? 
26 AC4 5 TRP A 202 ? TRP A 202  . ? 1_555 ? 
27 AC4 5 HOH J .   ? HOH A 439  . ? 1_555 ? 
28 AC5 2 ILE A 187 ? ILE A 187  . ? 1_555 ? 
29 AC5 2 ASP A 188 ? ASP A 188  . ? 1_555 ? 
30 AC6 2 ASP A 309 ? ASP A 309  . ? 1_555 ? 
31 AC6 2 LEU A 311 ? LEU A 311  . ? 1_555 ? 
32 AC7 1 GLU A 218 ? GLU A 218  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3SRG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3SRG 
_atom_sites.fract_transf_matrix[1][1]   0.010690 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010690 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006915 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
CA 
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ARG A 1 19  ? -8.661  2.610   20.605 1.00 72.16  ? 19   ARG A N     1 
ATOM   2    C  CA    . ARG A 1 19  ? -7.250  2.075   20.723 1.00 72.27  ? 19   ARG A CA    1 
ATOM   3    C  C     . ARG A 1 19  ? -7.151  0.902   21.736 1.00 71.61  ? 19   ARG A C     1 
ATOM   4    O  O     . ARG A 1 19  ? -6.672  -0.179  21.378 1.00 71.37  ? 19   ARG A O     1 
ATOM   5    C  CB    . ARG A 1 19  ? -6.237  3.189   21.069 1.00 72.77  ? 19   ARG A CB    1 
ATOM   6    N  N     . GLN A 1 20  ? -7.600  1.131   22.976 1.00 69.71  ? 20   GLN A N     1 
ATOM   7    C  CA    . GLN A 1 20  ? -7.722  0.071   23.958 1.00 67.99  ? 20   GLN A CA    1 
ATOM   8    C  C     . GLN A 1 20  ? -9.082  -0.662  23.900 1.00 66.81  ? 20   GLN A C     1 
ATOM   9    O  O     . GLN A 1 20  ? -9.160  -1.804  24.393 1.00 66.01  ? 20   GLN A O     1 
ATOM   10   C  CB    . GLN A 1 20  ? -7.463  0.580   25.382 1.00 68.38  ? 20   GLN A CB    1 
ATOM   11   C  CG    . GLN A 1 20  ? -6.000  1.046   25.650 1.00 70.67  ? 20   GLN A CG    1 
ATOM   12   C  CD    . GLN A 1 20  ? -5.025  -0.110  26.002 1.00 71.52  ? 20   GLN A CD    1 
ATOM   13   O  OE1   . GLN A 1 20  ? -3.959  -0.263  25.382 1.00 71.35  ? 20   GLN A OE1   1 
ATOM   14   N  NE2   . GLN A 1 20  ? -5.394  -0.909  27.006 1.00 70.75  ? 20   GLN A NE2   1 
ATOM   15   N  N     . LYS A 1 21  ? -10.120 -0.015  23.324 1.00 64.28  ? 21   LYS A N     1 
ATOM   16   C  CA    . LYS A 1 21  ? -11.487 -0.582  23.245 1.00 61.91  ? 21   LYS A CA    1 
ATOM   17   C  C     . LYS A 1 21  ? -11.331 -1.961  22.633 1.00 59.69  ? 21   LYS A C     1 
ATOM   18   O  O     . LYS A 1 21  ? -12.055 -2.872  22.972 1.00 59.46  ? 21   LYS A O     1 
ATOM   19   C  CB    . LYS A 1 21  ? -12.532 0.297   22.529 1.00 62.44  ? 21   LYS A CB    1 
ATOM   20   N  N     . SER A 1 22  ? -10.449 -2.153  21.681 1.00 57.31  ? 22   SER A N     1 
ATOM   21   C  CA    . SER A 1 22  ? -10.612 -2.090  20.270 1.00 54.65  ? 22   SER A CA    1 
ATOM   22   C  C     . SER A 1 22  ? -9.559  -3.252  20.186 1.00 52.35  ? 22   SER A C     1 
ATOM   23   O  O     . SER A 1 22  ? -9.831  -4.322  19.684 1.00 51.85  ? 22   SER A O     1 
ATOM   24   C  CB    . SER A 1 22  ? -10.057 -0.883  19.575 1.00 54.72  ? 22   SER A CB    1 
ATOM   25   O  OG    . SER A 1 22  ? -9.570  -1.326  18.280 1.00 57.08  ? 22   SER A OG    1 
ATOM   26   N  N     . SER A 1 23  ? -8.382  -3.038  20.765 1.00 49.37  ? 23   SER A N     1 
ATOM   27   C  CA    . SER A 1 23  ? -7.464  -4.130  21.015 1.00 48.56  ? 23   SER A CA    1 
ATOM   28   C  C     . SER A 1 23  ? -8.124  -5.184  21.949 1.00 46.36  ? 23   SER A C     1 
ATOM   29   O  O     . SER A 1 23  ? -7.992  -6.357  21.681 1.00 45.31  ? 23   SER A O     1 
ATOM   30   C  CB    . SER A 1 23  ? -6.106  -3.630  21.526 1.00 48.69  ? 23   SER A CB    1 
ATOM   31   O  OG    . SER A 1 23  ? -5.578  -4.489  22.516 1.00 49.50  ? 23   SER A OG    1 
ATOM   32   N  N     . PHE A 1 24  ? -8.838  -4.744  22.995 1.00 43.80  ? 24   PHE A N     1 
ATOM   33   C  CA    . PHE A 1 24  ? -9.643  -5.619  23.811 1.00 42.03  ? 24   PHE A CA    1 
ATOM   34   C  C     . PHE A 1 24  ? -10.695 -6.423  23.041 1.00 42.16  ? 24   PHE A C     1 
ATOM   35   O  O     . PHE A 1 24  ? -10.852 -7.643  23.260 1.00 41.10  ? 24   PHE A O     1 
ATOM   36   C  CB    . PHE A 1 24  ? -10.349 -4.878  24.919 1.00 41.11  ? 24   PHE A CB    1 
ATOM   37   C  CG    . PHE A 1 24  ? -11.166 -5.782  25.786 1.00 41.51  ? 24   PHE A CG    1 
ATOM   38   C  CD1   . PHE A 1 24  ? -10.621 -6.347  26.946 1.00 39.51  ? 24   PHE A CD1   1 
ATOM   39   C  CD2   . PHE A 1 24  ? -12.485 -6.092  25.443 1.00 41.02  ? 24   PHE A CD2   1 
ATOM   40   C  CE1   . PHE A 1 24  ? -11.368 -7.207  27.757 1.00 41.05  ? 24   PHE A CE1   1 
ATOM   41   C  CE2   . PHE A 1 24  ? -13.246 -6.955  26.249 1.00 39.60  ? 24   PHE A CE2   1 
ATOM   42   C  CZ    . PHE A 1 24  ? -12.673 -7.530  27.399 1.00 41.39  ? 24   PHE A CZ    1 
ATOM   43   N  N     . GLN A 1 25  ? -11.434 -5.742  22.173 1.00 41.52  ? 25   GLN A N     1 
ATOM   44   C  CA    . GLN A 1 25  ? -12.500 -6.386  21.415 1.00 39.78  ? 25   GLN A CA    1 
ATOM   45   C  C     . GLN A 1 25  ? -11.932 -7.405  20.420 1.00 38.87  ? 25   GLN A C     1 
ATOM   46   O  O     . GLN A 1 25  ? -12.526 -8.460  20.191 1.00 38.26  ? 25   GLN A O     1 
ATOM   47   C  CB    . GLN A 1 25  ? -13.296 -5.333  20.647 1.00 40.78  ? 25   GLN A CB    1 
ATOM   48   C  CG    . GLN A 1 25  ? -14.106 -4.414  21.592 1.00 41.19  ? 25   GLN A CG    1 
ATOM   49   C  CD    . GLN A 1 25  ? -15.215 -3.610  20.863 1.00 48.10  ? 25   GLN A CD    1 
ATOM   50   O  OE1   . GLN A 1 25  ? -16.307 -3.430  21.422 1.00 50.39  ? 25   GLN A OE1   1 
ATOM   51   N  NE2   . GLN A 1 25  ? -14.945 -3.151  19.622 1.00 41.23  ? 25   GLN A NE2   1 
ATOM   52   N  N     . THR A 1 26  ? -10.797 -7.093  19.821 1.00 37.85  ? 26   THR A N     1 
ATOM   53   C  CA    . THR A 1 26  ? -10.182 -8.035  18.936 1.00 37.97  ? 26   THR A CA    1 
ATOM   54   C  C     . THR A 1 26  ? -9.481  -9.188  19.686 1.00 36.14  ? 26   THR A C     1 
ATOM   55   O  O     . THR A 1 26  ? -9.752  -10.330 19.346 1.00 35.56  ? 26   THR A O     1 
ATOM   56   C  CB    . THR A 1 26  ? -9.370  -7.418  17.714 1.00 40.33  ? 26   THR A CB    1 
ATOM   57   O  OG1   . THR A 1 26  ? -7.984  -7.740  17.782 1.00 46.27  ? 26   THR A OG1   1 
ATOM   58   C  CG2   . THR A 1 26  ? -9.557  -5.967  17.512 1.00 41.36  ? 26   THR A CG2   1 
ATOM   59   N  N     . ARG A 1 27  ? -8.683  -8.921  20.740 1.00 33.54  ? 27   ARG A N     1 
ATOM   60   C  CA    . ARG A 1 27  ? -8.032  -10.034 21.504 1.00 32.03  ? 27   ARG A CA    1 
ATOM   61   C  C     . ARG A 1 27  ? -9.056  -11.027 21.972 1.00 29.36  ? 27   ARG A C     1 
ATOM   62   O  O     . ARG A 1 27  ? -8.875  -12.180 21.772 1.00 28.13  ? 27   ARG A O     1 
ATOM   63   C  CB    . ARG A 1 27  ? -7.196  -9.557  22.701 1.00 29.88  ? 27   ARG A CB    1 
ATOM   64   C  CG    . ARG A 1 27  ? -5.962  -8.847  22.247 1.00 33.32  ? 27   ARG A CG    1 
ATOM   65   C  CD    . ARG A 1 27  ? -5.353  -8.018  23.383 1.00 30.16  ? 27   ARG A CD    1 
ATOM   66   N  NE    . ARG A 1 27  ? -4.555  -8.864  24.285 1.00 27.46  ? 27   ARG A NE    1 
ATOM   67   C  CZ    . ARG A 1 27  ? -4.545  -8.753  25.612 1.00 30.89  ? 27   ARG A CZ    1 
ATOM   68   N  NH1   . ARG A 1 27  ? -5.310  -7.823  26.220 1.00 25.81  ? 27   ARG A NH1   1 
ATOM   69   N  NH2   . ARG A 1 27  ? -3.714  -9.530  26.363 1.00 25.57  ? 27   ARG A NH2   1 
ATOM   70   N  N     . PHE A 1 28  ? -10.108 -10.540 22.619 1.00 27.92  ? 28   PHE A N     1 
ATOM   71   C  CA    . PHE A 1 28  ? -11.136 -11.368 23.182 1.00 27.47  ? 28   PHE A CA    1 
ATOM   72   C  C     . PHE A 1 28  ? -12.255 -11.717 22.190 1.00 26.95  ? 28   PHE A C     1 
ATOM   73   O  O     . PHE A 1 28  ? -13.218 -12.347 22.566 1.00 25.04  ? 28   PHE A O     1 
ATOM   74   C  CB    . PHE A 1 28  ? -11.678 -10.790 24.507 1.00 27.62  ? 28   PHE A CB    1 
ATOM   75   C  CG    . PHE A 1 28  ? -10.611 -10.705 25.565 1.00 29.80  ? 28   PHE A CG    1 
ATOM   76   C  CD1   . PHE A 1 28  ? -10.374 -11.781 26.405 1.00 31.25  ? 28   PHE A CD1   1 
ATOM   77   C  CD2   . PHE A 1 28  ? -9.794  -9.577  25.671 1.00 32.82  ? 28   PHE A CD2   1 
ATOM   78   C  CE1   . PHE A 1 28  ? -9.366  -11.760 27.373 1.00 35.17  ? 28   PHE A CE1   1 
ATOM   79   C  CE2   . PHE A 1 28  ? -8.715  -9.550  26.639 1.00 32.74  ? 28   PHE A CE2   1 
ATOM   80   C  CZ    . PHE A 1 28  ? -8.528  -10.637 27.476 1.00 32.02  ? 28   PHE A CZ    1 
ATOM   81   N  N     . ASN A 1 29  ? -12.106 -11.332 20.929 1.00 29.15  ? 29   ASN A N     1 
ATOM   82   C  CA    . ASN A 1 29  ? -13.084 -11.742 19.878 1.00 31.57  ? 29   ASN A CA    1 
ATOM   83   C  C     . ASN A 1 29  ? -14.509 -11.529 20.398 1.00 33.34  ? 29   ASN A C     1 
ATOM   84   O  O     . ASN A 1 29  ? -15.354 -12.445 20.319 1.00 35.04  ? 29   ASN A O     1 
ATOM   85   C  CB    . ASN A 1 29  ? -12.905 -13.248 19.593 1.00 31.02  ? 29   ASN A CB    1 
ATOM   86   C  CG    . ASN A 1 29  ? -12.591 -13.525 18.176 1.00 32.91  ? 29   ASN A CG    1 
ATOM   87   O  OD1   . ASN A 1 29  ? -12.089 -12.665 17.492 1.00 34.74  ? 29   ASN A OD1   1 
ATOM   88   N  ND2   . ASN A 1 29  ? -12.870 -14.756 17.704 1.00 31.60  ? 29   ASN A ND2   1 
ATOM   89   N  N     . VAL A 1 30  ? -14.783 -10.363 20.978 1.00 33.49  ? 30   VAL A N     1 
ATOM   90   C  CA    . VAL A 1 30  ? -15.943 -10.272 21.822 1.00 36.08  ? 30   VAL A CA    1 
ATOM   91   C  C     . VAL A 1 30  ? -17.298 -10.291 21.004 1.00 37.37  ? 30   VAL A C     1 
ATOM   92   O  O     . VAL A 1 30  ? -18.344 -10.538 21.599 1.00 37.70  ? 30   VAL A O     1 
ATOM   93   C  CB    . VAL A 1 30  ? -15.944 -8.998  22.718 1.00 36.60  ? 30   VAL A CB    1 
ATOM   94   C  CG1   . VAL A 1 30  ? -14.614 -8.787  23.363 1.00 33.17  ? 30   VAL A CG1   1 
ATOM   95   C  CG2   . VAL A 1 30  ? -16.376 -7.780  21.850 1.00 38.37  ? 30   VAL A CG2   1 
ATOM   96   N  N     . HIS A 1 31  ? -17.237 -10.105 19.698 1.00 37.59  ? 31   HIS A N     1 
ATOM   97   C  CA    . HIS A 1 31  ? -18.427 -10.135 18.878 1.00 42.56  ? 31   HIS A CA    1 
ATOM   98   C  C     . HIS A 1 31  ? -18.736 -11.480 18.217 1.00 42.23  ? 31   HIS A C     1 
ATOM   99   O  O     . HIS A 1 31  ? -19.858 -11.627 17.694 1.00 42.95  ? 31   HIS A O     1 
ATOM   100  C  CB    . HIS A 1 31  ? -18.442 -8.977  17.825 1.00 43.65  ? 31   HIS A CB    1 
ATOM   101  C  CG    . HIS A 1 31  ? -18.535 -7.622  18.472 1.00 50.11  ? 31   HIS A CG    1 
ATOM   102  N  ND1   . HIS A 1 31  ? -17.703 -6.563  18.131 1.00 55.60  ? 31   HIS A ND1   1 
ATOM   103  C  CD2   . HIS A 1 31  ? -19.282 -7.196  19.533 1.00 55.20  ? 31   HIS A CD2   1 
ATOM   104  C  CE1   . HIS A 1 31  ? -17.976 -5.528  18.921 1.00 57.75  ? 31   HIS A CE1   1 
ATOM   105  N  NE2   . HIS A 1 31  ? -18.923 -5.886  19.783 1.00 58.30  ? 31   HIS A NE2   1 
ATOM   106  N  N     . ARG A 1 32  ? -17.776 -12.436 18.269 1.00 38.78  ? 32   ARG A N     1 
ATOM   107  C  CA    . ARG A 1 32  ? -17.867 -13.633 17.518 1.00 35.78  ? 32   ARG A CA    1 
ATOM   108  C  C     . ARG A 1 32  ? -19.080 -14.519 17.975 1.00 34.93  ? 32   ARG A C     1 
ATOM   109  O  O     . ARG A 1 32  ? -19.296 -14.785 19.176 1.00 33.42  ? 32   ARG A O     1 
ATOM   110  C  CB    . ARG A 1 32  ? -16.538 -14.387 17.551 1.00 36.71  ? 32   ARG A CB    1 
ATOM   111  C  CG    . ARG A 1 32  ? -16.568 -15.726 16.817 1.00 38.25  ? 32   ARG A CG    1 
ATOM   112  C  CD    . ARG A 1 32  ? -15.698 -15.936 15.538 1.00 39.75  ? 32   ARG A CD    1 
ATOM   113  N  NE    . ARG A 1 32  ? -16.216 -17.198 14.983 1.00 45.06  ? 32   ARG A NE    1 
ATOM   114  C  CZ    . ARG A 1 32  ? -15.639 -18.401 15.065 1.00 46.85  ? 32   ARG A CZ    1 
ATOM   115  N  NH1   . ARG A 1 32  ? -14.444 -18.544 15.631 1.00 47.76  ? 32   ARG A NH1   1 
ATOM   116  N  NH2   . ARG A 1 32  ? -16.292 -19.480 14.617 1.00 46.56  ? 32   ARG A NH2   1 
ATOM   117  N  N     . GLU A 1 33  ? -19.852 -14.960 16.995 1.00 32.65  ? 33   GLU A N     1 
ATOM   118  C  CA    . GLU A 1 33  ? -20.850 -15.982 17.236 1.00 35.00  ? 33   GLU A CA    1 
ATOM   119  C  C     . GLU A 1 33  ? -20.464 -17.151 16.373 1.00 34.79  ? 33   GLU A C     1 
ATOM   120  O  O     . GLU A 1 33  ? -19.927 -16.961 15.324 1.00 36.72  ? 33   GLU A O     1 
ATOM   121  C  CB    . GLU A 1 33  ? -22.306 -15.486 16.920 1.00 34.48  ? 33   GLU A CB    1 
ATOM   122  C  CG    . GLU A 1 33  ? -22.692 -14.254 17.760 1.00 33.86  ? 33   GLU A CG    1 
ATOM   123  C  CD    . GLU A 1 33  ? -22.924 -14.533 19.204 1.00 36.20  ? 33   GLU A CD    1 
ATOM   124  O  OE1   . GLU A 1 33  ? -22.890 -15.717 19.680 1.00 38.31  ? 33   GLU A OE1   1 
ATOM   125  O  OE2   . GLU A 1 33  ? -23.186 -13.531 19.922 1.00 41.44  ? 33   GLU A OE2   1 
ATOM   126  N  N     . VAL A 1 34  ? -20.794 -18.359 16.804 1.00 35.13  ? 34   VAL A N     1 
ATOM   127  C  CA    . VAL A 1 34  ? -20.327 -19.557 16.163 1.00 33.92  ? 34   VAL A CA    1 
ATOM   128  C  C     . VAL A 1 34  ? -21.296 -20.192 15.172 1.00 33.62  ? 34   VAL A C     1 
ATOM   129  O  O     . VAL A 1 34  ? -22.337 -20.719 15.559 1.00 34.29  ? 34   VAL A O     1 
ATOM   130  C  CB    . VAL A 1 34  ? -20.154 -20.678 17.314 1.00 35.04  ? 34   VAL A CB    1 
ATOM   131  C  CG1   . VAL A 1 34  ? -19.559 -21.904 16.799 1.00 31.39  ? 34   VAL A CG1   1 
ATOM   132  C  CG2   . VAL A 1 34  ? -19.405 -20.175 18.420 1.00 34.97  ? 34   VAL A CG2   1 
ATOM   133  N  N     . THR A 1 35  ? -20.887 -20.315 13.926 1.00 33.53  ? 35   THR A N     1 
ATOM   134  C  CA    . THR A 1 35  ? -21.658 -21.025 12.940 1.00 32.62  ? 35   THR A CA    1 
ATOM   135  C  C     . THR A 1 35  ? -21.531 -22.498 13.286 1.00 32.10  ? 35   THR A C     1 
ATOM   136  O  O     . THR A 1 35  ? -20.428 -22.991 13.369 1.00 31.09  ? 35   THR A O     1 
ATOM   137  C  CB    . THR A 1 35  ? -21.017 -20.770 11.510 1.00 35.66  ? 35   THR A CB    1 
ATOM   138  O  OG1   . THR A 1 35  ? -20.936 -19.359 11.239 1.00 36.75  ? 35   THR A OG1   1 
ATOM   139  C  CG2   . THR A 1 35  ? -21.748 -21.517 10.361 1.00 35.47  ? 35   THR A CG2   1 
ATOM   140  N  N     . PRO A 1 36  ? -22.666 -23.248 13.425 1.00 31.81  ? 36   PRO A N     1 
ATOM   141  C  CA    . PRO A 1 36  ? -22.508 -24.599 13.867 1.00 30.93  ? 36   PRO A CA    1 
ATOM   142  C  C     . PRO A 1 36  ? -21.930 -25.553 12.865 1.00 30.72  ? 36   PRO A C     1 
ATOM   143  O  O     . PRO A 1 36  ? -22.097 -25.343 11.670 1.00 30.64  ? 36   PRO A O     1 
ATOM   144  C  CB    . PRO A 1 36  ? -23.957 -25.043 14.321 1.00 32.57  ? 36   PRO A CB    1 
ATOM   145  C  CG    . PRO A 1 36  ? -24.858 -24.065 13.621 1.00 32.83  ? 36   PRO A CG    1 
ATOM   146  C  CD    . PRO A 1 36  ? -24.081 -22.789 13.494 1.00 31.81  ? 36   PRO A CD    1 
ATOM   147  N  N     . VAL A 1 37  ? -21.211 -26.595 13.368 1.00 28.44  ? 37   VAL A N     1 
ATOM   148  C  CA    . VAL A 1 37  ? -20.676 -27.590 12.490 1.00 28.25  ? 37   VAL A CA    1 
ATOM   149  C  C     . VAL A 1 37  ? -20.860 -28.828 13.280 1.00 29.59  ? 37   VAL A C     1 
ATOM   150  O  O     . VAL A 1 37  ? -20.236 -29.011 14.347 1.00 28.88  ? 37   VAL A O     1 
ATOM   151  C  CB    . VAL A 1 37  ? -19.145 -27.399 12.111 1.00 27.78  ? 37   VAL A CB    1 
ATOM   152  C  CG1   . VAL A 1 37  ? -18.643 -28.661 11.337 1.00 28.46  ? 37   VAL A CG1   1 
ATOM   153  C  CG2   . VAL A 1 37  ? -18.916 -26.127 11.201 1.00 25.10  ? 37   VAL A CG2   1 
ATOM   154  N  N     . GLU A 1 38  ? -21.687 -29.712 12.771 1.00 30.49  ? 38   GLU A N     1 
ATOM   155  C  CA    . GLU A 1 38  ? -22.135 -30.889 13.541 1.00 33.27  ? 38   GLU A CA    1 
ATOM   156  C  C     . GLU A 1 38  ? -21.419 -32.100 13.111 1.00 33.37  ? 38   GLU A C     1 
ATOM   157  O  O     . GLU A 1 38  ? -20.897 -32.201 11.998 1.00 33.62  ? 38   GLU A O     1 
ATOM   158  C  CB    . GLU A 1 38  ? -23.672 -31.136 13.375 1.00 34.71  ? 38   GLU A CB    1 
ATOM   159  C  CG    . GLU A 1 38  ? -24.580 -29.933 13.823 1.00 41.57  ? 38   GLU A CG    1 
ATOM   160  C  CD    . GLU A 1 38  ? -26.085 -30.112 13.405 1.00 57.41  ? 38   GLU A CD    1 
ATOM   161  O  OE1   . GLU A 1 38  ? -26.394 -31.026 12.582 1.00 60.47  ? 38   GLU A OE1   1 
ATOM   162  O  OE2   . GLU A 1 38  ? -26.955 -29.339 13.904 1.00 59.40  ? 38   GLU A OE2   1 
ATOM   163  N  N     . LEU A 1 39  ? -21.416 -33.070 14.005 1.00 34.49  ? 39   LEU A N     1 
ATOM   164  C  CA    . LEU A 1 39  ? -20.871 -34.356 13.671 1.00 36.41  ? 39   LEU A CA    1 
ATOM   165  C  C     . LEU A 1 39  ? -22.010 -35.391 13.852 1.00 39.24  ? 39   LEU A C     1 
ATOM   166  O  O     . LEU A 1 39  ? -22.907 -35.243 14.713 1.00 39.00  ? 39   LEU A O     1 
ATOM   167  C  CB    . LEU A 1 39  ? -19.660 -34.678 14.580 1.00 34.28  ? 39   LEU A CB    1 
ATOM   168  C  CG    . LEU A 1 39  ? -18.352 -33.982 14.219 1.00 33.13  ? 39   LEU A CG    1 
ATOM   169  C  CD1   . LEU A 1 39  ? -17.248 -34.126 15.328 1.00 31.77  ? 39   LEU A CD1   1 
ATOM   170  C  CD2   . LEU A 1 39  ? -17.794 -34.396 12.859 1.00 28.14  ? 39   LEU A CD2   1 
ATOM   171  N  N     . PRO A 1 40  ? -21.944 -36.464 13.081 1.00 42.81  ? 40   PRO A N     1 
ATOM   172  C  CA    . PRO A 1 40  ? -23.110 -37.469 13.049 1.00 44.81  ? 40   PRO A CA    1 
ATOM   173  C  C     . PRO A 1 40  ? -23.641 -37.951 14.444 1.00 46.49  ? 40   PRO A C     1 
ATOM   174  O  O     . PRO A 1 40  ? -24.922 -38.027 14.631 1.00 48.74  ? 40   PRO A O     1 
ATOM   175  C  CB    . PRO A 1 40  ? -22.552 -38.663 12.237 1.00 44.36  ? 40   PRO A CB    1 
ATOM   176  C  CG    . PRO A 1 40  ? -21.063 -38.382 11.963 1.00 43.63  ? 40   PRO A CG    1 
ATOM   177  C  CD    . PRO A 1 40  ? -20.805 -36.860 12.217 1.00 42.28  ? 40   PRO A CD    1 
ATOM   178  N  N     . ASN A 1 41  ? -22.719 -38.264 15.394 1.00 44.35  ? 41   ASN A N     1 
ATOM   179  C  CA    . ASN A 1 41  ? -23.078 -38.940 16.695 1.00 42.99  ? 41   ASN A CA    1 
ATOM   180  C  C     . ASN A 1 41  ? -22.073 -38.614 17.856 1.00 42.21  ? 41   ASN A C     1 
ATOM   181  O  O     . ASN A 1 41  ? -20.995 -39.246 17.958 1.00 43.95  ? 41   ASN A O     1 
ATOM   182  C  CB    . ASN A 1 41  ? -23.061 -40.439 16.411 1.00 42.26  ? 41   ASN A CB    1 
ATOM   183  C  CG    . ASN A 1 41  ? -23.254 -41.329 17.636 1.00 47.88  ? 41   ASN A CG    1 
ATOM   184  O  OD1   . ASN A 1 41  ? -24.100 -41.079 18.528 1.00 51.50  ? 41   ASN A OD1   1 
ATOM   185  N  ND2   . ASN A 1 41  ? -22.507 -42.457 17.639 1.00 46.61  ? 41   ASN A ND2   1 
ATOM   186  N  N     . CYS A 1 42  ? -22.442 -37.691 18.722 1.00 38.20  ? 42   CYS A N     1 
ATOM   187  C  CA    . CYS A 1 42  ? -21.643 -37.233 19.818 1.00 36.74  ? 42   CYS A CA    1 
ATOM   188  C  C     . CYS A 1 42  ? -22.329 -37.562 21.117 1.00 35.47  ? 42   CYS A C     1 
ATOM   189  O  O     . CYS A 1 42  ? -23.552 -37.308 21.251 1.00 34.79  ? 42   CYS A O     1 
ATOM   190  C  CB    . CYS A 1 42  ? -21.484 -35.709 19.730 1.00 36.25  ? 42   CYS A CB    1 
ATOM   191  S  SG    . CYS A 1 42  ? -20.471 -35.150 18.352 1.00 38.71  ? 42   CYS A SG    1 
ATOM   192  N  N     . ASN A 1 43  ? -21.568 -38.096 22.081 1.00 31.34  ? 43   ASN A N     1 
ATOM   193  C  CA    . ASN A 1 43  ? -22.067 -38.272 23.430 1.00 31.97  ? 43   ASN A CA    1 
ATOM   194  C  C     . ASN A 1 43  ? -21.189 -37.605 24.495 1.00 31.43  ? 43   ASN A C     1 
ATOM   195  O  O     . ASN A 1 43  ? -19.951 -37.718 24.419 1.00 29.55  ? 43   ASN A O     1 
ATOM   196  C  CB    . ASN A 1 43  ? -22.096 -39.767 23.697 1.00 32.21  ? 43   ASN A CB    1 
ATOM   197  C  CG    . ASN A 1 43  ? -23.152 -40.476 22.794 1.00 41.30  ? 43   ASN A CG    1 
ATOM   198  O  OD1   . ASN A 1 43  ? -22.809 -41.261 21.883 1.00 43.14  ? 43   ASN A OD1   1 
ATOM   199  N  ND2   . ASN A 1 43  ? -24.437 -40.148 23.047 1.00 37.93  ? 43   ASN A ND2   1 
ATOM   200  N  N     . LEU A 1 44  ? -21.825 -37.013 25.501 1.00 30.85  ? 44   LEU A N     1 
ATOM   201  C  CA    . LEU A 1 44  ? -21.126 -36.564 26.681 1.00 32.13  ? 44   LEU A CA    1 
ATOM   202  C  C     . LEU A 1 44  ? -20.477 -37.723 27.394 1.00 32.50  ? 44   LEU A C     1 
ATOM   203  O  O     . LEU A 1 44  ? -21.023 -38.792 27.431 1.00 31.76  ? 44   LEU A O     1 
ATOM   204  C  CB    . LEU A 1 44  ? -21.983 -35.746 27.593 1.00 31.01  ? 44   LEU A CB    1 
ATOM   205  C  CG    . LEU A 1 44  ? -22.335 -34.428 26.878 1.00 32.93  ? 44   LEU A CG    1 
ATOM   206  C  CD1   . LEU A 1 44  ? -23.681 -33.843 27.501 1.00 28.39  ? 44   LEU A CD1   1 
ATOM   207  C  CD2   . LEU A 1 44  ? -21.153 -33.377 26.895 1.00 26.17  ? 44   LEU A CD2   1 
ATOM   208  N  N     . VAL A 1 45  ? -19.250 -37.528 27.879 1.00 31.43  ? 45   VAL A N     1 
ATOM   209  C  CA    . VAL A 1 45  ? -18.554 -38.599 28.583 1.00 29.88  ? 45   VAL A CA    1 
ATOM   210  C  C     . VAL A 1 45  ? -19.067 -38.567 30.019 1.00 31.66  ? 45   VAL A C     1 
ATOM   211  O  O     . VAL A 1 45  ? -18.906 -37.566 30.772 1.00 29.04  ? 45   VAL A O     1 
ATOM   212  C  CB    . VAL A 1 45  ? -16.996 -38.419 28.557 1.00 28.81  ? 45   VAL A CB    1 
ATOM   213  C  CG1   . VAL A 1 45  ? -16.352 -39.512 29.401 1.00 25.54  ? 45   VAL A CG1   1 
ATOM   214  C  CG2   . VAL A 1 45  ? -16.500 -38.490 27.112 1.00 24.75  ? 45   VAL A CG2   1 
ATOM   215  N  N     . LYS A 1 46  ? -19.710 -39.658 30.410 1.00 31.83  ? 46   LYS A N     1 
ATOM   216  C  CA    . LYS A 1 46  ? -20.341 -39.655 31.703 1.00 34.93  ? 46   LYS A CA    1 
ATOM   217  C  C     . LYS A 1 46  ? -19.260 -39.645 32.804 1.00 34.06  ? 46   LYS A C     1 
ATOM   218  O  O     . LYS A 1 46  ? -18.290 -40.395 32.728 1.00 33.99  ? 46   LYS A O     1 
ATOM   219  C  CB    . LYS A 1 46  ? -21.245 -40.899 31.853 1.00 36.18  ? 46   LYS A CB    1 
ATOM   220  C  CG    . LYS A 1 46  ? -21.734 -41.062 33.309 1.00 42.57  ? 46   LYS A CG    1 
ATOM   221  N  N     . GLY A 1 47  ? -19.440 -38.800 33.808 1.00 34.13  ? 47   GLY A N     1 
ATOM   222  C  CA    . GLY A 1 47  ? -18.435 -38.686 34.888 1.00 35.33  ? 47   GLY A CA    1 
ATOM   223  C  C     . GLY A 1 47  ? -17.453 -37.494 34.751 1.00 34.84  ? 47   GLY A C     1 
ATOM   224  O  O     . GLY A 1 47  ? -16.633 -37.230 35.646 1.00 35.45  ? 47   GLY A O     1 
ATOM   225  N  N     . ILE A 1 48  ? -17.562 -36.744 33.654 1.00 32.98  ? 48   ILE A N     1 
ATOM   226  C  CA    . ILE A 1 48  ? -16.738 -35.539 33.484 1.00 30.27  ? 48   ILE A CA    1 
ATOM   227  C  C     . ILE A 1 48  ? -17.628 -34.355 33.567 1.00 30.47  ? 48   ILE A C     1 
ATOM   228  O  O     . ILE A 1 48  ? -18.361 -34.023 32.616 1.00 29.69  ? 48   ILE A O     1 
ATOM   229  C  CB    . ILE A 1 48  ? -15.861 -35.590 32.195 1.00 30.01  ? 48   ILE A CB    1 
ATOM   230  C  CG1   . ILE A 1 48  ? -14.949 -36.762 32.351 1.00 27.17  ? 48   ILE A CG1   1 
ATOM   231  C  CG2   . ILE A 1 48  ? -15.058 -34.242 31.989 1.00 26.12  ? 48   ILE A CG2   1 
ATOM   232  C  CD1   . ILE A 1 48  ? -14.266 -37.307 31.104 1.00 28.58  ? 48   ILE A CD1   1 
ATOM   233  N  N     . ASP A 1 49  ? -17.541 -33.683 34.708 1.00 29.93  ? 49   ASP A N     1 
ATOM   234  C  CA    . ASP A 1 49  ? -18.328 -32.485 34.887 1.00 31.64  ? 49   ASP A CA    1 
ATOM   235  C  C     . ASP A 1 49  ? -17.560 -31.321 35.434 1.00 30.46  ? 49   ASP A C     1 
ATOM   236  O  O     . ASP A 1 49  ? -18.154 -30.262 35.674 1.00 31.31  ? 49   ASP A O     1 
ATOM   237  C  CB    . ASP A 1 49  ? -19.486 -32.797 35.884 1.00 34.34  ? 49   ASP A CB    1 
ATOM   238  C  CG    . ASP A 1 49  ? -20.561 -33.614 35.216 1.00 39.97  ? 49   ASP A CG    1 
ATOM   239  O  OD1   . ASP A 1 49  ? -21.365 -32.989 34.452 1.00 43.63  ? 49   ASP A OD1   1 
ATOM   240  O  OD2   . ASP A 1 49  ? -20.502 -34.869 35.352 1.00 42.98  ? 49   ASP A OD2   1 
ATOM   241  N  N     . ASN A 1 50  ? -16.267 -31.504 35.664 1.00 28.51  ? 50   ASN A N     1 
ATOM   242  C  CA    . ASN A 1 50  ? -15.442 -30.444 36.263 1.00 29.87  ? 50   ASN A CA    1 
ATOM   243  C  C     . ASN A 1 50  ? -14.174 -30.162 35.438 1.00 28.57  ? 50   ASN A C     1 
ATOM   244  O  O     . ASN A 1 50  ? -13.102 -29.810 36.027 1.00 26.81  ? 50   ASN A O     1 
ATOM   245  C  CB    . ASN A 1 50  ? -15.007 -30.846 37.692 1.00 30.81  ? 50   ASN A CB    1 
ATOM   246  C  CG    . ASN A 1 50  ? -16.186 -30.880 38.659 1.00 35.95  ? 50   ASN A CG    1 
ATOM   247  O  OD1   . ASN A 1 50  ? -16.715 -29.831 39.062 1.00 44.88  ? 50   ASN A OD1   1 
ATOM   248  N  ND2   . ASN A 1 50  ? -16.672 -32.064 38.917 1.00 36.26  ? 50   ASN A ND2   1 
ATOM   249  N  N     . GLY A 1 51  ? -14.283 -30.344 34.113 1.00 25.58  ? 51   GLY A N     1 
ATOM   250  C  CA    . GLY A 1 51  ? -13.233 -29.929 33.205 1.00 22.56  ? 51   GLY A CA    1 
ATOM   251  C  C     . GLY A 1 51  ? -12.512 -31.120 32.735 1.00 23.03  ? 51   GLY A C     1 
ATOM   252  O  O     . GLY A 1 51  ? -12.516 -32.202 33.379 1.00 22.70  ? 51   GLY A O     1 
ATOM   253  N  N     . SER A 1 52  ? -11.911 -30.955 31.553 1.00 21.15  ? 52   SER A N     1 
ATOM   254  C  CA    . SER A 1 52  ? -11.105 -32.013 30.978 1.00 19.43  ? 52   SER A CA    1 
ATOM   255  C  C     . SER A 1 52  ? -10.073 -31.280 30.069 1.00 20.42  ? 52   SER A C     1 
ATOM   256  O  O     . SER A 1 52  ? -10.019 -31.511 28.823 1.00 19.10  ? 52   SER A O     1 
ATOM   257  C  CB    . SER A 1 52  ? -12.016 -32.943 30.179 1.00 21.14  ? 52   SER A CB    1 
ATOM   258  O  OG    . SER A 1 52  ? -12.925 -32.184 29.311 1.00 22.21  ? 52   SER A OG    1 
ATOM   259  N  N     . GLU A 1 53  ? -9.267  -30.397 30.706 1.00 19.07  ? 53   GLU A N     1 
ATOM   260  C  CA    . GLU A 1 53  ? -8.558  -29.300 30.025 1.00 17.77  ? 53   GLU A CA    1 
ATOM   261  C  C     . GLU A 1 53  ? -7.604  -29.814 29.063 1.00 15.49  ? 53   GLU A C     1 
ATOM   262  O  O     . GLU A 1 53  ? -7.450  -29.208 28.041 1.00 16.29  ? 53   GLU A O     1 
ATOM   263  C  CB    . GLU A 1 53  ? -7.880  -28.263 31.019 1.00 18.80  ? 53   GLU A CB    1 
ATOM   264  C  CG    . GLU A 1 53  ? -7.493  -26.975 30.289 1.00 22.36  ? 53   GLU A CG    1 
ATOM   265  C  CD    . GLU A 1 53  ? -6.207  -27.034 29.526 1.00 23.62  ? 53   GLU A CD    1 
ATOM   266  O  OE1   . GLU A 1 53  ? -5.400  -27.952 29.775 1.00 26.11  ? 53   GLU A OE1   1 
ATOM   267  O  OE2   . GLU A 1 53  ? -5.995  -26.134 28.693 1.00 24.98  ? 53   GLU A OE2   1 
ATOM   268  N  N     . ASP A 1 54  ? -6.987  -30.952 29.333 1.00 15.77  ? 54   ASP A N     1 
ATOM   269  C  CA    . ASP A 1 54  ? -5.996  -31.478 28.395 1.00 17.16  ? 54   ASP A CA    1 
ATOM   270  C  C     . ASP A 1 54  ? -6.098  -32.971 28.375 1.00 18.37  ? 54   ASP A C     1 
ATOM   271  O  O     . ASP A 1 54  ? -6.587  -33.580 29.302 1.00 19.77  ? 54   ASP A O     1 
ATOM   272  C  CB    . ASP A 1 54  ? -4.546  -31.016 28.733 1.00 18.19  ? 54   ASP A CB    1 
ATOM   273  C  CG    . ASP A 1 54  ? -3.622  -31.127 27.529 1.00 22.23  ? 54   ASP A CG    1 
ATOM   274  O  OD1   . ASP A 1 54  ? -4.175  -31.088 26.357 1.00 19.03  ? 54   ASP A OD1   1 
ATOM   275  O  OD2   . ASP A 1 54  ? -2.363  -31.086 27.724 1.00 20.62  ? 54   ASP A OD2   1 
ATOM   276  N  N     . LEU A 1 55  ? -5.692  -33.582 27.286 1.00 19.40  ? 55   LEU A N     1 
ATOM   277  C  CA    . LEU A 1 55  ? -5.788  -34.997 27.183 1.00 21.41  ? 55   LEU A CA    1 
ATOM   278  C  C     . LEU A 1 55  ? -4.791  -35.494 26.171 1.00 21.55  ? 55   LEU A C     1 
ATOM   279  O  O     . LEU A 1 55  ? -4.360  -34.777 25.298 1.00 21.99  ? 55   LEU A O     1 
ATOM   280  C  CB    . LEU A 1 55  ? -7.268  -35.467 26.823 1.00 22.25  ? 55   LEU A CB    1 
ATOM   281  C  CG    . LEU A 1 55  ? -7.971  -34.838 25.621 1.00 22.02  ? 55   LEU A CG    1 
ATOM   282  C  CD1   . LEU A 1 55  ? -7.509  -35.519 24.397 1.00 23.70  ? 55   LEU A CD1   1 
ATOM   283  C  CD2   . LEU A 1 55  ? -9.558  -34.881 25.736 1.00 25.80  ? 55   LEU A CD2   1 
ATOM   284  N  N     . GLU A 1 56  ? -4.382  -36.735 26.325 1.00 21.29  ? 56   GLU A N     1 
ATOM   285  C  CA    . GLU A 1 56  ? -3.412  -37.205 25.443 1.00 22.21  ? 56   GLU A CA    1 
ATOM   286  C  C     . GLU A 1 56  ? -3.672  -38.683 25.231 1.00 22.38  ? 56   GLU A C     1 
ATOM   287  O  O     . GLU A 1 56  ? -3.926  -39.382 26.193 1.00 23.04  ? 56   GLU A O     1 
ATOM   288  C  CB    . GLU A 1 56  ? -1.988  -37.116 26.023 1.00 22.58  ? 56   GLU A CB    1 
ATOM   289  C  CG    . GLU A 1 56  ? -1.027  -37.340 24.694 1.00 26.21  ? 56   GLU A CG    1 
ATOM   290  C  CD    . GLU A 1 56  ? 0.292   -36.641 24.807 1.00 32.69  ? 56   GLU A CD    1 
ATOM   291  O  OE1   . GLU A 1 56  ? 1.317   -37.299 24.544 1.00 36.35  ? 56   GLU A OE1   1 
ATOM   292  O  OE2   . GLU A 1 56  ? 0.314   -35.449 25.176 1.00 33.02  ? 56   GLU A OE2   1 
ATOM   293  N  N     . ILE A 1 57  ? -3.574  -39.150 23.999 1.00 22.48  ? 57   ILE A N     1 
ATOM   294  C  CA    . ILE A 1 57  ? -3.985  -40.534 23.715 1.00 24.53  ? 57   ILE A CA    1 
ATOM   295  C  C     . ILE A 1 57  ? -2.760  -41.321 23.349 1.00 25.50  ? 57   ILE A C     1 
ATOM   296  O  O     . ILE A 1 57  ? -2.055  -40.914 22.419 1.00 24.02  ? 57   ILE A O     1 
ATOM   297  C  CB    . ILE A 1 57  ? -4.993  -40.606 22.521 1.00 25.75  ? 57   ILE A CB    1 
ATOM   298  C  CG1   . ILE A 1 57  ? -6.248  -39.768 22.827 1.00 23.06  ? 57   ILE A CG1   1 
ATOM   299  C  CG2   . ILE A 1 57  ? -5.359  -42.101 22.234 1.00 24.27  ? 57   ILE A CG2   1 
ATOM   300  C  CD1   . ILE A 1 57  ? -7.174  -39.566 21.586 1.00 19.98  ? 57   ILE A CD1   1 
ATOM   301  N  N     . LEU A 1 58  ? -2.492  -42.412 24.069 1.00 25.72  ? 58   LEU A N     1 
ATOM   302  C  CA    . LEU A 1 58  ? -1.336  -43.305 23.679 1.00 29.83  ? 58   LEU A CA    1 
ATOM   303  C  C     . LEU A 1 58  ? -1.568  -44.052 22.343 1.00 31.21  ? 58   LEU A C     1 
ATOM   304  O  O     . LEU A 1 58  ? -2.742  -44.185 21.918 1.00 30.21  ? 58   LEU A O     1 
ATOM   305  C  CB    . LEU A 1 58  ? -1.010  -44.323 24.773 1.00 28.76  ? 58   LEU A CB    1 
ATOM   306  C  CG    . LEU A 1 58  ? -0.726  -43.757 26.191 1.00 34.26  ? 58   LEU A CG    1 
ATOM   307  C  CD1   . LEU A 1 58  ? -0.423  -44.862 27.203 1.00 32.92  ? 58   LEU A CD1   1 
ATOM   308  C  CD2   . LEU A 1 58  ? 0.459   -42.833 26.092 1.00 30.91  ? 58   LEU A CD2   1 
ATOM   309  N  N     . PRO A 1 59  ? -0.468  -44.507 21.672 1.00 33.70  ? 59   PRO A N     1 
ATOM   310  C  CA    . PRO A 1 59  ? -0.586  -45.374 20.469 1.00 35.33  ? 59   PRO A CA    1 
ATOM   311  C  C     . PRO A 1 59  ? -1.589  -46.532 20.640 1.00 35.86  ? 59   PRO A C     1 
ATOM   312  O  O     . PRO A 1 59  ? -2.312  -46.856 19.683 1.00 36.36  ? 59   PRO A O     1 
ATOM   313  C  CB    . PRO A 1 59  ? 0.858   -45.899 20.234 1.00 35.80  ? 59   PRO A CB    1 
ATOM   314  C  CG    . PRO A 1 59  ? 1.719   -44.640 20.678 1.00 35.24  ? 59   PRO A CG    1 
ATOM   315  C  CD    . PRO A 1 59  ? 0.956   -44.206 21.985 1.00 34.59  ? 59   PRO A CD    1 
ATOM   316  N  N     . ASN A 1 60  ? -1.706  -47.067 21.848 1.00 34.61  ? 60   ASN A N     1 
ATOM   317  C  CA    . ASN A 1 60  ? -2.615  -48.185 22.068 1.00 33.92  ? 60   ASN A CA    1 
ATOM   318  C  C     . ASN A 1 60  ? -4.054  -47.785 22.373 1.00 32.42  ? 60   ASN A C     1 
ATOM   319  O  O     . ASN A 1 60  ? -4.850  -48.608 22.802 1.00 32.39  ? 60   ASN A O     1 
ATOM   320  C  CB    . ASN A 1 60  ? -2.053  -49.108 23.182 1.00 34.13  ? 60   ASN A CB    1 
ATOM   321  C  CG    . ASN A 1 60  ? -2.057  -48.447 24.582 1.00 38.13  ? 60   ASN A CG    1 
ATOM   322  O  OD1   . ASN A 1 60  ? -2.500  -47.323 24.743 1.00 36.70  ? 60   ASN A OD1   1 
ATOM   323  N  ND2   . ASN A 1 60  ? -1.583  -49.181 25.608 1.00 35.77  ? 60   ASN A ND2   1 
ATOM   324  N  N     . GLY A 1 61  ? -4.405  -46.516 22.233 1.00 30.56  ? 61   GLY A N     1 
ATOM   325  C  CA    . GLY A 1 61  ? -5.796  -46.138 22.525 1.00 27.25  ? 61   GLY A CA    1 
ATOM   326  C  C     . GLY A 1 61  ? -6.148  -45.804 23.954 1.00 28.30  ? 61   GLY A C     1 
ATOM   327  O  O     . GLY A 1 61  ? -7.289  -45.413 24.218 1.00 28.25  ? 61   GLY A O     1 
ATOM   328  N  N     . LEU A 1 62  ? -5.201  -45.899 24.904 1.00 27.82  ? 62   LEU A N     1 
ATOM   329  C  CA    . LEU A 1 62  ? -5.494  -45.359 26.252 1.00 28.15  ? 62   LEU A CA    1 
ATOM   330  C  C     . LEU A 1 62  ? -5.403  -43.810 26.265 1.00 27.13  ? 62   LEU A C     1 
ATOM   331  O  O     . LEU A 1 62  ? -4.440  -43.252 25.779 1.00 26.88  ? 62   LEU A O     1 
ATOM   332  C  CB    . LEU A 1 62  ? -4.563  -45.960 27.305 1.00 28.50  ? 62   LEU A CB    1 
ATOM   333  C  CG    . LEU A 1 62  ? -4.708  -47.495 27.507 1.00 33.15  ? 62   LEU A CG    1 
ATOM   334  C  CD1   . LEU A 1 62  ? -3.742  -47.897 28.647 1.00 33.41  ? 62   LEU A CD1   1 
ATOM   335  C  CD2   . LEU A 1 62  ? -6.126  -47.924 27.901 1.00 31.58  ? 62   LEU A CD2   1 
ATOM   336  N  N     . ALA A 1 63  ? -6.379  -43.136 26.871 1.00 25.80  ? 63   ALA A N     1 
ATOM   337  C  CA    . ALA A 1 63  ? -6.413  -41.715 26.844 1.00 26.06  ? 63   ALA A CA    1 
ATOM   338  C  C     . ALA A 1 63  ? -6.310  -41.213 28.279 1.00 25.75  ? 63   ALA A C     1 
ATOM   339  O  O     . ALA A 1 63  ? -7.145  -41.582 29.084 1.00 24.85  ? 63   ALA A O     1 
ATOM   340  C  CB    . ALA A 1 63  ? -7.779  -41.191 26.252 1.00 22.89  ? 63   ALA A CB    1 
ATOM   341  N  N     . PHE A 1 64  ? -5.401  -40.268 28.532 1.00 23.81  ? 64   PHE A N     1 
ATOM   342  C  CA    . PHE A 1 64  ? -5.292  -39.604 29.863 1.00 22.45  ? 64   PHE A CA    1 
ATOM   343  C  C     . PHE A 1 64  ? -5.972  -38.279 29.762 1.00 20.93  ? 64   PHE A C     1 
ATOM   344  O  O     . PHE A 1 64  ? -5.776  -37.576 28.753 1.00 21.22  ? 64   PHE A O     1 
ATOM   345  C  CB    . PHE A 1 64  ? -3.822  -39.276 30.166 1.00 23.13  ? 64   PHE A CB    1 
ATOM   346  C  CG    . PHE A 1 64  ? -2.996  -40.472 30.439 1.00 28.12  ? 64   PHE A CG    1 
ATOM   347  C  CD1   . PHE A 1 64  ? -3.100  -41.145 31.678 1.00 23.31  ? 64   PHE A CD1   1 
ATOM   348  C  CD2   . PHE A 1 64  ? -2.106  -40.934 29.497 1.00 32.10  ? 64   PHE A CD2   1 
ATOM   349  C  CE1   . PHE A 1 64  ? -2.351  -42.264 31.942 1.00 28.02  ? 64   PHE A CE1   1 
ATOM   350  C  CE2   . PHE A 1 64  ? -1.290  -42.055 29.799 1.00 36.31  ? 64   PHE A CE2   1 
ATOM   351  C  CZ    . PHE A 1 64  ? -1.423  -42.711 31.018 1.00 32.95  ? 64   PHE A CZ    1 
ATOM   352  N  N     . ILE A 1 65  ? -6.705  -37.884 30.796 1.00 20.53  ? 65   ILE A N     1 
ATOM   353  C  CA    . ILE A 1 65  ? -7.360  -36.609 30.792 1.00 21.25  ? 65   ILE A CA    1 
ATOM   354  C  C     . ILE A 1 65  ? -7.100  -35.915 32.117 1.00 21.59  ? 65   ILE A C     1 
ATOM   355  O  O     . ILE A 1 65  ? -7.371  -36.464 33.197 1.00 21.26  ? 65   ILE A O     1 
ATOM   356  C  CB    . ILE A 1 65  ? -8.894  -36.859 30.632 1.00 22.91  ? 65   ILE A CB    1 
ATOM   357  C  CG1   . ILE A 1 65  ? -9.198  -37.693 29.343 1.00 22.07  ? 65   ILE A CG1   1 
ATOM   358  C  CG2   . ILE A 1 65  ? -9.755  -35.590 30.731 1.00 24.29  ? 65   ILE A CG2   1 
ATOM   359  C  CD1   . ILE A 1 65  ? -10.630 -38.228 29.391 1.00 29.48  ? 65   ILE A CD1   1 
ATOM   360  N  N     . SER A 1 66  ? -6.679  -34.672 32.107 1.00 20.59  ? 66   SER A N     1 
ATOM   361  C  CA    . SER A 1 66  ? -6.587  -34.048 33.408 1.00 22.55  ? 66   SER A CA    1 
ATOM   362  C  C     . SER A 1 66  ? -7.927  -33.345 33.641 1.00 23.65  ? 66   SER A C     1 
ATOM   363  O  O     . SER A 1 66  ? -8.554  -32.883 32.640 1.00 22.69  ? 66   SER A O     1 
ATOM   364  C  CB    . SER A 1 66  ? -5.417  -33.058 33.436 1.00 22.82  ? 66   SER A CB    1 
ATOM   365  O  OG    . SER A 1 66  ? -5.774  -31.940 32.672 1.00 26.81  ? 66   SER A OG    1 
ATOM   366  N  N     . SER A 1 67  ? -8.344  -33.203 34.912 1.00 22.17  ? 67   SER A N     1 
ATOM   367  C  CA    . SER A 1 67  ? -9.616  -32.619 35.218 1.00 25.08  ? 67   SER A CA    1 
ATOM   368  C  C     . SER A 1 67  ? -9.647  -31.939 36.559 1.00 24.79  ? 67   SER A C     1 
ATOM   369  O  O     . SER A 1 67  ? -8.890  -32.320 37.395 1.00 24.79  ? 67   SER A O     1 
ATOM   370  C  CB    . SER A 1 67  ? -10.772 -33.674 35.242 1.00 24.60  ? 67   SER A CB    1 
ATOM   371  O  OG    . SER A 1 67  ? -10.445 -34.662 36.195 1.00 31.45  ? 67   SER A OG    1 
