data_3STJ
# 
_entry.id   3STJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3STJ         
RCSB  RCSB066632   
WWPDB D_1000066632 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3STI 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3STJ 
_pdbx_database_status.recvd_initial_deposition_date   2011-07-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sawa, J.'     1 
'Malet, H.'    2 
'Krojer, T.'   3 
'Canellas, F.' 4 
'Ehrmann, M.'  5 
'Clausen, T.'  6 
# 
_citation.id                        primary 
_citation.title                     
'Molecular adaptation of the DegQ protease to exert protein quality control in the bacterial cell envelope.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                30680 
_citation.page_last                 30690 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21685389 
_citation.pdbx_database_id_DOI      10.1074/jbc.M111.243832 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sawa, J.'     1 
primary 'Malet, H.'    2 
primary 'Krojer, T.'   3 
primary 'Canellas, F.' 4 
primary 'Ehrmann, M.'  5 
primary 'Clausen, T.'  6 
# 
_cell.entry_id           3STJ 
_cell.length_a           115.316 
_cell.length_b           115.316 
_cell.length_c           287.419 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              39 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3STJ 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Protease degQ' 36007.609 12 3.4.21.- ? 'UNP residues 28-364' ? 
2 polymer nat 'peptide (UNK)' 613.749   13 ?        ? ?                     ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SIPGQVADQAPLPSLAPMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIINASKGYVLTN
NHVINQAQKISIQLNDGREFDAKLIGSDDQSDIALLQIQNPSKLTQIAIADSDKLRVGDFAVAVGNPFGLGQTATSGIVS
ALGRSGLNLEGLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLIDFGEIKRG
LLGIKGTEMSADIAKAFNLDVQRGAFVSEVLPGSGSAKAGVKAGDIITSLNGKPLNSFAELRSRIATTEPGTKVKLGLLR
NGKPLEVEVTLDTSTSSLEHHHHHH
;
;SIPGQVADQAPLPSLAPMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIINASKGYVLTN
NHVINQAQKISIQLNDGREFDAKLIGSDDQSDIALLQIQNPSKLTQIAIADSDKLRVGDFAVAVGNPFGLGQTATSGIVS
ALGRSGLNLEGLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLIDFGEIKRG
LLGIKGTEMSADIAKAFNLDVQRGAFVSEVLPGSGSAKAGVKAGDIITSLNGKPLNSFAELRSRIATTEPGTKVKLGLLR
NGKPLEVEVTLDTSTSSLEHHHHHH
;
A,B,C,D,E,F,G,H,I,J,K,L   ? 
2 'polypeptide(L)' no no '(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)' XXXXXXX M,N,O,P,Q,R,S,T,U,V,W,X,Z ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ILE n 
1 3   PRO n 
1 4   GLY n 
1 5   GLN n 
1 6   VAL n 
1 7   ALA n 
1 8   ASP n 
1 9   GLN n 
1 10  ALA n 
1 11  PRO n 
1 12  LEU n 
1 13  PRO n 
1 14  SER n 
1 15  LEU n 
1 16  ALA n 
1 17  PRO n 
1 18  MET n 
1 19  LEU n 
1 20  GLU n 
1 21  LYS n 
1 22  VAL n 
1 23  LEU n 
1 24  PRO n 
1 25  ALA n 
1 26  VAL n 
1 27  VAL n 
1 28  SER n 
1 29  VAL n 
1 30  ARG n 
1 31  VAL n 
1 32  GLU n 
1 33  GLY n 
1 34  THR n 
1 35  ALA n 
1 36  SER n 
1 37  GLN n 
1 38  GLY n 
1 39  GLN n 
1 40  LYS n 
1 41  ILE n 
1 42  PRO n 
1 43  GLU n 
1 44  GLU n 
1 45  PHE n 
1 46  LYS n 
1 47  LYS n 
1 48  PHE n 
1 49  PHE n 
1 50  GLY n 
1 51  ASP n 
1 52  ASP n 
1 53  LEU n 
1 54  PRO n 
1 55  ASP n 
1 56  GLN n 
1 57  PRO n 
1 58  ALA n 
1 59  GLN n 
1 60  PRO n 
1 61  PHE n 
1 62  GLU n 
1 63  GLY n 
1 64  LEU n 
1 65  GLY n 
1 66  SER n 
1 67  GLY n 
1 68  VAL n 
1 69  ILE n 
1 70  ILE n 
1 71  ASN n 
1 72  ALA n 
1 73  SER n 
1 74  LYS n 
1 75  GLY n 
1 76  TYR n 
1 77  VAL n 
1 78  LEU n 
1 79  THR n 
1 80  ASN n 
1 81  ASN n 
1 82  HIS n 
1 83  VAL n 
1 84  ILE n 
1 85  ASN n 
1 86  GLN n 
1 87  ALA n 
1 88  GLN n 
1 89  LYS n 
1 90  ILE n 
1 91  SER n 
1 92  ILE n 
1 93  GLN n 
1 94  LEU n 
1 95  ASN n 
1 96  ASP n 
1 97  GLY n 
1 98  ARG n 
1 99  GLU n 
1 100 PHE n 
1 101 ASP n 
1 102 ALA n 
1 103 LYS n 
1 104 LEU n 
1 105 ILE n 
1 106 GLY n 
1 107 SER n 
1 108 ASP n 
1 109 ASP n 
1 110 GLN n 
1 111 SER n 
1 112 ASP n 
1 113 ILE n 
1 114 ALA n 
1 115 LEU n 
1 116 LEU n 
1 117 GLN n 
1 118 ILE n 
1 119 GLN n 
1 120 ASN n 
1 121 PRO n 
1 122 SER n 
1 123 LYS n 
1 124 LEU n 
1 125 THR n 
1 126 GLN n 
1 127 ILE n 
1 128 ALA n 
1 129 ILE n 
1 130 ALA n 
1 131 ASP n 
1 132 SER n 
1 133 ASP n 
1 134 LYS n 
1 135 LEU n 
1 136 ARG n 
1 137 VAL n 
1 138 GLY n 
1 139 ASP n 
1 140 PHE n 
1 141 ALA n 
1 142 VAL n 
1 143 ALA n 
1 144 VAL n 
1 145 GLY n 
1 146 ASN n 
1 147 PRO n 
1 148 PHE n 
1 149 GLY n 
1 150 LEU n 
1 151 GLY n 
1 152 GLN n 
1 153 THR n 
1 154 ALA n 
1 155 THR n 
1 156 SER n 
1 157 GLY n 
1 158 ILE n 
1 159 VAL n 
1 160 SER n 
1 161 ALA n 
1 162 LEU n 
1 163 GLY n 
1 164 ARG n 
1 165 SER n 
1 166 GLY n 
1 167 LEU n 
1 168 ASN n 
1 169 LEU n 
1 170 GLU n 
1 171 GLY n 
1 172 LEU n 
1 173 GLU n 
1 174 ASN n 
1 175 PHE n 
1 176 ILE n 
1 177 GLN n 
1 178 THR n 
1 179 ASP n 
1 180 ALA n 
1 181 SER n 
1 182 ILE n 
1 183 ASN n 
1 184 ARG n 
1 185 GLY n 
1 186 ASN n 
1 187 SER n 
1 188 GLY n 
1 189 GLY n 
1 190 ALA n 
1 191 LEU n 
1 192 LEU n 
1 193 ASN n 
1 194 LEU n 
1 195 ASN n 
1 196 GLY n 
1 197 GLU n 
1 198 LEU n 
1 199 ILE n 
1 200 GLY n 
1 201 ILE n 
1 202 ASN n 
1 203 THR n 
1 204 ALA n 
1 205 ILE n 
1 206 LEU n 
1 207 ALA n 
1 208 PRO n 
1 209 GLY n 
1 210 GLY n 
1 211 GLY n 
1 212 SER n 
1 213 VAL n 
1 214 GLY n 
1 215 ILE n 
1 216 GLY n 
1 217 PHE n 
1 218 ALA n 
1 219 ILE n 
1 220 PRO n 
1 221 SER n 
1 222 ASN n 
1 223 MET n 
1 224 ALA n 
1 225 ARG n 
1 226 THR n 
1 227 LEU n 
1 228 ALA n 
1 229 GLN n 
1 230 GLN n 
1 231 LEU n 
1 232 ILE n 
1 233 ASP n 
1 234 PHE n 
1 235 GLY n 
1 236 GLU n 
1 237 ILE n 
1 238 LYS n 
1 239 ARG n 
1 240 GLY n 
1 241 LEU n 
1 242 LEU n 
1 243 GLY n 
1 244 ILE n 
1 245 LYS n 
1 246 GLY n 
1 247 THR n 
1 248 GLU n 
1 249 MET n 
1 250 SER n 
1 251 ALA n 
1 252 ASP n 
1 253 ILE n 
1 254 ALA n 
1 255 LYS n 
1 256 ALA n 
1 257 PHE n 
1 258 ASN n 
1 259 LEU n 
1 260 ASP n 
1 261 VAL n 
1 262 GLN n 
1 263 ARG n 
1 264 GLY n 
1 265 ALA n 
1 266 PHE n 
1 267 VAL n 
1 268 SER n 
1 269 GLU n 
1 270 VAL n 
1 271 LEU n 
1 272 PRO n 
1 273 GLY n 
1 274 SER n 
1 275 GLY n 
1 276 SER n 
1 277 ALA n 
1 278 LYS n 
1 279 ALA n 
1 280 GLY n 
1 281 VAL n 
1 282 LYS n 
1 283 ALA n 
1 284 GLY n 
1 285 ASP n 
1 286 ILE n 
1 287 ILE n 
1 288 THR n 
1 289 SER n 
1 290 LEU n 
1 291 ASN n 
1 292 GLY n 
1 293 LYS n 
1 294 PRO n 
1 295 LEU n 
1 296 ASN n 
1 297 SER n 
1 298 PHE n 
1 299 ALA n 
1 300 GLU n 
1 301 LEU n 
1 302 ARG n 
1 303 SER n 
1 304 ARG n 
1 305 ILE n 
1 306 ALA n 
1 307 THR n 
1 308 THR n 
1 309 GLU n 
1 310 PRO n 
1 311 GLY n 
1 312 THR n 
1 313 LYS n 
1 314 VAL n 
1 315 LYS n 
1 316 LEU n 
1 317 GLY n 
1 318 LEU n 
1 319 LEU n 
1 320 ARG n 
1 321 ASN n 
1 322 GLY n 
1 323 LYS n 
1 324 PRO n 
1 325 LEU n 
1 326 GLU n 
1 327 VAL n 
1 328 GLU n 
1 329 VAL n 
1 330 THR n 
1 331 LEU n 
1 332 ASP n 
1 333 THR n 
1 334 SER n 
1 335 THR n 
1 336 SER n 
1 337 SER n 
1 338 LEU n 
1 339 GLU n 
1 340 HIS n 
1 341 HIS n 
1 342 HIS n 
1 343 HIS n 
1 344 HIS n 
1 345 HIS n 
2 1   UNK n 
2 2   UNK n 
2 3   UNK n 
2 4   UNK n 
2 5   UNK n 
2 6   UNK n 
2 7   UNK n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'degQ, hhoA, b3234, JW3203' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    K12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_entity_src_nat.entity_id                  2 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Escherichia coli' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      562 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DEGQ_ECOLI P39099 1 
;SIPGQVADQAPLPSLAPMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIINASKGYVLTN
NHVINQAQKISIQLNDGREFDAKLIGSDDQSDIALLQIQNPSKLTQIAIADSDKLRVGDFAVAVGNPFGLGQTATSGIVS
ALGRSGLNLEGLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLIDFGEIKRG
LLGIKGTEMSADIAKAFNLDVQRGAFVSEVLPGSGSAKAGVKAGDIITSLNGKPLNSFAELRSRIATTEPGTKVKLGLLR
NGKPLEVEVTLDTSTSS
;
28 ? 
2 PDB 3STJ       3STJ   2 XXXXXXX ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3STJ A 1 ? 337 ? P39099 28  ? 364 ? 1   337 
2  1 3STJ B 1 ? 337 ? P39099 28  ? 364 ? 1   337 
3  1 3STJ C 1 ? 337 ? P39099 28  ? 364 ? 1   337 
4  1 3STJ D 1 ? 337 ? P39099 28  ? 364 ? 1   337 
5  1 3STJ E 1 ? 337 ? P39099 28  ? 364 ? 1   337 
6  1 3STJ F 1 ? 337 ? P39099 28  ? 364 ? 1   337 
7  1 3STJ G 1 ? 337 ? P39099 28  ? 364 ? 1   337 
8  1 3STJ H 1 ? 337 ? P39099 28  ? 364 ? 1   337 
9  1 3STJ I 1 ? 337 ? P39099 28  ? 364 ? 1   337 
10 1 3STJ J 1 ? 337 ? P39099 28  ? 364 ? 1   337 
11 1 3STJ K 1 ? 337 ? P39099 28  ? 364 ? 1   337 
12 1 3STJ L 1 ? 337 ? P39099 28  ? 364 ? 1   337 
13 2 3STJ M 1 ? 7   ? 3STJ   401 ? 407 ? 401 407 
14 2 3STJ N 1 ? 7   ? 3STJ   401 ? 407 ? 401 407 
15 2 3STJ O 1 ? 7   ? 3STJ   401 ? 407 ? 401 407 
16 2 3STJ P 1 ? 7   ? 3STJ   401 ? 407 ? 401 407 
17 2 3STJ Q 1 ? 7   ? 3STJ   401 ? 407 ? 401 407 
18 2 3STJ R 1 ? 7   ? 3STJ   401 ? 407 ? 401 407 
19 2 3STJ S 1 ? 7   ? 3STJ   401 ? 407 ? 401 407 
20 2 3STJ T 1 ? 7   ? 3STJ   401 ? 407 ? 401 407 
21 2 3STJ U 1 ? 7   ? 3STJ   401 ? 407 ? 401 407 
22 2 3STJ V 1 ? 7   ? 3STJ   401 ? 407 ? 401 407 
23 2 3STJ W 1 ? 7   ? 3STJ   401 ? 407 ? 401 407 
24 2 3STJ X 1 ? 7   ? 3STJ   401 ? 407 ? 401 407 
25 2 3STJ Z 1 ? 7   ? 3STJ   0   ? 6   ? 0   6   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  3STJ LEU A 338 ? UNP P39099 ? ? 'EXPRESSION TAG' 338 1  
1  3STJ GLU A 339 ? UNP P39099 ? ? 'EXPRESSION TAG' 339 2  
1  3STJ HIS A 340 ? UNP P39099 ? ? 'EXPRESSION TAG' 340 3  
1  3STJ HIS A 341 ? UNP P39099 ? ? 'EXPRESSION TAG' 341 4  
1  3STJ HIS A 342 ? UNP P39099 ? ? 'EXPRESSION TAG' 342 5  
1  3STJ HIS A 343 ? UNP P39099 ? ? 'EXPRESSION TAG' 343 6  
1  3STJ HIS A 344 ? UNP P39099 ? ? 'EXPRESSION TAG' 344 7  
1  3STJ HIS A 345 ? UNP P39099 ? ? 'EXPRESSION TAG' 345 8  
2  3STJ LEU B 338 ? UNP P39099 ? ? 'EXPRESSION TAG' 338 9  
2  3STJ GLU B 339 ? UNP P39099 ? ? 'EXPRESSION TAG' 339 10 
2  3STJ HIS B 340 ? UNP P39099 ? ? 'EXPRESSION TAG' 340 11 
2  3STJ HIS B 341 ? UNP P39099 ? ? 'EXPRESSION TAG' 341 12 
2  3STJ HIS B 342 ? UNP P39099 ? ? 'EXPRESSION TAG' 342 13 
2  3STJ HIS B 343 ? UNP P39099 ? ? 'EXPRESSION TAG' 343 14 
2  3STJ HIS B 344 ? UNP P39099 ? ? 'EXPRESSION TAG' 344 15 
2  3STJ HIS B 345 ? UNP P39099 ? ? 'EXPRESSION TAG' 345 16 
3  3STJ LEU C 338 ? UNP P39099 ? ? 'EXPRESSION TAG' 338 17 
3  3STJ GLU C 339 ? UNP P39099 ? ? 'EXPRESSION TAG' 339 18 
3  3STJ HIS C 340 ? UNP P39099 ? ? 'EXPRESSION TAG' 340 19 
3  3STJ HIS C 341 ? UNP P39099 ? ? 'EXPRESSION TAG' 341 20 
3  3STJ HIS C 342 ? UNP P39099 ? ? 'EXPRESSION TAG' 342 21 
3  3STJ HIS C 343 ? UNP P39099 ? ? 'EXPRESSION TAG' 343 22 
3  3STJ HIS C 344 ? UNP P39099 ? ? 'EXPRESSION TAG' 344 23 
3  3STJ HIS C 345 ? UNP P39099 ? ? 'EXPRESSION TAG' 345 24 
4  3STJ LEU D 338 ? UNP P39099 ? ? 'EXPRESSION TAG' 338 25 
4  3STJ GLU D 339 ? UNP P39099 ? ? 'EXPRESSION TAG' 339 26 
4  3STJ HIS D 340 ? UNP P39099 ? ? 'EXPRESSION TAG' 340 27 
4  3STJ HIS D 341 ? UNP P39099 ? ? 'EXPRESSION TAG' 341 28 
4  3STJ HIS D 342 ? UNP P39099 ? ? 'EXPRESSION TAG' 342 29 
4  3STJ HIS D 343 ? UNP P39099 ? ? 'EXPRESSION TAG' 343 30 
4  3STJ HIS D 344 ? UNP P39099 ? ? 'EXPRESSION TAG' 344 31 
4  3STJ HIS D 345 ? UNP P39099 ? ? 'EXPRESSION TAG' 345 32 
5  3STJ LEU E 338 ? UNP P39099 ? ? 'EXPRESSION TAG' 338 33 
5  3STJ GLU E 339 ? UNP P39099 ? ? 'EXPRESSION TAG' 339 34 
5  3STJ HIS E 340 ? UNP P39099 ? ? 'EXPRESSION TAG' 340 35 
5  3STJ HIS E 341 ? UNP P39099 ? ? 'EXPRESSION TAG' 341 36 
5  3STJ HIS E 342 ? UNP P39099 ? ? 'EXPRESSION TAG' 342 37 
5  3STJ HIS E 343 ? UNP P39099 ? ? 'EXPRESSION TAG' 343 38 
5  3STJ HIS E 344 ? UNP P39099 ? ? 'EXPRESSION TAG' 344 39 
5  3STJ HIS E 345 ? UNP P39099 ? ? 'EXPRESSION TAG' 345 40 
6  3STJ LEU F 338 ? UNP P39099 ? ? 'EXPRESSION TAG' 338 41 
6  3STJ GLU F 339 ? UNP P39099 ? ? 'EXPRESSION TAG' 339 42 
6  3STJ HIS F 340 ? UNP P39099 ? ? 'EXPRESSION TAG' 340 43 
6  3STJ HIS F 341 ? UNP P39099 ? ? 'EXPRESSION TAG' 341 44 
6  3STJ HIS F 342 ? UNP P39099 ? ? 'EXPRESSION TAG' 342 45 
6  3STJ HIS F 343 ? UNP P39099 ? ? 'EXPRESSION TAG' 343 46 
6  3STJ HIS F 344 ? UNP P39099 ? ? 'EXPRESSION TAG' 344 47 
6  3STJ HIS F 345 ? UNP P39099 ? ? 'EXPRESSION TAG' 345 48 
7  3STJ LEU G 338 ? UNP P39099 ? ? 'EXPRESSION TAG' 338 49 
7  3STJ GLU G 339 ? UNP P39099 ? ? 'EXPRESSION TAG' 339 50 
7  3STJ HIS G 340 ? UNP P39099 ? ? 'EXPRESSION TAG' 340 51 
7  3STJ HIS G 341 ? UNP P39099 ? ? 'EXPRESSION TAG' 341 52 
7  3STJ HIS G 342 ? UNP P39099 ? ? 'EXPRESSION TAG' 342 53 
7  3STJ HIS G 343 ? UNP P39099 ? ? 'EXPRESSION TAG' 343 54 
7  3STJ HIS G 344 ? UNP P39099 ? ? 'EXPRESSION TAG' 344 55 
7  3STJ HIS G 345 ? UNP P39099 ? ? 'EXPRESSION TAG' 345 56 
8  3STJ LEU H 338 ? UNP P39099 ? ? 'EXPRESSION TAG' 338 57 
8  3STJ GLU H 339 ? UNP P39099 ? ? 'EXPRESSION TAG' 339 58 
8  3STJ HIS H 340 ? UNP P39099 ? ? 'EXPRESSION TAG' 340 59 
8  3STJ HIS H 341 ? UNP P39099 ? ? 'EXPRESSION TAG' 341 60 
8  3STJ HIS H 342 ? UNP P39099 ? ? 'EXPRESSION TAG' 342 61 
8  3STJ HIS H 343 ? UNP P39099 ? ? 'EXPRESSION TAG' 343 62 
8  3STJ HIS H 344 ? UNP P39099 ? ? 'EXPRESSION TAG' 344 63 
8  3STJ HIS H 345 ? UNP P39099 ? ? 'EXPRESSION TAG' 345 64 
9  3STJ LEU I 338 ? UNP P39099 ? ? 'EXPRESSION TAG' 338 65 
9  3STJ GLU I 339 ? UNP P39099 ? ? 'EXPRESSION TAG' 339 66 
9  3STJ HIS I 340 ? UNP P39099 ? ? 'EXPRESSION TAG' 340 67 
9  3STJ HIS I 341 ? UNP P39099 ? ? 'EXPRESSION TAG' 341 68 
9  3STJ HIS I 342 ? UNP P39099 ? ? 'EXPRESSION TAG' 342 69 
9  3STJ HIS I 343 ? UNP P39099 ? ? 'EXPRESSION TAG' 343 70 
9  3STJ HIS I 344 ? UNP P39099 ? ? 'EXPRESSION TAG' 344 71 
9  3STJ HIS I 345 ? UNP P39099 ? ? 'EXPRESSION TAG' 345 72 
10 3STJ LEU J 338 ? UNP P39099 ? ? 'EXPRESSION TAG' 338 73 
10 3STJ GLU J 339 ? UNP P39099 ? ? 'EXPRESSION TAG' 339 74 
10 3STJ HIS J 340 ? UNP P39099 ? ? 'EXPRESSION TAG' 340 75 
10 3STJ HIS J 341 ? UNP P39099 ? ? 'EXPRESSION TAG' 341 76 
10 3STJ HIS J 342 ? UNP P39099 ? ? 'EXPRESSION TAG' 342 77 
10 3STJ HIS J 343 ? UNP P39099 ? ? 'EXPRESSION TAG' 343 78 
10 3STJ HIS J 344 ? UNP P39099 ? ? 'EXPRESSION TAG' 344 79 
10 3STJ HIS J 345 ? UNP P39099 ? ? 'EXPRESSION TAG' 345 80 
11 3STJ LEU K 338 ? UNP P39099 ? ? 'EXPRESSION TAG' 338 81 
11 3STJ GLU K 339 ? UNP P39099 ? ? 'EXPRESSION TAG' 339 82 
11 3STJ HIS K 340 ? UNP P39099 ? ? 'EXPRESSION TAG' 340 83 
11 3STJ HIS K 341 ? UNP P39099 ? ? 'EXPRESSION TAG' 341 84 
11 3STJ HIS K 342 ? UNP P39099 ? ? 'EXPRESSION TAG' 342 85 
11 3STJ HIS K 343 ? UNP P39099 ? ? 'EXPRESSION TAG' 343 86 
11 3STJ HIS K 344 ? UNP P39099 ? ? 'EXPRESSION TAG' 344 87 
11 3STJ HIS K 345 ? UNP P39099 ? ? 'EXPRESSION TAG' 345 88 
12 3STJ LEU L 338 ? UNP P39099 ? ? 'EXPRESSION TAG' 338 89 
12 3STJ GLU L 339 ? UNP P39099 ? ? 'EXPRESSION TAG' 339 90 
12 3STJ HIS L 340 ? UNP P39099 ? ? 'EXPRESSION TAG' 340 91 
12 3STJ HIS L 341 ? UNP P39099 ? ? 'EXPRESSION TAG' 341 92 
12 3STJ HIS L 342 ? UNP P39099 ? ? 'EXPRESSION TAG' 342 93 
12 3STJ HIS L 343 ? UNP P39099 ? ? 'EXPRESSION TAG' 343 94 
12 3STJ HIS L 344 ? UNP P39099 ? ? 'EXPRESSION TAG' 344 95 
12 3STJ HIS L 345 ? UNP P39099 ? ? 'EXPRESSION TAG' 345 96 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
UNK 'L-peptide linking' . UNKNOWN         ? 'C4 H9 N O2'     103.120 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3STJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.51 
_exptl_crystal.density_percent_sol   50.94 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.4 
_exptl_crystal_grow.pdbx_details    '24% PEG6000, 5% PEG100, 10% glycerol, 0.1M MES pH5.4, VAPOR DIFFUSION, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-04-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.96860 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.96860 
# 
_reflns.entry_id                     3STJ 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   124692 
_reflns.number_all                   124692 
_reflns.percent_possible_obs         95.4 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        68.23 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3STJ 
_refine.ls_number_reflns_obs                     124692 
_refine.ls_number_reflns_all                     124692 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.94 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1857 
_refine.ls_R_factor_all                          0.1857 
_refine.ls_R_factor_R_work                       0.1843 
_refine.ls_R_factor_R_free                       0.2120 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.04 
_refine.ls_number_reflns_R_free                  6289 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9428 
_refine.correlation_coeff_Fo_to_Fc_free          0.9292 
_refine.B_iso_mean                               60.28 
_refine.aniso_B[1][1]                            3.4936 
_refine.aniso_B[2][2]                            3.4936 
_refine.aniso_B[3][3]                            -6.9873 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3STJ 
_refine_analyze.Luzzati_coordinate_error_obs    0.348 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        26483 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               26483 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        19.94 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_bond_d                  0.010 ? 2.00  26770 HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               1.32  ? 2.00  36202 HARMONIC     'X-RAY DIFFRACTION' 
t_dihedral_angle_d        ?     ? 2.00  12553 SINUSOIDAL   'X-RAY DIFFRACTION' 
t_incorr_chiral_ct        ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_pseud_angle             ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_trig_c_planes           ?     ? 2.00  744   HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              ?     ? 5.00  3906  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      ?     ? 20.00 26770 HARMONIC     'X-RAY DIFFRACTION' 
t_nbd                     ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_omega_torsion           3.50  ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_other_torsion           3.13  ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_improper_torsion        ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion ?     ? 5.00  3691  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_sum_occupancies         ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_utility_distance        ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_utility_angle           ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_utility_torsion         ?     ? ?     ?     ?            'X-RAY DIFFRACTION' 
t_ideal_dist_contact      ?     ? 4.00  28646 SEMIHARMONIC 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.67 
_refine_ls_shell.number_reflns_R_work             7727 
_refine_ls_shell.R_factor_R_work                  0.2213 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2481 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.73 
_refine_ls_shell.number_reflns_R_free             384 
_refine_ls_shell.number_reflns_all                8111 
_refine_ls_shell.R_factor_all                     0.2225 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3STJ 
_struct.title                     'Crystal structure of the protease + PDZ1 domain of DegQ from Escherichia coli' 
_struct.pdbx_descriptor           'Protease degQ (E.C.3.4.21.-), peptide (UNK)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3STJ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'serine protease, PDZ domain, protease, chaperone, DegP, DegQ, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 1 ? 
J N N 1 ? 
K N N 1 ? 
L N N 1 ? 
M N N 2 ? 
N N N 2 ? 
O N N 2 ? 
P N N 2 ? 
Q N N 2 ? 
R N N 2 ? 
S N N 2 ? 
T N N 2 ? 
U N N 2 ? 
V N N 2 ? 
W N N 2 ? 
X N N 2 ? 
Y N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'AS PER THE AUTHORS THE PROTEIN IS ONLY PRESENT AS A TRIMER IN SOLUTION IN THE ABSENCE OF SUBSTRATES' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 15  ? LEU A 23  ? LEU A 15  LEU A 23  1 ? 9  
HELX_P HELX_P2  2  ASN A 80  ? ASN A 85  ? ASN A 80  ASN A 85  1 ? 6  
HELX_P HELX_P3  3  ASP A 131 ? LEU A 135 ? ASP A 131 LEU A 135 5 ? 5  
HELX_P HELX_P4  4  ASN A 146 ? LEU A 150 ? ASN A 146 LEU A 150 5 ? 5  
HELX_P HELX_P5  5  SER A 221 ? GLY A 235 ? SER A 221 GLY A 235 1 ? 15 
HELX_P HELX_P6  6  SER A 250 ? PHE A 257 ? SER A 250 PHE A 257 1 ? 8  
HELX_P HELX_P7  7  SER A 274 ? GLY A 280 ? SER A 274 GLY A 280 1 ? 7  
HELX_P HELX_P8  8  SER A 297 ? THR A 307 ? SER A 297 THR A 307 1 ? 11 
HELX_P HELX_P9  9  LEU B 15  ? LEU B 23  ? LEU B 15  LEU B 23  1 ? 9  
HELX_P HELX_P10 10 ASN B 80  ? ASN B 85  ? ASN B 80  ASN B 85  1 ? 6  
HELX_P HELX_P11 11 ASP B 131 ? LEU B 135 ? ASP B 131 LEU B 135 5 ? 5  
HELX_P HELX_P12 12 ASN B 146 ? LEU B 150 ? ASN B 146 LEU B 150 5 ? 5  
HELX_P HELX_P13 13 SER B 221 ? GLY B 235 ? SER B 221 GLY B 235 1 ? 15 
HELX_P HELX_P14 14 SER B 250 ? PHE B 257 ? SER B 250 PHE B 257 1 ? 8  
HELX_P HELX_P15 15 SER B 274 ? GLY B 280 ? SER B 274 GLY B 280 1 ? 7  
HELX_P HELX_P16 16 SER B 297 ? THR B 308 ? SER B 297 THR B 308 1 ? 12 
HELX_P HELX_P17 17 LEU C 15  ? LEU C 23  ? LEU C 15  LEU C 23  1 ? 9  
HELX_P HELX_P18 18 ASN C 80  ? ASN C 85  ? ASN C 80  ASN C 85  1 ? 6  
HELX_P HELX_P19 19 ASP C 131 ? LEU C 135 ? ASP C 131 LEU C 135 5 ? 5  
HELX_P HELX_P20 20 ASN C 146 ? LEU C 150 ? ASN C 146 LEU C 150 5 ? 5  
HELX_P HELX_P21 21 SER C 221 ? GLY C 235 ? SER C 221 GLY C 235 1 ? 15 
HELX_P HELX_P22 22 SER C 250 ? PHE C 257 ? SER C 250 PHE C 257 1 ? 8  
HELX_P HELX_P23 23 SER C 274 ? ALA C 279 ? SER C 274 ALA C 279 1 ? 6  
HELX_P HELX_P24 24 SER C 297 ? THR C 308 ? SER C 297 THR C 308 1 ? 12 
HELX_P HELX_P25 25 LEU D 15  ? LEU D 23  ? LEU D 15  LEU D 23  1 ? 9  
HELX_P HELX_P26 26 ASN D 80  ? ASN D 85  ? ASN D 80  ASN D 85  1 ? 6  
HELX_P HELX_P27 27 ASP D 131 ? LEU D 135 ? ASP D 131 LEU D 135 5 ? 5  
HELX_P HELX_P28 28 ASN D 146 ? LEU D 150 ? ASN D 146 LEU D 150 5 ? 5  
HELX_P HELX_P29 29 SER D 221 ? GLY D 235 ? SER D 221 GLY D 235 1 ? 15 
HELX_P HELX_P30 30 SER D 250 ? PHE D 257 ? SER D 250 PHE D 257 1 ? 8  
HELX_P HELX_P31 31 SER D 274 ? ALA D 279 ? SER D 274 ALA D 279 1 ? 6  
HELX_P HELX_P32 32 SER D 297 ? THR D 308 ? SER D 297 THR D 308 1 ? 12 
HELX_P HELX_P33 33 LEU E 15  ? LEU E 23  ? LEU E 15  LEU E 23  1 ? 9  
HELX_P HELX_P34 34 ASN E 80  ? ASN E 85  ? ASN E 80  ASN E 85  1 ? 6  
HELX_P HELX_P35 35 ASP E 131 ? LEU E 135 ? ASP E 131 LEU E 135 5 ? 5  
HELX_P HELX_P36 36 ASN E 146 ? LEU E 150 ? ASN E 146 LEU E 150 5 ? 5  
HELX_P HELX_P37 37 SER E 221 ? GLY E 235 ? SER E 221 GLY E 235 1 ? 15 
HELX_P HELX_P38 38 SER E 250 ? PHE E 257 ? SER E 250 PHE E 257 1 ? 8  
HELX_P HELX_P39 39 SER E 274 ? GLY E 280 ? SER E 274 GLY E 280 1 ? 7  
HELX_P HELX_P40 40 SER E 297 ? THR E 308 ? SER E 297 THR E 308 1 ? 12 
HELX_P HELX_P41 41 LEU F 15  ? LEU F 23  ? LEU F 15  LEU F 23  1 ? 9  
HELX_P HELX_P42 42 ASN F 80  ? ASN F 85  ? ASN F 80  ASN F 85  1 ? 6  
HELX_P HELX_P43 43 ASP F 131 ? LEU F 135 ? ASP F 131 LEU F 135 5 ? 5  
HELX_P HELX_P44 44 ASN F 146 ? LEU F 150 ? ASN F 146 LEU F 150 5 ? 5  
HELX_P HELX_P45 45 SER F 221 ? GLY F 235 ? SER F 221 GLY F 235 1 ? 15 
HELX_P HELX_P46 46 SER F 250 ? PHE F 257 ? SER F 250 PHE F 257 1 ? 8  
HELX_P HELX_P47 47 SER F 274 ? GLY F 280 ? SER F 274 GLY F 280 1 ? 7  
HELX_P HELX_P48 48 SER F 297 ? THR F 308 ? SER F 297 THR F 308 1 ? 12 
HELX_P HELX_P49 49 LEU G 15  ? LEU G 23  ? LEU G 15  LEU G 23  1 ? 9  
HELX_P HELX_P50 50 ASN G 80  ? ASN G 85  ? ASN G 80  ASN G 85  1 ? 6  
HELX_P HELX_P51 51 ASP G 131 ? LEU G 135 ? ASP G 131 LEU G 135 5 ? 5  
HELX_P HELX_P52 52 ASN G 146 ? LEU G 150 ? ASN G 146 LEU G 150 5 ? 5  
HELX_P HELX_P53 53 SER G 221 ? GLY G 235 ? SER G 221 GLY G 235 1 ? 15 
HELX_P HELX_P54 54 SER G 250 ? PHE G 257 ? SER G 250 PHE G 257 1 ? 8  
HELX_P HELX_P55 55 SER G 274 ? ALA G 279 ? SER G 274 ALA G 279 1 ? 6  
HELX_P HELX_P56 56 SER G 297 ? THR G 308 ? SER G 297 THR G 308 1 ? 12 
HELX_P HELX_P57 57 LEU H 15  ? LEU H 23  ? LEU H 15  LEU H 23  1 ? 9  
HELX_P HELX_P58 58 ASN H 80  ? ASN H 85  ? ASN H 80  ASN H 85  1 ? 6  
HELX_P HELX_P59 59 ASP H 131 ? LEU H 135 ? ASP H 131 LEU H 135 5 ? 5  
HELX_P HELX_P60 60 ASN H 146 ? LEU H 150 ? ASN H 146 LEU H 150 5 ? 5  
HELX_P HELX_P61 61 SER H 221 ? GLY H 235 ? SER H 221 GLY H 235 1 ? 15 
HELX_P HELX_P62 62 SER H 250 ? PHE H 257 ? SER H 250 PHE H 257 1 ? 8  
HELX_P HELX_P63 63 SER H 274 ? GLY H 280 ? SER H 274 GLY H 280 1 ? 7  
HELX_P HELX_P64 64 SER H 297 ? THR H 308 ? SER H 297 THR H 308 1 ? 12 
HELX_P HELX_P65 65 LEU I 15  ? LEU I 23  ? LEU I 15  LEU I 23  1 ? 9  
HELX_P HELX_P66 66 ASN I 80  ? ASN I 85  ? ASN I 80  ASN I 85  1 ? 6  
HELX_P HELX_P67 67 ASP I 131 ? LEU I 135 ? ASP I 131 LEU I 135 5 ? 5  
HELX_P HELX_P68 68 ASN I 146 ? LEU I 150 ? ASN I 146 LEU I 150 5 ? 5  
HELX_P HELX_P69 69 SER I 221 ? GLY I 235 ? SER I 221 GLY I 235 1 ? 15 
HELX_P HELX_P70 70 SER I 250 ? PHE I 257 ? SER I 250 PHE I 257 1 ? 8  
HELX_P HELX_P71 71 SER I 274 ? GLY I 280 ? SER I 274 GLY I 280 1 ? 7  
HELX_P HELX_P72 72 SER I 297 ? THR I 308 ? SER I 297 THR I 308 1 ? 12 
HELX_P HELX_P73 73 LEU J 15  ? LEU J 23  ? LEU J 15  LEU J 23  1 ? 9  
HELX_P HELX_P74 74 ASN J 80  ? ASN J 85  ? ASN J 80  ASN J 85  1 ? 6  
HELX_P HELX_P75 75 ASP J 131 ? LEU J 135 ? ASP J 131 LEU J 135 5 ? 5  
HELX_P HELX_P76 76 ASN J 146 ? LEU J 150 ? ASN J 146 LEU J 150 5 ? 5  
HELX_P HELX_P77 77 SER J 221 ? GLY J 235 ? SER J 221 GLY J 235 1 ? 15 
HELX_P HELX_P78 78 SER J 250 ? PHE J 257 ? SER J 250 PHE J 257 1 ? 8  
HELX_P HELX_P79 79 SER J 274 ? GLY J 280 ? SER J 274 GLY J 280 1 ? 7  
HELX_P HELX_P80 80 SER J 297 ? THR J 308 ? SER J 297 THR J 308 1 ? 12 
HELX_P HELX_P81 81 LEU K 15  ? LEU K 23  ? LEU K 15  LEU K 23  1 ? 9  
HELX_P HELX_P82 82 ASN K 80  ? ASN K 85  ? ASN K 80  ASN K 85  1 ? 6  
HELX_P HELX_P83 83 ASP K 131 ? LEU K 135 ? ASP K 131 LEU K 135 5 ? 5  
HELX_P HELX_P84 84 ASN K 146 ? LEU K 150 ? ASN K 146 LEU K 150 5 ? 5  
HELX_P HELX_P85 85 SER K 221 ? GLY K 235 ? SER K 221 GLY K 235 1 ? 15 
HELX_P HELX_P86 86 SER K 250 ? PHE K 257 ? SER K 250 PHE K 257 1 ? 8  
HELX_P HELX_P87 87 SER K 274 ? GLY K 280 ? SER K 274 GLY K 280 1 ? 7  
HELX_P HELX_P88 88 SER K 297 ? THR K 307 ? SER K 297 THR K 307 1 ? 11 
HELX_P HELX_P89 89 LEU L 15  ? LEU L 23  ? LEU L 15  LEU L 23  1 ? 9  
HELX_P HELX_P90 90 ASN L 81  ? ASN L 85  ? ASN L 81  ASN L 85  1 ? 5  
HELX_P HELX_P91 91 ASP L 131 ? LEU L 135 ? ASP L 131 LEU L 135 5 ? 5  
HELX_P HELX_P92 92 ASN L 146 ? LEU L 150 ? ASN L 146 LEU L 150 5 ? 5  
HELX_P HELX_P93 93 SER L 221 ? GLY L 235 ? SER L 221 GLY L 235 1 ? 15 
HELX_P HELX_P94 94 SER L 250 ? PHE L 257 ? SER L 250 PHE L 257 1 ? 8  
HELX_P HELX_P95 95 SER L 274 ? GLY L 280 ? SER L 274 GLY L 280 1 ? 7  
HELX_P HELX_P96 96 SER L 297 ? THR L 308 ? SER L 297 THR L 308 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 7 ? 
B  ? 8 ? 
C  ? 2 ? 
D  ? 4 ? 
E  ? 4 ? 
F  ? 7 ? 
G  ? 7 ? 
H  ? 2 ? 
I  ? 4 ? 
J  ? 5 ? 
K  ? 7 ? 
L  ? 7 ? 
M  ? 2 ? 
N  ? 4 ? 
O  ? 4 ? 
P  ? 7 ? 
Q  ? 7 ? 
R  ? 2 ? 
S  ? 4 ? 
T  ? 4 ? 
U  ? 7 ? 
V  ? 7 ? 
W  ? 2 ? 
X  ? 4 ? 
Y  ? 4 ? 
Z  ? 7 ? 
AA ? 7 ? 
AB ? 2 ? 
AC ? 4 ? 
AD ? 4 ? 
AE ? 7 ? 
AF ? 7 ? 
AG ? 2 ? 
AH ? 4 ? 
AI ? 4 ? 
AJ ? 7 ? 
AK ? 7 ? 
AL ? 2 ? 
AM ? 4 ? 
AN ? 4 ? 
AO ? 7 ? 
AP ? 7 ? 
AQ ? 2 ? 
AR ? 4 ? 
AS ? 4 ? 
AT ? 7 ? 
AU ? 7 ? 
AV ? 2 ? 
AW ? 4 ? 
AX ? 4 ? 
AY ? 7 ? 
AZ ? 7 ? 
BA ? 2 ? 
BB ? 4 ? 
BC ? 5 ? 
BD ? 7 ? 
BE ? 7 ? 
BF ? 2 ? 
BG ? 4 ? 
BH ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
A  4 5 ? anti-parallel 
A  5 6 ? anti-parallel 
A  6 7 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
B  6 7 ? anti-parallel 
B  7 8 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
F  5 6 ? anti-parallel 
F  6 7 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
G  4 5 ? anti-parallel 
G  5 6 ? anti-parallel 
G  6 7 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
J  4 5 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
K  4 5 ? anti-parallel 
K  5 6 ? anti-parallel 
K  6 7 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
L  4 5 ? anti-parallel 
L  5 6 ? anti-parallel 
L  6 7 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
P  4 5 ? anti-parallel 
P  5 6 ? anti-parallel 
P  6 7 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
Q  4 5 ? anti-parallel 
Q  5 6 ? anti-parallel 
Q  6 7 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
U  4 5 ? anti-parallel 
U  5 6 ? anti-parallel 
U  6 7 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
V  4 5 ? anti-parallel 
V  5 6 ? anti-parallel 
V  6 7 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
Z  4 5 ? anti-parallel 
Z  5 6 ? anti-parallel 
Z  6 7 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AE 4 5 ? anti-parallel 
AE 5 6 ? anti-parallel 
AE 6 7 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AF 5 6 ? anti-parallel 
AF 6 7 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AJ 4 5 ? anti-parallel 
AJ 5 6 ? anti-parallel 
AJ 6 7 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AK 4 5 ? anti-parallel 
AK 5 6 ? anti-parallel 
AK 6 7 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AO 4 5 ? anti-parallel 
AO 5 6 ? anti-parallel 
AO 6 7 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AP 4 5 ? anti-parallel 
AP 5 6 ? anti-parallel 
AP 6 7 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
AT 4 5 ? anti-parallel 
AT 5 6 ? anti-parallel 
AT 6 7 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
AU 4 5 ? anti-parallel 
AU 5 6 ? anti-parallel 
AU 6 7 ? anti-parallel 
AV 1 2 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AW 3 4 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AY 1 2 ? anti-parallel 
AY 2 3 ? anti-parallel 
AY 3 4 ? anti-parallel 
AY 4 5 ? anti-parallel 
AY 5 6 ? anti-parallel 
AY 6 7 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
AZ 3 4 ? anti-parallel 
AZ 4 5 ? anti-parallel 
AZ 5 6 ? anti-parallel 
AZ 6 7 ? anti-parallel 
BA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BC 4 5 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BD 4 5 ? anti-parallel 
BD 5 6 ? anti-parallel 
BD 6 7 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BE 4 5 ? anti-parallel 
BE 5 6 ? anti-parallel 
BE 6 7 ? anti-parallel 
BF 1 2 ? anti-parallel 
BG 1 2 ? anti-parallel 
BG 2 3 ? anti-parallel 
BG 3 4 ? anti-parallel 
BH 1 2 ? anti-parallel 
BH 2 3 ? anti-parallel 
BH 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 26  ? GLY A 33  ? VAL A 26  GLY A 33  
A  2 PHE A 61  ? ASN A 71  ? PHE A 61  ASN A 71  
A  3 TYR A 76  ? THR A 79  ? TYR A 76  THR A 79  
A  4 ILE A 113 ? ILE A 118 ? ILE A 113 ILE A 118 
A  5 GLU A 99  ? ASP A 108 ? GLU A 99  ASP A 108 
A  6 ALA A 87  ? GLN A 93  ? ALA A 87  GLN A 93  
A  7 VAL A 26  ? GLY A 33  ? VAL A 26  GLY A 33  
B  1 UNK Y 4   ? UNK Y 5   ? UNK Z 3   UNK Z 4   
B  2 LEU A 198 ? LEU A 206 ? LEU A 198 LEU A 206 
B  3 GLY A 216 ? PRO A 220 ? GLY A 216 PRO A 220 
B  4 PHE A 175 ? THR A 178 ? PHE A 175 THR A 178 
B  5 THR A 153 ? ARG A 164 ? THR A 153 ARG A 164 
B  6 PHE A 140 ? GLY A 145 ? PHE A 140 GLY A 145 
B  7 ALA A 190 ? LEU A 192 ? ALA A 190 LEU A 192 
B  8 LEU A 198 ? LEU A 206 ? LEU A 198 LEU A 206 
C  1 GLY A 240 ? LEU A 241 ? GLY A 240 LEU A 241 
C  2 ASP A 332 ? THR A 333 ? ASP A 332 THR A 333 
D  1 ILE A 286 ? ILE A 287 ? ILE A 286 ILE A 287 
D  2 ALA A 265 ? VAL A 270 ? ALA A 265 VAL A 270 
D  3 ILE A 244 ? GLU A 248 ? ILE A 244 GLU A 248 
D  4 UNK M 3   ? UNK M 4   ? UNK M 403 UNK M 404 
E  1 LYS A 293 ? PRO A 294 ? LYS A 293 PRO A 294 
E  2 SER A 289 ? LEU A 290 ? SER A 289 LEU A 290 
E  3 LYS A 313 ? ARG A 320 ? LYS A 313 ARG A 320 
E  4 LYS A 323 ? THR A 330 ? LYS A 323 THR A 330 
F  1 VAL B 26  ? GLY B 33  ? VAL B 26  GLY B 33  
F  2 PHE B 61  ? ASN B 71  ? PHE B 61  ASN B 71  
F  3 TYR B 76  ? THR B 79  ? TYR B 76  THR B 79  
F  4 ILE B 113 ? ILE B 118 ? ILE B 113 ILE B 118 
F  5 GLU B 99  ? ASP B 108 ? GLU B 99  ASP B 108 
F  6 ALA B 87  ? GLN B 93  ? ALA B 87  GLN B 93  
F  7 VAL B 26  ? GLY B 33  ? VAL B 26  GLY B 33  
G  1 PHE B 140 ? GLY B 145 ? PHE B 140 GLY B 145 
G  2 THR B 153 ? ARG B 164 ? THR B 153 ARG B 164 
G  3 PHE B 175 ? THR B 178 ? PHE B 175 THR B 178 
G  4 GLY B 216 ? PRO B 220 ? GLY B 216 PRO B 220 
G  5 LEU B 198 ? ILE B 205 ? LEU B 198 ILE B 205 
G  6 ALA B 190 ? LEU B 192 ? ALA B 190 LEU B 192 
G  7 PHE B 140 ? GLY B 145 ? PHE B 140 GLY B 145 
H  1 GLY B 240 ? LEU B 241 ? GLY B 240 LEU B 241 
H  2 ASP B 332 ? THR B 333 ? ASP B 332 THR B 333 
I  1 LYS B 293 ? PRO B 294 ? LYS B 293 PRO B 294 
I  2 ILE B 286 ? LEU B 290 ? ILE B 286 LEU B 290 
I  3 LYS B 313 ? ARG B 320 ? LYS B 313 ARG B 320 
I  4 LYS B 323 ? THR B 330 ? LYS B 323 THR B 330 
J  1 LYS B 293 ? PRO B 294 ? LYS B 293 PRO B 294 
J  2 ILE B 286 ? LEU B 290 ? ILE B 286 LEU B 290 
J  3 ALA B 265 ? VAL B 270 ? ALA B 265 VAL B 270 
J  4 ILE B 244 ? GLU B 248 ? ILE B 244 GLU B 248 
J  5 UNK N 3   ? UNK N 4   ? UNK N 403 UNK N 404 
K  1 VAL C 26  ? GLY C 33  ? VAL C 26  GLY C 33  
K  2 PHE C 61  ? ASN C 71  ? PHE C 61  ASN C 71  
K  3 TYR C 76  ? THR C 79  ? TYR C 76  THR C 79  
K  4 ILE C 113 ? ILE C 118 ? ILE C 113 ILE C 118 
K  5 GLU C 99  ? ASP C 108 ? GLU C 99  ASP C 108 
K  6 ALA C 87  ? GLN C 93  ? ALA C 87  GLN C 93  
K  7 VAL C 26  ? GLY C 33  ? VAL C 26  GLY C 33  
L  1 PHE C 140 ? GLY C 145 ? PHE C 140 GLY C 145 
L  2 THR C 153 ? ARG C 164 ? THR C 153 ARG C 164 
L  3 PHE C 175 ? THR C 178 ? PHE C 175 THR C 178 
L  4 GLY C 216 ? PRO C 220 ? GLY C 216 PRO C 220 
L  5 LEU C 198 ? ILE C 205 ? LEU C 198 ILE C 205 
L  6 ALA C 190 ? LEU C 192 ? ALA C 190 LEU C 192 
L  7 PHE C 140 ? GLY C 145 ? PHE C 140 GLY C 145 
M  1 GLY C 240 ? LEU C 241 ? GLY C 240 LEU C 241 
M  2 ASP C 332 ? THR C 333 ? ASP C 332 THR C 333 
N  1 ILE C 286 ? ILE C 287 ? ILE C 286 ILE C 287 
N  2 ALA C 265 ? VAL C 270 ? ALA C 265 VAL C 270 
N  3 ILE C 244 ? GLU C 248 ? ILE C 244 GLU C 248 
N  4 UNK O 3   ? UNK O 4   ? UNK O 403 UNK O 404 
O  1 LYS C 293 ? PRO C 294 ? LYS C 293 PRO C 294 
O  2 SER C 289 ? LEU C 290 ? SER C 289 LEU C 290 
O  3 LYS C 313 ? ARG C 320 ? LYS C 313 ARG C 320 
O  4 LYS C 323 ? THR C 330 ? LYS C 323 THR C 330 
P  1 VAL D 26  ? GLY D 33  ? VAL D 26  GLY D 33  
P  2 PHE D 61  ? ASN D 71  ? PHE D 61  ASN D 71  
P  3 TYR D 76  ? THR D 79  ? TYR D 76  THR D 79  
P  4 ILE D 113 ? ILE D 118 ? ILE D 113 ILE D 118 
P  5 GLU D 99  ? ASP D 108 ? GLU D 99  ASP D 108 
P  6 ALA D 87  ? GLN D 93  ? ALA D 87  GLN D 93  
P  7 VAL D 26  ? GLY D 33  ? VAL D 26  GLY D 33  
Q  1 PHE D 140 ? GLY D 145 ? PHE D 140 GLY D 145 
Q  2 THR D 153 ? ARG D 164 ? THR D 153 ARG D 164 
Q  3 PHE D 175 ? THR D 178 ? PHE D 175 THR D 178 
Q  4 GLY D 216 ? PRO D 220 ? GLY D 216 PRO D 220 
Q  5 LEU D 198 ? ILE D 205 ? LEU D 198 ILE D 205 
Q  6 ALA D 190 ? LEU D 192 ? ALA D 190 LEU D 192 
Q  7 PHE D 140 ? GLY D 145 ? PHE D 140 GLY D 145 
R  1 GLY D 240 ? LEU D 241 ? GLY D 240 LEU D 241 
R  2 ASP D 332 ? THR D 333 ? ASP D 332 THR D 333 
S  1 ILE D 286 ? ILE D 287 ? ILE D 286 ILE D 287 
S  2 ALA D 265 ? VAL D 270 ? ALA D 265 VAL D 270 
S  3 ILE D 244 ? GLU D 248 ? ILE D 244 GLU D 248 
S  4 UNK P 3   ? UNK P 4   ? UNK P 403 UNK P 404 
T  1 LYS D 293 ? PRO D 294 ? LYS D 293 PRO D 294 
T  2 SER D 289 ? LEU D 290 ? SER D 289 LEU D 290 
T  3 LYS D 313 ? ARG D 320 ? LYS D 313 ARG D 320 
T  4 LYS D 323 ? THR D 330 ? LYS D 323 THR D 330 
U  1 VAL E 26  ? GLY E 33  ? VAL E 26  GLY E 33  
U  2 PHE E 61  ? ASN E 71  ? PHE E 61  ASN E 71  
U  3 TYR E 76  ? THR E 79  ? TYR E 76  THR E 79  
U  4 ILE E 113 ? ILE E 118 ? ILE E 113 ILE E 118 
U  5 GLU E 99  ? ASP E 108 ? GLU E 99  ASP E 108 
U  6 ALA E 87  ? GLN E 93  ? ALA E 87  GLN E 93  
U  7 VAL E 26  ? GLY E 33  ? VAL E 26  GLY E 33  
V  1 PHE E 140 ? GLY E 145 ? PHE E 140 GLY E 145 
V  2 THR E 153 ? ARG E 164 ? THR E 153 ARG E 164 
V  3 PHE E 175 ? THR E 178 ? PHE E 175 THR E 178 
V  4 GLY E 216 ? PRO E 220 ? GLY E 216 PRO E 220 
V  5 LEU E 198 ? ILE E 205 ? LEU E 198 ILE E 205 
V  6 ALA E 190 ? LEU E 192 ? ALA E 190 LEU E 192 
V  7 PHE E 140 ? GLY E 145 ? PHE E 140 GLY E 145 
W  1 GLY E 240 ? LEU E 241 ? GLY E 240 LEU E 241 
W  2 ASP E 332 ? THR E 333 ? ASP E 332 THR E 333 
X  1 ILE E 286 ? ILE E 287 ? ILE E 286 ILE E 287 
X  2 ALA E 265 ? VAL E 270 ? ALA E 265 VAL E 270 
X  3 ILE E 244 ? GLU E 248 ? ILE E 244 GLU E 248 
X  4 UNK Q 3   ? UNK Q 4   ? UNK Q 403 UNK Q 404 
Y  1 LYS E 293 ? PRO E 294 ? LYS E 293 PRO E 294 
Y  2 SER E 289 ? LEU E 290 ? SER E 289 LEU E 290 
Y  3 LYS E 313 ? ARG E 320 ? LYS E 313 ARG E 320 
Y  4 LYS E 323 ? THR E 330 ? LYS E 323 THR E 330 
Z  1 VAL F 26  ? GLY F 33  ? VAL F 26  GLY F 33  
Z  2 PHE F 61  ? ASN F 71  ? PHE F 61  ASN F 71  
Z  3 TYR F 76  ? THR F 79  ? TYR F 76  THR F 79  
Z  4 ILE F 113 ? ILE F 118 ? ILE F 113 ILE F 118 
Z  5 GLU F 99  ? ASP F 108 ? GLU F 99  ASP F 108 
Z  6 ALA F 87  ? GLN F 93  ? ALA F 87  GLN F 93  
Z  7 VAL F 26  ? GLY F 33  ? VAL F 26  GLY F 33  
AA 1 PHE F 140 ? GLY F 145 ? PHE F 140 GLY F 145 
AA 2 THR F 153 ? ARG F 164 ? THR F 153 ARG F 164 
AA 3 PHE F 175 ? THR F 178 ? PHE F 175 THR F 178 
AA 4 GLY F 216 ? PRO F 220 ? GLY F 216 PRO F 220 
AA 5 LEU F 198 ? ILE F 205 ? LEU F 198 ILE F 205 
AA 6 ALA F 190 ? LEU F 192 ? ALA F 190 LEU F 192 
AA 7 PHE F 140 ? GLY F 145 ? PHE F 140 GLY F 145 
AB 1 GLY F 240 ? LEU F 241 ? GLY F 240 LEU F 241 
AB 2 ASP F 332 ? THR F 333 ? ASP F 332 THR F 333 
AC 1 ILE F 286 ? ILE F 287 ? ILE F 286 ILE F 287 
AC 2 ALA F 265 ? VAL F 270 ? ALA F 265 VAL F 270 
AC 3 ILE F 244 ? GLU F 248 ? ILE F 244 GLU F 248 
AC 4 UNK R 3   ? UNK R 4   ? UNK R 403 UNK R 404 
AD 1 LYS F 293 ? PRO F 294 ? LYS F 293 PRO F 294 
AD 2 SER F 289 ? LEU F 290 ? SER F 289 LEU F 290 
AD 3 LYS F 313 ? ARG F 320 ? LYS F 313 ARG F 320 
AD 4 LYS F 323 ? THR F 330 ? LYS F 323 THR F 330 
AE 1 VAL G 26  ? GLY G 33  ? VAL G 26  GLY G 33  
AE 2 PHE G 61  ? ASN G 71  ? PHE G 61  ASN G 71  
AE 3 TYR G 76  ? THR G 79  ? TYR G 76  THR G 79  
AE 4 ILE G 113 ? ILE G 118 ? ILE G 113 ILE G 118 
AE 5 GLU G 99  ? ASP G 108 ? GLU G 99  ASP G 108 
AE 6 ALA G 87  ? GLN G 93  ? ALA G 87  GLN G 93  
AE 7 VAL G 26  ? GLY G 33  ? VAL G 26  GLY G 33  
AF 1 PHE G 140 ? GLY G 145 ? PHE G 140 GLY G 145 
AF 2 THR G 153 ? ARG G 164 ? THR G 153 ARG G 164 
AF 3 PHE G 175 ? THR G 178 ? PHE G 175 THR G 178 
AF 4 GLY G 216 ? PRO G 220 ? GLY G 216 PRO G 220 
AF 5 LEU G 198 ? ILE G 205 ? LEU G 198 ILE G 205 
AF 6 ALA G 190 ? LEU G 192 ? ALA G 190 LEU G 192 
AF 7 PHE G 140 ? GLY G 145 ? PHE G 140 GLY G 145 
AG 1 GLY G 240 ? LEU G 241 ? GLY G 240 LEU G 241 
AG 2 ASP G 332 ? THR G 333 ? ASP G 332 THR G 333 
AH 1 ILE G 286 ? ILE G 287 ? ILE G 286 ILE G 287 
AH 2 ALA G 265 ? VAL G 270 ? ALA G 265 VAL G 270 
AH 3 ILE G 244 ? GLU G 248 ? ILE G 244 GLU G 248 
AH 4 UNK S 3   ? UNK S 4   ? UNK S 403 UNK S 404 
AI 1 LYS G 293 ? PRO G 294 ? LYS G 293 PRO G 294 
AI 2 SER G 289 ? LEU G 290 ? SER G 289 LEU G 290 
AI 3 LYS G 313 ? ARG G 320 ? LYS G 313 ARG G 320 
AI 4 LYS G 323 ? THR G 330 ? LYS G 323 THR G 330 
AJ 1 VAL H 26  ? GLY H 33  ? VAL H 26  GLY H 33  
AJ 2 PHE H 61  ? ASN H 71  ? PHE H 61  ASN H 71  
AJ 3 TYR H 76  ? THR H 79  ? TYR H 76  THR H 79  
AJ 4 ILE H 113 ? ILE H 118 ? ILE H 113 ILE H 118 
AJ 5 GLU H 99  ? ASP H 108 ? GLU H 99  ASP H 108 
AJ 6 ALA H 87  ? GLN H 93  ? ALA H 87  GLN H 93  
AJ 7 VAL H 26  ? GLY H 33  ? VAL H 26  GLY H 33  
AK 1 PHE H 140 ? GLY H 145 ? PHE H 140 GLY H 145 
AK 2 THR H 153 ? ARG H 164 ? THR H 153 ARG H 164 
AK 3 PHE H 175 ? THR H 178 ? PHE H 175 THR H 178 
AK 4 GLY H 216 ? PRO H 220 ? GLY H 216 PRO H 220 
AK 5 LEU H 198 ? ILE H 205 ? LEU H 198 ILE H 205 
AK 6 ALA H 190 ? LEU H 192 ? ALA H 190 LEU H 192 
AK 7 PHE H 140 ? GLY H 145 ? PHE H 140 GLY H 145 
AL 1 GLY H 240 ? LEU H 241 ? GLY H 240 LEU H 241 
AL 2 ASP H 332 ? THR H 333 ? ASP H 332 THR H 333 
AM 1 ILE H 286 ? ILE H 287 ? ILE H 286 ILE H 287 
AM 2 ALA H 265 ? VAL H 270 ? ALA H 265 VAL H 270 
AM 3 ILE H 244 ? GLU H 248 ? ILE H 244 GLU H 248 
AM 4 UNK T 3   ? UNK T 4   ? UNK T 403 UNK T 404 
AN 1 LYS H 293 ? PRO H 294 ? LYS H 293 PRO H 294 
AN 2 SER H 289 ? LEU H 290 ? SER H 289 LEU H 290 
AN 3 LYS H 313 ? ARG H 320 ? LYS H 313 ARG H 320 
AN 4 LYS H 323 ? THR H 330 ? LYS H 323 THR H 330 
AO 1 VAL I 26  ? GLY I 33  ? VAL I 26  GLY I 33  
AO 2 PHE I 61  ? ASN I 71  ? PHE I 61  ASN I 71  
AO 3 TYR I 76  ? THR I 79  ? TYR I 76  THR I 79  
AO 4 ILE I 113 ? ILE I 118 ? ILE I 113 ILE I 118 
AO 5 GLU I 99  ? ASP I 108 ? GLU I 99  ASP I 108 
AO 6 ALA I 87  ? GLN I 93  ? ALA I 87  GLN I 93  
AO 7 VAL I 26  ? GLY I 33  ? VAL I 26  GLY I 33  
AP 1 PHE I 140 ? GLY I 145 ? PHE I 140 GLY I 145 
AP 2 THR I 153 ? ARG I 164 ? THR I 153 ARG I 164 
AP 3 PHE I 175 ? THR I 178 ? PHE I 175 THR I 178 
AP 4 GLY I 216 ? PRO I 220 ? GLY I 216 PRO I 220 
AP 5 LEU I 198 ? ILE I 205 ? LEU I 198 ILE I 205 
AP 6 ALA I 190 ? LEU I 192 ? ALA I 190 LEU I 192 
AP 7 PHE I 140 ? GLY I 145 ? PHE I 140 GLY I 145 
AQ 1 GLY I 240 ? LEU I 241 ? GLY I 240 LEU I 241 
AQ 2 ASP I 332 ? THR I 333 ? ASP I 332 THR I 333 
AR 1 ILE I 286 ? ILE I 287 ? ILE I 286 ILE I 287 
AR 2 ALA I 265 ? VAL I 270 ? ALA I 265 VAL I 270 
AR 3 ILE I 244 ? GLU I 248 ? ILE I 244 GLU I 248 
AR 4 UNK U 3   ? UNK U 4   ? UNK U 403 UNK U 404 
AS 1 LYS I 293 ? PRO I 294 ? LYS I 293 PRO I 294 
AS 2 SER I 289 ? LEU I 290 ? SER I 289 LEU I 290 
AS 3 LYS I 313 ? ARG I 320 ? LYS I 313 ARG I 320 
AS 4 LYS I 323 ? THR I 330 ? LYS I 323 THR I 330 
AT 1 VAL J 26  ? GLY J 33  ? VAL J 26  GLY J 33  
AT 2 PHE J 61  ? ASN J 71  ? PHE J 61  ASN J 71  
AT 3 TYR J 76  ? THR J 79  ? TYR J 76  THR J 79  
AT 4 ILE J 113 ? ILE J 118 ? ILE J 113 ILE J 118 
AT 5 GLU J 99  ? ASP J 108 ? GLU J 99  ASP J 108 
AT 6 ALA J 87  ? GLN J 93  ? ALA J 87  GLN J 93  
AT 7 VAL J 26  ? GLY J 33  ? VAL J 26  GLY J 33  
AU 1 PHE J 140 ? GLY J 145 ? PHE J 140 GLY J 145 
AU 2 THR J 153 ? ARG J 164 ? THR J 153 ARG J 164 
AU 3 PHE J 175 ? THR J 178 ? PHE J 175 THR J 178 
AU 4 GLY J 216 ? PRO J 220 ? GLY J 216 PRO J 220 
AU 5 LEU J 198 ? ILE J 205 ? LEU J 198 ILE J 205 
AU 6 ALA J 190 ? LEU J 192 ? ALA J 190 LEU J 192 
AU 7 PHE J 140 ? GLY J 145 ? PHE J 140 GLY J 145 
AV 1 GLY J 240 ? LEU J 241 ? GLY J 240 LEU J 241 
AV 2 ASP J 332 ? THR J 333 ? ASP J 332 THR J 333 
AW 1 ILE J 286 ? ILE J 287 ? ILE J 286 ILE J 287 
AW 2 ALA J 265 ? VAL J 270 ? ALA J 265 VAL J 270 
AW 3 ILE J 244 ? GLU J 248 ? ILE J 244 GLU J 248 
AW 4 UNK V 3   ? UNK V 4   ? UNK V 403 UNK V 404 
AX 1 LYS J 293 ? PRO J 294 ? LYS J 293 PRO J 294 
AX 2 SER J 289 ? LEU J 290 ? SER J 289 LEU J 290 
AX 3 LYS J 313 ? ARG J 320 ? LYS J 313 ARG J 320 
AX 4 LYS J 323 ? THR J 330 ? LYS J 323 THR J 330 
AY 1 VAL K 26  ? GLY K 33  ? VAL K 26  GLY K 33  
AY 2 PHE K 61  ? ASN K 71  ? PHE K 61  ASN K 71  
AY 3 TYR K 76  ? THR K 79  ? TYR K 76  THR K 79  
AY 4 ILE K 113 ? ILE K 118 ? ILE K 113 ILE K 118 
AY 5 GLU K 99  ? ASP K 108 ? GLU K 99  ASP K 108 
AY 6 ALA K 87  ? GLN K 93  ? ALA K 87  GLN K 93  
AY 7 VAL K 26  ? GLY K 33  ? VAL K 26  GLY K 33  
AZ 1 PHE K 140 ? GLY K 145 ? PHE K 140 GLY K 145 
AZ 2 THR K 153 ? ARG K 164 ? THR K 153 ARG K 164 
AZ 3 PHE K 175 ? THR K 178 ? PHE K 175 THR K 178 
AZ 4 GLY K 216 ? PRO K 220 ? GLY K 216 PRO K 220 
AZ 5 LEU K 198 ? ILE K 205 ? LEU K 198 ILE K 205 
AZ 6 ALA K 190 ? LEU K 192 ? ALA K 190 LEU K 192 
AZ 7 PHE K 140 ? GLY K 145 ? PHE K 140 GLY K 145 
BA 1 GLY K 240 ? LEU K 241 ? GLY K 240 LEU K 241 
BA 2 ASP K 332 ? THR K 333 ? ASP K 332 THR K 333 
BB 1 LYS K 293 ? PRO K 294 ? LYS K 293 PRO K 294 
BB 2 ILE K 286 ? LEU K 290 ? ILE K 286 LEU K 290 
BB 3 LYS K 313 ? ARG K 320 ? LYS K 313 ARG K 320 
BB 4 LYS K 323 ? THR K 330 ? LYS K 323 THR K 330 
BC 1 LYS K 293 ? PRO K 294 ? LYS K 293 PRO K 294 
BC 2 ILE K 286 ? LEU K 290 ? ILE K 286 LEU K 290 
BC 3 ALA K 265 ? VAL K 270 ? ALA K 265 VAL K 270 
BC 4 ILE K 244 ? GLU K 248 ? ILE K 244 GLU K 248 
BC 5 UNK W 3   ? UNK W 4   ? UNK W 403 UNK W 404 
BD 1 VAL L 26  ? GLY L 33  ? VAL L 26  GLY L 33  
BD 2 PHE L 61  ? ASN L 71  ? PHE L 61  ASN L 71  
BD 3 TYR L 76  ? ASN L 80  ? TYR L 76  ASN L 80  
BD 4 ILE L 113 ? ILE L 118 ? ILE L 113 ILE L 118 
BD 5 GLU L 99  ? ASP L 108 ? GLU L 99  ASP L 108 
BD 6 ALA L 87  ? GLN L 93  ? ALA L 87  GLN L 93  
BD 7 VAL L 26  ? GLY L 33  ? VAL L 26  GLY L 33  
BE 1 PHE L 140 ? GLY L 145 ? PHE L 140 GLY L 145 
BE 2 THR L 153 ? ARG L 164 ? THR L 153 ARG L 164 
BE 3 PHE L 175 ? THR L 178 ? PHE L 175 THR L 178 
BE 4 GLY L 216 ? PRO L 220 ? GLY L 216 PRO L 220 
BE 5 LEU L 198 ? ILE L 205 ? LEU L 198 ILE L 205 
BE 6 ALA L 190 ? LEU L 192 ? ALA L 190 LEU L 192 
BE 7 PHE L 140 ? GLY L 145 ? PHE L 140 GLY L 145 
BF 1 GLY L 240 ? LEU L 241 ? GLY L 240 LEU L 241 
BF 2 ASP L 332 ? THR L 333 ? ASP L 332 THR L 333 
BG 1 ILE L 286 ? ILE L 287 ? ILE L 286 ILE L 287 
BG 2 ALA L 265 ? VAL L 270 ? ALA L 265 VAL L 270 
BG 3 ILE L 244 ? GLU L 248 ? ILE L 244 GLU L 248 
BG 4 UNK X 3   ? UNK X 4   ? UNK X 403 UNK X 404 
BH 1 LYS L 293 ? PRO L 294 ? LYS L 293 PRO L 294 
BH 2 SER L 289 ? LEU L 290 ? SER L 289 LEU L 290 
BH 3 LYS L 313 ? ARG L 320 ? LYS L 313 ARG L 320 
BH 4 LYS L 323 ? THR L 330 ? LYS L 323 THR L 330 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N VAL A 27  ? N VAL A 27  O GLY A 67  ? O GLY A 67  
A  2 3 N ILE A 70  ? N ILE A 70  O TYR A 76  ? O TYR A 76  
A  3 4 N VAL A 77  ? N VAL A 77  O LEU A 116 ? O LEU A 116 
A  4 5 O LEU A 115 ? O LEU A 115 N GLY A 106 ? N GLY A 106 
A  5 6 O PHE A 100 ? O PHE A 100 N ILE A 92  ? N ILE A 92  
A  6 7 O GLN A 88  ? O GLN A 88  N GLU A 32  ? N GLU A 32  
B  1 2 O UNK Y 5   ? O UNK Z 4   N ILE A 205 ? N ILE A 205 
B  2 3 N ALA A 204 ? N ALA A 204 O PHE A 217 ? O PHE A 217 
B  3 4 O GLY A 216 ? O GLY A 216 N THR A 178 ? N THR A 178 
B  4 5 O GLN A 177 ? O GLN A 177 N SER A 160 ? N SER A 160 
B  5 6 O GLY A 157 ? O GLY A 157 N ALA A 141 ? N ALA A 141 
B  6 7 N VAL A 142 ? N VAL A 142 O LEU A 192 ? O LEU A 192 
B  7 8 N LEU A 191 ? N LEU A 191 O ILE A 199 ? O ILE A 199 
C  1 2 N LEU A 241 ? N LEU A 241 O ASP A 332 ? O ASP A 332 
D  1 2 O ILE A 287 ? O ILE A 287 N ALA A 265 ? N ALA A 265 
D  2 3 O PHE A 266 ? O PHE A 266 N THR A 247 ? N THR A 247 
D  3 4 N GLY A 246 ? N GLY A 246 O UNK M 3   ? O UNK M 403 
E  1 2 O LYS A 293 ? O LYS A 293 N LEU A 290 ? N LEU A 290 
E  2 3 N SER A 289 ? N SER A 289 O GLY A 317 ? O GLY A 317 
E  3 4 N LEU A 316 ? N LEU A 316 O VAL A 327 ? O VAL A 327 
F  1 2 N VAL B 31  ? N VAL B 31  O GLY B 63  ? O GLY B 63  
F  2 3 N VAL B 68  ? N VAL B 68  O LEU B 78  ? O LEU B 78  
F  3 4 N VAL B 77  ? N VAL B 77  O LEU B 116 ? O LEU B 116 
F  4 5 O LEU B 115 ? O LEU B 115 N GLY B 106 ? N GLY B 106 
F  5 6 O PHE B 100 ? O PHE B 100 N ILE B 92  ? N ILE B 92  
F  6 7 O GLN B 88  ? O GLN B 88  N GLU B 32  ? N GLU B 32  
G  1 2 N ALA B 143 ? N ALA B 143 O THR B 155 ? O THR B 155 
G  2 3 N SER B 160 ? N SER B 160 O GLN B 177 ? O GLN B 177 
G  3 4 N ILE B 176 ? N ILE B 176 O ALA B 218 ? O ALA B 218 
G  4 5 O PHE B 217 ? O PHE B 217 N ALA B 204 ? N ALA B 204 
G  5 6 O ILE B 199 ? O ILE B 199 N LEU B 191 ? N LEU B 191 
G  6 7 O LEU B 192 ? O LEU B 192 N VAL B 142 ? N VAL B 142 
H  1 2 N LEU B 241 ? N LEU B 241 O ASP B 332 ? O ASP B 332 
I  1 2 O LYS B 293 ? O LYS B 293 N LEU B 290 ? N LEU B 290 
I  2 3 N THR B 288 ? N THR B 288 O GLY B 317 ? O GLY B 317 
I  3 4 N LEU B 316 ? N LEU B 316 O VAL B 327 ? O VAL B 327 
J  1 2 O LYS B 293 ? O LYS B 293 N LEU B 290 ? N LEU B 290 
J  2 3 O ILE B 287 ? O ILE B 287 N ALA B 265 ? N ALA B 265 
J  3 4 O PHE B 266 ? O PHE B 266 N THR B 247 ? N THR B 247 
J  4 5 N GLY B 246 ? N GLY B 246 O UNK N 3   ? O UNK N 403 
K  1 2 N VAL C 29  ? N VAL C 29  O GLY C 65  ? O GLY C 65  
K  2 3 N ILE C 70  ? N ILE C 70  O TYR C 76  ? O TYR C 76  
K  3 4 N VAL C 77  ? N VAL C 77  O LEU C 116 ? O LEU C 116 
K  4 5 O LEU C 115 ? O LEU C 115 N GLY C 106 ? N GLY C 106 
K  5 6 O PHE C 100 ? O PHE C 100 N ILE C 92  ? N ILE C 92  
K  6 7 O GLN C 88  ? O GLN C 88  N GLU C 32  ? N GLU C 32  
L  1 2 N ALA C 143 ? N ALA C 143 O THR C 155 ? O THR C 155 
L  2 3 N ALA C 161 ? N ALA C 161 O GLN C 177 ? O GLN C 177 
L  3 4 N ILE C 176 ? N ILE C 176 O ALA C 218 ? O ALA C 218 
L  4 5 O PHE C 217 ? O PHE C 217 N ALA C 204 ? N ALA C 204 
L  5 6 O ILE C 199 ? O ILE C 199 N LEU C 191 ? N LEU C 191 
L  6 7 O ALA C 190 ? O ALA C 190 N VAL C 144 ? N VAL C 144 
M  1 2 N LEU C 241 ? N LEU C 241 O ASP C 332 ? O ASP C 332 
N  1 2 O ILE C 287 ? O ILE C 287 N ALA C 265 ? N ALA C 265 
N  2 3 O PHE C 266 ? O PHE C 266 N THR C 247 ? N THR C 247 
N  3 4 N GLY C 246 ? N GLY C 246 O UNK O 3   ? O UNK O 403 
O  1 2 O LYS C 293 ? O LYS C 293 N LEU C 290 ? N LEU C 290 
O  2 3 N SER C 289 ? N SER C 289 O GLY C 317 ? O GLY C 317 
O  3 4 N LEU C 316 ? N LEU C 316 O VAL C 327 ? O VAL C 327 
P  1 2 N VAL D 31  ? N VAL D 31  O GLY D 63  ? O GLY D 63  
P  2 3 N ILE D 70  ? N ILE D 70  O TYR D 76  ? O TYR D 76  
P  3 4 N VAL D 77  ? N VAL D 77  O LEU D 116 ? O LEU D 116 
P  4 5 O LEU D 115 ? O LEU D 115 N GLY D 106 ? N GLY D 106 
P  5 6 O PHE D 100 ? O PHE D 100 N ILE D 92  ? N ILE D 92  
P  6 7 O GLN D 88  ? O GLN D 88  N GLU D 32  ? N GLU D 32  
Q  1 2 N GLY D 145 ? N GLY D 145 O THR D 153 ? O THR D 153 
Q  2 3 N SER D 160 ? N SER D 160 O GLN D 177 ? O GLN D 177 
Q  3 4 N ILE D 176 ? N ILE D 176 O ALA D 218 ? O ALA D 218 
Q  4 5 O PHE D 217 ? O PHE D 217 N ALA D 204 ? N ALA D 204 
Q  5 6 O ILE D 199 ? O ILE D 199 N LEU D 191 ? N LEU D 191 
Q  6 7 O ALA D 190 ? O ALA D 190 N VAL D 144 ? N VAL D 144 
R  1 2 N LEU D 241 ? N LEU D 241 O ASP D 332 ? O ASP D 332 
S  1 2 O ILE D 287 ? O ILE D 287 N ALA D 265 ? N ALA D 265 
S  2 3 O PHE D 266 ? O PHE D 266 N THR D 247 ? N THR D 247 
S  3 4 N GLY D 246 ? N GLY D 246 O UNK P 3   ? O UNK P 403 
T  1 2 O LYS D 293 ? O LYS D 293 N LEU D 290 ? N LEU D 290 
T  2 3 N SER D 289 ? N SER D 289 O GLY D 317 ? O GLY D 317 
T  3 4 N LEU D 316 ? N LEU D 316 O VAL D 327 ? O VAL D 327 
U  1 2 N VAL E 27  ? N VAL E 27  O GLY E 67  ? O GLY E 67  
U  2 3 N ILE E 70  ? N ILE E 70  O TYR E 76  ? O TYR E 76  
U  3 4 N VAL E 77  ? N VAL E 77  O LEU E 116 ? O LEU E 116 
U  4 5 O LEU E 115 ? O LEU E 115 N GLY E 106 ? N GLY E 106 
U  5 6 O PHE E 100 ? O PHE E 100 N ILE E 92  ? N ILE E 92  
U  6 7 O GLN E 88  ? O GLN E 88  N GLU E 32  ? N GLU E 32  
V  1 2 N ALA E 143 ? N ALA E 143 O THR E 155 ? O THR E 155 
V  2 3 N SER E 160 ? N SER E 160 O GLN E 177 ? O GLN E 177 
V  3 4 N ILE E 176 ? N ILE E 176 O ALA E 218 ? O ALA E 218 
V  4 5 O PHE E 217 ? O PHE E 217 N ALA E 204 ? N ALA E 204 
V  5 6 O ILE E 199 ? O ILE E 199 N LEU E 191 ? N LEU E 191 
V  6 7 O ALA E 190 ? O ALA E 190 N VAL E 144 ? N VAL E 144 
W  1 2 N LEU E 241 ? N LEU E 241 O ASP E 332 ? O ASP E 332 
X  1 2 O ILE E 287 ? O ILE E 287 N ALA E 265 ? N ALA E 265 
X  2 3 O PHE E 266 ? O PHE E 266 N THR E 247 ? N THR E 247 
X  3 4 N GLY E 246 ? N GLY E 246 O UNK Q 3   ? O UNK Q 403 
Y  1 2 O LYS E 293 ? O LYS E 293 N LEU E 290 ? N LEU E 290 
Y  2 3 N SER E 289 ? N SER E 289 O GLY E 317 ? O GLY E 317 
Y  3 4 N LEU E 316 ? N LEU E 316 O VAL E 327 ? O VAL E 327 
Z  1 2 N VAL F 31  ? N VAL F 31  O GLY F 63  ? O GLY F 63  
Z  2 3 N VAL F 68  ? N VAL F 68  O LEU F 78  ? O LEU F 78  
Z  3 4 N VAL F 77  ? N VAL F 77  O LEU F 116 ? O LEU F 116 
Z  4 5 O LEU F 115 ? O LEU F 115 N GLY F 106 ? N GLY F 106 
Z  5 6 O PHE F 100 ? O PHE F 100 N ILE F 92  ? N ILE F 92  
Z  6 7 O GLN F 88  ? O GLN F 88  N GLU F 32  ? N GLU F 32  
AA 1 2 N ALA F 143 ? N ALA F 143 O THR F 155 ? O THR F 155 
AA 2 3 N SER F 160 ? N SER F 160 O GLN F 177 ? O GLN F 177 
AA 3 4 N THR F 178 ? N THR F 178 O GLY F 216 ? O GLY F 216 
AA 4 5 O PHE F 217 ? O PHE F 217 N ALA F 204 ? N ALA F 204 
AA 5 6 O ILE F 199 ? O ILE F 199 N LEU F 191 ? N LEU F 191 
AA 6 7 O ALA F 190 ? O ALA F 190 N VAL F 144 ? N VAL F 144 
AB 1 2 N LEU F 241 ? N LEU F 241 O ASP F 332 ? O ASP F 332 
AC 1 2 O ILE F 287 ? O ILE F 287 N ALA F 265 ? N ALA F 265 
AC 2 3 O PHE F 266 ? O PHE F 266 N THR F 247 ? N THR F 247 
AC 3 4 N GLY F 246 ? N GLY F 246 O UNK R 3   ? O UNK R 403 
AD 1 2 O LYS F 293 ? O LYS F 293 N LEU F 290 ? N LEU F 290 
AD 2 3 N SER F 289 ? N SER F 289 O GLY F 317 ? O GLY F 317 
AD 3 4 N LEU F 316 ? N LEU F 316 O VAL F 327 ? O VAL F 327 
AE 1 2 N VAL G 29  ? N VAL G 29  O GLY G 65  ? O GLY G 65  
AE 2 3 N ILE G 70  ? N ILE G 70  O TYR G 76  ? O TYR G 76  
AE 3 4 N VAL G 77  ? N VAL G 77  O LEU G 116 ? O LEU G 116 
AE 4 5 O ILE G 113 ? O ILE G 113 N ASP G 108 ? N ASP G 108 
AE 5 6 O PHE G 100 ? O PHE G 100 N ILE G 92  ? N ILE G 92  
AE 6 7 O GLN G 88  ? O GLN G 88  N GLU G 32  ? N GLU G 32  
AF 1 2 N ALA G 143 ? N ALA G 143 O THR G 155 ? O THR G 155 
AF 2 3 N ALA G 161 ? N ALA G 161 O GLN G 177 ? O GLN G 177 
AF 3 4 N ILE G 176 ? N ILE G 176 O ALA G 218 ? O ALA G 218 
AF 4 5 O PHE G 217 ? O PHE G 217 N ALA G 204 ? N ALA G 204 
AF 5 6 O ILE G 199 ? O ILE G 199 N LEU G 191 ? N LEU G 191 
AF 6 7 O ALA G 190 ? O ALA G 190 N VAL G 144 ? N VAL G 144 
AG 1 2 N LEU G 241 ? N LEU G 241 O ASP G 332 ? O ASP G 332 
AH 1 2 O ILE G 287 ? O ILE G 287 N ALA G 265 ? N ALA G 265 
AH 2 3 O PHE G 266 ? O PHE G 266 N THR G 247 ? N THR G 247 
AH 3 4 N GLY G 246 ? N GLY G 246 O UNK S 3   ? O UNK S 403 
AI 1 2 O LYS G 293 ? O LYS G 293 N LEU G 290 ? N LEU G 290 
AI 2 3 N SER G 289 ? N SER G 289 O GLY G 317 ? O GLY G 317 
AI 3 4 N LEU G 316 ? N LEU G 316 O VAL G 327 ? O VAL G 327 
AJ 1 2 N VAL H 29  ? N VAL H 29  O GLY H 65  ? O GLY H 65  
AJ 2 3 N ILE H 70  ? N ILE H 70  O TYR H 76  ? O TYR H 76  
AJ 3 4 N VAL H 77  ? N VAL H 77  O LEU H 116 ? O LEU H 116 
AJ 4 5 O ILE H 113 ? O ILE H 113 N ASP H 108 ? N ASP H 108 
AJ 5 6 O PHE H 100 ? O PHE H 100 N ILE H 92  ? N ILE H 92  
AJ 6 7 O GLN H 88  ? O GLN H 88  N GLU H 32  ? N GLU H 32  
AK 1 2 N GLY H 145 ? N GLY H 145 O THR H 153 ? O THR H 153 
AK 2 3 N SER H 160 ? N SER H 160 O GLN H 177 ? O GLN H 177 
AK 3 4 N ILE H 176 ? N ILE H 176 O ALA H 218 ? O ALA H 218 
AK 4 5 O PHE H 217 ? O PHE H 217 N ALA H 204 ? N ALA H 204 
AK 5 6 O ILE H 199 ? O ILE H 199 N LEU H 191 ? N LEU H 191 
AK 6 7 O ALA H 190 ? O ALA H 190 N VAL H 144 ? N VAL H 144 
AL 1 2 N LEU H 241 ? N LEU H 241 O ASP H 332 ? O ASP H 332 
AM 1 2 O ILE H 287 ? O ILE H 287 N ALA H 265 ? N ALA H 265 
AM 2 3 O PHE H 266 ? O PHE H 266 N THR H 247 ? N THR H 247 
AM 3 4 N GLY H 246 ? N GLY H 246 O UNK T 3   ? O UNK T 403 
AN 1 2 O LYS H 293 ? O LYS H 293 N LEU H 290 ? N LEU H 290 
AN 2 3 N SER H 289 ? N SER H 289 O GLY H 317 ? O GLY H 317 
AN 3 4 N LEU H 316 ? N LEU H 316 O VAL H 327 ? O VAL H 327 
AO 1 2 N VAL I 31  ? N VAL I 31  O GLY I 63  ? O GLY I 63  
AO 2 3 N VAL I 68  ? N VAL I 68  O LEU I 78  ? O LEU I 78  
AO 3 4 N VAL I 77  ? N VAL I 77  O LEU I 116 ? O LEU I 116 
AO 4 5 O LEU I 115 ? O LEU I 115 N ILE I 105 ? N ILE I 105 
AO 5 6 O PHE I 100 ? O PHE I 100 N ILE I 92  ? N ILE I 92  
AO 6 7 O GLN I 88  ? O GLN I 88  N GLU I 32  ? N GLU I 32  
AP 1 2 N ALA I 143 ? N ALA I 143 O THR I 155 ? O THR I 155 
AP 2 3 N SER I 160 ? N SER I 160 O GLN I 177 ? O GLN I 177 
AP 3 4 N ILE I 176 ? N ILE I 176 O ALA I 218 ? O ALA I 218 
AP 4 5 O PHE I 217 ? O PHE I 217 N ALA I 204 ? N ALA I 204 
AP 5 6 O ILE I 199 ? O ILE I 199 N LEU I 191 ? N LEU I 191 
AP 6 7 O LEU I 192 ? O LEU I 192 N VAL I 142 ? N VAL I 142 
AQ 1 2 N LEU I 241 ? N LEU I 241 O ASP I 332 ? O ASP I 332 
AR 1 2 O ILE I 287 ? O ILE I 287 N ALA I 265 ? N ALA I 265 
AR 2 3 O PHE I 266 ? O PHE I 266 N THR I 247 ? N THR I 247 
AR 3 4 N GLY I 246 ? N GLY I 246 O UNK U 3   ? O UNK U 403 
AS 1 2 O LYS I 293 ? O LYS I 293 N LEU I 290 ? N LEU I 290 
AS 2 3 N SER I 289 ? N SER I 289 O GLY I 317 ? O GLY I 317 
AS 3 4 N LEU I 316 ? N LEU I 316 O VAL I 327 ? O VAL I 327 
AT 1 2 N VAL J 29  ? N VAL J 29  O GLY J 65  ? O GLY J 65  
AT 2 3 N ILE J 70  ? N ILE J 70  O TYR J 76  ? O TYR J 76  
AT 3 4 N VAL J 77  ? N VAL J 77  O LEU J 116 ? O LEU J 116 
AT 4 5 O LEU J 115 ? O LEU J 115 N GLY J 106 ? N GLY J 106 
AT 5 6 O PHE J 100 ? O PHE J 100 N ILE J 92  ? N ILE J 92  
AT 6 7 O GLN J 88  ? O GLN J 88  N GLU J 32  ? N GLU J 32  
AU 1 2 N ALA J 143 ? N ALA J 143 O THR J 155 ? O THR J 155 
AU 2 3 N SER J 160 ? N SER J 160 O GLN J 177 ? O GLN J 177 
AU 3 4 N ILE J 176 ? N ILE J 176 O ALA J 218 ? O ALA J 218 
AU 4 5 O PHE J 217 ? O PHE J 217 N ALA J 204 ? N ALA J 204 
AU 5 6 O ILE J 199 ? O ILE J 199 N LEU J 191 ? N LEU J 191 
AU 6 7 O ALA J 190 ? O ALA J 190 N VAL J 144 ? N VAL J 144 
AV 1 2 N LEU J 241 ? N LEU J 241 O ASP J 332 ? O ASP J 332 
AW 1 2 O ILE J 287 ? O ILE J 287 N ALA J 265 ? N ALA J 265 
AW 2 3 O SER J 268 ? O SER J 268 N LYS J 245 ? N LYS J 245 
AW 3 4 N GLY J 246 ? N GLY J 246 O UNK V 3   ? O UNK V 403 
AX 1 2 O LYS J 293 ? O LYS J 293 N LEU J 290 ? N LEU J 290 
AX 2 3 N SER J 289 ? N SER J 289 O GLY J 317 ? O GLY J 317 
AX 3 4 N LEU J 316 ? N LEU J 316 O VAL J 327 ? O VAL J 327 
AY 1 2 N VAL K 29  ? N VAL K 29  O GLY K 65  ? O GLY K 65  
AY 2 3 N ILE K 70  ? N ILE K 70  O TYR K 76  ? O TYR K 76  
AY 3 4 N VAL K 77  ? N VAL K 77  O LEU K 116 ? O LEU K 116 
AY 4 5 O LEU K 115 ? O LEU K 115 N GLY K 106 ? N GLY K 106 
AY 5 6 O PHE K 100 ? O PHE K 100 N ILE K 92  ? N ILE K 92  
AY 6 7 O GLN K 88  ? O GLN K 88  N GLU K 32  ? N GLU K 32  
AZ 1 2 N ALA K 143 ? N ALA K 143 O THR K 155 ? O THR K 155 
AZ 2 3 N SER K 160 ? N SER K 160 O GLN K 177 ? O GLN K 177 
AZ 3 4 N ILE K 176 ? N ILE K 176 O ALA K 218 ? O ALA K 218 
AZ 4 5 O PHE K 217 ? O PHE K 217 N ALA K 204 ? N ALA K 204 
AZ 5 6 O ILE K 199 ? O ILE K 199 N LEU K 191 ? N LEU K 191 
AZ 6 7 O LEU K 192 ? O LEU K 192 N VAL K 142 ? N VAL K 142 
BA 1 2 N LEU K 241 ? N LEU K 241 O ASP K 332 ? O ASP K 332 
BB 1 2 O LYS K 293 ? O LYS K 293 N LEU K 290 ? N LEU K 290 
BB 2 3 N THR K 288 ? N THR K 288 O GLY K 317 ? O GLY K 317 
BB 3 4 N LEU K 316 ? N LEU K 316 O VAL K 327 ? O VAL K 327 
BC 1 2 O LYS K 293 ? O LYS K 293 N LEU K 290 ? N LEU K 290 
BC 2 3 O ILE K 287 ? O ILE K 287 N ALA K 265 ? N ALA K 265 
BC 3 4 O PHE K 266 ? O PHE K 266 N THR K 247 ? N THR K 247 
BC 4 5 N GLY K 246 ? N GLY K 246 O UNK W 3   ? O UNK W 403 
BD 1 2 N VAL L 27  ? N VAL L 27  O GLY L 67  ? O GLY L 67  
BD 2 3 N ILE L 70  ? N ILE L 70  O TYR L 76  ? O TYR L 76  
BD 3 4 N VAL L 77  ? N VAL L 77  O LEU L 116 ? O LEU L 116 
BD 4 5 O LEU L 115 ? O LEU L 115 N GLY L 106 ? N GLY L 106 
BD 5 6 O PHE L 100 ? O PHE L 100 N ILE L 92  ? N ILE L 92  
BD 6 7 O GLN L 88  ? O GLN L 88  N GLU L 32  ? N GLU L 32  
BE 1 2 N GLY L 145 ? N GLY L 145 O THR L 153 ? O THR L 153 
BE 2 3 N ALA L 161 ? N ALA L 161 O GLN L 177 ? O GLN L 177 
BE 3 4 N ILE L 176 ? N ILE L 176 O ALA L 218 ? O ALA L 218 
BE 4 5 O PHE L 217 ? O PHE L 217 N ALA L 204 ? N ALA L 204 
BE 5 6 O ILE L 199 ? O ILE L 199 N LEU L 191 ? N LEU L 191 
BE 6 7 O LEU L 192 ? O LEU L 192 N VAL L 142 ? N VAL L 142 
BF 1 2 N LEU L 241 ? N LEU L 241 O ASP L 332 ? O ASP L 332 
BG 1 2 O ILE L 287 ? O ILE L 287 N ALA L 265 ? N ALA L 265 
BG 2 3 O PHE L 266 ? O PHE L 266 N THR L 247 ? N THR L 247 
BG 3 4 N GLY L 246 ? N GLY L 246 O UNK X 3   ? O UNK X 403 
BH 1 2 O LYS L 293 ? O LYS L 293 N LEU L 290 ? N LEU L 290 
BH 2 3 N SER L 289 ? N SER L 289 O GLY L 317 ? O GLY L 317 
BH 3 4 N LEU L 316 ? N LEU L 316 O VAL L 327 ? O VAL L 327 
# 
_database_PDB_matrix.entry_id          3STJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3STJ 
_atom_sites.fract_transf_matrix[1][1]   0.008672 
_atom_sites.fract_transf_matrix[1][2]   0.005007 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010013 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003479 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . PRO A 1 11  ? -29.059 34.551  -19.102 1.00 81.85  ? 11  PRO A N   1 
ATOM 2     C CA  . PRO A 1 11  ? -29.024 34.656  -20.570 1.00 80.80  ? 11  PRO A CA  1 
ATOM 3     C C   . PRO A 1 11  ? -30.163 35.519  -21.127 1.00 79.12  ? 11  PRO A C   1 
ATOM 4     O O   . PRO A 1 11  ? -29.977 36.145  -22.180 1.00 79.83  ? 11  PRO A O   1 
ATOM 5     C CB  . PRO A 1 11  ? -29.148 33.201  -21.043 1.00 83.02  ? 11  PRO A CB  1 
ATOM 6     C CG  . PRO A 1 11  ? -28.670 32.360  -19.882 1.00 88.11  ? 11  PRO A CG  1 
ATOM 7     C CD  . PRO A 1 11  ? -28.664 33.207  -18.627 1.00 83.90  ? 11  PRO A CD  1 
ATOM 8     N N   . LEU A 1 12  ? -31.338 35.550  -20.438 1.00 68.61  ? 12  LEU A N   1 
ATOM 9     C CA  . LEU A 1 12  ? -32.480 36.352  -20.883 1.00 64.30  ? 12  LEU A CA  1 
ATOM 10    C C   . LEU A 1 12  ? -32.247 37.832  -20.604 1.00 61.54  ? 12  LEU A C   1 
ATOM 11    O O   . LEU A 1 12  ? -31.817 38.169  -19.502 1.00 61.13  ? 12  LEU A O   1 
ATOM 12    C CB  . LEU A 1 12  ? -33.799 35.907  -20.217 1.00 63.39  ? 12  LEU A CB  1 
ATOM 13    C CG  . LEU A 1 12  ? -34.646 34.791  -20.858 1.00 66.28  ? 12  LEU A CG  1 
ATOM 14    C CD1 . LEU A 1 12  ? -36.021 34.733  -20.205 1.00 65.18  ? 12  LEU A CD1 1 
ATOM 15    C CD2 . LEU A 1 12  ? -34.847 34.987  -22.370 1.00 67.25  ? 12  LEU A CD2 1 
ATOM 16    N N   . PRO A 1 13  ? -32.556 38.733  -21.570 1.00 53.89  ? 13  PRO A N   1 
ATOM 17    C CA  . PRO A 1 13  ? -32.414 40.178  -21.295 1.00 52.09  ? 13  PRO A CA  1 
ATOM 18    C C   . PRO A 1 13  ? -33.322 40.610  -20.137 1.00 50.94  ? 13  PRO A C   1 
ATOM 19    O O   . PRO A 1 13  ? -34.435 40.094  -19.982 1.00 50.43  ? 13  PRO A O   1 
ATOM 20    C CB  . PRO A 1 13  ? -32.820 40.849  -22.613 1.00 53.70  ? 13  PRO A CB  1 
ATOM 21    C CG  . PRO A 1 13  ? -32.923 39.768  -23.610 1.00 57.98  ? 13  PRO A CG  1 
ATOM 22    C CD  . PRO A 1 13  ? -33.124 38.488  -22.912 1.00 53.98  ? 13  PRO A CD  1 
ATOM 23    N N   . SER A 1 14  ? -32.822 41.538  -19.308 1.00 43.49  ? 14  SER A N   1 
ATOM 24    C CA  . SER A 1 14  ? -33.492 42.022  -18.110 1.00 41.22  ? 14  SER A CA  1 
ATOM 25    C C   . SER A 1 14  ? -32.913 43.330  -17.631 1.00 43.27  ? 14  SER A C   1 
ATOM 26    O O   . SER A 1 14  ? -31.717 43.576  -17.842 1.00 42.30  ? 14  SER A O   1 
ATOM 27    C CB  . SER A 1 14  ? -33.349 40.996  -16.992 1.00 42.78  ? 14  SER A CB  1 
ATOM 28    O OG  . SER A 1 14  ? -34.009 41.465  -15.829 1.00 48.74  ? 14  SER A OG  1 
ATOM 29    N N   . LEU A 1 15  ? -33.744 44.141  -16.911 1.00 38.17  ? 15  LEU A N   1 
ATOM 30    C CA  . LEU A 1 15  ? -33.310 45.405  -16.304 1.00 35.97  ? 15  LEU A CA  1 
ATOM 31    C C   . LEU A 1 15  ? -32.885 45.178  -14.854 1.00 41.12  ? 15  LEU A C   1 
ATOM 32    O O   . LEU A 1 15  ? -32.321 46.082  -14.224 1.00 43.46  ? 15  LEU A O   1 
ATOM 33    C CB  . LEU A 1 15  ? -34.404 46.466  -16.374 1.00 35.09  ? 15  LEU A CB  1 
ATOM 34    C CG  . LEU A 1 15  ? -34.871 46.877  -17.755 1.00 38.31  ? 15  LEU A CG  1 
ATOM 35    C CD1 . LEU A 1 15  ? -35.884 47.983  -17.659 1.00 36.53  ? 15  LEU A CD1 1 
ATOM 36    C CD2 . LEU A 1 15  ? -33.697 47.254  -18.687 1.00 35.46  ? 15  LEU A CD2 1 
ATOM 37    N N   . ALA A 1 16  ? -33.122 43.949  -14.345 1.00 34.91  ? 16  ALA A N   1 
ATOM 38    C CA  . ALA A 1 16  ? -32.836 43.518  -12.978 1.00 33.52  ? 16  ALA A CA  1 
ATOM 39    C C   . ALA A 1 16  ? -31.359 43.677  -12.602 1.00 39.12  ? 16  ALA A C   1 
ATOM 40    O O   . ALA A 1 16  ? -31.115 44.227  -11.529 1.00 38.12  ? 16  ALA A O   1 
ATOM 41    C CB  . ALA A 1 16  ? -33.309 42.087  -12.748 1.00 33.08  ? 16  ALA A CB  1 
ATOM 42    N N   . PRO A 1 17  ? -30.345 43.276  -13.425 1.00 39.61  ? 17  PRO A N   1 
ATOM 43    C CA  . PRO A 1 17  ? -28.941 43.474  -12.984 1.00 39.33  ? 17  PRO A CA  1 
ATOM 44    C C   . PRO A 1 17  ? -28.623 44.950  -12.663 1.00 45.41  ? 17  PRO A C   1 
ATOM 45    O O   . PRO A 1 17  ? -28.016 45.203  -11.625 1.00 45.47  ? 17  PRO A O   1 
ATOM 46    C CB  . PRO A 1 17  ? -28.125 42.936  -14.152 1.00 39.73  ? 17  PRO A CB  1 
ATOM 47    C CG  . PRO A 1 17  ? -29.047 41.959  -14.826 1.00 43.47  ? 17  PRO A CG  1 
ATOM 48    C CD  . PRO A 1 17  ? -30.389 42.579  -14.737 1.00 39.94  ? 17  PRO A CD  1 
ATOM 49    N N   . MET A 1 18  ? -29.108 45.921  -13.470 1.00 43.16  ? 18  MET A N   1 
ATOM 50    C CA  . MET A 1 18  ? -28.836 47.322  -13.147 1.00 43.34  ? 18  MET A CA  1 
ATOM 51    C C   . MET A 1 18  ? -29.761 47.845  -12.021 1.00 45.37  ? 18  MET A C   1 
ATOM 52    O O   . MET A 1 18  ? -29.307 48.635  -11.195 1.00 46.18  ? 18  MET A O   1 
ATOM 53    C CB  . MET A 1 18  ? -28.834 48.246  -14.393 1.00 46.22  ? 18  MET A CB  1 
ATOM 54    C CG  . MET A 1 18  ? -30.161 48.787  -14.814 1.00 51.68  ? 18  MET A CG  1 
ATOM 55    S SD  . MET A 1 18  ? -30.693 50.285  -13.936 1.00 57.33  ? 18  MET A SD  1 
ATOM 56    C CE  . MET A 1 18  ? -32.155 50.664  -14.901 1.00 54.41  ? 18  MET A CE  1 
ATOM 57    N N   . LEU A 1 19  ? -31.013 47.404  -11.959 1.00 39.27  ? 19  LEU A N   1 
ATOM 58    C CA  . LEU A 1 19  ? -31.923 47.889  -10.922 1.00 38.53  ? 19  LEU A CA  1 
ATOM 59    C C   . LEU A 1 19  ? -31.516 47.431  -9.509  1.00 44.73  ? 19  LEU A C   1 
ATOM 60    O O   . LEU A 1 19  ? -31.643 48.210  -8.562  1.00 41.80  ? 19  LEU A O   1 
ATOM 61    C CB  . LEU A 1 19  ? -33.360 47.492  -11.240 1.00 37.62  ? 19  LEU A CB  1 
ATOM 62    C CG  . LEU A 1 19  ? -33.994 48.364  -12.334 1.00 40.01  ? 19  LEU A CG  1 
ATOM 63    C CD1 . LEU A 1 19  ? -35.228 47.741  -12.867 1.00 39.28  ? 19  LEU A CD1 1 
ATOM 64    C CD2 . LEU A 1 19  ? -34.272 49.779  -11.839 1.00 38.14  ? 19  LEU A CD2 1 
ATOM 65    N N   . GLU A 1 20  ? -30.933 46.214  -9.401  1.00 44.44  ? 20  GLU A N   1 
ATOM 66    C CA  . GLU A 1 20  ? -30.432 45.599  -8.164  1.00 44.70  ? 20  GLU A CA  1 
ATOM 67    C C   . GLU A 1 20  ? -29.482 46.545  -7.416  1.00 48.65  ? 20  GLU A C   1 
ATOM 68    O O   . GLU A 1 20  ? -29.586 46.683  -6.198  1.00 49.40  ? 20  GLU A O   1 
ATOM 69    C CB  . GLU A 1 20  ? -29.673 44.330  -8.539  1.00 46.32  ? 20  GLU A CB  1 
ATOM 70    C CG  . GLU A 1 20  ? -30.033 43.069  -7.785  1.00 61.72  ? 20  GLU A CG  1 
ATOM 71    C CD  . GLU A 1 20  ? -29.444 41.800  -8.391  1.00 103.74 ? 20  GLU A CD  1 
ATOM 72    O OE1 . GLU A 1 20  ? -28.484 41.893  -9.195  1.00 101.25 ? 20  GLU A OE1 1 
ATOM 73    O OE2 . GLU A 1 20  ? -29.975 40.706  -8.089  1.00 108.11 ? 20  GLU A OE2 1 
ATOM 74    N N   . LYS A 1 21  ? -28.583 47.212  -8.166  1.00 43.35  ? 21  LYS A N   1 
ATOM 75    C CA  . LYS A 1 21  ? -27.544 48.107  -7.655  1.00 42.68  ? 21  LYS A CA  1 
ATOM 76    C C   . LYS A 1 21  ? -28.050 49.490  -7.273  1.00 48.16  ? 21  LYS A C   1 
ATOM 77    O O   . LYS A 1 21  ? -27.579 50.080  -6.297  1.00 50.49  ? 21  LYS A O   1 
ATOM 78    C CB  . LYS A 1 21  ? -26.422 48.312  -8.701  1.00 42.51  ? 21  LYS A CB  1 
ATOM 79    C CG  . LYS A 1 21  ? -25.850 47.075  -9.357  1.00 54.22  ? 21  LYS A CG  1 
ATOM 80    C CD  . LYS A 1 21  ? -24.822 47.469  -10.402 1.00 62.65  ? 21  LYS A CD  1 
ATOM 81    C CE  . LYS A 1 21  ? -24.542 46.381  -11.403 1.00 71.37  ? 21  LYS A CE  1 
ATOM 82    N NZ  . LYS A 1 21  ? -23.479 46.791  -12.366 1.00 82.29  ? 21  LYS A NZ  1 
ATOM 83    N N   . VAL A 1 22  ? -28.913 50.038  -8.104  1.00 42.40  ? 22  VAL A N   1 
ATOM 84    C CA  . VAL A 1 22  ? -29.406 51.404  -8.099  1.00 40.89  ? 22  VAL A CA  1 
ATOM 85    C C   . VAL A 1 22  ? -30.755 51.635  -7.331  1.00 44.93  ? 22  VAL A C   1 
ATOM 86    O O   . VAL A 1 22  ? -30.958 52.758  -6.846  1.00 45.30  ? 22  VAL A O   1 
ATOM 87    C CB  . VAL A 1 22  ? -29.485 51.742  -9.600  1.00 43.90  ? 22  VAL A CB  1 
ATOM 88    C CG1 . VAL A 1 22  ? -30.803 52.342  -10.026 1.00 43.06  ? 22  VAL A CG1 1 
ATOM 89    C CG2 . VAL A 1 22  ? -28.302 52.575  -10.035 1.00 43.90  ? 22  VAL A CG2 1 
ATOM 90    N N   . LEU A 1 23  ? -31.647 50.608  -7.186  1.00 40.50  ? 23  LEU A N   1 
ATOM 91    C CA  . LEU A 1 23  ? -32.936 50.792  -6.478  1.00 40.15  ? 23  LEU A CA  1 
ATOM 92    C C   . LEU A 1 23  ? -32.782 51.310  -5.001  1.00 44.94  ? 23  LEU A C   1 
ATOM 93    O O   . LEU A 1 23  ? -33.621 52.118  -4.588  1.00 43.13  ? 23  LEU A O   1 
ATOM 94    C CB  . LEU A 1 23  ? -33.800 49.516  -6.456  1.00 39.32  ? 23  LEU A CB  1 
ATOM 95    C CG  . LEU A 1 23  ? -34.475 48.987  -7.739  1.00 41.42  ? 23  LEU A CG  1 
ATOM 96    C CD1 . LEU A 1 23  ? -35.073 47.588  -7.479  1.00 39.82  ? 23  LEU A CD1 1 
ATOM 97    C CD2 . LEU A 1 23  ? -35.506 49.972  -8.328  1.00 39.59  ? 23  LEU A CD2 1 
ATOM 98    N N   . PRO A 1 24  ? -31.750 50.891  -4.199  1.00 42.40  ? 24  PRO A N   1 
ATOM 99    C CA  . PRO A 1 24  ? -31.643 51.406  -2.806  1.00 41.48  ? 24  PRO A CA  1 
ATOM 100   C C   . PRO A 1 24  ? -31.556 52.931  -2.663  1.00 42.57  ? 24  PRO A C   1 
ATOM 101   O O   . PRO A 1 24  ? -31.882 53.431  -1.597  1.00 42.89  ? 24  PRO A O   1 
ATOM 102   C CB  . PRO A 1 24  ? -30.342 50.788  -2.296  1.00 43.26  ? 24  PRO A CB  1 
ATOM 103   C CG  . PRO A 1 24  ? -30.093 49.607  -3.167  1.00 47.62  ? 24  PRO A CG  1 
ATOM 104   C CD  . PRO A 1 24  ? -30.673 49.913  -4.493  1.00 43.41  ? 24  PRO A CD  1 
ATOM 105   N N   . ALA A 1 25  ? -31.120 53.653  -3.718  1.00 37.45  ? 25  ALA A N   1 
ATOM 106   C CA  . ALA A 1 25  ? -30.906 55.109  -3.780  1.00 36.05  ? 25  ALA A CA  1 
ATOM 107   C C   . ALA A 1 25  ? -32.206 55.886  -3.920  1.00 40.04  ? 25  ALA A C   1 
ATOM 108   O O   . ALA A 1 25  ? -32.247 57.083  -3.657  1.00 40.69  ? 25  ALA A O   1 
ATOM 109   C CB  . ALA A 1 25  ? -30.003 55.435  -4.962  1.00 36.05  ? 25  ALA A CB  1 
ATOM 110   N N   . VAL A 1 26  ? -33.239 55.230  -4.428  1.00 36.30  ? 26  VAL A N   1 
ATOM 111   C CA  . VAL A 1 26  ? -34.546 55.847  -4.636  1.00 34.73  ? 26  VAL A CA  1 
ATOM 112   C C   . VAL A 1 26  ? -35.347 55.551  -3.384  1.00 37.39  ? 26  VAL A C   1 
ATOM 113   O O   . VAL A 1 26  ? -35.444 54.379  -2.949  1.00 37.52  ? 26  VAL A O   1 
ATOM 114   C CB  . VAL A 1 26  ? -35.263 55.430  -5.956  1.00 36.47  ? 26  VAL A CB  1 
ATOM 115   C CG1 . VAL A 1 26  ? -36.471 56.329  -6.199  1.00 36.90  ? 26  VAL A CG1 1 
ATOM 116   C CG2 . VAL A 1 26  ? -34.321 55.499  -7.151  1.00 34.93  ? 26  VAL A CG2 1 
ATOM 117   N N   . VAL A 1 27  ? -35.881 56.620  -2.776  1.00 32.03  ? 27  VAL A N   1 
ATOM 118   C CA  . VAL A 1 27  ? -36.614 56.523  -1.498  1.00 31.81  ? 27  VAL A CA  1 
ATOM 119   C C   . VAL A 1 27  ? -38.069 56.986  -1.605  1.00 36.15  ? 27  VAL A C   1 
ATOM 120   O O   . VAL A 1 27  ? -38.462 57.667  -2.537  1.00 34.33  ? 27  VAL A O   1 
ATOM 121   C CB  . VAL A 1 27  ? -35.872 57.325  -0.367  1.00 34.52  ? 27  VAL A CB  1 
ATOM 122   C CG1 . VAL A 1 27  ? -34.424 56.866  -0.236  1.00 34.29  ? 27  VAL A CG1 1 
ATOM 123   C CG2 . VAL A 1 27  ? -35.925 58.834  -0.599  1.00 33.29  ? 27  VAL A CG2 1 
ATOM 124   N N   . SER A 1 28  ? -38.838 56.638  -0.596  1.00 37.49  ? 28  SER A N   1 
ATOM 125   C CA  . SER A 1 28  ? -40.221 57.028  -0.383  1.00 39.01  ? 28  SER A CA  1 
ATOM 126   C C   . SER A 1 28  ? -40.208 58.224  0.591   1.00 44.60  ? 28  SER A C   1 
ATOM 127   O O   . SER A 1 28  ? -39.478 58.199  1.590   1.00 43.62  ? 28  SER A O   1 
ATOM 128   C CB  . SER A 1 28  ? -41.004 55.837  0.172   1.00 45.22  ? 28  SER A CB  1 
ATOM 129   O OG  . SER A 1 28  ? -42.128 56.251  0.933   1.00 62.42  ? 28  SER A OG  1 
ATOM 130   N N   . VAL A 1 29  ? -40.953 59.290  0.272   1.00 41.90  ? 29  VAL A N   1 
ATOM 131   C CA  . VAL A 1 29  ? -40.972 60.497  1.105   1.00 41.32  ? 29  VAL A CA  1 
ATOM 132   C C   . VAL A 1 29  ? -42.374 60.634  1.713   1.00 47.53  ? 29  VAL A C   1 
ATOM 133   O O   . VAL A 1 29  ? -43.358 60.783  0.989   1.00 46.21  ? 29  VAL A O   1 
ATOM 134   C CB  . VAL A 1 29  ? -40.518 61.746  0.293   1.00 44.17  ? 29  VAL A CB  1 
ATOM 135   C CG1 . VAL A 1 29  ? -40.702 63.020  1.089   1.00 44.26  ? 29  VAL A CG1 1 
ATOM 136   C CG2 . VAL A 1 29  ? -39.071 61.615  -0.168  1.00 43.46  ? 29  VAL A CG2 1 
ATOM 137   N N   . ARG A 1 30  ? -42.465 60.486  3.033   1.00 47.44  ? 30  ARG A N   1 
ATOM 138   C CA  . ARG A 1 30  ? -43.729 60.572  3.785   1.00 48.36  ? 30  ARG A CA  1 
ATOM 139   C C   . ARG A 1 30  ? -43.763 61.929  4.476   1.00 53.16  ? 30  ARG A C   1 
ATOM 140   O O   . ARG A 1 30  ? -42.784 62.336  5.109   1.00 53.11  ? 30  ARG A O   1 
ATOM 141   C CB  . ARG A 1 30  ? -43.878 59.399  4.774   1.00 49.78  ? 30  ARG A CB  1 
ATOM 142   C CG  . ARG A 1 30  ? -45.295 59.212  5.337   1.00 70.99  ? 30  ARG A CG  1 