ATOM   372  N  N     . GLY A 1 68  ? -10.600 -31.017 36.747 1.00 24.43  ? 68   GLY A N     1 
ATOM   373  C  CA    . GLY A 1 68  ? -10.728 -30.280 37.979 1.00 27.13  ? 68   GLY A CA    1 
ATOM   374  C  C     . GLY A 1 68  ? -9.861  -29.038 38.063 1.00 30.52  ? 68   GLY A C     1 
ATOM   375  O  O     . GLY A 1 68  ? -9.590  -28.568 39.176 1.00 32.67  ? 68   GLY A O     1 
ATOM   376  N  N     . LEU A 1 69  ? -9.424  -28.470 36.931 1.00 27.70  ? 69   LEU A N     1 
ATOM   377  C  CA    . LEU A 1 69  ? -8.588  -27.347 37.018 1.00 26.91  ? 69   LEU A CA    1 
ATOM   378  C  C     . LEU A 1 69  ? -9.306  -26.166 37.701 1.00 28.91  ? 69   LEU A C     1 
ATOM   379  O  O     . LEU A 1 69  ? -10.461 -25.835 37.349 1.00 26.46  ? 69   LEU A O     1 
ATOM   380  C  CB    . LEU A 1 69  ? -8.161  -26.899 35.620 1.00 27.04  ? 69   LEU A CB    1 
ATOM   381  C  CG    . LEU A 1 69  ? -7.473  -25.548 35.462 1.00 26.07  ? 69   LEU A CG    1 
ATOM   382  C  CD1   . LEU A 1 69  ? -6.100  -25.540 36.163 1.00 21.30  ? 69   LEU A CD1   1 
ATOM   383  C  CD2   . LEU A 1 69  ? -7.282  -25.292 33.904 1.00 27.00  ? 69   LEU A CD2   1 
ATOM   384  N  N     . LYS A 1 70  ? -8.616  -25.495 38.644 1.00 28.86  ? 70   LYS A N     1 
ATOM   385  C  CA    . LYS A 1 70  ? -9.101  -24.184 39.154 1.00 31.63  ? 70   LYS A CA    1 
ATOM   386  C  C     . LYS A 1 70  ? -8.078  -23.152 38.743 1.00 32.22  ? 70   LYS A C     1 
ATOM   387  O  O     . LYS A 1 70  ? -6.917  -23.260 39.093 1.00 31.89  ? 70   LYS A O     1 
ATOM   388  C  CB    . LYS A 1 70  ? -9.249  -24.163 40.661 1.00 34.04  ? 70   LYS A CB    1 
ATOM   389  C  CG    . LYS A 1 70  ? -10.304 -25.176 41.199 1.00 38.46  ? 70   LYS A CG    1 
ATOM   390  C  CD    . LYS A 1 70  ? -9.651  -26.283 41.993 1.00 43.67  ? 70   LYS A CD    1 
ATOM   391  C  CE    . LYS A 1 70  ? -10.514 -27.534 41.920 1.00 46.95  ? 70   LYS A CE    1 
ATOM   392  N  NZ    . LYS A 1 70  ? -9.563  -28.750 41.806 1.00 44.80  ? 70   LYS A NZ    1 
ATOM   393  N  N     . TYR A 1 71  ? -8.503  -22.228 37.909 1.00 33.49  ? 71   TYR A N     1 
ATOM   394  C  CA    . TYR A 1 71  ? -7.636  -21.211 37.317 1.00 34.99  ? 71   TYR A CA    1 
ATOM   395  C  C     . TYR A 1 71  ? -8.198  -19.887 37.742 1.00 35.67  ? 71   TYR A C     1 
ATOM   396  O  O     . TYR A 1 71  ? -9.422  -19.708 37.663 1.00 36.11  ? 71   TYR A O     1 
ATOM   397  C  CB    . TYR A 1 71  ? -7.709  -21.291 35.778 1.00 32.97  ? 71   TYR A CB    1 
ATOM   398  C  CG    . TYR A 1 71  ? -6.587  -20.578 35.038 1.00 31.82  ? 71   TYR A CG    1 
ATOM   399  C  CD1   . TYR A 1 71  ? -5.417  -21.247 34.717 1.00 29.62  ? 71   TYR A CD1   1 
ATOM   400  C  CD2   . TYR A 1 71  ? -6.692  -19.205 34.669 1.00 33.79  ? 71   TYR A CD2   1 
ATOM   401  C  CE1   . TYR A 1 71  ? -4.366  -20.607 34.023 1.00 29.07  ? 71   TYR A CE1   1 
ATOM   402  C  CE2   . TYR A 1 71  ? -5.642  -18.543 33.969 1.00 30.93  ? 71   TYR A CE2   1 
ATOM   403  C  CZ    . TYR A 1 71  ? -4.487  -19.275 33.643 1.00 33.26  ? 71   TYR A CZ    1 
ATOM   404  O  OH    . TYR A 1 71  ? -3.442  -18.675 32.957 1.00 34.12  ? 71   TYR A OH    1 
ATOM   405  N  N     . PRO A 1 72  ? -7.324  -18.915 38.108 1.00 37.91  ? 72   PRO A N     1 
ATOM   406  C  CA    . PRO A 1 72  ? -7.798  -17.675 38.816 1.00 37.32  ? 72   PRO A CA    1 
ATOM   407  C  C     . PRO A 1 72  ? -8.607  -16.853 37.856 1.00 38.98  ? 72   PRO A C     1 
ATOM   408  O  O     . PRO A 1 72  ? -8.186  -16.716 36.658 1.00 38.22  ? 72   PRO A O     1 
ATOM   409  C  CB    . PRO A 1 72  ? -6.494  -16.894 39.156 1.00 38.12  ? 72   PRO A CB    1 
ATOM   410  C  CG    . PRO A 1 72  ? -5.347  -17.638 38.459 1.00 40.85  ? 72   PRO A CG    1 
ATOM   411  C  CD    . PRO A 1 72  ? -5.838  -19.053 38.099 1.00 38.30  ? 72   PRO A CD    1 
ATOM   412  N  N     . GLY A 1 73  ? -9.768  -16.327 38.308 1.00 38.03  ? 73   GLY A N     1 
ATOM   413  C  CA    . GLY A 1 73  ? -10.598 -15.547 37.355 1.00 36.96  ? 73   GLY A CA    1 
ATOM   414  C  C     . GLY A 1 73  ? -11.516 -16.482 36.534 1.00 36.98  ? 73   GLY A C     1 
ATOM   415  O  O     . GLY A 1 73  ? -12.450 -16.025 35.861 1.00 36.64  ? 73   GLY A O     1 
ATOM   416  N  N     . ILE A 1 74  ? -11.279 -17.797 36.594 1.00 35.83  ? 74   ILE A N     1 
ATOM   417  C  CA    . ILE A 1 74  ? -12.058 -18.694 35.728 1.00 35.06  ? 74   ILE A CA    1 
ATOM   418  C  C     . ILE A 1 74  ? -13.041 -19.569 36.545 1.00 35.05  ? 74   ILE A C     1 
ATOM   419  O  O     . ILE A 1 74  ? -12.747 -19.994 37.672 1.00 31.31  ? 74   ILE A O     1 
ATOM   420  C  CB    . ILE A 1 74  ? -11.118 -19.576 34.770 1.00 35.84  ? 74   ILE A CB    1 
ATOM   421  C  CG1   . ILE A 1 74  ? -10.206 -18.678 33.938 1.00 33.62  ? 74   ILE A CG1   1 
ATOM   422  C  CG2   . ILE A 1 74  ? -11.929 -20.713 33.939 1.00 33.19  ? 74   ILE A CG2   1 
ATOM   423  C  CD1   . ILE A 1 74  ? -10.922 -17.661 32.982 1.00 34.10  ? 74   ILE A CD1   1 
ATOM   424  N  N     . MET A 1 75  ? -14.207 -19.815 35.935 1.00 36.08  ? 75   MET A N     1 
ATOM   425  C  CA    . MET A 1 75  ? -15.223 -20.667 36.507 1.00 37.26  ? 75   MET A CA    1 
ATOM   426  C  C     . MET A 1 75  ? -14.685 -22.044 36.907 1.00 39.45  ? 75   MET A C     1 
ATOM   427  O  O     . MET A 1 75  ? -13.782 -22.627 36.252 1.00 36.77  ? 75   MET A O     1 
ATOM   428  C  CB    . MET A 1 75  ? -16.381 -20.814 35.530 1.00 37.81  ? 75   MET A CB    1 
ATOM   429  C  CG    . MET A 1 75  ? -17.635 -21.441 36.144 1.00 41.11  ? 75   MET A CG    1 
ATOM   430  S  SD    . MET A 1 75  ? -18.218 -20.533 37.614 1.00 50.70  ? 75   MET A SD    1 
ATOM   431  C  CE    . MET A 1 75  ? -19.486 -21.684 38.219 1.00 51.10  ? 75   MET A CE    1 
ATOM   432  N  N     . SER A 1 76  ? -15.173 -22.527 38.040 1.00 41.39  ? 76   SER A N     1 
ATOM   433  C  CA    . SER A 1 76  ? -15.051 -23.943 38.337 1.00 45.65  ? 76   SER A CA    1 
ATOM   434  C  C     . SER A 1 76  ? -16.245 -24.275 39.206 1.00 46.62  ? 76   SER A C     1 
ATOM   435  O  O     . SER A 1 76  ? -16.609 -23.482 40.052 1.00 46.78  ? 76   SER A O     1 
ATOM   436  C  CB    . SER A 1 76  ? -13.735 -24.289 39.063 1.00 46.61  ? 76   SER A CB    1 
ATOM   437  O  OG    . SER A 1 76  ? -13.788 -23.811 40.391 1.00 50.14  ? 76   SER A OG    1 
ATOM   438  N  N     . PHE A 1 77  ? -16.858 -25.432 38.974 1.00 48.14  ? 77   PHE A N     1 
ATOM   439  C  CA    . PHE A 1 77  ? -18.100 -25.778 39.649 1.00 50.15  ? 77   PHE A CA    1 
ATOM   440  C  C     . PHE A 1 77  ? -17.811 -26.376 41.048 1.00 51.48  ? 77   PHE A C     1 
ATOM   441  O  O     . PHE A 1 77  ? -18.669 -26.321 41.896 1.00 53.15  ? 77   PHE A O     1 
ATOM   442  C  CB    . PHE A 1 77  ? -18.961 -26.736 38.782 1.00 49.82  ? 77   PHE A CB    1 
ATOM   443  C  CG    . PHE A 1 77  ? -19.359 -26.167 37.437 1.00 49.26  ? 77   PHE A CG    1 
ATOM   444  C  CD1   . PHE A 1 77  ? -20.224 -25.065 37.350 1.00 49.00  ? 77   PHE A CD1   1 
ATOM   445  C  CD2   . PHE A 1 77  ? -18.867 -26.730 36.251 1.00 47.35  ? 77   PHE A CD2   1 
ATOM   446  C  CE1   . PHE A 1 77  ? -20.602 -24.526 36.083 1.00 48.71  ? 77   PHE A CE1   1 
ATOM   447  C  CE2   . PHE A 1 77  ? -19.254 -26.202 34.961 1.00 45.70  ? 77   PHE A CE2   1 
ATOM   448  C  CZ    . PHE A 1 77  ? -20.097 -25.091 34.888 1.00 46.05  ? 77   PHE A CZ    1 
ATOM   449  N  N     . ASP A 1 78  ? -16.635 -26.956 41.282 1.00 52.59  ? 78   ASP A N     1 
ATOM   450  C  CA    . ASP A 1 78  ? -16.303 -27.543 42.601 1.00 54.22  ? 78   ASP A CA    1 
ATOM   451  C  C     . ASP A 1 78  ? -14.949 -27.057 43.134 1.00 54.29  ? 78   ASP A C     1 
ATOM   452  O  O     . ASP A 1 78  ? -13.982 -27.821 43.183 1.00 52.95  ? 78   ASP A O     1 
ATOM   453  C  CB    . ASP A 1 78  ? -16.333 -29.082 42.572 1.00 55.17  ? 78   ASP A CB    1 
ATOM   454  C  CG    . ASP A 1 78  ? -17.757 -29.643 42.603 1.00 60.33  ? 78   ASP A CG    1 
ATOM   455  O  OD1   . ASP A 1 78  ? -18.199 -30.094 43.706 1.00 64.19  ? 78   ASP A OD1   1 
ATOM   456  O  OD2   . ASP A 1 78  ? -18.440 -29.603 41.539 1.00 61.01  ? 78   ASP A OD2   1 
ATOM   457  N  N     . PRO A 1 79  ? -14.879 -25.778 43.547 1.00 55.31  ? 79   PRO A N     1 
ATOM   458  C  CA    . PRO A 1 79  ? -13.564 -25.282 43.962 1.00 56.05  ? 79   PRO A CA    1 
ATOM   459  C  C     . PRO A 1 79  ? -12.951 -26.086 45.122 1.00 57.22  ? 79   PRO A C     1 
ATOM   460  O  O     . PRO A 1 79  ? -11.719 -26.061 45.284 1.00 57.60  ? 79   PRO A O     1 
ATOM   461  C  CB    . PRO A 1 79  ? -13.808 -23.812 44.337 1.00 56.43  ? 79   PRO A CB    1 
ATOM   462  C  CG    . PRO A 1 79  ? -15.205 -23.463 43.801 1.00 56.83  ? 79   PRO A CG    1 
ATOM   463  C  CD    . PRO A 1 79  ? -15.956 -24.771 43.664 1.00 55.23  ? 79   PRO A CD    1 
ATOM   464  N  N     . ASP A 1 80  ? -13.763 -26.843 45.875 1.00 57.84  ? 80   ASP A N     1 
ATOM   465  C  CA    . ASP A 1 80  ? -13.217 -27.616 47.025 1.00 58.41  ? 80   ASP A CA    1 
ATOM   466  C  C     . ASP A 1 80  ? -12.757 -29.060 46.694 1.00 58.36  ? 80   ASP A C     1 
ATOM   467  O  O     . ASP A 1 80  ? -12.021 -29.697 47.476 1.00 58.93  ? 80   ASP A O     1 
ATOM   468  C  CB    . ASP A 1 80  ? -14.165 -27.561 48.248 1.00 58.92  ? 80   ASP A CB    1 
ATOM   469  N  N     . LYS A 1 81  ? -13.164 -29.578 45.535 1.00 56.40  ? 81   LYS A N     1 
ATOM   470  C  CA    . LYS A 1 81  ? -12.703 -30.902 45.120 1.00 55.01  ? 81   LYS A CA    1 
ATOM   471  C  C     . LYS A 1 81  ? -11.309 -30.789 44.455 1.00 52.75  ? 81   LYS A C     1 
ATOM   472  O  O     . LYS A 1 81  ? -11.087 -29.913 43.619 1.00 52.33  ? 81   LYS A O     1 
ATOM   473  C  CB    . LYS A 1 81  ? -13.747 -31.540 44.192 1.00 55.74  ? 81   LYS A CB    1 
ATOM   474  C  CG    . LYS A 1 81  ? -13.412 -32.924 43.656 1.00 58.92  ? 81   LYS A CG    1 
ATOM   475  N  N     . SER A 1 82  ? -10.365 -31.649 44.837 1.00 49.12  ? 82   SER A N     1 
ATOM   476  C  CA    . SER A 1 82  ? -9.077  -31.671 44.135 1.00 46.32  ? 82   SER A CA    1 
ATOM   477  C  C     . SER A 1 82  ? -9.235  -32.297 42.703 1.00 41.80  ? 82   SER A C     1 
ATOM   478  O  O     . SER A 1 82  ? -10.259 -32.883 42.389 1.00 40.64  ? 82   SER A O     1 
ATOM   479  C  CB    . SER A 1 82  ? -7.973  -32.356 44.978 1.00 47.22  ? 82   SER A CB    1 
ATOM   480  O  OG    . SER A 1 82  ? -8.361  -33.680 45.348 1.00 46.32  ? 82   SER A OG    1 
ATOM   481  N  N     . GLY A 1 83  ? -8.214  -32.107 41.868 1.00 37.13  ? 83   GLY A N     1 
ATOM   482  C  CA    . GLY A 1 83  ? -8.229  -32.466 40.482 1.00 30.56  ? 83   GLY A CA    1 
ATOM   483  C  C     . GLY A 1 83  ? -7.842  -33.895 40.401 1.00 28.72  ? 83   GLY A C     1 
ATOM   484  O  O     . GLY A 1 83  ? -7.433  -34.512 41.392 1.00 27.35  ? 83   GLY A O     1 
ATOM   485  N  N     . LYS A 1 84  ? -7.910  -34.435 39.209 1.00 25.72  ? 84   LYS A N     1 
ATOM   486  C  CA    . LYS A 1 84  ? -7.663  -35.840 39.036 1.00 26.67  ? 84   LYS A CA    1 
ATOM   487  C  C     . LYS A 1 84  ? -7.089  -36.040 37.644 1.00 23.57  ? 84   LYS A C     1 
ATOM   488  O  O     . LYS A 1 84  ? -7.332  -35.225 36.749 1.00 23.46  ? 84   LYS A O     1 
ATOM   489  C  CB    . LYS A 1 84  ? -9.057  -36.561 39.064 1.00 28.00  ? 84   LYS A CB    1 
ATOM   490  C  CG    . LYS A 1 84  ? -9.871  -36.462 40.336 1.00 36.15  ? 84   LYS A CG    1 
ATOM   491  C  CD    . LYS A 1 84  ? -11.400 -36.706 39.964 1.00 45.15  ? 84   LYS A CD    1 
ATOM   492  C  CE    . LYS A 1 84  ? -12.348 -37.027 41.189 1.00 53.41  ? 84   LYS A CE    1 
ATOM   493  N  NZ    . LYS A 1 84  ? -11.869 -36.572 42.591 1.00 56.41  ? 84   LYS A NZ    1 
ATOM   494  N  N     . ILE A 1 85  ? -6.426  -37.144 37.427 1.00 22.88  ? 85   ILE A N     1 
ATOM   495  C  CA    . ILE A 1 85  ? -6.072  -37.565 36.100 1.00 23.81  ? 85   ILE A CA    1 
ATOM   496  C  C     . ILE A 1 85  ? -7.022  -38.771 35.814 1.00 25.93  ? 85   ILE A C     1 
ATOM   497  O  O     . ILE A 1 85  ? -7.110  -39.675 36.658 1.00 25.08  ? 85   ILE A O     1 
ATOM   498  C  CB    . ILE A 1 85  ? -4.633  -38.069 35.978 1.00 24.38  ? 85   ILE A CB    1 
ATOM   499  C  CG1   . ILE A 1 85  ? -3.545  -36.984 36.303 1.00 22.44  ? 85   ILE A CG1   1 
ATOM   500  C  CG2   . ILE A 1 85  ? -4.426  -38.531 34.546 1.00 22.54  ? 85   ILE A CG2   1 
ATOM   501  C  CD1   . ILE A 1 85  ? -3.753  -35.562 35.555 1.00 22.35  ? 85   ILE A CD1   1 
ATOM   502  N  N     . LEU A 1 86  ? -7.767  -38.739 34.698 1.00 23.73  ? 86   LEU A N     1 
ATOM   503  C  CA    . LEU A 1 86  ? -8.746  -39.791 34.330 1.00 23.98  ? 86   LEU A CA    1 
ATOM   504  C  C     . LEU A 1 86  ? -8.141  -40.563 33.233 1.00 25.20  ? 86   LEU A C     1 
ATOM   505  O  O     . LEU A 1 86  ? -7.179  -40.107 32.565 1.00 25.96  ? 86   LEU A O     1 
ATOM   506  C  CB    . LEU A 1 86  ? -10.055 -39.160 33.814 1.00 23.70  ? 86   LEU A CB    1 
ATOM   507  C  CG    . LEU A 1 86  ? -10.623 -38.110 34.737 1.00 21.90  ? 86   LEU A CG    1 
ATOM   508  C  CD1   . LEU A 1 86  ? -11.863 -37.464 34.139 1.00 27.21  ? 86   LEU A CD1   1 
ATOM   509  C  CD2   . LEU A 1 86  ? -10.940 -38.748 36.178 1.00 23.96  ? 86   LEU A CD2   1 
ATOM   510  N  N     . LEU A 1 87  ? -8.642  -41.781 33.074 1.00 27.68  ? 87   LEU A N     1 
ATOM   511  C  CA    . LEU A 1 87  ? -8.193  -42.718 32.062 1.00 28.78  ? 87   LEU A CA    1 
ATOM   512  C  C     . LEU A 1 87  ? -9.428  -43.246 31.269 1.00 29.46  ? 87   LEU A C     1 
ATOM   513  O  O     . LEU A 1 87  ? -10.452 -43.574 31.917 1.00 29.28  ? 87   LEU A O     1 
ATOM   514  C  CB    . LEU A 1 87  ? -7.467  -43.886 32.714 1.00 27.14  ? 87   LEU A CB    1 
ATOM   515  C  CG    . LEU A 1 87  ? -6.944  -44.786 31.572 1.00 32.23  ? 87   LEU A CG    1 
ATOM   516  C  CD1   . LEU A 1 87  ? -5.754  -44.168 30.838 1.00 31.69  ? 87   LEU A CD1   1 
ATOM   517  C  CD2   . LEU A 1 87  ? -6.560  -46.191 32.105 1.00 39.07  ? 87   LEU A CD2   1 
ATOM   518  N  N     . MET A 1 88  ? -9.362  -43.262 29.928 1.00 28.91  ? 88   MET A N     1 
ATOM   519  C  CA    . MET A 1 88  ? -10.438 -43.883 29.065 1.00 29.95  ? 88   MET A CA    1 
ATOM   520  C  C     . MET A 1 88  ? -9.739  -44.808 28.125 1.00 31.32  ? 88   MET A C     1 
ATOM   521  O  O     . MET A 1 88  ? -8.694  -44.449 27.582 1.00 30.86  ? 88   MET A O     1 
ATOM   522  C  CB    . MET A 1 88  ? -11.172 -42.874 28.187 1.00 29.95  ? 88   MET A CB    1 
ATOM   523  C  CG    . MET A 1 88  ? -12.059 -41.937 28.939 1.00 31.69  ? 88   MET A CG    1 
ATOM   524  S  SD    . MET A 1 88  ? -12.863 -40.672 27.924 1.00 37.01  ? 88   MET A SD    1 
ATOM   525  C  CE    . MET A 1 88  ? -14.029 -41.578 26.849 1.00 37.64  ? 88   MET A CE    1 
ATOM   526  N  N     . ASP A 1 89  ? -10.293 -46.002 27.934 1.00 31.18  ? 89   ASP A N     1 
ATOM   527  C  CA    . ASP A 1 89  ? -9.774  -46.904 26.921 1.00 33.75  ? 89   ASP A CA    1 
ATOM   528  C  C     . ASP A 1 89  ? -10.629 -46.745 25.651 1.00 34.01  ? 89   ASP A C     1 
ATOM   529  O  O     . ASP A 1 89  ? -11.775 -47.213 25.602 1.00 33.95  ? 89   ASP A O     1 
ATOM   530  C  CB    . ASP A 1 89  ? -9.841  -48.366 27.429 1.00 34.64  ? 89   ASP A CB    1 
ATOM   531  C  CG    . ASP A 1 89  ? -9.290  -49.358 26.440 1.00 36.60  ? 89   ASP A CG    1 
ATOM   532  O  OD1   . ASP A 1 89  ? -9.007  -49.046 25.234 1.00 38.49  ? 89   ASP A OD1   1 
ATOM   533  O  OD2   . ASP A 1 89  ? -9.046  -50.499 26.915 1.00 43.45  ? 89   ASP A OD2   1 
ATOM   534  N  N     . LEU A 1 90  ? -10.057 -46.110 24.629 1.00 34.12  ? 90   LEU A N     1 
ATOM   535  C  CA    . LEU A 1 90  ? -10.851 -45.697 23.464 1.00 35.30  ? 90   LEU A CA    1 
ATOM   536  C  C     . LEU A 1 90  ? -11.051 -46.875 22.455 1.00 36.53  ? 90   LEU A C     1 
ATOM   537  O  O     . LEU A 1 90  ? -11.703 -46.711 21.446 1.00 34.74  ? 90   LEU A O     1 
ATOM   538  C  CB    . LEU A 1 90  ? -10.266 -44.461 22.784 1.00 33.25  ? 90   LEU A CB    1 
ATOM   539  C  CG    . LEU A 1 90  ? -10.175 -43.197 23.623 1.00 33.68  ? 90   LEU A CG    1 
ATOM   540  C  CD1   . LEU A 1 90  ? -9.544  -42.060 22.790 1.00 32.60  ? 90   LEU A CD1   1 
ATOM   541  C  CD2   . LEU A 1 90  ? -11.531 -42.824 24.247 1.00 30.73  ? 90   LEU A CD2   1 
ATOM   542  N  N     . ASN A 1 91  ? -10.513 -48.042 22.783 1.00 38.10  ? 91   ASN A N     1 
ATOM   543  C  CA    . ASN A 1 91  ? -10.778 -49.281 22.046 1.00 41.34  ? 91   ASN A CA    1 
ATOM   544  C  C     . ASN A 1 91  ? -12.120 -49.876 22.424 1.00 43.74  ? 91   ASN A C     1 
ATOM   545  O  O     . ASN A 1 91  ? -12.593 -50.733 21.713 1.00 45.08  ? 91   ASN A O     1 
ATOM   546  C  CB    . ASN A 1 91  ? -9.701  -50.334 22.292 1.00 40.66  ? 91   ASN A CB    1 
ATOM   547  C  CG    . ASN A 1 91  ? -8.320  -49.861 21.891 1.00 41.87  ? 91   ASN A CG    1 
ATOM   548  O  OD1   . ASN A 1 91  ? -7.408  -49.741 22.734 1.00 42.87  ? 91   ASN A OD1   1 
ATOM   549  N  ND2   . ASN A 1 91  ? -8.153  -49.572 20.618 1.00 36.19  ? 91   ASN A ND2   1 
ATOM   550  N  N     . GLU A 1 92  ? -12.711 -49.434 23.539 1.00 45.15  ? 92   GLU A N     1 
ATOM   551  C  CA    . GLU A 1 92  ? -14.001 -49.910 23.985 1.00 47.47  ? 92   GLU A CA    1 
ATOM   552  C  C     . GLU A 1 92  ? -15.062 -49.223 23.106 1.00 49.30  ? 92   GLU A C     1 
ATOM   553  O  O     . GLU A 1 92  ? -14.845 -48.112 22.631 1.00 49.67  ? 92   GLU A O     1 
ATOM   554  C  CB    . GLU A 1 92  ? -14.271 -49.586 25.468 1.00 46.30  ? 92   GLU A CB    1 
ATOM   555  C  CG    . GLU A 1 92  ? -13.358 -50.328 26.495 1.00 48.69  ? 92   GLU A CG    1 
ATOM   556  C  CD    . GLU A 1 92  ? -13.573 -49.902 28.017 1.00 54.19  ? 92   GLU A CD    1 
ATOM   557  O  OE1   . GLU A 1 92  ? -12.785 -50.384 28.891 1.00 58.56  ? 92   GLU A OE1   1 
ATOM   558  O  OE2   . GLU A 1 92  ? -14.487 -49.090 28.377 1.00 52.44  ? 92   GLU A OE2   1 
ATOM   559  N  N     . LYS A 1 93  ? -16.215 -49.882 22.922 1.00 50.80  ? 93   LYS A N     1 
ATOM   560  C  CA    . LYS A 1 93  ? -17.334 -49.339 22.159 1.00 51.10  ? 93   LYS A CA    1 
ATOM   561  C  C     . LYS A 1 93  ? -17.932 -48.131 22.853 1.00 50.30  ? 93   LYS A C     1 
ATOM   562  O  O     . LYS A 1 93  ? -18.177 -47.110 22.193 1.00 50.15  ? 93   LYS A O     1 
ATOM   563  C  CB    . LYS A 1 93  ? -18.425 -50.429 21.955 1.00 53.69  ? 93   LYS A CB    1 
ATOM   564  N  N     . GLU A 1 94  ? -18.185 -48.254 24.162 1.00 48.49  ? 94   GLU A N     1 
ATOM   565  C  CA    . GLU A 1 94  ? -18.635 -47.109 24.984 1.00 48.82  ? 94   GLU A CA    1 
ATOM   566  C  C     . GLU A 1 94  ? -17.643 -46.855 26.116 1.00 45.02  ? 94   GLU A C     1 
ATOM   567  O  O     . GLU A 1 94  ? -17.867 -47.360 27.215 1.00 43.02  ? 94   GLU A O     1 
ATOM   568  C  CB    . GLU A 1 94  ? -20.011 -47.378 25.640 1.00 50.52  ? 94   GLU A CB    1 
ATOM   569  C  CG    . GLU A 1 94  ? -21.204 -47.002 24.773 1.00 60.41  ? 94   GLU A CG    1 
ATOM   570  C  CD    . GLU A 1 94  ? -22.313 -48.096 24.820 1.00 68.74  ? 94   GLU A CD    1 
ATOM   571  O  OE1   . GLU A 1 94  ? -22.813 -48.391 25.956 1.00 68.17  ? 94   GLU A OE1   1 
ATOM   572  O  OE2   . GLU A 1 94  ? -22.657 -48.643 23.722 1.00 70.10  ? 94   GLU A OE2   1 
ATOM   573  N  N     . PRO A 1 95  ? -16.561 -46.082 25.846 1.00 42.57  ? 95   PRO A N     1 
ATOM   574  C  CA    . PRO A 1 95  ? -15.484 -45.999 26.876 1.00 40.35  ? 95   PRO A CA    1 
ATOM   575  C  C     . PRO A 1 95  ? -15.966 -45.322 28.119 1.00 38.39  ? 95   PRO A C     1 
ATOM   576  O  O     . PRO A 1 95  ? -16.581 -44.269 28.059 1.00 37.02  ? 95   PRO A O     1 
ATOM   577  C  CB    . PRO A 1 95  ? -14.356 -45.209 26.200 1.00 40.93  ? 95   PRO A CB    1 
ATOM   578  C  CG    . PRO A 1 95  ? -14.791 -44.906 24.801 1.00 41.98  ? 95   PRO A CG    1 
ATOM   579  C  CD    . PRO A 1 95  ? -16.130 -45.611 24.516 1.00 41.96  ? 95   PRO A CD    1 
ATOM   580  N  N     . ALA A 1 96  ? -15.804 -45.978 29.242 1.00 37.57  ? 96   ALA A N     1 
ATOM   581  C  CA    . ALA A 1 96  ? -16.134 -45.327 30.526 1.00 39.61  ? 96   ALA A CA    1 
ATOM   582  C  C     . ALA A 1 96  ? -14.833 -44.665 31.114 1.00 38.81  ? 96   ALA A C     1 
ATOM   583  O  O     . ALA A 1 96  ? -13.740 -45.192 30.924 1.00 37.85  ? 96   ALA A O     1 
ATOM   584  C  CB    . ALA A 1 96  ? -16.752 -46.349 31.542 1.00 38.75  ? 96   ALA A CB    1 
ATOM   585  N  N     . VAL A 1 97  ? -14.962 -43.542 31.814 1.00 38.26  ? 97   VAL A N     1 
ATOM   586  C  CA    . VAL A 1 97  ? -13.817 -42.998 32.494 1.00 39.35  ? 97   VAL A CA    1 
ATOM   587  C  C     . VAL A 1 97  ? -13.588 -43.638 33.838 1.00 39.23  ? 97   VAL A C     1 
ATOM   588  O  O     . VAL A 1 97  ? -14.523 -43.830 34.609 1.00 39.43  ? 97   VAL A O     1 
ATOM   589  C  CB    . VAL A 1 97  ? -13.892 -41.447 32.748 1.00 39.86  ? 97   VAL A CB    1 
ATOM   590  C  CG1   . VAL A 1 97  ? -13.754 -40.799 31.512 1.00 43.50  ? 97   VAL A CG1   1 
ATOM   591  C  CG2   . VAL A 1 97  ? -15.204 -41.046 33.365 1.00 41.96  ? 97   VAL A CG2   1 
ATOM   592  N  N     . SER A 1 98  ? -12.331 -43.890 34.160 1.00 38.99  ? 98   SER A N     1 
ATOM   593  C  CA    . SER A 1 98  ? -11.986 -44.070 35.569 1.00 39.67  ? 98   SER A CA    1 
ATOM   594  C  C     . SER A 1 98  ? -10.927 -43.072 36.070 1.00 38.93  ? 98   SER A C     1 
ATOM   595  O  O     . SER A 1 98  ? -10.110 -42.511 35.292 1.00 37.13  ? 98   SER A O     1 
ATOM   596  C  CB    . SER A 1 98  ? -11.505 -45.487 35.837 1.00 40.08  ? 98   SER A CB    1 
ATOM   597  O  OG    . SER A 1 98  ? -10.707 -45.969 34.792 1.00 44.10  ? 98   SER A OG    1 
ATOM   598  N  N     . GLU A 1 99  ? -10.959 -42.870 37.377 1.00 36.59  ? 99   GLU A N     1 
ATOM   599  C  CA    . GLU A 1 99  ? -10.006 -42.034 38.036 1.00 37.65  ? 99   GLU A CA    1 
ATOM   600  C  C     . GLU A 1 99  ? -8.735  -42.816 38.313 1.00 36.42  ? 99   GLU A C     1 
ATOM   601  O  O     . GLU A 1 99  ? -8.800  -43.913 38.889 1.00 37.46  ? 99   GLU A O     1 
ATOM   602  C  CB    . GLU A 1 99  ? -10.627 -41.447 39.281 1.00 37.99  ? 99   GLU A CB    1 
ATOM   603  C  CG    . GLU A 1 99  ? -9.663  -40.589 40.060 1.00 46.04  ? 99   GLU A CG    1 
ATOM   604  C  CD    . GLU A 1 99  ? -10.262 -40.113 41.390 1.00 54.95  ? 99   GLU A CD    1 
ATOM   605  O  OE1   . GLU A 1 99  ? -11.508 -40.251 41.584 1.00 57.99  ? 99   GLU A OE1   1 
ATOM   606  O  OE2   . GLU A 1 99  ? -9.477  -39.574 42.210 1.00 58.32  ? 99   GLU A OE2   1 
ATOM   607  N  N     . LEU A 1 100 ? -7.597  -42.308 37.859 1.00 33.30  ? 100  LEU A N     1 
ATOM   608  C  CA    . LEU A 1 100 ? -6.299  -42.921 38.172 1.00 33.83  ? 100  LEU A CA    1 
ATOM   609  C  C     . LEU A 1 100 ? -5.919  -42.655 39.675 1.00 33.86  ? 100  LEU A C     1 
ATOM   610  O  O     . LEU A 1 100 ? -6.067  -41.522 40.201 1.00 32.83  ? 100  LEU A O     1 
ATOM   611  C  CB    . LEU A 1 100 ? -5.196  -42.396 37.237 1.00 32.74  ? 100  LEU A CB    1 
ATOM   612  C  CG    . LEU A 1 100 ? -5.285  -42.950 35.807 1.00 34.22  ? 100  LEU A CG    1 
ATOM   613  C  CD1   . LEU A 1 100 ? -4.261  -42.352 34.881 1.00 32.47  ? 100  LEU A CD1   1 
ATOM   614  C  CD2   . LEU A 1 100 ? -5.110  -44.485 35.833 1.00 33.19  ? 100  LEU A CD2   1 
ATOM   615  N  N     . GLU A 1 101 ? -5.429  -43.692 40.337 1.00 33.03  ? 101  GLU A N     1 
ATOM   616  C  CA    . GLU A 1 101 ? -4.948  -43.530 41.685 1.00 32.76  ? 101  GLU A CA    1 
ATOM   617  C  C     . GLU A 1 101 ? -3.533  -42.997 41.599 1.00 31.66  ? 101  GLU A C     1 
ATOM   618  O  O     . GLU A 1 101 ? -2.712  -43.580 40.926 1.00 32.85  ? 101  GLU A O     1 
ATOM   619  C  CB    . GLU A 1 101 ? -4.963  -44.854 42.482 1.00 33.00  ? 101  GLU A CB    1 
ATOM   620  C  CG    . GLU A 1 101 ? -4.684  -44.561 43.970 1.00 40.16  ? 101  GLU A CG    1 
ATOM   621  C  CD    . GLU A 1 101 ? -4.495  -45.791 44.915 1.00 51.95  ? 101  GLU A CD    1 
ATOM   622  O  OE1   . GLU A 1 101 ? -4.355  -46.955 44.443 1.00 49.57  ? 101  GLU A OE1   1 
ATOM   623  O  OE2   . GLU A 1 101 ? -4.419  -45.521 46.156 1.00 55.79  ? 101  GLU A OE2   1 
ATOM   624  N  N     . ILE A 1 102 ? -3.252  -41.912 42.298 1.00 30.44  ? 102  ILE A N     1 
ATOM   625  C  CA    . ILE A 1 102 ? -1.915  -41.437 42.352 1.00 32.40  ? 102  ILE A CA    1 
ATOM   626  C  C     . ILE A 1 102 ? -1.260  -42.030 43.613 1.00 33.15  ? 102  ILE A C     1 
ATOM   627  O  O     . ILE A 1 102 ? -1.803  -41.885 44.730 1.00 33.72  ? 102  ILE A O     1 
ATOM   628  C  CB    . ILE A 1 102 ? -1.884  -39.881 42.385 1.00 31.91  ? 102  ILE A CB    1 
ATOM   629  C  CG1   . ILE A 1 102 ? -2.183  -39.358 40.974 1.00 32.24  ? 102  ILE A CG1   1 
ATOM   630  C  CG2   . ILE A 1 102 ? -0.479  -39.387 42.780 1.00 30.55  ? 102  ILE A CG2   1 
ATOM   631  C  CD1   . ILE A 1 102 ? -2.570  -37.861 40.959 1.00 34.28  ? 102  ILE A CD1   1 
ATOM   632  N  N     . ILE A 1 103 ? -0.122  -42.670 43.456 1.00 33.08  ? 103  ILE A N     1 
ATOM   633  C  CA    . ILE A 1 103 ? 0.575   -43.157 44.648 1.00 34.12  ? 103  ILE A CA    1 
ATOM   634  C  C     . ILE A 1 103 ? 1.954   -42.550 44.774 1.00 34.43  ? 103  ILE A C     1 
ATOM   635  O  O     . ILE A 1 103 ? 2.558   -42.144 43.764 1.00 33.48  ? 103  ILE A O     1 
ATOM   636  C  CB    . ILE A 1 103 ? 0.676   -44.714 44.669 1.00 35.26  ? 103  ILE A CB    1 
ATOM   637  C  CG1   . ILE A 1 103 ? 1.442   -45.218 43.485 1.00 35.34  ? 103  ILE A CG1   1 
ATOM   638  C  CG2   . ILE A 1 103 ? -0.747  -45.372 44.669 1.00 33.16  ? 103  ILE A CG2   1 
ATOM   639  C  CD1   . ILE A 1 103 ? 1.362   -46.699 43.352 1.00 42.48  ? 103  ILE A CD1   1 
ATOM   640  N  N     . GLY A 1 104 ? 2.486   -42.543 46.008 1.00 34.91  ? 104  GLY A N     1 
ATOM   641  C  CA    . GLY A 1 104 ? 3.825   -42.023 46.258 1.00 34.13  ? 104  GLY A CA    1 
ATOM   642  C  C     . GLY A 1 104 ? 3.784   -41.061 47.452 1.00 34.00  ? 104  GLY A C     1 
ATOM   643  O  O     . GLY A 1 104 ? 2.712   -40.758 47.959 1.00 36.49  ? 104  GLY A O     1 
ATOM   644  N  N     . ASN A 1 105 ? 4.922   -40.558 47.920 1.00 29.03  ? 105  ASN A N     1 
ATOM   645  C  CA    . ASN A 1 105 ? 4.837   -39.728 49.093 1.00 27.69  ? 105  ASN A CA    1 
ATOM   646  C  C     . ASN A 1 105 ? 5.505   -38.479 48.756 1.00 26.22  ? 105  ASN A C     1 
ATOM   647  O  O     . ASN A 1 105 ? 5.712   -37.629 49.600 1.00 24.78  ? 105  ASN A O     1 
ATOM   648  C  CB    . ASN A 1 105 ? 5.512   -40.473 50.292 1.00 27.52  ? 105  ASN A CB    1 
ATOM   649  C  CG    . ASN A 1 105 ? 4.530   -41.485 50.936 1.00 29.09  ? 105  ASN A CG    1 
ATOM   650  O  OD1   . ASN A 1 105 ? 3.525   -41.063 51.496 1.00 31.21  ? 105  ASN A OD1   1 
ATOM   651  N  ND2   . ASN A 1 105 ? 4.832   -42.784 50.873 1.00 25.78  ? 105  ASN A ND2   1 
ATOM   652  N  N     . THR A 1 106 ? 5.852   -38.359 47.473 1.00 27.11  ? 106  THR A N     1 
ATOM   653  C  CA    . THR A 1 106 ? 6.498   -37.128 47.061 1.00 26.92  ? 106  THR A CA    1 
ATOM   654  C  C     . THR A 1 106 ? 5.483   -36.059 46.610 1.00 28.78  ? 106  THR A C     1 
ATOM   655  O  O     . THR A 1 106 ? 5.898   -34.994 46.245 1.00 28.22  ? 106  THR A O     1 
ATOM   656  C  CB    . THR A 1 106 ? 7.582   -37.415 46.054 1.00 27.04  ? 106  THR A CB    1 
ATOM   657  O  OG1   . THR A 1 106 ? 7.040   -38.330 45.098 1.00 25.60  ? 106  THR A OG1   1 
ATOM   658  C  CG2   . THR A 1 106 ? 8.825   -38.162 46.786 1.00 27.43  ? 106  THR A CG2   1 
ATOM   659  N  N     . LEU A 1 107 ? 4.173   -36.315 46.715 1.00 28.98  ? 107  LEU A N     1 
ATOM   660  C  CA    . LEU A 1 107 ? 3.187   -35.342 46.184 1.00 30.88  ? 107  LEU A CA    1 
ATOM   661  C  C     . LEU A 1 107 ? 2.044   -35.220 47.167 1.00 31.20  ? 107  LEU A C     1 
ATOM   662  O  O     . LEU A 1 107 ? 1.569   -36.244 47.707 1.00 31.93  ? 107  LEU A O     1 
ATOM   663  C  CB    . LEU A 1 107 ? 2.542   -35.893 44.841 1.00 30.90  ? 107  LEU A CB    1 
ATOM   664  C  CG    . LEU A 1 107 ? 1.493   -34.998 44.125 1.00 32.76  ? 107  LEU A CG    1 
ATOM   665  C  CD1   . LEU A 1 107 ? 2.170   -33.765 43.519 1.00 31.61  ? 107  LEU A CD1   1 
ATOM   666  C  CD2   . LEU A 1 107 ? 0.743   -35.727 43.036 1.00 33.73  ? 107  LEU A CD2   1 
ATOM   667  N  N     . ASP A 1 108 ? 1.581   -33.994 47.364 1.00 30.70  ? 108  ASP A N     1 
ATOM   668  C  CA    . ASP A 1 108 ? 0.393   -33.732 48.139 1.00 32.86  ? 108  ASP A CA    1 
ATOM   669  C  C     . ASP A 1 108 ? -0.853  -33.711 47.205 1.00 34.31  ? 108  ASP A C     1 
ATOM   670  O  O     . ASP A 1 108 ? -1.082  -32.699 46.551 1.00 32.85  ? 108  ASP A O     1 
ATOM   671  C  CB    . ASP A 1 108 ? 0.567   -32.335 48.758 1.00 32.20  ? 108  ASP A CB    1 
ATOM   672  C  CG    . ASP A 1 108 ? -0.615  -31.955 49.687 1.00 36.91  ? 108  ASP A CG    1 
ATOM   673  O  OD1   . ASP A 1 108 ? -1.591  -32.751 49.815 1.00 37.94  ? 108  ASP A OD1   1 
ATOM   674  O  OD2   . ASP A 1 108 ? -0.548  -30.868 50.295 1.00 41.91  ? 108  ASP A OD2   1 
ATOM   675  N  N     . ILE A 1 109 ? -1.584  -34.815 47.118 1.00 36.62  ? 109  ILE A N     1 
ATOM   676  C  CA    . ILE A 1 109 ? -2.757  -34.886 46.296 1.00 41.74  ? 109  ILE A CA    1 
ATOM   677  C  C     . ILE A 1 109 ? -3.867  -33.962 46.731 1.00 42.20  ? 109  ILE A C     1 
ATOM   678  O  O     . ILE A 1 109 ? -4.732  -33.639 45.927 1.00 42.48  ? 109  ILE A O     1 
ATOM   679  C  CB    . ILE A 1 109 ? -3.307  -36.338 46.083 1.00 42.88  ? 109  ILE A CB    1 
ATOM   680  C  CG1   . ILE A 1 109 ? -3.817  -36.917 47.398 1.00 45.96  ? 109  ILE A CG1   1 
ATOM   681  C  CG2   . ILE A 1 109 ? -2.218  -37.231 45.524 1.00 46.13  ? 109  ILE A CG2   1 
ATOM   682  N  N     . SER A 1 110 ? -3.837  -33.499 47.977 1.00 43.25  ? 110  SER A N     1 
ATOM   683  C  CA    . SER A 1 110 ? -4.993  -32.777 48.517 1.00 42.17  ? 110  SER A CA    1 
ATOM   684  C  C     . SER A 1 110 ? -4.999  -31.455 47.823 1.00 42.19  ? 110  SER A C     1 
ATOM   685  O  O     . SER A 1 110 ? -6.005  -30.726 47.809 1.00 41.85  ? 110  SER A O     1 
ATOM   686  C  CB    . SER A 1 110 ? -4.932  -32.598 50.059 1.00 42.57  ? 110  SER A CB    1 
ATOM   687  O  OG    . SER A 1 110 ? -4.048  -31.538 50.431 1.00 42.64  ? 110  SER A OG    1 
ATOM   688  N  N     . SER A 1 111 ? -3.865  -31.093 47.246 1.00 40.49  ? 111  SER A N     1 
ATOM   689  C  CA    . SER A 1 111 ? -3.926  -29.831 46.533 1.00 38.60  ? 111  SER A CA    1 
ATOM   690  C  C     . SER A 1 111 ? -3.695  -29.983 44.982 1.00 34.84  ? 111  SER A C     1 
ATOM   691  O  O     . SER A 1 111 ? -3.412  -29.005 44.281 1.00 35.11  ? 111  SER A O     1 
ATOM   692  C  CB    . SER A 1 111 ? -3.016  -28.817 47.228 1.00 38.43  ? 111  SER A CB    1 
ATOM   693  O  OG    . SER A 1 111 ? -1.703  -28.970 46.808 1.00 41.47  ? 111  SER A OG    1 
ATOM   694  N  N     . PHE A 1 112 ? -3.785  -31.204 44.482 1.00 31.50  ? 112  PHE A N     1 
ATOM   695  C  CA    . PHE A 1 112 ? -3.551  -31.484 43.068 1.00 28.55  ? 112  PHE A CA    1 
ATOM   696  C  C     . PHE A 1 112 ? -4.477  -30.629 42.159 1.00 26.62  ? 112  PHE A C     1 
ATOM   697  O  O     . PHE A 1 112 ? -5.705  -30.591 42.340 1.00 24.46  ? 112  PHE A O     1 
ATOM   698  C  CB    . PHE A 1 112 ? -3.750  -32.962 42.809 1.00 29.10  ? 112  PHE A CB    1 
ATOM   699  C  CG    . PHE A 1 112 ? -3.231  -33.445 41.462 1.00 27.94  ? 112  PHE A CG    1 
ATOM   700  C  CD1   . PHE A 1 112 ? -1.906  -33.233 41.096 1.00 26.44  ? 112  PHE A CD1   1 
ATOM   701  C  CD2   . PHE A 1 112 ? -4.071  -34.169 40.595 1.00 23.95  ? 112  PHE A CD2   1 
ATOM   702  C  CE1   . PHE A 1 112 ? -1.412  -33.735 39.918 1.00 25.43  ? 112  PHE A CE1   1 
ATOM   703  C  CE2   . PHE A 1 112 ? -3.575  -34.691 39.425 1.00 25.90  ? 112  PHE A CE2   1 
ATOM   704  C  CZ    . PHE A 1 112 ? -2.256  -34.468 39.062 1.00 23.12  ? 112  PHE A CZ    1 
ATOM   705  N  N     . ASN A 1 113 ? -3.890  -29.848 41.259 1.00 22.91  ? 113  ASN A N     1 
ATOM   706  C  CA    . ASN A 1 113 ? -4.730  -28.911 40.452 1.00 21.74  ? 113  ASN A CA    1 
ATOM   707  C  C     . ASN A 1 113 ? -4.168  -28.956 39.026 1.00 21.12  ? 113  ASN A C     1 
ATOM   708  O  O     . ASN A 1 113 ? -3.340  -28.085 38.624 1.00 19.89  ? 113  ASN A O     1 
ATOM   709  C  CB    . ASN A 1 113 ? -4.717  -27.495 41.090 1.00 22.76  ? 113  ASN A CB    1 
ATOM   710  C  CG    . ASN A 1 113 ? -5.578  -26.535 40.310 1.00 25.70  ? 113  ASN A CG    1 
ATOM   711  O  OD1   . ASN A 1 113 ? -6.411  -27.009 39.552 1.00 25.91  ? 113  ASN A OD1   1 
ATOM   712  N  ND2   . ASN A 1 113 ? -5.451  -25.217 40.510 1.00 19.67  ? 113  ASN A ND2   1 
ATOM   713  N  N     . PRO A 1 114 ? -4.491  -30.031 38.287 1.00 20.18  ? 114  PRO A N     1 
ATOM   714  C  CA    . PRO A 1 114 ? -3.794  -30.351 37.058 1.00 20.00  ? 114  PRO A CA    1 
ATOM   715  C  C     . PRO A 1 114 ? -4.250  -29.569 35.830 1.00 20.29  ? 114  PRO A C     1 
ATOM   716  O  O     . PRO A 1 114 ? -5.397  -29.183 35.747 1.00 20.61  ? 114  PRO A O     1 
ATOM   717  C  CB    . PRO A 1 114 ? -4.098  -31.855 36.843 1.00 19.74  ? 114  PRO A CB    1 
ATOM   718  C  CG    . PRO A 1 114 ? -5.469  -32.028 37.434 1.00 19.13  ? 114  PRO A CG    1 
ATOM   719  C  CD    . PRO A 1 114 ? -5.539  -31.046 38.619 1.00 20.97  ? 114  PRO A CD    1 
ATOM   720  N  N     . HIS A 1 115 ? -3.352  -29.349 34.884 1.00 19.35  ? 115  HIS A N     1 
ATOM   721  C  CA    . HIS A 1 115 ? -3.622  -28.382 33.779 1.00 18.84  ? 115  HIS A CA    1 
ATOM   722  C  C     . HIS A 1 115 ? -3.117  -29.118 32.509 1.00 17.44  ? 115  HIS A C     1 
ATOM   723  O  O     . HIS A 1 115 ? -3.494  -30.263 32.313 1.00 17.98  ? 115  HIS A O     1 
ATOM   724  C  CB    . HIS A 1 115 ? -2.911  -27.052 34.137 1.00 18.15  ? 115  HIS A CB    1 
ATOM   725  C  CG    . HIS A 1 115 ? -3.253  -25.925 33.214 1.00 23.10  ? 115  HIS A CG    1 
ATOM   726  N  ND1   . HIS A 1 115 ? -2.823  -24.626 33.404 1.00 24.11  ? 115  HIS A ND1   1 
ATOM   727  C  CD2   . HIS A 1 115 ? -4.037  -25.906 32.092 1.00 24.45  ? 115  HIS A CD2   1 
ATOM   728  C  CE1   . HIS A 1 115 ? -3.363  -23.847 32.474 1.00 25.74  ? 115  HIS A CE1   1 
ATOM   729  N  NE2   . HIS A 1 115 ? -4.087  -24.601 31.652 1.00 23.26  ? 115  HIS A NE2   1 
ATOM   730  N  N     . GLY A 1 116 ? -2.168  -28.607 31.729 1.00 17.58  ? 116  GLY A N     1 
ATOM   731  C  CA    . GLY A 1 116 ? -1.697  -29.387 30.575 1.00 15.50  ? 116  GLY A CA    1 
ATOM   732  C  C     . GLY A 1 116 ? -0.948  -30.671 30.951 1.00 19.86  ? 116  GLY A C     1 
ATOM   733  O  O     . GLY A 1 116 ? -0.347  -30.730 32.048 1.00 18.12  ? 116  GLY A O     1 
ATOM   734  N  N     . ILE A 1 117 ? -0.872  -31.650 30.019 1.00 17.56  ? 117  ILE A N     1 
ATOM   735  C  CA    . ILE A 1 117 ? -0.194  -32.865 30.263 1.00 19.01  ? 117  ILE A CA    1 
ATOM   736  C  C     . ILE A 1 117 ? 0.580   -33.219 29.009 1.00 20.49  ? 117  ILE A C     1 
ATOM   737  O  O     . ILE A 1 117 ? 0.413   -32.587 27.959 1.00 20.04  ? 117  ILE A O     1 
ATOM   738  C  CB    . ILE A 1 117 ? -1.177  -34.017 30.585 1.00 18.96  ? 117  ILE A CB    1 
ATOM   739  C  CG1   . ILE A 1 117 ? -2.061  -34.356 29.343 1.00 17.59  ? 117  ILE A CG1   1 
ATOM   740  C  CG2   . ILE A 1 117 ? -2.061  -33.645 31.805 1.00 15.37  ? 117  ILE A CG2   1 
ATOM   741  C  CD1   . ILE A 1 117 ? -3.103  -35.530 29.707 1.00 20.15  ? 117  ILE A CD1   1 
ATOM   742  N  N     . SER A 1 118 ? 1.435   -34.212 29.111 1.00 19.56  ? 118  SER A N     1 
ATOM   743  C  CA    . SER A 1 118 ? 2.156   -34.718 27.917 1.00 20.58  ? 118  SER A CA    1 
ATOM   744  C  C     . SER A 1 118 ? 2.677   -36.118 28.315 1.00 22.52  ? 118  SER A C     1 
ATOM   745  O  O     . SER A 1 118 ? 2.803   -36.417 29.480 1.00 23.29  ? 118  SER A O     1 
ATOM   746  C  CB    . SER A 1 118 ? 3.365   -33.857 27.515 1.00 21.91  ? 118  SER A CB    1 
ATOM   747  O  OG    . SER A 1 118 ? 3.967   -34.364 26.303 1.00 17.81  ? 118  SER A OG    1 
ATOM   748  N  N     . THR A 1 119 ? 2.974   -36.979 27.367 1.00 24.55  ? 119  THR A N     1 
ATOM   749  C  CA    . THR A 1 119 ? 3.426   -38.305 27.733 1.00 25.51  ? 119  THR A CA    1 
ATOM   750  C  C     . THR A 1 119 ? 4.757   -38.473 27.078 1.00 25.65  ? 119  THR A C     1 