ATOM 143   C CD  . ARG A 1 30  ? -45.284 58.318  6.575   1.00 90.63  ? 30  ARG A CD  1 
ATOM 144   N NE  . ARG A 1 30  ? -46.612 58.096  7.152   1.00 108.52 ? 30  ARG A NE  1 
ATOM 145   C CZ  . ARG A 1 30  ? -46.839 57.419  8.280   1.00 128.83 ? 30  ARG A CZ  1 
ATOM 146   N NH1 . ARG A 1 30  ? -45.826 56.921  8.982   1.00 113.84 ? 30  ARG A NH1 1 
ATOM 147   N NH2 . ARG A 1 30  ? -48.079 57.257  8.726   1.00 118.92 ? 30  ARG A NH2 1 
ATOM 148   N N   . VAL A 1 31  ? -44.863 62.643  4.310   1.00 50.46  ? 31  VAL A N   1 
ATOM 149   C CA  . VAL A 1 31  ? -45.018 63.993  4.826   1.00 51.41  ? 31  VAL A CA  1 
ATOM 150   C C   . VAL A 1 31  ? -46.299 64.121  5.701   1.00 58.02  ? 31  VAL A C   1 
ATOM 151   O O   . VAL A 1 31  ? -47.327 63.516  5.399   1.00 55.19  ? 31  VAL A O   1 
ATOM 152   C CB  . VAL A 1 31  ? -45.001 64.952  3.595   1.00 54.73  ? 31  VAL A CB  1 
ATOM 153   C CG1 . VAL A 1 31  ? -45.901 66.170  3.760   1.00 54.51  ? 31  VAL A CG1 1 
ATOM 154   C CG2 . VAL A 1 31  ? -43.580 65.359  3.237   1.00 54.07  ? 31  VAL A CG2 1 
ATOM 155   N N   . GLU A 1 32  ? -46.193 64.903  6.797   1.00 58.41  ? 32  GLU A N   1 
ATOM 156   C CA  . GLU A 1 32  ? -47.265 65.260  7.737   1.00 58.42  ? 32  GLU A CA  1 
ATOM 157   C C   . GLU A 1 32  ? -47.245 66.767  7.946   1.00 64.54  ? 32  GLU A C   1 
ATOM 158   O O   . GLU A 1 32  ? -46.179 67.338  8.164   1.00 62.75  ? 32  GLU A O   1 
ATOM 159   C CB  . GLU A 1 32  ? -47.088 64.539  9.079   1.00 59.70  ? 32  GLU A CB  1 
ATOM 160   C CG  . GLU A 1 32  ? -47.423 63.063  9.064   1.00 76.97  ? 32  GLU A CG  1 
ATOM 161   C CD  . GLU A 1 32  ? -47.595 62.450  10.445  1.00 110.27 ? 32  GLU A CD  1 
ATOM 162   O OE1 . GLU A 1 32  ? -46.614 62.442  11.226  1.00 108.27 ? 32  GLU A OE1 1 
ATOM 163   O OE2 . GLU A 1 32  ? -48.715 61.976  10.750  1.00 110.07 ? 32  GLU A OE2 1 
ATOM 164   N N   . GLY A 1 33  ? -48.398 67.411  7.901   1.00 65.76  ? 33  GLY A N   1 
ATOM 165   C CA  . GLY A 1 33  ? -48.460 68.855  8.115   1.00 67.39  ? 33  GLY A CA  1 
ATOM 166   C C   . GLY A 1 33  ? -49.819 69.381  8.531   1.00 74.46  ? 33  GLY A C   1 
ATOM 167   O O   . GLY A 1 33  ? -50.505 68.745  9.337   1.00 73.38  ? 33  GLY A O   1 
ATOM 168   N N   . THR A 1 34  ? -50.212 70.561  7.967   1.00 73.12  ? 34  THR A N   1 
ATOM 169   C CA  . THR A 1 34  ? -51.494 71.234  8.243   1.00 105.42 ? 34  THR A CA  1 
ATOM 170   C C   . THR A 1 34  ? -52.266 71.593  6.945   1.00 125.73 ? 34  THR A C   1 
ATOM 171   O O   . THR A 1 34  ? -51.687 71.789  5.876   1.00 84.61  ? 34  THR A O   1 
ATOM 172   C CB  . THR A 1 34  ? -51.277 72.471  9.130   1.00 112.12 ? 34  THR A CB  1 
ATOM 173   O OG1 . THR A 1 34  ? -52.540 72.957  9.571   1.00 108.33 ? 34  THR A OG1 1 
ATOM 174   C CG2 . THR A 1 34  ? -50.455 73.586  8.446   1.00 112.18 ? 34  THR A CG2 1 
ATOM 175   N N   . GLN A 1 59  ? -56.059 71.808  9.728   1.00 108.07 ? 59  GLN A N   1 
ATOM 176   C CA  . GLN A 1 59  ? -56.341 70.376  9.844   1.00 107.77 ? 59  GLN A CA  1 
ATOM 177   C C   . GLN A 1 59  ? -55.140 69.535  9.342   1.00 110.49 ? 59  GLN A C   1 
ATOM 178   O O   . GLN A 1 59  ? -54.618 69.820  8.253   1.00 110.20 ? 59  GLN A O   1 
ATOM 179   C CB  . GLN A 1 59  ? -57.622 70.010  9.061   1.00 109.22 ? 59  GLN A CB  1 
ATOM 180   C CG  . GLN A 1 59  ? -58.219 68.643  9.407   1.00 124.07 ? 59  GLN A CG  1 
ATOM 181   C CD  . GLN A 1 59  ? -59.188 68.163  8.350   1.00 144.18 ? 59  GLN A CD  1 
ATOM 182   O OE1 . GLN A 1 59  ? -60.405 68.380  8.424   1.00 140.36 ? 59  GLN A OE1 1 
ATOM 183   N NE2 . GLN A 1 59  ? -58.668 67.491  7.338   1.00 135.58 ? 59  GLN A NE2 1 
ATOM 184   N N   . PRO A 1 60  ? -54.718 68.479  10.098  1.00 105.07 ? 60  PRO A N   1 
ATOM 185   C CA  . PRO A 1 60  ? -53.568 67.664  9.656   1.00 103.81 ? 60  PRO A CA  1 
ATOM 186   C C   . PRO A 1 60  ? -53.825 66.827  8.392   1.00 103.19 ? 60  PRO A C   1 
ATOM 187   O O   . PRO A 1 60  ? -54.955 66.377  8.150   1.00 102.99 ? 60  PRO A O   1 
ATOM 188   C CB  . PRO A 1 60  ? -53.284 66.753  10.860  1.00 105.67 ? 60  PRO A CB  1 
ATOM 189   C CG  . PRO A 1 60  ? -53.991 67.384  12.014  1.00 110.32 ? 60  PRO A CG  1 
ATOM 190   C CD  . PRO A 1 60  ? -55.203 68.027  11.415  1.00 106.20 ? 60  PRO A CD  1 
ATOM 191   N N   . PHE A 1 61  ? -52.742 66.628  7.588   1.00 94.90  ? 61  PHE A N   1 
ATOM 192   C CA  . PHE A 1 61  ? -52.718 65.838  6.346   1.00 91.89  ? 61  PHE A CA  1 
ATOM 193   C C   . PHE A 1 61  ? -51.494 64.892  6.297   1.00 89.71  ? 61  PHE A C   1 
ATOM 194   O O   . PHE A 1 61  ? -50.468 65.171  6.922   1.00 88.07  ? 61  PHE A O   1 
ATOM 195   C CB  . PHE A 1 61  ? -52.733 66.759  5.100   1.00 93.15  ? 61  PHE A CB  1 
ATOM 196   C CG  . PHE A 1 61  ? -51.415 67.401  4.711   1.00 93.99  ? 61  PHE A CG  1 
ATOM 197   C CD1 . PHE A 1 61  ? -50.582 66.805  3.771   1.00 95.91  ? 61  PHE A CD1 1 
ATOM 198   C CD2 . PHE A 1 61  ? -51.022 68.614  5.266   1.00 95.55  ? 61  PHE A CD2 1 
ATOM 199   C CE1 . PHE A 1 61  ? -49.367 67.398  3.416   1.00 96.46  ? 61  PHE A CE1 1 
ATOM 200   C CE2 . PHE A 1 61  ? -49.809 69.209  4.901   1.00 97.66  ? 61  PHE A CE2 1 
ATOM 201   C CZ  . PHE A 1 61  ? -48.986 68.594  3.986   1.00 95.32  ? 61  PHE A CZ  1 
ATOM 202   N N   . GLU A 1 62  ? -51.612 63.796  5.522   1.00 83.29  ? 62  GLU A N   1 
ATOM 203   C CA  . GLU A 1 62  ? -50.541 62.824  5.275   1.00 81.72  ? 62  GLU A CA  1 
ATOM 204   C C   . GLU A 1 62  ? -50.338 62.673  3.762   1.00 81.16  ? 62  GLU A C   1 
ATOM 205   O O   . GLU A 1 62  ? -51.239 62.212  3.047   1.00 81.01  ? 62  GLU A O   1 
ATOM 206   C CB  . GLU A 1 62  ? -50.814 61.462  5.944   1.00 83.36  ? 62  GLU A CB  1 
ATOM 207   C CG  . GLU A 1 62  ? -50.285 61.372  7.367   1.00 98.80  ? 62  GLU A CG  1 
ATOM 208   C CD  . GLU A 1 62  ? -50.568 60.092  8.136   1.00 133.13 ? 62  GLU A CD  1 
ATOM 209   O OE1 . GLU A 1 62  ? -50.406 58.989  7.562   1.00 140.55 ? 62  GLU A OE1 1 
ATOM 210   O OE2 . GLU A 1 62  ? -50.893 60.194  9.342   1.00 127.89 ? 62  GLU A OE2 1 
ATOM 211   N N   . GLY A 1 63  ? -49.173 63.116  3.291   1.00 73.53  ? 63  GLY A N   1 
ATOM 212   C CA  . GLY A 1 63  ? -48.789 63.061  1.882   1.00 71.31  ? 63  GLY A CA  1 
ATOM 213   C C   . GLY A 1 63  ? -47.707 62.035  1.596   1.00 70.61  ? 63  GLY A C   1 
ATOM 214   O O   . GLY A 1 63  ? -46.919 61.691  2.487   1.00 69.65  ? 63  GLY A O   1 
ATOM 215   N N   . LEU A 1 64  ? -47.666 61.523  0.352   1.00 63.55  ? 64  LEU A N   1 
ATOM 216   C CA  . LEU A 1 64  ? -46.666 60.533  -0.038  1.00 61.15  ? 64  LEU A CA  1 
ATOM 217   C C   . LEU A 1 64  ? -46.128 60.767  -1.445  1.00 57.49  ? 64  LEU A C   1 
ATOM 218   O O   . LEU A 1 64  ? -46.881 60.999  -2.382  1.00 57.40  ? 64  LEU A O   1 
ATOM 219   C CB  . LEU A 1 64  ? -47.208 59.115  0.078   1.00 61.89  ? 64  LEU A CB  1 
ATOM 220   C CG  . LEU A 1 64  ? -46.231 58.135  0.718   1.00 67.82  ? 64  LEU A CG  1 
ATOM 221   C CD1 . LEU A 1 64  ? -46.934 57.278  1.788   1.00 68.34  ? 64  LEU A CD1 1 
ATOM 222   C CD2 . LEU A 1 64  ? -45.438 57.324  -0.350  1.00 69.45  ? 64  LEU A CD2 1 
ATOM 223   N N   . GLY A 1 65  ? -44.813 60.724  -1.553  1.00 48.67  ? 65  GLY A N   1 
ATOM 224   C CA  . GLY A 1 65  ? -44.073 60.921  -2.784  1.00 45.73  ? 65  GLY A CA  1 
ATOM 225   C C   . GLY A 1 65  ? -42.804 60.108  -2.786  1.00 44.87  ? 65  GLY A C   1 
ATOM 226   O O   . GLY A 1 65  ? -42.700 59.077  -2.118  1.00 44.02  ? 65  GLY A O   1 
ATOM 227   N N   . SER A 1 66  ? -41.838 60.569  -3.536  1.00 40.02  ? 66  SER A N   1 
ATOM 228   C CA  . SER A 1 66  ? -40.565 59.881  -3.657  1.00 39.70  ? 66  SER A CA  1 
ATOM 229   C C   . SER A 1 66  ? -39.433 60.850  -3.602  1.00 41.43  ? 66  SER A C   1 
ATOM 230   O O   . SER A 1 66  ? -39.654 62.053  -3.612  1.00 41.45  ? 66  SER A O   1 
ATOM 231   C CB  . SER A 1 66  ? -40.491 59.098  -4.968  1.00 41.76  ? 66  SER A CB  1 
ATOM 232   O OG  . SER A 1 66  ? -41.488 58.096  -5.012  1.00 50.11  ? 66  SER A OG  1 
ATOM 233   N N   . GLY A 1 67  ? -38.233 60.302  -3.573  1.00 35.62  ? 67  GLY A N   1 
ATOM 234   C CA  . GLY A 1 67  ? -36.993 61.044  -3.549  1.00 34.87  ? 67  GLY A CA  1 
ATOM 235   C C   . GLY A 1 67  ? -35.828 60.212  -4.032  1.00 38.25  ? 67  GLY A C   1 
ATOM 236   O O   . GLY A 1 67  ? -35.949 59.003  -4.210  1.00 37.61  ? 67  GLY A O   1 
ATOM 237   N N   . VAL A 1 68  ? -34.697 60.855  -4.261  1.00 36.38  ? 68  VAL A N   1 
ATOM 238   C CA  . VAL A 1 68  ? -33.448 60.222  -4.715  1.00 35.96  ? 68  VAL A CA  1 
ATOM 239   C C   . VAL A 1 68  ? -32.275 60.694  -3.869  1.00 39.20  ? 68  VAL A C   1 
ATOM 240   O O   . VAL A 1 68  ? -32.033 61.922  -3.764  1.00 37.33  ? 68  VAL A O   1 
ATOM 241   C CB  . VAL A 1 68  ? -33.124 60.520  -6.201  1.00 39.44  ? 68  VAL A CB  1 
ATOM 242   C CG1 . VAL A 1 68  ? -31.988 59.607  -6.697  1.00 38.30  ? 68  VAL A CG1 1 
ATOM 243   C CG2 . VAL A 1 68  ? -34.374 60.440  -7.098  1.00 38.84  ? 68  VAL A CG2 1 
ATOM 244   N N   . ILE A 1 69  ? -31.511 59.718  -3.341  1.00 34.39  ? 69  ILE A N   1 
ATOM 245   C CA  . ILE A 1 69  ? -30.309 59.990  -2.586  1.00 34.31  ? 69  ILE A CA  1 
ATOM 246   C C   . ILE A 1 69  ? -29.227 60.414  -3.579  1.00 43.85  ? 69  ILE A C   1 
ATOM 247   O O   . ILE A 1 69  ? -28.751 59.636  -4.411  1.00 41.98  ? 69  ILE A O   1 
ATOM 248   C CB  . ILE A 1 69  ? -29.863 58.840  -1.654  1.00 36.85  ? 69  ILE A CB  1 
ATOM 249   C CG1 . ILE A 1 69  ? -30.989 58.512  -0.619  1.00 35.77  ? 69  ILE A CG1 1 
ATOM 250   C CG2 . ILE A 1 69  ? -28.539 59.214  -0.929  1.00 35.55  ? 69  ILE A CG2 1 
ATOM 251   C CD1 . ILE A 1 69  ? -30.842 57.159  0.012   1.00 37.58  ? 69  ILE A CD1 1 
ATOM 252   N N   . ILE A 1 70  ? -28.876 61.693  -3.476  1.00 46.32  ? 70  ILE A N   1 
ATOM 253   C CA  . ILE A 1 70  ? -27.927 62.362  -4.329  1.00 48.06  ? 70  ILE A CA  1 
ATOM 254   C C   . ILE A 1 70  ? -26.511 62.389  -3.648  1.00 51.35  ? 70  ILE A C   1 
ATOM 255   O O   . ILE A 1 70  ? -25.491 62.410  -4.359  1.00 51.89  ? 70  ILE A O   1 
ATOM 256   C CB  . ILE A 1 70  ? -28.545 63.747  -4.640  1.00 53.06  ? 70  ILE A CB  1 
ATOM 257   C CG1 . ILE A 1 70  ? -28.496 64.049  -6.122  1.00 55.41  ? 70  ILE A CG1 1 
ATOM 258   C CG2 . ILE A 1 70  ? -28.109 64.921  -3.714  1.00 55.00  ? 70  ILE A CG2 1 
ATOM 259   C CD1 . ILE A 1 70  ? -28.395 65.612  -6.486  1.00 76.50  ? 70  ILE A CD1 1 
ATOM 260   N N   . ASN A 1 71  ? -26.467 62.330  -2.284  1.00 44.98  ? 71  ASN A N   1 
ATOM 261   C CA  . ASN A 1 71  ? -25.249 62.275  -1.462  1.00 42.57  ? 71  ASN A CA  1 
ATOM 262   C C   . ASN A 1 71  ? -25.477 61.362  -0.275  1.00 42.73  ? 71  ASN A C   1 
ATOM 263   O O   . ASN A 1 71  ? -26.121 61.774  0.697   1.00 41.37  ? 71  ASN A O   1 
ATOM 264   C CB  . ASN A 1 71  ? -24.808 63.670  -0.990  1.00 41.70  ? 71  ASN A CB  1 
ATOM 265   C CG  . ASN A 1 71  ? -23.454 63.721  -0.301  1.00 51.68  ? 71  ASN A CG  1 
ATOM 266   O OD1 . ASN A 1 71  ? -23.063 62.847  0.510   1.00 49.59  ? 71  ASN A OD1 1 
ATOM 267   N ND2 . ASN A 1 71  ? -22.737 64.790  -0.572  1.00 33.79  ? 71  ASN A ND2 1 
ATOM 268   N N   . ALA A 1 72  ? -24.910 60.134  -0.339  1.00 38.76  ? 72  ALA A N   1 
ATOM 269   C CA  . ALA A 1 72  ? -25.031 59.090  0.692   1.00 38.03  ? 72  ALA A CA  1 
ATOM 270   C C   . ALA A 1 72  ? -24.407 59.511  2.053   1.00 45.93  ? 72  ALA A C   1 
ATOM 271   O O   . ALA A 1 72  ? -25.005 59.242  3.100   1.00 46.82  ? 72  ALA A O   1 
ATOM 272   C CB  . ALA A 1 72  ? -24.398 57.803  0.194   1.00 37.57  ? 72  ALA A CB  1 
ATOM 273   N N   . SER A 1 73  ? -23.226 60.197  2.030   1.00 43.58  ? 73  SER A N   1 
ATOM 274   C CA  . SER A 1 73  ? -22.504 60.631  3.246   1.00 42.91  ? 73  SER A CA  1 
ATOM 275   C C   . SER A 1 73  ? -23.295 61.686  4.038   1.00 45.98  ? 73  SER A C   1 
ATOM 276   O O   . SER A 1 73  ? -23.459 61.555  5.244   1.00 45.20  ? 73  SER A O   1 
ATOM 277   C CB  . SER A 1 73  ? -21.123 61.179  2.895   1.00 46.35  ? 73  SER A CB  1 
ATOM 278   O OG  . SER A 1 73  ? -20.505 60.456  1.844   1.00 61.25  ? 73  SER A OG  1 
ATOM 279   N N   . LYS A 1 74  ? -23.795 62.715  3.355   1.00 43.36  ? 74  LYS A N   1 
ATOM 280   C CA  . LYS A 1 74  ? -24.545 63.801  3.979   1.00 43.27  ? 74  LYS A CA  1 
ATOM 281   C C   . LYS A 1 74  ? -26.056 63.500  4.108   1.00 48.58  ? 74  LYS A C   1 
ATOM 282   O O   . LYS A 1 74  ? -26.761 64.197  4.841   1.00 47.76  ? 74  LYS A O   1 
ATOM 283   C CB  . LYS A 1 74  ? -24.337 65.092  3.176   1.00 46.20  ? 74  LYS A CB  1 
ATOM 284   C CG  . LYS A 1 74  ? -22.873 65.514  3.008   1.00 56.91  ? 74  LYS A CG  1 
ATOM 285   C CD  . LYS A 1 74  ? -22.432 66.511  4.080   1.00 70.76  ? 74  LYS A CD  1 
ATOM 286   C CE  . LYS A 1 74  ? -21.001 66.968  3.893   1.00 95.53  ? 74  LYS A CE  1 
ATOM 287   N NZ  . LYS A 1 74  ? -20.817 67.794  2.667   1.00 114.79 ? 74  LYS A NZ  1 
ATOM 288   N N   . GLY A 1 75  ? -26.538 62.481  3.391   1.00 46.79  ? 75  GLY A N   1 
ATOM 289   C CA  . GLY A 1 75  ? -27.947 62.091  3.395   1.00 45.51  ? 75  GLY A CA  1 
ATOM 290   C C   . GLY A 1 75  ? -28.808 63.076  2.635   1.00 48.30  ? 75  GLY A C   1 
ATOM 291   O O   . GLY A 1 75  ? -29.935 63.354  3.052   1.00 47.11  ? 75  GLY A O   1 
ATOM 292   N N   . TYR A 1 76  ? -28.271 63.622  1.513   1.00 44.98  ? 76  TYR A N   1 
ATOM 293   C CA  . TYR A 1 76  ? -28.982 64.603  0.675   1.00 44.65  ? 76  TYR A CA  1 
ATOM 294   C C   . TYR A 1 76  ? -29.960 63.895  -0.303  1.00 48.73  ? 76  TYR A C   1 
ATOM 295   O O   . TYR A 1 76  ? -29.544 63.098  -1.164  1.00 47.86  ? 76  TYR A O   1 
ATOM 296   C CB  . TYR A 1 76  ? -28.009 65.521  -0.088  1.00 45.29  ? 76  TYR A CB  1 
ATOM 297   C CG  . TYR A 1 76  ? -27.246 66.529  0.756   1.00 48.79  ? 76  TYR A CG  1 
ATOM 298   C CD1 . TYR A 1 76  ? -25.940 66.898  0.430   1.00 50.45  ? 76  TYR A CD1 1 
ATOM 299   C CD2 . TYR A 1 76  ? -27.852 67.174  1.830   1.00 50.27  ? 76  TYR A CD2 1 
ATOM 300   C CE1 . TYR A 1 76  ? -25.245 67.853  1.175   1.00 50.04  ? 76  TYR A CE1 1 
ATOM 301   C CE2 . TYR A 1 76  ? -27.165 68.124  2.587   1.00 51.98  ? 76  TYR A CE2 1 
ATOM 302   C CZ  . TYR A 1 76  ? -25.861 68.463  2.256   1.00 59.17  ? 76  TYR A CZ  1 
ATOM 303   O OH  . TYR A 1 76  ? -25.203 69.431  2.984   1.00 58.76  ? 76  TYR A OH  1 
ATOM 304   N N   . VAL A 1 77  ? -31.267 64.224  -0.163  1.00 43.52  ? 77  VAL A N   1 
ATOM 305   C CA  . VAL A 1 77  ? -32.368 63.651  -0.928  1.00 41.79  ? 77  VAL A CA  1 
ATOM 306   C C   . VAL A 1 77  ? -33.025 64.726  -1.758  1.00 45.64  ? 77  VAL A C   1 
ATOM 307   O O   . VAL A 1 77  ? -33.591 65.678  -1.200  1.00 45.60  ? 77  VAL A O   1 
ATOM 308   C CB  . VAL A 1 77  ? -33.427 62.924  -0.023  1.00 43.99  ? 77  VAL A CB  1 
ATOM 309   C CG1 . VAL A 1 77  ? -34.650 62.486  -0.824  1.00 43.35  ? 77  VAL A CG1 1 
ATOM 310   C CG2 . VAL A 1 77  ? -32.832 61.731  0.703   1.00 43.16  ? 77  VAL A CG2 1 
ATOM 311   N N   . LEU A 1 78  ? -33.009 64.524  -3.100  1.00 41.43  ? 78  LEU A N   1 
ATOM 312   C CA  . LEU A 1 78  ? -33.698 65.369  -4.074  1.00 40.16  ? 78  LEU A CA  1 
ATOM 313   C C   . LEU A 1 78  ? -35.167 64.955  -4.128  1.00 42.93  ? 78  LEU A C   1 
ATOM 314   O O   . LEU A 1 78  ? -35.463 63.765  -4.093  1.00 41.99  ? 78  LEU A O   1 
ATOM 315   C CB  . LEU A 1 78  ? -33.061 65.207  -5.462  1.00 40.20  ? 78  LEU A CB  1 
ATOM 316   C CG  . LEU A 1 78  ? -32.288 66.388  -6.048  1.00 46.29  ? 78  LEU A CG  1 
ATOM 317   C CD1 . LEU A 1 78  ? -31.844 66.075  -7.460  1.00 46.35  ? 78  LEU A CD1 1 
ATOM 318   C CD2 . LEU A 1 78  ? -33.121 67.668  -6.064  1.00 50.40  ? 78  LEU A CD2 1 
ATOM 319   N N   . THR A 1 79  ? -36.091 65.910  -4.212  1.00 39.92  ? 79  THR A N   1 
ATOM 320   C CA  . THR A 1 79  ? -37.530 65.616  -4.330  1.00 39.16  ? 79  THR A CA  1 
ATOM 321   C C   . THR A 1 79  ? -38.203 66.775  -5.052  1.00 41.19  ? 79  THR A C   1 
ATOM 322   O O   . THR A 1 79  ? -37.510 67.638  -5.590  1.00 42.31  ? 79  THR A O   1 
ATOM 323   C CB  . THR A 1 79  ? -38.167 65.268  -2.943  1.00 48.67  ? 79  THR A CB  1 
ATOM 324   O OG1 . THR A 1 79  ? -39.493 64.772  -3.149  1.00 52.12  ? 79  THR A OG1 1 
ATOM 325   C CG2 . THR A 1 79  ? -38.176 66.435  -1.965  1.00 44.99  ? 79  THR A CG2 1 
ATOM 326   N N   . ASN A 1 80  ? -39.530 66.777  -5.120  1.00 38.07  ? 80  ASN A N   1 
ATOM 327   C CA  . ASN A 1 80  ? -40.257 67.909  -5.682  1.00 38.64  ? 80  ASN A CA  1 
ATOM 328   C C   . ASN A 1 80  ? -40.701 68.793  -4.552  1.00 46.80  ? 80  ASN A C   1 
ATOM 329   O O   . ASN A 1 80  ? -41.040 68.297  -3.458  1.00 45.48  ? 80  ASN A O   1 
ATOM 330   C CB  . ASN A 1 80  ? -41.472 67.508  -6.542  1.00 37.23  ? 80  ASN A CB  1 
ATOM 331   C CG  . ASN A 1 80  ? -41.165 66.981  -7.921  1.00 47.23  ? 80  ASN A CG  1 
ATOM 332   O OD1 . ASN A 1 80  ? -41.646 65.921  -8.297  1.00 49.71  ? 80  ASN A OD1 1 
ATOM 333   N ND2 . ASN A 1 80  ? -40.379 67.688  -8.710  1.00 34.48  ? 80  ASN A ND2 1 
ATOM 334   N N   . ASN A 1 81  ? -40.750 70.109  -4.831  1.00 46.58  ? 81  ASN A N   1 
ATOM 335   C CA  . ASN A 1 81  ? -41.212 71.088  -3.860  1.00 46.97  ? 81  ASN A CA  1 
ATOM 336   C C   . ASN A 1 81  ? -42.669 70.788  -3.469  1.00 49.90  ? 81  ASN A C   1 
ATOM 337   O O   . ASN A 1 81  ? -42.971 70.798  -2.275  1.00 49.12  ? 81  ASN A O   1 
ATOM 338   C CB  . ASN A 1 81  ? -41.053 72.518  -4.402  1.00 48.70  ? 81  ASN A CB  1 
ATOM 339   C CG  . ASN A 1 81  ? -41.557 73.592  -3.465  1.00 63.65  ? 81  ASN A CG  1 
ATOM 340   O OD1 . ASN A 1 81  ? -41.069 73.741  -2.322  1.00 46.09  ? 81  ASN A OD1 1 
ATOM 341   N ND2 . ASN A 1 81  ? -42.561 74.350  -3.922  1.00 50.80  ? 81  ASN A ND2 1 
ATOM 342   N N   . HIS A 1 82  ? -43.538 70.437  -4.447  1.00 46.12  ? 82  HIS A N   1 
ATOM 343   C CA  . HIS A 1 82  ? -44.967 70.155  -4.181  1.00 45.76  ? 82  HIS A CA  1 
ATOM 344   C C   . HIS A 1 82  ? -45.179 68.909  -3.261  1.00 48.67  ? 82  HIS A C   1 
ATOM 345   O O   . HIS A 1 82  ? -46.248 68.758  -2.670  1.00 47.07  ? 82  HIS A O   1 
ATOM 346   C CB  . HIS A 1 82  ? -45.782 70.038  -5.486  1.00 45.92  ? 82  HIS A CB  1 
ATOM 347   C CG  . HIS A 1 82  ? -45.520 68.803  -6.294  1.00 49.09  ? 82  HIS A CG  1 
ATOM 348   N ND1 . HIS A 1 82  ? -44.763 68.848  -7.447  1.00 50.68  ? 82  HIS A ND1 1 
ATOM 349   C CD2 . HIS A 1 82  ? -45.968 67.538  -6.115  1.00 50.33  ? 82  HIS A CD2 1 
ATOM 350   C CE1 . HIS A 1 82  ? -44.765 67.617  -7.925  1.00 49.98  ? 82  HIS A CE1 1 
ATOM 351   N NE2 . HIS A 1 82  ? -45.475 66.793  -7.154  1.00 50.07  ? 82  HIS A NE2 1 
ATOM 352   N N   . VAL A 1 83  ? -44.159 68.048  -3.130  1.00 45.37  ? 83  VAL A N   1 
ATOM 353   C CA  . VAL A 1 83  ? -44.215 66.876  -2.246  1.00 44.64  ? 83  VAL A CA  1 
ATOM 354   C C   . VAL A 1 83  ? -44.078 67.348  -0.794  1.00 51.95  ? 83  VAL A C   1 
ATOM 355   O O   . VAL A 1 83  ? -44.719 66.822  0.097   1.00 52.14  ? 83  VAL A O   1 
ATOM 356   C CB  . VAL A 1 83  ? -43.101 65.843  -2.612  1.00 45.86  ? 83  VAL A CB  1 
ATOM 357   C CG1 . VAL A 1 83  ? -43.067 64.667  -1.634  1.00 44.50  ? 83  VAL A CG1 1 
ATOM 358   C CG2 . VAL A 1 83  ? -43.253 65.344  -4.039  1.00 45.53  ? 83  VAL A CG2 1 
ATOM 359   N N   . ILE A 1 84  ? -43.248 68.362  -0.591  1.00 51.20  ? 84  ILE A N   1 
ATOM 360   C CA  . ILE A 1 84  ? -42.792 68.885  0.680   1.00 52.09  ? 84  ILE A CA  1 
ATOM 361   C C   . ILE A 1 84  ? -43.449 70.204  1.120   1.00 61.90  ? 84  ILE A C   1 
ATOM 362   O O   . ILE A 1 84  ? -43.309 70.576  2.281   1.00 62.70  ? 84  ILE A O   1 
ATOM 363   C CB  . ILE A 1 84  ? -41.253 69.028  0.440   1.00 53.71  ? 84  ILE A CB  1 
ATOM 364   C CG1 . ILE A 1 84  ? -40.460 68.087  1.306   1.00 54.48  ? 84  ILE A CG1 1 
ATOM 365   C CG2 . ILE A 1 84  ? -40.675 70.455  0.335   1.00 50.79  ? 84  ILE A CG2 1 
ATOM 366   C CD1 . ILE A 1 84  ? -40.644 66.669  0.942   1.00 63.87  ? 84  ILE A CD1 1 
ATOM 367   N N   . ASN A 1 85  ? -44.151 70.875  0.211   1.00 61.83  ? 85  ASN A N   1 
ATOM 368   C CA  . ASN A 1 85  ? -44.770 72.189  0.334   1.00 63.66  ? 85  ASN A CA  1 
ATOM 369   C C   . ASN A 1 85  ? -45.300 72.584  1.733   1.00 70.30  ? 85  ASN A C   1 
ATOM 370   O O   . ASN A 1 85  ? -44.891 73.625  2.253   1.00 69.17  ? 85  ASN A O   1 
ATOM 371   C CB  . ASN A 1 85  ? -45.908 72.334  -0.691  1.00 69.69  ? 85  ASN A CB  1 
ATOM 372   C CG  . ASN A 1 85  ? -45.760 73.546  -1.583  1.00 103.81 ? 85  ASN A CG  1 
ATOM 373   O OD1 . ASN A 1 85  ? -45.233 74.595  -1.181  1.00 103.34 ? 85  ASN A OD1 1 
ATOM 374   N ND2 . ASN A 1 85  ? -46.232 73.435  -2.818  1.00 94.63  ? 85  ASN A ND2 1 
ATOM 375   N N   . GLN A 1 86  ? -46.203 71.800  2.327   1.00 70.10  ? 86  GLN A N   1 
ATOM 376   C CA  . GLN A 1 86  ? -46.803 72.199  3.613   1.00 71.99  ? 86  GLN A CA  1 
ATOM 377   C C   . GLN A 1 86  ? -46.338 71.305  4.791   1.00 76.80  ? 86  GLN A C   1 
ATOM 378   O O   . GLN A 1 86  ? -46.981 71.288  5.850   1.00 77.12  ? 86  GLN A O   1 
ATOM 379   C CB  . GLN A 1 86  ? -48.358 72.162  3.509   1.00 74.17  ? 86  GLN A CB  1 
ATOM 380   C CG  . GLN A 1 86  ? -49.000 72.921  2.333   1.00 95.85  ? 86  GLN A CG  1 
ATOM 381   C CD  . GLN A 1 86  ? -49.642 72.007  1.295   1.00 108.82 ? 86  GLN A CD  1 
ATOM 382   O OE1 . GLN A 1 86  ? -48.966 71.345  0.515   1.00 105.60 ? 86  GLN A OE1 1 
ATOM 383   N NE2 . GLN A 1 86  ? -50.968 71.941  1.256   1.00 94.65  ? 86  GLN A NE2 1 
ATOM 384   N N   . ALA A 1 87  ? -45.226 70.578  4.607   1.00 72.75  ? 87  ALA A N   1 
ATOM 385   C CA  . ALA A 1 87  ? -44.728 69.607  5.569   1.00 72.15  ? 87  ALA A CA  1 
ATOM 386   C C   . ALA A 1 87  ? -44.230 70.221  6.866   1.00 75.81  ? 87  ALA A C   1 
ATOM 387   O O   . ALA A 1 87  ? -43.531 71.232  6.859   1.00 76.41  ? 87  ALA A O   1 
ATOM 388   C CB  . ALA A 1 87  ? -43.625 68.782  4.941   1.00 72.79  ? 87  ALA A CB  1 
ATOM 389   N N   . GLN A 1 88  ? -44.588 69.569  7.977   1.00 71.56  ? 88  GLN A N   1 
ATOM 390   C CA  . GLN A 1 88  ? -44.168 69.874  9.349   1.00 70.88  ? 88  GLN A CA  1 
ATOM 391   C C   . GLN A 1 88  ? -43.247 68.760  9.814   1.00 72.36  ? 88  GLN A C   1 
ATOM 392   O O   . GLN A 1 88  ? -42.313 68.997  10.584  1.00 72.84  ? 88  GLN A O   1 
ATOM 393   C CB  . GLN A 1 88  ? -45.380 70.017  10.280  1.00 72.39  ? 88  GLN A CB  1 
ATOM 394   C CG  . GLN A 1 88  ? -46.197 71.276  9.995   1.00 99.85  ? 88  GLN A CG  1 
ATOM 395   C CD  . GLN A 1 88  ? -47.486 71.357  10.774  1.00 128.95 ? 88  GLN A CD  1 
ATOM 396   O OE1 . GLN A 1 88  ? -47.941 70.400  11.412  1.00 127.62 ? 88  GLN A OE1 1 
ATOM 397   N NE2 . GLN A 1 88  ? -48.123 72.510  10.713  1.00 124.23 ? 88  GLN A NE2 1 
ATOM 398   N N   . LYS A 1 89  ? -43.526 67.531  9.331   1.00 65.26  ? 89  LYS A N   1 
ATOM 399   C CA  . LYS A 1 89  ? -42.733 66.327  9.581   1.00 63.15  ? 89  LYS A CA  1 
ATOM 400   C C   . LYS A 1 89  ? -42.484 65.617  8.252   1.00 60.31  ? 89  LYS A C   1 
ATOM 401   O O   . LYS A 1 89  ? -43.412 65.453  7.463   1.00 59.05  ? 89  LYS A O   1 
ATOM 402   C CB  . LYS A 1 89  ? -43.406 65.396  10.608  1.00 65.39  ? 89  LYS A CB  1 
ATOM 403   C CG  . LYS A 1 89  ? -43.229 65.884  12.045  1.00 86.47  ? 89  LYS A CG  1 
ATOM 404   C CD  . LYS A 1 89  ? -43.887 64.948  13.067  1.00 100.25 ? 89  LYS A CD  1 
ATOM 405   C CE  . LYS A 1 89  ? -43.439 65.215  14.495  1.00 101.24 ? 89  LYS A CE  1 
ATOM 406   N NZ  . LYS A 1 89  ? -43.517 63.993  15.358  1.00 97.93  ? 89  LYS A NZ  1 
ATOM 407   N N   . ILE A 1 90  ? -41.212 65.280  7.975   1.00 52.82  ? 90  ILE A N   1 
ATOM 408   C CA  . ILE A 1 90  ? -40.786 64.578  6.770   1.00 50.02  ? 90  ILE A CA  1 
ATOM 409   C C   . ILE A 1 90  ? -40.026 63.331  7.193   1.00 55.75  ? 90  ILE A C   1 
ATOM 410   O O   . ILE A 1 90  ? -39.057 63.423  7.949   1.00 56.56  ? 90  ILE A O   1 
ATOM 411   C CB  . ILE A 1 90  ? -39.943 65.459  5.804   1.00 51.23  ? 90  ILE A CB  1 
ATOM 412   C CG1 . ILE A 1 90  ? -40.669 66.753  5.411   1.00 50.72  ? 90  ILE A CG1 1 
ATOM 413   C CG2 . ILE A 1 90  ? -39.549 64.672  4.555   1.00 50.95  ? 90  ILE A CG2 1 
ATOM 414   C CD1 . ILE A 1 90  ? -39.784 67.870  4.907   1.00 47.81  ? 90  ILE A CD1 1 
ATOM 415   N N   . SER A 1 91  ? -40.458 62.169  6.693   1.00 51.96  ? 91  SER A N   1 
ATOM 416   C CA  . SER A 1 91  ? -39.776 60.890  6.904   1.00 51.38  ? 91  SER A CA  1 
ATOM 417   C C   . SER A 1 91  ? -39.429 60.250  5.549   1.00 51.71  ? 91  SER A C   1 
ATOM 418   O O   . SER A 1 91  ? -40.169 60.412  4.574   1.00 49.28  ? 91  SER A O   1 
ATOM 419   C CB  . SER A 1 91  ? -40.590 59.927  7.767   1.00 55.29  ? 91  SER A CB  1 
ATOM 420   O OG  . SER A 1 91  ? -41.971 60.233  7.754   1.00 70.88  ? 91  SER A OG  1 
ATOM 421   N N   . ILE A 1 92  ? -38.283 59.555  5.499   1.00 46.82  ? 92  ILE A N   1 
ATOM 422   C CA  . ILE A 1 92  ? -37.789 58.855  4.326   1.00 45.81  ? 92  ILE A CA  1 
ATOM 423   C C   . ILE A 1 92  ? -37.814 57.357  4.620   1.00 50.35  ? 92  ILE A C   1 
ATOM 424   O O   . ILE A 1 92  ? -37.478 56.953  5.727   1.00 51.81  ? 92  ILE A O   1 
ATOM 425   C CB  . ILE A 1 92  ? -36.364 59.398  3.954   1.00 48.48  ? 92  ILE A CB  1 
ATOM 426   C CG1 . ILE A 1 92  ? -36.449 60.521  2.911   1.00 49.31  ? 92  ILE A CG1 1 
ATOM 427   C CG2 . ILE A 1 92  ? -35.392 58.315  3.445   1.00 46.45  ? 92  ILE A CG2 1 
ATOM 428   C CD1 . ILE A 1 92  ? -37.136 61.774  3.271   1.00 52.02  ? 92  ILE A CD1 1 
ATOM 429   N N   . GLN A 1 93  ? -38.238 56.541  3.652   1.00 46.11  ? 93  GLN A N   1 
ATOM 430   C CA  . GLN A 1 93  ? -38.200 55.093  3.824   1.00 45.77  ? 93  GLN A CA  1 
ATOM 431   C C   . GLN A 1 93  ? -37.392 54.489  2.694   1.00 48.55  ? 93  GLN A C   1 
ATOM 432   O O   . GLN A 1 93  ? -37.638 54.804  1.524   1.00 49.84  ? 93  GLN A O   1 
ATOM 433   C CB  . GLN A 1 93  ? -39.596 54.448  3.922   1.00 47.28  ? 93  GLN A CB  1 
ATOM 434   C CG  . GLN A 1 93  ? -39.484 52.972  4.300   1.00 62.95  ? 93  GLN A CG  1 
ATOM 435   C CD  . GLN A 1 93  ? -40.785 52.230  4.324   1.00 92.97  ? 93  GLN A CD  1 
ATOM 436   O OE1 . GLN A 1 93  ? -41.220 51.734  5.370   1.00 93.01  ? 93  GLN A OE1 1 
ATOM 437   N NE2 . GLN A 1 93  ? -41.409 52.078  3.166   1.00 87.82  ? 93  GLN A NE2 1 
ATOM 438   N N   . LEU A 1 94  ? -36.417 53.643  3.046   1.00 42.22  ? 94  LEU A N   1 
ATOM 439   C CA  . LEU A 1 94  ? -35.570 52.947  2.083   1.00 41.16  ? 94  LEU A CA  1 
ATOM 440   C C   . LEU A 1 94  ? -36.270 51.666  1.634   1.00 49.71  ? 94  LEU A C   1 
ATOM 441   O O   . LEU A 1 94  ? -37.177 51.190  2.319   1.00 50.11  ? 94  LEU A O   1 
ATOM 442   C CB  . LEU A 1 94  ? -34.179 52.631  2.666   1.00 40.34  ? 94  LEU A CB  1 
ATOM 443   C CG  . LEU A 1 94  ? -33.397 53.723  3.380   1.00 43.31  ? 94  LEU A CG  1 
ATOM 444   C CD1 . LEU A 1 94  ? -32.012 53.270  3.649   1.00 43.51  ? 94  LEU A CD1 1 
ATOM 445   C CD2 . LEU A 1 94  ? -33.325 54.990  2.570   1.00 43.94  ? 94  LEU A CD2 1 
ATOM 446   N N   . ASN A 1 95  ? -35.845 51.091  0.502   1.00 49.79  ? 95  ASN A N   1 
ATOM 447   C CA  . ASN A 1 95  ? -36.463 49.864  -0.016  1.00 50.25  ? 95  ASN A CA  1 
ATOM 448   C C   . ASN A 1 95  ? -36.151 48.614  0.871   1.00 53.90  ? 95  ASN A C   1 
ATOM 449   O O   . ASN A 1 95  ? -36.766 47.560  0.660   1.00 56.26  ? 95  ASN A O   1 
ATOM 450   C CB  . ASN A 1 95  ? -36.088 49.605  -1.502  1.00 48.89  ? 95  ASN A CB  1 
ATOM 451   C CG  . ASN A 1 95  ? -34.641 49.367  -1.798  1.00 71.19  ? 95  ASN A CG  1 
ATOM 452   O OD1 . ASN A 1 95  ? -33.762 49.418  -0.928  1.00 81.04  ? 95  ASN A OD1 1 
ATOM 453   N ND2 . ASN A 1 95  ? -34.364 49.096  -3.050  1.00 59.99  ? 95  ASN A ND2 1 
ATOM 454   N N   . ASP A 1 96  ? -35.258 48.742  1.874   1.00 46.15  ? 96  ASP A N   1 
ATOM 455   C CA  . ASP A 1 96  ? -34.944 47.659  2.805   1.00 45.39  ? 96  ASP A CA  1 
ATOM 456   C C   . ASP A 1 96  ? -35.837 47.730  4.063   1.00 48.73  ? 96  ASP A C   1 
ATOM 457   O O   . ASP A 1 96  ? -35.811 46.820  4.903   1.00 48.20  ? 96  ASP A O   1 
ATOM 458   C CB  . ASP A 1 96  ? -33.453 47.670  3.187   1.00 47.85  ? 96  ASP A CB  1 
ATOM 459   C CG  . ASP A 1 96  ? -32.911 48.896  3.918   1.00 59.46  ? 96  ASP A CG  1 
ATOM 460   O OD1 . ASP A 1 96  ? -33.724 49.782  4.302   1.00 58.48  ? 96  ASP A OD1 1 
ATOM 461   O OD2 . ASP A 1 96  ? -31.677 48.954  4.136   1.00 65.01  ? 96  ASP A OD2 1 
ATOM 462   N N   . GLY A 1 97  ? -36.612 48.812  4.165   1.00 44.53  ? 97  GLY A N   1 
ATOM 463   C CA  . GLY A 1 97  ? -37.530 49.039  5.265   1.00 44.72  ? 97  GLY A CA  1 
ATOM 464   C C   . GLY A 1 97  ? -37.079 50.051  6.292   1.00 50.58  ? 97  GLY A C   1 
ATOM 465   O O   . GLY A 1 97  ? -37.871 50.421  7.155   1.00 51.32  ? 97  GLY A O   1 
ATOM 466   N N   . ARG A 1 98  ? -35.819 50.513  6.218   1.00 47.49  ? 98  ARG A N   1 
ATOM 467   C CA  . ARG A 1 98  ? -35.295 51.497  7.165   1.00 46.98  ? 98  ARG A CA  1 
ATOM 468   C C   . ARG A 1 98  ? -35.954 52.852  6.978   1.00 50.72  ? 98  ARG A C   1 
ATOM 469   O O   . ARG A 1 98  ? -36.107 53.322  5.855   1.00 48.88  ? 98  ARG A O   1 
ATOM 470   C CB  . ARG A 1 98  ? -33.781 51.639  7.050   1.00 45.69  ? 98  ARG A CB  1 
ATOM 471   C CG  . ARG A 1 98  ? -33.026 50.465  7.611   1.00 41.09  ? 98  ARG A CG  1 
ATOM 472   C CD  . ARG A 1 98  ? -31.547 50.717  7.672   1.00 50.79  ? 98  ARG A CD  1 
ATOM 473   N NE  . ARG A 1 98  ? -30.929 50.733  6.347   1.00 63.29  ? 98  ARG A NE  1 
ATOM 474   C CZ  . ARG A 1 98  ? -29.889 51.492  6.024   1.00 75.21  ? 98  ARG A CZ  1 
ATOM 475   N NH1 . ARG A 1 98  ? -29.351 52.307  6.920   1.00 63.54  ? 98  ARG A NH1 1 
ATOM 476   N NH2 . ARG A 1 98  ? -29.380 51.441  4.802   1.00 57.09  ? 98  ARG A NH2 1 
ATOM 477   N N   . GLU A 1 99  ? -36.340 53.457  8.098   1.00 49.97  ? 99  GLU A N   1 
ATOM 478   C CA  . GLU A 1 99  ? -36.997 54.763  8.183   1.00 51.06  ? 99  GLU A CA  1 
ATOM 479   C C   . GLU A 1 99  ? -36.070 55.776  8.835   1.00 54.34  ? 99  GLU A C   1 
ATOM 480   O O   . GLU A 1 99  ? -35.356 55.446  9.796   1.00 55.53  ? 99  GLU A O   1 
ATOM 481   C CB  . GLU A 1 99  ? -38.317 54.665  8.979   1.00 53.07  ? 99  GLU A CB  1 
ATOM 482   C CG  . GLU A 1 99  ? -39.450 53.949  8.259   1.00 67.81  ? 99  GLU A CG  1 
ATOM 483   C CD  . GLU A 1 99  ? -40.469 53.242  9.139   1.00 96.32  ? 99  GLU A CD  1 
ATOM 484   O OE1 . GLU A 1 99  ? -40.692 53.684  10.292  1.00 90.92  ? 99  GLU A OE1 1 
ATOM 485   O OE2 . GLU A 1 99  ? -41.037 52.227  8.669   1.00 92.19  ? 99  GLU A OE2 1 
ATOM 486   N N   . PHE A 1 100 ? -36.087 57.003  8.318   1.00 47.87  ? 100 PHE A N   1 
ATOM 487   C CA  . PHE A 1 100 ? -35.270 58.124  8.784   1.00 45.22  ? 100 PHE A CA  1 
ATOM 488   C C   . PHE A 1 100 ? -36.071 59.391  8.826   1.00 53.85  ? 100 PHE A C   1 
ATOM 489   O O   . PHE A 1 100 ? -36.980 59.573  8.016   1.00 54.01  ? 100 PHE A O   1 
ATOM 490   C CB  . PHE A 1 100 ? -34.088 58.361  7.834   1.00 44.77  ? 100 PHE A CB  1 
ATOM 491   C CG  . PHE A 1 100 ? -33.054 57.275  7.753   1.00 45.21  ? 100 PHE A CG  1 
ATOM 492   C CD1 . PHE A 1 100 ? -33.169 56.249  6.823   1.00 47.85  ? 100 PHE A CD1 1 
ATOM 493   C CD2 . PHE A 1 100 ? -31.929 57.302  8.571   1.00 45.42  ? 100 PHE A CD2 1 
ATOM 494   C CE1 . PHE A 1 100 ? -32.202 55.246  6.749   1.00 48.10  ? 100 PHE A CE1 1 
ATOM 495   C CE2 . PHE A 1 100 ? -30.953 56.311  8.477   1.00 46.95  ? 100 PHE A CE2 1 
ATOM 496   C CZ  . PHE A 1 100 ? -31.094 55.290  7.569   1.00 45.12  ? 100 PHE A CZ  1 
ATOM 497   N N   . ASP A 1 101 ? -35.684 60.320  9.698   1.00 52.71  ? 101 ASP A N   1 
ATOM 498   C CA  . ASP A 1 101 ? -36.289 61.635  9.701   1.00 52.53  ? 101 ASP A CA  1 
ATOM 499   C C   . ASP A 1 101 ? -35.530 62.504  8.719   1.00 51.96  ? 101 ASP A C   1 
ATOM 500   O O   . ASP A 1 101 ? -34.384 62.197  8.367   1.00 49.10  ? 101 ASP A O   1 
ATOM 501   C CB  . ASP A 1 101 ? -36.341 62.250  11.100  1.00 55.89  ? 101 ASP A CB  1 
ATOM 502   C CG  . ASP A 1 101 ? -37.745 62.206  11.630  1.00 82.24  ? 101 ASP A CG  1 
ATOM 503   O OD1 . ASP A 1 101 ? -38.558 63.087  11.236  1.00 86.49  ? 101 ASP A OD1 1 
ATOM 504   O OD2 . ASP A 1 101 ? -38.079 61.223  12.338  1.00 92.01  ? 101 ASP A OD2 1 
ATOM 505   N N   . ALA A 1 102 ? -36.197 63.537  8.206   1.00 48.09  ? 102 ALA A N   1 
ATOM 506   C CA  . ALA A 1 102 ? -35.561 64.424  7.239   1.00 47.91  ? 102 ALA A CA  1 
ATOM 507   C C   . ALA A 1 102 ? -35.936 65.872  7.504   1.00 52.03  ? 102 ALA A C   1 
ATOM 508   O O   . ALA A 1 102 ? -37.036 66.157  7.977   1.00 50.96  ? 102 ALA A O   1 
ATOM 509   C CB  . ALA A 1 102 ? -35.942 64.032  5.816   1.00 48.17  ? 102 ALA A CB  1 
ATOM 510   N N   . LYS A 1 103 ? -35.013 66.781  7.188   1.00 48.78  ? 103 LYS A N   1 
ATOM 511   C CA  . LYS A 1 103 ? -35.220 68.212  7.333   1.00 48.44  ? 103 LYS A CA  1 
ATOM 512   C C   . LYS A 1 103 ? -35.070 68.872  5.973   1.00 53.13  ? 103 LYS A C   1 
ATOM 513   O O   . LYS A 1 103 ? -34.227 68.458  5.171   1.00 53.52  ? 103 LYS A O   1 
ATOM 514   C CB  . LYS A 1 103 ? -34.228 68.815  8.350   1.00 50.77  ? 103 LYS A CB  1 
ATOM 515   C CG  . LYS A 1 103 ? -34.591 68.544  9.805   1.00 65.83  ? 103 LYS A CG  1 
ATOM 516   C CD  . LYS A 1 103 ? -33.547 69.121  10.756  1.00 76.69  ? 103 LYS A CD  1 
ATOM 517   C CE  . LYS A 1 103 ? -33.887 68.871  12.208  1.00 84.48  ? 103 LYS A CE  1 
ATOM 518   N NZ  . LYS A 1 103 ? -32.873 69.459  13.116  1.00 93.74  ? 103 LYS A NZ  1 
ATOM 519   N N   . LEU A 1 104 ? -35.882 69.898  5.713   1.00 49.18  ? 104 LEU A N   1 
ATOM 520   C CA  . LEU A 1 104 ? -35.806 70.649  4.472   1.00 48.12  ? 104 LEU A CA  1 
ATOM 521   C C   . LEU A 1 104 ? -34.580 71.551  4.478   1.00 51.63  ? 104 LEU A C   1 
ATOM 522   O O   . LEU A 1 104 ? -34.454 72.393  5.359   1.00 51.73  ? 104 LEU A O   1 
ATOM 523   C CB  . LEU A 1 104 ? -37.088 71.466  4.258   1.00 47.58  ? 104 LEU A CB  1 
ATOM 524   C CG  . LEU A 1 104 ? -37.154 72.308  2.978   1.00 51.00  ? 104 LEU A CG  1 
ATOM 525   C CD1 . LEU A 1 104 ? -37.150 71.437  1.725   1.00 50.99  ? 104 LEU A CD1 1 
ATOM 526   C CD2 . LEU A 1 104 ? -38.363 73.208  2.998   1.00 50.67  ? 104 LEU A CD2 1 
ATOM 527   N N   . ILE A 1 105 ? -33.664 71.343  3.523   1.00 48.72  ? 105 ILE A N   1 
ATOM 528   C CA  . ILE A 1 105 ? -32.458 72.165  3.375   1.00 48.96  ? 105 ILE A CA  1 
ATOM 529   C C   . ILE A 1 105 ? -32.836 73.456  2.611   1.00 53.69  ? 105 ILE A C   1 
ATOM 530   O O   . ILE A 1 105 ? -32.471 74.557  3.018   1.00 56.03  ? 105 ILE A O   1 
ATOM 531   C CB  . ILE A 1 105 ? -31.304 71.376  2.688   1.00 51.96  ? 105 ILE A CB  1 
ATOM 532   C CG1 . ILE A 1 105 ? -30.756 70.247  3.585   1.00 51.78  ? 105 ILE A CG1 1 
ATOM 533   C CG2 . ILE A 1 105 ? -30.177 72.289  2.193   1.00 53.26  ? 105 ILE A CG2 1 
ATOM 534   C CD1 . ILE A 1 105 ? -30.508 70.608  5.097   1.00 58.51  ? 105 ILE A CD1 1 
ATOM 535   N N   . GLY A 1 106 ? -33.585 73.294  1.537   1.00 47.33  ? 106 GLY A N   1 
ATOM 536   C CA  . GLY A 1 106 ? -34.034 74.387  0.700   1.00 46.26  ? 106 GLY A CA  1 
ATOM 537   C C   . GLY A 1 106 ? -34.932 73.892  -0.402  1.00 50.65  ? 106 GLY A C   1 
ATOM 538   O O   . GLY A 1 106 ? -35.024 72.688  -0.634  1.00 49.45  ? 106 GLY A O   1 
ATOM 539   N N   . SER A 1 107 ? -35.604 74.825  -1.085  1.00 50.06  ? 107 SER A N   1 
ATOM 540   C CA  . SER A 1 107 ? -36.517 74.523  -2.176  1.00 50.66  ? 107 SER A CA  1 
ATOM 541   C C   . SER A 1 107 ? -36.597 75.672  -3.179  1.00 57.33  ? 107 SER A C   1 
ATOM 542   O O   . SER A 1 107 ? -36.207 76.797  -2.872  1.00 57.50  ? 107 SER A O   1 
ATOM 543   C CB  . SER A 1 107 ? -37.903 74.208  -1.625  1.00 53.99  ? 107 SER A CB  1 
ATOM 544   O OG  . SER A 1 107 ? -38.475 75.338  -0.985  1.00 63.33  ? 107 SER A OG  1 
ATOM 545   N N   . ASP A 1 108 ? -37.080 75.368  -4.389  1.00 55.96  ? 108 ASP A N   1 
ATOM 546   C CA  . ASP A 1 108 ? -37.348 76.318  -5.463  1.00 55.87  ? 108 ASP A CA  1 
ATOM 547   C C   . ASP A 1 108 ? -38.759 76.077  -5.974  1.00 60.67  ? 108 ASP A C   1 
ATOM 548   O O   . ASP A 1 108 ? -39.023 75.040  -6.575  1.00 60.36  ? 108 ASP A O   1 
ATOM 549   C CB  . ASP A 1 108 ? -36.313 76.221  -6.602  1.00 57.44  ? 108 ASP A CB  1 
ATOM 550   C CG  . ASP A 1 108 ? -36.512 77.225  -7.737  1.00 67.28  ? 108 ASP A CG  1 
ATOM 551   O OD1 . ASP A 1 108 ? -37.289 78.207  -7.554  1.00 67.31  ? 108 ASP A OD1 1 
ATOM 552   O OD2 . ASP A 1 108 ? -35.868 77.056  -8.790  1.00 72.41  ? 108 ASP A OD2 1 
ATOM 553   N N   . ASP A 1 109 ? -39.661 77.030  -5.710  1.00 59.06  ? 109 ASP A N   1 
ATOM 554   C CA  . ASP A 1 109 ? -41.070 77.026  -6.122  1.00 59.34  ? 109 ASP A CA  1 
ATOM 555   C C   . ASP A 1 109 ? -41.214 77.040  -7.641  1.00 61.07  ? 109 ASP A C   1 
ATOM 556   O O   . ASP A 1 109 ? -42.086 76.358  -8.170  1.00 60.83  ? 109 ASP A O   1 
ATOM 557   C CB  . ASP A 1 109 ? -41.810 78.272  -5.580  1.00 62.81  ? 109 ASP A CB  1 
ATOM 558   C CG  . ASP A 1 109 ? -41.536 78.744  -4.158  1.00 87.20  ? 109 ASP A CG  1 
ATOM 559   O OD1 . ASP A 1 109 ? -42.377 79.498  -3.618  1.00 89.69  ? 109 ASP A OD1 1 
ATOM 560   O OD2 . ASP A 1 109 ? -40.427 78.458  -3.626  1.00 98.25  ? 109 ASP A OD2 1 
ATOM 561   N N   . GLN A 1 110 ? -40.387 77.851  -8.330  1.00 56.46  ? 110 GLN A N   1 
ATOM 562   C CA  . GLN A 1 110 ? -40.437 78.058  -9.776  1.00 56.23  ? 110 GLN A CA  1 
ATOM 563   C C   . GLN A 1 110 ? -40.082 76.810  -10.595 1.00 59.55  ? 110 GLN A C   1 
ATOM 564   O O   . GLN A 1 110 ? -40.738 76.542  -11.609 1.00 58.11  ? 110 GLN A O   1 
ATOM 565   C CB  . GLN A 1 110 ? -39.518 79.212  -10.174 1.00 57.86  ? 110 GLN A CB  1 
ATOM 566   C CG  . GLN A 1 110 ? -40.079 80.587  -9.853  1.00 79.66  ? 110 GLN A CG  1 
ATOM 567   C CD  . GLN A 1 110 ? -39.173 81.663  -10.409 1.00 110.93 ? 110 GLN A CD  1 
ATOM 568   O OE1 . GLN A 1 110 ? -39.180 81.964  -11.615 1.00 104.65 ? 110 GLN A OE1 1 
ATOM 569   N NE2 . GLN A 1 110 ? -38.351 82.250  -9.542  1.00 108.00 ? 110 GLN A NE2 1 
ATOM 570   N N   . SER A 1 111 ? -39.047 76.064  -10.185 1.00 56.67  ? 111 SER A N   1 
ATOM 571   C CA  . SER A 1 111 ? -38.639 74.868  -10.921 1.00 56.27  ? 111 SER A CA  1 
ATOM 572   C C   . SER A 1 111 ? -39.228 73.571  -10.310 1.00 58.14  ? 111 SER A C   1 
ATOM 573   O O   . SER A 1 111 ? -39.223 72.548  -10.988 1.00 57.98  ? 111 SER A O   1 
ATOM 574   C CB  . SER A 1 111 ? -37.122 74.783  -10.988 1.00 60.01  ? 111 SER A CB  1 
ATOM 575   O OG  . SER A 1 111 ? -36.597 74.721  -9.675  1.00 66.70  ? 111 SER A OG  1 
ATOM 576   N N   . ASP A 1 112 ? -39.764 73.632  -9.061  1.00 52.09  ? 112 ASP A N   1 
ATOM 577   C CA  . ASP A 1 112 ? -40.369 72.531  -8.283  1.00 50.51  ? 112 ASP A CA  1 
ATOM 578   C C   . ASP A 1 112 ? -39.299 71.512  -7.778  1.00 51.71  ? 112 ASP A C   1 
ATOM 579   O O   . ASP A 1 112 ? -39.507 70.298  -7.797  1.00 48.48  ? 112 ASP A O   1 
ATOM 580   C CB  . ASP A 1 112 ? -41.486 71.819  -9.070  1.00 51.98  ? 112 ASP A CB  1 
ATOM 581   C CG  . ASP A 1 112 ? -42.534 71.056  -8.262  1.00 52.98  ? 112 ASP A CG  1 
ATOM 582   O OD1 . ASP A 1 112 ? -42.428 71.030  -7.017  1.00 51.57  ? 112 ASP A OD1 1 
ATOM 583   O OD2 . ASP A 1 112 ? -43.461 70.495  -8.878  1.00 55.44  ? 112 ASP A OD2 1 
ATOM 584   N N   . ILE A 1 113 ? -38.165 72.026  -7.289  1.00 49.04  ? 113 ILE A N   1 
ATOM 585   C CA  . ILE A 1 113 ? -37.129 71.172  -6.732  1.00 48.36  ? 113 ILE A CA  1 
ATOM 586   C C   . ILE A 1 113 ? -36.940 71.520  -5.260  1.00 53.25  ? 113 ILE A C   1 
ATOM 587   O O   . ILE A 1 113 ? -36.965 72.690  -4.883  1.00 54.16  ? 113 ILE A O   1 
ATOM 588   C CB  . ILE A 1 113 ? -35.831 71.252  -7.555  1.00 50.82  ? 113 ILE A CB  1 
ATOM 589   C CG1 . ILE A 1 113 ? -35.854 70.117  -8.569  1.00 51.51  ? 113 ILE A CG1 1 
ATOM 590   C CG2 . ILE A 1 113 ? -34.553 71.164  -6.666  1.00 49.64  ? 113 ILE A CG2 1 
ATOM 591   C CD1 . ILE A 1 113 ? -35.273 70.454  -9.774  1.00 62.33  ? 113 ILE A CD1 1 
ATOM 592   N N   . ALA A 1 114 ? -36.811 70.486  -4.431  1.00 47.96  ? 114 ALA A N   1 
ATOM 593   C CA  . ALA A 1 114 ? -36.571 70.606  -2.996  1.00 46.32  ? 114 ALA A CA  1 
ATOM 594   C C   . ALA A 1 114 ? -35.429 69.701  -2.629  1.00 51.39  ? 114 ALA A C   1 
ATOM 595   O O   . ALA A 1 114 ? -35.232 68.656  -3.264  1.00 49.55  ? 114 ALA A O   1 
ATOM 596   C CB  . ALA A 1 114 ? -37.819 70.237  -2.207  1.00 46.23  ? 114 ALA A CB  1 
ATOM 597   N N   . LEU A 1 115 ? -34.641 70.111  -1.628  1.00 49.84  ? 115 LEU A N   1 
ATOM 598   C CA  . LEU A 1 115 ? -33.537 69.291  -1.150  1.00 49.30  ? 115 LEU A CA  1 
ATOM 599   C C   . LEU A 1 115 ? -33.727 69.021  0.324   1.00 49.87  ? 115 LEU A C   1 
ATOM 600   O O   . LEU A 1 115 ? -33.994 69.932  1.114   1.00 49.03  ? 115 LEU A O   1 
ATOM 601   C CB  . LEU A 1 115 ? -32.175 69.912  -1.438  1.00 49.53  ? 115 LEU A CB  1 
ATOM 602   C CG  . LEU A 1 115 ? -30.988 69.045  -1.050  1.00 54.14  ? 115 LEU A CG  1 
ATOM 603   C CD1 . LEU A 1 115 ? -30.615 68.079  -2.168  1.00 54.36  ? 115 LEU A CD1 1 
ATOM 604   C CD2 . LEU A 1 115 ? -29.840 69.898  -0.661  1.00 56.85  ? 115 LEU A CD2 1 
ATOM 605   N N   . LEU A 1 116 ? -33.638 67.738  0.659   1.00 44.17  ? 116 LEU A N   1 
ATOM 606   C CA  . LEU A 1 116 ? -33.798 67.230  2.012   1.00 42.32  ? 116 LEU A CA  1 
ATOM 607   C C   . LEU A 1 116 ? -32.498 66.699  2.557   1.00 47.71  ? 116 LEU A C   1 
ATOM 608   O O   . LEU A 1 116 ? -31.630 66.251  1.788   1.00 46.38  ? 116 LEU A O   1 
ATOM 609   C CB  . LEU A 1 116 ? -34.823 66.077  2.037   1.00 41.07  ? 116 LEU A CB  1 
ATOM 610   C CG  . LEU A 1 116 ? -36.218 66.302  1.489   1.00 43.53  ? 116 LEU A CG  1 
ATOM 611   C CD1 . LEU A 1 116 ? -36.934 64.989  1.351   1.00 42.21  ? 116 LEU A CD1 1 
ATOM 612   C CD2 . LEU A 1 116 ? -37.014 67.252  2.349   1.00 43.17  ? 116 LEU A CD2 1 
ATOM 613   N N   . GLN A 1 117 ? -32.385 66.680  3.898   1.00 45.51  ? 117 GLN A N   1 
ATOM 614   C CA  . GLN A 1 117 ? -31.260 66.038  4.538   1.00 45.50  ? 117 GLN A CA  1 
ATOM 615   C C   . GLN A 1 117 ? -31.770 65.032  5.537   1.00 51.17  ? 117 GLN A C   1 
ATOM 616   O O   . GLN A 1 117 ? -32.553 65.384  6.436   1.00 52.96  ? 117 GLN A O   1 
ATOM 617   C CB  . GLN A 1 117 ? -30.315 67.021  5.193   1.00 46.51  ? 117 GLN A CB  1 
ATOM 618   C CG  . GLN A 1 117 ? -29.053 66.353  5.725   1.00 51.54  ? 117 GLN A CG  1 
ATOM 619   C CD  . GLN A 1 117 ? -27.998 67.333  6.119   1.00 63.51  ? 117 GLN A CD  1 
ATOM 620   O OE1 . GLN A 1 117 ? -28.290 68.409  6.667   1.00 58.45  ? 117 GLN A OE1 1 
ATOM 621   N NE2 . GLN A 1 117 ? -26.742 66.957  5.869   1.00 53.99  ? 117 GLN A NE2 1 
ATOM 622   N N   . ILE A 1 118 ? -31.343 63.769  5.357   1.00 45.95  ? 118 ILE A N   1 
ATOM 623   C CA  . ILE A 1 118 ? -31.668 62.675  6.261   1.00 45.23  ? 118 ILE A CA  1 
ATOM 624   C C   . ILE A 1 118 ? -30.949 62.931  7.591   1.00 48.55  ? 118 ILE A C   1 
ATOM 625   O O   . ILE A 1 118 ? -29.758 63.228  7.594   1.00 45.09  ? 118 ILE A O   1 
ATOM 626   C CB  . ILE A 1 118 ? -31.279 61.308  5.635   1.00 47.51  ? 118 ILE A CB  1 
ATOM 627   C CG1 . ILE A 1 118 ? -32.230 60.924  4.488   1.00 48.09  ? 118 ILE A CG1 1 
ATOM 628   C CG2 . ILE A 1 118 ? -31.186 60.192  6.685   1.00 45.05  ? 118 ILE A CG2 1 
ATOM 629   C CD1 . ILE A 1 118 ? -31.666 59.822  3.530   1.00 47.97  ? 118 ILE A CD1 1 
ATOM 630   N N   . GLN A 1 119 ? -31.691 62.828  8.705   1.00 48.78  ? 119 GLN A N   1 
ATOM 631   C CA  . GLN A 1 119 ? -31.165 62.973  10.068  1.00 49.12  ? 119 GLN A CA  1 
ATOM 632   C C   . GLN A 1 119 ? -30.564 61.642  10.477  1.00 54.56  ? 119 GLN A C   1 
ATOM 633   O O   . GLN A 1 119 ? -31.235 60.595  10.439  1.00 54.54  ? 119 GLN A O   1 
ATOM 634   C CB  . GLN A 1 119 ? -32.256 63.444  11.058  1.00 50.25  ? 119 GLN A CB  1 
ATOM 635   C CG  . GLN A 1 119 ? -32.910 64.770  10.677  1.00 67.51  ? 119 GLN A CG  1 
ATOM 636   C CD  . GLN A 1 119 ? -31.908 65.891  10.521  1.00 85.60  ? 119 GLN A CD  1 
ATOM 637   O OE1 . GLN A 1 119 ? -31.384 66.429  11.499  1.00 85.64  ? 119 GLN A OE1 1 
ATOM 638   N NE2 . GLN A 1 119 ? -31.625 66.270  9.285   1.00 73.12  ? 119 GLN A NE2 1 
ATOM 639   N N   . ASN A 1 120 ? -29.275 61.689  10.831  1.00 52.09  ? 120 ASN A N   1 
ATOM 640   C CA  . ASN A 1 120 ? -28.434 60.552  11.222  1.00 52.28  ? 120 ASN A CA  1 
ATOM 641   C C   . ASN A 1 120 ? -28.419 59.503  10.094  1.00 55.16  ? 120 ASN A C   1 
ATOM 642   O O   . ASN A 1 120 ? -28.855 58.365  10.321  1.00 55.41  ? 120 ASN A O   1 
ATOM 643   C CB  . ASN A 1 120 ? -28.838 59.947  12.594  1.00 54.70  ? 120 ASN A CB  1 
ATOM 644   C CG  . ASN A 1 120 ? -28.818 60.966  13.729  1.00 87.57  ? 120 ASN A CG  1 
ATOM 645   O OD1 . ASN A 1 120 ? -29.858 61.281  14.317  1.00 86.13  ? 120 ASN A OD1 1 
ATOM 646   N ND2 . ASN A 1 120 ? -27.654 61.558  14.031  1.00 76.03  ? 120 ASN A ND2 1 
ATOM 647   N N   . PRO A 1 121 ? -27.912 59.872  8.870   1.00 48.97  ? 121 PRO A N   1 
ATOM 648   C CA  . PRO A 1 121 ? -27.835 58.882  7.780   1.00 48.40  ? 121 PRO A CA  1 
ATOM 649   C C   . PRO A 1 121 ? -26.838 57.774  8.098   1.00 52.00  ? 121 PRO A C   1 
ATOM 650   O O   . PRO A 1 121 ? -25.895 57.996  8.844   1.00 52.81  ? 121 PRO A O   1 
ATOM 651   C CB  . PRO A 1 121 ? -27.376 59.715  6.577   1.00 50.13  ? 121 PRO A CB  1 
ATOM 652   C CG  . PRO A 1 121 ? -26.673 60.869  7.149   1.00 53.19  ? 121 PRO A CG  1 
ATOM 653   C CD  . PRO A 1 121 ? -27.341 61.170  8.445   1.00 48.28  ? 121 PRO A CD  1 
ATOM 654   N N   . SER A 1 122 ? -27.059 56.581  7.550   1.00 48.61  ? 122 SER A N   1 
ATOM 655   C CA  . SER A 1 122 ? -26.215 55.405  7.791   1.00 46.89  ? 122 SER A CA  1 
ATOM 656   C C   . SER A 1 122 ? -26.408 54.395  6.657   1.00 47.54  ? 122 SER A C   1 
ATOM 657   O O   . SER A 1 122 ? -27.543 54.135  6.273   1.00 47.27  ? 122 SER A O   1 
ATOM 658   C CB  . SER A 1 122 ? -26.571 54.786  9.152   1.00 48.98  ? 122 SER A CB  1 
ATOM 659   O OG  . SER A 1 122 ? -26.234 53.417  9.306   1.00 58.82  ? 122 SER A OG  1 
ATOM 660   N N   . LYS A 1 123 ? -25.301 53.834  6.132   1.00 42.62  ? 123 LYS A N   1 
ATOM 661   C CA  . LYS A 1 123 ? -25.245 52.801  5.089   1.00 42.20  ? 123 LYS A CA  1 
ATOM 662   C C   . LYS A 1 123 ? -26.249 53.091  3.919   1.00 45.12  ? 123 LYS A C   1 
ATOM 663   O O   . LYS A 1 123 ? -27.070 52.251  3.552   1.00 43.35  ? 123 LYS A O   1 
ATOM 664   C CB  . LYS A 1 123 ? -25.504 51.415  5.714   1.00 45.41  ? 123 LYS A CB  1 
ATOM 665   C CG  . LYS A 1 123 ? -24.415 50.904  6.651   1.00 52.05  ? 123 LYS A CG  1 
ATOM 666   C CD  . LYS A 1 123 ? -24.890 49.651  7.348   1.00 69.61  ? 123 LYS A CD  1 
ATOM 667   C CE  . LYS A 1 123 ? -23.826 48.935  8.157   1.00 75.93  ? 123 LYS A CE  1 
ATOM 668   N NZ  . LYS A 1 123 ? -24.322 47.618  8.676   1.00 71.69  ? 123 LYS A NZ  1 
ATOM 669   N N   . LEU A 1 124 ? -26.155 54.300  3.356   1.00 40.78  ? 124 LEU A N   1 
ATOM 670   C CA  . LEU A 1 124 ? -26.965 54.806  2.258   1.00 39.38  ? 124 LEU A CA  1 
ATOM 671   C C   . LEU A 1 124 ? -26.263 54.562  0.919   1.00 46.78  ? 124 LEU A C   1 
ATOM 672   O O   . LEU A 1 124 ? -25.036 54.446  0.881   1.00 47.90  ? 124 LEU A O   1 
ATOM 673   C CB  . LEU A 1 124 ? -27.155 56.305  2.477   1.00 38.39  ? 124 LEU A CB  1 
ATOM 674   C CG  . LEU A 1 124 ? -28.472 56.845  3.026   1.00 41.52  ? 124 LEU A CG  1 
ATOM 675   C CD1 . LEU A 1 124 ? -29.107 55.972  4.131   1.00 40.91  ? 124 LEU A CD1 1 
ATOM 676   C CD2 . LEU A 1 124 ? -28.306 58.262  3.468   1.00 39.10  ? 124 LEU A CD2 1 
ATOM 677   N N   . THR A 1 125 ? -27.041 54.474  -0.180  1.00 42.92  ? 125 THR A N   1 
ATOM 678   C CA  . THR A 1 125 ? -26.570 54.275  -1.545  1.00 41.72  ? 125 THR A CA  1 
ATOM 679   C C   . THR A 1 125 ? -26.951 55.528  -2.322  1.00 48.35  ? 125 THR A C   1 
ATOM 680   O O   . THR A 1 125 ? -28.090 55.987  -2.229  1.00 50.49  ? 125 THR A O   1 
ATOM 681   C CB  . THR A 1 125 ? -27.178 52.989  -2.108  1.00 48.50  ? 125 THR A CB  1 
ATOM 682   O OG1 . THR A 1 125 ? -26.684 51.892  -1.344  1.00 50.00  ? 125 THR A OG1 1 
ATOM 683   C CG2 . THR A 1 125 ? -26.856 52.760  -3.595  1.00 46.66  ? 125 THR A CG2 1 
ATOM 684   N N   . GLN A 1 126 ? -26.014 56.116  -3.040  1.00 44.49  ? 126 GLN A N   1 
ATOM 685   C CA  . GLN A 1 126 ? -26.337 57.324  -3.792  1.00 45.01  ? 126 GLN A CA  1 
ATOM 686   C C   . GLN A 1 126 ? -26.403 57.028  -5.269  1.00 52.13  ? 126 GLN A C   1 
ATOM 687   O O   . GLN A 1 126 ? -25.894 56.008  -5.748  1.00 54.66  ? 126 GLN A O   1 
ATOM 688   C CB  . GLN A 1 126 ? -25.361 58.475  -3.511  1.00 45.91  ? 126 GLN A CB  1 
ATOM 689   C CG  . GLN A 1 126 ? -23.914 58.166  -3.819  1.00 41.48  ? 126 GLN A CG  1 
ATOM 690   C CD  . GLN A 1 126 ? -23.088 59.412  -3.753  1.00 61.99  ? 126 GLN A CD  1 
ATOM 691   O OE1 . GLN A 1 126 ? -22.570 59.873  -4.765  1.00 63.28  ? 126 GLN A OE1 1 
ATOM 692   N NE2 . GLN A 1 126 ? -22.948 59.991  -2.563  1.00 56.79  ? 126 GLN A NE2 1 
ATOM 693   N N   . ILE A 1 127 ? -27.058 57.910  -5.986  1.00 47.92  ? 127 ILE A N   1 
ATOM 694   C CA  . ILE A 1 127 ? -27.251 57.754  -7.409  1.00 46.79  ? 127 ILE A CA  1 
ATOM 695   C C   . ILE A 1 127 ? -26.150 58.473  -8.186  1.00 51.13  ? 127 ILE A C   1 
ATOM 696   O O   . ILE A 1 127 ? -25.650 59.521  -7.754  1.00 53.94  ? 127 ILE A O   1 
ATOM 697   C CB  . ILE A 1 127 ? -28.676 58.292  -7.751  1.00 48.62  ? 127 ILE A CB  1 
ATOM 698   C CG1 . ILE A 1 127 ? -29.656 57.204  -8.306  1.00 49.02  ? 127 ILE A CG1 1 
ATOM 699   C CG2 . ILE A 1 127 ? -28.745 59.668  -8.444  1.00 45.72  ? 127 ILE A CG2 1 
ATOM 700   C CD1 . ILE A 1 127 ? -29.286 56.420  -9.344  1.00 54.61  ? 127 ILE A CD1 1 
ATOM 701   N N   . ALA A 1 128 ? -25.797 57.906  -9.345  1.00 44.56  ? 128 ALA A N   1 
ATOM 702   C CA  . ALA A 1 128 ? -24.912 58.524  -10.319 1.00 42.45  ? 128 ALA A CA  1 
ATOM 703   C C   . ALA A 1 128 ? -25.795 59.421  -11.182 1.00 44.74  ? 128 ALA A C   1 
ATOM 704   O O   . ALA A 1 128 ? -26.937 59.047  -11.502 1.00 43.11  ? 128 ALA A O   1 
ATOM 705   C CB  . ALA A 1 128 ? -24.206 57.467  -11.152 1.00 42.56  ? 128 ALA A CB  1 
ATOM 706   N N   . ILE A 1 129 ? -25.313 60.616  -11.520 1.00 41.30  ? 129 ILE A N   1 
ATOM 707   C CA  . ILE A 1 129 ? -26.103 61.551  -12.336 1.00 39.48  ? 129 ILE A CA  1 
ATOM 708   C C   . ILE A 1 129 ? -25.512 61.599  -13.745 1.00 44.40  ? 129 ILE A C   1 
ATOM 709   O O   . ILE A 1 129 ? -24.309 61.765  -13.903 1.00 45.56  ? 129 ILE A O   1 
ATOM 710   C CB  . ILE A 1 129 ? -26.211 62.956  -11.662 1.00 40.54  ? 129 ILE A CB  1 
ATOM 711   C CG1 . ILE A 1 129 ? -26.799 62.825  -10.246 1.00 38.62  ? 129 ILE A CG1 1 
ATOM 712   C CG2 . ILE A 1 129 ? -27.001 63.942  -12.518 1.00 39.79  ? 129 ILE A CG2 1 
ATOM 713   C CD1 . ILE A 1 129 ? -26.673 63.995  -9.407  1.00 41.09  ? 129 ILE A CD1 1 
ATOM 714   N N   . ALA A 1 130 ? -26.364 61.409  -14.758 1.00 41.33  ? 130 ALA A N   1 
ATOM 715   C CA  . ALA A 1 130 ? -26.010 61.467  -16.175 1.00 41.32  ? 130 ALA A CA  1 
ATOM 716   C C   . ALA A 1 130 ? -26.179 62.892  -16.727 1.00 47.91  ? 130 ALA A C   1 
ATOM 717   O O   . ALA A 1 130 ? -26.870 63.728  -16.115 1.00 46.63  ? 130 ALA A O   1 
ATOM 718   C CB  . ALA A 1 130 ? -26.901 60.509  -16.959 1.00 41.96  ? 130 ALA A CB  1 
ATOM 719   N N   . ASP A 1 131 ? -25.566 63.156  -17.905 1.00 45.60  ? 131 ASP A N   1 
ATOM 720   C CA  . ASP A 1 131 ? -25.706 64.426  -18.604 1.00 44.96  ? 131 ASP A CA  1 
ATOM 721   C C   . ASP A 1 131 ? -27.009 64.357  -19.417 1.00 50.17  ? 131 ASP A C   1 
ATOM 722   O O   . ASP A 1 131 ? -27.068 63.674  -20.451 1.00 48.67  ? 131 ASP A O   1 
ATOM 723   C CB  . ASP A 1 131 ? -24.472 64.713  -19.481 1.00 46.25  ? 131 ASP A CB  1 
ATOM 724   C CG  . ASP A 1 131 ? -24.450 66.062  -20.205 1.00 57.81  ? 131 ASP A CG  1 
ATOM 725   O OD1 . ASP A 1 131 ? -23.461 66.332  -20.920 1.00 62.60  ? 131 ASP A OD1 1 
ATOM 726   O OD2 . ASP A 1 131 ? -25.434 66.836  -20.078 1.00 51.43  ? 131 ASP A OD2 1 
ATOM 727   N N   . SER A 1 132 ? -28.054 65.068  -18.931 1.00 48.29  ? 132 SER A N   1 
ATOM 728   C CA  . SER A 1 132 ? -29.372 65.092  -19.555 1.00 48.62  ? 132 SER A CA  1 
ATOM 729   C C   . SER A 1 132 ? -29.348 65.809  -20.923 1.00 50.81  ? 132 SER A C   1 
ATOM 730   O O   . SER A 1 132 ? -30.228 65.561  -21.761 1.00 50.18  ? 132 SER A O   1 
ATOM 731   C CB  . SER A 1 132 ? -30.404 65.719  -18.618 1.00 53.99  ? 132 SER A CB  1 
ATOM 732   O OG  . SER A 1 132 ? -30.093 67.064  -18.296 1.00 67.15  ? 132 SER A OG  1 
ATOM 733   N N   . ASP A 1 133 ? -28.322 66.634  -21.177 1.00 46.66  ? 133 ASP A N   1 
ATOM 734   C CA  . ASP A 1 133 ? -28.187 67.309  -22.472 1.00 47.07  ? 133 ASP A CA  1 
ATOM 735   C C   . ASP A 1 133 ? -27.755 66.325  -23.570 1.00 48.34  ? 133 ASP A C   1 
ATOM 736   O O   . ASP A 1 133 ? -27.924 66.633  -24.745 1.00 47.10  ? 133 ASP A O   1 
ATOM 737   C CB  . ASP A 1 133 ? -27.202 68.494  -22.387 1.00 50.08  ? 133 ASP A CB  1 
ATOM 738   C CG  . ASP A 1 133 ? -27.731 69.698  -21.626 1.00 66.38  ? 133 ASP A CG  1 
ATOM 739   O OD1 . ASP A 1 133 ? -28.984 69.881  -21.586 1.00 67.59  ? 133 ASP A OD1 1 
ATOM 740   O OD2 . ASP A 1 133 ? -26.899 70.462  -21.071 1.00 69.72  ? 133 ASP A OD2 1 
ATOM 741   N N   . LYS A 1 134 ? -27.275 65.123  -23.187 1.00 44.40  ? 134 LYS A N   1 
ATOM 742   C CA  . LYS A 1 134 ? -26.841 64.091  -24.130 1.00 43.77  ? 134 LYS A CA  1 
ATOM 743   C C   . LYS A 1 134 ? -28.011 63.135  -24.505 1.00 46.65  ? 134 LYS A C   1 
ATOM 744   O O   . LYS A 1 134 ? -27.842 62.235  -25.345 1.00 45.24  ? 134 LYS A O   1 
ATOM 745   C CB  . LYS A 1 134 ? -25.633 63.320  -23.569 1.00 45.54  ? 134 LYS A CB  1 
ATOM 746   C CG  . LYS A 1 134 ? -24.327 64.106  -23.696 1.00 64.14  ? 134 LYS A CG  1 
ATOM 747   C CD  . LYS A 1 134 ? -23.211 63.538  -22.816 1.00 77.88  ? 134 LYS A CD  1 
ATOM 748   C CE  . LYS A 1 134 ? -22.127 62.813  -23.579 1.00 94.02  ? 134 LYS A CE  1 
ATOM 749   N NZ  . LYS A 1 134 ? -21.255 63.749  -24.335 1.00 105.48 ? 134 LYS A NZ  1 
ATOM 750   N N   . LEU A 1 135 ? -29.200 63.375  -23.932 1.00 43.03  ? 135 LEU A N   1 
ATOM 751   C CA  . LEU A 1 135 ? -30.383 62.554  -24.193 1.00 44.17  ? 135 LEU A CA  1 
ATOM 752   C C   . LEU A 1 135 ? -30.944 62.776  -25.598 1.00 50.07  ? 135 LEU A C   1 
ATOM 753   O O   . LEU A 1 135 ? -30.819 63.861  -26.161 1.00 50.15  ? 135 LEU A O   1 
ATOM 754   C CB  . LEU A 1 135 ? -31.501 62.830  -23.165 1.00 43.88  ? 135 LEU A CB  1 
ATOM 755   C CG  . LEU A 1 135 ? -31.300 62.326  -21.740 1.00 47.31  ? 135 LEU A CG  1 
ATOM 756   C CD1 . LEU A 1 135 ? -32.408 62.832  -20.834 1.00 45.43  ? 135 LEU A CD1 1 
ATOM 757   C CD2 . LEU A 1 135 ? -31.223 60.825  -21.705 1.00 50.18  ? 135 LEU A CD2 1 
ATOM 758   N N   . ARG A 1 136 ? -31.588 61.735  -26.137 1.00 45.66  ? 136 ARG A N   1 
ATOM 759   C CA  . ARG A 1 136 ? -32.260 61.765  -27.423 1.00 44.56  ? 136 ARG A CA  1 
ATOM 760   C C   . ARG A 1 136 ? -33.594 61.036  -27.355 1.00 46.34  ? 136 ARG A C   1 
ATOM 761   O O   . ARG A 1 136 ? -33.727 60.082  -26.565 1.00 44.16  ? 136 ARG A O   1 
ATOM 762   C CB  . ARG A 1 136 ? -31.403 61.118  -28.497 1.00 43.82  ? 136 ARG A CB  1 
ATOM 763   C CG  . ARG A 1 136 ? -30.293 61.986  -29.045 1.00 49.96  ? 136 ARG A CG  1 
ATOM 764   C CD  . ARG A 1 136 ? -29.571 61.209  -30.132 1.00 51.98  ? 136 ARG A CD  1 
ATOM 765   N NE  . ARG A 1 136 ? -29.012 59.954  -29.617 1.00 60.26  ? 136 ARG A NE  1 
ATOM 766   C CZ  . ARG A 1 136 ? -28.473 58.993  -30.364 1.00 65.07  ? 136 ARG A CZ  1 
ATOM 767   N NH1 . ARG A 1 136 ? -28.442 59.109  -31.688 1.00 38.84  ? 136 ARG A NH1 1 
ATOM 768   N NH2 . ARG A 1 136 ? -27.972 57.900  -29.792 1.00 42.78  ? 136 ARG A NH2 1 
ATOM 769   N N   . VAL A 1 137 ? -34.570 61.468  -28.218 1.00 40.73  ? 137 VAL A N   1 
ATOM 770   C CA  . VAL A 1 137 ? -35.879 60.820  -28.353 1.00 38.79  ? 137 VAL A CA  1 
ATOM 771   C C   . VAL A 1 137 ? -35.640 59.352  -28.790 1.00 42.66  ? 137 VAL A C   1 
ATOM 772   O O   . VAL A 1 137 ? -34.872 59.133  -29.726 1.00 40.28  ? 137 VAL A O   1 
ATOM 773   C CB  . VAL A 1 137 ? -36.842 61.580  -29.303 1.00 40.34  ? 137 VAL A CB  1 
ATOM 774   C CG1 . VAL A 1 137 ? -38.133 60.786  -29.516 1.00 40.03  ? 137 VAL A CG1 1 
ATOM 775   C CG2 . VAL A 1 137 ? -37.166 62.961  -28.754 1.00 39.67  ? 137 VAL A CG2 1 
ATOM 776   N N   . GLY A 1 138 ? -36.214 58.393  -28.029 1.00 41.29  ? 138 GLY A N   1 
ATOM 777   C CA  . GLY A 1 138 ? -36.078 56.953  -28.252 1.00 41.16  ? 138 GLY A CA  1 
ATOM 778   C C   . GLY A 1 138 ? -35.133 56.240  -27.299 1.00 45.09  ? 138 GLY A C   1 
ATOM 779   O O   . GLY A 1 138 ? -34.993 55.012  -27.343 1.00 45.02  ? 138 GLY A O   1 
ATOM 780   N N   . ASP A 1 139 ? -34.447 57.003  -26.446 1.00 41.42  ? 139 ASP A N   1 
ATOM 781   C CA  . ASP A 1 139 ? -33.567 56.432  -25.419 1.00 40.37  ? 139 ASP A CA  1 
ATOM 782   C C   . ASP A 1 139 ? -34.448 55.705  -24.402 1.00 41.46  ? 139 ASP A C   1 
ATOM 783   O O   . ASP A 1 139 ? -35.597 56.098  -24.211 1.00 41.78  ? 139 ASP A O   1 
ATOM 784   C CB  . ASP A 1 139 ? -32.705 57.529  -24.742 1.00 41.46  ? 139 ASP A CB  1 
ATOM 785   C CG  . ASP A 1 139 ? -31.534 58.037  -25.565 1.00 53.06  ? 139 ASP A CG  1 
ATOM 786   O OD1 . ASP A 1 139 ? -31.115 57.329  -26.506 1.00 54.09  ? 139 ASP A OD1 1 
ATOM 787   O OD2 . ASP A 1 139 ? -30.993 59.121  -25.229 1.00 64.68  ? 139 ASP A OD2 1 
ATOM 788   N N   . PHE A 1 140 ? -33.945 54.650  -23.785 1.00 36.47  ? 140 PHE A N   1 
ATOM 789   C CA  . PHE A 1 140 ? -34.745 53.912  -22.820 1.00 35.65  ? 140 PHE A CA  1 
ATOM 790   C C   . PHE A 1 140 ? -34.666 54.558  -21.455 1.00 42.38  ? 140 PHE A C   1 
ATOM 791   O O   . PHE A 1 140 ? -33.621 55.099  -21.081 1.00 42.22  ? 140 PHE A O   1 
ATOM 792   C CB  . PHE A 1 140 ? -34.341 52.435  -22.782 1.00 36.47  ? 140 PHE A CB  1 
ATOM 793   C CG  . PHE A 1 140 ? -34.707 51.721  -24.067 1.00 37.75  ? 140 PHE A CG  1 
ATOM 794   C CD1 . PHE A 1 140 ? -33.731 51.357  -24.979 1.00 40.36  ? 140 PHE A CD1 1 
ATOM 795   C CD2 . PHE A 1 140 ? -36.041 51.475  -24.396 1.00 40.12  ? 140 PHE A CD2 1 
ATOM 796   C CE1 . PHE A 1 140 ? -34.063 50.713  -26.170 1.00 40.48  ? 140 PHE A CE1 1 
ATOM 797   C CE2 . PHE A 1 140 ? -36.377 50.825  -25.587 1.00 42.39  ? 140 PHE A CE2 1 
ATOM 798   C CZ  . PHE A 1 140 ? -35.381 50.450  -26.464 1.00 40.73  ? 140 PHE A CZ  1 
ATOM 799   N N   . ALA A 1 141 ? -35.800 54.566  -20.742 1.00 40.21  ? 141 ALA A N   1 
ATOM 800   C CA  . ALA A 1 141 ? -35.903 55.174  -19.408 1.00 39.99  ? 141 ALA A CA  1 
ATOM 801   C C   . ALA A 1 141 ? -36.676 54.275  -18.460 1.00 41.16  ? 141 ALA A C   1 
ATOM 802   O O   . ALA A 1 141 ? -37.621 53.594  -18.883 1.00 38.44  ? 141 ALA A O   1 
ATOM 803   C CB  . ALA A 1 141 ? -36.577 56.551  -19.488 1.00 40.28  ? 141 ALA A CB  1 
ATOM 804   N N   . VAL A 1 142 ? -36.232 54.259  -17.177 1.00 36.13  ? 142 VAL A N   1 
ATOM 805   C CA  . VAL A 1 142 ? -36.849 53.520  -16.072 1.00 34.43  ? 142 VAL A CA  1 
ATOM 806   C C   . VAL A 1 142 ? -37.251 54.552  -15.014 1.00 38.49  ? 142 VAL A C   1 
ATOM 807   O O   . VAL A 1 142 ? -36.404 55.311  -14.530 1.00 38.05  ? 142 VAL A O   1 
ATOM 808   C CB  . VAL A 1 142 ? -35.946 52.381  -15.486 1.00 36.60  ? 142 VAL A CB  1 
ATOM 809   C CG1 . VAL A 1 142 ? -36.651 51.618  -14.334 1.00 34.97  ? 142 VAL A CG1 1 
ATOM 810   C CG2 . VAL A 1 142 ? -35.493 51.434  -16.576 1.00 35.44  ? 142 VAL A CG2 1 
ATOM 811   N N   . ALA A 1 143 ? -38.551 54.638  -14.743 1.00 35.61  ? 143 ALA A N   1 
ATOM 812   C CA  . ALA A 1 143 ? -39.140 55.514  -13.736 1.00 35.77  ? 143 ALA A CA  1 
ATOM 813   C C   . ALA A 1 143 ? -39.283 54.733  -12.400 1.00 39.51  ? 143 ALA A C   1 
ATOM 814   O O   . ALA A 1 143 ? -39.793 53.610  -12.388 1.00 40.34  ? 143 ALA A O   1 
ATOM 815   C CB  . ALA A 1 143 ? -40.483 56.022  -14.225 1.00 36.58  ? 143 ALA A CB  1 
ATOM 816   N N   . VAL A 1 144 ? -38.744 55.269  -11.308 1.00 35.37  ? 144 VAL A N   1 
ATOM 817   C CA  . VAL A 1 144 ? -38.752 54.582  -10.001 1.00 35.28  ? 144 VAL A CA  1 
ATOM 818   C C   . VAL A 1 144 ? -39.366 55.526  -8.947  1.00 40.17  ? 144 VAL A C   1 
ATOM 819   O O   . VAL A 1 144 ? -38.967 56.678  -8.817  1.00 40.19  ? 144 VAL A O   1 
ATOM 820   C CB  . VAL A 1 144 ? -37.336 54.063  -9.587  1.00 38.10  ? 144 VAL A CB  1 
ATOM 821   C CG1 . VAL A 1 144 ? -37.395 53.253  -8.285  1.00 37.83  ? 144 VAL A CG1 1 
ATOM 822   C CG2 . VAL A 1 144 ? -36.673 53.249  -10.706 1.00 36.65  ? 144 VAL A CG2 1 
ATOM 823   N N   . GLY A 1 145 ? -40.373 55.030  -8.261  1.00 37.27  ? 145 GLY A N   1 
ATOM 824   C CA  . GLY A 1 145 ? -41.117 55.789  -7.270  1.00 36.51  ? 145 GLY A CA  1 
ATOM 825   C C   . GLY A 1 145 ? -42.166 54.980  -6.531  1.00 42.50  ? 145 GLY A C   1 
ATOM 826   O O   . GLY A 1 145 ? -42.181 53.741  -6.570  1.00 40.79  ? 145 GLY A O   1 
ATOM 827   N N   . ASN A 1 146 ? -43.092 55.704  -5.889  1.00 41.35  ? 146 ASN A N   1 
ATOM 828   C CA  . ASN A 1 146 ? -44.128 55.186  -5.008  1.00 40.40  ? 146 ASN A CA  1 
ATOM 829   C C   . ASN A 1 146 ? -45.541 55.548  -5.451  1.00 44.31  ? 146 ASN A C   1 
ATOM 830   O O   . ASN A 1 146 ? -46.239 56.260  -4.710  1.00 44.31  ? 146 ASN A O   1 
ATOM 831   C CB  . ASN A 1 146 ? -43.878 55.787  -3.633  1.00 43.10  ? 146 ASN A CB  1 
ATOM 832   C CG  . ASN A 1 146 ? -43.763 54.753  -2.590  1.00 78.15  ? 146 ASN A CG  1 
ATOM 833   O OD1 . ASN A 1 146 ? -42.652 54.316  -2.264  1.00 78.37  ? 146 ASN A OD1 1 
ATOM 834   N ND2 . ASN A 1 146 ? -44.915 54.298  -2.106  1.00 66.83  ? 146 ASN A ND2 1 
ATOM 835   N N   . PRO A 1 147 ? -46.038 55.065  -6.610  1.00 40.20  ? 147 PRO A N   1 
ATOM 836   C CA  . PRO A 1 147 ? -47.397 55.450  -7.003  1.00 39.14  ? 147 PRO A CA  1 
ATOM 837   C C   . PRO A 1 147 ? -48.405 54.825  -6.074  1.00 42.22  ? 147 PRO A C   1 
ATOM 838   O O   . PRO A 1 147 ? -48.222 53.667  -5.674  1.00 41.80  ? 147 PRO A O   1 
ATOM 839   C CB  . PRO A 1 147 ? -47.523 54.938  -8.436  1.00 40.73  ? 147 PRO A CB  1 
ATOM 840   C CG  . PRO A 1 147 ? -46.506 53.870  -8.547  1.00 45.37  ? 147 PRO A CG  1 
ATOM 841   C CD  . PRO A 1 147 ? -45.401 54.207  -7.630  1.00 41.49  ? 147 PRO A CD  1 
ATOM 842   N N   . PHE A 1 148 ? -49.397 55.636  -5.643  1.00 39.12  ? 148 PHE A N   1 
ATOM 843   C CA  . PHE A 1 148 ? -50.528 55.261  -4.769  1.00 39.97  ? 148 PHE A CA  1 
ATOM 844   C C   . PHE A 1 148 ? -50.071 54.643  -3.422  1.00 48.94  ? 148 PHE A C   1 
ATOM 845   O O   . PHE A 1 148 ? -50.818 53.869  -2.807  1.00 50.00  ? 148 PHE A O   1 
ATOM 846   C CB  . PHE A 1 148 ? -51.503 54.297  -5.509  1.00 41.10  ? 148 PHE A CB  1 
ATOM 847   C CG  . PHE A 1 148 ? -51.896 54.791  -6.893  1.00 42.97  ? 148 PHE A CG  1 
ATOM 848   C CD1 . PHE A 1 148 ? -51.620 54.035  -8.026  1.00 46.57  ? 148 PHE A CD1 1 
ATOM 849   C CD2 . PHE A 1 148 ? -52.486 56.042  -7.068  1.00 43.61  ? 148 PHE A CD2 1 
ATOM 850   C CE1 . PHE A 1 148 ? -51.942 54.515  -9.300  1.00 47.12  ? 148 PHE A CE1 1 
ATOM 851   C CE2 . PHE A 1 148 ? -52.836 56.498  -8.338  1.00 45.74  ? 148 PHE A CE2 1 
ATOM 852   C CZ  . PHE A 1 148 ? -52.556 55.739  -9.443  1.00 44.44  ? 148 PHE A CZ  1 
ATOM 853   N N   . GLY A 1 149 ? -48.862 55.016  -2.996  1.00 46.36  ? 149 GLY A N   1 
ATOM 854   C CA  . GLY A 1 149 ? -48.198 54.555  -1.786  1.00 46.03  ? 149 GLY A CA  1 
ATOM 855   C C   . GLY A 1 149 ? -48.013 53.059  -1.707  1.00 48.81  ? 149 GLY A C   1 
ATOM 856   O O   . GLY A 1 149 ? -48.106 52.488  -0.620  1.00 48.57  ? 149 GLY A O   1 
ATOM 857   N N   . LEU A 1 150 ? -47.753 52.406  -2.839  1.00 45.70  ? 150 LEU A N   1 
ATOM 858   C CA  . LEU A 1 150 ? -47.654 50.931  -2.864  1.00 45.34  ? 150 LEU A CA  1 
ATOM 859   C C   . LEU A 1 150 ? -46.337 50.399  -2.324  1.00 47.59  ? 150 LEU A C   1 
ATOM 860   O O   . LEU A 1 150 ? -46.268 49.274  -1.801  1.00 48.77  ? 150 LEU A O   1 
ATOM 861   C CB  . LEU A 1 150 ? -47.852 50.385  -4.288  1.00 44.85  ? 150 LEU A CB  1 
ATOM 862   C CG  . LEU A 1 150 ? -49.207 50.571  -4.895  1.00 49.59  ? 150 LEU A CG  1 
ATOM 863   C CD1 . LEU A 1 150 ? -49.147 50.449  -6.390  1.00 48.28  ? 150 LEU A CD1 1 
ATOM 864   C CD2 . LEU A 1 150 ? -50.190 49.587  -4.302  1.00 53.89  ? 150 LEU A CD2 1 
ATOM 865   N N   . GLY A 1 151 ? -45.314 51.201  -2.482  1.00 40.74  ? 151 GLY A N   1 
ATOM 866   C CA  . GLY A 1 151 ? -43.949 50.821  -2.174  1.00 39.63  ? 151 GLY A CA  1 
ATOM 867   C C   . GLY A 1 151 ? -43.190 51.070  -3.459  1.00 41.78  ? 151 GLY A C   1 
ATOM 868   O O   . GLY A 1 151 ? -43.787 51.518  -4.453  1.00 41.40  ? 151 GLY A O   1 
ATOM 869   N N   . GLN A 1 152 ? -41.887 50.775  -3.458  1.00 36.79  ? 152 GLN A N   1 
ATOM 870   C CA  . GLN A 1 152 ? -41.030 50.980  -4.628  1.00 35.51  ? 152 GLN A CA  1 
ATOM 871   C C   . GLN A 1 152 ? -41.526 50.176  -5.854  1.00 40.70  ? 152 GLN A C   1 
ATOM 872   O O   . GLN A 1 152 ? -41.674 48.933  -5.822  1.00 42.96  ? 152 GLN A O   1 
ATOM 873   C CB  . GLN A 1 152 ? -39.582 50.635  -4.322  1.00 35.18  ? 152 GLN A CB  1 
ATOM 874   C CG  . GLN A 1 152 ? -38.655 51.198  -5.374  1.00 49.41  ? 152 GLN A CG  1 
ATOM 875   C CD  . GLN A 1 152 ? -37.245 51.168  -4.895  1.00 63.48  ? 152 GLN A CD  1 
ATOM 876   O OE1 . GLN A 1 152 ? -36.666 52.199  -4.489  1.00 55.15  ? 152 GLN A OE1 1 
ATOM 877   N NE2 . GLN A 1 152 ? -36.675 49.973  -4.928  1.00 53.51  ? 152 GLN A NE2 1 
ATOM 878   N N   . THR A 1 153 ? -41.807 50.928  -6.905  1.00 33.03  ? 153 THR A N   1 
ATOM 879   C CA  . THR A 1 153 ? -42.298 50.481  -8.191  1.00 31.37  ? 153 THR A CA  1 
ATOM 880   C C   . THR A 1 153 ? -41.391 50.996  -9.277  1.00 31.50  ? 153 THR A C   1 
ATOM 881   O O   . THR A 1 153 ? -41.067 52.193  -9.296  1.00 30.72  ? 153 THR A O   1 
ATOM 882   C CB  . THR A 1 153 ? -43.708 51.000  -8.368  1.00 44.40  ? 153 THR A CB  1 
ATOM 883   O OG1 . THR A 1 153 ? -44.544 50.354  -7.412  1.00 49.57  ? 153 THR A OG1 1 
ATOM 884   C CG2 . THR A 1 153 ? -44.243 50.819  -9.776  1.00 41.39  ? 153 THR A CG2 1 
ATOM 885   N N   . ALA A 1 154 ? -40.995 50.100  -10.188 1.00 27.32  ? 154 ALA A N   1 
ATOM 886   C CA  . ALA A 1 154 ? -40.180 50.433  -11.364 1.00 28.16  ? 154 ALA A CA  1 
ATOM 887   C C   . ALA A 1 154 ? -41.032 50.327  -12.625 1.00 34.13  ? 154 ALA A C   1 
ATOM 888   O O   . ALA A 1 154 ? -41.737 49.328  -12.793 1.00 36.19  ? 154 ALA A O   1 
ATOM 889   C CB  . ALA A 1 154 ? -38.987 49.498  -11.454 1.00 28.75  ? 154 ALA A CB  1 
ATOM 890   N N   . THR A 1 155 ? -41.028 51.359  -13.489 1.00 29.21  ? 155 THR A N   1 
ATOM 891   C CA  . THR A 1 155 ? -41.799 51.285  -14.730 1.00 28.78  ? 155 THR A CA  1 
ATOM 892   C C   . THR A 1 155 ? -40.879 51.636  -15.859 1.00 35.55  ? 155 THR A C   1 
ATOM 893   O O   . THR A 1 155 ? -39.916 52.344  -15.633 1.00 36.03  ? 155 THR A O   1 
ATOM 894   C CB  . THR A 1 155 ? -43.084 52.108  -14.693 1.00 30.04  ? 155 THR A CB  1 
ATOM 895   O OG1 . THR A 1 155 ? -42.794 53.477  -14.418 1.00 36.24  ? 155 THR A OG1 1 
ATOM 896   C CG2 . THR A 1 155 ? -44.122 51.531  -13.732 1.00 16.60  ? 155 THR A CG2 1 
ATOM 897   N N   . SER A 1 156 ? -41.167 51.136  -17.069 1.00 34.66  ? 156 SER A N   1 
ATOM 898   C CA  . SER A 1 156 ? -40.317 51.253  -18.252 1.00 34.12  ? 156 SER A CA  1 
ATOM 899   C C   . SER A 1 156 ? -40.965 51.949  -19.454 1.00 37.84  ? 156 SER A C   1 
ATOM 900   O O   . SER A 1 156 ? -42.134 51.734  -19.770 1.00 37.97  ? 156 SER A O   1 
ATOM 901   C CB  . SER A 1 156 ? -39.876 49.861  -18.686 1.00 38.63  ? 156 SER A CB  1 
ATOM 902   O OG  . SER A 1 156 ? -38.564 49.931  -19.211 1.00 53.18  ? 156 SER A OG  1 
ATOM 903   N N   . GLY A 1 157 ? -40.140 52.708  -20.162 1.00 33.48  ? 157 GLY A N   1 
ATOM 904   C CA  . GLY A 1 157 ? -40.511 53.466  -21.342 1.00 31.94  ? 157 GLY A CA  1 
ATOM 905   C C   . GLY A 1 157 ? -39.319 54.042  -22.066 1.00 35.59  ? 157 GLY A C   1 
ATOM 906   O O   . GLY A 1 157 ? -38.168 53.724  -21.769 1.00 37.10  ? 157 GLY A O   1 
ATOM 907   N N   . ILE A 1 158 ? -39.591 54.881  -23.027 1.00 31.97  ? 158 ILE A N   1 
ATOM 908   C CA  . ILE A 1 158 ? -38.568 55.569  -23.798 1.00 31.05  ? 158 ILE A CA  1 
ATOM 909   C C   . ILE A 1 158 ? -38.646 57.023  -23.444 1.00 35.74  ? 158 ILE A C   1 
ATOM 910   O O   . ILE A 1 158 ? -39.607 57.425  -22.771 1.00 34.55  ? 158 ILE A O   1 
ATOM 911   C CB  . ILE A 1 158 ? -38.741 55.354  -25.343 1.00 33.56  ? 158 ILE A CB  1 
ATOM 912   C CG1 . ILE A 1 158 ? -40.116 55.838  -25.868 1.00 33.64  ? 158 ILE A CG1 1 
ATOM 913   C CG2 . ILE A 1 158 ? -38.405 53.947  -25.791 1.00 32.66  ? 158 ILE A CG2 1 
ATOM 914   C CD1 . ILE A 1 158 ? -40.176 56.044  -27.370 1.00 38.07  ? 158 ILE A CD1 1 
ATOM 915   N N   . VAL A 1 159 ? -37.641 57.816  -23.884 1.00 33.65  ? 159 VAL A N   1 
ATOM 916   C CA  . VAL A 1 159 ? -37.692 59.281  -23.812 1.00 34.39  ? 159 VAL A CA  1 
ATOM 917   C C   . VAL A 1 159 ? -38.539 59.652  -25.053 1.00 37.66  ? 159 VAL A C   1 
ATOM 918   O O   . VAL A 1 159 ? -38.162 59.276  -26.170 1.00 35.21  ? 159 VAL A O   1 
ATOM 919   C CB  . VAL A 1 159 ? -36.277 59.950  -23.790 1.00 38.15  ? 159 VAL A CB  1 
ATOM 920   C CG1 . VAL A 1 159 ? -36.356 61.470  -23.998 1.00 36.50  ? 159 VAL A CG1 1 
ATOM 921   C CG2 . VAL A 1 159 ? -35.498 59.597  -22.526 1.00 37.61  ? 159 VAL A CG2 1 
ATOM 922   N N   . SER A 1 160 ? -39.722 60.280  -24.837 1.00 35.90  ? 160 SER A N   1 
ATOM 923   C CA  . SER A 1 160 ? -40.728 60.644  -25.856 1.00 34.83  ? 160 SER A CA  1 
ATOM 924   C C   . SER A 1 160 ? -40.468 61.976  -26.506 1.00 40.40  ? 160 SER A C   1 
ATOM 925   O O   . SER A 1 160 ? -40.783 62.148  -27.690 1.00 42.62  ? 160 SER A O   1 
ATOM 926   C CB  . SER A 1 160 ? -42.118 60.670  -25.231 1.00 38.10  ? 160 SER A CB  1 
ATOM 927   O OG  . SER A 1 160 ? -42.533 59.361  -24.879 1.00 48.11  ? 160 SER A OG  1 
ATOM 928   N N   . ALA A 1 161 ? -39.966 62.947  -25.723 1.00 35.96  ? 161 ALA A N   1 
ATOM 929   C CA  . ALA A 1 161 ? -39.688 64.318  -26.144 1.00 35.86  ? 161 ALA A CA  1 
ATOM 930   C C   . ALA A 1 161 ? -38.746 64.984  -25.160 1.00 41.49  ? 161 ALA A C   1 
ATOM 931   O O   . ALA A 1 161 ? -38.570 64.495  -24.039 1.00 40.49  ? 161 ALA A O   1 
ATOM 932   C CB  . ALA A 1 161 ? -40.983 65.108  -26.249 1.00 36.62  ? 161 ALA A CB  1 
ATOM 933   N N   . LEU A 1 162 ? -38.139 66.105  -25.578 1.00 39.84  ? 162 LEU A N   1 
ATOM 934   C CA  . LEU A 1 162 ? -37.190 66.863  -24.761 1.00 40.11  ? 162 LEU A CA  1 
ATOM 935   C C   . LEU A 1 162 ? -37.455 68.364  -24.862 1.00 50.26  ? 162 LEU A C   1 
ATOM 936   O O   . LEU A 1 162 ? -38.028 68.817  -25.855 1.00 52.76  ? 162 LEU A O   1 
ATOM 937   C CB  . LEU A 1 162 ? -35.753 66.543  -25.213 1.00 38.14  ? 162 LEU A CB  1 
ATOM 938   C CG  . LEU A 1 162 ? -35.249 65.140  -24.977 1.00 38.59  ? 162 LEU A CG  1 
ATOM 939   C CD1 . LEU A 1 162 ? -34.147 64.790  -25.951 1.00 37.03  ? 162 LEU A CD1 1 
ATOM 940   C CD2 . LEU A 1 162 ? -34.810 64.944  -23.532 1.00 37.52  ? 162 LEU A CD2 1 
ATOM 941   N N   . GLY A 1 163 ? -37.032 69.117  -23.852 1.00 48.05  ? 163 GLY A N   1 
ATOM 942   C CA  . GLY A 1 163 ? -37.199 70.569  -23.831 1.00 49.25  ? 163 GLY A CA  1 
ATOM 943   C C   . GLY A 1 163 ? -38.635 71.046  -23.861 1.00 56.83  ? 163 GLY A C   1 
ATOM 944   O O   . GLY A 1 163 ? -38.931 72.057  -24.502 1.00 58.56  ? 163 GLY A O   1 
ATOM 945   N N   . ARG A 1 164 ? -39.534 70.333  -23.157 1.00 53.61  ? 164 ARG A N   1 
ATOM 946   C CA  . ARG A 1 164 ? -40.962 70.630  -23.124 1.00 53.71  ? 164 ARG A CA  1 
ATOM 947   C C   . ARG A 1 164 ? -41.288 71.764  -22.166 1.00 61.35  ? 164 ARG A C   1 
ATOM 948   O O   . ARG A 1 164 ? -41.045 71.671  -20.956 1.00 60.12  ? 164 ARG A O   1 
ATOM 949   C CB  . ARG A 1 164 ? -41.780 69.375  -22.769 1.00 51.54  ? 164 ARG A CB  1 
ATOM 950   C CG  . ARG A 1 164 ? -42.007 68.429  -23.938 1.00 49.58  ? 164 ARG A CG  1 
ATOM 951   C CD  . ARG A 1 164 ? -42.987 68.988  -24.946 1.00 57.07  ? 164 ARG A CD  1 
ATOM 952   N NE  . ARG A 1 164 ? -43.710 67.911  -25.630 1.00 64.89  ? 164 ARG A NE  1 
ATOM 953   C CZ  . ARG A 1 164 ? -43.420 67.428  -26.835 1.00 63.47  ? 164 ARG A CZ  1 
ATOM 954   N NH1 . ARG A 1 164 ? -42.415 67.926  -27.535 1.00 48.34  ? 164 ARG A NH1 1 
ATOM 955   N NH2 . ARG A 1 164 ? -44.138 66.449  -27.348 1.00 53.77  ? 164 ARG A NH2 1 
ATOM 956   N N   . SER A 1 165 ? -41.884 72.833  -22.736 1.00 61.60  ? 165 SER A N   1 
ATOM 957   C CA  . SER A 1 165 ? -42.287 74.065  -22.052 1.00 62.04  ? 165 SER A CA  1 
ATOM 958   C C   . SER A 1 165 ? -43.753 74.416  -22.365 1.00 69.22  ? 165 SER A C   1 
ATOM 959   O O   . SER A 1 165 ? -44.411 73.695  -23.123 1.00 69.62  ? 165 SER A O   1 
ATOM 960   C CB  . SER A 1 165 ? -41.367 75.206  -22.483 1.00 64.14  ? 165 SER A CB  1 
ATOM 961   O OG  . SER A 1 165 ? -39.999 74.960  -22.181 1.00 72.24  ? 165 SER A OG  1 
ATOM 962   N N   . GLY A 1 166 ? -44.238 75.516  -21.771 1.00 66.71  ? 166 GLY A N   1 
ATOM 963   C CA  . GLY A 1 166 ? -45.574 76.072  -21.979 1.00 66.05  ? 166 GLY A CA  1 
ATOM 964   C C   . GLY A 1 166 ? -46.713 75.159  -21.594 1.00 70.67  ? 166 GLY A C   1 
ATOM 965   O O   . GLY A 1 166 ? -47.777 75.185  -22.225 1.00 71.47  ? 166 GLY A O   1 
ATOM 966   N N   . LEU A 1 167 ? -46.494 74.338  -20.563 1.00 65.98  ? 167 LEU A N   1 
ATOM 967   C CA  . LEU A 1 167 ? -47.507 73.401  -20.078 1.00 65.30  ? 167 LEU A CA  1 
ATOM 968   C C   . LEU A 1 167 ? -48.248 74.003  -18.888 1.00 68.91  ? 167 LEU A C   1 
ATOM 969   O O   . LEU A 1 167 ? -49.219 73.409  -18.399 1.00 68.02  ? 167 LEU A O   1 
ATOM 970   C CB  . LEU A 1 167 ? -46.874 72.037  -19.700 1.00 65.23  ? 167 LEU A CB  1 
ATOM 971   C CG  . LEU A 1 167 ? -45.816 71.438  -20.648 1.00 69.47  ? 167 LEU A CG  1 
ATOM 972   C CD1 . LEU A 1 167 ? -45.122 70.261  -20.015 1.00 68.95  ? 167 LEU A CD1 1 
ATOM 973   C CD2 . LEU A 1 167 ? -46.401 71.041  -21.999 1.00 70.65  ? 167 LEU A CD2 1 
ATOM 974   N N   . ASN A 1 168 ? -47.785 75.194  -18.427 1.00 66.16  ? 168 ASN A N   1 
ATOM 975   C CA  . ASN A 1 168 ? -48.327 75.953  -17.294 1.00 66.55  ? 168 ASN A CA  1 
ATOM 976   C C   . ASN A 1 168 ? -48.435 75.070  -16.035 1.00 69.24  ? 168 ASN A C   1 
ATOM 977   O O   . ASN A 1 168 ? -49.433 75.113  -15.313 1.00 70.20  ? 168 ASN A O   1 
ATOM 978   C CB  . ASN A 1 168 ? -49.682 76.614  -17.655 1.00 72.36  ? 168 ASN A CB  1 
ATOM 979   C CG  . ASN A 1 168 ? -49.553 77.940  -18.394 1.00 112.52 ? 168 ASN A CG  1 
ATOM 980   O OD1 . ASN A 1 168 ? -48.593 78.194  -19.145 1.00 105.97 ? 168 ASN A OD1 1 
ATOM 981   N ND2 . ASN A 1 168 ? -50.531 78.820  -18.196 1.00 109.61 ? 168 ASN A ND2 1 
ATOM 982   N N   . LEU A 1 169 ? -47.397 74.260  -15.800 1.00 63.25  ? 169 LEU A N   1 
ATOM 983   C CA  . LEU A 1 169 ? -47.286 73.363  -14.653 1.00 62.37  ? 169 LEU A CA  1 
ATOM 984   C C   . LEU A 1 169 ? -46.389 74.017  -13.615 1.00 65.05  ? 169 LEU A C   1 
ATOM 985   O O   . LEU A 1 169 ? -46.717 74.078  -12.424 1.00 63.52  ? 169 LEU A O   1 
ATOM 986   C CB  . LEU A 1 169 ? -46.687 72.008  -15.101 1.00 62.75  ? 169 LEU A CB  1 
ATOM 987   C CG  . LEU A 1 169 ? -47.542 71.139  -16.015 1.00 68.48  ? 169 LEU A CG  1 
ATOM 988   C CD1 . LEU A 1 169 ? -46.712 70.058  -16.688 1.00 68.37  ? 169 LEU A CD1 1 
ATOM 989   C CD2 . LEU A 1 169 ? -48.650 70.489  -15.240 1.00 73.78  ? 169 LEU A CD2 1 
ATOM 990   N N   . GLU A 1 170 ? -45.249 74.538  -14.110 1.00 60.54  ? 170 GLU A N   1 
ATOM 991   C CA  . GLU A 1 170 ? -44.198 75.184  -13.359 1.00 58.98  ? 170 GLU A CA  1 
ATOM 992   C C   . GLU A 1 170 ? -43.877 76.566  -13.922 1.00 59.60  ? 170 GLU A C   1 
ATOM 993   O O   . GLU A 1 170 ? -44.227 76.871  -15.066 1.00 57.80  ? 170 GLU A O   1 
ATOM 994   C CB  . GLU A 1 170 ? -42.956 74.294  -13.442 1.00 60.57  ? 170 GLU A CB  1 
ATOM 995   C CG  . GLU A 1 170 ? -42.558 73.658  -12.131 1.00 73.45  ? 170 GLU A CG  1 
ATOM 996   C CD  . GLU A 1 170 ? -43.634 72.837  -11.459 1.00 86.09  ? 170 GLU A CD  1 
ATOM 997   O OE1 . GLU A 1 170 ? -43.829 71.669  -11.866 1.00 63.50  ? 170 GLU A OE1 1 
ATOM 998   O OE2 . GLU A 1 170 ? -44.222 73.333  -10.470 1.00 85.41  ? 170 GLU A OE2 1 
ATOM 999   N N   . GLY A 1 171 ? -43.201 77.382  -13.108 1.00 54.81  ? 171 GLY A N   1 
ATOM 1000  C CA  . GLY A 1 171 ? -42.708 78.694  -13.505 1.00 53.37  ? 171 GLY A CA  1 
ATOM 1001  C C   . GLY A 1 171 ? -41.586 78.532  -14.510 1.00 57.03  ? 171 GLY A C   1 
ATOM 1002  O O   . GLY A 1 171 ? -41.552 79.239  -15.509 1.00 57.94  ? 171 GLY A O   1 
ATOM 1003  N N   . LEU A 1 172 ? -40.695 77.550  -14.276 1.00 53.60  ? 172 LEU A N   1 
ATOM 1004  C CA  . LEU A 1 172 ? -39.577 77.198  -15.153 1.00 54.05  ? 172 LEU A CA  1 
ATOM 1005  C C   . LEU A 1 172 ? -39.699 75.743  -15.560 1.00 59.69  ? 172 LEU A C   1 
ATOM 1006  O O   . LEU A 1 172 ? -39.719 74.854  -14.706 1.00 61.10  ? 172 LEU A O   1 
ATOM 1007  C CB  . LEU A 1 172 ? -38.212 77.452  -14.476 1.00 54.09  ? 172 LEU A CB  1 
ATOM 1008  C CG  . LEU A 1 172 ? -37.974 78.857  -13.914 1.00 56.88  ? 172 LEU A CG  1 
ATOM 1009  C CD1 . LEU A 1 172 ? -36.867 78.841  -12.909 1.00 56.03  ? 172 LEU A CD1 1 
ATOM 1010  C CD2 . LEU A 1 172 ? -37.742 79.871  -15.029 1.00 55.87  ? 172 LEU A CD2 1 
ATOM 1011  N N   . GLU A 1 173 ? -39.819 75.508  -16.872 1.00 56.23  ? 173 GLU A N   1 
ATOM 1012  C CA  . GLU A 1 173 ? -39.985 74.179  -17.460 1.00 54.41  ? 173 GLU A CA  1 
ATOM 1013  C C   . GLU A 1 173 ? -39.004 73.931  -18.584 1.00 53.58  ? 173 GLU A C   1 
ATOM 1014  O O   . GLU A 1 173 ? -38.853 74.765  -19.489 1.00 53.76  ? 173 GLU A O   1 
ATOM 1015  C CB  . GLU A 1 173 ? -41.421 73.992  -18.021 1.00 55.85  ? 173 GLU A CB  1 
ATOM 1016  C CG  . GLU A 1 173 ? -42.577 74.349  -17.097 1.00 63.50  ? 173 GLU A CG  1 
ATOM 1017  C CD  . GLU A 1 173 ? -43.957 74.347  -17.732 1.00 77.35  ? 173 GLU A CD  1 
ATOM 1018  O OE1 . GLU A 1 173 ? -44.044 74.268  -18.979 1.00 68.21  ? 173 GLU A OE1 1 
ATOM 1019  O OE2 . GLU A 1 173 ? -44.956 74.435  -16.982 1.00 71.01  ? 173 GLU A OE2 1 
ATOM 1020  N N   . ASN A 1 174 ? -38.407 72.742  -18.565 1.00 47.22  ? 174 ASN A N   1 
ATOM 1021  C CA  . ASN A 1 174 ? -37.528 72.221  -19.611 1.00 45.94  ? 174 ASN A CA  1 
ATOM 1022  C C   . ASN A 1 174 ? -37.575 70.682  -19.517 1.00 46.78  ? 174 ASN A C   1 
ATOM 1023  O O   . ASN A 1 174 ? -36.565 69.972  -19.565 1.00 46.27  ? 174 ASN A O   1 
ATOM 1024  C CB  . ASN A 1 174 ? -36.125 72.798  -19.484 1.00 44.99  ? 174 ASN A CB  1 
ATOM 1025  C CG  . ASN A 1 174 ? -35.188 72.391  -20.585 1.00 54.48  ? 174 ASN A CG  1 
ATOM 1026  O OD1 . ASN A 1 174 ? -34.026 72.001  -20.345 1.00 55.72  ? 174 ASN A OD1 1 
ATOM 1027  N ND2 . ASN A 1 174 ? -35.693 72.408  -21.798 1.00 30.97  ? 174 ASN A ND2 1 
ATOM 1028  N N   . PHE A 1 175 ? -38.790 70.191  -19.409 1.00 41.15  ? 175 PHE A N   1 
ATOM 1029  C CA  . PHE A 1 175 ? -39.142 68.812  -19.160 1.00 39.84  ? 175 PHE A CA  1 
ATOM 1030  C C   . PHE A 1 175 ? -38.736 67.800  -20.202 1.00 44.87  ? 175 PHE A C   1 
ATOM 1031  O O   . PHE A 1 175 ? -38.798 68.043  -21.413 1.00 47.16  ? 175 PHE A O   1 
ATOM 1032  C CB  . PHE A 1 175 ? -40.662 68.700  -18.991 1.00 41.20  ? 175 PHE A CB  1 
ATOM 1033  C CG  . PHE A 1 175 ? -41.219 69.285  -17.719 1.00 43.09  ? 175 PHE A CG  1 
ATOM 1034  C CD1 . PHE A 1 175 ? -42.239 70.222  -17.758 1.00 47.89  ? 175 PHE A CD1 1 
ATOM 1035  C CD2 . PHE A 1 175 ? -40.752 68.869  -16.478 1.00 45.44  ? 175 PHE A CD2 1 
ATOM 1036  C CE1 . PHE A 1 175 ? -42.788 70.731  -16.576 1.00 49.37  ? 175 PHE A CE1 1 
ATOM 1037  C CE2 . PHE A 1 175 ? -41.303 69.371  -15.300 1.00 48.48  ? 175 PHE A CE2 1 
ATOM 1038  C CZ  . PHE A 1 175 ? -42.303 70.313  -15.356 1.00 47.62  ? 175 PHE A CZ  1 
ATOM 1039  N N   . ILE A 1 176 ? -38.352 66.622  -19.689 1.00 39.26  ? 176 ILE A N   1 
ATOM 1040  C CA  . ILE A 1 176 ? -38.171 65.390  -20.436 1.00 38.54  ? 176 ILE A CA  1 
ATOM 1041  C C   . ILE A 1 176 ? -39.567 64.769  -20.437 1.00 44.86  ? 176 ILE A C   1 
ATOM 1042  O O   . ILE A 1 176 ? -40.235 64.758  -19.380 1.00 43.97  ? 176 ILE A O   1 
ATOM 1043  C CB  . ILE A 1 176 ? -37.120 64.423  -19.816 1.00 40.10  ? 176 ILE A CB  1 
ATOM 1044  C CG1 . ILE A 1 176 ? -35.725 65.067  -19.701 1.00 39.32  ? 176 ILE A CG1 1 
ATOM 1045  C CG2 . ILE A 1 176 ? -37.073 63.081  -20.582 1.00 37.52  ? 176 ILE A CG2 1 
ATOM 1046  C CD1 . ILE A 1 176 ? -34.924 64.410  -18.620 1.00 34.98  ? 176 ILE A CD1 1 
ATOM 1047  N N   . GLN A 1 177 ? -40.036 64.314  -21.606 1.00 39.91  ? 177 GLN A N   1 
ATOM 1048  C CA  . GLN A 1 177 ? -41.320 63.650  -21.671 1.00 39.46  ? 177 GLN A CA  1 
ATOM 1049  C C   . GLN A 1 177 ? -41.080 62.136  -21.813 1.00 43.04  ? 177 GLN A C   1 
ATOM 1050  O O   . GLN A 1 177 ? -40.229 61.724  -22.598 1.00 43.73  ? 177 GLN A O   1 
ATOM 1051  C CB  . GLN A 1 177 ? -42.169 64.211  -22.808 1.00 40.29  ? 177 GLN A CB  1 
ATOM 1052  C CG  . GLN A 1 177 ? -43.618 63.813  -22.702 1.00 37.62  ? 177 GLN A CG  1 
ATOM 1053  C CD  . GLN A 1 177 ? -44.376 64.305  -23.880 1.00 54.55  ? 177 GLN A CD  1 
ATOM 1054  O OE1 . GLN A 1 177 ? -44.362 65.486  -24.197 1.00 53.96  ? 177 GLN A OE1 1 
ATOM 1055  N NE2 . GLN A 1 177 ? -45.045 63.405  -24.566 1.00 48.72  ? 177 GLN A NE2 1 
ATOM 1056  N N   . THR A 1 178 ? -41.790 61.323  -21.031 1.00 37.32  ? 178 THR A N   1 
ATOM 1057  C CA  . THR A 1 178 ? -41.604 59.880  -21.093 1.00 36.37  ? 178 THR A CA  1 
ATOM 1058  C C   . THR A 1 178 ? -42.950 59.153  -21.136 1.00 39.59  ? 178 THR A C   1 
ATOM 1059  O O   . THR A 1 178 ? -43.945 59.662  -20.604 1.00 39.14  ? 178 THR A O   1 
ATOM 1060  C CB  . THR A 1 178 ? -40.729 59.376  -19.905 1.00 34.28  ? 178 THR A CB  1 
ATOM 1061  O OG1 . THR A 1 178 ? -40.564 57.943  -20.003 1.00 35.45  ? 178 THR A OG1 1 
ATOM 1062  C CG2 . THR A 1 178 ? -41.324 59.727  -18.549 1.00 25.53  ? 178 THR A CG2 1 
ATOM 1063  N N   . ASP A 1 179 ? -42.952 57.936  -21.714 1.00 36.14  ? 179 ASP A N   1 
ATOM 1064  C CA  . ASP A 1 179 ? -44.131 57.085  -21.733 1.00 37.21  ? 179 ASP A CA  1 
ATOM 1065  C C   . ASP A 1 179 ? -44.027 56.016  -20.620 1.00 41.29  ? 179 ASP A C   1 
ATOM 1066  O O   . ASP A 1 179 ? -44.913 55.177  -20.514 1.00 42.01  ? 179 ASP A O   1 
ATOM 1067  C CB  . ASP A 1 179 ? -44.416 56.474  -23.121 1.00 40.08  ? 179 ASP A CB  1 
ATOM 1068  C CG  . ASP A 1 179 ? -43.423 55.448  -23.649 1.00 60.86  ? 179 ASP A CG  1 
ATOM 1069  O OD1 . ASP A 1 179 ? -42.251 55.478  -23.220 1.00 62.83  ? 179 ASP A OD1 1 
ATOM 1070  O OD2 . ASP A 1 179 ? -43.804 54.665  -24.548 1.00 72.89  ? 179 ASP A OD2 1 
ATOM 1071  N N   . ALA A 1 180 ? -43.007 56.089  -19.751 1.00 37.79  ? 180 ALA A N   1 
ATOM 1072  C CA  . ALA A 1 180 ? -42.937 55.205  -18.587 1.00 39.13  ? 180 ALA A CA  1 
ATOM 1073  C C   . ALA A 1 180 ? -44.119 55.578  -17.656 1.00 45.22  ? 180 ALA A C   1 
ATOM 1074  O O   . ALA A 1 180 ? -44.363 56.776  -17.464 1.00 47.48  ? 180 ALA A O   1 
ATOM 1075  C CB  . ALA A 1 180 ? -41.603 55.377  -17.879 1.00 39.88  ? 180 ALA A CB  1 
ATOM 1076  N N   . SER A 1 181 ? -44.901 54.593  -17.173 1.00 39.42  ? 181 SER A N   1 
ATOM 1077  C CA  . SER A 1 181 ? -46.054 54.853  -16.312 1.00 38.48  ? 181 SER A CA  1 
ATOM 1078  C C   . SER A 1 181 ? -45.654 55.623  -15.071 1.00 44.44  ? 181 SER A C   1 
ATOM 1079  O O   . SER A 1 181 ? -44.839 55.155  -14.282 1.00 46.38  ? 181 SER A O   1 
ATOM 1080  C CB  . SER A 1 181 ? -46.761 53.559  -15.926 1.00 40.88  ? 181 SER A CB  1 
ATOM 1081  O OG  . SER A 1 181 ? -47.300 52.937  -17.084 1.00 54.86  ? 181 SER A OG  1 
ATOM 1082  N N   . ILE A 1 182 ? -46.171 56.845  -14.961 1.00 39.00  ? 182 ILE A N   1 
ATOM 1083  C CA  . ILE A 1 182 ? -45.941 57.775  -13.872 1.00 39.24  ? 182 ILE A CA  1 
ATOM 1084  C C   . ILE A 1 182 ? -47.325 58.175  -13.371 1.00 44.55  ? 182 ILE A C   1 
ATOM 1085  O O   . ILE A 1 182 ? -48.164 58.606  -14.138 1.00 45.12  ? 182 ILE A O   1 
ATOM 1086  C CB  . ILE A 1 182 ? -45.028 58.986  -14.310 1.00 42.32  ? 182 ILE A CB  1 
ATOM 1087  C CG1 . ILE A 1 182 ? -43.612 58.490  -14.646 1.00 42.51  ? 182 ILE A CG1 1 
ATOM 1088  C CG2 . ILE A 1 182 ? -44.942 60.064  -13.211 1.00 44.04  ? 182 ILE A CG2 1 
ATOM 1089  C CD1 . ILE A 1 182 ? -42.830 59.390  -15.490 1.00 51.35  ? 182 ILE A CD1 1 
ATOM 1090  N N   . ASN A 1 183 ? -47.569 57.970  -12.099 1.00 42.23  ? 183 ASN A N   1 
ATOM 1091  C CA  . ASN A 1 183 ? -48.845 58.209  -11.440 1.00 41.73  ? 183 ASN A CA  1 
ATOM 1092  C C   . ASN A 1 183 ? -48.633 59.010  -10.159 1.00 45.15  ? 183 ASN A C   1 
ATOM 1093  O O   . ASN A 1 183 ? -47.498 59.268  -9.792  1.00 44.96  ? 183 ASN A O   1 
ATOM 1094  C CB  . ASN A 1 183 ? -49.503 56.851  -11.124 1.00 37.31  ? 183 ASN A CB  1 
ATOM 1095  C CG  . ASN A 1 183 ? -50.126 56.199  -12.325 1.00 44.18  ? 183 ASN A CG  1 
ATOM 1096  O OD1 . ASN A 1 183 ? -51.180 56.618  -12.804 1.00 43.86  ? 183 ASN A OD1 1 
ATOM 1097  N ND2 . ASN A 1 183 ? -49.490 55.160  -12.851 1.00 28.96  ? 183 ASN A ND2 1 
ATOM 1098  N N   . ARG A 1 184 ? -49.719 59.391  -9.485  1.00 41.49  ? 184 ARG A N   1 
ATOM 1099  C CA  . ARG A 1 184 ? -49.678 60.090  -8.206  1.00 41.68  ? 184 ARG A CA  1 
ATOM 1100  C C   . ARG A 1 184 ? -48.845 59.262  -7.209  1.00 42.56  ? 184 ARG A C   1 
ATOM 1101  O O   . ARG A 1 184 ? -49.107 58.071  -7.046  1.00 42.41  ? 184 ARG A O   1 
ATOM 1102  C CB  . ARG A 1 184 ? -51.110 60.328  -7.668  1.00 44.53  ? 184 ARG A CB  1 
ATOM 1103  C CG  . ARG A 1 184 ? -51.827 61.495  -8.331  1.00 63.32  ? 184 ARG A CG  1 
ATOM 1104  C CD  . ARG A 1 184 ? -53.157 61.779  -7.648  1.00 84.89  ? 184 ARG A CD  1 
ATOM 1105  N NE  . ARG A 1 184 ? -54.176 60.774  -7.973  1.00 97.28  ? 184 ARG A NE  1 
ATOM 1106  C CZ  . ARG A 1 184 ? -55.247 60.997  -8.734  1.00 108.66 ? 184 ARG A CZ  1 
ATOM 1107  N NH1 . ARG A 1 184 ? -55.476 62.207  -9.235  1.00 92.46  ? 184 ARG A NH1 1 
ATOM 1108  N NH2 . ARG A 1 184 ? -56.108 60.017  -8.982  1.00 89.28  ? 184 ARG A NH2 1 
ATOM 1109  N N   . GLY A 1 185 ? -47.827 59.897  -6.620  1.00 36.79  ? 185 GLY A N   1 
ATOM 1110  C CA  . GLY A 1 185 ? -46.898 59.296  -5.669  1.00 36.05  ? 185 GLY A CA  1 
ATOM 1111  C C   . GLY A 1 185 ? -45.509 59.081  -6.243  1.00 40.98  ? 185 GLY A C   1 
ATOM 1112  O O   . GLY A 1 185 ? -44.569 58.742  -5.517  1.00 41.29  ? 185 GLY A O   1 
ATOM 1113  N N   . ASN A 1 186 ? -45.375 59.261  -7.563  1.00 36.92  ? 186 ASN A N   1 
ATOM 1114  C CA  . ASN A 1 186 ? -44.117 59.125  -8.298  1.00 36.35  ? 186 ASN A CA  1 
ATOM 1115  C C   . ASN A 1 186 ? -43.268 60.393  -8.215  1.00 41.07  ? 186 ASN A C   1 
ATOM 1116  O O   . ASN A 1 186 ? -42.071 60.329  -8.473  1.00 41.53  ? 186 ASN A O   1 
ATOM 1117  C CB  . ASN A 1 186 ? -44.419 58.817  -9.772  1.00 36.46  ? 186 ASN A CB  1 
ATOM 1118  C CG  . ASN A 1 186 ? -44.375 57.377  -10.138 1.00 41.55  ? 186 ASN A CG  1 
ATOM 1119  O OD1 . ASN A 1 186 ? -43.332 56.740  -10.132 1.00 29.47  ? 186 ASN A OD1 1 
ATOM 1120  N ND2 . ASN A 1 186 ? -45.491 56.860  -10.559 1.00 43.73  ? 186 ASN A ND2 1 
ATOM 1121  N N   . SER A 1 187 ? -43.887 61.547  -7.895  1.00 39.29  ? 187 SER A N   1 
ATOM 1122  C CA  . SER A 1 187 ? -43.217 62.849  -7.781  1.00 39.93  ? 187 SER A CA  1 
ATOM 1123  C C   . SER A 1 187 ? -41.980 62.820  -6.897  1.00 43.73  ? 187 SER A C   1 
ATOM 1124  O O   . SER A 1 187 ? -42.022 62.326  -5.764  1.00 43.83  ? 187 SER A O   1 
ATOM 1125  C CB  . SER A 1 187 ? -44.163 63.892  -7.217  1.00 44.20  ? 187 SER A CB  1 
ATOM 1126  O OG  . SER A 1 187 ? -45.207 64.195  -8.112  1.00 55.47  ? 187 SER A OG  1 
ATOM 1127  N N   . GLY A 1 188 ? -40.911 63.399  -7.420  1.00 38.99  ? 188 GLY A N   1 
ATOM 1128  C CA  . GLY A 1 188 ? -39.624 63.451  -6.751  1.00 39.08  ? 188 GLY A CA  1 
ATOM 1129  C C   . GLY A 1 188 ? -38.805 62.196  -6.973  1.00 43.94  ? 188 GLY A C   1 
ATOM 1130  O O   . GLY A 1 188 ? -37.632 62.171  -6.622  1.00 45.16  ? 188 GLY A O   1 
ATOM 1131  N N   . GLY A 1 189 ? -39.413 61.157  -7.553  1.00 38.47  ? 189 GLY A N   1 
ATOM 1132  C CA  . GLY A 1 189 ? -38.717 59.910  -7.846  1.00 36.69  ? 189 GLY A CA  1 
ATOM 1133  C C   . GLY A 1 189 ? -37.755 60.006  -9.006  1.00 36.86  ? 189 GLY A C   1 
ATOM 1134  O O   . GLY A 1 189 ? -37.675 61.040  -9.684  1.00 33.70  ? 189 GLY A O   1 
ATOM 1135  N N   . ALA A 1 190 ? -37.086 58.875  -9.299  1.00 33.49  ? 190 ALA A N   1 
ATOM 1136  C CA  . ALA A 1 190 ? -36.045 58.798  -10.327 1.00 32.71  ? 190 ALA A CA  1 
ATOM 1137  C C   . ALA A 1 190 ? -36.498 58.397  -11.719 1.00 39.81  ? 190 ALA A C   1 
ATOM 1138  O O   . ALA A 1 190 ? -37.268 57.443  -11.907 1.00 40.18  ? 190 ALA A O   1 
ATOM 1139  C CB  . ALA A 1 190 ? -34.972 57.816  -9.881  1.00 33.06  ? 190 ALA A CB  1 
ATOM 1140  N N   . LEU A 1 191 ? -35.929 59.089  -12.711 1.00 36.05  ? 191 LEU A N   1 
ATOM 1141  C CA  . LEU A 1 191 ? -36.013 58.719  -14.117 1.00 34.49  ? 191 LEU A CA  1 
ATOM 1142  C C   . LEU A 1 191 ? -34.591 58.326  -14.484 1.00 37.97  ? 191 LEU A C   1 
ATOM 1143  O O   . LEU A 1 191 ? -33.696 59.175  -14.453 1.00 37.92  ? 191 LEU A O   1 
ATOM 1144  C CB  . LEU A 1 191 ? -36.599 59.811  -15.025 1.00 33.79  ? 191 LEU A CB  1 
ATOM 1145  C CG  . LEU A 1 191 ? -36.926 59.333  -16.457 1.00 36.62  ? 191 LEU A CG  1 
ATOM 1146  C CD1 . LEU A 1 191 ? -38.165 58.466  -16.501 1.00 34.77  ? 191 LEU A CD1 1 
ATOM 1147  C CD2 . LEU A 1 191 ? -37.066 60.500  -17.413 1.00 39.84  ? 191 LEU A CD2 1 
ATOM 1148  N N   . LEU A 1 192 ? -34.364 57.009  -14.669 1.00 34.93  ? 192 LEU A N   1 
ATOM 1149  C CA  . LEU A 1 192 ? -33.050 56.415  -14.907 1.00 34.44  ? 192 LEU A CA  1 
ATOM 1150  C C   . LEU A 1 192 ? -32.797 55.991  -16.331 1.00 39.20  ? 192 LEU A C   1 
ATOM 1151  O O   . LEU A 1 192 ? -33.720 55.660  -17.056 1.00 39.21  ? 192 LEU A O   1 
ATOM 1152  C CB  . LEU A 1 192 ? -32.866 55.160  -14.030 1.00 34.38  ? 192 LEU A CB  1 
ATOM 1153  C CG  . LEU A 1 192 ? -33.176 55.244  -12.537 1.00 38.68  ? 192 LEU A CG  1 
ATOM 1154  C CD1 . LEU A 1 192 ? -33.110 53.878  -11.928 1.00 38.57  ? 192 LEU A CD1 1 
ATOM 1155  C CD2 . LEU A 1 192 ? -32.228 56.198  -11.805 1.00 38.79  ? 192 LEU A CD2 1 
ATOM 1156  N N   . ASN A 1 193 ? -31.527 55.906  -16.703 1.00 37.78  ? 193 ASN A N   1 
ATOM 1157  C CA  . ASN A 1 193 ? -31.154 55.358  -17.996 1.00 37.88  ? 193 ASN A CA  1 
ATOM 1158  C C   . ASN A 1 193 ? -30.907 53.842  -17.789 1.00 40.85  ? 193 ASN A C   1 
ATOM 1159  O O   . ASN A 1 193 ? -31.133 53.333  -16.687 1.00 39.30  ? 193 ASN A O   1 
ATOM 1160  C CB  . ASN A 1 193 ? -29.941 56.106  -18.628 1.00 37.26  ? 193 ASN A CB  1 
ATOM 1161  C CG  . ASN A 1 193 ? -28.632 56.127  -17.870 1.00 47.37  ? 193 ASN A CG  1 
ATOM 1162  O OD1 . ASN A 1 193 ? -28.318 55.248  -17.076 1.00 46.84  ? 193 ASN A OD1 1 
ATOM 1163  N ND2 . ASN A 1 193 ? -27.791 57.108  -18.170 1.00 35.92  ? 193 ASN A ND2 1 
ATOM 1164  N N   . LEU A 1 194 ? -30.432 53.140  -18.830 1.00 38.15  ? 194 LEU A N   1 
ATOM 1165  C CA  . LEU A 1 194 ? -30.121 51.709  -18.748 1.00 37.66  ? 194 LEU A CA  1 
ATOM 1166  C C   . LEU A 1 194 ? -28.870 51.420  -17.894 1.00 42.68  ? 194 LEU A C   1 
ATOM 1167  O O   . LEU A 1 194 ? -28.665 50.269  -17.533 1.00 45.41  ? 194 LEU A O   1 
ATOM 1168  C CB  . LEU A 1 194 ? -29.995 51.081  -20.152 1.00 37.24  ? 194 LEU A CB  1 
ATOM 1169  C CG  . LEU A 1 194 ? -31.298 51.007  -20.964 1.00 41.53  ? 194 LEU A CG  1 
ATOM 1170  C CD1 . LEU A 1 194 ? -31.098 50.372  -22.279 1.00 41.61  ? 194 LEU A CD1 1 
ATOM 1171  C CD2 . LEU A 1 194 ? -32.364 50.246  -20.251 1.00 43.15  ? 194 LEU A CD2 1 
ATOM 1172  N N   . ASN A 1 195 ? -28.076 52.445  -17.518 1.00 38.03  ? 195 ASN A N   1 
ATOM 1173  C CA  . ASN A 1 195 ? -26.918 52.296  -16.621 1.00 36.72  ? 195 ASN A CA  1 
ATOM 1174  C C   . ASN A 1 195 ? -27.313 52.596  -15.179 1.00 41.86  ? 195 ASN A C   1 
ATOM 1175  O O   . ASN A 1 195 ? -26.472 52.526  -14.280 1.00 43.72  ? 195 ASN A O   1 
ATOM 1176  C CB  . ASN A 1 195 ? -25.791 53.226  -17.038 1.00 35.35  ? 195 ASN A CB  1 
ATOM 1177  C CG  . ASN A 1 195 ? -25.045 52.795  -18.279 1.00 60.77  ? 195 ASN A CG  1 
ATOM 1178  O OD1 . ASN A 1 195 ? -24.771 51.601  -18.502 1.00 53.08  ? 195 ASN A OD1 1 
ATOM 1179  N ND2 . ASN A 1 195 ? -24.644 53.777  -19.084 1.00 52.25  ? 195 ASN A ND2 1 
ATOM 1180  N N   . GLY A 1 196 ? -28.577 52.960  -14.970 1.00 36.51  ? 196 GLY A N   1 
ATOM 1181  C CA  . GLY A 1 196 ? -29.104 53.284  -13.655 1.00 34.53  ? 196 GLY A CA  1 
ATOM 1182  C C   . GLY A 1 196 ? -28.707 54.658  -13.188 1.00 37.99  ? 196 GLY A C   1 
ATOM 1183  O O   . GLY A 1 196 ? -28.703 54.916  -11.988 1.00 39.01  ? 196 GLY A O   1 
ATOM 1184  N N   . GLU A 1 197 ? -28.342 55.537  -14.125 1.00 32.82  ? 197 GLU A N   1 
ATOM 1185  C CA  . GLU A 1 197 ? -27.937 56.906  -13.845 1.00 32.50  ? 197 GLU A CA  1 
ATOM 1186  C C   . GLU A 1 197 ? -29.151 57.819  -13.930 1.00 39.78  ? 197 GLU A C   1 
ATOM 1187  O O   . GLU A 1 197 ? -30.020 57.605  -14.797 1.00 40.81  ? 197 GLU A O   1 
ATOM 1188  C CB  . GLU A 1 197 ? -26.841 57.383  -14.809 1.00 33.11  ? 197 GLU A CB  1 
ATOM 1189  C CG  . GLU A 1 197 ? -25.546 56.599  -14.748 1.00 41.69  ? 197 GLU A CG  1 
ATOM 1190  C CD  . GLU A 1 197 ? -24.674 56.619  -16.003 1.00 72.18  ? 197 GLU A CD  1 
ATOM 1191  O OE1 . GLU A 1 197 ? -23.552 56.070  -15.932 1.00 86.37  ? 197 GLU A OE1 1 
ATOM 1192  O OE2 . GLU A 1 197 ? -25.096 57.166  -17.051 1.00 62.63  ? 197 GLU A OE2 1 
ATOM 1193  N N   . LEU A 1 198 ? -29.184 58.874  -13.075 1.00 35.53  ? 198 LEU A N   1 
ATOM 1194  C CA  . LEU A 1 198 ? -30.313 59.793  -13.042 1.00 34.97  ? 198 LEU A CA  1 
ATOM 1195  C C   . LEU A 1 198 ? -30.361 60.635  -14.302 1.00 39.46  ? 198 LEU A C   1 
ATOM 1196  O O   . LEU A 1 198 ? -29.368 61.286  -14.610 1.00 40.22  ? 198 LEU A O   1 
ATOM 1197  C CB  . LEU A 1 198 ? -30.246 60.684  -11.783 1.00 34.24  ? 198 LEU A CB  1 
ATOM 1198  C CG  . LEU A 1 198 ? -31.497 61.507  -11.435 1.00 37.73  ? 198 LEU A CG  1 
ATOM 1199  C CD1 . LEU A 1 198 ? -32.599 60.640  -10.890 1.00 37.94  ? 198 LEU A CD1 1 
ATOM 1200  C CD2 . LEU A 1 198 ? -31.187 62.589  -10.429 1.00 35.78  ? 198 LEU A CD2 1 
ATOM 1201  N N   . ILE A 1 199 ? -31.498 60.607  -15.049 1.00 34.55  ? 199 ILE A N   1 
ATOM 1202  C CA  . ILE A 1 199 ? -31.648 61.498  -16.202 1.00 33.56  ? 199 ILE A CA  1 
ATOM 1203  C C   . ILE A 1 199 ? -32.706 62.609  -15.904 1.00 37.01  ? 199 ILE A C   1 
ATOM 1204  O O   . ILE A 1 199 ? -32.716 63.642  -16.596 1.00 37.48  ? 199 ILE A O   1 
ATOM 1205  C CB  . ILE A 1 199 ? -31.881 60.813  -17.552 1.00 36.09  ? 199 ILE A CB  1 
ATOM 1206  C CG1 . ILE A 1 199 ? -33.181 59.972  -17.563 1.00 36.06  ? 199 ILE A CG1 1 
ATOM 1207  C CG2 . ILE A 1 199 ? -30.616 60.045  -17.953 1.00 35.81  ? 199 ILE A CG2 1 
ATOM 1208  C CD1 . ILE A 1 199 ? -33.659 59.529  -18.915 1.00 37.05  ? 199 ILE A CD1 1 
ATOM 1209  N N   . GLY A 1 200 ? -33.520 62.415  -14.860 1.00 30.71  ? 200 GLY A N   1 
ATOM 1210  C CA  . GLY A 1 200 ? -34.518 63.395  -14.449 1.00 30.18  ? 200 GLY A CA  1 
ATOM 1211  C C   . GLY A 1 200 ? -35.201 63.103  -13.134 1.00 35.69  ? 200 GLY A C   1 
ATOM 1212  O O   . GLY A 1 200 ? -35.042 62.028  -12.562 1.00 34.32  ? 200 GLY A O   1 
ATOM 1213  N N   . ILE A 1 201 ? -35.964 64.057  -12.641 1.00 36.48  ? 201 ILE A N   1 
ATOM 1214  C CA  . ILE A 1 201 ? -36.779 63.901  -11.408 1.00 37.57  ? 201 ILE A CA  1 
ATOM 1215  C C   . ILE A 1 201 ? -38.271 63.962  -11.841 1.00 41.36  ? 201 ILE A C   1 
ATOM 1216  O O   . ILE A 1 201 ? -38.711 65.003  -12.322 1.00 41.41  ? 201 ILE A O   1 
ATOM 1217  C CB  . ILE A 1 201 ? -36.368 64.988  -10.350 1.00 40.59  ? 201 ILE A CB  1 
ATOM 1218  C CG1 . ILE A 1 201 ? -34.953 64.745  -9.801  1.00 40.47  ? 201 ILE A CG1 1 
ATOM 1219  C CG2 . ILE A 1 201 ? -37.394 65.209  -9.237  1.00 41.54  ? 201 ILE A CG2 1 
ATOM 1220  C CD1 . ILE A 1 201 ? -34.782 63.596  -8.880  1.00 42.90  ? 201 ILE A CD1 1 
ATOM 1221  N N   . ASN A 1 202 ? -39.003 62.837  -11.758 1.00 39.00  ? 202 ASN A N   1 
ATOM 1222  C CA  . ASN A 1 202 ? -40.425 62.735  -12.175 1.00 39.07  ? 202 ASN A CA  1 
ATOM 1223  C C   . ASN A 1 202 ? -41.247 63.775  -11.438 1.00 44.09  ? 202 ASN A C   1 
ATOM 1224  O O   . ASN A 1 202 ? -41.125 63.875  -10.236 1.00 44.31  ? 202 ASN A O   1 
ATOM 1225  C CB  . ASN A 1 202 ? -40.961 61.324  -11.964 1.00 31.84  ? 202 ASN A CB  1 
ATOM 1226  C CG  . ASN A 1 202 ? -40.130 60.302  -12.724 1.00 45.71  ? 202 ASN A CG  1 
ATOM 1227  O OD1 . ASN A 1 202 ? -39.833 59.216  -12.223 1.00 45.26  ? 202 ASN A OD1 1 
ATOM 1228  N ND2 . ASN A 1 202 ? -39.674 60.651  -13.932 1.00 26.33  ? 202 ASN A ND2 1 
ATOM 1229  N N   . THR A 1 203 ? -41.964 64.627  -12.161 1.00 42.18  ? 203 THR A N   1 
ATOM 1230  C CA  . THR A 1 203 ? -42.635 65.771  -11.549 1.00 43.74  ? 203 THR A CA  1 
ATOM 1231  C C   . THR A 1 203 ? -44.140 65.880  -11.830 1.00 50.62  ? 203 THR A C   1 
ATOM 1232  O O   . THR A 1 203 ? -44.900 66.205  -10.913 1.00 51.88  ? 203 THR A O   1 
ATOM 1233  C CB  . THR A 1 203 ? -41.937 67.036  -12.062 1.00 48.87  ? 203 THR A CB  1 
ATOM 1234  O OG1 . THR A 1 203 ? -40.565 66.910  -11.739 1.00 48.90  ? 203 THR A OG1 1 
ATOM 1235  C CG2 . THR A 1 203 ? -42.495 68.325  -11.465 1.00 49.38  ? 203 THR A CG2 1 
ATOM 1236  N N   . ALA A 1 204 ? -44.550 65.730  -13.096 1.00 45.85  ? 204 ALA A N   1 
ATOM 1237  C CA  . ALA A 1 204 ? -45.937 65.945  -13.481 1.00 44.81  ? 204 ALA A CA  1 
ATOM 1238  C C   . ALA A 1 204 ? -46.373 65.001  -14.582 1.00 46.59  ? 204 ALA A C   1 
ATOM 1239  O O   . ALA A 1 204 ? -45.538 64.382  -15.233 1.00 45.88  ? 204 ALA A O   1 
ATOM 1240  C CB  . ALA A 1 204 ? -46.086 67.393  -13.961 1.00 45.49  ? 204 ALA A CB  1 
ATOM 1241  N N   . ILE A 1 205 ? -47.675 64.919  -14.820 1.00 44.22  ? 205 ILE A N   1 
ATOM 1242  C CA  . ILE A 1 205 ? -48.246 64.109  -15.905 1.00 44.71  ? 205 ILE A CA  1 
ATOM 1243  C C   . ILE A 1 205 ? -49.427 64.854  -16.591 1.00 50.68  ? 205 ILE A C   1 
ATOM 1244  O O   . ILE A 1 205 ? -50.002 65.781  -16.011 1.00 49.42  ? 205 ILE A O   1 
ATOM 1245  C CB  . ILE A 1 205 ? -48.693 62.694  -15.404 1.00 47.02  ? 205 ILE A CB  1 
ATOM 1246  C CG1 . ILE A 1 205 ? -49.943 62.755  -14.491 1.00 47.17  ? 205 ILE A CG1 1 
ATOM 1247  C CG2 . ILE A 1 205 ? -47.539 61.907  -14.751 1.00 47.04  ? 205 ILE A CG2 1 
ATOM 1248  C CD1 . ILE A 1 205 ? -50.615 61.389  -14.184 1.00 42.05  ? 205 ILE A CD1 1 
ATOM 1249  N N   . LEU A 1 206 ? -49.753 64.454  -17.830 1.00 48.89  ? 206 LEU A N   1 
ATOM 1250  C CA  . LEU A 1 206 ? -50.958 64.869  -18.544 1.00 49.94  ? 206 LEU A CA  1 
ATOM 1251  C C   . LEU A 1 206 ? -51.872 63.684  -18.468 1.00 60.45  ? 206 LEU A C   1 
ATOM 1252  O O   . LEU A 1 206 ? -51.509 62.611  -18.948 1.00 61.18  ? 206 LEU A O   1 
ATOM 1253  C CB  . LEU A 1 206 ? -50.721 65.290  -19.995 1.00 49.90  ? 206 LEU A CB  1 
ATOM 1254  C CG  . LEU A 1 206 ? -50.241 66.695  -20.308 1.00 55.49  ? 206 LEU A CG  1 
ATOM 1255  C CD1 . LEU A 1 206 ? -50.705 67.090  -21.696 1.00 55.93  ? 206 LEU A CD1 1 
ATOM 1256  C CD2 . LEU A 1 206 ? -50.704 67.736  -19.266 1.00 58.18  ? 206 LEU A CD2 1 
ATOM 1257  N N   . ALA A 1 207 ? -52.989 63.815  -17.766 1.00 62.24  ? 207 ALA A N   1 
ATOM 1258  C CA  . ALA A 1 207 ? -53.911 62.699  -17.541 1.00 63.73  ? 207 ALA A CA  1 
ATOM 1259  C C   . ALA A 1 207 ? -55.345 63.185  -17.469 1.00 69.81  ? 207 ALA A C   1 
ATOM 1260  O O   . ALA A 1 207 ? -55.719 63.780  -16.451 1.00 70.04  ? 207 ALA A O   1 
ATOM 1261  C CB  . ALA A 1 207 ? -53.551 61.978  -16.250 1.00 64.37  ? 207 ALA A CB  1 
ATOM 1262  N N   . PRO A 1 208 ? -56.171 62.917  -18.515 1.00 66.11  ? 208 PRO A N   1 
ATOM 1263  C CA  . PRO A 1 208 ? -57.587 63.343  -18.457 1.00 65.77  ? 208 PRO A CA  1 
ATOM 1264  C C   . PRO A 1 208 ? -58.338 62.830  -17.210 1.00 70.52  ? 208 PRO A C   1 
ATOM 1265  O O   . PRO A 1 208 ? -59.100 63.601  -16.625 1.00 71.36  ? 208 PRO A O   1 
ATOM 1266  C CB  . PRO A 1 208 ? -58.195 62.762  -19.737 1.00 67.17  ? 208 PRO A CB  1 
ATOM 1267  C CG  . PRO A 1 208 ? -57.043 62.458  -20.633 1.00 71.20  ? 208 PRO A CG  1 
ATOM 1268  C CD  . PRO A 1 208 ? -55.862 62.191  -19.768 1.00 66.73  ? 208 PRO A CD  1 
ATOM 1269  N N   . GLY A 1 209 ? -58.080 61.584  -16.786 1.00 65.73  ? 209 GLY A N   1 
ATOM 1270  C CA  . GLY A 1 209 ? -58.751 60.991  -15.635 1.00 65.19  ? 209 GLY A CA  1 
ATOM 1271  C C   . GLY A 1 209 ? -57.910 60.651  -14.421 1.00 68.60  ? 209 GLY A C   1 
ATOM 1272  O O   . GLY A 1 209 ? -58.175 59.647  -13.761 1.00 68.74  ? 209 GLY A O   1 
ATOM 1273  N N   . GLY A 1 210 ? -56.914 61.481  -14.112 1.00 64.23  ? 210 GLY A N   1 
ATOM 1274  C CA  . GLY A 1 210 ? -56.068 61.302  -12.929 1.00 62.92  ? 210 GLY A CA  1 
ATOM 1275  C C   . GLY A 1 210 ? -55.062 60.158  -12.922 1.00 64.16  ? 210 GLY A C   1 
ATOM 1276  O O   . GLY A 1 210 ? -54.287 60.003  -11.963 1.00 65.15  ? 210 GLY A O   1 
ATOM 1277  N N   . GLY A 1 211 ? -55.057 59.361  -13.983 1.00 54.82  ? 211 GLY A N   1 
ATOM 1278  C CA  . GLY A 1 211 ? -54.117 58.263  -14.126 1.00 51.36  ? 211 GLY A CA  1 
ATOM 1279  C C   . GLY A 1 211 ? -53.324 58.356  -15.410 1.00 48.49  ? 211 GLY A C   1 
ATOM 1280  O O   . GLY A 1 211 ? -53.794 58.923  -16.399 1.00 48.84  ? 211 GLY A O   1 
ATOM 1281  N N   . SER A 1 212 ? -52.127 57.769  -15.404 1.00 40.03  ? 212 SER A N   1 
ATOM 1282  C CA  . SER A 1 212 ? -51.181 57.699  -16.518 1.00 36.28  ? 212 SER A CA  1 
ATOM 1283  C C   . SER A 1 212 ? -51.818 57.226  -17.812 1.00 36.17  ? 212 SER A C   1 
ATOM 1284  O O   . SER A 1 212 ? -52.579 56.244  -17.843 1.00 35.68  ? 212 SER A O   1 
ATOM 1285  C CB  . SER A 1 212 ? -50.020 56.776  -16.168 1.00 38.49  ? 212 SER A CB  1 
ATOM 1286  O OG  . SER A 1 212 ? -49.068 56.690  -17.210 1.00 48.47  ? 212 SER A OG  1 
ATOM 1287  N N   . VAL A 1 213 ? -51.511 57.973  -18.885 1.00 31.41  ? 213 VAL A N   1 
ATOM 1288  C CA  . VAL A 1 213 ? -51.921 57.724  -20.271 1.00 29.06  ? 213 VAL A CA  1 
ATOM 1289  C C   . VAL A 1 213 ? -50.649 57.699  -21.125 1.00 35.11  ? 213 VAL A C   1 
ATOM 1290  O O   . VAL A 1 213 ? -50.742 57.805  -22.364 1.00 36.84  ? 213 VAL A O   1 
ATOM 1291  C CB  . VAL A 1 213 ? -52.986 58.726  -20.828 1.00 30.84  ? 213 VAL A CB  1 
ATOM 1292  C CG1 . VAL A 1 213 ? -54.281 58.680  -20.043 1.00 30.57  ? 213 VAL A CG1 1 
ATOM 1293  C CG2 . VAL A 1 213 ? -52.461 60.133  -20.928 1.00 30.03  ? 213 VAL A CG2 1 
ATOM 1294  N N   . GLY A 1 214 ? -49.476 57.610  -20.449 1.00 30.43  ? 214 GLY A N   1 
ATOM 1295  C CA  . GLY A 1 214 ? -48.151 57.569  -21.069 1.00 30.52  ? 214 GLY A CA  1 
ATOM 1296  C C   . GLY A 1 214 ? -47.564 58.895  -21.508 1.00 37.83  ? 214 GLY A C   1 
ATOM 1297  O O   . GLY A 1 214 ? -46.754 58.921  -22.426 1.00 39.55  ? 214 GLY A O   1 
ATOM 1298  N N   . ILE A 1 215 ? -47.991 60.004  -20.880 1.00 37.04  ? 215 ILE A N   1 
ATOM 1299  C CA  . ILE A 1 215 ? -47.502 61.387  -21.058 1.00 37.16  ? 215 ILE A CA  1 
ATOM 1300  C C   . ILE A 1 215 ? -46.990 61.910  -19.672 1.00 40.26  ? 215 ILE A C   1 
ATOM 1301  O O   . ILE A 1 215 ? -47.739 62.558  -18.929 1.00 39.99  ? 215 ILE A O   1 
ATOM 1302  C CB  . ILE A 1 215 ? -48.567 62.361  -21.677 1.00 40.21  ? 215 ILE A CB  1 
ATOM 1303  C CG1 . ILE A 1 215 ? -49.468 61.721  -22.784 1.00 41.37  ? 215 ILE A CG1 1 
ATOM 1304  C CG2 . ILE A 1 215 ? -47.920 63.684  -22.125 1.00 38.60  ? 215 ILE A CG2 1 
ATOM 1305  C CD1 . ILE A 1 215 ? -48.844 61.603  -24.232 1.00 52.67  ? 215 ILE A CD1 1 
ATOM 1306  N N   . GLY A 1 216 ? -45.744 61.594  -19.345 1.00 35.99  ? 216 GLY A N   1 
ATOM 1307  C CA  . GLY A 1 216 ? -45.116 61.984  -18.081 1.00 36.09  ? 216 GLY A CA  1 
ATOM 1308  C C   . GLY A 1 216 ? -43.966 62.967  -18.232 1.00 40.50  ? 216 GLY A C   1 
ATOM 1309  O O   . GLY A 1 216 ? -43.250 62.940  -19.235 1.00 41.31  ? 216 GLY A O   1 
ATOM 1310  N N   . PHE A 1 217 ? -43.771 63.838  -17.235 1.00 36.51  ? 217 PHE A N   1 
ATOM 1311  C CA  . PHE A 1 217 ? -42.728 64.872  -17.310 1.00 35.55  ? 217 PHE A CA  1 
ATOM 1312  C C   . PHE A 1 217 ? -41.773 64.786  -16.141 1.00 38.41  ? 217 PHE A C   1 
ATOM 1313  O O   . PHE A 1 217 ? -42.192 64.576  -15.003 1.00 36.55  ? 217 PHE A O   1 
ATOM 1314  C CB  . PHE A 1 217 ? -43.330 66.285  -17.405 1.00 35.78  ? 217 PHE A CB  1 
ATOM 1315  C CG  . PHE A 1 217 ? -44.300 66.408  -18.562 1.00 35.79  ? 217 PHE A CG  1 
ATOM 1316  C CD1 . PHE A 1 217 ? -43.839 66.585  -19.860 1.00 37.29  ? 217 PHE A CD1 1 
ATOM 1317  C CD2 . PHE A 1 217 ? -45.674 66.307  -18.358 1.00 34.31  ? 217 PHE A CD2 1 
ATOM 1318  C CE1 . PHE A 1 217 ? -44.733 66.675  -20.932 1.00 36.89  ? 217 PHE A CE1 1 
ATOM 1319  C CE2 . PHE A 1 217 ? -46.568 66.397  -19.432 1.00 35.83  ? 217 PHE A CE2 1 
ATOM 1320  C CZ  . PHE A 1 217 ? -46.091 66.584  -20.711 1.00 34.06  ? 217 PHE A CZ  1 
ATOM 1321  N N   . ALA A 1 218 ? -40.485 64.956  -16.451 1.00 35.05  ? 218 ALA A N   1 
ATOM 1322  C CA  . ALA A 1 218 ? -39.391 64.941  -15.504 1.00 34.89  ? 218 ALA A CA  1 
ATOM 1323  C C   . ALA A 1 218 ? -38.514 66.176  -15.653 1.00 38.89  ? 218 ALA A C   1 
ATOM 1324  O O   . ALA A 1 218 ? -38.184 66.566  -16.769 1.00 36.78  ? 218 ALA A O   1 
ATOM 1325  C CB  . ALA A 1 218 ? -38.544 63.688  -15.700 1.00 35.42  ? 218 ALA A CB  1 
ATOM 1326  N N   . ILE A 1 219 ? -38.111 66.778  -14.515 1.00 37.17  ? 219 ILE A N   1 
ATOM 1327  C CA  . ILE A 1 219 ? -37.137 67.864  -14.530 1.00 37.53  ? 219 ILE A CA  1 
ATOM 1328  C C   . ILE A 1 219 ? -35.785 67.209  -14.930 1.00 42.57  ? 219 ILE A C   1 
ATOM 1329  O O   . ILE A 1 219 ? -35.377 66.213  -14.286 1.00 41.60  ? 219 ILE A O   1 
ATOM 1330  C CB  . ILE A 1 219 ? -37.049 68.590  -13.155 1.00 40.14  ? 219 ILE A CB  1 
ATOM 1331  C CG1 . ILE A 1 219 ? -38.394 69.261  -12.781 1.00 40.21  ? 219 ILE A CG1 1 
ATOM 1332  C CG2 . ILE A 1 219 ? -35.874 69.595  -13.143 1.00 38.59  ? 219 ILE A CG2 1 
ATOM 1333  C CD1 . ILE A 1 219 ? -38.602 69.454  -11.304 1.00 42.23  ? 219 ILE A CD1 1 
ATOM 1334  N N   . PRO A 1 220 ? -35.090 67.702  -15.977 1.00 38.06  ? 220 PRO A N   1 
ATOM 1335  C CA  . PRO A 1 220 ? -33.801 67.065  -16.346 1.00 37.45  ? 220 PRO A CA  1 
ATOM 1336  C C   . PRO A 1 220 ? -32.756 67.120  -15.204 1.00 43.04  ? 220 PRO A C   1 
ATOM 1337  O O   . PRO A 1 220 ? -32.744 68.061  -14.397 1.00 42.94  ? 220 PRO A O   1 
ATOM 1338  C CB  . PRO A 1 220 ? -33.346 67.824  -17.603 1.00 37.36  ? 220 PRO A CB  1 
ATOM 1339  C CG  . PRO A 1 220 ? -34.164 69.018  -17.670 1.00 41.67  ? 220 PRO A CG  1 
ATOM 1340  C CD  . PRO A 1 220 ? -35.414 68.839  -16.858 1.00 38.55  ? 220 PRO A CD  1 
ATOM 1341  N N   . SER A 1 221 ? -31.920 66.070  -15.123 1.00 38.51  ? 221 SER A N   1 
ATOM 1342  C CA  . SER A 1 221 ? -30.878 65.870  -14.127 1.00 38.45  ? 221 SER A CA  1 
ATOM 1343  C C   . SER A 1 221 ? -29.893 67.039  -14.050 1.00 43.23  ? 221 SER A C   1 
ATOM 1344  O O   . SER A 1 221 ? -29.497 67.398  -12.943 1.00 44.92  ? 221 SER A O   1 
ATOM 1345  C CB  . SER A 1 221 ? -30.118 64.566  -14.374 1.00 40.44  ? 221 SER A CB  1 
ATOM 1346  O OG  . SER A 1 221 ? -29.570 64.487  -15.680 1.00 46.11  ? 221 SER A OG  1 
ATOM 1347  N N   . ASN A 1 222 ? -29.517 67.642  -15.187 1.00 37.27  ? 222 ASN A N   1 
ATOM 1348  C CA  . ASN A 1 222 ? -28.594 68.778  -15.188 1.00 37.30  ? 222 ASN A CA  1 
ATOM 1349  C C   . ASN A 1 222 ? -29.186 69.971  -14.442 1.00 44.73  ? 222 ASN A C   1 
ATOM 1350  O O   . ASN A 1 222 ? -28.513 70.571  -13.614 1.00 46.87  ? 222 ASN A O   1 
ATOM 1351  C CB  . ASN A 1 222 ? -28.217 69.177  -16.604 1.00 36.39  ? 222 ASN A CB  1 
ATOM 1352  C CG  . ASN A 1 222 ? -27.311 68.227  -17.351 1.00 55.86  ? 222 ASN A CG  1 
ATOM 1353  O OD1 . ASN A 1 222 ? -26.903 68.529  -18.471 1.00 53.29  ? 222 ASN A OD1 1 
ATOM 1354  N ND2 . ASN A 1 222 ? -26.980 67.068  -16.780 1.00 51.45  ? 222 ASN A ND2 1 
ATOM 1355  N N   . MET A 1 223 ? -30.457 70.257  -14.686 1.00 43.07  ? 223 MET A N   1 
ATOM 1356  C CA  . MET A 1 223 ? -31.215 71.308  -14.024 1.00 44.05  ? 223 MET A CA  1 
ATOM 1357  C C   . MET A 1 223 ? -31.367 70.977  -12.526 1.00 53.00  ? 223 MET A C   1 
ATOM 1358  O O   . MET A 1 223 ? -31.110 71.843  -11.686 1.00 54.35  ? 223 MET A O   1 
ATOM 1359  C CB  . MET A 1 223 ? -32.584 71.463  -14.697 1.00 46.52  ? 223 MET A CB  1 
ATOM 1360  C CG  . MET A 1 223 ? -33.377 72.593  -14.148 1.00 52.10  ? 223 MET A CG  1 
ATOM 1361  S SD  . MET A 1 223 ? -34.818 72.974  -15.145 1.00 59.50  ? 223 MET A SD  1 
ATOM 1362  C CE  . MET A 1 223 ? -33.978 73.550  -16.729 1.00 56.85  ? 223 MET A CE  1 
ATOM 1363  N N   . ALA A 1 224 ? -31.765 69.722  -12.198 1.00 48.52  ? 224 ALA A N   1 
ATOM 1364  C CA  . ALA A 1 224 ? -31.937 69.273  -10.829 1.00 47.46  ? 224 ALA A CA  1 
ATOM 1365  C C   . ALA A 1 224 ? -30.621 69.320  -10.052 1.00 52.01  ? 224 ALA A C   1 
ATOM 1366  O O   . ALA A 1 224 ? -30.636 69.798  -8.928  1.00 51.95  ? 224 ALA A O   1 
ATOM 1367  C CB  . ALA A 1 224 ? -32.515 67.869  -10.812 1.00 48.14  ? 224 ALA A CB  1 
ATOM 1368  N N   . ARG A 1 225 ? -29.489 68.869  -10.658 1.00 49.81  ? 225 ARG A N   1 
ATOM 1369  C CA  . ARG A 1 225 ? -28.146 68.839  -10.058 1.00 49.95  ? 225 ARG A CA  1 
ATOM 1370  C C   . ARG A 1 225 ? -27.681 70.265  -9.691  1.00 54.56  ? 225 ARG A C   1 
ATOM 1371  O O   . ARG A 1 225 ? -27.291 70.510  -8.545  1.00 55.69  ? 225 ARG A O   1 
ATOM 1372  C CB  . ARG A 1 225 ? -27.138 68.171  -11.021 1.00 49.76  ? 225 ARG A CB  1 
ATOM 1373  C CG  . ARG A 1 225 ? -25.824 67.743  -10.387 1.00 59.67  ? 225 ARG A CG  1 
ATOM 1374  C CD  . ARG A 1 225 ? -24.652 67.821  -11.360 1.00 82.57  ? 225 ARG A CD  1 
ATOM 1375  N NE  . ARG A 1 225 ? -24.685 66.786  -12.401 1.00 102.42 ? 225 ARG A NE  1 
ATOM 1376  C CZ  . ARG A 1 225 ? -24.919 67.022  -13.691 1.00 122.19 ? 225 ARG A CZ  1 
ATOM 1377  N NH1 . ARG A 1 225 ? -25.139 68.261  -14.118 1.00 114.83 ? 225 ARG A NH1 1 
ATOM 1378  N NH2 . ARG A 1 225 ? -24.930 66.021  -14.564 1.00 104.04 ? 225 ARG A NH2 1 
ATOM 1379  N N   . THR A 1 226 ? -27.744 71.192  -10.657 1.00 49.64  ? 226 THR A N   1 
ATOM 1380  C CA  . THR A 1 226 ? -27.368 72.596  -10.489 1.00 50.03  ? 226 THR A CA  1 
ATOM 1381  C C   . THR A 1 226 ? -28.191 73.266  -9.359  1.00 54.03  ? 226 THR A C   1 
ATOM 1382  O O   . THR A 1 226 ? -27.613 73.896  -8.468  1.00 55.08  ? 226 THR A O   1 
ATOM 1383  C CB  . THR A 1 226 ? -27.545 73.324  -11.819 1.00 63.83  ? 226 THR A CB  1 
ATOM 1384  O OG1 . THR A 1 226 ? -26.778 72.645  -12.812 1.00 65.94  ? 226 THR A OG1 1 
ATOM 1385  C CG2 . THR A 1 226 ? -27.130 74.781  -11.751 1.00 65.14  ? 226 THR A CG2 1 
ATOM 1386  N N   . LEU A 1 227 ? -29.518 73.119  -9.393  1.00 48.87  ? 227 LEU A N   1 
ATOM 1387  C CA  . LEU A 1 227 ? -30.391 73.693  -8.374  1.00 48.61  ? 227 LEU A CA  1 
ATOM 1388  C C   . LEU A 1 227 ? -30.092 73.092  -6.988  1.00 54.66  ? 227 LEU A C   1 
ATOM 1389  O O   . LEU A 1 227 ? -30.011 73.843  -6.018  1.00 55.49  ? 227 LEU A O   1 
ATOM 1390  C CB  . LEU A 1 227 ? -31.873 73.530  -8.743  1.00 48.21  ? 227 LEU A CB  1 
ATOM 1391  C CG  . LEU A 1 227 ? -32.324 74.311  -9.980  1.00 52.59  ? 227 LEU A CG  1 
ATOM 1392  C CD1 . LEU A 1 227 ? -33.588 73.731  -10.550 1.00 53.43  ? 227 LEU A CD1 1 
ATOM 1393  C CD2 . LEU A 1 227 ? -32.477 75.795  -9.708  1.00 52.36  ? 227 LEU A CD2 1 
ATOM 1394  N N   . ALA A 1 228 ? -29.848 71.761  -6.917  1.00 50.64  ? 228 ALA A N   1 
ATOM 1395  C CA  . ALA A 1 228 ? -29.481 71.065  -5.684  1.00 49.91  ? 228 ALA A CA  1 
ATOM 1396  C C   . ALA A 1 228 ? -28.178 71.663  -5.088  1.00 53.65  ? 228 ALA A C   1 
ATOM 1397  O O   . ALA A 1 228 ? -28.133 71.906  -3.879  1.00 52.45  ? 228 ALA A O   1 
ATOM 1398  C CB  . ALA A 1 228 ? -29.324 69.567  -5.941  1.00 50.16  ? 228 ALA A CB  1 
ATOM 1399  N N   . GLN A 1 229 ? -27.158 71.950  -5.948  1.00 51.03  ? 229 GLN A N   1 
ATOM 1400  C CA  . GLN A 1 229 ? -25.880 72.547  -5.519  1.00 51.60  ? 229 GLN A CA  1 
ATOM 1401  C C   . GLN A 1 229 ? -26.089 73.908  -4.878  1.00 51.62  ? 229 GLN A C   1 
ATOM 1402  O O   . GLN A 1 229 ? -25.559 74.151  -3.796  1.00 48.95  ? 229 GLN A O   1 
ATOM 1403  C CB  . GLN A 1 229 ? -24.857 72.667  -6.664  1.00 53.43  ? 229 GLN A CB  1 
ATOM 1404  C CG  . GLN A 1 229 ? -23.789 71.552  -6.631  1.00 82.60  ? 229 GLN A CG  1 
ATOM 1405  C CD  . GLN A 1 229 ? -23.089 71.353  -5.293  1.00 105.08 ? 229 GLN A CD  1 
ATOM 1406  O OE1 . GLN A 1 229 ? -22.657 72.304  -4.625  1.00 99.64  ? 229 GLN A OE1 1 
ATOM 1407  N NE2 . GLN A 1 229 ? -22.943 70.099  -4.885  1.00 101.85 ? 229 GLN A NE2 1 
ATOM 1408  N N   . GLN A 1 230 ? -26.925 74.745  -5.499  1.00 47.33  ? 230 GLN A N   1 
ATOM 1409  C CA  . GLN A 1 230 ? -27.274 76.056  -4.990  1.00 47.23  ? 230 GLN A CA  1 
ATOM 1410  C C   . GLN A 1 230 ? -27.941 75.961  -3.624  1.00 51.99  ? 230 GLN A C   1 
ATOM 1411  O O   . GLN A 1 230 ? -27.709 76.817  -2.782  1.00 53.00  ? 230 GLN A O   1 
ATOM 1412  C CB  . GLN A 1 230 ? -28.190 76.786  -5.983  1.00 48.98  ? 230 GLN A CB  1 
ATOM 1413  C CG  . GLN A 1 230 ? -27.409 77.414  -7.147  1.00 58.49  ? 230 GLN A CG  1 
ATOM 1414  C CD  . GLN A 1 230 ? -28.270 77.795  -8.315  1.00 69.05  ? 230 GLN A CD  1 
ATOM 1415  O OE1 . GLN A 1 230 ? -28.005 77.410  -9.456  1.00 68.03  ? 230 GLN A OE1 1 
ATOM 1416  N NE2 . GLN A 1 230 ? -29.320 78.546  -8.073  1.00 55.84  ? 230 GLN A NE2 1 
ATOM 1417  N N   . LEU A 1 231 ? -28.737 74.918  -3.384  1.00 48.50  ? 231 LEU A N   1 
ATOM 1418  C CA  . LEU A 1 231 ? -29.396 74.742  -2.096  1.00 48.95  ? 231 LEU A CA  1 
ATOM 1419  C C   . LEU A 1 231 ? -28.432 74.182  -1.041  1.00 57.17  ? 231 LEU A C   1 
ATOM 1420  O O   . LEU A 1 231 ? -28.577 74.527  0.132   1.00 57.59  ? 231 LEU A O   1 
ATOM 1421  C CB  . LEU A 1 231 ? -30.652 73.863  -2.212  1.00 49.16  ? 231 LEU A CB  1 
ATOM 1422  C CG  . LEU A 1 231 ? -31.765 74.348  -3.164  1.00 53.84  ? 231 LEU A CG  1 
ATOM 1423  C CD1 . LEU A 1 231 ? -32.749 73.231  -3.443  1.00 54.92  ? 231 LEU A CD1 1 
ATOM 1424  C CD2 . LEU A 1 231 ? -32.492 75.562  -2.622  1.00 54.12  ? 231 LEU A CD2 1 
ATOM 1425  N N   . ILE A 1 232 ? -27.446 73.334  -1.427  1.00 57.27  ? 232 ILE A N   1 
ATOM 1426  C CA  . ILE A 1 232 ? -26.486 72.825  -0.431  1.00 58.35  ? 232 ILE A CA  1 
ATOM 1427  C C   . ILE A 1 232 ? -25.532 74.005  -0.026  1.00 62.74  ? 232 ILE A C   1 
ATOM 1428  O O   . ILE A 1 232 ? -25.248 74.186  1.162   1.00 61.56  ? 232 ILE A O   1 
ATOM 1429  C CB  . ILE A 1 232 ? -25.704 71.508  -0.811  1.00 61.85  ? 232 ILE A CB  1 
ATOM 1430  C CG1 . ILE A 1 232 ? -24.442 71.760  -1.642  1.00 64.07  ? 232 ILE A CG1 1 
ATOM 1431  C CG2 . ILE A 1 232 ? -26.583 70.424  -1.444  1.00 60.63  ? 232 ILE A CG2 1 
ATOM 1432  C CD1 . ILE A 1 232 ? -23.312 70.687  -1.432  1.00 80.43  ? 232 ILE A CD1 1 
ATOM 1433  N N   . ASP A 1 233 ? -25.137 74.841  -1.016  1.00 59.74  ? 233 ASP A N   1 
ATOM 1434  C CA  . ASP A 1 233 ? -24.233 75.981  -0.856  1.00 59.86  ? 233 ASP A CA  1 
ATOM 1435  C C   . ASP A 1 233 ? -24.849 77.222  -0.204  1.00 66.17  ? 233 ASP A C   1 
ATOM 1436  O O   . ASP A 1 233 ? -24.121 77.917  0.504   1.00 68.14  ? 233 ASP A O   1 
ATOM 1437  C CB  . ASP A 1 233 ? -23.670 76.426  -2.224  1.00 60.91  ? 233 ASP A CB  1 
ATOM 1438  C CG  . ASP A 1 233 ? -22.736 75.455  -2.921  1.00 64.74  ? 233 ASP A CG  1 
ATOM 1439  O OD1 . ASP A 1 233 ? -22.378 74.424  -2.305  1.00 65.48  ? 233 ASP A OD1 1 
ATOM 1440  O OD2 . ASP A 1 233 ? -22.368 75.722  -4.088  1.00 66.49  ? 233 ASP A OD2 1 
ATOM 1441  N N   . PHE A 1 234 ? -26.123 77.571  -0.504  1.00 60.99  ? 234 PHE A N   1 
ATOM 1442  C CA  . PHE A 1 234 ? -26.700 78.818  -0.001  1.00 59.88  ? 234 PHE A CA  1 
ATOM 1443  C C   . PHE A 1 234 ? -28.038 78.675  0.738   1.00 63.00  ? 234 PHE A C   1 
ATOM 1444  O O   . PHE A 1 234 ? -28.530 79.674  1.288   1.00 63.68  ? 234 PHE A O   1 
ATOM 1445  C CB  . PHE A 1 234 ? -26.893 79.815  -1.162  1.00 61.91  ? 234 PHE A CB  1 
ATOM 1446  C CG  . PHE A 1 234 ? -25.782 79.859  -2.186  1.00 64.19  ? 234 PHE A CG  1 
ATOM 1447  C CD1 . PHE A 1 234 ? -25.998 79.423  -3.487  1.00 67.55  ? 234 PHE A CD1 1 
ATOM 1448  C CD2 . PHE A 1 234 ? -24.522 80.346  -1.853  1.00 67.14  ? 234 PHE A CD2 1 
ATOM 1449  C CE1 . PHE A 1 234 ? -24.963 79.437  -4.430  1.00 68.31  ? 234 PHE A CE1 1 
ATOM 1450  C CE2 . PHE A 1 234 ? -23.490 80.375  -2.803  1.00 69.85  ? 234 PHE A CE2 1 
ATOM 1451  C CZ  . PHE A 1 234 ? -23.720 79.926  -4.086  1.00 67.37  ? 234 PHE A CZ  1 
ATOM 1452  N N   . GLY A 1 235 ? -28.638 77.483  0.721   1.00 57.00  ? 235 GLY A N   1 
ATOM 1453  C CA  . GLY A 1 235 ? -29.940 77.253  1.343   1.00 55.62  ? 235 GLY A CA  1 
ATOM 1454  C C   . GLY A 1 235 ? -31.079 77.871  0.557   1.00 59.60  ? 235 GLY A C   1 
ATOM 1455  O O   . GLY A 1 235 ? -32.235 77.797  0.964   1.00 58.13  ? 235 GLY A O   1 
ATOM 1456  N N   . GLU A 1 236 ? -30.750 78.482  -0.588  1.00 59.39  ? 236 GLU A N   1 
ATOM 1457  C CA  . GLU A 1 236 ? -31.659 79.130  -1.538  1.00 60.97  ? 236 GLU A CA  1 
ATOM 1458  C C   . GLU A 1 236 ? -31.026 79.137  -2.926  1.00 64.55  ? 236 GLU A C   1 
ATOM 1459  O O   . GLU A 1 236 ? -29.813 78.938  -3.060  1.00 65.59  ? 236 GLU A O   1 
ATOM 1460  C CB  . GLU A 1 236 ? -32.019 80.561  -1.089  1.00 63.04  ? 236 GLU A CB  1 
ATOM 1461  C CG  . GLU A 1 236 ? -30.815 81.483  -0.919  1.00 76.56  ? 236 GLU A CG  1 
ATOM 1462  C CD  . GLU A 1 236 ? -31.133 82.963  -0.854  1.00 95.21  ? 236 GLU A CD  1 
ATOM 1463  O OE1 . GLU A 1 236 ? -32.229 83.328  -0.365  1.00 78.25  ? 236 GLU A OE1 1 
ATOM 1464  O OE2 . GLU A 1 236 ? -30.283 83.762  -1.310  1.00 92.95  ? 236 GLU A OE2 1 
ATOM 1465  N N   . ILE A 1 237 ? -31.837 79.380  -3.943  1.00 59.54  ? 237 ILE A N   1 
ATOM 1466  C CA  . ILE A 1 237 ? -31.366 79.440  -5.327  1.00 59.14  ? 237 ILE A CA  1 
ATOM 1467  C C   . ILE A 1 237 ? -30.909 80.855  -5.677  1.00 63.07  ? 237 ILE A C   1 
ATOM 1468  O O   . ILE A 1 237 ? -31.353 81.832  -5.078  1.00 62.09  ? 237 ILE A O   1 
ATOM 1469  C CB  . ILE A 1 237 ? -32.436 78.919  -6.357  1.00 61.33  ? 237 ILE A CB  1 
ATOM 1470  C CG1 . ILE A 1 237 ? -33.796 79.702  -6.304  1.00 61.14  ? 237 ILE A CG1 1 
ATOM 1471  C CG2 . ILE A 1 237 ? -32.594 77.386  -6.294  1.00 59.86  ? 237 ILE A CG2 1 
ATOM 1472  C CD1 . ILE A 1 237 ? -34.775 79.530  -4.926  1.00 70.77  ? 237 ILE A CD1 1 
ATOM 1473  N N   . LYS A 1 238 ? -30.025 80.944  -6.666  1.00 61.13  ? 238 LYS A N   1 
ATOM 1474  C CA  . LYS A 1 238 ? -29.490 82.175  -7.222  1.00 61.16  ? 238 LYS A CA  1 
ATOM 1475  C C   . LYS A 1 238 ? -29.901 82.220  -8.689  1.00 63.65  ? 238 LYS A C   1 
ATOM 1476  O O   . LYS A 1 238 ? -29.398 81.458  -9.516  1.00 63.14  ? 238 LYS A O   1 
ATOM 1477  C CB  . LYS A 1 238 ? -27.972 82.250  -7.005  1.00 64.97  ? 238 LYS A CB  1 
ATOM 1478  C CG  . LYS A 1 238 ? -27.619 82.686  -5.583  1.00 86.15  ? 238 LYS A CG  1 
ATOM 1479  C CD  . LYS A 1 238 ? -26.128 82.848  -5.378  1.00 96.94  ? 238 LYS A CD  1 
ATOM 1480  C CE  . LYS A 1 238 ? -25.823 83.351  -3.990  1.00 106.26 ? 238 LYS A CE  1 
ATOM 1481  N NZ  . LYS A 1 238 ? -24.390 83.713  -3.840  1.00 116.21 ? 238 LYS A NZ  1 
ATOM 1482  N N   . ARG A 1 239 ? -30.914 83.045  -8.968  1.00 59.84  ? 239 ARG A N   1 
ATOM 1483  C CA  . ARG A 1 239 ? -31.524 83.228  -10.280 1.00 60.27  ? 239 ARG A CA  1 
ATOM 1484  C C   . ARG A 1 239 ? -30.693 84.158  -11.149 1.00 65.87  ? 239 ARG A C   1 
ATOM 1485  O O   . ARG A 1 239 ? -30.529 85.325  -10.806 1.00 66.54  ? 239 ARG A O   1 
ATOM 1486  C CB  . ARG A 1 239 ? -32.943 83.798  -10.104 1.00 60.53  ? 239 ARG A CB  1 
ATOM 1487  C CG  . ARG A 1 239 ? -33.935 83.399  -11.182 1.00 68.61  ? 239 ARG A CG  1 
ATOM 1488  C CD  . ARG A 1 239 ? -34.870 82.305  -10.698 1.00 73.76  ? 239 ARG A CD  1 
ATOM 1489  N NE  . ARG A 1 239 ? -34.198 81.007  -10.689 1.00 71.59  ? 239 ARG A NE  1 
ATOM 1490  C CZ  . ARG A 1 239 ? -34.712 79.889  -10.194 1.00 75.05  ? 239 ARG A CZ  1 
ATOM 1491  N NH1 . ARG A 1 239 ? -35.923 79.890  -9.647  1.00 54.66  ? 239 ARG A NH1 1 
ATOM 1492  N NH2 . ARG A 1 239 ? -34.019 78.762  -10.234 1.00 59.52  ? 239 ARG A NH2 1 
ATOM 1493  N N   . GLY A 1 240 ? -30.186 83.636  -12.259 1.00 63.06  ? 240 GLY A N   1 
ATOM 1494  C CA  . GLY A 1 240 ? -29.386 84.395  -13.213 1.00 63.19  ? 240 GLY A CA  1 
ATOM 1495  C C   . GLY A 1 240 ? -30.223 84.984  -14.332 1.00 69.50  ? 240 GLY A C   1 
ATOM 1496  O O   . GLY A 1 240 ? -31.326 84.492  -14.605 1.00 70.29  ? 240 GLY A O   1 
ATOM 1497  N N   . LEU A 1 241 ? -29.735 86.074  -14.967 1.00 66.30  ? 241 LEU A N   1 
ATOM 1498  C CA  . LEU A 1 241 ? -30.439 86.677  -16.092 1.00 66.43  ? 241 LEU A CA  1 
ATOM 1499  C C   . LEU A 1 241 ? -29.471 87.226  -17.118 1.00 70.75  ? 241 LEU A C   1 
ATOM 1500  O O   . LEU A 1 241 ? -28.374 87.661  -16.769 1.00 72.72  ? 241 LEU A O   1 
ATOM 1501  C CB  . LEU A 1 241 ? -31.514 87.729  -15.711 1.00 66.62  ? 241 LEU A CB  1 
ATOM 1502  C CG  . LEU A 1 241 ? -31.178 89.063  -15.040 1.00 72.03  ? 241 LEU A CG  1 
ATOM 1503  C CD1 . LEU A 1 241 ? -30.620 90.080  -16.022 1.00 72.35  ? 241 LEU A CD1 1 
ATOM 1504  C CD2 . LEU A 1 241 ? -32.444 89.703  -14.547 1.00 75.16  ? 241 LEU A CD2 1 
ATOM 1505  N N   . LEU A 1 242 ? -29.883 87.178  -18.388 1.00 65.70  ? 242 LEU A N   1 
ATOM 1506  C CA  . LEU A 1 242 ? -29.135 87.694  -19.532 1.00 65.76  ? 242 LEU A CA  1 
ATOM 1507  C C   . LEU A 1 242 ? -29.252 89.227  -19.646 1.00 71.63  ? 242 LEU A C   1 
ATOM 1508  O O   . LEU A 1 242 ? -28.264 89.885  -19.955 1.00 72.45  ? 242 LEU A O   1 
ATOM 1509  C CB  . LEU A 1 242 ? -29.660 87.064  -20.839 1.00 65.15  ? 242 LEU A CB  1 
ATOM 1510  C CG  . LEU A 1 242 ? -29.248 85.649  -21.178 1.00 68.68  ? 242 LEU A CG  1 
ATOM 1511  C CD1 . LEU A 1 242 ? -30.045 85.156  -22.360 1.00 68.68  ? 242 LEU A CD1 1 
ATOM 1512  C CD2 . LEU A 1 242 ? -27.768 85.569  -21.503 1.00 68.91  ? 242 LEU A CD2 1 
ATOM 1513  N N   . GLY A 1 243 ? -30.462 89.752  -19.432 1.00 66.87  ? 243 GLY A N   1 
ATOM 1514  C CA  . GLY A 1 243 ? -30.810 91.158  -19.587 1.00 66.15  ? 243 GLY A CA  1 
ATOM 1515  C C   . GLY A 1 243 ? -31.396 91.363  -20.967 1.00 69.82  ? 243 GLY A C   1 
ATOM 1516  O O   . GLY A 1 243 ? -31.097 92.343  -21.651 1.00 69.62  ? 243 GLY A O   1 
ATOM 1517  N N   . ILE A 1 244 ? -32.219 90.398  -21.378 1.00 65.87  ? 244 ILE A N   1 
ATOM 1518  C CA  . ILE A 1 244 ? -32.866 90.289  -22.671 1.00 65.39  ? 244 ILE A CA  1 
ATOM 1519  C C   . ILE A 1 244 ? -34.394 90.280  -22.503 1.00 67.76  ? 244 ILE A C   1 
ATOM 1520  O O   . ILE A 1 244 ? -34.913 89.752  -21.526 1.00 67.98  ? 244 ILE A O   1 
ATOM 1521  C CB  . ILE A 1 244 ? -32.315 88.961  -23.314 1.00 69.04  ? 244 ILE A CB  1 
ATOM 1522  C CG1 . ILE A 1 244 ? -30.909 89.140  -23.918 1.00 69.85  ? 244 ILE A CG1 1 
ATOM 1523  C CG2 . ILE A 1 244 ? -33.272 88.199  -24.261 1.00 69.96  ? 244 ILE A CG2 1 
ATOM 1524  C CD1 . ILE A 1 244 ? -30.712 90.324  -24.798 1.00 78.15  ? 244 ILE A CD1 1 
ATOM 1525  N N   . LYS A 1 245 ? -35.091 90.886  -23.453 1.00 62.60  ? 245 LYS A N   1 
ATOM 1526  C CA  . LYS A 1 245 ? -36.532 90.878  -23.564 1.00 62.36  ? 245 LYS A CA  1 
ATOM 1527  C C   . LYS A 1 245 ? -36.818 90.400  -24.951 1.00 67.23  ? 245 LYS A C   1 
ATOM 1528  O O   . LYS A 1 245 ? -36.221 90.887  -25.914 1.00 67.39  ? 245 LYS A O   1 
ATOM 1529  C CB  . LYS A 1 245 ? -37.176 92.243  -23.262 1.00 65.09  ? 245 LYS A CB  1 
ATOM 1530  C CG  . LYS A 1 245 ? -37.841 92.301  -21.890 1.00 86.99  ? 245 LYS A CG  1 
ATOM 1531  C CD  . LYS A 1 245 ? -38.813 93.476  -21.773 1.00 102.86 ? 245 LYS A CD  1 
ATOM 1532  C CE  . LYS A 1 245 ? -38.225 94.643  -21.008 1.00 116.98 ? 245 LYS A CE  1 
ATOM 1533  N NZ  . LYS A 1 245 ? -39.149 95.809  -20.977 1.00 124.54 ? 245 LYS A NZ  1 
ATOM 1534  N N   . GLY A 1 246 ? -37.659 89.388  -25.051 1.00 64.14  ? 246 GLY A N   1 
ATOM 1535  C CA  . GLY A 1 246 ? -37.977 88.822  -26.346 1.00 63.82  ? 246 GLY A CA  1 
ATOM 1536  C C   . GLY A 1 246 ? -39.191 87.940  -26.409 1.00 69.82  ? 246 GLY A C   1 
ATOM 1537  O O   . GLY A 1 246 ? -39.873 87.699  -25.408 1.00 72.03  ? 246 GLY A O   1 
ATOM 1538  N N   . THR A 1 247 ? -39.458 87.471  -27.614 1.00 65.16  ? 247 THR A N   1 
ATOM 1539  C CA  . THR A 1 247 ? -40.564 86.595  -27.939 1.00 64.34  ? 247 THR A CA  1 
ATOM 1540  C C   . THR A 1 247 ? -40.028 85.316  -28.560 1.00 66.16  ? 247 THR A C   1 
ATOM 1541  O O   . THR A 1 247 ? -38.822 85.160  -28.762 1.00 64.29  ? 247 THR A O   1 
ATOM 1542  C CB  . THR A 1 247 ? -41.561 87.306  -28.881 1.00 73.96  ? 247 THR A CB  1 
ATOM 1543  O OG1 . THR A 1 247 ? -40.908 87.742  -30.077 1.00 72.65  ? 247 THR A OG1 1 
ATOM 1544  C CG2 . THR A 1 247 ? -42.327 88.418  -28.200 1.00 72.74  ? 247 THR A CG2 1 
ATOM 1545  N N   . GLU A 1 248 ? -40.940 84.398  -28.848 1.00 63.26  ? 248 GLU A N   1 
ATOM 1546  C CA  . GLU A 1 248 ? -40.615 83.154  -29.498 1.00 63.38  ? 248 GLU A CA  1 
ATOM 1547  C C   . GLU A 1 248 ? -40.318 83.407  -30.958 1.00 67.40  ? 248 GLU A C   1 
ATOM 1548  O O   . GLU A 1 248 ? -41.033 84.167  -31.624 1.00 66.54  ? 248 GLU A O   1 
ATOM 1549  C CB  . GLU A 1 248 ? -41.782 82.149  -29.363 1.00 64.65  ? 248 GLU A CB  1 
ATOM 1550  C CG  . GLU A 1 248 ? -41.893 81.484  -28.000 1.00 70.64  ? 248 GLU A CG  1 
ATOM 1551  C CD  . GLU A 1 248 ? -40.819 80.480  -27.622 1.00 80.26  ? 248 GLU A CD  1 
ATOM 1552  O OE1 . GLU A 1 248 ? -40.018 80.076  -28.498 1.00 59.86  ? 248 GLU A OE1 1 
ATOM 1553  O OE2 . GLU A 1 248 ? -40.781 80.096  -26.432 1.00 81.63  ? 248 GLU A OE2 1 
ATOM 1554  N N   . MET A 1 249 ? -39.259 82.769  -31.448 1.00 63.67  ? 249 MET A N   1 
ATOM 1555  C CA  . MET A 1 249 ? -38.913 82.790  -32.848 1.00 63.46  ? 249 MET A CA  1 
ATOM 1556  C C   . MET A 1 249 ? -39.956 81.917  -33.561 1.00 67.99  ? 249 MET A C   1 
ATOM 1557  O O   . MET A 1 249 ? -40.331 80.874  -33.023 1.00 69.36  ? 249 MET A O   1 
ATOM 1558  C CB  . MET A 1 249 ? -37.461 82.286  -33.022 1.00 65.59  ? 249 MET A CB  1 
ATOM 1559  C CG  . MET A 1 249 ? -36.983 82.120  -34.469 1.00 68.79  ? 249 MET A CG  1 
ATOM 1560  S SD  . MET A 1 249 ? -37.305 83.434  -35.689 1.00 72.73  ? 249 MET A SD  1 
ATOM 1561  C CE  . MET A 1 249 ? -37.088 84.814  -34.727 1.00 69.80  ? 249 MET A CE  1 
ATOM 1562  N N   . SER A 1 250 ? -40.484 82.372  -34.708 1.00 62.48  ? 250 SER A N   1 
ATOM 1563  C CA  . SER A 1 250 ? -41.495 81.627  -35.463 1.00 60.93  ? 250 SER A CA  1 
ATOM 1564  C C   . SER A 1 250 ? -41.101 81.449  -36.913 1.00 62.71  ? 250 SER A C   1 
ATOM 1565  O O   . SER A 1 250 ? -40.172 82.099  -37.394 1.00 62.48  ? 250 SER A O   1 
ATOM 1566  C CB  . SER A 1 250 ? -42.852 82.323  -35.381 1.00 64.34  ? 250 SER A CB  1 
ATOM 1567  O OG  . SER A 1 250 ? -42.856 83.617  -35.960 1.00 74.82  ? 250 SER A OG  1 
ATOM 1568  N N   . ALA A 1 251 ? -41.833 80.580  -37.617 1.00 59.79  ? 251 ALA A N   1 
ATOM 1569  C CA  . ALA A 1 251 ? -41.677 80.323  -39.056 1.00 59.99  ? 251 ALA A CA  1 
ATOM 1570  C C   . ALA A 1 251 ? -42.007 81.587  -39.855 1.00 66.53  ? 251 ALA A C   1 
ATOM 1571  O O   . ALA A 1 251 ? -41.481 81.782  -40.950 1.00 68.23  ? 251 ALA A O   1 
ATOM 1572  C CB  . ALA A 1 251 ? -42.592 79.183  -39.483 1.00 60.17  ? 251 ALA A CB  1 
ATOM 1573  N N   . ASP A 1 252 ? -42.866 82.448  -39.281 1.00 62.44  ? 252 ASP A N   1 
ATOM 1574  C CA  . ASP A 1 252 ? -43.340 83.705  -39.845 1.00 61.75  ? 252 ASP A CA  1 
ATOM 1575  C C   . ASP A 1 252 ? -42.221 84.732  -39.858 1.00 62.69  ? 252 ASP A C   1 
ATOM 1576  O O   . ASP A 1 252 ? -41.977 85.329  -40.907 1.00 60.66  ? 252 ASP A O   1 
ATOM 1577  C CB  . ASP A 1 252 ? -44.571 84.199  -39.075 1.00 64.37  ? 252 ASP A CB  1 
ATOM 1578  C CG  . ASP A 1 252 ? -45.643 83.118  -38.934 1.00 81.59  ? 252 ASP A CG  1 
ATOM 1579  O OD1 . ASP A 1 252 ? -46.180 82.671  -39.976 1.00 80.35  ? 252 ASP A OD1 1 
ATOM 1580  O OD2 . ASP A 1 252 ? -45.873 82.651  -37.789 1.00 92.73  ? 252 ASP A OD2 1 
ATOM 1581  N N   . ILE A 1 253 ? -41.497 84.891  -38.733 1.00 60.34  ? 253 ILE A N   1 
ATOM 1582  C CA  . ILE A 1 253 ? -40.333 85.786  -38.669 1.00 61.03  ? 253 ILE A CA  1 
ATOM 1583  C C   . ILE A 1 253 ? -39.289 85.294  -39.683 1.00 64.21  ? 253 ILE A C   1 
ATOM 1584  O O   . ILE A 1 253 ? -38.793 86.093  -40.468 1.00 62.43  ? 253 ILE A O   1 
ATOM 1585  C CB  . ILE A 1 253 ? -39.714 85.900  -37.242 1.00 65.10  ? 253 ILE A CB  1 
ATOM 1586  C CG1 . ILE A 1 253 ? -40.749 86.120  -36.104 1.00 65.95  ? 253 ILE A CG1 1 
ATOM 1587  C CG2 . ILE A 1 253 ? -38.567 86.915  -37.199 1.00 66.73  ? 253 ILE A CG2 1 
ATOM 1588  C CD1 . ILE A 1 253 ? -41.529 87.387  -36.126 1.00 78.17  ? 253 ILE A CD1 1 
ATOM 1589  N N   . ALA A 1 254 ? -38.997 83.973  -39.685 1.00 61.87  ? 254 ALA A N   1 
ATOM 1590  C CA  . ALA A 1 254 ? -38.048 83.298  -40.568 1.00 61.64  ? 254 ALA A CA  1 
ATOM 1591  C C   . ALA A 1 254 ? -38.346 83.564  -42.042 1.00 67.43  ? 254 ALA A C   1 
ATOM 1592  O O   . ALA A 1 254 ? -37.426 83.910  -42.783 1.00 67.68  ? 254 ALA A O   1 
ATOM 1593  C CB  . ALA A 1 254 ? -38.074 81.802  -40.304 1.00 62.38  ? 254 ALA A CB  1 
ATOM 1594  N N   . LYS A 1 255 ? -39.621 83.416  -42.466 1.00 65.02  ? 255 LYS A N   1 
ATOM 1595  C CA  . LYS A 1 255 ? -40.029 83.637  -43.861 1.00 65.15  ? 255 LYS A CA  1 
ATOM 1596  C C   . LYS A 1 255 ? -39.822 85.107  -44.273 1.00 70.13  ? 255 LYS A C   1 
ATOM 1597  O O   . LYS A 1 255 ? -39.272 85.381  -45.343 1.00 69.99  ? 255 LYS A O   1 
ATOM 1598  C CB  . LYS A 1 255 ? -41.485 83.203  -44.089 1.00 67.08  ? 255 LYS A CB  1 
ATOM 1599  C CG  . LYS A 1 255 ? -41.596 81.840  -44.767 1.00 76.00  ? 255 LYS A CG  1 
ATOM 1600  C CD  . LYS A 1 255 ? -42.980 81.236  -44.588 1.00 85.93  ? 255 LYS A CD  1 
ATOM 1601  C CE  . LYS A 1 255 ? -42.951 79.732  -44.448 1.00 95.00  ? 255 LYS A CE  1 
ATOM 1602  N NZ  . LYS A 1 255 ? -43.972 79.235  -43.479 1.00 98.90  ? 255 LYS A NZ  1 
ATOM 1603  N N   . ALA A 1 256 ? -40.198 86.035  -43.388 1.00 67.41  ? 256 ALA A N   1 
ATOM 1604  C CA  . ALA A 1 256 ? -40.072 87.478  -43.593 1.00 67.43  ? 256 ALA A CA  1 
ATOM 1605  C C   . ALA A 1 256 ? -38.623 87.923  -43.822 1.00 73.25  ? 256 ALA A C   1 
ATOM 1606  O O   . ALA A 1 256 ? -38.405 88.859  -44.596 1.00 73.22  ? 256 ALA A O   1 
ATOM 1607  C CB  . ALA A 1 256 ? -40.645 88.225  -42.402 1.00 67.76  ? 256 ALA A CB  1 
ATOM 1608  N N   . PHE A 1 257 ? -37.639 87.258  -43.160 1.00 69.75  ? 257 PHE A N   1 
ATOM 1609  C CA  . PHE A 1 257 ? -36.220 87.627  -43.247 1.00 68.62  ? 257 PHE A CA  1 
ATOM 1610  C C   . PHE A 1 257 ? -35.349 86.581  -43.949 1.00 70.15  ? 257 PHE A C   1 
ATOM 1611  O O   . PHE A 1 257 ? -34.118 86.639  -43.848 1.00 67.84  ? 257 PHE A O   1 
ATOM 1612  C CB  . PHE A 1 257 ? -35.679 87.925  -41.847 1.00 70.65  ? 257 PHE A CB  1 
ATOM 1613  C CG  . PHE A 1 257 ? -36.458 89.009  -41.141 1.00 72.80  ? 257 PHE A CG  1 
ATOM 1614  C CD1 . PHE A 1 257 ? -36.999 88.788  -39.882 1.00 76.58  ? 257 PHE A CD1 1 
ATOM 1615  C CD2 . PHE A 1 257 ? -36.687 90.241  -41.752 1.00 75.61  ? 257 PHE A CD2 1 
ATOM 1616  C CE1 . PHE A 1 257 ? -37.738 89.790  -39.231 1.00 77.27  ? 257 PHE A CE1 1 
ATOM 1617  C CE2 . PHE A 1 257 ? -37.437 91.238  -41.106 1.00 78.48  ? 257 PHE A CE2 1 
ATOM 1618  C CZ  . PHE A 1 257 ? -37.954 91.005  -39.848 1.00 76.16  ? 257 PHE A CZ  1 
ATOM 1619  N N   . ASN A 1 258 ? -35.994 85.660  -44.705 1.00 67.56  ? 258 ASN A N   1 
ATOM 1620  C CA  . ASN A 1 258 ? -35.377 84.583  -45.492 1.00 67.25  ? 258 ASN A CA  1 
ATOM 1621  C C   . ASN A 1 258 ? -34.343 83.775  -44.667 1.00 69.58  ? 258 ASN A C   1 
ATOM 1622  O O   . ASN A 1 258 ? -33.235 83.508  -45.150 1.00 69.54  ? 258 ASN A O   1 
ATOM 1623  C CB  . ASN A 1 258 ? -34.735 85.155  -46.758 1.00 70.96  ? 258 ASN A CB  1 
ATOM 1624  C CG  . ASN A 1 258 ? -34.996 84.334  -47.984 1.00 111.44 ? 258 ASN A CG  1 
ATOM 1625  O OD1 . ASN A 1 258 ? -34.507 83.205  -48.139 1.00 105.32 ? 258 ASN A OD1 1 
ATOM 1626  N ND2 . ASN A 1 258 ? -35.778 84.901  -48.890 1.00 110.96 ? 258 ASN A ND2 1 
ATOM 1627  N N   . LEU A 1 259 ? -34.725 83.367  -43.432 1.00 63.51  ? 259 LEU A N   1 
ATOM 1628  C CA  . LEU A 1 259 ? -33.862 82.605  -42.518 1.00 62.29  ? 259 LEU A CA  1 
ATOM 1629  C C   . LEU A 1 259 ? -34.196 81.116  -42.544 1.00 65.27  ? 259 LEU A C   1 
ATOM 1630  O O   . LEU A 1 259 ? -35.349 80.757  -42.814 1.00 62.46  ? 259 LEU A O   1 
ATOM 1631  C CB  . LEU A 1 259 ? -33.979 83.142  -41.090 1.00 62.22  ? 259 LEU A CB  1 
ATOM 1632  C CG  . LEU A 1 259 ? -33.853 84.650  -40.920 1.00 66.74  ? 259 LEU A CG  1 
ATOM 1633  C CD1 . LEU A 1 259 ? -34.341 85.067  -39.559 1.00 67.01  ? 259 LEU A CD1 1 
ATOM 1634  C CD2 . LEU A 1 259 ? -32.427 85.116  -41.162 1.00 67.34  ? 259 LEU A CD2 1 
ATOM 1635  N N   . ASP A 1 260 ? -33.180 80.251  -42.264 1.00 64.57  ? 260 ASP A N   1 
ATOM 1636  C CA  . ASP A 1 260 ? -33.348 78.795  -42.291 1.00 65.63  ? 260 ASP A CA  1 
ATOM 1637  C C   . ASP A 1 260 ? -33.480 78.175  -40.877 1.00 71.10  ? 260 ASP A C   1 
ATOM 1638  O O   . ASP A 1 260 ? -33.420 76.953  -40.734 1.00 72.22  ? 260 ASP A O   1 
ATOM 1639  C CB  . ASP A 1 260 ? -32.254 78.109  -43.109 1.00 68.08  ? 260 ASP A CB  1 
ATOM 1640  C CG  . ASP A 1 260 ? -32.466 78.266  -44.621 1.00 86.32  ? 260 ASP A CG  1 
ATOM 1641  O OD1 . ASP A 1 260 ? -32.890 77.273  -45.280 1.00 86.01  ? 260 ASP A OD1 1 
ATOM 1642  O OD2 . ASP A 1 260 ? -32.231 79.385  -45.143 1.00 96.38  ? 260 ASP A OD2 1 
ATOM 1643  N N   . VAL A 1 261 ? -33.770 79.007  -39.867 1.00 66.56  ? 261 VAL A N   1 
ATOM 1644  C CA  . VAL A 1 261 ? -34.041 78.586  -38.489 1.00 66.05  ? 261 VAL A CA  1 
ATOM 1645  C C   . VAL A 1 261 ? -35.397 79.197  -38.085 1.00 66.74  ? 261 VAL A C   1 
ATOM 1646  O O   . VAL A 1 261 ? -35.663 80.345  -38.439 1.00 66.02  ? 261 VAL A O   1 
ATOM 1647  C CB  . VAL A 1 261 ? -32.878 78.922  -37.494 1.00 70.73  ? 261 VAL A CB  1 
ATOM 1648  C CG1 . VAL A 1 261 ? -32.614 80.421  -37.402 1.00 70.77  ? 261 VAL A CG1 1 
ATOM 1649  C CG2 . VAL A 1 261 ? -33.122 78.325  -36.100 1.00 70.50  ? 261 VAL A CG2 1 
ATOM 1650  N N   . GLN A 1 262 ? -36.261 78.428  -37.390 1.00 61.12  ? 262 GLN A N   1 
ATOM 1651  C CA  . GLN A 1 262 ? -37.600 78.922  -37.007 1.00 59.38  ? 262 GLN A CA  1 
ATOM 1652  C C   . GLN A 1 262 ? -37.890 78.723  -35.518 1.00 60.95  ? 262 GLN A C   1 
ATOM 1653  O O   . GLN A 1 262 ? -38.990 79.053  -35.069 1.00 59.40  ? 262 GLN A O   1 
ATOM 1654  C CB  . GLN A 1 262 ? -38.730 78.310  -37.860 1.00 59.78  ? 262 GLN A CB  1 
ATOM 1655  C CG  . GLN A 1 262 ? -38.418 76.965  -38.507 1.00 77.42  ? 262 GLN A CG  1 
ATOM 1656  C CD  . GLN A 1 262 ? -37.567 77.040  -39.750 1.00 93.25  ? 262 GLN A CD  1 
ATOM 1657  O OE1 . GLN A 1 262 ? -36.617 76.272  -39.921 1.00 91.47  ? 262 GLN A OE1 1 
ATOM 1658  N NE2 . GLN A 1 262 ? -37.906 77.929  -40.663 1.00 80.48  ? 262 GLN A NE2 1 
ATOM 1659  N N   . ARG A 1 263 ? -36.894 78.232  -34.749 1.00 56.56  ? 263 ARG A N   1 
ATOM 1660  C CA  . ARG A 1 263 ? -37.028 78.014  -33.308 1.00 55.97  ? 263 ARG A CA  1 
ATOM 1661  C C   . ARG A 1 263 ? -35.895 78.712  -32.576 1.00 61.55  ? 263 ARG A C   1 
ATOM 1662  O O   . ARG A 1 263 ? -34.743 78.682  -33.032 1.00 61.60  ? 263 ARG A O   1 
ATOM 1663  C CB  . ARG A 1 263 ? -37.067 76.519  -32.964 1.00 55.30  ? 263 ARG A CB  1 
ATOM 1664  C CG  . ARG A 1 263 ? -38.280 75.792  -33.546 1.00 66.95  ? 263 ARG A CG  1 
ATOM 1665  C CD  . ARG A 1 263 ? -38.546 74.446  -32.913 1.00 79.27  ? 263 ARG A CD  1 
ATOM 1666  N NE  . ARG A 1 263 ? -37.427 73.521  -33.089 1.00 97.85  ? 263 ARG A NE  1 
ATOM 1667  C CZ  . ARG A 1 263 ? -37.493 72.213  -32.873 1.00 122.16 ? 263 ARG A CZ  1 
ATOM 1668  N NH1 . ARG A 1 263 ? -38.637 71.653  -32.493 1.00 113.12 ? 263 ARG A NH1 1 
ATOM 1669  N NH2 . ARG A 1 263 ? -36.423 71.450  -33.053 1.00 112.14 ? 263 ARG A NH2 1 
ATOM 1670  N N   . GLY A 1 264 ? -36.239 79.333  -31.450 1.00 58.33  ? 264 GLY A N   1 
ATOM 1671  C CA  . GLY A 1 264 ? -35.298 80.061  -30.613 1.00 57.88  ? 264 GLY A CA  1 
ATOM 1672  C C   . GLY A 1 264 ? -35.898 81.312  -30.015 1.00 62.08  ? 264 GLY A C   1 
ATOM 1673  O O   . GLY A 1 264 ? -37.118 81.400  -29.860 1.00 62.60  ? 264 GLY A O   1 
ATOM 1674  N N   . ALA A 1 265 ? -35.042 82.304  -29.693 1.00 57.63  ? 265 ALA A N   1 
ATOM 1675  C CA  . ALA A 1 265 ? -35.472 83.561  -29.092 1.00 56.30  ? 265 ALA A CA  1 
ATOM 1676  C C   . ALA A 1 265 ? -35.267 84.736  -30.023 1.00 61.22  ? 265 ALA A C   1 
ATOM 1677  O O   . ALA A 1 265 ? -34.190 84.924  -30.565 1.00 61.45  ? 265 ALA A O   1 
ATOM 1678  C CB  . ALA A 1 265 ? -34.726 83.798  -27.798 1.00 56.60  ? 265 ALA A CB  1 
ATOM 1679  N N   . PHE A 1 266 ? -36.307 85.528  -30.206 1.00 59.19  ? 266 PHE A N   1 
ATOM 1680  C CA  . PHE A 1 266 ? -36.249 86.746  -30.987 1.00 59.33  ? 266 PHE A CA  1 
ATOM 1681  C C   . PHE A 1 266 ? -36.064 87.888  -30.000 1.00 60.87  ? 266 PHE A C   1 
ATOM 1682  O O   . PHE A 1 266 ? -36.941 88.108  -29.175 1.00 60.61  ? 266 PHE A O   1 
ATOM 1683  C CB  . PHE A 1 266 ? -37.518 86.905  -31.833 1.00 61.83  ? 266 PHE A CB  1 
ATOM 1684  C CG  . PHE A 1 266 ? -37.538 88.173  -32.647 1.00 63.94  ? 266 PHE A CG  1 
ATOM 1685  C CD1 . PHE A 1 266 ? -38.334 89.246  -32.269 1.00 67.95  ? 266 PHE A CD1 1 
ATOM 1686  C CD2 . PHE A 1 266 ? -36.733 88.308  -33.768 1.00 66.45  ? 266 PHE A CD2 1 
ATOM 1687  C CE1 . PHE A 1 266 ? -38.346 90.424  -33.013 1.00 69.37  ? 266 PHE A CE1 1 
ATOM 1688  C CE2 . PHE A 1 266 ? -36.735 89.489  -34.504 1.00 70.03  ? 266 PHE A CE2 1 
ATOM 1689  C CZ  . PHE A 1 266 ? -37.545 90.539  -34.124 1.00 68.64  ? 266 PHE A CZ  1 
ATOM 1690  N N   . VAL A 1 267 ? -34.907 88.573  -30.037 1.00 55.58  ? 267 VAL A N   1 
ATOM 1691  C CA  . VAL A 1 267 ? -34.586 89.651  -29.089 1.00 53.43  ? 267 VAL A CA  1 
ATOM 1692  C C   . VAL A 1 267 ? -35.220 90.946  -29.549 1.00 57.51  ? 267 VAL A C   1 
ATOM 1693  O O   . VAL A 1 267 ? -34.985 91.380  -30.670 1.00 56.66  ? 267 VAL A O   1 
ATOM 1694  C CB  . VAL A 1 267 ? -33.060 89.820  -28.872 1.00 55.18  ? 267 VAL A CB  1 
ATOM 1695  C CG1 . VAL A 1 267 ? -32.761 90.886  -27.819 1.00 54.14  ? 267 VAL A CG1 1 
ATOM 1696  C CG2 . VAL A 1 267 ? -32.418 88.496  -28.485 1.00 54.60  ? 267 VAL A CG2 1 
ATOM 1697  N N   . SER A 1 268 ? -36.029 91.555  -28.681 1.00 54.77  ? 268 SER A N   1 
ATOM 1698  C CA  . SER A 1 268 ? -36.685 92.823  -28.968 1.00 54.76  ? 268 SER A CA  1 
ATOM 1699  C C   . SER A 1 268 ? -36.003 93.954  -28.198 1.00 60.43  ? 268 SER A C   1 
ATOM 1700  O O   . SER A 1 268 ? -36.018 95.103  -28.636 1.00 61.93  ? 268 SER A O   1 
ATOM 1701  C CB  . SER A 1 268 ? -38.173 92.754  -28.622 1.00 57.77  ? 268 SER A CB  1 
ATOM 1702  O OG  . SER A 1 268 ? -38.435 92.536  -27.245 1.00 63.37  ? 268 SER A OG  1 
ATOM 1703  N N   . GLU A 1 269 ? -35.423 93.634  -27.052 1.00 56.69  ? 269 GLU A N   1 
ATOM 1704  C CA  . GLU A 1 269 ? -34.761 94.602  -26.196 1.00 57.55  ? 269 GLU A CA  1 
ATOM 1705  C C   . GLU A 1 269 ? -33.549 94.010  -25.511 1.00 62.76  ? 269 GLU A C   1 
ATOM 1706  O O   . GLU A 1 269 ? -33.567 92.863  -25.079 1.00 62.90  ? 269 GLU A O   1 
ATOM 1707  C CB  . GLU A 1 269 ? -35.726 95.114  -25.097 1.00 58.96  ? 269 GLU A CB  1 
ATOM 1708  C CG  . GLU A 1 269 ? -36.577 96.314  -25.450 1.00 71.75  ? 269 GLU A CG  1 
ATOM 1709  C CD  . GLU A 1 269 ? -37.082 97.036  -24.214 1.00 106.67 ? 269 GLU A CD  1 
ATOM 1710  O OE1 . GLU A 1 269 ? -36.334 97.883  -23.669 1.00 105.88 ? 269 GLU A OE1 1 
ATOM 1711  O OE2 . GLU A 1 269 ? -38.208 96.721  -23.763 1.00 105.82 ? 269 GLU A OE2 1 
ATOM 1712  N N   . VAL A 1 270 ? -32.523 94.823  -25.349 1.00 59.95  ? 270 VAL A N   1 
ATOM 1713  C CA  . VAL A 1 270 ? -31.338 94.479  -24.578 1.00 59.39  ? 270 VAL A CA  1 
ATOM 1714  C C   . VAL A 1 270 ? -31.262 95.533  -23.474 1.00 67.35  ? 270 VAL A C   1 
ATOM 1715  O O   . VAL A 1 270 ? -31.169 96.724  -23.769 1.00 66.22  ? 270 VAL A O   1 
ATOM 1716  C CB  . VAL A 1 270 ? -30.056 94.382  -25.426 1.00 61.49  ? 270 VAL A CB  1 
ATOM 1717  C CG1 . VAL A 1 270 ? -28.905 93.844  -24.593 1.00 61.42  ? 270 VAL A CG1 1 
ATOM 1718  C CG2 . VAL A 1 270 ? -30.271 93.526  -26.665 1.00 60.59  ? 270 VAL A CG2 1 
ATOM 1719  N N   . LEU A 1 271 ? -31.396 95.111  -22.215 1.00 68.49  ? 271 LEU A N   1 
ATOM 1720  C CA  . LEU A 1 271 ? -31.390 96.038  -21.084 1.00 70.38  ? 271 LEU A CA  1 
ATOM 1721  C C   . LEU A 1 271 ? -29.989 96.656  -20.888 1.00 79.39  ? 271 LEU A C   1 
ATOM 1722  O O   . LEU A 1 271 ? -28.989 95.939  -20.951 1.00 79.87  ? 271 LEU A O   1 
ATOM 1723  C CB  . LEU A 1 271 ? -31.896 95.355  -19.806 1.00 70.55  ? 271 LEU A CB  1 
ATOM 1724  C CG  . LEU A 1 271 ? -33.266 94.637  -19.942 1.00 75.71  ? 271 LEU A CG  1 
ATOM 1725  C CD1 . LEU A 1 271 ? -33.562 93.767  -18.725 1.00 75.90  ? 271 LEU A CD1 1 
ATOM 1726  C CD2 . LEU A 1 271 ? -34.428 95.627  -20.230 1.00 77.60  ? 271 LEU A CD2 1 
ATOM 1727  N N   . PRO A 1 272 ? -29.889 98.001  -20.772 1.00 78.60  ? 272 PRO A N   1 
ATOM 1728  C CA  . PRO A 1 272 ? -28.563 98.627  -20.642 1.00 78.88  ? 272 PRO A CA  1 
ATOM 1729  C C   . PRO A 1 272 ? -27.912 98.312  -19.298 1.00 83.69  ? 272 PRO A C   1 
ATOM 1730  O O   . PRO A 1 272 ? -28.592 98.303  -18.258 1.00 83.15  ? 272 PRO A O   1 
ATOM 1731  C CB  . PRO A 1 272 ? -28.857 100.128 -20.791 1.00 80.72  ? 272 PRO A CB  1 
ATOM 1732  C CG  . PRO A 1 272 ? -30.277 100.220 -21.291 1.00 85.11  ? 272 PRO A CG  1 
ATOM 1733  C CD  . PRO A 1 272 ? -30.958 99.016  -20.736 1.00 80.58  ? 272 PRO A CD  1 
ATOM 1734  N N   . GLY A 1 273 ? -26.607 98.028  -19.350 1.00 80.15  ? 273 GLY A N   1 
ATOM 1735  C CA  . GLY A 1 273 ? -25.809 97.679  -18.178 1.00 79.81  ? 273 GLY A CA  1 
ATOM 1736  C C   . GLY A 1 273 ? -25.787 96.192  -17.872 1.00 82.92  ? 273 GLY A C   1 
ATOM 1737  O O   . GLY A 1 273 ? -25.090 95.748  -16.949 1.00 83.22  ? 273 GLY A O   1 
ATOM 1738  N N   . SER A 1 274 ? -26.554 95.414  -18.644 1.00 77.61  ? 274 SER A N   1 
ATOM 1739  C CA  . SER A 1 274 ? -26.629 93.968  -18.498 1.00 76.60  ? 274 SER A CA  1 
ATOM 1740  C C   . SER A 1 274 ? -25.435 93.294  -19.184 1.00 79.71  ? 274 SER A C   1 
ATOM 1741  O O   . SER A 1 274 ? -24.745 93.926  -20.000 1.00 79.09  ? 274 SER A O   1 
ATOM 1742  C CB  . SER A 1 274 ? -27.936 93.448  -19.085 1.00 78.33  ? 274 SER A CB  1 
ATOM 1743  O OG  . SER A 1 274 ? -27.956 93.598  -20.496 1.00 83.51  ? 274 SER A OG  1 
ATOM 1744  N N   . GLY A 1 275 ? -25.228 92.014  -18.857 1.00 74.71  ? 275 GLY A N   1 
ATOM 1745  C CA  . GLY A 1 275 ? -24.182 91.186  -19.441 1.00 73.40  ? 275 GLY A CA  1 
ATOM 1746  C C   . GLY A 1 275 ? -24.352 91.023  -20.939 1.00 74.69  ? 275 GLY A C   1 
ATOM 1747  O O   . GLY A 1 275 ? -23.368 90.820  -21.641 1.00 75.45  ? 275 GLY A O   1 
ATOM 1748  N N   . SER A 1 276 ? -25.602 91.097  -21.434 1.00 68.53  ? 276 SER A N   1 
ATOM 1749  C CA  . SER A 1 276 ? -25.947 90.996  -22.852 1.00 67.96  ? 276 SER A CA  1 
ATOM 1750  C C   . SER A 1 276 ? -25.590 92.282  -23.588 1.00 72.24  ? 276 SER A C   1 
ATOM 1751  O O   . SER A 1 276 ? -25.167 92.219  -24.743 1.00 71.78  ? 276 SER A O   1 
ATOM 1752  C CB  . SER A 1 276 ? -27.429 90.680  -23.030 1.00 69.83  ? 276 SER A CB  1 
ATOM 1753  O OG  . SER A 1 276 ? -27.735 89.350  -22.645 1.00 73.02  ? 276 SER A OG  1 
ATOM 1754  N N   . ALA A 1 277 ? -25.771 93.449  -22.917 1.00 68.98  ? 277 ALA A N   1 
ATOM 1755  C CA  . ALA A 1 277 ? -25.425 94.778  -23.442 1.00 67.98  ? 277 ALA A CA  1 
ATOM 1756  C C   . ALA A 1 277 ? -23.904 94.861  -23.648 1.00 70.50  ? 277 ALA A C   1 
ATOM 1757  O O   . ALA A 1 277 ? -23.440 95.123  -24.768 1.00 69.72  ? 277 ALA A O   1 
ATOM 1758  C CB  . ALA A 1 277 ? -25.909 95.866  -22.481 1.00 68.36  ? 277 ALA A CB  1 
ATOM 1759  N N   . LYS A 1 278 ? -23.146 94.522  -22.577 1.00 66.06  ? 278 LYS A N   1 
ATOM 1760  C CA  . LYS A 1 278 ? -21.685 94.503  -22.534 1.00 65.65  ? 278 LYS A CA  1 
ATOM 1761  C C   . LYS A 1 278 ? -21.091 93.537  -23.577 1.00 70.87  ? 278 LYS A C   1 
ATOM 1762  O O   . LYS A 1 278 ? -20.066 93.848  -24.191 1.00 71.30  ? 278 LYS A O   1 
ATOM 1763  C CB  . LYS A 1 278 ? -21.203 94.119  -21.127 1.00 67.61  ? 278 LYS A CB  1 
ATOM 1764  C CG  . LYS A 1 278 ? -21.481 95.171  -20.062 1.00 81.72  ? 278 LYS A CG  1 
ATOM 1765  C CD  . LYS A 1 278 ? -21.488 94.578  -18.659 1.00 90.56  ? 278 LYS A CD  1 
ATOM 1766  C CE  . LYS A 1 278 ? -21.731 95.637  -17.610 1.00 97.81  ? 278 LYS A CE  1 
ATOM 1767  N NZ  . LYS A 1 278 ? -21.892 95.040  -16.259 1.00 105.69 ? 278 LYS A NZ  1 
ATOM 1768  N N   . ALA A 1 279 ? -21.746 92.385  -23.793 1.00 66.82  ? 279 ALA A N   1 
ATOM 1769  C CA  . ALA A 1 279 ? -21.300 91.360  -24.738 1.00 65.94  ? 279 ALA A CA  1 
ATOM 1770  C C   . ALA A 1 279 ? -21.581 91.740  -26.197 1.00 68.62  ? 279 ALA A C   1 