ATOM   751  O  O     . THR A 1 119 ? 5.089   -37.778 26.111 1.00 25.71  ? 119  THR A O     1 
ATOM   752  C  CB    . THR A 1 119 ? 2.488   -39.401 27.235 1.00 26.57  ? 119  THR A CB    1 
ATOM   753  O  OG1   . THR A 1 119 ? 2.398   -39.329 25.801 1.00 26.52  ? 119  THR A OG1   1 
ATOM   754  C  CG2   . THR A 1 119 ? 1.103   -39.290 27.907 1.00 27.79  ? 119  THR A CG2   1 
ATOM   755  N  N     . PHE A 1 120 ? 5.556   -39.338 27.636 1.00 26.75  ? 120  PHE A N     1 
ATOM   756  C  CA    . PHE A 1 120 ? 6.779   -39.790 26.948 1.00 28.71  ? 120  PHE A CA    1 
ATOM   757  C  C     . PHE A 1 120 ? 6.969   -41.299 27.128 1.00 29.24  ? 120  PHE A C     1 
ATOM   758  O  O     . PHE A 1 120 ? 6.857   -41.793 28.233 1.00 29.16  ? 120  PHE A O     1 
ATOM   759  C  CB    . PHE A 1 120 ? 7.997   -39.111 27.521 1.00 27.64  ? 120  PHE A CB    1 
ATOM   760  C  CG    . PHE A 1 120 ? 9.282   -39.557 26.845 1.00 31.33  ? 120  PHE A CG    1 
ATOM   761  C  CD1   . PHE A 1 120 ? 9.637   -39.054 25.602 1.00 32.72  ? 120  PHE A CD1   1 
ATOM   762  C  CD2   . PHE A 1 120 ? 10.120  -40.501 27.453 1.00 35.00  ? 120  PHE A CD2   1 
ATOM   763  C  CE1   . PHE A 1 120 ? 10.819  -39.484 24.917 1.00 33.75  ? 120  PHE A CE1   1 
ATOM   764  C  CE2   . PHE A 1 120 ? 11.301  -40.925 26.823 1.00 35.90  ? 120  PHE A CE2   1 
ATOM   765  C  CZ    . PHE A 1 120 ? 11.656  -40.404 25.533 1.00 36.46  ? 120  PHE A CZ    1 
ATOM   766  N  N     . ILE A 1 121 ? 7.196   -42.017 26.040 1.00 31.37  ? 121  ILE A N     1 
ATOM   767  C  CA    . ILE A 1 121 ? 7.363   -43.436 26.115 1.00 34.92  ? 121  ILE A CA    1 
ATOM   768  C  C     . ILE A 1 121 ? 8.870   -43.730 25.935 1.00 37.56  ? 121  ILE A C     1 
ATOM   769  O  O     . ILE A 1 121 ? 9.445   -43.433 24.892 1.00 36.90  ? 121  ILE A O     1 
ATOM   770  C  CB    . ILE A 1 121 ? 6.490   -44.210 25.090 1.00 36.43  ? 121  ILE A CB    1 
ATOM   771  C  CG1   . ILE A 1 121 ? 5.030   -43.769 25.183 1.00 37.22  ? 121  ILE A CG1   1 
ATOM   772  C  CG2   . ILE A 1 121 ? 6.616   -45.847 25.329 1.00 36.54  ? 121  ILE A CG2   1 
ATOM   773  C  CD1   . ILE A 1 121 ? 4.069   -44.539 24.194 1.00 45.41  ? 121  ILE A CD1   1 
ATOM   774  N  N     . ASP A 1 122 ? 9.501   -44.249 26.989 1.00 39.67  ? 122  ASP A N     1 
ATOM   775  C  CA    . ASP A 1 122 ? 10.901  -44.622 26.912 1.00 44.63  ? 122  ASP A CA    1 
ATOM   776  C  C     . ASP A 1 122 ? 11.133  -45.872 26.025 1.00 46.39  ? 122  ASP A C     1 
ATOM   777  O  O     . ASP A 1 122 ? 10.206  -46.648 25.718 1.00 44.43  ? 122  ASP A O     1 
ATOM   778  C  CB    . ASP A 1 122 ? 11.485  -44.852 28.328 1.00 45.53  ? 122  ASP A CB    1 
ATOM   779  C  CG    . ASP A 1 122 ? 12.930  -44.303 28.466 1.00 49.98  ? 122  ASP A CG    1 
ATOM   780  O  OD1   . ASP A 1 122 ? 13.443  -44.196 29.614 1.00 53.75  ? 122  ASP A OD1   1 
ATOM   781  O  OD2   . ASP A 1 122 ? 13.543  -43.973 27.411 1.00 53.88  ? 122  ASP A OD2   1 
ATOM   782  N  N     . ASP A 1 123 ? 12.389  -46.047 25.631 1.00 50.25  ? 123  ASP A N     1 
ATOM   783  C  CA    . ASP A 1 123 ? 12.874  -47.256 24.929 1.00 53.24  ? 123  ASP A CA    1 
ATOM   784  C  C     . ASP A 1 123 ? 12.477  -48.586 25.547 1.00 53.83  ? 123  ASP A C     1 
ATOM   785  O  O     . ASP A 1 123 ? 12.178  -49.528 24.812 1.00 54.74  ? 123  ASP A O     1 
ATOM   786  C  CB    . ASP A 1 123 ? 14.406  -47.191 24.790 1.00 55.10  ? 123  ASP A CB    1 
ATOM   787  C  CG    . ASP A 1 123 ? 14.829  -46.258 23.664 1.00 59.69  ? 123  ASP A CG    1 
ATOM   788  O  OD1   . ASP A 1 123 ? 14.010  -46.105 22.723 1.00 64.32  ? 123  ASP A OD1   1 
ATOM   789  O  OD2   . ASP A 1 123 ? 15.945  -45.679 23.709 1.00 64.54  ? 123  ASP A OD2   1 
ATOM   790  N  N     . ASP A 1 124 ? 12.479  -48.673 26.881 1.00 54.64  ? 124  ASP A N     1 
ATOM   791  C  CA    . ASP A 1 124 ? 11.975  -49.861 27.595 1.00 54.74  ? 124  ASP A CA    1 
ATOM   792  C  C     . ASP A 1 124 ? 10.446  -49.917 27.614 1.00 52.96  ? 124  ASP A C     1 
ATOM   793  O  O     . ASP A 1 124 ? 9.845   -50.808 28.255 1.00 52.90  ? 124  ASP A O     1 
ATOM   794  C  CB    . ASP A 1 124 ? 12.581  -49.976 29.027 1.00 56.70  ? 124  ASP A CB    1 
ATOM   795  C  CG    . ASP A 1 124 ? 12.193  -48.799 29.983 1.00 62.43  ? 124  ASP A CG    1 
ATOM   796  O  OD1   . ASP A 1 124 ? 11.271  -48.013 29.658 1.00 68.25  ? 124  ASP A OD1   1 
ATOM   797  O  OD2   . ASP A 1 124 ? 12.805  -48.660 31.093 1.00 65.03  ? 124  ASP A OD2   1 
ATOM   798  N  N     . ASN A 1 125 ? 9.794   -48.963 26.921 1.00 50.61  ? 125  ASN A N     1 
ATOM   799  C  CA    . ASN A 1 125 ? 8.311   -48.895 26.892 1.00 48.24  ? 125  ASN A CA    1 
ATOM   800  C  C     . ASN A 1 125 ? 7.646   -48.407 28.182 1.00 44.16  ? 125  ASN A C     1 
ATOM   801  O  O     . ASN A 1 125 ? 6.432   -48.515 28.321 1.00 43.39  ? 125  ASN A O     1 
ATOM   802  C  CB    . ASN A 1 125 ? 7.694   -50.261 26.557 1.00 50.34  ? 125  ASN A CB    1 
ATOM   803  C  CG    . ASN A 1 125 ? 7.800   -50.590 25.107 1.00 57.88  ? 125  ASN A CG    1 
ATOM   804  O  OD1   . ASN A 1 125 ? 7.324   -49.829 24.223 1.00 63.84  ? 125  ASN A OD1   1 
ATOM   805  N  ND2   . ASN A 1 125 ? 8.452   -51.733 24.823 1.00 63.45  ? 125  ASN A ND2   1 
ATOM   806  N  N     . THR A 1 126 ? 8.426   -47.924 29.133 1.00 40.94  ? 126  THR A N     1 
ATOM   807  C  CA    . THR A 1 126 ? 7.864   -47.201 30.280 1.00 39.05  ? 126  THR A CA    1 
ATOM   808  C  C     . THR A 1 126 ? 7.159   -45.896 29.769 1.00 35.17  ? 126  THR A C     1 
ATOM   809  O  O     . THR A 1 126 ? 7.696   -45.166 28.912 1.00 33.65  ? 126  THR A O     1 
ATOM   810  C  CB    . THR A 1 126 ? 8.993   -46.789 31.221 1.00 41.09  ? 126  THR A CB    1 
ATOM   811  O  OG1   . THR A 1 126 ? 9.803   -47.949 31.546 1.00 45.87  ? 126  THR A OG1   1 
ATOM   812  C  CG2   . THR A 1 126 ? 8.434   -46.132 32.502 1.00 38.26  ? 126  THR A CG2   1 
ATOM   813  N  N     . VAL A 1 127 ? 5.946   -45.691 30.257 1.00 32.09  ? 127  VAL A N     1 
ATOM   814  C  CA    . VAL A 1 127 ? 5.138   -44.540 29.985 1.00 29.51  ? 127  VAL A CA    1 
ATOM   815  C  C     . VAL A 1 127 ? 5.226   -43.557 31.114 1.00 28.65  ? 127  VAL A C     1 
ATOM   816  O  O     . VAL A 1 127 ? 4.824   -43.865 32.226 1.00 28.46  ? 127  VAL A O     1 
ATOM   817  C  CB    . VAL A 1 127 ? 3.663   -44.893 29.821 1.00 30.81  ? 127  VAL A CB    1 
ATOM   818  C  CG1   . VAL A 1 127 ? 2.892   -43.599 29.550 1.00 24.53  ? 127  VAL A CG1   1 
ATOM   819  C  CG2   . VAL A 1 127 ? 3.470   -45.979 28.623 1.00 30.82  ? 127  VAL A CG2   1 
ATOM   820  N  N     . TYR A 1 128 ? 5.745   -42.371 30.802 1.00 25.22  ? 128  TYR A N     1 
ATOM   821  C  CA    . TYR A 1 128 ? 5.797   -41.277 31.744 1.00 25.96  ? 128  TYR A CA    1 
ATOM   822  C  C     . TYR A 1 128 ? 4.663   -40.323 31.369 1.00 24.03  ? 128  TYR A C     1 
ATOM   823  O  O     . TYR A 1 128 ? 4.485   -40.029 30.181 1.00 25.54  ? 128  TYR A O     1 
ATOM   824  C  CB    . TYR A 1 128 ? 7.139   -40.545 31.549 1.00 25.41  ? 128  TYR A CB    1 
ATOM   825  C  CG    . TYR A 1 128 ? 8.298   -41.411 32.017 1.00 28.59  ? 128  TYR A CG    1 
ATOM   826  C  CD1   . TYR A 1 128 ? 8.610   -41.497 33.406 1.00 34.51  ? 128  TYR A CD1   1 
ATOM   827  C  CD2   . TYR A 1 128 ? 9.049   -42.153 31.123 1.00 28.54  ? 128  TYR A CD2   1 
ATOM   828  C  CE1   . TYR A 1 128 ? 9.693   -42.299 33.892 1.00 36.13  ? 128  TYR A CE1   1 
ATOM   829  C  CE2   . TYR A 1 128 ? 10.130  -42.990 31.602 1.00 30.95  ? 128  TYR A CE2   1 
ATOM   830  C  CZ    . TYR A 1 128 ? 10.430  -43.035 32.981 1.00 35.33  ? 128  TYR A CZ    1 
ATOM   831  O  OH    . TYR A 1 128 ? 11.457  -43.829 33.461 1.00 42.89  ? 128  TYR A OH    1 
ATOM   832  N  N     . LEU A 1 129 ? 3.963   -39.841 32.370 1.00 23.20  ? 129  LEU A N     1 
ATOM   833  C  CA    . LEU A 1 129 ? 3.008   -38.744 32.251 1.00 21.76  ? 129  LEU A CA    1 
ATOM   834  C  C     . LEU A 1 129 ? 3.561   -37.519 32.952 1.00 21.29  ? 129  LEU A C     1 
ATOM   835  O  O     . LEU A 1 129 ? 3.888   -37.618 34.165 1.00 21.62  ? 129  LEU A O     1 
ATOM   836  C  CB    . LEU A 1 129 ? 1.671   -39.166 32.916 1.00 19.45  ? 129  LEU A CB    1 
ATOM   837  C  CG    . LEU A 1 129 ? 0.576   -38.104 32.800 1.00 23.29  ? 129  LEU A CG    1 
ATOM   838  C  CD1   . LEU A 1 129 ? 0.164   -37.991 31.307 1.00 21.15  ? 129  LEU A CD1   1 
ATOM   839  C  CD2   . LEU A 1 129 ? -0.621  -38.493 33.721 1.00 20.69  ? 129  LEU A CD2   1 
ATOM   840  N  N     . LEU A 1 130 ? 3.617   -36.365 32.239 1.00 19.87  ? 130  LEU A N     1 
ATOM   841  C  CA    . LEU A 1 130 ? 4.012   -35.058 32.840 1.00 20.32  ? 130  LEU A CA    1 
ATOM   842  C  C     . LEU A 1 130 ? 2.775   -34.243 32.970 1.00 19.97  ? 130  LEU A C     1 
ATOM   843  O  O     . LEU A 1 130 ? 1.989   -34.171 32.001 1.00 20.12  ? 130  LEU A O     1 
ATOM   844  C  CB    . LEU A 1 130 ? 5.085   -34.321 31.992 1.00 18.73  ? 130  LEU A CB    1 
ATOM   845  C  CG    . LEU A 1 130 ? 6.485   -34.981 32.149 1.00 24.61  ? 130  LEU A CG    1 
ATOM   846  C  CD1   . LEU A 1 130 ? 6.547   -36.385 31.361 1.00 27.80  ? 130  LEU A CD1   1 
ATOM   847  C  CD2   . LEU A 1 130 ? 7.559   -34.031 31.560 1.00 23.50  ? 130  LEU A CD2   1 
ATOM   848  N  N     . VAL A 1 131 ? 2.570   -33.638 34.130 1.00 18.77  ? 131  VAL A N     1 
ATOM   849  C  CA    . VAL A 1 131 ? 1.344   -32.933 34.368 1.00 19.72  ? 131  VAL A CA    1 
ATOM   850  C  C     . VAL A 1 131 ? 1.702   -31.577 34.992 1.00 21.29  ? 131  VAL A C     1 
ATOM   851  O  O     . VAL A 1 131 ? 2.339   -31.525 36.060 1.00 21.49  ? 131  VAL A O     1 
ATOM   852  C  CB    . VAL A 1 131 ? 0.458   -33.692 35.376 1.00 19.93  ? 131  VAL A CB    1 
ATOM   853  C  CG1   . VAL A 1 131 ? -0.846  -32.874 35.767 1.00 19.52  ? 131  VAL A CG1   1 
ATOM   854  C  CG2   . VAL A 1 131 ? 0.161   -35.137 34.970 1.00 14.68  ? 131  VAL A CG2   1 
ATOM   855  N  N     . VAL A 1 132 ? 1.356   -30.491 34.323 1.00 20.34  ? 132  VAL A N     1 
ATOM   856  C  CA    . VAL A 1 132 ? 1.354   -29.149 34.942 1.00 19.34  ? 132  VAL A CA    1 
ATOM   857  C  C     . VAL A 1 132 ? 0.453   -29.121 36.150 1.00 21.72  ? 132  VAL A C     1 
ATOM   858  O  O     . VAL A 1 132 ? -0.750  -29.571 36.086 1.00 21.82  ? 132  VAL A O     1 
ATOM   859  C  CB    . VAL A 1 132 ? 0.863   -28.115 33.924 1.00 19.74  ? 132  VAL A CB    1 
ATOM   860  C  CG1   . VAL A 1 132 ? 0.861   -26.752 34.512 1.00 17.47  ? 132  VAL A CG1   1 
ATOM   861  C  CG2   . VAL A 1 132 ? 1.716   -28.194 32.586 1.00 18.27  ? 132  VAL A CG2   1 
ATOM   862  N  N     . ASN A 1 133 ? 0.945   -28.587 37.268 1.00 20.46  ? 133  ASN A N     1 
ATOM   863  C  CA    . ASN A 1 133 ? 0.123   -28.625 38.469 1.00 22.05  ? 133  ASN A CA    1 
ATOM   864  C  C     . ASN A 1 133 ? 0.148   -27.198 39.073 1.00 23.14  ? 133  ASN A C     1 
ATOM   865  O  O     . ASN A 1 133 ? 1.203   -26.495 39.028 1.00 24.79  ? 133  ASN A O     1 
ATOM   866  C  CB    . ASN A 1 133 ? 0.684   -29.776 39.374 1.00 21.62  ? 133  ASN A CB    1 
ATOM   867  C  CG    . ASN A 1 133 ? -0.072  -29.962 40.731 1.00 25.23  ? 133  ASN A CG    1 
ATOM   868  O  OD1   . ASN A 1 133 ? -1.254  -29.613 40.864 1.00 30.45  ? 133  ASN A OD1   1 
ATOM   869  N  ND2   . ASN A 1 133 ? 0.638   -30.508 41.750 1.00 22.85  ? 133  ASN A ND2   1 
ATOM   870  N  N     . HIS A 1 134 ? -0.992  -26.726 39.548 1.00 21.70  ? 134  HIS A N     1 
ATOM   871  C  CA    . HIS A 1 134 ? -1.077  -25.402 40.216 1.00 22.77  ? 134  HIS A CA    1 
ATOM   872  C  C     . HIS A 1 134 ? -1.494  -25.531 41.683 1.00 25.20  ? 134  HIS A C     1 
ATOM   873  O  O     . HIS A 1 134 ? -2.645  -25.249 42.057 1.00 24.23  ? 134  HIS A O     1 
ATOM   874  C  CB    . HIS A 1 134 ? -1.988  -24.442 39.429 1.00 22.72  ? 134  HIS A CB    1 
ATOM   875  C  CG    . HIS A 1 134 ? -1.548  -24.242 37.997 1.00 23.20  ? 134  HIS A CG    1 
ATOM   876  N  ND1   . HIS A 1 134 ? -0.315  -23.763 37.645 1.00 23.52  ? 134  HIS A ND1   1 
ATOM   877  C  CD2   . HIS A 1 134 ? -2.162  -24.545 36.835 1.00 25.09  ? 134  HIS A CD2   1 
ATOM   878  C  CE1   . HIS A 1 134 ? -0.197  -23.706 36.333 1.00 23.20  ? 134  HIS A CE1   1 
ATOM   879  N  NE2   . HIS A 1 134 ? -1.322  -24.153 35.819 1.00 26.10  ? 134  HIS A NE2   1 
ATOM   880  N  N     . PRO A 1 135 ? -0.605  -26.076 42.527 1.00 29.84  ? 135  PRO A N     1 
ATOM   881  C  CA    . PRO A 1 135 ? -1.050  -26.168 43.947 1.00 32.88  ? 135  PRO A CA    1 
ATOM   882  C  C     . PRO A 1 135 ? -0.916  -24.763 44.549 1.00 35.96  ? 135  PRO A C     1 
ATOM   883  O  O     . PRO A 1 135 ? 0.182   -24.191 44.527 1.00 38.19  ? 135  PRO A O     1 
ATOM   884  C  CB    . PRO A 1 135 ? -0.015  -27.118 44.592 1.00 34.20  ? 135  PRO A CB    1 
ATOM   885  C  CG    . PRO A 1 135 ? 1.263   -26.956 43.723 1.00 30.78  ? 135  PRO A CG    1 
ATOM   886  C  CD    . PRO A 1 135 ? 0.716   -26.727 42.295 1.00 29.25  ? 135  PRO A CD    1 
ATOM   887  N  N     . GLY A 1 136 ? -2.021  -24.161 44.948 1.00 37.94  ? 136  GLY A N     1 
ATOM   888  C  CA    . GLY A 1 136 ? -2.028  -22.706 45.223 1.00 40.42  ? 136  GLY A CA    1 
ATOM   889  C  C     . GLY A 1 136 ? -1.736  -21.809 44.008 1.00 42.96  ? 136  GLY A C     1 
ATOM   890  O  O     . GLY A 1 136 ? -2.078  -22.108 42.829 1.00 44.00  ? 136  GLY A O     1 
ATOM   891  N  N     . SER A 1 137 ? -1.115  -20.663 44.218 1.00 42.87  ? 137  SER A N     1 
ATOM   892  C  CA    . SER A 1 137 ? -0.987  -19.810 42.993 1.00 44.06  ? 137  SER A CA    1 
ATOM   893  C  C     . SER A 1 137 ? 0.119   -20.283 41.958 1.00 42.50  ? 137  SER A C     1 
ATOM   894  O  O     . SER A 1 137 ? 0.277   -19.711 40.837 1.00 45.18  ? 137  SER A O     1 
ATOM   895  C  CB    . SER A 1 137 ? -0.840  -18.313 43.379 1.00 43.97  ? 137  SER A CB    1 
ATOM   896  N  N     . SER A 1 138 ? 0.820   -21.343 42.301 1.00 38.07  ? 138  SER A N     1 
ATOM   897  C  CA    . SER A 1 138 ? 2.161   -21.600 41.781 1.00 34.63  ? 138  SER A CA    1 
ATOM   898  C  C     . SER A 1 138 ? 2.127   -22.599 40.593 1.00 31.70  ? 138  SER A C     1 
ATOM   899  O  O     . SER A 1 138 ? 1.039   -23.095 40.240 1.00 30.02  ? 138  SER A O     1 
ATOM   900  C  CB    . SER A 1 138 ? 2.992   -22.167 42.956 1.00 33.77  ? 138  SER A CB    1 
ATOM   901  O  OG    . SER A 1 138 ? 2.731   -23.563 43.039 1.00 37.77  ? 138  SER A OG    1 
ATOM   902  N  N     . SER A 1 139 ? 3.286   -22.884 39.986 1.00 28.15  ? 139  SER A N     1 
ATOM   903  C  CA    . SER A 1 139 ? 3.377   -23.903 38.991 1.00 26.43  ? 139  SER A CA    1 
ATOM   904  C  C     . SER A 1 139 ? 4.499   -24.890 39.272 1.00 24.99  ? 139  SER A C     1 
ATOM   905  O  O     . SER A 1 139 ? 5.636   -24.490 39.583 1.00 23.24  ? 139  SER A O     1 
ATOM   906  C  CB    . SER A 1 139 ? 3.684   -23.289 37.603 1.00 25.39  ? 139  SER A CB    1 
ATOM   907  O  OG    . SER A 1 139 ? 2.600   -22.551 37.105 1.00 31.14  ? 139  SER A OG    1 
ATOM   908  N  N     . THR A 1 140 ? 4.211   -26.146 38.980 1.00 22.05  ? 140  THR A N     1 
ATOM   909  C  CA    . THR A 1 140 ? 5.202   -27.205 38.955 1.00 22.12  ? 140  THR A CA    1 
ATOM   910  C  C     . THR A 1 140 ? 4.808   -28.064 37.802 1.00 20.87  ? 140  THR A C     1 
ATOM   911  O  O     . THR A 1 140 ? 3.683   -27.893 37.184 1.00 21.04  ? 140  THR A O     1 
ATOM   912  C  CB    . THR A 1 140 ? 5.108   -28.094 40.222 1.00 22.15  ? 140  THR A CB    1 
ATOM   913  O  OG1   . THR A 1 140 ? 3.877   -28.794 40.197 1.00 26.06  ? 140  THR A OG1   1 
ATOM   914  C  CG2   . THR A 1 140 ? 5.068   -27.135 41.611 1.00 18.08  ? 140  THR A CG2   1 
ATOM   915  N  N     . VAL A 1 141 ? 5.725   -28.903 37.417 1.00 21.37  ? 141  VAL A N     1 
ATOM   916  C  CA    . VAL A 1 141 ? 5.447   -29.966 36.469 1.00 21.66  ? 141  VAL A CA    1 
ATOM   917  C  C     . VAL A 1 141 ? 5.715   -31.251 37.261 1.00 24.78  ? 141  VAL A C     1 
ATOM   918  O  O     . VAL A 1 141 ? 6.843   -31.417 37.796 1.00 22.49  ? 141  VAL A O     1 
ATOM   919  C  CB    . VAL A 1 141 ? 6.382   -29.831 35.215 1.00 22.35  ? 141  VAL A CB    1 
ATOM   920  C  CG1   . VAL A 1 141 ? 6.262   -31.052 34.335 1.00 20.06  ? 141  VAL A CG1   1 
ATOM   921  C  CG2   . VAL A 1 141 ? 6.049   -28.565 34.369 1.00 20.42  ? 141  VAL A CG2   1 
ATOM   922  N  N     . GLU A 1 142 ? 4.704   -32.132 37.394 1.00 23.66  ? 142  GLU A N     1 
ATOM   923  C  CA    . GLU A 1 142 ? 4.860   -33.385 38.125 1.00 24.23  ? 142  GLU A CA    1 
ATOM   924  C  C     . GLU A 1 142 ? 5.125   -34.470 37.135 1.00 25.88  ? 142  GLU A C     1 
ATOM   925  O  O     . GLU A 1 142 ? 4.460   -34.479 36.055 1.00 26.35  ? 142  GLU A O     1 
ATOM   926  C  CB    . GLU A 1 142 ? 3.582   -33.696 38.907 1.00 22.53  ? 142  GLU A CB    1 
ATOM   927  C  CG    . GLU A 1 142 ? 3.064   -32.511 39.549 1.00 23.35  ? 142  GLU A CG    1 
ATOM   928  C  CD    . GLU A 1 142 ? 3.856   -32.179 40.858 1.00 27.12  ? 142  GLU A CD    1 
ATOM   929  O  OE1   . GLU A 1 142 ? 4.762   -32.985 41.200 1.00 26.01  ? 142  GLU A OE1   1 
ATOM   930  O  OE2   . GLU A 1 142 ? 3.519   -31.191 41.557 1.00 24.48  ? 142  GLU A OE2   1 
ATOM   931  N  N     . VAL A 1 143 ? 6.069   -35.376 37.454 1.00 23.47  ? 143  VAL A N     1 
ATOM   932  C  CA    . VAL A 1 143 ? 6.438   -36.496 36.587 1.00 23.63  ? 143  VAL A CA    1 
ATOM   933  C  C     . VAL A 1 143 ? 5.898   -37.758 37.257 1.00 25.71  ? 143  VAL A C     1 
ATOM   934  O  O     . VAL A 1 143 ? 6.122   -37.948 38.464 1.00 25.62  ? 143  VAL A O     1 
ATOM   935  C  CB    . VAL A 1 143 ? 7.960   -36.571 36.362 1.00 25.14  ? 143  VAL A CB    1 
ATOM   936  C  CG1   . VAL A 1 143 ? 8.332   -37.650 35.241 1.00 25.52  ? 143  VAL A CG1   1 
ATOM   937  C  CG2   . VAL A 1 143 ? 8.438   -35.229 35.841 1.00 22.93  ? 143  VAL A CG2   1 
ATOM   938  N  N     . PHE A 1 144 ? 5.129   -38.567 36.514 1.00 24.92  ? 144  PHE A N     1 
ATOM   939  C  CA    . PHE A 1 144 ? 4.545   -39.819 36.983 1.00 24.67  ? 144  PHE A CA    1 
ATOM   940  C  C     . PHE A 1 144 ? 4.961   -40.915 36.055 1.00 25.34  ? 144  PHE A C     1 
ATOM   941  O  O     . PHE A 1 144 ? 5.194   -40.661 34.880 1.00 26.20  ? 144  PHE A O     1 
ATOM   942  C  CB    . PHE A 1 144 ? 3.021   -39.832 36.946 1.00 24.43  ? 144  PHE A CB    1 
ATOM   943  C  CG    . PHE A 1 144 ? 2.381   -38.758 37.757 1.00 25.53  ? 144  PHE A CG    1 
ATOM   944  C  CD1   . PHE A 1 144 ? 2.010   -39.001 39.075 1.00 20.76  ? 144  PHE A CD1   1 
ATOM   945  C  CD2   . PHE A 1 144 ? 2.108   -37.524 37.189 1.00 23.01  ? 144  PHE A CD2   1 
ATOM   946  C  CE1   . PHE A 1 144 ? 1.351   -38.032 39.849 1.00 24.27  ? 144  PHE A CE1   1 
ATOM   947  C  CE2   . PHE A 1 144 ? 1.486   -36.517 37.935 1.00 22.50  ? 144  PHE A CE2   1 
ATOM   948  C  CZ    . PHE A 1 144 ? 1.101   -36.764 39.304 1.00 22.58  ? 144  PHE A CZ    1 
ATOM   949  N  N     . LYS A 1 145 ? 5.113   -42.125 36.589 1.00 25.91  ? 145  LYS A N     1 
ATOM   950  C  CA    . LYS A 1 145 ? 5.206   -43.312 35.792 1.00 27.42  ? 145  LYS A CA    1 
ATOM   951  C  C     . LYS A 1 145 ? 3.809   -43.974 35.766 1.00 26.83  ? 145  LYS A C     1 
ATOM   952  O  O     . LYS A 1 145 ? 3.182   -44.154 36.821 1.00 27.78  ? 145  LYS A O     1 
ATOM   953  C  CB    . LYS A 1 145 ? 6.236   -44.264 36.384 1.00 27.75  ? 145  LYS A CB    1 
ATOM   954  C  CG    . LYS A 1 145 ? 6.304   -45.638 35.643 1.00 33.64  ? 145  LYS A CG    1 
ATOM   955  C  CD    . LYS A 1 145 ? 7.345   -46.607 36.313 1.00 36.72  ? 145  LYS A CD    1 
ATOM   956  N  N     . PHE A 1 146 ? 3.332   -44.349 34.582 1.00 27.67  ? 146  PHE A N     1 
ATOM   957  C  CA    . PHE A 1 146 ? 1.960   -44.918 34.466 1.00 28.92  ? 146  PHE A CA    1 
ATOM   958  C  C     . PHE A 1 146 ? 2.080   -46.423 34.745 1.00 31.96  ? 146  PHE A C     1 
ATOM   959  O  O     . PHE A 1 146 ? 2.856   -47.096 34.100 1.00 31.89  ? 146  PHE A O     1 
ATOM   960  C  CB    . PHE A 1 146 ? 1.406   -44.720 33.033 1.00 27.62  ? 146  PHE A CB    1 
ATOM   961  C  CG    . PHE A 1 146 ? 0.058   -45.426 32.758 1.00 28.49  ? 146  PHE A CG    1 
ATOM   962  C  CD1   . PHE A 1 146 ? -0.973  -45.314 33.639 1.00 22.02  ? 146  PHE A CD1   1 
ATOM   963  C  CD2   . PHE A 1 146 ? -0.149  -46.154 31.554 1.00 28.57  ? 146  PHE A CD2   1 
ATOM   964  C  CE1   . PHE A 1 146 ? -2.228  -45.909 33.382 1.00 29.40  ? 146  PHE A CE1   1 
ATOM   965  C  CE2   . PHE A 1 146 ? -1.383  -46.710 31.270 1.00 30.99  ? 146  PHE A CE2   1 
ATOM   966  C  CZ    . PHE A 1 146 ? -2.427  -46.618 32.217 1.00 27.70  ? 146  PHE A CZ    1 
ATOM   967  N  N     . GLN A 1 147 ? 1.273   -46.952 35.643 1.00 34.80  ? 147  GLN A N     1 
ATOM   968  C  CA    . GLN A 1 147 ? 1.356   -48.411 35.937 1.00 38.93  ? 147  GLN A CA    1 
ATOM   969  C  C     . GLN A 1 147 ? 0.084   -49.022 35.337 1.00 39.50  ? 147  GLN A C     1 
ATOM   970  O  O     . GLN A 1 147 ? -0.994  -48.925 35.918 1.00 38.10  ? 147  GLN A O     1 
ATOM   971  C  CB    . GLN A 1 147 ? 1.542   -48.612 37.461 1.00 38.88  ? 147  GLN A CB    1 
ATOM   972  C  CG    . GLN A 1 147 ? 3.001   -48.165 37.859 1.00 43.73  ? 147  GLN A CG    1 
ATOM   973  C  CD    . GLN A 1 147 ? 3.441   -48.521 39.275 1.00 49.95  ? 147  GLN A CD    1 
ATOM   974  O  OE1   . GLN A 1 147 ? 2.654   -48.407 40.239 1.00 49.78  ? 147  GLN A OE1   1 
ATOM   975  N  NE2   . GLN A 1 147 ? 4.733   -48.913 39.420 1.00 50.53  ? 147  GLN A NE2   1 
ATOM   976  N  N     . GLU A 1 148 ? 0.197   -49.504 34.097 1.00 43.02  ? 148  GLU A N     1 
ATOM   977  C  CA    . GLU A 1 148 ? -1.017  -49.915 33.352 1.00 47.00  ? 148  GLU A CA    1 
ATOM   978  C  C     . GLU A 1 148 ? -1.876  -50.990 34.035 1.00 48.06  ? 148  GLU A C     1 
ATOM   979  O  O     . GLU A 1 148 ? -3.079  -50.747 34.323 1.00 48.41  ? 148  GLU A O     1 
ATOM   980  C  CB    . GLU A 1 148 ? -0.739  -50.337 31.911 1.00 48.13  ? 148  GLU A CB    1 
ATOM   981  C  CG    . GLU A 1 148 ? -2.107  -50.500 31.155 1.00 52.37  ? 148  GLU A CG    1 
ATOM   982  C  CD    . GLU A 1 148 ? -1.966  -51.018 29.732 1.00 56.63  ? 148  GLU A CD    1 
ATOM   983  O  OE1   . GLU A 1 148 ? -0.921  -50.760 29.087 1.00 59.30  ? 148  GLU A OE1   1 
ATOM   984  O  OE2   . GLU A 1 148 ? -2.933  -51.667 29.258 1.00 60.26  ? 148  GLU A OE2   1 
ATOM   985  N  N     . GLU A 1 149 ? -1.254  -52.132 34.356 1.00 49.29  ? 149  GLU A N     1 
ATOM   986  C  CA    . GLU A 1 149 ? -1.998  -53.214 35.064 1.00 50.43  ? 149  GLU A CA    1 
ATOM   987  C  C     . GLU A 1 149 ? -2.723  -52.630 36.276 1.00 50.37  ? 149  GLU A C     1 
ATOM   988  O  O     . GLU A 1 149 ? -3.908  -52.980 36.568 1.00 52.23  ? 149  GLU A O     1 
ATOM   989  C  CB    . GLU A 1 149 ? -1.087  -54.416 35.456 1.00 50.88  ? 149  GLU A CB    1 
ATOM   990  N  N     . GLU A 1 150 ? -2.085  -51.688 36.962 1.00 47.92  ? 150  GLU A N     1 
ATOM   991  C  CA    . GLU A 1 150 ? -2.716  -51.197 38.173 1.00 46.06  ? 150  GLU A CA    1 
ATOM   992  C  C     . GLU A 1 150 ? -3.664  -50.057 37.933 1.00 44.98  ? 150  GLU A C     1 
ATOM   993  O  O     . GLU A 1 150 ? -4.378  -49.684 38.868 1.00 45.16  ? 150  GLU A O     1 
ATOM   994  C  CB    . GLU A 1 150 ? -1.680  -50.833 39.276 1.00 46.26  ? 150  GLU A CB    1 
ATOM   995  C  CG    . GLU A 1 150 ? -0.710  -51.986 39.624 1.00 48.82  ? 150  GLU A CG    1 
ATOM   996  C  CD    . GLU A 1 150 ? 0.189   -52.345 38.430 1.00 54.01  ? 150  GLU A CD    1 
ATOM   997  N  N     . LYS A 1 151 ? -3.653  -49.426 36.739 1.00 43.80  ? 151  LYS A N     1 
ATOM   998  C  CA    . LYS A 1 151 ? -4.467  -48.180 36.575 1.00 41.10  ? 151  LYS A CA    1 
ATOM   999  C  C     . LYS A 1 151 ? -4.035  -47.187 37.653 1.00 38.65  ? 151  LYS A C     1 
ATOM   1000 O  O     . LYS A 1 151 ? -4.852  -46.611 38.383 1.00 39.41  ? 151  LYS A O     1 
ATOM   1001 C  CB    . LYS A 1 151 ? -5.968  -48.433 36.765 1.00 42.90  ? 151  LYS A CB    1 
ATOM   1002 C  CG    . LYS A 1 151 ? -6.747  -49.057 35.581 1.00 44.87  ? 151  LYS A CG    1 
ATOM   1003 C  CD    . LYS A 1 151 ? -8.272  -49.014 35.937 1.00 49.51  ? 151  LYS A CD    1 
ATOM   1004 N  N     . SER A 1 152 ? -2.739  -46.989 37.776 1.00 35.38  ? 152  SER A N     1 
ATOM   1005 C  CA    . SER A 1 152 ? -2.280  -46.013 38.737 1.00 33.50  ? 152  SER A CA    1 
ATOM   1006 C  C     . SER A 1 152 ? -1.080  -45.218 38.213 1.00 29.81  ? 152  SER A C     1 
ATOM   1007 O  O     . SER A 1 152 ? -0.392  -45.603 37.236 1.00 28.92  ? 152  SER A O     1 
ATOM   1008 C  CB    . SER A 1 152 ? -1.941  -46.749 40.085 1.00 33.42  ? 152  SER A CB    1 
ATOM   1009 O  OG    . SER A 1 152 ? -0.709  -47.379 39.890 1.00 37.17  ? 152  SER A OG    1 
ATOM   1010 N  N     . LEU A 1 153 ? -0.854  -44.106 38.872 1.00 29.56  ? 153  LEU A N     1 
ATOM   1011 C  CA    . LEU A 1 153 ? 0.240   -43.169 38.528 1.00 29.19  ? 153  LEU A CA    1 
ATOM   1012 C  C     . LEU A 1 153 ? 1.160   -43.110 39.741 1.00 28.85  ? 153  LEU A C     1 
ATOM   1013 O  O     . LEU A 1 153 ? 0.719   -42.793 40.851 1.00 29.54  ? 153  LEU A O     1 
ATOM   1014 C  CB    . LEU A 1 153 ? -0.318  -41.771 38.233 1.00 28.37  ? 153  LEU A CB    1 
ATOM   1015 C  CG    . LEU A 1 153 ? -1.162  -41.668 36.909 1.00 27.23  ? 153  LEU A CG    1 
ATOM   1016 C  CD1   . LEU A 1 153 ? -1.892  -40.328 36.934 1.00 25.65  ? 153  LEU A CD1   1 
ATOM   1017 C  CD2   . LEU A 1 153 ? -0.259  -41.807 35.678 1.00 19.79  ? 153  LEU A CD2   1 
ATOM   1018 N  N     . LEU A 1 154 ? 2.409   -43.458 39.510 1.00 28.05  ? 154  LEU A N     1 
ATOM   1019 C  CA    . LEU A 1 154 ? 3.444   -43.437 40.558 1.00 28.23  ? 154  LEU A CA    1 
ATOM   1020 C  C     . LEU A 1 154 ? 4.175   -42.130 40.422 1.00 26.99  ? 154  LEU A C     1 
ATOM   1021 O  O     . LEU A 1 154 ? 4.857   -41.938 39.456 1.00 27.62  ? 154  LEU A O     1 
ATOM   1022 C  CB    . LEU A 1 154 ? 4.429   -44.609 40.306 1.00 27.00  ? 154  LEU A CB    1 
ATOM   1023 C  CG    . LEU A 1 154 ? 5.679   -44.630 41.241 1.00 30.71  ? 154  LEU A CG    1 
ATOM   1024 C  CD1   . LEU A 1 154 ? 5.304   -44.642 42.714 1.00 29.32  ? 154  LEU A CD1   1 
ATOM   1025 C  CD2   . LEU A 1 154 ? 6.654   -45.818 40.874 1.00 29.11  ? 154  LEU A CD2   1 
ATOM   1026 N  N     . HIS A 1 155 ? 4.001   -41.217 41.343 1.00 27.78  ? 155  HIS A N     1 
ATOM   1027 C  CA    . HIS A 1 155 ? 4.707   -39.939 41.320 1.00 28.36  ? 155  HIS A CA    1 
ATOM   1028 C  C     . HIS A 1 155 ? 6.183   -40.145 41.478 1.00 29.35  ? 155  HIS A C     1 
ATOM   1029 O  O     . HIS A 1 155 ? 6.599   -40.887 42.355 1.00 30.93  ? 155  HIS A O     1 
ATOM   1030 C  CB    . HIS A 1 155 ? 4.250   -39.033 42.456 1.00 26.25  ? 155  HIS A CB    1 
ATOM   1031 C  CG    . HIS A 1 155 ? 4.781   -37.654 42.332 1.00 29.58  ? 155  HIS A CG    1 
ATOM   1032 N  ND1   . HIS A 1 155 ? 5.701   -37.123 43.213 1.00 25.10  ? 155  HIS A ND1   1 
ATOM   1033 C  CD2   . HIS A 1 155 ? 4.511   -36.670 41.417 1.00 25.86  ? 155  HIS A CD2   1 
ATOM   1034 C  CE1   . HIS A 1 155 ? 5.961   -35.873 42.866 1.00 29.06  ? 155  HIS A CE1   1 
ATOM   1035 N  NE2   . HIS A 1 155 ? 5.249   -35.571 41.780 1.00 25.73  ? 155  HIS A NE2   1 
ATOM   1036 N  N     . LEU A 1 156 ? 6.965   -39.524 40.611 1.00 28.74  ? 156  LEU A N     1 
ATOM   1037 C  CA    . LEU A 1 156 ? 8.401   -39.659 40.592 1.00 30.02  ? 156  LEU A CA    1 
ATOM   1038 C  C     . LEU A 1 156 ? 9.063   -38.369 41.100 1.00 31.29  ? 156  LEU A C     1 
ATOM   1039 O  O     . LEU A 1 156 ? 9.930   -38.470 41.991 1.00 30.34  ? 156  LEU A O     1 
ATOM   1040 C  CB    . LEU A 1 156 ? 8.948   -39.976 39.209 1.00 27.00  ? 156  LEU A CB    1 
ATOM   1041 C  CG    . LEU A 1 156 ? 8.494   -41.370 38.701 1.00 33.67  ? 156  LEU A CG    1 
ATOM   1042 C  CD1   . LEU A 1 156 ? 9.085   -41.614 37.355 1.00 37.74  ? 156  LEU A CD1   1 
ATOM   1043 C  CD2   . LEU A 1 156 ? 8.860   -42.507 39.652 1.00 36.82  ? 156  LEU A CD2   1 
ATOM   1044 N  N     . LYS A 1 157 ? 8.654   -37.191 40.552 1.00 29.88  ? 157  LYS A N     1 
ATOM   1045 C  CA    . LYS A 1 157 ? 9.393   -35.915 40.717 1.00 30.03  ? 157  LYS A CA    1 
ATOM   1046 C  C     . LYS A 1 157 ? 8.497   -34.695 40.547 1.00 30.92  ? 157  LYS A C     1 
ATOM   1047 O  O     . LYS A 1 157 ? 7.623   -34.693 39.611 1.00 29.52  ? 157  LYS A O     1 
ATOM   1048 C  CB    . LYS A 1 157 ? 10.537  -35.831 39.653 1.00 30.45  ? 157  LYS A CB    1 
ATOM   1049 C  CG    . LYS A 1 157 ? 11.763  -35.105 40.248 1.00 39.29  ? 157  LYS A CG    1 
ATOM   1050 C  CD    . LYS A 1 157 ? 12.868  -34.771 39.221 1.00 49.62  ? 157  LYS A CD    1 
ATOM   1051 C  CE    . LYS A 1 157 ? 13.847  -33.632 39.761 1.00 52.51  ? 157  LYS A CE    1 
ATOM   1052 N  NZ    . LYS A 1 157 ? 13.131  -32.400 40.468 1.00 51.84  ? 157  LYS A NZ    1 
ATOM   1053 N  N     . THR A 1 158 ? 8.706   -33.673 41.399 1.00 27.45  ? 158  THR A N     1 
ATOM   1054 C  CA    . THR A 1 158 ? 8.157   -32.382 41.250 1.00 28.27  ? 158  THR A CA    1 
ATOM   1055 C  C     . THR A 1 158 ? 9.206   -31.482 40.676 1.00 29.82  ? 158  THR A C     1 
ATOM   1056 O  O     . THR A 1 158 ? 10.311  -31.446 41.225 1.00 28.18  ? 158  THR A O     1 
ATOM   1057 C  CB    . THR A 1 158 ? 7.677   -31.850 42.564 1.00 29.26  ? 158  THR A CB    1 
ATOM   1058 O  OG1   . THR A 1 158 ? 6.602   -32.683 42.973 1.00 29.13  ? 158  THR A OG1   1 
ATOM   1059 C  CG2   . THR A 1 158 ? 7.147   -30.386 42.479 1.00 27.77  ? 158  THR A CG2   1 
ATOM   1060 N  N     . ILE A 1 159 ? 8.902   -30.828 39.509 1.00 28.06  ? 159  ILE A N     1 
ATOM   1061 C  CA    . ILE A 1 159 ? 9.788   -29.927 38.848 1.00 25.82  ? 159  ILE A CA    1 
ATOM   1062 C  C     . ILE A 1 159 ? 9.252   -28.546 39.043 1.00 27.98  ? 159  ILE A C     1 
ATOM   1063 O  O     . ILE A 1 159 ? 8.036   -28.255 38.850 1.00 26.60  ? 159  ILE A O     1 
ATOM   1064 C  CB    . ILE A 1 159 ? 9.947   -30.258 37.400 1.00 27.22  ? 159  ILE A CB    1 
ATOM   1065 C  CG1   . ILE A 1 159 ? 10.553  -31.648 37.282 1.00 28.21  ? 159  ILE A CG1   1 
ATOM   1066 C  CG2   . ILE A 1 159 ? 10.793  -29.134 36.616 1.00 24.59  ? 159  ILE A CG2   1 
ATOM   1067 C  CD1   . ILE A 1 159 ? 10.702  -32.155 35.887 1.00 27.72  ? 159  ILE A CD1   1 
ATOM   1068 N  N     . ARG A 1 160 ? 10.116  -27.655 39.484 1.00 26.68  ? 160  ARG A N     1 
ATOM   1069 C  CA    . ARG A 1 160 ? 9.781   -26.243 39.497 1.00 28.67  ? 160  ARG A CA    1 
ATOM   1070 C  C     . ARG A 1 160 ? 11.045  -25.419 39.155 1.00 28.28  ? 160  ARG A C     1 
ATOM   1071 O  O     . ARG A 1 160 ? 12.172  -25.953 39.106 1.00 26.86  ? 160  ARG A O     1 
ATOM   1072 C  CB    . ARG A 1 160 ? 9.059   -25.817 40.778 1.00 30.16  ? 160  ARG A CB    1 
ATOM   1073 C  CG    . ARG A 1 160 ? 9.885   -25.597 42.005 1.00 38.13  ? 160  ARG A CG    1 
ATOM   1074 C  CD    . ARG A 1 160 ? 8.906   -25.323 43.181 1.00 43.09  ? 160  ARG A CD    1 
ATOM   1075 N  NE    . ARG A 1 160 ? 9.280   -26.348 44.052 1.00 49.26  ? 160  ARG A NE    1 
ATOM   1076 C  CZ    . ARG A 1 160 ? 8.561   -27.273 44.636 1.00 47.25  ? 160  ARG A CZ    1 
ATOM   1077 N  NH1   . ARG A 1 160 ? 7.226   -27.330 44.708 1.00 40.73  ? 160  ARG A NH1   1 
ATOM   1078 N  NH2   . ARG A 1 160 ? 9.316   -28.124 45.257 1.00 51.80  ? 160  ARG A NH2   1 
ATOM   1079 N  N     . HIS A 1 161 ? 10.848  -24.177 38.752 1.00 27.19  ? 161  HIS A N     1 
ATOM   1080 C  CA    . HIS A 1 161 ? 11.961  -23.459 38.186 1.00 27.41  ? 161  HIS A CA    1 
ATOM   1081 C  C     . HIS A 1 161 ? 11.539  -22.020 37.992 1.00 27.62  ? 161  HIS A C     1 
ATOM   1082 O  O     . HIS A 1 161 ? 10.346  -21.687 37.691 1.00 27.71  ? 161  HIS A O     1 
ATOM   1083 C  CB    . HIS A 1 161 ? 12.440  -24.065 36.843 1.00 26.34  ? 161  HIS A CB    1 
ATOM   1084 C  CG    . HIS A 1 161 ? 13.814  -23.588 36.449 1.00 29.64  ? 161  HIS A CG    1 
ATOM   1085 N  ND1   . HIS A 1 161 ? 14.037  -22.327 35.933 1.00 33.23  ? 161  HIS A ND1   1 
ATOM   1086 C  CD2   . HIS A 1 161 ? 15.051  -24.147 36.627 1.00 27.77  ? 161  HIS A CD2   1 
ATOM   1087 C  CE1   . HIS A 1 161 ? 15.342  -22.173 35.693 1.00 31.69  ? 161  HIS A CE1   1 
ATOM   1088 N  NE2   . HIS A 1 161 ? 15.969  -23.264 36.101 1.00 32.62  ? 161  HIS A NE2   1 
ATOM   1089 N  N     . LYS A 1 162 ? 12.508  -21.133 38.144 1.00 27.07  ? 162  LYS A N     1 
ATOM   1090 C  CA    . LYS A 1 162 ? 12.256  -19.697 37.939 1.00 28.79  ? 162  LYS A CA    1 
ATOM   1091 C  C     . LYS A 1 162 ? 11.765  -19.411 36.458 1.00 25.89  ? 162  LYS A C     1 
ATOM   1092 O  O     . LYS A 1 162 ? 11.019  -18.457 36.225 1.00 28.29  ? 162  LYS A O     1 
ATOM   1093 C  CB    . LYS A 1 162 ? 13.595  -18.902 38.145 1.00 30.71  ? 162  LYS A CB    1 
ATOM   1094 C  CG    . LYS A 1 162 ? 13.353  -17.380 38.260 1.00 37.11  ? 162  LYS A CG    1 
ATOM   1095 N  N     . LEU A 1 163 ? 12.257  -20.168 35.492 1.00 23.53  ? 163  LEU A N     1 
ATOM   1096 C  CA    . LEU A 1 163 ? 11.783  -20.062 34.104 1.00 25.50  ? 163  LEU A CA    1 
ATOM   1097 C  C     . LEU A 1 163 ? 10.419  -20.818 33.775 1.00 24.82  ? 163  LEU A C     1 
ATOM   1098 O  O     . LEU A 1 163 ? 10.065  -20.995 32.589 1.00 24.97  ? 163  LEU A O     1 
ATOM   1099 C  CB    . LEU A 1 163 ? 12.894  -20.405 33.087 1.00 25.68  ? 163  LEU A CB    1 
ATOM   1100 C  CG    . LEU A 1 163 ? 14.147  -19.455 33.141 1.00 27.83  ? 163  LEU A CG    1 
ATOM   1101 C  CD1   . LEU A 1 163 ? 15.336  -20.030 32.284 1.00 23.50  ? 163  LEU A CD1   1 
ATOM   1102 C  CD2   . LEU A 1 163 ? 13.828  -17.972 32.824 1.00 25.07  ? 163  LEU A CD2   1 
ATOM   1103 N  N     . LEU A 1 164 ? 9.675   -21.167 34.834 1.00 22.98  ? 164  LEU A N     1 
ATOM   1104 C  CA    . LEU A 1 164 ? 8.348   -21.910 34.767 1.00 20.65  ? 164  LEU A CA    1 
ATOM   1105 C  C     . LEU A 1 164 ? 7.475   -21.238 35.731 1.00 18.96  ? 164  LEU A C     1 
ATOM   1106 O  O     . LEU A 1 164 ? 7.016   -21.883 36.641 1.00 20.51  ? 164  LEU A O     1 
ATOM   1107 C  CB    . LEU A 1 164 ? 8.498   -23.405 35.219 1.00 17.51  ? 164  LEU A CB    1 
ATOM   1108 C  CG    . LEU A 1 164 ? 9.360   -24.218 34.219 1.00 21.38  ? 164  LEU A CG    1 
ATOM   1109 C  CD1   . LEU A 1 164 ? 9.700   -25.627 34.697 1.00 20.66  ? 164  LEU A CD1   1 
ATOM   1110 C  CD2   . LEU A 1 164 ? 8.881   -24.221 32.703 1.00 17.93  ? 164  LEU A CD2   1 
ATOM   1111 N  N     . PRO A 1 165 ? 7.289   -19.916 35.616 1.00 19.17  ? 165  PRO A N     1 
ATOM   1112 C  CA    . PRO A 1 165 ? 6.487   -19.246 36.622 1.00 20.60  ? 165  PRO A CA    1 
ATOM   1113 C  C     . PRO A 1 165 ? 4.963   -19.480 36.476 1.00 22.96  ? 165  PRO A C     1 
ATOM   1114 O  O     . PRO A 1 165 ? 4.224   -19.290 37.464 1.00 22.84  ? 165  PRO A O     1 
ATOM   1115 C  CB    . PRO A 1 165 ? 6.661   -17.731 36.265 1.00 20.88  ? 165  PRO A CB    1 
ATOM   1116 C  CG    . PRO A 1 165 ? 7.086   -17.775 34.775 1.00 21.09  ? 165  PRO A CG    1 
ATOM   1117 C  CD    . PRO A 1 165 ? 7.918   -18.986 34.666 1.00 18.24  ? 165  PRO A CD    1 
ATOM   1118 N  N     . SER A 1 166 ? 4.484   -19.744 35.247 1.00 23.12  ? 166  SER A N     1 
ATOM   1119 C  CA    . SER A 1 166 ? 3.019   -19.820 35.099 1.00 22.54  ? 166  SER A CA    1 
ATOM   1120 C  C     . SER A 1 166 ? 2.692   -20.772 33.930 1.00 22.27  ? 166  SER A C     1 
ATOM   1121 O  O     . SER A 1 166 ? 2.326   -20.329 32.824 1.00 23.01  ? 166  SER A O     1 
ATOM   1122 C  CB    . SER A 1 166 ? 2.608   -18.430 34.760 1.00 23.01  ? 166  SER A CB    1 
ATOM   1123 O  OG    . SER A 1 166 ? 1.217   -18.245 34.871 1.00 26.23  ? 166  SER A OG    1 
ATOM   1124 N  N     . VAL A 1 167 ? 2.941   -22.048 34.162 1.00 19.63  ? 167  VAL A N     1 
ATOM   1125 C  CA    . VAL A 1 167 ? 3.011   -22.993 33.094 1.00 19.03  ? 167  VAL A CA    1 
ATOM   1126 C  C     . VAL A 1 167 ? 1.558   -23.312 32.673 1.00 18.63  ? 167  VAL A C     1 
ATOM   1127 O  O     . VAL A 1 167 ? 0.657   -23.396 33.527 1.00 17.43  ? 167  VAL A O     1 
ATOM   1128 C  CB    . VAL A 1 167 ? 3.752   -24.254 33.545 1.00 17.68  ? 167  VAL A CB    1 