ATOM 1771  O O   . ALA A 1 279 ? -21.013 91.137  -27.111 1.00 68.85  ? 279 ALA A O   1 
ATOM 1772  C CB  . ALA A 1 279 ? -21.966 90.037  -24.411 1.00 66.42  ? 279 ALA A CB  1 
ATOM 1773  N N   . GLY A 1 280 ? -22.456 92.714  -26.403 1.00 63.39  ? 280 GLY A N   1 
ATOM 1774  C CA  . GLY A 1 280 ? -22.816 93.169  -27.738 1.00 62.35  ? 280 GLY A CA  1 
ATOM 1775  C C   . GLY A 1 280 ? -24.052 92.533  -28.343 1.00 64.65  ? 280 GLY A C   1 
ATOM 1776  O O   . GLY A 1 280 ? -24.169 92.473  -29.571 1.00 63.24  ? 280 GLY A O   1 
ATOM 1777  N N   . VAL A 1 281 ? -24.992 92.050  -27.498 1.00 61.22  ? 281 VAL A N   1 
ATOM 1778  C CA  . VAL A 1 281 ? -26.261 91.502  -27.995 1.00 60.81  ? 281 VAL A CA  1 
ATOM 1779  C C   . VAL A 1 281 ? -27.116 92.717  -28.427 1.00 64.96  ? 281 VAL A C   1 
ATOM 1780  O O   . VAL A 1 281 ? -27.112 93.751  -27.742 1.00 63.63  ? 281 VAL A O   1 
ATOM 1781  C CB  . VAL A 1 281 ? -27.010 90.555  -27.006 1.00 63.62  ? 281 VAL A CB  1 
ATOM 1782  C CG1 . VAL A 1 281 ? -28.210 89.893  -27.686 1.00 62.82  ? 281 VAL A CG1 1 
ATOM 1783  C CG2 . VAL A 1 281 ? -26.081 89.493  -26.421 1.00 63.07  ? 281 VAL A CG2 1 
ATOM 1784  N N   . LYS A 1 282 ? -27.788 92.607  -29.594 1.00 61.79  ? 282 LYS A N   1 
ATOM 1785  C CA  . LYS A 1 282 ? -28.582 93.694  -30.170 1.00 61.11  ? 282 LYS A CA  1 
ATOM 1786  C C   . LYS A 1 282 ? -30.036 93.278  -30.551 1.00 62.01  ? 282 LYS A C   1 
ATOM 1787  O O   . LYS A 1 282 ? -30.254 92.255  -31.203 1.00 60.30  ? 282 LYS A O   1 
ATOM 1788  C CB  . LYS A 1 282 ? -27.855 94.265  -31.416 1.00 63.73  ? 282 LYS A CB  1 
ATOM 1789  C CG  . LYS A 1 282 ? -26.601 95.067  -31.080 1.00 80.06  ? 282 LYS A CG  1 
ATOM 1790  C CD  . LYS A 1 282 ? -25.728 95.271  -32.300 1.00 95.22  ? 282 LYS A CD  1 
ATOM 1791  C CE  . LYS A 1 282 ? -24.411 95.925  -31.947 1.00 107.61 ? 282 LYS A CE  1 
ATOM 1792  N NZ  . LYS A 1 282 ? -23.637 96.323  -33.157 1.00 114.94 ? 282 LYS A NZ  1 
ATOM 1793  N N   . ALA A 1 283 ? -31.022 94.125  -30.186 1.00 57.02  ? 283 ALA A N   1 
ATOM 1794  C CA  . ALA A 1 283 ? -32.426 93.948  -30.561 1.00 56.18  ? 283 ALA A CA  1 
ATOM 1795  C C   . ALA A 1 283 ? -32.527 93.569  -32.051 1.00 61.25  ? 283 ALA A C   1 
ATOM 1796  O O   . ALA A 1 283 ? -31.872 94.176  -32.896 1.00 60.30  ? 283 ALA A O   1 
ATOM 1797  C CB  . ALA A 1 283 ? -33.200 95.225  -30.289 1.00 56.56  ? 283 ALA A CB  1 
ATOM 1798  N N   . GLY A 1 284 ? -33.281 92.518  -32.331 1.00 59.71  ? 284 GLY A N   1 
ATOM 1799  C CA  . GLY A 1 284 ? -33.454 91.953  -33.665 1.00 59.69  ? 284 GLY A CA  1 
ATOM 1800  C C   . GLY A 1 284 ? -32.659 90.675  -33.848 1.00 63.60  ? 284 GLY A C   1 
ATOM 1801  O O   . GLY A 1 284 ? -32.827 89.985  -34.856 1.00 63.12  ? 284 GLY A O   1 
ATOM 1802  N N   . ASP A 1 285 ? -31.782 90.349  -32.873 1.00 61.05  ? 285 ASP A N   1 
ATOM 1803  C CA  . ASP A 1 285 ? -30.978 89.122  -32.916 1.00 61.64  ? 285 ASP A CA  1 
ATOM 1804  C C   . ASP A 1 285 ? -31.848 87.904  -32.640 1.00 66.00  ? 285 ASP A C   1 
ATOM 1805  O O   . ASP A 1 285 ? -32.869 88.003  -31.947 1.00 66.26  ? 285 ASP A O   1 
ATOM 1806  C CB  . ASP A 1 285 ? -29.805 89.160  -31.901 1.00 63.42  ? 285 ASP A CB  1 
ATOM 1807  C CG  . ASP A 1 285 ? -28.680 90.151  -32.188 1.00 73.20  ? 285 ASP A CG  1 
ATOM 1808  O OD1 . ASP A 1 285 ? -28.729 90.830  -33.243 1.00 76.10  ? 285 ASP A OD1 1 
ATOM 1809  O OD2 . ASP A 1 285 ? -27.792 90.301  -31.327 1.00 74.79  ? 285 ASP A OD2 1 
ATOM 1810  N N   . ILE A 1 286 ? -31.434 86.754  -33.177 1.00 60.96  ? 286 ILE A N   1 
ATOM 1811  C CA  . ILE A 1 286 ? -32.146 85.502  -32.980 1.00 59.10  ? 286 ILE A CA  1 
ATOM 1812  C C   . ILE A 1 286 ? -31.194 84.530  -32.293 1.00 61.06  ? 286 ILE A C   1 
ATOM 1813  O O   . ILE A 1 286 ? -30.269 84.023  -32.921 1.00 60.30  ? 286 ILE A O   1 
ATOM 1814  C CB  . ILE A 1 286 ? -32.767 84.956  -34.300 1.00 61.45  ? 286 ILE A CB  1 
ATOM 1815  C CG1 . ILE A 1 286 ? -33.807 85.968  -34.828 1.00 61.80  ? 286 ILE A CG1 1 
ATOM 1816  C CG2 . ILE A 1 286 ? -33.411 83.577  -34.078 1.00 61.26  ? 286 ILE A CG2 1 
ATOM 1817  C CD1 . ILE A 1 286 ? -33.904 86.077  -36.229 1.00 66.76  ? 286 ILE A CD1 1 
ATOM 1818  N N   . ILE A 1 287 ? -31.404 84.310  -30.979 1.00 56.36  ? 287 ILE A N   1 
ATOM 1819  C CA  . ILE A 1 287 ? -30.613 83.370  -30.197 1.00 54.91  ? 287 ILE A CA  1 
ATOM 1820  C C   . ILE A 1 287 ? -31.062 81.963  -30.599 1.00 60.30  ? 287 ILE A C   1 
ATOM 1821  O O   . ILE A 1 287 ? -32.225 81.604  -30.430 1.00 60.73  ? 287 ILE A O   1 
ATOM 1822  C CB  . ILE A 1 287 ? -30.683 83.632  -28.675 1.00 57.19  ? 287 ILE A CB  1 
ATOM 1823  C CG1 . ILE A 1 287 ? -30.372 85.107  -28.353 1.00 56.55  ? 287 ILE A CG1 1 
ATOM 1824  C CG2 . ILE A 1 287 ? -29.730 82.673  -27.915 1.00 57.39  ? 287 ILE A CG2 1 
ATOM 1825  C CD1 . ILE A 1 287 ? -30.697 85.546  -26.938 1.00 67.71  ? 287 ILE A CD1 1 
ATOM 1826  N N   . THR A 1 288 ? -30.137 81.213  -31.191 1.00 57.55  ? 288 THR A N   1 
ATOM 1827  C CA  . THR A 1 288 ? -30.306 79.872  -31.765 1.00 57.37  ? 288 THR A CA  1 
ATOM 1828  C C   . THR A 1 288 ? -29.739 78.778  -30.832 1.00 59.85  ? 288 THR A C   1 
ATOM 1829  O O   . THR A 1 288 ? -30.241 77.652  -30.832 1.00 59.14  ? 288 THR A O   1 
ATOM 1830  C CB  . THR A 1 288 ? -29.572 79.878  -33.133 1.00 68.13  ? 288 THR A CB  1 
ATOM 1831  O OG1 . THR A 1 288 ? -30.321 80.687  -34.032 1.00 74.46  ? 288 THR A OG1 1 
ATOM 1832  C CG2 . THR A 1 288 ? -29.388 78.487  -33.737 1.00 67.57  ? 288 THR A CG2 1 
ATOM 1833  N N   . SER A 1 289 ? -28.656 79.095  -30.101 1.00 54.23  ? 289 SER A N   1 
ATOM 1834  C CA  . SER A 1 289 ? -27.971 78.146  -29.250 1.00 52.80  ? 289 SER A CA  1 
ATOM 1835  C C   . SER A 1 289 ? -27.604 78.719  -27.898 1.00 55.68  ? 289 SER A C   1 
ATOM 1836  O O   . SER A 1 289 ? -27.432 79.929  -27.742 1.00 54.00  ? 289 SER A O   1 
ATOM 1837  C CB  . SER A 1 289 ? -26.685 77.682  -29.923 1.00 56.38  ? 289 SER A CB  1 
ATOM 1838  O OG  . SER A 1 289 ? -26.955 76.964  -31.111 1.00 73.39  ? 289 SER A OG  1 
ATOM 1839  N N   . LEU A 1 290 ? -27.427 77.812  -26.937 1.00 51.85  ? 290 LEU A N   1 
ATOM 1840  C CA  . LEU A 1 290 ? -26.911 78.085  -25.624 1.00 52.13  ? 290 LEU A CA  1 
ATOM 1841  C C   . LEU A 1 290 ? -25.837 77.047  -25.374 1.00 58.27  ? 290 LEU A C   1 
ATOM 1842  O O   . LEU A 1 290 ? -26.138 75.852  -25.414 1.00 59.44  ? 290 LEU A O   1 
ATOM 1843  C CB  . LEU A 1 290 ? -28.010 78.083  -24.548 1.00 51.95  ? 290 LEU A CB  1 
ATOM 1844  C CG  . LEU A 1 290 ? -27.539 78.360  -23.108 1.00 56.28  ? 290 LEU A CG  1 
ATOM 1845  C CD1 . LEU A 1 290 ? -26.863 79.737  -22.980 1.00 57.06  ? 290 LEU A CD1 1 
ATOM 1846  C CD2 . LEU A 1 290 ? -28.686 78.250  -22.142 1.00 56.79  ? 290 LEU A CD2 1 
ATOM 1847  N N   . ASN A 1 291 ? -24.568 77.501  -25.216 1.00 54.19  ? 291 ASN A N   1 
ATOM 1848  C CA  . ASN A 1 291 ? -23.378 76.664  -24.989 1.00 52.78  ? 291 ASN A CA  1 
ATOM 1849  C C   . ASN A 1 291 ? -23.265 75.542  -26.048 1.00 55.97  ? 291 ASN A C   1 
ATOM 1850  O O   . ASN A 1 291 ? -23.019 74.379  -25.709 1.00 55.80  ? 291 ASN A O   1 
ATOM 1851  C CB  . ASN A 1 291 ? -23.372 76.084  -23.561 1.00 46.73  ? 291 ASN A CB  1 
ATOM 1852  C CG  . ASN A 1 291 ? -23.325 77.148  -22.482 1.00 63.49  ? 291 ASN A CG  1 
ATOM 1853  O OD1 . ASN A 1 291 ? -22.716 78.222  -22.644 1.00 55.95  ? 291 ASN A OD1 1 
ATOM 1854  N ND2 . ASN A 1 291 ? -23.968 76.871  -21.348 1.00 44.76  ? 291 ASN A ND2 1 
ATOM 1855  N N   . GLY A 1 292 ? -23.480 75.913  -27.306 1.00 51.45  ? 292 GLY A N   1 
ATOM 1856  C CA  . GLY A 1 292 ? -23.397 74.996  -28.430 1.00 51.98  ? 292 GLY A CA  1 
ATOM 1857  C C   . GLY A 1 292 ? -24.600 74.098  -28.655 1.00 59.73  ? 292 GLY A C   1 
ATOM 1858  O O   . GLY A 1 292 ? -24.683 73.435  -29.699 1.00 61.90  ? 292 GLY A O   1 
ATOM 1859  N N   . LYS A 1 293 ? -25.550 74.062  -27.699 1.00 54.13  ? 293 LYS A N   1 
ATOM 1860  C CA  . LYS A 1 293 ? -26.743 73.241  -27.832 1.00 52.00  ? 293 LYS A CA  1 
ATOM 1861  C C   . LYS A 1 293 ? -27.900 74.056  -28.421 1.00 57.32  ? 293 LYS A C   1 
ATOM 1862  O O   . LYS A 1 293 ? -28.266 75.084  -27.840 1.00 56.85  ? 293 LYS A O   1 
ATOM 1863  C CB  . LYS A 1 293 ? -27.140 72.636  -26.487 1.00 52.06  ? 293 LYS A CB  1 
ATOM 1864  C CG  . LYS A 1 293 ? -28.160 71.528  -26.624 1.00 41.82  ? 293 LYS A CG  1 
ATOM 1865  C CD  . LYS A 1 293 ? -28.613 71.001  -25.273 1.00 43.00  ? 293 LYS A CD  1 
ATOM 1866  C CE  . LYS A 1 293 ? -29.806 70.077  -25.402 1.00 57.70  ? 293 LYS A CE  1 
ATOM 1867  N NZ  . LYS A 1 293 ? -29.458 68.804  -26.098 1.00 74.05  ? 293 LYS A NZ  1 
ATOM 1868  N N   . PRO A 1 294 ? -28.499 73.608  -29.560 1.00 54.97  ? 294 PRO A N   1 
ATOM 1869  C CA  . PRO A 1 294 ? -29.633 74.355  -30.138 1.00 54.83  ? 294 PRO A CA  1 
ATOM 1870  C C   . PRO A 1 294 ? -30.831 74.480  -29.188 1.00 60.12  ? 294 PRO A C   1 
ATOM 1871  O O   . PRO A 1 294 ? -31.158 73.552  -28.433 1.00 59.74  ? 294 PRO A O   1 
ATOM 1872  C CB  . PRO A 1 294 ? -30.012 73.535  -31.377 1.00 56.29  ? 294 PRO A CB  1 
ATOM 1873  C CG  . PRO A 1 294 ? -28.793 72.720  -31.694 1.00 60.45  ? 294 PRO A CG  1 
ATOM 1874  C CD  . PRO A 1 294 ? -28.172 72.416  -30.374 1.00 56.19  ? 294 PRO A CD  1 
ATOM 1875  N N   . LEU A 1 295 ? -31.470 75.650  -29.225 1.00 57.25  ? 295 LEU A N   1 
ATOM 1876  C CA  . LEU A 1 295 ? -32.668 75.969  -28.452 1.00 57.16  ? 295 LEU A CA  1 
ATOM 1877  C C   . LEU A 1 295 ? -33.926 75.669  -29.267 1.00 62.96  ? 295 LEU A C   1 
ATOM 1878  O O   . LEU A 1 295 ? -34.009 76.069  -30.446 1.00 62.92  ? 295 LEU A O   1 
ATOM 1879  C CB  . LEU A 1 295 ? -32.670 77.450  -28.056 1.00 56.90  ? 295 LEU A CB  1 
ATOM 1880  C CG  . LEU A 1 295 ? -31.631 77.908  -27.060 1.00 61.14  ? 295 LEU A CG  1 
ATOM 1881  C CD1 . LEU A 1 295 ? -31.467 79.401  -27.146 1.00 61.66  ? 295 LEU A CD1 1 
ATOM 1882  C CD2 . LEU A 1 295 ? -31.987 77.468  -25.623 1.00 61.31  ? 295 LEU A CD2 1 
ATOM 1883  N N   . ASN A 1 296 ? -34.902 74.960  -28.659 1.00 59.28  ? 296 ASN A N   1 
ATOM 1884  C CA  . ASN A 1 296 ? -36.145 74.683  -29.381 1.00 58.63  ? 296 ASN A CA  1 
ATOM 1885  C C   . ASN A 1 296 ? -37.183 75.783  -29.090 1.00 59.37  ? 296 ASN A C   1 
ATOM 1886  O O   . ASN A 1 296 ? -38.209 75.851  -29.773 1.00 56.63  ? 296 ASN A O   1 
ATOM 1887  C CB  . ASN A 1 296 ? -36.700 73.265  -29.135 1.00 61.47  ? 296 ASN A CB  1 
ATOM 1888  C CG  . ASN A 1 296 ? -36.889 72.816  -27.703 1.00 92.59  ? 296 ASN A CG  1 
ATOM 1889  O OD1 . ASN A 1 296 ? -37.473 73.509  -26.855 1.00 88.05  ? 296 ASN A OD1 1 
ATOM 1890  N ND2 . ASN A 1 296 ? -36.474 71.585  -27.429 1.00 85.79  ? 296 ASN A ND2 1 
ATOM 1891  N N   . SER A 1 297 ? -36.877 76.683  -28.120 1.00 55.60  ? 297 SER A N   1 
ATOM 1892  C CA  . SER A 1 297 ? -37.755 77.787  -27.748 1.00 54.03  ? 297 SER A CA  1 
ATOM 1893  C C   . SER A 1 297 ? -37.057 78.843  -26.892 1.00 55.19  ? 297 SER A C   1 
ATOM 1894  O O   . SER A 1 297 ? -35.985 78.596  -26.332 1.00 54.18  ? 297 SER A O   1 
ATOM 1895  C CB  . SER A 1 297 ? -38.973 77.259  -26.982 1.00 56.85  ? 297 SER A CB  1 
ATOM 1896  O OG  . SER A 1 297 ? -38.644 76.741  -25.703 1.00 64.16  ? 297 SER A OG  1 
ATOM 1897  N N   . PHE A 1 298 ? -37.714 80.003  -26.754 1.00 50.70  ? 298 PHE A N   1 
ATOM 1898  C CA  . PHE A 1 298 ? -37.328 81.090  -25.876 1.00 51.35  ? 298 PHE A CA  1 
ATOM 1899  C C   . PHE A 1 298 ? -37.586 80.650  -24.426 1.00 56.47  ? 298 PHE A C   1 
ATOM 1900  O O   . PHE A 1 298 ? -36.837 81.012  -23.519 1.00 58.60  ? 298 PHE A O   1 
ATOM 1901  C CB  . PHE A 1 298 ? -38.119 82.368  -26.225 1.00 54.28  ? 298 PHE A CB  1 
ATOM 1902  C CG  . PHE A 1 298 ? -37.953 83.496  -25.238 1.00 58.10  ? 298 PHE A CG  1 
ATOM 1903  C CD1 . PHE A 1 298 ? -36.783 84.247  -25.201 1.00 62.54  ? 298 PHE A CD1 1 
ATOM 1904  C CD2 . PHE A 1 298 ? -38.948 83.788  -24.317 1.00 63.26  ? 298 PHE A CD2 1 
ATOM 1905  C CE1 . PHE A 1 298 ? -36.616 85.279  -24.273 1.00 64.08  ? 298 PHE A CE1 1 
ATOM 1906  C CE2 . PHE A 1 298 ? -38.776 84.819  -23.379 1.00 66.81  ? 298 PHE A CE2 1 
ATOM 1907  C CZ  . PHE A 1 298 ? -37.610 85.558  -23.368 1.00 64.41  ? 298 PHE A CZ  1 
ATOM 1908  N N   . ALA A 1 299 ? -38.657 79.864  -24.215 1.00 51.70  ? 299 ALA A N   1 
ATOM 1909  C CA  . ALA A 1 299 ? -39.062 79.308  -22.919 1.00 50.37  ? 299 ALA A CA  1 
ATOM 1910  C C   . ALA A 1 299 ? -37.967 78.390  -22.350 1.00 54.03  ? 299 ALA A C   1 
ATOM 1911  O O   . ALA A 1 299 ? -37.734 78.401  -21.137 1.00 54.44  ? 299 ALA A O   1 
ATOM 1912  C CB  . ALA A 1 299 ? -40.367 78.550  -23.062 1.00 50.32  ? 299 ALA A CB  1 
ATOM 1913  N N   . GLU A 1 300 ? -37.294 77.620  -23.232 1.00 49.16  ? 300 GLU A N   1 
ATOM 1914  C CA  . GLU A 1 300 ? -36.176 76.750  -22.890 1.00 48.55  ? 300 GLU A CA  1 
ATOM 1915  C C   . GLU A 1 300 ? -34.999 77.621  -22.437 1.00 52.88  ? 300 GLU A C   1 
ATOM 1916  O O   . GLU A 1 300 ? -34.416 77.358  -21.383 1.00 52.26  ? 300 GLU A O   1 
ATOM 1917  C CB  . GLU A 1 300 ? -35.781 75.855  -24.082 1.00 49.47  ? 300 GLU A CB  1 
ATOM 1918  C CG  . GLU A 1 300 ? -34.657 74.882  -23.744 1.00 58.15  ? 300 GLU A CG  1 
ATOM 1919  C CD  . GLU A 1 300 ? -34.070 74.053  -24.869 1.00 77.95  ? 300 GLU A CD  1 
ATOM 1920  O OE1 . GLU A 1 300 ? -34.631 74.061  -25.987 1.00 76.42  ? 300 GLU A OE1 1 
ATOM 1921  O OE2 . GLU A 1 300 ? -33.025 73.407  -24.632 1.00 77.52  ? 300 GLU A OE2 1 
ATOM 1922  N N   . LEU A 1 301 ? -34.691 78.682  -23.218 1.00 49.41  ? 301 LEU A N   1 
ATOM 1923  C CA  . LEU A 1 301 ? -33.637 79.653  -22.926 1.00 49.25  ? 301 LEU A CA  1 
ATOM 1924  C C   . LEU A 1 301 ? -33.897 80.300  -21.558 1.00 52.20  ? 301 LEU A C   1 
ATOM 1925  O O   . LEU A 1 301 ? -33.029 80.269  -20.689 1.00 49.99  ? 301 LEU A O   1 
ATOM 1926  C CB  . LEU A 1 301 ? -33.596 80.699  -24.055 1.00 49.43  ? 301 LEU A CB  1 
ATOM 1927  C CG  . LEU A 1 301 ? -32.358 81.602  -24.251 1.00 54.12  ? 301 LEU A CG  1 
ATOM 1928  C CD1 . LEU A 1 301 ? -32.673 83.040  -24.013 1.00 53.50  ? 301 LEU A CD1 1 
ATOM 1929  C CD2 . LEU A 1 301 ? -31.105 81.097  -23.531 1.00 56.02  ? 301 LEU A CD2 1 
ATOM 1930  N N   . ARG A 1 302 ? -35.126 80.777  -21.344 1.00 51.18  ? 302 ARG A N   1 
ATOM 1931  C CA  . ARG A 1 302 ? -35.576 81.382  -20.090 1.00 52.33  ? 302 ARG A CA  1 
ATOM 1932  C C   . ARG A 1 302 ? -35.310 80.427  -18.876 1.00 56.86  ? 302 ARG A C   1 
ATOM 1933  O O   . ARG A 1 302 ? -34.668 80.829  -17.911 1.00 55.59  ? 302 ARG A O   1 
ATOM 1934  C CB  . ARG A 1 302 ? -37.075 81.769  -20.201 1.00 52.79  ? 302 ARG A CB  1 
ATOM 1935  C CG  . ARG A 1 302 ? -37.561 82.666  -19.058 1.00 68.27  ? 302 ARG A CG  1 
ATOM 1936  C CD  . ARG A 1 302 ? -39.023 83.042  -19.169 1.00 79.90  ? 302 ARG A CD  1 
ATOM 1937  N NE  . ARG A 1 302 ? -39.594 83.285  -17.838 1.00 97.57  ? 302 ARG A NE  1 
ATOM 1938  C CZ  . ARG A 1 302 ? -40.238 82.372  -17.108 1.00 117.01 ? 302 ARG A CZ  1 
ATOM 1939  N NH1 . ARG A 1 302 ? -40.424 81.144  -17.580 1.00 105.28 ? 302 ARG A NH1 1 
ATOM 1940  N NH2 . ARG A 1 302 ? -40.712 82.685  -15.907 1.00 103.34 ? 302 ARG A NH2 1 
ATOM 1941  N N   . SER A 1 303 ? -35.754 79.162  -18.969 1.00 54.74  ? 303 SER A N   1 
ATOM 1942  C CA  . SER A 1 303 ? -35.591 78.154  -17.915 1.00 54.34  ? 303 SER A CA  1 
ATOM 1943  C C   . SER A 1 303 ? -34.117 77.760  -17.694 1.00 55.56  ? 303 SER A C   1 
ATOM 1944  O O   . SER A 1 303 ? -33.729 77.528  -16.554 1.00 55.18  ? 303 SER A O   1 
ATOM 1945  C CB  . SER A 1 303 ? -36.426 76.915  -18.227 1.00 57.92  ? 303 SER A CB  1 
ATOM 1946  O OG  . SER A 1 303 ? -35.972 76.326  -19.434 1.00 73.51  ? 303 SER A OG  1 
ATOM 1947  N N   . ARG A 1 304 ? -33.310 77.674  -18.767 1.00 50.23  ? 304 ARG A N   1 
ATOM 1948  C CA  . ARG A 1 304 ? -31.901 77.295  -18.656 1.00 48.88  ? 304 ARG A CA  1 
ATOM 1949  C C   . ARG A 1 304 ? -31.072 78.413  -18.051 1.00 55.24  ? 304 ARG A C   1 
ATOM 1950  O O   . ARG A 1 304 ? -30.220 78.142  -17.215 1.00 55.64  ? 304 ARG A O   1 
ATOM 1951  C CB  . ARG A 1 304 ? -31.338 76.917  -20.007 1.00 44.40  ? 304 ARG A CB  1 
ATOM 1952  C CG  . ARG A 1 304 ? -31.758 75.541  -20.476 1.00 49.16  ? 304 ARG A CG  1 
ATOM 1953  C CD  . ARG A 1 304 ? -31.082 75.224  -21.785 1.00 46.11  ? 304 ARG A CD  1 
ATOM 1954  N NE  . ARG A 1 304 ? -31.348 73.858  -22.235 1.00 53.91  ? 304 ARG A NE  1 
ATOM 1955  C CZ  . ARG A 1 304 ? -30.602 72.794  -21.931 1.00 69.08  ? 304 ARG A CZ  1 
ATOM 1956  N NH1 . ARG A 1 304 ? -29.559 72.911  -21.112 1.00 47.75  ? 304 ARG A NH1 1 
ATOM 1957  N NH2 . ARG A 1 304 ? -30.909 71.600  -22.424 1.00 61.54  ? 304 ARG A NH2 1 
ATOM 1958  N N   . ILE A 1 305 ? -31.306 79.660  -18.497 1.00 51.36  ? 305 ILE A N   1 
ATOM 1959  C CA  . ILE A 1 305 ? -30.615 80.829  -17.993 1.00 51.19  ? 305 ILE A CA  1 
ATOM 1960  C C   . ILE A 1 305 ? -30.949 81.040  -16.484 1.00 57.81  ? 305 ILE A C   1 
ATOM 1961  O O   . ILE A 1 305 ? -30.012 81.273  -15.727 1.00 58.88  ? 305 ILE A O   1 
ATOM 1962  C CB  . ILE A 1 305 ? -30.927 82.088  -18.886 1.00 53.63  ? 305 ILE A CB  1 
ATOM 1963  C CG1 . ILE A 1 305 ? -30.199 82.053  -20.249 1.00 52.78  ? 305 ILE A CG1 1 
ATOM 1964  C CG2 . ILE A 1 305 ? -30.721 83.431  -18.179 1.00 54.16  ? 305 ILE A CG2 1 
ATOM 1965  C CD1 . ILE A 1 305 ? -28.657 81.826  -20.303 1.00 48.94  ? 305 ILE A CD1 1 
ATOM 1966  N N   . ALA A 1 306 ? -32.242 80.953  -16.048 1.00 54.88  ? 306 ALA A N   1 
ATOM 1967  C CA  . ALA A 1 306 ? -32.681 81.187  -14.641 1.00 55.05  ? 306 ALA A CA  1 
ATOM 1968  C C   . ALA A 1 306 ? -32.121 80.192  -13.657 1.00 63.87  ? 306 ALA A C   1 
ATOM 1969  O O   . ALA A 1 306 ? -31.974 80.513  -12.482 1.00 65.61  ? 306 ALA A O   1 
ATOM 1970  C CB  . ALA A 1 306 ? -34.196 81.163  -14.538 1.00 55.14  ? 306 ALA A CB  1 
ATOM 1971  N N   . THR A 1 307 ? -31.843 78.975  -14.130 1.00 62.68  ? 307 THR A N   1 
ATOM 1972  C CA  . THR A 1 307 ? -31.337 77.846  -13.363 1.00 62.50  ? 307 THR A CA  1 
ATOM 1973  C C   . THR A 1 307 ? -29.806 77.912  -13.313 1.00 66.53  ? 307 THR A C   1 
ATOM 1974  O O   . THR A 1 307 ? -29.179 77.169  -12.557 1.00 67.89  ? 307 THR A O   1 
ATOM 1975  C CB  . THR A 1 307 ? -31.908 76.590  -13.984 1.00 70.37  ? 307 THR A CB  1 
ATOM 1976  O OG1 . THR A 1 307 ? -33.295 76.603  -13.663 1.00 69.42  ? 307 THR A OG1 1 
ATOM 1977  C CG2 . THR A 1 307 ? -31.280 75.330  -13.461 1.00 72.69  ? 307 THR A CG2 1 
ATOM 1978  N N   . THR A 1 308 ? -29.215 78.825  -14.069 1.00 61.55  ? 308 THR A N   1 
ATOM 1979  C CA  . THR A 1 308 ? -27.775 79.035  -14.037 1.00 61.71  ? 308 THR A CA  1 
ATOM 1980  C C   . THR A 1 308 ? -27.479 80.179  -13.038 1.00 66.91  ? 308 THR A C   1 
ATOM 1981  O O   . THR A 1 308 ? -28.211 81.166  -12.982 1.00 67.14  ? 308 THR A O   1 
ATOM 1982  C CB  . THR A 1 308 ? -27.226 79.278  -15.442 1.00 66.81  ? 308 THR A CB  1 
ATOM 1983  O OG1 . THR A 1 308 ? -27.809 78.331  -16.340 1.00 68.68  ? 308 THR A OG1 1 
ATOM 1984  C CG2 . THR A 1 308 ? -25.713 79.159  -15.499 1.00 61.45  ? 308 THR A CG2 1 
ATOM 1985  N N   . GLU A 1 309 ? -26.424 80.007  -12.236 1.00 64.67  ? 309 GLU A N   1 
ATOM 1986  C CA  . GLU A 1 309 ? -25.977 80.929  -11.188 1.00 65.19  ? 309 GLU A CA  1 
ATOM 1987  C C   . GLU A 1 309 ? -25.480 82.287  -11.744 1.00 68.03  ? 309 GLU A C   1 
ATOM 1988  O O   . GLU A 1 309 ? -24.702 82.281  -12.701 1.00 67.10  ? 309 GLU A O   1 
ATOM 1989  C CB  . GLU A 1 309 ? -24.841 80.266  -10.391 1.00 66.91  ? 309 GLU A CB  1 
ATOM 1990  C CG  . GLU A 1 309 ? -24.823 80.627  -8.919  1.00 84.41  ? 309 GLU A CG  1 
ATOM 1991  C CD  . GLU A 1 309 ? -23.607 80.115  -8.171  1.00 117.05 ? 309 GLU A CD  1 
ATOM 1992  O OE1 . GLU A 1 309 ? -22.805 80.956  -7.700  1.00 117.36 ? 309 GLU A OE1 1 
ATOM 1993  O OE2 . GLU A 1 309 ? -23.455 78.876  -8.056  1.00 110.13 ? 309 GLU A OE2 1 
ATOM 1994  N N   . PRO A 1 310 ? -25.856 83.452  -11.135 1.00 63.21  ? 310 PRO A N   1 
ATOM 1995  C CA  . PRO A 1 310 ? -25.304 84.741  -11.601 1.00 62.47  ? 310 PRO A CA  1 
ATOM 1996  C C   . PRO A 1 310 ? -23.777 84.751  -11.532 1.00 65.59  ? 310 PRO A C   1 
ATOM 1997  O O   . PRO A 1 310 ? -23.198 84.199  -10.597 1.00 65.48  ? 310 PRO A O   1 
ATOM 1998  C CB  . PRO A 1 310 ? -25.900 85.755  -10.616 1.00 63.83  ? 310 PRO A CB  1 
ATOM 1999  C CG  . PRO A 1 310 ? -27.117 85.092  -10.086 1.00 68.37  ? 310 PRO A CG  1 
ATOM 2000  C CD  . PRO A 1 310 ? -26.753 83.652  -9.981  1.00 64.01  ? 310 PRO A CD  1 
ATOM 2001  N N   . GLY A 1 311 ? -23.148 85.340  -12.533 1.00 61.76  ? 311 GLY A N   1 
ATOM 2002  C CA  . GLY A 1 311 ? -21.695 85.385  -12.624 1.00 62.32  ? 311 GLY A CA  1 
ATOM 2003  C C   . GLY A 1 311 ? -21.145 84.369  -13.604 1.00 68.50  ? 311 GLY A C   1 
ATOM 2004  O O   . GLY A 1 311 ? -20.014 84.523  -14.089 1.00 68.79  ? 311 GLY A O   1 
ATOM 2005  N N   . THR A 1 312 ? -21.958 83.327  -13.922 1.00 64.70  ? 312 THR A N   1 
ATOM 2006  C CA  . THR A 1 312 ? -21.592 82.282  -14.872 1.00 64.32  ? 312 THR A CA  1 
ATOM 2007  C C   . THR A 1 312 ? -21.543 82.862  -16.270 1.00 66.56  ? 312 THR A C   1 
ATOM 2008  O O   . THR A 1 312 ? -22.372 83.697  -16.616 1.00 64.64  ? 312 THR A O   1 
ATOM 2009  C CB  . THR A 1 312 ? -22.576 81.084  -14.802 1.00 74.48  ? 312 THR A CB  1 
ATOM 2010  O OG1 . THR A 1 312 ? -22.759 80.680  -13.443 1.00 76.37  ? 312 THR A OG1 1 
ATOM 2011  C CG2 . THR A 1 312 ? -22.125 79.875  -15.643 1.00 69.90  ? 312 THR A CG2 1 
ATOM 2012  N N   . LYS A 1 313 ? -20.555 82.426  -17.057 1.00 64.79  ? 313 LYS A N   1 
ATOM 2013  C CA  . LYS A 1 313 ? -20.395 82.837  -18.443 1.00 65.55  ? 313 LYS A CA  1 
ATOM 2014  C C   . LYS A 1 313 ? -21.047 81.804  -19.335 1.00 69.89  ? 313 LYS A C   1 
ATOM 2015  O O   . LYS A 1 313 ? -20.861 80.603  -19.117 1.00 70.86  ? 313 LYS A O   1 
ATOM 2016  C CB  . LYS A 1 313 ? -18.914 83.037  -18.807 1.00 68.87  ? 313 LYS A CB  1 
ATOM 2017  C CG  . LYS A 1 313 ? -18.328 84.298  -18.190 1.00 89.83  ? 313 LYS A CG  1 
ATOM 2018  C CD  . LYS A 1 313 ? -16.997 84.648  -18.803 1.00 103.69 ? 313 LYS A CD  1 
ATOM 2019  C CE  . LYS A 1 313 ? -16.370 85.830  -18.111 1.00 116.13 ? 313 LYS A CE  1 
ATOM 2020  N NZ  . LYS A 1 313 ? -15.234 86.364  -18.896 1.00 125.78 ? 313 LYS A NZ  1 
ATOM 2021  N N   . VAL A 1 314 ? -21.860 82.262  -20.298 1.00 65.14  ? 314 VAL A N   1 
ATOM 2022  C CA  . VAL A 1 314 ? -22.567 81.389  -21.238 1.00 63.92  ? 314 VAL A CA  1 
ATOM 2023  C C   . VAL A 1 314 ? -22.235 81.817  -22.659 1.00 68.23  ? 314 VAL A C   1 
ATOM 2024  O O   . VAL A 1 314 ? -21.955 82.987  -22.894 1.00 68.71  ? 314 VAL A O   1 
ATOM 2025  C CB  . VAL A 1 314 ? -24.109 81.336  -20.997 1.00 66.94  ? 314 VAL A CB  1 
ATOM 2026  C CG1 . VAL A 1 314 ? -24.451 80.716  -19.638 1.00 66.66  ? 314 VAL A CG1 1 
ATOM 2027  C CG2 . VAL A 1 314 ? -24.774 82.708  -21.157 1.00 66.17  ? 314 VAL A CG2 1 
ATOM 2028  N N   . LYS A 1 315 ? -22.278 80.880  -23.605 1.00 64.65  ? 315 LYS A N   1 
ATOM 2029  C CA  . LYS A 1 315 ? -22.040 81.170  -25.011 1.00 63.65  ? 315 LYS A CA  1 
ATOM 2030  C C   . LYS A 1 315 ? -23.374 81.141  -25.740 1.00 68.29  ? 315 LYS A C   1 
ATOM 2031  O O   . LYS A 1 315 ? -24.129 80.167  -25.645 1.00 70.37  ? 315 LYS A O   1 
ATOM 2032  C CB  . LYS A 1 315 ? -21.005 80.213  -25.622 1.00 66.03  ? 315 LYS A CB  1 
ATOM 2033  C CG  . LYS A 1 315 ? -19.577 80.713  -25.390 1.00 84.57  ? 315 LYS A CG  1 
ATOM 2034  C CD  . LYS A 1 315 ? -18.512 79.676  -25.696 1.00 99.23  ? 315 LYS A CD  1 
ATOM 2035  C CE  . LYS A 1 315 ? -17.158 80.103  -25.178 1.00 108.79 ? 315 LYS A CE  1 
ATOM 2036  N NZ  . LYS A 1 315 ? -16.167 78.991  -25.256 1.00 114.87 ? 315 LYS A NZ  1 
ATOM 2037  N N   . LEU A 1 316 ? -23.675 82.238  -26.442 1.00 62.48  ? 316 LEU A N   1 
ATOM 2038  C CA  . LEU A 1 316 ? -24.922 82.446  -27.168 1.00 60.81  ? 316 LEU A CA  1 
ATOM 2039  C C   . LEU A 1 316 ? -24.764 82.321  -28.673 1.00 63.79  ? 316 LEU A C   1 
ATOM 2040  O O   . LEU A 1 316 ? -24.084 83.123  -29.289 1.00 63.29  ? 316 LEU A O   1 
ATOM 2041  C CB  . LEU A 1 316 ? -25.462 83.851  -26.826 1.00 60.52  ? 316 LEU A CB  1 
ATOM 2042  C CG  . LEU A 1 316 ? -26.674 83.974  -25.898 1.00 64.30  ? 316 LEU A CG  1 
ATOM 2043  C CD1 . LEU A 1 316 ? -26.483 83.221  -24.593 1.00 65.18  ? 316 LEU A CD1 1 
ATOM 2044  C CD2 . LEU A 1 316 ? -26.969 85.415  -25.589 1.00 63.62  ? 316 LEU A CD2 1 
ATOM 2045  N N   . GLY A 1 317 ? -25.411 81.314  -29.245 1.00 61.54  ? 317 GLY A N   1 
ATOM 2046  C CA  . GLY A 1 317 ? -25.496 81.095  -30.685 1.00 61.50  ? 317 GLY A CA  1 
ATOM 2047  C C   . GLY A 1 317 ? -26.519 82.089  -31.178 1.00 68.15  ? 317 GLY A C   1 
ATOM 2048  O O   . GLY A 1 317 ? -27.685 82.046  -30.774 1.00 68.60  ? 317 GLY A O   1 
ATOM 2049  N N   . LEU A 1 318 ? -26.065 83.043  -31.973 1.00 65.40  ? 318 LEU A N   1 
ATOM 2050  C CA  . LEU A 1 318 ? -26.839 84.199  -32.408 1.00 64.81  ? 318 LEU A CA  1 
ATOM 2051  C C   . LEU A 1 318 ? -26.955 84.295  -33.934 1.00 66.36  ? 318 LEU A C   1 
ATOM 2052  O O   . LEU A 1 318 ? -26.233 83.605  -34.648 1.00 64.35  ? 318 LEU A O   1 
ATOM 2053  C CB  . LEU A 1 318 ? -26.043 85.369  -31.853 1.00 64.89  ? 318 LEU A CB  1 
ATOM 2054  C CG  . LEU A 1 318 ? -26.706 86.664  -31.611 1.00 69.31  ? 318 LEU A CG  1 
ATOM 2055  C CD1 . LEU A 1 318 ? -26.377 87.150  -30.224 1.00 68.81  ? 318 LEU A CD1 1 
ATOM 2056  C CD2 . LEU A 1 318 ? -26.242 87.667  -32.654 1.00 72.18  ? 318 LEU A CD2 1 
ATOM 2057  N N   . LEU A 1 319 ? -27.873 85.139  -34.427 1.00 64.33  ? 319 LEU A N   1 
ATOM 2058  C CA  . LEU A 1 319 ? -28.085 85.330  -35.865 1.00 64.93  ? 319 LEU A CA  1 
ATOM 2059  C C   . LEU A 1 319 ? -28.541 86.770  -36.157 1.00 69.28  ? 319 LEU A C   1 
ATOM 2060  O O   . LEU A 1 319 ? -29.706 87.097  -35.907 1.00 68.51  ? 319 LEU A O   1 
ATOM 2061  C CB  . LEU A 1 319 ? -29.121 84.304  -36.379 1.00 64.80  ? 319 LEU A CB  1 
ATOM 2062  C CG  . LEU A 1 319 ? -28.921 83.770  -37.784 1.00 69.45  ? 319 LEU A CG  1 
ATOM 2063  C CD1 . LEU A 1 319 ? -27.821 82.724  -37.819 1.00 68.52  ? 319 LEU A CD1 1 
ATOM 2064  C CD2 . LEU A 1 319 ? -30.216 83.162  -38.323 1.00 72.96  ? 319 LEU A CD2 1 
ATOM 2065  N N   . ARG A 1 320 ? -27.615 87.648  -36.635 1.00 65.57  ? 320 ARG A N   1 
ATOM 2066  C CA  . ARG A 1 320 ? -28.016 89.019  -36.968 1.00 65.17  ? 320 ARG A CA  1 
ATOM 2067  C C   . ARG A 1 320 ? -27.805 89.292  -38.452 1.00 70.03  ? 320 ARG A C   1 
ATOM 2068  O O   . ARG A 1 320 ? -26.761 88.974  -39.025 1.00 69.11  ? 320 ARG A O   1 
ATOM 2069  C CB  . ARG A 1 320 ? -27.419 90.104  -36.058 1.00 63.77  ? 320 ARG A CB  1 
ATOM 2070  C CG  . ARG A 1 320 ? -25.989 90.549  -36.273 1.00 67.82  ? 320 ARG A CG  1 
ATOM 2071  C CD  . ARG A 1 320 ? -25.701 91.788  -35.437 1.00 55.57  ? 320 ARG A CD  1 
ATOM 2072  N NE  . ARG A 1 320 ? -25.836 91.547  -34.001 1.00 54.89  ? 320 ARG A NE  1 
ATOM 2073  C CZ  . ARG A 1 320 ? -24.894 91.787  -33.092 1.00 75.72  ? 320 ARG A CZ  1 
ATOM 2074  N NH1 . ARG A 1 320 ? -23.714 92.274  -33.457 1.00 71.38  ? 320 ARG A NH1 1 
ATOM 2075  N NH2 . ARG A 1 320 ? -25.123 91.534  -31.810 1.00 63.63  ? 320 ARG A NH2 1 
ATOM 2076  N N   . ASN A 1 321 ? -28.882 89.794  -39.079 1.00 68.53  ? 321 ASN A N   1 
ATOM 2077  C CA  . ASN A 1 321 ? -29.022 90.080  -40.510 1.00 69.19  ? 321 ASN A CA  1 
ATOM 2078  C C   . ASN A 1 321 ? -28.724 88.811  -41.350 1.00 74.42  ? 321 ASN A C   1 
ATOM 2079  O O   . ASN A 1 321 ? -28.199 88.887  -42.462 1.00 73.75  ? 321 ASN A O   1 
ATOM 2080  C CB  . ASN A 1 321 ? -28.182 91.287  -40.933 1.00 69.01  ? 321 ASN A CB  1 
ATOM 2081  C CG  . ASN A 1 321 ? -28.826 92.589  -40.523 1.00 90.33  ? 321 ASN A CG  1 
ATOM 2082  O OD1 . ASN A 1 321 ? -28.356 93.291  -39.615 1.00 76.52  ? 321 ASN A OD1 1 
ATOM 2083  N ND2 . ASN A 1 321 ? -29.948 92.925  -41.160 1.00 83.64  ? 321 ASN A ND2 1 
ATOM 2084  N N   . GLY A 1 322 ? -29.113 87.662  -40.791 1.00 71.60  ? 322 GLY A N   1 
ATOM 2085  C CA  . GLY A 1 322 ? -28.957 86.339  -41.384 1.00 71.20  ? 322 GLY A CA  1 
ATOM 2086  C C   . GLY A 1 322 ? -27.571 85.747  -41.260 1.00 74.64  ? 322 GLY A C   1 
ATOM 2087  O O   . GLY A 1 322 ? -27.308 84.680  -41.825 1.00 74.45  ? 322 GLY A O   1 
ATOM 2088  N N   . LYS A 1 323 ? -26.678 86.427  -40.516 1.00 70.74  ? 323 LYS A N   1 
ATOM 2089  C CA  . LYS A 1 323 ? -25.290 85.998  -40.353 1.00 70.27  ? 323 LYS A CA  1 
ATOM 2090  C C   . LYS A 1 323 ? -25.046 85.440  -38.942 1.00 72.84  ? 323 LYS A C   1 
ATOM 2091  O O   . LYS A 1 323 ? -25.430 86.076  -37.950 1.00 71.51  ? 323 LYS A O   1 
ATOM 2092  C CB  . LYS A 1 323 ? -24.296 87.156  -40.667 1.00 72.55  ? 323 LYS A CB  1 
ATOM 2093  C CG  . LYS A 1 323 ? -24.505 87.856  -42.028 1.00 81.77  ? 323 LYS A CG  1 
ATOM 2094  C CD  . LYS A 1 323 ? -24.243 86.945  -43.239 1.00 90.30  ? 323 LYS A CD  1 
ATOM 2095  C CE  . LYS A 1 323 ? -24.964 87.420  -44.480 1.00 95.25  ? 323 LYS A CE  1 
ATOM 2096  N NZ  . LYS A 1 323 ? -24.864 86.435  -45.592 1.00 97.65  ? 323 LYS A NZ  1 
ATOM 2097  N N   . PRO A 1 324 ? -24.386 84.257  -38.847 1.00 69.03  ? 324 PRO A N   1 
ATOM 2098  C CA  . PRO A 1 324 ? -24.118 83.660  -37.521 1.00 68.35  ? 324 PRO A CA  1 
ATOM 2099  C C   . PRO A 1 324 ? -23.042 84.383  -36.720 1.00 71.91  ? 324 PRO A C   1 
ATOM 2100  O O   . PRO A 1 324 ? -22.096 84.903  -37.296 1.00 71.38  ? 324 PRO A O   1 
ATOM 2101  C CB  . PRO A 1 324 ? -23.661 82.231  -37.846 1.00 69.82  ? 324 PRO A CB  1 
ATOM 2102  C CG  . PRO A 1 324 ? -23.889 82.047  -39.314 1.00 74.39  ? 324 PRO A CG  1 
ATOM 2103  C CD  . PRO A 1 324 ? -23.881 83.398  -39.935 1.00 69.97  ? 324 PRO A CD  1 
ATOM 2104  N N   . LEU A 1 325 ? -23.205 84.401  -35.385 1.00 69.65  ? 325 LEU A N   1 
ATOM 2105  C CA  . LEU A 1 325 ? -22.292 84.966  -34.382 1.00 70.40  ? 325 LEU A CA  1 
ATOM 2106  C C   . LEU A 1 325 ? -22.347 84.164  -33.088 1.00 74.57  ? 325 LEU A C   1 
ATOM 2107  O O   . LEU A 1 325 ? -23.388 83.617  -32.755 1.00 74.49  ? 325 LEU A O   1 
ATOM 2108  C CB  . LEU A 1 325 ? -22.628 86.437  -34.041 1.00 71.03  ? 325 LEU A CB  1 
ATOM 2109  C CG  . LEU A 1 325 ? -22.655 87.496  -35.143 1.00 77.10  ? 325 LEU A CG  1 
ATOM 2110  C CD1 . LEU A 1 325 ? -23.162 88.813  -34.584 1.00 77.88  ? 325 LEU A CD1 1 
ATOM 2111  C CD2 . LEU A 1 325 ? -21.280 87.694  -35.781 1.00 78.79  ? 325 LEU A CD2 1 
ATOM 2112  N N   . GLU A 1 326 ? -21.254 84.136  -32.340 1.00 71.44  ? 326 GLU A N   1 
ATOM 2113  C CA  . GLU A 1 326 ? -21.169 83.521  -31.021 1.00 71.42  ? 326 GLU A CA  1 
ATOM 2114  C C   . GLU A 1 326 ? -20.811 84.637  -30.050 1.00 74.88  ? 326 GLU A C   1 
ATOM 2115  O O   . GLU A 1 326 ? -19.914 85.435  -30.337 1.00 74.54  ? 326 GLU A O   1 
ATOM 2116  C CB  . GLU A 1 326 ? -20.152 82.366  -30.996 1.00 73.13  ? 326 GLU A CB  1 
ATOM 2117  C CG  . GLU A 1 326 ? -20.784 80.985  -30.919 1.00 88.87  ? 326 GLU A CG  1 
ATOM 2118  C CD  . GLU A 1 326 ? -20.837 80.329  -29.547 1.00 121.35 ? 326 GLU A CD  1 
ATOM 2119  O OE1 . GLU A 1 326 ? -19.811 80.365  -28.826 1.00 124.56 ? 326 GLU A OE1 1 
ATOM 2120  O OE2 . GLU A 1 326 ? -21.883 79.718  -29.219 1.00 118.57 ? 326 GLU A OE2 1 
ATOM 2121  N N   . VAL A 1 327 ? -21.551 84.755  -28.948 1.00 71.06  ? 327 VAL A N   1 
ATOM 2122  C CA  . VAL A 1 327 ? -21.324 85.820  -27.975 1.00 70.58  ? 327 VAL A CA  1 
ATOM 2123  C C   . VAL A 1 327 ? -21.222 85.219  -26.559 1.00 73.51  ? 327 VAL A C   1 
ATOM 2124  O O   . VAL A 1 327 ? -22.066 84.412  -26.180 1.00 73.72  ? 327 VAL A O   1 
ATOM 2125  C CB  . VAL A 1 327 ? -22.458 86.884  -28.105 1.00 74.70  ? 327 VAL A CB  1 
ATOM 2126  C CG1 . VAL A 1 327 ? -22.483 87.833  -26.924 1.00 74.53  ? 327 VAL A CG1 1 
ATOM 2127  C CG2 . VAL A 1 327 ? -22.344 87.670  -29.409 1.00 74.61  ? 327 VAL A CG2 1 
ATOM 2128  N N   . GLU A 1 328 ? -20.187 85.605  -25.791 1.00 69.32  ? 328 GLU A N   1 
ATOM 2129  C CA  . GLU A 1 328 ? -20.008 85.145  -24.408 1.00 69.15  ? 328 GLU A CA  1 
ATOM 2130  C C   . GLU A 1 328 ? -20.621 86.195  -23.475 1.00 71.48  ? 328 GLU A C   1 
ATOM 2131  O O   . GLU A 1 328 ? -20.276 87.372  -23.564 1.00 72.37  ? 328 GLU A O   1 
ATOM 2132  C CB  . GLU A 1 328 ? -18.530 84.860  -24.071 1.00 70.78  ? 328 GLU A CB  1 
ATOM 2133  C CG  . GLU A 1 328 ? -18.313 84.097  -22.767 1.00 83.82  ? 328 GLU A CG  1 
ATOM 2134  C CD  . GLU A 1 328 ? -16.880 83.675  -22.505 1.00 109.07 ? 328 GLU A CD  1 
ATOM 2135  O OE1 . GLU A 1 328 ? -16.597 82.457  -22.584 1.00 117.67 ? 328 GLU A OE1 1 
ATOM 2136  O OE2 . GLU A 1 328 ? -16.038 84.560  -22.225 1.00 94.94  ? 328 GLU A OE2 1 
ATOM 2137  N N   . VAL A 1 329 ? -21.574 85.777  -22.629 1.00 64.97  ? 329 VAL A N   1 
ATOM 2138  C CA  . VAL A 1 329 ? -22.319 86.666  -21.739 1.00 63.23  ? 329 VAL A CA  1 
ATOM 2139  C C   . VAL A 1 329 ? -22.105 86.237  -20.295 1.00 68.42  ? 329 VAL A C   1 
ATOM 2140  O O   . VAL A 1 329 ? -22.211 85.051  -19.986 1.00 68.68  ? 329 VAL A O   1 
ATOM 2141  C CB  . VAL A 1 329 ? -23.853 86.691  -22.094 1.00 65.09  ? 329 VAL A CB  1 
ATOM 2142  C CG1 . VAL A 1 329 ? -24.625 87.670  -21.225 1.00 64.10  ? 329 VAL A CG1 1 
ATOM 2143  C CG2 . VAL A 1 329 ? -24.101 86.998  -23.568 1.00 64.79  ? 329 VAL A CG2 1 
ATOM 2144  N N   . THR A 1 330 ? -21.846 87.206  -19.409 1.00 65.42  ? 330 THR A N   1 
ATOM 2145  C CA  . THR A 1 330 ? -21.738 86.972  -17.971 1.00 65.39  ? 330 THR A CA  1 
ATOM 2146  C C   . THR A 1 330 ? -23.117 87.272  -17.393 1.00 68.50  ? 330 THR A C   1 
ATOM 2147  O O   . THR A 1 330 ? -23.672 88.349  -17.617 1.00 66.60  ? 330 THR A O   1 
ATOM 2148  C CB  . THR A 1 330 ? -20.607 87.785  -17.339 1.00 71.94  ? 330 THR A CB  1 
ATOM 2149  O OG1 . THR A 1 330 ? -19.391 87.504  -18.041 1.00 75.77  ? 330 THR A OG1 1 
ATOM 2150  C CG2 . THR A 1 330 ? -20.438 87.488  -15.853 1.00 66.33  ? 330 THR A CG2 1 
ATOM 2151  N N   . LEU A 1 331 ? -23.676 86.303  -16.669 1.00 65.83  ? 331 LEU A N   1 
ATOM 2152  C CA  . LEU A 1 331 ? -25.024 86.423  -16.137 1.00 65.30  ? 331 LEU A CA  1 
ATOM 2153  C C   . LEU A 1 331 ? -25.094 87.349  -14.958 1.00 68.74  ? 331 LEU A C   1 
ATOM 2154  O O   . LEU A 1 331 ? -24.216 87.335  -14.091 1.00 67.71  ? 331 LEU A O   1 
ATOM 2155  C CB  . LEU A 1 331 ? -25.614 85.047  -15.762 1.00 64.77  ? 331 LEU A CB  1 
ATOM 2156  C CG  . LEU A 1 331 ? -25.744 84.012  -16.885 1.00 67.63  ? 331 LEU A CG  1 
ATOM 2157  C CD1 . LEU A 1 331 ? -26.431 82.778  -16.378 1.00 67.54  ? 331 LEU A CD1 1 
ATOM 2158  C CD2 . LEU A 1 331 ? -26.471 84.572  -18.104 1.00 67.18  ? 331 LEU A CD2 1 
ATOM 2159  N N   . ASP A 1 332 ? -26.164 88.154  -14.940 1.00 66.07  ? 332 ASP A N   1 
ATOM 2160  C CA  . ASP A 1 332 ? -26.480 89.082  -13.863 1.00 67.23  ? 332 ASP A CA  1 
ATOM 2161  C C   . ASP A 1 332 ? -27.393 88.371  -12.865 1.00 72.78  ? 332 ASP A C   1 
ATOM 2162  O O   . ASP A 1 332 ? -27.679 87.189  -13.042 1.00 72.66  ? 332 ASP A O   1 
ATOM 2163  C CB  . ASP A 1 332 ? -27.156 90.354  -14.425 1.00 69.70  ? 332 ASP A CB  1 
ATOM 2164  C CG  . ASP A 1 332 ? -26.378 91.071  -15.515 1.00 83.69  ? 332 ASP A CG  1 
ATOM 2165  O OD1 . ASP A 1 332 ? -26.879 91.126  -16.662 1.00 85.22  ? 332 ASP A OD1 1 
ATOM 2166  O OD2 . ASP A 1 332 ? -25.272 91.594  -15.219 1.00 88.08  ? 332 ASP A OD2 1 
ATOM 2167  N N   . THR A 1 333 ? -27.858 89.076  -11.831 1.00 70.73  ? 333 THR A N   1 
ATOM 2168  C CA  . THR A 1 333 ? -28.784 88.510  -10.857 1.00 71.77  ? 333 THR A CA  1 
ATOM 2169  C C   . THR A 1 333 ? -30.198 89.016  -11.190 1.00 78.58  ? 333 THR A C   1 
ATOM 2170  O O   . THR A 1 333 ? -30.336 90.120  -11.731 1.00 78.69  ? 333 THR A O   1 
ATOM 2171  C CB  . THR A 1 333 ? -28.346 88.845  -9.421  1.00 82.62  ? 333 THR A CB  1 
ATOM 2172  O OG1 . THR A 1 333 ? -26.930 88.680  -9.313  1.00 86.26  ? 333 THR A OG1 1 
ATOM 2173  C CG2 . THR A 1 333 ? -29.044 87.970  -8.370  1.00 80.62  ? 333 THR A CG2 1 
ATOM 2174  N N   . SER A 1 334 ? -31.238 88.197  -10.889 1.00 76.12  ? 334 SER A N   1 
ATOM 2175  C CA  . SER A 1 334 ? -32.644 88.532  -11.121 1.00 79.44  ? 334 SER A CA  1 
ATOM 2176  C C   . SER A 1 334 ? -33.294 89.061  -9.828  1.00 90.50  ? 334 SER A C   1 
ATOM 2177  O O   . SER A 1 334 ? -33.080 88.444  -8.755  1.00 88.45  ? 334 SER A O   1 
ATOM 2178  C CB  . SER A 1 334 ? -33.406 87.318  -11.653 1.00 82.59  ? 334 SER A CB  1 
ATOM 2179  O OG  . SER A 1 334 ? -34.746 87.628  -12.008 1.00 86.53  ? 334 SER A OG  1 
ATOM 2180  N N   . PRO B 1 11  ? -34.184 38.922  -38.175 1.00 72.65  ? 11  PRO B N   1 
ATOM 2181  C CA  . PRO B 1 11  ? -33.032 39.740  -37.768 1.00 72.10  ? 11  PRO B CA  1 
ATOM 2182  C C   . PRO B 1 11  ? -33.435 40.852  -36.800 1.00 71.77  ? 11  PRO B C   1 
ATOM 2183  O O   . PRO B 1 11  ? -32.636 41.195  -35.916 1.00 71.73  ? 11  PRO B O   1 
ATOM 2184  C CB  . PRO B 1 11  ? -32.492 40.313  -39.093 1.00 74.41  ? 11  PRO B CB  1 
ATOM 2185  C CG  . PRO B 1 11  ? -33.060 39.404  -40.190 1.00 79.53  ? 11  PRO B CG  1 
ATOM 2186  C CD  . PRO B 1 11  ? -34.045 38.433  -39.562 1.00 75.13  ? 11  PRO B CD  1 
ATOM 2187  N N   . LEU B 1 12  ? -34.653 41.436  -36.965 1.00 63.73  ? 12  LEU B N   1 
ATOM 2188  C CA  . LEU B 1 12  ? -35.126 42.485  -36.050 1.00 60.27  ? 12  LEU B CA  1 
ATOM 2189  C C   . LEU B 1 12  ? -35.577 41.866  -34.723 1.00 57.80  ? 12  LEU B C   1 
ATOM 2190  O O   . LEU B 1 12  ? -36.279 40.848  -34.757 1.00 55.75  ? 12  LEU B O   1 
ATOM 2191  C CB  . LEU B 1 12  ? -36.291 43.310  -36.643 1.00 59.61  ? 12  LEU B CB  1 
ATOM 2192  C CG  . LEU B 1 12  ? -35.991 44.552  -37.511 1.00 62.85  ? 12  LEU B CG  1 
ATOM 2193  C CD1 . LEU B 1 12  ? -37.279 45.336  -37.782 1.00 61.87  ? 12  LEU B CD1 1 
ATOM 2194  C CD2 . LEU B 1 12  ? -34.934 45.478  -36.890 1.00 62.30  ? 12  LEU B CD2 1 
ATOM 2195  N N   . PRO B 1 13  ? -35.213 42.467  -33.556 1.00 51.89  ? 13  PRO B N   1 
ATOM 2196  C CA  . PRO B 1 13  ? -35.713 41.952  -32.263 1.00 49.99  ? 13  PRO B CA  1 
ATOM 2197  C C   . PRO B 1 13  ? -37.236 41.928  -32.221 1.00 49.01  ? 13  PRO B C   1 
ATOM 2198  O O   . PRO B 1 13  ? -37.890 42.851  -32.731 1.00 48.00  ? 13  PRO B O   1 
ATOM 2199  C CB  . PRO B 1 13  ? -35.169 42.954  -31.243 1.00 51.81  ? 13  PRO B CB  1 
ATOM 2200  C CG  . PRO B 1 13  ? -34.089 43.678  -31.927 1.00 56.81  ? 13  PRO B CG  1 
ATOM 2201  C CD  . PRO B 1 13  ? -34.424 43.701  -33.367 1.00 52.97  ? 13  PRO B CD  1 
ATOM 2202  N N   . SER B 1 14  ? -37.797 40.839  -31.668 1.00 43.04  ? 14  SER B N   1 
ATOM 2203  C CA  . SER B 1 14  ? -39.236 40.624  -31.601 1.00 40.82  ? 14  SER B CA  1 
ATOM 2204  C C   . SER B 1 14  ? -39.607 39.583  -30.565 1.00 41.41  ? 14  SER B C   1 
ATOM 2205  O O   . SER B 1 14  ? -38.831 38.665  -30.299 1.00 41.93  ? 14  SER B O   1 
ATOM 2206  C CB  . SER B 1 14  ? -39.754 40.173  -32.969 1.00 42.09  ? 14  SER B CB  1 
ATOM 2207  O OG  . SER B 1 14  ? -41.155 39.938  -32.968 1.00 47.69  ? 14  SER B OG  1 
ATOM 2208  N N   . LEU B 1 15  ? -40.836 39.678  -30.046 1.00 34.70  ? 15  LEU B N   1 
ATOM 2209  C CA  . LEU B 1 15  ? -41.415 38.702  -29.116 1.00 32.52  ? 15  LEU B CA  1 
ATOM 2210  C C   . LEU B 1 15  ? -42.198 37.642  -29.886 1.00 33.50  ? 15  LEU B C   1 
ATOM 2211  O O   . LEU B 1 15  ? -42.588 36.631  -29.292 1.00 31.31  ? 15  LEU B O   1 
ATOM 2212  C CB  . LEU B 1 15  ? -42.343 39.432  -28.111 1.00 32.15  ? 15  LEU B CB  1 
ATOM 2213  C CG  . LEU B 1 15  ? -41.690 40.520  -27.270 1.00 34.94  ? 15  LEU B CG  1 
ATOM 2214  C CD1 . LEU B 1 15  ? -42.694 41.118  -26.345 1.00 34.95  ? 15  LEU B CD1 1 
ATOM 2215  C CD2 . LEU B 1 15  ? -40.462 39.969  -26.480 1.00 30.27  ? 15  LEU B CD2 1 
ATOM 2216  N N   . ALA B 1 16  ? -42.444 37.896  -31.215 1.00 31.02  ? 16  ALA B N   1 
ATOM 2217  C CA  . ALA B 1 16  ? -43.202 37.031  -32.151 1.00 32.08  ? 16  ALA B CA  1 
ATOM 2218  C C   . ALA B 1 16  ? -42.689 35.589  -32.198 1.00 39.48  ? 16  ALA B C   1 
ATOM 2219  O O   . ALA B 1 16  ? -43.540 34.704  -32.070 1.00 39.77  ? 16  ALA B O   1 
ATOM 2220  C CB  . ALA B 1 16  ? -43.211 37.617  -33.548 1.00 32.56  ? 16  ALA B CB  1 
ATOM 2221  N N   . PRO B 1 17  ? -41.352 35.291  -32.328 1.00 38.15  ? 17  PRO B N   1 
ATOM 2222  C CA  . PRO B 1 17  ? -40.916 33.874  -32.327 1.00 37.06  ? 17  PRO B CA  1 
ATOM 2223  C C   . PRO B 1 17  ? -41.368 33.101  -31.079 1.00 42.93  ? 17  PRO B C   1 
ATOM 2224  O O   . PRO B 1 17  ? -41.901 31.992  -31.242 1.00 43.43  ? 17  PRO B O   1 
ATOM 2225  C CB  . PRO B 1 17  ? -39.401 33.974  -32.423 1.00 37.77  ? 17  PRO B CB  1 
ATOM 2226  C CG  . PRO B 1 17  ? -39.157 35.307  -33.102 1.00 42.11  ? 17  PRO B CG  1 
ATOM 2227  C CD  . PRO B 1 17  ? -40.189 36.198  -32.525 1.00 38.91  ? 17  PRO B CD  1 
ATOM 2228  N N   . MET B 1 18  ? -41.274 33.689  -29.849 1.00 40.42  ? 18  MET B N   1 
ATOM 2229  C CA  . MET B 1 18  ? -41.810 32.918  -28.711 1.00 40.44  ? 18  MET B CA  1 
ATOM 2230  C C   . MET B 1 18  ? -43.349 33.058  -28.547 1.00 42.30  ? 18  MET B C   1 
ATOM 2231  O O   . MET B 1 18  ? -43.960 32.136  -28.008 1.00 43.07  ? 18  MET B O   1 
ATOM 2232  C CB  . MET B 1 18  ? -41.085 33.159  -27.371 1.00 43.18  ? 18  MET B CB  1 
ATOM 2233  C CG  . MET B 1 18  ? -41.438 34.425  -26.673 1.00 48.02  ? 18  MET B CG  1 
ATOM 2234  S SD  . MET B 1 18  ? -42.798 34.351  -25.463 1.00 52.45  ? 18  MET B SD  1 
ATOM 2235  C CE  . MET B 1 18  ? -42.728 36.089  -24.887 1.00 48.52  ? 18  MET B CE  1 
ATOM 2236  N N   . LEU B 1 19  ? -43.976 34.157  -29.005 1.00 37.26  ? 19  LEU B N   1 
ATOM 2237  C CA  . LEU B 1 19  ? -45.421 34.288  -28.806 1.00 37.11  ? 19  LEU B CA  1 
ATOM 2238  C C   . LEU B 1 19  ? -46.175 33.308  -29.652 1.00 47.45  ? 19  LEU B C   1 
ATOM 2239  O O   . LEU B 1 19  ? -47.120 32.689  -29.171 1.00 48.65  ? 19  LEU B O   1 
ATOM 2240  C CB  . LEU B 1 19  ? -45.943 35.721  -29.004 1.00 35.83  ? 19  LEU B CB  1 
ATOM 2241  C CG  . LEU B 1 19  ? -45.699 36.676  -27.778 1.00 37.90  ? 19  LEU B CG  1 
ATOM 2242  C CD1 . LEU B 1 19  ? -46.345 38.011  -27.994 1.00 37.70  ? 19  LEU B CD1 1 
ATOM 2243  C CD2 . LEU B 1 19  ? -46.173 36.053  -26.444 1.00 34.18  ? 19  LEU B CD2 1 
ATOM 2244  N N   . GLU B 1 20  ? -45.692 33.090  -30.870 1.00 47.54  ? 20  GLU B N   1 
ATOM 2245  C CA  . GLU B 1 20  ? -46.192 32.148  -31.870 1.00 48.67  ? 20  GLU B CA  1 
ATOM 2246  C C   . GLU B 1 20  ? -46.515 30.773  -31.232 1.00 54.90  ? 20  GLU B C   1 
ATOM 2247  O O   . GLU B 1 20  ? -47.633 30.252  -31.354 1.00 56.46  ? 20  GLU B O   1 
ATOM 2248  C CB  . GLU B 1 20  ? -45.043 31.989  -32.862 1.00 50.63  ? 20  GLU B CB  1 
ATOM 2249  C CG  . GLU B 1 20  ? -45.358 31.759  -34.318 1.00 67.80  ? 20  GLU B CG  1 
ATOM 2250  C CD  . GLU B 1 20  ? -44.080 31.961  -35.114 1.00 101.59 ? 20  GLU B CD  1 
ATOM 2251  O OE1 . GLU B 1 20  ? -43.079 31.264  -34.820 1.00 95.28  ? 20  GLU B OE1 1 
ATOM 2252  O OE2 . GLU B 1 20  ? -44.047 32.897  -35.947 1.00 100.27 ? 20  GLU B OE2 1 
ATOM 2253  N N   . LYS B 1 21  ? -45.535 30.222  -30.503 1.00 49.23  ? 21  LYS B N   1 
ATOM 2254  C CA  . LYS B 1 21  ? -45.605 28.894  -29.917 1.00 47.62  ? 21  LYS B CA  1 
ATOM 2255  C C   . LYS B 1 21  ? -46.506 28.795  -28.716 1.00 49.79  ? 21  LYS B C   1 
ATOM 2256  O O   . LYS B 1 21  ? -47.067 27.740  -28.444 1.00 51.80  ? 21  LYS B O   1 
ATOM 2257  C CB  . LYS B 1 21  ? -44.199 28.447  -29.471 1.00 49.30  ? 21  LYS B CB  1 
ATOM 2258  C CG  . LYS B 1 21  ? -43.058 28.704  -30.441 1.00 56.15  ? 21  LYS B CG  1 
ATOM 2259  C CD  . LYS B 1 21  ? -41.764 28.151  -29.858 1.00 66.72  ? 21  LYS B CD  1 
ATOM 2260  C CE  . LYS B 1 21  ? -40.531 28.708  -30.506 1.00 78.16  ? 21  LYS B CE  1 
ATOM 2261  N NZ  . LYS B 1 21  ? -39.305 28.072  -29.966 1.00 87.64  ? 21  LYS B NZ  1 
ATOM 2262  N N   . VAL B 1 22  ? -46.595 29.863  -27.963 1.00 43.89  ? 22  VAL B N   1 
ATOM 2263  C CA  . VAL B 1 22  ? -47.220 29.925  -26.636 1.00 41.08  ? 22  VAL B CA  1 
ATOM 2264  C C   . VAL B 1 22  ? -48.661 30.510  -26.618 1.00 42.13  ? 22  VAL B C   1 
ATOM 2265  O O   . VAL B 1 22  ? -49.475 30.013  -25.844 1.00 41.47  ? 22  VAL B O   1 
ATOM 2266  C CB  . VAL B 1 22  ? -46.211 30.770  -25.815 1.00 42.97  ? 22  VAL B CB  1 
ATOM 2267  C CG1 . VAL B 1 22  ? -46.855 31.572  -24.706 1.00 42.76  ? 22  VAL B CG1 1 
ATOM 2268  C CG2 . VAL B 1 22  ? -45.058 29.914  -25.323 1.00 41.50  ? 22  VAL B CG2 1 
ATOM 2269  N N   . LEU B 1 23  ? -48.988 31.514  -27.471 1.00 37.24  ? 23  LEU B N   1 
ATOM 2270  C CA  . LEU B 1 23  ? -50.329 32.127  -27.504 1.00 37.24  ? 23  LEU B CA  1 
ATOM 2271  C C   . LEU B 1 23  ? -51.516 31.099  -27.559 1.00 41.97  ? 23  LEU B C   1 
ATOM 2272  O O   . LEU B 1 23  ? -52.499 31.322  -26.839 1.00 40.13  ? 23  LEU B O   1 
ATOM 2273  C CB  . LEU B 1 23  ? -50.483 33.115  -28.654 1.00 37.02  ? 23  LEU B CB  1 
ATOM 2274  C CG  . LEU B 1 23  ? -49.719 34.407  -28.565 1.00 41.34  ? 23  LEU B CG  1 
ATOM 2275  C CD1 . LEU B 1 23  ? -49.570 35.008  -29.921 1.00 40.10  ? 23  LEU B CD1 1 
ATOM 2276  C CD2 . LEU B 1 23  ? -50.349 35.384  -27.569 1.00 45.66  ? 23  LEU B CD2 1 
ATOM 2277  N N   . PRO B 1 24  ? -51.448 29.969  -28.324 1.00 39.80  ? 24  PRO B N   1 
ATOM 2278  C CA  . PRO B 1 24  ? -52.582 29.014  -28.314 1.00 39.89  ? 24  PRO B CA  1 
ATOM 2279  C C   . PRO B 1 24  ? -52.943 28.453  -26.912 1.00 41.91  ? 24  PRO B C   1 
ATOM 2280  O O   . PRO B 1 24  ? -54.082 28.011  -26.735 1.00 43.37  ? 24  PRO B O   1 
ATOM 2281  C CB  . PRO B 1 24  ? -52.101 27.887  -29.254 1.00 41.22  ? 24  PRO B CB  1 
ATOM 2282  C CG  . PRO B 1 24  ? -51.114 28.543  -30.168 1.00 44.94  ? 24  PRO B CG  1 
ATOM 2283  C CD  . PRO B 1 24  ? -50.395 29.518  -29.270 1.00 41.42  ? 24  PRO B CD  1 
ATOM 2284  N N   . ALA B 1 25  ? -52.016 28.509  -25.921 1.00 33.16  ? 25  ALA B N   1 
ATOM 2285  C CA  . ALA B 1 25  ? -52.242 28.027  -24.549 1.00 30.75  ? 25  ALA B CA  1 
ATOM 2286  C C   . ALA B 1 25  ? -53.146 28.964  -23.725 1.00 34.96  ? 25  ALA B C   1 
ATOM 2287  O O   . ALA B 1 25  ? -53.695 28.543  -22.715 1.00 35.65  ? 25  ALA B O   1 
ATOM 2288  C CB  . ALA B 1 25  ? -50.903 27.853  -23.835 1.00 30.19  ? 25  ALA B CB  1 
ATOM 2289  N N   . VAL B 1 26  ? -53.265 30.238  -24.120 1.00 31.13  ? 26  VAL B N   1 
ATOM 2290  C CA  . VAL B 1 26  ? -54.047 31.223  -23.398 1.00 30.51  ? 26  VAL B CA  1 
ATOM 2291  C C   . VAL B 1 26  ? -55.409 31.349  -24.084 1.00 37.74  ? 26  VAL B C   1 
ATOM 2292  O O   . VAL B 1 26  ? -55.502 31.619  -25.281 1.00 39.79  ? 26  VAL B O   1 
ATOM 2293  C CB  . VAL B 1 26  ? -53.294 32.563  -23.272 1.00 33.28  ? 26  VAL B CB  1 
ATOM 2294  C CG1 . VAL B 1 26  ? -54.042 33.536  -22.329 1.00 32.80  ? 26  VAL B CG1 1 
ATOM 2295  C CG2 . VAL B 1 26  ? -51.855 32.328  -22.807 1.00 32.61  ? 26  VAL B CG2 1 
ATOM 2296  N N   . VAL B 1 27  ? -56.457 31.125  -23.312 1.00 33.77  ? 27  VAL B N   1 
ATOM 2297  C CA  . VAL B 1 27  ? -57.828 31.037  -23.792 1.00 33.41  ? 27  VAL B CA  1 
ATOM 2298  C C   . VAL B 1 27  ? -58.699 32.129  -23.252 1.00 39.94  ? 27  VAL B C   1 
ATOM 2299  O O   . VAL B 1 27  ? -58.370 32.755  -22.258 1.00 41.56  ? 27  VAL B O   1 
ATOM 2300  C CB  . VAL B 1 27  ? -58.444 29.633  -23.453 1.00 35.85  ? 27  VAL B CB  1 
ATOM 2301  C CG1 . VAL B 1 27  ? -57.575 28.513  -24.007 1.00 34.15  ? 27  VAL B CG1 1 
ATOM 2302  C CG2 . VAL B 1 27  ? -58.656 29.440  -21.949 1.00 35.60  ? 27  VAL B CG2 1 
ATOM 2303  N N   . SER B 1 28  ? -59.838 32.331  -23.912 1.00 37.69  ? 28  SER B N   1 
ATOM 2304  C CA  . SER B 1 28  ? -60.908 33.251  -23.547 1.00 36.70  ? 28  SER B CA  1 
ATOM 2305  C C   . SER B 1 28  ? -61.963 32.441  -22.761 1.00 41.41  ? 28  SER B C   1 
ATOM 2306  O O   . SER B 1 28  ? -62.273 31.313  -23.134 1.00 42.50  ? 28  SER B O   1 
ATOM 2307  C CB  . SER B 1 28  ? -61.469 33.897  -24.800 1.00 39.23  ? 28  SER B CB  1 
ATOM 2308  O OG  . SER B 1 28  ? -62.814 34.305  -24.616 1.00 58.23  ? 28  SER B OG  1 
ATOM 2309  N N   . VAL B 1 29  ? -62.427 32.964  -21.635 1.00 38.19  ? 29  VAL B N   1 
ATOM 2310  C CA  . VAL B 1 29  ? -63.380 32.248  -20.772 1.00 37.71  ? 29  VAL B CA  1 
ATOM 2311  C C   . VAL B 1 29  ? -64.714 33.005  -20.788 1.00 44.06  ? 29  VAL B C   1 
ATOM 2312  O O   . VAL B 1 29  ? -64.795 34.161  -20.380 1.00 44.51  ? 29  VAL B O   1 
ATOM 2313  C CB  . VAL B 1 29  ? -62.809 32.039  -19.338 1.00 40.49  ? 29  VAL B CB  1 
ATOM 2314  C CG1 . VAL B 1 29  ? -63.826 31.368  -18.433 1.00 41.02  ? 29  VAL B CG1 1 
ATOM 2315  C CG2 . VAL B 1 29  ? -61.528 31.223  -19.374 1.00 39.86  ? 29  VAL B CG2 1 
ATOM 2316  N N   . ARG B 1 30  ? -65.737 32.371  -21.338 1.00 43.89  ? 30  ARG B N   1 
ATOM 2317  C CA  . ARG B 1 30  ? -67.068 32.959  -21.459 1.00 45.92  ? 30  ARG B CA  1 
ATOM 2318  C C   . ARG B 1 30  ? -67.967 32.283  -20.443 1.00 50.06  ? 30  ARG B C   1 
ATOM 2319  O O   . ARG B 1 30  ? -67.967 31.061  -20.311 1.00 48.33  ? 30  ARG B O   1 
ATOM 2320  C CB  . ARG B 1 30  ? -67.587 32.831  -22.900 1.00 52.03  ? 30  ARG B CB  1 
ATOM 2321  C CG  . ARG B 1 30  ? -68.760 33.742  -23.237 1.00 70.98  ? 30  ARG B CG  1 
ATOM 2322  C CD  . ARG B 1 30  ? -69.390 33.310  -24.551 1.00 90.38  ? 30  ARG B CD  1 
ATOM 2323  N NE  . ARG B 1 30  ? -70.655 34.000  -24.822 1.00 106.07 ? 30  ARG B NE  1 
ATOM 2324  C CZ  . ARG B 1 30  ? -71.387 33.806  -25.917 1.00 124.98 ? 30  ARG B CZ  1 
ATOM 2325  N NH1 . ARG B 1 30  ? -70.982 32.956  -26.854 1.00 116.55 ? 30  ARG B NH1 1 
ATOM 2326  N NH2 . ARG B 1 30  ? -72.521 34.470  -26.089 1.00 109.74 ? 30  ARG B NH2 1 
ATOM 2327  N N   . VAL B 1 31  ? -68.687 33.091  -19.687 1.00 50.44  ? 31  VAL B N   1 
ATOM 2328  C CA  . VAL B 1 31  ? -69.507 32.632  -18.573 1.00 51.83  ? 31  VAL B CA  1 
ATOM 2329  C C   . VAL B 1 31  ? -70.950 33.171  -18.689 1.00 57.48  ? 31  VAL B C   1 
ATOM 2330  O O   . VAL B 1 31  ? -71.165 34.304  -19.112 1.00 55.79  ? 31  VAL B O   1 
ATOM 2331  C CB  . VAL B 1 31  ? -68.779 33.069  -17.256 1.00 56.39  ? 31  VAL B CB  1 
ATOM 2332  C CG1 . VAL B 1 31  ? -69.731 33.422  -16.124 1.00 56.85  ? 31  VAL B CG1 1 
ATOM 2333  C CG2 . VAL B 1 31  ? -67.779 32.021  -16.805 1.00 56.15  ? 31  VAL B CG2 1 
ATOM 2334  N N   . GLU B 1 32  ? -71.925 32.328  -18.306 1.00 57.90  ? 32  GLU B N   1 
ATOM 2335  C CA  . GLU B 1 32  ? -73.365 32.630  -18.243 1.00 59.33  ? 32  GLU B CA  1 
ATOM 2336  C C   . GLU B 1 32  ? -73.936 32.159  -16.907 1.00 65.38  ? 32  GLU B C   1 
ATOM 2337  O O   . GLU B 1 32  ? -73.626 31.044  -16.476 1.00 64.71  ? 32  GLU B O   1 
ATOM 2338  C CB  . GLU B 1 32  ? -74.121 31.939  -19.395 1.00 60.95  ? 32  GLU B CB  1 
ATOM 2339  C CG  . GLU B 1 32  ? -73.927 32.572  -20.758 1.00 73.45  ? 32  GLU B CG  1 
ATOM 2340  C CD  . GLU B 1 32  ? -74.935 32.105  -21.788 1.00 108.15 ? 32  GLU B CD  1 
ATOM 2341  O OE1 . GLU B 1 32  ? -74.982 30.885  -22.080 1.00 109.14 ? 32  GLU B OE1 1 
ATOM 2342  O OE2 . GLU B 1 32  ? -75.708 32.961  -22.277 1.00 110.96 ? 32  GLU B OE2 1 
ATOM 2343  N N   . GLY B 1 33  ? -74.796 32.958  -16.283 1.00 65.08  ? 33  GLY B N   1 
ATOM 2344  C CA  . GLY B 1 33  ? -75.417 32.529  -15.033 1.00 67.13  ? 33  GLY B CA  1 
ATOM 2345  C C   . GLY B 1 33  ? -76.539 33.403  -14.510 1.00 76.00  ? 33  GLY B C   1 
ATOM 2346  O O   . GLY B 1 33  ? -77.265 34.028  -15.288 1.00 75.66  ? 33  GLY B O   1 
ATOM 2347  N N   . THR B 1 34  ? -76.667 33.436  -13.161 1.00 75.59  ? 34  THR B N   1 
ATOM 2348  C CA  . THR B 1 34  ? -77.602 34.233  -12.351 1.00 126.21 ? 34  THR B CA  1 
ATOM 2349  C C   . THR B 1 34  ? -77.184 35.718  -12.365 1.00 154.59 ? 34  THR B C   1 
ATOM 2350  O O   . THR B 1 34  ? -77.471 36.494  -11.446 1.00 115.11 ? 34  THR B O   1 
ATOM 2351  C CB  . THR B 1 34  ? -77.648 33.676  -10.907 1.00 137.86 ? 34  THR B CB  1 
ATOM 2352  O OG1 . THR B 1 34  ? -78.414 34.564  -10.083 1.00 139.60 ? 34  THR B OG1 1 
ATOM 2353  C CG2 . THR B 1 34  ? -76.246 33.484  -10.291 1.00 136.21 ? 34  THR B CG2 1 
ATOM 2354  N N   . GLN B 1 59  ? -80.935 37.511  -11.994 1.00 87.47  ? 59  GLN B N   1 
ATOM 2355  C CA  . GLN B 1 59  ? -81.046 38.060  -13.344 1.00 87.21  ? 59  GLN B CA  1 
ATOM 2356  C C   . GLN B 1 59  ? -79.997 37.423  -14.283 1.00 89.55  ? 59  GLN B C   1 
ATOM 2357  O O   . GLN B 1 59  ? -78.835 37.357  -13.897 1.00 89.37  ? 59  GLN B O   1 
ATOM 2358  C CB  . GLN B 1 59  ? -80.883 39.601  -13.325 1.00 88.72  ? 59  GLN B CB  1 
ATOM 2359  C CG  . GLN B 1 59  ? -81.379 40.298  -14.597 1.00 100.76 ? 59  GLN B CG  1 
ATOM 2360  C CD  . GLN B 1 59  ? -80.870 41.706  -14.744 1.00 114.37 ? 59  GLN B CD  1 
ATOM 2361  O OE1 . GLN B 1 59  ? -81.579 42.667  -14.447 1.00 110.65 ? 59  GLN B OE1 1 
ATOM 2362  N NE2 . GLN B 1 59  ? -79.658 41.861  -15.272 1.00 100.28 ? 59  GLN B NE2 1 
ATOM 2363  N N   . PRO B 1 60  ? -80.364 36.996  -15.524 1.00 84.63  ? 60  PRO B N   1 
ATOM 2364  C CA  . PRO B 1 60  ? -79.360 36.412  -16.446 1.00 83.81  ? 60  PRO B CA  1 
ATOM 2365  C C   . PRO B 1 60  ? -78.244 37.395  -16.861 1.00 84.44  ? 60  PRO B C   1 
ATOM 2366  O O   . PRO B 1 60  ? -78.514 38.579  -17.097 1.00 83.81  ? 60  PRO B O   1 
ATOM 2367  C CB  . PRO B 1 60  ? -80.202 35.993  -17.665 1.00 85.87  ? 60  PRO B CB  1 
ATOM 2368  C CG  . PRO B 1 60  ? -81.605 35.900  -17.154 1.00 90.54  ? 60  PRO B CG  1 
ATOM 2369  C CD  . PRO B 1 60  ? -81.707 36.989  -16.139 1.00 86.10  ? 60  PRO B CD  1 
ATOM 2370  N N   . PHE B 1 61  ? -76.984 36.916  -16.889 1.00 78.63  ? 61  PHE B N   1 
ATOM 2371  C CA  . PHE B 1 61  ? -75.816 37.742  -17.239 1.00 76.68  ? 61  PHE B CA  1 
ATOM 2372  C C   . PHE B 1 61  ? -74.758 36.951  -18.048 1.00 75.93  ? 61  PHE B C   1 
ATOM 2373  O O   . PHE B 1 61  ? -74.678 35.722  -17.947 1.00 74.28  ? 61  PHE B O   1 
ATOM 2374  C CB  . PHE B 1 61  ? -75.170 38.335  -15.958 1.00 78.24  ? 61  PHE B CB  1 
ATOM 2375  C CG  . PHE B 1 61  ? -74.253 37.381  -15.226 1.00 79.47  ? 61  PHE B CG  1 
ATOM 2376  C CD1 . PHE B 1 61  ? -72.880 37.392  -15.461 1.00 81.96  ? 61  PHE B CD1 1 
ATOM 2377  C CD2 . PHE B 1 61  ? -74.766 36.431  -14.353 1.00 81.13  ? 61  PHE B CD2 1 
ATOM 2378  C CE1 . PHE B 1 61  ? -72.043 36.464  -14.839 1.00 82.59  ? 61  PHE B CE1 1 
ATOM 2379  C CE2 . PHE B 1 61  ? -73.922 35.525  -13.705 1.00 83.78  ? 61  PHE B CE2 1 
ATOM 2380  C CZ  . PHE B 1 61  ? -72.569 35.541  -13.960 1.00 81.90  ? 61  PHE B CZ  1 
ATOM 2381  N N   . GLU B 1 62  ? -73.900 37.690  -18.774 1.00 70.82  ? 62  GLU B N   1 
ATOM 2382  C CA  . GLU B 1 62  ? -72.801 37.165  -19.581 1.00 69.92  ? 62  GLU B CA  1 
ATOM 2383  C C   . GLU B 1 62  ? -71.501 37.841  -19.156 1.00 71.23  ? 62  GLU B C   1 
ATOM 2384  O O   . GLU B 1 62  ? -71.398 39.069  -19.196 1.00 71.37  ? 62  GLU B O   1 
ATOM 2385  C CB  . GLU B 1 62  ? -73.069 37.355  -21.091 1.00 71.67  ? 62  GLU B CB  1 
ATOM 2386  C CG  . GLU B 1 62  ? -73.789 36.164  -21.716 1.00 90.39  ? 62  GLU B CG  1 
ATOM 2387  C CD  . GLU B 1 62  ? -74.194 36.261  -23.179 1.00 125.19 ? 62  GLU B CD  1 
ATOM 2388  O OE1 . GLU B 1 62  ? -73.355 36.676  -24.012 1.00 127.88 ? 62  GLU B OE1 1 
ATOM 2389  O OE2 . GLU B 1 62  ? -75.336 35.857  -23.499 1.00 121.47 ? 62  GLU B OE2 1 
ATOM 2390  N N   . GLY B 1 63  ? -70.546 37.033  -18.704 1.00 64.32  ? 63  GLY B N   1 
ATOM 2391  C CA  . GLY B 1 63  ? -69.231 37.490  -18.275 1.00 62.15  ? 63  GLY B CA  1 
ATOM 2392  C C   . GLY B 1 63  ? -68.115 37.031  -19.194 1.00 61.84  ? 63  GLY B C   1 
ATOM 2393  O O   . GLY B 1 63  ? -68.226 35.994  -19.856 1.00 58.47  ? 63  GLY B O   1 
ATOM 2394  N N   . LEU B 1 64  ? -67.021 37.801  -19.231 1.00 58.31  ? 64  LEU B N   1 
ATOM 2395  C CA  . LEU B 1 64  ? -65.878 37.461  -20.063 1.00 57.33  ? 64  LEU B CA  1 
ATOM 2396  C C   . LEU B 1 64  ? -64.553 37.733  -19.364 1.00 55.93  ? 64  LEU B C   1 
ATOM 2397  O O   . LEU B 1 64  ? -64.332 38.829  -18.834 1.00 56.40  ? 64  LEU B O   1 
ATOM 2398  C CB  . LEU B 1 64  ? -65.927 38.206  -21.410 1.00 57.93  ? 64  LEU B CB  1 
ATOM 2399  C CG  . LEU B 1 64  ? -65.582 37.299  -22.585 1.00 65.11  ? 64  LEU B CG  1 
ATOM 2400  C CD1 . LEU B 1 64  ? -66.555 37.492  -23.724 1.00 66.22  ? 64  LEU B CD1 1 
ATOM 2401  C CD2 . LEU B 1 64  ? -64.089 37.420  -23.004 1.00 69.25  ? 64  LEU B CD2 1 
ATOM 2402  N N   . GLY B 1 65  ? -63.680 36.728  -19.393 1.00 46.41  ? 65  GLY B N   1 
ATOM 2403  C CA  . GLY B 1 65  ? -62.327 36.795  -18.859 1.00 43.06  ? 65  GLY B CA  1 
ATOM 2404  C C   . GLY B 1 65  ? -61.349 35.999  -19.701 1.00 40.03  ? 65  GLY B C   1 
ATOM 2405  O O   . GLY B 1 65  ? -61.594 35.736  -20.887 1.00 38.51  ? 65  GLY B O   1 
ATOM 2406  N N   . SER B 1 66  ? -60.222 35.620  -19.096 1.00 31.94  ? 66  SER B N   1 
ATOM 2407  C CA  . SER B 1 66  ? -59.241 34.810  -19.797 1.00 30.60  ? 66  SER B CA  1 
ATOM 2408  C C   . SER B 1 66  ? -58.879 33.600  -18.925 1.00 32.92  ? 66  SER B C   1 
ATOM 2409  O O   . SER B 1 66  ? -59.339 33.512  -17.791 1.00 33.04  ? 66  SER B O   1 
ATOM 2410  C CB  . SER B 1 66  ? -58.008 35.630  -20.172 1.00 31.61  ? 66  SER B CB  1 
ATOM 2411  O OG  . SER B 1 66  ? -58.353 36.937  -20.597 1.00 40.56  ? 66  SER B OG  1 
ATOM 2412  N N   . GLY B 1 67  ? -58.096 32.684  -19.483 1.00 27.86  ? 67  GLY B N   1 
ATOM 2413  C CA  . GLY B 1 67  ? -57.604 31.483  -18.827 1.00 27.85  ? 67  GLY B CA  1 
ATOM 2414  C C   . GLY B 1 67  ? -56.315 30.991  -19.448 1.00 30.91  ? 67  GLY B C   1 
ATOM 2415  O O   . GLY B 1 67  ? -55.903 31.492  -20.504 1.00 29.67  ? 67  GLY B O   1 
ATOM 2416  N N   . VAL B 1 68  ? -55.654 30.040  -18.774 1.00 28.12  ? 68  VAL B N   1 
ATOM 2417  C CA  . VAL B 1 68  ? -54.382 29.456  -19.253 1.00 29.67  ? 68  VAL B CA  1 
ATOM 2418  C C   . VAL B 1 68  ? -54.461 27.924  -19.185 1.00 35.59  ? 68  VAL B C   1 
ATOM 2419  O O   . VAL B 1 68  ? -54.774 27.375  -18.099 1.00 32.78  ? 68  VAL B O   1 
ATOM 2420  C CB  . VAL B 1 68  ? -53.157 29.959  -18.443 1.00 34.28  ? 68  VAL B CB  1 
ATOM 2421  C CG1 . VAL B 1 68  ? -51.856 29.441  -19.039 1.00 34.79  ? 68  VAL B CG1 1 
ATOM 2422  C CG2 . VAL B 1 68  ? -53.123 31.470  -18.347 1.00 33.94  ? 68  VAL B CG2 1 
ATOM 2423  N N   . ILE B 1 69  ? -54.158 27.239  -20.336 1.00 33.63  ? 69  ILE B N   1 
ATOM 2424  C CA  . ILE B 1 69  ? -54.148 25.771  -20.409 1.00 34.91  ? 69  ILE B CA  1 
ATOM 2425  C C   . ILE B 1 69  ? -52.874 25.300  -19.734 1.00 40.65  ? 69  ILE B C   1 
ATOM 2426  O O   . ILE B 1 69  ? -51.762 25.574  -20.181 1.00 39.02  ? 69  ILE B O   1 
ATOM 2427  C CB  . ILE B 1 69  ? -54.327 25.157  -21.834 1.00 38.72  ? 69  ILE B CB  1 
ATOM 2428  C CG1 . ILE B 1 69  ? -55.654 25.599  -22.483 1.00 38.76  ? 69  ILE B CG1 1 
ATOM 2429  C CG2 . ILE B 1 69  ? -54.225 23.602  -21.783 1.00 39.86  ? 69  ILE B CG2 1 
ATOM 2430  C CD1 . ILE B 1 69  ? -55.650 25.428  -24.004 1.00 51.13  ? 69  ILE B CD1 1 
ATOM 2431  N N   . ILE B 1 70  ? -53.065 24.624  -18.627 1.00 42.66  ? 70  ILE B N   1 
ATOM 2432  C CA  . ILE B 1 70  ? -52.025 24.162  -17.732 1.00 44.14  ? 70  ILE B CA  1 
ATOM 2433  C C   . ILE B 1 70  ? -51.709 22.663  -18.012 1.00 49.40  ? 70  ILE B C   1 
ATOM 2434  O O   . ILE B 1 70  ? -50.562 22.243  -17.836 1.00 50.25  ? 70  ILE B O   1 
ATOM 2435  C CB  . ILE B 1 70  ? -52.510 24.505  -16.292 1.00 47.60  ? 70  ILE B CB  1 
ATOM 2436  C CG1 . ILE B 1 70  ? -51.469 25.261  -15.503 1.00 50.71  ? 70  ILE B CG1 1 
ATOM 2437  C CG2 . ILE B 1 70  ? -53.216 23.388  -15.540 1.00 46.84  ? 70  ILE B CG2 1 
ATOM 2438  C CD1 . ILE B 1 70  ? -51.493 24.951  -13.903 1.00 75.46  ? 70  ILE B CD1 1 
ATOM 2439  N N   . ASN B 1 71  ? -52.705 21.902  -18.518 1.00 45.66  ? 71  ASN B N   1 
ATOM 2440  C CA  . ASN B 1 71  ? -52.604 20.485  -18.915 1.00 45.25  ? 71  ASN B CA  1 
ATOM 2441  C C   . ASN B 1 71  ? -53.448 20.237  -20.188 1.00 47.32  ? 71  ASN B C   1 
ATOM 2442  O O   . ASN B 1 71  ? -54.673 20.126  -20.101 1.00 46.06  ? 71  ASN B O   1 
ATOM 2443  C CB  . ASN B 1 71  ? -53.056 19.543  -17.778 1.00 43.91  ? 71  ASN B CB  1 
ATOM 2444  C CG  . ASN B 1 71  ? -52.779 18.067  -18.028 1.00 57.94  ? 71  ASN B CG  1 
ATOM 2445  O OD1 . ASN B 1 71  ? -52.959 17.521  -19.122 1.00 53.72  ? 71  ASN B OD1 1 
ATOM 2446  N ND2 . ASN B 1 71  ? -52.390 17.366  -16.981 1.00 50.79  ? 71  ASN B ND2 1 
ATOM 2447  N N   . ALA B 1 72  ? -52.778 20.113  -21.343 1.00 43.36  ? 72  ALA B N   1 
ATOM 2448  C CA  . ALA B 1 72  ? -53.384 19.879  -22.659 1.00 43.30  ? 72  ALA B CA  1 
ATOM 2449  C C   . ALA B 1 72  ? -54.165 18.533  -22.747 1.00 49.31  ? 72  ALA B C   1 
ATOM 2450  O O   . ALA B 1 72  ? -55.241 18.518  -23.318 1.00 48.65  ? 72  ALA B O   1 
ATOM 2451  C CB  . ALA B 1 72  ? -52.313 19.929  -23.724 1.00 43.54  ? 72  ALA B CB  1 
ATOM 2452  N N   . SER B 1 73  ? -53.642 17.428  -22.171 1.00 47.99  ? 73  SER B N   1 
ATOM 2453  C CA  . SER B 1 73  ? -54.270 16.087  -22.167 1.00 47.52  ? 73  SER B CA  1 
ATOM 2454  C C   . SER B 1 73  ? -55.578 16.062  -21.369 1.00 53.43  ? 73  SER B C   1 
ATOM 2455  O O   . SER B 1 73  ? -56.589 15.541  -21.844 1.00 53.69  ? 73  SER B O   1 
ATOM 2456  C CB  . SER B 1 73  ? -53.326 15.043  -21.575 1.00 51.86  ? 73  SER B CB  1 
ATOM 2457  O OG  . SER B 1 73  ? -51.963 15.291  -21.884 1.00 73.94  ? 73  SER B OG  1 
ATOM 2458  N N   . LYS B 1 74  ? -55.568 16.616  -20.146 1.00 49.28  ? 74  LYS B N   1 
ATOM 2459  C CA  . LYS B 1 74  ? -56.753 16.610  -19.289 1.00 47.64  ? 74  LYS B CA  1 
ATOM 2460  C C   . LYS B 1 74  ? -57.672 17.819  -19.550 1.00 50.11  ? 74  LYS B C   1 
ATOM 2461  O O   . LYS B 1 74  ? -58.814 17.824  -19.104 1.00 49.03  ? 74  LYS B O   1 
ATOM 2462  C CB  . LYS B 1 74  ? -56.333 16.575  -17.813 1.00 49.07  ? 74  LYS B CB  1 
ATOM 2463  C CG  . LYS B 1 74  ? -55.425 15.404  -17.436 1.00 61.43  ? 74  LYS B CG  1 
ATOM 2464  C CD  . LYS B 1 74  ? -56.202 14.230  -16.858 1.00 78.25  ? 74  LYS B CD  1 
ATOM 2465  C CE  . LYS B 1 74  ? -55.293 13.097  -16.426 1.00 86.54  ? 74  LYS B CE  1 
ATOM 2466  N NZ  . LYS B 1 74  ? -54.574 13.408  -15.161 1.00 96.77  ? 74  LYS B NZ  1 
ATOM 2467  N N   . GLY B 1 75  ? -57.166 18.816  -20.268 1.00 45.93  ? 75  GLY B N   1 
ATOM 2468  C CA  . GLY B 1 75  ? -57.899 20.036  -20.563 1.00 44.76  ? 75  GLY B CA  1 
ATOM 2469  C C   . GLY B 1 75  ? -58.047 20.933  -19.356 1.00 49.23  ? 75  GLY B C   1 
ATOM 2470  O O   . GLY B 1 75  ? -59.083 21.577  -19.194 1.00 49.48  ? 75  GLY B O   1 
ATOM 2471  N N   . TYR B 1 76  ? -57.012 20.981  -18.489 1.00 46.89  ? 76  TYR B N   1 
ATOM 2472  C CA  . TYR B 1 76  ? -57.025 21.793  -17.261 1.00 45.75  ? 76  TYR B CA  1 
ATOM 2473  C C   . TYR B 1 76  ? -56.678 23.264  -17.562 1.00 43.55  ? 76  TYR B C   1 
ATOM 2474  O O   . TYR B 1 76  ? -55.600 23.570  -18.079 1.00 41.92  ? 76  TYR B O   1 
ATOM 2475  C CB  . TYR B 1 76  ? -56.083 21.216  -16.184 1.00 47.44  ? 76  TYR B CB  1 
ATOM 2476  C CG  . TYR B 1 76  ? -56.531 19.921  -15.539 1.00 51.01  ? 76  TYR B CG  1 
ATOM 2477  C CD1 . TYR B 1 76  ? -55.602 18.960  -15.141 1.00 53.12  ? 76  TYR B CD1 1 
ATOM 2478  C CD2 . TYR B 1 76  ? -57.880 19.687  -15.250 1.00 52.41  ? 76  TYR B CD2 1 
ATOM 2479  C CE1 . TYR B 1 76  ? -56.006 17.777  -14.510 1.00 54.40  ? 76  TYR B CE1 1 
ATOM 2480  C CE2 . TYR B 1 76  ? -58.297 18.506  -14.627 1.00 53.34  ? 76  TYR B CE2 1 
ATOM 2481  C CZ  . TYR B 1 76  ? -57.356 17.552  -14.261 1.00 63.52  ? 76  TYR B CZ  1 
ATOM 2482  O OH  . TYR B 1 76  ? -57.769 16.395  -13.633 1.00 64.93  ? 76  TYR B OH  1 
ATOM 2483  N N   . VAL B 1 77  ? -57.624 24.161  -17.248 1.00 37.29  ? 77  VAL B N   1 
ATOM 2484  C CA  . VAL B 1 77  ? -57.489 25.596  -17.454 1.00 36.57  ? 77  VAL B CA  1 
ATOM 2485  C C   . VAL B 1 77  ? -57.501 26.348  -16.103 1.00 42.42  ? 77  VAL B C   1 
ATOM 2486  O O   . VAL B 1 77  ? -58.430 26.208  -15.296 1.00 41.25  ? 77  VAL B O   1 
ATOM 2487  C CB  . VAL B 1 77  ? -58.575 26.130  -18.411 1.00 39.15  ? 77  VAL B CB  1 
ATOM 2488  C CG1 . VAL B 1 77  ? -58.535 27.649  -18.528 1.00 38.16  ? 77  VAL B CG1 1 
ATOM 2489  C CG2 . VAL B 1 77  ? -58.445 25.488  -19.791 1.00 39.57  ? 77  VAL B CG2 1 
ATOM 2490  N N   . LEU B 1 78  ? -56.448 27.166  -15.889 1.00 39.98  ? 78  LEU B N   1 
ATOM 2491  C CA  . LEU B 1 78  ? -56.323 28.058  -14.734 1.00 39.66  ? 78  LEU B CA  1 
ATOM 2492  C C   . LEU B 1 78  ? -56.979 29.381  -15.034 1.00 42.20  ? 78  LEU B C   1 
ATOM 2493  O O   . LEU B 1 78  ? -56.768 29.955  -16.099 1.00 41.91  ? 78  LEU B O   1 
ATOM 2494  C CB  . LEU B 1 78  ? -54.858 28.301  -14.348 1.00 39.63  ? 78  LEU B CB  1 
ATOM 2495  C CG  . LEU B 1 78  ? -54.320 27.628  -13.070 1.00 44.21  ? 78  LEU B CG  1 
ATOM 2496  C CD1 . LEU B 1 78  ? -52.902 28.047  -12.829 1.00 44.32  ? 78  LEU B CD1 1 
ATOM 2497  C CD2 . LEU B 1 78  ? -55.129 27.987  -11.856 1.00 44.99  ? 78  LEU B CD2 1 
ATOM 2498  N N   . THR B 1 79  ? -57.768 29.873  -14.092 1.00 40.22  ? 79  THR B N   1 
ATOM 2499  C CA  . THR B 1 79  ? -58.413 31.181  -14.225 1.00 40.65  ? 79  THR B CA  1 
ATOM 2500  C C   . THR B 1 79  ? -58.611 31.792  -12.817 1.00 41.03  ? 79  THR B C   1 
ATOM 2501  O O   . THR B 1 79  ? -58.044 31.293  -11.843 1.00 39.90  ? 79  THR B O   1 
ATOM 2502  C CB  . THR B 1 79  ? -59.713 31.124  -15.103 1.00 47.47  ? 79  THR B CB  1 
ATOM 2503  O OG1 . THR B 1 79  ? -60.049 32.458  -15.498 1.00 43.52  ? 79  THR B OG1 1 
ATOM 2504  C CG2 . THR B 1 79  ? -60.906 30.444  -14.410 1.00 43.72  ? 79  THR B CG2 1 
ATOM 2505  N N   . ASN B 1 80  ? -59.331 32.911  -12.745 1.00 36.63  ? 80  ASN B N   1 
ATOM 2506  C CA  . ASN B 1 80  ? -59.655 33.547  -11.479 1.00 37.20  ? 80  ASN B CA  1 
ATOM 2507  C C   . ASN B 1 80  ? -61.018 33.078  -11.018 1.00 41.70  ? 80  ASN B C   1 
ATOM 2508  O O   . ASN B 1 80  ? -61.914 32.790  -11.832 1.00 42.06  ? 80  ASN B O   1 
ATOM 2509  C CB  . ASN B 1 80  ? -59.627 35.093  -11.552 1.00 37.48  ? 80  ASN B CB  1 
ATOM 2510  C CG  . ASN B 1 80  ? -58.261 35.742  -11.608 1.00 48.95  ? 80  ASN B CG  1 
ATOM 2511  O OD1 . ASN B 1 80  ? -58.001 36.593  -12.456 1.00 39.25  ? 80  ASN B OD1 1 
ATOM 2512  N ND2 . ASN B 1 80  ? -57.378 35.414  -10.677 1.00 37.87  ? 80  ASN B ND2 1 
ATOM 2513  N N   . ASN B 1 81  ? -61.180 33.036  -9.711  1.00 38.04  ? 81  ASN B N   1 
ATOM 2514  C CA  . ASN B 1 81  ? -62.436 32.691  -9.117  1.00 38.75  ? 81  ASN B CA  1 
ATOM 2515  C C   . ASN B 1 81  ? -63.474 33.787  -9.405  1.00 46.30  ? 81  ASN B C   1 
ATOM 2516  O O   . ASN B 1 81  ? -64.609 33.450  -9.687  1.00 47.92  ? 81  ASN B O   1 
ATOM 2517  C CB  . ASN B 1 81  ? -62.268 32.472  -7.636  1.00 38.73  ? 81  ASN B CB  1 
ATOM 2518  C CG  . ASN B 1 81  ? -63.585 32.294  -6.937  1.00 59.33  ? 81  ASN B CG  1 
ATOM 2519  O OD1 . ASN B 1 81  ? -64.220 31.238  -7.062  1.00 52.70  ? 81  ASN B OD1 1 
ATOM 2520  N ND2 . ASN B 1 81  ? -64.072 33.367  -6.285  1.00 49.59  ? 81  ASN B ND2 1 
ATOM 2521  N N   . HIS B 1 82  ? -63.090 35.077  -9.400  1.00 43.63  ? 82  HIS B N   1 
ATOM 2522  C CA  . HIS B 1 82  ? -64.036 36.157  -9.650  1.00 43.36  ? 82  HIS B CA  1 
ATOM 2523  C C   . HIS B 1 82  ? -64.570 36.146  -11.105 1.00 50.42  ? 82  HIS B C   1 
ATOM 2524  O O   . HIS B 1 82  ? -65.491 36.905  -11.426 1.00 50.71  ? 82  HIS B O   1 
ATOM 2525  C CB  . HIS B 1 82  ? -63.422 37.517  -9.294  1.00 43.45  ? 82  HIS B CB  1 
ATOM 2526  C CG  . HIS B 1 82  ? -62.335 37.989  -10.209 1.00 46.62  ? 82  HIS B CG  1 
ATOM 2527  N ND1 . HIS B 1 82  ? -61.031 38.105  -9.775  1.00 48.15  ? 82  HIS B ND1 1 
ATOM 2528  C CD2 . HIS B 1 82  ? -62.402 38.433  -11.482 1.00 47.31  ? 82  HIS B CD2 1 
ATOM 2529  C CE1 . HIS B 1 82  ? -60.344 38.579  -10.799 1.00 46.51  ? 82  HIS B CE1 1 
ATOM 2530  N NE2 . HIS B 1 82  ? -61.123 38.782  -11.848 1.00 46.67  ? 82  HIS B NE2 1 
ATOM 2531  N N   . VAL B 1 83  ? -64.015 35.279  -11.964 1.00 47.74  ? 83  VAL B N   1 
ATOM 2532  C CA  . VAL B 1 83  ? -64.408 35.162  -13.378 1.00 47.38  ? 83  VAL B CA  1 
ATOM 2533  C C   . VAL B 1 83  ? -65.556 34.121  -13.526 1.00 54.03  ? 83  VAL B C   1 
ATOM 2534  O O   . VAL B 1 83  ? -66.468 34.320  -14.324 1.00 55.26  ? 83  VAL B O   1 
ATOM 2535  C CB  . VAL B 1 83  ? -63.160 34.799  -14.256 1.00 48.95  ? 83  VAL B CB  1 
ATOM 2536  C CG1 . VAL B 1 83  ? -63.529 34.456  -15.701 1.00 48.56  ? 83  VAL B CG1 1 
ATOM 2537  C CG2 . VAL B 1 83  ? -62.132 35.908  -14.229 1.00 47.94  ? 83  VAL B CG2 1 
ATOM 2538  N N   . ILE B 1 84  ? -65.496 33.034  -12.762 1.00 50.48  ? 84  ILE B N   1 
ATOM 2539  C CA  . ILE B 1 84  ? -66.435 31.909  -12.818 1.00 50.09  ? 84  ILE B CA  1 
ATOM 2540  C C   . ILE B 1 84  ? -67.411 31.874  -11.598 1.00 58.02  ? 84  ILE B C   1 
ATOM 2541  O O   . ILE B 1 84  ? -68.183 30.915  -11.451 1.00 55.64  ? 84  ILE B O   1 
ATOM 2542  C CB  . ILE B 1 84  ? -65.567 30.604  -12.884 1.00 51.65  ? 84  ILE B CB  1 
ATOM 2543  C CG1 . ILE B 1 84  ? -64.597 30.488  -11.693 1.00 51.48  ? 84  ILE B CG1 1 
ATOM 2544  C CG2 . ILE B 1 84  ? -64.804 30.505  -14.203 1.00 50.58  ? 84  ILE B CG2 1 
ATOM 2545  C CD1 . ILE B 1 84  ? -65.179 29.903  -10.365 1.00 61.61  ? 84  ILE B CD1 1 
ATOM 2546  N N   . ASN B 1 85  ? -67.336 32.906  -10.723 1.00 59.86  ? 85  ASN B N   1 
ATOM 2547  C CA  . ASN B 1 85  ? -68.034 33.005  -9.444  1.00 62.19  ? 85  ASN B CA  1 
ATOM 2548  C C   . ASN B 1 85  ? -69.540 32.692  -9.498  1.00 71.80  ? 85  ASN B C   1 
ATOM 2549  O O   . ASN B 1 85  ? -70.008 31.883  -8.685  1.00 71.80  ? 85  ASN B O   1 
ATOM 2550  C CB  . ASN B 1 85  ? -67.821 34.371  -8.781  1.00 63.38  ? 85  ASN B CB  1 
ATOM 2551  C CG  . ASN B 1 85  ? -67.646 34.253  -7.277  1.00 95.54  ? 85  ASN B CG  1 
ATOM 2552  O OD1 . ASN B 1 85  ? -68.302 33.439  -6.601  1.00 86.11  ? 85  ASN B OD1 1 
ATOM 2553  N ND2 . ASN B 1 85  ? -66.720 35.036  -6.715  1.00 92.35  ? 85  ASN B ND2 1 
ATOM 2554  N N   . GLN B 1 86  ? -70.302 33.321  -10.408 1.00 71.41  ? 86  GLN B N   1 
ATOM 2555  C CA  . GLN B 1 86  ? -71.747 33.050  -10.441 1.00 73.14  ? 86  GLN B CA  1 
ATOM 2556  C C   . GLN B 1 86  ? -72.166 32.188  -11.652 1.00 77.50  ? 86  GLN B C   1 
ATOM 2557  O O   . GLN B 1 86  ? -73.360 32.064  -11.927 1.00 78.52  ? 86  GLN B O   1 
ATOM 2558  C CB  . GLN B 1 86  ? -72.537 34.377  -10.420 1.00 75.24  ? 86  GLN B CB  1 
ATOM 2559  C CG  . GLN B 1 86  ? -72.286 35.264  -9.185  1.00 93.32  ? 86  GLN B CG  1 
ATOM 2560  C CD  . GLN B 1 86  ? -71.632 36.592  -9.534  1.00 113.43 ? 86  GLN B CD  1 
ATOM 2561  O OE1 . GLN B 1 86  ? -70.504 36.661  -10.050 1.00 112.76 ? 86  GLN B OE1 1 
ATOM 2562  N NE2 . GLN B 1 86  ? -72.305 37.686  -9.208  1.00 97.78  ? 86  GLN B NE2 1 
ATOM 2563  N N   . ALA B 1 87  ? -71.188 31.553  -12.322 1.00 72.93  ? 87  ALA B N   1 
ATOM 2564  C CA  . ALA B 1 87  ? -71.360 30.779  -13.549 1.00 72.00  ? 87  ALA B CA  1 
ATOM 2565  C C   . ALA B 1 87  ? -72.208 29.522  -13.402 1.00 74.46  ? 87  ALA B C   1 
ATOM 2566  O O   . ALA B 1 87  ? -72.042 28.739  -12.469 1.00 74.76  ? 87  ALA B O   1 
ATOM 2567  C CB  . ALA B 1 87  ? -70.009 30.399  -14.130 1.00 72.71  ? 87  ALA B CB  1 
ATOM 2568  N N   . GLN B 1 88  ? -73.100 29.337  -14.378 1.00 68.83  ? 88  GLN B N   1 
ATOM 2569  C CA  . GLN B 1 88  ? -73.982 28.191  -14.556 1.00 67.07  ? 88  GLN B CA  1 
ATOM 2570  C C   . GLN B 1 88  ? -73.519 27.441  -15.792 1.00 67.19  ? 88  GLN B C   1 
ATOM 2571  O O   . GLN B 1 88  ? -73.630 26.220  -15.858 1.00 66.76  ? 88  GLN B O   1 
ATOM 2572  C CB  . GLN B 1 88  ? -75.440 28.651  -14.693 1.00 68.73  ? 88  GLN B CB  1 
ATOM 2573  C CG  . GLN B 1 88  ? -76.035 29.198  -13.392 1.00 98.79  ? 88  GLN B CG  1 
ATOM 2574  C CD  . GLN B 1 88  ? -77.424 29.771  -13.573 1.00 126.85 ? 88  GLN B CD  1 
ATOM 2575  O OE1 . GLN B 1 88  ? -77.952 29.883  -14.689 1.00 122.38 ? 88  GLN B OE1 1 
ATOM 2576  N NE2 . GLN B 1 88  ? -78.048 30.161  -12.472 1.00 122.42 ? 88  GLN B NE2 1 
ATOM 2577  N N   . LYS B 1 89  ? -72.995 28.194  -16.778 1.00 61.71  ? 89  LYS B N   1 
ATOM 2578  C CA  . LYS B 1 89  ? -72.426 27.688  -18.026 1.00 60.19  ? 89  LYS B CA  1 
ATOM 2579  C C   . LYS B 1 89  ? -71.072 28.362  -18.270 1.00 58.59  ? 89  LYS B C   1 
ATOM 2580  O O   . LYS B 1 89  ? -70.962 29.585  -18.134 1.00 56.78  ? 89  LYS B O   1 
ATOM 2581  C CB  . LYS B 1 89  ? -73.387 27.894  -19.217 1.00 62.89  ? 89  LYS B CB  1 
ATOM 2582  C CG  . LYS B 1 89  ? -74.523 26.869  -19.237 1.00 83.54  ? 89  LYS B CG  1 
ATOM 2583  C CD  . LYS B 1 89  ? -75.529 27.107  -20.365 1.00 98.26  ? 89  LYS B CD  1 
ATOM 2584  C CE  . LYS B 1 89  ? -76.586 26.016  -20.411 1.00 102.19 ? 89  LYS B CE  1 
ATOM 2585  N NZ  . LYS B 1 89  ? -77.539 26.195  -21.543 1.00 104.28 ? 89  LYS B NZ  1 
ATOM 2586  N N   . ILE B 1 90  ? -70.036 27.547  -18.558 1.00 51.70  ? 90  ILE B N   1 
ATOM 2587  C CA  . ILE B 1 90  ? -68.674 28.026  -18.836 1.00 49.61  ? 90  ILE B CA  1 
ATOM 2588  C C   . ILE B 1 90  ? -68.217 27.462  -20.182 1.00 51.55  ? 90  ILE B C   1 
ATOM 2589  O O   . ILE B 1 90  ? -68.254 26.243  -20.390 1.00 51.47  ? 90  ILE B O   1 
ATOM 2590  C CB  . ILE B 1 90  ? -67.645 27.672  -17.702 1.00 50.80  ? 90  ILE B CB  1 
ATOM 2591  C CG1 . ILE B 1 90  ? -68.104 28.166  -16.327 1.00 49.29  ? 90  ILE B CG1 1 
ATOM 2592  C CG2 . ILE B 1 90  ? -66.243 28.193  -18.032 1.00 50.16  ? 90  ILE B CG2 1 
ATOM 2593  C CD1 . ILE B 1 90  ? -67.501 27.453  -15.163 1.00 43.74  ? 90  ILE B CD1 1 
ATOM 2594  N N   . SER B 1 91  ? -67.756 28.343  -21.065 1.00 45.57  ? 91  SER B N   1 
ATOM 2595  C CA  . SER B 1 91  ? -67.212 27.971  -22.365 1.00 45.94  ? 91  SER B CA  1 
ATOM 2596  C C   . SER B 1 91  ? -65.822 28.577  -22.527 1.00 51.51  ? 91  SER B C   1 
ATOM 2597  O O   . SER B 1 91  ? -65.552 29.666  -22.008 1.00 52.47  ? 91  SER B O   1 
ATOM 2598  C CB  . SER B 1 91  ? -68.133 28.392  -23.521 1.00 50.97  ? 91  SER B CB  1 
ATOM 2599  O OG  . SER B 1 91  ? -69.012 29.459  -23.193 1.00 68.55  ? 91  SER B OG  1 
ATOM 2600  N N   . ILE B 1 92  ? -64.938 27.855  -23.233 1.00 47.18  ? 92  ILE B N   1 
ATOM 2601  C CA  . ILE B 1 92  ? -63.574 28.281  -23.501 1.00 46.70  ? 92  ILE B CA  1 
ATOM 2602  C C   . ILE B 1 92  ? -63.451 28.497  -24.983 1.00 54.47  ? 92  ILE B C   1 
ATOM 2603  O O   . ILE B 1 92  ? -63.982 27.693  -25.756 1.00 55.11  ? 92  ILE B O   1 
ATOM 2604  C CB  . ILE B 1 92  ? -62.568 27.223  -22.938 1.00 49.36  ? 92  ILE B CB  1 
ATOM 2605  C CG1 . ILE B 1 92  ? -62.080 27.593  -21.508 1.00 49.73  ? 92  ILE B CG1 1 
ATOM 2606  C CG2 . ILE B 1 92  ? -61.342 26.983  -23.845 1.00 48.28  ? 92  ILE B CG2 1 
ATOM 2607  C CD1 . ILE B 1 92  ? -63.075 27.648  -20.412 1.00 54.06  ? 92  ILE B CD1 1 
ATOM 2608  N N   . GLN B 1 93  ? -62.772 29.591  -25.401 1.00 52.43  ? 93  GLN B N   1 
ATOM 2609  C CA  . GLN B 1 93  ? -62.528 29.816  -26.820 1.00 51.81  ? 93  GLN B CA  1 
ATOM 2610  C C   . GLN B 1 93  ? -61.042 29.919  -27.071 1.00 53.30  ? 93  GLN B C   1 
ATOM 2611  O O   . GLN B 1 93  ? -60.365 30.660  -26.370 1.00 52.57  ? 93  GLN B O   1 
ATOM 2612  C CB  . GLN B 1 93  ? -63.266 31.039  -27.371 1.00 53.51  ? 93  GLN B CB  1 
ATOM 2613  C CG  . GLN B 1 93  ? -63.174 31.075  -28.903 1.00 77.14  ? 93  GLN B CG  1 
ATOM 2614  C CD  . GLN B 1 93  ? -63.805 32.279  -29.534 1.00 100.24 ? 93  GLN B CD  1 
ATOM 2615  O OE1 . GLN B 1 93  ? -64.780 32.163  -30.272 1.00 97.24  ? 93  GLN B OE1 1 
ATOM 2616  N NE2 . GLN B 1 93  ? -63.242 33.456  -29.305 1.00 95.87  ? 93  GLN B NE2 1 
ATOM 2617  N N   . LEU B 1 94  ? -60.531 29.135  -28.032 1.00 49.76  ? 94  LEU B N   1 
ATOM 2618  C CA  . LEU B 1 94  ? -59.118 29.142  -28.417 1.00 49.37  ? 94  LEU B CA  1 
ATOM 2619  C C   . LEU B 1 94  ? -58.899 30.243  -29.436 1.00 52.28  ? 94  LEU B C   1 
ATOM 2620  O O   . LEU B 1 94  ? -59.865 30.711  -30.050 1.00 50.36  ? 94  LEU B O   1 
ATOM 2621  C CB  . LEU B 1 94  ? -58.634 27.782  -28.974 1.00 49.44  ? 94  LEU B CB  1 
ATOM 2622  C CG  . LEU B 1 94  ? -58.987 26.489  -28.224 1.00 53.81  ? 94  LEU B CG  1 
ATOM 2623  C CD1 . LEU B 1 94  ? -58.232 25.325  -28.813 1.00 53.84  ? 94  LEU B CD1 1 
ATOM 2624  C CD2 . LEU B 1 94  ? -58.676 26.570  -26.759 1.00 54.13  ? 94  LEU B CD2 1 
ATOM 2625  N N   . ASN B 1 95  ? -57.633 30.658  -29.628 1.00 50.96  ? 95  ASN B N   1 
ATOM 2626  C CA  . ASN B 1 95  ? -57.311 31.752  -30.546 1.00 51.27  ? 95  ASN B CA  1 
ATOM 2627  C C   . ASN B 1 95  ? -57.509 31.340  -32.037 1.00 56.77  ? 95  ASN B C   1 
ATOM 2628  O O   . ASN B 1 95  ? -57.465 32.204  -32.901 1.00 58.81  ? 95  ASN B O   1 
ATOM 2629  C CB  . ASN B 1 95  ? -55.898 32.335  -30.269 1.00 47.50  ? 95  ASN B CB  1 
ATOM 2630  C CG  . ASN B 1 95  ? -54.739 31.407  -30.497 1.00 61.01  ? 95  ASN B CG  1 
ATOM 2631  O OD1 . ASN B 1 95  ? -54.905 30.211  -30.766 1.00 66.70  ? 95  ASN B OD1 1 
ATOM 2632  N ND2 . ASN B 1 95  ? -53.528 31.953  -30.411 1.00 44.66  ? 95  ASN B ND2 1 
ATOM 2633  N N   . ASP B 1 96  ? -57.794 30.054  -32.322 1.00 51.57  ? 96  ASP B N   1 
ATOM 2634  C CA  . ASP B 1 96  ? -58.072 29.537  -33.677 1.00 49.35  ? 96  ASP B CA  1 
ATOM 2635  C C   . ASP B 1 96  ? -59.600 29.528  -33.967 1.00 52.01  ? 96  ASP B C   1 
ATOM 2636  O O   . ASP B 1 96  ? -60.027 29.249  -35.097 1.00 50.37  ? 96  ASP B O   1 
ATOM 2637  C CB  . ASP B 1 96  ? -57.468 28.129  -33.880 1.00 49.91  ? 96  ASP B CB  1 
ATOM 2638  C CG  . ASP B 1 96  ? -57.997 27.000  -32.998 1.00 53.42  ? 96  ASP B CG  1 
ATOM 2639  O OD1 . ASP B 1 96  ? -58.982 27.233  -32.246 1.00 50.80  ? 96  ASP B OD1 1 
ATOM 2640  O OD2 . ASP B 1 96  ? -57.448 25.863  -33.090 1.00 59.63  ? 96  ASP B OD2 1 
ATOM 2641  N N   . GLY B 1 97  ? -60.390 29.834  -32.936 1.00 48.52  ? 97  GLY B N   1 
ATOM 2642  C CA  . GLY B 1 97  ? -61.845 29.900  -33.017 1.00 48.07  ? 97  GLY B CA  1 
ATOM 2643  C C   . GLY B 1 97  ? -62.590 28.725  -32.403 1.00 51.56  ? 97  GLY B C   1 
ATOM 2644  O O   . GLY B 1 97  ? -63.824 28.769  -32.300 1.00 50.08  ? 97  GLY B O   1 
ATOM 2645  N N   . ARG B 1 98  ? -61.862 27.649  -32.022 1.00 48.08  ? 98  ARG B N   1 
ATOM 2646  C CA  . ARG B 1 98  ? -62.484 26.467  -31.434 1.00 48.51  ? 98  ARG B CA  1 
ATOM 2647  C C   . ARG B 1 98  ? -63.070 26.766  -30.069 1.00 52.51  ? 98  ARG B C   1 
ATOM 2648  O O   . ARG B 1 98  ? -62.426 27.397  -29.238 1.00 54.26  ? 98  ARG B O   1 
ATOM 2649  C CB  . ARG B 1 98  ? -61.499 25.299  -31.331 1.00 49.74  ? 98  ARG B CB  1 
ATOM 2650  C CG  . ARG B 1 98  ? -61.199 24.653  -32.667 1.00 54.93  ? 98  ARG B CG  1 
ATOM 2651  C CD  . ARG B 1 98  ? -60.439 23.369  -32.508 1.00 57.07  ? 98  ARG B CD  1 
ATOM 2652  N NE  . ARG B 1 98  ? -59.043 23.590  -32.132 1.00 57.05  ? 98  ARG B NE  1 
ATOM 2653  C CZ  . ARG B 1 98  ? -58.340 22.748  -31.379 1.00 75.98  ? 98  ARG B CZ  1 
ATOM 2654  N NH1 . ARG B 1 98  ? -58.907 21.643  -30.899 1.00 59.63  ? 98  ARG B NH1 1 
ATOM 2655  N NH2 . ARG B 1 98  ? -57.076 23.016  -31.079 1.00 64.57  ? 98  ARG B NH2 1 
ATOM 2656  N N   . GLU B 1 99  ? -64.309 26.327  -29.862 1.00 47.37  ? 99  GLU B N   1 
ATOM 2657  C CA  . GLU B 1 99  ? -65.079 26.496  -28.633 1.00 46.05  ? 99  GLU B CA  1 
ATOM 2658  C C   . GLU B 1 99  ? -65.259 25.149  -27.965 1.00 50.77  ? 99  GLU B C   1 
ATOM 2659  O O   . GLU B 1 99  ? -65.478 24.132  -28.632 1.00 50.60  ? 99  GLU B O   1 
ATOM 2660  C CB  . GLU B 1 99  ? -66.450 27.141  -28.904 1.00 46.75  ? 99  GLU B CB  1 
ATOM 2661  C CG  . GLU B 1 99  ? -66.402 28.618  -29.246 1.00 58.64  ? 99  GLU B CG  1 
ATOM 2662  C CD  . GLU B 1 99  ? -67.549 29.153  -30.083 1.00 98.25  ? 99  GLU B CD  1 
ATOM 2663  O OE1 . GLU B 1 99  ? -68.696 28.674  -29.919 1.00 88.63  ? 99  GLU B OE1 1 
ATOM 2664  O OE2 . GLU B 1 99  ? -67.298 30.074  -30.896 1.00 106.25 ? 99  GLU B OE2 1 
ATOM 2665  N N   . PHE B 1 100 ? -65.152 25.148  -26.642 1.00 47.58  ? 100 PHE B N   1 
ATOM 2666  C CA  . PHE B 1 100 ? -65.304 23.974  -25.796 1.00 46.76  ? 100 PHE B CA  1 
ATOM 2667  C C   . PHE B 1 100 ? -66.115 24.288  -24.584 1.00 51.43  ? 100 PHE B C   1 
ATOM 2668  O O   . PHE B 1 100 ? -66.075 25.414  -24.092 1.00 50.87  ? 100 PHE B O   1 
ATOM 2669  C CB  . PHE B 1 100 ? -63.944 23.471  -25.321 1.00 48.45  ? 100 PHE B CB  1 
ATOM 2670  C CG  . PHE B 1 100 ? -63.009 22.937  -26.376 1.00 49.89  ? 100 PHE B CG  1 
ATOM 2671  C CD1 . PHE B 1 100 ? -62.113 23.786  -27.027 1.00 52.74  ? 100 PHE B CD1 1 
ATOM 2672  C CD2 . PHE B 1 100 ? -62.962 21.572  -26.661 1.00 50.33  ? 100 PHE B CD2 1 
ATOM 2673  C CE1 . PHE B 1 100 ? -61.222 23.290  -27.981 1.00 53.01  ? 100 PHE B CE1 1 
ATOM 2674  C CE2 . PHE B 1 100 ? -62.054 21.075  -27.600 1.00 53.80  ? 100 PHE B CE2 1 
ATOM 2675  C CZ  . PHE B 1 100 ? -61.192 21.939  -28.259 1.00 51.93  ? 100 PHE B CZ  1 
ATOM 2676  N N   . ASP B 1 101 ? -66.812 23.290  -24.058 1.00 50.43  ? 101 ASP B N   1 
ATOM 2677  C CA  . ASP B 1 101 ? -67.505 23.472  -22.802 1.00 50.40  ? 101 ASP B CA  1 
ATOM 2678  C C   . ASP B 1 101 ? -66.519 23.182  -21.689 1.00 51.88  ? 101 ASP B C   1 
ATOM 2679  O O   . ASP B 1 101 ? -65.518 22.490  -21.908 1.00 49.83  ? 101 ASP B O   1 
ATOM 2680  C CB  . ASP B 1 101 ? -68.763 22.623  -22.702 1.00 52.75  ? 101 ASP B CB  1 
ATOM 2681  C CG  . ASP B 1 101 ? -69.989 23.502  -22.868 1.00 80.03  ? 101 ASP B CG  1 
ATOM 2682  O OD1 . ASP B 1 101 ? -70.395 24.163  -21.867 1.00 82.67  ? 101 ASP B OD1 1 
ATOM 2683  O OD2 . ASP B 1 101 ? -70.479 23.626  -24.018 1.00 91.75  ? 101 ASP B OD2 1 
ATOM 2684  N N   . ALA B 1 102 ? -66.753 23.780  -20.517 1.00 48.44  ? 102 ALA B N   1 
ATOM 2685  C CA  . ALA B 1 102 ? -65.863 23.583  -19.380 1.00 47.18  ? 102 ALA B CA  1 
ATOM 2686  C C   . ALA B 1 102 ? -66.643 23.402  -18.109 1.00 50.12  ? 102 ALA B C   1 
ATOM 2687  O O   . ALA B 1 102 ? -67.723 23.969  -17.941 1.00 48.25  ? 102 ALA B O   1 
ATOM 2688  C CB  . ALA B 1 102 ? -64.905 24.762  -19.248 1.00 47.46  ? 102 ALA B CB  1 
ATOM 2689  N N   . LYS B 1 103 ? -66.078 22.614  -17.204 1.00 49.88  ? 103 LYS B N   1 
ATOM 2690  C CA  . LYS B 1 103 ? -66.671 22.352  -15.891 1.00 51.00  ? 103 LYS B CA  1 
ATOM 2691  C C   . LYS B 1 103 ? -65.715 22.827  -14.815 1.00 53.84  ? 103 LYS B C   1 
ATOM 2692  O O   . LYS B 1 103 ? -64.502 22.676  -14.957 1.00 51.12  ? 103 LYS B O   1 
ATOM 2693  C CB  . LYS B 1 103 ? -67.010 20.852  -15.712 1.00 53.94  ? 103 LYS B CB  1 
ATOM 2694  C CG  . LYS B 1 103 ? -68.279 20.432  -16.437 1.00 74.06  ? 103 LYS B CG  1 
ATOM 2695  C CD  . LYS B 1 103 ? -68.558 18.947  -16.316 1.00 93.26  ? 103 LYS B CD  1 
ATOM 2696  C CE  . LYS B 1 103 ? -69.838 18.572  -17.037 1.00 109.09 ? 103 LYS B CE  1 
ATOM 2697  N NZ  . LYS B 1 103 ? -70.173 17.133  -16.881 1.00 117.79 ? 103 LYS B NZ  1 
ATOM 2698  N N   . LEU B 1 104 ? -66.263 23.423  -13.750 1.00 51.49  ? 104 LEU B N   1 
ATOM 2699  C CA  . LEU B 1 104 ? -65.470 23.886  -12.629 1.00 50.91  ? 104 LEU B CA  1 
ATOM 2700  C C   . LEU B 1 104 ? -64.997 22.687  -11.819 1.00 58.90  ? 104 LEU B C   1 
ATOM 2701  O O   . LEU B 1 104 ? -65.830 21.918  -11.312 1.00 60.15  ? 104 LEU B O   1 
ATOM 2702  C CB  . LEU B 1 104 ? -66.285 24.841  -11.757 1.00 50.22  ? 104 LEU B CB  1 
ATOM 2703  C CG  . LEU B 1 104 ? -65.583 25.407  -10.530 1.00 54.59  ? 104 LEU B CG  1 
ATOM 2704  C CD1 . LEU B 1 104 ? -64.373 26.277  -10.909 1.00 54.83  ? 104 LEU B CD1 1 
ATOM 2705  C CD2 . LEU B 1 104 ? -66.539 26.208  -9.705  1.00 56.22  ? 104 LEU B CD2 1 
ATOM 2706  N N   . ILE B 1 105 ? -63.662 22.505  -11.730 1.00 55.46  ? 105 ILE B N   1 
ATOM 2707  C CA  . ILE B 1 105 ? -63.059 21.429  -10.948 1.00 55.87  ? 105 ILE B CA  1 
ATOM 2708  C C   . ILE B 1 105 ? -63.050 21.849  -9.469  1.00 60.67  ? 105 ILE B C   1 
ATOM 2709  O O   . ILE B 1 105 ? -63.449 21.076  -8.602  1.00 62.17  ? 105 ILE B O   1 
ATOM 2710  C CB  . ILE B 1 105 ? -61.652 21.063  -11.486 1.00 59.35  ? 105 ILE B CB  1 
ATOM 2711  C CG1 . ILE B 1 105 ? -61.726 20.396  -12.874 1.00 60.30  ? 105 ILE B CG1 1 
ATOM 2712  C CG2 . ILE B 1 105 ? -60.864 20.196  -10.502 1.00 58.98  ? 105 ILE B CG2 1 
ATOM 2713  C CD1 . ILE B 1 105 ? -62.799 19.259  -13.054 1.00 68.42  ? 105 ILE B CD1 1 
ATOM 2714  N N   . GLY B 1 106 ? -62.645 23.085  -9.222  1.00 55.55  ? 106 GLY B N   1 
ATOM 2715  C CA  . GLY B 1 106 ? -62.578 23.666  -7.895  1.00 54.18  ? 106 GLY B CA  1 
ATOM 2716  C C   . GLY B 1 106 ? -62.111 25.099  -7.952  1.00 55.82  ? 106 GLY B C   1 
ATOM 2717  O O   . GLY B 1 106 ? -61.652 25.572  -8.992  1.00 53.00  ? 106 GLY B O   1 
ATOM 2718  N N   . SER B 1 107 ? -62.227 25.797  -6.824  1.00 53.84  ? 107 SER B N   1 
ATOM 2719  C CA  . SER B 1 107 ? -61.828 27.192  -6.710  1.00 53.21  ? 107 SER B CA  1 
ATOM 2720  C C   . SER B 1 107 ? -61.426 27.538  -5.288  1.00 58.19  ? 107 SER B C   1 
ATOM 2721  O O   . SER B 1 107 ? -61.771 26.814  -4.354  1.00 57.54  ? 107 SER B O   1 
ATOM 2722  C CB  . SER B 1 107 ? -62.967 28.098  -7.151  1.00 55.02  ? 107 SER B CB  1 
ATOM 2723  O OG  . SER B 1 107 ? -64.081 27.929  -6.298  1.00 64.80  ? 107 SER B OG  1 
ATOM 2724  N N   . ASP B 1 108 ? -60.685 28.648  -5.135  1.00 54.44  ? 108 ASP B N   1 
ATOM 2725  C CA  . ASP B 1 108 ? -60.287 29.216  -3.858  1.00 53.48  ? 108 ASP B CA  1 
ATOM 2726  C C   . ASP B 1 108 ? -60.661 30.697  -3.860  1.00 57.31  ? 108 ASP B C   1 
ATOM 2727  O O   . ASP B 1 108 ? -60.096 31.480  -4.631  1.00 57.61  ? 108 ASP B O   1 
ATOM 2728  C CB  . ASP B 1 108 ? -58.790 29.001  -3.578  1.00 55.37  ? 108 ASP B CB  1 
ATOM 2729  C CG  . ASP B 1 108 ? -58.285 29.556  -2.250  1.00 65.04  ? 108 ASP B CG  1 
ATOM 2730  O OD1 . ASP B 1 108 ? -59.128 29.867  -1.366  1.00 66.34  ? 108 ASP B OD1 1 
ATOM 2731  O OD2 . ASP B 1 108 ? -57.053 29.640  -2.078  1.00 69.10  ? 108 ASP B OD2 1 
ATOM 2732  N N   . ASP B 1 109 ? -61.625 31.062  -3.007  1.00 53.57  ? 109 ASP B N   1 
ATOM 2733  C CA  . ASP B 1 109 ? -62.130 32.426  -2.813  1.00 53.95  ? 109 ASP B CA  1 
ATOM 2734  C C   . ASP B 1 109 ? -61.047 33.361  -2.277  1.00 54.31  ? 109 ASP B C   1 
ATOM 2735  O O   . ASP B 1 109 ? -60.984 34.521  -2.676  1.00 54.23  ? 109 ASP B O   1 
ATOM 2736  C CB  . ASP B 1 109 ? -63.311 32.449  -1.806  1.00 57.53  ? 109 ASP B CB  1 
ATOM 2737  C CG  . ASP B 1 109 ? -64.372 31.353  -1.892  1.00 90.24  ? 109 ASP B CG  1 
ATOM 2738  O OD1 . ASP B 1 109 ? -65.529 31.610  -1.456  1.00 94.37  ? 109 ASP B OD1 1 
ATOM 2739  O OD2 . ASP B 1 109 ? -64.032 30.208  -2.319  1.00 103.07 ? 109 ASP B OD2 1 
ATOM 2740  N N   . GLN B 1 110 ? -60.228 32.866  -1.338  1.00 49.01  ? 110 GLN B N   1 
ATOM 2741  C CA  . GLN B 1 110 ? -59.212 33.656  -0.651  1.00 49.14  ? 110 GLN B CA  1 
ATOM 2742  C C   . GLN B 1 110 ? -58.054 34.092  -1.550  1.00 52.71  ? 110 GLN B C   1 
ATOM 2743  O O   . GLN B 1 110 ? -57.602 35.235  -1.448  1.00 53.46  ? 110 GLN B O   1 
ATOM 2744  C CB  . GLN B 1 110 ? -58.678 32.885  0.549   1.00 50.75  ? 110 GLN B CB  1 
ATOM 2745  C CG  . GLN B 1 110 ? -59.618 32.894  1.749   1.00 75.86  ? 110 GLN B CG  1 
ATOM 2746  C CD  . GLN B 1 110 ? -58.965 32.207  2.927   1.00 117.31 ? 110 GLN B CD  1 
ATOM 2747  O OE1 . GLN B 1 110 ? -58.110 32.781  3.627   1.00 115.02 ? 110 GLN B OE1 1 
ATOM 2748  N NE2 . GLN B 1 110 ? -59.326 30.946  3.152   1.00 113.76 ? 110 GLN B NE2 1 
ATOM 2749  N N   . SER B 1 111 ? -57.562 33.192  -2.409  1.00 48.07  ? 111 SER B N   1 
ATOM 2750  C CA  . SER B 1 111 ? -56.446 33.511  -3.291  1.00 46.49  ? 111 SER B CA  1 
ATOM 2751  C C   . SER B 1 111 ? -56.915 33.952  -4.690  1.00 48.24  ? 111 SER B C   1 
ATOM 2752  O O   . SER B 1 111 ? -56.123 34.555  -5.419  1.00 48.75  ? 111 SER B O   1 
ATOM 2753  C CB  . SER B 1 111 ? -55.486 32.337  -3.392  1.00 48.00  ? 111 SER B CB  1 
ATOM 2754  O OG  . SER B 1 111 ? -56.168 31.224  -3.932  1.00 61.45  ? 111 SER B OG  1 
ATOM 2755  N N   . ASP B 1 112 ? -58.192 33.685  -5.042  1.00 42.00  ? 112 ASP B N   1 
ATOM 2756  C CA  . ASP B 1 112 ? -58.844 34.026  -6.324  1.00 42.14  ? 112 ASP B CA  1 
ATOM 2757  C C   . ASP B 1 112 ? -58.353 33.125  -7.487  1.00 45.27  ? 112 ASP B C   1 
ATOM 2758  O O   . ASP B 1 112 ? -58.150 33.597  -8.609  1.00 42.46  ? 112 ASP B O   1 
ATOM 2759  C CB  . ASP B 1 112 ? -58.685 35.514  -6.690  1.00 43.54  ? 112 ASP B CB  1 
ATOM 2760  C CG  . ASP B 1 112 ? -59.736 36.116  -7.596  1.00 49.11  ? 112 ASP B CG  1 
ATOM 2761  O OD1 . ASP B 1 112 ? -60.650 35.378  -8.028  1.00 50.45  ? 112 ASP B OD1 1 
ATOM 2762  O OD2 . ASP B 1 112 ? -59.641 37.326  -7.877  1.00 51.02  ? 112 ASP B OD2 1 
ATOM 2763  N N   . ILE B 1 113 ? -58.211 31.817  -7.221  1.00 43.09  ? 113 ILE B N   1 
ATOM 2764  C CA  . ILE B 1 113 ? -57.820 30.896  -8.272  1.00 43.22  ? 113 ILE B CA  1 
ATOM 2765  C C   . ILE B 1 113 ? -58.901 29.831  -8.440  1.00 46.45  ? 113 ILE B C   1 
ATOM 2766  O O   . ILE B 1 113 ? -59.367 29.247  -7.469  1.00 46.81  ? 113 ILE B O   1 
ATOM 2767  C CB  . ILE B 1 113 ? -56.400 30.317  -8.031  1.00 46.46  ? 113 ILE B CB  1 
ATOM 2768  C CG1 . ILE B 1 113 ? -55.396 31.176  -8.807  1.00 47.14  ? 113 ILE B CG1 1 
ATOM 2769  C CG2 . ILE B 1 113 ? -56.254 28.842  -8.485  1.00 46.47  ? 113 ILE B CG2 1 
ATOM 2770  C CD1 . ILE B 1 113 ? -54.245 31.306  -8.140  1.00 63.32  ? 113 ILE B CD1 1 
ATOM 2771  N N   . ALA B 1 114 ? -59.316 29.618  -9.678  1.00 42.20  ? 114 ALA B N   1 
ATOM 2772  C CA  . ALA B 1 114 ? -60.270 28.581  -10.045 1.00 41.98  ? 114 ALA B CA  1 
ATOM 2773  C C   . ALA B 1 114 ? -59.643 27.720  -11.101 1.00 45.66  ? 114 ALA B C   1 
ATOM 2774  O O   . ALA B 1 114 ? -58.848 28.228  -11.905 1.00 44.38  ? 114 ALA B O   1 
ATOM 2775  C CB  . ALA B 1 114 ? -61.566 29.192  -10.556 1.00 42.50  ? 114 ALA B CB  1 
ATOM 2776  N N   . LEU B 1 115 ? -59.961 26.413  -11.074 1.00 43.23  ? 115 LEU B N   1 
ATOM 2777  C CA  . LEU B 1 115 ? -59.490 25.450  -12.052 1.00 44.05  ? 115 LEU B CA  1 
ATOM 2778  C C   . LEU B 1 115 ? -60.683 24.855  -12.796 1.00 48.63  ? 115 LEU B C   1 
ATOM 2779  O O   . LEU B 1 115 ? -61.661 24.433  -12.177 1.00 48.60  ? 115 LEU B O   1 
ATOM 2780  C CB  . LEU B 1 115 ? -58.637 24.348  -11.415 1.00 44.66  ? 115 LEU B CB  1 
ATOM 2781  C CG  . LEU B 1 115 ? -58.005 23.348  -12.408 1.00 49.42  ? 115 LEU B CG  1 
ATOM 2782  C CD1 . LEU B 1 115 ? -56.667 23.861  -12.958 1.00 49.42  ? 115 LEU B CD1 1 
ATOM 2783  C CD2 . LEU B 1 115 ? -57.860 22.010  -11.782 1.00 49.60  ? 115 LEU B CD2 1 
ATOM 2784  N N   . LEU B 1 116 ? -60.590 24.859  -14.131 1.00 44.18  ? 116 LEU B N   1 
ATOM 2785  C CA  . LEU B 1 116 ? -61.600 24.346  -15.036 1.00 43.09  ? 116 LEU B CA  1 
ATOM 2786  C C   . LEU B 1 116 ? -61.086 23.161  -15.811 1.00 48.41  ? 116 LEU B C   1 
ATOM 2787  O O   . LEU B 1 116 ? -59.878 23.011  -15.991 1.00 48.79  ? 116 LEU B O   1 
ATOM 2788  C CB  . LEU B 1 116 ? -62.030 25.433  -16.026 1.00 42.93  ? 116 LEU B CB  1 
ATOM 2789  C CG  . LEU B 1 116 ? -62.376 26.831  -15.480 1.00 46.54  ? 116 LEU B CG  1 
ATOM 2790  C CD1 . LEU B 1 116 ? -62.596 27.793  -16.615 1.00 45.41  ? 116 LEU B CD1 1 
ATOM 2791  C CD2 . LEU B 1 116 ? -63.605 26.791  -14.581 1.00 48.75  ? 116 LEU B CD2 1 
ATOM 2792  N N   . GLN B 1 117 ? -62.009 22.318  -16.290 1.00 45.39  ? 117 GLN B N   1 
ATOM 2793  C CA  . GLN B 1 117 ? -61.670 21.198  -17.152 1.00 44.98  ? 117 GLN B CA  1 
ATOM 2794  C C   . GLN B 1 117 ? -62.483 21.280  -18.414 1.00 50.83  ? 117 GLN B C   1 
ATOM 2795  O O   . GLN B 1 117 ? -63.718 21.325  -18.356 1.00 52.54  ? 117 GLN B O   1 
ATOM 2796  C CB  . GLN B 1 117 ? -61.862 19.860  -16.470 1.00 46.18  ? 117 GLN B CB  1 
ATOM 2797  C CG  . GLN B 1 117 ? -61.379 18.690  -17.316 1.00 51.72  ? 117 GLN B CG  1 
ATOM 2798  C CD  . GLN B 1 117 ? -61.297 17.395  -16.551 1.00 55.91  ? 117 GLN B CD  1 
ATOM 2799  O OE1 . GLN B 1 117 ? -62.136 17.069  -15.696 1.00 52.30  ? 117 GLN B OE1 1 
ATOM 2800  N NE2 . GLN B 1 117 ? -60.303 16.606  -16.881 1.00 37.77  ? 117 GLN B NE2 1 
ATOM 2801  N N   . ILE B 1 118 ? -61.787 21.351  -19.553 1.00 47.17  ? 118 ILE B N   1 
ATOM 2802  C CA  . ILE B 1 118 ? -62.385 21.377  -20.886 1.00 48.00  ? 118 ILE B CA  1 
ATOM 2803  C C   . ILE B 1 118 ? -63.027 20.016  -21.145 1.00 53.28  ? 118 ILE B C   1 
ATOM 2804  O O   . ILE B 1 118 ? -62.376 18.978  -20.952 1.00 53.18  ? 118 ILE B O   1 
ATOM 2805  C CB  . ILE B 1 118 ? -61.324 21.721  -21.965 1.00 51.47  ? 118 ILE B CB  1 
ATOM 2806  C CG1 . ILE B 1 118 ? -60.939 23.194  -21.922 1.00 51.94  ? 118 ILE B CG1 1 
ATOM 2807  C CG2 . ILE B 1 118 ? -61.781 21.311  -23.354 1.00 53.47  ? 118 ILE B CG2 1 
ATOM 2808  C CD1 . ILE B 1 118 ? -59.626 23.505  -22.631 1.00 58.98  ? 118 ILE B CD1 1 
ATOM 2809  N N   . GLN B 1 119 ? -64.305 20.030  -21.557 1.00 49.76  ? 119 GLN B N   1 
ATOM 2810  C CA  . GLN B 1 119 ? -65.060 18.821  -21.901 1.00 48.65  ? 119 GLN B CA  1 
ATOM 2811  C C   . GLN B 1 119 ? -64.660 18.393  -23.315 1.00 53.73  ? 119 GLN B C   1 
ATOM 2812  O O   . GLN B 1 119 ? -64.752 19.188  -24.264 1.00 53.59  ? 119 GLN B O   1 
ATOM 2813  C CB  . GLN B 1 119 ? -66.573 19.049  -21.763 1.00 48.53  ? 119 GLN B CB  1 
ATOM 2814  C CG  . GLN B 1 119 ? -66.999 19.474  -20.366 1.00 58.61  ? 119 GLN B CG  1 
ATOM 2815  C CD  . GLN B 1 119 ? -66.571 18.494  -19.289 1.00 73.65  ? 119 GLN B CD  1 
ATOM 2816  O OE1 . GLN B 1 119 ? -67.151 17.420  -19.129 1.00 74.69  ? 119 GLN B OE1 1 
ATOM 2817  N NE2 . GLN B 1 119 ? -65.554 18.849  -18.522 1.00 52.08  ? 119 GLN B NE2 1 
ATOM 2818  N N   . ASN B 1 120 ? -64.157 17.155  -23.420 1.00 51.00  ? 120 ASN B N   1 
ATOM 2819  C CA  . ASN B 1 120 ? -63.673 16.511  -24.641 1.00 52.12  ? 120 ASN B CA  1 
ATOM 2820  C C   . ASN B 1 120 ? -62.558 17.366  -25.297 1.00 57.88  ? 120 ASN B C   1 
ATOM 2821  O O   . ASN B 1 120 ? -62.713 17.847  -26.426 1.00 57.38  ? 120 ASN B O   1 
ATOM 2822  C CB  . ASN B 1 120 ? -64.829 16.164  -25.607 1.00 53.90  ? 120 ASN B CB  1 
ATOM 2823  C CG  . ASN B 1 120 ? -65.843 15.220  -24.952 1.00 79.13  ? 120 ASN B CG  1 
ATOM 2824  O OD1 . ASN B 1 120 ? -66.980 15.593  -24.652 1.00 64.54  ? 120 ASN B OD1 1 
ATOM 2825  N ND2 . ASN B 1 120 ? -65.427 13.999  -24.608 1.00 75.39  ? 120 ASN B ND2 1 
ATOM 2826  N N   . PRO B 1 121 ? -61.407 17.536  -24.571 1.00 55.09  ? 121 PRO B N   1 
ATOM 2827  C CA  . PRO B 1 121 ? -60.286 18.315  -25.131 1.00 53.94  ? 121 PRO B CA  1 
ATOM 2828  C C   . PRO B 1 121 ? -59.644 17.618  -26.313 1.00 57.71  ? 121 PRO B C   1 
ATOM 2829  O O   . PRO B 1 121 ? -59.642 16.394  -26.368 1.00 59.89  ? 121 PRO B O   1 
ATOM 2830  C CB  . PRO B 1 121 ? -59.309 18.408  -23.962 1.00 55.35  ? 121 PRO B CB  1 
ATOM 2831  C CG  . PRO B 1 121 ? -59.616 17.253  -23.105 1.00 59.96  ? 121 PRO B CG  1 
ATOM 2832  C CD  . PRO B 1 121 ? -61.074 17.014  -23.226 1.00 55.95  ? 121 PRO B CD  1 
ATOM 2833  N N   . SER B 1 122 ? -59.087 18.392  -27.247 1.00 51.84  ? 122 SER B N   1 
ATOM 2834  C CA  . SER B 1 122 ? -58.468 17.865  -28.460 1.00 50.27  ? 122 SER B CA  1 
ATOM 2835  C C   . SER B 1 122 ? -57.480 18.873  -29.039 1.00 52.24  ? 122 SER B C   1 
ATOM 2836  O O   . SER B 1 122 ? -57.833 20.047  -29.158 1.00 53.80  ? 122 SER B O   1 
ATOM 2837  C CB  . SER B 1 122 ? -59.563 17.543  -29.482 1.00 53.75  ? 122 SER B CB  1 
ATOM 2838  O OG  . SER B 1 122 ? -59.049 17.393  -30.793 1.00 68.62  ? 122 SER B OG  1 
ATOM 2839  N N   . LYS B 1 123 ? -56.260 18.415  -29.409 1.00 47.07  ? 123 LYS B N   1 
ATOM 2840  C CA  . LYS B 1 123 ? -55.174 19.187  -30.046 1.00 47.35  ? 123 LYS B CA  1 
ATOM 2841  C C   . LYS B 1 123 ? -54.934 20.535  -29.326 1.00 51.62  ? 123 LYS B C   1 
ATOM 2842  O O   . LYS B 1 123 ? -54.899 21.604  -29.944 1.00 51.70  ? 123 LYS B O   1 
ATOM 2843  C CB  . LYS B 1 123 ? -55.472 19.416  -31.555 1.00 51.83  ? 123 LYS B CB  1 
ATOM 2844  C CG  . LYS B 1 123 ? -55.487 18.155  -32.439 1.00 72.83  ? 123 LYS B CG  1 
ATOM 2845  C CD  . LYS B 1 123 ? -56.050 18.471  -33.835 1.00 86.65  ? 123 LYS B CD  1 
ATOM 2846  C CE  . LYS B 1 123 ? -56.390 17.245  -34.655 1.00 103.54 ? 123 LYS B CE  1 
ATOM 2847  N NZ  . LYS B 1 123 ? -57.264 17.572  -35.819 1.00 109.92 ? 123 LYS B NZ  1 
ATOM 2848  N N   . LEU B 1 124 ? -54.808 20.469  -28.003 1.00 47.43  ? 124 LEU B N   1 
ATOM 2849  C CA  . LEU B 1 124 ? -54.604 21.619  -27.126 1.00 45.61  ? 124 LEU B CA  1 
ATOM 2850  C C   . LEU B 1 124 ? -53.110 21.875  -26.896 1.00 50.44  ? 124 LEU B C   1 
ATOM 2851  O O   . LEU B 1 124 ? -52.298 20.943  -26.958 1.00 48.99  ? 124 LEU B O   1 
ATOM 2852  C CB  . LEU B 1 124 ? -55.279 21.297  -25.793 1.00 44.82  ? 124 LEU B CB  1 
ATOM 2853  C CG  . LEU B 1 124 ? -56.602 21.955  -25.415 1.00 47.74  ? 124 LEU B CG  1 
ATOM 2854  C CD1 . LEU B 1 124 ? -57.573 22.034  -26.555 1.00 47.25  ? 124 LEU B CD1 1 
ATOM 2855  C CD2 . LEU B 1 124 ? -57.213 21.264  -24.239 1.00 44.85  ? 124 LEU B CD2 1 
ATOM 2856  N N   . THR B 1 125 ? -52.761 23.145  -26.630 1.00 48.20  ? 125 THR B N   1 
ATOM 2857  C CA  . THR B 1 125 ? -51.404 23.602  -26.323 1.00 46.66  ? 125 THR B CA  1 
ATOM 2858  C C   . THR B 1 125 ? -51.387 23.975  -24.856 1.00 49.72  ? 125 THR B C   1 
ATOM 2859  O O   . THR B 1 125 ? -52.317 24.639  -24.390 1.00 50.25  ? 125 THR B O   1 
ATOM 2860  C CB  . THR B 1 125 ? -51.014 24.768  -27.234 1.00 51.51  ? 125 THR B CB  1 
ATOM 2861  O OG1 . THR B 1 125 ? -51.120 24.337  -28.590 1.00 50.53  ? 125 THR B OG1 1 
ATOM 2862  C CG2 . THR B 1 125 ? -49.594 25.283  -26.969 1.00 52.02  ? 125 THR B CG2 1 
ATOM 2863  N N   . GLN B 1 126 ? -50.377 23.509  -24.118 1.00 44.31  ? 126 GLN B N   1 
ATOM 2864  C CA  . GLN B 1 126 ? -50.267 23.837  -22.710 1.00 43.72  ? 126 GLN B CA  1 
ATOM 2865  C C   . GLN B 1 126 ? -49.066 24.748  -22.465 1.00 51.85  ? 126 GLN B C   1 
ATOM 2866  O O   . GLN B 1 126 ? -48.123 24.811  -23.261 1.00 54.80  ? 126 GLN B O   1 
ATOM 2867  C CB  . GLN B 1 126 ? -50.217 22.602  -21.818 1.00 44.02  ? 126 GLN B CB  1 
ATOM 2868  C CG  . GLN B 1 126 ? -49.033 21.683  -22.072 1.00 50.36  ? 126 GLN B CG  1 
ATOM 2869  C CD  . GLN B 1 126 ? -48.886 20.660  -20.989 1.00 62.76  ? 126 GLN B CD  1 
ATOM 2870  O OE1 . GLN B 1 126 ? -47.895 20.655  -20.267 1.00 61.51  ? 126 GLN B OE1 1 
ATOM 2871  N NE2 . GLN B 1 126 ? -49.856 19.762  -20.856 1.00 54.85  ? 126 GLN B NE2 1 
ATOM 2872  N N   . ILE B 1 127 ? -49.114 25.468  -21.367 1.00 46.78  ? 127 ILE B N   1 
ATOM 2873  C CA  . ILE B 1 127 ? -48.072 26.404  -21.012 1.00 45.47  ? 127 ILE B CA  1 
ATOM 2874  C C   . ILE B 1 127 ? -47.042 25.739  -20.101 1.00 46.05  ? 127 ILE B C   1 
ATOM 2875  O O   . ILE B 1 127 ? -47.388 24.869  -19.286 1.00 45.70  ? 127 ILE B O   1 
ATOM 2876  C CB  . ILE B 1 127 ? -48.771 27.629  -20.319 1.00 48.40  ? 127 ILE B CB  1 
ATOM 2877  C CG1 . ILE B 1 127 ? -48.608 28.983  -21.065 1.00 47.98  ? 127 ILE B CG1 1 
ATOM 2878  C CG2 . ILE B 1 127 ? -48.644 27.707  -18.780 1.00 47.48  ? 127 ILE B CG2 1 
ATOM 2879  C CD1 . ILE B 1 127 ? -47.373 29.385  -21.469 1.00 50.17  ? 127 ILE B CD1 1 
ATOM 2880  N N   . ALA B 1 128 ? -45.776 26.173  -20.244 1.00 39.31  ? 128 ALA B N   1 
ATOM 2881  C CA  . ALA B 1 128 ? -44.695 25.784  -19.351 1.00 37.83  ? 128 ALA B CA  1 
ATOM 2882  C C   . ALA B 1 128 ? -44.735 26.736  -18.170 1.00 40.37  ? 128 ALA B C   1 
ATOM 2883  O O   . ALA B 1 128 ? -44.987 27.925  -18.363 1.00 39.96  ? 128 ALA B O   1 
ATOM 2884  C CB  . ALA B 1 128 ? -43.361 25.860  -20.072 1.00 38.26  ? 128 ALA B CB  1 
ATOM 2885  N N   . ILE B 1 129 ? -44.551 26.238  -16.953 1.00 38.50  ? 129 ILE B N   1 
ATOM 2886  C CA  . ILE B 1 129 ? -44.596 27.102  -15.755 1.00 38.63  ? 129 ILE B CA  1 
ATOM 2887  C C   . ILE B 1 129 ? -43.166 27.351  -15.223 1.00 42.91  ? 129 ILE B C   1 
ATOM 2888  O O   . ILE B 1 129 ? -42.409 26.401  -15.009 1.00 43.39  ? 129 ILE B O   1 
ATOM 2889  C CB  . ILE B 1 129 ? -45.539 26.532  -14.671 1.00 40.74  ? 129 ILE B CB  1 
ATOM 2890  C CG1 . ILE B 1 129 ? -46.962 26.352  -15.244 1.00 39.97  ? 129 ILE B CG1 1 
ATOM 2891  C CG2 . ILE B 1 129 ? -45.562 27.419  -13.415 1.00 41.96  ? 129 ILE B CG2 1 
ATOM 2892  C CD1 . ILE B 1 129 ? -47.887 25.526  -14.442 1.00 40.18  ? 129 ILE B CD1 1 
ATOM 2893  N N   . ALA B 1 130 ? -42.808 28.640  -15.048 1.00 37.56  ? 130 ALA B N   1 
ATOM 2894  C CA  . ALA B 1 130 ? -41.512 29.080  -14.521 1.00 35.53  ? 130 ALA B CA  1 
ATOM 2895  C C   . ALA B 1 130 ? -41.560 29.216  -13.013 1.00 41.87  ? 130 ALA B C   1 
ATOM 2896  O O   . ALA B 1 130 ? -42.650 29.269  -12.408 1.00 42.22  ? 130 ALA B O   1 
ATOM 2897  C CB  . ALA B 1 130 ? -41.115 30.410  -15.136 1.00 35.08  ? 130 ALA B CB  1 
ATOM 2898  N N   . ASP B 1 131 ? -40.362 29.292  -12.401 1.00 38.45  ? 131 ASP B N   1 
ATOM 2899  C CA  . ASP B 1 131 ? -40.220 29.492  -10.974 1.00 37.94  ? 131 ASP B CA  1 
ATOM 2900  C C   . ASP B 1 131 ? -40.325 31.005  -10.709 1.00 42.81  ? 131 ASP B C   1 
ATOM 2901  O O   . ASP B 1 131 ? -39.368 31.745  -10.967 1.00 43.76  ? 131 ASP B O   1 
ATOM 2902  C CB  . ASP B 1 131 ? -38.891 28.885  -10.463 1.00 39.28  ? 131 ASP B CB  1 
ATOM 2903  C CG  . ASP B 1 131 ? -38.658 28.935  -8.954  1.00 50.71  ? 131 ASP B CG  1 
ATOM 2904  O OD1 . ASP B 1 131 ? -37.615 28.425  -8.504  1.00 53.08  ? 131 ASP B OD1 1 
ATOM 2905  O OD2 . ASP B 1 131 ? -39.525 29.497  -8.222  1.00 49.27  ? 131 ASP B OD2 1 
ATOM 2906  N N   . SER B 1 132 ? -41.508 31.463  -10.260 1.00 37.73  ? 132 SER B N   1 
ATOM 2907  C CA  . SER B 1 132 ? -41.752 32.867  -9.927  1.00 37.02  ? 132 SER B CA  1 
ATOM 2908  C C   . SER B 1 132 ? -40.859 33.370  -8.741  1.00 42.27  ? 132 SER B C   1 
ATOM 2909  O O   . SER B 1 132 ? -40.689 34.583  -8.596  1.00 41.36  ? 132 SER B O   1 
ATOM 2910  C CB  . SER B 1 132 ? -43.227 33.103  -9.617  1.00 37.75  ? 132 SER B CB  1 
ATOM 2911  O OG  . SER B 1 132 ? -43.695 32.229  -8.607  1.00 40.98  ? 132 SER B OG  1 
ATOM 2912  N N   . ASP B 1 133 ? -40.288 32.460  -7.911  1.00 40.17  ? 133 ASP B N   1 
ATOM 2913  C CA  . ASP B 1 133 ? -39.372 32.863  -6.818  1.00 40.00  ? 133 ASP B CA  1 
ATOM 2914  C C   . ASP B 1 133 ? -38.007 33.306  -7.386  1.00 44.66  ? 133 ASP B C   1 
ATOM 2915  O O   . ASP B 1 133 ? -37.269 34.000  -6.697  1.00 45.44  ? 133 ASP B O   1 
ATOM 2916  C CB  . ASP B 1 133 ? -39.189 31.746  -5.766  1.00 40.86  ? 133 ASP B CB  1 
ATOM 2917  C CG  . ASP B 1 133 ? -40.421 31.543  -4.900  1.00 54.16  ? 133 ASP B CG  1 
ATOM 2918  O OD1 . ASP B 1 133 ? -41.189 32.534  -4.703  1.00 51.38  ? 133 ASP B OD1 1 
ATOM 2919  O OD2 . ASP B 1 133 ? -40.630 30.395  -4.415  1.00 64.36  ? 133 ASP B OD2 1 
ATOM 2920  N N   . LYS B 1 134 ? -37.726 32.991  -8.661  1.00 40.10  ? 134 LYS B N   1 
ATOM 2921  C CA  . LYS B 1 134 ? -36.493 33.399  -9.332  1.00 39.47  ? 134 LYS B CA  1 
ATOM 2922  C C   . LYS B 1 134 ? -36.661 34.769  -10.054 1.00 40.83  ? 134 LYS B C   1 
ATOM 2923  O O   . LYS B 1 134 ? -35.677 35.290  -10.600 1.00 38.32  ? 134 LYS B O   1 
ATOM 2924  C CB  . LYS B 1 134 ? -36.010 32.303  -10.303 1.00 41.89  ? 134 LYS B CB  1 
ATOM 2925  C CG  . LYS B 1 134 ? -35.359 31.119  -9.594  1.00 56.34  ? 134 LYS B CG  1 
ATOM 2926  C CD  . LYS B 1 134 ? -35.285 29.886  -10.501 1.00 72.45  ? 134 LYS B CD  1 
ATOM 2927  C CE  . LYS B 1 134 ? -33.892 29.535  -10.978 1.00 95.27  ? 134 LYS B CE  1 
ATOM 2928  N NZ  . LYS B 1 134 ? -33.093 28.856  -9.926  1.00 106.50 ? 134 LYS B NZ  1 
ATOM 2929  N N   . LEU B 1 135 ? -37.879 35.380  -9.978  1.00 36.66  ? 135 LEU B N   1 
ATOM 2930  C CA  . LEU B 1 135 ? -38.191 36.677  -10.587 1.00 36.46  ? 135 LEU B CA  1 
ATOM 2931  C C   . LEU B 1 135 ? -37.539 37.814  -9.874  1.00 41.74  ? 135 LEU B C   1 
ATOM 2932  O O   . LEU B 1 135 ? -37.356 37.768  -8.655  1.00 41.41  ? 135 LEU B O   1 
ATOM 2933  C CB  . LEU B 1 135 ? -39.694 36.950  -10.613 1.00 36.56  ? 135 LEU B CB  1 
ATOM 2934  C CG  . LEU B 1 135 ? -40.547 36.160  -11.588 1.00 41.57  ? 135 LEU B CG  1 
ATOM 2935  C CD1 . LEU B 1 135 ? -42.030 36.460  -11.350 1.00 40.89  ? 135 LEU B CD1 1 
ATOM 2936  C CD2 . LEU B 1 135 ? -40.158 36.449  -13.033 1.00 44.59  ? 135 LEU B CD2 1 
ATOM 2937  N N   . ARG B 1 136 ? -37.235 38.876  -10.636 1.00 38.43  ? 136 ARG B N   1 
ATOM 2938  C CA  . ARG B 1 136 ? -36.635 40.107  -10.119 1.00 36.86  ? 136 ARG B CA  1 
ATOM 2939  C C   . ARG B 1 136 ? -37.239 41.313  -10.776 1.00 37.73  ? 136 ARG B C   1 
ATOM 2940  O O   . ARG B 1 136 ? -37.680 41.239  -11.935 1.00 37.67  ? 136 ARG B O   1 
ATOM 2941  C CB  . ARG B 1 136 ? -35.122 40.116  -10.338 1.00 36.57  ? 136 ARG B CB  1 
ATOM 2942  C CG  . ARG B 1 136 ? -34.348 39.283  -9.328  1.00 44.92  ? 136 ARG B CG  1 
ATOM 2943  C CD  . ARG B 1 136 ? -32.867 39.402  -9.570  1.00 49.73  ? 136 ARG B CD  1 
ATOM 2944  N NE  . ARG B 1 136 ? -32.519 39.038  -10.938 1.00 47.18  ? 136 ARG B NE  1 
ATOM 2945  C CZ  . ARG B 1 136 ? -31.336 39.288  -11.482 1.00 66.03  ? 136 ARG B CZ  1 
ATOM 2946  N NH1 . ARG B 1 136 ? -30.385 39.892  -10.772 1.00 50.29  ? 136 ARG B NH1 1 
ATOM 2947  N NH2 . ARG B 1 136 ? -31.096 38.951  -12.744 1.00 60.11  ? 136 ARG B NH2 1 
ATOM 2948  N N   . VAL B 1 137 ? -37.258 42.432  -10.039 1.00 31.17  ? 137 VAL B N   1 
ATOM 2949  C CA  . VAL B 1 137 ? -37.746 43.720  -10.543 1.00 30.32  ? 137 VAL B CA  1 
ATOM 2950  C C   . VAL B 1 137 ? -36.840 44.108  -11.719 1.00 36.41  ? 137 VAL B C   1 
ATOM 2951  O O   . VAL B 1 137 ? -35.624 44.146  -11.566 1.00 38.02  ? 137 VAL B O   1 
ATOM 2952  C CB  . VAL B 1 137 ? -37.790 44.796  -9.423  1.00 31.89  ? 137 VAL B CB  1 
ATOM 2953  C CG1 . VAL B 1 137 ? -38.096 46.168  -9.994  1.00 31.83  ? 137 VAL B CG1 1 
ATOM 2954  C CG2 . VAL B 1 137 ? -38.784 44.418  -8.341  1.00 30.71  ? 137 VAL B CG2 1 
ATOM 2955  N N   . GLY B 1 138 ? -37.438 44.301  -12.877 1.00 32.64  ? 138 GLY B N   1 
ATOM 2956  C CA  . GLY B 1 138 ? -36.703 44.635  -14.081 1.00 32.83  ? 138 GLY B CA  1 
ATOM 2957  C C   . GLY B 1 138 ? -36.852 43.604  -15.168 1.00 37.35  ? 138 GLY B C   1 
ATOM 2958  O O   . GLY B 1 138 ? -36.641 43.931  -16.341 1.00 39.34  ? 138 GLY B O   1 
ATOM 2959  N N   . ASP B 1 139 ? -37.221 42.356  -14.779 1.00 31.59  ? 139 ASP B N   1 
ATOM 2960  C CA  . ASP B 1 139 ? -37.462 41.243  -15.709 1.00 30.09  ? 139 ASP B CA  1 
ATOM 2961  C C   . ASP B 1 139 ? -38.615 41.603  -16.622 1.00 33.86  ? 139 ASP B C   1 
ATOM 2962  O O   . ASP B 1 139 ? -39.563 42.266  -16.193 1.00 34.39  ? 139 ASP B O   1 
ATOM 2963  C CB  . ASP B 1 139 ? -37.732 39.912  -14.970 1.00 31.11  ? 139 ASP B CB  1 
ATOM 2964  C CG  . ASP B 1 139 ? -36.542 39.289  -14.229 1.00 45.66  ? 139 ASP B CG  1 
ATOM 2965  O OD1 . ASP B 1 139 ? -35.381 39.594  -14.586 1.00 49.53  ? 139 ASP B OD1 1 
ATOM 2966  O OD2 . ASP B 1 139 ? -36.772 38.459  -13.321 1.00 56.19  ? 139 ASP B OD2 1 
ATOM 2967  N N   . PHE B 1 140 ? -38.502 41.250  -17.901 1.00 31.63  ? 140 PHE B N   1 
ATOM 2968  C CA  . PHE B 1 140 ? -39.530 41.569  -18.900 1.00 30.79  ? 140 PHE B CA  1 
ATOM 2969  C C   . PHE B 1 140 ? -40.691 40.606  -18.796 1.00 33.84  ? 140 PHE B C   1 
ATOM 2970  O O   . PHE B 1 140 ? -40.512 39.433  -18.474 1.00 31.82  ? 140 PHE B O   1 
ATOM 2971  C CB  . PHE B 1 140 ? -38.940 41.582  -20.298 1.00 32.53  ? 140 PHE B CB  1 
ATOM 2972  C CG  . PHE B 1 140 ? -37.963 42.712  -20.489 1.00 34.13  ? 140 PHE B CG  1 
ATOM 2973  C CD1 . PHE B 1 140 ? -36.595 42.475  -20.516 1.00 37.37  ? 140 PHE B CD1 1 
ATOM 2974  C CD2 . PHE B 1 140 ? -38.411 44.023  -20.642 1.00 36.64  ? 140 PHE B CD2 1 
ATOM 2975  C CE1 . PHE B 1 140 ? -35.683 43.530  -20.712 1.00 37.96  ? 140 PHE B CE1 1 
ATOM 2976  C CE2 . PHE B 1 140 ? -37.500 45.077  -20.836 1.00 38.55  ? 140 PHE B CE2 1 
ATOM 2977  C CZ  . PHE B 1 140 ? -36.141 44.821  -20.860 1.00 36.32  ? 140 PHE B CZ  1 
ATOM 2978  N N   . ALA B 1 141 ? -41.896 41.124  -18.980 1.00 32.57  ? 141 ALA B N   1 
ATOM 2979  C CA  . ALA B 1 141 ? -43.137 40.342  -18.862 1.00 32.13  ? 141 ALA B CA  1 
ATOM 2980  C C   . ALA B 1 141 ? -44.088 40.676  -19.959 1.00 36.99  ? 141 ALA B C   1 
ATOM 2981  O O   . ALA B 1 141 ? -44.141 41.830  -20.412 1.00 36.51  ? 141 ALA B O   1 
ATOM 2982  C CB  . ALA B 1 141 ? -43.808 40.597  -17.524 1.00 32.65  ? 141 ALA B CB  1 
ATOM 2983  N N   . VAL B 1 142 ? -44.831 39.652  -20.421 1.00 34.89  ? 142 VAL B N   1 
ATOM 2984  C CA  . VAL B 1 142 ? -45.854 39.791  -21.467 1.00 33.09  ? 142 VAL B CA  1 
ATOM 2985  C C   . VAL B 1 142 ? -47.164 39.305  -20.887 1.00 37.28  ? 142 VAL B C   1 
ATOM 2986  O O   . VAL B 1 142 ? -47.237 38.183  -20.381 1.00 38.97  ? 142 VAL B O   1 
ATOM 2987  C CB  . VAL B 1 142 ? -45.484 39.056  -22.794 1.00 35.74  ? 142 VAL B CB  1 
ATOM 2988  C CG1 . VAL B 1 142 ? -46.544 39.286  -23.877 1.00 34.39  ? 142 VAL B CG1 1 
ATOM 2989  C CG2 . VAL B 1 142 ? -44.095 39.459  -23.299 1.00 34.60  ? 142 VAL B CG2 1 
ATOM 2990  N N   . ALA B 1 143 ? -48.182 40.174  -20.911 1.00 34.54  ? 143 ALA B N   1 
ATOM 2991  C CA  . ALA B 1 143 ? -49.549 39.859  -20.460 1.00 33.25  ? 143 ALA B CA  1 
ATOM 2992  C C   . ALA B 1 143 ? -50.367 39.423  -21.660 1.00 35.15  ? 143 ALA B C   1 
ATOM 2993  O O   . ALA B 1 143 ? -50.288 40.041  -22.733 1.00 33.96  ? 143 ALA B O   1 
ATOM 2994  C CB  . ALA B 1 143 ? -50.196 41.054  -19.762 1.00 33.02  ? 143 ALA B CB  1 
ATOM 2995  N N   . VAL B 1 144 ? -51.048 38.291  -21.517 1.00 32.79  ? 144 VAL B N   1 
ATOM 2996  C CA  . VAL B 1 144 ? -51.899 37.716  -22.561 1.00 32.63  ? 144 VAL B CA  1 
ATOM 2997  C C   . VAL B 1 144 ? -53.221 37.474  -21.928 1.00 35.97  ? 144 VAL B C   1 
ATOM 2998  O O   . VAL B 1 144 ? -53.298 36.781  -20.895 1.00 35.94  ? 144 VAL B O   1 
ATOM 2999  C CB  . VAL B 1 144 ? -51.332 36.438  -23.255 1.00 37.14  ? 144 VAL B CB  1 
ATOM 3000  C CG1 . VAL B 1 144 ? -52.205 36.029  -24.441 1.00 36.55  ? 144 VAL B CG1 1 
ATOM 3001  C CG2 . VAL B 1 144 ? -49.885 36.635  -23.720 1.00 37.03  ? 144 VAL B CG2 1 
ATOM 3002  N N   . GLY B 1 145 ? -54.236 38.111  -22.500 1.00 30.70  ? 145 GLY B N   1 
ATOM 3003  C CA  . GLY B 1 145 ? -55.601 38.015  -22.031 1.00 30.18  ? 145 GLY B CA  1 
ATOM 3004  C C   . GLY B 1 145 ? -56.566 38.530  -23.067 1.00 37.85  ? 145 GLY B C   1 
ATOM 3005  O O   . GLY B 1 145 ? -56.175 38.775  -24.205 1.00 34.12  ? 145 GLY B O   1 
ATOM 3006  N N   . ASN B 1 146 ? -57.836 38.728  -22.648 1.00 40.88  ? 146 ASN B N   1 
ATOM 3007  C CA  . ASN B 1 146 ? -58.943 39.189  -23.490 1.00 41.82  ? 146 ASN B CA  1 
ATOM 3008  C C   . ASN B 1 146 ? -59.538 40.513  -22.992 1.00 44.00  ? 146 ASN B C   1 
ATOM 3009  O O   . ASN B 1 146 ? -60.689 40.505  -22.548 1.00 40.75  ? 146 ASN B O   1 
ATOM 3010  C CB  . ASN B 1 146 ? -60.045 38.120  -23.529 1.00 47.08  ? 146 ASN B CB  1 
ATOM 3011  C CG  . ASN B 1 146 ? -60.477 37.890  -24.937 1.00 81.20  ? 146 ASN B CG  1 
ATOM 3012  O OD1 . ASN B 1 146 ? -59.892 37.049  -25.636 1.00 80.51  ? 146 ASN B OD1 1 
ATOM 3013  N ND2 . ASN B 1 146 ? -61.391 38.738  -25.424 1.00 65.93  ? 146 ASN B ND2 1 
ATOM 3014  N N   . PRO B 1 147 ? -58.802 41.661  -23.063 1.00 41.59  ? 147 PRO B N   1 
ATOM 3015  C CA  . PRO B 1 147 ? -59.363 42.906  -22.503 1.00 41.20  ? 147 PRO B CA  1 
ATOM 3016  C C   . PRO B 1 147 ? -60.516 43.426  -23.344 1.00 47.03  ? 147 PRO B C   1 
ATOM 3017  O O   . PRO B 1 147 ? -60.438 43.387  -24.583 1.00 47.26  ? 147 PRO B O   1 
ATOM 3018  C CB  . PRO B 1 147 ? -58.171 43.864  -22.469 1.00 41.73  ? 147 PRO B CB  1 
ATOM 3019  C CG  . PRO B 1 147 ? -57.245 43.352  -23.516 1.00 45.63  ? 147 PRO B CG  1 
ATOM 3020  C CD  . PRO B 1 147 ? -57.420 41.865  -23.552 1.00 41.68  ? 147 PRO B CD  1 
ATOM 3021  N N   . PHE B 1 148 ? -61.615 43.832  -22.646 1.00 43.10  ? 148 PHE B N   1 
ATOM 3022  C CA  . PHE B 1 148 ? -62.874 44.369  -23.184 1.00 42.92  ? 148 PHE B CA  1 
ATOM 3023  C C   . PHE B 1 148 ? -63.530 43.448  -24.234 1.00 47.78  ? 148 PHE B C   1 
ATOM 3024  O O   . PHE B 1 148 ? -64.244 43.940  -25.101 1.00 49.26  ? 148 PHE B O   1 
ATOM 3025  C CB  . PHE B 1 148 ? -62.657 45.786  -23.764 1.00 44.71  ? 148 PHE B CB  1 
ATOM 3026  C CG  . PHE B 1 148 ? -61.999 46.754  -22.809 1.00 45.70  ? 148 PHE B CG  1 
ATOM 3027  C CD1 . PHE B 1 148 ? -60.815 47.385  -23.145 1.00 48.82  ? 148 PHE B CD1 1 
ATOM 3028  C CD2 . PHE B 1 148 ? -62.557 47.015  -21.559 1.00 47.72  ? 148 PHE B CD2 1 
ATOM 3029  C CE1 . PHE B 1 148 ? -60.189 48.254  -22.246 1.00 49.46  ? 148 PHE B CE1 1 
ATOM 3030  C CE2 . PHE B 1 148 ? -61.928 47.880  -20.660 1.00 50.15  ? 148 PHE B CE2 1 
ATOM 3031  C CZ  . PHE B 1 148 ? -60.748 48.495  -21.011 1.00 47.79  ? 148 PHE B CZ  1 
ATOM 3032  N N   . GLY B 1 149 ? -63.307 42.137  -24.110 1.00 43.53  ? 149 GLY B N   1 
ATOM 3033  C CA  . GLY B 1 149 ? -63.803 41.098  -25.001 1.00 42.90  ? 149 GLY B CA  1 
ATOM 3034  C C   . GLY B 1 149 ? -63.382 41.275  -26.444 1.00 49.69  ? 149 GLY B C   1 
ATOM 3035  O O   . GLY B 1 149 ? -64.151 40.916  -27.347 1.00 50.92  ? 149 GLY B O   1 
ATOM 3036  N N   . LEU B 1 150 ? -62.170 41.830  -26.683 1.00 45.41  ? 150 LEU B N   1 
ATOM 3037  C CA  . LEU B 1 150 ? -61.707 42.115  -28.049 1.00 45.09  ? 150 LEU B CA  1 
ATOM 3038  C C   . LEU B 1 150 ? -61.182 40.896  -28.800 1.00 46.48  ? 150 LEU B C   1 
ATOM 3039  O O   . LEU B 1 150 ? -61.119 40.889  -30.038 1.00 46.19  ? 150 LEU B O   1 
ATOM 3040  C CB  . LEU B 1 150 ? -60.589 43.167  -28.034 1.00 45.23  ? 150 LEU B CB  1 
ATOM 3041  C CG  . LEU B 1 150 ? -60.956 44.568  -27.600 1.00 50.01  ? 150 LEU B CG  1 
ATOM 3042  C CD1 . LEU B 1 150 ? -59.715 45.350  -27.291 1.00 49.93  ? 150 LEU B CD1 1 
ATOM 3043  C CD2 . LEU B 1 150 ? -61.844 45.266  -28.635 1.00 50.91  ? 150 LEU B CD2 1 
ATOM 3044  N N   . GLY B 1 151 ? -60.752 39.911  -28.051 1.00 40.30  ? 151 GLY B N   1 
ATOM 3045  C CA  . GLY B 1 151 ? -60.052 38.766  -28.604 1.00 39.25  ? 151 GLY B CA  1 
ATOM 3046  C C   . GLY B 1 151 ? -58.671 38.794  -27.983 1.00 44.59  ? 151 GLY B C   1 
ATOM 3047  O O   . GLY B 1 151 ? -58.322 39.767  -27.295 1.00 46.32  ? 151 GLY B O   1 
ATOM 3048  N N   . GLN B 1 152 ? -57.891 37.730  -28.184 1.00 40.37  ? 152 GLN B N   1 
ATOM 3049  C CA  . GLN B 1 152 ? -56.547 37.567  -27.633 1.00 39.24  ? 152 GLN B CA  1 
ATOM 3050  C C   . GLN B 1 152 ? -55.675 38.796  -27.927 1.00 44.70  ? 152 GLN B C   1 
ATOM 3051  O O   . GLN B 1 152 ? -55.524 39.232  -29.084 1.00 45.90  ? 152 GLN B O   1 
ATOM 3052  C CB  . GLN B 1 152 ? -55.885 36.279  -28.135 1.00 39.42  ? 152 GLN B CB  1 
ATOM 3053  C CG  . GLN B 1 152 ? -54.945 35.682  -27.085 1.00 48.83  ? 152 GLN B CG  1 
ATOM 3054  C CD  . GLN B 1 152 ? -54.138 34.490  -27.557 1.00 62.39  ? 152 GLN B CD  1 
ATOM 3055  O OE1 . GLN B 1 152 ? -53.993 33.492  -26.840 1.00 49.87  ? 152 GLN B OE1 1 
ATOM 3056  N NE2 . GLN B 1 152 ? -53.524 34.591  -28.731 1.00 55.39  ? 152 GLN B NE2 1 
ATOM 3057  N N   . THR B 1 153 ? -55.155 39.369  -26.839 1.00 39.35  ? 153 THR B N   1 
ATOM 3058  C CA  . THR B 1 153 ? -54.318 40.562  -26.835 1.00 38.20  ? 153 THR B CA  1 
ATOM 3059  C C   . THR B 1 153 ? -53.088 40.293  -26.001 1.00 37.81  ? 153 THR B C   1 
ATOM 3060  O O   . THR B 1 153 ? -53.208 39.841  -24.866 1.00 36.98  ? 153 THR B O   1 
ATOM 3061  C CB  . THR B 1 153 ? -55.116 41.773  -26.304 1.00 43.86  ? 153 THR B CB  1 
ATOM 3062  O OG1 . THR B 1 153 ? -56.151 42.093  -27.208 1.00 42.57  ? 153 THR B OG1 1 
ATOM 3063  C CG2 . THR B 1 153 ? -54.275 43.006  -26.073 1.00 42.82  ? 153 THR B CG2 1 
ATOM 3064  N N   . ALA B 1 154 ? -51.913 40.632  -26.559 1.00 32.01  ? 154 ALA B N   1 
ATOM 3065  C CA  . ALA B 1 154 ? -50.636 40.563  -25.875 1.00 31.43  ? 154 ALA B CA  1 
ATOM 3066  C C   . ALA B 1 154 ? -50.119 41.983  -25.589 1.00 34.37  ? 154 ALA B C   1 
ATOM 3067  O O   . ALA B 1 154 ? -50.136 42.845  -26.470 1.00 32.80  ? 154 ALA B O   1 
ATOM 3068  C CB  . ALA B 1 154 ? -49.636 39.781  -26.711 1.00 32.00  ? 154 ALA B CB  1 
ATOM 3069  N N   . THR B 1 155 ? -49.713 42.246  -24.347 1.00 31.19  ? 155 THR B N   1 
ATOM 3070  C CA  . THR B 1 155 ? -49.164 43.556  -23.959 1.00 31.01  ? 155 THR B CA  1 
ATOM 3071  C C   . THR B 1 155 ? -47.850 43.287  -23.252 1.00 36.49  ? 155 THR B C   1 
ATOM 3072  O O   . THR B 1 155 ? -47.688 42.248  -22.625 1.00 37.41  ? 155 THR B O   1 
ATOM 3073  C CB  . THR B 1 155 ? -50.158 44.404  -23.136 1.00 37.62  ? 155 THR B CB  1 
ATOM 3074  O OG1 . THR B 1 155 ? -50.556 43.701  -21.965 1.00 41.57  ? 155 THR B OG1 1 
ATOM 3075  C CG2 . THR B 1 155 ? -51.398 44.802  -23.923 1.00 33.69  ? 155 THR B CG2 1 
ATOM 3076  N N   . SER B 1 156 ? -46.904 44.182  -23.384 1.00 34.22  ? 156 SER B N   1 
ATOM 3077  C CA  . SER B 1 156 ? -45.546 44.029  -22.850 1.00 33.92  ? 156 SER B CA  1 
ATOM 3078  C C   . SER B 1 156 ? -45.194 45.075  -21.774 1.00 34.64  ? 156 SER B C   1 
ATOM 3079  O O   . SER B 1 156 ? -45.645 46.206  -21.827 1.00 34.96  ? 156 SER B O   1 
ATOM 3080  C CB  . SER B 1 156 ? -44.551 44.145  -24.003 1.00 38.99  ? 156 SER B CB  1 
ATOM 3081  O OG  . SER B 1 156 ? -43.239 43.783  -23.611 1.00 60.22  ? 156 SER B OG  1 
ATOM 3082  N N   . GLY B 1 157 ? -44.363 44.679  -20.834 1.00 30.08  ? 157 GLY B N   1 
ATOM 3083  C CA  . GLY B 1 157 ? -43.880 45.542  -19.767 1.00 29.92  ? 157 GLY B CA  1 
ATOM 3084  C C   . GLY B 1 157 ? -42.768 44.887  -18.983 1.00 34.91  ? 157 GLY B C   1 
ATOM 3085  O O   . GLY B 1 157 ? -42.087 43.987  -19.497 1.00 35.78  ? 157 GLY B O   1 
ATOM 3086  N N   . ILE B 1 158 ? -42.574 45.336  -17.730 1.00 31.43  ? 158 ILE B N   1 
ATOM 3087  C CA  . ILE B 1 158 ? -41.550 44.783  -16.831 1.00 30.10  ? 158 ILE B CA  1 
ATOM 3088  C C   . ILE B 1 158 ? -42.190 44.331  -15.539 1.00 32.79  ? 158 ILE B C   1 
ATOM 3089  O O   . ILE B 1 158 ? -43.354 44.664  -15.286 1.00 29.84  ? 158 ILE B O   1 
ATOM 3090  C CB  . ILE B 1 158 ? -40.384 45.778  -16.533 1.00 31.97  ? 158 ILE B CB  1 
ATOM 3091  C CG1 . ILE B 1 158 ? -40.870 47.071  -15.839 1.00 30.92  ? 158 ILE B CG1 1 
ATOM 3092  C CG2 . ILE B 1 158 ? -39.495 46.036  -17.761 1.00 31.91  ? 158 ILE B CG2 1 
ATOM 3093  C CD1 . ILE B 1 158 ? -39.748 47.852  -15.079 1.00 38.79  ? 158 ILE B CD1 1 
ATOM 3094  N N   . VAL B 1 159 ? -41.407 43.582  -14.703 1.00 29.67  ? 159 VAL B N   1 
ATOM 3095  C CA  . VAL B 1 159 ? -41.794 43.228  -13.339 1.00 29.23  ? 159 VAL B CA  1 
ATOM 3096  C C   . VAL B 1 159 ? -41.449 44.466  -12.545 1.00 33.84  ? 159 VAL B C   1 
ATOM 3097  O O   . VAL B 1 159 ? -40.283 44.849  -12.509 1.00 32.67  ? 159 VAL B O   1 
ATOM 3098  C CB  . VAL B 1 159 ? -41.146 41.933  -12.798 1.00 32.10  ? 159 VAL B CB  1 
ATOM 3099  C CG1 . VAL B 1 159 ? -41.426 41.749  -11.310 1.00 30.33  ? 159 VAL B CG1 1 
ATOM 3100  C CG2 . VAL B 1 159 ? -41.613 40.721  -13.588 1.00 31.72  ? 159 VAL B CG2 1 
ATOM 3101  N N   . SER B 1 160 ? -42.490 45.190  -12.080 1.00 32.11  ? 160 SER B N   1 
ATOM 3102  C CA  . SER B 1 160 ? -42.405 46.470  -11.368 1.00 30.58  ? 160 SER B CA  1 
ATOM 3103  C C   . SER B 1 160 ? -42.114 46.303  -9.881  1.00 35.29  ? 160 SER B C   1 
ATOM 3104  O O   . SER B 1 160 ? -41.440 47.148  -9.300  1.00 36.90  ? 160 SER B O   1 
ATOM 3105  C CB  . SER B 1 160 ? -43.713 47.219  -11.525 1.00 30.82  ? 160 SER B CB  1 
ATOM 3106  O OG  . SER B 1 160 ? -43.833 47.636  -12.870 1.00 40.87  ? 160 SER B OG  1 
ATOM 3107  N N   . ALA B 1 161 ? -42.655 45.231  -9.264  1.00 29.17  ? 161 ALA B N   1 
ATOM 3108  C CA  . ALA B 1 161 ? -42.534 44.913  -7.840  1.00 28.36  ? 161 ALA B CA  1 
ATOM 3109  C C   . ALA B 1 161 ? -42.909 43.468  -7.607  1.00 35.32  ? 161 ALA B C   1 
ATOM 3110  O O   . ALA B 1 161 ? -43.507 42.827  -8.479  1.00 35.33  ? 161 ALA B O   1 
ATOM 3111  C CB  . ALA B 1 161 ? -43.417 45.839  -7.011  1.00 28.31  ? 161 ALA B CB  1 
ATOM 3112  N N   . LEU B 1 162 ? -42.542 42.936  -6.446  1.00 35.39  ? 162 LEU B N   1 
ATOM 3113  C CA  . LEU B 1 162 ? -42.792 41.527  -6.064  1.00 35.84  ? 162 LEU B CA  1 
ATOM 3114  C C   . LEU B 1 162 ? -43.241 41.439  -4.618  1.00 42.68  ? 162 LEU B C   1 
ATOM 3115  O O   . LEU B 1 162 ? -42.910 42.335  -3.831  1.00 43.66  ? 162 LEU B O   1 
ATOM 3116  C CB  . LEU B 1 162 ? -41.522 40.700  -6.253  1.00 35.79  ? 162 LEU B CB  1 
ATOM 3117  C CG  . LEU B 1 162 ? -41.052 40.513  -7.700  1.00 41.35  ? 162 LEU B CG  1 
ATOM 3118  C CD1 . LEU B 1 162 ? -39.584 40.231  -7.742  1.00 40.27  ? 162 LEU B CD1 1 
ATOM 3119  C CD2 . LEU B 1 162 ? -41.876 39.421  -8.446  1.00 44.05  ? 162 LEU B CD2 1 
ATOM 3120  N N   . GLY B 1 163 ? -43.977 40.377  -4.276  1.00 39.13  ? 163 GLY B N   1 
ATOM 3121  C CA  . GLY B 1 163 ? -44.468 40.142  -2.921  1.00 38.71  ? 163 GLY B CA  1 
ATOM 3122  C C   . GLY B 1 163 ? -45.396 41.219  -2.404  1.00 46.48  ? 163 GLY B C   1 
ATOM 3123  O O   . GLY B 1 163 ? -45.333 41.571  -1.223  1.00 47.17  ? 163 GLY B O   1 
ATOM 3124  N N   . ARG B 1 164 ? -46.262 41.755  -3.289  1.00 44.28  ? 164 ARG B N   1 
ATOM 3125  C CA  . ARG B 1 164 ? -47.192 42.832  -2.957  1.00 44.62  ? 164 ARG B CA  1 
ATOM 3126  C C   . ARG B 1 164 ? -48.419 42.347  -2.212  1.00 51.58  ? 164 ARG B C   1 
ATOM 3127  O O   . ARG B 1 164 ? -49.169 41.506  -2.709  1.00 50.29  ? 164 ARG B O   1 
ATOM 3128  C CB  . ARG B 1 164 ? -47.618 43.593  -4.227  1.00 43.10  ? 164 ARG B CB  1 
ATOM 3129  C CG  . ARG B 1 164 ? -46.620 44.633  -4.675  1.00 37.42  ? 164 ARG B CG  1 
ATOM 3130  C CD  . ARG B 1 164 ? -46.578 45.834  -3.747  1.00 31.52  ? 164 ARG B CD  1 
ATOM 3131  N NE  . ARG B 1 164 ? -46.224 47.040  -4.485  1.00 40.37  ? 164 ARG B NE  1 
ATOM 3132  C CZ  . ARG B 1 164 ? -45.011 47.563  -4.526  1.00 42.15  ? 164 ARG B CZ  1 
ATOM 3133  N NH1 . ARG B 1 164 ? -44.027 47.017  -3.832  1.00 25.81  ? 164 ARG B NH1 1 
ATOM 3134  N NH2 . ARG B 1 164 ? -44.774 48.642  -5.246  1.00 42.95  ? 164 ARG B NH2 1 
ATOM 3135  N N   . SER B 1 165 ? -48.655 42.960  -1.046  1.00 52.99  ? 165 SER B N   1 
ATOM 3136  C CA  . SER B 1 165 ? -49.747 42.642  -0.130  1.00 54.19  ? 165 SER B CA  1 
ATOM 3137  C C   . SER B 1 165 ? -50.473 43.923  0.385   1.00 62.23  ? 165 SER B C   1 
ATOM 3138  O O   . SER B 1 165 ? -50.179 45.037  -0.080  1.00 63.64  ? 165 SER B O   1 
ATOM 3139  C CB  . SER B 1 165 ? -49.192 41.828  1.034   1.00 57.15  ? 165 SER B CB  1 
ATOM 3140  O OG  . SER B 1 165 ? -48.795 40.532  0.598   1.00 68.10  ? 165 SER B OG  1 
ATOM 3141  N N   . GLY B 1 166 ? -51.445 43.734  1.288   1.00 58.29  ? 166 GLY B N   1 
ATOM 3142  C CA  . GLY B 1 166 ? -52.208 44.809  1.911   1.00 58.56  ? 166 GLY B CA  1 
ATOM 3143  C C   . GLY B 1 166 ? -52.908 45.747  0.948   1.00 66.05  ? 166 GLY B C   1 
ATOM 3144  O O   . GLY B 1 166 ? -53.041 46.947  1.220   1.00 66.80  ? 166 GLY B O   1 
ATOM 3145  N N   . LEU B 1 167 ? -53.356 45.206  -0.187  1.00 63.35  ? 167 LEU B N   1 
ATOM 3146  C CA  . LEU B 1 167 ? -54.063 45.970  -1.203  1.00 63.65  ? 167 LEU B CA  1 
ATOM 3147  C C   . LEU B 1 167 ? -55.580 45.807  -1.027  1.00 70.23  ? 167 LEU B C   1 
ATOM 3148  O O   . LEU B 1 167 ? -56.367 46.469  -1.718  1.00 68.79  ? 167 LEU B O   1 
ATOM 3149  C CB  . LEU B 1 167 ? -53.620 45.531  -2.616  1.00 63.64  ? 167 LEU B CB  1 
ATOM 3150  C CG  . LEU B 1 167 ? -52.122 45.312  -2.875  1.00 68.42  ? 167 LEU B CG  1 
ATOM 3151  C CD1 . LEU B 1 167 ? -51.891 44.670  -4.215  1.00 68.34  ? 167 LEU B CD1 1 
ATOM 3152  C CD2 . LEU B 1 167 ? -51.340 46.606  -2.793  1.00 70.56  ? 167 LEU B CD2 1 
ATOM 3153  N N   . ASN B 1 168 ? -55.983 44.924  -0.082  1.00 69.67  ? 168 ASN B N   1 
ATOM 3154  C CA  . ASN B 1 168 ? -57.375 44.592  0.242   1.00 70.48  ? 168 ASN B CA  1 
ATOM 3155  C C   . ASN B 1 168 ? -58.166 44.227  -1.038  1.00 71.91  ? 168 ASN B C   1 
ATOM 3156  O O   . ASN B 1 168 ? -59.294 44.682  -1.256  1.00 72.81  ? 168 ASN B O   1 
ATOM 3157  C CB  . ASN B 1 168 ? -58.057 45.724  1.049   1.00 77.31  ? 168 ASN B CB  1 
ATOM 3158  C CG  . ASN B 1 168 ? -57.759 45.686  2.540   1.00 117.06 ? 168 ASN B CG  1 
ATOM 3159  O OD1 . ASN B 1 168 ? -56.688 45.244  3.000   1.00 115.27 ? 168 ASN B OD1 1 
ATOM 3160  N ND2 . ASN B 1 168 ? -58.706 46.166  3.335   1.00 109.93 ? 168 ASN B ND2 1 
ATOM 3161  N N   . LEU B 1 169 ? -57.532 43.417  -1.889  1.00 64.19  ? 169 LEU B N   1 
ATOM 3162  C CA  . LEU B 1 169 ? -58.107 42.911  -3.132  1.00 61.74  ? 169 LEU B CA  1 
ATOM 3163  C C   . LEU B 1 169 ? -58.554 41.484  -2.905  1.00 60.38  ? 169 LEU B C   1 
ATOM 3164  O O   . LEU B 1 169 ? -59.668 41.098  -3.262  1.00 59.40  ? 169 LEU B O   1 
ATOM 3165  C CB  . LEU B 1 169 ? -57.059 42.973  -4.266  1.00 61.67  ? 169 LEU B CB  1 
ATOM 3166  C CG  . LEU B 1 169 ? -56.619 44.364  -4.736  1.00 65.39  ? 169 LEU B CG  1 
ATOM 3167  C CD1 . LEU B 1 169 ? -55.345 44.278  -5.528  1.00 64.87  ? 169 LEU B CD1 1 
ATOM 3168  C CD2 . LEU B 1 169 ? -57.703 45.030  -5.565  1.00 65.86  ? 169 LEU B CD2 1 
ATOM 3169  N N   . GLU B 1 170 ? -57.669 40.714  -2.270  1.00 54.20  ? 170 GLU B N   1 
ATOM 3170  C CA  . GLU B 1 170 ? -57.829 39.308  -1.970  1.00 53.05  ? 170 GLU B CA  1 
ATOM 3171  C C   . GLU B 1 170 ? -57.581 39.029  -0.493  1.00 51.44  ? 170 GLU B C   1 
ATOM 3172  O O   . GLU B 1 170 ? -57.004 39.858  0.209   1.00 50.40  ? 170 GLU B O   1 
ATOM 3173  C CB  . GLU B 1 170 ? -56.814 38.529  -2.835  1.00 54.98  ? 170 GLU B CB  1 
ATOM 3174  C CG  . GLU B 1 170 ? -57.443 37.637  -3.879  1.00 66.18  ? 170 GLU B CG  1 
ATOM 3175  C CD  . GLU B 1 170 ? -58.375 38.341  -4.838  1.00 80.45  ? 170 GLU B CD  1 
ATOM 3176  O OE1 . GLU B 1 170 ? -57.873 38.983  -5.791  1.00 59.08  ? 170 GLU B OE1 1 
ATOM 3177  O OE2 . GLU B 1 170 ? -59.608 38.184  -4.676  1.00 72.22  ? 170 GLU B OE2 1 
ATOM 3178  N N   . GLY B 1 171 ? -57.998 37.858  -0.046  1.00 45.31  ? 171 GLY B N   1 
ATOM 3179  C CA  . GLY B 1 171 ? -57.742 37.398  1.310   1.00 44.44  ? 171 GLY B CA  1 
ATOM 3180  C C   . GLY B 1 171 ? -56.281 37.030  1.457   1.00 49.63  ? 171 GLY B C   1 
ATOM 3181  O O   . GLY B 1 171 ? -55.648 37.366  2.464   1.00 51.34  ? 171 GLY B O   1 
ATOM 3182  N N   . LEU B 1 172 ? -55.717 36.379  0.414   1.00 44.64  ? 172 LEU B N   1 
ATOM 3183  C CA  . LEU B 1 172 ? -54.302 35.992  0.345   1.00 43.34  ? 172 LEU B CA  1 
ATOM 3184  C C   . LEU B 1 172 ? -53.672 36.636  -0.871  1.00 45.75  ? 172 LEU B C   1 
ATOM 3185  O O   . LEU B 1 172 ? -54.127 36.417  -1.997  1.00 46.01  ? 172 LEU B O   1 
ATOM 3186  C CB  . LEU B 1 172 ? -54.127 34.467  0.314   1.00 43.22  ? 172 LEU B CB  1 
ATOM 3187  C CG  . LEU B 1 172 ? -54.814 33.688  1.435   1.00 47.60  ? 172 LEU B CG  1 
ATOM 3188  C CD1 . LEU B 1 172 ? -54.941 32.264  1.077   1.00 47.93  ? 172 LEU B CD1 1 
ATOM 3189  C CD2 . LEU B 1 172 ? -54.086 33.845  2.757   1.00 49.08  ? 172 LEU B CD2 1 
ATOM 3190  N N   . GLU B 1 173 ? -52.662 37.478  -0.624  1.00 40.20  ? 173 GLU B N   1 
ATOM 3191  C CA  . GLU B 1 173 ? -51.954 38.248  -1.625  1.00 38.25  ? 173 GLU B CA  1 
ATOM 3192  C C   . GLU B 1 173 ? -50.442 38.101  -1.503  1.00 43.05  ? 173 GLU B C   1 
ATOM 3193  O O   . GLU B 1 173 ? -49.855 38.303  -0.433  1.00 42.18  ? 173 GLU B O   1 
ATOM 3194  C CB  . GLU B 1 173 ? -52.302 39.755  -1.524  1.00 39.09  ? 173 GLU B CB  1 
ATOM 3195  C CG  . GLU B 1 173 ? -53.776 40.134  -1.490  1.00 51.50  ? 173 GLU B CG  1 
ATOM 3196  C CD  . GLU B 1 173 ? -54.091 41.596  -1.216  1.00 77.63  ? 173 GLU B CD  1 
ATOM 3197  O OE1 . GLU B 1 173 ? -53.169 42.351  -0.836  1.00 81.11  ? 173 GLU B OE1 1 
ATOM 3198  O OE2 . GLU B 1 173 ? -55.270 41.987  -1.375  1.00 77.86  ? 173 GLU B OE2 1 
ATOM 3199  N N   . ASN B 1 174 ? -49.809 37.848  -2.641  1.00 40.96  ? 174 ASN B N   1 
ATOM 3200  C CA  . ASN B 1 174 ? -48.357 37.798  -2.809  1.00 40.13  ? 174 ASN B CA  1 
ATOM 3201  C C   . ASN B 1 174 ? -48.062 38.174  -4.267  1.00 40.84  ? 174 ASN B C   1 
ATOM 3202  O O   . ASN B 1 174 ? -47.279 37.547  -4.958  1.00 41.09  ? 174 ASN B O   1 
ATOM 3203  C CB  . ASN B 1 174 ? -47.821 36.427  -2.410  1.00 38.99  ? 174 ASN B CB  1 
ATOM 3204  C CG  . ASN B 1 174 ? -46.318 36.337  -2.427  1.00 51.22  ? 174 ASN B CG  1 
ATOM 3205  O OD1 . ASN B 1 174 ? -45.752 35.355  -2.891  1.00 59.70  ? 174 ASN B OD1 1 
ATOM 3206  N ND2 . ASN B 1 174 ? -45.638 37.378  -2.004  1.00 31.73  ? 174 ASN B ND2 1 
ATOM 3207  N N   . PHE B 1 175 ? -48.716 39.228  -4.709  1.00 37.30  ? 175 PHE B N   1 
ATOM 3208  C CA  . PHE B 1 175 ? -48.746 39.696  -6.079  1.00 38.17  ? 175 PHE B CA  1 
ATOM 3209  C C   . PHE B 1 175 ? -47.428 40.154  -6.698  1.00 43.02  ? 175 PHE B C   1 
ATOM 3210  O O   . PHE B 1 175 ? -46.601 40.803  -6.058  1.00 44.61  ? 175 PHE B O   1 
ATOM 3211  C CB  . PHE B 1 175 ? -49.725 40.874  -6.197  1.00 39.93  ? 175 PHE B CB  1 
ATOM 3212  C CG  . PHE B 1 175 ? -51.180 40.517  -6.068  1.00 41.54  ? 175 PHE B CG  1 
ATOM 3213  C CD1 . PHE B 1 175 ? -51.984 41.144  -5.123  1.00 45.79  ? 175 PHE B CD1 1 
ATOM 3214  C CD2 . PHE B 1 175 ? -51.763 39.585  -6.915  1.00 43.20  ? 175 PHE B CD2 1 
ATOM 3215  C CE1 . PHE B 1 175 ? -53.352 40.846  -5.036  1.00 46.54  ? 175 PHE B CE1 1 
ATOM 3216  C CE2 . PHE B 1 175 ? -53.134 39.295  -6.829  1.00 46.24  ? 175 PHE B CE2 1 
ATOM 3217  C CZ  . PHE B 1 175 ? -53.916 39.923  -5.891  1.00 44.33  ? 175 PHE B CZ  1 
ATOM 3218  N N   . ILE B 1 176 ? -47.289 39.832  -7.986  1.00 37.94  ? 176 ILE B N   1 
ATOM 3219  C CA  . ILE B 1 176 ? -46.309 40.368  -8.900  1.00 37.69  ? 176 ILE B CA  1 
ATOM 3220  C C   . ILE B 1 176 ? -46.954 41.637  -9.435  1.00 43.00  ? 176 ILE B C   1 
ATOM 3221  O O   . ILE B 1 176 ? -48.143 41.614  -9.807  1.00 41.69  ? 176 ILE B O   1 
ATOM 3222  C CB  . ILE B 1 176 ? -45.945 39.390  -10.052 1.00 40.49  ? 176 ILE B CB  1 
ATOM 3223  C CG1 . ILE B 1 176 ? -45.384 38.060  -9.527  1.00 40.78  ? 176 ILE B CG1 1 
ATOM 3224  C CG2 . ILE B 1 176 ? -44.995 40.069  -11.091 1.00 38.90  ? 176 ILE B CG2 1 
ATOM 3225  C CD1 . ILE B 1 176 ? -45.557 36.991  -10.439 1.00 51.89  ? 176 ILE B CD1 1 
ATOM 3226  N N   . GLN B 1 177 ? -46.214 42.748  -9.442  1.00 39.59  ? 177 GLN B N   1 
ATOM 3227  C CA  . GLN B 1 177 ? -46.739 43.988  -9.997  1.00 37.76  ? 177 GLN B CA  1 
ATOM 3228  C C   . GLN B 1 177 ? -46.078 44.213  -11.369 1.00 40.40  ? 177 GLN B C   1 
ATOM 3229  O O   . GLN B 1 177 ? -44.876 43.986  -11.510 1.00 40.02  ? 177 GLN B O   1 
ATOM 3230  C CB  . GLN B 1 177 ? -46.510 45.147  -9.030  1.00 38.07  ? 177 GLN B CB  1 
ATOM 3231  C CG  . GLN B 1 177 ? -47.310 46.381  -9.397  1.00 30.89  ? 177 GLN B CG  1 
ATOM 3232  C CD  . GLN B 1 177 ? -46.977 47.497  -8.484  1.00 42.17  ? 177 GLN B CD  1 
ATOM 3233  O OE1 . GLN B 1 177 ? -47.001 47.356  -7.261  1.00 42.99  ? 177 GLN B OE1 1 
ATOM 3234  N NE2 . GLN B 1 177 ? -46.630 48.621  -9.061  1.00 36.71  ? 177 GLN B NE2 1 
ATOM 3235  N N   . THR B 1 178 ? -46.859 44.633  -12.379 1.00 35.18  ? 178 THR B N   1 
ATOM 3236  C CA  . THR B 1 178 ? -46.319 44.822  -13.730 1.00 33.83  ? 178 THR B CA  1 
ATOM 3237  C C   . THR B 1 178 ? -46.893 46.065  -14.366 1.00 36.74  ? 178 THR B C   1 
ATOM 3238  O O   . THR B 1 178 ? -47.975 46.481  -14.002 1.00 39.11  ? 178 THR B O   1 
ATOM 3239  C CB  . THR B 1 178 ? -46.548 43.553  -14.614 1.00 35.61  ? 178 THR B CB  1 
ATOM 3240  O OG1 . THR B 1 178 ? -46.015 43.772  -15.910 1.00 34.49  ? 178 THR B OG1 1 
ATOM 3241  C CG2 . THR B 1 178 ? -48.028 43.151  -14.737 1.00 31.45  ? 178 THR B CG2 1 
ATOM 3242  N N   . ASP B 1 179 ? -46.175 46.657  -15.312 1.00 33.35  ? 179 ASP B N   1 
ATOM 3243  C CA  . ASP B 1 179 ? -46.646 47.853  -16.024 1.00 33.56  ? 179 ASP B CA  1 
ATOM 3244  C C   . ASP B 1 179 ? -47.170 47.475  -17.428 1.00 37.35  ? 179 ASP B C   1 
ATOM 3245  O O   . ASP B 1 179 ? -47.544 48.361  -18.198 1.00 37.91  ? 179 ASP B O   1 
ATOM 3246  C CB  . ASP B 1 179 ? -45.585 48.987  -16.078 1.00 35.24  ? 179 ASP B CB  1 
ATOM 3247  C CG  . ASP B 1 179 ? -44.339 48.734  -16.906 1.00 46.41  ? 179 ASP B CG  1 
ATOM 3248  O OD1 . ASP B 1 179 ? -43.991 47.546  -17.110 1.00 44.63  ? 179 ASP B OD1 1 
ATOM 3249  O OD2 . ASP B 1 179 ? -43.680 49.733  -17.316 1.00 56.31  ? 179 ASP B OD2 1 
ATOM 3250  N N   . ALA B 1 180 ? -47.233 46.174  -17.734 1.00 32.46  ? 180 ALA B N   1 
ATOM 3251  C CA  . ALA B 1 180 ? -47.878 45.665  -18.944 1.00 33.51  ? 180 ALA B CA  1 
ATOM 3252  C C   . ALA B 1 180 ? -49.373 46.028  -18.846 1.00 41.39  ? 180 ALA B C   1 
ATOM 3253  O O   . ALA B 1 180 ? -49.970 45.850  -17.780 1.00 44.67  ? 180 ALA B O   1 
ATOM 3254  C CB  . ALA B 1 180 ? -47.697 44.140  -19.039 1.00 34.03  ? 180 ALA B CB  1 
ATOM 3255  N N   . SER B 1 181 ? -49.949 46.625  -19.885 1.00 38.67  ? 181 SER B N   1 
ATOM 3256  C CA  . SER B 1 181 ? -51.360 47.042  -19.865 1.00 37.46  ? 181 SER B CA  1 
ATOM 3257  C C   . SER B 1 181 ? -52.278 45.854  -19.591 1.00 36.67  ? 181 SER B C   1 
ATOM 3258  O O   . SER B 1 181 ? -52.264 44.867  -20.321 1.00 33.45  ? 181 SER B O   1 
ATOM 3259  C CB  . SER B 1 181 ? -51.746 47.731  -21.167 1.00 41.15  ? 181 SER B CB  1 
ATOM 3260  O OG  . SER B 1 181 ? -51.017 48.944  -21.278 1.00 52.38  ? 181 SER B OG  1 
ATOM 3261  N N   . ILE B 1 182 ? -52.978 45.932  -18.463 1.00 31.58  ? 182 ILE B N   1 
ATOM 3262  C CA  . ILE B 1 182 ? -53.914 44.946  -17.966 1.00 32.27  ? 182 ILE B CA  1 
ATOM 3263  C C   . ILE B 1 182 ? -55.206 45.696  -17.721 1.00 41.02  ? 182 ILE B C   1 
ATOM 3264  O O   . ILE B 1 182 ? -55.221 46.704  -17.028 1.00 41.65  ? 182 ILE B O   1 
ATOM 3265  C CB  . ILE B 1 182 ? -53.362 44.178  -16.724 1.00 35.36  ? 182 ILE B CB  1 
ATOM 3266  C CG1 . ILE B 1 182 ? -52.157 43.296  -17.133 1.00 36.03  ? 182 ILE B CG1 1 
ATOM 3267  C CG2 . ILE B 1 182 ? -54.437 43.315  -16.065 1.00 36.26  ? 182 ILE B CG2 1 
ATOM 3268  C CD1 . ILE B 1 182 ? -51.245 42.947  -16.019 1.00 41.25  ? 182 ILE B CD1 1 
ATOM 3269  N N   . ASN B 1 183 ? -56.281 45.237  -18.359 1.00 39.94  ? 183 ASN B N   1 
ATOM 3270  C CA  . ASN B 1 183 ? -57.591 45.879  -18.303 1.00 39.15  ? 183 ASN B CA  1 
ATOM 3271  C C   . ASN B 1 183 ? -58.640 44.840  -17.998 1.00 41.83  ? 183 ASN B C   1 
ATOM 3272  O O   . ASN B 1 183 ? -58.310 43.670  -17.925 1.00 40.36  ? 183 ASN B O   1 
ATOM 3273  C CB  . ASN B 1 183 ? -57.884 46.579  -19.633 1.00 34.60  ? 183 ASN B CB  1 
ATOM 3274  C CG  . ASN B 1 183 ? -57.154 47.881  -19.812 1.00 44.22  ? 183 ASN B CG  1 
ATOM 3275  O OD1 . ASN B 1 183 ? -57.532 48.908  -19.245 1.00 53.32  ? 183 ASN B OD1 1 
ATOM 3276  N ND2 . ASN B 1 183 ? -56.119 47.890  -20.631 1.00 25.15  ? 183 ASN B ND2 1 
ATOM 3277  N N   . ARG B 1 184 ? -59.890 45.259  -17.788 1.00 39.50  ? 184 ARG B N   1 
ATOM 3278  C CA  . ARG B 1 184 ? -61.018 44.348  -17.549 1.00 38.75  ? 184 ARG B CA  1 
ATOM 3279  C C   . ARG B 1 184 ? -61.133 43.380  -18.726 1.00 39.84  ? 184 ARG B C   1 
ATOM 3280  O O   . ARG B 1 184 ? -61.096 43.799  -19.887 1.00 36.04  ? 184 ARG B O   1 
ATOM 3281  C CB  . ARG B 1 184 ? -62.317 45.128  -17.360 1.00 41.55  ? 184 ARG B CB  1 
ATOM 3282  C CG  . ARG B 1 184 ? -62.445 45.788  -15.981 1.00 62.55  ? 184 ARG B CG  1 
ATOM 3283  C CD  . ARG B 1 184 ? -63.827 46.396  -15.801 1.00 92.38  ? 184 ARG B CD  1 
ATOM 3284  N NE  . ARG B 1 184 ? -64.002 47.610  -16.605 1.00 109.36 ? 184 ARG B NE  1 
ATOM 3285  C CZ  . ARG B 1 184 ? -64.106 48.834  -16.101 1.00 122.94 ? 184 ARG B CZ  1 
ATOM 3286  N NH1 . ARG B 1 184 ? -64.091 49.020  -14.785 1.00 107.85 ? 184 ARG B NH1 1 
ATOM 3287  N NH2 . ARG B 1 184 ? -64.246 49.880  -16.905 1.00 107.13 ? 184 ARG B NH2 1 
ATOM 3288  N N   . GLY B 1 185 ? -61.223 42.097  -18.392 1.00 37.38  ? 185 GLY B N   1 
ATOM 3289  C CA  . GLY B 1 185 ? -61.246 40.991  -19.339 1.00 36.14  ? 185 GLY B CA  1 
ATOM 3290  C C   . GLY B 1 185 ? -59.893 40.312  -19.391 1.00 39.40  ? 185 GLY B C   1 
ATOM 3291  O O   . GLY B 1 185 ? -59.768 39.248  -20.007 1.00 39.77  ? 185 GLY B O   1 
ATOM 3292  N N   . ASN B 1 186 ? -58.854 40.927  -18.742 1.00 33.67  ? 186 ASN B N   1 
ATOM 3293  C CA  . ASN B 1 186 ? -57.506 40.353  -18.677 1.00 33.08  ? 186 ASN B CA  1 
ATOM 3294  C C   . ASN B 1 186 ? -57.421 39.298  -17.584 1.00 37.55  ? 186 ASN B C   1 
ATOM 3295  O O   . ASN B 1 186 ? -56.493 38.475  -17.593 1.00 38.44  ? 186 ASN B O   1 
ATOM 3296  C CB  . ASN B 1 186 ? -56.452 41.424  -18.459 1.00 33.82  ? 186 ASN B CB  1 
ATOM 3297  C CG  . ASN B 1 186 ? -55.626 41.743  -19.673 1.00 41.28  ? 186 ASN B CG  1 
ATOM 3298  O OD1 . ASN B 1 186 ? -54.683 41.043  -20.017 1.00 40.08  ? 186 ASN B OD1 1 
ATOM 3299  N ND2 . ASN B 1 186 ? -55.927 42.830  -20.312 1.00 29.81  ? 186 ASN B ND2 1 
ATOM 3300  N N   . SER B 1 187 ? -58.427 39.284  -16.686 1.00 34.08  ? 187 SER B N   1 
ATOM 3301  C CA  . SER B 1 187 ? -58.553 38.364  -15.545 1.00 34.12  ? 187 SER B CA  1 
ATOM 3302  C C   . SER B 1 187 ? -58.473 36.861  -15.913 1.00 37.17  ? 187 SER B C   1 
ATOM 3303  O O   . SER B 1 187 ? -59.198 36.366  -16.785 1.00 37.90  ? 187 SER B O   1 
ATOM 3304  C CB  . SER B 1 187 ? -59.858 38.621  -14.816 1.00 38.19  ? 187 SER B CB  1 
ATOM 3305  O OG  . SER B 1 187 ? -59.788 39.852  -14.124 1.00 52.77  ? 187 SER B OG  1 
ATOM 3306  N N   . GLY B 1 188 ? -57.599 36.161  -15.210 1.00 31.16  ? 188 GLY B N   1 
ATOM 3307  C CA  . GLY B 1 188 ? -57.372 34.737  -15.414 1.00 30.70  ? 188 GLY B CA  1 
ATOM 3308  C C   . GLY B 1 188 ? -56.307 34.451  -16.444 1.00 33.39  ? 188 GLY B C   1 
ATOM 3309  O O   . GLY B 1 188 ? -55.793 33.341  -16.511 1.00 33.82  ? 188 GLY B O   1 
ATOM 3310  N N   . GLY B 1 189 ? -55.956 35.465  -17.215 1.00 29.46  ? 189 GLY B N   1 
ATOM 3311  C CA  . GLY B 1 189 ? -54.921 35.369  -18.219 1.00 29.60  ? 189 GLY B CA  1 
ATOM 3312  C C   . GLY B 1 189 ? -53.513 35.197  -17.689 1.00 35.46  ? 189 GLY B C   1 
ATOM 3313  O O   . GLY B 1 189 ? -53.244 35.253  -16.482 1.00 33.69  ? 189 GLY B O   1 
ATOM 3314  N N   . ALA B 1 190 ? -52.596 35.051  -18.642 1.00 34.38  ? 190 ALA B N   1 
ATOM 3315  C CA  . ALA B 1 190 ? -51.179 34.762  -18.446 1.00 33.00  ? 190 ALA B CA  1 
ATOM 3316  C C   . ALA B 1 190 ? -50.303 35.982  -18.377 1.00 34.68  ? 190 ALA B C   1 
ATOM 3317  O O   . ALA B 1 190 ? -50.417 36.914  -19.183 1.00 30.78  ? 190 ALA B O   1 
ATOM 3318  C CB  . ALA B 1 190 ? -50.677 33.886  -19.594 1.00 33.09  ? 190 ALA B CB  1 
ATOM 3319  N N   . LEU B 1 191 ? -49.360 35.910  -17.431 1.00 31.48  ? 191 LEU B N   1 
ATOM 3320  C CA  . LEU B 1 191 ? -48.223 36.793  -17.316 1.00 29.71  ? 191 LEU B CA  1 
ATOM 3321  C C   . LEU B 1 191 ? -47.042 35.886  -17.635 1.00 32.58  ? 191 LEU B C   1 
ATOM 3322  O O   . LEU B 1 191 ? -46.860 34.868  -16.961 1.00 30.88  ? 191 LEU B O   1 
ATOM 3323  C CB  . LEU B 1 191 ? -48.121 37.487  -15.939 1.00 29.08  ? 191 LEU B CB  1 
ATOM 3324  C CG  . LEU B 1 191 ? -47.077 38.649  -15.915 1.00 30.56  ? 191 LEU B CG  1 
ATOM 3325  C CD1 . LEU B 1 191 ? -47.558 39.856  -16.709 1.00 28.14  ? 191 LEU B CD1 1 
ATOM 3326  C CD2 . LEU B 1 191 ? -46.690 39.021  -14.526 1.00 30.10  ? 191 LEU B CD2 1 
ATOM 3327  N N   . LEU B 1 192 ? -46.324 36.184  -18.716 1.00 31.48  ? 192 LEU B N   1 
ATOM 3328  C CA  . LEU B 1 192 ? -45.228 35.341  -19.210 1.00 33.15  ? 192 LEU B CA  1 
ATOM 3329  C C   . LEU B 1 192 ? -43.870 36.013  -19.170 1.00 37.48  ? 192 LEU B C   1 
ATOM 3330  O O   . LEU B 1 192 ? -43.790 37.235  -19.300 1.00 36.63  ? 192 LEU B O   1 
ATOM 3331  C CB  . LEU B 1 192 ? -45.485 34.935  -20.692 1.00 32.99  ? 192 LEU B CB  1 
ATOM 3332  C CG  . LEU B 1 192 ? -46.873 34.435  -21.067 1.00 36.31  ? 192 LEU B CG  1 
ATOM 3333  C CD1 . LEU B 1 192 ? -47.031 34.427  -22.534 1.00 35.35  ? 192 LEU B CD1 1 
ATOM 3334  C CD2 . LEU B 1 192 ? -47.177 33.067  -20.467 1.00 34.53  ? 192 LEU B CD2 1 
ATOM 3335  N N   . ASN B 1 193 ? -42.802 35.196  -19.140 1.00 34.75  ? 193 ASN B N   1 
ATOM 3336  C CA  . ASN B 1 193 ? -41.455 35.722  -19.273 1.00 36.14  ? 193 ASN B CA  1 
ATOM 3337  C C   . ASN B 1 193 ? -41.069 35.711  -20.757 1.00 41.83  ? 193 ASN B C   1 
ATOM 3338  O O   . ASN B 1 193 ? -41.906 35.383  -21.608 1.00 42.78  ? 193 ASN B O   1 
ATOM 3339  C CB  . ASN B 1 193 ? -40.458 34.952  -18.393 1.00 40.23  ? 193 ASN B CB  1 
ATOM 3340  C CG  . ASN B 1 193 ? -40.316 33.474  -18.664 1.00 55.32  ? 193 ASN B CG  1 
ATOM 3341  O OD1 . ASN B 1 193 ? -40.626 32.963  -19.749 1.00 45.40  ? 193 ASN B OD1 1 
ATOM 3342  N ND2 . ASN B 1 193 ? -39.807 32.763  -17.665 1.00 36.99  ? 193 ASN B ND2 1 
ATOM 3343  N N   . LEU B 1 194 ? -39.811 36.056  -21.072 1.00 39.44  ? 194 LEU B N   1 
ATOM 3344  C CA  . LEU B 1 194 ? -39.312 36.100  -22.445 1.00 39.04  ? 194 LEU B CA  1 
ATOM 3345  C C   . LEU B 1 194 ? -39.114 34.692  -23.070 1.00 43.59  ? 194 LEU B C   1 
ATOM 3346  O O   . LEU B 1 194 ? -38.937 34.611  -24.280 1.00 46.17  ? 194 LEU B O   1 
ATOM 3347  C CB  . LEU B 1 194 ? -38.034 36.933  -22.545 1.00 38.44  ? 194 LEU B CB  1 
ATOM 3348  C CG  . LEU B 1 194 ? -38.193 38.442  -22.332 1.00 39.99  ? 194 LEU B CG  1 
ATOM 3349  C CD1 . LEU B 1 194 ? -36.884 39.138  -22.475 1.00 39.23  ? 194 LEU B CD1 1 
ATOM 3350  C CD2 . LEU B 1 194 ? -39.216 39.047  -23.274 1.00 39.99  ? 194 LEU B CD2 1 
ATOM 3351  N N   . ASN B 1 195 ? -39.234 33.613  -22.288 1.00 37.07  ? 195 ASN B N   1 
ATOM 3352  C CA  . ASN B 1 195 ? -39.196 32.241  -22.790 1.00 36.81  ? 195 ASN B CA  1 
ATOM 3353  C C   . ASN B 1 195 ? -40.627 31.708  -23.039 1.00 42.99  ? 195 ASN B C   1 
ATOM 3354  O O   . ASN B 1 195 ? -40.794 30.547  -23.446 1.00 43.22  ? 195 ASN B O   1 
ATOM 3355  C CB  . ASN B 1 195 ? -38.488 31.321  -21.791 1.00 37.20  ? 195 ASN B CB  1 
ATOM 3356  C CG  . ASN B 1 195 ? -36.999 31.464  -21.741 1.00 63.04  ? 195 ASN B CG  1 
ATOM 3357  O OD1 . ASN B 1 195 ? -36.328 31.670  -22.759 1.00 67.03  ? 195 ASN B OD1 1 
ATOM 3358  N ND2 . ASN B 1 195 ? -36.446 31.303  -20.546 1.00 51.97  ? 195 ASN B ND2 1 
ATOM 3359  N N   . GLY B 1 196 ? -41.632 32.538  -22.743 1.00 39.36  ? 196 GLY B N   1 
ATOM 3360  C CA  . GLY B 1 196 ? -43.038 32.185  -22.899 1.00 38.56  ? 196 GLY B CA  1 
ATOM 3361  C C   . GLY B 1 196 ? -43.538 31.271  -21.822 1.00 42.74  ? 196 GLY B C   1 
ATOM 3362  O O   . GLY B 1 196 ? -44.511 30.549  -22.020 1.00 43.56  ? 196 GLY B O   1 
ATOM 3363  N N   . GLU B 1 197 ? -42.864 31.282  -20.676 1.00 39.49  ? 197 GLU B N   1 
ATOM 3364  C CA  . GLU B 1 197 ? -43.226 30.465  -19.516 1.00 37.75  ? 197 GLU B CA  1 
ATOM 3365  C C   . GLU B 1 197 ? -44.083 31.302  -18.593 1.00 39.99  ? 197 GLU B C   1 
ATOM 3366  O O   . GLU B 1 197 ? -43.855 32.508  -18.453 1.00 39.67  ? 197 GLU B O   1 
ATOM 3367  C CB  . GLU B 1 197 ? -41.971 29.954  -18.782 1.00 38.60  ? 197 GLU B CB  1 
ATOM 3368  C CG  . GLU B 1 197 ? -41.076 29.036  -19.597 1.00 45.58  ? 197 GLU B CG  1 
ATOM 3369  C CD  . GLU B 1 197 ? -39.619 28.941  -19.171 1.00 83.78  ? 197 GLU B CD  1 
ATOM 3370  O OE1 . GLU B 1 197 ? -38.893 28.115  -19.770 1.00 103.41 ? 197 GLU B OE1 1 
ATOM 3371  O OE2 . GLU B 1 197 ? -39.192 29.694  -18.263 1.00 78.61  ? 197 GLU B OE2 1 
ATOM 3372  N N   . LEU B 1 198 ? -45.050 30.659  -17.942 1.00 35.29  ? 198 LEU B N   1 
ATOM 3373  C CA  . LEU B 1 198 ? -45.968 31.321  -17.021 1.00 33.56  ? 198 LEU B CA  1 
ATOM 3374  C C   . LEU B 1 198 ? -45.248 31.771  -15.762 1.00 37.08  ? 198 LEU B C   1 
ATOM 3375  O O   . LEU B 1 198 ? -44.609 30.958  -15.100 1.00 35.40  ? 198 LEU B O   1 
ATOM 3376  C CB  . LEU B 1 198 ? -47.140 30.387  -16.666 1.00 32.61  ? 198 LEU B CB  1 
ATOM 3377  C CG  . LEU B 1 198 ? -48.354 31.022  -16.004 1.00 34.77  ? 198 LEU B CG  1 
ATOM 3378  C CD1 . LEU B 1 198 ? -49.160 31.777  -17.002 1.00 33.04  ? 198 LEU B CD1 1 
ATOM 3379  C CD2 . LEU B 1 198 ? -49.215 29.978  -15.304 1.00 32.73  ? 198 LEU B CD2 1 
ATOM 3380  N N   . ILE B 1 199 ? -45.336 33.076  -15.458 1.00 34.10  ? 199 ILE B N   1 
ATOM 3381  C CA  . ILE B 1 199 ? -44.779 33.639  -14.227 1.00 33.61  ? 199 ILE B CA  1 
ATOM 3382  C C   . ILE B 1 199 ? -45.944 34.108  -13.318 1.00 36.47  ? 199 ILE B C   1 
ATOM 3383  O O   . ILE B 1 199 ? -45.737 34.335  -12.145 1.00 33.82  ? 199 ILE B O   1 
ATOM 3384  C CB  . ILE B 1 199 ? -43.721 34.729  -14.451 1.00 35.57  ? 199 ILE B CB  1 
ATOM 3385  C CG1 . ILE B 1 199 ? -44.272 35.935  -15.264 1.00 34.34  ? 199 ILE B CG1 1 
ATOM 3386  C CG2 . ILE B 1 199 ? -42.455 34.103  -15.059 1.00 36.92  ? 199 ILE B CG2 1 
ATOM 3387  C CD1 . ILE B 1 199 ? -43.390 37.254  -15.206 1.00 26.75  ? 199 ILE B CD1 1 
ATOM 3388  N N   . GLY B 1 200 ? -47.166 34.168  -13.859 1.00 32.52  ? 200 GLY B N   1 
ATOM 3389  C CA  . GLY B 1 200 ? -48.312 34.567  -13.061 1.00 31.49  ? 200 GLY B CA  1 
ATOM 3390  C C   . GLY B 1 200 ? -49.641 34.618  -13.770 1.00 33.34  ? 200 GLY B C   1 
ATOM 3391  O O   . GLY B 1 200 ? -49.699 34.613  -15.007 1.00 34.00  ? 200 GLY B O   1 
ATOM 3392  N N   . ILE B 1 201 ? -50.714 34.694  -12.962 1.00 28.10  ? 201 ILE B N   1 
ATOM 3393  C CA  . ILE B 1 201 ? -52.116 34.762  -13.418 1.00 28.06  ? 201 ILE B CA  1 
ATOM 3394  C C   . ILE B 1 201 ? -52.621 36.198  -13.216 1.00 36.14  ? 201 ILE B C   1 
ATOM 3395  O O   . ILE B 1 201 ? -52.777 36.637  -12.076 1.00 36.33  ? 201 ILE B O   1 
ATOM 3396  C CB  . ILE B 1 201 ? -53.019 33.674  -12.715 1.00 28.92  ? 201 ILE B CB  1 
ATOM 3397  C CG1 . ILE B 1 201 ? -52.562 32.224  -13.069 1.00 27.99  ? 201 ILE B CG1 1 
ATOM 3398  C CG2 . ILE B 1 201 ? -54.493 33.868  -13.009 1.00 28.49  ? 201 ILE B CG2 1 