ATOM   1129 C  CG1   . VAL A 1 167 ? 3.878   -25.274 32.378 1.00 18.15  ? 167  VAL A CG1   1 
ATOM   1130 C  CG2   . VAL A 1 167 ? 5.260   -23.835 34.010 1.00 19.72  ? 167  VAL A CG2   1 
ATOM   1131 N  N     . ASN A 1 168 ? 1.370   -23.501 31.386 1.00 18.21  ? 168  ASN A N     1 
ATOM   1132 C  CA    . ASN A 1 168 ? 0.000   -23.795 30.836 1.00 16.71  ? 168  ASN A CA    1 
ATOM   1133 C  C     . ASN A 1 168 ? 0.001   -25.173 30.275 1.00 15.63  ? 168  ASN A C     1 
ATOM   1134 O  O     . ASN A 1 168 ? -0.769  -26.059 30.670 1.00 15.69  ? 168  ASN A O     1 
ATOM   1135 C  CB    . ASN A 1 168 ? -0.351  -22.776 29.750 1.00 16.03  ? 168  ASN A CB    1 
ATOM   1136 C  CG    . ASN A 1 168 ? -1.788  -22.914 29.290 1.00 19.23  ? 168  ASN A CG    1 
ATOM   1137 O  OD1   . ASN A 1 168 ? -2.107  -23.924 28.714 1.00 21.74  ? 168  ASN A OD1   1 
ATOM   1138 N  ND2   . ASN A 1 168 ? -2.673  -22.010 29.695 1.00 13.90  ? 168  ASN A ND2   1 
ATOM   1139 N  N     . ASP A 1 169 ? 0.940   -25.440 29.390 1.00 17.42  ? 169  ASP A N     1 
ATOM   1140 C  CA    . ASP A 1 169 ? 1.039   -26.812 28.856 1.00 17.63  ? 169  ASP A CA    1 
ATOM   1141 C  C     . ASP A 1 169 ? 2.488   -27.172 28.609 1.00 18.91  ? 169  ASP A C     1 
ATOM   1142 O  O     . ASP A 1 169 ? 3.379   -26.267 28.513 1.00 19.63  ? 169  ASP A O     1 
ATOM   1143 C  CB    . ASP A 1 169 ? 0.245   -26.894 27.506 1.00 17.19  ? 169  ASP A CB    1 
ATOM   1144 C  CG    . ASP A 1 169 ? -0.088  -28.382 27.101 1.00 20.91  ? 169  ASP A CG    1 
ATOM   1145 O  OD1   . ASP A 1 169 ? 0.259   -29.369 27.828 1.00 15.24  ? 169  ASP A OD1   1 
ATOM   1146 O  OD2   . ASP A 1 169 ? -0.626  -28.582 26.028 1.00 22.63  ? 169  ASP A OD2   1 
ATOM   1147 N  N     . ILE A 1 170 ? 2.772   -28.459 28.474 1.00 19.31  ? 170  ILE A N     1 
ATOM   1148 C  CA    . ILE A 1 170 ? 4.144   -28.832 28.084 1.00 19.65  ? 170  ILE A CA    1 
ATOM   1149 C  C     . ILE A 1 170 ? 4.096   -29.864 26.967 1.00 19.73  ? 170  ILE A C     1 
ATOM   1150 O  O     . ILE A 1 170 ? 3.073   -30.559 26.782 1.00 21.01  ? 170  ILE A O     1 
ATOM   1151 C  CB    . ILE A 1 170 ? 5.069   -29.352 29.320 1.00 20.98  ? 170  ILE A CB    1 
ATOM   1152 C  CG1   . ILE A 1 170 ? 4.783   -30.831 29.678 1.00 21.68  ? 170  ILE A CG1   1 
ATOM   1153 C  CG2   . ILE A 1 170 ? 4.932   -28.414 30.617 1.00 16.44  ? 170  ILE A CG2   1 
ATOM   1154 C  CD1   . ILE A 1 170 ? 3.308   -31.145 30.278 1.00 16.52  ? 170  ILE A CD1   1 
ATOM   1155 N  N     . VAL A 1 171 ? 5.214   -30.046 26.255 1.00 19.53  ? 171  VAL A N     1 
ATOM   1156 C  CA    . VAL A 1 171 ? 5.355   -31.225 25.465 1.00 18.21  ? 171  VAL A CA    1 
ATOM   1157 C  C     . VAL A 1 171 ? 6.638   -31.986 25.830 1.00 21.10  ? 171  VAL A C     1 
ATOM   1158 O  O     . VAL A 1 171 ? 7.742   -31.375 25.812 1.00 22.20  ? 171  VAL A O     1 
ATOM   1159 C  CB    . VAL A 1 171 ? 5.261   -30.920 23.949 1.00 18.50  ? 171  VAL A CB    1 
ATOM   1160 C  CG1   . VAL A 1 171 ? 6.308   -29.929 23.484 1.00 16.16  ? 171  VAL A CG1   1 
ATOM   1161 C  CG2   . VAL A 1 171 ? 5.399   -32.253 23.133 1.00 14.42  ? 171  VAL A CG2   1 
ATOM   1162 N  N     . ALA A 1 172 ? 6.527   -33.274 26.181 1.00 20.86  ? 172  ALA A N     1 
ATOM   1163 C  CA    . ALA A 1 172 ? 7.692   -33.999 26.735 1.00 21.66  ? 172  ALA A CA    1 
ATOM   1164 C  C     . ALA A 1 172 ? 8.586   -34.466 25.585 1.00 23.13  ? 172  ALA A C     1 
ATOM   1165 O  O     . ALA A 1 172 ? 8.088   -34.931 24.525 1.00 23.26  ? 172  ALA A O     1 
ATOM   1166 C  CB    . ALA A 1 172 ? 7.188   -35.255 27.547 1.00 21.58  ? 172  ALA A CB    1 
ATOM   1167 N  N     . VAL A 1 173 ? 9.910   -34.396 25.762 1.00 25.16  ? 173  VAL A N     1 
ATOM   1168 C  CA    . VAL A 1 173 ? 10.830  -34.983 24.767 1.00 25.33  ? 173  VAL A CA    1 
ATOM   1169 C  C     . VAL A 1 173 ? 11.787  -35.933 25.523 1.00 28.37  ? 173  VAL A C     1 
ATOM   1170 O  O     . VAL A 1 173 ? 12.740  -36.424 24.942 1.00 31.12  ? 173  VAL A O     1 
ATOM   1171 C  CB    . VAL A 1 173 ? 11.607  -33.859 24.024 1.00 26.22  ? 173  VAL A CB    1 
ATOM   1172 C  CG1   . VAL A 1 173 ? 10.610  -32.937 23.335 1.00 25.49  ? 173  VAL A CG1   1 
ATOM   1173 C  CG2   . VAL A 1 173 ? 12.533  -32.982 25.023 1.00 22.39  ? 173  VAL A CG2   1 
ATOM   1174 N  N     . GLY A 1 174 ? 11.504  -36.200 26.796 1.00 29.06  ? 174  GLY A N     1 
ATOM   1175 C  CA    . GLY A 1 174 ? 12.201  -37.215 27.586 1.00 29.54  ? 174  GLY A CA    1 
ATOM   1176 C  C     . GLY A 1 174 ? 11.441  -37.271 28.887 1.00 30.89  ? 174  GLY A C     1 
ATOM   1177 O  O     . GLY A 1 174 ? 10.484  -36.507 29.077 1.00 30.53  ? 174  GLY A O     1 
ATOM   1178 N  N     . PRO A 1 175 ? 11.878  -38.140 29.850 1.00 32.27  ? 175  PRO A N     1 
ATOM   1179 C  CA    . PRO A 1 175 ? 11.124  -38.347 31.132 1.00 30.54  ? 175  PRO A CA    1 
ATOM   1180 C  C     . PRO A 1 175 ? 11.100  -37.121 32.022 1.00 32.67  ? 175  PRO A C     1 
ATOM   1181 O  O     . PRO A 1 175 ? 10.234  -37.013 32.918 1.00 32.77  ? 175  PRO A O     1 
ATOM   1182 C  CB    . PRO A 1 175 ? 11.927  -39.467 31.837 1.00 32.54  ? 175  PRO A CB    1 
ATOM   1183 C  CG    . PRO A 1 175 ? 12.684  -40.177 30.699 1.00 32.54  ? 175  PRO A CG    1 
ATOM   1184 C  CD    . PRO A 1 175 ? 13.090  -38.992 29.763 1.00 31.15  ? 175  PRO A CD    1 
ATOM   1185 N  N     . GLU A 1 176 ? 12.082  -36.221 31.843 1.00 30.98  ? 176  GLU A N     1 
ATOM   1186 C  CA    . GLU A 1 176 ? 12.018  -34.941 32.515 1.00 32.26  ? 176  GLU A CA    1 
ATOM   1187 C  C     . GLU A 1 176 ? 12.578  -33.840 31.662 1.00 29.99  ? 176  GLU A C     1 
ATOM   1188 O  O     . GLU A 1 176 ? 13.376  -33.050 32.150 1.00 30.78  ? 176  GLU A O     1 
ATOM   1189 C  CB    . GLU A 1 176 ? 12.732  -34.947 33.867 1.00 33.18  ? 176  GLU A CB    1 
ATOM   1190 C  CG    . GLU A 1 176 ? 13.954  -35.779 33.952 1.00 40.34  ? 176  GLU A CG    1 
ATOM   1191 C  CD    . GLU A 1 176 ? 14.547  -35.831 35.419 1.00 49.18  ? 176  GLU A CD    1 
ATOM   1192 O  OE1   . GLU A 1 176 ? 14.444  -34.859 36.211 1.00 50.97  ? 176  GLU A OE1   1 
ATOM   1193 O  OE2   . GLU A 1 176 ? 15.135  -36.862 35.760 1.00 57.00  ? 176  GLU A OE2   1 
ATOM   1194 N  N     . HIS A 1 177 ? 12.194  -33.827 30.380 1.00 27.91  ? 177  HIS A N     1 
ATOM   1195 C  CA    . HIS A 1 177 ? 12.729  -32.893 29.398 1.00 26.50  ? 177  HIS A CA    1 
ATOM   1196 C  C     . HIS A 1 177 ? 11.464  -32.487 28.633 1.00 26.54  ? 177  HIS A C     1 
ATOM   1197 O  O     . HIS A 1 177 ? 10.763  -33.389 28.065 1.00 24.15  ? 177  HIS A O     1 
ATOM   1198 C  CB    . HIS A 1 177 ? 13.673  -33.614 28.444 1.00 25.68  ? 177  HIS A CB    1 
ATOM   1199 C  CG    . HIS A 1 177 ? 14.734  -34.435 29.129 1.00 36.41  ? 177  HIS A CG    1 
ATOM   1200 N  ND1   . HIS A 1 177 ? 14.439  -35.499 29.972 1.00 39.02  ? 177  HIS A ND1   1 
ATOM   1201 C  CD2   . HIS A 1 177 ? 16.095  -34.371 29.061 1.00 37.24  ? 177  HIS A CD2   1 
ATOM   1202 C  CE1   . HIS A 1 177 ? 15.573  -36.036 30.406 1.00 40.82  ? 177  HIS A CE1   1 
ATOM   1203 N  NE2   . HIS A 1 177 ? 16.583  -35.383 29.854 1.00 40.19  ? 177  HIS A NE2   1 
ATOM   1204 N  N     . PHE A 1 178 ? 11.234  -31.171 28.516 1.00 22.36  ? 178  PHE A N     1 
ATOM   1205 C  CA    . PHE A 1 178 ? 10.010  -30.747 27.864 1.00 23.57  ? 178  PHE A CA    1 
ATOM   1206 C  C     . PHE A 1 178 ? 10.149  -29.293 27.466 1.00 23.72  ? 178  PHE A C     1 
ATOM   1207 O  O     . PHE A 1 178 ? 10.976  -28.571 28.083 1.00 22.38  ? 178  PHE A O     1 
ATOM   1208 C  CB    . PHE A 1 178 ? 8.808   -30.913 28.858 1.00 20.52  ? 178  PHE A CB    1 
ATOM   1209 C  CG    . PHE A 1 178 ? 9.009   -30.248 30.210 1.00 24.73  ? 178  PHE A CG    1 
ATOM   1210 C  CD1   . PHE A 1 178 ? 8.692   -28.941 30.373 1.00 21.99  ? 178  PHE A CD1   1 
ATOM   1211 C  CD2   . PHE A 1 178 ? 9.570   -30.971 31.319 1.00 22.50  ? 178  PHE A CD2   1 
ATOM   1212 C  CE1   . PHE A 1 178 ? 8.801   -28.331 31.591 1.00 19.20  ? 178  PHE A CE1   1 
ATOM   1213 C  CE2   . PHE A 1 178 ? 9.746   -30.371 32.539 1.00 20.13  ? 178  PHE A CE2   1 
ATOM   1214 C  CZ    . PHE A 1 178 ? 9.392   -29.046 32.700 1.00 24.18  ? 178  PHE A CZ    1 
ATOM   1215 N  N     . TYR A 1 179 ? 9.368   -28.856 26.457 1.00 20.57  ? 179  TYR A N     1 
ATOM   1216 C  CA    . TYR A 1 179 ? 9.108   -27.432 26.323 1.00 19.41  ? 179  TYR A CA    1 
ATOM   1217 C  C     . TYR A 1 179 ? 7.812   -27.110 27.023 1.00 20.00  ? 179  TYR A C     1 
ATOM   1218 O  O     . TYR A 1 179 ? 6.816   -27.880 26.926 1.00 19.90  ? 179  TYR A O     1 
ATOM   1219 C  CB    . TYR A 1 179 ? 8.949   -27.059 24.889 1.00 16.89  ? 179  TYR A CB    1 
ATOM   1220 C  CG    . TYR A 1 179 ? 10.194  -27.382 24.065 1.00 21.43  ? 179  TYR A CG    1 
ATOM   1221 C  CD1   . TYR A 1 179 ? 11.141  -26.389 23.782 1.00 21.21  ? 179  TYR A CD1   1 
ATOM   1222 C  CD2   . TYR A 1 179 ? 10.421  -28.673 23.580 1.00 23.65  ? 179  TYR A CD2   1 
ATOM   1223 C  CE1   . TYR A 1 179 ? 12.272  -26.647 23.003 1.00 21.85  ? 179  TYR A CE1   1 
ATOM   1224 C  CE2   . TYR A 1 179 ? 11.600  -28.998 22.790 1.00 22.01  ? 179  TYR A CE2   1 
ATOM   1225 C  CZ    . TYR A 1 179 ? 12.498  -27.928 22.499 1.00 26.72  ? 179  TYR A CZ    1 
ATOM   1226 O  OH    . TYR A 1 179 ? 13.614  -28.132 21.737 1.00 25.44  ? 179  TYR A OH    1 
ATOM   1227 N  N     . ALA A 1 180 ? 7.776   -25.945 27.623 1.00 18.61  ? 180  ALA A N     1 
ATOM   1228 C  CA    . ALA A 1 180 ? 6.652   -25.533 28.415 1.00 19.29  ? 180  ALA A CA    1 
ATOM   1229 C  C     . ALA A 1 180 ? 6.301   -24.151 27.947 1.00 21.58  ? 180  ALA A C     1 
ATOM   1230 O  O     . ALA A 1 180 ? 7.214   -23.300 27.733 1.00 21.74  ? 180  ALA A O     1 
ATOM   1231 C  CB    . ALA A 1 180 ? 7.105   -25.445 29.893 1.00 15.90  ? 180  ALA A CB    1 
ATOM   1232 N  N     . THR A 1 181 ? 5.011   -23.875 27.844 1.00 20.88  ? 181  THR A N     1 
ATOM   1233 C  CA    . THR A 1 181 ? 4.540   -22.508 27.644 1.00 19.32  ? 181  THR A CA    1 
ATOM   1234 C  C     . THR A 1 181 ? 4.266   -21.905 28.998 1.00 20.64  ? 181  THR A C     1 
ATOM   1235 O  O     . THR A 1 181 ? 3.718   -22.608 29.865 1.00 20.44  ? 181  THR A O     1 
ATOM   1236 C  CB    . THR A 1 181 ? 3.230   -22.502 26.825 1.00 20.32  ? 181  THR A CB    1 
ATOM   1237 O  OG1   . THR A 1 181 ? 2.269   -23.383 27.411 1.00 18.69  ? 181  THR A OG1   1 
ATOM   1238 C  CG2   . THR A 1 181 ? 3.505   -22.908 25.344 1.00 14.16  ? 181  THR A CG2   1 
ATOM   1239 N  N     . ASN A 1 182 ? 4.600   -20.623 29.207 1.00 19.66  ? 182  ASN A N     1 
ATOM   1240 C  CA    . ASN A 1 182 ? 4.126   -19.883 30.393 1.00 21.78  ? 182  ASN A CA    1 
ATOM   1241 C  C     . ASN A 1 182 ? 3.136   -18.925 29.840 1.00 22.19  ? 182  ASN A C     1 
ATOM   1242 O  O     . ASN A 1 182 ? 3.499   -18.152 28.954 1.00 23.14  ? 182  ASN A O     1 
ATOM   1243 C  CB    . ASN A 1 182 ? 5.316   -19.094 31.038 1.00 22.39  ? 182  ASN A CB    1 
ATOM   1244 C  CG    . ASN A 1 182 ? 6.328   -20.028 31.636 1.00 23.02  ? 182  ASN A CG    1 
ATOM   1245 O  OD1   . ASN A 1 182 ? 6.055   -20.598 32.723 1.00 23.09  ? 182  ASN A OD1   1 
ATOM   1246 N  ND2   . ASN A 1 182 ? 7.491   -20.259 30.927 1.00 19.52  ? 182  ASN A ND2   1 
ATOM   1247 N  N     . ASP A 1 183 ? 1.896   -18.942 30.320 1.00 21.46  ? 183  ASP A N     1 
ATOM   1248 C  CA    . ASP A 1 183 ? 0.901   -18.115 29.691 1.00 21.03  ? 183  ASP A CA    1 
ATOM   1249 C  C     . ASP A 1 183 ? 0.965   -16.702 30.246 1.00 22.14  ? 183  ASP A C     1 
ATOM   1250 O  O     . ASP A 1 183 ? 0.254   -15.824 29.750 1.00 20.91  ? 183  ASP A O     1 
ATOM   1251 C  CB    . ASP A 1 183 ? -0.525  -18.778 29.840 1.00 21.73  ? 183  ASP A CB    1 
ATOM   1252 C  CG    . ASP A 1 183 ? -0.849  -19.206 31.328 1.00 23.64  ? 183  ASP A CG    1 
ATOM   1253 O  OD1   . ASP A 1 183 ? -0.284  -18.649 32.317 1.00 28.12  ? 183  ASP A OD1   1 
ATOM   1254 O  OD2   . ASP A 1 183 ? -1.722  -20.071 31.550 1.00 22.80  ? 183  ASP A OD2   1 
ATOM   1255 N  N     . HIS A 1 184 ? 1.814   -16.492 31.283 1.00 22.15  ? 184  HIS A N     1 
ATOM   1256 C  CA    . HIS A 1 184 ? 2.102   -15.160 31.879 1.00 23.95  ? 184  HIS A CA    1 
ATOM   1257 C  C     . HIS A 1 184 ? 3.573   -15.179 32.353 1.00 24.78  ? 184  HIS A C     1 
ATOM   1258 O  O     . HIS A 1 184 ? 4.185   -16.237 32.594 1.00 22.44  ? 184  HIS A O     1 
ATOM   1259 C  CB    . HIS A 1 184 ? 1.252   -14.828 33.130 1.00 22.95  ? 184  HIS A CB    1 
ATOM   1260 C  CG    . HIS A 1 184 ? -0.222  -14.716 32.843 1.00 27.61  ? 184  HIS A CG    1 
ATOM   1261 N  ND1   . HIS A 1 184 ? -1.036  -15.831 32.684 1.00 26.89  ? 184  HIS A ND1   1 
ATOM   1262 C  CD2   . HIS A 1 184 ? -1.031  -13.640 32.722 1.00 32.12  ? 184  HIS A CD2   1 
ATOM   1263 C  CE1   . HIS A 1 184 ? -2.280  -15.435 32.445 1.00 32.08  ? 184  HIS A CE1   1 
ATOM   1264 N  NE2   . HIS A 1 184 ? -2.304  -14.114 32.444 1.00 35.39  ? 184  HIS A NE2   1 
ATOM   1265 N  N     . TYR A 1 185 ? 4.079   -13.968 32.524 1.00 25.06  ? 185  TYR A N     1 
ATOM   1266 C  CA    . TYR A 1 185 ? 5.450   -13.736 33.052 1.00 25.72  ? 185  TYR A CA    1 
ATOM   1267 C  C     . TYR A 1 185 ? 5.290   -13.754 34.556 1.00 25.57  ? 185  TYR A C     1 
ATOM   1268 O  O     . TYR A 1 185 ? 6.138   -14.300 35.216 1.00 25.17  ? 185  TYR A O     1 
ATOM   1269 C  CB    . TYR A 1 185 ? 5.963   -12.350 32.525 1.00 25.73  ? 185  TYR A CB    1 
ATOM   1270 C  CG    . TYR A 1 185 ? 7.253   -11.944 33.105 1.00 32.33  ? 185  TYR A CG    1 
ATOM   1271 C  CD1   . TYR A 1 185 ? 8.464   -12.238 32.433 1.00 34.75  ? 185  TYR A CD1   1 
ATOM   1272 C  CD2   . TYR A 1 185 ? 7.304   -11.313 34.373 1.00 33.29  ? 185  TYR A CD2   1 
ATOM   1273 C  CE1   . TYR A 1 185 ? 9.688   -11.876 32.984 1.00 39.29  ? 185  TYR A CE1   1 
ATOM   1274 C  CE2   . TYR A 1 185 ? 8.534   -10.967 34.946 1.00 37.03  ? 185  TYR A CE2   1 
ATOM   1275 C  CZ    . TYR A 1 185 ? 9.714   -11.258 34.246 1.00 41.56  ? 185  TYR A CZ    1 
ATOM   1276 O  OH    . TYR A 1 185 ? 10.917  -10.942 34.802 1.00 45.64  ? 185  TYR A OH    1 
ATOM   1277 N  N     . PHE A 1 186 ? 4.209   -13.199 35.114 1.00 25.44  ? 186  PHE A N     1 
ATOM   1278 C  CA    . PHE A 1 186 ? 4.095   -13.136 36.587 1.00 29.54  ? 186  PHE A CA    1 
ATOM   1279 C  C     . PHE A 1 186 ? 3.497   -14.385 37.246 1.00 32.91  ? 186  PHE A C     1 
ATOM   1280 O  O     . PHE A 1 186 ? 2.776   -15.139 36.586 1.00 32.07  ? 186  PHE A O     1 
ATOM   1281 C  CB    . PHE A 1 186 ? 3.314   -11.911 37.038 1.00 27.90  ? 186  PHE A CB    1 
ATOM   1282 C  CG    . PHE A 1 186 ? 4.064   -10.635 36.813 1.00 30.72  ? 186  PHE A CG    1 
ATOM   1283 C  CD1   . PHE A 1 186 ? 5.265   -10.360 37.543 1.00 27.60  ? 186  PHE A CD1   1 
ATOM   1284 C  CD2   . PHE A 1 186 ? 3.633   -9.748  35.829 1.00 33.52  ? 186  PHE A CD2   1 
ATOM   1285 C  CE1   . PHE A 1 186 ? 5.996   -9.203  37.286 1.00 32.89  ? 186  PHE A CE1   1 
ATOM   1286 C  CE2   . PHE A 1 186 ? 4.367   -8.532  35.568 1.00 38.42  ? 186  PHE A CE2   1 
ATOM   1287 C  CZ    . PHE A 1 186 ? 5.539   -8.258  36.309 1.00 34.76  ? 186  PHE A CZ    1 
ATOM   1288 N  N     . ILE A 1 187 ? 3.829   -14.611 38.526 1.00 33.95  ? 187  ILE A N     1 
ATOM   1289 C  CA    . ILE A 1 187 ? 3.290   -15.744 39.266 1.00 36.16  ? 187  ILE A CA    1 
ATOM   1290 C  C     . ILE A 1 187 ? 2.040   -15.313 39.996 1.00 37.72  ? 187  ILE A C     1 
ATOM   1291 O  O     . ILE A 1 187 ? 0.997   -15.968 39.921 1.00 39.77  ? 187  ILE A O     1 
ATOM   1292 C  CB    . ILE A 1 187 ? 4.292   -16.284 40.286 1.00 36.93  ? 187  ILE A CB    1 
ATOM   1293 C  CG1   . ILE A 1 187 ? 5.560   -16.874 39.591 1.00 35.51  ? 187  ILE A CG1   1 
ATOM   1294 C  CG2   . ILE A 1 187 ? 3.584   -17.279 41.195 1.00 35.41  ? 187  ILE A CG2   1 
ATOM   1295 C  CD1   . ILE A 1 187 ? 6.793   -17.087 40.553 1.00 35.65  ? 187  ILE A CD1   1 
ATOM   1296 N  N     . ASP A 1 188 ? 2.113   -14.199 40.709 1.00 38.54  ? 188  ASP A N     1 
ATOM   1297 C  CA    . ASP A 1 188 ? 0.977   -13.702 41.431 1.00 38.91  ? 188  ASP A CA    1 
ATOM   1298 C  C     . ASP A 1 188 ? -0.282  -13.395 40.563 1.00 38.43  ? 188  ASP A C     1 
ATOM   1299 O  O     . ASP A 1 188 ? -0.189  -12.632 39.611 1.00 37.42  ? 188  ASP A O     1 
ATOM   1300 C  CB    . ASP A 1 188 ? 1.401   -12.429 42.174 1.00 40.15  ? 188  ASP A CB    1 
ATOM   1301 C  CG    . ASP A 1 188 ? 0.369   -11.994 43.163 1.00 45.99  ? 188  ASP A CG    1 
ATOM   1302 O  OD1   . ASP A 1 188 ? 0.427   -12.504 44.309 1.00 61.05  ? 188  ASP A OD1   1 
ATOM   1303 O  OD2   . ASP A 1 188 ? -0.516  -11.223 42.814 1.00 42.07  ? 188  ASP A OD2   1 
ATOM   1304 N  N     . PRO A 1 189 ? -1.484  -13.923 40.941 1.00 38.21  ? 189  PRO A N     1 
ATOM   1305 C  CA    . PRO A 1 189 ? -2.669  -13.800 40.061 1.00 38.66  ? 189  PRO A CA    1 
ATOM   1306 C  C     . PRO A 1 189 ? -3.180  -12.391 39.915 1.00 38.47  ? 189  PRO A C     1 
ATOM   1307 O  O     . PRO A 1 189 ? -3.714  -12.038 38.871 1.00 37.81  ? 189  PRO A O     1 
ATOM   1308 C  CB    . PRO A 1 189 ? -3.760  -14.656 40.765 1.00 40.17  ? 189  PRO A CB    1 
ATOM   1309 C  CG    . PRO A 1 189 ? -3.003  -15.590 41.667 1.00 41.96  ? 189  PRO A CG    1 
ATOM   1310 C  CD    . PRO A 1 189 ? -1.771  -14.745 42.121 1.00 38.62  ? 189  PRO A CD    1 
ATOM   1311 N  N     . TYR A 1 190 ? -3.050  -11.574 40.959 1.00 38.44  ? 190  TYR A N     1 
ATOM   1312 C  CA    . TYR A 1 190 ? -3.371  -10.154 40.810 1.00 38.09  ? 190  TYR A CA    1 
ATOM   1313 C  C     . TYR A 1 190 ? -2.472  -9.504  39.751 1.00 36.09  ? 190  TYR A C     1 
ATOM   1314 O  O     . TYR A 1 190 ? -2.947  -8.784  38.900 1.00 36.61  ? 190  TYR A O     1 
ATOM   1315 C  CB    . TYR A 1 190 ? -3.304  -9.414  42.185 1.00 39.19  ? 190  TYR A CB    1 
ATOM   1316 C  CG    . TYR A 1 190 ? -3.683  -7.953  42.091 1.00 45.88  ? 190  TYR A CG    1 
ATOM   1317 C  CD1   . TYR A 1 190 ? -5.045  -7.565  41.930 1.00 53.36  ? 190  TYR A CD1   1 
ATOM   1318 C  CD2   . TYR A 1 190 ? -2.700  -6.929  42.162 1.00 51.95  ? 190  TYR A CD2   1 
ATOM   1319 C  CE1   . TYR A 1 190 ? -5.432  -6.179  41.826 1.00 53.84  ? 190  TYR A CE1   1 
ATOM   1320 C  CE2   . TYR A 1 190 ? -3.067  -5.517  42.062 1.00 54.19  ? 190  TYR A CE2   1 
ATOM   1321 C  CZ    . TYR A 1 190 ? -4.438  -5.174  41.893 1.00 57.61  ? 190  TYR A CZ    1 
ATOM   1322 O  OH    . TYR A 1 190 ? -4.828  -3.856  41.785 1.00 58.43  ? 190  TYR A OH    1 
ATOM   1323 N  N     . LEU A 1 191 ? -1.169  -9.767  39.792 1.00 34.59  ? 191  LEU A N     1 
ATOM   1324 C  CA    . LEU A 1 191 ? -0.219  -9.202  38.776 1.00 33.02  ? 191  LEU A CA    1 
ATOM   1325 C  C     . LEU A 1 191 ? -0.522  -9.797  37.373 1.00 31.00  ? 191  LEU A C     1 
ATOM   1326 O  O     . LEU A 1 191 ? -0.505  -9.109  36.354 1.00 30.64  ? 191  LEU A O     1 
ATOM   1327 C  CB    . LEU A 1 191 ? 1.256   -9.544  39.214 1.00 31.26  ? 191  LEU A CB    1 
ATOM   1328 C  CG    . LEU A 1 191 ? 2.110   -8.519  40.020 1.00 35.22  ? 191  LEU A CG    1 
ATOM   1329 C  CD1   . LEU A 1 191 ? 1.292   -7.405  40.651 1.00 34.64  ? 191  LEU A CD1   1 
ATOM   1330 C  CD2   . LEU A 1 191 ? 3.114   -9.184  41.010 1.00 34.67  ? 191  LEU A CD2   1 
ATOM   1331 N  N     . LYS A 1 192 ? -0.803  -11.090 37.329 1.00 30.23  ? 192  LYS A N     1 
ATOM   1332 C  CA    . LYS A 1 192 ? -1.137  -11.748 36.044 1.00 30.00  ? 192  LYS A CA    1 
ATOM   1333 C  C     . LYS A 1 192 ? -2.350  -11.090 35.431 1.00 30.48  ? 192  LYS A C     1 
ATOM   1334 O  O     . LYS A 1 192 ? -2.456  -10.898 34.194 1.00 29.38  ? 192  LYS A O     1 
ATOM   1335 C  CB    . LYS A 1 192 ? -1.537  -13.174 36.292 1.00 27.59  ? 192  LYS A CB    1 
ATOM   1336 C  CG    . LYS A 1 192 ? -0.426  -14.082 36.487 1.00 30.87  ? 192  LYS A CG    1 
ATOM   1337 C  CD    . LYS A 1 192 ? -1.149  -15.428 36.697 1.00 36.34  ? 192  LYS A CD    1 
ATOM   1338 C  CE    . LYS A 1 192 ? -0.286  -16.470 37.110 1.00 40.23  ? 192  LYS A CE    1 
ATOM   1339 N  NZ    . LYS A 1 192 ? -1.103  -17.662 36.862 1.00 47.09  ? 192  LYS A NZ    1 
ATOM   1340 N  N     . SER A 1 193 ? -3.282  -10.716 36.287 1.00 30.97  ? 193  SER A N     1 
ATOM   1341 C  CA    . SER A 1 193 ? -4.471  -10.130 35.724 1.00 33.53  ? 193  SER A CA    1 
ATOM   1342 C  C     . SER A 1 193 ? -4.162  -8.775  35.077 1.00 33.46  ? 193  SER A C     1 
ATOM   1343 O  O     . SER A 1 193 ? -4.519  -8.510  33.893 1.00 33.72  ? 193  SER A O     1 
ATOM   1344 C  CB    . SER A 1 193 ? -5.591  -10.058 36.793 1.00 35.43  ? 193  SER A CB    1 
ATOM   1345 O  OG    . SER A 1 193 ? -6.576  -9.197  36.226 1.00 42.69  ? 193  SER A OG    1 
ATOM   1346 N  N     . TRP A 1 194 ? -3.439  -7.912  35.809 1.00 33.30  ? 194  TRP A N     1 
ATOM   1347 C  CA    . TRP A 1 194 ? -2.889  -6.701  35.179 1.00 33.55  ? 194  TRP A CA    1 
ATOM   1348 C  C     . TRP A 1 194 ? -2.042  -6.979  33.945 1.00 31.64  ? 194  TRP A C     1 
ATOM   1349 O  O     . TRP A 1 194 ? -2.191  -6.304  32.928 1.00 31.85  ? 194  TRP A O     1 
ATOM   1350 C  CB    . TRP A 1 194 ? -2.028  -5.898  36.179 1.00 34.89  ? 194  TRP A CB    1 
ATOM   1351 C  CG    . TRP A 1 194 ? -2.848  -5.104  37.136 1.00 39.94  ? 194  TRP A CG    1 
ATOM   1352 C  CD1   . TRP A 1 194 ? -3.232  -5.488  38.389 1.00 45.06  ? 194  TRP A CD1   1 
ATOM   1353 C  CD2   . TRP A 1 194 ? -3.409  -3.833  36.908 1.00 42.95  ? 194  TRP A CD2   1 
ATOM   1354 N  NE1   . TRP A 1 194 ? -3.964  -4.507  38.968 1.00 47.39  ? 194  TRP A NE1   1 
ATOM   1355 C  CE2   . TRP A 1 194 ? -4.089  -3.468  38.086 1.00 46.99  ? 194  TRP A CE2   1 
ATOM   1356 C  CE3   . TRP A 1 194 ? -3.372  -2.929  35.828 1.00 48.68  ? 194  TRP A CE3   1 
ATOM   1357 C  CZ2   . TRP A 1 194 ? -4.767  -2.233  38.227 1.00 49.82  ? 194  TRP A CZ2   1 
ATOM   1358 C  CZ3   . TRP A 1 194 ? -4.036  -1.688  35.954 1.00 53.28  ? 194  TRP A CZ3   1 
ATOM   1359 C  CH2   . TRP A 1 194 ? -4.721  -1.352  37.160 1.00 53.29  ? 194  TRP A CH2   1 
ATOM   1360 N  N     . GLU A 1 195 ? -1.140  -7.943  34.028 1.00 29.99  ? 195  GLU A N     1 
ATOM   1361 C  CA    . GLU A 1 195 ? -0.278  -8.203  32.848 1.00 30.77  ? 195  GLU A CA    1 
ATOM   1362 C  C     . GLU A 1 195 ? -1.180  -8.527  31.606 1.00 31.95  ? 195  GLU A C     1 
ATOM   1363 O  O     . GLU A 1 195 ? -0.933  -8.020  30.473 1.00 32.44  ? 195  GLU A O     1 
ATOM   1364 C  CB    . GLU A 1 195 ? 0.590   -9.410  33.185 1.00 29.29  ? 195  GLU A CB    1 
ATOM   1365 C  CG    . GLU A 1 195 ? 1.497   -9.894  32.100 1.00 28.52  ? 195  GLU A CG    1 
ATOM   1366 C  CD    . GLU A 1 195 ? 2.118   -11.200 32.402 1.00 27.95  ? 195  GLU A CD    1 
ATOM   1367 O  OE1   . GLU A 1 195 ? 2.064   -11.608 33.628 1.00 27.02  ? 195  GLU A OE1   1 
ATOM   1368 O  OE2   . GLU A 1 195 ? 2.707   -11.836 31.431 1.00 26.60  ? 195  GLU A OE2   1 
ATOM   1369 N  N     . MET A 1 196 ? -2.255  -9.315  31.820 1.00 30.87  ? 196  MET A N     1 
ATOM   1370 C  CA    . MET A 1 196 ? -3.090  -9.706  30.663 1.00 32.75  ? 196  MET A CA    1 
ATOM   1371 C  C     . MET A 1 196 ? -3.848  -8.513  30.097 1.00 32.39  ? 196  MET A C     1 
ATOM   1372 O  O     . MET A 1 196 ? -3.851  -8.289  28.900 1.00 31.59  ? 196  MET A O     1 
ATOM   1373 C  CB    . MET A 1 196 ? -4.093  -10.837 31.000 1.00 32.93  ? 196  MET A CB    1 
ATOM   1374 C  CG    . MET A 1 196 ? -4.935  -11.281 29.753 1.00 34.60  ? 196  MET A CG    1 
ATOM   1375 S  SD    . MET A 1 196 ? -6.038  -12.586 30.274 1.00 38.89  ? 196  MET A SD    1 
ATOM   1376 C  CE    . MET A 1 196 ? -7.347  -11.655 31.109 1.00 40.53  ? 196  MET A CE    1 
ATOM   1377 N  N     . HIS A 1 197 ? -4.511  -7.768  30.965 1.00 34.68  ? 197  HIS A N     1 
ATOM   1378 C  CA    . HIS A 1 197 ? -5.319  -6.636  30.532 1.00 35.94  ? 197  HIS A CA    1 
ATOM   1379 C  C     . HIS A 1 197 ? -4.516  -5.495  29.995 1.00 36.15  ? 197  HIS A C     1 
ATOM   1380 O  O     . HIS A 1 197 ? -4.981  -4.773  29.162 1.00 37.93  ? 197  HIS A O     1 
ATOM   1381 C  CB    . HIS A 1 197 ? -6.278  -6.217  31.649 1.00 37.07  ? 197  HIS A CB    1 
ATOM   1382 C  CG    . HIS A 1 197 ? -7.361  -7.231  31.875 1.00 42.62  ? 197  HIS A CG    1 
ATOM   1383 N  ND1   . HIS A 1 197 ? -8.268  -7.583  30.887 1.00 47.37  ? 197  HIS A ND1   1 
ATOM   1384 C  CD2   . HIS A 1 197 ? -7.654  -8.007  32.951 1.00 47.58  ? 197  HIS A CD2   1 
ATOM   1385 C  CE1   . HIS A 1 197 ? -9.083  -8.509  31.364 1.00 49.96  ? 197  HIS A CE1   1 
ATOM   1386 N  NE2   . HIS A 1 197 ? -8.727  -8.791  32.610 1.00 47.70  ? 197  HIS A NE2   1 
ATOM   1387 N  N     . LEU A 1 198 ? -3.275  -5.347  30.427 1.00 36.82  ? 198  LEU A N     1 
ATOM   1388 C  CA    . LEU A 1 198 ? -2.419  -4.304  29.863 1.00 36.99  ? 198  LEU A CA    1 
ATOM   1389 C  C     . LEU A 1 198 ? -1.878  -4.700  28.491 1.00 37.28  ? 198  LEU A C     1 
ATOM   1390 O  O     . LEU A 1 198 ? -1.234  -3.869  27.805 1.00 38.39  ? 198  LEU A O     1 
ATOM   1391 C  CB    . LEU A 1 198 ? -1.241  -4.046  30.842 1.00 38.25  ? 198  LEU A CB    1 
ATOM   1392 C  CG    . LEU A 1 198 ? -1.520  -3.266  32.167 1.00 38.22  ? 198  LEU A CG    1 
ATOM   1393 C  CD1   . LEU A 1 198 ? -0.231  -3.027  32.962 1.00 39.27  ? 198  LEU A CD1   1 
ATOM   1394 C  CD2   . LEU A 1 198 ? -2.182  -1.874  31.865 1.00 42.20  ? 198  LEU A CD2   1 
ATOM   1395 N  N     . GLY A 1 199 ? -2.113  -5.963  28.073 1.00 35.49  ? 199  GLY A N     1 
ATOM   1396 C  CA    . GLY A 1 199 ? -1.562  -6.467  26.810 1.00 31.79  ? 199  GLY A CA    1 
ATOM   1397 C  C     . GLY A 1 199 ? -0.054  -6.420  26.712 1.00 31.22  ? 199  GLY A C     1 
ATOM   1398 O  O     . GLY A 1 199 ? 0.460   -6.177  25.619 1.00 32.10  ? 199  GLY A O     1 
ATOM   1399 N  N     . LEU A 1 200 ? 0.676   -6.662  27.818 1.00 29.42  ? 200  LEU A N     1 
ATOM   1400 C  CA    . LEU A 1 200 ? 2.147   -6.705  27.766 1.00 29.77  ? 200  LEU A CA    1 
ATOM   1401 C  C     . LEU A 1 200 ? 2.718   -7.753  26.802 1.00 29.44  ? 200  LEU A C     1 
ATOM   1402 O  O     . LEU A 1 200 ? 3.752   -7.530  26.163 1.00 28.74  ? 200  LEU A O     1 
ATOM   1403 C  CB    . LEU A 1 200 ? 2.718   -6.935  29.177 1.00 30.63  ? 200  LEU A CB    1 
ATOM   1404 C  CG    . LEU A 1 200 ? 2.269   -5.920  30.255 1.00 31.84  ? 200  LEU A CG    1 
ATOM   1405 C  CD1   . LEU A 1 200 ? 2.887   -6.278  31.637 1.00 30.31  ? 200  LEU A CD1   1 
ATOM   1406 C  CD2   . LEU A 1 200 ? 2.652   -4.483  29.805 1.00 35.56  ? 200  LEU A CD2   1 
ATOM   1407 N  N     . ALA A 1 201 ? 2.085   -8.946  26.724 1.00 27.61  ? 201  ALA A N     1 
ATOM   1408 C  CA    . ALA A 1 201 ? 2.669   -9.980  25.851 1.00 25.83  ? 201  ALA A CA    1 
ATOM   1409 C  C     . ALA A 1 201 ? 4.088   -10.321 26.248 1.00 24.31  ? 201  ALA A C     1 
ATOM   1410 O  O     . ALA A 1 201 ? 4.992   -10.220 25.456 1.00 25.59  ? 201  ALA A O     1 
ATOM   1411 C  CB    . ALA A 1 201 ? 2.580   -9.589  24.365 1.00 26.17  ? 201  ALA A CB    1 
ATOM   1412 N  N     . TRP A 1 202 ? 4.254   -10.742 27.485 1.00 23.74  ? 202  TRP A N     1 
ATOM   1413 C  CA    . TRP A 1 202 ? 5.505   -11.166 28.075 1.00 25.25  ? 202  TRP A CA    1 
ATOM   1414 C  C     . TRP A 1 202 ? 5.555   -12.661 28.350 1.00 24.94  ? 202  TRP A C     1 
ATOM   1415 O  O     . TRP A 1 202 ? 6.478   -13.134 28.960 1.00 23.20  ? 202  TRP A O     1 
ATOM   1416 C  CB    . TRP A 1 202 ? 5.679   -10.503 29.453 1.00 26.21  ? 202  TRP A CB    1 
ATOM   1417 C  CG    . TRP A 1 202 ? 5.931   -9.000  29.392 1.00 30.65  ? 202  TRP A CG    1 
ATOM   1418 C  CD1   . TRP A 1 202 ? 6.080   -8.218  28.255 1.00 29.44  ? 202  TRP A CD1   1 
ATOM   1419 C  CD2   . TRP A 1 202 ? 6.136   -8.116  30.522 1.00 29.24  ? 202  TRP A CD2   1 
ATOM   1420 N  NE1   . TRP A 1 202 ? 6.316   -6.867  28.635 1.00 29.56  ? 202  TRP A NE1   1 
ATOM   1421 C  CE2   . TRP A 1 202 ? 6.345   -6.786  29.998 1.00 33.73  ? 202  TRP A CE2   1 
ATOM   1422 C  CE3   . TRP A 1 202 ? 6.093   -8.295  31.908 1.00 31.67  ? 202  TRP A CE3   1 
ATOM   1423 C  CZ2   . TRP A 1 202 ? 6.563   -5.664  30.836 1.00 33.45  ? 202  TRP A CZ2   1 
ATOM   1424 C  CZ3   . TRP A 1 202 ? 6.285   -7.145  32.746 1.00 34.82  ? 202  TRP A CZ3   1 
ATOM   1425 C  CH2   . TRP A 1 202 ? 6.500   -5.877  32.196 1.00 32.15  ? 202  TRP A CH2   1 
ATOM   1426 N  N     . SER A 1 203 ? 4.590   -13.400 27.800 1.00 24.08  ? 203  SER A N     1 
ATOM   1427 C  CA    . SER A 1 203 ? 4.479   -14.831 28.034 1.00 23.65  ? 203  SER A CA    1 
ATOM   1428 C  C     . SER A 1 203 ? 5.602   -15.435 27.185 1.00 22.19  ? 203  SER A C     1 
ATOM   1429 O  O     . SER A 1 203 ? 6.051   -14.811 26.210 1.00 21.78  ? 203  SER A O     1 
ATOM   1430 C  CB    . SER A 1 203 ? 2.994   -15.218 27.586 1.00 23.42  ? 203  SER A CB    1 
ATOM   1431 O  OG    . SER A 1 203 ? 2.972   -16.407 26.918 1.00 27.90  ? 203  SER A OG    1 
ATOM   1432 N  N     . PHE A 1 204 ? 6.095   -16.615 27.568 1.00 21.21  ? 204  PHE A N     1 
ATOM   1433 C  CA    . PHE A 1 204 ? 7.269   -17.136 26.940 1.00 21.52  ? 204  PHE A CA    1 
ATOM   1434 C  C     . PHE A 1 204 ? 7.355   -18.641 27.036 1.00 20.89  ? 204  PHE A C     1 
ATOM   1435 O  O     . PHE A 1 204 ? 6.626   -19.243 27.806 1.00 21.31  ? 204  PHE A O     1 
ATOM   1436 C  CB    . PHE A 1 204 ? 8.579   -16.447 27.550 1.00 21.57  ? 204  PHE A CB    1 
ATOM   1437 C  CG    . PHE A 1 204 ? 8.831   -16.763 29.004 1.00 19.19  ? 204  PHE A CG    1 
ATOM   1438 C  CD1   . PHE A 1 204 ? 9.667   -17.804 29.340 1.00 19.64  ? 204  PHE A CD1   1 
ATOM   1439 C  CD2   . PHE A 1 204 ? 8.200   -16.021 30.003 1.00 20.34  ? 204  PHE A CD2   1 
ATOM   1440 C  CE1   . PHE A 1 204 ? 9.968   -18.103 30.637 1.00 18.91  ? 204  PHE A CE1   1 
ATOM   1441 C  CE2   . PHE A 1 204 ? 8.458   -16.277 31.321 1.00 22.09  ? 204  PHE A CE2   1 
ATOM   1442 C  CZ    . PHE A 1 204 ? 9.377   -17.325 31.662 1.00 19.02  ? 204  PHE A CZ    1 
ATOM   1443 N  N     . VAL A 1 205 ? 8.275   -19.234 26.274 1.00 19.33  ? 205  VAL A N     1 
ATOM   1444 C  CA    . VAL A 1 205 ? 8.399   -20.669 26.244 1.00 18.29  ? 205  VAL A CA    1 
ATOM   1445 C  C     . VAL A 1 205 ? 9.773   -21.082 26.679 1.00 21.09  ? 205  VAL A C     1 
ATOM   1446 O  O     . VAL A 1 205 ? 10.756  -20.419 26.251 1.00 22.07  ? 205  VAL A O     1 
ATOM   1447 C  CB    . VAL A 1 205 ? 8.130   -21.163 24.755 1.00 17.88  ? 205  VAL A CB    1 
ATOM   1448 C  CG1   . VAL A 1 205 ? 8.364   -22.624 24.612 1.00 14.67  ? 205  VAL A CG1   1 
ATOM   1449 C  CG2   . VAL A 1 205 ? 6.684   -20.769 24.268 1.00 16.52  ? 205  VAL A CG2   1 
ATOM   1450 N  N     . THR A 1 206 ? 9.841   -22.116 27.522 1.00 20.96  ? 206  THR A N     1 
ATOM   1451 C  CA    . THR A 1 206 ? 11.038  -22.598 28.229 1.00 24.80  ? 206  THR A CA    1 
ATOM   1452 C  C     . THR A 1 206 ? 11.351  -24.001 27.812 1.00 25.30  ? 206  THR A C     1 
ATOM   1453 O  O     . THR A 1 206 ? 10.421  -24.758 27.610 1.00 28.92  ? 206  THR A O     1 
ATOM   1454 C  CB    . THR A 1 206 ? 10.805  -22.520 29.730 1.00 24.65  ? 206  THR A CB    1 
ATOM   1455 O  OG1   . THR A 1 206 ? 10.667  -21.140 30.021 1.00 25.04  ? 206  THR A OG1   1 
ATOM   1456 C  CG2   . THR A 1 206 ? 11.992  -23.152 30.617 1.00 23.95  ? 206  THR A CG2   1 
ATOM   1457 N  N     . TYR A 1 207 ? 12.599  -24.286 27.457 1.00 24.73  ? 207  TYR A N     1 
ATOM   1458 C  CA    . TYR A 1 207 ? 13.064  -25.651 27.336 1.00 26.67  ? 207  TYR A CA    1 
ATOM   1459 C  C     . TYR A 1 207 ? 13.632  -26.082 28.689 1.00 27.77  ? 207  TYR A C     1 
ATOM   1460 O  O     . TYR A 1 207 ? 14.490  -25.389 29.245 1.00 28.61  ? 207  TYR A O     1 
ATOM   1461 C  CB    . TYR A 1 207 ? 14.128  -25.814 26.219 1.00 26.55  ? 207  TYR A CB    1 
ATOM   1462 C  CG    . TYR A 1 207 ? 14.750  -27.184 26.255 1.00 29.59  ? 207  TYR A CG    1 
ATOM   1463 C  CD1   . TYR A 1 207 ? 14.027  -28.303 25.847 1.00 28.37  ? 207  TYR A CD1   1 
ATOM   1464 C  CD2   . TYR A 1 207 ? 16.083  -27.375 26.707 1.00 33.82  ? 207  TYR A CD2   1 
ATOM   1465 C  CE1   . TYR A 1 207 ? 14.573  -29.557 25.894 1.00 33.60  ? 207  TYR A CE1   1 
ATOM   1466 C  CE2   . TYR A 1 207 ? 16.667  -28.682 26.735 1.00 31.84  ? 207  TYR A CE2   1 
ATOM   1467 C  CZ    . TYR A 1 207 ? 15.912  -29.730 26.358 1.00 35.15  ? 207  TYR A CZ    1 
ATOM   1468 O  OH    . TYR A 1 207 ? 16.413  -30.995 26.378 1.00 43.53  ? 207  TYR A OH    1 
ATOM   1469 N  N     . TYR A 1 208 ? 13.120  -27.175 29.234 1.00 27.15  ? 208  TYR A N     1 
ATOM   1470 C  CA    . TYR A 1 208 ? 13.533  -27.681 30.523 1.00 28.24  ? 208  TYR A CA    1 
ATOM   1471 C  C     . TYR A 1 208 ? 14.195  -29.031 30.333 1.00 29.68  ? 208  TYR A C     1 
ATOM   1472 O  O     . TYR A 1 208 ? 13.675  -29.919 29.646 1.00 29.05  ? 208  TYR A O     1 
ATOM   1473 C  CB    . TYR A 1 208 ? 12.379  -27.818 31.568 1.00 28.04  ? 208  TYR A CB    1 
ATOM   1474 C  CG    . TYR A 1 208 ? 12.904  -28.305 32.948 1.00 29.19  ? 208  TYR A CG    1 
ATOM   1475 C  CD1   . TYR A 1 208 ? 13.199  -27.412 33.973 1.00 28.27  ? 208  TYR A CD1   1 
ATOM   1476 C  CD2   . TYR A 1 208 ? 13.127  -29.645 33.169 1.00 28.26  ? 208  TYR A CD2   1 
ATOM   1477 C  CE1   . TYR A 1 208 ? 13.747  -27.879 35.185 1.00 28.78  ? 208  TYR A CE1   1 
ATOM   1478 C  CE2   . TYR A 1 208 ? 13.618  -30.131 34.360 1.00 30.81  ? 208  TYR A CE2   1 
ATOM   1479 C  CZ    . TYR A 1 208 ? 13.943  -29.217 35.357 1.00 33.24  ? 208  TYR A CZ    1 
ATOM   1480 O  OH    . TYR A 1 208 ? 14.367  -29.729 36.547 1.00 36.92  ? 208  TYR A OH    1 
ATOM   1481 N  N     . SER A 1 209 ? 15.362  -29.185 30.936 1.00 30.18  ? 209  SER A N     1 
ATOM   1482 C  CA    . SER A 1 209 ? 16.020  -30.498 31.072 1.00 32.65  ? 209  SER A CA    1 
ATOM   1483 C  C     . SER A 1 209 ? 16.944  -30.506 32.337 1.00 34.21  ? 209  SER A C     1 
ATOM   1484 O  O     . SER A 1 209 ? 17.177  -29.487 32.950 1.00 33.40  ? 209  SER A O     1 
ATOM   1485 C  CB    . SER A 1 209 ? 16.871  -30.858 29.831 1.00 33.42  ? 209  SER A CB    1 
ATOM   1486 O  OG    . SER A 1 209 ? 17.914  -29.909 29.724 1.00 32.13  ? 209  SER A OG    1 
ATOM   1487 N  N     . PRO A 1 210 ? 17.417  -31.677 32.747 1.00 36.30  ? 210  PRO A N     1 
ATOM   1488 C  CA    . PRO A 1 210 ? 18.173  -31.705 34.051 1.00 39.11  ? 210  PRO A CA    1 
ATOM   1489 C  C     . PRO A 1 210 ? 19.415  -30.767 34.062 1.00 40.27  ? 210  PRO A C     1 
ATOM   1490 O  O     . PRO A 1 210 ? 19.630  -30.045 35.027 1.00 40.72  ? 210  PRO A O     1 
ATOM   1491 C  CB    . PRO A 1 210 ? 18.550  -33.205 34.192 1.00 40.31  ? 210  PRO A CB    1 
ATOM   1492 C  CG    . PRO A 1 210 ? 17.247  -33.873 33.654 1.00 39.70  ? 210  PRO A CG    1 
ATOM   1493 C  CD    . PRO A 1 210 ? 17.042  -33.031 32.315 1.00 35.21  ? 210  PRO A CD    1 
ATOM   1494 N  N     . ASN A 1 211 ? 20.144  -30.700 32.961 1.00 41.59  ? 211  ASN A N     1 
ATOM   1495 C  CA    . ASN A 1 211 ? 21.399  -29.920 32.988 1.00 44.52  ? 211  ASN A CA    1 
ATOM   1496 C  C     . ASN A 1 211 ? 21.304  -28.501 32.318 1.00 43.99  ? 211  ASN A C     1 
ATOM   1497 O  O     . ASN A 1 211 ? 22.293  -27.745 32.265 1.00 43.10  ? 211  ASN A O     1 
ATOM   1498 C  CB    . ASN A 1 211 ? 22.511  -30.782 32.310 1.00 45.82  ? 211  ASN A CB    1 
ATOM   1499 N  N     . ASP A 1 212 ? 20.104  -28.166 31.787 1.00 40.42  ? 212  ASP A N     1 
ATOM   1500 C  CA    . ASP A 1 212 ? 19.979  -27.057 30.878 1.00 36.41  ? 212  ASP A CA    1 
ATOM   1501 C  C     . ASP A 1 212 ? 18.507  -26.553 30.771 1.00 34.13  ? 212  ASP A C     1 
ATOM   1502 O  O     . ASP A 1 212 ? 17.673  -27.237 30.229 1.00 33.26  ? 212  ASP A O     1 
ATOM   1503 C  CB    . ASP A 1 212 ? 20.460  -27.544 29.553 1.00 36.98  ? 212  ASP A CB    1 
ATOM   1504 C  CG    . ASP A 1 212 ? 20.500  -26.465 28.543 1.00 43.12  ? 212  ASP A CG    1 
ATOM   1505 O  OD1   . ASP A 1 212 ? 20.579  -25.271 28.922 1.00 43.18  ? 212  ASP A OD1   1 
ATOM   1506 O  OD2   . ASP A 1 212 ? 20.474  -26.836 27.347 1.00 55.59  ? 212  ASP A OD2   1 
ATOM   1507 N  N     . VAL A 1 213 ? 18.247  -25.371 31.299 1.00 31.35  ? 213  VAL A N     1 