ATOM 3399  C CD1 . ILE B 1 201 ? -52.678 31.823  -14.650 1.00 34.55  ? 201 ILE B CD1 1 
ATOM 3400  N N   . ASN B 1 202 ? -52.827 36.946  -14.320 1.00 35.05  ? 202 ASN B N   1 
ATOM 3401  C CA  . ASN B 1 202 ? -53.273 38.342  -14.207 1.00 35.72  ? 202 ASN B CA  1 
ATOM 3402  C C   . ASN B 1 202 ? -54.609 38.381  -13.437 1.00 42.75  ? 202 ASN B C   1 
ATOM 3403  O O   . ASN B 1 202 ? -55.502 37.590  -13.747 1.00 43.53  ? 202 ASN B O   1 
ATOM 3404  C CB  . ASN B 1 202 ? -53.336 39.024  -15.562 1.00 28.61  ? 202 ASN B CB  1 
ATOM 3405  C CG  . ASN B 1 202 ? -51.993 39.100  -16.236 1.00 47.22  ? 202 ASN B CG  1 
ATOM 3406  O OD1 . ASN B 1 202 ? -51.839 38.744  -17.412 1.00 51.72  ? 202 ASN B OD1 1 
ATOM 3407  N ND2 . ASN B 1 202 ? -50.989 39.576  -15.517 1.00 32.98  ? 202 ASN B ND2 1 
ATOM 3408  N N   . THR B 1 203 ? -54.684 39.192  -12.355 1.00 39.61  ? 203 THR B N   1 
ATOM 3409  C CA  . THR B 1 203 ? -55.841 39.164  -11.455 1.00 40.05  ? 203 THR B CA  1 
ATOM 3410  C C   . THR B 1 203 ? -56.494 40.506  -11.176 1.00 43.87  ? 203 THR B C   1 
ATOM 3411  O O   . THR B 1 203 ? -57.708 40.553  -11.146 1.00 43.35  ? 203 THR B O   1 
ATOM 3412  C CB  . THR B 1 203 ? -55.393 38.559  -10.127 1.00 44.71  ? 203 THR B CB  1 
ATOM 3413  O OG1 . THR B 1 203 ? -54.781 37.310  -10.411 1.00 49.48  ? 203 THR B OG1 1 
ATOM 3414  C CG2 . THR B 1 203 ? -56.528 38.363  -9.141  1.00 39.55  ? 203 THR B CG2 1 
ATOM 3415  N N   . ALA B 1 204 ? -55.719 41.558  -10.887 1.00 40.92  ? 204 ALA B N   1 
ATOM 3416  C CA  . ALA B 1 204 ? -56.293 42.839  -10.511 1.00 41.10  ? 204 ALA B CA  1 
ATOM 3417  C C   . ALA B 1 204 ? -55.477 43.992  -10.988 1.00 46.19  ? 204 ALA B C   1 
ATOM 3418  O O   . ALA B 1 204 ? -54.356 43.795  -11.417 1.00 46.06  ? 204 ALA B O   1 
ATOM 3419  C CB  . ALA B 1 204 ? -56.402 42.900  -8.999  1.00 42.17  ? 204 ALA B CB  1 
ATOM 3420  N N   . ILE B 1 205 ? -56.027 45.214  -10.900 1.00 45.84  ? 205 ILE B N   1 
ATOM 3421  C CA  . ILE B 1 205 ? -55.330 46.458  -11.271 1.00 45.53  ? 205 ILE B CA  1 
ATOM 3422  C C   . ILE B 1 205 ? -55.696 47.596  -10.313 1.00 52.72  ? 205 ILE B C   1 
ATOM 3423  O O   . ILE B 1 205 ? -56.734 47.540  -9.656  1.00 50.44  ? 205 ILE B O   1 
ATOM 3424  C CB  . ILE B 1 205 ? -55.587 46.890  -12.743 1.00 47.24  ? 205 ILE B CB  1 
ATOM 3425  C CG1 . ILE B 1 205 ? -57.021 47.392  -12.986 1.00 46.53  ? 205 ILE B CG1 1 
ATOM 3426  C CG2 . ILE B 1 205 ? -55.147 45.830  -13.751 1.00 47.63  ? 205 ILE B CG2 1 
ATOM 3427  C CD1 . ILE B 1 205 ? -57.261 48.072  -14.322 1.00 43.45  ? 205 ILE B CD1 1 
ATOM 3428  N N   . LEU B 1 206 ? -54.818 48.623  -10.236 1.00 53.33  ? 206 LEU B N   1 
ATOM 3429  C CA  . LEU B 1 206 ? -55.074 49.887  -9.546  1.00 54.36  ? 206 LEU B CA  1 
ATOM 3430  C C   . LEU B 1 206 ? -55.336 50.880  -10.640 1.00 59.97  ? 206 LEU B C   1 
ATOM 3431  O O   . LEU B 1 206 ? -54.454 51.108  -11.476 1.00 59.34  ? 206 LEU B O   1 
ATOM 3432  C CB  . LEU B 1 206 ? -53.930 50.350  -8.635  1.00 54.98  ? 206 LEU B CB  1 
ATOM 3433  C CG  . LEU B 1 206 ? -53.803 49.781  -7.222  1.00 59.81  ? 206 LEU B CG  1 
ATOM 3434  C CD1 . LEU B 1 206 ? -53.117 50.784  -6.330  1.00 60.35  ? 206 LEU B CD1 1 
ATOM 3435  C CD2 . LEU B 1 206 ? -55.148 49.368  -6.621  1.00 60.53  ? 206 LEU B CD2 1 
ATOM 3436  N N   . ALA B 1 207 ? -56.575 51.380  -10.724 1.00 59.08  ? 207 ALA B N   1 
ATOM 3437  C CA  . ALA B 1 207 ? -56.980 52.268  -11.803 1.00 60.49  ? 207 ALA B CA  1 
ATOM 3438  C C   . ALA B 1 207 ? -57.994 53.297  -11.332 1.00 67.86  ? 207 ALA B C   1 
ATOM 3439  O O   . ALA B 1 207 ? -59.148 52.929  -11.072 1.00 68.84  ? 207 ALA B O   1 
ATOM 3440  C CB  . ALA B 1 207 ? -57.577 51.444  -12.934 1.00 61.43  ? 207 ALA B CB  1 
ATOM 3441  N N   . PRO B 1 208 ? -57.605 54.592  -11.268 1.00 65.06  ? 208 PRO B N   1 
ATOM 3442  C CA  . PRO B 1 208 ? -58.556 55.642  -10.854 1.00 65.20  ? 208 PRO B CA  1 
ATOM 3443  C C   . PRO B 1 208 ? -59.885 55.630  -11.628 1.00 69.97  ? 208 PRO B C   1 
ATOM 3444  O O   . PRO B 1 208 ? -60.948 55.728  -11.005 1.00 71.12  ? 208 PRO B O   1 
ATOM 3445  C CB  . PRO B 1 208 ? -57.785 56.939  -11.133 1.00 66.81  ? 208 PRO B CB  1 
ATOM 3446  C CG  . PRO B 1 208 ? -56.376 56.561  -11.011 1.00 70.95  ? 208 PRO B CG  1 
ATOM 3447  C CD  . PRO B 1 208 ? -56.279 55.169  -11.558 1.00 66.44  ? 208 PRO B CD  1 
ATOM 3448  N N   . GLY B 1 209 ? -59.821 55.466  -12.949 1.00 64.86  ? 209 GLY B N   1 
ATOM 3449  C CA  . GLY B 1 209 ? -61.013 55.488  -13.791 1.00 63.84  ? 209 GLY B CA  1 
ATOM 3450  C C   . GLY B 1 209 ? -61.348 54.220  -14.546 1.00 66.59  ? 209 GLY B C   1 
ATOM 3451  O O   . GLY B 1 209 ? -61.816 54.288  -15.685 1.00 65.23  ? 209 GLY B O   1 
ATOM 3452  N N   . GLY B 1 210 ? -61.118 53.071  -13.918 1.00 62.87  ? 210 GLY B N   1 
ATOM 3453  C CA  . GLY B 1 210 ? -61.450 51.777  -14.509 1.00 62.39  ? 210 GLY B CA  1 
ATOM 3454  C C   . GLY B 1 210 ? -60.583 51.253  -15.643 1.00 64.94  ? 210 GLY B C   1 
ATOM 3455  O O   . GLY B 1 210 ? -60.810 50.138  -16.127 1.00 67.44  ? 210 GLY B O   1 
ATOM 3456  N N   . GLY B 1 211 ? -59.602 52.039  -16.067 1.00 56.52  ? 211 GLY B N   1 
ATOM 3457  C CA  . GLY B 1 211 ? -58.671 51.635  -17.111 1.00 53.80  ? 211 GLY B CA  1 
ATOM 3458  C C   . GLY B 1 211 ? -57.235 51.644  -16.635 1.00 50.54  ? 211 GLY B C   1 
ATOM 3459  O O   . GLY B 1 211 ? -56.889 52.428  -15.742 1.00 47.86  ? 211 GLY B O   1 
ATOM 3460  N N   . SER B 1 212 ? -56.377 50.805  -17.281 1.00 42.31  ? 212 SER B N   1 
ATOM 3461  C CA  . SER B 1 212 ? -54.947 50.666  -17.012 1.00 38.57  ? 212 SER B CA  1 
ATOM 3462  C C   . SER B 1 212 ? -54.187 51.979  -17.028 1.00 41.03  ? 212 SER B C   1 
ATOM 3463  O O   . SER B 1 212 ? -54.299 52.807  -17.952 1.00 41.48  ? 212 SER B O   1 
ATOM 3464  C CB  . SER B 1 212 ? -54.284 49.712  -17.999 1.00 40.04  ? 212 SER B CB  1 
ATOM 3465  O OG  . SER B 1 212 ? -52.937 49.432  -17.639 1.00 40.79  ? 212 SER B OG  1 
ATOM 3466  N N   . VAL B 1 213 ? -53.389 52.144  -15.964 1.00 37.29  ? 213 VAL B N   1 
ATOM 3467  C CA  . VAL B 1 213 ? -52.469 53.256  -15.711 1.00 35.58  ? 213 VAL B CA  1 
ATOM 3468  C C   . VAL B 1 213 ? -51.044 52.675  -15.508 1.00 35.61  ? 213 VAL B C   1 
ATOM 3469  O O   . VAL B 1 213 ? -50.142 53.414  -15.125 1.00 33.97  ? 213 VAL B O   1 
ATOM 3470  C CB  . VAL B 1 213 ? -52.926 54.156  -14.511 1.00 39.32  ? 213 VAL B CB  1 
ATOM 3471  C CG1 . VAL B 1 213 ? -54.285 54.790  -14.771 1.00 38.03  ? 213 VAL B CG1 1 
ATOM 3472  C CG2 . VAL B 1 213 ? -52.907 53.404  -13.178 1.00 38.76  ? 213 VAL B CG2 1 
ATOM 3473  N N   . GLY B 1 214 ? -50.883 51.358  -15.760 1.00 32.19  ? 214 GLY B N   1 
ATOM 3474  C CA  . GLY B 1 214 ? -49.623 50.635  -15.593 1.00 32.69  ? 214 GLY B CA  1 
ATOM 3475  C C   . GLY B 1 214 ? -49.336 50.056  -14.208 1.00 38.69  ? 214 GLY B C   1 
ATOM 3476  O O   . GLY B 1 214 ? -48.172 49.820  -13.874 1.00 40.31  ? 214 GLY B O   1 
ATOM 3477  N N   . ILE B 1 215 ? -50.386 49.810  -13.390 1.00 33.54  ? 215 ILE B N   1 
ATOM 3478  C CA  . ILE B 1 215 ? -50.274 49.190  -12.068 1.00 32.79  ? 215 ILE B CA  1 
ATOM 3479  C C   . ILE B 1 215 ? -51.168 47.965  -12.066 1.00 39.58  ? 215 ILE B C   1 
ATOM 3480  O O   . ILE B 1 215 ? -52.370 48.065  -11.751 1.00 42.88  ? 215 ILE B O   1 
ATOM 3481  C CB  . ILE B 1 215 ? -50.621 50.159  -10.890 1.00 35.67  ? 215 ILE B CB  1 
ATOM 3482  C CG1 . ILE B 1 215 ? -50.005 51.593  -11.035 1.00 35.46  ? 215 ILE B CG1 1 
ATOM 3483  C CG2 . ILE B 1 215 ? -50.362 49.496  -9.526  1.00 35.80  ? 215 ILE B CG2 1 
ATOM 3484  C CD1 . ILE B 1 215 ? -48.594 51.743  -10.679 1.00 34.83  ? 215 ILE B CD1 1 
ATOM 3485  N N   . GLY B 1 216 ? -50.600 46.834  -12.470 1.00 33.22  ? 216 GLY B N   1 
ATOM 3486  C CA  . GLY B 1 216 ? -51.324 45.572  -12.583 1.00 31.24  ? 216 GLY B CA  1 
ATOM 3487  C C   . GLY B 1 216 ? -50.752 44.530  -11.672 1.00 31.46  ? 216 GLY B C   1 
ATOM 3488  O O   . GLY B 1 216 ? -49.554 44.553  -11.390 1.00 30.23  ? 216 GLY B O   1 
ATOM 3489  N N   . PHE B 1 217 ? -51.595 43.596  -11.240 1.00 28.44  ? 217 PHE B N   1 
ATOM 3490  C CA  . PHE B 1 217 ? -51.216 42.541  -10.297 1.00 28.31  ? 217 PHE B CA  1 
ATOM 3491  C C   . PHE B 1 217 ? -51.524 41.147  -10.812 1.00 33.86  ? 217 PHE B C   1 
ATOM 3492  O O   . PHE B 1 217 ? -52.592 40.908  -11.374 1.00 34.45  ? 217 PHE B O   1 
ATOM 3493  C CB  . PHE B 1 217 ? -51.885 42.763  -8.926  1.00 29.24  ? 217 PHE B CB  1 
ATOM 3494  C CG  . PHE B 1 217 ? -51.578 44.128  -8.363  1.00 29.93  ? 217 PHE B CG  1 
ATOM 3495  C CD1 . PHE B 1 217 ? -50.342 44.401  -7.786  1.00 32.12  ? 217 PHE B CD1 1 
ATOM 3496  C CD2 . PHE B 1 217 ? -52.499 45.153  -8.457  1.00 33.65  ? 217 PHE B CD2 1 
ATOM 3497  C CE1 . PHE B 1 217 ? -50.050 45.676  -7.291  1.00 32.92  ? 217 PHE B CE1 1 
ATOM 3498  C CE2 . PHE B 1 217 ? -52.199 46.437  -7.969  1.00 36.20  ? 217 PHE B CE2 1 
ATOM 3499  C CZ  . PHE B 1 217 ? -50.980 46.685  -7.381  1.00 32.32  ? 217 PHE B CZ  1 
ATOM 3500  N N   . ALA B 1 218 ? -50.572 40.223  -10.577 1.00 30.92  ? 218 ALA B N   1 
ATOM 3501  C CA  . ALA B 1 218 ? -50.640 38.823  -10.986 1.00 30.71  ? 218 ALA B CA  1 
ATOM 3502  C C   . ALA B 1 218 ? -50.354 37.882  -9.825  1.00 36.89  ? 218 ALA B C   1 
ATOM 3503  O O   . ALA B 1 218 ? -49.373 38.065  -9.110  1.00 36.60  ? 218 ALA B O   1 
ATOM 3504  C CB  . ALA B 1 218 ? -49.651 38.550  -12.119 1.00 30.61  ? 218 ALA B CB  1 
ATOM 3505  N N   . ILE B 1 219 ? -51.191 36.844  -9.653  1.00 34.89  ? 219 ILE B N   1 
ATOM 3506  C CA  . ILE B 1 219 ? -50.917 35.800  -8.659  1.00 34.36  ? 219 ILE B CA  1 
ATOM 3507  C C   . ILE B 1 219 ? -49.674 35.069  -9.168  1.00 40.01  ? 219 ILE B C   1 
ATOM 3508  O O   . ILE B 1 219 ? -49.678 34.646  -10.332 1.00 40.03  ? 219 ILE B O   1 
ATOM 3509  C CB  . ILE B 1 219 ? -52.129 34.838  -8.470  1.00 36.39  ? 219 ILE B CB  1 
ATOM 3510  C CG1 . ILE B 1 219 ? -53.377 35.594  -7.927  1.00 35.53  ? 219 ILE B CG1 1 
ATOM 3511  C CG2 . ILE B 1 219 ? -51.733 33.664  -7.567  1.00 35.62  ? 219 ILE B CG2 1 
ATOM 3512  C CD1 . ILE B 1 219 ? -54.681 34.935  -8.213  1.00 32.73  ? 219 ILE B CD1 1 
ATOM 3513  N N   . PRO B 1 220 ? -48.586 34.949  -8.378  1.00 37.39  ? 220 PRO B N   1 
ATOM 3514  C CA  . PRO B 1 220 ? -47.373 34.263  -8.901  1.00 35.65  ? 220 PRO B CA  1 
ATOM 3515  C C   . PRO B 1 220 ? -47.609 32.795  -9.281  1.00 38.58  ? 220 PRO B C   1 
ATOM 3516  O O   . PRO B 1 220 ? -48.473 32.109  -8.684  1.00 35.95  ? 220 PRO B O   1 
ATOM 3517  C CB  . PRO B 1 220 ? -46.349 34.395  -7.781  1.00 35.94  ? 220 PRO B CB  1 
ATOM 3518  C CG  . PRO B 1 220 ? -47.097 34.807  -6.584  1.00 40.02  ? 220 PRO B CG  1 
ATOM 3519  C CD  . PRO B 1 220 ? -48.390 35.426  -6.990  1.00 37.63  ? 220 PRO B CD  1 
ATOM 3520  N N   . SER B 1 221 ? -46.826 32.333  -10.307 1.00 35.06  ? 221 SER B N   1 
ATOM 3521  C CA  . SER B 1 221 ? -46.937 31.004  -10.899 1.00 35.34  ? 221 SER B CA  1 
ATOM 3522  C C   . SER B 1 221 ? -46.778 29.891  -9.888  1.00 40.46  ? 221 SER B C   1 
ATOM 3523  O O   . SER B 1 221 ? -47.508 28.920  -9.971  1.00 41.50  ? 221 SER B O   1 
ATOM 3524  C CB  . SER B 1 221 ? -45.950 30.816  -12.046 1.00 40.26  ? 221 SER B CB  1 
ATOM 3525  O OG  . SER B 1 221 ? -44.591 31.020  -11.700 1.00 51.98  ? 221 SER B OG  1 
ATOM 3526  N N   . ASN B 1 222 ? -45.876 30.028  -8.925  1.00 37.69  ? 222 ASN B N   1 
ATOM 3527  C CA  . ASN B 1 222 ? -45.657 28.995  -7.905  1.00 38.29  ? 222 ASN B CA  1 
ATOM 3528  C C   . ASN B 1 222 ? -46.896 28.815  -7.020  1.00 43.51  ? 222 ASN B C   1 
ATOM 3529  O O   . ASN B 1 222 ? -47.298 27.684  -6.761  1.00 43.88  ? 222 ASN B O   1 
ATOM 3530  C CB  . ASN B 1 222 ? -44.433 29.331  -7.061  1.00 34.78  ? 222 ASN B CB  1 
ATOM 3531  C CG  . ASN B 1 222 ? -43.089 29.237  -7.761  1.00 48.49  ? 222 ASN B CG  1 
ATOM 3532  O OD1 . ASN B 1 222 ? -42.069 29.514  -7.154  1.00 35.96  ? 222 ASN B OD1 1 
ATOM 3533  N ND2 . ASN B 1 222 ? -43.034 28.896  -9.049  1.00 41.08  ? 222 ASN B ND2 1 
ATOM 3534  N N   . MET B 1 223 ? -47.533 29.926  -6.644  1.00 40.75  ? 223 MET B N   1 
ATOM 3535  C CA  . MET B 1 223 ? -48.766 29.935  -5.865  1.00 42.33  ? 223 MET B CA  1 
ATOM 3536  C C   . MET B 1 223 ? -49.920 29.319  -6.673  1.00 49.53  ? 223 MET B C   1 
ATOM 3537  O O   . MET B 1 223 ? -50.610 28.447  -6.155  1.00 49.96  ? 223 MET B O   1 
ATOM 3538  C CB  . MET B 1 223 ? -49.110 31.368  -5.440  1.00 44.58  ? 223 MET B CB  1 
ATOM 3539  C CG  . MET B 1 223 ? -50.334 31.461  -4.562  1.00 48.93  ? 223 MET B CG  1 
ATOM 3540  S SD  . MET B 1 223 ? -50.529 33.093  -3.827  1.00 54.24  ? 223 MET B SD  1 
ATOM 3541  C CE  . MET B 1 223 ? -49.011 33.099  -2.752  1.00 50.72  ? 223 MET B CE  1 
ATOM 3542  N N   . ALA B 1 224 ? -50.134 29.774  -7.926  1.00 46.14  ? 224 ALA B N   1 
ATOM 3543  C CA  . ALA B 1 224 ? -51.183 29.237  -8.799  1.00 44.72  ? 224 ALA B CA  1 
ATOM 3544  C C   . ALA B 1 224 ? -50.977 27.743  -9.088  1.00 48.10  ? 224 ALA B C   1 
ATOM 3545  O O   . ALA B 1 224 ? -51.957 27.011  -9.034  1.00 47.88  ? 224 ALA B O   1 
ATOM 3546  C CB  . ALA B 1 224 ? -51.238 30.014  -10.093 1.00 44.91  ? 224 ALA B CB  1 
ATOM 3547  N N   . ARG B 1 225 ? -49.717 27.281  -9.353  1.00 44.76  ? 225 ARG B N   1 
ATOM 3548  C CA  . ARG B 1 225 ? -49.385 25.868  -9.623  1.00 44.34  ? 225 ARG B CA  1 
ATOM 3549  C C   . ARG B 1 225 ? -49.745 24.969  -8.408  1.00 47.97  ? 225 ARG B C   1 
ATOM 3550  O O   . ARG B 1 225 ? -50.449 23.971  -8.571  1.00 48.98  ? 225 ARG B O   1 
ATOM 3551  C CB  . ARG B 1 225 ? -47.894 25.728  -9.966  1.00 46.22  ? 225 ARG B CB  1 
ATOM 3552  C CG  . ARG B 1 225 ? -47.504 24.413  -10.627 1.00 51.43  ? 225 ARG B CG  1 
ATOM 3553  C CD  . ARG B 1 225 ? -46.100 23.981  -10.259 1.00 68.34  ? 225 ARG B CD  1 
ATOM 3554  N NE  . ARG B 1 225 ? -45.061 24.804  -10.879 1.00 94.78  ? 225 ARG B NE  1 
ATOM 3555  C CZ  . ARG B 1 225 ? -44.259 25.630  -10.211 1.00 118.82 ? 225 ARG B CZ  1 
ATOM 3556  N NH1 . ARG B 1 225 ? -44.370 25.754  -8.892  1.00 111.67 ? 225 ARG B NH1 1 
ATOM 3557  N NH2 . ARG B 1 225 ? -43.333 26.333  -10.854 1.00 106.83 ? 225 ARG B NH2 1 
ATOM 3558  N N   . THR B 1 226 ? -49.281 25.342  -7.203  1.00 42.09  ? 226 THR B N   1 
ATOM 3559  C CA  . THR B 1 226 ? -49.566 24.624  -5.961  1.00 41.86  ? 226 THR B CA  1 
ATOM 3560  C C   . THR B 1 226 ? -51.094 24.528  -5.687  1.00 47.61  ? 226 THR B C   1 
ATOM 3561  O O   . THR B 1 226 ? -51.607 23.442  -5.385  1.00 49.19  ? 226 THR B O   1 
ATOM 3562  C CB  . THR B 1 226 ? -48.851 25.305  -4.813  1.00 52.63  ? 226 THR B CB  1 
ATOM 3563  O OG1 . THR B 1 226 ? -47.469 25.385  -5.140  1.00 54.03  ? 226 THR B OG1 1 
ATOM 3564  C CG2 . THR B 1 226 ? -49.031 24.565  -3.497  1.00 53.55  ? 226 THR B CG2 1 
ATOM 3565  N N   . LEU B 1 227 ? -51.809 25.655  -5.797  1.00 42.78  ? 227 LEU B N   1 
ATOM 3566  C CA  . LEU B 1 227 ? -53.254 25.671  -5.574  1.00 41.67  ? 227 LEU B CA  1 
ATOM 3567  C C   . LEU B 1 227 ? -53.959 24.816  -6.629  1.00 46.41  ? 227 LEU B C   1 
ATOM 3568  O O   . LEU B 1 227 ? -54.845 24.050  -6.273  1.00 45.06  ? 227 LEU B O   1 
ATOM 3569  C CB  . LEU B 1 227 ? -53.810 27.107  -5.556  1.00 40.81  ? 227 LEU B CB  1 
ATOM 3570  C CG  . LEU B 1 227 ? -53.347 27.979  -4.380  1.00 43.90  ? 227 LEU B CG  1 
ATOM 3571  C CD1 . LEU B 1 227 ? -53.496 29.440  -4.699  1.00 43.03  ? 227 LEU B CD1 1 
ATOM 3572  C CD2 . LEU B 1 227 ? -54.074 27.629  -3.105  1.00 46.47  ? 227 LEU B CD2 1 
ATOM 3573  N N   . ALA B 1 228 ? -53.500 24.873  -7.900  1.00 45.26  ? 228 ALA B N   1 
ATOM 3574  C CA  . ALA B 1 228 ? -54.049 24.067  -8.996  1.00 45.88  ? 228 ALA B CA  1 
ATOM 3575  C C   . ALA B 1 228 ? -53.908 22.572  -8.686  1.00 52.42  ? 228 ALA B C   1 
ATOM 3576  O O   . ALA B 1 228 ? -54.883 21.847  -8.874  1.00 53.07  ? 228 ALA B O   1 
ATOM 3577  C CB  . ALA B 1 228 ? -53.371 24.403  -10.319 1.00 46.05  ? 228 ALA B CB  1 
ATOM 3578  N N   . GLN B 1 229 ? -52.729 22.132  -8.154  1.00 48.90  ? 229 GLN B N   1 
ATOM 3579  C CA  . GLN B 1 229 ? -52.470 20.736  -7.778  1.00 48.56  ? 229 GLN B CA  1 
ATOM 3580  C C   . GLN B 1 229 ? -53.442 20.273  -6.711  1.00 51.97  ? 229 GLN B C   1 
ATOM 3581  O O   . GLN B 1 229 ? -53.985 19.174  -6.835  1.00 52.78  ? 229 GLN B O   1 
ATOM 3582  C CB  . GLN B 1 229 ? -51.022 20.502  -7.309  1.00 50.08  ? 229 GLN B CB  1 
ATOM 3583  C CG  . GLN B 1 229 ? -50.114 19.878  -8.374  1.00 68.23  ? 229 GLN B CG  1 
ATOM 3584  C CD  . GLN B 1 229 ? -50.677 18.642  -9.078  1.00 87.67  ? 229 GLN B CD  1 
ATOM 3585  O OE1 . GLN B 1 229 ? -51.218 17.719  -8.451  1.00 87.93  ? 229 GLN B OE1 1 
ATOM 3586  N NE2 . GLN B 1 229 ? -50.555 18.593  -10.408 1.00 63.28  ? 229 GLN B NE2 1 
ATOM 3587  N N   . GLN B 1 230 ? -53.714 21.124  -5.703  1.00 47.19  ? 230 GLN B N   1 
ATOM 3588  C CA  . GLN B 1 230 ? -54.684 20.828  -4.630  1.00 45.98  ? 230 GLN B CA  1 
ATOM 3589  C C   . GLN B 1 230 ? -56.098 20.636  -5.191  1.00 51.42  ? 230 GLN B C   1 
ATOM 3590  O O   . GLN B 1 230 ? -56.843 19.797  -4.700  1.00 51.11  ? 230 GLN B O   1 
ATOM 3591  C CB  . GLN B 1 230 ? -54.686 21.937  -3.580  1.00 44.90  ? 230 GLN B CB  1 
ATOM 3592  C CG  . GLN B 1 230 ? -53.576 21.759  -2.588  1.00 46.19  ? 230 GLN B CG  1 
ATOM 3593  C CD  . GLN B 1 230 ? -53.296 23.012  -1.813  1.00 70.90  ? 230 GLN B CD  1 
ATOM 3594  O OE1 . GLN B 1 230 ? -52.164 23.527  -1.809  1.00 64.72  ? 230 GLN B OE1 1 
ATOM 3595  N NE2 . GLN B 1 230 ? -54.312 23.531  -1.132  1.00 59.84  ? 230 GLN B NE2 1 
ATOM 3596  N N   . LEU B 1 231 ? -56.455 21.411  -6.214  1.00 48.60  ? 231 LEU B N   1 
ATOM 3597  C CA  . LEU B 1 231 ? -57.766 21.304  -6.828  1.00 49.10  ? 231 LEU B CA  1 
ATOM 3598  C C   . LEU B 1 231 ? -57.840 20.090  -7.758  1.00 54.84  ? 231 LEU B C   1 
ATOM 3599  O O   . LEU B 1 231 ? -58.909 19.507  -7.832  1.00 55.25  ? 231 LEU B O   1 
ATOM 3600  C CB  . LEU B 1 231 ? -58.167 22.597  -7.571  1.00 48.94  ? 231 LEU B CB  1 
ATOM 3601  C CG  . LEU B 1 231 ? -58.242 23.893  -6.739  1.00 51.60  ? 231 LEU B CG  1 
ATOM 3602  C CD1 . LEU B 1 231 ? -58.279 25.117  -7.649  1.00 51.06  ? 231 LEU B CD1 1 
ATOM 3603  C CD2 . LEU B 1 231 ? -59.423 23.891  -5.786  1.00 49.35  ? 231 LEU B CD2 1 
ATOM 3604  N N   . ILE B 1 232 ? -56.735 19.678  -8.434  1.00 53.30  ? 232 ILE B N   1 
ATOM 3605  C CA  . ILE B 1 232 ? -56.780 18.479  -9.276  1.00 54.64  ? 232 ILE B CA  1 
ATOM 3606  C C   . ILE B 1 232 ? -56.836 17.243  -8.347  1.00 60.37  ? 232 ILE B C   1 
ATOM 3607  O O   . ILE B 1 232 ? -57.562 16.304  -8.654  1.00 60.68  ? 232 ILE B O   1 
ATOM 3608  C CB  . ILE B 1 232 ? -55.687 18.345  -10.397 1.00 58.95  ? 232 ILE B CB  1 
ATOM 3609  C CG1 . ILE B 1 232 ? -54.366 17.711  -9.920  1.00 61.38  ? 232 ILE B CG1 1 
ATOM 3610  C CG2 . ILE B 1 232 ? -55.445 19.636  -11.174 1.00 59.75  ? 232 ILE B CG2 1 
ATOM 3611  C CD1 . ILE B 1 232 ? -53.569 16.901  -11.036 1.00 74.12  ? 232 ILE B CD1 1 
ATOM 3612  N N   . ASP B 1 233 ? -56.156 17.292  -7.179  1.00 58.02  ? 233 ASP B N   1 
ATOM 3613  C CA  . ASP B 1 233 ? -56.115 16.191  -6.207  1.00 58.17  ? 233 ASP B CA  1 
ATOM 3614  C C   . ASP B 1 233 ? -57.346 16.071  -5.322  1.00 61.98  ? 233 ASP B C   1 
ATOM 3615  O O   . ASP B 1 233 ? -57.677 14.950  -4.932  1.00 64.68  ? 233 ASP B O   1 
ATOM 3616  C CB  . ASP B 1 233 ? -54.896 16.319  -5.275  1.00 60.51  ? 233 ASP B CB  1 
ATOM 3617  C CG  . ASP B 1 233 ? -53.532 16.254  -5.942  1.00 76.99  ? 233 ASP B CG  1 
ATOM 3618  O OD1 . ASP B 1 233 ? -53.479 16.036  -7.175  1.00 80.64  ? 233 ASP B OD1 1 
ATOM 3619  O OD2 . ASP B 1 233 ? -52.517 16.468  -5.240  1.00 82.00  ? 233 ASP B OD2 1 
ATOM 3620  N N   . PHE B 1 234 ? -57.985 17.182  -4.936  1.00 55.60  ? 234 PHE B N   1 
ATOM 3621  C CA  . PHE B 1 234 ? -59.073 17.089  -3.966  1.00 55.08  ? 234 PHE B CA  1 
ATOM 3622  C C   . PHE B 1 234 ? -60.353 17.856  -4.313  1.00 59.01  ? 234 PHE B C   1 
ATOM 3623  O O   . PHE B 1 234 ? -61.335 17.734  -3.563  1.00 59.50  ? 234 PHE B O   1 
ATOM 3624  C CB  . PHE B 1 234 ? -58.585 17.592  -2.592  1.00 56.87  ? 234 PHE B CB  1 
ATOM 3625  C CG  . PHE B 1 234 ? -57.184 17.206  -2.191  1.00 59.01  ? 234 PHE B CG  1 
ATOM 3626  C CD1 . PHE B 1 234 ? -56.161 18.152  -2.176  1.00 63.57  ? 234 PHE B CD1 1 
ATOM 3627  C CD2 . PHE B 1 234 ? -56.886 15.906  -1.815  1.00 61.14  ? 234 PHE B CD2 1 
ATOM 3628  C CE1 . PHE B 1 234 ? -54.857 17.789  -1.831  1.00 64.20  ? 234 PHE B CE1 1 
ATOM 3629  C CE2 . PHE B 1 234 ? -55.593 15.553  -1.435  1.00 63.76  ? 234 PHE B CE2 1 
ATOM 3630  C CZ  . PHE B 1 234 ? -54.586 16.491  -1.455  1.00 62.26  ? 234 PHE B CZ  1 
ATOM 3631  N N   . GLY B 1 235 ? -60.338 18.679  -5.365  1.00 54.32  ? 235 GLY B N   1 
ATOM 3632  C CA  . GLY B 1 235 ? -61.497 19.507  -5.722  1.00 54.25  ? 235 GLY B CA  1 
ATOM 3633  C C   . GLY B 1 235 ? -61.689 20.707  -4.801  1.00 59.49  ? 235 GLY B C   1 
ATOM 3634  O O   . GLY B 1 235 ? -62.610 21.516  -4.961  1.00 58.78  ? 235 GLY B O   1 
ATOM 3635  N N   . GLU B 1 236 ? -60.796 20.826  -3.831  1.00 57.71  ? 236 GLU B N   1 
ATOM 3636  C CA  . GLU B 1 236 ? -60.772 21.890  -2.857  1.00 58.29  ? 236 GLU B CA  1 
ATOM 3637  C C   . GLU B 1 236 ? -59.347 22.076  -2.388  1.00 60.07  ? 236 GLU B C   1 
ATOM 3638  O O   . GLU B 1 236 ? -58.497 21.182  -2.558  1.00 59.40  ? 236 GLU B O   1 
ATOM 3639  C CB  . GLU B 1 236 ? -61.718 21.589  -1.670  1.00 60.61  ? 236 GLU B CB  1 
ATOM 3640  C CG  . GLU B 1 236 ? -61.417 20.280  -0.947  1.00 73.56  ? 236 GLU B CG  1 
ATOM 3641  C CD  . GLU B 1 236 ? -62.097 20.088  0.393   1.00 97.37  ? 236 GLU B CD  1 
ATOM 3642  O OE1 . GLU B 1 236 ? -63.247 20.557  0.556   1.00 79.56  ? 236 GLU B OE1 1 
ATOM 3643  O OE2 . GLU B 1 236 ? -61.484 19.445  1.276   1.00 99.81  ? 236 GLU B OE2 1 
ATOM 3644  N N   . ILE B 1 237 ? -59.099 23.232  -1.775  1.00 54.69  ? 237 ILE B N   1 
ATOM 3645  C CA  . ILE B 1 237 ? -57.792 23.567  -1.233  1.00 53.45  ? 237 ILE B CA  1 
ATOM 3646  C C   . ILE B 1 237 ? -57.715 23.049  0.195   1.00 62.76  ? 237 ILE B C   1 
ATOM 3647  O O   . ILE B 1 237 ? -58.746 22.932  0.885   1.00 63.54  ? 237 ILE B O   1 
ATOM 3648  C CB  . ILE B 1 237 ? -57.439 25.097  -1.325  1.00 54.01  ? 237 ILE B CB  1 
ATOM 3649  C CG1 . ILE B 1 237 ? -58.481 26.006  -0.629  1.00 54.03  ? 237 ILE B CG1 1 
ATOM 3650  C CG2 . ILE B 1 237 ? -57.181 25.533  -2.785  1.00 50.61  ? 237 ILE B CG2 1 
ATOM 3651  C CD1 . ILE B 1 237 ? -58.413 26.191  0.932   1.00 61.06  ? 237 ILE B CD1 1 
ATOM 3652  N N   . LYS B 1 238 ? -56.487 22.718  0.629   1.00 60.47  ? 238 LYS B N   1 
ATOM 3653  C CA  . LYS B 1 238 ? -56.206 22.326  2.005   1.00 59.67  ? 238 LYS B CA  1 
ATOM 3654  C C   . LYS B 1 238 ? -55.277 23.437  2.528   1.00 60.44  ? 238 LYS B C   1 
ATOM 3655  O O   . LYS B 1 238 ? -54.155 23.617  2.031   1.00 58.47  ? 238 LYS B O   1 
ATOM 3656  C CB  . LYS B 1 238 ? -55.645 20.888  2.114   1.00 62.62  ? 238 LYS B CB  1 
ATOM 3657  C CG  . LYS B 1 238 ? -56.516 19.821  1.439   1.00 81.38  ? 238 LYS B CG  1 
ATOM 3658  C CD  . LYS B 1 238 ? -56.393 18.427  2.065   1.00 87.24  ? 238 LYS B CD  1 
ATOM 3659  C CE  . LYS B 1 238 ? -57.611 17.554  1.784   1.00 85.77  ? 238 LYS B CE  1 
ATOM 3660  N NZ  . LYS B 1 238 ? -58.796 17.930  2.613   1.00 85.12  ? 238 LYS B NZ  1 
ATOM 3661  N N   . ARG B 1 239 ? -55.842 24.276  3.416   1.00 55.90  ? 239 ARG B N   1 
ATOM 3662  C CA  . ARG B 1 239 ? -55.222 25.446  4.042   1.00 54.60  ? 239 ARG B CA  1 
ATOM 3663  C C   . ARG B 1 239 ? -54.243 25.055  5.168   1.00 55.90  ? 239 ARG B C   1 
ATOM 3664  O O   . ARG B 1 239 ? -54.662 24.498  6.193   1.00 55.45  ? 239 ARG B O   1 
ATOM 3665  C CB  . ARG B 1 239 ? -56.333 26.361  4.604   1.00 52.30  ? 239 ARG B CB  1 
ATOM 3666  C CG  . ARG B 1 239 ? -55.911 27.811  4.721   1.00 60.93  ? 239 ARG B CG  1 
ATOM 3667  C CD  . ARG B 1 239 ? -56.478 28.637  3.595   1.00 67.18  ? 239 ARG B CD  1 
ATOM 3668  N NE  . ARG B 1 239 ? -55.748 28.431  2.344   1.00 65.65  ? 239 ARG B NE  1 
ATOM 3669  C CZ  . ARG B 1 239 ? -56.184 28.852  1.165   1.00 74.35  ? 239 ARG B CZ  1 
ATOM 3670  N NH1 . ARG B 1 239 ? -57.360 29.474  1.066   1.00 48.32  ? 239 ARG B NH1 1 
ATOM 3671  N NH2 . ARG B 1 239 ? -55.464 28.634  0.068   1.00 58.20  ? 239 ARG B NH2 1 
ATOM 3672  N N   . GLY B 1 240 ? -52.968 25.372  4.972   1.00 49.78  ? 240 GLY B N   1 
ATOM 3673  C CA  . GLY B 1 240 ? -51.945 25.084  5.967   1.00 49.21  ? 240 GLY B CA  1 
ATOM 3674  C C   . GLY B 1 240 ? -51.759 26.207  6.974   1.00 52.58  ? 240 GLY B C   1 
ATOM 3675  O O   . GLY B 1 240 ? -52.025 27.373  6.667   1.00 51.75  ? 240 GLY B O   1 
ATOM 3676  N N   . LEU B 1 241 ? -51.343 25.866  8.206   1.00 49.68  ? 241 LEU B N   1 
ATOM 3677  C CA  . LEU B 1 241 ? -51.027 26.880  9.199   1.00 49.66  ? 241 LEU B CA  1 
ATOM 3678  C C   . LEU B 1 241 ? -49.793 26.499  10.011  1.00 50.85  ? 241 LEU B C   1 
ATOM 3679  O O   . LEU B 1 241 ? -49.550 25.316  10.259  1.00 50.58  ? 241 LEU B O   1 
ATOM 3680  C CB  . LEU B 1 241 ? -52.194 27.321  10.113  1.00 50.47  ? 241 LEU B CB  1 
ATOM 3681  C CG  . LEU B 1 241 ? -52.851 26.390  11.114  1.00 57.26  ? 241 LEU B CG  1 
ATOM 3682  C CD1 . LEU B 1 241 ? -52.025 26.206  12.368  1.00 57.73  ? 241 LEU B CD1 1 
ATOM 3683  C CD2 . LEU B 1 241 ? -54.111 27.024  11.610  1.00 61.87  ? 241 LEU B CD2 1 
ATOM 3684  N N   . LEU B 1 242 ? -49.015 27.520  10.400  1.00 46.32  ? 242 LEU B N   1 
ATOM 3685  C CA  . LEU B 1 242 ? -47.820 27.374  11.232  1.00 46.84  ? 242 LEU B CA  1 
ATOM 3686  C C   . LEU B 1 242 ? -48.168 27.151  12.718  1.00 51.96  ? 242 LEU B C   1 
ATOM 3687  O O   . LEU B 1 242 ? -47.518 26.345  13.376  1.00 52.99  ? 242 LEU B O   1 
ATOM 3688  C CB  . LEU B 1 242 ? -46.938 28.624  11.116  1.00 46.29  ? 242 LEU B CB  1 
ATOM 3689  C CG  . LEU B 1 242 ? -46.073 28.763  9.880   1.00 49.93  ? 242 LEU B CG  1 
ATOM 3690  C CD1 . LEU B 1 242 ? -45.486 30.143  9.827   1.00 49.45  ? 242 LEU B CD1 1 
ATOM 3691  C CD2 . LEU B 1 242 ? -44.939 27.724  9.870   1.00 52.69  ? 242 LEU B CD2 1 
ATOM 3692  N N   . GLY B 1 243 ? -49.167 27.891  13.211  1.00 47.77  ? 243 GLY B N   1 
ATOM 3693  C CA  . GLY B 1 243 ? -49.605 27.915  14.604  1.00 46.54  ? 243 GLY B CA  1 
ATOM 3694  C C   . GLY B 1 243 ? -48.907 29.057  15.304  1.00 49.03  ? 243 GLY B C   1 
ATOM 3695  O O   . GLY B 1 243 ? -48.442 28.913  16.432  1.00 49.69  ? 243 GLY B O   1 
ATOM 3696  N N   . ILE B 1 244 ? -48.799 30.181  14.596  1.00 44.24  ? 244 ILE B N   1 
ATOM 3697  C CA  . ILE B 1 244 ? -48.114 31.407  14.965  1.00 44.03  ? 244 ILE B CA  1 
ATOM 3698  C C   . ILE B 1 244 ? -49.120 32.565  14.953  1.00 47.13  ? 244 ILE B C   1 
ATOM 3699  O O   . ILE B 1 244 ? -50.041 32.597  14.129  1.00 44.22  ? 244 ILE B O   1 
ATOM 3700  C CB  . ILE B 1 244 ? -46.955 31.597  13.918  1.00 48.57  ? 244 ILE B CB  1 
ATOM 3701  C CG1 . ILE B 1 244 ? -45.739 30.712  14.209  1.00 50.10  ? 244 ILE B CG1 1 
ATOM 3702  C CG2 . ILE B 1 244 ? -46.576 33.044  13.524  1.00 49.33  ? 244 ILE B CG2 1 
ATOM 3703  C CD1 . ILE B 1 244 ? -45.242 30.739  15.574  1.00 62.22  ? 244 ILE B CD1 1 
ATOM 3704  N N   . LYS B 1 245 ? -48.932 33.505  15.883  1.00 45.29  ? 245 LYS B N   1 
ATOM 3705  C CA  . LYS B 1 245 ? -49.665 34.761  15.959  1.00 45.77  ? 245 LYS B CA  1 
ATOM 3706  C C   . LYS B 1 245 ? -48.613 35.836  15.995  1.00 50.02  ? 245 LYS B C   1 
ATOM 3707  O O   . LYS B 1 245 ? -47.647 35.746  16.752  1.00 48.28  ? 245 LYS B O   1 
ATOM 3708  C CB  . LYS B 1 245 ? -50.646 34.840  17.137  1.00 47.88  ? 245 LYS B CB  1 
ATOM 3709  C CG  . LYS B 1 245 ? -52.099 34.594  16.722  1.00 54.02  ? 245 LYS B CG  1 
ATOM 3710  C CD  . LYS B 1 245 ? -53.110 35.025  17.797  1.00 70.22  ? 245 LYS B CD  1 
ATOM 3711  C CE  . LYS B 1 245 ? -53.644 33.868  18.619  1.00 84.62  ? 245 LYS B CE  1 
ATOM 3712  N NZ  . LYS B 1 245 ? -54.507 34.311  19.750  1.00 99.01  ? 245 LYS B NZ  1 
ATOM 3713  N N   . GLY B 1 246 ? -48.752 36.800  15.113  1.00 49.12  ? 246 GLY B N   1 
ATOM 3714  C CA  . GLY B 1 246 ? -47.774 37.868  15.037  1.00 49.91  ? 246 GLY B CA  1 
ATOM 3715  C C   . GLY B 1 246 ? -48.181 39.111  14.293  1.00 54.54  ? 246 GLY B C   1 
ATOM 3716  O O   . GLY B 1 246 ? -49.278 39.205  13.747  1.00 55.29  ? 246 GLY B O   1 
ATOM 3717  N N   . THR B 1 247 ? -47.267 40.066  14.280  1.00 51.42  ? 247 THR B N   1 
ATOM 3718  C CA  . THR B 1 247 ? -47.397 41.369  13.629  1.00 50.46  ? 247 THR B CA  1 
ATOM 3719  C C   . THR B 1 247 ? -46.262 41.519  12.617  1.00 48.78  ? 247 THR B C   1 
ATOM 3720  O O   . THR B 1 247 ? -45.371 40.671  12.526  1.00 47.72  ? 247 THR B O   1 
ATOM 3721  C CB  . THR B 1 247 ? -47.390 42.456  14.728  1.00 70.76  ? 247 THR B CB  1 
ATOM 3722  O OG1 . THR B 1 247 ? -48.571 42.264  15.496  1.00 79.93  ? 247 THR B OG1 1 
ATOM 3723  C CG2 . THR B 1 247 ? -47.394 43.898  14.203  1.00 74.42  ? 247 THR B CG2 1 
ATOM 3724  N N   . GLU B 1 248 ? -46.327 42.583  11.840  1.00 43.09  ? 248 GLU B N   1 
ATOM 3725  C CA  . GLU B 1 248 ? -45.313 42.966  10.893  1.00 41.85  ? 248 GLU B CA  1 
ATOM 3726  C C   . GLU B 1 248 ? -44.090 43.451  11.633  1.00 49.17  ? 248 GLU B C   1 
ATOM 3727  O O   . GLU B 1 248 ? -44.183 44.204  12.616  1.00 51.35  ? 248 GLU B O   1 
ATOM 3728  C CB  . GLU B 1 248 ? -45.823 44.073  9.965   1.00 42.23  ? 248 GLU B CB  1 
ATOM 3729  C CG  . GLU B 1 248 ? -46.793 43.613  8.893   1.00 45.57  ? 248 GLU B CG  1 
ATOM 3730  C CD  . GLU B 1 248 ? -46.223 42.774  7.767   1.00 58.05  ? 248 GLU B CD  1 
ATOM 3731  O OE1 . GLU B 1 248 ? -44.981 42.682  7.637   1.00 54.13  ? 248 GLU B OE1 1 
ATOM 3732  O OE2 . GLU B 1 248 ? -47.037 42.201  7.010   1.00 52.08  ? 248 GLU B OE2 1 
ATOM 3733  N N   . MET B 1 249 ? -42.941 42.995  11.170  1.00 44.94  ? 249 MET B N   1 
ATOM 3734  C CA  . MET B 1 249 ? -41.661 43.429  11.665  1.00 43.47  ? 249 MET B CA  1 
ATOM 3735  C C   . MET B 1 249 ? -41.472 44.861  11.125  1.00 49.50  ? 249 MET B C   1 
ATOM 3736  O O   . MET B 1 249 ? -41.842 45.142  9.975   1.00 50.48  ? 249 MET B O   1 
ATOM 3737  C CB  . MET B 1 249 ? -40.577 42.436  11.201  1.00 44.85  ? 249 MET B CB  1 
ATOM 3738  C CG  . MET B 1 249 ? -39.146 42.834  11.477  1.00 47.77  ? 249 MET B CG  1 
ATOM 3739  S SD  . MET B 1 249 ? -38.704 43.391  13.127  1.00 52.18  ? 249 MET B SD  1 
ATOM 3740  C CE  . MET B 1 249 ? -39.688 42.403  14.092  1.00 48.94  ? 249 MET B CE  1 
ATOM 3741  N N   . SER B 1 250 ? -40.978 45.771  11.974  1.00 45.23  ? 250 SER B N   1 
ATOM 3742  C CA  . SER B 1 250 ? -40.779 47.160  11.600  1.00 43.54  ? 250 SER B CA  1 
ATOM 3743  C C   . SER B 1 250 ? -39.366 47.618  11.891  1.00 41.98  ? 250 SER B C   1 
ATOM 3744  O O   . SER B 1 250 ? -38.630 46.953  12.611  1.00 41.72  ? 250 SER B O   1 
ATOM 3745  C CB  . SER B 1 250 ? -41.783 48.049  12.332  1.00 48.60  ? 250 SER B CB  1 
ATOM 3746  O OG  . SER B 1 250 ? -41.612 48.036  13.741  1.00 57.87  ? 250 SER B OG  1 
ATOM 3747  N N   . ALA B 1 251 ? -39.011 48.787  11.353  1.00 36.88  ? 251 ALA B N   1 
ATOM 3748  C CA  . ALA B 1 251 ? -37.733 49.468  11.568  1.00 35.94  ? 251 ALA B CA  1 
ATOM 3749  C C   . ALA B 1 251 ? -37.581 49.839  13.041  1.00 43.04  ? 251 ALA B C   1 
ATOM 3750  O O   . ALA B 1 251 ? -36.465 49.891  13.558  1.00 45.26  ? 251 ALA B O   1 
ATOM 3751  C CB  . ALA B 1 251 ? -37.660 50.712  10.692  1.00 34.97  ? 251 ALA B CB  1 
ATOM 3752  N N   . ASP B 1 252 ? -38.721 50.073  13.712  1.00 40.23  ? 252 ASP B N   1 
ATOM 3753  C CA  . ASP B 1 252 ? -38.831 50.456  15.123  1.00 40.21  ? 252 ASP B CA  1 
ATOM 3754  C C   . ASP B 1 252 ? -38.454 49.291  16.024  1.00 42.04  ? 252 ASP B C   1 
ATOM 3755  O O   . ASP B 1 252 ? -37.641 49.493  16.916  1.00 41.80  ? 252 ASP B O   1 
ATOM 3756  C CB  . ASP B 1 252 ? -40.238 50.976  15.419  1.00 43.18  ? 252 ASP B CB  1 
ATOM 3757  C CG  . ASP B 1 252 ? -40.692 52.023  14.403  1.00 63.56  ? 252 ASP B CG  1 
ATOM 3758  O OD1 . ASP B 1 252 ? -40.060 53.106  14.343  1.00 61.23  ? 252 ASP B OD1 1 
ATOM 3759  O OD2 . ASP B 1 252 ? -41.622 51.716  13.595  1.00 77.94  ? 252 ASP B OD2 1 
ATOM 3760  N N   . ILE B 1 253 ? -38.966 48.065  15.754  1.00 38.38  ? 253 ILE B N   1 
ATOM 3761  C CA  . ILE B 1 253 ? -38.572 46.867  16.496  1.00 38.87  ? 253 ILE B CA  1 
ATOM 3762  C C   . ILE B 1 253 ? -37.072 46.625  16.252  1.00 44.46  ? 253 ILE B C   1 
ATOM 3763  O O   . ILE B 1 253 ? -36.322 46.413  17.198  1.00 44.65  ? 253 ILE B O   1 
ATOM 3764  C CB  . ILE B 1 253 ? -39.407 45.608  16.123  1.00 42.27  ? 253 ILE B CB  1 
ATOM 3765  C CG1 . ILE B 1 253 ? -40.937 45.840  16.032  1.00 42.12  ? 253 ILE B CG1 1 
ATOM 3766  C CG2 . ILE B 1 253 ? -39.031 44.375  16.963  1.00 43.18  ? 253 ILE B CG2 1 
ATOM 3767  C CD1 . ILE B 1 253 ? -41.603 46.179  17.250  1.00 50.34  ? 253 ILE B CD1 1 
ATOM 3768  N N   . ALA B 1 254 ? -36.638 46.694  14.982  1.00 42.82  ? 254 ALA B N   1 
ATOM 3769  C CA  . ALA B 1 254 ? -35.245 46.495  14.583  1.00 42.79  ? 254 ALA B CA  1 
ATOM 3770  C C   . ALA B 1 254 ? -34.299 47.452  15.331  1.00 49.07  ? 254 ALA B C   1 
ATOM 3771  O O   . ALA B 1 254 ? -33.300 46.967  15.863  1.00 50.63  ? 254 ALA B O   1 
ATOM 3772  C CB  . ALA B 1 254 ? -35.101 46.671  13.087  1.00 43.14  ? 254 ALA B CB  1 
ATOM 3773  N N   . LYS B 1 255 ? -34.612 48.784  15.399  1.00 43.57  ? 255 LYS B N   1 
ATOM 3774  C CA  . LYS B 1 255 ? -33.791 49.774  16.107  1.00 43.98  ? 255 LYS B CA  1 
ATOM 3775  C C   . LYS B 1 255 ? -33.706 49.463  17.624  1.00 48.57  ? 255 LYS B C   1 
ATOM 3776  O O   . LYS B 1 255 ? -32.618 49.477  18.188  1.00 48.88  ? 255 LYS B O   1 
ATOM 3777  C CB  . LYS B 1 255 ? -34.317 51.202  15.893  1.00 46.28  ? 255 LYS B CB  1 
ATOM 3778  C CG  . LYS B 1 255 ? -33.450 52.040  14.956  1.00 60.46  ? 255 LYS B CG  1 
ATOM 3779  C CD  . LYS B 1 255 ? -34.261 53.173  14.323  1.00 79.31  ? 255 LYS B CD  1 
ATOM 3780  C CE  . LYS B 1 255 ? -33.979 53.371  12.845  1.00 97.38  ? 255 LYS B CE  1 
ATOM 3781  N NZ  . LYS B 1 255 ? -35.193 53.812  12.094  1.00 103.53 ? 255 LYS B NZ  1 
ATOM 3782  N N   . ALA B 1 256 ? -34.838 49.130  18.249  1.00 45.58  ? 256 ALA B N   1 
ATOM 3783  C CA  . ALA B 1 256 ? -34.948 48.779  19.662  1.00 46.03  ? 256 ALA B CA  1 
ATOM 3784  C C   . ALA B 1 256 ? -34.071 47.604  20.061  1.00 52.07  ? 256 ALA B C   1 
ATOM 3785  O O   . ALA B 1 256 ? -33.549 47.620  21.175  1.00 53.58  ? 256 ALA B O   1 
ATOM 3786  C CB  . ALA B 1 256 ? -36.386 48.459  20.000  1.00 46.72  ? 256 ALA B CB  1 
ATOM 3787  N N   . PHE B 1 257 ? -33.865 46.616  19.158  1.00 49.72  ? 257 PHE B N   1 
ATOM 3788  C CA  . PHE B 1 257 ? -33.066 45.407  19.442  1.00 49.95  ? 257 PHE B CA  1 
ATOM 3789  C C   . PHE B 1 257 ? -31.772 45.317  18.633  1.00 53.20  ? 257 PHE B C   1 
ATOM 3790  O O   . PHE B 1 257 ? -31.177 44.259  18.578  1.00 53.40  ? 257 PHE B O   1 
ATOM 3791  C CB  . PHE B 1 257 ? -33.920 44.155  19.238  1.00 51.96  ? 257 PHE B CB  1 
ATOM 3792  C CG  . PHE B 1 257 ? -35.182 44.178  20.074  1.00 54.46  ? 257 PHE B CG  1 
ATOM 3793  C CD1 . PHE B 1 257 ? -36.432 44.039  19.481  1.00 58.34  ? 257 PHE B CD1 1 
ATOM 3794  C CD2 . PHE B 1 257 ? -35.125 44.393  21.448  1.00 57.99  ? 257 PHE B CD2 1 
ATOM 3795  C CE1 . PHE B 1 257 ? -37.601 44.067  20.254  1.00 59.36  ? 257 PHE B CE1 1 
ATOM 3796  C CE2 . PHE B 1 257 ? -36.297 44.445  22.217  1.00 61.19  ? 257 PHE B CE2 1 
ATOM 3797  C CZ  . PHE B 1 257 ? -37.526 44.270  21.614  1.00 59.01  ? 257 PHE B CZ  1 
ATOM 3798  N N   . ASN B 1 258 ? -31.320 46.437  18.064  1.00 51.72  ? 258 ASN B N   1 
ATOM 3799  C CA  . ASN B 1 258 ? -30.088 46.593  17.280  1.00 53.30  ? 258 ASN B CA  1 
ATOM 3800  C C   . ASN B 1 258 ? -29.941 45.503  16.181  1.00 58.56  ? 258 ASN B C   1 
ATOM 3801  O O   . ASN B 1 258 ? -28.873 44.890  16.037  1.00 59.39  ? 258 ASN B O   1 
ATOM 3802  C CB  . ASN B 1 258 ? -28.853 46.627  18.204  1.00 56.84  ? 258 ASN B CB  1 
ATOM 3803  C CG  . ASN B 1 258 ? -27.849 47.665  17.771  1.00 92.69  ? 258 ASN B CG  1 
ATOM 3804  O OD1 . ASN B 1 258 ? -27.105 47.481  16.800  1.00 88.13  ? 258 ASN B OD1 1 
ATOM 3805  N ND2 . ASN B 1 258 ? -27.830 48.804  18.457  1.00 90.31  ? 258 ASN B ND2 1 
ATOM 3806  N N   . LEU B 1 259 ? -31.024 45.287  15.396  1.00 52.56  ? 259 LEU B N   1 
ATOM 3807  C CA  . LEU B 1 259 ? -31.081 44.278  14.337  1.00 49.77  ? 259 LEU B CA  1 
ATOM 3808  C C   . LEU B 1 259 ? -30.863 44.908  12.975  1.00 57.59  ? 259 LEU B C   1 
ATOM 3809  O O   . LEU B 1 259 ? -31.152 46.098  12.789  1.00 57.30  ? 259 LEU B O   1 
ATOM 3810  C CB  . LEU B 1 259 ? -32.420 43.539  14.381  1.00 48.39  ? 259 LEU B CB  1 
ATOM 3811  C CG  . LEU B 1 259 ? -32.832 42.941  15.734  1.00 51.17  ? 259 LEU B CG  1 
ATOM 3812  C CD1 . LEU B 1 259 ? -34.267 42.505  15.721  1.00 50.00  ? 259 LEU B CD1 1 
ATOM 3813  C CD2 . LEU B 1 259 ? -31.927 41.796  16.153  1.00 52.51  ? 259 LEU B CD2 1 
ATOM 3814  N N   . ASP B 1 260 ? -30.336 44.111  12.021  1.00 57.37  ? 260 ASP B N   1 
ATOM 3815  C CA  . ASP B 1 260 ? -30.036 44.550  10.654  1.00 58.44  ? 260 ASP B CA  1 
ATOM 3816  C C   . ASP B 1 260 ? -31.124 44.124  9.621   1.00 60.22  ? 260 ASP B C   1 
ATOM 3817  O O   . ASP B 1 260 ? -30.924 44.253  8.417   1.00 61.31  ? 260 ASP B O   1 
ATOM 3818  C CB  . ASP B 1 260 ? -28.643 44.055  10.232  1.00 61.91  ? 260 ASP B CB  1 
ATOM 3819  C CG  . ASP B 1 260 ? -27.540 44.913  10.829  1.00 88.92  ? 260 ASP B CG  1 
ATOM 3820  O OD1 . ASP B 1 260 ? -26.961 45.758  10.077  1.00 91.45  ? 260 ASP B OD1 1 
ATOM 3821  O OD2 . ASP B 1 260 ? -27.289 44.791  12.063  1.00 100.78 ? 260 ASP B OD2 1 
ATOM 3822  N N   . VAL B 1 261 ? -32.276 43.681  10.099  1.00 54.93  ? 261 VAL B N   1 
ATOM 3823  C CA  . VAL B 1 261 ? -33.424 43.295  9.279   1.00 54.20  ? 261 VAL B CA  1 
ATOM 3824  C C   . VAL B 1 261 ? -34.652 44.060  9.825   1.00 55.53  ? 261 VAL B C   1 
ATOM 3825  O O   . VAL B 1 261 ? -34.800 44.199  11.032  1.00 55.00  ? 261 VAL B O   1 
ATOM 3826  C CB  . VAL B 1 261 ? -33.625 41.742  9.231   1.00 58.13  ? 261 VAL B CB  1 
ATOM 3827  C CG1 . VAL B 1 261 ? -33.924 41.159  10.614  1.00 57.98  ? 261 VAL B CG1 1 
ATOM 3828  C CG2 . VAL B 1 261 ? -34.709 41.343  8.226   1.00 57.68  ? 261 VAL B CG2 1 
ATOM 3829  N N   . GLN B 1 262 ? -35.504 44.583  8.943   1.00 50.20  ? 262 GLN B N   1 
ATOM 3830  C CA  . GLN B 1 262 ? -36.674 45.364  9.376   1.00 48.44  ? 262 GLN B CA  1 
ATOM 3831  C C   . GLN B 1 262 ? -37.948 44.882  8.709   1.00 46.77  ? 262 GLN B C   1 
ATOM 3832  O O   . GLN B 1 262 ? -39.003 45.456  8.928   1.00 46.57  ? 262 GLN B O   1 
ATOM 3833  C CB  . GLN B 1 262 ? -36.487 46.890  9.151   1.00 49.99  ? 262 GLN B CB  1 
ATOM 3834  C CG  . GLN B 1 262 ? -35.469 47.312  8.081   1.00 60.07  ? 262 GLN B CG  1 
ATOM 3835  C CD  . GLN B 1 262 ? -34.024 47.221  8.503   1.00 67.51  ? 262 GLN B CD  1 
ATOM 3836  O OE1 . GLN B 1 262 ? -33.187 46.723  7.759   1.00 70.91  ? 262 GLN B OE1 1 
ATOM 3837  N NE2 . GLN B 1 262 ? -33.681 47.739  9.671   1.00 47.71  ? 262 GLN B NE2 1 
ATOM 3838  N N   . ARG B 1 263 ? -37.861 43.800  7.934   1.00 40.54  ? 263 ARG B N   1 
ATOM 3839  C CA  . ARG B 1 263 ? -39.002 43.208  7.236   1.00 38.76  ? 263 ARG B CA  1 
ATOM 3840  C C   . ARG B 1 263 ? -39.116 41.726  7.619   1.00 41.95  ? 263 ARG B C   1 
ATOM 3841  O O   . ARG B 1 263 ? -38.114 41.023  7.736   1.00 41.12  ? 263 ARG B O   1 
ATOM 3842  C CB  . ARG B 1 263 ? -38.872 43.384  5.710   1.00 35.66  ? 263 ARG B CB  1 
ATOM 3843  C CG  . ARG B 1 263 ? -38.823 44.837  5.279   1.00 45.00  ? 263 ARG B CG  1 
ATOM 3844  C CD  . ARG B 1 263 ? -39.200 45.043  3.846   1.00 63.53  ? 263 ARG B CD  1 
ATOM 3845  N NE  . ARG B 1 263 ? -38.208 44.485  2.940   1.00 79.53  ? 263 ARG B NE  1 
ATOM 3846  C CZ  . ARG B 1 263 ? -38.146 44.789  1.650   1.00 98.49  ? 263 ARG B CZ  1 
ATOM 3847  N NH1 . ARG B 1 263 ? -39.011 45.648  1.119   1.00 81.59  ? 263 ARG B NH1 1 
ATOM 3848  N NH2 . ARG B 1 263 ? -37.209 44.248  0.881   1.00 87.22  ? 263 ARG B NH2 1 
ATOM 3849  N N   . GLY B 1 264 ? -40.344 41.280  7.828   1.00 38.31  ? 264 GLY B N   1 
ATOM 3850  C CA  . GLY B 1 264 ? -40.614 39.908  8.226   1.00 37.90  ? 264 GLY B CA  1 
ATOM 3851  C C   . GLY B 1 264 ? -41.766 39.803  9.195   1.00 41.49  ? 264 GLY B C   1 
ATOM 3852  O O   . GLY B 1 264 ? -42.611 40.708  9.279   1.00 39.06  ? 264 GLY B O   1 
ATOM 3853  N N   . ALA B 1 265 ? -41.777 38.697  9.963   1.00 39.86  ? 265 ALA B N   1 
ATOM 3854  C CA  . ALA B 1 265 ? -42.818 38.447  10.952  1.00 40.04  ? 265 ALA B CA  1 
ATOM 3855  C C   . ALA B 1 265 ? -42.282 38.509  12.380  1.00 45.09  ? 265 ALA B C   1 
ATOM 3856  O O   . ALA B 1 265 ? -41.295 37.857  12.709  1.00 45.32  ? 265 ALA B O   1 
ATOM 3857  C CB  . ALA B 1 265 ? -43.469 37.103  10.698  1.00 39.79  ? 265 ALA B CB  1 
ATOM 3858  N N   . PHE B 1 266 ? -42.949 39.290  13.222  1.00 41.87  ? 266 PHE B N   1 
ATOM 3859  C CA  . PHE B 1 266 ? -42.623 39.367  14.637  1.00 41.98  ? 266 PHE B CA  1 
ATOM 3860  C C   . PHE B 1 266 ? -43.580 38.421  15.348  1.00 44.69  ? 266 PHE B C   1 
ATOM 3861  O O   . PHE B 1 266 ? -44.785 38.624  15.259  1.00 43.64  ? 266 PHE B O   1 
ATOM 3862  C CB  . PHE B 1 266 ? -42.728 40.809  15.136  1.00 44.41  ? 266 PHE B CB  1 
ATOM 3863  C CG  . PHE B 1 266 ? -42.429 40.952  16.602  1.00 47.84  ? 266 PHE B CG  1 
ATOM 3864  C CD1 . PHE B 1 266 ? -43.454 41.166  17.517  1.00 52.72  ? 266 PHE B CD1 1 
ATOM 3865  C CD2 . PHE B 1 266 ? -41.127 40.822  17.083  1.00 50.47  ? 266 PHE B CD2 1 
ATOM 3866  C CE1 . PHE B 1 266 ? -43.174 41.263  18.882  1.00 54.16  ? 266 PHE B CE1 1 
ATOM 3867  C CE2 . PHE B 1 266 ? -40.852 40.918  18.447  1.00 52.96  ? 266 PHE B CE2 1 
ATOM 3868  C CZ  . PHE B 1 266 ? -41.872 41.133  19.337  1.00 51.72  ? 266 PHE B CZ  1 
ATOM 3869  N N   . VAL B 1 267 ? -43.063 37.344  15.968  1.00 42.32  ? 267 VAL B N   1 
ATOM 3870  C CA  . VAL B 1 267 ? -43.901 36.338  16.629  1.00 42.27  ? 267 VAL B CA  1 
ATOM 3871  C C   . VAL B 1 267 ? -44.248 36.791  18.030  1.00 45.13  ? 267 VAL B C   1 
ATOM 3872  O O   . VAL B 1 267 ? -43.361 37.051  18.827  1.00 43.28  ? 267 VAL B O   1 
ATOM 3873  C CB  . VAL B 1 267 ? -43.257 34.924  16.643  1.00 45.68  ? 267 VAL B CB  1 
ATOM 3874  C CG1 . VAL B 1 267 ? -44.200 33.888  17.254  1.00 44.47  ? 267 VAL B CG1 1 
ATOM 3875  C CG2 . VAL B 1 267 ? -42.844 34.503  15.241  1.00 45.97  ? 267 VAL B CG2 1 
ATOM 3876  N N   . SER B 1 268 ? -45.540 36.870  18.323  1.00 43.70  ? 268 SER B N   1 
ATOM 3877  C CA  . SER B 1 268 ? -46.024 37.261  19.639  1.00 44.89  ? 268 SER B CA  1 
ATOM 3878  C C   . SER B 1 268 ? -46.542 36.033  20.408  1.00 50.80  ? 268 SER B C   1 
ATOM 3879  O O   . SER B 1 268 ? -46.524 36.020  21.633  1.00 52.32  ? 268 SER B O   1 
ATOM 3880  C CB  . SER B 1 268 ? -47.121 38.328  19.510  1.00 49.03  ? 268 SER B CB  1 
ATOM 3881  O OG  . SER B 1 268 ? -48.291 37.874  18.840  1.00 60.12  ? 268 SER B OG  1 
ATOM 3882  N N   . GLU B 1 269 ? -47.014 35.016  19.694  1.00 47.41  ? 269 GLU B N   1 
ATOM 3883  C CA  . GLU B 1 269 ? -47.607 33.837  20.312  1.00 47.34  ? 269 GLU B CA  1 
ATOM 3884  C C   . GLU B 1 269 ? -47.417 32.592  19.447  1.00 50.46  ? 269 GLU B C   1 
ATOM 3885  O O   . GLU B 1 269 ? -47.658 32.631  18.245  1.00 50.02  ? 269 GLU B O   1 
ATOM 3886  C CB  . GLU B 1 269 ? -49.110 34.106  20.513  1.00 48.44  ? 269 GLU B CB  1 
ATOM 3887  C CG  . GLU B 1 269 ? -49.847 33.144  21.423  1.00 58.12  ? 269 GLU B CG  1 
ATOM 3888  C CD  . GLU B 1 269 ? -51.323 33.463  21.610  1.00 83.76  ? 269 GLU B CD  1 
ATOM 3889  O OE1 . GLU B 1 269 ? -52.118 32.501  21.717  1.00 106.07 ? 269 GLU B OE1 1 
ATOM 3890  O OE2 . GLU B 1 269 ? -51.694 34.661  21.622  1.00 53.36  ? 269 GLU B OE2 1 
ATOM 3891  N N   . VAL B 1 270 ? -47.011 31.492  20.074  1.00 46.95  ? 270 VAL B N   1 
ATOM 3892  C CA  . VAL B 1 270 ? -46.853 30.180  19.437  1.00 47.06  ? 270 VAL B CA  1 
ATOM 3893  C C   . VAL B 1 270 ? -47.936 29.274  20.052  1.00 51.76  ? 270 VAL B C   1 
ATOM 3894  O O   . VAL B 1 270 ? -47.956 29.081  21.267  1.00 51.40  ? 270 VAL B O   1 
ATOM 3895  C CB  . VAL B 1 270 ? -45.410 29.596  19.565  1.00 50.27  ? 270 VAL B CB  1 
ATOM 3896  C CG1 . VAL B 1 270 ? -45.256 28.319  18.749  1.00 49.80  ? 270 VAL B CG1 1 
ATOM 3897  C CG2 . VAL B 1 270 ? -44.360 30.620  19.136  1.00 49.62  ? 270 VAL B CG2 1 
ATOM 3898  N N   . LEU B 1 271 ? -48.880 28.812  19.233  1.00 49.68  ? 271 LEU B N   1 
ATOM 3899  C CA  . LEU B 1 271 ? -50.001 28.018  19.722  1.00 52.16  ? 271 LEU B CA  1 
ATOM 3900  C C   . LEU B 1 271 ? -49.527 26.638  20.188  1.00 59.01  ? 271 LEU B C   1 
ATOM 3901  O O   . LEU B 1 271 ? -48.717 26.016  19.511  1.00 60.15  ? 271 LEU B O   1 
ATOM 3902  C CB  . LEU B 1 271 ? -51.127 27.917  18.675  1.00 53.24  ? 271 LEU B CB  1 
ATOM 3903  C CG  . LEU B 1 271 ? -51.616 29.290  18.113  1.00 60.62  ? 271 LEU B CG  1 
ATOM 3904  C CD1 . LEU B 1 271 ? -52.519 29.106  16.910  1.00 62.15  ? 271 LEU B CD1 1 
ATOM 3905  C CD2 . LEU B 1 271 ? -52.305 30.161  19.191  1.00 60.74  ? 271 LEU B CD2 1 
ATOM 3906  N N   . PRO B 1 272 ? -49.941 26.176  21.388  1.00 56.89  ? 272 PRO B N   1 
ATOM 3907  C CA  . PRO B 1 272 ? -49.436 24.878  21.888  1.00 56.11  ? 272 PRO B CA  1 
ATOM 3908  C C   . PRO B 1 272 ? -50.010 23.706  21.101  1.00 56.56  ? 272 PRO B C   1 
ATOM 3909  O O   . PRO B 1 272 ? -51.198 23.705  20.769  1.00 53.59  ? 272 PRO B O   1 
ATOM 3910  C CB  . PRO B 1 272 ? -49.882 24.851  23.366  1.00 58.02  ? 272 PRO B CB  1 
ATOM 3911  C CG  . PRO B 1 272 ? -50.377 26.257  23.674  1.00 62.76  ? 272 PRO B CG  1 
ATOM 3912  C CD  . PRO B 1 272 ? -50.863 26.801  22.362  1.00 58.96  ? 272 PRO B CD  1 
ATOM 3913  N N   . GLY B 1 273 ? -49.133 22.755  20.772  1.00 52.65  ? 273 GLY B N   1 
ATOM 3914  C CA  . GLY B 1 273 ? -49.486 21.567  20.007  1.00 52.35  ? 273 GLY B CA  1 
ATOM 3915  C C   . GLY B 1 273 ? -49.352 21.739  18.509  1.00 56.54  ? 273 GLY B C   1 
ATOM 3916  O O   . GLY B 1 273 ? -49.587 20.795  17.745  1.00 56.76  ? 273 GLY B O   1 
ATOM 3917  N N   . SER B 1 274 ? -48.972 22.954  18.082  1.00 52.23  ? 274 SER B N   1 
ATOM 3918  C CA  . SER B 1 274 ? -48.780 23.288  16.677  1.00 50.68  ? 274 SER B CA  1 
ATOM 3919  C C   . SER B 1 274 ? -47.399 22.836  16.215  1.00 52.49  ? 274 SER B C   1 
ATOM 3920  O O   . SER B 1 274 ? -46.523 22.576  17.059  1.00 51.12  ? 274 SER B O   1 
ATOM 3921  C CB  . SER B 1 274 ? -48.946 24.786  16.459  1.00 51.76  ? 274 SER B CB  1 
ATOM 3922  O OG  . SER B 1 274 ? -47.878 25.484  17.073  1.00 53.96  ? 274 SER B OG  1 
ATOM 3923  N N   . GLY B 1 275 ? -47.213 22.784  14.885  1.00 46.78  ? 275 GLY B N   1 
ATOM 3924  C CA  . GLY B 1 275 ? -45.959 22.407  14.258  1.00 44.70  ? 275 GLY B CA  1 
ATOM 3925  C C   . GLY B 1 275 ? -44.839 23.329  14.679  1.00 49.79  ? 275 GLY B C   1 
ATOM 3926  O O   . GLY B 1 275 ? -43.702 22.875  14.857  1.00 49.88  ? 275 GLY B O   1 
ATOM 3927  N N   . SER B 1 276 ? -45.169 24.639  14.873  1.00 46.01  ? 276 SER B N   1 
ATOM 3928  C CA  . SER B 1 276 ? -44.225 25.680  15.301  1.00 45.01  ? 276 SER B CA  1 
ATOM 3929  C C   . SER B 1 276 ? -43.766 25.478  16.742  1.00 46.81  ? 276 SER B C   1 
ATOM 3930  O O   . SER B 1 276 ? -42.586 25.695  17.021  1.00 47.48  ? 276 SER B O   1 
ATOM 3931  C CB  . SER B 1 276 ? -44.831 27.067  15.129  1.00 47.84  ? 276 SER B CB  1 
ATOM 3932  O OG  . SER B 1 276 ? -44.974 27.415  13.761  1.00 52.72  ? 276 SER B OG  1 
ATOM 3933  N N   . ALA B 1 277 ? -44.675 25.094  17.656  1.00 42.70  ? 277 ALA B N   1 
ATOM 3934  C CA  . ALA B 1 277 ? -44.320 24.759  19.051  1.00 42.89  ? 277 ALA B CA  1 
ATOM 3935  C C   . ALA B 1 277 ? -43.382 23.510  19.056  1.00 47.71  ? 277 ALA B C   1 
ATOM 3936  O O   . ALA B 1 277 ? -42.283 23.587  19.609  1.00 46.35  ? 277 ALA B O   1 
ATOM 3937  C CB  . ALA B 1 277 ? -45.582 24.496  19.875  1.00 43.22  ? 277 ALA B CB  1 
ATOM 3938  N N   . LYS B 1 278 ? -43.763 22.420  18.314  1.00 44.32  ? 278 LYS B N   1 
ATOM 3939  C CA  . LYS B 1 278 ? -42.975 21.180  18.197  1.00 44.60  ? 278 LYS B CA  1 
ATOM 3940  C C   . LYS B 1 278 ? -41.587 21.430  17.633  1.00 49.71  ? 278 LYS B C   1 
ATOM 3941  O O   . LYS B 1 278 ? -40.628 20.832  18.106  1.00 50.94  ? 278 LYS B O   1 
ATOM 3942  C CB  . LYS B 1 278 ? -43.703 20.125  17.350  1.00 46.92  ? 278 LYS B CB  1 
ATOM 3943  C CG  . LYS B 1 278 ? -44.951 19.550  18.028  1.00 56.28  ? 278 LYS B CG  1 
ATOM 3944  C CD  . LYS B 1 278 ? -45.914 18.990  16.996  1.00 71.60  ? 278 LYS B CD  1 
ATOM 3945  C CE  . LYS B 1 278 ? -47.152 18.407  17.630  1.00 86.34  ? 278 LYS B CE  1 
ATOM 3946  N NZ  . LYS B 1 278 ? -48.146 17.999  16.598  1.00 97.84  ? 278 LYS B NZ  1 
ATOM 3947  N N   . ALA B 1 279 ? -41.470 22.340  16.667  1.00 46.29  ? 279 ALA B N   1 
ATOM 3948  C CA  . ALA B 1 279 ? -40.201 22.701  16.017  1.00 44.41  ? 279 ALA B CA  1 
ATOM 3949  C C   . ALA B 1 279 ? -39.329 23.602  16.883  1.00 48.89  ? 279 ALA B C   1 
ATOM 3950  O O   . ALA B 1 279 ? -38.152 23.760  16.567  1.00 48.88  ? 279 ALA B O   1 
ATOM 3951  C CB  . ALA B 1 279 ? -40.482 23.392  14.698  1.00 44.46  ? 279 ALA B CB  1 
ATOM 3952  N N   . GLY B 1 280 ? -39.904 24.214  17.927  1.00 45.99  ? 280 GLY B N   1 
ATOM 3953  C CA  . GLY B 1 280 ? -39.171 25.100  18.830  1.00 45.55  ? 280 GLY B CA  1 
ATOM 3954  C C   . GLY B 1 280 ? -39.223 26.584  18.513  1.00 50.32  ? 280 GLY B C   1 
ATOM 3955  O O   . GLY B 1 280 ? -38.297 27.323  18.892  1.00 49.11  ? 280 GLY B O   1 
ATOM 3956  N N   . VAL B 1 281 ? -40.306 27.043  17.800  1.00 45.74  ? 281 VAL B N   1 
ATOM 3957  C CA  . VAL B 1 281 ? -40.494 28.472  17.524  1.00 44.69  ? 281 VAL B CA  1 
ATOM 3958  C C   . VAL B 1 281 ? -40.951 29.124  18.841  1.00 46.97  ? 281 VAL B C   1 
ATOM 3959  O O   . VAL B 1 281 ? -41.762 28.548  19.570  1.00 46.00  ? 281 VAL B O   1 
ATOM 3960  C CB  . VAL B 1 281 ? -41.440 28.804  16.344  1.00 48.66  ? 281 VAL B CB  1 
ATOM 3961  C CG1 . VAL B 1 281 ? -41.406 30.298  16.035  1.00 48.05  ? 281 VAL B CG1 1 
ATOM 3962  C CG2 . VAL B 1 281 ? -41.080 28.004  15.087  1.00 48.92  ? 281 VAL B CG2 1 
ATOM 3963  N N   . LYS B 1 282 ? -40.387 30.282  19.175  1.00 43.67  ? 282 LYS B N   1 
ATOM 3964  C CA  . LYS B 1 282 ? -40.711 30.945  20.431  1.00 44.18  ? 282 LYS B CA  1 
ATOM 3965  C C   . LYS B 1 282 ? -41.191 32.373  20.214  1.00 47.11  ? 282 LYS B C   1 
ATOM 3966  O O   . LYS B 1 282 ? -40.746 33.044  19.278  1.00 45.01  ? 282 LYS B O   1 
ATOM 3967  C CB  . LYS B 1 282 ? -39.475 30.938  21.370  1.00 47.16  ? 282 LYS B CB  1 
ATOM 3968  C CG  . LYS B 1 282 ? -39.074 29.535  21.840  1.00 59.22  ? 282 LYS B CG  1 
ATOM 3969  C CD  . LYS B 1 282 ? -37.896 29.583  22.792  1.00 74.00  ? 282 LYS B CD  1 
ATOM 3970  C CE  . LYS B 1 282 ? -37.738 28.301  23.566  1.00 87.62  ? 282 LYS B CE  1 
ATOM 3971  N NZ  . LYS B 1 282 ? -36.473 28.290  24.361  1.00 88.63  ? 282 LYS B NZ  1 
ATOM 3972  N N   . ALA B 1 283 ? -42.088 32.849  21.107  1.00 42.74  ? 283 ALA B N   1 
ATOM 3973  C CA  . ALA B 1 283 ? -42.578 34.231  21.075  1.00 40.23  ? 283 ALA B CA  1 
ATOM 3974  C C   . ALA B 1 283 ? -41.373 35.182  21.200  1.00 44.13  ? 283 ALA B C   1 
ATOM 3975  O O   . ALA B 1 283 ? -40.441 34.908  21.967  1.00 42.81  ? 283 ALA B O   1 
ATOM 3976  C CB  . ALA B 1 283 ? -43.571 34.459  22.195  1.00 39.83  ? 283 ALA B CB  1 
ATOM 3977  N N   . GLY B 1 284 ? -41.367 36.233  20.378  1.00 40.40  ? 284 GLY B N   1 
ATOM 3978  C CA  . GLY B 1 284 ? -40.289 37.213  20.312  1.00 38.56  ? 284 GLY B CA  1 
ATOM 3979  C C   . GLY B 1 284 ? -39.357 36.961  19.146  1.00 42.90  ? 284 GLY B C   1 
ATOM 3980  O O   . GLY B 1 284 ? -38.463 37.766  18.873  1.00 44.10  ? 284 GLY B O   1 
ATOM 3981  N N   . ASP B 1 285 ? -39.521 35.825  18.468  1.00 40.77  ? 285 ASP B N   1 
ATOM 3982  C CA  . ASP B 1 285 ? -38.701 35.481  17.304  1.00 41.18  ? 285 ASP B CA  1 
ATOM 3983  C C   . ASP B 1 285 ? -39.108 36.341  16.120  1.00 43.07  ? 285 ASP B C   1 
ATOM 3984  O O   . ASP B 1 285 ? -40.255 36.808  16.036  1.00 39.99  ? 285 ASP B O   1 
ATOM 3985  C CB  . ASP B 1 285 ? -38.816 33.978  16.917  1.00 43.73  ? 285 ASP B CB  1 
ATOM 3986  C CG  . ASP B 1 285 ? -38.215 32.964  17.883  1.00 61.41  ? 285 ASP B CG  1 
ATOM 3987  O OD1 . ASP B 1 285 ? -37.594 33.384  18.877  1.00 65.94  ? 285 ASP B OD1 1 
ATOM 3988  O OD2 . ASP B 1 285 ? -38.450 31.753  17.691  1.00 65.33  ? 285 ASP B OD2 1 
ATOM 3989  N N   . ILE B 1 286 ? -38.154 36.549  15.206  1.00 40.33  ? 286 ILE B N   1 
ATOM 3990  C CA  . ILE B 1 286 ? -38.404 37.303  13.995  1.00 40.15  ? 286 ILE B CA  1 
ATOM 3991  C C   . ILE B 1 286 ? -38.171 36.365  12.817  1.00 42.95  ? 286 ILE B C   1 
ATOM 3992  O O   . ILE B 1 286 ? -37.019 36.001  12.536  1.00 45.51  ? 286 ILE B O   1 
ATOM 3993  C CB  . ILE B 1 286 ? -37.571 38.615  13.952  1.00 43.44  ? 286 ILE B CB  1 
ATOM 3994  C CG1 . ILE B 1 286 ? -38.024 39.528  15.128  1.00 44.03  ? 286 ILE B CG1 1 
ATOM 3995  C CG2 . ILE B 1 286 ? -37.748 39.339  12.595  1.00 43.60  ? 286 ILE B CG2 1 
ATOM 3996  C CD1 . ILE B 1 286 ? -37.018 40.290  15.687  1.00 45.03  ? 286 ILE B CD1 1 
ATOM 3997  N N   . ILE B 1 287 ? -39.268 35.938  12.164  1.00 35.07  ? 287 ILE B N   1 
ATOM 3998  C CA  . ILE B 1 287 ? -39.184 35.091  10.983  1.00 35.88  ? 287 ILE B CA  1 
ATOM 3999  C C   . ILE B 1 287 ? -38.736 35.985  9.811   1.00 42.89  ? 287 ILE B C   1 
ATOM 4000  O O   . ILE B 1 287 ? -39.422 36.936  9.435   1.00 43.70  ? 287 ILE B O   1 
ATOM 4001  C CB  . ILE B 1 287 ? -40.469 34.274  10.686  1.00 38.53  ? 287 ILE B CB  1 
ATOM 4002  C CG1 . ILE B 1 287 ? -40.919 33.491  11.945  1.00 37.58  ? 287 ILE B CG1 1 
ATOM 4003  C CG2 . ILE B 1 287 ? -40.228 33.315  9.490   1.00 37.35  ? 287 ILE B CG2 1 
ATOM 4004  C CD1 . ILE B 1 287 ? -42.348 32.993  11.855  1.00 43.65  ? 287 ILE B CD1 1 
ATOM 4005  N N   . THR B 1 288 ? -37.550 35.691  9.295   1.00 40.80  ? 288 THR B N   1 
ATOM 4006  C CA  . THR B 1 288 ? -36.838 36.424  8.257   1.00 41.14  ? 288 THR B CA  1 
ATOM 4007  C C   . THR B 1 288 ? -36.972 35.733  6.890   1.00 44.32  ? 288 THR B C   1 
ATOM 4008  O O   . THR B 1 288 ? -36.966 36.408  5.862   1.00 44.75  ? 288 THR B O   1 
ATOM 4009  C CB  . THR B 1 288 ? -35.350 36.504  8.720   1.00 50.90  ? 288 THR B CB  1 
ATOM 4010  O OG1 . THR B 1 288 ? -35.274 37.393  9.823   1.00 53.87  ? 288 THR B OG1 1 
ATOM 4011  C CG2 . THR B 1 288 ? -34.412 36.996  7.653   1.00 56.01  ? 288 THR B CG2 1 
ATOM 4012  N N   . SER B 1 289 ? -37.019 34.397  6.883   1.00 38.40  ? 289 SER B N   1 
ATOM 4013  C CA  . SER B 1 289 ? -37.023 33.595  5.677   1.00 37.27  ? 289 SER B CA  1 
ATOM 4014  C C   . SER B 1 289 ? -38.013 32.469  5.720   1.00 39.39  ? 289 SER B C   1 
ATOM 4015  O O   . SER B 1 289 ? -38.359 31.953  6.794   1.00 36.22  ? 289 SER B O   1 
ATOM 4016  C CB  . SER B 1 289 ? -35.642 32.973  5.457   1.00 40.62  ? 289 SER B CB  1 
ATOM 4017  O OG  . SER B 1 289 ? -34.677 33.981  5.227   1.00 67.22  ? 289 SER B OG  1 
ATOM 4018  N N   . LEU B 1 290 ? -38.384 32.028  4.512   1.00 35.55  ? 290 LEU B N   1 
ATOM 4019  C CA  . LEU B 1 290 ? -39.176 30.853  4.278   1.00 35.57  ? 290 LEU B CA  1 
ATOM 4020  C C   . LEU B 1 290 ? -38.476 30.102  3.161   1.00 44.47  ? 290 LEU B C   1 
ATOM 4021  O O   . LEU B 1 290 ? -38.283 30.657  2.072   1.00 46.70  ? 290 LEU B O   1 
ATOM 4022  C CB  . LEU B 1 290 ? -40.637 31.200  3.958   1.00 34.93  ? 290 LEU B CB  1 
ATOM 4023  C CG  . LEU B 1 290 ? -41.559 30.025  3.651   1.00 40.34  ? 290 LEU B CG  1 
ATOM 4024  C CD1 . LEU B 1 290 ? -41.671 29.065  4.841   1.00 39.65  ? 290 LEU B CD1 1 
ATOM 4025  C CD2 . LEU B 1 290 ? -42.943 30.535  3.230   1.00 43.84  ? 290 LEU B CD2 1 
ATOM 4026  N N   . ASN B 1 291 ? -38.021 28.875  3.460   1.00 42.18  ? 291 ASN B N   1 
ATOM 4027  C CA  . ASN B 1 291 ? -37.309 27.972  2.546   1.00 42.57  ? 291 ASN B CA  1 
ATOM 4028  C C   . ASN B 1 291 ? -36.115 28.692  1.878   1.00 46.83  ? 291 ASN B C   1 
ATOM 4029  O O   . ASN B 1 291 ? -35.941 28.624  0.670   1.00 46.87  ? 291 ASN B O   1 
ATOM 4030  C CB  . ASN B 1 291 ? -38.285 27.373  1.503   1.00 42.19  ? 291 ASN B CB  1 
ATOM 4031  C CG  . ASN B 1 291 ? -39.363 26.494  2.104   1.00 49.07  ? 291 ASN B CG  1 
ATOM 4032  O OD1 . ASN B 1 291 ? -39.190 25.840  3.131   1.00 40.93  ? 291 ASN B OD1 1 
ATOM 4033  N ND2 . ASN B 1 291 ? -40.512 26.466  1.491   1.00 46.13  ? 291 ASN B ND2 1 
ATOM 4034  N N   . GLY B 1 292 ? -35.346 29.420  2.689   1.00 43.14  ? 292 GLY B N   1 
ATOM 4035  C CA  . GLY B 1 292 ? -34.162 30.157  2.267   1.00 41.88  ? 292 GLY B CA  1 
ATOM 4036  C C   . GLY B 1 292 ? -34.413 31.485  1.602   1.00 47.43  ? 292 GLY B C   1 
ATOM 4037  O O   . GLY B 1 292 ? -33.468 32.252  1.417   1.00 50.51  ? 292 GLY B O   1 
ATOM 4038  N N   . LYS B 1 293 ? -35.670 31.785  1.239   1.00 42.39  ? 293 LYS B N   1 
ATOM 4039  C CA  . LYS B 1 293 ? -35.996 33.039  0.570   1.00 40.70  ? 293 LYS B CA  1 
ATOM 4040  C C   . LYS B 1 293 ? -36.438 34.088  1.589   1.00 45.15  ? 293 LYS B C   1 
ATOM 4041  O O   . LYS B 1 293 ? -37.377 33.837  2.349   1.00 45.87  ? 293 LYS B O   1 
ATOM 4042  C CB  . LYS B 1 293 ? -37.077 32.824  -0.501  1.00 40.93  ? 293 LYS B CB  1 
ATOM 4043  C CG  . LYS B 1 293 ? -37.218 34.017  -1.455  1.00 37.19  ? 293 LYS B CG  1 
ATOM 4044  C CD  . LYS B 1 293 ? -38.415 33.837  -2.398  1.00 44.94  ? 293 LYS B CD  1 
ATOM 4045  C CE  . LYS B 1 293 ? -38.799 35.105  -3.118  1.00 45.52  ? 293 LYS B CE  1 
ATOM 4046  N NZ  . LYS B 1 293 ? -37.788 35.517  -4.118  1.00 56.53  ? 293 LYS B NZ  1 
ATOM 4047  N N   . PRO B 1 294 ? -35.795 35.284  1.601   1.00 40.92  ? 294 PRO B N   1 
ATOM 4048  C CA  . PRO B 1 294 ? -36.217 36.347  2.549   1.00 39.42  ? 294 PRO B CA  1 
ATOM 4049  C C   . PRO B 1 294 ? -37.671 36.792  2.371   1.00 42.19  ? 294 PRO B C   1 
ATOM 4050  O O   . PRO B 1 294 ? -38.163 36.897  1.255   1.00 43.97  ? 294 PRO B O   1 
ATOM 4051  C CB  . PRO B 1 294 ? -35.256 37.513  2.248   1.00 40.07  ? 294 PRO B CB  1 
ATOM 4052  C CG  . PRO B 1 294 ? -34.098 36.882  1.567   1.00 44.57  ? 294 PRO B CG  1 
ATOM 4053  C CD  . PRO B 1 294 ? -34.640 35.726  0.784   1.00 41.00  ? 294 PRO B CD  1 
ATOM 4054  N N   . LEU B 1 295 ? -38.339 37.068  3.489   1.00 37.37  ? 295 LEU B N   1 
ATOM 4055  C CA  . LEU B 1 295 ? -39.714 37.556  3.543   1.00 36.96  ? 295 LEU B CA  1 
ATOM 4056  C C   . LEU B 1 295 ? -39.742 39.071  3.583   1.00 42.25  ? 295 LEU B C   1 
ATOM 4057  O O   . LEU B 1 295 ? -39.034 39.657  4.407   1.00 41.34  ? 295 LEU B O   1 
ATOM 4058  C CB  . LEU B 1 295 ? -40.433 37.007  4.793   1.00 36.60  ? 295 LEU B CB  1 
ATOM 4059  C CG  . LEU B 1 295 ? -40.743 35.533  4.824   1.00 40.72  ? 295 LEU B CG  1 
ATOM 4060  C CD1 . LEU B 1 295 ? -41.002 35.099  6.230   1.00 40.72  ? 295 LEU B CD1 1 
ATOM 4061  C CD2 . LEU B 1 295 ? -41.934 35.183  3.912   1.00 39.62  ? 295 LEU B CD2 1 
ATOM 4062  N N   . ASN B 1 296 ? -40.573 39.714  2.733   1.00 40.99  ? 296 ASN B N   1 
ATOM 4063  C CA  . ASN B 1 296 ? -40.637 41.172  2.770   1.00 42.69  ? 296 ASN B CA  1 
ATOM 4064  C C   . ASN B 1 296 ? -41.764 41.630  3.730   1.00 47.49  ? 296 ASN B C   1 
ATOM 4065  O O   . ASN B 1 296 ? -41.846 42.828  4.069   1.00 46.19  ? 296 ASN B O   1 
ATOM 4066  C CB  . ASN B 1 296 ? -40.740 41.814  1.374   1.00 49.00  ? 296 ASN B CB  1 
ATOM 4067  C CG  . ASN B 1 296 ? -41.858 41.344  0.479   1.00 94.19  ? 296 ASN B CG  1 
ATOM 4068  O OD1 . ASN B 1 296 ? -43.037 41.229  0.868   1.00 91.44  ? 296 ASN B OD1 1 
ATOM 4069  N ND2 . ASN B 1 296 ? -41.511 41.151  -0.783  1.00 91.37  ? 296 ASN B ND2 1 
ATOM 4070  N N   . SER B 1 297 ? -42.584 40.662  4.220   1.00 43.85  ? 297 SER B N   1 
ATOM 4071  C CA  . SER B 1 297 ? -43.671 40.940  5.160   1.00 42.67  ? 297 SER B CA  1 
ATOM 4072  C C   . SER B 1 297 ? -44.219 39.670  5.840   1.00 44.13  ? 297 SER B C   1 
ATOM 4073  O O   . SER B 1 297 ? -43.980 38.556  5.382   1.00 39.63  ? 297 SER B O   1 
ATOM 4074  C CB  . SER B 1 297 ? -44.817 41.669  4.455   1.00 45.06  ? 297 SER B CB  1 
ATOM 4075  O OG  . SER B 1 297 ? -45.481 40.852  3.506   1.00 57.66  ? 297 SER B OG  1 
ATOM 4076  N N   . PHE B 1 298 ? -45.004 39.877  6.909   1.00 42.78  ? 298 PHE B N   1 
ATOM 4077  C CA  . PHE B 1 298 ? -45.738 38.849  7.607   1.00 44.69  ? 298 PHE B CA  1 
ATOM 4078  C C   . PHE B 1 298 ? -46.903 38.395  6.699   1.00 48.03  ? 298 PHE B C   1 
ATOM 4079  O O   . PHE B 1 298 ? -47.265 37.219  6.679   1.00 48.43  ? 298 PHE B O   1 
ATOM 4080  C CB  . PHE B 1 298 ? -46.239 39.384  8.967   1.00 48.32  ? 298 PHE B CB  1 
ATOM 4081  C CG  . PHE B 1 298 ? -47.211 38.472  9.673   1.00 52.02  ? 298 PHE B CG  1 
ATOM 4082  C CD1 . PHE B 1 298 ? -46.772 37.326  10.318  1.00 57.29  ? 298 PHE B CD1 1 
ATOM 4083  C CD2 . PHE B 1 298 ? -48.571 38.740  9.664   1.00 57.40  ? 298 PHE B CD2 1 
ATOM 4084  C CE1 . PHE B 1 298 ? -47.669 36.462  10.956  1.00 58.88  ? 298 PHE B CE1 1 
ATOM 4085  C CE2 . PHE B 1 298 ? -49.476 37.869  10.295  1.00 61.85  ? 298 PHE B CE2 1 
ATOM 4086  C CZ  . PHE B 1 298 ? -49.015 36.730  10.931  1.00 59.54  ? 298 PHE B CZ  1 
ATOM 4087  N N   . ALA B 1 299 ? -47.477 39.341  5.950   1.00 43.85  ? 299 ALA B N   1 
ATOM 4088  C CA  . ALA B 1 299 ? -48.565 39.126  4.996   1.00 43.31  ? 299 ALA B CA  1 
ATOM 4089  C C   . ALA B 1 299 ? -48.144 38.158  3.888   1.00 48.08  ? 299 ALA B C   1 
ATOM 4090  O O   . ALA B 1 299 ? -48.967 37.346  3.458   1.00 49.17  ? 299 ALA B O   1 
ATOM 4091  C CB  . ALA B 1 299 ? -48.998 40.454  4.397   1.00 43.42  ? 299 ALA B CB  1 
ATOM 4092  N N   . GLU B 1 300 ? -46.865 38.236  3.449   1.00 42.76  ? 300 GLU B N   1 
ATOM 4093  C CA  . GLU B 1 300 ? -46.254 37.340  2.461   1.00 41.53  ? 300 GLU B CA  1 
ATOM 4094  C C   . GLU B 1 300 ? -46.152 35.946  3.065   1.00 44.30  ? 300 GLU B C   1 
ATOM 4095  O O   . GLU B 1 300 ? -46.516 34.969  2.417   1.00 43.75  ? 300 GLU B O   1 
ATOM 4096  C CB  . GLU B 1 300 ? -44.866 37.856  2.016   1.00 42.48  ? 300 GLU B CB  1 
ATOM 4097  C CG  . GLU B 1 300 ? -44.219 36.993  0.941   1.00 49.69  ? 300 GLU B CG  1 
ATOM 4098  C CD  . GLU B 1 300 ? -42.784 37.273  0.547   1.00 65.21  ? 300 GLU B CD  1 
ATOM 4099  O OE1 . GLU B 1 300 ? -42.234 38.313  0.968   1.00 82.32  ? 300 GLU B OE1 1 
ATOM 4100  O OE2 . GLU B 1 300 ? -42.202 36.440  -0.181  1.00 60.77  ? 300 GLU B OE2 1 
ATOM 4101  N N   . LEU B 1 301 ? -45.670 35.861  4.313   1.00 40.99  ? 301 LEU B N   1 
ATOM 4102  C CA  . LEU B 1 301 ? -45.548 34.616  5.064   1.00 41.39  ? 301 LEU B CA  1 
ATOM 4103  C C   . LEU B 1 301 ? -46.923 33.959  5.193   1.00 46.01  ? 301 LEU B C   1 
ATOM 4104  O O   . LEU B 1 301 ? -47.065 32.790  4.853   1.00 45.73  ? 301 LEU B O   1 
ATOM 4105  C CB  . LEU B 1 301 ? -44.944 34.913  6.449   1.00 41.66  ? 301 LEU B CB  1 
ATOM 4106  C CG  . LEU B 1 301 ? -44.332 33.783  7.311   1.00 45.84  ? 301 LEU B CG  1 
ATOM 4107  C CD1 . LEU B 1 301 ? -45.075 33.604  8.585   1.00 46.59  ? 301 LEU B CD1 1 
ATOM 4108  C CD2 . LEU B 1 301 ? -44.015 32.500  6.536   1.00 43.74  ? 301 LEU B CD2 1 
ATOM 4109  N N   . ARG B 1 302 ? -47.941 34.740  5.597   1.00 42.55  ? 302 ARG B N   1 
ATOM 4110  C CA  . ARG B 1 302 ? -49.321 34.291  5.757   1.00 42.21  ? 302 ARG B CA  1 
ATOM 4111  C C   . ARG B 1 302 ? -49.860 33.689  4.429   1.00 45.30  ? 302 ARG B C   1 
ATOM 4112  O O   . ARG B 1 302 ? -50.346 32.560  4.423   1.00 45.26  ? 302 ARG B O   1 
ATOM 4113  C CB  . ARG B 1 302 ? -50.187 35.466  6.266   1.00 44.19  ? 302 ARG B CB  1 
ATOM 4114  C CG  . ARG B 1 302 ? -51.576 35.070  6.719   1.00 63.04  ? 302 ARG B CG  1 
ATOM 4115  C CD  . ARG B 1 302 ? -52.402 36.248  7.191   1.00 79.41  ? 302 ARG B CD  1 
ATOM 4116  N NE  . ARG B 1 302 ? -53.838 36.007  6.985   1.00 96.12  ? 302 ARG B NE  1 
ATOM 4117  C CZ  . ARG B 1 302 ? -54.523 36.390  5.907   1.00 114.18 ? 302 ARG B CZ  1 
ATOM 4118  N NH1 . ARG B 1 302 ? -53.916 37.041  4.920   1.00 104.34 ? 302 ARG B NH1 1 
ATOM 4119  N NH2 . ARG B 1 302 ? -55.821 36.130  5.810   1.00 96.77  ? 302 ARG B NH2 1 
ATOM 4120  N N   . SER B 1 303 ? -49.718 34.392  3.310   1.00 42.92  ? 303 SER B N   1 
ATOM 4121  C CA  . SER B 1 303 ? -50.195 33.893  2.004   1.00 43.50  ? 303 SER B CA  1 
ATOM 4122  C C   . SER B 1 303 ? -49.391 32.674  1.500   1.00 47.02  ? 303 SER B C   1 
ATOM 4123  O O   . SER B 1 303 ? -49.976 31.766  0.918   1.00 48.45  ? 303 SER B O   1 
ATOM 4124  C CB  . SER B 1 303 ? -50.148 34.994  0.956   1.00 47.44  ? 303 SER B CB  1 
ATOM 4125  O OG  . SER B 1 303 ? -48.814 35.134  0.501   1.00 57.38  ? 303 SER B OG  1 
ATOM 4126  N N   . ARG B 1 304 ? -48.069 32.653  1.716   1.00 41.06  ? 304 ARG B N   1 
ATOM 4127  C CA  . ARG B 1 304 ? -47.256 31.520  1.301   1.00 40.17  ? 304 ARG B CA  1 
ATOM 4128  C C   . ARG B 1 304 ? -47.597 30.256  2.111   1.00 43.03  ? 304 ARG B C   1 
ATOM 4129  O O   . ARG B 1 304 ? -47.685 29.177  1.527   1.00 42.82  ? 304 ARG B O   1 
ATOM 4130  C CB  . ARG B 1 304 ? -45.774 31.846  1.410   1.00 40.77  ? 304 ARG B CB  1 
ATOM 4131  C CG  . ARG B 1 304 ? -45.269 32.723  0.287   1.00 42.98  ? 304 ARG B CG  1 
ATOM 4132  C CD  . ARG B 1 304 ? -43.795 32.969  0.451   1.00 42.97  ? 304 ARG B CD  1 
ATOM 4133  N NE  . ARG B 1 304 ? -43.214 33.747  -0.652  1.00 43.54  ? 304 ARG B NE  1 
ATOM 4134  C CZ  . ARG B 1 304 ? -42.712 33.231  -1.768  1.00 48.43  ? 304 ARG B CZ  1 
ATOM 4135  N NH1 . ARG B 1 304 ? -42.747 31.924  -1.976  1.00 40.12  ? 304 ARG B NH1 1 
ATOM 4136  N NH2 . ARG B 1 304 ? -42.188 34.024  -2.695  1.00 37.44  ? 304 ARG B NH2 1 
ATOM 4137  N N   . ILE B 1 305 ? -47.834 30.389  3.429   1.00 39.31  ? 305 ILE B N   1 
ATOM 4138  C CA  . ILE B 1 305 ? -48.174 29.251  4.299   1.00 38.80  ? 305 ILE B CA  1 
ATOM 4139  C C   . ILE B 1 305 ? -49.603 28.746  4.026   1.00 44.62  ? 305 ILE B C   1 
ATOM 4140  O O   . ILE B 1 305 ? -49.804 27.555  4.065   1.00 45.75  ? 305 ILE B O   1 
ATOM 4141  C CB  . ILE B 1 305 ? -47.962 29.585  5.813   1.00 41.30  ? 305 ILE B CB  1 
ATOM 4142  C CG1 . ILE B 1 305 ? -46.477 29.901  6.142   1.00 41.05  ? 305 ILE B CG1 1 
ATOM 4143  C CG2 . ILE B 1 305 ? -48.501 28.481  6.755   1.00 41.96  ? 305 ILE B CG2 1 
ATOM 4144  C CD1 . ILE B 1 305 ? -45.322 28.797  5.917   1.00 31.01  ? 305 ILE B CD1 1 
ATOM 4145  N N   . ALA B 1 306 ? -50.577 29.617  3.767   1.00 42.65  ? 306 ALA B N   1 
ATOM 4146  C CA  . ALA B 1 306 ? -51.964 29.198  3.550   1.00 43.22  ? 306 ALA B CA  1 
ATOM 4147  C C   . ALA B 1 306 ? -52.179 28.490  2.193   1.00 52.28  ? 306 ALA B C   1 
ATOM 4148  O O   . ALA B 1 306 ? -53.155 27.765  2.020   1.00 54.70  ? 306 ALA B O   1 
ATOM 4149  C CB  . ALA B 1 306 ? -52.892 30.397  3.672   1.00 43.29  ? 306 ALA B CB  1 
ATOM 4150  N N   . THR B 1 307 ? -51.279 28.729  1.243   1.00 50.02  ? 307 THR B N   1 
ATOM 4151  C CA  . THR B 1 307 ? -51.202 28.186  -0.120  1.00 49.06  ? 307 THR B CA  1 
ATOM 4152  C C   . THR B 1 307 ? -50.534 26.805  -0.042  1.00 53.74  ? 307 THR B C   1 
ATOM 4153  O O   . THR B 1 307 ? -50.728 25.963  -0.921  1.00 55.27  ? 307 THR B O   1 
ATOM 4154  C CB  . THR B 1 307 ? -50.407 29.226  -0.927  1.00 53.72  ? 307 THR B CB  1 
ATOM 4155  O OG1 . THR B 1 307 ? -51.282 30.307  -1.214  1.00 43.61  ? 307 THR B OG1 1 
ATOM 4156  C CG2 . THR B 1 307 ? -49.725 28.685  -2.193  1.00 58.18  ? 307 THR B CG2 1 
ATOM 4157  N N   . THR B 1 308 ? -49.751 26.573  1.017   1.00 48.60  ? 308 THR B N   1 
ATOM 4158  C CA  . THR B 1 308 ? -49.055 25.313  1.196   1.00 47.72  ? 308 THR B CA  1 
ATOM 4159  C C   . THR B 1 308 ? -49.983 24.319  1.931   1.00 53.02  ? 308 THR B C   1 
ATOM 4160  O O   . THR B 1 308 ? -50.695 24.682  2.869   1.00 51.69  ? 308 THR B O   1 
ATOM 4161  C CB  . THR B 1 308 ? -47.705 25.534  1.865   1.00 50.44  ? 308 THR B CB  1 
ATOM 4162  O OG1 . THR B 1 308 ? -47.053 26.642  1.252   1.00 52.47  ? 308 THR B OG1 1 
ATOM 4163  C CG2 . THR B 1 308 ? -46.793 24.349  1.731   1.00 48.38  ? 308 THR B CG2 1 
ATOM 4164  N N   . GLU B 1 309 ? -49.983 23.058  1.448   1.00 50.54  ? 309 GLU B N   1 
ATOM 4165  C CA  . GLU B 1 309 ? -50.783 21.930  1.936   1.00 49.71  ? 309 GLU B CA  1 
ATOM 4166  C C   . GLU B 1 309 ? -50.415 21.507  3.367   1.00 48.78  ? 309 GLU B C   1 
ATOM 4167  O O   . GLU B 1 309 ? -49.228 21.360  3.655   1.00 46.69  ? 309 GLU B O   1 
ATOM 4168  C CB  . GLU B 1 309 ? -50.547 20.738  0.996   1.00 51.86  ? 309 GLU B CB  1 
ATOM 4169  C CG  . GLU B 1 309 ? -51.720 19.794  0.843   1.00 71.22  ? 309 GLU B CG  1 
ATOM 4170  C CD  . GLU B 1 309 ? -51.402 18.533  0.054   1.00 107.26 ? 309 GLU B CD  1 
ATOM 4171  O OE1 . GLU B 1 309 ? -51.488 17.432  0.645   1.00 114.34 ? 309 GLU B OE1 1 
ATOM 4172  O OE2 . GLU B 1 309 ? -51.041 18.646  -1.142  1.00 102.59 ? 309 GLU B OE2 1 
ATOM 4173  N N   . PRO B 1 310 ? -51.402 21.232  4.258   1.00 43.98  ? 310 PRO B N   1 
ATOM 4174  C CA  . PRO B 1 310 ? -51.070 20.745  5.607   1.00 43.48  ? 310 PRO B CA  1 
ATOM 4175  C C   . PRO B 1 310 ? -50.267 19.451  5.547   1.00 48.78  ? 310 PRO B C   1 
ATOM 4176  O O   . PRO B 1 310 ? -50.531 18.612  4.692   1.00 50.91  ? 310 PRO B O   1 
ATOM 4177  C CB  . PRO B 1 310 ? -52.447 20.498  6.235   1.00 44.68  ? 310 PRO B CB  1 
ATOM 4178  C CG  . PRO B 1 310 ? -53.363 21.390  5.491   1.00 48.77  ? 310 PRO B CG  1 
ATOM 4179  C CD  . PRO B 1 310 ? -52.860 21.330  4.089   1.00 45.07  ? 310 PRO B CD  1 
ATOM 4180  N N   . GLY B 1 311 ? -49.281 19.320  6.418   1.00 43.02  ? 311 GLY B N   1 
ATOM 4181  C CA  . GLY B 1 311 ? -48.409 18.159  6.447   1.00 42.16  ? 311 GLY B CA  1 
ATOM 4182  C C   . GLY B 1 311 ? -47.072 18.429  5.788   1.00 48.61  ? 311 GLY B C   1 
ATOM 4183  O O   . GLY B 1 311 ? -46.101 17.705  6.041   1.00 49.24  ? 311 GLY B O   1 
ATOM 4184  N N   . THR B 1 312 ? -47.009 19.484  4.935   1.00 44.91  ? 312 THR B N   1 
ATOM 4185  C CA  . THR B 1 312 ? -45.779 19.909  4.263   1.00 44.30  ? 312 THR B CA  1 
ATOM 4186  C C   . THR B 1 312 ? -44.821 20.496  5.282   1.00 44.59  ? 312 THR B C   1 
ATOM 4187  O O   . THR B 1 312 ? -45.242 21.227  6.180   1.00 42.34  ? 312 THR B O   1 
ATOM 4188  C CB  . THR B 1 312 ? -46.069 20.941  3.151   1.00 53.56  ? 312 THR B CB  1 
ATOM 4189  O OG1 . THR B 1 312 ? -47.132 20.476  2.326   1.00 54.09  ? 312 THR B OG1 1 
ATOM 4190  C CG2 . THR B 1 312 ? -44.838 21.264  2.293   1.00 46.27  ? 312 THR B CG2 1 
ATOM 4191  N N   . LYS B 1 313 ? -43.541 20.172  5.125   1.00 41.64  ? 313 LYS B N   1 
ATOM 4192  C CA  . LYS B 1 313 ? -42.468 20.672  5.965   1.00 41.03  ? 313 LYS B CA  1 
ATOM 4193  C C   . LYS B 1 313 ? -41.841 21.896  5.299   1.00 47.35  ? 313 LYS B C   1 
ATOM 4194  O O   . LYS B 1 313 ? -41.547 21.866  4.101   1.00 48.12  ? 313 LYS B O   1 
ATOM 4195  C CB  . LYS B 1 313 ? -41.429 19.583  6.234   1.00 41.77  ? 313 LYS B CB  1 
ATOM 4196  C CG  . LYS B 1 313 ? -41.917 18.542  7.228   1.00 38.62  ? 313 LYS B CG  1 
ATOM 4197  C CD  . LYS B 1 313 ? -40.800 17.656  7.695   1.00 42.21  ? 313 LYS B CD  1 
ATOM 4198  C CE  . LYS B 1 313 ? -41.328 16.494  8.476   1.00 35.76  ? 313 LYS B CE  1 
ATOM 4199  N NZ  . LYS B 1 313 ? -40.213 15.849  9.178   1.00 57.74  ? 313 LYS B NZ  1 
ATOM 4200  N N   . VAL B 1 314 ? -41.675 22.983  6.073   1.00 44.03  ? 314 VAL B N   1 
ATOM 4201  C CA  . VAL B 1 314 ? -41.080 24.239  5.588   1.00 43.07  ? 314 VAL B CA  1 
ATOM 4202  C C   . VAL B 1 314 ? -39.881 24.589  6.463   1.00 45.89  ? 314 VAL B C   1 
ATOM 4203  O O   . VAL B 1 314 ? -39.824 24.186  7.627   1.00 44.91  ? 314 VAL B O   1 
ATOM 4204  C CB  . VAL B 1 314 ? -42.120 25.413  5.516   1.00 46.33  ? 314 VAL B CB  1 
ATOM 4205  C CG1 . VAL B 1 314 ? -43.223 25.122  4.494   1.00 45.08  ? 314 VAL B CG1 1 
ATOM 4206  C CG2 . VAL B 1 314 ? -42.725 25.750  6.893   1.00 45.96  ? 314 VAL B CG2 1 
ATOM 4207  N N   . LYS B 1 315 ? -38.923 25.323  5.903   1.00 42.13  ? 315 LYS B N   1 
ATOM 4208  C CA  . LYS B 1 315 ? -37.743 25.769  6.642   1.00 41.56  ? 315 LYS B CA  1 
ATOM 4209  C C   . LYS B 1 315 ? -37.923 27.253  6.955   1.00 46.38  ? 315 LYS B C   1 
ATOM 4210  O O   . LYS B 1 315 ? -38.154 28.065  6.065   1.00 46.82  ? 315 LYS B O   1 
ATOM 4211  C CB  . LYS B 1 315 ? -36.417 25.447  5.903   1.00 42.58  ? 315 LYS B CB  1 
ATOM 4212  C CG  . LYS B 1 315 ? -35.939 24.040  6.239   1.00 66.21  ? 315 LYS B CG  1 
ATOM 4213  C CD  . LYS B 1 315 ? -34.833 23.521  5.334   1.00 86.43  ? 315 LYS B CD  1 