ATOM   1508 C  CA    . VAL A 1 213 ? 16.976  -24.761 31.344 1.00 30.94  ? 213  VAL A CA    1 
ATOM   1509 C  C     . VAL A 1 213 ? 17.159  -23.400 30.721 1.00 30.97  ? 213  VAL A C     1 
ATOM   1510 O  O     . VAL A 1 213 ? 17.947  -22.628 31.221 1.00 30.58  ? 213  VAL A O     1 
ATOM   1511 C  CB    . VAL A 1 213 ? 16.423  -24.536 32.734 1.00 30.59  ? 213  VAL A CB    1 
ATOM   1512 C  CG1   . VAL A 1 213 ? 14.932  -24.053 32.616 1.00 27.06  ? 213  VAL A CG1   1 
ATOM   1513 C  CG2   . VAL A 1 213 ? 16.452  -25.814 33.557 1.00 28.99  ? 213  VAL A CG2   1 
ATOM   1514 N  N     . ARG A 1 214 ? 16.405  -23.120 29.636 1.00 28.19  ? 214  ARG A N     1 
ATOM   1515 C  CA    . ARG A 1 214 ? 16.473  -21.833 28.948 1.00 28.02  ? 214  ARG A CA    1 
ATOM   1516 C  C     . ARG A 1 214 ? 15.187  -21.382 28.240 1.00 27.97  ? 214  ARG A C     1 
ATOM   1517 O  O     . ARG A 1 214 ? 14.411  -22.227 27.744 1.00 26.72  ? 214  ARG A O     1 
ATOM   1518 C  CB    . ARG A 1 214 ? 17.586  -21.843 27.905 1.00 28.45  ? 214  ARG A CB    1 
ATOM   1519 C  CG    . ARG A 1 214 ? 17.602  -23.019 26.922 1.00 34.29  ? 214  ARG A CG    1 
ATOM   1520 C  CD    . ARG A 1 214 ? 18.924  -22.975 26.047 1.00 44.13  ? 214  ARG A CD    1 
ATOM   1521 N  NE    . ARG A 1 214 ? 19.526  -24.329 25.952 1.00 52.81  ? 214  ARG A NE    1 
ATOM   1522 C  CZ    . ARG A 1 214 ? 19.555  -25.087 24.853 1.00 51.99  ? 214  ARG A CZ    1 
ATOM   1523 N  NH1   . ARG A 1 214 ? 19.054  -24.637 23.721 1.00 55.89  ? 214  ARG A NH1   1 
ATOM   1524 N  NH2   . ARG A 1 214 ? 20.103  -26.300 24.866 1.00 53.48  ? 214  ARG A NH2   1 
ATOM   1525 N  N     . VAL A 1 215 ? 15.035  -20.072 28.095 1.00 26.50  ? 215  VAL A N     1 
ATOM   1526 C  CA    . VAL A 1 215 ? 13.967  -19.489 27.302 1.00 27.76  ? 215  VAL A CA    1 
ATOM   1527 C  C     . VAL A 1 215 ? 14.238  -19.788 25.840 1.00 29.73  ? 215  VAL A C     1 
ATOM   1528 O  O     . VAL A 1 215 ? 15.406  -19.593 25.376 1.00 28.80  ? 215  VAL A O     1 
ATOM   1529 C  CB    . VAL A 1 215 ? 13.845  -17.983 27.583 1.00 28.23  ? 215  VAL A CB    1 
ATOM   1530 C  CG1   . VAL A 1 215 ? 12.738  -17.289 26.645 1.00 27.34  ? 215  VAL A CG1   1 
ATOM   1531 C  CG2   . VAL A 1 215 ? 13.472  -17.781 29.050 1.00 27.35  ? 215  VAL A CG2   1 
ATOM   1532 N  N     . VAL A 1 216 ? 13.215  -20.277 25.080 1.00 26.29  ? 216  VAL A N     1 
ATOM   1533 C  CA    . VAL A 1 216 ? 13.482  -20.542 23.673 1.00 24.36  ? 216  VAL A CA    1 
ATOM   1534 C  C     . VAL A 1 216 ? 12.713  -19.636 22.769 1.00 24.57  ? 216  VAL A C     1 
ATOM   1535 O  O     . VAL A 1 216 ? 12.946  -19.596 21.552 1.00 24.37  ? 216  VAL A O     1 
ATOM   1536 C  CB    . VAL A 1 216 ? 13.274  -22.022 23.272 1.00 24.17  ? 216  VAL A CB    1 
ATOM   1537 C  CG1   . VAL A 1 216 ? 14.451  -22.882 23.837 1.00 22.20  ? 216  VAL A CG1   1 
ATOM   1538 C  CG2   . VAL A 1 216 ? 11.804  -22.590 23.678 1.00 20.60  ? 216  VAL A CG2   1 
ATOM   1539 N  N     . ALA A 1 217 ? 11.725  -18.967 23.325 1.00 23.03  ? 217  ALA A N     1 
ATOM   1540 C  CA    . ALA A 1 217 ? 10.924  -18.052 22.523 1.00 23.37  ? 217  ALA A CA    1 
ATOM   1541 C  C     . ALA A 1 217 ? 10.176  -17.178 23.467 1.00 22.67  ? 217  ALA A C     1 
ATOM   1542 O  O     . ALA A 1 217 ? 9.856   -17.621 24.582 1.00 23.81  ? 217  ALA A O     1 
ATOM   1543 C  CB    . ALA A 1 217 ? 9.929   -18.878 21.511 1.00 24.34  ? 217  ALA A CB    1 
ATOM   1544 N  N     . GLU A 1 218 ? 9.836   -15.949 23.077 1.00 24.29  ? 218  GLU A N     1 
ATOM   1545 C  CA    . GLU A 1 218 ? 9.243   -15.037 24.033 1.00 24.68  ? 218  GLU A CA    1 
ATOM   1546 C  C     . GLU A 1 218 ? 8.396   -13.945 23.401 1.00 25.23  ? 218  GLU A C     1 
ATOM   1547 O  O     . GLU A 1 218 ? 8.348   -13.829 22.205 1.00 26.97  ? 218  GLU A O     1 
ATOM   1548 C  CB    . GLU A 1 218 ? 10.404  -14.367 24.841 1.00 27.35  ? 218  GLU A CB    1 
ATOM   1549 C  CG    . GLU A 1 218 ? 11.280  -13.434 24.021 1.00 32.87  ? 218  GLU A CG    1 
ATOM   1550 C  CD    . GLU A 1 218 ? 12.462  -12.736 24.867 1.00 48.34  ? 218  GLU A CD    1 
ATOM   1551 O  OE1   . GLU A 1 218 ? 13.182  -13.369 25.678 1.00 46.74  ? 218  GLU A OE1   1 
ATOM   1552 O  OE2   . GLU A 1 218 ? 12.664  -11.520 24.682 1.00 55.38  ? 218  GLU A OE2   1 
ATOM   1553 N  N     . GLY A 1 219 ? 7.656   -13.180 24.197 1.00 25.49  ? 219  GLY A N     1 
ATOM   1554 C  CA    . GLY A 1 219 ? 6.874   -12.044 23.652 1.00 25.62  ? 219  GLY A CA    1 
ATOM   1555 C  C     . GLY A 1 219 ? 5.474   -12.490 23.124 1.00 26.72  ? 219  GLY A C     1 
ATOM   1556 O  O     . GLY A 1 219 ? 4.944   -11.869 22.234 1.00 26.87  ? 219  GLY A O     1 
ATOM   1557 N  N     . PHE A 1 220 ? 4.883   -13.524 23.727 1.00 25.72  ? 220  PHE A N     1 
ATOM   1558 C  CA    . PHE A 1 220 ? 3.551   -14.038 23.384 1.00 23.95  ? 220  PHE A CA    1 
ATOM   1559 C  C     . PHE A 1 220 ? 2.436   -13.384 24.164 1.00 24.92  ? 220  PHE A C     1 
ATOM   1560 O  O     . PHE A 1 220 ? 2.616   -12.987 25.344 1.00 23.27  ? 220  PHE A O     1 
ATOM   1561 C  CB    . PHE A 1 220 ? 3.526   -15.534 23.715 1.00 23.43  ? 220  PHE A CB    1 
ATOM   1562 C  CG    . PHE A 1 220 ? 4.429   -16.362 22.781 1.00 24.10  ? 220  PHE A CG    1 
ATOM   1563 C  CD1   . PHE A 1 220 ? 3.954   -16.810 21.582 1.00 24.96  ? 220  PHE A CD1   1 
ATOM   1564 C  CD2   . PHE A 1 220 ? 5.761   -16.621 23.110 1.00 23.40  ? 220  PHE A CD2   1 
ATOM   1565 C  CE1   . PHE A 1 220 ? 4.778   -17.558 20.711 1.00 26.06  ? 220  PHE A CE1   1 
ATOM   1566 C  CE2   . PHE A 1 220 ? 6.563   -17.369 22.292 1.00 23.85  ? 220  PHE A CE2   1 
ATOM   1567 C  CZ    . PHE A 1 220 ? 6.073   -17.851 21.070 1.00 20.84  ? 220  PHE A CZ    1 
ATOM   1568 N  N     . ASP A 1 221 ? 1.287   -13.225 23.486 1.00 23.83  ? 221  ASP A N     1 
ATOM   1569 C  CA    . ASP A 1 221 ? 0.074   -12.828 24.175 1.00 22.60  ? 221  ASP A CA    1 
ATOM   1570 C  C     . ASP A 1 221 ? -0.687  -14.119 24.586 1.00 23.33  ? 221  ASP A C     1 
ATOM   1571 O  O     . ASP A 1 221 ? -1.550  -14.618 23.800 1.00 23.27  ? 221  ASP A O     1 
ATOM   1572 C  CB    . ASP A 1 221 ? -0.750  -11.931 23.231 1.00 22.49  ? 221  ASP A CB    1 
ATOM   1573 C  CG    . ASP A 1 221 ? -1.892  -11.271 23.932 1.00 24.96  ? 221  ASP A CG    1 
ATOM   1574 O  OD1   . ASP A 1 221 ? -2.074  -11.537 25.166 1.00 26.73  ? 221  ASP A OD1   1 
ATOM   1575 O  OD2   . ASP A 1 221 ? -2.643  -10.524 23.252 1.00 30.52  ? 221  ASP A OD2   1 
ATOM   1576 N  N     . PHE A 1 222 ? -0.326  -14.671 25.759 1.00 23.39  ? 222  PHE A N     1 
ATOM   1577 C  CA    . PHE A 1 222 ? -0.916  -15.874 26.382 1.00 23.85  ? 222  PHE A CA    1 
ATOM   1578 C  C     . PHE A 1 222 ? -0.586  -17.189 25.595 1.00 24.90  ? 222  PHE A C     1 
ATOM   1579 O  O     . PHE A 1 222 ? -1.498  -17.787 24.958 1.00 22.02  ? 222  PHE A O     1 
ATOM   1580 C  CB    . PHE A 1 222 ? -2.455  -15.617 26.587 1.00 22.80  ? 222  PHE A CB    1 
ATOM   1581 C  CG    . PHE A 1 222 ? -3.100  -16.445 27.681 1.00 27.51  ? 222  PHE A CG    1 
ATOM   1582 C  CD1   . PHE A 1 222 ? -3.728  -15.835 28.788 1.00 31.98  ? 222  PHE A CD1   1 
ATOM   1583 C  CD2   . PHE A 1 222 ? -3.206  -17.841 27.553 1.00 32.56  ? 222  PHE A CD2   1 
ATOM   1584 C  CE1   . PHE A 1 222 ? -4.417  -16.628 29.789 1.00 29.32  ? 222  PHE A CE1   1 
ATOM   1585 C  CE2   . PHE A 1 222 ? -3.844  -18.627 28.535 1.00 28.42  ? 222  PHE A CE2   1 
ATOM   1586 C  CZ    . PHE A 1 222 ? -4.448  -18.020 29.664 1.00 25.79  ? 222  PHE A CZ    1 
ATOM   1587 N  N     . ALA A 1 223 ? 0.711   -17.587 25.589 1.00 21.72  ? 223  ALA A N     1 
ATOM   1588 C  CA    . ALA A 1 223 ? 1.117   -18.814 24.974 1.00 22.02  ? 223  ALA A CA    1 
ATOM   1589 C  C     . ALA A 1 223 ? 0.370   -19.911 25.737 1.00 22.71  ? 223  ALA A C     1 
ATOM   1590 O  O     . ALA A 1 223 ? 0.188   -19.819 26.969 1.00 21.00  ? 223  ALA A O     1 
ATOM   1591 C  CB    . ALA A 1 223 ? 2.712   -19.048 25.084 1.00 22.30  ? 223  ALA A CB    1 
ATOM   1592 N  N     . ASN A 1 224 ? -0.058  -20.977 25.023 1.00 21.51  ? 224  ASN A N     1 
ATOM   1593 C  CA    . ASN A 1 224 ? -0.983  -21.875 25.676 1.00 20.20  ? 224  ASN A CA    1 
ATOM   1594 C  C     . ASN A 1 224 ? -0.596  -23.274 25.216 1.00 20.63  ? 224  ASN A C     1 
ATOM   1595 O  O     . ASN A 1 224 ? 0.320   -23.913 25.780 1.00 20.36  ? 224  ASN A O     1 
ATOM   1596 C  CB    . ASN A 1 224 ? -2.451  -21.456 25.232 1.00 20.99  ? 224  ASN A CB    1 
ATOM   1597 C  CG    . ASN A 1 224 ? -3.507  -22.113 26.065 1.00 27.99  ? 224  ASN A CG    1 
ATOM   1598 O  OD1   . ASN A 1 224 ? -3.418  -23.337 26.391 1.00 33.58  ? 224  ASN A OD1   1 
ATOM   1599 N  ND2   . ASN A 1 224 ? -4.437  -21.332 26.536 1.00 29.58  ? 224  ASN A ND2   1 
ATOM   1600 N  N     . GLY A 1 225 ? -1.229  -23.778 24.158 1.00 18.50  ? 225  GLY A N     1 
ATOM   1601 C  CA    . GLY A 1 225 ? -0.892  -25.157 23.750 1.00 16.65  ? 225  GLY A CA    1 
ATOM   1602 C  C     . GLY A 1 225 ? 0.500   -25.223 23.147 1.00 17.12  ? 225  GLY A C     1 
ATOM   1603 O  O     . GLY A 1 225 ? 1.029   -24.186 22.590 1.00 15.23  ? 225  GLY A O     1 
ATOM   1604 N  N     . ILE A 1 226 ? 1.071   -26.453 23.185 1.00 15.81  ? 226  ILE A N     1 
ATOM   1605 C  CA    . ILE A 1 226 ? 2.356   -26.608 22.564 1.00 16.55  ? 226  ILE A CA    1 
ATOM   1606 C  C     . ILE A 1 226 ? 2.466   -28.072 22.211 1.00 17.45  ? 226  ILE A C     1 
ATOM   1607 O  O     . ILE A 1 226 ? 1.997   -28.966 22.972 1.00 19.46  ? 226  ILE A O     1 
ATOM   1608 C  CB    . ILE A 1 226 ? 3.517   -26.138 23.520 1.00 17.12  ? 226  ILE A CB    1 
ATOM   1609 C  CG1   . ILE A 1 226 ? 4.920   -26.368 22.826 1.00 17.25  ? 226  ILE A CG1   1 
ATOM   1610 C  CG2   . ILE A 1 226 ? 3.492   -26.999 24.799 1.00 12.21  ? 226  ILE A CG2   1 
ATOM   1611 C  CD1   . ILE A 1 226 ? 6.058   -25.477 23.558 1.00 17.16  ? 226  ILE A CD1   1 
ATOM   1612 N  N     . ASN A 1 227 ? 3.071   -28.356 21.068 1.00 15.55  ? 227  ASN A N     1 
ATOM   1613 C  CA    . ASN A 1 227 ? 3.237   -29.743 20.764 1.00 18.72  ? 227  ASN A CA    1 
ATOM   1614 C  C     . ASN A 1 227 ? 4.363   -29.837 19.701 1.00 18.40  ? 227  ASN A C     1 
ATOM   1615 O  O     . ASN A 1 227 ? 4.911   -28.816 19.361 1.00 20.63  ? 227  ASN A O     1 
ATOM   1616 C  CB    . ASN A 1 227 ? 1.915   -30.293 20.168 1.00 16.46  ? 227  ASN A CB    1 
ATOM   1617 C  CG    . ASN A 1 227 ? 1.714   -31.814 20.507 1.00 21.07  ? 227  ASN A CG    1 
ATOM   1618 O  OD1   . ASN A 1 227 ? 2.665   -32.565 20.385 1.00 18.57  ? 227  ASN A OD1   1 
ATOM   1619 N  ND2   . ASN A 1 227 ? 0.518   -32.220 20.947 1.00 16.33  ? 227  ASN A ND2   1 
ATOM   1620 N  N     . ILE A 1 228 ? 4.617   -31.017 19.141 1.00 17.81  ? 228  ILE A N     1 
ATOM   1621 C  CA    . ILE A 1 228 ? 5.782   -31.277 18.319 1.00 20.28  ? 228  ILE A CA    1 
ATOM   1622 C  C     . ILE A 1 228 ? 5.398   -32.208 17.172 1.00 21.00  ? 228  ILE A C     1 
ATOM   1623 O  O     . ILE A 1 228 ? 4.493   -33.066 17.328 1.00 20.89  ? 228  ILE A O     1 
ATOM   1624 C  CB    . ILE A 1 228 ? 6.858   -32.001 19.235 1.00 20.25  ? 228  ILE A CB    1 
ATOM   1625 C  CG1   . ILE A 1 228 ? 8.234   -32.056 18.551 1.00 24.62  ? 228  ILE A CG1   1 
ATOM   1626 C  CG2   . ILE A 1 228 ? 6.392   -33.479 19.595 1.00 20.14  ? 228  ILE A CG2   1 
ATOM   1627 C  CD1   . ILE A 1 228 ? 9.429   -32.422 19.691 1.00 26.76  ? 228  ILE A CD1   1 
ATOM   1628 N  N     . SER A 1 229 ? 6.058   -32.086 16.028 1.00 21.33  ? 229  SER A N     1 
ATOM   1629 C  CA    . SER A 1 229 ? 5.765   -33.002 14.924 1.00 23.47  ? 229  SER A CA    1 
ATOM   1630 C  C     . SER A 1 229 ? 6.225   -34.425 15.274 1.00 24.85  ? 229  SER A C     1 
ATOM   1631 O  O     . SER A 1 229 ? 7.083   -34.613 16.127 1.00 22.77  ? 229  SER A O     1 
ATOM   1632 C  CB    . SER A 1 229 ? 6.467   -32.532 13.632 1.00 24.15  ? 229  SER A CB    1 
ATOM   1633 O  OG    . SER A 1 229 ? 7.843   -32.557 13.908 1.00 26.57  ? 229  SER A OG    1 
ATOM   1634 N  N     . PRO A 1 230 ? 5.633   -35.446 14.638 1.00 26.72  ? 230  PRO A N     1 
ATOM   1635 C  CA    . PRO A 1 230 ? 6.034   -36.828 15.017 1.00 28.21  ? 230  PRO A CA    1 
ATOM   1636 C  C     . PRO A 1 230 ? 7.562   -37.119 14.766 1.00 30.08  ? 230  PRO A C     1 
ATOM   1637 O  O     . PRO A 1 230 ? 8.125   -37.958 15.443 1.00 29.60  ? 230  PRO A O     1 
ATOM   1638 C  CB    . PRO A 1 230 ? 5.240   -37.679 14.057 1.00 27.44  ? 230  PRO A CB    1 
ATOM   1639 C  CG    . PRO A 1 230 ? 3.978   -36.765 13.787 1.00 27.93  ? 230  PRO A CG    1 
ATOM   1640 C  CD    . PRO A 1 230 ? 4.543   -35.414 13.640 1.00 25.61  ? 230  PRO A CD    1 
ATOM   1641 N  N     . ASP A 1 231 ? 8.187   -36.416 13.829 1.00 30.31  ? 231  ASP A N     1 
ATOM   1642 C  CA    . ASP A 1 231 ? 9.643   -36.615 13.569 1.00 33.34  ? 231  ASP A CA    1 
ATOM   1643 C  C     . ASP A 1 231 ? 10.532  -35.704 14.462 1.00 33.04  ? 231  ASP A C     1 
ATOM   1644 O  O     . ASP A 1 231 ? 11.774  -35.762 14.406 1.00 33.66  ? 231  ASP A O     1 
ATOM   1645 C  CB    . ASP A 1 231 ? 9.955   -36.398 12.056 1.00 31.81  ? 231  ASP A CB    1 
ATOM   1646 C  CG    . ASP A 1 231 ? 9.695   -34.963 11.611 1.00 36.67  ? 231  ASP A CG    1 
ATOM   1647 O  OD1   . ASP A 1 231 ? 9.369   -34.057 12.440 1.00 36.35  ? 231  ASP A OD1   1 
ATOM   1648 O  OD2   . ASP A 1 231 ? 9.833   -34.684 10.420 1.00 38.47  ? 231  ASP A OD2   1 
ATOM   1649 N  N     . GLY A 1 232 ? 9.898   -34.874 15.298 1.00 32.02  ? 232  GLY A N     1 
ATOM   1650 C  CA    . GLY A 1 232 ? 10.620  -34.062 16.286 1.00 26.98  ? 232  GLY A CA    1 
ATOM   1651 C  C     . GLY A 1 232 ? 11.273  -32.852 15.685 1.00 26.50  ? 232  GLY A C     1 
ATOM   1652 O  O     . GLY A 1 232 ? 12.007  -32.193 16.394 1.00 26.43  ? 232  GLY A O     1 
ATOM   1653 N  N     . LYS A 1 233 ? 10.990  -32.517 14.426 1.00 23.78  ? 233  LYS A N     1 
ATOM   1654 C  CA    . LYS A 1 233 ? 11.600  -31.338 13.764 1.00 26.86  ? 233  LYS A CA    1 
ATOM   1655 C  C     . LYS A 1 233 ? 10.893  -29.986 13.862 1.00 26.86  ? 233  LYS A C     1 
ATOM   1656 O  O     . LYS A 1 233 ? 11.526  -28.965 13.552 1.00 24.94  ? 233  LYS A O     1 
ATOM   1657 C  CB    . LYS A 1 233 ? 11.774  -31.575 12.245 1.00 28.85  ? 233  LYS A CB    1 
ATOM   1658 C  CG    . LYS A 1 233 ? 12.794  -32.705 11.934 1.00 33.52  ? 233  LYS A CG    1 
ATOM   1659 C  CD    . LYS A 1 233 ? 12.812  -33.113 10.418 1.00 44.08  ? 233  LYS A CD    1 
ATOM   1660 N  N     . TYR A 1 234 ? 9.609   -29.973 14.296 1.00 23.09  ? 234  TYR A N     1 
ATOM   1661 C  CA    . TYR A 1 234 ? 8.888   -28.703 14.392 1.00 21.19  ? 234  TYR A CA    1 
ATOM   1662 C  C     . TYR A 1 234 ? 8.151   -28.682 15.706 1.00 20.89  ? 234  TYR A C     1 
ATOM   1663 O  O     . TYR A 1 234 ? 7.667   -29.703 16.186 1.00 19.85  ? 234  TYR A O     1 
ATOM   1664 C  CB    . TYR A 1 234 ? 7.888   -28.632 13.260 1.00 21.46  ? 234  TYR A CB    1 
ATOM   1665 C  CG    . TYR A 1 234 ? 8.557   -28.760 11.920 1.00 25.64  ? 234  TYR A CG    1 
ATOM   1666 C  CD1   . TYR A 1 234 ? 9.157   -27.651 11.343 1.00 27.21  ? 234  TYR A CD1   1 
ATOM   1667 C  CD2   . TYR A 1 234 ? 8.672   -30.000 11.288 1.00 29.05  ? 234  TYR A CD2   1 
ATOM   1668 C  CE1   . TYR A 1 234 ? 9.838   -27.761 10.099 1.00 33.43  ? 234  TYR A CE1   1 
ATOM   1669 C  CE2   . TYR A 1 234 ? 9.338   -30.149 10.043 1.00 30.91  ? 234  TYR A CE2   1 
ATOM   1670 C  CZ    . TYR A 1 234 ? 9.910   -28.995 9.465  1.00 36.16  ? 234  TYR A CZ    1 
ATOM   1671 O  OH    . TYR A 1 234 ? 10.546  -29.041 8.254  1.00 42.21  ? 234  TYR A OH    1 
ATOM   1672 N  N     . VAL A 1 235 ? 8.036   -27.494 16.260 1.00 22.00  ? 235  VAL A N     1 
ATOM   1673 C  CA    . VAL A 1 235 ? 7.359   -27.306 17.501 1.00 20.96  ? 235  VAL A CA    1 
ATOM   1674 C  C     . VAL A 1 235 ? 6.253   -26.303 17.122 1.00 21.34  ? 235  VAL A C     1 
ATOM   1675 O  O     . VAL A 1 235 ? 6.486   -25.401 16.334 1.00 20.95  ? 235  VAL A O     1 
ATOM   1676 C  CB    . VAL A 1 235 ? 8.299   -26.758 18.583 1.00 20.47  ? 235  VAL A CB    1 
ATOM   1677 C  CG1   . VAL A 1 235 ? 7.505   -26.086 19.791 1.00 18.18  ? 235  VAL A CG1   1 
ATOM   1678 C  CG2   . VAL A 1 235 ? 9.105   -27.957 19.101 1.00 20.44  ? 235  VAL A CG2   1 
ATOM   1679 N  N     . TYR A 1 236 ? 5.060   -26.523 17.669 1.00 19.99  ? 236  TYR A N     1 
ATOM   1680 C  CA    . TYR A 1 236 ? 3.862   -25.676 17.390 1.00 18.49  ? 236  TYR A CA    1 
ATOM   1681 C  C     . TYR A 1 236 ? 3.474   -25.021 18.651 1.00 16.94  ? 236  TYR A C     1 
ATOM   1682 O  O     . TYR A 1 236 ? 3.315   -25.705 19.673 1.00 18.42  ? 236  TYR A O     1 
ATOM   1683 C  CB    . TYR A 1 236 ? 2.699   -26.613 16.939 1.00 17.44  ? 236  TYR A CB    1 
ATOM   1684 C  CG    . TYR A 1 236 ? 3.093   -27.523 15.779 1.00 19.25  ? 236  TYR A CG    1 
ATOM   1685 C  CD1   . TYR A 1 236 ? 3.572   -26.967 14.582 1.00 17.56  ? 236  TYR A CD1   1 
ATOM   1686 C  CD2   . TYR A 1 236 ? 2.995   -28.915 15.880 1.00 20.86  ? 236  TYR A CD2   1 
ATOM   1687 C  CE1   . TYR A 1 236 ? 3.994   -27.808 13.481 1.00 18.07  ? 236  TYR A CE1   1 
ATOM   1688 C  CE2   . TYR A 1 236 ? 3.413   -29.789 14.786 1.00 21.66  ? 236  TYR A CE2   1 
ATOM   1689 C  CZ    . TYR A 1 236 ? 3.898   -29.185 13.601 1.00 20.95  ? 236  TYR A CZ    1 
ATOM   1690 O  OH    . TYR A 1 236 ? 4.237   -29.984 12.514 1.00 22.24  ? 236  TYR A OH    1 
ATOM   1691 N  N     . ILE A 1 237 ? 3.198   -23.721 18.636 1.00 18.40  ? 237  ILE A N     1 
ATOM   1692 C  CA    . ILE A 1 237 ? 2.820   -23.083 19.907 1.00 17.71  ? 237  ILE A CA    1 
ATOM   1693 C  C     . ILE A 1 237 ? 1.584   -22.250 19.620 1.00 19.37  ? 237  ILE A C     1 
ATOM   1694 O  O     . ILE A 1 237 ? 1.595   -21.444 18.686 1.00 18.34  ? 237  ILE A O     1 
ATOM   1695 C  CB    . ILE A 1 237 ? 3.916   -22.115 20.332 1.00 18.74  ? 237  ILE A CB    1 
ATOM   1696 C  CG1   . ILE A 1 237 ? 5.242   -22.944 20.538 1.00 23.12  ? 237  ILE A CG1   1 
ATOM   1697 C  CG2   . ILE A 1 237 ? 3.520   -21.261 21.591 1.00 17.03  ? 237  ILE A CG2   1 
ATOM   1698 C  CD1   . ILE A 1 237 ? 6.565   -22.042 20.728 1.00 21.75  ? 237  ILE A CD1   1 
ATOM   1699 N  N     . ALA A 1 238 ? 0.577   -22.375 20.471 1.00 17.86  ? 238  ALA A N     1 
ATOM   1700 C  CA    . ALA A 1 238 ? -0.653  -21.607 20.303 1.00 18.94  ? 238  ALA A CA    1 
ATOM   1701 C  C     . ALA A 1 238 ? -0.531  -20.328 21.123 1.00 19.77  ? 238  ALA A C     1 
ATOM   1702 O  O     . ALA A 1 238 ? -0.075  -20.356 22.273 1.00 20.04  ? 238  ALA A O     1 
ATOM   1703 C  CB    . ALA A 1 238 ? -1.837  -22.425 20.854 1.00 16.66  ? 238  ALA A CB    1 
ATOM   1704 N  N     . GLU A 1 239 ? -0.955  -19.226 20.537 1.00 19.73  ? 239  GLU A N     1 
ATOM   1705 C  CA    . GLU A 1 239 ? -0.845  -17.961 21.220 1.00 20.93  ? 239  GLU A CA    1 
ATOM   1706 C  C     . GLU A 1 239 ? -2.289  -17.538 21.292 1.00 20.39  ? 239  GLU A C     1 
ATOM   1707 O  O     . GLU A 1 239 ? -2.855  -16.985 20.330 1.00 19.78  ? 239  GLU A O     1 
ATOM   1708 C  CB    . GLU A 1 239 ? -0.051  -16.954 20.390 1.00 19.77  ? 239  GLU A CB    1 
ATOM   1709 C  CG    . GLU A 1 239 ? 0.167   -15.629 21.164 1.00 25.34  ? 239  GLU A CG    1 
ATOM   1710 C  CD    . GLU A 1 239 ? 0.943   -14.556 20.313 1.00 24.69  ? 239  GLU A CD    1 
ATOM   1711 O  OE1   . GLU A 1 239 ? 1.190   -14.777 19.093 1.00 24.51  ? 239  GLU A OE1   1 
ATOM   1712 O  OE2   . GLU A 1 239 ? 1.331   -13.521 20.909 1.00 27.20  ? 239  GLU A OE2   1 
ATOM   1713 N  N     . LEU A 1 240 ? -2.882  -17.837 22.435 1.00 20.59  ? 240  LEU A N     1 
ATOM   1714 C  CA    . LEU A 1 240 ? -4.331  -17.730 22.611 1.00 21.60  ? 240  LEU A CA    1 
ATOM   1715 C  C     . LEU A 1 240 ? -4.961  -16.366 22.227 1.00 22.72  ? 240  LEU A C     1 
ATOM   1716 O  O     . LEU A 1 240 ? -5.912  -16.313 21.395 1.00 20.78  ? 240  LEU A O     1 
ATOM   1717 C  CB    . LEU A 1 240 ? -4.672  -18.087 24.055 1.00 19.38  ? 240  LEU A CB    1 
ATOM   1718 C  CG    . LEU A 1 240 ? -6.212  -17.964 24.358 1.00 24.63  ? 240  LEU A CG    1 
ATOM   1719 C  CD1   . LEU A 1 240 ? -6.806  -19.361 24.306 1.00 18.96  ? 240  LEU A CD1   1 
ATOM   1720 C  CD2   . LEU A 1 240 ? -6.404  -17.494 25.745 1.00 27.80  ? 240  LEU A CD2   1 
ATOM   1721 N  N     . LEU A 1 241 ? -4.447  -15.275 22.827 1.00 22.38  ? 241  LEU A N     1 
ATOM   1722 C  CA    . LEU A 1 241 ? -5.109  -13.954 22.686 1.00 24.70  ? 241  LEU A CA    1 
ATOM   1723 C  C     . LEU A 1 241 ? -4.690  -13.246 21.417 1.00 25.07  ? 241  LEU A C     1 
ATOM   1724 O  O     . LEU A 1 241 ? -5.357  -12.324 20.956 1.00 25.31  ? 241  LEU A O     1 
ATOM   1725 C  CB    . LEU A 1 241 ? -4.903  -13.080 23.915 1.00 24.11  ? 241  LEU A CB    1 
ATOM   1726 C  CG    . LEU A 1 241 ? -5.640  -13.666 25.135 1.00 25.93  ? 241  LEU A CG    1 
ATOM   1727 C  CD1   . LEU A 1 241 ? -5.392  -12.811 26.441 1.00 23.40  ? 241  LEU A CD1   1 
ATOM   1728 C  CD2   . LEU A 1 241 ? -7.204  -13.743 24.905 1.00 20.24  ? 241  LEU A CD2   1 
ATOM   1729 N  N     . ALA A 1 242 ? -3.665  -13.767 20.760 1.00 23.81  ? 242  ALA A N     1 
ATOM   1730 C  CA    . ALA A 1 242 ? -3.344  -13.274 19.416 1.00 23.41  ? 242  ALA A CA    1 
ATOM   1731 C  C     . ALA A 1 242 ? -4.063  -14.098 18.318 1.00 22.14  ? 242  ALA A C     1 
ATOM   1732 O  O     . ALA A 1 242 ? -3.965  -13.717 17.186 1.00 23.15  ? 242  ALA A O     1 
ATOM   1733 C  CB    . ALA A 1 242 ? -1.822  -13.338 19.123 1.00 22.30  ? 242  ALA A CB    1 
ATOM   1734 N  N     . HIS A 1 243 ? -4.585  -15.277 18.620 1.00 21.15  ? 243  HIS A N     1 
ATOM   1735 C  CA    . HIS A 1 243 ? -5.297  -16.146 17.605 1.00 22.02  ? 243  HIS A CA    1 
ATOM   1736 C  C     . HIS A 1 243 ? -4.331  -16.667 16.573 1.00 22.66  ? 243  HIS A C     1 
ATOM   1737 O  O     . HIS A 1 243 ? -4.664  -16.670 15.360 1.00 22.96  ? 243  HIS A O     1 
ATOM   1738 C  CB    . HIS A 1 243 ? -6.484  -15.410 16.877 1.00 22.06  ? 243  HIS A CB    1 
ATOM   1739 C  CG    . HIS A 1 243 ? -7.333  -14.566 17.802 1.00 20.79  ? 243  HIS A CG    1 
ATOM   1740 N  ND1   . HIS A 1 243 ? -8.162  -13.557 17.349 1.00 26.93  ? 243  HIS A ND1   1 
ATOM   1741 C  CD2   . HIS A 1 243 ? -7.368  -14.486 19.162 1.00 25.20  ? 243  HIS A CD2   1 
ATOM   1742 C  CE1   . HIS A 1 243 ? -8.718  -12.931 18.385 1.00 25.76  ? 243  HIS A CE1   1 
ATOM   1743 N  NE2   . HIS A 1 243 ? -8.268  -13.482 19.497 1.00 25.72  ? 243  HIS A NE2   1 
ATOM   1744 N  N     . LYS A 1 244 ? -3.143  -17.108 17.050 1.00 20.52  ? 244  LYS A N     1 
ATOM   1745 C  CA    . LYS A 1 244 ? -2.098  -17.606 16.171 1.00 20.69  ? 244  LYS A CA    1 
ATOM   1746 C  C     . LYS A 1 244 ? -1.593  -18.932 16.644 1.00 19.25  ? 244  LYS A C     1 
ATOM   1747 O  O     . LYS A 1 244 ? -1.520  -19.195 17.845 1.00 20.34  ? 244  LYS A O     1 
ATOM   1748 C  CB    . LYS A 1 244 ? -0.898  -16.597 16.173 1.00 20.35  ? 244  LYS A CB    1 
ATOM   1749 C  CG    . LYS A 1 244 ? -1.330  -15.323 15.334 1.00 25.16  ? 244  LYS A CG    1 
ATOM   1750 C  CD    . LYS A 1 244 ? -0.283  -14.213 15.418 1.00 30.51  ? 244  LYS A CD    1 
ATOM   1751 C  CE    . LYS A 1 244 ? -0.618  -13.023 14.483 1.00 37.00  ? 244  LYS A CE    1 
ATOM   1752 N  NZ    . LYS A 1 244 ? 0.223   -11.991 15.109 1.00 42.90  ? 244  LYS A NZ    1 
ATOM   1753 N  N     . ILE A 1 245 ? -1.173  -19.732 15.701 1.00 19.04  ? 245  ILE A N     1 
ATOM   1754 C  CA    . ILE A 1 245 ? -0.301  -20.845 16.007 1.00 20.86  ? 245  ILE A CA    1 
ATOM   1755 C  C     . ILE A 1 245 ? 1.087   -20.584 15.294 1.00 22.98  ? 245  ILE A C     1 
ATOM   1756 O  O     . ILE A 1 245 ? 1.116   -20.303 14.097 1.00 23.16  ? 245  ILE A O     1 
ATOM   1757 C  CB    . ILE A 1 245 ? -0.942  -22.203 15.479 1.00 21.02  ? 245  ILE A CB    1 
ATOM   1758 C  CG1   . ILE A 1 245 ? -2.202  -22.522 16.351 1.00 19.42  ? 245  ILE A CG1   1 
ATOM   1759 C  CG2   . ILE A 1 245 ? 0.135   -23.343 15.582 1.00 15.48  ? 245  ILE A CG2   1 
ATOM   1760 C  CD1   . ILE A 1 245 ? -2.934  -23.746 15.982 1.00 19.27  ? 245  ILE A CD1   1 
ATOM   1761 N  N     . HIS A 1 246 ? 2.182   -20.713 16.043 1.00 21.65  ? 246  HIS A N     1 
ATOM   1762 C  CA    . HIS A 1 246 ? 3.544   -20.409 15.581 1.00 22.82  ? 246  HIS A CA    1 
ATOM   1763 C  C     . HIS A 1 246 ? 4.201   -21.744 15.333 1.00 23.15  ? 246  HIS A C     1 
ATOM   1764 O  O     . HIS A 1 246 ? 3.990   -22.699 16.093 1.00 23.72  ? 246  HIS A O     1 
ATOM   1765 C  CB    . HIS A 1 246 ? 4.304   -19.648 16.665 1.00 23.35  ? 246  HIS A CB    1 
ATOM   1766 C  CG    . HIS A 1 246 ? 3.714   -18.305 16.996 1.00 24.54  ? 246  HIS A CG    1 
ATOM   1767 N  ND1   . HIS A 1 246 ? 4.352   -17.113 16.689 1.00 25.48  ? 246  HIS A ND1   1 
ATOM   1768 C  CD2   . HIS A 1 246 ? 2.546   -17.964 17.601 1.00 22.20  ? 246  HIS A CD2   1 
ATOM   1769 C  CE1   . HIS A 1 246 ? 3.604   -16.096 17.095 1.00 29.03  ? 246  HIS A CE1   1 
ATOM   1770 N  NE2   . HIS A 1 246 ? 2.506   -16.579 17.664 1.00 25.45  ? 246  HIS A NE2   1 
ATOM   1771 N  N     . VAL A 1 247 ? 4.875   -21.873 14.204 1.00 21.56  ? 247  VAL A N     1 
ATOM   1772 C  CA    . VAL A 1 247 ? 5.508   -23.115 13.873 1.00 22.73  ? 247  VAL A CA    1 
ATOM   1773 C  C     . VAL A 1 247 ? 7.006   -22.693 13.964 1.00 24.64  ? 247  VAL A C     1 
ATOM   1774 O  O     . VAL A 1 247 ? 7.389   -21.712 13.381 1.00 24.56  ? 247  VAL A O     1 
ATOM   1775 C  CB    . VAL A 1 247 ? 5.219   -23.521 12.430 1.00 23.39  ? 247  VAL A CB    1 
ATOM   1776 C  CG1   . VAL A 1 247 ? 6.030   -24.764 12.031 1.00 20.89  ? 247  VAL A CG1   1 
ATOM   1777 C  CG2   . VAL A 1 247 ? 3.656   -23.745 12.164 1.00 21.49  ? 247  VAL A CG2   1 
ATOM   1778 N  N     . TYR A 1 248 ? 7.801   -23.467 14.668 1.00 23.64  ? 248  TYR A N     1 
ATOM   1779 C  CA    . TYR A 1 248 ? 9.207   -23.272 14.805 1.00 25.51  ? 248  TYR A CA    1 
ATOM   1780 C  C     . TYR A 1 248 ? 9.892   -24.544 14.316 1.00 26.95  ? 248  TYR A C     1 
ATOM   1781 O  O     . TYR A 1 248 ? 9.460   -25.664 14.648 1.00 26.84  ? 248  TYR A O     1 
ATOM   1782 C  CB    . TYR A 1 248 ? 9.552   -23.171 16.288 1.00 22.38  ? 248  TYR A CB    1 
ATOM   1783 C  CG    . TYR A 1 248 ? 9.220   -21.829 16.843 1.00 26.19  ? 248  TYR A CG    1 
ATOM   1784 C  CD1   . TYR A 1 248 ? 10.227  -20.881 17.044 1.00 25.16  ? 248  TYR A CD1   1 
ATOM   1785 C  CD2   . TYR A 1 248 ? 7.896   -21.461 17.154 1.00 29.58  ? 248  TYR A CD2   1 
ATOM   1786 C  CE1   . TYR A 1 248 ? 9.943   -19.623 17.551 1.00 27.29  ? 248  TYR A CE1   1 
ATOM   1787 C  CE2   . TYR A 1 248 ? 7.611   -20.169 17.648 1.00 26.33  ? 248  TYR A CE2   1 
ATOM   1788 C  CZ    . TYR A 1 248 ? 8.647   -19.269 17.852 1.00 31.62  ? 248  TYR A CZ    1 
ATOM   1789 O  OH    . TYR A 1 248 ? 8.428   -17.922 18.266 1.00 36.24  ? 248  TYR A OH    1 
ATOM   1790 N  N     . GLU A 1 249 ? 11.052  -24.363 13.691 1.00 26.40  ? 249  GLU A N     1 
ATOM   1791 C  CA    . GLU A 1 249 ? 11.960  -25.500 13.514 1.00 26.89  ? 249  GLU A CA    1 
ATOM   1792 C  C     . GLU A 1 249 ? 12.613  -25.817 14.808 1.00 24.33  ? 249  GLU A C     1 
ATOM   1793 O  O     . GLU A 1 249 ? 13.025  -24.892 15.510 1.00 21.41  ? 249  GLU A O     1 
ATOM   1794 C  CB    . GLU A 1 249 ? 13.051  -25.154 12.504 1.00 28.01  ? 249  GLU A CB    1 
ATOM   1795 C  CG    . GLU A 1 249 ? 12.484  -25.075 11.086 1.00 37.51  ? 249  GLU A CG    1 
ATOM   1796 C  CD    . GLU A 1 249 ? 13.594  -24.850 9.977  1.00 51.88  ? 249  GLU A CD    1 
ATOM   1797 O  OE1   . GLU A 1 249 ? 14.754  -24.380 10.275 1.00 52.23  ? 249  GLU A OE1   1 
ATOM   1798 O  OE2   . GLU A 1 249 ? 13.265  -25.172 8.791  1.00 56.78  ? 249  GLU A OE2   1 
ATOM   1799 N  N     . LYS A 1 250 ? 12.739  -27.117 15.109 1.00 23.51  ? 250  LYS A N     1 
ATOM   1800 C  CA    . LYS A 1 250 ? 13.355  -27.519 16.323 1.00 24.12  ? 250  LYS A CA    1 
ATOM   1801 C  C     . LYS A 1 250 ? 14.669  -28.191 15.906 1.00 26.77  ? 250  LYS A C     1 
ATOM   1802 O  O     . LYS A 1 250 ? 14.655  -29.158 15.111 1.00 25.54  ? 250  LYS A O     1 
ATOM   1803 C  CB    . LYS A 1 250 ? 12.543  -28.602 17.017 1.00 22.91  ? 250  LYS A CB    1 
ATOM   1804 C  CG    . LYS A 1 250 ? 13.217  -29.217 18.195 1.00 23.36  ? 250  LYS A CG    1 
ATOM   1805 C  CD    . LYS A 1 250 ? 12.225  -29.967 19.090 1.00 26.74  ? 250  LYS A CD    1 
ATOM   1806 C  CE    . LYS A 1 250 ? 12.813  -31.168 19.803 1.00 28.64  ? 250  LYS A CE    1 
ATOM   1807 N  NZ    . LYS A 1 250 ? 13.289  -32.292 18.868 1.00 26.66  ? 250  LYS A NZ    1 
ATOM   1808 N  N     . HIS A 1 251 ? 15.743  -27.805 16.571 1.00 26.01  ? 251  HIS A N     1 
ATOM   1809 C  CA    . HIS A 1 251 ? 17.115  -28.219 16.126 1.00 27.95  ? 251  HIS A CA    1 
ATOM   1810 C  C     . HIS A 1 251 ? 17.656  -29.259 17.043 1.00 28.20  ? 251  HIS A C     1 
ATOM   1811 O  O     . HIS A 1 251 ? 17.149  -29.427 18.173 1.00 28.50  ? 251  HIS A O     1 
ATOM   1812 C  CB    . HIS A 1 251 ? 18.039  -27.005 16.055 1.00 24.52  ? 251  HIS A CB    1 
ATOM   1813 C  CG    . HIS A 1 251 ? 17.535  -25.987 15.106 1.00 25.03  ? 251  HIS A CG    1 
ATOM   1814 N  ND1   . HIS A 1 251 ? 17.543  -26.182 13.751 1.00 29.29  ? 251  HIS A ND1   1 
ATOM   1815 C  CD2   . HIS A 1 251 ? 16.932  -24.793 15.308 1.00 25.23  ? 251  HIS A CD2   1 
ATOM   1816 C  CE1   . HIS A 1 251 ? 17.007  -25.139 13.135 1.00 26.00  ? 251  HIS A CE1   1 
ATOM   1817 N  NE2   . HIS A 1 251 ? 16.620  -24.281 14.061 1.00 27.53  ? 251  HIS A NE2   1 
ATOM   1818 N  N     . ALA A 1 252 ? 18.678  -29.993 16.581 1.00 29.30  ? 252  ALA A N     1 
ATOM   1819 C  CA    . ALA A 1 252 ? 19.299  -31.021 17.472 1.00 29.81  ? 252  ALA A CA    1 
ATOM   1820 C  C     . ALA A 1 252 ? 19.834  -30.453 18.798 1.00 30.15  ? 252  ALA A C     1 
ATOM   1821 O  O     . ALA A 1 252 ? 19.990  -31.217 19.795 1.00 32.38  ? 252  ALA A O     1 
ATOM   1822 C  CB    . ALA A 1 252 ? 20.468  -31.822 16.694 1.00 30.54  ? 252  ALA A CB    1 
ATOM   1823 N  N     . ASN A 1 253 ? 20.159  -29.151 18.860 1.00 28.49  ? 253  ASN A N     1 
ATOM   1824 C  CA    . ASN A 1 253 ? 20.619  -28.623 20.169 1.00 30.33  ? 253  ASN A CA    1 
ATOM   1825 C  C     . ASN A 1 253 ? 19.465  -28.059 20.992 1.00 29.20  ? 253  ASN A C     1 
ATOM   1826 O  O     . ASN A 1 253 ? 19.688  -27.289 21.921 1.00 28.87  ? 253  ASN A O     1 
ATOM   1827 C  CB    . ASN A 1 253 ? 21.736  -27.528 20.012 1.00 28.61  ? 253  ASN A CB    1 
ATOM   1828 C  CG    . ASN A 1 253 ? 21.248  -26.262 19.288 1.00 32.98  ? 253  ASN A CG    1 
ATOM   1829 O  OD1   . ASN A 1 253 ? 20.034  -26.103 18.970 1.00 32.79  ? 253  ASN A OD1   1 
ATOM   1830 N  ND2   . ASN A 1 253 ? 22.187  -25.282 19.112 1.00 23.96  ? 253  ASN A ND2   1 
ATOM   1831 N  N     . TRP A 1 254 ? 18.218  -28.358 20.562 1.00 29.28  ? 254  TRP A N     1 
ATOM   1832 C  CA    . TRP A 1 254 ? 16.974  -27.982 21.304 1.00 27.66  ? 254  TRP A CA    1 
ATOM   1833 C  C     . TRP A 1 254 ? 16.557  -26.581 21.141 1.00 28.43  ? 254  TRP A C     1 
ATOM   1834 O  O     . TRP A 1 254 ? 15.513  -26.238 21.663 1.00 29.37  ? 254  TRP A O     1 
ATOM   1835 C  CB    . TRP A 1 254 ? 17.004  -28.316 22.789 1.00 27.92  ? 254  TRP A CB    1 
ATOM   1836 C  CG    . TRP A 1 254 ? 17.452  -29.774 22.999 1.00 29.98  ? 254  TRP A CG    1 
ATOM   1837 C  CD1   . TRP A 1 254 ? 18.702  -30.208 23.425 1.00 32.29  ? 254  TRP A CD1   1 
ATOM   1838 C  CD2   . TRP A 1 254 ? 16.654  -30.966 22.831 1.00 32.42  ? 254  TRP A CD2   1 
ATOM   1839 N  NE1   . TRP A 1 254 ? 18.743  -31.578 23.458 1.00 35.82  ? 254  TRP A NE1   1 
ATOM   1840 C  CE2   . TRP A 1 254 ? 17.500  -32.082 23.144 1.00 34.31  ? 254  TRP A CE2   1 
ATOM   1841 C  CE3   . TRP A 1 254 ? 15.313  -31.202 22.464 1.00 30.88  ? 254  TRP A CE3   1 
ATOM   1842 C  CZ2   . TRP A 1 254 ? 17.063  -33.417 23.044 1.00 35.69  ? 254  TRP A CZ2   1 
ATOM   1843 C  CZ3   . TRP A 1 254 ? 14.850  -32.551 22.393 1.00 28.53  ? 254  TRP A CZ3   1 
ATOM   1844 C  CH2   . TRP A 1 254 ? 15.723  -33.640 22.665 1.00 32.75  ? 254  TRP A CH2   1 
ATOM   1845 N  N     . THR A 1 255 ? 17.284  -25.766 20.369 1.00 26.94  ? 255  THR A N     1 
ATOM   1846 C  CA    . THR A 1 255 ? 16.794  -24.444 20.096 1.00 26.19  ? 255  THR A CA    1 
ATOM   1847 C  C     . THR A 1 255 ? 15.647  -24.465 19.086 1.00 24.96  ? 255  THR A C     1 
ATOM   1848 O  O     . THR A 1 255 ? 15.461  -25.413 18.327 1.00 24.28  ? 255  THR A O     1 
ATOM   1849 C  CB    . THR A 1 255 ? 17.923  -23.468 19.559 1.00 28.38  ? 255  THR A CB    1 
ATOM   1850 O  OG1   . THR A 1 255 ? 18.506  -23.965 18.343 1.00 26.52  ? 255  THR A OG1   1 
ATOM   1851 C  CG2   . THR A 1 255 ? 19.040  -23.258 20.649 1.00 28.26  ? 255  THR A CG2   1 
ATOM   1852 N  N     . LEU A 1 256 ? 14.947  -23.356 19.007 1.00 24.91  ? 256  LEU A N     1 
ATOM   1853 C  CA    . LEU A 1 256 ? 13.856  -23.225 18.096 1.00 26.17  ? 256  LEU A CA    1 
ATOM   1854 C  C     . LEU A 1 256 ? 14.110  -22.010 17.265 1.00 26.33  ? 256  LEU A C     1 
ATOM   1855 O  O     . LEU A 1 256 ? 14.528  -21.005 17.797 1.00 26.66  ? 256  LEU A O     1 
ATOM   1856 C  CB    . LEU A 1 256 ? 12.570  -22.954 18.893 1.00 23.74  ? 256  LEU A CB    1 
ATOM   1857 C  CG    . LEU A 1 256 ? 12.164  -23.999 19.932 1.00 26.18  ? 256  LEU A CG    1 
ATOM   1858 C  CD1   . LEU A 1 256 ? 10.694  -23.671 20.482 1.00 22.96  ? 256  LEU A CD1   1 
ATOM   1859 C  CD2   . LEU A 1 256 ? 12.170  -25.432 19.303 1.00 17.19  ? 256  LEU A CD2   1 
ATOM   1860 N  N     . THR A 1 257 ? 13.760  -22.066 15.993 1.00 26.98  ? 257  THR A N     1 
ATOM   1861 C  CA    . THR A 1 257 ? 13.793  -20.851 15.237 1.00 29.44  ? 257  THR A CA    1 
ATOM   1862 C  C     . THR A 1 257 ? 12.452  -20.685 14.529 1.00 29.21  ? 257  THR A C     1 
ATOM   1863 O  O     . THR A 1 257 ? 11.901  -21.618 14.050 1.00 29.82  ? 257  THR A O     1 
ATOM   1864 C  CB    . THR A 1 257 ? 14.970  -20.873 14.174 1.00 27.57  ? 257  THR A CB    1 
ATOM   1865 O  OG1   . THR A 1 257 ? 14.849  -22.072 13.439 1.00 34.49  ? 257  THR A OG1   1 
ATOM   1866 C  CG2   . THR A 1 257 ? 16.345  -21.015 14.921 1.00 31.13  ? 257  THR A CG2   1 
ATOM   1867 N  N     . PRO A 1 258 ? 11.988  -19.451 14.419 1.00 32.08  ? 258  PRO A N     1 
ATOM   1868 C  CA    . PRO A 1 258 ? 10.698  -19.137 13.775 1.00 32.61  ? 258  PRO A CA    1 
ATOM   1869 C  C     . PRO A 1 258 ? 10.669  -19.542 12.324 1.00 33.93  ? 258  PRO A C     1 
ATOM   1870 O  O     . PRO A 1 258 ? 11.596  -19.260 11.582 1.00 35.10  ? 258  PRO A O     1 
ATOM   1871 C  CB    . PRO A 1 258 ? 10.503  -17.620 13.990 1.00 32.33  ? 258  PRO A CB    1 
ATOM   1872 C  CG    . PRO A 1 258 ? 11.889  -17.081 14.458 1.00 33.60  ? 258  PRO A CG    1 
ATOM   1873 C  CD    . PRO A 1 258 ? 12.706  -18.263 15.003 1.00 29.72  ? 258  PRO A CD    1 
ATOM   1874 N  N     . LEU A 1 259 ? 9.589   -20.226 11.928 1.00 33.11  ? 259  LEU A N     1 
ATOM   1875 C  CA    . LEU A 1 259 ? 9.416   -20.685 10.599 1.00 32.46  ? 259  LEU A CA    1 
ATOM   1876 C  C     . LEU A 1 259 ? 8.150   -20.054 9.995  1.00 32.92  ? 259  LEU A C     1 
ATOM   1877 O  O     . LEU A 1 259 ? 8.234   -19.413 8.961  1.00 32.15  ? 259  LEU A O     1 
ATOM   1878 C  CB    . LEU A 1 259 ? 9.377   -22.197 10.555 1.00 33.40  ? 259  LEU A CB    1 
ATOM   1879 C  CG    . LEU A 1 259 ? 9.072   -22.781 9.163  1.00 37.83  ? 259  LEU A CG    1 
ATOM   1880 C  CD1   . LEU A 1 259 ? 10.078  -22.296 8.142  1.00 45.91  ? 259  LEU A CD1   1 
ATOM   1881 C  CD2   . LEU A 1 259 ? 9.090   -24.297 9.150  1.00 41.68  ? 259  LEU A CD2   1 
ATOM   1882 N  N     . ARG A 1 260 ? 6.983   -20.201 10.631 1.00 30.82  ? 260  ARG A N     1 
ATOM   1883 C  CA    . ARG A 1 260 ? 5.843   -19.484 10.139 1.00 30.78  ? 260  ARG A CA    1 
ATOM   1884 C  C     . ARG A 1 260 ? 4.787   -19.265 11.186 1.00 29.01  ? 260  ARG A C     1 
ATOM   1885 O  O     . ARG A 1 260 ? 4.848   -19.837 12.261 1.00 27.84  ? 260  ARG A O     1 
ATOM   1886 C  CB    . ARG A 1 260 ? 5.241   -20.247 8.948  1.00 34.23  ? 260  ARG A CB    1 