ATOM 4214  C CE  . LYS B 1 315 ? -34.607 22.037  5.561   1.00 91.75  ? 315 LYS B CE  1 
ATOM 4215  N NZ  . LYS B 1 315 ? -33.556 21.465  4.676   1.00 99.82  ? 315 LYS B NZ  1 
ATOM 4216  N N   . LEU B 1 316 ? -37.931 27.578  8.240   1.00 42.30  ? 316 LEU B N   1 
ATOM 4217  C CA  . LEU B 1 316 ? -38.136 28.931  8.722   1.00 40.62  ? 316 LEU B CA  1 
ATOM 4218  C C   . LEU B 1 316 ? -36.838 29.560  9.133   1.00 44.77  ? 316 LEU B C   1 
ATOM 4219  O O   . LEU B 1 316 ? -36.159 29.046  10.018  1.00 46.61  ? 316 LEU B O   1 
ATOM 4220  C CB  . LEU B 1 316 ? -39.084 28.864  9.939   1.00 40.07  ? 316 LEU B CB  1 
ATOM 4221  C CG  . LEU B 1 316 ? -40.476 29.456  9.819   1.00 43.14  ? 316 LEU B CG  1 
ATOM 4222  C CD1 . LEU B 1 316 ? -41.040 29.343  8.438   1.00 42.69  ? 316 LEU B CD1 1 
ATOM 4223  C CD2 . LEU B 1 316 ? -41.398 28.851  10.812  1.00 42.36  ? 316 LEU B CD2 1 
ATOM 4224  N N   . GLY B 1 317 ? -36.525 30.689  8.533   1.00 40.07  ? 317 GLY B N   1 
ATOM 4225  C CA  . GLY B 1 317 ? -35.381 31.513  8.902   1.00 38.96  ? 317 GLY B CA  1 
ATOM 4226  C C   . GLY B 1 317 ? -35.848 32.426  10.016  1.00 44.12  ? 317 GLY B C   1 
ATOM 4227  O O   . GLY B 1 317 ? -36.836 33.157  9.890   1.00 42.52  ? 317 GLY B O   1 
ATOM 4228  N N   . LEU B 1 318 ? -35.164 32.339  11.129  1.00 43.37  ? 318 LEU B N   1 
ATOM 4229  C CA  . LEU B 1 318 ? -35.488 32.978  12.400  1.00 43.59  ? 318 LEU B CA  1 
ATOM 4230  C C   . LEU B 1 318 ? -34.365 33.827  12.985  1.00 46.98  ? 318 LEU B C   1 
ATOM 4231  O O   . LEU B 1 318 ? -33.190 33.638  12.674  1.00 44.73  ? 318 LEU B O   1 
ATOM 4232  C CB  . LEU B 1 318 ? -35.678 31.800  13.323  1.00 43.93  ? 318 LEU B CB  1 
ATOM 4233  C CG  . LEU B 1 318 ? -36.774 31.804  14.258  1.00 48.53  ? 318 LEU B CG  1 
ATOM 4234  C CD1 . LEU B 1 318 ? -37.905 31.013  13.707  1.00 47.83  ? 318 LEU B CD1 1 
ATOM 4235  C CD2 . LEU B 1 318 ? -36.285 31.183  15.506  1.00 54.78  ? 318 LEU B CD2 1 
ATOM 4236  N N   . LEU B 1 319 ? -34.731 34.728  13.878  1.00 45.86  ? 319 LEU B N   1 
ATOM 4237  C CA  . LEU B 1 319 ? -33.782 35.589  14.585  1.00 46.40  ? 319 LEU B CA  1 
ATOM 4238  C C   . LEU B 1 319 ? -34.220 35.609  16.061  1.00 51.53  ? 319 LEU B C   1 
ATOM 4239  O O   . LEU B 1 319 ? -35.338 36.017  16.365  1.00 51.85  ? 319 LEU B O   1 
ATOM 4240  C CB  . LEU B 1 319 ? -33.759 36.977  13.916  1.00 46.01  ? 319 LEU B CB  1 
ATOM 4241  C CG  . LEU B 1 319 ? -32.463 37.775  13.837  1.00 50.08  ? 319 LEU B CG  1 
ATOM 4242  C CD1 . LEU B 1 319 ? -31.265 36.958  13.320  1.00 49.22  ? 319 LEU B CD1 1 
ATOM 4243  C CD2 . LEU B 1 319 ? -32.660 38.968  12.954  1.00 51.93  ? 319 LEU B CD2 1 
ATOM 4244  N N   . ARG B 1 320 ? -33.414 35.013  16.940  1.00 49.22  ? 320 ARG B N   1 
ATOM 4245  C CA  . ARG B 1 320 ? -33.717 34.885  18.382  1.00 49.89  ? 320 ARG B CA  1 
ATOM 4246  C C   . ARG B 1 320 ? -32.614 35.553  19.211  1.00 55.87  ? 320 ARG B C   1 
ATOM 4247  O O   . ARG B 1 320 ? -31.480 35.051  19.277  1.00 55.69  ? 320 ARG B O   1 
ATOM 4248  C CB  . ARG B 1 320 ? -33.867 33.398  18.751  1.00 47.77  ? 320 ARG B CB  1 
ATOM 4249  C CG  . ARG B 1 320 ? -34.297 33.141  20.181  1.00 42.85  ? 320 ARG B CG  1 
ATOM 4250  C CD  . ARG B 1 320 ? -34.612 31.681  20.358  1.00 42.04  ? 320 ARG B CD  1 
ATOM 4251  N NE  . ARG B 1 320 ? -35.667 31.236  19.450  1.00 55.54  ? 320 ARG B NE  1 
ATOM 4252  C CZ  . ARG B 1 320 ? -35.998 29.965  19.267  1.00 70.17  ? 320 ARG B CZ  1 
ATOM 4253  N NH1 . ARG B 1 320 ? -35.349 29.004  19.916  1.00 59.92  ? 320 ARG B NH1 1 
ATOM 4254  N NH2 . ARG B 1 320 ? -36.972 29.640  18.423  1.00 45.80  ? 320 ARG B NH2 1 
ATOM 4255  N N   . ASN B 1 321 ? -32.950 36.716  19.806  1.00 53.52  ? 321 ASN B N   1 
ATOM 4256  C CA  . ASN B 1 321 ? -32.035 37.568  20.582  1.00 52.76  ? 321 ASN B CA  1 
ATOM 4257  C C   . ASN B 1 321 ? -30.859 38.000  19.708  1.00 53.93  ? 321 ASN B C   1 
ATOM 4258  O O   . ASN B 1 321 ? -29.728 38.086  20.173  1.00 53.64  ? 321 ASN B O   1 
ATOM 4259  C CB  . ASN B 1 321 ? -31.592 36.881  21.889  1.00 54.98  ? 321 ASN B CB  1 
ATOM 4260  C CG  . ASN B 1 321 ? -32.688 36.932  22.938  1.00 83.75  ? 321 ASN B CG  1 
ATOM 4261  O OD1 . ASN B 1 321 ? -33.357 35.936  23.241  1.00 65.65  ? 321 ASN B OD1 1 
ATOM 4262  N ND2 . ASN B 1 321 ? -32.961 38.124  23.459  1.00 83.05  ? 321 ASN B ND2 1 
ATOM 4263  N N   . GLY B 1 322 ? -31.161 38.293  18.443  1.00 49.45  ? 322 GLY B N   1 
ATOM 4264  C CA  . GLY B 1 322 ? -30.188 38.751  17.455  1.00 48.99  ? 322 GLY B CA  1 
ATOM 4265  C C   . GLY B 1 322 ? -29.337 37.659  16.840  1.00 52.76  ? 322 GLY B C   1 
ATOM 4266  O O   . GLY B 1 322 ? -28.425 37.951  16.066  1.00 52.14  ? 322 GLY B O   1 
ATOM 4267  N N   . LYS B 1 323 ? -29.643 36.394  17.157  1.00 50.46  ? 323 LYS B N   1 
ATOM 4268  C CA  . LYS B 1 323 ? -28.912 35.228  16.662  1.00 50.56  ? 323 LYS B CA  1 
ATOM 4269  C C   . LYS B 1 323 ? -29.745 34.468  15.613  1.00 53.55  ? 323 LYS B C   1 
ATOM 4270  O O   . LYS B 1 323 ? -30.932 34.185  15.829  1.00 50.34  ? 323 LYS B O   1 
ATOM 4271  C CB  . LYS B 1 323 ? -28.492 34.282  17.818  1.00 53.63  ? 323 LYS B CB  1 
ATOM 4272  C CG  . LYS B 1 323 ? -27.771 34.950  18.994  1.00 76.42  ? 323 LYS B CG  1 
ATOM 4273  C CD  . LYS B 1 323 ? -26.398 35.508  18.628  1.00 94.45  ? 323 LYS B CD  1 
ATOM 4274  C CE  . LYS B 1 323 ? -25.967 36.588  19.599  1.00 114.27 ? 323 LYS B CE  1 
ATOM 4275  N NZ  . LYS B 1 323 ? -24.703 37.249  19.177  1.00 123.45 ? 323 LYS B NZ  1 
ATOM 4276  N N   . PRO B 1 324 ? -29.117 34.116  14.467  1.00 52.35  ? 324 PRO B N   1 
ATOM 4277  C CA  . PRO B 1 324 ? -29.856 33.369  13.416  1.00 51.68  ? 324 PRO B CA  1 
ATOM 4278  C C   . PRO B 1 324 ? -30.084 31.894  13.764  1.00 54.26  ? 324 PRO B C   1 
ATOM 4279  O O   . PRO B 1 324 ? -29.247 31.275  14.419  1.00 54.63  ? 324 PRO B O   1 
ATOM 4280  C CB  . PRO B 1 324 ? -28.950 33.483  12.180  1.00 53.46  ? 324 PRO B CB  1 
ATOM 4281  C CG  . PRO B 1 324 ? -27.813 34.404  12.568  1.00 58.28  ? 324 PRO B CG  1 
ATOM 4282  C CD  . PRO B 1 324 ? -27.720 34.381  14.062  1.00 53.84  ? 324 PRO B CD  1 
ATOM 4283  N N   . LEU B 1 325 ? -31.230 31.340  13.334  1.00 49.50  ? 325 LEU B N   1 
ATOM 4284  C CA  . LEU B 1 325 ? -31.634 29.930  13.498  1.00 48.21  ? 325 LEU B CA  1 
ATOM 4285  C C   . LEU B 1 325 ? -32.424 29.475  12.293  1.00 51.97  ? 325 LEU B C   1 
ATOM 4286  O O   . LEU B 1 325 ? -33.136 30.281  11.703  1.00 49.93  ? 325 LEU B O   1 
ATOM 4287  C CB  . LEU B 1 325 ? -32.506 29.701  14.750  1.00 47.71  ? 325 LEU B CB  1 
ATOM 4288  C CG  . LEU B 1 325 ? -31.993 30.127  16.127  1.00 52.79  ? 325 LEU B CG  1 
ATOM 4289  C CD1 . LEU B 1 325 ? -33.066 29.959  17.154  1.00 53.25  ? 325 LEU B CD1 1 
ATOM 4290  C CD2 . LEU B 1 325 ? -30.799 29.303  16.557  1.00 56.69  ? 325 LEU B CD2 1 
ATOM 4291  N N   . GLU B 1 326 ? -32.333 28.186  11.945  1.00 50.20  ? 326 GLU B N   1 
ATOM 4292  C CA  . GLU B 1 326 ? -33.135 27.581  10.873  1.00 49.99  ? 326 GLU B CA  1 
ATOM 4293  C C   . GLU B 1 326 ? -33.949 26.497  11.539  1.00 53.15  ? 326 GLU B C   1 
ATOM 4294  O O   . GLU B 1 326 ? -33.405 25.721  12.316  1.00 54.70  ? 326 GLU B O   1 
ATOM 4295  C CB  . GLU B 1 326 ? -32.263 27.044  9.731   1.00 51.91  ? 326 GLU B CB  1 
ATOM 4296  C CG  . GLU B 1 326 ? -32.314 27.841  8.438   1.00 68.91  ? 326 GLU B CG  1 
ATOM 4297  C CD  . GLU B 1 326 ? -33.245 27.328  7.346   1.00 103.16 ? 326 GLU B CD  1 
ATOM 4298  O OE1 . GLU B 1 326 ? -33.238 26.109  7.056   1.00 88.12  ? 326 GLU B OE1 1 
ATOM 4299  O OE2 . GLU B 1 326 ? -33.948 28.169  6.740   1.00 112.53 ? 326 GLU B OE2 1 
ATOM 4300  N N   . VAL B 1 327 ? -35.255 26.477  11.313  1.00 47.42  ? 327 VAL B N   1 
ATOM 4301  C CA  . VAL B 1 327 ? -36.171 25.543  11.971  1.00 45.23  ? 327 VAL B CA  1 
ATOM 4302  C C   . VAL B 1 327 ? -37.088 24.904  10.916  1.00 48.45  ? 327 VAL B C   1 
ATOM 4303  O O   . VAL B 1 327 ? -37.628 25.596  10.052  1.00 48.10  ? 327 VAL B O   1 
ATOM 4304  C CB  . VAL B 1 327 ? -36.947 26.352  13.066  1.00 48.45  ? 327 VAL B CB  1 
ATOM 4305  C CG1 . VAL B 1 327 ? -38.257 25.717  13.460  1.00 48.63  ? 327 VAL B CG1 1 
ATOM 4306  C CG2 . VAL B 1 327 ? -36.069 26.580  14.293  1.00 47.90  ? 327 VAL B CG2 1 
ATOM 4307  N N   . GLU B 1 328 ? -37.256 23.591  10.981  1.00 45.20  ? 328 GLU B N   1 
ATOM 4308  C CA  . GLU B 1 328 ? -38.134 22.865  10.061  1.00 45.29  ? 328 GLU B CA  1 
ATOM 4309  C C   . GLU B 1 328 ? -39.474 22.661  10.761  1.00 46.54  ? 328 GLU B C   1 
ATOM 4310  O O   . GLU B 1 328 ? -39.498 22.138  11.866  1.00 48.69  ? 328 GLU B O   1 
ATOM 4311  C CB  . GLU B 1 328 ? -37.502 21.529  9.607   1.00 47.13  ? 328 GLU B CB  1 
ATOM 4312  C CG  . GLU B 1 328 ? -38.221 20.843  8.447   1.00 59.25  ? 328 GLU B CG  1 
ATOM 4313  C CD  . GLU B 1 328 ? -37.512 19.616  7.891   1.00 75.06  ? 328 GLU B CD  1 
ATOM 4314  O OE1 . GLU B 1 328 ? -37.013 19.700  6.743   1.00 82.63  ? 328 GLU B OE1 1 
ATOM 4315  O OE2 . GLU B 1 328 ? -37.426 18.588  8.606   1.00 45.94  ? 328 GLU B OE2 1 
ATOM 4316  N N   . VAL B 1 329 ? -40.565 23.141  10.153  1.00 37.59  ? 329 VAL B N   1 
ATOM 4317  C CA  . VAL B 1 329 ? -41.910 23.108  10.719  1.00 34.35  ? 329 VAL B CA  1 
ATOM 4318  C C   . VAL B 1 329 ? -42.834 22.299  9.813   1.00 39.80  ? 329 VAL B C   1 
ATOM 4319  O O   . VAL B 1 329 ? -42.831 22.496  8.592   1.00 38.64  ? 329 VAL B O   1 
ATOM 4320  C CB  . VAL B 1 329 ? -42.485 24.556  10.927  1.00 35.17  ? 329 VAL B CB  1 
ATOM 4321  C CG1 . VAL B 1 329 ? -43.847 24.526  11.611  1.00 33.76  ? 329 VAL B CG1 1 
ATOM 4322  C CG2 . VAL B 1 329 ? -41.531 25.457  11.691  1.00 34.35  ? 329 VAL B CG2 1 
ATOM 4323  N N   . THR B 1 330 ? -43.655 21.435  10.416  1.00 38.06  ? 330 THR B N   1 
ATOM 4324  C CA  . THR B 1 330 ? -44.673 20.658  9.705   1.00 38.45  ? 330 THR B CA  1 
ATOM 4325  C C   . THR B 1 330 ? -45.985 21.452  9.834   1.00 46.07  ? 330 THR B C   1 
ATOM 4326  O O   . THR B 1 330 ? -46.425 21.800  10.950  1.00 46.09  ? 330 THR B O   1 
ATOM 4327  C CB  . THR B 1 330 ? -44.768 19.219  10.243  1.00 41.16  ? 330 THR B CB  1 
ATOM 4328  O OG1 . THR B 1 330 ? -43.469 18.619  10.212  1.00 46.32  ? 330 THR B OG1 1 
ATOM 4329  C CG2 . THR B 1 330 ? -45.761 18.366  9.466   1.00 31.02  ? 330 THR B CG2 1 
ATOM 4330  N N   . LEU B 1 331 ? -46.599 21.746  8.699   1.00 41.82  ? 331 LEU B N   1 
ATOM 4331  C CA  . LEU B 1 331 ? -47.813 22.540  8.703   1.00 42.43  ? 331 LEU B CA  1 
ATOM 4332  C C   . LEU B 1 331 ? -49.028 21.765  9.173   1.00 49.32  ? 331 LEU B C   1 
ATOM 4333  O O   . LEU B 1 331 ? -49.205 20.582  8.843   1.00 48.90  ? 331 LEU B O   1 
ATOM 4334  C CB  . LEU B 1 331 ? -48.084 23.127  7.314   1.00 42.50  ? 331 LEU B CB  1 
ATOM 4335  C CG  . LEU B 1 331 ? -46.997 24.049  6.734   1.00 46.54  ? 331 LEU B CG  1 
ATOM 4336  C CD1 . LEU B 1 331 ? -47.446 24.615  5.434   1.00 47.21  ? 331 LEU B CD1 1 
ATOM 4337  C CD2 . LEU B 1 331 ? -46.618 25.167  7.699   1.00 44.74  ? 331 LEU B CD2 1 
ATOM 4338  N N   . ASP B 1 332 ? -49.852 22.447  9.969   1.00 47.86  ? 332 ASP B N   1 
ATOM 4339  C CA  . ASP B 1 332 ? -51.109 21.922  10.490  1.00 49.43  ? 332 ASP B CA  1 
ATOM 4340  C C   . ASP B 1 332 ? -52.218 22.318  9.524   1.00 53.52  ? 332 ASP B C   1 
ATOM 4341  O O   . ASP B 1 332 ? -51.928 22.930  8.497   1.00 52.98  ? 332 ASP B O   1 
ATOM 4342  C CB  . ASP B 1 332 ? -51.385 22.465  11.918  1.00 52.20  ? 332 ASP B CB  1 
ATOM 4343  C CG  . ASP B 1 332 ? -50.289 22.226  12.944  1.00 65.89  ? 332 ASP B CG  1 
ATOM 4344  O OD1 . ASP B 1 332 ? -49.705 23.221  13.429  1.00 67.01  ? 332 ASP B OD1 1 
ATOM 4345  O OD2 . ASP B 1 332 ? -50.019 21.042  13.268  1.00 71.62  ? 332 ASP B OD2 1 
ATOM 4346  N N   . THR B 1 333 ? -53.470 21.979  9.843   1.00 50.91  ? 333 THR B N   1 
ATOM 4347  C CA  . THR B 1 333 ? -54.622 22.352  9.026   1.00 51.86  ? 333 THR B CA  1 
ATOM 4348  C C   . THR B 1 333 ? -55.300 23.564  9.687   1.00 57.69  ? 333 THR B C   1 
ATOM 4349  O O   . THR B 1 333 ? -55.240 23.709  10.916  1.00 56.71  ? 333 THR B O   1 
ATOM 4350  C CB  . THR B 1 333 ? -55.573 21.163  8.844   1.00 60.68  ? 333 THR B CB  1 
ATOM 4351  O OG1 . THR B 1 333 ? -54.813 19.982  8.565   1.00 61.46  ? 333 THR B OG1 1 
ATOM 4352  C CG2 . THR B 1 333 ? -56.592 21.392  7.739   1.00 60.15  ? 333 THR B CG2 1 
ATOM 4353  N N   . SER B 1 334 ? -55.915 24.441  8.866   1.00 55.00  ? 334 SER B N   1 
ATOM 4354  C CA  . SER B 1 334 ? -56.608 25.643  9.335   1.00 58.87  ? 334 SER B CA  1 
ATOM 4355  C C   . SER B 1 334 ? -58.136 25.391  9.466   1.00 76.76  ? 334 SER B C   1 
ATOM 4356  O O   . SER B 1 334 ? -58.731 24.753  8.553   1.00 69.20  ? 334 SER B O   1 
ATOM 4357  C CB  . SER B 1 334 ? -56.324 26.806  8.394   1.00 61.96  ? 334 SER B CB  1 
ATOM 4358  O OG  . SER B 1 334 ? -56.858 28.022  8.885   1.00 69.97  ? 334 SER B OG  1 
ATOM 4359  N N   . PRO C 1 11  ? -23.047 53.177  -26.942 1.00 78.92  ? 11  PRO C N   1 
ATOM 4360  C CA  . PRO C 1 11  ? -22.940 51.796  -26.445 1.00 77.57  ? 11  PRO C CA  1 
ATOM 4361  C C   . PRO C 1 11  ? -24.276 51.256  -25.937 1.00 76.41  ? 11  PRO C C   1 
ATOM 4362  O O   . PRO C 1 11  ? -24.553 50.060  -26.099 1.00 76.52  ? 11  PRO C O   1 
ATOM 4363  C CB  . PRO C 1 11  ? -21.905 51.903  -25.312 1.00 79.69  ? 11  PRO C CB  1 
ATOM 4364  C CG  . PRO C 1 11  ? -21.160 53.228  -25.550 1.00 84.89  ? 11  PRO C CG  1 
ATOM 4365  C CD  . PRO C 1 11  ? -21.798 53.936  -26.723 1.00 80.73  ? 11  PRO C CD  1 
ATOM 4366  N N   . LEU C 1 12  ? -25.102 52.133  -25.319 1.00 67.12  ? 12  LEU C N   1 
ATOM 4367  C CA  . LEU C 1 12  ? -26.404 51.749  -24.763 1.00 63.60  ? 12  LEU C CA  1 
ATOM 4368  C C   . LEU C 1 12  ? -27.439 51.513  -25.858 1.00 61.50  ? 12  LEU C C   1 
ATOM 4369  O O   . LEU C 1 12  ? -27.538 52.331  -26.775 1.00 60.84  ? 12  LEU C O   1 
ATOM 4370  C CB  . LEU C 1 12  ? -26.947 52.823  -23.779 1.00 62.94  ? 12  LEU C CB  1 
ATOM 4371  C CG  . LEU C 1 12  ? -26.410 52.838  -22.346 1.00 65.27  ? 12  LEU C CG  1 
ATOM 4372  C CD1 . LEU C 1 12  ? -27.074 53.930  -21.537 1.00 64.19  ? 12  LEU C CD1 1 
ATOM 4373  C CD2 . LEU C 1 12  ? -26.586 51.483  -21.672 1.00 67.29  ? 12  LEU C CD2 1 
ATOM 4374  N N   . PRO C 1 13  ? -28.245 50.429  -25.758 1.00 54.11  ? 13  PRO C N   1 
ATOM 4375  C CA  . PRO C 1 13  ? -29.343 50.225  -26.725 1.00 52.61  ? 13  PRO C CA  1 
ATOM 4376  C C   . PRO C 1 13  ? -30.353 51.382  -26.675 1.00 52.46  ? 13  PRO C C   1 
ATOM 4377  O O   . PRO C 1 13  ? -30.673 51.891  -25.595 1.00 51.14  ? 13  PRO C O   1 
ATOM 4378  C CB  . PRO C 1 13  ? -29.996 48.914  -26.266 1.00 54.53  ? 13  PRO C CB  1 
ATOM 4379  C CG  . PRO C 1 13  ? -29.054 48.301  -25.334 1.00 59.32  ? 13  PRO C CG  1 
ATOM 4380  C CD  . PRO C 1 13  ? -28.272 49.401  -24.707 1.00 55.41  ? 13  PRO C CD  1 
ATOM 4381  N N   . SER C 1 14  ? -30.835 51.806  -27.852 1.00 46.47  ? 14  SER C N   1 
ATOM 4382  C CA  . SER C 1 14  ? -31.737 52.935  -27.992 1.00 44.41  ? 14  SER C CA  1 
ATOM 4383  C C   . SER C 1 14  ? -32.525 52.916  -29.320 1.00 46.49  ? 14  SER C C   1 
ATOM 4384  O O   . SER C 1 14  ? -32.077 52.323  -30.292 1.00 46.41  ? 14  SER C O   1 
ATOM 4385  C CB  . SER C 1 14  ? -30.902 54.206  -27.920 1.00 44.33  ? 14  SER C CB  1 
ATOM 4386  O OG  . SER C 1 14  ? -31.658 55.380  -28.137 1.00 48.61  ? 14  SER C OG  1 
ATOM 4387  N N   . LEU C 1 15  ? -33.673 53.621  -29.364 1.00 40.52  ? 15  LEU C N   1 
ATOM 4388  C CA  . LEU C 1 15  ? -34.480 53.793  -30.577 1.00 38.75  ? 15  LEU C CA  1 
ATOM 4389  C C   . LEU C 1 15  ? -34.091 55.091  -31.296 1.00 40.05  ? 15  LEU C C   1 
ATOM 4390  O O   . LEU C 1 15  ? -34.474 55.310  -32.446 1.00 36.58  ? 15  LEU C O   1 
ATOM 4391  C CB  . LEU C 1 15  ? -35.989 53.776  -30.264 1.00 38.29  ? 15  LEU C CB  1 
ATOM 4392  C CG  . LEU C 1 15  ? -36.512 52.510  -29.578 1.00 41.29  ? 15  LEU C CG  1 
ATOM 4393  C CD1 . LEU C 1 15  ? -37.964 52.623  -29.274 1.00 40.39  ? 15  LEU C CD1 1 
ATOM 4394  C CD2 . LEU C 1 15  ? -36.286 51.300  -30.431 1.00 39.37  ? 15  LEU C CD2 1 
ATOM 4395  N N   . ALA C 1 16  ? -33.283 55.924  -30.612 1.00 39.26  ? 16  ALA C N   1 
ATOM 4396  C CA  . ALA C 1 16  ? -32.766 57.229  -31.070 1.00 39.19  ? 16  ALA C CA  1 
ATOM 4397  C C   . ALA C 1 16  ? -32.019 57.152  -32.418 1.00 42.55  ? 16  ALA C C   1 
ATOM 4398  O O   . ALA C 1 16  ? -32.373 57.945  -33.278 1.00 42.42  ? 16  ALA C O   1 
ATOM 4399  C CB  . ALA C 1 16  ? -31.880 57.866  -30.005 1.00 39.12  ? 16  ALA C CB  1 
ATOM 4400  N N   . PRO C 1 17  ? -31.058 56.231  -32.666 1.00 40.74  ? 17  PRO C N   1 
ATOM 4401  C CA  . PRO C 1 17  ? -30.394 56.187  -33.988 1.00 41.67  ? 17  PRO C CA  1 
ATOM 4402  C C   . PRO C 1 17  ? -31.362 56.090  -35.184 1.00 48.78  ? 17  PRO C C   1 
ATOM 4403  O O   . PRO C 1 17  ? -31.225 56.850  -36.150 1.00 48.08  ? 17  PRO C O   1 
ATOM 4404  C CB  . PRO C 1 17  ? -29.520 54.926  -33.888 1.00 42.62  ? 17  PRO C CB  1 
ATOM 4405  C CG  . PRO C 1 17  ? -29.192 54.827  -32.459 1.00 46.35  ? 17  PRO C CG  1 
ATOM 4406  C CD  . PRO C 1 17  ? -30.476 55.209  -31.769 1.00 43.03  ? 17  PRO C CD  1 
ATOM 4407  N N   . MET C 1 18  ? -32.352 55.179  -35.114 1.00 47.83  ? 18  MET C N   1 
ATOM 4408  C CA  . MET C 1 18  ? -33.333 55.074  -36.186 1.00 47.01  ? 18  MET C CA  1 
ATOM 4409  C C   . MET C 1 18  ? -34.374 56.236  -36.131 1.00 47.08  ? 18  MET C C   1 
ATOM 4410  O O   . MET C 1 18  ? -34.808 56.650  -37.204 1.00 47.62  ? 18  MET C O   1 
ATOM 4411  C CB  . MET C 1 18  ? -33.999 53.680  -36.232 1.00 49.61  ? 18  MET C CB  1 
ATOM 4412  C CG  . MET C 1 18  ? -35.107 53.458  -35.250 1.00 54.39  ? 18  MET C CG  1 
ATOM 4413  S SD  . MET C 1 18  ? -36.756 53.884  -35.861 1.00 59.60  ? 18  MET C SD  1 
ATOM 4414  C CE  . MET C 1 18  ? -37.736 53.136  -34.599 1.00 56.16  ? 18  MET C CE  1 
ATOM 4415  N N   . LEU C 1 19  ? -34.776 56.762  -34.935 1.00 40.09  ? 19  LEU C N   1 
ATOM 4416  C CA  . LEU C 1 19  ? -35.800 57.830  -34.933 1.00 40.31  ? 19  LEU C CA  1 
ATOM 4417  C C   . LEU C 1 19  ? -35.260 59.143  -35.476 1.00 49.48  ? 19  LEU C C   1 
ATOM 4418  O O   . LEU C 1 19  ? -36.017 59.904  -36.068 1.00 50.98  ? 19  LEU C O   1 
ATOM 4419  C CB  . LEU C 1 19  ? -36.465 58.077  -33.562 1.00 39.07  ? 19  LEU C CB  1 
ATOM 4420  C CG  . LEU C 1 19  ? -37.398 56.974  -33.045 1.00 40.55  ? 19  LEU C CG  1 
ATOM 4421  C CD1 . LEU C 1 19  ? -37.557 57.059  -31.530 1.00 37.99  ? 19  LEU C CD1 1 
ATOM 4422  C CD2 . LEU C 1 19  ? -38.733 56.940  -33.806 1.00 39.81  ? 19  LEU C CD2 1 
ATOM 4423  N N   . GLU C 1 20  ? -33.955 59.384  -35.301 1.00 47.68  ? 20  GLU C N   1 
ATOM 4424  C CA  . GLU C 1 20  ? -33.233 60.560  -35.755 1.00 48.96  ? 20  GLU C CA  1 
ATOM 4425  C C   . GLU C 1 20  ? -33.457 60.802  -37.266 1.00 54.41  ? 20  GLU C C   1 
ATOM 4426  O O   . GLU C 1 20  ? -33.708 61.945  -37.687 1.00 55.78  ? 20  GLU C O   1 
ATOM 4427  C CB  . GLU C 1 20  ? -31.742 60.331  -35.486 1.00 50.98  ? 20  GLU C CB  1 
ATOM 4428  C CG  . GLU C 1 20  ? -30.982 61.483  -34.862 1.00 64.24  ? 20  GLU C CG  1 
ATOM 4429  C CD  . GLU C 1 20  ? -29.649 61.069  -34.260 1.00 95.87  ? 20  GLU C CD  1 
ATOM 4430  O OE1 . GLU C 1 20  ? -29.096 60.018  -34.669 1.00 76.48  ? 20  GLU C OE1 1 
ATOM 4431  O OE2 . GLU C 1 20  ? -29.177 61.783  -33.344 1.00 100.34 ? 20  GLU C OE2 1 
ATOM 4432  N N   . LYS C 1 21  ? -33.396 59.714  -38.061 1.00 48.35  ? 21  LYS C N   1 
ATOM 4433  C CA  . LYS C 1 21  ? -33.527 59.753  -39.519 1.00 47.61  ? 21  LYS C CA  1 
ATOM 4434  C C   . LYS C 1 21  ? -34.969 59.843  -39.992 1.00 52.02  ? 21  LYS C C   1 
ATOM 4435  O O   . LYS C 1 21  ? -35.233 60.374  -41.068 1.00 53.23  ? 21  LYS C O   1 
ATOM 4436  C CB  . LYS C 1 21  ? -32.890 58.493  -40.177 1.00 48.23  ? 21  LYS C CB  1 
ATOM 4437  C CG  . LYS C 1 21  ? -31.523 58.021  -39.655 1.00 40.62  ? 21  LYS C CG  1 
ATOM 4438  C CD  . LYS C 1 21  ? -31.202 56.687  -40.282 1.00 37.53  ? 21  LYS C CD  1 
ATOM 4439  C CE  . LYS C 1 21  ? -30.182 55.881  -39.544 1.00 51.50  ? 21  LYS C CE  1 
ATOM 4440  N NZ  . LYS C 1 21  ? -29.910 54.584  -40.235 1.00 61.34  ? 21  LYS C NZ  1 
ATOM 4441  N N   . VAL C 1 22  ? -35.892 59.315  -39.201 1.00 47.06  ? 22  VAL C N   1 
ATOM 4442  C CA  . VAL C 1 22  ? -37.296 59.097  -39.550 1.00 44.91  ? 22  VAL C CA  1 
ATOM 4443  C C   . VAL C 1 22  ? -38.287 60.137  -38.970 1.00 47.78  ? 22  VAL C C   1 
ATOM 4444  O O   . VAL C 1 22  ? -39.219 60.519  -39.670 1.00 46.21  ? 22  VAL C O   1 
ATOM 4445  C CB  . VAL C 1 22  ? -37.570 57.653  -39.058 1.00 47.20  ? 22  VAL C CB  1 
ATOM 4446  C CG1 . VAL C 1 22  ? -38.863 57.495  -38.261 1.00 47.30  ? 22  VAL C CG1 1 
ATOM 4447  C CG2 . VAL C 1 22  ? -37.437 56.654  -40.192 1.00 45.62  ? 22  VAL C CG2 1 
ATOM 4448  N N   . LEU C 1 23  ? -38.070 60.633  -37.739 1.00 44.42  ? 23  LEU C N   1 
ATOM 4449  C CA  . LEU C 1 23  ? -38.994 61.588  -37.122 1.00 44.26  ? 23  LEU C CA  1 
ATOM 4450  C C   . LEU C 1 23  ? -39.355 62.780  -38.050 1.00 49.16  ? 23  LEU C C   1 
ATOM 4451  O O   . LEU C 1 23  ? -40.535 63.170  -38.043 1.00 49.19  ? 23  LEU C O   1 
ATOM 4452  C CB  . LEU C 1 23  ? -38.450 62.120  -35.781 1.00 44.41  ? 23  LEU C CB  1 
ATOM 4453  C CG  . LEU C 1 23  ? -38.417 61.148  -34.594 1.00 49.88  ? 23  LEU C CG  1 
ATOM 4454  C CD1 . LEU C 1 23  ? -37.644 61.733  -33.442 1.00 49.70  ? 23  LEU C CD1 1 
ATOM 4455  C CD2 . LEU C 1 23  ? -39.825 60.663  -34.175 1.00 51.73  ? 23  LEU C CD2 1 
ATOM 4456  N N   . PRO C 1 24  ? -38.404 63.361  -38.861 1.00 44.39  ? 24  PRO C N   1 
ATOM 4457  C CA  . PRO C 1 24  ? -38.772 64.492  -39.714 1.00 43.77  ? 24  PRO C CA  1 
ATOM 4458  C C   . PRO C 1 24  ? -39.959 64.222  -40.654 1.00 46.39  ? 24  PRO C C   1 
ATOM 4459  O O   . PRO C 1 24  ? -40.687 65.184  -40.975 1.00 45.28  ? 24  PRO C O   1 
ATOM 4460  C CB  . PRO C 1 24  ? -37.490 64.736  -40.500 1.00 45.51  ? 24  PRO C CB  1 
ATOM 4461  C CG  . PRO C 1 24  ? -36.416 64.290  -39.584 1.00 49.05  ? 24  PRO C CG  1 
ATOM 4462  C CD  . PRO C 1 24  ? -36.958 63.062  -39.009 1.00 44.88  ? 24  PRO C CD  1 
ATOM 4463  N N   . ALA C 1 25  ? -40.192 62.913  -41.036 1.00 41.19  ? 25  ALA C N   1 
ATOM 4464  C CA  . ALA C 1 25  ? -41.286 62.473  -41.932 1.00 39.33  ? 25  ALA C CA  1 
ATOM 4465  C C   . ALA C 1 25  ? -42.684 62.550  -41.280 1.00 42.24  ? 25  ALA C C   1 
ATOM 4466  O O   . ALA C 1 25  ? -43.690 62.494  -41.985 1.00 40.38  ? 25  ALA C O   1 
ATOM 4467  C CB  . ALA C 1 25  ? -41.032 61.055  -42.421 1.00 39.37  ? 25  ALA C CB  1 
ATOM 4468  N N   . VAL C 1 26  ? -42.751 62.632  -39.940 1.00 39.93  ? 26  VAL C N   1 
ATOM 4469  C CA  . VAL C 1 26  ? -44.038 62.668  -39.239 1.00 39.81  ? 26  VAL C CA  1 
ATOM 4470  C C   . VAL C 1 26  ? -44.339 64.091  -38.870 1.00 47.97  ? 26  VAL C C   1 
ATOM 4471  O O   . VAL C 1 26  ? -43.566 64.724  -38.155 1.00 50.14  ? 26  VAL C O   1 
ATOM 4472  C CB  . VAL C 1 26  ? -44.090 61.751  -38.018 1.00 41.28  ? 26  VAL C CB  1 
ATOM 4473  C CG1 . VAL C 1 26  ? -45.507 61.697  -37.460 1.00 40.54  ? 26  VAL C CG1 1 
ATOM 4474  C CG2 . VAL C 1 26  ? -43.568 60.359  -38.360 1.00 40.26  ? 26  VAL C CG2 1 
ATOM 4475  N N   . VAL C 1 27  ? -45.462 64.592  -39.358 1.00 44.43  ? 27  VAL C N   1 
ATOM 4476  C CA  . VAL C 1 27  ? -45.850 65.989  -39.197 1.00 43.94  ? 27  VAL C CA  1 
ATOM 4477  C C   . VAL C 1 27  ? -47.077 66.167  -38.294 1.00 46.79  ? 27  VAL C C   1 
ATOM 4478  O O   . VAL C 1 27  ? -47.807 65.224  -38.020 1.00 46.16  ? 27  VAL C O   1 
ATOM 4479  C CB  . VAL C 1 27  ? -46.099 66.643  -40.602 1.00 46.65  ? 27  VAL C CB  1 
ATOM 4480  C CG1 . VAL C 1 27  ? -44.887 66.473  -41.495 1.00 45.66  ? 27  VAL C CG1 1 
ATOM 4481  C CG2 . VAL C 1 27  ? -47.345 66.072  -41.287 1.00 46.18  ? 27  VAL C CG2 1 
ATOM 4482  N N   . SER C 1 28  ? -47.309 67.411  -37.908 1.00 44.50  ? 28  SER C N   1 
ATOM 4483  C CA  . SER C 1 28  ? -48.434 67.887  -37.129 1.00 45.98  ? 28  SER C CA  1 
ATOM 4484  C C   . SER C 1 28  ? -49.422 68.504  -38.118 1.00 54.81  ? 28  SER C C   1 
ATOM 4485  O O   . SER C 1 28  ? -49.009 69.277  -38.989 1.00 57.05  ? 28  SER C O   1 
ATOM 4486  C CB  . SER C 1 28  ? -47.947 68.893  -36.083 1.00 49.42  ? 28  SER C CB  1 
ATOM 4487  O OG  . SER C 1 28  ? -48.958 69.810  -35.697 1.00 61.08  ? 28  SER C OG  1 
ATOM 4488  N N   . VAL C 1 29  ? -50.706 68.138  -38.028 1.00 51.44  ? 29  VAL C N   1 
ATOM 4489  C CA  . VAL C 1 29  ? -51.725 68.638  -38.948 1.00 50.38  ? 29  VAL C CA  1 
ATOM 4490  C C   . VAL C 1 29  ? -52.673 69.570  -38.173 1.00 58.05  ? 29  VAL C C   1 
ATOM 4491  O O   . VAL C 1 29  ? -53.358 69.145  -37.243 1.00 57.45  ? 29  VAL C O   1 
ATOM 4492  C CB  . VAL C 1 29  ? -52.447 67.464  -39.669 1.00 52.07  ? 29  VAL C CB  1 
ATOM 4493  C CG1 . VAL C 1 29  ? -53.611 67.961  -40.527 1.00 52.01  ? 29  VAL C CG1 1 
ATOM 4494  C CG2 . VAL C 1 29  ? -51.466 66.666  -40.518 1.00 50.79  ? 29  VAL C CG2 1 
ATOM 4495  N N   . ARG C 1 30  ? -52.652 70.850  -38.528 1.00 59.52  ? 30  ARG C N   1 
ATOM 4496  C CA  . ARG C 1 30  ? -53.464 71.884  -37.893 1.00 62.18  ? 30  ARG C CA  1 
ATOM 4497  C C   . ARG C 1 30  ? -54.589 72.247  -38.857 1.00 70.11  ? 30  ARG C C   1 
ATOM 4498  O O   . ARG C 1 30  ? -54.369 72.460  -40.056 1.00 70.04  ? 30  ARG C O   1 
ATOM 4499  C CB  . ARG C 1 30  ? -52.589 73.094  -37.511 1.00 66.28  ? 30  ARG C CB  1 
ATOM 4500  C CG  . ARG C 1 30  ? -53.218 74.051  -36.510 1.00 87.21  ? 30  ARG C CG  1 
ATOM 4501  C CD  . ARG C 1 30  ? -52.400 75.331  -36.450 1.00 112.16 ? 30  ARG C CD  1 
ATOM 4502  N NE  . ARG C 1 30  ? -53.015 76.360  -35.608 1.00 133.43 ? 30  ARG C NE  1 
ATOM 4503  C CZ  . ARG C 1 30  ? -52.475 77.552  -35.360 1.00 151.80 ? 30  ARG C CZ  1 
ATOM 4504  N NH1 . ARG C 1 30  ? -51.297 77.878  -35.882 1.00 136.19 ? 30  ARG C NH1 1 
ATOM 4505  N NH2 . ARG C 1 30  ? -53.104 78.424  -34.583 1.00 142.38 ? 30  ARG C NH2 1 
ATOM 4506  N N   . VAL C 1 31  ? -55.801 72.264  -38.333 1.00 69.42  ? 31  VAL C N   1 
ATOM 4507  C CA  . VAL C 1 31  ? -56.999 72.470  -39.121 1.00 70.79  ? 31  VAL C CA  1 
ATOM 4508  C C   . VAL C 1 31  ? -57.846 73.622  -38.540 1.00 76.77  ? 31  VAL C C   1 
ATOM 4509  O O   . VAL C 1 31  ? -57.925 73.797  -37.327 1.00 76.39  ? 31  VAL C O   1 
ATOM 4510  C CB  . VAL C 1 31  ? -57.742 71.095  -39.174 1.00 75.57  ? 31  VAL C CB  1 
ATOM 4511  C CG1 . VAL C 1 31  ? -59.263 71.218  -39.157 1.00 75.71  ? 31  VAL C CG1 1 
ATOM 4512  C CG2 . VAL C 1 31  ? -57.254 70.249  -40.354 1.00 75.48  ? 31  VAL C CG2 1 
ATOM 4513  N N   . GLU C 1 32  ? -58.452 74.415  -39.437 1.00 75.68  ? 32  GLU C N   1 
ATOM 4514  C CA  . GLU C 1 32  ? -59.356 75.539  -39.134 1.00 76.10  ? 32  GLU C CA  1 
ATOM 4515  C C   . GLU C 1 32  ? -60.607 75.386  -39.975 1.00 80.65  ? 32  GLU C C   1 
ATOM 4516  O O   . GLU C 1 32  ? -60.515 75.136  -41.171 1.00 79.85  ? 32  GLU C O   1 
ATOM 4517  C CB  . GLU C 1 32  ? -58.689 76.907  -39.394 1.00 77.44  ? 32  GLU C CB  1 
ATOM 4518  C CG  . GLU C 1 32  ? -57.624 77.275  -38.378 1.00 88.37  ? 32  GLU C CG  1 
ATOM 4519  C CD  . GLU C 1 32  ? -57.086 78.685  -38.493 1.00 111.81 ? 32  GLU C CD  1 
ATOM 4520  O OE1 . GLU C 1 32  ? -56.445 78.991  -39.524 1.00 95.95  ? 32  GLU C OE1 1 
ATOM 4521  O OE2 . GLU C 1 32  ? -57.269 79.470  -37.534 1.00 111.12 ? 32  GLU C OE2 1 
ATOM 4522  N N   . GLY C 1 33  ? -61.764 75.509  -39.352 1.00 79.71  ? 33  GLY C N   1 
ATOM 4523  C CA  . GLY C 1 33  ? -63.026 75.375  -40.067 1.00 80.75  ? 33  GLY C CA  1 
ATOM 4524  C C   . GLY C 1 33  ? -64.194 76.058  -39.395 1.00 86.75  ? 33  GLY C C   1 
ATOM 4525  O O   . GLY C 1 33  ? -64.026 77.112  -38.772 1.00 85.63  ? 33  GLY C O   1 
ATOM 4526  N N   . THR C 1 34  ? -65.393 75.451  -39.542 1.00 85.18  ? 34  THR C N   1 
ATOM 4527  C CA  . THR C 1 34  ? -66.652 75.937  -38.971 1.00 126.88 ? 34  THR C CA  1 
ATOM 4528  C C   . THR C 1 34  ? -67.271 74.861  -38.059 1.00 149.96 ? 34  THR C C   1 
ATOM 4529  O O   . THR C 1 34  ? -68.309 75.085  -37.434 1.00 109.44 ? 34  THR C O   1 
ATOM 4530  C CB  . THR C 1 34  ? -67.614 76.375  -40.091 1.00 136.26 ? 34  THR C CB  1 
ATOM 4531  O OG1 . THR C 1 34  ? -68.742 77.016  -39.496 1.00 137.21 ? 34  THR C OG1 1 
ATOM 4532  C CG2 . THR C 1 34  ? -68.070 75.206  -40.982 1.00 135.28 ? 34  THR C CG2 1 
ATOM 4533  N N   . GLN C 1 59  ? -69.730 78.413  -36.224 1.00 109.11 ? 59  GLN C N   1 
ATOM 4534  C CA  . GLN C 1 59  ? -68.721 79.014  -35.355 1.00 108.97 ? 59  GLN C CA  1 
ATOM 4535  C C   . GLN C 1 59  ? -67.317 78.458  -35.691 1.00 113.12 ? 59  GLN C C   1 
ATOM 4536  O O   . GLN C 1 59  ? -67.181 77.236  -35.830 1.00 113.26 ? 59  GLN C O   1 
ATOM 4537  C CB  . GLN C 1 59  ? -69.063 78.776  -33.866 1.00 110.25 ? 59  GLN C CB  1 
ATOM 4538  C CG  . GLN C 1 59  ? -68.306 79.690  -32.899 1.00 123.86 ? 59  GLN C CG  1 
ATOM 4539  C CD  . GLN C 1 59  ? -68.316 79.211  -31.469 1.00 140.18 ? 59  GLN C CD  1 
ATOM 4540  O OE1 . GLN C 1 59  ? -69.045 79.740  -30.628 1.00 133.32 ? 59  GLN C OE1 1 
ATOM 4541  N NE2 . GLN C 1 59  ? -67.454 78.251  -31.144 1.00 132.40 ? 59  GLN C NE2 1 
ATOM 4542  N N   . PRO C 1 60  ? -66.262 79.326  -35.795 1.00 108.72 ? 60  PRO C N   1 
ATOM 4543  C CA  . PRO C 1 60  ? -64.910 78.816  -36.121 1.00 107.73 ? 60  PRO C CA  1 
ATOM 4544  C C   . PRO C 1 60  ? -64.290 77.923  -35.040 1.00 107.30 ? 60  PRO C C   1 
ATOM 4545  O O   . PRO C 1 60  ? -64.523 78.130  -33.849 1.00 107.29 ? 60  PRO C O   1 
ATOM 4546  C CB  . PRO C 1 60  ? -64.072 80.096  -36.294 1.00 109.76 ? 60  PRO C CB  1 
ATOM 4547  C CG  . PRO C 1 60  ? -65.060 81.202  -36.480 1.00 114.27 ? 60  PRO C CG  1 
ATOM 4548  C CD  . PRO C 1 60  ? -66.256 80.802  -35.684 1.00 109.99 ? 60  PRO C CD  1 
ATOM 4549  N N   . PHE C 1 61  ? -63.489 76.932  -35.477 1.00 99.87  ? 61  PHE C N   1 
ATOM 4550  C CA  . PHE C 1 61  ? -62.796 75.974  -34.608 1.00 97.59  ? 61  PHE C CA  1 
ATOM 4551  C C   . PHE C 1 61  ? -61.358 75.729  -35.080 1.00 96.77  ? 61  PHE C C   1 
ATOM 4552  O O   . PHE C 1 61  ? -61.043 75.932  -36.256 1.00 96.01  ? 61  PHE C O   1 
ATOM 4553  C CB  . PHE C 1 61  ? -63.562 74.631  -34.532 1.00 98.99  ? 61  PHE C CB  1 
ATOM 4554  C CG  . PHE C 1 61  ? -63.394 73.705  -35.726 1.00 100.11 ? 61  PHE C CG  1 
ATOM 4555  C CD1 . PHE C 1 61  ? -62.344 72.789  -35.782 1.00 102.59 ? 61  PHE C CD1 1 
ATOM 4556  C CD2 . PHE C 1 61  ? -64.295 73.734  -36.782 1.00 101.84 ? 61  PHE C CD2 1 
ATOM 4557  C CE1 . PHE C 1 61  ? -62.177 71.950  -36.896 1.00 103.14 ? 61  PHE C CE1 1 
ATOM 4558  C CE2 . PHE C 1 61  ? -64.149 72.860  -37.880 1.00 104.45 ? 61  PHE C CE2 1 
ATOM 4559  C CZ  . PHE C 1 61  ? -63.078 71.995  -37.939 1.00 102.21 ? 61  PHE C CZ  1 
ATOM 4560  N N   . GLU C 1 62  ? -60.510 75.232  -34.161 1.00 89.92  ? 62  GLU C N   1 
ATOM 4561  C CA  . GLU C 1 62  ? -59.115 74.865  -34.419 1.00 87.72  ? 62  GLU C CA  1 
ATOM 4562  C C   . GLU C 1 62  ? -58.880 73.437  -33.934 1.00 84.08  ? 62  GLU C C   1 
ATOM 4563  O O   . GLU C 1 62  ? -59.012 73.158  -32.743 1.00 83.96  ? 62  GLU C O   1 
ATOM 4564  C CB  . GLU C 1 62  ? -58.134 75.854  -33.771 1.00 89.43  ? 62  GLU C CB  1 
ATOM 4565  C CG  . GLU C 1 62  ? -57.763 77.017  -34.681 1.00 103.15 ? 62  GLU C CG  1 
ATOM 4566  C CD  . GLU C 1 62  ? -56.884 78.111  -34.097 1.00 130.18 ? 62  GLU C CD  1 
ATOM 4567  O OE1 . GLU C 1 62  ? -55.904 77.784  -33.389 1.00 133.17 ? 62  GLU C OE1 1 
ATOM 4568  O OE2 . GLU C 1 62  ? -57.150 79.300  -34.393 1.00 122.01 ? 62  GLU C OE2 1 
ATOM 4569  N N   . GLY C 1 63  ? -58.602 72.545  -34.877 1.00 74.64  ? 63  GLY C N   1 
ATOM 4570  C CA  . GLY C 1 63  ? -58.381 71.129  -34.621 1.00 72.19  ? 63  GLY C CA  1 
ATOM 4571  C C   . GLY C 1 63  ? -56.949 70.704  -34.827 1.00 70.75  ? 63  GLY C C   1 
ATOM 4572  O O   . GLY C 1 63  ? -56.208 71.347  -35.585 1.00 70.24  ? 63  GLY C O   1 
ATOM 4573  N N   . LEU C 1 64  ? -56.544 69.619  -34.142 1.00 63.29  ? 64  LEU C N   1 
ATOM 4574  C CA  . LEU C 1 64  ? -55.169 69.154  -34.252 1.00 61.59  ? 64  LEU C CA  1 
ATOM 4575  C C   . LEU C 1 64  ? -55.068 67.646  -34.309 1.00 60.20  ? 64  LEU C C   1 
ATOM 4576  O O   . LEU C 1 64  ? -55.679 66.949  -33.502 1.00 59.35  ? 64  LEU C O   1 
ATOM 4577  C CB  . LEU C 1 64  ? -54.301 69.694  -33.102 1.00 61.78  ? 64  LEU C CB  1 
ATOM 4578  C CG  . LEU C 1 64  ? -52.949 70.223  -33.539 1.00 67.37  ? 64  LEU C CG  1 
ATOM 4579  C CD1 . LEU C 1 64  ? -52.670 71.593  -32.912 1.00 67.47  ? 64  LEU C CD1 1 
ATOM 4580  C CD2 . LEU C 1 64  ? -51.826 69.169  -33.303 1.00 71.99  ? 64  LEU C CD2 1 
ATOM 4581  N N   . GLY C 1 65  ? -54.264 67.179  -35.260 1.00 52.76  ? 65  GLY C N   1 
ATOM 4582  C CA  . GLY C 1 65  ? -53.940 65.781  -35.483 1.00 51.29  ? 65  GLY C CA  1 
ATOM 4583  C C   . GLY C 1 65  ? -52.520 65.645  -35.995 1.00 53.01  ? 65  GLY C C   1 
ATOM 4584  O O   . GLY C 1 65  ? -51.750 66.617  -35.966 1.00 53.74  ? 65  GLY C O   1 
ATOM 4585  N N   . SER C 1 66  ? -52.154 64.444  -36.459 1.00 45.39  ? 66  SER C N   1 
ATOM 4586  C CA  . SER C 1 66  ? -50.816 64.223  -36.993 1.00 44.74  ? 66  SER C CA  1 
ATOM 4587  C C   . SER C 1 66  ? -50.895 63.763  -38.444 1.00 47.16  ? 66  SER C C   1 
ATOM 4588  O O   . SER C 1 66  ? -51.983 63.513  -38.942 1.00 49.06  ? 66  SER C O   1 
ATOM 4589  C CB  . SER C 1 66  ? -50.051 63.196  -36.158 1.00 48.04  ? 66  SER C CB  1 
ATOM 4590  O OG  . SER C 1 66  ? -50.315 63.304  -34.773 1.00 58.49  ? 66  SER C OG  1 
ATOM 4591  N N   . GLY C 1 67  ? -49.755 63.649  -39.103 1.00 40.47  ? 67  GLY C N   1 
ATOM 4592  C CA  . GLY C 1 67  ? -49.688 63.154  -40.467 1.00 39.77  ? 67  GLY C CA  1 
ATOM 4593  C C   . GLY C 1 67  ? -48.349 62.507  -40.752 1.00 42.90  ? 67  GLY C C   1 
ATOM 4594  O O   . GLY C 1 67  ? -47.414 62.626  -39.958 1.00 43.93  ? 67  GLY C O   1 
ATOM 4595  N N   . VAL C 1 68  ? -48.248 61.821  -41.882 1.00 37.83  ? 68  VAL C N   1 
ATOM 4596  C CA  . VAL C 1 68  ? -47.018 61.158  -42.327 1.00 38.53  ? 68  VAL C CA  1 
ATOM 4597  C C   . VAL C 1 68  ? -46.700 61.567  -43.794 1.00 47.24  ? 68  VAL C C   1 
ATOM 4598  O O   . VAL C 1 68  ? -47.571 61.427  -44.665 1.00 46.81  ? 68  VAL C O   1 
ATOM 4599  C CB  . VAL C 1 68  ? -47.100 59.602  -42.199 1.00 40.83  ? 68  VAL C CB  1 
ATOM 4600  C CG1 . VAL C 1 68  ? -45.790 58.953  -42.638 1.00 40.49  ? 68  VAL C CG1 1 
ATOM 4601  C CG2 . VAL C 1 68  ? -47.481 59.153  -40.785 1.00 39.16  ? 68  VAL C CG2 1 
ATOM 4602  N N   . ILE C 1 69  ? -45.446 62.028  -44.067 1.00 44.94  ? 69  ILE C N   1 
ATOM 4603  C CA  . ILE C 1 69  ? -45.008 62.366  -45.419 1.00 44.53  ? 69  ILE C CA  1 
ATOM 4604  C C   . ILE C 1 69  ? -44.708 61.056  -46.125 1.00 52.83  ? 69  ILE C C   1 
ATOM 4605  O O   . ILE C 1 69  ? -43.798 60.314  -45.732 1.00 53.54  ? 69  ILE C O   1 
ATOM 4606  C CB  . ILE C 1 69  ? -43.842 63.379  -45.509 1.00 46.37  ? 69  ILE C CB  1 
ATOM 4607  C CG1 . ILE C 1 69  ? -44.217 64.730  -44.849 1.00 45.78  ? 69  ILE C CG1 1 
ATOM 4608  C CG2 . ILE C 1 69  ? -43.419 63.597  -46.985 1.00 46.41  ? 69  ILE C CG2 1 
ATOM 4609  C CD1 . ILE C 1 69  ? -42.971 65.576  -44.449 1.00 39.21  ? 69  ILE C CD1 1 
ATOM 4610  N N   . ILE C 1 70  ? -45.514 60.771  -47.141 1.00 51.96  ? 70  ILE C N   1 
ATOM 4611  C CA  . ILE C 1 70  ? -45.468 59.545  -47.912 1.00 54.14  ? 70  ILE C CA  1 
ATOM 4612  C C   . ILE C 1 70  ? -44.669 59.757  -49.230 1.00 60.26  ? 70  ILE C C   1 
ATOM 4613  O O   . ILE C 1 70  ? -44.051 58.813  -49.715 1.00 60.93  ? 70  ILE C O   1 
ATOM 4614  C CB  . ILE C 1 70  ? -46.938 59.087  -48.089 1.00 58.71  ? 70  ILE C CB  1 
ATOM 4615  C CG1 . ILE C 1 70  ? -47.128 57.621  -47.710 1.00 60.84  ? 70  ILE C CG1 1 
ATOM 4616  C CG2 . ILE C 1 70  ? -47.643 59.531  -49.385 1.00 59.61  ? 70  ILE C CG2 1 
ATOM 4617  C CD1 . ILE C 1 70  ? -48.354 56.891  -48.390 1.00 80.69  ? 70  ILE C CD1 1 
ATOM 4618  N N   . ASN C 1 71  ? -44.630 61.011  -49.748 1.00 56.93  ? 71  ASN C N   1 
ATOM 4619  C CA  . ASN C 1 71  ? -43.881 61.443  -50.941 1.00 56.00  ? 71  ASN C CA  1 
ATOM 4620  C C   . ASN C 1 71  ? -43.298 62.847  -50.714 1.00 58.78  ? 71  ASN C C   1 
ATOM 4621  O O   . ASN C 1 71  ? -44.030 63.833  -50.825 1.00 57.59  ? 71  ASN C O   1 
ATOM 4622  C CB  . ASN C 1 71  ? -44.758 61.435  -52.198 1.00 55.45  ? 71  ASN C CB  1 
ATOM 4623  C CG  . ASN C 1 71  ? -44.005 61.668  -53.502 1.00 75.12  ? 71  ASN C CG  1 
ATOM 4624  O OD1 . ASN C 1 71  ? -43.100 62.511  -53.618 1.00 70.38  ? 71  ASN C OD1 1 
ATOM 4625  N ND2 . ASN C 1 71  ? -44.382 60.934  -54.531 1.00 63.08  ? 71  ASN C ND2 1 
ATOM 4626  N N   . ALA C 1 72  ? -41.975 62.931  -50.430 1.00 54.98  ? 72  ALA C N   1 
ATOM 4627  C CA  . ALA C 1 72  ? -41.235 64.172  -50.164 1.00 54.11  ? 72  ALA C CA  1 
ATOM 4628  C C   . ALA C 1 72  ? -41.246 65.150  -51.360 1.00 60.27  ? 72  ALA C C   1 
ATOM 4629  O O   . ALA C 1 72  ? -41.420 66.349  -51.143 1.00 59.43  ? 72  ALA C O   1 
ATOM 4630  C CB  . ALA C 1 72  ? -39.811 63.842  -49.775 1.00 54.26  ? 72  ALA C CB  1 
ATOM 4631  N N   . SER C 1 73  ? -41.090 64.640  -52.613 1.00 59.46  ? 73  SER C N   1 
ATOM 4632  C CA  . SER C 1 73  ? -41.063 65.446  -53.857 1.00 60.17  ? 73  SER C CA  1 
ATOM 4633  C C   . SER C 1 73  ? -42.398 66.149  -54.129 1.00 63.74  ? 73  SER C C   1 
ATOM 4634  O O   . SER C 1 73  ? -42.410 67.354  -54.391 1.00 63.87  ? 73  SER C O   1 
ATOM 4635  C CB  . SER C 1 73  ? -40.695 64.589  -55.067 1.00 64.13  ? 73  SER C CB  1 
ATOM 4636  O OG  . SER C 1 73  ? -39.723 63.607  -54.745 1.00 76.79  ? 73  SER C OG  1 
ATOM 4637  N N   . LYS C 1 74  ? -43.513 65.400  -54.061 1.00 58.52  ? 74  LYS C N   1 
ATOM 4638  C CA  . LYS C 1 74  ? -44.859 65.923  -54.318 1.00 56.90  ? 74  LYS C CA  1 
ATOM 4639  C C   . LYS C 1 74  ? -45.502 66.540  -53.064 1.00 59.36  ? 74  LYS C C   1 
ATOM 4640  O O   . LYS C 1 74  ? -46.512 67.239  -53.187 1.00 60.07  ? 74  LYS C O   1 
ATOM 4641  C CB  . LYS C 1 74  ? -45.760 64.804  -54.867 1.00 58.18  ? 74  LYS C CB  1 
ATOM 4642  C CG  . LYS C 1 74  ? -45.236 64.145  -56.129 1.00 62.19  ? 74  LYS C CG  1 
ATOM 4643  C CD  . LYS C 1 74  ? -45.840 64.753  -57.393 1.00 69.87  ? 74  LYS C CD  1 
ATOM 4644  C CE  . LYS C 1 74  ? -45.432 64.027  -58.660 1.00 70.53  ? 74  LYS C CE  1 
ATOM 4645  N NZ  . LYS C 1 74  ? -46.004 62.648  -58.746 1.00 72.51  ? 74  LYS C NZ  1 
ATOM 4646  N N   . GLY C 1 75  ? -44.924 66.276  -51.888 1.00 53.43  ? 75  GLY C N   1 
ATOM 4647  C CA  . GLY C 1 75  ? -45.444 66.758  -50.611 1.00 52.53  ? 75  GLY C CA  1 
ATOM 4648  C C   . GLY C 1 75  ? -46.728 66.063  -50.199 1.00 55.23  ? 75  GLY C C   1 
ATOM 4649  O O   . GLY C 1 75  ? -47.623 66.708  -49.639 1.00 53.90  ? 75  GLY C O   1 
ATOM 4650  N N   . TYR C 1 76  ? -46.838 64.743  -50.500 1.00 51.12  ? 76  TYR C N   1 
ATOM 4651  C CA  . TYR C 1 76  ? -48.015 63.936  -50.166 1.00 51.33  ? 76  TYR C CA  1 
ATOM 4652  C C   . TYR C 1 76  ? -47.970 63.485  -48.699 1.00 54.57  ? 76  TYR C C   1 
ATOM 4653  O O   . TYR C 1 76  ? -47.025 62.808  -48.266 1.00 54.10  ? 76  TYR C O   1 
ATOM 4654  C CB  . TYR C 1 76  ? -48.166 62.716  -51.093 1.00 52.71  ? 76  TYR C CB  1 
ATOM 4655  C CG  . TYR C 1 76  ? -48.572 63.023  -52.519 1.00 56.68  ? 76  TYR C CG  1 
ATOM 4656  C CD1 . TYR C 1 76  ? -48.096 62.254  -53.584 1.00 58.40  ? 76  TYR C CD1 1 
ATOM 4657  C CD2 . TYR C 1 76  ? -49.494 64.036  -52.804 1.00 57.78  ? 76  TYR C CD2 1 
ATOM 4658  C CE1 . TYR C 1 76  ? -48.496 62.507  -54.896 1.00 58.50  ? 76  TYR C CE1 1 
ATOM 4659  C CE2 . TYR C 1 76  ? -49.895 64.302  -54.115 1.00 58.67  ? 76  TYR C CE2 1 
ATOM 4660  C CZ  . TYR C 1 76  ? -49.383 63.542  -55.158 1.00 65.90  ? 76  TYR C CZ  1 
ATOM 4661  O OH  . TYR C 1 76  ? -49.773 63.787  -56.454 1.00 65.96  ? 76  TYR C OH  1 
ATOM 4662  N N   . VAL C 1 77  ? -49.003 63.854  -47.947 1.00 48.40  ? 77  VAL C N   1 
ATOM 4663  C CA  . VAL C 1 77  ? -49.107 63.514  -46.544 1.00 46.00  ? 77  VAL C CA  1 
ATOM 4664  C C   . VAL C 1 77  ? -50.318 62.664  -46.336 1.00 49.10  ? 77  VAL C C   1 
ATOM 4665  O O   . VAL C 1 77  ? -51.415 63.083  -46.680 1.00 49.64  ? 77  VAL C O   1 
ATOM 4666  C CB  . VAL C 1 77  ? -49.150 64.780  -45.657 1.00 48.07  ? 77  VAL C CB  1 
ATOM 4667  C CG1 . VAL C 1 77  ? -49.365 64.432  -44.172 1.00 46.51  ? 77  VAL C CG1 1 
ATOM 4668  C CG2 . VAL C 1 77  ? -47.895 65.624  -45.857 1.00 47.44  ? 77  VAL C CG2 1 
ATOM 4669  N N   . LEU C 1 78  ? -50.125 61.487  -45.739 1.00 45.29  ? 78  LEU C N   1 
ATOM 4670  C CA  . LEU C 1 78  ? -51.206 60.593  -45.336 1.00 44.83  ? 78  LEU C CA  1 
ATOM 4671  C C   . LEU C 1 78  ? -51.719 61.007  -43.957 1.00 49.20  ? 78  LEU C C   1 
ATOM 4672  O O   . LEU C 1 78  ? -50.914 61.358  -43.092 1.00 49.25  ? 78  LEU C O   1 
ATOM 4673  C CB  . LEU C 1 78  ? -50.719 59.141  -45.285 1.00 44.42  ? 78  LEU C CB  1 
ATOM 4674  C CG  . LEU C 1 78  ? -51.477 58.139  -46.126 1.00 48.45  ? 78  LEU C CG  1 
ATOM 4675  C CD1 . LEU C 1 78  ? -50.960 56.768  -45.884 1.00 47.64  ? 78  LEU C CD1 1 
ATOM 4676  C CD2 . LEU C 1 78  ? -52.966 58.183  -45.850 1.00 52.30  ? 78  LEU C CD2 1 
ATOM 4677  N N   . THR C 1 79  ? -53.043 60.961  -43.749 1.00 45.77  ? 79  THR C N   1 
ATOM 4678  C CA  . THR C 1 79  ? -53.693 61.281  -42.467 1.00 46.07  ? 79  THR C CA  1 
ATOM 4679  C C   . THR C 1 79  ? -55.055 60.554  -42.387 1.00 51.40  ? 79  THR C C   1 
ATOM 4680  O O   . THR C 1 79  ? -55.347 59.668  -43.205 1.00 52.86  ? 79  THR C O   1 
ATOM 4681  C CB  . THR C 1 79  ? -53.792 62.825  -42.213 1.00 51.48  ? 79  THR C CB  1 
ATOM 4682  O OG1 . THR C 1 79  ? -54.090 63.081  -40.824 1.00 45.69  ? 79  THR C OG1 1 
ATOM 4683  C CG2 . THR C 1 79  ? -54.787 63.557  -43.165 1.00 45.86  ? 79  THR C CG2 1 
ATOM 4684  N N   . ASN C 1 80  ? -55.844 60.897  -41.357 1.00 45.91  ? 80  ASN C N   1 
ATOM 4685  C CA  . ASN C 1 80  ? -57.167 60.369  -41.075 1.00 44.20  ? 80  ASN C CA  1 
ATOM 4686  C C   . ASN C 1 80  ? -58.204 61.350  -41.552 1.00 48.84  ? 80  ASN C C   1 
ATOM 4687  O O   . ASN C 1 80  ? -58.095 62.559  -41.322 1.00 47.41  ? 80  ASN C O   1 
ATOM 4688  C CB  . ASN C 1 80  ? -57.335 60.137  -39.575 1.00 37.80  ? 80  ASN C CB  1 
ATOM 4689  C CG  . ASN C 1 80  ? -56.820 58.840  -39.030 1.00 52.21  ? 80  ASN C CG  1 
ATOM 4690  O OD1 . ASN C 1 80  ? -56.579 58.722  -37.842 1.00 53.07  ? 80  ASN C OD1 1 
ATOM 4691  N ND2 . ASN C 1 80  ? -56.721 57.806  -39.831 1.00 47.76  ? 80  ASN C ND2 1 
ATOM 4692  N N   . ASN C 1 81  ? -59.240 60.829  -42.171 1.00 47.53  ? 81  ASN C N   1 
ATOM 4693  C CA  . ASN C 1 81  ? -60.346 61.646  -42.658 1.00 48.94  ? 81  ASN C CA  1 
ATOM 4694  C C   . ASN C 1 81  ? -60.972 62.457  -41.515 1.00 55.11  ? 81  ASN C C   1 
ATOM 4695  O O   . ASN C 1 81  ? -61.229 63.651  -41.688 1.00 56.85  ? 81  ASN C O   1 
ATOM 4696  C CB  . ASN C 1 81  ? -61.397 60.766  -43.342 1.00 49.21  ? 81  ASN C CB  1 
ATOM 4697  C CG  . ASN C 1 81  ? -62.585 61.514  -43.852 1.00 64.38  ? 81  ASN C CG  1 
ATOM 4698  O OD1 . ASN C 1 81  ? -62.470 62.397  -44.701 1.00 57.40  ? 81  ASN C OD1 1 
ATOM 4699  N ND2 . ASN C 1 81  ? -63.751 61.182  -43.323 1.00 65.18  ? 81  ASN C ND2 1 
ATOM 4700  N N   . HIS C 1 82  ? -61.142 61.825  -40.342 1.00 50.88  ? 82  HIS C N   1 
ATOM 4701  C CA  . HIS C 1 82  ? -61.734 62.462  -39.181 1.00 50.79  ? 82  HIS C CA  1 
ATOM 4702  C C   . HIS C 1 82  ? -60.910 63.686  -38.678 1.00 53.22  ? 82  HIS C C   1 
ATOM 4703  O O   . HIS C 1 82  ? -61.473 64.551  -38.015 1.00 51.91  ? 82  HIS C O   1 
ATOM 4704  C CB  . HIS C 1 82  ? -61.999 61.431  -38.064 1.00 51.50  ? 82  HIS C CB  1 
ATOM 4705  C CG  . HIS C 1 82  ? -60.818 61.019  -37.234 1.00 54.11  ? 82  HIS C CG  1 
ATOM 4706  N ND1 . HIS C 1 82  ? -60.370 59.709  -37.221 1.00 55.41  ? 82  HIS C ND1 1 
ATOM 4707  C CD2 . HIS C 1 82  ? -60.109 61.727  -36.326 1.00 54.17  ? 82  HIS C CD2 1 
ATOM 4708  C CE1 . HIS C 1 82  ? -59.373 59.682  -36.356 1.00 53.75  ? 82  HIS C CE1 1 
ATOM 4709  N NE2 . HIS C 1 82  ? -59.184 60.871  -35.793 1.00 53.69  ? 82  HIS C NE2 1 
ATOM 4710  N N   . VAL C 1 83  ? -59.621 63.784  -39.035 1.00 50.53  ? 83  VAL C N   1 
ATOM 4711  C CA  . VAL C 1 83  ? -58.773 64.929  -38.656 1.00 50.55  ? 83  VAL C CA  1 
ATOM 4712  C C   . VAL C 1 83  ? -59.127 66.150  -39.542 1.00 56.68  ? 83  VAL C C   1 
ATOM 4713  O O   . VAL C 1 83  ? -59.177 67.283  -39.063 1.00 55.66  ? 83  VAL C O   1 
ATOM 4714  C CB  . VAL C 1 83  ? -57.247 64.565  -38.748 1.00 53.78  ? 83  VAL C CB  1 
ATOM 4715  C CG1 . VAL C 1 83  ? -56.349 65.789  -38.551 1.00 53.24  ? 83  VAL C CG1 1 
ATOM 4716  C CG2 . VAL C 1 83  ? -56.874 63.463  -37.754 1.00 53.29  ? 83  VAL C CG2 1 
ATOM 4717  N N   . ILE C 1 84  ? -59.417 65.882  -40.820 1.00 56.09  ? 84  ILE C N   1 
ATOM 4718  C CA  . ILE C 1 84  ? -59.643 66.826  -41.905 1.00 57.02  ? 84  ILE C CA  1 
ATOM 4719  C C   . ILE C 1 84  ? -61.131 67.106  -42.251 1.00 63.64  ? 84  ILE C C   1 
ATOM 4720  O O   . ILE C 1 84  ? -61.401 68.076  -42.945 1.00 65.10  ? 84  ILE C O   1 
ATOM 4721  C CB  . ILE C 1 84  ? -58.872 66.163  -43.084 1.00 60.13  ? 84  ILE C CB  1 
ATOM 4722  C CG1 . ILE C 1 84  ? -57.674 66.980  -43.503 1.00 61.39  ? 84  ILE C CG1 1 
ATOM 4723  C CG2 . ILE C 1 84  ? -59.708 65.594  -44.239 1.00 58.80  ? 84  ILE C CG2 1 
ATOM 4724  C CD1 . ILE C 1 84  ? -56.567 66.992  -42.473 1.00 71.88  ? 84  ILE C CD1 1 
ATOM 4725  N N   . ASN C 1 85  ? -62.058 66.272  -41.781 1.00 60.31  ? 85  ASN C N   1 
ATOM 4726  C CA  . ASN C 1 85  ? -63.498 66.287  -42.018 1.00 61.29  ? 85  ASN C CA  1 
ATOM 4727  C C   . ASN C 1 85  ? -64.156 67.673  -42.231 1.00 68.78  ? 85  ASN C C   1 
ATOM 4728  O O   . ASN C 1 85  ? -64.836 67.850  -43.246 1.00 67.52  ? 85  ASN C O   1 
ATOM 4729  C CB  . ASN C 1 85  ? -64.218 65.592  -40.866 1.00 64.14  ? 85  ASN C CB  1 
ATOM 4730  C CG  . ASN C 1 85  ? -65.092 64.456  -41.309 1.00 97.99  ? 85  ASN C CG  1 
ATOM 4731  O OD1 . ASN C 1 85  ? -65.638 64.452  -42.418 1.00 94.45  ? 85  ASN C OD1 1 
ATOM 4732  N ND2 . ASN C 1 85  ? -65.252 63.460  -40.447 1.00 94.04  ? 85  ASN C ND2 1 
ATOM 4733  N N   . GLN C 1 86  ? -63.999 68.632  -41.290 1.00 68.81  ? 86  GLN C N   1 
ATOM 4734  C CA  . GLN C 1 86  ? -64.687 69.934  -41.418 1.00 70.46  ? 86  GLN C CA  1 
ATOM 4735  C C   . GLN C 1 86  ? -63.739 71.109  -41.747 1.00 73.75  ? 86  GLN C C   1 
ATOM 4736  O O   . GLN C 1 86  ? -64.134 72.278  -41.640 1.00 73.08  ? 86  GLN C O   1 
ATOM 4737  C CB  . GLN C 1 86  ? -65.487 70.249  -40.129 1.00 72.39  ? 86  GLN C CB  1 
ATOM 4738  C CG  . GLN C 1 86  ? -66.495 69.157  -39.726 1.00 100.06 ? 86  GLN C CG  1 
ATOM 4739  C CD  . GLN C 1 86  ? -66.135 68.486  -38.415 1.00 127.36 ? 86  GLN C CD  1 
ATOM 4740  O OE1 . GLN C 1 86  ? -65.101 67.805  -38.289 1.00 125.50 ? 86  GLN C OE1 1 
ATOM 4741  N NE2 . GLN C 1 86  ? -67.005 68.637  -37.420 1.00 117.49 ? 86  GLN C NE2 1 
ATOM 4742  N N   . ALA C 1 87  ? -62.514 70.787  -42.177 1.00 70.34  ? 87  ALA C N   1 
ATOM 4743  C CA  . ALA C 1 87  ? -61.458 71.756  -42.471 1.00 70.02  ? 87  ALA C CA  1 
ATOM 4744  C C   . ALA C 1 87  ? -61.743 72.658  -43.670 1.00 72.22  ? 87  ALA C C   1 
ATOM 4745  O O   . ALA C 1 87  ? -62.171 72.197  -44.732 1.00 70.96  ? 87  ALA C O   1 
ATOM 4746  C CB  . ALA C 1 87  ? -60.135 71.043  -42.695 1.00 70.48  ? 87  ALA C CB  1 
ATOM 4747  N N   . GLN C 1 88  ? -61.450 73.949  -43.475 1.00 67.52  ? 88  GLN C N   1 
ATOM 4748  C CA  . GLN C 1 88  ? -61.521 75.021  -44.456 1.00 66.70  ? 88  GLN C CA  1 
ATOM 4749  C C   . GLN C 1 88  ? -60.094 75.454  -44.782 1.00 69.42  ? 88  GLN C C   1 
ATOM 4750  O O   . GLN C 1 88  ? -59.807 75.846  -45.915 1.00 70.21  ? 88  GLN C O   1 
ATOM 4751  C CB  . GLN C 1 88  ? -62.362 76.184  -43.930 1.00 67.91  ? 88  GLN C CB  1 
ATOM 4752  C CG  . GLN C 1 88  ? -63.852 75.854  -43.829 1.00 96.18  ? 88  GLN C CG  1 
ATOM 4753  C CD  . GLN C 1 88  ? -64.674 76.936  -43.168 1.00 125.69 ? 88  GLN C CD  1 
ATOM 4754  O OE1 . GLN C 1 88  ? -64.154 77.901  -42.589 1.00 125.70 ? 88  GLN C OE1 1 
ATOM 4755  N NE2 . GLN C 1 88  ? -65.988 76.785  -43.224 1.00 116.79 ? 88  GLN C NE2 1 
ATOM 4756  N N   . LYS C 1 89  ? -59.201 75.366  -43.781 1.00 63.66  ? 89  LYS C N   1 
ATOM 4757  C CA  . LYS C 1 89  ? -57.773 75.652  -43.890 1.00 63.45  ? 89  LYS C CA  1 
ATOM 4758  C C   . LYS C 1 89  ? -56.995 74.526  -43.211 1.00 66.12  ? 89  LYS C C   1 
ATOM 4759  O O   . LYS C 1 89  ? -57.362 74.099  -42.115 1.00 66.73  ? 89  LYS C O   1 
ATOM 4760  C CB  . LYS C 1 89  ? -57.418 77.023  -43.291 1.00 66.69  ? 89  LYS C CB  1 
ATOM 4761  C CG  . LYS C 1 89  ? -57.759 78.196  -44.208 1.00 89.26  ? 89  LYS C CG  1 
ATOM 4762  C CD  . LYS C 1 89  ? -57.547 79.559  -43.523 1.00 102.43 ? 89  LYS C CD  1 
ATOM 4763  C CE  . LYS C 1 89  ? -58.039 80.710  -44.374 1.00 113.70 ? 89  LYS C CE  1 
ATOM 4764  N NZ  . LYS C 1 89  ? -58.091 81.983  -43.613 1.00 122.97 ? 89  LYS C NZ  1 
ATOM 4765  N N   . ILE C 1 90  ? -55.965 74.006  -43.894 1.00 60.29  ? 90  ILE C N   1 
ATOM 4766  C CA  . ILE C 1 90  ? -55.107 72.930  -43.396 1.00 59.32  ? 90  ILE C CA  1 
ATOM 4767  C C   . ILE C 1 90  ? -53.647 73.388  -43.465 1.00 64.87  ? 90  ILE C C   1 
ATOM 4768  O O   . ILE C 1 90  ? -53.176 73.810  -44.527 1.00 65.65  ? 90  ILE C O   1 
ATOM 4769  C CB  . ILE C 1 90  ? -55.309 71.584  -44.162 1.00 61.62  ? 90  ILE C CB  1 
ATOM 4770  C CG1 . ILE C 1 90  ? -56.778 71.133  -44.150 1.00 60.62  ? 90  ILE C CG1 1 
ATOM 4771  C CG2 . ILE C 1 90  ? -54.393 70.480  -43.591 1.00 63.26  ? 90  ILE C CG2 1 
ATOM 4772  C CD1 . ILE C 1 90  ? -57.181 70.198  -45.278 1.00 56.95  ? 90  ILE C CD1 1 
ATOM 4773  N N   . SER C 1 91  ? -52.935 73.277  -42.333 1.00 61.02  ? 91  SER C N   1 
ATOM 4774  C CA  . SER C 1 91  ? -51.515 73.602  -42.239 1.00 60.62  ? 91  SER C CA  1 
ATOM 4775  C C   . SER C 1 91  ? -50.765 72.425  -41.656 1.00 64.47  ? 91  SER C C   1 
ATOM 4776  O O   . SER C 1 91  ? -51.315 71.672  -40.841 1.00 64.58  ? 91  SER C O   1 
ATOM 4777  C CB  . SER C 1 91  ? -51.263 74.869  -41.421 1.00 64.66  ? 91  SER C CB  1 
ATOM 4778  O OG  . SER C 1 91  ? -52.328 75.181  -40.533 1.00 76.47  ? 91  SER C OG  1 
ATOM 4779  N N   . ILE C 1 92  ? -49.520 72.241  -42.114 1.00 59.36  ? 92  ILE C N   1 
ATOM 4780  C CA  . ILE C 1 92  ? -48.642 71.169  -41.675 1.00 58.45  ? 92  ILE C CA  1 
ATOM 4781  C C   . ILE C 1 92  ? -47.454 71.805  -40.954 1.00 62.14  ? 92  ILE C C   1 
ATOM 4782  O O   . ILE C 1 92  ? -46.946 72.829  -41.405 1.00 61.44  ? 92  ILE C O   1 
ATOM 4783  C CB  . ILE C 1 92  ? -48.228 70.276  -42.902 1.00 61.01  ? 92  ILE C CB  1 
ATOM 4784  C CG1 . ILE C 1 92  ? -49.146 69.052  -43.045 1.00 61.34  ? 92  ILE C CG1 1 
ATOM 4785  C CG2 . ILE C 1 92  ? -46.770 69.797  -42.853 1.00 60.91  ? 92  ILE C CG2 1 
ATOM 4786  C CD1 . ILE C 1 92  ? -50.578 69.282  -43.377 1.00 67.97  ? 92  ILE C CD1 1 
ATOM 4787  N N   . GLN C 1 93  ? -47.032 71.217  -39.825 1.00 58.23  ? 93  GLN C N   1 
ATOM 4788  C CA  . GLN C 1 93  ? -45.852 71.709  -39.133 1.00 57.10  ? 93  GLN C CA  1 
ATOM 4789  C C   . GLN C 1 93  ? -44.845 70.588  -39.003 1.00 60.88  ? 93  GLN C C   1 
ATOM 4790  O O   . GLN C 1 93  ? -45.204 69.496  -38.568 1.00 61.44  ? 93  GLN C O   1 
ATOM 4791  C CB  . GLN C 1 93  ? -46.165 72.342  -37.777 1.00 57.48  ? 93  GLN C CB  1 
ATOM 4792  C CG  . GLN C 1 93  ? -44.930 73.045  -37.211 1.00 69.29  ? 93  GLN C CG  1 
ATOM 4793  C CD  . GLN C 1 93  ? -45.120 73.617  -35.837 1.00 86.10  ? 93  GLN C CD  1 
ATOM 4794  O OE1 . GLN C 1 93  ? -45.059 74.835  -35.647 1.00 87.52  ? 93  GLN C OE1 1 
ATOM 4795  N NE2 . GLN C 1 93  ? -45.307 72.760  -34.841 1.00 68.44  ? 93  GLN C NE2 1 
ATOM 4796  N N   . LEU C 1 94  ? -43.594 70.850  -39.415 1.00 56.30  ? 94  LEU C N   1 
ATOM 4797  C CA  . LEU C 1 94  ? -42.502 69.881  -39.318 1.00 55.73  ? 94  LEU C CA  1 
ATOM 4798  C C   . LEU C 1 94  ? -41.889 69.975  -37.936 1.00 60.74  ? 94  LEU C C   1 
ATOM 4799  O O   . LEU C 1 94  ? -42.085 70.987  -37.248 1.00 61.13  ? 94  LEU C O   1 
ATOM 4800  C CB  . LEU C 1 94  ? -41.429 70.092  -40.411 1.00 55.43  ? 94  LEU C CB  1 
ATOM 4801  C CG  . LEU C 1 94  ? -41.864 70.283  -41.874 1.00 59.03  ? 94  LEU C CG  1 
ATOM 4802  C CD1 . LEU C 1 94  ? -40.667 70.241  -42.775 1.00 59.69  ? 94  LEU C CD1 1 
ATOM 4803  C CD2 . LEU C 1 94  ? -42.852 69.236  -42.329 1.00 56.58  ? 94  LEU C CD2 1 
ATOM 4804  N N   . ASN C 1 95  ? -41.141 68.938  -37.518 1.00 57.92  ? 95  ASN C N   1 
ATOM 4805  C CA  . ASN C 1 95  ? -40.549 68.927  -36.171 1.00 58.18  ? 95  ASN C CA  1 
ATOM 4806  C C   . ASN C 1 95  ? -39.384 69.965  -36.019 1.00 62.54  ? 95  ASN C C   1 
ATOM 4807  O O   . ASN C 1 95  ? -38.934 70.202  -34.899 1.00 61.91  ? 95  ASN C O   1 
ATOM 4808  C CB  . ASN C 1 95  ? -40.126 67.499  -35.741 1.00 54.76  ? 95  ASN C CB  1 
ATOM 4809  C CG  . ASN C 1 95  ? -39.018 66.871  -36.544 1.00 77.78  ? 95  ASN C CG  1 
ATOM 4810  O OD1 . ASN C 1 95  ? -38.524 67.413  -37.556 1.00 89.36  ? 95  ASN C OD1 1 
ATOM 4811  N ND2 . ASN C 1 95  ? -38.603 65.700  -36.099 1.00 53.80  ? 95  ASN C ND2 1 
ATOM 4812  N N   . ASP C 1 96  ? -38.954 70.611  -37.130 1.00 59.50  ? 96  ASP C N   1 
ATOM 4813  C CA  . ASP C 1 96  ? -37.911 71.652  -37.135 1.00 58.36  ? 96  ASP C CA  1 
ATOM 4814  C C   . ASP C 1 96  ? -38.538 73.067  -36.988 1.00 61.00  ? 96  ASP C C   1 
ATOM 4815  O O   . ASP C 1 96  ? -37.812 74.067  -36.867 1.00 60.39  ? 96  ASP C O   1 
ATOM 4816  C CB  . ASP C 1 96  ? -37.037 71.563  -38.409 1.00 59.59  ? 96  ASP C CB  1 
ATOM 4817  C CG  . ASP C 1 96  ? -37.726 71.789  -39.756 1.00 70.31  ? 96  ASP C CG  1 
ATOM 4818  O OD1 . ASP C 1 96  ? -38.923 72.188  -39.764 1.00 70.89  ? 96  ASP C OD1 1 
ATOM 4819  O OD2 . ASP C 1 96  ? -37.063 71.580  -40.807 1.00 73.02  ? 96  ASP C OD2 1 
ATOM 4820  N N   . GLY C 1 97  ? -39.874 73.122  -37.019 1.00 56.03  ? 97  GLY C N   1 
ATOM 4821  C CA  . GLY C 1 97  ? -40.638 74.356  -36.877 1.00 55.14  ? 97  GLY C CA  1 
ATOM 4822  C C   . GLY C 1 97  ? -41.210 74.921  -38.164 1.00 60.63  ? 97  GLY C C   1 
ATOM 4823  O O   . GLY C 1 97  ? -41.996 75.870  -38.109 1.00 61.91  ? 97  GLY C O   1 
ATOM 4824  N N   . ARG C 1 98  ? -40.814 74.374  -39.337 1.00 56.40  ? 98  ARG C N   1 
ATOM 4825  C CA  . ARG C 1 98  ? -41.306 74.855  -40.626 1.00 55.85  ? 98  ARG C CA  1 
ATOM 4826  C C   . ARG C 1 98  ? -42.787 74.553  -40.804 1.00 60.46  ? 98  ARG C C   1 
ATOM 4827  O O   . ARG C 1 98  ? -43.235 73.437  -40.527 1.00 61.11  ? 98  ARG C O   1 
ATOM 4828  C CB  . ARG C 1 98  ? -40.508 74.239  -41.780 1.00 56.44  ? 98  ARG C CB  1 
ATOM 4829  C CG  . ARG C 1 98  ? -39.108 74.822  -41.924 1.00 62.38  ? 98  ARG C CG  1 
ATOM 4830  C CD  . ARG C 1 98  ? -38.454 74.422  -43.218 1.00 64.27  ? 98  ARG C CD  1 
ATOM 4831  N NE  . ARG C 1 98  ? -38.041 73.023  -43.213 1.00 76.40  ? 98  ARG C NE  1 
ATOM 4832  C CZ  . ARG C 1 98  ? -38.018 72.250  -44.294 1.00 89.01  ? 98  ARG C CZ  1 
ATOM 4833  N NH1 . ARG C 1 98  ? -38.404 72.730  -45.473 1.00 77.12  ? 98  ARG C NH1 1 
ATOM 4834  N NH2 . ARG C 1 98  ? -37.626 70.987  -44.204 1.00 69.90  ? 98  ARG C NH2 1 
ATOM 4835  N N   . GLU C 1 99  ? -43.539 75.563  -41.247 1.00 55.97  ? 99  GLU C N   1 
ATOM 4836  C CA  . GLU C 1 99  ? -44.975 75.501  -41.499 1.00 55.30  ? 99  GLU C CA  1 
ATOM 4837  C C   . GLU C 1 99  ? -45.255 75.582  -42.995 1.00 59.39  ? 99  GLU C C   1 
ATOM 4838  O O   . GLU C 1 99  ? -44.614 76.361  -43.703 1.00 59.92  ? 99  GLU C O   1 
ATOM 4839  C CB  . GLU C 1 99  ? -45.704 76.636  -40.763 1.00 56.54  ? 99  GLU C CB  1 
ATOM 4840  C CG  . GLU C 1 99  ? -45.786 76.449  -39.259 1.00 69.58  ? 99  GLU C CG  1 
ATOM 4841  C CD  . GLU C 1 99  ? -45.935 77.706  -38.420 1.00 104.49 ? 99  GLU C CD  1 
ATOM 4842  O OE1 . GLU C 1 99  ? -46.626 78.653  -38.864 1.00 104.77 ? 99  GLU C OE1 1 
ATOM 4843  O OE2 . GLU C 1 99  ? -45.399 77.718  -37.288 1.00 105.01 ? 99  GLU C OE2 1 
ATOM 4844  N N   . PHE C 1 100 ? -46.227 74.794  -43.465 1.00 55.52  ? 100 PHE C N   1 
ATOM 4845  C CA  . PHE C 1 100 ? -46.662 74.727  -44.860 1.00 55.53  ? 100 PHE C CA  1 
ATOM 4846  C C   . PHE C 1 100 ? -48.147 74.685  -44.961 1.00 62.90  ? 100 PHE C C   1 
ATOM 4847  O O   . PHE C 1 100 ? -48.810 74.156  -44.068 1.00 63.38  ? 100 PHE C O   1 
ATOM 4848  C CB  . PHE C 1 100 ? -46.123 73.466  -45.538 1.00 57.31  ? 100 PHE C CB  1 
ATOM 4849  C CG  . PHE C 1 100 ? -44.630 73.375  -45.706 1.00 58.90  ? 100 PHE C CG  1 
ATOM 4850  C CD1 . PHE C 1 100 ? -43.835 72.831  -44.705 1.00 62.48  ? 100 PHE C CD1 1 
ATOM 4851  C CD2 . PHE C 1 100 ? -44.021 73.779  -46.894 1.00 60.98  ? 100 PHE C CD2 1 
ATOM 4852  C CE1 . PHE C 1 100 ? -42.443 72.734  -44.870 1.00 64.29  ? 100 PHE C CE1 1 
ATOM 4853  C CE2 . PHE C 1 100 ? -42.637 73.663  -47.067 1.00 64.00  ? 100 PHE C CE2 1 
ATOM 4854  C CZ  . PHE C 1 100 ? -41.852 73.154  -46.050 1.00 62.60  ? 100 PHE C CZ  1 
ATOM 4855  N N   . ASP C 1 101 ? -48.686 75.173  -46.077 1.00 61.60  ? 101 ASP C N   1 
ATOM 4856  C CA  . ASP C 1 101 ? -50.109 75.060  -46.311 1.00 61.19  ? 101 ASP C CA  1 
ATOM 4857  C C   . ASP C 1 101 ? -50.345 73.746  -47.000 1.00 62.91  ? 101 ASP C C   1 
ATOM 4858  O O   . ASP C 1 101 ? -49.420 73.188  -47.610 1.00 61.37  ? 101 ASP C O   1 
ATOM 4859  C CB  . ASP C 1 101 ? -50.666 76.245  -47.101 1.00 63.86  ? 101 ASP C CB  1 
ATOM 4860  C CG  . ASP C 1 101 ? -51.478 77.153  -46.196 1.00 85.72  ? 101 ASP C CG  1 
ATOM 4861  O OD1 . ASP C 1 101 ? -52.662 76.807  -45.898 1.00 86.18  ? 101 ASP C OD1 1 
ATOM 4862  O OD2 . ASP C 1 101 ? -50.914 78.151  -45.709 1.00 98.81  ? 101 ASP C OD2 1 
ATOM 4863  N N   . ALA C 1 102 ? -51.556 73.205  -46.844 1.00 59.37  ? 102 ALA C N   1 
ATOM 4864  C CA  . ALA C 1 102 ? -51.882 71.921  -47.454 1.00 58.92  ? 102 ALA C CA  1 
ATOM 4865  C C   . ALA C 1 102 ? -53.273 71.948  -48.047 1.00 61.09  ? 102 ALA C C   1 
ATOM 4866  O O   . ALA C 1 102 ? -54.164 72.651  -47.540 1.00 60.56  ? 102 ALA C O   1 
ATOM 4867  C CB  . ALA C 1 102 ? -51.763 70.797  -46.426 1.00 59.33  ? 102 ALA C CB  1 
ATOM 4868  N N   . LYS C 1 103 ? -53.455 71.170  -49.122 1.00 55.26  ? 103 LYS C N   1 
ATOM 4869  C CA  . LYS C 1 103 ? -54.746 71.040  -49.786 1.00 54.48  ? 103 LYS C CA  1 
ATOM 4870  C C   . LYS C 1 103 ? -55.176 69.590  -49.764 1.00 55.64  ? 103 LYS C C   1 
ATOM 4871  O O   . LYS C 1 103 ? -54.331 68.704  -49.894 1.00 54.54  ? 103 LYS C O   1 
ATOM 4872  C CB  . LYS C 1 103 ? -54.669 71.572  -51.228 1.00 57.77  ? 103 LYS C CB  1 
ATOM 4873  C CG  . LYS C 1 103 ? -54.689 73.100  -51.349 1.00 64.85  ? 103 LYS C CG  1 
ATOM 4874  C CD  . LYS C 1 103 ? -54.567 73.518  -52.807 1.00 76.83  ? 103 LYS C CD  1 
ATOM 4875  C CE  . LYS C 1 103 ? -54.634 75.008  -53.037 1.00 88.26  ? 103 LYS C CE  1 
ATOM 4876  N NZ  . LYS C 1 103 ? -54.514 75.336  -54.488 1.00 95.34  ? 103 LYS C NZ  1 
ATOM 4877  N N   . LEU C 1 104 ? -56.483 69.346  -49.591 1.00 52.16  ? 104 LEU C N   1 
ATOM 4878  C CA  . LEU C 1 104 ? -57.018 67.986  -49.579 1.00 52.92  ? 104 LEU C CA  1 
ATOM 4879  C C   . LEU C 1 104 ? -57.043 67.419  -50.997 1.00 60.54  ? 104 LEU C C   1 
ATOM 4880  O O   . LEU C 1 104 ? -57.670 68.005  -51.882 1.00 61.57  ? 104 LEU C O   1 
ATOM 4881  C CB  . LEU C 1 104 ? -58.424 67.960  -48.956 1.00 52.80  ? 104 LEU C CB  1 
ATOM 4882  C CG  . LEU C 1 104 ? -59.128 66.590  -48.890 1.00 57.59  ? 104 LEU C CG  1 
ATOM 4883  C CD1 . LEU C 1 104 ? -58.397 65.615  -47.955 1.00 57.51  ? 104 LEU C CD1 1 
ATOM 4884  C CD2 . LEU C 1 104 ? -60.559 66.739  -48.457 1.00 59.20  ? 104 LEU C CD2 1 
ATOM 4885  N N   . ILE C 1 105 ? -56.325 66.310  -51.220 1.00 57.32  ? 105 ILE C N   1 
ATOM 4886  C CA  . ILE C 1 105 ? -56.281 65.632  -52.520 1.00 56.56  ? 105 ILE C CA  1 
ATOM 4887  C C   . ILE C 1 105 ? -57.525 64.734  -52.647 1.00 61.38  ? 105 ILE C C   1 
ATOM 4888  O O   . ILE C 1 105 ? -58.190 64.721  -53.686 1.00 63.28  ? 105 ILE C O   1 
ATOM 4889  C CB  . ILE C 1 105 ? -54.944 64.843  -52.715 1.00 58.82  ? 105 ILE C CB  1 
ATOM 4890  C CG1 . ILE C 1 105 ? -53.730 65.784  -52.853 1.00 58.46  ? 105 ILE C CG1 1 
ATOM 4891  C CG2 . ILE C 1 105 ? -55.010 63.839  -53.874 1.00 58.88  ? 105 ILE C CG2 1 
ATOM 4892  C CD1 . ILE C 1 105 ? -53.911 67.048  -53.814 1.00 58.71  ? 105 ILE C CD1 1 
ATOM 4893  N N   . GLY C 1 106 ? -57.823 64.009  -51.585 1.00 54.75  ? 106 GLY C N   1 
ATOM 4894  C CA  . GLY C 1 106 ? -58.963 63.116  -51.528 1.00 53.75  ? 106 GLY C CA  1 
ATOM 4895  C C   . GLY C 1 106 ? -59.061 62.444  -50.179 1.00 57.34  ? 106 GLY C C   1 
ATOM 4896  O O   . GLY C 1 106 ? -58.132 62.518  -49.375 1.00 55.65  ? 106 GLY C O   1 
ATOM 4897  N N   . SER C 1 107 ? -60.187 61.772  -49.930 1.00 56.02  ? 107 SER C N   1 
ATOM 4898  C CA  . SER C 1 107 ? -60.452 61.086  -48.673 1.00 56.03  ? 107 SER C CA  1 
ATOM 4899  C C   . SER C 1 107 ? -61.418 59.921  -48.852 1.00 58.06  ? 107 SER C C   1 
ATOM 4900  O O   . SER C 1 107 ? -62.151 59.875  -49.830 1.00 56.49  ? 107 SER C O   1 
ATOM 4901  C CB  . SER C 1 107 ? -61.020 62.070  -47.647 1.00 59.81  ? 107 SER C CB  1 
ATOM 4902  O OG  . SER C 1 107 ? -62.287 62.569  -48.047 1.00 66.93  ? 107 SER C OG  1 
ATOM 4903  N N   . ASP C 1 108 ? -61.412 58.992  -47.884 1.00 55.15  ? 108 ASP C N   1 
ATOM 4904  C CA  . ASP C 1 108 ? -62.317 57.850  -47.791 1.00 54.63  ? 108 ASP C CA  1 
ATOM 4905  C C   . ASP C 1 108 ? -62.924 57.824  -46.391 1.00 58.89  ? 108 ASP C C   1 
ATOM 4906  O O   . ASP C 1 108 ? -62.217 57.592  -45.412 1.00 57.18  ? 108 ASP C O   1 
ATOM 4907  C CB  . ASP C 1 108 ? -61.607 56.527  -48.123 1.00 55.85  ? 108 ASP C CB  1 
ATOM 4908  C CG  . ASP C 1 108 ? -62.496 55.289  -48.071 1.00 68.53  ? 108 ASP C CG  1 
ATOM 4909  O OD1 . ASP C 1 108 ? -63.750 55.445  -48.049 1.00 69.11  ? 108 ASP C OD1 1 
ATOM 4910  O OD2 . ASP C 1 108 ? -61.945 54.163  -48.093 1.00 74.77  ? 108 ASP C OD2 1 
ATOM 4911  N N   . ASP C 1 109 ? -64.230 58.079  -46.312 1.00 58.18  ? 109 ASP C N   1 
ATOM 4912  C CA  . ASP C 1 109 ? -65.026 58.092  -45.076 1.00 59.09  ? 109 ASP C CA  1 
ATOM 4913  C C   . ASP C 1 109 ? -65.062 56.714  -44.408 1.00 61.22  ? 109 ASP C C   1 
ATOM 4914  O O   . ASP C 1 109 ? -65.008 56.624  -43.183 1.00 61.91  ? 109 ASP C O   1 
ATOM 4915  C CB  . ASP C 1 109 ? -66.491 58.510  -45.370 1.00 62.51  ? 109 ASP C CB  1 
ATOM 4916  C CG  . ASP C 1 109 ? -66.743 59.675  -46.317 1.00 89.76  ? 109 ASP C CG  1 
ATOM 4917  O OD1 . ASP C 1 109 ? -67.828 60.299  -46.212 1.00 93.53  ? 109 ASP C OD1 1 
ATOM 4918  O OD2 . ASP C 1 109 ? -65.892 59.920  -47.213 1.00 100.27 ? 109 ASP C OD2 1 
ATOM 4919  N N   . GLN C 1 110 ? -65.212 55.649  -45.220 1.00 55.33  ? 110 GLN C N   1 
ATOM 4920  C CA  . GLN C 1 110 ? -65.371 54.277  -44.766 1.00 54.53  ? 110 GLN C CA  1 
ATOM 4921  C C   . GLN C 1 110 ? -64.114 53.704  -44.091 1.00 60.53  ? 110 GLN C C   1 
ATOM 4922  O O   . GLN C 1 110 ? -64.231 52.999  -43.085 1.00 60.88  ? 110 GLN C O   1 
ATOM 4923  C CB  . GLN C 1 110 ? -65.785 53.390  -45.928 1.00 55.46  ? 110 GLN C CB  1 
ATOM 4924  C CG  . GLN C 1 110 ? -67.251 53.513  -46.316 1.00 67.05  ? 110 GLN C CG  1 
ATOM 4925  C CD  . GLN C 1 110 ? -67.579 52.513  -47.414 1.00 90.77  ? 110 GLN C CD  1 
ATOM 4926  O OE1 . GLN C 1 110 ? -67.736 51.305  -47.177 1.00 84.65  ? 110 GLN C OE1 1 
ATOM 4927  N NE2 . GLN C 1 110 ? -67.646 52.987  -48.651 1.00 79.55  ? 110 GLN C NE2 1 
ATOM 4928  N N   . SER C 1 111 ? -62.927 53.979  -44.637 1.00 56.41  ? 111 SER C N   1 
ATOM 4929  C CA  . SER C 1 111 ? -61.703 53.455  -44.054 1.00 55.97  ? 111 SER C CA  1 
ATOM 4930  C C   . SER C 1 111 ? -61.009 54.465  -43.132 1.00 59.82  ? 111 SER C C   1 
ATOM 4931  O O   . SER C 1 111 ? -60.171 54.051  -42.339 1.00 60.63  ? 111 SER C O   1 
ATOM 4932  C CB  . SER C 1 111 ? -60.748 52.991  -45.146 1.00 57.81  ? 111 SER C CB  1 
ATOM 4933  O OG  . SER C 1 111 ? -60.431 54.076  -45.996 1.00 66.75  ? 111 SER C OG  1 
ATOM 4934  N N   . ASP C 1 112 ? -61.371 55.758  -43.218 1.00 55.71  ? 112 ASP C N   1 
ATOM 4935  C CA  . ASP C 1 112 ? -60.843 56.899  -42.442 1.00 55.59  ? 112 ASP C CA  1 
ATOM 4936  C C   . ASP C 1 112 ? -59.427 57.256  -42.909 1.00 60.51  ? 112 ASP C C   1 
ATOM 4937  O O   . ASP C 1 112 ? -58.530 57.485  -42.088 1.00 62.09  ? 112 ASP C O   1 
ATOM 4938  C CB  . ASP C 1 112 ? -60.894 56.685  -40.897 1.00 56.60  ? 112 ASP C CB  1 
ATOM 4939  C CG  . ASP C 1 112 ? -60.984 57.939  -40.035 1.00 53.20  ? 112 ASP C CG  1 
ATOM 4940  O OD1 . ASP C 1 112 ? -60.628 59.019  -40.523 1.00 50.02  ? 112 ASP C OD1 1 
ATOM 4941  O OD2 . ASP C 1 112 ? -61.381 57.823  -38.850 1.00 57.65  ? 112 ASP C OD2 1 
ATOM 4942  N N   . ILE C 1 113 ? -59.242 57.352  -44.234 1.00 54.69  ? 113 ILE C N   1 
ATOM 4943  C CA  . ILE C 1 113 ? -57.969 57.772  -44.792 1.00 52.61  ? 113 ILE C CA  1 
ATOM 4944  C C   . ILE C 1 113 ? -58.190 59.018  -45.645 1.00 54.67  ? 113 ILE C C   1 
ATOM 4945  O O   . ILE C 1 113 ? -59.166 59.097  -46.382 1.00 54.58  ? 113 ILE C O   1 
ATOM 4946  C CB  . ILE C 1 113 ? -57.249 56.625  -45.520 1.00 54.88  ? 113 ILE C CB  1 
ATOM 4947  C CG1 . ILE C 1 113 ? -56.302 55.965  -44.519 1.00 55.94  ? 113 ILE C CG1 1 
ATOM 4948  C CG2 . ILE C 1 113 ? -56.458 57.105  -46.764 1.00 53.11  ? 113 ILE C CG2 1 
ATOM 4949  C CD1 . ILE C 1 113 ? -56.189 54.596  -44.693 1.00 66.37  ? 113 ILE C CD1 1 
ATOM 4950  N N   . ALA C 1 114 ? -57.314 60.014  -45.486 1.00 49.18  ? 114 ALA C N   1 
ATOM 4951  C CA  . ALA C 1 114 ? -57.336 61.261  -46.232 1.00 47.49  ? 114 ALA C CA  1 
ATOM 4952  C C   . ALA C 1 114 ? -55.953 61.493  -46.724 1.00 52.73  ? 114 ALA C C   1 
ATOM 4953  O O   . ALA C 1 114 ? -55.013 61.073  -46.049 1.00 53.76  ? 114 ALA C O   1 
ATOM 4954  C CB  . ALA C 1 114 ? -57.801 62.407  -45.339 1.00 47.54  ? 114 ALA C CB  1 
ATOM 4955  N N   . LEU C 1 115 ? -55.799 62.100  -47.912 1.00 50.11  ? 115 LEU C N   1 
ATOM 4956  C CA  . LEU C 1 115 ? -54.488 62.425  -48.479 1.00 50.26  ? 115 LEU C CA  1 
ATOM 4957  C C   . LEU C 1 115 ? -54.409 63.926  -48.737 1.00 54.78  ? 115 LEU C C   1 
ATOM 4958  O O   . LEU C 1 115 ? -55.321 64.519  -49.313 1.00 56.03  ? 115 LEU C O   1 
ATOM 4959  C CB  . LEU C 1 115 ? -54.184 61.624  -49.750 1.00 50.41  ? 115 LEU C CB  1 
ATOM 4960  C CG  . LEU C 1 115 ? -52.790 61.852  -50.345 1.00 55.62  ? 115 LEU C CG  1 
ATOM 4961  C CD1 . LEU C 1 115 ? -51.746 60.929  -49.716 1.00 56.28  ? 115 LEU C CD1 1 
ATOM 4962  C CD2 . LEU C 1 115 ? -52.821 61.672  -51.825 1.00 58.01  ? 115 LEU C CD2 1 
ATOM 4963  N N   . LEU C 1 116 ? -53.327 64.534  -48.267 1.00 50.06  ? 116 LEU C N   1 
ATOM 4964  C CA  . LEU C 1 116 ? -53.068 65.953  -48.406 1.00 49.68  ? 116 LEU C CA  1 
ATOM 4965  C C   . LEU C 1 116 ? -51.838 66.199  -49.254 1.00 54.12  ? 116 LEU C C   1 
ATOM 4966  O O   . LEU C 1 116 ? -50.957 65.330  -49.348 1.00 52.47  ? 116 LEU C O   1 
ATOM 4967  C CB  . LEU C 1 116 ? -52.846 66.605  -47.021 1.00 49.33  ? 116 LEU C CB  1 
ATOM 4968  C CG  . LEU C 1 116 ? -53.833 66.312  -45.911 1.00 52.77  ? 116 LEU C CG  1 
ATOM 4969  C CD1 . LEU C 1 116 ? -53.339 66.885  -44.628 1.00 52.35  ? 116 LEU C CD1 1 
ATOM 4970  C CD2 . LEU C 1 116 ? -55.226 66.850  -46.237 1.00 54.70  ? 116 LEU C CD2 1 
ATOM 4971  N N   . GLN C 1 117 ? -51.766 67.406  -49.842 1.00 51.75  ? 117 GLN C N   1 
ATOM 4972  C CA  . GLN C 1 117 ? -50.604 67.829  -50.593 1.00 52.20  ? 117 GLN C CA  1 
ATOM 4973  C C   . GLN C 1 117 ? -50.102 69.145  -50.038 1.00 58.56  ? 117 GLN C C   1 
ATOM 4974  O O   . GLN C 1 117 ? -50.856 70.119  -49.954 1.00 59.74  ? 117 GLN C O   1 
ATOM 4975  C CB  . GLN C 1 117 ? -50.883 67.932  -52.086 1.00 53.16  ? 117 GLN C CB  1 
ATOM 4976  C CG  . GLN C 1 117 ? -49.628 68.229  -52.894 1.00 62.85  ? 117 GLN C CG  1 
ATOM 4977  C CD  . GLN C 1 117 ? -49.824 68.016  -54.362 1.00 72.32  ? 117 GLN C CD  1 
ATOM 4978  O OE1 . GLN C 1 117 ? -50.896 68.295  -54.928 1.00 74.74  ? 117 GLN C OE1 1 
ATOM 4979  N NE2 . GLN C 1 117 ? -48.777 67.531  -55.006 1.00 42.59  ? 117 GLN C NE2 1 
ATOM 4980  N N   . ILE C 1 118 ? -48.836 69.151  -49.628 1.00 55.48  ? 118 ILE C N   1 
ATOM 4981  C CA  . ILE C 1 118 ? -48.149 70.337  -49.130 1.00 56.09  ? 118 ILE C CA  1 
ATOM 4982  C C   . ILE C 1 118 ? -47.951 71.307  -50.308 1.00 61.65  ? 118 ILE C C   1 
ATOM 4983  O O   . ILE C 1 118 ? -47.479 70.902  -51.374 1.00 61.78  ? 118 ILE C O   1 
ATOM 4984  C CB  . ILE C 1 118 ? -46.798 69.957  -48.462 1.00 58.46  ? 118 ILE C CB  1 
ATOM 4985  C CG1 . ILE C 1 118 ? -47.019 69.266  -47.099 1.00 58.28  ? 118 ILE C CG1 1 
ATOM 4986  C CG2 . ILE C 1 118 ? -45.869 71.167  -48.336 1.00 58.19  ? 118 ILE C CG2 1 
ATOM 4987  C CD1 . ILE C 1 118 ? -45.810 68.519  -46.570 1.00 55.31  ? 118 ILE C CD1 1 
ATOM 4988  N N   . GLN C 1 119 ? -48.340 72.569  -50.104 1.00 57.45  ? 119 GLN C N   1 
ATOM 4989  C CA  . GLN C 1 119 ? -48.180 73.630  -51.076 1.00 56.69  ? 119 GLN C CA  1 
ATOM 4990  C C   . GLN C 1 119 ? -46.745 74.132  -50.998 1.00 62.68  ? 119 GLN C C   1 
ATOM 4991  O O   . GLN C 1 119 ? -46.274 74.526  -49.918 1.00 62.83  ? 119 GLN C O   1 
ATOM 4992  C CB  . GLN C 1 119 ? -49.209 74.753  -50.842 1.00 57.51  ? 119 GLN C CB  1 
ATOM 4993  C CG  . GLN C 1 119 ? -50.671 74.293  -50.934 1.00 67.06  ? 119 GLN C CG  1 
ATOM 4994  C CD  . GLN C 1 119 ? -50.997 73.591  -52.244 1.00 79.20  ? 119 GLN C CD  1 
ATOM 4995  O OE1 . GLN C 1 119 ? -51.117 74.220  -53.301 1.00 81.55  ? 119 GLN C OE1 1 
ATOM 4996  N NE2 . GLN C 1 119 ? -51.139 72.273  -52.209 1.00 57.09  ? 119 GLN C NE2 1 
ATOM 4997  N N   . ASN C 1 120 ? -46.040 74.059  -52.151 1.00 60.53  ? 120 ASN C N   1 
ATOM 4998  C CA  . ASN C 1 120 ? -44.631 74.433  -52.357 1.00 60.59  ? 120 ASN C CA  1 
ATOM 4999  C C   . ASN C 1 120 ? -43.721 73.671  -51.348 1.00 66.09  ? 120 ASN C C   1 
ATOM 5000  O O   . ASN C 1 120 ? -43.068 74.282  -50.483 1.00 66.50  ? 120 ASN C O   1 
ATOM 5001  C CB  . ASN C 1 120 ? -44.422 75.965  -52.323 1.00 56.35  ? 120 ASN C CB  1 
ATOM 5002  C CG  . ASN C 1 120 ? -45.269 76.687  -53.353 1.00 85.13  ? 120 ASN C CG  1 
ATOM 5003  O OD1 . ASN C 1 120 ? -46.202 77.425  -53.020 1.00 79.88  ? 120 ASN C OD1 1 
ATOM 5004  N ND2 . ASN C 1 120 ? -45.014 76.440  -54.638 1.00 78.75  ? 120 ASN C ND2 1 
ATOM 5005  N N   . PRO C 1 121 ? -43.679 72.316  -51.467 1.00 61.72  ? 121 PRO C N   1 
ATOM 5006  C CA  . PRO C 1 121 ? -42.822 71.529  -50.567 1.00 61.37  ? 121 PRO C CA  1 
ATOM 5007  C C   . PRO C 1 121 ? -41.342 71.796  -50.836 1.00 65.10  ? 121 PRO C C   1 
ATOM 5008  O O   . PRO C 1 121 ? -40.966 72.081  -51.977 1.00 64.45  ? 121 PRO C O   1 
ATOM 5009  C CB  . PRO C 1 121 ? -43.208 70.082  -50.901 1.00 62.59  ? 121 PRO C CB  1 
ATOM 5010  C CG  . PRO C 1 121 ? -43.715 70.128  -52.284 1.00 65.94  ? 121 PRO C CG  1 
ATOM 5011  C CD  . PRO C 1 121 ? -44.384 71.444  -52.433 1.00 62.10  ? 121 PRO C CD  1 
ATOM 5012  N N   . SER C 1 122 ? -40.512 71.684  -49.791 1.00 61.84  ? 122 SER C N   1 
ATOM 5013  C CA  . SER C 1 122 ? -39.072 71.922  -49.862 1.00 61.50  ? 122 SER C CA  1 
ATOM 5014  C C   . SER C 1 122 ? -38.340 71.177  -48.740 1.00 62.83  ? 122 SER C C   1 
ATOM 5015  O O   . SER C 1 122 ? -38.768 71.247  -47.595 1.00 60.90  ? 122 SER C O   1 
ATOM 5016  C CB  . SER C 1 122 ? -38.795 73.424  -49.778 1.00 65.42  ? 122 SER C CB  1 
ATOM 5017  O OG  . SER C 1 122 ? -37.430 73.697  -49.514 1.00 77.00  ? 122 SER C OG  1 
ATOM 5018  N N   . LYS C 1 123 ? -37.227 70.483  -49.082 1.00 59.43  ? 123 LYS C N   1 
ATOM 5019  C CA  . LYS C 1 123 ? -36.333 69.731  -48.179 1.00 58.91  ? 123 LYS C CA  1 
ATOM 5020  C C   . LYS C 1 123 ? -37.136 68.872  -47.164 1.00 61.19  ? 123 LYS C C   1 
ATOM 5021  O O   . LYS C 1 123 ? -36.937 68.950  -45.944 1.00 60.83  ? 123 LYS C O   1 
ATOM 5022  C CB  . LYS C 1 123 ? -35.372 70.698  -47.453 1.00 62.50  ? 123 LYS C CB  1 
ATOM 5023  C CG  . LYS C 1 123 ? -34.355 71.406  -48.346 1.00 75.11  ? 123 LYS C CG  1 
ATOM 5024  C CD  . LYS C 1 123 ? -33.605 72.473  -47.572 1.00 83.97  ? 123 LYS C CD  1 
ATOM 5025  C CE  . LYS C 1 123 ? -32.517 73.125  -48.399 1.00 87.39  ? 123 LYS C CE  1 
ATOM 5026  N NZ  . LYS C 1 123 ? -31.937 74.315  -47.713 1.00 85.91  ? 123 LYS C NZ  1 
ATOM 5027  N N   . LEU C 1 124 ? -38.067 68.069  -47.696 1.00 55.32  ? 124 LEU C N   1 