ATOM   1887 C  CG    . ARG A 1 260 ? 4.497   -21.469 9.296  1.00 38.06  ? 260  ARG A CG    1 
ATOM   1888 C  CD    . ARG A 1 260 ? 4.287   -22.296 8.057  1.00 50.70  ? 260  ARG A CD    1 
ATOM   1889 N  NE    . ARG A 1 260 ? 3.667   -21.529 6.960  1.00 55.49  ? 260  ARG A NE    1 
ATOM   1890 C  CZ    . ARG A 1 260 ? 3.067   -22.078 5.908  1.00 52.36  ? 260  ARG A CZ    1 
ATOM   1891 N  NH1   . ARG A 1 260 ? 2.987   -23.389 5.830  1.00 50.20  ? 260  ARG A NH1   1 
ATOM   1892 N  NH2   . ARG A 1 260 ? 2.558   -21.312 4.932  1.00 54.80  ? 260  ARG A NH2   1 
ATOM   1893 N  N     . VAL A 1 261 ? 3.803   -18.455 10.862 1.00 28.34  ? 261  VAL A N     1 
ATOM   1894 C  CA    . VAL A 1 261 ? 2.731   -18.133 11.795 1.00 29.13  ? 261  VAL A CA    1 
ATOM   1895 C  C     . VAL A 1 261 ? 1.433   -18.236 11.018 1.00 30.15  ? 261  VAL A C     1 
ATOM   1896 O  O     . VAL A 1 261 ? 1.267   -17.559 9.986  1.00 28.80  ? 261  VAL A O     1 
ATOM   1897 C  CB    . VAL A 1 261 ? 2.877   -16.697 12.414 1.00 30.08  ? 261  VAL A CB    1 
ATOM   1898 C  CG1   . VAL A 1 261 ? 1.847   -16.491 13.495 1.00 32.79  ? 261  VAL A CG1   1 
ATOM   1899 C  CG2   . VAL A 1 261 ? 4.396   -16.446 12.967 1.00 30.16  ? 261  VAL A CG2   1 
ATOM   1900 N  N     . LEU A 1 262 ? 0.491   -19.008 11.561 1.00 28.74  ? 262  LEU A N     1 
ATOM   1901 C  CA    . LEU A 1 262 ? -0.905  -19.046 11.060 1.00 29.78  ? 262  LEU A CA    1 
ATOM   1902 C  C     . LEU A 1 262 ? -1.785  -18.220 11.954 1.00 29.42  ? 262  LEU A C     1 
ATOM   1903 O  O     . LEU A 1 262 ? -1.668  -18.311 13.190 1.00 29.53  ? 262  LEU A O     1 
ATOM   1904 C  CB    . LEU A 1 262 ? -1.424  -20.493 11.043 1.00 27.51  ? 262  LEU A CB    1 
ATOM   1905 C  CG    . LEU A 1 262 ? -0.817  -21.467 9.976  1.00 33.65  ? 262  LEU A CG    1 
ATOM   1906 C  CD1   . LEU A 1 262 ? 0.717   -21.686 10.035 1.00 31.36  ? 262  LEU A CD1   1 
ATOM   1907 C  CD2   . LEU A 1 262 ? -1.520  -22.877 9.931  1.00 29.34  ? 262  LEU A CD2   1 
ATOM   1908 N  N     . SER A 1 263 ? -2.700  -17.474 11.334 1.00 28.04  ? 263  SER A N     1 
ATOM   1909 C  CA    . SER A 1 263 ? -3.748  -16.686 12.005 1.00 29.15  ? 263  SER A CA    1 
ATOM   1910 C  C     . SER A 1 263 ? -5.145  -17.302 11.874 1.00 28.85  ? 263  SER A C     1 
ATOM   1911 O  O     . SER A 1 263 ? -5.466  -17.915 10.859 1.00 29.19  ? 263  SER A O     1 
ATOM   1912 C  CB    . SER A 1 263 ? -3.808  -15.266 11.365 1.00 29.96  ? 263  SER A CB    1 
ATOM   1913 O  OG    . SER A 1 263 ? -2.483  -14.731 11.449 1.00 35.28  ? 263  SER A OG    1 
ATOM   1914 N  N     . PHE A 1 264 ? -5.985  -17.081 12.880 1.00 26.76  ? 264  PHE A N     1 
ATOM   1915 C  CA    . PHE A 1 264 ? -7.285  -17.739 12.916 1.00 26.68  ? 264  PHE A CA    1 
ATOM   1916 C  C     . PHE A 1 264 ? -8.292  -16.706 13.386 1.00 27.60  ? 264  PHE A C     1 
ATOM   1917 O  O     . PHE A 1 264 ? -7.906  -15.690 13.972 1.00 26.40  ? 264  PHE A O     1 
ATOM   1918 C  CB    . PHE A 1 264 ? -7.250  -18.932 13.920 1.00 24.82  ? 264  PHE A CB    1 
ATOM   1919 C  CG    . PHE A 1 264 ? -6.276  -19.993 13.499 1.00 24.95  ? 264  PHE A CG    1 
ATOM   1920 C  CD1   . PHE A 1 264 ? -6.667  -20.935 12.551 1.00 25.58  ? 264  PHE A CD1   1 
ATOM   1921 C  CD2   . PHE A 1 264 ? -4.943  -19.943 13.900 1.00 22.54  ? 264  PHE A CD2   1 
ATOM   1922 C  CE1   . PHE A 1 264 ? -5.848  -21.863 12.088 1.00 24.22  ? 264  PHE A CE1   1 
ATOM   1923 C  CE2   . PHE A 1 264 ? -4.082  -20.952 13.476 1.00 27.29  ? 264  PHE A CE2   1 
ATOM   1924 C  CZ    . PHE A 1 264 ? -4.524  -21.904 12.540 1.00 28.27  ? 264  PHE A CZ    1 
ATOM   1925 N  N     . ASP A 1 265 ? -9.579  -16.988 13.190 1.00 28.13  ? 265  ASP A N     1 
ATOM   1926 C  CA    . ASP A 1 265 ? -10.609 -16.120 13.811 1.00 29.95  ? 265  ASP A CA    1 
ATOM   1927 C  C     . ASP A 1 265 ? -11.092 -16.670 15.133 1.00 28.96  ? 265  ASP A C     1 
ATOM   1928 O  O     . ASP A 1 265 ? -12.239 -16.519 15.468 1.00 32.40  ? 265  ASP A O     1 
ATOM   1929 C  CB    . ASP A 1 265 ? -11.822 -15.982 12.835 1.00 33.06  ? 265  ASP A CB    1 
ATOM   1930 C  CG    . ASP A 1 265 ? -12.862 -14.878 13.306 1.00 36.64  ? 265  ASP A CG    1 
ATOM   1931 N  N     . THR A 1 266 ? -10.271 -17.403 15.864 1.00 26.55  ? 266  THR A N     1 
ATOM   1932 C  CA    . THR A 1 266 ? -10.696 -18.032 17.093 1.00 23.63  ? 266  THR A CA    1 
ATOM   1933 C  C     . THR A 1 266 ? -9.528  -18.031 18.102 1.00 22.76  ? 266  THR A C     1 
ATOM   1934 O  O     . THR A 1 266 ? -8.373  -17.887 17.700 1.00 21.86  ? 266  THR A O     1 
ATOM   1935 C  CB    . THR A 1 266 ? -11.165 -19.453 16.737 1.00 24.22  ? 266  THR A CB    1 
ATOM   1936 O  OG1   . THR A 1 266 ? -11.916 -19.981 17.805 1.00 25.87  ? 266  THR A OG1   1 
ATOM   1937 C  CG2   . THR A 1 266 ? -9.995  -20.413 16.329 1.00 23.05  ? 266  THR A CG2   1 
ATOM   1938 N  N     . LEU A 1 267 ? -9.826  -18.169 19.395 1.00 21.54  ? 267  LEU A N     1 
ATOM   1939 C  CA    . LEU A 1 267 ? -8.785  -18.190 20.409 1.00 23.25  ? 267  LEU A CA    1 
ATOM   1940 C  C     . LEU A 1 267 ? -8.291  -19.645 20.482 1.00 22.22  ? 267  LEU A C     1 
ATOM   1941 O  O     . LEU A 1 267 ? -8.987  -20.477 21.052 1.00 26.24  ? 267  LEU A O     1 
ATOM   1942 C  CB    . LEU A 1 267 ? -9.315  -17.762 21.812 1.00 18.49  ? 267  LEU A CB    1 
ATOM   1943 C  CG    . LEU A 1 267 ? -9.420  -16.239 22.188 1.00 22.37  ? 267  LEU A CG    1 
ATOM   1944 C  CD1   . LEU A 1 267 ? -10.473 -15.554 21.318 1.00 24.46  ? 267  LEU A CD1   1 
ATOM   1945 C  CD2   . LEU A 1 267 ? -9.913  -16.044 23.702 1.00 22.02  ? 267  LEU A CD2   1 
ATOM   1946 N  N     . VAL A 1 268 ? -7.088  -19.922 20.033 1.00 22.13  ? 268  VAL A N     1 
ATOM   1947 C  CA    . VAL A 1 268 ? -6.539  -21.314 19.989 1.00 20.74  ? 268  VAL A CA    1 
ATOM   1948 C  C     . VAL A 1 268 ? -6.012  -21.722 21.371 1.00 21.55  ? 268  VAL A C     1 
ATOM   1949 O  O     . VAL A 1 268 ? -5.311  -20.948 22.032 1.00 22.76  ? 268  VAL A O     1 
ATOM   1950 C  CB    . VAL A 1 268 ? -5.457  -21.435 18.906 1.00 20.82  ? 268  VAL A CB    1 
ATOM   1951 C  CG1   . VAL A 1 268 ? -6.079  -21.410 17.477 1.00 20.77  ? 268  VAL A CG1   1 
ATOM   1952 C  CG2   . VAL A 1 268 ? -4.375  -20.269 18.998 1.00 21.02  ? 268  VAL A CG2   1 
ATOM   1953 N  N     . ASP A 1 269 ? -6.331  -22.915 21.826 1.00 19.44  ? 269  ASP A N     1 
ATOM   1954 C  CA    . ASP A 1 269 ? -5.969  -23.320 23.188 1.00 19.27  ? 269  ASP A CA    1 
ATOM   1955 C  C     . ASP A 1 269 ? -4.930  -24.475 23.092 1.00 20.63  ? 269  ASP A C     1 
ATOM   1956 O  O     . ASP A 1 269 ? -3.789  -24.181 22.781 1.00 19.25  ? 269  ASP A O     1 
ATOM   1957 C  CB    . ASP A 1 269 ? -7.216  -23.598 24.037 1.00 18.49  ? 269  ASP A CB    1 
ATOM   1958 C  CG    . ASP A 1 269 ? -6.933  -23.538 25.565 1.00 23.57  ? 269  ASP A CG    1 
ATOM   1959 O  OD1   . ASP A 1 269 ? -7.715  -22.900 26.328 1.00 26.30  ? 269  ASP A OD1   1 
ATOM   1960 O  OD2   . ASP A 1 269 ? -5.905  -24.104 26.027 1.00 20.24  ? 269  ASP A OD2   1 
ATOM   1961 N  N     . ASN A 1 270 ? -5.311  -25.756 23.225 1.00 18.67  ? 270  ASN A N     1 
ATOM   1962 C  CA    . ASN A 1 270 ? -4.314  -26.786 23.126 1.00 18.55  ? 270  ASN A CA    1 
ATOM   1963 C  C     . ASN A 1 270 ? -4.229  -27.413 21.739 1.00 19.14  ? 270  ASN A C     1 
ATOM   1964 O  O     . ASN A 1 270 ? -5.245  -27.460 21.007 1.00 21.24  ? 270  ASN A O     1 
ATOM   1965 C  CB    . ASN A 1 270 ? -4.567  -27.894 24.212 1.00 17.31  ? 270  ASN A CB    1 
ATOM   1966 C  CG    . ASN A 1 270 ? -4.520  -27.321 25.631 1.00 20.66  ? 270  ASN A CG    1 
ATOM   1967 O  OD1   . ASN A 1 270 ? -3.932  -26.215 25.883 1.00 18.90  ? 270  ASN A OD1   1 
ATOM   1968 N  ND2   . ASN A 1 270 ? -5.168  -28.009 26.553 1.00 18.64  ? 270  ASN A ND2   1 
ATOM   1969 N  N     . ILE A 1 271 ? -3.030  -27.869 21.391 1.00 17.43  ? 271  ILE A N     1 
ATOM   1970 C  CA    . ILE A 1 271 ? -2.702  -28.504 20.150 1.00 16.17  ? 271  ILE A CA    1 
ATOM   1971 C  C     . ILE A 1 271 ? -2.374  -29.936 20.374 1.00 17.57  ? 271  ILE A C     1 
ATOM   1972 O  O     . ILE A 1 271 ? -1.524  -30.278 21.251 1.00 17.52  ? 271  ILE A O     1 
ATOM   1973 C  CB    . ILE A 1 271 ? -1.453  -27.828 19.525 1.00 16.81  ? 271  ILE A CB    1 
ATOM   1974 C  CG1   . ILE A 1 271 ? -1.702  -26.307 19.354 1.00 14.70  ? 271  ILE A CG1   1 
ATOM   1975 C  CG2   . ILE A 1 271 ? -0.992  -28.533 18.233 1.00 14.73  ? 271  ILE A CG2   1 
ATOM   1976 C  CD1   . ILE A 1 271 ? -0.309  -25.560 18.965 1.00 19.69  ? 271  ILE A CD1   1 
ATOM   1977 N  N     . SER A 1 272 ? -3.094  -30.797 19.645 1.00 16.70  ? 272  SER A N     1 
ATOM   1978 C  CA    . SER A 1 272 ? -2.791  -32.216 19.579 1.00 17.90  ? 272  SER A CA    1 
ATOM   1979 C  C     . SER A 1 272 ? -2.240  -32.507 18.201 1.00 17.67  ? 272  SER A C     1 
ATOM   1980 O  O     . SER A 1 272 ? -2.569  -31.812 17.215 1.00 19.03  ? 272  SER A O     1 
ATOM   1981 C  CB    . SER A 1 272 ? -4.082  -33.091 19.806 1.00 19.04  ? 272  SER A CB    1 
ATOM   1982 O  OG    . SER A 1 272 ? -4.615  -32.834 21.118 1.00 19.94  ? 272  SER A OG    1 
ATOM   1983 N  N     . VAL A 1 273 ? -1.398  -33.519 18.114 1.00 18.48  ? 273  VAL A N     1 
ATOM   1984 C  CA    . VAL A 1 273 ? -0.743  -33.803 16.842 1.00 20.90  ? 273  VAL A CA    1 
ATOM   1985 C  C     . VAL A 1 273 ? -1.016  -35.296 16.551 1.00 22.36  ? 273  VAL A C     1 
ATOM   1986 O  O     . VAL A 1 273 ? -0.786  -36.163 17.392 1.00 20.96  ? 273  VAL A O     1 
ATOM   1987 C  CB    . VAL A 1 273 ? 0.780   -33.552 16.873 1.00 20.95  ? 273  VAL A CB    1 
ATOM   1988 C  CG1   . VAL A 1 273 ? 1.484   -34.074 15.598 1.00 22.56  ? 273  VAL A CG1   1 
ATOM   1989 C  CG2   . VAL A 1 273 ? 1.029   -32.054 17.069 1.00 19.84  ? 273  VAL A CG2   1 
ATOM   1990 N  N     . ASP A 1 274 ? -1.550  -35.559 15.363 1.00 23.82  ? 274  ASP A N     1 
ATOM   1991 C  CA    . ASP A 1 274 ? -1.852  -36.949 15.017 1.00 24.66  ? 274  ASP A CA    1 
ATOM   1992 C  C     . ASP A 1 274 ? -0.562  -37.655 14.573 1.00 24.35  ? 274  ASP A C     1 
ATOM   1993 O  O     . ASP A 1 274 ? 0.071   -37.210 13.628 1.00 24.28  ? 274  ASP A O     1 
ATOM   1994 C  CB    . ASP A 1 274 ? -2.918  -36.984 13.870 1.00 23.92  ? 274  ASP A CB    1 
ATOM   1995 C  CG    . ASP A 1 274 ? -3.059  -38.419 13.307 1.00 27.51  ? 274  ASP A CG    1 
ATOM   1996 O  OD1   . ASP A 1 274 ? -3.478  -39.302 14.099 1.00 32.53  ? 274  ASP A OD1   1 
ATOM   1997 O  OD2   . ASP A 1 274 ? -2.633  -38.649 12.173 1.00 30.73  ? 274  ASP A OD2   1 
ATOM   1998 N  N     . PRO A 1 275 ? -0.168  -38.753 15.233 1.00 25.66  ? 275  PRO A N     1 
ATOM   1999 C  CA    . PRO A 1 275 ? 1.191   -39.225 14.949 1.00 27.11  ? 275  PRO A CA    1 
ATOM   2000 C  C     . PRO A 1 275 ? 1.294   -39.860 13.581 1.00 30.13  ? 275  PRO A C     1 
ATOM   2001 O  O     . PRO A 1 275 ? 2.383   -39.961 13.048 1.00 32.68  ? 275  PRO A O     1 
ATOM   2002 C  CB    . PRO A 1 275 ? 1.476   -40.314 16.019 1.00 26.15  ? 275  PRO A CB    1 
ATOM   2003 C  CG    . PRO A 1 275 ? 0.128   -40.640 16.589 1.00 28.83  ? 275  PRO A CG    1 
ATOM   2004 C  CD    . PRO A 1 275 ? -0.785  -39.431 16.390 1.00 25.72  ? 275  PRO A CD    1 
ATOM   2005 N  N     . VAL A 1 276 ? 0.188   -40.263 12.971 1.00 32.04  ? 276  VAL A N     1 
ATOM   2006 C  CA    . VAL A 1 276 ? 0.329   -40.821 11.608 1.00 33.17  ? 276  VAL A CA    1 
ATOM   2007 C  C     . VAL A 1 276 ? 0.469   -39.795 10.531 1.00 33.16  ? 276  VAL A C     1 
ATOM   2008 O  O     . VAL A 1 276 ? 1.255   -39.972 9.584  1.00 33.97  ? 276  VAL A O     1 
ATOM   2009 C  CB    . VAL A 1 276 ? -0.887  -41.670 11.240 1.00 34.67  ? 276  VAL A CB    1 
ATOM   2010 C  CG1   . VAL A 1 276 ? -0.672  -42.240 9.850  1.00 35.32  ? 276  VAL A CG1   1 
ATOM   2011 C  CG2   . VAL A 1 276 ? -1.078  -42.745 12.324 1.00 30.99  ? 276  VAL A CG2   1 
ATOM   2012 N  N     . THR A 1 277 ? -0.324  -38.726 10.599 1.00 31.43  ? 277  THR A N     1 
ATOM   2013 C  CA    . THR A 1 277 ? -0.254  -37.717 9.493  1.00 28.88  ? 277  THR A CA    1 
ATOM   2014 C  C     . THR A 1 277 ? 0.566   -36.498 9.911  1.00 27.52  ? 277  THR A C     1 
ATOM   2015 O  O     . THR A 1 277 ? 0.913   -35.684 9.058  1.00 26.74  ? 277  THR A O     1 
ATOM   2016 C  CB    . THR A 1 277 ? -1.647  -37.159 9.194  1.00 29.17  ? 277  THR A CB    1 
ATOM   2017 O  OG1   . THR A 1 277 ? -2.212  -36.706 10.436 1.00 28.88  ? 277  THR A OG1   1 
ATOM   2018 C  CG2   . THR A 1 277 ? -2.612  -38.237 8.562  1.00 28.96  ? 277  THR A CG2   1 
ATOM   2019 N  N     . GLY A 1 278 ? 0.757   -36.293 11.234 1.00 25.78  ? 278  GLY A N     1 
ATOM   2020 C  CA    . GLY A 1 278 ? 1.286   -35.003 11.699 1.00 24.11  ? 278  GLY A CA    1 
ATOM   2021 C  C     . GLY A 1 278 ? 0.273   -33.852 11.656 1.00 23.97  ? 278  GLY A C     1 
ATOM   2022 O  O     . GLY A 1 278 ? 0.660   -32.705 11.874 1.00 24.03  ? 278  GLY A O     1 
ATOM   2023 N  N     . ASP A 1 279 ? -1.007  -34.123 11.350 1.00 19.95  ? 279  ASP A N     1 
ATOM   2024 C  CA    . ASP A 1 279 ? -2.045  -33.063 11.389 1.00 21.39  ? 279  ASP A CA    1 
ATOM   2025 C  C     . ASP A 1 279 ? -2.104  -32.479 12.801 1.00 18.61  ? 279  ASP A C     1 
ATOM   2026 O  O     . ASP A 1 279 ? -2.016  -33.239 13.771 1.00 18.04  ? 279  ASP A O     1 
ATOM   2027 C  CB    . ASP A 1 279 ? -3.501  -33.633 11.138 1.00 19.90  ? 279  ASP A CB    1 
ATOM   2028 C  CG    . ASP A 1 279 ? -3.704  -34.122 9.688  1.00 27.26  ? 279  ASP A CG    1 
ATOM   2029 O  OD1   . ASP A 1 279 ? -2.793  -33.786 8.868  1.00 25.03  ? 279  ASP A OD1   1 
ATOM   2030 O  OD2   . ASP A 1 279 ? -4.767  -34.808 9.400  1.00 29.57  ? 279  ASP A OD2   1 
ATOM   2031 N  N     . LEU A 1 280 ? -2.428  -31.207 12.876 1.00 17.56  ? 280  LEU A N     1 
ATOM   2032 C  CA    . LEU A 1 280 ? -2.801  -30.606 14.164 1.00 20.40  ? 280  LEU A CA    1 
ATOM   2033 C  C     . LEU A 1 280 ? -4.311  -30.680 14.383 1.00 19.64  ? 280  LEU A C     1 
ATOM   2034 O  O     . LEU A 1 280 ? -5.081  -30.393 13.462 1.00 21.20  ? 280  LEU A O     1 
ATOM   2035 C  CB    . LEU A 1 280 ? -2.408  -29.122 14.157 1.00 20.05  ? 280  LEU A CB    1 
ATOM   2036 C  CG    . LEU A 1 280 ? -0.902  -28.890 14.389 1.00 22.84  ? 280  LEU A CG    1 
ATOM   2037 C  CD1   . LEU A 1 280 ? -0.051  -29.406 13.309 1.00 23.74  ? 280  LEU A CD1   1 
ATOM   2038 C  CD2   . LEU A 1 280 ? -0.640  -27.317 14.652 1.00 17.44  ? 280  LEU A CD2   1 
ATOM   2039 N  N     . TRP A 1 281 ? -4.704  -31.000 15.593 1.00 18.89  ? 281  TRP A N     1 
ATOM   2040 C  CA    . TRP A 1 281 ? -6.115  -30.919 16.041 1.00 18.46  ? 281  TRP A CA    1 
ATOM   2041 C  C     . TRP A 1 281 ? -6.168  -29.917 17.207 1.00 18.69  ? 281  TRP A C     1 
ATOM   2042 O  O     . TRP A 1 281 ? -5.431  -30.067 18.202 1.00 17.18  ? 281  TRP A O     1 
ATOM   2043 C  CB    . TRP A 1 281 ? -6.533  -32.310 16.488 1.00 17.10  ? 281  TRP A CB    1 
ATOM   2044 C  CG    . TRP A 1 281 ? -6.720  -33.205 15.276 1.00 18.84  ? 281  TRP A CG    1 
ATOM   2045 C  CD1   . TRP A 1 281 ? -5.758  -33.902 14.593 1.00 19.54  ? 281  TRP A CD1   1 
ATOM   2046 C  CD2   . TRP A 1 281 ? -7.961  -33.426 14.569 1.00 21.74  ? 281  TRP A CD2   1 
ATOM   2047 N  NE1   . TRP A 1 281 ? -6.318  -34.532 13.513 1.00 19.40  ? 281  TRP A NE1   1 
ATOM   2048 C  CE2   . TRP A 1 281 ? -7.664  -34.288 13.467 1.00 19.28  ? 281  TRP A CE2   1 
ATOM   2049 C  CE3   . TRP A 1 281 ? -9.288  -32.984 14.769 1.00 20.65  ? 281  TRP A CE3   1 
ATOM   2050 C  CZ2   . TRP A 1 281 ? -8.662  -34.788 12.582 1.00 23.70  ? 281  TRP A CZ2   1 
ATOM   2051 C  CZ3   . TRP A 1 281 ? -10.308 -33.461 13.865 1.00 22.27  ? 281  TRP A CZ3   1 
ATOM   2052 C  CH2   . TRP A 1 281 ? -9.969  -34.364 12.788 1.00 21.02  ? 281  TRP A CH2   1 
ATOM   2053 N  N     . VAL A 1 282 ? -6.947  -28.859 17.060 1.00 17.92  ? 282  VAL A N     1 
ATOM   2054 C  CA    . VAL A 1 282 ? -6.814  -27.721 17.979 1.00 18.36  ? 282  VAL A CA    1 
ATOM   2055 C  C     . VAL A 1 282 ? -8.162  -27.458 18.630 1.00 19.21  ? 282  VAL A C     1 
ATOM   2056 O  O     . VAL A 1 282 ? -9.138  -27.263 17.894 1.00 18.61  ? 282  VAL A O     1 
ATOM   2057 C  CB    . VAL A 1 282 ? -6.336  -26.468 17.226 1.00 19.60  ? 282  VAL A CB    1 
ATOM   2058 C  CG1   . VAL A 1 282 ? -5.981  -25.272 18.274 1.00 18.77  ? 282  VAL A CG1   1 
ATOM   2059 C  CG2   . VAL A 1 282 ? -5.104  -26.817 16.351 1.00 17.29  ? 282  VAL A CG2   1 
ATOM   2060 N  N     . GLY A 1 283 ? -8.222  -27.406 19.962 1.00 17.76  ? 283  GLY A N     1 
ATOM   2061 C  CA    . GLY A 1 283 ? -9.448  -26.954 20.672 1.00 19.65  ? 283  GLY A CA    1 
ATOM   2062 C  C     . GLY A 1 283 ? -9.384  -25.457 20.805 1.00 21.80  ? 283  GLY A C     1 
ATOM   2063 O  O     . GLY A 1 283 ? -8.282  -24.870 21.099 1.00 19.65  ? 283  GLY A O     1 
ATOM   2064 N  N     . CYS A 1 284 ? -10.526 -24.797 20.587 1.00 20.12  ? 284  CYS A N     1 
ATOM   2065 C  CA    . CYS A 1 284 ? -10.503 -23.336 20.417 1.00 21.33  ? 284  CYS A CA    1 
ATOM   2066 C  C     . CYS A 1 284 ? -11.733 -22.700 21.108 1.00 23.87  ? 284  CYS A C     1 
ATOM   2067 O  O     . CYS A 1 284 ? -12.784 -23.399 21.287 1.00 20.85  ? 284  CYS A O     1 
ATOM   2068 C  CB    . CYS A 1 284 ? -10.593 -22.918 18.972 1.00 22.48  ? 284  CYS A CB    1 
ATOM   2069 S  SG    . CYS A 1 284 ? -9.365  -23.604 17.885 1.00 26.25  ? 284  CYS A SG    1 
ATOM   2070 N  N     . HIS A 1 285 ? -11.576 -21.421 21.523 1.00 20.47  ? 285  HIS A N     1 
ATOM   2071 C  CA    . HIS A 1 285 ? -12.658 -20.656 22.135 1.00 21.54  ? 285  HIS A CA    1 
ATOM   2072 C  C     . HIS A 1 285 ? -13.090 -19.566 21.116 1.00 21.81  ? 285  HIS A C     1 
ATOM   2073 O  O     . HIS A 1 285 ? -12.307 -18.648 20.831 1.00 21.48  ? 285  HIS A O     1 
ATOM   2074 C  CB    . HIS A 1 285 ? -12.155 -20.026 23.429 1.00 22.27  ? 285  HIS A CB    1 
ATOM   2075 C  CG    . HIS A 1 285 ? -11.532 -21.023 24.360 1.00 21.93  ? 285  HIS A CG    1 
ATOM   2076 N  ND1   . HIS A 1 285 ? -12.277 -21.889 25.117 1.00 20.34  ? 285  HIS A ND1   1 
ATOM   2077 C  CD2   . HIS A 1 285 ? -10.234 -21.295 24.647 1.00 20.28  ? 285  HIS A CD2   1 
ATOM   2078 C  CE1   . HIS A 1 285 ? -11.487 -22.665 25.829 1.00 19.05  ? 285  HIS A CE1   1 
ATOM   2079 N  NE2   . HIS A 1 285 ? -10.242 -22.304 25.574 1.00 20.57  ? 285  HIS A NE2   1 
ATOM   2080 N  N     . PRO A 1 286 ? -14.266 -19.730 20.472 1.00 21.94  ? 286  PRO A N     1 
ATOM   2081 C  CA    . PRO A 1 286 ? -14.697 -18.772 19.423 1.00 22.91  ? 286  PRO A CA    1 
ATOM   2082 C  C     . PRO A 1 286 ? -14.814 -17.356 19.931 1.00 23.47  ? 286  PRO A C     1 
ATOM   2083 O  O     . PRO A 1 286 ? -14.331 -16.414 19.254 1.00 24.13  ? 286  PRO A O     1 
ATOM   2084 C  CB    . PRO A 1 286 ? -16.097 -19.278 19.010 1.00 23.44  ? 286  PRO A CB    1 
ATOM   2085 C  CG    . PRO A 1 286 ? -15.991 -20.715 19.154 1.00 23.03  ? 286  PRO A CG    1 
ATOM   2086 C  CD    . PRO A 1 286 ? -15.194 -20.880 20.537 1.00 22.70  ? 286  PRO A CD    1 
ATOM   2087 N  N     . ASN A 1 287 ? -15.294 -17.232 21.157 1.00 25.04  ? 287  ASN A N     1 
ATOM   2088 C  CA    . ASN A 1 287 ? -15.536 -15.935 21.773 1.00 27.31  ? 287  ASN A CA    1 
ATOM   2089 C  C     . ASN A 1 287 ? -14.843 -15.852 23.125 1.00 26.35  ? 287  ASN A C     1 
ATOM   2090 O  O     . ASN A 1 287 ? -15.175 -16.566 24.076 1.00 27.23  ? 287  ASN A O     1 
ATOM   2091 C  CB    . ASN A 1 287 ? -17.051 -15.753 21.971 1.00 27.66  ? 287  ASN A CB    1 
ATOM   2092 C  CG    . ASN A 1 287 ? -17.409 -14.317 22.445 1.00 34.60  ? 287  ASN A CG    1 
ATOM   2093 O  OD1   . ASN A 1 287 ? -16.837 -13.824 23.431 1.00 34.35  ? 287  ASN A OD1   1 
ATOM   2094 N  ND2   . ASN A 1 287 ? -18.310 -13.631 21.710 1.00 34.03  ? 287  ASN A ND2   1 
ATOM   2095 N  N     . GLY A 1 288 ? -13.889 -14.965 23.238 1.00 27.13  ? 288  GLY A N     1 
ATOM   2096 C  CA    . GLY A 1 288 ? -13.097 -14.901 24.459 1.00 27.79  ? 288  GLY A CA    1 
ATOM   2097 C  C     . GLY A 1 288 ? -13.788 -14.309 25.647 1.00 29.47  ? 288  GLY A C     1 
ATOM   2098 O  O     . GLY A 1 288 ? -13.497 -14.663 26.820 1.00 27.61  ? 288  GLY A O     1 
ATOM   2099 N  N     . MET A 1 289 ? -14.697 -13.375 25.356 1.00 29.44  ? 289  MET A N     1 
ATOM   2100 C  CA    . MET A 1 289 ? -15.449 -12.762 26.446 1.00 31.75  ? 289  MET A CA    1 
ATOM   2101 C  C     . MET A 1 289 ? -16.144 -13.851 27.246 1.00 30.33  ? 289  MET A C     1 
ATOM   2102 O  O     . MET A 1 289 ? -16.142 -13.845 28.477 1.00 31.25  ? 289  MET A O     1 
ATOM   2103 C  CB    . MET A 1 289 ? -16.490 -11.757 25.873 1.00 32.60  ? 289  MET A CB    1 
ATOM   2104 C  CG    . MET A 1 289 ? -17.398 -11.139 26.938 1.00 44.39  ? 289  MET A CG    1 
ATOM   2105 S  SD    . MET A 1 289 ? -16.721 -9.548  27.605 1.00 64.93  ? 289  MET A SD    1 
ATOM   2106 C  CE    . MET A 1 289 ? -15.028 -9.683  27.025 1.00 58.41  ? 289  MET A CE    1 
ATOM   2107 N  N     . ARG A 1 290 ? -16.739 -14.808 26.549 1.00 29.54  ? 290  ARG A N     1 
ATOM   2108 C  CA    . ARG A 1 290 ? -17.548 -15.794 27.236 1.00 29.34  ? 290  ARG A CA    1 
ATOM   2109 C  C     . ARG A 1 290 ? -16.761 -16.804 28.033 1.00 26.81  ? 290  ARG A C     1 
ATOM   2110 O  O     . ARG A 1 290 ? -17.263 -17.364 28.984 1.00 27.49  ? 290  ARG A O     1 
ATOM   2111 C  CB    . ARG A 1 290 ? -18.421 -16.555 26.223 1.00 29.13  ? 290  ARG A CB    1 
ATOM   2112 C  CG    . ARG A 1 290 ? -19.558 -15.653 25.655 1.00 36.07  ? 290  ARG A CG    1 
ATOM   2113 C  CD    . ARG A 1 290 ? -20.434 -16.497 24.713 1.00 41.96  ? 290  ARG A CD    1 
ATOM   2114 N  NE    . ARG A 1 290 ? -21.279 -15.578 23.968 1.00 50.06  ? 290  ARG A NE    1 
ATOM   2115 C  CZ    . ARG A 1 290 ? -21.406 -15.573 22.653 1.00 53.09  ? 290  ARG A CZ    1 
ATOM   2116 N  NH1   . ARG A 1 290 ? -20.773 -16.484 21.902 1.00 53.47  ? 290  ARG A NH1   1 
ATOM   2117 N  NH2   . ARG A 1 290 ? -22.163 -14.636 22.105 1.00 56.29  ? 290  ARG A NH2   1 
ATOM   2118 N  N     . ILE A 1 291 ? -15.544 -17.078 27.625 1.00 25.85  ? 291  ILE A N     1 
ATOM   2119 C  CA    . ILE A 1 291 ? -14.768 -18.107 28.359 1.00 26.71  ? 291  ILE A CA    1 
ATOM   2120 C  C     . ILE A 1 291 ? -14.028 -17.407 29.530 1.00 26.88  ? 291  ILE A C     1 
ATOM   2121 O  O     . ILE A 1 291 ? -13.770 -18.016 30.558 1.00 28.31  ? 291  ILE A O     1 
ATOM   2122 C  CB    . ILE A 1 291 ? -13.776 -18.883 27.366 1.00 25.59  ? 291  ILE A CB    1 
ATOM   2123 C  CG1   . ILE A 1 291 ? -13.016 -20.008 28.094 1.00 27.26  ? 291  ILE A CG1   1 
ATOM   2124 C  CG2   . ILE A 1 291 ? -12.790 -17.901 26.707 1.00 22.10  ? 291  ILE A CG2   1 
ATOM   2125 C  CD1   . ILE A 1 291 ? -13.996 -21.117 28.748 1.00 26.43  ? 291  ILE A CD1   1 
ATOM   2126 N  N     . PHE A 1 292 ? -13.649 -16.147 29.362 1.00 26.67  ? 292  PHE A N     1 
ATOM   2127 C  CA    . PHE A 1 292 ? -12.955 -15.449 30.475 1.00 28.56  ? 292  PHE A CA    1 
ATOM   2128 C  C     . PHE A 1 292 ? -13.913 -14.846 31.544 1.00 31.32  ? 292  PHE A C     1 
ATOM   2129 O  O     . PHE A 1 292 ? -13.537 -14.668 32.708 1.00 31.04  ? 292  PHE A O     1 
ATOM   2130 C  CB    . PHE A 1 292 ? -12.008 -14.341 29.944 1.00 27.05  ? 292  PHE A CB    1 
ATOM   2131 C  CG    . PHE A 1 292 ? -10.660 -14.866 29.465 1.00 27.12  ? 292  PHE A CG    1 
ATOM   2132 C  CD1   . PHE A 1 292 ? -9.552  -14.896 30.368 1.00 29.94  ? 292  PHE A CD1   1 
ATOM   2133 C  CD2   . PHE A 1 292 ? -10.455 -15.224 28.125 1.00 24.13  ? 292  PHE A CD2   1 
ATOM   2134 C  CE1   . PHE A 1 292 ? -8.228  -15.316 29.937 1.00 25.27  ? 292  PHE A CE1   1 
ATOM   2135 C  CE2   . PHE A 1 292 ? -9.130  -15.646 27.657 1.00 23.53  ? 292  PHE A CE2   1 
ATOM   2136 C  CZ    . PHE A 1 292 ? -8.039  -15.711 28.580 1.00 23.48  ? 292  PHE A CZ    1 
ATOM   2137 N  N     . PHE A 1 293 ? -15.148 -14.535 31.145 1.00 32.42  ? 293  PHE A N     1 
ATOM   2138 C  CA    . PHE A 1 293 ? -16.144 -13.975 32.114 1.00 33.88  ? 293  PHE A CA    1 
ATOM   2139 C  C     . PHE A 1 293 ? -17.368 -14.828 32.094 1.00 34.43  ? 293  PHE A C     1 
ATOM   2140 O  O     . PHE A 1 293 ? -18.272 -14.558 31.337 1.00 35.13  ? 293  PHE A O     1 
ATOM   2141 C  CB    . PHE A 1 293 ? -16.477 -12.561 31.703 1.00 34.25  ? 293  PHE A CB    1 
ATOM   2142 C  CG    . PHE A 1 293 ? -15.259 -11.691 31.582 1.00 36.96  ? 293  PHE A CG    1 
ATOM   2143 C  CD1   . PHE A 1 293 ? -14.664 -11.139 32.719 1.00 45.08  ? 293  PHE A CD1   1 
ATOM   2144 C  CD2   . PHE A 1 293 ? -14.665 -11.489 30.354 1.00 38.64  ? 293  PHE A CD2   1 
ATOM   2145 C  CE1   . PHE A 1 293 ? -13.483 -10.353 32.610 1.00 47.53  ? 293  PHE A CE1   1 
ATOM   2146 C  CE2   . PHE A 1 293 ? -13.517 -10.718 30.218 1.00 40.87  ? 293  PHE A CE2   1 
ATOM   2147 C  CZ    . PHE A 1 293 ? -12.922 -10.132 31.333 1.00 45.82  ? 293  PHE A CZ    1 
ATOM   2148 N  N     . TYR A 1 294 ? -17.361 -15.910 32.857 1.00 35.68  ? 294  TYR A N     1 
ATOM   2149 C  CA    . TYR A 1 294 ? -18.409 -16.889 32.756 1.00 37.93  ? 294  TYR A CA    1 
ATOM   2150 C  C     . TYR A 1 294 ? -19.785 -16.263 33.051 1.00 39.80  ? 294  TYR A C     1 
ATOM   2151 O  O     . TYR A 1 294 ? -19.967 -15.514 34.012 1.00 39.84  ? 294  TYR A O     1 
ATOM   2152 C  CB    . TYR A 1 294 ? -18.238 -18.001 33.735 1.00 36.85  ? 294  TYR A CB    1 
ATOM   2153 C  CG    . TYR A 1 294 ? -19.231 -19.142 33.497 1.00 40.91  ? 294  TYR A CG    1 
ATOM   2154 C  CD1   . TYR A 1 294 ? -19.104 -19.934 32.361 1.00 42.98  ? 294  TYR A CD1   1 
ATOM   2155 C  CD2   . TYR A 1 294 ? -20.282 -19.437 34.399 1.00 43.91  ? 294  TYR A CD2   1 
ATOM   2156 C  CE1   . TYR A 1 294 ? -19.949 -20.987 32.082 1.00 44.09  ? 294  TYR A CE1   1 
ATOM   2157 C  CE2   . TYR A 1 294 ? -21.200 -20.570 34.115 1.00 45.99  ? 294  TYR A CE2   1 
ATOM   2158 C  CZ    . TYR A 1 294 ? -20.986 -21.327 32.935 1.00 48.58  ? 294  TYR A CZ    1 
ATOM   2159 O  OH    . TYR A 1 294 ? -21.787 -22.425 32.508 1.00 53.51  ? 294  TYR A OH    1 
ATOM   2160 N  N     . ASP A 1 295 ? -20.735 -16.631 32.223 1.00 39.97  ? 295  ASP A N     1 
ATOM   2161 C  CA    . ASP A 1 295 ? -22.121 -16.225 32.393 1.00 40.90  ? 295  ASP A CA    1 
ATOM   2162 C  C     . ASP A 1 295 ? -22.935 -17.480 32.092 1.00 40.09  ? 295  ASP A C     1 
ATOM   2163 O  O     . ASP A 1 295 ? -23.016 -17.883 30.949 1.00 38.49  ? 295  ASP A O     1 
ATOM   2164 C  CB    . ASP A 1 295 ? -22.423 -15.086 31.391 1.00 40.39  ? 295  ASP A CB    1 
ATOM   2165 C  CG    . ASP A 1 295 ? -23.874 -14.511 31.536 1.00 45.26  ? 295  ASP A CG    1 
ATOM   2166 O  OD1   . ASP A 1 295 ? -24.113 -13.455 30.883 1.00 47.25  ? 295  ASP A OD1   1 
ATOM   2167 O  OD2   . ASP A 1 295 ? -24.724 -15.156 32.227 1.00 38.29  ? 295  ASP A OD2   1 
ATOM   2168 N  N     . ALA A 1 296 ? -23.525 -18.097 33.112 1.00 42.70  ? 296  ALA A N     1 
ATOM   2169 C  CA    . ALA A 1 296 ? -24.340 -19.324 32.888 1.00 44.56  ? 296  ALA A CA    1 
ATOM   2170 C  C     . ALA A 1 296 ? -25.402 -19.178 31.799 1.00 45.12  ? 296  ALA A C     1 
ATOM   2171 O  O     . ALA A 1 296 ? -25.744 -20.186 31.151 1.00 46.63  ? 296  ALA A O     1 
ATOM   2172 C  CB    . ALA A 1 296 ? -24.997 -19.836 34.196 1.00 45.45  ? 296  ALA A CB    1 
ATOM   2173 N  N     . GLU A 1 297 ? -25.912 -17.957 31.606 1.00 43.30  ? 297  GLU A N     1 
ATOM   2174 C  CA    . GLU A 1 297 ? -26.937 -17.696 30.600 1.00 44.27  ? 297  GLU A CA    1 
ATOM   2175 C  C     . GLU A 1 297 ? -26.337 -17.408 29.226 1.00 43.72  ? 297  GLU A C     1 
ATOM   2176 O  O     . GLU A 1 297 ? -27.073 -17.281 28.226 1.00 44.09  ? 297  GLU A O     1 
ATOM   2177 C  CB    . GLU A 1 297 ? -27.839 -16.484 31.030 1.00 45.38  ? 297  GLU A CB    1 
ATOM   2178 N  N     . ASN A 1 298 ? -25.014 -17.213 29.175 1.00 40.24  ? 298  ASN A N     1 
ATOM   2179 C  CA    . ASN A 1 298 ? -24.360 -16.964 27.913 1.00 38.60  ? 298  ASN A CA    1 
ATOM   2180 C  C     . ASN A 1 298 ? -22.961 -17.685 27.883 1.00 35.77  ? 298  ASN A C     1 
ATOM   2181 O  O     . ASN A 1 298 ? -21.918 -17.050 27.845 1.00 33.91  ? 298  ASN A O     1 
ATOM   2182 C  CB    . ASN A 1 298 ? -24.272 -15.468 27.676 1.00 39.35  ? 298  ASN A CB    1 
ATOM   2183 C  CG    . ASN A 1 298 ? -23.907 -15.134 26.248 1.00 47.25  ? 298  ASN A CG    1 
ATOM   2184 O  OD1   . ASN A 1 298 ? -23.955 -15.994 25.348 1.00 53.67  ? 298  ASN A OD1   1 
ATOM   2185 N  ND2   . ASN A 1 298 ? -23.522 -13.876 26.019 1.00 56.36  ? 298  ASN A ND2   1 
ATOM   2186 N  N     . PRO A 1 299 ? -22.994 -19.004 27.940 1.00 33.69  ? 299  PRO A N     1 
ATOM   2187 C  CA    . PRO A 1 299 ? -21.871 -19.827 28.219 1.00 32.27  ? 299  PRO A CA    1 
ATOM   2188 C  C     . PRO A 1 299 ? -20.933 -19.880 27.016 1.00 29.81  ? 299  PRO A C     1 
ATOM   2189 O  O     . PRO A 1 299 ? -21.308 -19.584 25.898 1.00 28.37  ? 299  PRO A O     1 
ATOM   2190 C  CB    . PRO A 1 299 ? -22.507 -21.180 28.545 1.00 34.09  ? 299  PRO A CB    1 
ATOM   2191 C  CG    . PRO A 1 299 ? -23.791 -21.213 27.679 1.00 35.22  ? 299  PRO A CG    1 
ATOM   2192 C  CD    . PRO A 1 299 ? -24.212 -19.789 27.592 1.00 35.17  ? 299  PRO A CD    1 
ATOM   2193 N  N     . PRO A 1 300 ? -19.670 -20.189 27.257 1.00 28.38  ? 300  PRO A N     1 
ATOM   2194 C  CA    . PRO A 1 300 ? -18.761 -20.250 26.085 1.00 26.55  ? 300  PRO A CA    1 
ATOM   2195 C  C     . PRO A 1 300 ? -19.098 -21.431 25.196 1.00 25.82  ? 300  PRO A C     1 
ATOM   2196 O  O     . PRO A 1 300 ? -19.581 -22.442 25.712 1.00 28.59  ? 300  PRO A O     1 
ATOM   2197 C  CB    . PRO A 1 300 ? -17.372 -20.454 26.752 1.00 27.65  ? 300  PRO A CB    1 
ATOM   2198 C  CG    . PRO A 1 300 ? -17.678 -21.123 28.062 1.00 25.90  ? 300  PRO A CG    1 
ATOM   2199 C  CD    . PRO A 1 300 ? -19.048 -20.659 28.510 1.00 26.90  ? 300  PRO A CD    1 
ATOM   2200 N  N     . GLY A 1 301 ? -18.790 -21.345 23.907 1.00 24.87  ? 301  GLY A N     1 
ATOM   2201 C  CA    . GLY A 1 301 ? -19.067 -22.420 22.976 1.00 23.06  ? 301  GLY A CA    1 
ATOM   2202 C  C     . GLY A 1 301 ? -17.793 -23.282 22.806 1.00 24.39  ? 301  GLY A C     1 
ATOM   2203 O  O     . GLY A 1 301 ? -16.932 -23.315 23.711 1.00 22.98  ? 301  GLY A O     1 
ATOM   2204 N  N     . SER A 1 302 ? -17.739 -24.040 21.704 1.00 22.29  ? 302  SER A N     1 
ATOM   2205 C  CA    . SER A 1 302 ? -16.702 -25.001 21.450 1.00 22.14  ? 302  SER A CA    1 
ATOM   2206 C  C     . SER A 1 302 ? -16.420 -24.932 19.982 1.00 23.06  ? 302  SER A C     1 
ATOM   2207 O  O     . SER A 1 302 ? -17.352 -24.636 19.185 1.00 21.94  ? 302  SER A O     1 
ATOM   2208 C  CB    . SER A 1 302 ? -17.076 -26.421 21.814 1.00 20.32  ? 302  SER A CB    1 
ATOM   2209 O  OG    . SER A 1 302 ? -16.975 -26.531 23.245 1.00 22.69  ? 302  SER A OG    1 
ATOM   2210 N  N     . GLU A 1 303 ? -15.157 -25.222 19.612 1.00 21.03  ? 303  GLU A N     1 
ATOM   2211 C  CA    . GLU A 1 303 ? -14.711 -25.217 18.217 1.00 22.36  ? 303  GLU A CA    1 
ATOM   2212 C  C     . GLU A 1 303 ? -13.399 -26.040 18.081 1.00 22.79  ? 303  GLU A C     1 
ATOM   2213 O  O     . GLU A 1 303 ? -12.478 -25.885 18.920 1.00 23.30  ? 303  GLU A O     1 
ATOM   2214 C  CB    . GLU A 1 303 ? -14.542 -23.783 17.716 1.00 21.86  ? 303  GLU A CB    1 
ATOM   2215 C  CG    . GLU A 1 303 ? -14.064 -23.665 16.213 1.00 27.98  ? 303  GLU A CG    1 
ATOM   2216 C  CD    . GLU A 1 303 ? -14.191 -22.221 15.644 1.00 37.04  ? 303  GLU A CD    1 
ATOM   2217 O  OE1   . GLU A 1 303 ? -13.767 -21.252 16.300 1.00 36.35  ? 303  GLU A OE1   1 
ATOM   2218 O  OE2   . GLU A 1 303 ? -14.821 -22.048 14.579 1.00 42.62  ? 303  GLU A OE2   1 
ATOM   2219 N  N     . VAL A 1 304 ? -13.373 -26.992 17.132 1.00 20.76  ? 304  VAL A N     1 
ATOM   2220 C  CA    . VAL A 1 304 ? -12.249 -27.842 16.903 1.00 19.63  ? 304  VAL A CA    1 
ATOM   2221 C  C     . VAL A 1 304 ? -11.781 -27.619 15.446 1.00 22.19  ? 304  VAL A C     1 
ATOM   2222 O  O     . VAL A 1 304 ? -12.622 -27.666 14.507 1.00 22.60  ? 304  VAL A O     1 
ATOM   2223 C  CB    . VAL A 1 304 ? -12.607 -29.333 17.070 1.00 19.42  ? 304  VAL A CB    1 
ATOM   2224 C  CG1   . VAL A 1 304 ? -11.423 -30.191 16.713 1.00 15.58  ? 304  VAL A CG1   1 
ATOM   2225 C  CG2   . VAL A 1 304 ? -13.069 -29.645 18.492 1.00 19.77  ? 304  VAL A CG2   1 
ATOM   2226 N  N     . LEU A 1 305 ? -10.482 -27.298 15.257 1.00 18.76  ? 305  LEU A N     1 
ATOM   2227 C  CA    . LEU A 1 305 ? -9.881  -27.194 13.908 1.00 20.14  ? 305  LEU A CA    1 
ATOM   2228 C  C     . LEU A 1 305 ? -8.985  -28.360 13.656 1.00 20.12  ? 305  LEU A C     1 
ATOM   2229 O  O     . LEU A 1 305 ? -8.374  -28.899 14.598 1.00 20.61  ? 305  LEU A O     1 
ATOM   2230 C  CB    . LEU A 1 305 ? -8.953  -25.946 13.805 1.00 16.89  ? 305  LEU A CB    1 
ATOM   2231 C  CG    . LEU A 1 305 ? -9.543  -24.653 14.304 1.00 22.70  ? 305  LEU A CG    1 
ATOM   2232 C  CD1   . LEU A 1 305 ? -8.545  -23.547 14.140 1.00 28.03  ? 305  LEU A CD1   1 
ATOM   2233 C  CD2   . LEU A 1 305 ? -10.836 -24.354 13.453 1.00 26.00  ? 305  LEU A CD2   1 
ATOM   2234 N  N     . ARG A 1 306 ? -8.882  -28.739 12.394 1.00 19.42  ? 306  ARG A N     1 
ATOM   2235 C  CA    . ARG A 1 306 ? -7.900  -29.722 11.955 1.00 19.68  ? 306  ARG A CA    1 
ATOM   2236 C  C     . ARG A 1 306 ? -7.024  -28.917 11.002 1.00 20.43  ? 306  ARG A C     1 
ATOM   2237 O  O     . ARG A 1 306 ? -7.520  -28.169 10.172 1.00 19.99  ? 306  ARG A O     1 
ATOM   2238 C  CB    . ARG A 1 306 ? -8.552  -30.861 11.182 1.00 20.00  ? 306  ARG A CB    1 
ATOM   2239 C  CG    . ARG A 1 306 ? -7.487  -31.848 10.597 1.00 20.17  ? 306  ARG A CG    1 
ATOM   2240 C  CD    . ARG A 1 306 ? -8.291  -32.834 9.565  1.00 18.36  ? 306  ARG A CD    1 
ATOM   2241 N  NE    . ARG A 1 306 ? -7.384  -33.907 9.119  1.00 22.84  ? 306  ARG A NE    1 
ATOM   2242 C  CZ    . ARG A 1 306 ? -7.749  -34.786 8.191  1.00 24.31  ? 306  ARG A CZ    1 
ATOM   2243 N  NH1   . ARG A 1 306 ? -9.013  -34.678 7.602  1.00 18.83  ? 306  ARG A NH1   1 
ATOM   2244 N  NH2   . ARG A 1 306 ? -6.818  -35.677 7.787  1.00 19.05  ? 306  ARG A NH2   1 
ATOM   2245 N  N     . ILE A 1 307 ? -5.709  -29.034 11.131 1.00 21.04  ? 307  ILE A N     1 
ATOM   2246 C  CA    . ILE A 1 307 ? -4.816  -28.284 10.221 1.00 20.29  ? 307  ILE A CA    1 
ATOM   2247 C  C     . ILE A 1 307 ? -3.965  -29.335 9.552  1.00 21.64  ? 307  ILE A C     1 
ATOM   2248 O  O     . ILE A 1 307 ? -3.316  -30.109 10.217 1.00 21.95  ? 307  ILE A O     1 
ATOM   2249 C  CB    . ILE A 1 307 ? -3.890  -27.287 11.003 1.00 20.53  ? 307  ILE A CB    1 
ATOM   2250 C  CG1   . ILE A 1 307 ? -4.784  -26.325 11.825 1.00 20.51  ? 307  ILE A CG1   1 
ATOM   2251 C  CG2   . ILE A 1 307 ? -3.002  -26.363 10.022 1.00 20.80  ? 307  ILE A CG2   1 
ATOM   2252 C  CD1   . ILE A 1 307 ? -3.926  -25.480 12.824 1.00 25.47  ? 307  ILE A CD1   1 
ATOM   2253 N  N     . GLN A 1 308 ? -3.965  -29.351 8.230  1.00 22.64  ? 308  GLN A N     1 
ATOM   2254 C  CA    . GLN A 1 308 ? -3.188  -30.293 7.455  1.00 24.54  ? 308  GLN A CA    1 
ATOM   2255 C  C     . GLN A 1 308 ? -2.168  -29.516 6.630  1.00 25.82  ? 308  GLN A C     1 
ATOM   2256 O  O     . GLN A 1 308 ? -2.387  -28.342 6.303  1.00 26.21  ? 308  GLN A O     1 
ATOM   2257 C  CB    . GLN A 1 308 ? -4.086  -31.056 6.454  1.00 23.23  ? 308  GLN A CB    1 
ATOM   2258 C  CG    . GLN A 1 308 ? -5.132  -31.927 7.091  1.00 24.52  ? 308  GLN A CG    1 
ATOM   2259 C  CD    . GLN A 1 308 ? -6.199  -32.321 6.079  1.00 26.96  ? 308  GLN A CD    1 
ATOM   2260 O  OE1   . GLN A 1 308 ? -7.182  -31.638 5.935  1.00 29.96  ? 308  GLN A OE1   1 
ATOM   2261 N  NE2   . GLN A 1 308 ? -5.964  -33.385 5.350  1.00 25.30  ? 308  GLN A NE2   1 
ATOM   2262 N  N     . ASP A 1 309 ? -1.049  -30.159 6.354  1.00 29.28  ? 309  ASP A N     1 
ATOM   2263 C  CA    . ASP A 1 309 ? -0.008  -29.606 5.477  1.00 32.34  ? 309  ASP A CA    1 
ATOM   2264 C  C     . ASP A 1 309 ? 0.461   -28.297 6.017  1.00 32.18  ? 309  ASP A C     1 
ATOM   2265 O  O     . ASP A 1 309 ? 0.521   -27.303 5.314  1.00 32.17  ? 309  ASP A O     1 
ATOM   2266 C  CB    . ASP A 1 309 ? -0.518  -29.508 4.005  1.00 34.23  ? 309  ASP A CB    1 
ATOM   2267 C  CG    . ASP A 1 309 ? -0.941  -30.916 3.425  1.00 43.31  ? 309  ASP A CG    1 
ATOM   2268 O  OD1   . ASP A 1 309 ? -0.654  -32.014 4.047  1.00 47.58  ? 309  ASP A OD1   1 
ATOM   2269 O  OD2   . ASP A 1 309 ? -1.606  -30.924 2.355  1.00 54.57  ? 309  ASP A OD2   1 
ATOM   2270 N  N     . ILE A 1 310 ? 0.798   -28.278 7.305  1.00 32.73  ? 310  ILE A N     1 
ATOM   2271 C  CA    . ILE A 1 310 ? 1.044   -26.992 7.943  1.00 33.53  ? 310  ILE A CA    1 
ATOM   2272 C  C     . ILE A 1 310 ? 2.329   -26.263 7.375  1.00 36.71  ? 310  ILE A C     1 
ATOM   2273 O  O     . ILE A 1 310 ? 2.469   -25.042 7.497  1.00 37.21  ? 310  ILE A O     1 
ATOM   2274 C  CB    . ILE A 1 310 ? 1.125   -27.149 9.509  1.00 33.11  ? 310  ILE A CB    1 
ATOM   2275 C  CG1   . ILE A 1 310 ? 1.058   -25.782 10.179 1.00 31.54  ? 310  ILE A CG1   1 
ATOM   2276 C  CG2   . ILE A 1 310 ? 2.380   -27.969 9.896  1.00 27.99  ? 310  ILE A CG2   1 
ATOM   2277 C  CD1   . ILE A 1 310 ? 0.686   -25.820 11.590 1.00 28.69  ? 310  ILE A CD1   1 
ATOM   2278 N  N     . LEU A 1 311 ? 3.264   -27.013 6.801  1.00 39.78  ? 311  LEU A N     1 
ATOM   2279 C  CA    . LEU A 1 311 ? 4.442   -26.406 6.119  1.00 43.71  ? 311  LEU A CA    1 
ATOM   2280 C  C     . LEU A 1 311 ? 4.213   -25.969 4.652  1.00 46.18  ? 311  LEU A C     1 
ATOM   2281 O  O     . LEU A 1 311 ? 5.024   -25.234 4.097  1.00 46.54  ? 311  LEU A O     1 
ATOM   2282 C  CB    . LEU A 1 311 ? 5.590   -27.384 6.149  1.00 43.67  ? 311  LEU A CB    1 
ATOM   2283 C  CG    . LEU A 1 311 ? 5.974   -27.860 7.553  1.00 44.83  ? 311  LEU A CG    1 
ATOM   2284 C  CD1   . LEU A 1 311 ? 6.978   -28.987 7.454  1.00 45.64  ? 311  LEU A CD1   1 
ATOM   2285 C  CD2   . LEU A 1 311 ? 6.439   -26.619 8.424  1.00 40.50  ? 311  LEU A CD2   1 
ATOM   2286 N  N     . SER A 1 312 ? 3.119   -26.434 4.031  1.00 47.94  ? 312  SER A N     1 
ATOM   2287 C  CA    . SER A 1 312 ? 2.821   -26.142 2.617  1.00 49.48  ? 312  SER A CA    1 
ATOM   2288 C  C     . SER A 1 312 ? 2.491   -24.669 2.472  1.00 50.00  ? 312  SER A C     1 
ATOM   2289 O  O     . SER A 1 312 ? 2.356   -23.951 3.470  1.00 49.51  ? 312  SER A O     1 
ATOM   2290 C  CB    . SER A 1 312 ? 1.669   -27.039 2.095  1.00 50.17  ? 312  SER A CB    1 
ATOM   2291 O  OG    . SER A 1 312 ? 0.389   -26.607 2.563  1.00 49.75  ? 312  SER A OG    1 
ATOM   2292 N  N     . GLU A 1 313 ? 2.359   -24.205 1.236  1.00 51.65  ? 313  GLU A N     1 
ATOM   2293 C  CA    . GLU A 1 313 ? 2.103   -22.771 0.983  1.00 51.85  ? 313  GLU A CA    1 
ATOM   2294 C  C     . GLU A 1 313 ? 0.766   -22.260 1.559  1.00 51.52  ? 313  GLU A C     1 
ATOM   2295 O  O     . GLU A 1 313 ? 0.689   -21.146 2.118  1.00 51.84  ? 313  GLU A O     1 
ATOM   2296 C  CB    . GLU A 1 313 ? 2.216   -22.476 -0.528 1.00 53.81  ? 313  GLU A CB    1 
ATOM   2297 N  N     . GLU A 1 314 ? -0.300  -23.058 1.404  1.00 50.21  ? 314  GLU A N     1 
ATOM   2298 C  CA    . GLU A 1 314 ? -1.566  -22.740 2.102  1.00 48.53  ? 314  GLU A CA    1 
ATOM   2299 C  C     . GLU A 1 314 ? -2.046  -23.941 2.923  1.00 45.09  ? 314  GLU A C     1 
ATOM   2300 O  O     . GLU A 1 314 ? -2.634  -24.884 2.381  1.00 44.39  ? 314  GLU A O     1 
ATOM   2301 C  CB    . GLU A 1 314 ? -2.660  -22.189 1.137  1.00 50.21  ? 314  GLU A CB    1 
ATOM   2302 N  N     . PRO A 1 315 ? -1.739  -23.932 4.236  1.00 42.55  ? 315  PRO A N     1 
ATOM   2303 C  CA    . PRO A 1 315 ? -2.217  -25.001 5.165  1.00 39.98  ? 315  PRO A CA    1 
ATOM   2304 C  C     . PRO A 1 315 ? -3.719  -25.160 5.029  1.00 37.78  ? 315  PRO A C     1 
ATOM   2305 O  O     . PRO A 1 315 ? -4.434  -24.212 4.787  1.00 37.99  ? 315  PRO A O     1 
ATOM   2306 C  CB    . PRO A 1 315 ? -1.806  -24.463 6.551  1.00 39.30  ? 315  PRO A CB    1 
ATOM   2307 C  CG    . PRO A 1 315 ? -0.489  -23.675 6.191  1.00 40.04  ? 315  PRO A CG    1 
ATOM   2308 C  CD    . PRO A 1 315 ? -0.868  -22.957 4.920  1.00 41.83  ? 315  PRO A CD    1 
ATOM   2309 N  N     . LYS A 1 316 ? -4.178  -26.375 5.082  1.00 35.85  ? 316  LYS A N     1 
ATOM   2310 C  CA    . LYS A 1 316 ? -5.589  -26.628 4.976  1.00 35.00  ? 316  LYS A CA    1 
ATOM   2311 C  C     . LYS A 1 316 ? -6.176  -26.664 6.404  1.00 32.00  ? 316  LYS A C     1 
ATOM   2312 O  O     . LYS A 1 316 ? -5.817  -27.508 7.208  1.00 32.88  ? 316  LYS A O     1 
ATOM   2313 C  CB    . LYS A 1 316 ? -5.754  -27.974 4.252  1.00 35.12  ? 316  LYS A CB    1 
ATOM   2314 C  CG    . LYS A 1 316 ? -7.187  -28.390 3.966  1.00 42.88  ? 316  LYS A CG    1 
ATOM   2315 N  N     . VAL A 1 317 ? -7.069  -25.755 6.689  1.00 29.50  ? 317  VAL A N     1 
ATOM   2316 C  CA    . VAL A 1 317 ? -7.722  -25.590 7.971  1.00 28.10  ? 317  VAL A CA    1 
ATOM   2317 C  C     . VAL A 1 317 ? -9.229  -25.926 7.779  1.00 29.09  ? 317  VAL A C     1 
ATOM   2318 O  O     . VAL A 1 317 ? -9.914  -25.274 6.993  1.00 28.87  ? 317  VAL A O     1 
ATOM   2319 C  CB    . VAL A 1 317 ? -7.561  -24.135 8.482  1.00 28.34  ? 317  VAL A CB    1 
ATOM   2320 C  CG1   . VAL A 1 317 ? -8.168  -23.923 9.902  1.00 26.63  ? 317  VAL A CG1   1 
ATOM   2321 C  CG2   . VAL A 1 317 ? -6.031  -23.741 8.507  1.00 26.42  ? 317  VAL A CG2   1 
ATOM   2322 N  N     . THR A 1 318 ? -9.715  -26.901 8.544  1.00 26.94  ? 318  THR A N     1 
ATOM   2323 C  CA    . THR A 1 318 ? -11.115 -27.256 8.572  1.00 28.12  ? 318  THR A CA    1 
ATOM   2324 C  C     . THR A 1 318 ? -11.686 -27.121 9.992  1.00 26.26  ? 318  THR A C     1 
ATOM   2325 O  O     . THR A 1 318 ? -11.094 -27.622 10.975 1.00 24.58  ? 318  THR A O     1 
ATOM   2326 C  CB    . THR A 1 318 ? -11.257 -28.763 8.089  1.00 29.21  ? 318  THR A CB    1 
ATOM   2327 O  OG1   . THR A 1 318 ? -10.569 -28.893 6.839  1.00 30.48  ? 318  THR A OG1   1 
ATOM   2328 C  CG2   . THR A 1 318 ? -12.818 -29.223 7.929  1.00 30.20  ? 318  THR A CG2   1 
ATOM   2329 N  N     . VAL A 1 319 ? -12.868 -26.502 10.082 1.00 24.74  ? 319  VAL A N     1 
ATOM   2330 C  CA    . VAL A 1 319 ? -13.671 -26.610 11.265 1.00 22.89  ? 319  VAL A CA    1 
ATOM   2331 C  C     . VAL A 1 319 ? -14.309 -27.974 11.279 1.00 25.98  ? 319  VAL A C     1 
ATOM   2332 O  O     . VAL A 1 319 ? -15.178 -28.271 10.451 1.00 26.18  ? 319  VAL A O     1 
ATOM   2333 C  CB    . VAL A 1 319 ? -14.748 -25.512 11.373 1.00 23.83  ? 319  VAL A CB    1 
ATOM   2334 C  CG1   . VAL A 1 319 ? -15.507 -25.644 12.695 1.00 19.33  ? 319  VAL A CG1   1 
ATOM   2335 C  CG2   . VAL A 1 319 ? -14.117 -24.065 11.282 1.00 22.88  ? 319  VAL A CG2   1 
ATOM   2336 N  N     . VAL A 1 320 ? -13.934 -28.820 12.241 1.00 25.45  ? 320  VAL A N     1 
ATOM   2337 C  CA    . VAL A 1 320 ? -14.498 -30.146 12.285 1.00 25.88  ? 320  VAL A CA    1 
ATOM   2338 C  C     . VAL A 1 320 ? -15.739 -30.182 13.193 1.00 26.58  ? 320  VAL A C     1 
ATOM   2339 O  O     . VAL A 1 320 ? -16.620 -31.048 13.051 1.00 24.77  ? 320  VAL A O     1 
ATOM   2340 C  CB    . VAL A 1 320 ? -13.368 -31.142 12.749 1.00 28.53  ? 320  VAL A CB    1 
ATOM   2341 C  CG1   . VAL A 1 320 ? -13.875 -32.555 12.951 1.00 29.16  ? 320  VAL A CG1   1 
ATOM   2342 C  CG2   . VAL A 1 320 ? -12.236 -31.185 11.650 1.00 25.84  ? 320  VAL A CG2   1 
ATOM   2343 N  N     . TYR A 1 321 ? -15.804 -29.304 14.197 1.00 24.50  ? 321  TYR A N     1 
ATOM   2344 C  CA    . TYR A 1 321 ? -16.957 -29.383 15.112 1.00 23.52  ? 321  TYR A CA    1 
ATOM   2345 C  C     . TYR A 1 321 ? -17.025 -27.989 15.696 1.00 24.16  ? 321  TYR A C     1 
ATOM   2346 O  O     . TYR A 1 321 ? -15.945 -27.328 15.941 1.00 23.16  ? 321  TYR A O     1 
ATOM   2347 C  CB    . TYR A 1 321 ? -16.750 -30.419 16.257 1.00 23.25  ? 321  TYR A CB    1 
ATOM   2348 C  CG    . TYR A 1 321 ? -17.863 -30.368 17.316 1.00 25.68  ? 321  TYR A CG    1 
ATOM   2349 C  CD1   . TYR A 1 321 ? -19.123 -31.030 17.095 1.00 29.14  ? 321  TYR A CD1   1 
ATOM   2350 C  CD2   . TYR A 1 321 ? -17.685 -29.657 18.540 1.00 25.21  ? 321  TYR A CD2   1 
ATOM   2351 C  CE1   . TYR A 1 321 ? -20.162 -30.943 18.047 1.00 26.84  ? 321  TYR A CE1   1 
ATOM   2352 C  CE2   . TYR A 1 321 ? -18.689 -29.589 19.472 1.00 27.20  ? 321  TYR A CE2   1 
ATOM   2353 C  CZ    . TYR A 1 321 ? -19.945 -30.265 19.205 1.00 28.90  ? 321  TYR A CZ    1 
ATOM   2354 O  OH    . TYR A 1 321 ? -20.945 -30.229 20.128 1.00 31.68  ? 321  TYR A OH    1 
ATOM   2355 N  N     . ALA A 1 322 ? -18.226 -27.459 15.825 1.00 22.79  ? 322  ALA A N     1 
ATOM   2356 C  CA    . ALA A 1 322 ? -18.372 -26.112 16.381 1.00 25.29  ? 322  ALA A CA    1 
ATOM   2357 C  C     . ALA A 1 322 ? -19.796 -25.913 16.944 1.00 26.92  ? 322  ALA A C     1 
ATOM   2358 O  O     . ALA A 1 322 ? -20.781 -26.271 16.237 1.00 27.81  ? 322  ALA A O     1 
ATOM   2359 C  CB    . ALA A 1 322 ? -18.000 -24.994 15.290 1.00 22.50  ? 322  ALA A CB    1 
ATOM   2360 N  N     . GLU A 1 323 ? -19.946 -25.236 18.107 1.00 26.16  ? 323  GLU A N     1 
ATOM   2361 C  CA    . GLU A 1 323 ? -21.322 -25.067 18.614 1.00 25.61  ? 323  GLU A CA    1 
ATOM   2362 C  C     . GLU A 1 323 ? -21.237 -24.005 19.627 1.00 26.94  ? 323  GLU A C     1 
ATOM   2363 O  O     . GLU A 1 323 ? -20.114 -23.540 20.014 1.00 23.69  ? 323  GLU A O     1 
ATOM   2364 C  CB    . GLU A 1 323 ? -21.891 -26.339 19.309 1.00 25.70  ? 323  GLU A CB    1 
ATOM   2365 C  CG    . GLU A 1 323 ? -20.915 -26.748 20.544 1.00 30.48  ? 323  GLU A CG    1 
ATOM   2366 C  CD    . GLU A 1 323 ? -21.626 -27.434 21.719 1.00 32.88  ? 323  GLU A CD    1 
ATOM   2367 O  OE1   . GLU A 1 323 ? -21.424 -28.666 21.917 1.00 35.86  ? 323  GLU A OE1   1 
ATOM   2368 O  OE2   . GLU A 1 323 ? -22.365 -26.733 22.420 1.00 32.94  ? 323  GLU A OE2   1 
ATOM   2369 N  N     . ASN A 1 324 ? -22.418 -23.596 20.098 1.00 25.14  ? 324  ASN A N     1 
ATOM   2370 C  CA    . ASN A 1 324 ? -22.473 -22.434 20.942 1.00 26.76  ? 324  ASN A CA    1 
ATOM   2371 C  C     . ASN A 1 324 ? -22.510 -22.669 22.423 1.00 26.51  ? 324  ASN A C     1 
ATOM   2372 O  O     . ASN A 1 324 ? -22.640 -21.688 23.167 1.00 27.94  ? 324  ASN A O     1 
ATOM   2373 C  CB    . ASN A 1 324 ? -23.668 -21.537 20.552 1.00 27.46  ? 324  ASN A CB    1 
ATOM   2374 C  CG    . ASN A 1 324 ? -24.984 -22.236 20.829 1.00 28.79  ? 324  ASN A CG    1 
ATOM   2375 O  OD1   . ASN A 1 324 ? -24.980 -23.352 21.312 1.00 26.09  ? 324  ASN A OD1   1 
ATOM   2376 N  ND2   . ASN A 1 324 ? -26.099 -21.605 20.473 1.00 32.85  ? 324  ASN A ND2   1 
ATOM   2377 N  N     . GLY A 1 325 ? -22.307 -23.894 22.895 1.00 26.81  ? 325  GLY A N     1 
ATOM   2378 C  CA    . GLY A 1 325 ? -22.326 -24.087 24.337 1.00 30.52  ? 325  GLY A CA    1 
ATOM   2379 C  C     . GLY A 1 325 ? -23.570 -24.798 24.897 1.00 34.11  ? 325  GLY A C     1 
ATOM   2380 O  O     . GLY A 1 325 ? -23.642 -25.106 26.111 1.00 32.75  ? 325  GLY A O     1 
ATOM   2381 N  N     . THR A 1 326 ? -24.531 -25.108 24.010 1.00 34.95  ? 326  THR A N     1 
ATOM   2382 C  CA    . THR A 1 326 ? -25.737 -25.797 24.496 1.00 36.17  ? 326  THR A CA    1 
ATOM   2383 C  C     . THR A 1 326 ? -25.379 -27.243 24.817 1.00 36.27  ? 326  THR A C     1 
ATOM   2384 O  O     . THR A 1 326 ? -26.075 -27.868 25.657 1.00 37.59  ? 326  THR A O     1 
ATOM   2385 C  CB    . THR A 1 326 ? -26.935 -25.695 23.505 1.00 37.00  ? 326  THR A CB    1 
ATOM   2386 O  OG1   . THR A 1 326 ? -26.592 -26.308 22.259 1.00 41.75  ? 326  THR A OG1   1 
ATOM   2387 C  CG2   . THR A 1 326 ? -27.316 -24.202 23.231 1.00 32.58  ? 326  THR A CG2   1 
ATOM   2388 N  N     . VAL A 1 327 ? -24.294 -27.776 24.235 1.00 32.37  ? 327  VAL A N     1 
ATOM   2389 C  CA    . VAL A 1 327 ? -23.854 -29.144 24.634 1.00 30.53  ? 327  VAL A CA    1 
ATOM   2390 C  C     . VAL A 1 327 ? -22.497 -29.068 25.426 1.00 30.58  ? 327  VAL A C     1 
ATOM   2391 O  O     . VAL A 1 327 ? -22.427 -29.442 26.590 1.00 28.93  ? 327  VAL A O     1 
ATOM   2392 C  CB    . VAL A 1 327 ? -23.831 -30.185 23.403 1.00 31.13  ? 327  VAL A CB    1 
ATOM   2393 C  CG1   . VAL A 1 327 ? -23.276 -31.533 23.832 1.00 28.21  ? 327  VAL A CG1   1 
ATOM   2394 C  CG2   . VAL A 1 327 ? -25.312 -30.396 22.755 1.00 31.45  ? 327  VAL A CG2   1 
ATOM   2395 N  N     . LEU A 1 328 ? -21.457 -28.499 24.794 1.00 27.70  ? 328  LEU A N     1 
ATOM   2396 C  CA    . LEU A 1 328 ? -20.120 -28.533 25.384 1.00 25.75  ? 328  LEU A CA    1 
ATOM   2397 C  C     . LEU A 1 328 ? -19.561 -27.141 25.456 1.00 24.41  ? 328  LEU A C     1 
ATOM   2398 O  O     . LEU A 1 328 ? -19.557 -26.413 24.468 1.00 23.72  ? 328  LEU A O     1 
ATOM   2399 C  CB    . LEU A 1 328 ? -19.215 -29.485 24.591 1.00 25.02  ? 328  LEU A CB    1 
ATOM   2400 C  CG    . LEU A 1 328 ? -17.811 -29.744 25.194 1.00 23.59  ? 328  LEU A CG    1 
ATOM   2401 C  CD1   . LEU A 1 328 ? -17.944 -30.746 26.301 1.00 16.28  ? 328  LEU A CD1   1 
ATOM   2402 C  CD2   . LEU A 1 328 ? -16.916 -30.233 24.085 1.00 17.90  ? 328  LEU A CD2   1 
ATOM   2403 N  N     . GLN A 1 329 ? -19.217 -26.736 26.666 1.00 23.37  ? 329  GLN A N     1 
ATOM   2404 C  CA    . GLN A 1 329 ? -18.745 -25.360 26.905 1.00 25.24  ? 329  GLN A CA    1 
ATOM   2405 C  C     . GLN A 1 329 ? -17.244 -25.252 27.124 1.00 23.87  ? 329  GLN A C     1 
ATOM   2406 O  O     . GLN A 1 329 ? -16.719 -25.878 28.046 1.00 24.85  ? 329  GLN A O     1 
ATOM   2407 C  CB    . GLN A 1 329 ? -19.479 -24.797 28.171 1.00 24.21  ? 329  GLN A CB    1 
ATOM   2408 C  CG    . GLN A 1 329 ? -21.037 -24.813 27.924 1.00 29.21  ? 329  GLN A CG    1 
ATOM   2409 C  CD    . GLN A 1 329 ? -21.803 -24.333 29.183 1.00 36.62  ? 329  GLN A CD    1 
ATOM   2410 O  OE1   . GLN A 1 329 ? -21.192 -23.885 30.166 1.00 31.86  ? 329  GLN A OE1   1 
ATOM   2411 N  NE2   . GLN A 1 329 ? -23.135 -24.380 29.121 1.00 37.00  ? 329  GLN A NE2   1 
ATOM   2412 N  N     . GLY A 1 330 ? -16.577 -24.419 26.348 1.00 23.77  ? 330  GLY A N     1 
ATOM   2413 C  CA    . GLY A 1 330 ? -15.168 -24.090 26.639 1.00 21.69  ? 330  GLY A CA    1 
ATOM   2414 C  C     . GLY A 1 330 ? -14.216 -25.138 26.136 1.00 21.22  ? 330  GLY A C     1 
ATOM   2415 O  O     . GLY A 1 330 ? -13.323 -25.463 26.892 1.00 21.94  ? 330  GLY A O     1 
ATOM   2416 N  N     . SER A 1 331 ? -14.389 -25.674 24.893 1.00 19.76  ? 331  SER A N     1 
ATOM   2417 C  CA    . SER A 1 331 ? -13.494 -26.710 24.400 1.00 19.61  ? 331  SER A CA    1 
ATOM   2418 C  C     . SER A 1 331 ? -12.003 -26.133 24.392 1.00 20.62  ? 331  SER A C     1 
ATOM   2419 O  O     . SER A 1 331 ? -11.753 -24.999 23.922 1.00 18.98  ? 331  SER A O     1 
ATOM   2420 C  CB    . SER A 1 331 ? -13.867 -27.087 22.977 1.00 17.59  ? 331  SER A CB    1 
ATOM   2421 O  OG    . SER A 1 331 ? -13.797 -25.948 22.125 1.00 19.79  ? 331  SER A OG    1 
ATOM   2422 N  N     . THR A 1 332 ? -11.067 -26.903 24.932 1.00 19.46  ? 332  THR A N     1 
ATOM   2423 C  CA    . THR A 1 332 ? -9.655  -26.531 24.955 1.00 19.40  ? 332  THR A CA    1 
ATOM   2424 C  C     . THR A 1 332 ? -8.829  -27.543 24.130 1.00 19.37  ? 332  THR A C     1 
ATOM   2425 O  O     . THR A 1 332 ? -7.686  -27.270 23.779 1.00 19.53  ? 332  THR A O     1 
ATOM   2426 C  CB    . THR A 1 332 ? -9.152  -26.672 26.447 1.00 20.34  ? 332  THR A CB    1 
ATOM   2427 O  OG1   . THR A 1 332 ? -9.644  -27.912 27.003 1.00 19.18  ? 332  THR A OG1   1 
ATOM   2428 C  CG2   . THR A 1 332 ? -9.769  -25.610 27.231 1.00 20.33  ? 332  THR A CG2   1 
ATOM   2429 N  N     . VAL A 1 333 ? -9.376  -28.736 23.864 1.00 16.64  ? 333  VAL A N     1 
ATOM   2430 C  CA    . VAL A 1 333 ? -8.433  -29.764 23.398 1.00 17.59  ? 333  VAL A CA    1 
ATOM   2431 C  C     . VAL A 1 333 ? -9.252  -30.763 22.610 1.00 16.66  ? 333  VAL A C     1 
ATOM   2432 O  O     . VAL A 1 333 ? -10.437 -30.920 22.904 1.00 16.45  ? 333  VAL A O     1 
ATOM   2433 C  CB    . VAL A 1 333 ? -7.712  -30.453 24.574 1.00 15.92  ? 333  VAL A CB    1 
ATOM   2434 C  CG1   . VAL A 1 333 ? -8.745  -31.248 25.508 1.00 11.63  ? 333  VAL A CG1   1 
ATOM   2435 C  CG2   . VAL A 1 333 ? -6.568  -31.364 24.102 1.00 14.59  ? 333  VAL A CG2   1 
ATOM   2436 N  N     . ALA A 1 334 ? -8.644  -31.349 21.602 1.00 17.78  ? 334  ALA A N     1 
ATOM   2437 C  CA    . ALA A 1 334 ? -9.319  -32.362 20.769 1.00 18.40  ? 334  ALA A CA    1 
ATOM   2438 C  C     . ALA A 1 334 ? -8.291  -33.267 20.219 1.00 20.04  ? 334  ALA A C     1 
ATOM   2439 O  O     . ALA A 1 334 ? -7.259  -32.794 19.716 1.00 21.24  ? 334  ALA A O     1 
ATOM   2440 C  CB    . ALA A 1 334 ? -10.045 -31.634 19.585 1.00 19.34  ? 334  ALA A CB    1 
ATOM   2441 N  N     . ALA A 1 335 ? -8.546  -34.564 20.270 1.00 19.45  ? 335  ALA A N     1 
ATOM   2442 C  CA    . ALA A 1 335 ? -7.705  -35.487 19.625 1.00 20.63  ? 335  ALA A CA    1 
ATOM   2443 C  C     . ALA A 1 335 ? -8.521  -36.660 19.002 1.00 20.80  ? 335  ALA A C     1 
ATOM   2444 O  O     . ALA A 1 335 ? -9.639  -36.945 19.429 1.00 21.59  ? 335  ALA A O     1 
ATOM   2445 C  CB    . ALA A 1 335 ? -6.679  -36.059 20.651 1.00 19.58  ? 335  ALA A CB    1 
ATOM   2446 N  N     . VAL A 1 336 ? -7.903  -37.349 18.032 1.00 20.41  ? 336  VAL A N     1 
ATOM   2447 C  CA    . VAL A 1 336 ? -8.589  -38.385 17.330 1.00 22.54  ? 336  VAL A CA    1 
ATOM   2448 C  C     . VAL A 1 336 ? -7.903  -39.708 17.493 1.00 23.25  ? 336  VAL A C     1 
ATOM   2449 O  O     . VAL A 1 336 ? -6.633  -39.792 17.565 1.00 21.98  ? 336  VAL A O     1 
ATOM   2450 C  CB    . VAL A 1 336 ? -8.767  -38.086 15.788 1.00 21.90  ? 336  VAL A CB    1 
ATOM   2451 C  CG1   . VAL A 1 336 ? -9.741  -36.881 15.661 1.00 20.72  ? 336  VAL A CG1   1 
ATOM   2452 C  CG2   . VAL A 1 336 ? -7.480  -37.783 15.116 1.00 21.88  ? 336  VAL A CG2   1 
ATOM   2453 N  N     . TYR A 1 337 ? -8.744  -40.734 17.449 1.00 22.33  ? 337  TYR A N     1 
ATOM   2454 C  CA    . TYR A 1 337 ? -8.257  -42.106 17.539 1.00 23.71  ? 337  TYR A CA    1 
ATOM   2455 C  C     . TYR A 1 337 ? -9.221  -43.007 16.765 1.00 24.31  ? 337  TYR A C     1 
ATOM   2456 O  O     . TYR A 1 337 ? -10.397 -43.085 17.100 1.00 25.43  ? 337  TYR A O     1 
ATOM   2457 C  CB    . TYR A 1 337 ? -8.241  -42.524 19.017 1.00 21.58  ? 337  TYR A CB    1 
ATOM   2458 C  CG    . TYR A 1 337 ? -7.738  -43.965 19.208 1.00 27.51  ? 337  TYR A CG    1 
ATOM   2459 C  CD1   . TYR A 1 337 ? -6.412  -44.293 18.991 1.00 25.85  ? 337  TYR A CD1   1 
ATOM   2460 C  CD2   . TYR A 1 337 ? -8.638  -45.011 19.553 1.00 26.98  ? 337  TYR A CD2   1 
ATOM   2461 C  CE1   . TYR A 1 337 ? -5.975  -45.610 19.113 1.00 27.44  ? 337  TYR A CE1   1 
ATOM   2462 C  CE2   . TYR A 1 337 ? -8.153  -46.377 19.722 1.00 29.10  ? 337  TYR A CE2   1 
ATOM   2463 C  CZ    . TYR A 1 337 ? -6.814  -46.614 19.496 1.00 27.56  ? 337  TYR A CZ    1 
ATOM   2464 O  OH    . TYR A 1 337 ? -6.305  -47.891 19.675 1.00 30.56  ? 337  TYR A OH    1 
ATOM   2465 N  N     . LYS A 1 338 ? -8.747  -43.595 15.678 1.00 27.07  ? 338  LYS A N     1 
ATOM   2466 C  CA    . LYS A 1 338 ? -9.522  -44.569 14.877 1.00 26.70  ? 338  LYS A CA    1 
ATOM   2467 C  C     . LYS A 1 338 ? -10.959 -44.116 14.584 1.00 27.43  ? 338  LYS A C     1 
ATOM   2468 O  O     . LYS A 1 338 ? -11.884 -44.872 14.822 1.00 24.02  ? 338  LYS A O     1 
ATOM   2469 C  CB    . LYS A 1 338 ? -9.568  -45.882 15.646 1.00 26.34  ? 338  LYS A CB    1 
ATOM   2470 C  CG    . LYS A 1 338 ? -8.105  -46.492 15.679 1.00 29.88  ? 338  LYS A CG    1 
ATOM   2471 C  CD    . LYS A 1 338 ? -8.169  -47.931 16.228 1.00 35.82  ? 338  LYS A CD    1 
ATOM   2472 C  CE    . LYS A 1 338 ? -6.752  -48.478 16.606 1.00 38.08  ? 338  LYS A CE    1 
ATOM   2473 N  NZ    . LYS A 1 338 ? -5.795  -48.398 15.534 1.00 34.89  ? 338  LYS A NZ    1 
ATOM   2474 N  N     . GLY A 1 339 ? -11.126 -42.889 14.089 1.00 26.46  ? 339  GLY A N     1 
ATOM   2475 C  CA    . GLY A 1 339 ? -12.452 -42.409 13.613 1.00 25.84  ? 339  GLY A CA    1 
ATOM   2476 C  C     . GLY A 1 339 ? -13.278 -41.702 14.666 1.00 26.84  ? 339  GLY A C     1 
ATOM   2477 O  O     . GLY A 1 339 ? -14.385 -41.222 14.399 1.00 24.40  ? 339  GLY A O     1 
ATOM   2478 N  N     . LYS A 1 340 ? -12.755 -41.680 15.897 1.00 26.79  ? 340  LYS A N     1 
ATOM   2479 C  CA    . LYS A 1 340 ? -13.423 -40.978 16.995 1.00 27.68  ? 340  LYS A CA    1 
ATOM   2480 C  C     . LYS A 1 340 ? -12.601 -39.707 17.405 1.00 27.44  ? 340  LYS A C     1 
ATOM   2481 O  O     . LYS A 1 340 ? -11.339 -39.661 17.315 1.00 26.90  ? 340  LYS A O     1 
ATOM   2482 C  CB    . LYS A 1 340 ? -13.528 -41.913 18.178 1.00 28.84  ? 340  LYS A CB    1 
ATOM   2483 C  CG    . LYS A 1 340 ? -14.155 -43.318 17.745 1.00 34.45  ? 340  LYS A CG    1 
ATOM   2484 C  CD    . LYS A 1 340 ? -15.618 -43.134 17.848 1.00 38.03  ? 340  LYS A CD    1 
ATOM   2485 C  CE    . LYS A 1 340 ? -16.382 -44.519 18.021 1.00 52.27  ? 340  LYS A CE    1 
ATOM   2486 N  N     . LEU A 1 341 ? -13.344 -38.769 17.932 1.00 24.01  ? 341  LEU A N     1 
ATOM   2487 C  CA    . LEU A 1 341 ? -12.894 -37.503 18.304 1.00 23.81  ? 341  LEU A CA    1 
ATOM   2488 C  C     . LEU A 1 341 ? -13.313 -37.311 19.756 1.00 23.64  ? 341  LEU A C     1 
ATOM   2489 O  O     . LEU A 1 341 ? -14.503 -37.428 20.101 1.00 22.02  ? 341  LEU A O     1 
ATOM   2490 C  CB    . LEU A 1 341 ? -13.522 -36.432 17.450 1.00 21.53  ? 341  LEU A CB    1 
ATOM   2491 C  CG    . LEU A 1 341 ? -13.198 -34.951 17.868 1.00 23.60  ? 341  LEU A CG    1 
ATOM   2492 C  CD1   . LEU A 1 341 ? -11.773 -34.523 17.488 1.00 20.91  ? 341  LEU A CD1   1 
ATOM   2493 C  CD2   . LEU A 1 341 ? -14.163 -33.997 17.129 1.00 19.82  ? 341  LEU A CD2   1 
ATOM   2494 N  N     . LEU A 1 342 ? -12.320 -37.020 20.590 1.00 19.43  ? 342  LEU A N     1 
ATOM   2495 C  CA    . LEU A 1 342 ? -12.581 -36.715 22.013 1.00 19.09  ? 342  LEU A CA    1 
ATOM   2496 C  C     . LEU A 1 342 ? -12.239 -35.224 22.252 1.00 19.79  ? 342  LEU A C     1 
ATOM   2497 O  O     . LEU A 1 342 ? -11.149 -34.763 21.854 1.00 19.84  ? 342  LEU A O     1 
ATOM   2498 C  CB    . LEU A 1 342 ? -11.643 -37.635 22.833 1.00 17.91  ? 342  LEU A CB    1 
ATOM   2499 C  CG    . LEU A 1 342 ? -11.762 -37.534 24.393 1.00 23.06  ? 342  LEU A CG    1 
ATOM   2500 C  CD1   . LEU A 1 342 ? -13.201 -37.839 24.822 1.00 25.77  ? 342  LEU A CD1   1 
ATOM   2501 C  CD2   . LEU A 1 342 ? -10.688 -38.546 25.060 1.00 22.91  ? 342  LEU A CD2   1 
ATOM   2502 N  N     . ILE A 1 343 ? -13.140 -34.468 22.859 1.00 18.79  ? 343  ILE A N     1 
ATOM   2503 C  CA    . ILE A 1 343 ? -12.955 -33.049 23.037 1.00 18.30  ? 343  ILE A CA    1 
ATOM   2504 C  C     . ILE A 1 343 ? -13.109 -32.729 24.500 1.00 20.48  ? 343  ILE A C     1 
ATOM   2505 O  O     . ILE A 1 343 ? -14.137 -33.146 25.111 1.00 18.42  ? 343  ILE A O     1 
ATOM   2506 C  CB    . ILE A 1 343 ? -14.055 -32.252 22.306 1.00 20.20  ? 343  ILE A CB    1 
ATOM   2507 C  CG1   . ILE A 1 343 ? -14.306 -32.823 20.874 1.00 19.90  ? 343  ILE A CG1   1 
ATOM   2508 C  CG2   . ILE A 1 343 ? -13.740 -30.705 22.302 1.00 14.25  ? 343  ILE A CG2   1 
ATOM   2509 C  CD1   . ILE A 1 343 ? -15.513 -32.040 20.121 1.00 23.24  ? 343  ILE A CD1   1 
ATOM   2510 N  N     . GLY A 1 344 ? -12.120 -31.977 25.070 1.00 18.67  ? 344  GLY A N     1 
ATOM   2511 C  CA    . GLY A 1 344 ? -12.170 -31.626 26.505 1.00 15.95  ? 344  GLY A CA    1 
ATOM   2512 C  C     . GLY A 1 344 ? -12.371 -30.137 26.667 1.00 15.66  ? 344  GLY A C     1 
ATOM   2513 O  O     . GLY A 1 344 ? -12.339 -29.363 25.657 1.00 16.68  ? 344  GLY A O     1 
ATOM   2514 N  N     . THR A 1 345 ? -12.634 -29.715 27.899 1.00 16.69  ? 345  THR A N     1 
ATOM   2515 C  CA    . THR A 1 345 ? -12.961 -28.301 28.166 1.00 17.68  ? 345  THR A CA    1 
ATOM   2516 C  C     . THR A 1 345 ? -12.240 -27.822 29.389 1.00 18.71  ? 345  THR A C     1 
ATOM   2517 O  O     . THR A 1 345 ? -11.763 -28.617 30.178 1.00 19.93  ? 345  THR A O     1 
ATOM   2518 C  CB    . THR A 1 345 ? -14.496 -28.142 28.476 1.00 20.00  ? 345  THR A CB    1 
ATOM   2519 O  OG1   . THR A 1 345 ? -14.814 -28.902 29.659 1.00 16.16  ? 345  THR A OG1   1 
ATOM   2520 C  CG2   . THR A 1 345 ? -15.316 -28.733 27.247 1.00 17.02  ? 345  THR A CG2   1 
ATOM   2521 N  N     . VAL A 1 346 ? -12.234 -26.525 29.584 1.00 21.83  ? 346  VAL A N     1 
ATOM   2522 C  CA    . VAL A 1 346 ? -11.609 -26.023 30.793 1.00 23.94  ? 346  VAL A CA    1 
ATOM   2523 C  C     . VAL A 1 346 ? -12.148 -26.528 32.143 1.00 25.48  ? 346  VAL A C     1 
ATOM   2524 O  O     . VAL A 1 346 ? -11.342 -27.045 32.981 1.00 23.99  ? 346  VAL A O     1 
ATOM   2525 C  CB    . VAL A 1 346 ? -11.256 -24.471 30.798 1.00 24.84  ? 346  VAL A CB    1 
ATOM   2526 C  CG1   . VAL A 1 346 ? -11.357 -23.662 29.553 1.00 24.53  ? 346  VAL A CG1   1 
ATOM   2527 C  CG2   . VAL A 1 346 ? -11.005 -23.840 32.099 1.00 25.21  ? 346  VAL A CG2   1 
ATOM   2528 N  N     . PHE A 1 347 ? -13.482 -26.409 32.325 1.00 25.67  ? 347  PHE A N     1 
ATOM   2529 C  CA    . PHE A 1 347 ? -14.109 -26.603 33.618 1.00 26.36  ? 347  PHE A CA    1 
ATOM   2530 C  C     . PHE A 1 347 ? -15.504 -27.290 33.456 1.00 27.20  ? 347  PHE A C     1 
ATOM   2531 O  O     . PHE A 1 347 ? -16.238 -27.311 34.399 1.00 27.01  ? 347  PHE A O     1 
ATOM   2532 C  CB    . PHE A 1 347 ? -14.257 -25.261 34.359 1.00 25.90  ? 347  PHE A CB    1 
ATOM   2533 C  CG    . PHE A 1 347 ? -15.041 -24.220 33.577 1.00 28.74  ? 347  PHE A CG    1 
ATOM   2534 C  CD1   . PHE A 1 347 ? -16.440 -24.342 33.400 1.00 29.17  ? 347  PHE A CD1   1 
ATOM   2535 C  CD2   . PHE A 1 347 ? -14.371 -23.170 32.951 1.00 28.35  ? 347  PHE A CD2   1 
ATOM   2536 C  CE1   . PHE A 1 347 ? -17.137 -23.380 32.634 1.00 29.34  ? 347  PHE A CE1   1 
ATOM   2537 C  CE2   . PHE A 1 347 ? -15.054 -22.214 32.151 1.00 26.74  ? 347  PHE A CE2   1 
ATOM   2538 C  CZ    . PHE A 1 347 ? -16.446 -22.320 31.999 1.00 31.09  ? 347  PHE A CZ    1 
ATOM   2539 N  N     . HIS A 1 348 ? -15.824 -27.885 32.292 1.00 25.50  ? 348  HIS A N     1 
ATOM   2540 C  CA    . HIS A 1 348 ? -17.185 -28.366 32.026 1.00 25.72  ? 348  HIS A CA    1 
ATOM   2541 C  C     . HIS A 1 348 ? -17.115 -29.870 31.731 1.00 23.56  ? 348  HIS A C     1 
ATOM   2542 O  O     . HIS A 1 348 ? -16.611 -30.660 32.501 1.00 23.78  ? 348  HIS A O     1 
ATOM   2543 C  CB    . HIS A 1 348 ? -17.748 -27.544 30.839 1.00 25.62  ? 348  HIS A CB    1 
ATOM   2544 C  CG    . HIS A 1 348 ? -19.211 -27.741 30.544 1.00 28.41  ? 348  HIS A CG    1 
ATOM   2545 N  ND1   . HIS A 1 348 ? -19.658 -28.284 29.353 1.00 25.68  ? 348  HIS A ND1   1 
ATOM   2546 C  CD2   . HIS A 1 348 ? -20.331 -27.424 31.265 1.00 27.42  ? 348  HIS A CD2   1 
ATOM   2547 C  CE1   . HIS A 1 348 ? -20.992 -28.307 29.355 1.00 27.23  ? 348  HIS A CE1   1 
ATOM   2548 N  NE2   . HIS A 1 348 ? -21.416 -27.787 30.497 1.00 29.47  ? 348  HIS A NE2   1 
ATOM   2549 N  N     . LYS A 1 349 ? -17.594 -30.274 30.576 1.00 23.93  ? 349  LYS A N     1 
ATOM   2550 C  CA    . LYS A 1 349 ? -17.693 -31.693 30.272 1.00 23.47  ? 349  LYS A CA    1 
ATOM   2551 C  C     . LYS A 1 349 ? -16.702 -32.087 29.235 1.00 22.72  ? 349  LYS A C     1 
ATOM   2552 O  O     . LYS A 1 349 ? -15.776 -31.361 28.998 1.00 23.86  ? 349  LYS A O     1 
ATOM   2553 C  CB    . LYS A 1 349 ? -19.121 -31.961 29.782 1.00 26.02  ? 349  LYS A CB    1 
ATOM   2554 C  CG    . LYS A 1 349 ? -20.131 -31.620 30.900 1.00 31.20  ? 349  LYS A CG    1 
ATOM   2555 C  CD    . LYS A 1 349 ? -21.628 -31.895 30.450 1.00 29.43  ? 349  LYS A CD    1 
ATOM   2556 C  CE    . LYS A 1 349 ? -22.563 -31.394 31.600 1.00 33.85  ? 349  LYS A CE    1 
ATOM   2557 N  NZ    . LYS A 1 349 ? -23.976 -31.211 31.029 1.00 37.16  ? 349  LYS A NZ    1 
ATOM   2558 N  N     . ALA A 1 350 ? -16.825 -33.284 28.706 1.00 21.54  ? 350  ALA A N     1 
ATOM   2559 C  CA    . ALA A 1 350 ? -16.038 -33.762 27.570 1.00 22.28  ? 350  ALA A CA    1 
ATOM   2560 C  C     . ALA A 1 350 ? -17.039 -34.432 26.549 1.00 23.45  ? 350  ALA A C     1 
ATOM   2561 O  O     . ALA A 1 350 ? -18.069 -34.990 26.949 1.00 24.70  ? 350  ALA A O     1 
ATOM   2562 C  CB    . ALA A 1 350 ? -15.025 -34.830 28.063 1.00 18.11  ? 350  ALA A CB    1 
ATOM   2563 N  N     . LEU A 1 351 ? -16.723 -34.396 25.262 1.00 24.34  ? 351  LEU A N     1 
ATOM   2564 C  CA    . LEU A 1 351 ? -17.585 -34.955 24.233 1.00 25.69  ? 351  LEU A CA    1 
ATOM   2565 C  C     . LEU A 1 351 ? -16.821 -36.029 23.454 1.00 25.88  ? 351  LEU A C     1 
ATOM   2566 O  O     . LEU A 1 351 ? -15.657 -35.806 23.122 1.00 27.26  ? 351  LEU A O     1 
ATOM   2567 C  CB    . LEU A 1 351 ? -18.052 -33.837 23.325 1.00 24.14  ? 351  LEU A CB    1 
ATOM   2568 C  CG    . LEU A 1 351 ? -19.296 -33.974 22.464 1.00 28.95  ? 351  LEU A CG    1 
ATOM   2569 C  CD1   . LEU A 1 351 ? -20.582 -34.312 23.295 1.00 24.30  ? 351  LEU A CD1   1 
ATOM   2570 C  CD2   . LEU A 1 351 ? -19.519 -32.633 21.665 1.00 26.58  ? 351  LEU A CD2   1 
ATOM   2571 N  N     . TYR A 1 352 ? -17.437 -37.187 23.175 1.00 23.23  ? 352  TYR A N     1 
ATOM   2572 C  CA    . TYR A 1 352 ? -16.831 -38.229 22.304 1.00 25.01  ? 352  TYR A CA    1 
ATOM   2573 C  C     . TYR A 1 352 ? -17.756 -38.443 21.066 1.00 27.59  ? 352  TYR A C     1 
ATOM   2574 O  O     . TYR A 1 352 ? -19.017 -38.675 21.220 1.00 28.26  ? 352  TYR A O     1 
ATOM   2575 C  CB    . TYR A 1 352 ? -16.751 -39.529 23.121 1.00 23.56  ? 352  TYR A CB    1 
ATOM   2576 C  CG    . TYR A 1 352 ? -15.916 -40.647 22.577 1.00 26.61  ? 352  TYR A CG    1 
ATOM   2577 C  CD1   . TYR A 1 352 ? -14.604 -40.407 22.213 1.00 28.30  ? 352  TYR A CD1   1 
ATOM   2578 C  CD2   . TYR A 1 352 ? -16.413 -41.988 22.471 1.00 25.38  ? 352  TYR A CD2   1 
ATOM   2579 C  CE1   . TYR A 1 352 ? -13.831 -41.403 21.717 1.00 26.82  ? 352  TYR A CE1   1 
ATOM   2580 C  CE2   . TYR A 1 352 ? -15.585 -43.032 21.986 1.00 28.00  ? 352  TYR A CE2   1 
ATOM   2581 C  CZ    . TYR A 1 352 ? -14.282 -42.721 21.660 1.00 28.52  ? 352  TYR A CZ    1 
ATOM   2582 O  OH    . TYR A 1 352 ? -13.340 -43.633 21.195 1.00 33.14  ? 352  TYR A OH    1 
ATOM   2583 N  N     . CYS A 1 353 ? -17.164 -38.414 19.878 1.00 27.67  ? 353  CYS A N     1 
ATOM   2584 C  CA    . CYS A 1 353 ? -17.894 -38.191 18.603 1.00 30.83  ? 353  CYS A CA    1 
ATOM   2585 C  C     . CYS A 1 353 ? -17.301 -39.100 17.583 1.00 30.39  ? 353  CYS A C     1 
ATOM   2586 O  O     . CYS A 1 353 ? -16.082 -39.289 17.566 1.00 29.05  ? 353  CYS A O     1 
ATOM   2587 C  CB    . CYS A 1 353 ? -17.662 -36.747 18.005 1.00 29.79  ? 353  CYS A CB    1 
ATOM   2588 S  SG    . CYS A 1 353 ? -18.230 -35.346 19.066 1.00 37.51  ? 353  CYS A SG    1 
ATOM   2589 N  N     . ASP A 1 354 ? -18.148 -39.574 16.679 1.00 29.97  ? 354  ASP A N     1 
ATOM   2590 C  CA    . ASP A 1 354 ? -17.727 -40.180 15.411 1.00 32.07  ? 354  ASP A CA    1 
ATOM   2591 C  C     . ASP A 1 354 ? -17.324 -39.080 14.514 1.00 32.37  ? 354  ASP A C     1 
ATOM   2592 O  O     . ASP A 1 354 ? -17.963 -38.045 14.513 1.00 33.84  ? 354  ASP A O     1 
ATOM   2593 C  CB    . ASP A 1 354 ? -18.932 -40.924 14.754 1.00 31.83  ? 354  ASP A CB    1 
ATOM   2594 C  CG    . ASP A 1 354 ? -19.292 -42.212 15.503 1.00 38.71  ? 354  ASP A CG    1 
ATOM   2595 O  OD1   . ASP A 1 354 ? -18.421 -42.840 16.169 1.00 42.77  ? 354  ASP A OD1   1 
ATOM   2596 O  OD2   . ASP A 1 354 ? -20.453 -42.609 15.440 1.00 47.77  ? 354  ASP A OD2   1 
ATOM   2597 N  N     . LEU A 1 355 ? -16.307 -39.274 13.721 1.00 34.56  ? 355  LEU A N     1 
ATOM   2598 C  CA    . LEU A 1 355 ? -15.951 -38.247 12.772 1.00 40.55  ? 355  LEU A CA    1 
ATOM   2599 C  C     . LEU A 1 355 ? -16.867 -38.237 11.474 1.00 44.36  ? 355  LEU A C     1 
ATOM   2600 O  O     . LEU A 1 355 ? -17.017 -37.159 10.784 1.00 45.64  ? 355  LEU A O     1 
ATOM   2601 C  CB    . LEU A 1 355 ? -14.548 -38.499 12.275 1.00 39.37  ? 355  LEU A CB    1 
ATOM   2602 C  CG    . LEU A 1 355 ? -13.353 -37.686 12.801 1.00 41.18  ? 355  LEU A CG    1 
ATOM   2603 C  CD1   . LEU A 1 355 ? -13.643 -36.319 13.504 1.00 33.49  ? 355  LEU A CD1   1 
ATOM   2604 C  CD2   . LEU A 1 355 ? -12.386 -38.540 13.561 1.00 36.68  ? 355  LEU A CD2   1 
ATOM   2605 O  OXT   . LEU A 1 355 ? -17.364 -39.333 11.060 1.00 45.19  ? 355  LEU A OXT   1 
HETATM 2606 CA CA    . CA  B 2 .   ? -0.546  -31.016 26.368 1.00 19.59  ? 1356 CA  A CA    1 
HETATM 2607 CA CA    . CA  C 2 .   ? -4.286  -24.818 27.608 1.00 21.58  ? 1357 CA  A CA    1 
HETATM 2608 O  O1    . OCH D 3 .   ? -5.294  -23.487 29.326 1.00 27.31  ? 1358 OCH A O1    1 
HETATM 2609 N  N2    . OCH D 3 .   ? -6.867  -21.958 28.720 1.00 33.19  ? 1358 OCH A N2    1 
HETATM 2610 C  C3    . OCH D 3 .   ? -7.710  -20.932 28.972 1.00 33.40  ? 1358 OCH A C3    1 
HETATM 2611 C  C4    . OCH D 3 .   ? -8.490  -20.399 27.950 1.00 28.40  ? 1358 OCH A C4    1 
HETATM 2612 C  C5    . OCH D 3 .   ? -9.366  -19.328 28.206 1.00 28.98  ? 1358 OCH A C5    1 
HETATM 2613 C  C6    . OCH D 3 .   ? -9.495  -18.822 29.509 1.00 31.24  ? 1358 OCH A C6    1 
HETATM 2614 C  C7    . OCH D 3 .   ? -8.725  -19.373 30.543 1.00 32.54  ? 1358 OCH A C7    1 
HETATM 2615 C  C8    . OCH D 3 .   ? -7.819  -20.419 30.288 1.00 34.01  ? 1358 OCH A C8    1 
HETATM 2616 C  C9    . OCH D 3 .   ? -7.017  -20.989 31.315 1.00 34.66  ? 1358 OCH A C9    1 
HETATM 2617 C  C10   . OCH D 3 .   ? -6.165  -22.072 31.004 1.00 32.82  ? 1358 OCH A C10   1 
HETATM 2618 C  C1    . OCH D 3 .   ? -6.118  -22.518 29.684 1.00 30.09  ? 1358 OCH A C1    1 
HETATM 2619 C  C1B   . LMT E 4 .   ? 2.401   -1.985  26.824 1.00 64.27  ? 356  LMT A C1B   1 
HETATM 2620 C  C2B   . LMT E 4 .   ? 1.091   -2.120  25.990 1.00 63.77  ? 356  LMT A C2B   1 
HETATM 2621 C  C3B   . LMT E 4 .   ? 0.068   -1.000  26.134 1.00 65.50  ? 356  LMT A C3B   1 
HETATM 2622 C  C4B   . LMT E 4 .   ? -0.142  -0.619  27.608 1.00 66.01  ? 356  LMT A C4B   1 
HETATM 2623 C  C5B   . LMT E 4 .   ? 1.196   -0.155  28.208 1.00 68.35  ? 356  LMT A C5B   1 
HETATM 2624 C  C6B   . LMT E 4 .   ? 1.109   0.015   29.732 1.00 73.62  ? 356  LMT A C6B   1 
HETATM 2625 O  O1B   . LMT E 4 .   ? 3.598   -1.712  26.035 1.00 62.93  ? 356  LMT A O1B   1 
HETATM 2626 O  O2B   . LMT E 4 .   ? 1.301   -2.366  24.586 1.00 60.79  ? 356  LMT A O2B   1 
HETATM 2627 O  O3B   . LMT E 4 .   ? -1.138  -1.494  25.533 1.00 64.16  ? 356  LMT A O3B   1 
HETATM 2628 O  "O4'" . LMT E 4 .   ? -1.253  0.304   27.816 1.00 62.79  ? 356  LMT A "O4'" 1 
HETATM 2629 O  O5B   . LMT E 4 .   ? 2.310   -1.059  27.967 1.00 69.23  ? 356  LMT A O5B   1 
HETATM 2630 O  O6B   . LMT E 4 .   ? 0.717   1.337   30.184 1.00 75.82  ? 356  LMT A O6B   1 
HETATM 2631 C  "C1'" . LMT E 4 .   ? 6.361   -5.066  26.121 1.00 60.09  ? 356  LMT A "C1'" 1 
HETATM 2632 C  "C2'" . LMT E 4 .   ? 6.783   -3.675  26.650 1.00 58.84  ? 356  LMT A "C2'" 1 
HETATM 2633 C  "C3'" . LMT E 4 .   ? 5.680   -2.622  26.863 1.00 61.00  ? 356  LMT A "C3'" 1 
HETATM 2634 C  "C4'" . LMT E 4 .   ? 4.628   -2.667  25.730 1.00 61.57  ? 356  LMT A "C4'" 1 
HETATM 2635 C  "C5'" . LMT E 4 .   ? 4.133   -4.136  25.424 1.00 59.21  ? 356  LMT A "C5'" 1 
HETATM 2636 C  "C6'" . LMT E 4 .   ? 3.869   -4.532  23.945 1.00 63.46  ? 356  LMT A "C6'" 1 
HETATM 2637 O  "O1'" . LMT E 4 .   ? 6.979   -5.519  24.874 1.00 67.23  ? 356  LMT A "O1'" 1 
HETATM 2638 O  "O2'" . LMT E 4 .   ? 7.192   -3.954  27.964 1.00 52.92  ? 356  LMT A "O2'" 1 
HETATM 2639 O  "O3'" . LMT E 4 .   ? 6.284   -1.328  27.168 1.00 62.46  ? 356  LMT A "O3'" 1 
HETATM 2640 O  "O5'" . LMT E 4 .   ? 4.947   -5.146  26.095 1.00 57.28  ? 356  LMT A "O5'" 1 
HETATM 2641 O  "O6'" . LMT E 4 .   ? 4.071   -5.945  23.518 1.00 62.23  ? 356  LMT A "O6'" 1 
HETATM 2642 C  C1    . LMT E 4 .   ? 8.115   -6.430  24.977 1.00 67.37  ? 356  LMT A C1    1 
HETATM 2643 BR BR    . BR  F 5 .   ? -5.154  -51.598 25.813 1.00 111.90 ? 1360 BR  A BR    1 
HETATM 2644 CL CL    . CL  G 6 .   ? 5.050   -12.664 40.808 1.00 32.30  ? 1361 CL  A CL    1 
HETATM 2645 CL CL    . CL  H 6 .   ? 3.480   -30.401 5.668  1.00 48.21  ? 1362 CL  A CL    1 
HETATM 2646 CA CA    . CA  I 2 .   ? 6.529   -13.919 19.111 1.00 74.01  ? 1363 CA  A CA    1 
HETATM 2647 O  O     . HOH J 7 .   ? -24.735 -36.988 25.493 1.00 39.11  ? 357  HOH A O     1 
HETATM 2648 O  O     . HOH J 7 .   ? -19.168 -35.102 30.349 1.00 29.32  ? 358  HOH A O     1 
HETATM 2649 O  O     . HOH J 7 .   ? -3.257  -26.614 28.951 1.00 20.57  ? 359  HOH A O     1 
HETATM 2650 O  O     . HOH J 7 .   ? -2.358  -31.072 24.469 1.00 16.38  ? 360  HOH A O     1 
HETATM 2651 O  O     . HOH J 7 .   ? -0.935  -33.131 25.057 1.00 20.99  ? 361  HOH A O     1 
HETATM 2652 O  O     . HOH J 7 .   ? -3.318  -37.394 21.655 1.00 28.57  ? 362  HOH A O     1 
HETATM 2653 O  O     . HOH J 7 .   ? -6.108  -38.805 39.749 1.00 30.00  ? 363  HOH A O     1 
HETATM 2654 O  O     . HOH J 7 .   ? -5.338  -40.649 43.837 1.00 34.04  ? 364  HOH A O     1 
HETATM 2655 O  O     . HOH J 7 .   ? 1.086   -43.506 48.483 1.00 38.02  ? 365  HOH A O     1 
HETATM 2656 O  O     . HOH J 7 .   ? 3.094   -31.578 46.556 1.00 36.50  ? 366  HOH A O     1 
HETATM 2657 O  O     . HOH J 7 .   ? -0.469  -31.049 44.423 1.00 31.01  ? 367  HOH A O     1 
HETATM 2658 O  O     . HOH J 7 .   ? -7.495  -29.915 33.953 1.00 27.88  ? 368  HOH A O     1 
HETATM 2659 O  O     . HOH J 7 .   ? 2.243   -33.661 24.368 1.00 19.44  ? 369  HOH A O     1 
HETATM 2660 O  O     . HOH J 7 .   ? 7.035   -40.702 23.599 1.00 36.22  ? 370  HOH A O     1 
HETATM 2661 O  O     . HOH J 7 .   ? 5.444   -20.709 40.135 1.00 31.70  ? 371  HOH A O     1 
HETATM 2662 O  O     . HOH J 7 .   ? 1.661   -20.087 38.406 1.00 41.67  ? 372  HOH A O     1 
HETATM 2663 O  O     . HOH J 7 .   ? 7.859   -23.514 38.590 1.00 18.54  ? 373  HOH A O     1 
HETATM 2664 O  O     . HOH J 7 .   ? 3.900   -30.228 44.046 1.00 38.00  ? 374  HOH A O     1 
HETATM 2665 O  O     . HOH J 7 .   ? 7.999   -21.133 40.195 1.00 43.94  ? 375  HOH A O     1 
HETATM 2666 O  O     . HOH J 7 .   ? 15.057  -21.623 39.346 1.00 33.36  ? 376  HOH A O     1 
HETATM 2667 O  O     . HOH J 7 .   ? -1.122  -28.406 23.431 1.00 16.88  ? 377  HOH A O     1 
HETATM 2668 O  O     . HOH J 7 .   ? 1.271   -30.872 24.905 1.00 20.62  ? 378  HOH A O     1 
HETATM 2669 O  O     . HOH J 7 .   ? 0.290   -13.412 28.377 1.00 24.70  ? 379  HOH A O     1 
HETATM 2670 O  O     . HOH J 7 .   ? 1.895   -11.281 29.126 1.00 24.33  ? 380  HOH A O     1 
HETATM 2671 O  O     . HOH J 7 .   ? -0.228  -9.685  28.349 1.00 25.95  ? 381  HOH A O     1 
HETATM 2672 O  O     . HOH J 7 .   ? 8.396   -12.584 27.158 1.00 33.62  ? 382  HOH A O     1 
HETATM 2673 O  O     . HOH J 7 .   ? 17.348  -18.370 29.128 1.00 27.92  ? 383  HOH A O     1 
HETATM 2674 O  O     . HOH J 7 .   ? -0.916  -34.836 20.779 1.00 23.99  ? 384  HOH A O     1 
HETATM 2675 O  O     . HOH J 7 .   ? 4.028   -35.632 18.077 1.00 28.84  ? 385  HOH A O     1 
HETATM 2676 O  O     . HOH J 7 .   ? 3.200   -32.321 12.547 1.00 18.95  ? 386  HOH A O     1 
HETATM 2677 O  O     . HOH J 7 .   ? 7.022   -16.985 15.851 1.00 28.87  ? 387  HOH A O     1 
HETATM 2678 O  O     . HOH J 7 .   ? 7.233   -18.687 13.889 1.00 32.73  ? 388  HOH A O     1 
HETATM 2679 O  O     . HOH J 7 .   ? 2.220   -12.706 17.661 1.00 33.04  ? 389  HOH A O     1 
HETATM 2680 O  O     . HOH J 7 .   ? -2.096  -10.128 20.952 1.00 36.78  ? 390  HOH A O     1 
HETATM 2681 O  O     . HOH J 7 .   ? -5.822  -10.598 18.676 1.00 34.91  ? 391  HOH A O     1 
HETATM 2682 O  O     . HOH J 7 .   ? 12.487  -34.797 20.181 1.00 24.18  ? 392  HOH A O     1 
HETATM 2683 O  O     . HOH J 7 .   ? 15.454  -21.029 20.896 1.00 32.68  ? 393  HOH A O     1 
HETATM 2684 O  O     . HOH J 7 .   ? 3.939   -16.760 8.240  1.00 39.51  ? 394  HOH A O     1 
HETATM 2685 O  O     . HOH J 7 .   ? -2.776  -17.926 8.399  1.00 36.99  ? 395  HOH A O     1 
HETATM 2686 O  O     . HOH J 7 .   ? -10.383 -19.593 11.992 1.00 39.43  ? 396  HOH A O     1 
HETATM 2687 O  O     . HOH J 7 .   ? -3.776  -34.819 22.569 1.00 21.72  ? 397  HOH A O     1 
HETATM 2688 O  O     . HOH J 7 .   ? -5.375  -36.486 11.481 1.00 25.65  ? 398  HOH A O     1 
HETATM 2689 O  O     . HOH J 7 .   ? -0.649  -32.803 7.805  1.00 32.11  ? 399  HOH A O     1 
HETATM 2690 O  O     . HOH J 7 .   ? -6.053  -30.155 20.809 1.00 17.99  ? 400  HOH A O     1 
HETATM 2691 O  O     . HOH J 7 .   ? -15.036 -21.387 24.583 1.00 25.83  ? 401  HOH A O     1 
HETATM 2692 O  O     . HOH J 7 .   ? -16.078 -19.118 23.734 1.00 26.33  ? 402  HOH A O     1 
HETATM 2693 O  O     . HOH J 7 .   ? -19.954 -17.144 29.651 1.00 28.09  ? 403  HOH A O     1 
HETATM 2694 O  O     . HOH J 7 .   ? -7.960  -29.538 7.400  1.00 28.86  ? 404  HOH A O     1 
HETATM 2695 O  O     . HOH J 7 .   ? -14.062 -25.239 7.633  1.00 35.45  ? 405  HOH A O     1 
HETATM 2696 O  O     . HOH J 7 .   ? -16.899 -32.270 10.602 1.00 35.49  ? 406  HOH A O     1 
HETATM 2697 O  O     . HOH J 7 .   ? -27.439 -24.716 19.479 1.00 30.53  ? 407  HOH A O     1 
HETATM 2698 O  O     . HOH J 7 .   ? -25.388 -18.898 19.694 1.00 28.51  ? 408  HOH A O     1 
HETATM 2699 O  O     . HOH J 7 .   ? -5.148  -36.051 17.278 1.00 29.30  ? 409  HOH A O     1 
HETATM 2700 O  O     . HOH J 7 .   ? -10.047 -29.349 34.014 1.00 19.33  ? 410  HOH A O     1 
HETATM 2701 O  O     . HOH J 7 .   ? -15.196 -24.900 30.231 1.00 20.92  ? 411  HOH A O     1 
HETATM 2702 O  O     . HOH J 7 .   ? -1.813  -11.792 27.786 1.00 26.49  ? 412  HOH A O     1 
HETATM 2703 O  O     . HOH J 7 .   ? 16.186  -31.753 19.009 1.00 37.99  ? 413  HOH A O     1 
HETATM 2704 O  O     . HOH J 7 .   ? 15.249  -31.743 15.611 1.00 41.11  ? 414  HOH A O     1 
HETATM 2705 O  O     . HOH J 7 .   ? 22.175  -22.751 27.125 1.00 45.35  ? 415  HOH A O     1 
HETATM 2706 O  O     . HOH J 7 .   ? -7.746  -23.792 4.542  1.00 39.30  ? 416  HOH A O     1 
HETATM 2707 O  O     . HOH J 7 .   ? -12.733 -20.614 12.933 1.00 47.30  ? 417  HOH A O     1 
HETATM 2708 O  O     . HOH J 7 .   ? -17.723 -22.312 12.910 1.00 44.51  ? 418  HOH A O     1 
HETATM 2709 O  O     . HOH J 7 .   ? -18.151 -19.080 12.722 1.00 42.25  ? 419  HOH A O     1 
HETATM 2710 O  O     . HOH J 7 .   ? -19.641 -13.970 14.226 1.00 36.31  ? 420  HOH A O     1 
HETATM 2711 O  O     . HOH J 7 .   ? -14.728 -9.795  17.382 1.00 52.87  ? 421  HOH A O     1 
HETATM 2712 O  O     . HOH J 7 .   ? -4.396  -38.636 16.812 1.00 29.02  ? 422  HOH A O     1 
HETATM 2713 O  O     . HOH J 7 .   ? 0.973   -31.451 8.788  1.00 52.52  ? 423  HOH A O     1 
HETATM 2714 O  O     . HOH J 7 .   ? -22.616 -18.304 19.272 1.00 33.12  ? 424  HOH A O     1 
HETATM 2715 O  O     . HOH J 7 .   ? -15.660 -26.987 37.124 1.00 30.15  ? 425  HOH A O     1 
HETATM 2716 O  O     . HOH J 7 .   ? -4.994  -39.512 11.030 1.00 33.20  ? 426  HOH A O     1 
HETATM 2717 O  O     . HOH J 7 .   ? -5.986  -38.830 8.640  1.00 35.95  ? 427  HOH A O     1 
HETATM 2718 O  O     . HOH J 7 .   ? 11.210  -15.139 20.405 1.00 26.31  ? 428  HOH A O     1 
HETATM 2719 O  O     . HOH J 7 .   ? 10.638  -16.176 18.420 1.00 33.95  ? 429  HOH A O     1 
HETATM 2720 O  O     . HOH J 7 .   ? -11.222 -21.343 39.312 1.00 44.37  ? 430  HOH A O     1 
HETATM 2721 O  O     . HOH J 7 .   ? -14.969 -16.383 34.608 1.00 37.25  ? 431  HOH A O     1 
HETATM 2722 O  O     . HOH J 7 .   ? -14.728 -18.576 33.285 1.00 35.26  ? 432  HOH A O     1 
HETATM 2723 O  O     . HOH J 7 .   ? -12.715 -27.349 37.161 1.00 42.82  ? 433  HOH A O     1 
HETATM 2724 O  O     . HOH J 7 .   ? -12.254 -32.476 40.570 1.00 45.67  ? 434  HOH A O     1 
HETATM 2725 O  O     . HOH J 7 .   ? -12.511 -34.214 38.282 1.00 50.84  ? 435  HOH A O     1 
HETATM 2726 O  O     . HOH J 7 .   ? -10.500 -17.217 41.043 1.00 41.41  ? 436  HOH A O     1 
HETATM 2727 O  O     . HOH J 7 .   ? -4.998  -13.601 33.276 1.00 52.04  ? 437  HOH A O     1 
HETATM 2728 O  O     . HOH J 7 .   ? 19.769  -30.611 27.020 1.00 55.41  ? 438  HOH A O     1 
HETATM 2729 O  O     . HOH J 7 .   ? 5.735   -8.372  23.596 1.00 38.64  ? 439  HOH A O     1 
HETATM 2730 O  O     . HOH J 7 .   ? 5.750   -9.294  21.405 1.00 44.20  ? 440  HOH A O     1 
HETATM 2731 O  O     . HOH J 7 .   ? -7.471  -28.565 43.436 1.00 47.99  ? 441  HOH A O     1 
HETATM 2732 O  O     . HOH J 7 .   ? -2.696  -45.884 17.012 1.00 43.52  ? 442  HOH A O     1 
HETATM 2733 O  O     . HOH J 7 .   ? -14.534 -33.284 35.470 1.00 35.69  ? 443  HOH A O     1 
HETATM 2734 O  O     . HOH J 7 .   ? -16.613 -34.270 37.408 1.00 37.46  ? 444  HOH A O     1 
HETATM 2735 O  O     . HOH J 7 .   ? -12.679 -29.807 40.752 1.00 46.64  ? 445  HOH A O     1 
HETATM 2736 O  O     . HOH J 7 .   ? -13.890 -27.972 40.016 1.00 42.32  ? 446  HOH A O     1 
HETATM 2737 O  O     . HOH J 7 .   ? -21.540 -36.955 34.109 1.00 49.56  ? 447  HOH A O     1 
HETATM 2738 O  O     . HOH J 7 .   ? -20.066 -42.000 28.975 1.00 40.05  ? 448  HOH A O     1 
HETATM 2739 O  O     . HOH J 7 .   ? -17.685 -42.462 31.787 1.00 39.49  ? 449  HOH A O     1 
HETATM 2740 O  O     . HOH J 7 .   ? -14.614 -45.997 20.799 1.00 37.19  ? 450  HOH A O     1 
HETATM 2741 O  O     . HOH J 7 .   ? -11.011 -23.337 36.260 1.00 40.53  ? 451  HOH A O     1 
HETATM 2742 O  O     . HOH J 7 .   ? -12.621 -46.689 29.420 1.00 45.34  ? 452  HOH A O     1 
HETATM 2743 O  O     . HOH J 7 .   ? -11.087 -46.923 32.367 1.00 52.95  ? 453  HOH A O     1 
HETATM 2744 O  O     . HOH J 7 .   ? -1.116  -21.402 33.834 1.00 27.82  ? 454  HOH A O     1 
HETATM 2745 O  O     . HOH J 7 .   ? -1.385  -20.605 36.543 1.00 35.50  ? 455  HOH A O     1 
HETATM 2746 O  O     . HOH J 7 .   ? -2.067  -20.088 38.748 1.00 38.81  ? 456  HOH A O     1 
HETATM 2747 O  O     . HOH J 7 .   ? -4.018  -5.993  20.685 1.00 60.34  ? 457  HOH A O     1 
HETATM 2748 O  O     . HOH J 7 .   ? -11.386 -33.160 8.147  1.00 35.02  ? 458  HOH A O     1 
HETATM 2749 O  O     . HOH J 7 .   ? -24.448 -30.081 28.473 1.00 34.63  ? 459  HOH A O     1 
HETATM 2750 O  O     . HOH J 7 .   ? -24.394 -28.104 30.496 1.00 47.16  ? 460  HOH A O     1 
HETATM 2751 O  O     . HOH J 7 .   ? -18.315 -18.961 22.125 1.00 18.60  ? 461  HOH A O     1 
HETATM 2752 O  O     . HOH J 7 .   ? -0.286  -15.174 10.097 1.00 37.90  ? 462  HOH A O     1 
HETATM 2753 O  O     . HOH J 7 .   ? 21.992  -32.196 21.520 1.00 46.74  ? 463  HOH A O     1 
HETATM 2754 O  O     . HOH J 7 .   ? 13.033  -36.811 22.328 1.00 43.89  ? 464  HOH A O     1 
HETATM 2755 O  O     . HOH J 7 .   ? 6.664   -35.389 11.046 1.00 40.12  ? 465  HOH A O     1 
HETATM 2756 O  O     . HOH J 7 .   ? -15.654 -34.982 10.127 1.00 50.72  ? 466  HOH A O     1 
HETATM 2757 O  O     . HOH J 7 .   ? -21.312 -19.292 21.627 1.00 51.44  ? 467  HOH A O     1 
HETATM 2758 O  O     . HOH J 7 .   ? -22.707 -29.427 9.901  1.00 38.65  ? 468  HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   LYS 3   3   ?   ?   ?   A . n 
A 1 4   LEU 4   4   ?   ?   ?   A . n 
A 1 5   THR 5   5   ?   ?   ?   A . n 
A 1 6   ALA 6   6   ?   ?   ?   A . n 
A 1 7   LEU 7   7   ?   ?   ?   A . n 
A 1 8   THR 8   8   ?   ?   ?   A . n 
A 1 9   LEU 9   9   ?   ?   ?   A . n 
A 1 10  LEU 10  10  ?   ?   ?   A . n 
A 1 11  GLY 11  11  ?   ?   ?   A . n 
A 1 12  MET 12  12  ?   ?   ?   A . n 
A 1 13  GLY 13  13  ?   ?   ?   A . n 
A 1 14  LEU 14  14  ?   ?   ?   A . n 
A 1 15  ALA 15  15  ?   ?   ?   A . n 
A 1 16  LEU 16  16  ?   ?   ?   A . n 
A 1 17  PHE 17  17  ?   ?   ?   A . n 
A 1 18  ASP 18  18  ?   ?   ?   A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  GLN 20  20  20  GLN GLN A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  PHE 24  24  24  PHE PHE A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  ASN 29  29  29  ASN ASN A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  VAL 37  37  37  VAL VAL A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  ASN 41  41  41  ASN ASN A . n 
A 1 42  CYS 42  42  42  CYS CYS A . n 
A 1 43  ASN 43  43  43  ASN ASN A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  PRO 72  72  72  PRO PRO A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  ILE 74  74  74  ILE ILE A . n 
A 1 75  MET 75  75  75  MET MET A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  ASP 80  80  80  ASP ASP A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  ILE 85  85  85  ILE ILE A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  MET 88  88  88  MET MET A . n 
A 1 89  ASP 89  89  89  ASP ASP A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 ILE 109 109 109 ILE ILE A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 HIS 115 115 115 HIS HIS A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ILE 117 117 117 ILE ILE A . n 
A 1 118 SER 118 118 118 SER SER A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 ASP 124 124 124 ASP ASP A . n 
A 1 125 ASN 125 125 125 ASN ASN A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 TYR 128 128 128 TYR TYR A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 ASN 133 133 133 ASN ASN A . n 
A 1 134 HIS 134 134 134 HIS HIS A . n 
A 1 135 PRO 135 135 135 PRO PRO A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 THR 140 140 140 THR THR A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 VAL 143 143 143 VAL VAL A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 LYS 145 145 145 LYS LYS A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 GLN 147 147 147 GLN GLN A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 LEU 154 154 154 LEU LEU A . n 
A 1 155 HIS 155 155 155 HIS HIS A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 LYS 157 157 157 LYS LYS A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 HIS 161 161 161 HIS HIS A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 ASN 168 168 168 ASN ASN A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 ILE 170 170 170 ILE ILE A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 PRO 175 175 175 PRO PRO A . n 
A 1 176 GLU 176 176 176 GLU GLU A . n 
A 1 177 HIS 177 177 177 HIS HIS A . n 
A 1 178 PHE 178 178 178 PHE PHE A . n 
A 1 179 TYR 179 179 179 TYR TYR A . n 
A 1 180 ALA 180 180 180 ALA ALA A . n 
A 1 181 THR 181 181 181 THR THR A . n 
A 1 182 ASN 182 182 182 ASN ASN A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 HIS 184 184 184 HIS HIS A . n 
A 1 185 TYR 185 185 185 TYR TYR A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ASP 188 188 188 ASP ASP A . n 
A 1 189 PRO 189 189 189 PRO PRO A . n 
A 1 190 TYR 190 190 190 TYR TYR A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 TRP 194 194 194 TRP TRP A . n 
A 1 195 GLU 195 195 195 GLU GLU A . n 
A 1 196 MET 196 196 196 MET MET A . n 
A 1 197 HIS 197 197 197 HIS HIS A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 TRP 202 202 202 TRP TRP A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 PHE 204 204 204 PHE PHE A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 THR 206 206 206 THR THR A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 TYR 208 208 208 TYR TYR A . n 
A 1 209 SER 209 209 209 SER SER A . n 
A 1 210 PRO 210 210 210 PRO PRO A . n 
A 1 211 ASN 211 211 211 ASN ASN A . n 
A 1 212 ASP 212 212 212 ASP ASP A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 VAL 216 216 216 VAL VAL A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 GLU 218 218 218 GLU GLU A . n 
A 1 219 GLY 219 219 219 GLY GLY A . n 
A 1 220 PHE 220 220 220 PHE PHE A . n 
A 1 221 ASP 221 221 221 ASP ASP A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 ASN 224 224 224 ASN ASN A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 ILE 226 226 226 ILE ILE A . n 
A 1 227 ASN 227 227 227 ASN ASN A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 PRO 230 230 230 PRO PRO A . n 
A 1 231 ASP 231 231 231 ASP ASP A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 TYR 234 234 234 TYR TYR A . n 
A 1 235 VAL 235 235 235 VAL VAL A . n 
A 1 236 TYR 236 236 236 TYR TYR A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 ALA 238 238 238 ALA ALA A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 ALA 242 242 242 ALA ALA A . n 
A 1 243 HIS 243 243 243 HIS HIS A . n 
A 1 244 LYS 244 244 244 LYS LYS A . n 
A 1 245 ILE 245 245 245 ILE ILE A . n 
A 1 246 HIS 246 246 246 HIS HIS A . n 
A 1 247 VAL 247 247 247 VAL VAL A . n 
A 1 248 TYR 248 248 248 TYR TYR A . n 
A 1 249 GLU 249 249 249 GLU GLU A . n 
A 1 250 LYS 250 250 250 LYS LYS A . n 
A 1 251 HIS 251 251 251 HIS HIS A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 TRP 254 254 254 TRP TRP A . n 
A 1 255 THR 255 255 255 THR THR A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 THR 257 257 257 THR THR A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 ARG 260 260 260 ARG ARG A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 SER 263 263 263 SER SER A . n 
A 1 264 PHE 264 264 264 PHE PHE A . n 
A 1 265 ASP 265 265 265 ASP ASP A . n 
A 1 266 THR 266 266 266 THR THR A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 VAL 268 268 268 VAL VAL A . n 
A 1 269 ASP 269 269 269 ASP ASP A . n 
A 1 270 ASN 270 270 270 ASN ASN A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 SER 272 272 272 SER SER A . n 
A 1 273 VAL 273 273 273 VAL VAL A . n 
A 1 274 ASP 274 274 274 ASP ASP A . n 
A 1 275 PRO 275 275 275 PRO PRO A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 THR 277 277 277 THR THR A . n 
A 1 278 GLY 278 278 278 GLY GLY A . n 
A 1 279 ASP 279 279 279 ASP ASP A . n 
A 1 280 LEU 280 280 280 LEU LEU A . n 
A 1 281 TRP 281 281 281 TRP TRP A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 CYS 284 284 284 CYS CYS A . n 
A 1 285 HIS 285 285 285 HIS HIS A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 ASN 287 287 287 ASN ASN A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 MET 289 289 289 MET MET A . n 
A 1 290 ARG 290 290 290 ARG ARG A . n 
A 1 291 ILE 291 291 291 ILE ILE A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 PHE 293 293 293 PHE PHE A . n 
A 1 294 TYR 294 294 294 TYR TYR A . n 
A 1 295 ASP 295 295 295 ASP ASP A . n 
A 1 296 ALA 296 296 296 ALA ALA A . n 
A 1 297 GLU 297 297 297 GLU GLU A . n 
A 1 298 ASN 298 298 298 ASN ASN A . n 
A 1 299 PRO 299 299 299 PRO PRO A . n 
A 1 300 PRO 300 300 300 PRO PRO A . n 
A 1 301 GLY 301 301 301 GLY GLY A . n 
A 1 302 SER 302 302 302 SER SER A . n 
A 1 303 GLU 303 303 303 GLU GLU A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 ARG 306 306 306 ARG ARG A . n 
A 1 307 ILE 307 307 307 ILE ILE A . n 
A 1 308 GLN 308 308 308 GLN GLN A . n 
A 1 309 ASP 309 309 309 ASP ASP A . n 
A 1 310 ILE 310 310 310 ILE ILE A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 SER 312 312 312 SER SER A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 GLU 314 314 314 GLU GLU A . n 
A 1 315 PRO 315 315 315 PRO PRO A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 VAL 319 319 319 VAL VAL A . n 
A 1 320 VAL 320 320 320 VAL VAL A . n 
A 1 321 TYR 321 321 321 TYR TYR A . n 
A 1 322 ALA 322 322 322 ALA ALA A . n 
A 1 323 GLU 323 323 323 GLU GLU A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 GLY 325 325 325 GLY GLY A . n 
A 1 326 THR 326 326 326 THR THR A . n 
A 1 327 VAL 327 327 327 VAL VAL A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 GLN 329 329 329 GLN GLN A . n 
A 1 330 GLY 330 330 330 GLY GLY A . n 
A 1 331 SER 331 331 331 SER SER A . n 
A 1 332 THR 332 332 332 THR THR A . n 
A 1 333 VAL 333 333 333 VAL VAL A . n 
A 1 334 ALA 334 334 334 ALA ALA A . n 
A 1 335 ALA 335 335 335 ALA ALA A . n 
A 1 336 VAL 336 336 336 VAL VAL A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 LYS 338 338 338 LYS LYS A . n 
A 1 339 GLY 339 339 339 GLY GLY A . n 
A 1 340 LYS 340 340 340 LYS LYS A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 LEU 342 342 342 LEU LEU A . n 
A 1 343 ILE 343 343 343 ILE ILE A . n 
A 1 344 GLY 344 344 344 GLY GLY A . n 
A 1 345 THR 345 345 345 THR THR A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 PHE 347 347 347 PHE PHE A . n 
A 1 348 HIS 348 348 348 HIS HIS A . n 
A 1 349 LYS 349 349 349 LYS LYS A . n 
A 1 350 ALA 350 350 350 ALA ALA A . n 
A 1 351 LEU 351 351 351 LEU LEU A . n 
A 1 352 TYR 352 352 352 TYR TYR A . n 
A 1 353 CYS 353 353 353 CYS CYS A . n 
A 1 354 ASP 354 354 354 ASP ASP A . n 
A 1 355 LEU 355 355 355 LEU LEU A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASN 224 ? A ASN 224  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 OD1 ? A ASN 270 ? A ASN 270  ? 1_555 85.9  ? 
2  OD1 ? A ASN 224 ? A ASN 224  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 OD2 ? A ASP 269 ? A ASP 269  ? 1_555 71.6  ? 
3  OD1 ? A ASN 270 ? A ASN 270  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 OD2 ? A ASP 269 ? A ASP 269  ? 1_555 77.5  ? 
4  OD1 ? A ASN 224 ? A ASN 224  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 O1  ? D OCH .   ? A OCH 1358 ? 1_555 101.4 ? 
5  OD1 ? A ASN 270 ? A ASN 270  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 O1  ? D OCH .   ? A OCH 1358 ? 1_555 164.1 ? 
6  OD2 ? A ASP 269 ? A ASP 269  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 O1  ? D OCH .   ? A OCH 1358 ? 1_555 91.3  ? 
7  OD1 ? A ASN 224 ? A ASN 224  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 OE2 ? A GLU 53  ? A GLU 53   ? 1_555 159.3 ? 
8  OD1 ? A ASN 270 ? A ASN 270  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 OE2 ? A GLU 53  ? A GLU 53   ? 1_555 96.8  ? 
9  OD2 ? A ASP 269 ? A ASP 269  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 OE2 ? A GLU 53  ? A GLU 53   ? 1_555 88.9  ? 
10 O1  ? D OCH .   ? A OCH 1358 ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 OE2 ? A GLU 53  ? A GLU 53   ? 1_555 71.5  ? 
11 OD1 ? A ASN 224 ? A ASN 224  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 O   ? J HOH .   ? A HOH 359  ? 1_555 130.9 ? 
12 OD1 ? A ASN 270 ? A ASN 270  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 O   ? J HOH .   ? A HOH 359  ? 1_555 84.2  ? 
13 OD2 ? A ASP 269 ? A ASP 269  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 O   ? J HOH .   ? A HOH 359  ? 1_555 150.0 ? 
14 O1  ? D OCH .   ? A OCH 1358 ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 O   ? J HOH .   ? A HOH 359  ? 1_555 100.9 ? 
15 OE2 ? A GLU 53  ? A GLU 53   ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 O   ? J HOH .   ? A HOH 359  ? 1_555 69.7  ? 
16 OD1 ? A ASN 224 ? A ASN 224  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 OD1 ? A ASN 168 ? A ASN 168  ? 1_555 70.0  ? 
17 OD1 ? A ASN 270 ? A ASN 270  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 OD1 ? A ASN 168 ? A ASN 168  ? 1_555 114.1 ? 
18 OD2 ? A ASP 269 ? A ASP 269  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 OD1 ? A ASN 168 ? A ASN 168  ? 1_555 138.7 ? 
19 O1  ? D OCH .   ? A OCH 1358 ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 OD1 ? A ASN 168 ? A ASN 168  ? 1_555 81.8  ? 
20 OE2 ? A GLU 53  ? A GLU 53   ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 OD1 ? A ASN 168 ? A ASN 168  ? 1_555 126.1 ? 
21 O   ? J HOH .   ? A HOH 359  ? 1_555 CA ? C CA . ? A CA 1357 ? 1_555 OD1 ? A ASN 168 ? A ASN 168  ? 1_555 70.7  ? 
22 OD2 ? A ASP 54  ? A ASP 54   ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 O   ? J HOH .   ? A HOH 378  ? 1_555 177.3 ? 
23 OD2 ? A ASP 54  ? A ASP 54   ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 OD1 ? A ASP 169 ? A ASP 169  ? 1_555 85.7  ? 
24 O   ? J HOH .   ? A HOH 378  ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 OD1 ? A ASP 169 ? A ASP 169  ? 1_555 94.6  ? 
25 OD2 ? A ASP 54  ? A ASP 54   ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 O   ? A ILE 117 ? A ILE 117  ? 1_555 84.5  ? 
26 O   ? J HOH .   ? A HOH 378  ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 O   ? A ILE 117 ? A ILE 117  ? 1_555 98.2  ? 
27 OD1 ? A ASP 169 ? A ASP 169  ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 O   ? A ILE 117 ? A ILE 117  ? 1_555 84.9  ? 
28 OD2 ? A ASP 54  ? A ASP 54   ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 OD2 ? A ASP 169 ? A ASP 169  ? 1_555 95.0  ? 
29 O   ? J HOH .   ? A HOH 378  ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 OD2 ? A ASP 169 ? A ASP 169  ? 1_555 83.0  ? 
30 OD1 ? A ASP 169 ? A ASP 169  ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 OD2 ? A ASP 169 ? A ASP 169  ? 1_555 53.2  ? 
31 O   ? A ILE 117 ? A ILE 117  ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 OD2 ? A ASP 169 ? A ASP 169  ? 1_555 137.9 ? 
32 OD2 ? A ASP 54  ? A ASP 54   ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 O   ? J HOH .   ? A HOH 361  ? 1_555 99.3  ? 
33 O   ? J HOH .   ? A HOH 378  ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 O   ? J HOH .   ? A HOH 361  ? 1_555 81.1  ? 
34 OD1 ? A ASP 169 ? A ASP 169  ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 O   ? J HOH .   ? A HOH 361  ? 1_555 165.4 ? 
35 O   ? A ILE 117 ? A ILE 117  ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 O   ? J HOH .   ? A HOH 361  ? 1_555 81.9  ? 
36 OD2 ? A ASP 169 ? A ASP 169  ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 O   ? J HOH .   ? A HOH 361  ? 1_555 139.0 ? 
37 OD2 ? A ASP 54  ? A ASP 54   ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 O   ? J HOH .   ? A HOH 360  ? 1_555 83.0  ? 
38 O   ? J HOH .   ? A HOH 378  ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 O   ? J HOH .   ? A HOH 360  ? 1_555 94.9  ? 
39 OD1 ? A ASP 169 ? A ASP 169  ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 O   ? J HOH .   ? A HOH 360  ? 1_555 134.6 ? 
40 O   ? A ILE 117 ? A ILE 117  ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 O   ? J HOH .   ? A HOH 360  ? 1_555 137.0 ? 
41 OD2 ? A ASP 169 ? A ASP 169  ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 O   ? J HOH .   ? A HOH 360  ? 1_555 84.2  ? 
42 O   ? J HOH .   ? A HOH 361  ? 1_555 CA ? B CA . ? A CA 1356 ? 1_555 O   ? J HOH .   ? A HOH 360  ? 1_555 59.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-03-21 
2 'Structure model' 1 1 2012-04-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.5.0102 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB  A GLU 56  ? ? CG  A GLU 56  ? ? 1.655 1.517 0.138 0.019 N 
2 1 CG  A GLU 218 ? ? CD  A GLU 218 ? ? 1.612 1.515 0.097 0.015 N 
3 1 CE2 A TYR 294 ? ? CD2 A TYR 294 ? ? 1.486 1.389 0.097 0.015 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N   A SER 22  ? ? CA A SER 22  ? ? C   A SER 22  ? ? 86.76  111.00 -24.24 2.70 N 
2 1 NE  A ARG 160 ? ? CZ A ARG 160 ? ? NH1 A ARG 160 ? ? 127.02 120.30 6.72   0.50 N 
3 1 NE  A ARG 160 ? ? CZ A ARG 160 ? ? NH2 A ARG 160 ? ? 110.96 120.30 -9.34  0.50 N 
4 1 NE  A ARG 306 ? ? CZ A ARG 306 ? ? NH2 A ARG 306 ? ? 117.12 120.30 -3.18  0.50 N 
5 1 CG1 A VAL 346 ? ? CB A VAL 346 ? ? CG2 A VAL 346 ? ? 121.30 110.90 10.40  1.60 N 
6 1 CA  A VAL 346 ? ? CB A VAL 346 ? ? CG1 A VAL 346 ? ? 120.82 110.90 9.92   1.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 22  ? ? -145.42 -55.77  
2  1 SER A 52  ? ? -153.09 59.72   
3  1 HIS A 115 ? ? -136.49 -121.21 
4  1 HIS A 134 ? ? -116.59 69.68   
5  1 HIS A 161 ? ? -171.99 147.20  
6  1 SER A 166 ? ? -151.82 70.27   
7  1 GLU A 176 ? ? -144.45 45.16   
8  1 ASP A 212 ? ? -160.74 110.23  
9  1 PHE A 222 ? ? 68.88   67.23   
10 1 ASN A 224 ? ? -142.45 -93.61  
11 1 ASP A 269 ? ? -113.82 -98.84  
12 1 PHE A 347 ? ? -143.99 15.27   
13 1 HIS A 348 ? ? -121.66 -122.58 
14 1 LYS A 349 ? ? -109.55 -169.07 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    21 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   SER 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    22 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -92.84 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 19  ? CG  ? A ARG 19  CG  
2  1 Y 1 A ARG 19  ? CD  ? A ARG 19  CD  
3  1 Y 1 A ARG 19  ? NE  ? A ARG 19  NE  
4  1 Y 1 A ARG 19  ? CZ  ? A ARG 19  CZ  
5  1 Y 1 A ARG 19  ? NH1 ? A ARG 19  NH1 
6  1 Y 1 A ARG 19  ? NH2 ? A ARG 19  NH2 
7  1 Y 1 A LYS 21  ? CG  ? A LYS 21  CG  
8  1 Y 1 A LYS 21  ? CD  ? A LYS 21  CD  
9  1 Y 1 A LYS 21  ? CE  ? A LYS 21  CE  
10 1 Y 1 A LYS 21  ? NZ  ? A LYS 21  NZ  
11 1 Y 1 A LYS 46  ? CD  ? A LYS 46  CD  
12 1 Y 1 A LYS 46  ? CE  ? A LYS 46  CE  
13 1 Y 1 A LYS 46  ? NZ  ? A LYS 46  NZ  
14 1 Y 1 A ASP 80  ? CG  ? A ASP 80  CG  
15 1 Y 1 A ASP 80  ? OD1 ? A ASP 80  OD1 
16 1 Y 1 A ASP 80  ? OD2 ? A ASP 80  OD2 
17 1 Y 1 A LYS 81  ? CD  ? A LYS 81  CD  
18 1 Y 1 A LYS 81  ? CE  ? A LYS 81  CE  
19 1 Y 1 A LYS 81  ? NZ  ? A LYS 81  NZ  
20 1 Y 1 A LYS 93  ? CG  ? A LYS 93  CG  
21 1 Y 1 A LYS 93  ? CD  ? A LYS 93  CD  
22 1 Y 1 A LYS 93  ? CE  ? A LYS 93  CE  
23 1 Y 1 A LYS 93  ? NZ  ? A LYS 93  NZ  
24 1 Y 1 A ILE 109 ? CD1 ? A ILE 109 CD1 
25 1 Y 1 A SER 137 ? OG  ? A SER 137 OG  
26 1 Y 1 A LYS 145 ? CE  ? A LYS 145 CE  
27 1 Y 1 A LYS 145 ? NZ  ? A LYS 145 NZ  
28 1 Y 1 A GLU 149 ? CG  ? A GLU 149 CG  
29 1 Y 1 A GLU 149 ? CD  ? A GLU 149 CD  
30 1 Y 1 A GLU 149 ? OE1 ? A GLU 149 OE1 
31 1 Y 1 A GLU 149 ? OE2 ? A GLU 149 OE2 
32 1 Y 1 A GLU 150 ? OE1 ? A GLU 150 OE1 
33 1 Y 1 A GLU 150 ? OE2 ? A GLU 150 OE2 
34 1 Y 1 A LYS 151 ? CE  ? A LYS 151 CE  
35 1 Y 1 A LYS 151 ? NZ  ? A LYS 151 NZ  
36 1 Y 1 A LYS 162 ? CD  ? A LYS 162 CD  
37 1 Y 1 A LYS 162 ? CE  ? A LYS 162 CE  
38 1 Y 1 A LYS 162 ? NZ  ? A LYS 162 NZ  
39 1 Y 1 A ASN 211 ? CG  ? A ASN 211 CG  
40 1 Y 1 A ASN 211 ? OD1 ? A ASN 211 OD1 
41 1 Y 1 A ASN 211 ? ND2 ? A ASN 211 ND2 
42 1 Y 1 A LYS 233 ? CE  ? A LYS 233 CE  
43 1 Y 1 A LYS 233 ? NZ  ? A LYS 233 NZ  
44 1 Y 1 A ASP 265 ? OD1 ? A ASP 265 OD1 
45 1 Y 1 A ASP 265 ? OD2 ? A ASP 265 OD2 
46 1 Y 1 A GLU 297 ? CG  ? A GLU 297 CG  
47 1 Y 1 A GLU 297 ? CD  ? A GLU 297 CD  
48 1 Y 1 A GLU 297 ? OE1 ? A GLU 297 OE1 
49 1 Y 1 A GLU 297 ? OE2 ? A GLU 297 OE2 
50 1 Y 1 A GLU 313 ? CG  ? A GLU 313 CG  
51 1 Y 1 A GLU 313 ? CD  ? A GLU 313 CD  
52 1 Y 1 A GLU 313 ? OE1 ? A GLU 313 OE1 
53 1 Y 1 A GLU 313 ? OE2 ? A GLU 313 OE2 
54 1 Y 1 A GLU 314 ? CG  ? A GLU 314 CG  
55 1 Y 1 A GLU 314 ? CD  ? A GLU 314 CD  
56 1 Y 1 A GLU 314 ? OE1 ? A GLU 314 OE1 
57 1 Y 1 A GLU 314 ? OE2 ? A GLU 314 OE2 
58 1 Y 1 A LYS 316 ? CD  ? A LYS 316 CD  
59 1 Y 1 A LYS 316 ? CE  ? A LYS 316 CE  
60 1 Y 1 A LYS 316 ? NZ  ? A LYS 316 NZ  
61 1 Y 1 A LYS 340 ? NZ  ? A LYS 340 NZ  
62 1 N 1 A LMT 356 ? C2  ? E LMT 1   C2  
63 1 N 1 A LMT 356 ? C3  ? E LMT 1   C3  
64 1 N 1 A LMT 356 ? C4  ? E LMT 1   C4  
65 1 N 1 A LMT 356 ? C5  ? E LMT 1   C5  
66 1 N 1 A LMT 356 ? C6  ? E LMT 1   C6  
67 1 N 1 A LMT 356 ? C7  ? E LMT 1   C7  
68 1 N 1 A LMT 356 ? C8  ? E LMT 1   C8  
69 1 N 1 A LMT 356 ? C9  ? E LMT 1   C9  
70 1 N 1 A LMT 356 ? C10 ? E LMT 1   C10 
71 1 N 1 A LMT 356 ? C11 ? E LMT 1   C11 
72 1 N 1 A LMT 356 ? C12 ? E LMT 1   C12 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1  ? A MET 1  
2  1 Y 1 A ALA 2  ? A ALA 2  
3  1 Y 1 A LYS 3  ? A LYS 3  
4  1 Y 1 A LEU 4  ? A LEU 4  
5  1 Y 1 A THR 5  ? A THR 5  
6  1 Y 1 A ALA 6  ? A ALA 6  
7  1 Y 1 A LEU 7  ? A LEU 7  
8  1 Y 1 A THR 8  ? A THR 8  
9  1 Y 1 A LEU 9  ? A LEU 9  
10 1 Y 1 A LEU 10 ? A LEU 10 
11 1 Y 1 A GLY 11 ? A GLY 11 
12 1 Y 1 A MET 12 ? A MET 12 
13 1 Y 1 A GLY 13 ? A GLY 13 
14 1 Y 1 A LEU 14 ? A LEU 14 
15 1 Y 1 A ALA 15 ? A ALA 15 
16 1 Y 1 A LEU 16 ? A LEU 16 
17 1 Y 1 A PHE 17 ? A PHE 17 
18 1 Y 1 A ASP 18 ? A ASP 18 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'            CA  
3 'QUINOLIN-2(1H)-ONE'     OCH 
4 DODECYL-BETA-D-MALTOSIDE LMT 
5 'BROMIDE ION'            BR  
6 'CHLORIDE ION'           CL  
7 water                    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1   1356 1356 CA  CA  A . 
C 2 CA  1   1357 1357 CA  CA  A . 
D 3 OCH 1   1358 1358 OCH OCH A . 
E 4 LMT 1   356  1    LMT LMT A . 
F 5 BR  1   1360 1360 BR  BR  A . 
G 6 CL  1   1361 1361 CL  CL  A . 
H 6 CL  1   1362 1362 CL  CL  A . 
I 2 CA  1   1363 1363 CA  CA  A . 
J 7 HOH 1   357  2    HOH HOH A . 
J 7 HOH 2   358  3    HOH HOH A . 
J 7 HOH 3   359  4    HOH HOH A . 
J 7 HOH 4   360  5    HOH HOH A . 
J 7 HOH 5   361  6    HOH HOH A . 
J 7 HOH 6   362  7    HOH HOH A . 
J 7 HOH 7   363  10   HOH HOH A . 
J 7 HOH 8   364  11   HOH HOH A . 
J 7 HOH 9   365  12   HOH HOH A . 
J 7 HOH 10  366  14   HOH HOH A . 
J 7 HOH 11  367  15   HOH HOH A . 
J 7 HOH 12  368  16   HOH HOH A . 
J 7 HOH 13  369  17   HOH HOH A . 
J 7 HOH 14  370  18   HOH HOH A . 
J 7 HOH 15  371  19   HOH HOH A . 
J 7 HOH 16  372  20   HOH HOH A . 
J 7 HOH 17  373  21   HOH HOH A . 
J 7 HOH 18  374  22   HOH HOH A . 
J 7 HOH 19  375  26   HOH HOH A . 
J 7 HOH 20  376  27   HOH HOH A . 
J 7 HOH 21  377  31   HOH HOH A . 
J 7 HOH 22  378  32   HOH HOH A . 
J 7 HOH 23  379  33   HOH HOH A . 
J 7 HOH 24  380  35   HOH HOH A . 
J 7 HOH 25  381  36   HOH HOH A . 
J 7 HOH 26  382  37   HOH HOH A . 
J 7 HOH 27  383  40   HOH HOH A . 
J 7 HOH 28  384  42   HOH HOH A . 
J 7 HOH 29  385  43   HOH HOH A . 
J 7 HOH 30  386  45   HOH HOH A . 
J 7 HOH 31  387  46   HOH HOH A . 
J 7 HOH 32  388  47   HOH HOH A . 
J 7 HOH 33  389  49   HOH HOH A . 
J 7 HOH 34  390  50   HOH HOH A . 
J 7 HOH 35  391  51   HOH HOH A . 
J 7 HOH 36  392  52   HOH HOH A . 
J 7 HOH 37  393  53   HOH HOH A . 
J 7 HOH 38  394  54   HOH HOH A . 
J 7 HOH 39  395  55   HOH HOH A . 
J 7 HOH 40  396  57   HOH HOH A . 
J 7 HOH 41  397  58   HOH HOH A . 
J 7 HOH 42  398  60   HOH HOH A . 
J 7 HOH 43  399  61   HOH HOH A . 
J 7 HOH 44  400  62   HOH HOH A . 
J 7 HOH 45  401  63   HOH HOH A . 
J 7 HOH 46  402  64   HOH HOH A . 
J 7 HOH 47  403  65   HOH HOH A . 
J 7 HOH 48  404  69   HOH HOH A . 
J 7 HOH 49  405  70   HOH HOH A . 
J 7 HOH 50  406  71   HOH HOH A . 
J 7 HOH 51  407  72   HOH HOH A . 
J 7 HOH 52  408  73   HOH HOH A . 
J 7 HOH 53  409  75   HOH HOH A . 
J 7 HOH 54  410  76   HOH HOH A . 
J 7 HOH 55  411  77   HOH HOH A . 
J 7 HOH 56  412  82   HOH HOH A . 
J 7 HOH 57  413  85   HOH HOH A . 
J 7 HOH 58  414  86   HOH HOH A . 
J 7 HOH 59  415  87   HOH HOH A . 
J 7 HOH 60  416  89   HOH HOH A . 
J 7 HOH 61  417  90   HOH HOH A . 
J 7 HOH 62  418  91   HOH HOH A . 
J 7 HOH 63  419  92   HOH HOH A . 
J 7 HOH 64  420  93   HOH HOH A . 
J 7 HOH 65  421  94   HOH HOH A . 
J 7 HOH 66  422  95   HOH HOH A . 
J 7 HOH 67  423  98   HOH HOH A . 
J 7 HOH 68  424  101  HOH HOH A . 
J 7 HOH 69  425  108  HOH HOH A . 
J 7 HOH 70  426  109  HOH HOH A . 
J 7 HOH 71  427  110  HOH HOH A . 
J 7 HOH 72  428  113  HOH HOH A . 
J 7 HOH 73  429  114  HOH HOH A . 
J 7 HOH 74  430  116  HOH HOH A . 
J 7 HOH 75  431  117  HOH HOH A . 
J 7 HOH 76  432  118  HOH HOH A . 
J 7 HOH 77  433  119  HOH HOH A . 
J 7 HOH 78  434  120  HOH HOH A . 
J 7 HOH 79  435  121  HOH HOH A . 
J 7 HOH 80  436  122  HOH HOH A . 
J 7 HOH 81  437  123  HOH HOH A . 
J 7 HOH 82  438  129  HOH HOH A . 
J 7 HOH 83  439  131  HOH HOH A . 
J 7 HOH 84  440  132  HOH HOH A . 
J 7 HOH 85  441  133  HOH HOH A . 
J 7 HOH 86  442  140  HOH HOH A . 
J 7 HOH 87  443  143  HOH HOH A . 
J 7 HOH 88  444  144  HOH HOH A . 
J 7 HOH 89  445  145  HOH HOH A . 
J 7 HOH 90  446  146  HOH HOH A . 
J 7 HOH 91  447  147  HOH HOH A . 
J 7 HOH 92  448  151  HOH HOH A . 
J 7 HOH 93  449  152  HOH HOH A . 
J 7 HOH 94  450  154  HOH HOH A . 
J 7 HOH 95  451  159  HOH HOH A . 
J 7 HOH 96  452  160  HOH HOH A . 
J 7 HOH 97  453  161  HOH HOH A . 
J 7 HOH 98  454  162  HOH HOH A . 
J 7 HOH 99  455  163  HOH HOH A . 
J 7 HOH 100 456  164  HOH HOH A . 
J 7 HOH 101 457  170  HOH HOH A . 
J 7 HOH 102 458  172  HOH HOH A . 
J 7 HOH 103 459  178  HOH HOH A . 
J 7 HOH 104 460  179  HOH HOH A . 
J 7 HOH 105 461  187  HOH HOH A . 
J 7 HOH 106 462  191  HOH HOH A . 
J 7 HOH 107 463  195  HOH HOH A . 
J 7 HOH 108 464  196  HOH HOH A . 
J 7 HOH 109 465  198  HOH HOH A . 
J 7 HOH 110 466  200  HOH HOH A . 
J 7 HOH 111 467  205  HOH HOH A . 
J 7 HOH 112 468  206  HOH HOH A . 
#