ATOM 5028  C CA  . LEU C 1 124 ? -38.941 67.181  -46.936 1.00 52.21  ? 124 LEU C CA  1 
ATOM 5029  C C   . LEU C 1 124 ? -38.342 65.785  -46.819 1.00 54.72  ? 124 LEU C C   1 
ATOM 5030  O O   . LEU C 1 124 ? -37.562 65.360  -47.674 1.00 53.83  ? 124 LEU C O   1 
ATOM 5031  C CB  . LEU C 1 124 ? -40.270 67.100  -47.675 1.00 51.48  ? 124 LEU C CB  1 
ATOM 5032  C CG  . LEU C 1 124 ? -41.486 67.844  -47.167 1.00 54.08  ? 124 LEU C CG  1 
ATOM 5033  C CD1 . LEU C 1 124 ? -41.170 69.238  -46.662 1.00 52.89  ? 124 LEU C CD1 1 
ATOM 5034  C CD2 . LEU C 1 124 ? -42.560 67.853  -48.222 1.00 55.53  ? 124 LEU C CD2 1 
ATOM 5035  N N   . THR C 1 125 ? -38.714 65.073  -45.754 1.00 51.42  ? 125 THR C N   1 
ATOM 5036  C CA  . THR C 1 125 ? -38.294 63.697  -45.499 1.00 50.76  ? 125 THR C CA  1 
ATOM 5037  C C   . THR C 1 125 ? -39.515 62.828  -45.661 1.00 53.82  ? 125 THR C C   1 
ATOM 5038  O O   . THR C 1 125 ? -40.582 63.194  -45.169 1.00 53.06  ? 125 THR C O   1 
ATOM 5039  C CB  . THR C 1 125 ? -37.660 63.568  -44.101 1.00 58.52  ? 125 THR C CB  1 
ATOM 5040  O OG1 . THR C 1 125 ? -36.621 64.544  -43.949 1.00 65.25  ? 125 THR C OG1 1 
ATOM 5041  C CG2 . THR C 1 125 ? -37.123 62.164  -43.819 1.00 51.65  ? 125 THR C CG2 1 
ATOM 5042  N N   . GLN C 1 126 ? -39.383 61.701  -46.367 1.00 50.04  ? 126 GLN C N   1 
ATOM 5043  C CA  . GLN C 1 126 ? -40.504 60.793  -46.536 1.00 49.35  ? 126 GLN C CA  1 
ATOM 5044  C C   . GLN C 1 126 ? -40.249 59.494  -45.805 1.00 54.18  ? 126 GLN C C   1 
ATOM 5045  O O   . GLN C 1 126 ? -39.105 59.138  -45.506 1.00 55.10  ? 126 GLN C O   1 
ATOM 5046  C CB  . GLN C 1 126 ? -40.836 60.536  -48.004 1.00 50.76  ? 126 GLN C CB  1 
ATOM 5047  C CG  . GLN C 1 126 ? -39.705 59.908  -48.817 1.00 58.72  ? 126 GLN C CG  1 
ATOM 5048  C CD  . GLN C 1 126 ? -40.209 59.431  -50.145 1.00 70.67  ? 126 GLN C CD  1 
ATOM 5049  O OE1 . GLN C 1 126 ? -40.237 58.233  -50.416 1.00 70.45  ? 126 GLN C OE1 1 
ATOM 5050  N NE2 . GLN C 1 126 ? -40.646 60.348  -50.987 1.00 58.27  ? 126 GLN C NE2 1 
ATOM 5051  N N   . ILE C 1 127 ? -41.330 58.790  -45.514 1.00 49.65  ? 127 ILE C N   1 
ATOM 5052  C CA  . ILE C 1 127 ? -41.291 57.532  -44.809 1.00 48.08  ? 127 ILE C CA  1 
ATOM 5053  C C   . ILE C 1 127 ? -41.193 56.354  -45.776 1.00 51.41  ? 127 ILE C C   1 
ATOM 5054  O O   . ILE C 1 127 ? -41.751 56.393  -46.881 1.00 54.36  ? 127 ILE C O   1 
ATOM 5055  C CB  . ILE C 1 127 ? -42.579 57.478  -43.920 1.00 50.10  ? 127 ILE C CB  1 
ATOM 5056  C CG1 . ILE C 1 127 ? -42.299 57.463  -42.384 1.00 49.80  ? 127 ILE C CG1 1 
ATOM 5057  C CG2 . ILE C 1 127 ? -43.695 56.536  -44.394 1.00 49.08  ? 127 ILE C CG2 1 
ATOM 5058  C CD1 . ILE C 1 127 ? -41.355 56.564  -41.878 1.00 54.02  ? 127 ILE C CD1 1 
ATOM 5059  N N   . ALA C 1 128 ? -40.501 55.308  -45.355 1.00 44.27  ? 128 ALA C N   1 
ATOM 5060  C CA  . ALA C 1 128 ? -40.450 54.041  -46.074 1.00 42.95  ? 128 ALA C CA  1 
ATOM 5061  C C   . ALA C 1 128 ? -41.663 53.224  -45.590 1.00 49.50  ? 128 ALA C C   1 
ATOM 5062  O O   . ALA C 1 128 ? -42.002 53.295  -44.397 1.00 51.28  ? 128 ALA C O   1 
ATOM 5063  C CB  . ALA C 1 128 ? -39.141 53.318  -45.780 1.00 42.83  ? 128 ALA C CB  1 
ATOM 5064  N N   . ILE C 1 129 ? -42.339 52.495  -46.483 1.00 44.38  ? 129 ILE C N   1 
ATOM 5065  C CA  . ILE C 1 129 ? -43.534 51.728  -46.092 1.00 43.01  ? 129 ILE C CA  1 
ATOM 5066  C C   . ILE C 1 129 ? -43.220 50.233  -46.074 1.00 49.65  ? 129 ILE C C   1 
ATOM 5067  O O   . ILE C 1 129 ? -42.705 49.712  -47.059 1.00 52.47  ? 129 ILE C O   1 
ATOM 5068  C CB  . ILE C 1 129 ? -44.744 52.059  -47.000 1.00 43.99  ? 129 ILE C CB  1 
ATOM 5069  C CG1 . ILE C 1 129 ? -45.039 53.575  -46.950 1.00 42.55  ? 129 ILE C CG1 1 
ATOM 5070  C CG2 . ILE C 1 129 ? -45.987 51.223  -46.610 1.00 44.22  ? 129 ILE C CG2 1 
ATOM 5071  C CD1 . ILE C 1 129 ? -45.936 54.075  -47.973 1.00 41.33  ? 129 ILE C CD1 1 
ATOM 5072  N N   . ALA C 1 130 ? -43.518 49.556  -44.948 1.00 44.30  ? 130 ALA C N   1 
ATOM 5073  C CA  . ALA C 1 130 ? -43.316 48.119  -44.761 1.00 42.96  ? 130 ALA C CA  1 
ATOM 5074  C C   . ALA C 1 130 ? -44.566 47.323  -45.169 1.00 49.45  ? 130 ALA C C   1 
ATOM 5075  O O   . ALA C 1 130 ? -45.657 47.893  -45.286 1.00 49.78  ? 130 ALA C O   1 
ATOM 5076  C CB  . ALA C 1 130 ? -42.972 47.832  -43.303 1.00 43.24  ? 130 ALA C CB  1 
ATOM 5077  N N   . ASP C 1 131 ? -44.406 45.998  -45.374 1.00 47.03  ? 131 ASP C N   1 
ATOM 5078  C CA  . ASP C 1 131 ? -45.507 45.096  -45.692 1.00 46.75  ? 131 ASP C CA  1 
ATOM 5079  C C   . ASP C 1 131 ? -46.175 44.704  -44.380 1.00 49.99  ? 131 ASP C C   1 
ATOM 5080  O O   . ASP C 1 131 ? -45.636 43.883  -43.626 1.00 49.51  ? 131 ASP C O   1 
ATOM 5081  C CB  . ASP C 1 131 ? -45.018 43.862  -46.490 1.00 48.58  ? 131 ASP C CB  1 
ATOM 5082  C CG  . ASP C 1 131 ? -46.103 42.887  -46.961 1.00 58.65  ? 131 ASP C CG  1 
ATOM 5083  O OD1 . ASP C 1 131 ? -45.756 41.894  -47.644 1.00 61.76  ? 131 ASP C OD1 1 
ATOM 5084  O OD2 . ASP C 1 131 ? -47.295 43.108  -46.638 1.00 56.00  ? 131 ASP C OD2 1 
ATOM 5085  N N   . SER C 1 132 ? -47.358 45.298  -44.116 1.00 45.87  ? 132 SER C N   1 
ATOM 5086  C CA  . SER C 1 132 ? -48.137 45.053  -42.901 1.00 44.94  ? 132 SER C CA  1 
ATOM 5087  C C   . SER C 1 132 ? -48.664 43.611  -42.811 1.00 48.45  ? 132 SER C C   1 
ATOM 5088  O O   . SER C 1 132 ? -48.921 43.138  -41.700 1.00 48.91  ? 132 SER C O   1 
ATOM 5089  C CB  . SER C 1 132 ? -49.278 46.052  -42.781 1.00 47.25  ? 132 SER C CB  1 
ATOM 5090  O OG  . SER C 1 132 ? -50.207 45.957  -43.845 1.00 51.67  ? 132 SER C OG  1 
ATOM 5091  N N   . ASP C 1 133 ? -48.747 42.882  -43.945 1.00 44.96  ? 133 ASP C N   1 
ATOM 5092  C CA  . ASP C 1 133 ? -49.182 41.476  -43.952 1.00 44.50  ? 133 ASP C CA  1 
ATOM 5093  C C   . ASP C 1 133 ? -48.093 40.570  -43.394 1.00 47.39  ? 133 ASP C C   1 
ATOM 5094  O O   . ASP C 1 133 ? -48.383 39.428  -43.025 1.00 48.48  ? 133 ASP C O   1 
ATOM 5095  C CB  . ASP C 1 133 ? -49.616 41.019  -45.357 1.00 47.20  ? 133 ASP C CB  1 
ATOM 5096  C CG  . ASP C 1 133 ? -50.943 41.612  -45.826 1.00 62.24  ? 133 ASP C CG  1 
ATOM 5097  O OD1 . ASP C 1 133 ? -51.799 41.915  -44.964 1.00 63.47  ? 133 ASP C OD1 1 
ATOM 5098  O OD2 . ASP C 1 133 ? -51.127 41.765  -47.057 1.00 67.67  ? 133 ASP C OD2 1 
ATOM 5099  N N   . LYS C 1 134 ? -46.854 41.093  -43.259 1.00 42.98  ? 134 LYS C N   1 
ATOM 5100  C CA  . LYS C 1 134 ? -45.723 40.317  -42.721 1.00 42.13  ? 134 LYS C CA  1 
ATOM 5101  C C   . LYS C 1 134 ? -45.564 40.527  -41.187 1.00 44.35  ? 134 LYS C C   1 
ATOM 5102  O O   . LYS C 1 134 ? -44.672 39.926  -40.575 1.00 42.76  ? 134 LYS C O   1 
ATOM 5103  C CB  . LYS C 1 134 ? -44.426 40.636  -43.479 1.00 43.93  ? 134 LYS C CB  1 
ATOM 5104  C CG  . LYS C 1 134 ? -44.347 39.952  -44.844 1.00 59.26  ? 134 LYS C CG  1 
ATOM 5105  C CD  . LYS C 1 134 ? -43.290 40.582  -45.752 1.00 78.82  ? 134 LYS C CD  1 
ATOM 5106  C CE  . LYS C 1 134 ? -42.223 39.592  -46.192 1.00 98.40  ? 134 LYS C CE  1 
ATOM 5107  N NZ  . LYS C 1 134 ? -42.717 38.588  -47.191 1.00 103.45 ? 134 LYS C NZ  1 
ATOM 5108  N N   . LEU C 1 135 ? -46.482 41.325  -40.570 1.00 39.19  ? 135 LEU C N   1 
ATOM 5109  C CA  . LEU C 1 135 ? -46.480 41.620  -39.142 1.00 37.42  ? 135 LEU C CA  1 
ATOM 5110  C C   . LEU C 1 135 ? -46.946 40.454  -38.329 1.00 44.81  ? 135 LEU C C   1 
ATOM 5111  O O   . LEU C 1 135 ? -47.788 39.666  -38.766 1.00 46.13  ? 135 LEU C O   1 
ATOM 5112  C CB  . LEU C 1 135 ? -47.368 42.814  -38.817 1.00 37.08  ? 135 LEU C CB  1 
ATOM 5113  C CG  . LEU C 1 135 ? -46.890 44.198  -39.197 1.00 41.34  ? 135 LEU C CG  1 
ATOM 5114  C CD1 . LEU C 1 135 ? -48.001 45.221  -38.931 1.00 40.97  ? 135 LEU C CD1 1 
ATOM 5115  C CD2 . LEU C 1 135 ? -45.613 44.572  -38.447 1.00 44.93  ? 135 LEU C CD2 1 
ATOM 5116  N N   . ARG C 1 136 ? -46.431 40.371  -37.097 1.00 43.63  ? 136 ARG C N   1 
ATOM 5117  C CA  . ARG C 1 136 ? -46.802 39.325  -36.133 1.00 43.03  ? 136 ARG C CA  1 
ATOM 5118  C C   . ARG C 1 136 ? -46.967 39.920  -34.761 1.00 44.18  ? 136 ARG C C   1 
ATOM 5119  O O   . ARG C 1 136 ? -46.316 40.909  -34.431 1.00 44.60  ? 136 ARG C O   1 
ATOM 5120  C CB  . ARG C 1 136 ? -45.768 38.198  -36.088 1.00 40.84  ? 136 ARG C CB  1 
ATOM 5121  C CG  . ARG C 1 136 ? -45.801 37.246  -37.279 1.00 49.74  ? 136 ARG C CG  1 
ATOM 5122  C CD  . ARG C 1 136 ? -44.698 36.202  -37.167 1.00 57.33  ? 136 ARG C CD  1 
ATOM 5123  N NE  . ARG C 1 136 ? -43.363 36.820  -37.081 1.00 53.97  ? 136 ARG C NE  1 
ATOM 5124  C CZ  . ARG C 1 136 ? -42.266 36.183  -36.682 1.00 61.78  ? 136 ARG C CZ  1 
ATOM 5125  N NH1 . ARG C 1 136 ? -42.324 34.898  -36.326 1.00 46.09  ? 136 ARG C NH1 1 
ATOM 5126  N NH2 . ARG C 1 136 ? -41.108 36.832  -36.597 1.00 41.76  ? 136 ARG C NH2 1 
ATOM 5127  N N   . VAL C 1 137 ? -47.851 39.324  -33.973 1.00 38.72  ? 137 VAL C N   1 
ATOM 5128  C CA  . VAL C 1 137 ? -48.090 39.690  -32.578 1.00 38.02  ? 137 VAL C CA  1 
ATOM 5129  C C   . VAL C 1 137 ? -46.760 39.472  -31.824 1.00 43.72  ? 137 VAL C C   1 
ATOM 5130  O O   . VAL C 1 137 ? -46.202 38.374  -31.864 1.00 43.97  ? 137 VAL C O   1 
ATOM 5131  C CB  . VAL C 1 137 ? -49.283 38.871  -31.978 1.00 39.58  ? 137 VAL C CB  1 
ATOM 5132  C CG1 . VAL C 1 137 ? -49.433 39.118  -30.481 1.00 39.26  ? 137 VAL C CG1 1 
ATOM 5133  C CG2 . VAL C 1 137 ? -50.573 39.202  -32.700 1.00 37.98  ? 137 VAL C CG2 1 
ATOM 5134  N N   . GLY C 1 138 ? -46.252 40.535  -31.215 1.00 41.06  ? 138 GLY C N   1 
ATOM 5135  C CA  . GLY C 1 138 ? -44.982 40.510  -30.504 1.00 41.04  ? 138 GLY C CA  1 
ATOM 5136  C C   . GLY C 1 138 ? -43.949 41.429  -31.130 1.00 45.44  ? 138 GLY C C   1 
ATOM 5137  O O   . GLY C 1 138 ? -42.967 41.789  -30.481 1.00 46.65  ? 138 GLY C O   1 
ATOM 5138  N N   . ASP C 1 139 ? -44.163 41.820  -32.402 1.00 40.07  ? 139 ASP C N   1 
ATOM 5139  C CA  . ASP C 1 139 ? -43.266 42.743  -33.097 1.00 39.52  ? 139 ASP C CA  1 
ATOM 5140  C C   . ASP C 1 139 ? -43.288 44.092  -32.398 1.00 42.31  ? 139 ASP C C   1 
ATOM 5141  O O   . ASP C 1 139 ? -44.330 44.505  -31.914 1.00 43.67  ? 139 ASP C O   1 
ATOM 5142  C CB  . ASP C 1 139 ? -43.645 42.887  -34.598 1.00 40.61  ? 139 ASP C CB  1 
ATOM 5143  C CG  . ASP C 1 139 ? -43.367 41.684  -35.486 1.00 51.80  ? 139 ASP C CG  1 
ATOM 5144  O OD1 . ASP C 1 139 ? -42.488 40.863  -35.129 1.00 50.92  ? 139 ASP C OD1 1 
ATOM 5145  O OD2 . ASP C 1 139 ? -43.999 41.581  -36.557 1.00 67.27  ? 139 ASP C OD2 1 
ATOM 5146  N N   . PHE C 1 140 ? -42.142 44.764  -32.317 1.00 37.31  ? 140 PHE C N   1 
ATOM 5147  C CA  . PHE C 1 140 ? -42.055 46.058  -31.640 1.00 35.35  ? 140 PHE C CA  1 
ATOM 5148  C C   . PHE C 1 140 ? -42.565 47.172  -32.534 1.00 40.14  ? 140 PHE C C   1 
ATOM 5149  O O   . PHE C 1 140 ? -42.387 47.137  -33.747 1.00 40.34  ? 140 PHE C O   1 
ATOM 5150  C CB  . PHE C 1 140 ? -40.623 46.330  -31.156 1.00 36.02  ? 140 PHE C CB  1 
ATOM 5151  C CG  . PHE C 1 140 ? -40.209 45.392  -30.051 1.00 36.73  ? 140 PHE C CG  1 
ATOM 5152  C CD1 . PHE C 1 140 ? -39.354 44.321  -30.310 1.00 38.18  ? 140 PHE C CD1 1 
ATOM 5153  C CD2 . PHE C 1 140 ? -40.743 45.522  -28.764 1.00 38.38  ? 140 PHE C CD2 1 
ATOM 5154  C CE1 . PHE C 1 140 ? -39.011 43.409  -29.298 1.00 38.83  ? 140 PHE C CE1 1 
ATOM 5155  C CE2 . PHE C 1 140 ? -40.416 44.601  -27.753 1.00 40.83  ? 140 PHE C CE2 1 
ATOM 5156  C CZ  . PHE C 1 140 ? -39.555 43.547  -28.030 1.00 39.29  ? 140 PHE C CZ  1 
ATOM 5157  N N   . ALA C 1 141 ? -43.245 48.150  -31.929 1.00 36.49  ? 141 ALA C N   1 
ATOM 5158  C CA  . ALA C 1 141 ? -43.820 49.280  -32.661 1.00 35.91  ? 141 ALA C CA  1 
ATOM 5159  C C   . ALA C 1 141 ? -43.574 50.573  -31.936 1.00 38.79  ? 141 ALA C C   1 
ATOM 5160  O O   . ALA C 1 141 ? -43.555 50.591  -30.696 1.00 39.98  ? 141 ALA C O   1 
ATOM 5161  C CB  . ALA C 1 141 ? -45.329 49.081  -32.866 1.00 36.26  ? 141 ALA C CB  1 
ATOM 5162  N N   . VAL C 1 142 ? -43.382 51.658  -32.711 1.00 33.49  ? 142 VAL C N   1 
ATOM 5163  C CA  . VAL C 1 142 ? -43.191 53.005  -32.190 1.00 34.23  ? 142 VAL C CA  1 
ATOM 5164  C C   . VAL C 1 142 ? -44.265 53.898  -32.796 1.00 40.74  ? 142 VAL C C   1 
ATOM 5165  O O   . VAL C 1 142 ? -44.404 53.950  -34.023 1.00 41.81  ? 142 VAL C O   1 
ATOM 5166  C CB  . VAL C 1 142 ? -41.761 53.568  -32.429 1.00 38.58  ? 142 VAL C CB  1 
ATOM 5167  C CG1 . VAL C 1 142 ? -41.605 54.946  -31.807 1.00 38.61  ? 142 VAL C CG1 1 
ATOM 5168  C CG2 . VAL C 1 142 ? -40.682 52.622  -31.907 1.00 37.69  ? 142 VAL C CG2 1 
ATOM 5169  N N   . ALA C 1 143 ? -45.079 54.545  -31.931 1.00 36.82  ? 143 ALA C N   1 
ATOM 5170  C CA  . ALA C 1 143 ? -46.111 55.493  -32.359 1.00 34.99  ? 143 ALA C CA  1 
ATOM 5171  C C   . ALA C 1 143 ? -45.510 56.899  -32.335 1.00 38.06  ? 143 ALA C C   1 
ATOM 5172  O O   . ALA C 1 143 ? -44.866 57.279  -31.348 1.00 38.04  ? 143 ALA C O   1 
ATOM 5173  C CB  . ALA C 1 143 ? -47.349 55.400  -31.457 1.00 35.56  ? 143 ALA C CB  1 
ATOM 5174  N N   . VAL C 1 144 ? -45.631 57.639  -33.446 1.00 34.07  ? 144 VAL C N   1 
ATOM 5175  C CA  . VAL C 1 144 ? -45.120 59.023  -33.540 1.00 33.86  ? 144 VAL C CA  1 
ATOM 5176  C C   . VAL C 1 144 ? -46.306 59.902  -33.904 1.00 41.80  ? 144 VAL C C   1 
ATOM 5177  O O   . VAL C 1 144 ? -46.919 59.699  -34.951 1.00 45.09  ? 144 VAL C O   1 
ATOM 5178  C CB  . VAL C 1 144 ? -43.917 59.203  -34.530 1.00 35.96  ? 144 VAL C CB  1 
ATOM 5179  C CG1 . VAL C 1 144 ? -43.404 60.633  -34.515 1.00 34.62  ? 144 VAL C CG1 1 
ATOM 5180  C CG2 . VAL C 1 144 ? -42.779 58.235  -34.218 1.00 35.42  ? 144 VAL C CG2 1 
ATOM 5181  N N   . GLY C 1 145 ? -46.658 60.817  -33.021 1.00 38.67  ? 145 GLY C N   1 
ATOM 5182  C CA  . GLY C 1 145 ? -47.776 61.725  -33.226 1.00 39.49  ? 145 GLY C CA  1 
ATOM 5183  C C   . GLY C 1 145 ? -47.689 62.972  -32.379 1.00 47.91  ? 145 GLY C C   1 
ATOM 5184  O O   . GLY C 1 145 ? -46.647 63.261  -31.776 1.00 48.80  ? 145 GLY C O   1 
ATOM 5185  N N   . ASN C 1 146 ? -48.812 63.703  -32.305 1.00 45.93  ? 146 ASN C N   1 
ATOM 5186  C CA  . ASN C 1 146 ? -48.925 64.967  -31.587 1.00 45.91  ? 146 ASN C CA  1 
ATOM 5187  C C   . ASN C 1 146 ? -50.020 64.920  -30.497 1.00 50.77  ? 146 ASN C C   1 
ATOM 5188  O O   . ASN C 1 146 ? -50.991 65.675  -30.581 1.00 50.62  ? 146 ASN C O   1 
ATOM 5189  C CB  . ASN C 1 146 ? -49.216 66.074  -32.602 1.00 44.93  ? 146 ASN C CB  1 
ATOM 5190  C CG  . ASN C 1 146 ? -48.378 67.280  -32.364 1.00 78.98  ? 146 ASN C CG  1 
ATOM 5191  O OD1 . ASN C 1 146 ? -47.433 67.529  -33.104 1.00 80.91  ? 146 ASN C OD1 1 
ATOM 5192  N ND2 . ASN C 1 146 ? -48.664 68.019  -31.292 1.00 68.70  ? 146 ASN C ND2 1 
ATOM 5193  N N   . PRO C 1 147 ? -49.886 64.071  -29.452 1.00 48.62  ? 147 PRO C N   1 
ATOM 5194  C CA  . PRO C 1 147 ? -50.946 63.993  -28.422 1.00 48.26  ? 147 PRO C CA  1 
ATOM 5195  C C   . PRO C 1 147 ? -51.137 65.279  -27.634 1.00 51.79  ? 147 PRO C C   1 
ATOM 5196  O O   . PRO C 1 147 ? -50.149 65.898  -27.206 1.00 50.69  ? 147 PRO C O   1 
ATOM 5197  C CB  . PRO C 1 147 ? -50.448 62.882  -27.489 1.00 50.17  ? 147 PRO C CB  1 
ATOM 5198  C CG  . PRO C 1 147 ? -48.985 62.821  -27.712 1.00 54.83  ? 147 PRO C CG  1 
ATOM 5199  C CD  . PRO C 1 147 ? -48.804 63.109  -29.166 1.00 50.44  ? 147 PRO C CD  1 
ATOM 5200  N N   . PHE C 1 148 ? -52.419 65.678  -27.453 1.00 48.72  ? 148 PHE C N   1 
ATOM 5201  C CA  . PHE C 1 148 ? -52.863 66.877  -26.725 1.00 48.95  ? 148 PHE C CA  1 
ATOM 5202  C C   . PHE C 1 148 ? -52.167 68.157  -27.227 1.00 53.39  ? 148 PHE C C   1 
ATOM 5203  O O   . PHE C 1 148 ? -52.024 69.114  -26.466 1.00 52.72  ? 148 PHE C O   1 
ATOM 5204  C CB  . PHE C 1 148 ? -52.657 66.699  -25.197 1.00 51.22  ? 148 PHE C CB  1 
ATOM 5205  C CG  . PHE C 1 148 ? -53.242 65.416  -24.635 1.00 53.05  ? 148 PHE C CG  1 
ATOM 5206  C CD1 . PHE C 1 148 ? -52.424 64.461  -24.032 1.00 56.68  ? 148 PHE C CD1 1 
ATOM 5207  C CD2 . PHE C 1 148 ? -54.601 65.139  -24.754 1.00 54.82  ? 148 PHE C CD2 1 
ATOM 5208  C CE1 . PHE C 1 148 ? -52.965 63.261  -23.534 1.00 56.90  ? 148 PHE C CE1 1 
ATOM 5209  C CE2 . PHE C 1 148 ? -55.133 63.930  -24.277 1.00 57.52  ? 148 PHE C CE2 1 
ATOM 5210  C CZ  . PHE C 1 148 ? -54.313 63.005  -23.664 1.00 54.92  ? 148 PHE C CZ  1 
ATOM 5211  N N   . GLY C 1 149 ? -51.755 68.142  -28.501 1.00 51.07  ? 149 GLY C N   1 
ATOM 5212  C CA  . GLY C 1 149 ? -51.066 69.226  -29.195 1.00 51.37  ? 149 GLY C CA  1 
ATOM 5213  C C   . GLY C 1 149 ? -49.765 69.662  -28.553 1.00 55.92  ? 149 GLY C C   1 
ATOM 5214  O O   . GLY C 1 149 ? -49.415 70.844  -28.628 1.00 56.77  ? 149 GLY C O   1 
ATOM 5215  N N   . LEU C 1 150 ? -49.033 68.723  -27.937 1.00 51.04  ? 150 LEU C N   1 
ATOM 5216  C CA  . LEU C 1 150 ? -47.801 69.035  -27.198 1.00 49.93  ? 150 LEU C CA  1 
ATOM 5217  C C   . LEU C 1 150 ? -46.581 69.323  -28.075 1.00 51.77  ? 150 LEU C C   1 
ATOM 5218  O O   . LEU C 1 150 ? -45.633 70.007  -27.638 1.00 50.98  ? 150 LEU C O   1 
ATOM 5219  C CB  . LEU C 1 150 ? -47.442 67.864  -26.264 1.00 49.43  ? 150 LEU C CB  1 
ATOM 5220  C CG  . LEU C 1 150 ? -48.365 67.612  -25.105 1.00 52.70  ? 150 LEU C CG  1 
ATOM 5221  C CD1 . LEU C 1 150 ? -48.111 66.274  -24.515 1.00 52.38  ? 150 LEU C CD1 1 
ATOM 5222  C CD2 . LEU C 1 150 ? -48.267 68.695  -24.071 1.00 54.51  ? 150 LEU C CD2 1 
ATOM 5223  N N   . GLY C 1 151 ? -46.600 68.748  -29.264 1.00 46.87  ? 151 GLY C N   1 
ATOM 5224  C CA  . GLY C 1 151 ? -45.485 68.737  -30.204 1.00 45.75  ? 151 GLY C CA  1 
ATOM 5225  C C   . GLY C 1 151 ? -45.161 67.279  -30.490 1.00 47.22  ? 151 GLY C C   1 
ATOM 5226  O O   . GLY C 1 151 ? -45.716 66.391  -29.836 1.00 47.67  ? 151 GLY C O   1 
ATOM 5227  N N   . GLN C 1 152 ? -44.297 66.999  -31.456 1.00 41.83  ? 152 GLN C N   1 
ATOM 5228  C CA  . GLN C 1 152 ? -43.993 65.613  -31.770 1.00 41.77  ? 152 GLN C CA  1 
ATOM 5229  C C   . GLN C 1 152 ? -43.618 64.785  -30.516 1.00 47.93  ? 152 GLN C C   1 
ATOM 5230  O O   . GLN C 1 152 ? -42.872 65.249  -29.654 1.00 49.59  ? 152 GLN C O   1 
ATOM 5231  C CB  . GLN C 1 152 ? -42.905 65.499  -32.821 1.00 41.89  ? 152 GLN C CB  1 
ATOM 5232  C CG  . GLN C 1 152 ? -42.774 64.080  -33.306 1.00 43.59  ? 152 GLN C CG  1 
ATOM 5233  C CD  . GLN C 1 152 ? -41.887 64.017  -34.479 1.00 67.84  ? 152 GLN C CD  1 
ATOM 5234  O OE1 . GLN C 1 152 ? -42.347 63.990  -35.624 1.00 65.68  ? 152 GLN C OE1 1 
ATOM 5235  N NE2 . GLN C 1 152 ? -40.595 64.047  -34.213 1.00 62.69  ? 152 GLN C NE2 1 
ATOM 5236  N N   . THR C 1 153 ? -44.183 63.575  -30.428 1.00 43.73  ? 153 THR C N   1 
ATOM 5237  C CA  . THR C 1 153 ? -44.006 62.631  -29.329 1.00 42.61  ? 153 THR C CA  1 
ATOM 5238  C C   . THR C 1 153 ? -43.877 61.235  -29.895 1.00 44.08  ? 153 THR C C   1 
ATOM 5239  O O   . THR C 1 153 ? -44.658 60.862  -30.763 1.00 44.30  ? 153 THR C O   1 
ATOM 5240  C CB  . THR C 1 153 ? -45.223 62.735  -28.394 1.00 48.65  ? 153 THR C CB  1 
ATOM 5241  O OG1 . THR C 1 153 ? -45.279 64.027  -27.792 1.00 50.47  ? 153 THR C OG1 1 
ATOM 5242  C CG2 . THR C 1 153 ? -45.297 61.618  -27.350 1.00 42.73  ? 153 THR C CG2 1 
ATOM 5243  N N   . ALA C 1 154 ? -42.911 60.465  -29.395 1.00 38.53  ? 154 ALA C N   1 
ATOM 5244  C CA  . ALA C 1 154 ? -42.720 59.062  -29.755 1.00 37.65  ? 154 ALA C CA  1 
ATOM 5245  C C   . ALA C 1 154 ? -43.061 58.175  -28.543 1.00 39.72  ? 154 ALA C C   1 
ATOM 5246  O O   . ALA C 1 154 ? -42.629 58.463  -27.430 1.00 38.87  ? 154 ALA C O   1 
ATOM 5247  C CB  . ALA C 1 154 ? -41.279 58.809  -30.223 1.00 38.08  ? 154 ALA C CB  1 
ATOM 5248  N N   . THR C 1 155 ? -43.872 57.133  -28.746 1.00 35.45  ? 155 THR C N   1 
ATOM 5249  C CA  . THR C 1 155 ? -44.212 56.182  -27.679 1.00 34.89  ? 155 THR C CA  1 
ATOM 5250  C C   . THR C 1 155 ? -43.917 54.791  -28.215 1.00 39.80  ? 155 THR C C   1 
ATOM 5251  O O   . THR C 1 155 ? -43.966 54.579  -29.416 1.00 42.58  ? 155 THR C O   1 
ATOM 5252  C CB  . THR C 1 155 ? -45.639 56.378  -27.151 1.00 39.54  ? 155 THR C CB  1 
ATOM 5253  O OG1 . THR C 1 155 ? -46.571 56.255  -28.218 1.00 37.82  ? 155 THR C OG1 1 
ATOM 5254  C CG2 . THR C 1 155 ? -45.849 57.750  -26.431 1.00 29.71  ? 155 THR C CG2 1 
ATOM 5255  N N   . SER C 1 156 ? -43.526 53.875  -27.359 1.00 34.94  ? 156 SER C N   1 
ATOM 5256  C CA  . SER C 1 156 ? -43.108 52.524  -27.746 1.00 34.49  ? 156 SER C CA  1 
ATOM 5257  C C   . SER C 1 156 ? -44.013 51.434  -27.134 1.00 39.21  ? 156 SER C C   1 
ATOM 5258  O O   . SER C 1 156 ? -44.551 51.591  -26.034 1.00 37.58  ? 156 SER C O   1 
ATOM 5259  C CB  . SER C 1 156 ? -41.667 52.287  -27.294 1.00 37.30  ? 156 SER C CB  1 
ATOM 5260  O OG  . SER C 1 156 ? -41.132 51.072  -27.793 1.00 51.30  ? 156 SER C OG  1 
ATOM 5261  N N   . GLY C 1 157 ? -44.138 50.328  -27.853 1.00 36.12  ? 157 GLY C N   1 
ATOM 5262  C CA  . GLY C 1 157 ? -44.911 49.170  -27.433 1.00 34.92  ? 157 GLY C CA  1 
ATOM 5263  C C   . GLY C 1 157 ? -44.723 48.010  -28.377 1.00 37.68  ? 157 GLY C C   1 
ATOM 5264  O O   . GLY C 1 157 ? -43.718 47.948  -29.088 1.00 38.03  ? 157 GLY C O   1 
ATOM 5265  N N   . ILE C 1 158 ? -45.684 47.080  -28.388 1.00 34.25  ? 158 ILE C N   1 
ATOM 5266  C CA  . ILE C 1 158 ? -45.656 45.893  -29.262 1.00 33.65  ? 158 ILE C CA  1 
ATOM 5267  C C   . ILE C 1 158 ? -46.914 45.842  -30.127 1.00 37.55  ? 158 ILE C C   1 
ATOM 5268  O O   . ILE C 1 158 ? -47.864 46.604  -29.890 1.00 36.84  ? 158 ILE C O   1 
ATOM 5269  C CB  . ILE C 1 158 ? -45.485 44.551  -28.477 1.00 35.61  ? 158 ILE C CB  1 
ATOM 5270  C CG1 . ILE C 1 158 ? -46.640 44.280  -27.478 1.00 36.41  ? 158 ILE C CG1 1 
ATOM 5271  C CG2 . ILE C 1 158 ? -44.132 44.433  -27.841 1.00 34.53  ? 158 ILE C CG2 1 
ATOM 5272  C CD1 . ILE C 1 158 ? -46.820 42.756  -27.037 1.00 39.29  ? 158 ILE C CD1 1 
ATOM 5273  N N   . VAL C 1 159 ? -46.921 44.908  -31.111 1.00 32.71  ? 159 VAL C N   1 
ATOM 5274  C CA  . VAL C 1 159 ? -48.099 44.595  -31.904 1.00 31.43  ? 159 VAL C CA  1 
ATOM 5275  C C   . VAL C 1 159 ? -48.840 43.617  -31.028 1.00 35.09  ? 159 VAL C C   1 
ATOM 5276  O O   . VAL C 1 159 ? -48.315 42.536  -30.734 1.00 32.39  ? 159 VAL C O   1 
ATOM 5277  C CB  . VAL C 1 159 ? -47.797 44.073  -33.338 1.00 33.59  ? 159 VAL C CB  1 
ATOM 5278  C CG1 . VAL C 1 159 ? -49.074 43.555  -34.013 1.00 31.41  ? 159 VAL C CG1 1 
ATOM 5279  C CG2 . VAL C 1 159 ? -47.138 45.166  -34.197 1.00 33.07  ? 159 VAL C CG2 1 
ATOM 5280  N N   . SER C 1 160 ? -49.995 44.064  -30.505 1.00 34.04  ? 160 SER C N   1 
ATOM 5281  C CA  . SER C 1 160 ? -50.842 43.334  -29.561 1.00 34.86  ? 160 SER C CA  1 
ATOM 5282  C C   . SER C 1 160 ? -51.766 42.334  -30.231 1.00 40.06  ? 160 SER C C   1 
ATOM 5283  O O   . SER C 1 160 ? -52.039 41.292  -29.649 1.00 41.11  ? 160 SER C O   1 
ATOM 5284  C CB  . SER C 1 160 ? -51.672 44.321  -28.740 1.00 37.70  ? 160 SER C CB  1 
ATOM 5285  O OG  . SER C 1 160 ? -50.856 45.026  -27.819 1.00 43.84  ? 160 SER C OG  1 
ATOM 5286  N N   . ALA C 1 161 ? -52.290 42.688  -31.413 1.00 36.54  ? 161 ALA C N   1 
ATOM 5287  C CA  . ALA C 1 161 ? -53.229 41.913  -32.218 1.00 37.63  ? 161 ALA C CA  1 
ATOM 5288  C C   . ALA C 1 161 ? -53.268 42.443  -33.639 1.00 44.70  ? 161 ALA C C   1 
ATOM 5289  O O   . ALA C 1 161 ? -52.801 43.559  -33.897 1.00 45.12  ? 161 ALA C O   1 
ATOM 5290  C CB  . ALA C 1 161 ? -54.620 41.969  -31.614 1.00 38.36  ? 161 ALA C CB  1 
ATOM 5291  N N   . LEU C 1 162 ? -53.820 41.641  -34.565 1.00 42.00  ? 162 LEU C N   1 
ATOM 5292  C CA  . LEU C 1 162 ? -53.909 41.966  -35.993 1.00 41.68  ? 162 LEU C CA  1 
ATOM 5293  C C   . LEU C 1 162 ? -55.265 41.595  -36.550 1.00 49.95  ? 162 LEU C C   1 
ATOM 5294  O O   . LEU C 1 162 ? -55.914 40.705  -36.011 1.00 52.29  ? 162 LEU C O   1 
ATOM 5295  C CB  . LEU C 1 162 ? -52.793 41.204  -36.746 1.00 40.19  ? 162 LEU C CB  1 
ATOM 5296  C CG  . LEU C 1 162 ? -51.349 41.626  -36.434 1.00 40.78  ? 162 LEU C CG  1 
ATOM 5297  C CD1 . LEU C 1 162 ? -50.394 40.544  -36.771 1.00 39.53  ? 162 LEU C CD1 1 
ATOM 5298  C CD2 . LEU C 1 162 ? -50.963 42.915  -37.135 1.00 39.98  ? 162 LEU C CD2 1 
ATOM 5299  N N   . GLY C 1 163 ? -55.682 42.258  -37.620 1.00 47.61  ? 163 GLY C N   1 
ATOM 5300  C CA  . GLY C 1 163 ? -56.973 41.994  -38.257 1.00 47.44  ? 163 GLY C CA  1 
ATOM 5301  C C   . GLY C 1 163 ? -58.189 42.256  -37.393 1.00 53.25  ? 163 GLY C C   1 
ATOM 5302  O O   . GLY C 1 163 ? -59.177 41.523  -37.477 1.00 54.61  ? 163 GLY C O   1 
ATOM 5303  N N   . ARG C 1 164 ? -58.135 43.314  -36.575 1.00 50.49  ? 164 ARG C N   1 
ATOM 5304  C CA  . ARG C 1 164 ? -59.208 43.671  -35.661 1.00 50.86  ? 164 ARG C CA  1 
ATOM 5305  C C   . ARG C 1 164 ? -60.359 44.382  -36.351 1.00 57.39  ? 164 ARG C C   1 
ATOM 5306  O O   . ARG C 1 164 ? -60.181 45.451  -36.937 1.00 56.41  ? 164 ARG C O   1 
ATOM 5307  C CB  . ARG C 1 164 ? -58.669 44.526  -34.500 1.00 48.37  ? 164 ARG C CB  1 
ATOM 5308  C CG  . ARG C 1 164 ? -58.008 43.716  -33.404 1.00 53.47  ? 164 ARG C CG  1 
ATOM 5309  C CD  . ARG C 1 164 ? -59.009 42.916  -32.580 1.00 53.68  ? 164 ARG C CD  1 
ATOM 5310  N NE  . ARG C 1 164 ? -58.481 42.663  -31.241 1.00 55.41  ? 164 ARG C NE  1 
ATOM 5311  C CZ  . ARG C 1 164 ? -57.888 41.541  -30.854 1.00 54.70  ? 164 ARG C CZ  1 
ATOM 5312  N NH1 . ARG C 1 164 ? -57.776 40.515  -31.689 1.00 31.66  ? 164 ARG C NH1 1 
ATOM 5313  N NH2 . ARG C 1 164 ? -57.424 41.427  -29.626 1.00 45.33  ? 164 ARG C NH2 1 
ATOM 5314  N N   . SER C 1 165 ? -61.552 43.798  -36.216 1.00 57.96  ? 165 SER C N   1 
ATOM 5315  C CA  . SER C 1 165 ? -62.812 44.290  -36.775 1.00 59.87  ? 165 SER C CA  1 
ATOM 5316  C C   . SER C 1 165 ? -63.927 44.291  -35.727 1.00 67.40  ? 165 SER C C   1 
ATOM 5317  O O   . SER C 1 165 ? -63.691 43.923  -34.572 1.00 67.59  ? 165 SER C O   1 
ATOM 5318  C CB  . SER C 1 165 ? -63.229 43.407  -37.944 1.00 66.03  ? 165 SER C CB  1 
ATOM 5319  O OG  . SER C 1 165 ? -62.285 43.391  -39.004 1.00 79.85  ? 165 SER C OG  1 
ATOM 5320  N N   . GLY C 1 166 ? -65.128 44.706  -36.154 1.00 66.06  ? 166 GLY C N   1 
ATOM 5321  C CA  . GLY C 1 166 ? -66.351 44.751  -35.353 1.00 65.58  ? 166 GLY C CA  1 
ATOM 5322  C C   . GLY C 1 166 ? -66.305 45.668  -34.155 1.00 70.04  ? 166 GLY C C   1 
ATOM 5323  O O   . GLY C 1 166 ? -66.966 45.398  -33.147 1.00 71.21  ? 166 GLY C O   1 
ATOM 5324  N N   . LEU C 1 167 ? -65.530 46.753  -34.251 1.00 65.29  ? 167 LEU C N   1 
ATOM 5325  C CA  . LEU C 1 167 ? -65.380 47.705  -33.163 1.00 65.19  ? 167 LEU C CA  1 
ATOM 5326  C C   . LEU C 1 167 ? -66.334 48.884  -33.368 1.00 70.86  ? 167 LEU C C   1 
ATOM 5327  O O   . LEU C 1 167 ? -66.434 49.757  -32.490 1.00 71.06  ? 167 LEU C O   1 
ATOM 5328  C CB  . LEU C 1 167 ? -63.907 48.184  -33.042 1.00 65.04  ? 167 LEU C CB  1 
ATOM 5329  C CG  . LEU C 1 167 ? -62.773 47.137  -33.209 1.00 69.76  ? 167 LEU C CG  1 
ATOM 5330  C CD1 . LEU C 1 167 ? -61.426 47.802  -33.353 1.00 70.26  ? 167 LEU C CD1 1 
ATOM 5331  C CD2 . LEU C 1 167 ? -62.733 46.147  -32.067 1.00 69.95  ? 167 LEU C CD2 1 
ATOM 5332  N N   . ASN C 1 168 ? -67.029 48.908  -34.533 1.00 67.00  ? 168 ASN C N   1 
ATOM 5333  C CA  . ASN C 1 168 ? -67.970 49.951  -34.948 1.00 67.52  ? 168 ASN C CA  1 
ATOM 5334  C C   . ASN C 1 168 ? -67.343 51.363  -34.814 1.00 70.29  ? 168 ASN C C   1 
ATOM 5335  O O   . ASN C 1 168 ? -67.975 52.310  -34.338 1.00 70.65  ? 168 ASN C O   1 
ATOM 5336  C CB  . ASN C 1 168 ? -69.308 49.827  -34.191 1.00 73.36  ? 168 ASN C CB  1 
ATOM 5337  C CG  . ASN C 1 168 ? -70.259 48.823  -34.822 1.00 108.63 ? 168 ASN C CG  1 
ATOM 5338  O OD1 . ASN C 1 168 ? -69.853 47.813  -35.437 1.00 101.13 ? 168 ASN C OD1 1 
ATOM 5339  N ND2 . ASN C 1 168 ? -71.557 49.089  -34.692 1.00 102.64 ? 168 ASN C ND2 1 
ATOM 5340  N N   . LEU C 1 169 ? -66.088 51.476  -35.247 1.00 64.82  ? 169 LEU C N   1 
ATOM 5341  C CA  . LEU C 1 169 ? -65.316 52.718  -35.250 1.00 64.13  ? 169 LEU C CA  1 
ATOM 5342  C C   . LEU C 1 169 ? -65.334 53.287  -36.650 1.00 64.60  ? 169 LEU C C   1 
ATOM 5343  O O   . LEU C 1 169 ? -65.551 54.482  -36.844 1.00 62.71  ? 169 LEU C O   1 
ATOM 5344  C CB  . LEU C 1 169 ? -63.857 52.450  -34.806 1.00 64.44  ? 169 LEU C CB  1 
ATOM 5345  C CG  . LEU C 1 169 ? -63.637 51.995  -33.355 1.00 69.91  ? 169 LEU C CG  1 
ATOM 5346  C CD1 . LEU C 1 169 ? -62.257 51.391  -33.181 1.00 70.14  ? 169 LEU C CD1 1 
ATOM 5347  C CD2 . LEU C 1 169 ? -63.818 53.150  -32.379 1.00 73.59  ? 169 LEU C CD2 1 
ATOM 5348  N N   . GLU C 1 170 ? -65.128 52.389  -37.628 1.00 59.53  ? 170 GLU C N   1 
ATOM 5349  C CA  . GLU C 1 170 ? -65.058 52.664  -39.052 1.00 58.08  ? 170 GLU C CA  1 
ATOM 5350  C C   . GLU C 1 170 ? -65.976 51.748  -39.832 1.00 58.74  ? 170 GLU C C   1 
ATOM 5351  O O   . GLU C 1 170 ? -66.382 50.710  -39.326 1.00 58.76  ? 170 GLU C O   1 
ATOM 5352  C CB  . GLU C 1 170 ? -63.613 52.444  -39.505 1.00 59.51  ? 170 GLU C CB  1 
ATOM 5353  C CG  . GLU C 1 170 ? -62.915 53.704  -39.952 1.00 70.92  ? 170 GLU C CG  1 
ATOM 5354  C CD  . GLU C 1 170 ? -62.872 54.815  -38.926 1.00 80.73  ? 170 GLU C CD  1 
ATOM 5355  O OE1 . GLU C 1 170 ? -62.018 54.750  -38.011 1.00 56.99  ? 170 GLU C OE1 1 
ATOM 5356  O OE2 . GLU C 1 170 ? -63.644 55.786  -39.084 1.00 77.32  ? 170 GLU C OE2 1 
ATOM 5357  N N   . GLY C 1 171 ? -66.266 52.125  -41.071 1.00 53.04  ? 171 GLY C N   1 
ATOM 5358  C CA  . GLY C 1 171 ? -67.044 51.314  -41.995 1.00 51.25  ? 171 GLY C CA  1 
ATOM 5359  C C   . GLY C 1 171 ? -66.249 50.092  -42.397 1.00 53.19  ? 171 GLY C C   1 
ATOM 5360  O O   . GLY C 1 171 ? -66.788 48.987  -42.427 1.00 52.93  ? 171 GLY C O   1 
ATOM 5361  N N   . LEU C 1 172 ? -64.938 50.285  -42.652 1.00 49.35  ? 172 LEU C N   1 
ATOM 5362  C CA  . LEU C 1 172 ? -63.981 49.235  -43.026 1.00 48.96  ? 172 LEU C CA  1 
ATOM 5363  C C   . LEU C 1 172 ? -62.855 49.217  -42.030 1.00 51.78  ? 172 LEU C C   1 
ATOM 5364  O O   . LEU C 1 172 ? -62.151 50.222  -41.855 1.00 50.70  ? 172 LEU C O   1 
ATOM 5365  C CB  . LEU C 1 172 ? -63.427 49.428  -44.461 1.00 49.34  ? 172 LEU C CB  1 
ATOM 5366  C CG  . LEU C 1 172 ? -64.472 49.567  -45.581 1.00 53.91  ? 172 LEU C CG  1 
ATOM 5367  C CD1 . LEU C 1 172 ? -63.856 50.178  -46.793 1.00 54.49  ? 172 LEU C CD1 1 
ATOM 5368  C CD2 . LEU C 1 172 ? -65.190 48.242  -45.872 1.00 52.01  ? 172 LEU C CD2 1 
ATOM 5369  N N   . GLU C 1 173 ? -62.727 48.079  -41.330 1.00 48.14  ? 173 GLU C N   1 
ATOM 5370  C CA  . GLU C 1 173 ? -61.734 47.878  -40.286 1.00 46.48  ? 173 GLU C CA  1 
ATOM 5371  C C   . GLU C 1 173 ? -60.933 46.608  -40.504 1.00 49.64  ? 173 GLU C C   1 
ATOM 5372  O O   . GLU C 1 173 ? -61.490 45.528  -40.725 1.00 48.35  ? 173 GLU C O   1 
ATOM 5373  C CB  . GLU C 1 173 ? -62.400 47.793  -38.901 1.00 47.54  ? 173 GLU C CB  1 
ATOM 5374  C CG  . GLU C 1 173 ? -63.363 48.905  -38.526 1.00 58.52  ? 173 GLU C CG  1 
ATOM 5375  C CD  . GLU C 1 173 ? -64.141 48.698  -37.234 1.00 76.44  ? 173 GLU C CD  1 
ATOM 5376  O OE1 . GLU C 1 173 ? -64.075 47.587  -36.655 1.00 75.53  ? 173 GLU C OE1 1 
ATOM 5377  O OE2 . GLU C 1 173 ? -64.811 49.662  -36.795 1.00 56.26  ? 173 GLU C OE2 1 
ATOM 5378  N N   . ASN C 1 174 ? -59.623 46.735  -40.357 1.00 46.58  ? 174 ASN C N   1 
ATOM 5379  C CA  . ASN C 1 174 ? -58.667 45.632  -40.392 1.00 45.67  ? 174 ASN C CA  1 
ATOM 5380  C C   . ASN C 1 174 ? -57.445 46.098  -39.566 1.00 45.03  ? 174 ASN C C   1 
ATOM 5381  O O   . ASN C 1 174 ? -56.290 45.962  -39.959 1.00 44.41  ? 174 ASN C O   1 
ATOM 5382  C CB  . ASN C 1 174 ? -58.325 45.233  -41.836 1.00 44.72  ? 174 ASN C CB  1 
ATOM 5383  C CG  . ASN C 1 174 ? -57.441 44.016  -41.928 1.00 56.64  ? 174 ASN C CG  1 
ATOM 5384  O OD1 . ASN C 1 174 ? -56.448 43.983  -42.661 1.00 52.79  ? 174 ASN C OD1 1 
ATOM 5385  N ND2 . ASN C 1 174 ? -57.718 43.029  -41.109 1.00 38.80  ? 174 ASN C ND2 1 
ATOM 5386  N N   . PHE C 1 175 ? -57.749 46.628  -38.399 1.00 38.16  ? 175 PHE C N   1 
ATOM 5387  C CA  . PHE C 1 175 ? -56.826 47.276  -37.497 1.00 37.55  ? 175 PHE C CA  1 
ATOM 5388  C C   . PHE C 1 175 ? -55.716 46.414  -36.903 1.00 39.21  ? 175 PHE C C   1 
ATOM 5389  O O   . PHE C 1 175 ? -55.918 45.247  -36.549 1.00 37.66  ? 175 PHE C O   1 
ATOM 5390  C CB  . PHE C 1 175 ? -57.602 47.883  -36.318 1.00 39.21  ? 175 PHE C CB  1 
ATOM 5391  C CG  . PHE C 1 175 ? -58.441 49.082  -36.642 1.00 40.69  ? 175 PHE C CG  1 
ATOM 5392  C CD1 . PHE C 1 175 ? -59.798 49.105  -36.341 1.00 43.86  ? 175 PHE C CD1 1 
ATOM 5393  C CD2 . PHE C 1 175 ? -57.876 50.206  -37.225 1.00 43.86  ? 175 PHE C CD2 1 
ATOM 5394  C CE1 . PHE C 1 175 ? -60.566 50.245  -36.600 1.00 45.17  ? 175 PHE C CE1 1 
ATOM 5395  C CE2 . PHE C 1 175 ? -58.648 51.335  -37.504 1.00 46.71  ? 175 PHE C CE2 1 
ATOM 5396  C CZ  . PHE C 1 175 ? -59.985 51.347  -37.188 1.00 44.69  ? 175 PHE C CZ  1 
ATOM 5397  N N   . ILE C 1 176 ? -54.543 47.051  -36.767 1.00 34.10  ? 176 ILE C N   1 
ATOM 5398  C CA  . ILE C 1 176 ? -53.423 46.589  -35.975 1.00 35.03  ? 176 ILE C CA  1 
ATOM 5399  C C   . ILE C 1 176 ? -53.723 47.101  -34.570 1.00 41.04  ? 176 ILE C C   1 
ATOM 5400  O O   . ILE C 1 176 ? -54.093 48.275  -34.429 1.00 40.83  ? 176 ILE C O   1 
ATOM 5401  C CB  . ILE C 1 176 ? -52.039 47.110  -36.491 1.00 37.64  ? 176 ILE C CB  1 
ATOM 5402  C CG1 . ILE C 1 176 ? -51.725 46.615  -37.924 1.00 36.88  ? 176 ILE C CG1 1 
ATOM 5403  C CG2 . ILE C 1 176 ? -50.895 46.755  -35.504 1.00 37.40  ? 176 ILE C CG2 1 
ATOM 5404  C CD1 . ILE C 1 176 ? -50.855 47.503  -38.622 1.00 35.23  ? 176 ILE C CD1 1 
ATOM 5405  N N   . GLN C 1 177 ? -53.589 46.248  -33.544 1.00 37.63  ? 177 GLN C N   1 
ATOM 5406  C CA  . GLN C 1 177 ? -53.760 46.693  -32.166 1.00 36.79  ? 177 GLN C CA  1 
ATOM 5407  C C   . GLN C 1 177 ? -52.373 46.831  -31.499 1.00 40.03  ? 177 GLN C C   1 
ATOM 5408  O O   . GLN C 1 177 ? -51.528 45.967  -31.675 1.00 41.75  ? 177 GLN C O   1 
ATOM 5409  C CB  . GLN C 1 177 ? -54.660 45.742  -31.413 1.00 37.50  ? 177 GLN C CB  1 
ATOM 5410  C CG  . GLN C 1 177 ? -55.176 46.309  -30.111 1.00 35.30  ? 177 GLN C CG  1 
ATOM 5411  C CD  . GLN C 1 177 ? -55.994 45.278  -29.411 1.00 49.94  ? 177 GLN C CD  1 
ATOM 5412  O OE1 . GLN C 1 177 ? -56.922 44.699  -29.974 1.00 51.22  ? 177 GLN C OE1 1 
ATOM 5413  N NE2 . GLN C 1 177 ? -55.648 44.991  -28.175 1.00 39.92  ? 177 GLN C NE2 1 
ATOM 5414  N N   . THR C 1 178 ? -52.125 47.920  -30.788 1.00 35.46  ? 178 THR C N   1 
ATOM 5415  C CA  . THR C 1 178 ? -50.818 48.149  -30.148 1.00 35.39  ? 178 THR C CA  1 
ATOM 5416  C C   . THR C 1 178 ? -50.972 48.682  -28.733 1.00 39.93  ? 178 THR C C   1 
ATOM 5417  O O   . THR C 1 178 ? -51.974 49.328  -28.427 1.00 41.21  ? 178 THR C O   1 
ATOM 5418  C CB  . THR C 1 178 ? -49.927 49.088  -31.002 1.00 42.44  ? 178 THR C CB  1 
ATOM 5419  O OG1 . THR C 1 178 ? -48.658 49.272  -30.364 1.00 43.55  ? 178 THR C OG1 1 
ATOM 5420  C CG2 . THR C 1 178 ? -50.564 50.451  -31.300 1.00 34.55  ? 178 THR C CG2 1 
ATOM 5421  N N   . ASP C 1 179 ? -49.977 48.424  -27.877 1.00 37.30  ? 179 ASP C N   1 
ATOM 5422  C CA  . ASP C 1 179 ? -49.999 48.917  -26.494 1.00 38.01  ? 179 ASP C CA  1 
ATOM 5423  C C   . ASP C 1 179 ? -49.126 50.190  -26.342 1.00 43.52  ? 179 ASP C C   1 
ATOM 5424  O O   . ASP C 1 179 ? -48.988 50.719  -25.223 1.00 44.47  ? 179 ASP C O   1 
ATOM 5425  C CB  . ASP C 1 179 ? -49.656 47.818  -25.456 1.00 38.95  ? 179 ASP C CB  1 
ATOM 5426  C CG  . ASP C 1 179 ? -48.241 47.297  -25.453 1.00 51.99  ? 179 ASP C CG  1 
ATOM 5427  O OD1 . ASP C 1 179 ? -47.569 47.407  -26.491 1.00 53.37  ? 179 ASP C OD1 1 
ATOM 5428  O OD2 . ASP C 1 179 ? -47.817 46.743  -24.417 1.00 62.91  ? 179 ASP C OD2 1 
ATOM 5429  N N   . ALA C 1 180 ? -48.610 50.718  -27.476 1.00 39.02  ? 180 ALA C N   1 
ATOM 5430  C CA  . ALA C 1 180 ? -47.907 51.998  -27.500 1.00 39.86  ? 180 ALA C CA  1 
ATOM 5431  C C   . ALA C 1 180 ? -48.933 53.079  -27.133 1.00 48.04  ? 180 ALA C C   1 
ATOM 5432  O O   . ALA C 1 180 ? -50.065 53.028  -27.638 1.00 51.56  ? 180 ALA C O   1 
ATOM 5433  C CB  . ALA C 1 180 ? -47.318 52.253  -28.881 1.00 40.52  ? 180 ALA C CB  1 
ATOM 5434  N N   . SER C 1 181 ? -48.599 53.986  -26.206 1.00 43.01  ? 181 SER C N   1 
ATOM 5435  C CA  . SER C 1 181 ? -49.537 55.030  -25.773 1.00 41.31  ? 181 SER C CA  1 
ATOM 5436  C C   . SER C 1 181 ? -49.962 55.893  -26.940 1.00 40.68  ? 181 SER C C   1 
ATOM 5437  O O   . SER C 1 181 ? -49.133 56.509  -27.588 1.00 40.48  ? 181 SER C O   1 
ATOM 5438  C CB  . SER C 1 181 ? -48.942 55.886  -24.657 1.00 44.57  ? 181 SER C CB  1 
ATOM 5439  O OG  . SER C 1 181 ? -48.787 55.087  -23.499 1.00 59.24  ? 181 SER C OG  1 
ATOM 5440  N N   . ILE C 1 182 ? -51.248 55.864  -27.245 1.00 36.03  ? 182 ILE C N   1 
ATOM 5441  C CA  . ILE C 1 182 ? -51.905 56.613  -28.308 1.00 35.57  ? 182 ILE C CA  1 
ATOM 5442  C C   . ILE C 1 182 ? -53.034 57.371  -27.639 1.00 39.27  ? 182 ILE C C   1 
ATOM 5443  O O   . ILE C 1 182 ? -53.844 56.779  -26.952 1.00 39.18  ? 182 ILE C O   1 
ATOM 5444  C CB  . ILE C 1 182 ? -52.348 55.669  -29.478 1.00 38.91  ? 182 ILE C CB  1 
ATOM 5445  C CG1 . ILE C 1 182 ? -51.116 55.068  -30.179 1.00 39.54  ? 182 ILE C CG1 1 
ATOM 5446  C CG2 . ILE C 1 182 ? -53.265 56.373  -30.484 1.00 39.71  ? 182 ILE C CG2 1 
ATOM 5447  C CD1 . ILE C 1 182 ? -51.384 53.823  -30.917 1.00 53.95  ? 182 ILE C CD1 1 
ATOM 5448  N N   . ASN C 1 183 ? -53.048 58.681  -27.808 1.00 38.44  ? 183 ASN C N   1 
ATOM 5449  C CA  . ASN C 1 183 ? -54.012 59.574  -27.179 1.00 39.41  ? 183 ASN C CA  1 
ATOM 5450  C C   . ASN C 1 183 ? -54.628 60.507  -28.214 1.00 45.95  ? 183 ASN C C   1 
ATOM 5451  O O   . ASN C 1 183 ? -54.209 60.479  -29.354 1.00 47.28  ? 183 ASN C O   1 
ATOM 5452  C CB  . ASN C 1 183 ? -53.278 60.384  -26.062 1.00 35.91  ? 183 ASN C CB  1 
ATOM 5453  C CG  . ASN C 1 183 ? -53.130 59.592  -24.786 1.00 46.03  ? 183 ASN C CG  1 
ATOM 5454  O OD1 . ASN C 1 183 ? -54.108 59.356  -24.053 1.00 36.18  ? 183 ASN C OD1 1 
ATOM 5455  N ND2 . ASN C 1 183 ? -51.916 59.128  -24.510 1.00 36.74  ? 183 ASN C ND2 1 
ATOM 5456  N N   . ARG C 1 184 ? -55.604 61.334  -27.820 1.00 44.24  ? 184 ARG C N   1 
ATOM 5457  C CA  . ARG C 1 184 ? -56.205 62.350  -28.689 1.00 44.89  ? 184 ARG C CA  1 
ATOM 5458  C C   . ARG C 1 184 ? -55.099 63.260  -29.214 1.00 47.00  ? 184 ARG C C   1 
ATOM 5459  O O   . ARG C 1 184 ? -54.315 63.772  -28.420 1.00 47.67  ? 184 ARG C O   1 
ATOM 5460  C CB  . ARG C 1 184 ? -57.280 63.161  -27.940 1.00 46.91  ? 184 ARG C CB  1 
ATOM 5461  C CG  . ARG C 1 184 ? -58.591 62.411  -27.748 1.00 65.41  ? 184 ARG C CG  1 
ATOM 5462  C CD  . ARG C 1 184 ? -59.658 63.322  -27.166 1.00 92.39  ? 184 ARG C CD  1 
ATOM 5463  N NE  . ARG C 1 184 ? -59.442 63.581  -25.740 1.00 114.12 ? 184 ARG C NE  1 
ATOM 5464  C CZ  . ARG C 1 184 ? -60.222 63.116  -24.770 1.00 135.96 ? 184 ARG C CZ  1 
ATOM 5465  N NH1 . ARG C 1 184 ? -61.292 62.383  -25.061 1.00 124.67 ? 184 ARG C NH1 1 
ATOM 5466  N NH2 . ARG C 1 184 ? -59.948 63.393  -23.501 1.00 125.18 ? 184 ARG C NH2 1 
ATOM 5467  N N   . GLY C 1 185 ? -54.996 63.366  -30.538 1.00 41.31  ? 185 GLY C N   1 
ATOM 5468  C CA  . GLY C 1 185 ? -53.952 64.138  -31.198 1.00 40.80  ? 185 GLY C CA  1 
ATOM 5469  C C   . GLY C 1 185 ? -52.953 63.262  -31.937 1.00 46.25  ? 185 GLY C C   1 
ATOM 5470  O O   . GLY C 1 185 ? -52.215 63.752  -32.800 1.00 45.30  ? 185 GLY C O   1 
ATOM 5471  N N   . ASN C 1 186 ? -52.931 61.952  -31.612 1.00 43.82  ? 186 ASN C N   1 
ATOM 5472  C CA  . ASN C 1 186 ? -52.036 60.975  -32.232 1.00 44.25  ? 186 ASN C CA  1 
ATOM 5473  C C   . ASN C 1 186 ? -52.548 60.515  -33.573 1.00 46.14  ? 186 ASN C C   1 
ATOM 5474  O O   . ASN C 1 186 ? -51.746 60.081  -34.403 1.00 47.54  ? 186 ASN C O   1 
ATOM 5475  C CB  . ASN C 1 186 ? -51.856 59.734  -31.334 1.00 46.96  ? 186 ASN C CB  1 
ATOM 5476  C CG  . ASN C 1 186 ? -50.606 59.721  -30.508 1.00 51.81  ? 186 ASN C CG  1 
ATOM 5477  O OD1 . ASN C 1 186 ? -49.550 59.242  -30.924 1.00 44.99  ? 186 ASN C OD1 1 
ATOM 5478  N ND2 . ASN C 1 186 ? -50.738 60.123  -29.279 1.00 47.32  ? 186 ASN C ND2 1 
ATOM 5479  N N   . SER C 1 187 ? -53.872 60.547  -33.758 1.00 40.40  ? 187 SER C N   1 
ATOM 5480  C CA  . SER C 1 187 ? -54.552 60.052  -34.955 1.00 39.75  ? 187 SER C CA  1 
ATOM 5481  C C   . SER C 1 187 ? -54.048 60.707  -36.245 1.00 45.10  ? 187 SER C C   1 
ATOM 5482  O O   . SER C 1 187 ? -53.808 61.911  -36.292 1.00 46.52  ? 187 SER C O   1 
ATOM 5483  C CB  . SER C 1 187 ? -56.066 60.189  -34.841 1.00 39.68  ? 187 SER C CB  1 
ATOM 5484  O OG  . SER C 1 187 ? -56.458 61.441  -34.314 1.00 47.72  ? 187 SER C OG  1 
ATOM 5485  N N   . GLY C 1 188 ? -53.864 59.876  -37.261 1.00 40.57  ? 188 GLY C N   1 
ATOM 5486  C CA  . GLY C 1 188 ? -53.348 60.287  -38.556 1.00 40.78  ? 188 GLY C CA  1 
ATOM 5487  C C   . GLY C 1 188 ? -51.843 60.174  -38.608 1.00 44.57  ? 188 GLY C C   1 
ATOM 5488  O O   . GLY C 1 188 ? -51.245 60.364  -39.663 1.00 43.97  ? 188 GLY C O   1 
ATOM 5489  N N   . GLY C 1 189 ? -51.251 59.874  -37.454 1.00 40.05  ? 189 GLY C N   1 
ATOM 5490  C CA  . GLY C 1 189 ? -49.817 59.740  -37.271 1.00 38.84  ? 189 GLY C CA  1 
ATOM 5491  C C   . GLY C 1 189 ? -49.306 58.337  -37.492 1.00 38.99  ? 189 GLY C C   1 
ATOM 5492  O O   . GLY C 1 189 ? -50.079 57.399  -37.712 1.00 34.87  ? 189 GLY C O   1 
ATOM 5493  N N   . ALA C 1 190 ? -47.990 58.190  -37.309 1.00 37.15  ? 190 ALA C N   1 
ATOM 5494  C CA  . ALA C 1 190 ? -47.253 56.995  -37.642 1.00 38.47  ? 190 ALA C CA  1 
ATOM 5495  C C   . ALA C 1 190 ? -47.109 55.939  -36.569 1.00 44.36  ? 190 ALA C C   1 
ATOM 5496  O O   . ALA C 1 190 ? -46.768 56.224  -35.407 1.00 44.31  ? 190 ALA C O   1 
ATOM 5497  C CB  . ALA C 1 190 ? -45.859 57.375  -38.125 1.00 39.38  ? 190 ALA C CB  1 
ATOM 5498  N N   . LEU C 1 191 ? -47.277 54.675  -37.046 1.00 38.78  ? 191 LEU C N   1 
ATOM 5499  C CA  . LEU C 1 191 ? -46.950 53.459  -36.344 1.00 37.36  ? 191 LEU C CA  1 
ATOM 5500  C C   . LEU C 1 191 ? -45.796 52.856  -37.137 1.00 41.34  ? 191 LEU C C   1 
ATOM 5501  O O   . LEU C 1 191 ? -45.960 52.539  -38.314 1.00 40.09  ? 191 LEU C O   1 
ATOM 5502  C CB  . LEU C 1 191 ? -48.130 52.489  -36.170 1.00 36.59  ? 191 LEU C CB  1 
ATOM 5503  C CG  . LEU C 1 191 ? -47.874 51.366  -35.168 1.00 39.54  ? 191 LEU C CG  1 
ATOM 5504  C CD1 . LEU C 1 191 ? -47.841 51.912  -33.720 1.00 39.18  ? 191 LEU C CD1 1 
ATOM 5505  C CD2 . LEU C 1 191 ? -48.866 50.218  -35.348 1.00 41.09  ? 191 LEU C CD2 1 
ATOM 5506  N N   . LEU C 1 192 ? -44.617 52.775  -36.512 1.00 38.61  ? 192 LEU C N   1 
ATOM 5507  C CA  . LEU C 1 192 ? -43.385 52.323  -37.159 1.00 38.38  ? 192 LEU C CA  1 
ATOM 5508  C C   . LEU C 1 192 ? -42.801 51.070  -36.575 1.00 43.93  ? 192 LEU C C   1 
ATOM 5509  O O   . LEU C 1 192 ? -42.983 50.810  -35.386 1.00 44.32  ? 192 LEU C O   1 
ATOM 5510  C CB  . LEU C 1 192 ? -42.303 53.409  -37.029 1.00 37.68  ? 192 LEU C CB  1 
ATOM 5511  C CG  . LEU C 1 192 ? -42.682 54.838  -37.316 1.00 41.13  ? 192 LEU C CG  1 
ATOM 5512  C CD1 . LEU C 1 192 ? -41.617 55.747  -36.809 1.00 41.14  ? 192 LEU C CD1 1 
ATOM 5513  C CD2 . LEU C 1 192 ? -42.971 55.063  -38.802 1.00 39.53  ? 192 LEU C CD2 1 
ATOM 5514  N N   . ASN C 1 193 ? -41.996 50.346  -37.384 1.00 40.39  ? 193 ASN C N   1 
ATOM 5515  C CA  . ASN C 1 193 ? -41.272 49.182  -36.882 1.00 40.31  ? 193 ASN C CA  1 
ATOM 5516  C C   . ASN C 1 193 ? -39.904 49.656  -36.396 1.00 43.51  ? 193 ASN C C   1 
ATOM 5517  O O   . ASN C 1 193 ? -39.644 50.873  -36.402 1.00 41.90  ? 193 ASN C O   1 
ATOM 5518  C CB  . ASN C 1 193 ? -41.170 48.068  -37.929 1.00 42.24  ? 193 ASN C CB  1 
ATOM 5519  C CG  . ASN C 1 193 ? -40.498 48.412  -39.240 1.00 56.86  ? 193 ASN C CG  1 
ATOM 5520  O OD1 . ASN C 1 193 ? -39.684 49.338  -39.354 1.00 53.85  ? 193 ASN C OD1 1 
ATOM 5521  N ND2 . ASN C 1 193 ? -40.831 47.641  -40.267 1.00 41.25  ? 193 ASN C ND2 1 
ATOM 5522  N N   . LEU C 1 194 ? -39.018 48.708  -36.010 1.00 41.18  ? 194 LEU C N   1 
ATOM 5523  C CA  . LEU C 1 194 ? -37.680 49.063  -35.499 1.00 40.73  ? 194 LEU C CA  1 
ATOM 5524  C C   . LEU C 1 194 ? -36.722 49.587  -36.594 1.00 45.20  ? 194 LEU C C   1 
ATOM 5525  O O   . LEU C 1 194 ? -35.676 50.128  -36.252 1.00 46.87  ? 194 LEU C O   1 
ATOM 5526  C CB  . LEU C 1 194 ? -37.046 47.903  -34.706 1.00 39.73  ? 194 LEU C CB  1 
ATOM 5527  C CG  . LEU C 1 194 ? -37.746 47.552  -33.375 1.00 41.45  ? 194 LEU C CG  1 
ATOM 5528  C CD1 . LEU C 1 194 ? -37.094 46.382  -32.704 1.00 40.56  ? 194 LEU C CD1 1 
ATOM 5529  C CD2 . LEU C 1 194 ? -37.807 48.730  -32.436 1.00 40.31  ? 194 LEU C CD2 1 
ATOM 5530  N N   . ASN C 1 195 ? -37.105 49.508  -37.881 1.00 40.88  ? 195 ASN C N   1 
ATOM 5531  C CA  . ASN C 1 195 ? -36.339 50.062  -39.012 1.00 40.07  ? 195 ASN C CA  1 
ATOM 5532  C C   . ASN C 1 195 ? -36.856 51.446  -39.373 1.00 44.55  ? 195 ASN C C   1 
ATOM 5533  O O   . ASN C 1 195 ? -36.348 52.071  -40.304 1.00 44.08  ? 195 ASN C O   1 
ATOM 5534  C CB  . ASN C 1 195 ? -36.422 49.158  -40.238 1.00 44.14  ? 195 ASN C CB  1 
ATOM 5535  C CG  . ASN C 1 195 ? -35.663 47.859  -40.132 1.00 76.37  ? 195 ASN C CG  1 
ATOM 5536  O OD1 . ASN C 1 195 ? -34.560 47.792  -39.570 1.00 74.12  ? 195 ASN C OD1 1 
ATOM 5537  N ND2 . ASN C 1 195 ? -36.225 46.802  -40.716 1.00 65.57  ? 195 ASN C ND2 1 
ATOM 5538  N N   . GLY C 1 196 ? -37.883 51.905  -38.658 1.00 42.07  ? 196 GLY C N   1 
ATOM 5539  C CA  . GLY C 1 196 ? -38.495 53.207  -38.891 1.00 41.71  ? 196 GLY C CA  1 
ATOM 5540  C C   . GLY C 1 196 ? -39.372 53.232  -40.126 1.00 46.08  ? 196 GLY C C   1 
ATOM 5541  O O   . GLY C 1 196 ? -39.584 54.295  -40.710 1.00 45.72  ? 196 GLY C O   1 
ATOM 5542  N N   . GLU C 1 197 ? -39.876 52.048  -40.536 1.00 41.37  ? 197 GLU C N   1 
ATOM 5543  C CA  . GLU C 1 197 ? -40.762 51.892  -41.676 1.00 40.53  ? 197 GLU C CA  1 
ATOM 5544  C C   . GLU C 1 197 ? -42.185 51.925  -41.190 1.00 45.85  ? 197 GLU C C   1 
ATOM 5545  O O   . GLU C 1 197 ? -42.476 51.398  -40.122 1.00 46.68  ? 197 GLU C O   1 
ATOM 5546  C CB  . GLU C 1 197 ? -40.478 50.577  -42.424 1.00 41.76  ? 197 GLU C CB  1 
ATOM 5547  C CG  . GLU C 1 197 ? -39.086 50.494  -43.046 1.00 51.47  ? 197 GLU C CG  1 
ATOM 5548  C CD  . GLU C 1 197 ? -38.521 49.111  -43.335 1.00 68.85  ? 197 GLU C CD  1 
ATOM 5549  O OE1 . GLU C 1 197 ? -37.397 49.051  -43.887 1.00 76.81  ? 197 GLU C OE1 1 
ATOM 5550  O OE2 . GLU C 1 197 ? -39.171 48.094  -42.993 1.00 57.25  ? 197 GLU C OE2 1 
ATOM 5551  N N   . LEU C 1 198 ? -43.082 52.522  -41.975 1.00 42.65  ? 198 LEU C N   1 
ATOM 5552  C CA  . LEU C 1 198 ? -44.508 52.622  -41.655 1.00 40.88  ? 198 LEU C CA  1 
ATOM 5553  C C   . LEU C 1 198 ? -45.186 51.263  -41.681 1.00 42.07  ? 198 LEU C C   1 
ATOM 5554  O O   . LEU C 1 198 ? -45.125 50.558  -42.685 1.00 43.24  ? 198 LEU C O   1 
ATOM 5555  C CB  . LEU C 1 198 ? -45.210 53.576  -42.637 1.00 40.58  ? 198 LEU C CB  1 
ATOM 5556  C CG  . LEU C 1 198 ? -46.588 54.084  -42.222 1.00 43.95  ? 198 LEU C CG  1 
ATOM 5557  C CD1 . LEU C 1 198 ? -46.484 55.114  -41.121 1.00 42.80  ? 198 LEU C CD1 1 
ATOM 5558  C CD2 . LEU C 1 198 ? -47.338 54.641  -43.411 1.00 44.11  ? 198 LEU C CD2 1 
ATOM 5559  N N   . ILE C 1 199 ? -45.830 50.899  -40.570 1.00 36.15  ? 199 ILE C N   1 
ATOM 5560  C CA  . ILE C 1 199 ? -46.572 49.643  -40.468 1.00 34.43  ? 199 ILE C CA  1 
ATOM 5561  C C   . ILE C 1 199 ? -48.066 49.941  -40.314 1.00 36.11  ? 199 ILE C C   1 
ATOM 5562  O O   . ILE C 1 199 ? -48.880 49.058  -40.558 1.00 37.24  ? 199 ILE C O   1 
ATOM 5563  C CB  . ILE C 1 199 ? -46.042 48.652  -39.384 1.00 36.36  ? 199 ILE C CB  1 
ATOM 5564  C CG1 . ILE C 1 199 ? -45.982 49.292  -37.968 1.00 35.76  ? 199 ILE C CG1 1 
ATOM 5565  C CG2 . ILE C 1 199 ? -44.684 48.076  -39.822 1.00 33.58  ? 199 ILE C CG2 1 
ATOM 5566  C CD1 . ILE C 1 199 ? -45.935 48.295  -36.824 1.00 32.32  ? 199 ILE C CD1 1 
ATOM 5567  N N   . GLY C 1 200 ? -48.420 51.174  -40.002 1.00 30.28  ? 200 GLY C N   1 
ATOM 5568  C CA  . GLY C 1 200 ? -49.819 51.549  -39.866 1.00 30.93  ? 200 GLY C CA  1 
ATOM 5569  C C   . GLY C 1 200 ? -50.026 53.026  -39.644 1.00 38.75  ? 200 GLY C C   1 
ATOM 5570  O O   . GLY C 1 200 ? -49.059 53.748  -39.422 1.00 40.99  ? 200 GLY C O   1 
ATOM 5571  N N   . ILE C 1 201 ? -51.282 53.488  -39.661 1.00 36.84  ? 201 ILE C N   1 
ATOM 5572  C CA  . ILE C 1 201 ? -51.620 54.899  -39.406 1.00 37.56  ? 201 ILE C CA  1 
ATOM 5573  C C   . ILE C 1 201 ? -52.472 54.938  -38.111 1.00 42.21  ? 201 ILE C C   1 
ATOM 5574  O O   . ILE C 1 201 ? -53.603 54.441  -38.133 1.00 43.22  ? 201 ILE C O   1 
ATOM 5575  C CB  . ILE C 1 201 ? -52.337 55.526  -40.680 1.00 41.23  ? 201 ILE C CB  1 
ATOM 5576  C CG1 . ILE C 1 201 ? -51.364 55.688  -41.905 1.00 41.01  ? 201 ILE C CG1 1 
ATOM 5577  C CG2 . ILE C 1 201 ? -53.120 56.845  -40.384 1.00 42.38  ? 201 ILE C CG2 1 
ATOM 5578  C CD1 . ILE C 1 201 ? -50.208 56.835  -41.757 1.00 45.08  ? 201 ILE C CD1 1 
ATOM 5579  N N   . ASN C 1 202 ? -51.917 55.450  -36.975 1.00 38.27  ? 202 ASN C N   1 
ATOM 5580  C CA  . ASN C 1 202 ? -52.653 55.522  -35.685 1.00 37.57  ? 202 ASN C CA  1 
ATOM 5581  C C   . ASN C 1 202 ? -54.018 56.197  -35.907 1.00 41.63  ? 202 ASN C C   1 
ATOM 5582  O O   . ASN C 1 202 ? -54.079 57.264  -36.512 1.00 41.47  ? 202 ASN C O   1 
ATOM 5583  C CB  . ASN C 1 202 ? -51.847 56.247  -34.621 1.00 34.13  ? 202 ASN C CB  1 
ATOM 5584  C CG  . ASN C 1 202 ? -50.474 55.652  -34.365 1.00 55.80  ? 202 ASN C CG  1 
ATOM 5585  O OD1 . ASN C 1 202 ? -49.480 56.371  -34.149 1.00 50.71  ? 202 ASN C OD1 1 
ATOM 5586  N ND2 . ASN C 1 202 ? -50.385 54.334  -34.376 1.00 40.27  ? 202 ASN C ND2 1 
ATOM 5587  N N   . THR C 1 203 ? -55.109 55.516  -35.549 1.00 38.86  ? 203 THR C N   1 
ATOM 5588  C CA  . THR C 1 203 ? -56.438 56.026  -35.871 1.00 39.75  ? 203 THR C CA  1 
ATOM 5589  C C   . THR C 1 203 ? -57.373 56.158  -34.661 1.00 46.44  ? 203 THR C C   1 
ATOM 5590  O O   . THR C 1 203 ? -57.953 57.229  -34.473 1.00 48.16  ? 203 THR C O   1 
ATOM 5591  C CB  . THR C 1 203 ? -57.042 55.127  -36.955 1.00 46.40  ? 203 THR C CB  1 
ATOM 5592  O OG1 . THR C 1 203 ? -56.201 55.227  -38.106 1.00 46.17  ? 203 THR C OG1 1 
ATOM 5593  C CG2 . THR C 1 203 ? -58.468 55.494  -37.318 1.00 43.14  ? 203 THR C CG2 1 
ATOM 5594  N N   . ALA C 1 204 ? -57.553 55.101  -33.879 1.00 42.01  ? 204 ALA C N   1 
ATOM 5595  C CA  . ALA C 1 204 ? -58.509 55.099  -32.778 1.00 42.40  ? 204 ALA C CA  1 
ATOM 5596  C C   . ALA C 1 204 ? -57.965 54.431  -31.533 1.00 47.91  ? 204 ALA C C   1 
ATOM 5597  O O   . ALA C 1 204 ? -56.955 53.731  -31.602 1.00 49.42  ? 204 ALA C O   1 
ATOM 5598  C CB  . ALA C 1 204 ? -59.770 54.355  -33.233 1.00 43.39  ? 204 ALA C CB  1 
ATOM 5599  N N   . ILE C 1 205 ? -58.661 54.599  -30.399 1.00 45.63  ? 205 ILE C N   1 
ATOM 5600  C CA  . ILE C 1 205 ? -58.322 53.918  -29.143 1.00 46.20  ? 205 ILE C CA  1 
ATOM 5601  C C   . ILE C 1 205 ? -59.580 53.417  -28.406 1.00 48.99  ? 205 ILE C C   1 
ATOM 5602  O O   . ILE C 1 205 ? -60.671 53.907  -28.663 1.00 47.08  ? 205 ILE C O   1 
ATOM 5603  C CB  . ILE C 1 205 ? -57.459 54.811  -28.214 1.00 49.46  ? 205 ILE C CB  1 
ATOM 5604  C CG1 . ILE C 1 205 ? -58.249 55.995  -27.622 1.00 48.90  ? 205 ILE C CG1 1 
ATOM 5605  C CG2 . ILE C 1 205 ? -56.151 55.242  -28.897 1.00 51.90  ? 205 ILE C CG2 1 
ATOM 5606  C CD1 . ILE C 1 205 ? -57.542 56.749  -26.526 1.00 50.26  ? 205 ILE C CD1 1 
ATOM 5607  N N   . LEU C 1 206 ? -59.413 52.424  -27.520 1.00 48.11  ? 206 LEU C N   1 
ATOM 5608  C CA  . LEU C 1 206 ? -60.411 51.964  -26.550 1.00 49.42  ? 206 LEU C CA  1 
ATOM 5609  C C   . LEU C 1 206 ? -59.981 52.534  -25.231 1.00 57.81  ? 206 LEU C C   1 
ATOM 5610  O O   . LEU C 1 206 ? -58.869 52.250  -24.778 1.00 58.31  ? 206 LEU C O   1 
ATOM 5611  C CB  . LEU C 1 206 ? -60.544 50.440  -26.465 1.00 49.97  ? 206 LEU C CB  1 
ATOM 5612  C CG  . LEU C 1 206 ? -61.433 49.697  -27.459 1.00 55.09  ? 206 LEU C CG  1 
ATOM 5613  C CD1 . LEU C 1 206 ? -62.020 48.467  -26.783 1.00 55.72  ? 206 LEU C CD1 1 
ATOM 5614  C CD2 . LEU C 1 206 ? -62.577 50.573  -28.013 1.00 56.59  ? 206 LEU C CD2 1 
ATOM 5615  N N   . ALA C 1 207 ? -60.775 53.445  -24.681 1.00 59.18  ? 207 ALA C N   1 
ATOM 5616  C CA  . ALA C 1 207 ? -60.425 54.154  -23.456 1.00 61.14  ? 207 ALA C CA  1 
ATOM 5617  C C   . ALA C 1 207 ? -61.671 54.471  -22.639 1.00 69.37  ? 207 ALA C C   1 
ATOM 5618  O O   . ALA C 1 207 ? -62.462 55.335  -23.044 1.00 69.67  ? 207 ALA C O   1 
ATOM 5619  C CB  . ALA C 1 207 ? -59.683 55.445  -23.803 1.00 62.10  ? 207 ALA C CB  1 
ATOM 5620  N N   . PRO C 1 208 ? -61.854 53.818  -21.468 1.00 68.96  ? 208 PRO C N   1 
ATOM 5621  C CA  . PRO C 1 208 ? -63.043 54.118  -20.640 1.00 69.49  ? 208 PRO C CA  1 
ATOM 5622  C C   . PRO C 1 208 ? -63.189 55.617  -20.282 1.00 73.68  ? 208 PRO C C   1 
ATOM 5623  O O   . PRO C 1 208 ? -64.304 56.147  -20.336 1.00 74.15  ? 208 PRO C O   1 
ATOM 5624  C CB  . PRO C 1 208 ? -62.837 53.261  -19.384 1.00 71.16  ? 208 PRO C CB  1 
ATOM 5625  C CG  . PRO C 1 208 ? -61.895 52.196  -19.791 1.00 75.41  ? 208 PRO C CG  1 
ATOM 5626  C CD  . PRO C 1 208 ? -61.006 52.783  -20.841 1.00 70.80  ? 208 PRO C CD  1 
ATOM 5627  N N   . GLY C 1 209 ? -62.082 56.296  -19.984 1.00 68.25  ? 209 GLY C N   1 
ATOM 5628  C CA  . GLY C 1 209 ? -62.137 57.706  -19.626 1.00 67.20  ? 209 GLY C CA  1 
ATOM 5629  C C   . GLY C 1 209 ? -61.389 58.672  -20.518 1.00 69.46  ? 209 GLY C C   1 
ATOM 5630  O O   . GLY C 1 209 ? -60.806 59.632  -20.005 1.00 70.35  ? 209 GLY C O   1 
ATOM 5631  N N   . GLY C 1 210 ? -61.412 58.433  -21.833 1.00 63.17  ? 210 GLY C N   1 
ATOM 5632  C CA  . GLY C 1 210 ? -60.782 59.302  -22.831 1.00 61.98  ? 210 GLY C CA  1 
ATOM 5633  C C   . GLY C 1 210 ? -59.257 59.371  -22.870 1.00 64.75  ? 210 GLY C C   1 
ATOM 5634  O O   . GLY C 1 210 ? -58.685 60.197  -23.602 1.00 66.20  ? 210 GLY C O   1 
ATOM 5635  N N   . GLY C 1 211 ? -58.590 58.515  -22.093 1.00 56.77  ? 211 GLY C N   1 
ATOM 5636  C CA  . GLY C 1 211 ? -57.136 58.453  -22.036 1.00 53.85  ? 211 GLY C CA  1 
ATOM 5637  C C   . GLY C 1 211 ? -56.627 57.052  -22.297 1.00 52.30  ? 211 GLY C C   1 
ATOM 5638  O O   . GLY C 1 211 ? -57.284 56.083  -21.896 1.00 52.13  ? 211 GLY C O   1 
ATOM 5639  N N   . SER C 1 212 ? -55.458 56.930  -22.980 1.00 43.13  ? 212 SER C N   1 
ATOM 5640  C CA  . SER C 1 212 ? -54.813 55.644  -23.287 1.00 39.97  ? 212 SER C CA  1 
ATOM 5641  C C   . SER C 1 212 ? -54.732 54.712  -22.078 1.00 43.78  ? 212 SER C C   1 
ATOM 5642  O O   . SER C 1 212 ? -54.354 55.136  -20.968 1.00 46.43  ? 212 SER C O   1 
ATOM 5643  C CB  . SER C 1 212 ? -53.401 55.859  -23.811 1.00 39.02  ? 212 SER C CB  1 
ATOM 5644  O OG  . SER C 1 212 ? -52.835 54.623  -24.211 1.00 41.42  ? 212 SER C OG  1 
ATOM 5645  N N   . VAL C 1 213 ? -55.110 53.439  -22.314 1.00 36.31  ? 213 VAL C N   1 
ATOM 5646  C CA  . VAL C 1 213 ? -55.078 52.316  -21.375 1.00 33.34  ? 213 VAL C CA  1 
ATOM 5647  C C   . VAL C 1 213 ? -54.254 51.205  -22.037 1.00 34.67  ? 213 VAL C C   1 
ATOM 5648  O O   . VAL C 1 213 ? -54.231 50.065  -21.559 1.00 35.33  ? 213 VAL C O   1 
ATOM 5649  C CB  . VAL C 1 213 ? -56.499 51.834  -20.920 1.00 37.24  ? 213 VAL C CB  1 
ATOM 5650  C CG1 . VAL C 1 213 ? -57.262 52.927  -20.188 1.00 36.80  ? 213 VAL C CG1 1 
ATOM 5651  C CG2 . VAL C 1 213 ? -57.327 51.244  -22.058 1.00 36.42  ? 213 VAL C CG2 1 
ATOM 5652  N N   . GLY C 1 214 ? -53.601 51.557  -23.151 1.00 28.62  ? 214 GLY C N   1 
ATOM 5653  C CA  . GLY C 1 214 ? -52.805 50.626  -23.930 1.00 28.81  ? 214 GLY C CA  1 
ATOM 5654  C C   . GLY C 1 214 ? -53.537 49.726  -24.917 1.00 36.14  ? 214 GLY C C   1 
ATOM 5655  O O   . GLY C 1 214 ? -53.045 48.622  -25.188 1.00 40.28  ? 214 GLY C O   1 
ATOM 5656  N N   . ILE C 1 215 ? -54.698 50.168  -25.459 1.00 30.11  ? 215 ILE C N   1 
ATOM 5657  C CA  . ILE C 1 215 ? -55.517 49.504  -26.495 1.00 30.17  ? 215 ILE C CA  1 
ATOM 5658  C C   . ILE C 1 215 ? -55.706 50.535  -27.621 1.00 36.25  ? 215 ILE C C   1 
ATOM 5659  O O   . ILE C 1 215 ? -56.643 51.350  -27.578 1.00 37.02  ? 215 ILE C O   1 
ATOM 5660  C CB  . ILE C 1 215 ? -56.895 48.950  -25.987 1.00 34.25  ? 215 ILE C CB  1 
ATOM 5661  C CG1 . ILE C 1 215 ? -56.851 48.171  -24.637 1.00 33.98  ? 215 ILE C CG1 1 
ATOM 5662  C CG2 . ILE C 1 215 ? -57.638 48.187  -27.076 1.00 37.39  ? 215 ILE C CG2 1 
ATOM 5663  C CD1 . ILE C 1 215 ? -56.316 46.802  -24.712 1.00 29.17  ? 215 ILE C CD1 1 
ATOM 5664  N N   . GLY C 1 216 ? -54.769 50.541  -28.564 1.00 32.65  ? 216 GLY C N   1 
ATOM 5665  C CA  . GLY C 1 216 ? -54.736 51.489  -29.675 1.00 32.57  ? 216 GLY C CA  1 
ATOM 5666  C C   . GLY C 1 216 ? -54.849 50.801  -31.014 1.00 38.34  ? 216 GLY C C   1 
ATOM 5667  O O   . GLY C 1 216 ? -54.415 49.656  -31.169 1.00 37.78  ? 216 GLY C O   1 
ATOM 5668  N N   . PHE C 1 217 ? -55.471 51.479  -31.987 1.00 35.30  ? 217 PHE C N   1 
ATOM 5669  C CA  . PHE C 1 217 ? -55.699 50.888  -33.298 1.00 34.05  ? 217 PHE C CA  1 
ATOM 5670  C C   . PHE C 1 217 ? -55.121 51.725  -34.426 1.00 36.45  ? 217 PHE C C   1 
ATOM 5671  O O   . PHE C 1 217 ? -55.242 52.951  -34.441 1.00 36.70  ? 217 PHE C O   1 
ATOM 5672  C CB  . PHE C 1 217 ? -57.193 50.651  -33.535 1.00 34.98  ? 217 PHE C CB  1 
ATOM 5673  C CG  . PHE C 1 217 ? -57.809 49.801  -32.454 1.00 35.90  ? 217 PHE C CG  1 
ATOM 5674  C CD1 . PHE C 1 217 ? -57.656 48.421  -32.461 1.00 38.05  ? 217 PHE C CD1 1 
ATOM 5675  C CD2 . PHE C 1 217 ? -58.519 50.383  -31.414 1.00 37.77  ? 217 PHE C CD2 1 
ATOM 5676  C CE1 . PHE C 1 217 ? -58.207 47.636  -31.445 1.00 39.64  ? 217 PHE C CE1 1 
ATOM 5677  C CE2 . PHE C 1 217 ? -59.081 49.596  -30.409 1.00 40.91  ? 217 PHE C CE2 1 
ATOM 5678  C CZ  . PHE C 1 217 ? -58.927 48.228  -30.433 1.00 38.79  ? 217 PHE C CZ  1 
ATOM 5679  N N   . ALA C 1 218 ? -54.500 51.036  -35.361 1.00 29.73  ? 218 ALA C N   1 
ATOM 5680  C CA  . ALA C 1 218 ? -53.916 51.639  -36.528 1.00 30.35  ? 218 ALA C CA  1 
ATOM 5681  C C   . ALA C 1 218 ? -54.485 50.980  -37.822 1.00 36.03  ? 218 ALA C C   1 
ATOM 5682  O O   . ALA C 1 218 ? -54.733 49.769  -37.870 1.00 34.07  ? 218 ALA C O   1 
ATOM 5683  C CB  . ALA C 1 218 ? -52.381 51.503  -36.466 1.00 30.66  ? 218 ALA C CB  1 
ATOM 5684  N N   . ILE C 1 219 ? -54.692 51.780  -38.868 1.00 34.69  ? 219 ILE C N   1 
ATOM 5685  C CA  . ILE C 1 219 ? -55.032 51.237  -40.188 1.00 34.12  ? 219 ILE C CA  1 
ATOM 5686  C C   . ILE C 1 219 ? -53.721 50.617  -40.716 1.00 39.66  ? 219 ILE C C   1 
ATOM 5687  O O   . ILE C 1 219 ? -52.699 51.312  -40.704 1.00 40.50  ? 219 ILE C O   1 
ATOM 5688  C CB  . ILE C 1 219 ? -55.586 52.337  -41.131 1.00 36.47  ? 219 ILE C CB  1 
ATOM 5689  C CG1 . ILE C 1 219 ? -56.927 52.921  -40.605 1.00 36.33  ? 219 ILE C CG1 1 
ATOM 5690  C CG2 . ILE C 1 219 ? -55.720 51.791  -42.567 1.00 35.60  ? 219 ILE C CG2 1 
ATOM 5691  C CD1 . ILE C 1 219 ? -57.221 54.314  -41.125 1.00 37.10  ? 219 ILE C CD1 1 
ATOM 5692  N N   . PRO C 1 220 ? -53.678 49.345  -41.146 1.00 34.99  ? 220 PRO C N   1 
ATOM 5693  C CA  . PRO C 1 220 ? -52.391 48.794  -41.636 1.00 34.91  ? 220 PRO C CA  1 
ATOM 5694  C C   . PRO C 1 220 ? -51.855 49.529  -42.875 1.00 43.03  ? 220 PRO C C   1 
ATOM 5695  O O   . PRO C 1 220 ? -52.636 50.046  -43.672 1.00 43.50  ? 220 PRO C O   1 
ATOM 5696  C CB  . PRO C 1 220 ? -52.697 47.330  -41.916 1.00 35.63  ? 220 PRO C CB  1 
ATOM 5697  C CG  . PRO C 1 220 ? -54.180 47.219  -41.936 1.00 39.31  ? 220 PRO C CG  1 
ATOM 5698  C CD  . PRO C 1 220 ? -54.773 48.359  -41.205 1.00 34.99  ? 220 PRO C CD  1 
ATOM 5699  N N   . SER C 1 221 ? -50.507 49.649  -42.972 1.00 42.52  ? 221 SER C N   1 
ATOM 5700  C CA  . SER C 1 221 ? -49.771 50.363  -44.038 1.00 42.28  ? 221 SER C CA  1 
ATOM 5701  C C   . SER C 1 221 ? -50.157 49.899  -45.454 1.00 46.78  ? 221 SER C C   1 
ATOM 5702  O O   . SER C 1 221 ? -50.256 50.743  -46.330 1.00 46.53  ? 221 SER C O   1 
ATOM 5703  C CB  . SER C 1 221 ? -48.261 50.223  -43.860 1.00 43.10  ? 221 SER C CB  1 
ATOM 5704  O OG  . SER C 1 221 ? -47.862 48.864  -43.803 1.00 47.99  ? 221 SER C OG  1 
ATOM 5705  N N   . ASN C 1 222 ? -50.401 48.593  -45.670 1.00 43.64  ? 222 ASN C N   1 
ATOM 5706  C CA  . ASN C 1 222 ? -50.797 48.081  -46.988 1.00 43.98  ? 222 ASN C CA  1 
ATOM 5707  C C   . ASN C 1 222 ? -52.127 48.674  -47.414 1.00 52.04  ? 222 ASN C C   1 
ATOM 5708  O O   . ASN C 1 222 ? -52.249 49.116  -48.557 1.00 54.06  ? 222 ASN C O   1 
ATOM 5709  C CB  . ASN C 1 222 ? -50.878 46.555  -47.007 1.00 35.05  ? 222 ASN C CB  1 
ATOM 5710  C CG  . ASN C 1 222 ? -49.555 45.831  -46.948 1.00 43.48  ? 222 ASN C CG  1 
ATOM 5711  O OD1 . ASN C 1 222 ? -49.529 44.599  -46.961 1.00 34.70  ? 222 ASN C OD1 1 
ATOM 5712  N ND2 . ASN C 1 222 ? -48.432 46.553  -46.824 1.00 35.56  ? 222 ASN C ND2 1 
ATOM 5713  N N   . MET C 1 223 ? -53.099 48.734  -46.481 1.00 48.40  ? 223 MET C N   1 
ATOM 5714  C CA  . MET C 1 223 ? -54.415 49.314  -46.707 1.00 48.22  ? 223 MET C CA  1 
ATOM 5715  C C   . MET C 1 223 ? -54.273 50.820  -46.952 1.00 54.25  ? 223 MET C C   1 
ATOM 5716  O O   . MET C 1 223 ? -54.837 51.336  -47.914 1.00 54.68  ? 223 MET C O   1 
ATOM 5717  C CB  . MET C 1 223 ? -55.320 49.025  -45.511 1.00 50.84  ? 223 MET C CB  1 
ATOM 5718  C CG  . MET C 1 223 ? -56.738 49.525  -45.688 1.00 55.41  ? 223 MET C CG  1 
ATOM 5719  S SD  . MET C 1 223 ? -57.881 48.909  -44.424 1.00 60.31  ? 223 MET C SD  1 
ATOM 5720  C CE  . MET C 1 223 ? -57.869 47.067  -44.836 1.00 57.31  ? 223 MET C CE  1 
ATOM 5721  N N   . ALA C 1 224 ? -53.492 51.513  -46.104 1.00 51.10  ? 224 ALA C N   1 
ATOM 5722  C CA  . ALA C 1 224 ? -53.257 52.945  -46.211 1.00 50.10  ? 224 ALA C CA  1 
ATOM 5723  C C   . ALA C 1 224 ? -52.537 53.303  -47.522 1.00 54.06  ? 224 ALA C C   1 
ATOM 5724  O O   . ALA C 1 224 ? -52.945 54.259  -48.169 1.00 55.04  ? 224 ALA C O   1 
ATOM 5725  C CB  . ALA C 1 224 ? -52.464 53.429  -45.013 1.00 50.59  ? 224 ALA C CB  1 
ATOM 5726  N N   . ARG C 1 225 ? -51.509 52.524  -47.930 1.00 50.28  ? 225 ARG C N   1 
ATOM 5727  C CA  . ARG C 1 225 ? -50.725 52.736  -49.169 1.00 50.52  ? 225 ARG C CA  1 
ATOM 5728  C C   . ARG C 1 225 ? -51.625 52.615  -50.417 1.00 52.71  ? 225 ARG C C   1 
ATOM 5729  O O   . ARG C 1 225 ? -51.617 53.514  -51.248 1.00 50.85  ? 225 ARG C O   1 
ATOM 5730  C CB  . ARG C 1 225 ? -49.566 51.727  -49.256 1.00 51.46  ? 225 ARG C CB  1 
ATOM 5731  C CG  . ARG C 1 225 ? -48.487 52.057  -50.290 1.00 64.98  ? 225 ARG C CG  1 
ATOM 5732  C CD  . ARG C 1 225 ? -47.837 50.810  -50.890 1.00 80.62  ? 225 ARG C CD  1 
ATOM 5733  N NE  . ARG C 1 225 ? -46.996 50.079  -49.935 1.00 100.21 ? 225 ARG C NE  1 
ATOM 5734  C CZ  . ARG C 1 225 ? -47.294 48.886  -49.416 1.00 121.75 ? 225 ARG C CZ  1 
ATOM 5735  N NH1 . ARG C 1 225 ? -48.417 48.264  -49.759 1.00 115.06 ? 225 ARG C NH1 1 
ATOM 5736  N NH2 . ARG C 1 225 ? -46.462 48.301  -48.561 1.00 103.96 ? 225 ARG C NH2 1 
ATOM 5737  N N   . THR C 1 226 ? -52.409 51.512  -50.518 1.00 48.83  ? 226 THR C N   1 
ATOM 5738  C CA  . THR C 1 226 ? -53.351 51.223  -51.612 1.00 47.61  ? 226 THR C CA  1 
ATOM 5739  C C   . THR C 1 226 ? -54.383 52.341  -51.746 1.00 49.69  ? 226 THR C C   1 
ATOM 5740  O O   . THR C 1 226 ? -54.582 52.847  -52.859 1.00 49.25  ? 226 THR C O   1 
ATOM 5741  C CB  . THR C 1 226 ? -54.012 49.872  -51.366 1.00 51.19  ? 226 THR C CB  1 
ATOM 5742  O OG1 . THR C 1 226 ? -52.968 48.902  -51.274 1.00 47.01  ? 226 THR C OG1 1 
ATOM 5743  C CG2 . THR C 1 226 ? -55.050 49.477  -52.449 1.00 49.11  ? 226 THR C CG2 1 
ATOM 5744  N N   . LEU C 1 227 ? -55.009 52.744  -50.621 1.00 44.05  ? 227 LEU C N   1 
ATOM 5745  C CA  . LEU C 1 227 ? -56.011 53.813  -50.639 1.00 43.73  ? 227 LEU C CA  1 
ATOM 5746  C C   . LEU C 1 227 ? -55.386 55.134  -51.069 1.00 50.24  ? 227 LEU C C   1 
ATOM 5747  O O   . LEU C 1 227 ? -55.966 55.819  -51.905 1.00 49.85  ? 227 LEU C O   1 
ATOM 5748  C CB  . LEU C 1 227 ? -56.734 53.944  -49.290 1.00 43.07  ? 227 LEU C CB  1 
ATOM 5749  C CG  . LEU C 1 227 ? -57.623 52.728  -48.921 1.00 46.83  ? 227 LEU C CG  1 
ATOM 5750  C CD1 . LEU C 1 227 ? -57.854 52.657  -47.459 1.00 47.03  ? 227 LEU C CD1 1 
ATOM 5751  C CD2 . LEU C 1 227 ? -58.931 52.684  -49.715 1.00 44.23  ? 227 LEU C CD2 1 
ATOM 5752  N N   . ALA C 1 228 ? -54.165 55.438  -50.577 1.00 48.75  ? 228 ALA C N   1 
ATOM 5753  C CA  . ALA C 1 228 ? -53.424 56.641  -50.938 1.00 49.02  ? 228 ALA C CA  1 
ATOM 5754  C C   . ALA C 1 228 ? -53.149 56.677  -52.452 1.00 54.84  ? 228 ALA C C   1 
ATOM 5755  O O   . ALA C 1 228 ? -53.360 57.721  -53.068 1.00 55.97  ? 228 ALA C O   1 
ATOM 5756  C CB  . ALA C 1 228 ? -52.123 56.714  -50.154 1.00 49.80  ? 228 ALA C CB  1 
ATOM 5757  N N   . GLN C 1 229 ? -52.756 55.534  -53.055 1.00 51.67  ? 229 GLN C N   1 
ATOM 5758  C CA  . GLN C 1 229 ? -52.507 55.429  -54.500 1.00 52.61  ? 229 GLN C CA  1 
ATOM 5759  C C   . GLN C 1 229 ? -53.759 55.747  -55.294 1.00 57.57  ? 229 GLN C C   1 
ATOM 5760  O O   . GLN C 1 229 ? -53.668 56.519  -56.238 1.00 58.60  ? 229 GLN C O   1 
ATOM 5761  C CB  . GLN C 1 229 ? -51.951 54.053  -54.925 1.00 53.78  ? 229 GLN C CB  1 
ATOM 5762  C CG  . GLN C 1 229 ? -50.425 54.032  -55.127 1.00 72.40  ? 229 GLN C CG  1 
ATOM 5763  C CD  . GLN C 1 229 ? -49.888 55.114  -56.055 1.00 89.41  ? 229 GLN C CD  1 
ATOM 5764  O OE1 . GLN C 1 229 ? -50.434 55.386  -57.138 1.00 85.00  ? 229 GLN C OE1 1 
ATOM 5765  N NE2 . GLN C 1 229 ? -48.802 55.765  -55.637 1.00 73.78  ? 229 GLN C NE2 1 
ATOM 5766  N N   . GLN C 1 230 ? -54.925 55.213  -54.877 1.00 53.12  ? 230 GLN C N   1 
ATOM 5767  C CA  . GLN C 1 230 ? -56.216 55.474  -55.511 1.00 53.12  ? 230 GLN C CA  1 
ATOM 5768  C C   . GLN C 1 230 ? -56.558 56.961  -55.465 1.00 60.90  ? 230 GLN C C   1 
ATOM 5769  O O   . GLN C 1 230 ? -57.129 57.484  -56.418 1.00 61.49  ? 230 GLN C O   1 
ATOM 5770  C CB  . GLN C 1 230 ? -57.331 54.657  -54.852 1.00 53.87  ? 230 GLN C CB  1 
ATOM 5771  C CG  . GLN C 1 230 ? -57.373 53.208  -55.337 1.00 55.48  ? 230 GLN C CG  1 
ATOM 5772  C CD  . GLN C 1 230 ? -58.195 52.303  -54.457 1.00 66.80  ? 230 GLN C CD  1 
ATOM 5773  O OE1 . GLN C 1 230 ? -57.743 51.244  -54.000 1.00 62.03  ? 230 GLN C OE1 1 
ATOM 5774  N NE2 . GLN C 1 230 ? -59.417 52.693  -54.196 1.00 64.44  ? 230 GLN C NE2 1 
ATOM 5775  N N   . LEU C 1 231 ? -56.180 57.656  -54.384 1.00 58.85  ? 231 LEU C N   1 
ATOM 5776  C CA  . LEU C 1 231 ? -56.447 59.090  -54.262 1.00 58.13  ? 231 LEU C CA  1 
ATOM 5777  C C   . LEU C 1 231 ? -55.446 59.916  -55.088 1.00 63.42  ? 231 LEU C C   1 
ATOM 5778  O O   . LEU C 1 231 ? -55.843 60.952  -55.617 1.00 63.36  ? 231 LEU C O   1 
ATOM 5779  C CB  . LEU C 1 231 ? -56.470 59.554  -52.796 1.00 57.63  ? 231 LEU C CB  1 
ATOM 5780  C CG  . LEU C 1 231 ? -57.508 58.885  -51.861 1.00 60.97  ? 231 LEU C CG  1 
ATOM 5781  C CD1 . LEU C 1 231 ? -57.166 59.144  -50.392 1.00 61.08  ? 231 LEU C CD1 1 
ATOM 5782  C CD2 . LEU C 1 231 ? -58.921 59.342  -52.157 1.00 59.77  ? 231 LEU C CD2 1 
ATOM 5783  N N   . ILE C 1 232 ? -54.172 59.472  -55.230 1.00 61.14  ? 232 ILE C N   1 
ATOM 5784  C CA  . ILE C 1 232 ? -53.221 60.233  -56.053 1.00 61.55  ? 232 ILE C CA  1 
ATOM 5785  C C   . ILE C 1 232 ? -53.625 60.052  -57.546 1.00 64.64  ? 232 ILE C C   1 
ATOM 5786  O O   . ILE C 1 232 ? -53.609 61.030  -58.292 1.00 64.09  ? 232 ILE C O   1 
ATOM 5787  C CB  . ILE C 1 232 ? -51.685 59.962  -55.802 1.00 65.62  ? 232 ILE C CB  1 
ATOM 5788  C CG1 . ILE C 1 232 ? -51.128 58.771  -56.589 1.00 67.38  ? 232 ILE C CG1 1 
ATOM 5789  C CG2 . ILE C 1 232 ? -51.285 59.889  -54.316 1.00 66.22  ? 232 ILE C CG2 1 
ATOM 5790  C CD1 . ILE C 1 232 ? -49.600 58.904  -56.974 1.00 80.19  ? 232 ILE C CD1 1 
ATOM 5791  N N   . ASP C 1 233 ? -54.066 58.826  -57.934 1.00 60.59  ? 233 ASP C N   1 
ATOM 5792  C CA  . ASP C 1 233 ? -54.438 58.439  -59.293 1.00 60.19  ? 233 ASP C CA  1 
ATOM 5793  C C   . ASP C 1 233 ? -55.807 58.928  -59.754 1.00 67.20  ? 233 ASP C C   1 
ATOM 5794  O O   . ASP C 1 233 ? -55.942 59.250  -60.935 1.00 67.19  ? 233 ASP C O   1 
ATOM 5795  C CB  . ASP C 1 233 ? -54.436 56.910  -59.441 1.00 61.04  ? 233 ASP C CB  1 
ATOM 5796  C CG  . ASP C 1 233 ? -53.100 56.199  -59.368 1.00 71.49  ? 233 ASP C CG  1 
ATOM 5797  O OD1 . ASP C 1 233 ? -52.052 56.889  -59.358 1.00 73.59  ? 233 ASP C OD1 1 
ATOM 5798  O OD2 . ASP C 1 233 ? -53.097 54.942  -59.345 1.00 77.19  ? 233 ASP C OD2 1 
ATOM 5799  N N   . PHE C 1 234 ? -56.837 58.900  -58.867 1.00 64.94  ? 234 PHE C N   1 
ATOM 5800  C CA  . PHE C 1 234 ? -58.229 59.213  -59.233 1.00 64.19  ? 234 PHE C CA  1 
ATOM 5801  C C   . PHE C 1 234 ? -58.902 60.319  -58.406 1.00 67.57  ? 234 PHE C C   1 
ATOM 5802  O O   . PHE C 1 234 ? -60.049 60.667  -58.715 1.00 68.13  ? 234 PHE C O   1 
ATOM 5803  C CB  . PHE C 1 234 ? -59.097 57.942  -59.114 1.00 65.80  ? 234 PHE C CB  1 
ATOM 5804  C CG  . PHE C 1 234 ? -58.471 56.691  -59.676 1.00 67.69  ? 234 PHE C CG  1 
ATOM 5805  C CD1 . PHE C 1 234 ? -57.861 55.766  -58.843 1.00 71.01  ? 234 PHE C CD1 1 
ATOM 5806  C CD2 . PHE C 1 234 ? -58.497 56.432  -61.037 1.00 70.61  ? 234 PHE C CD2 1 
ATOM 5807  C CE1 . PHE C 1 234 ? -57.276 54.611  -59.362 1.00 72.19  ? 234 PHE C CE1 1 
ATOM 5808  C CE2 . PHE C 1 234 ? -57.922 55.270  -61.553 1.00 73.73  ? 234 PHE C CE2 1 
ATOM 5809  C CZ  . PHE C 1 234 ? -57.304 54.375  -60.713 1.00 71.74  ? 234 PHE C CZ  1 
ATOM 5810  N N   . GLY C 1 235 ? -58.244 60.816  -57.351 1.00 61.82  ? 235 GLY C N   1 
ATOM 5811  C CA  . GLY C 1 235 ? -58.830 61.835  -56.480 1.00 60.87  ? 235 GLY C CA  1 
ATOM 5812  C C   . GLY C 1 235 ? -59.983 61.312  -55.643 1.00 63.31  ? 235 GLY C C   1 
ATOM 5813  O O   . GLY C 1 235 ? -60.594 62.058  -54.880 1.00 63.89  ? 235 GLY C O   1 
ATOM 5814  N N   . GLU C 1 236 ? -60.280 60.020  -55.791 1.00 58.87  ? 236 GLU C N   1 
ATOM 5815  C CA  . GLU C 1 236 ? -61.348 59.270  -55.136 1.00 58.69  ? 236 GLU C CA  1 
ATOM 5816  C C   . GLU C 1 236 ? -60.973 57.791  -55.070 1.00 61.80  ? 236 GLU C C   1 
ATOM 5817  O O   . GLU C 1 236 ? -60.103 57.328  -55.823 1.00 62.83  ? 236 GLU C O   1 
ATOM 5818  C CB  . GLU C 1 236 ? -62.682 59.446  -55.885 1.00 60.35  ? 236 GLU C CB  1 
ATOM 5819  C CG  . GLU C 1 236 ? -62.637 59.008  -57.345 1.00 73.28  ? 236 GLU C CG  1 
ATOM 5820  C CD  . GLU C 1 236 ? -63.964 58.924  -58.067 1.00 95.48  ? 236 GLU C CD  1 
ATOM 5821  O OE1 . GLU C 1 236 ? -64.845 59.772  -57.796 1.00 62.98  ? 236 GLU C OE1 1 
ATOM 5822  O OE2 . GLU C 1 236 ? -64.099 58.045  -58.950 1.00 100.63 ? 236 GLU C OE2 1 
ATOM 5823  N N   . ILE C 1 237 ? -61.642 57.047  -54.190 1.00 56.16  ? 237 ILE C N   1 
ATOM 5824  C CA  . ILE C 1 237 ? -61.385 55.613  -54.057 1.00 54.93  ? 237 ILE C CA  1 
ATOM 5825  C C   . ILE C 1 237 ? -62.267 54.846  -55.026 1.00 60.05  ? 237 ILE C C   1 
ATOM 5826  O O   . ILE C 1 237 ? -63.298 55.350  -55.491 1.00 60.31  ? 237 ILE C O   1 
ATOM 5827  C CB  . ILE C 1 237 ? -61.523 55.072  -52.591 1.00 56.29  ? 237 ILE C CB  1 
ATOM 5828  C CG1 . ILE C 1 237 ? -62.914 55.371  -51.969 1.00 55.49  ? 237 ILE C CG1 1 
ATOM 5829  C CG2 . ILE C 1 237 ? -60.351 55.563  -51.697 1.00 54.49  ? 237 ILE C CG2 1 
ATOM 5830  C CD1 . ILE C 1 237 ? -64.053 54.370  -52.289 1.00 57.33  ? 237 ILE C CD1 1 
ATOM 5831  N N   . LYS C 1 238 ? -61.870 53.601  -55.278 1.00 56.84  ? 238 LYS C N   1 
ATOM 5832  C CA  . LYS C 1 238 ? -62.574 52.654  -56.111 1.00 56.33  ? 238 LYS C CA  1 
ATOM 5833  C C   . LYS C 1 238 ? -62.833 51.405  -55.258 1.00 58.14  ? 238 LYS C C   1 
ATOM 5834  O O   . LYS C 1 238 ? -61.897 50.669  -54.914 1.00 56.75  ? 238 LYS C O   1 
ATOM 5835  C CB  . LYS C 1 238 ? -61.783 52.401  -57.415 1.00 59.13  ? 238 LYS C CB  1 
ATOM 5836  C CG  . LYS C 1 238 ? -62.246 53.364  -58.506 1.00 74.07  ? 238 LYS C CG  1 
ATOM 5837  C CD  . LYS C 1 238 ? -61.179 54.161  -59.226 1.00 86.50  ? 238 LYS C CD  1 
ATOM 5838  C CE  . LYS C 1 238 ? -61.825 55.401  -59.852 1.00 97.41  ? 238 LYS C CE  1 
ATOM 5839  N NZ  . LYS C 1 238 ? -61.841 55.372  -61.349 1.00 104.06 ? 238 LYS C NZ  1 
ATOM 5840  N N   . ARG C 1 239 ? -64.120 51.222  -54.864 1.00 54.18  ? 239 ARG C N   1 
ATOM 5841  C CA  . ARG C 1 239 ? -64.580 50.149  -53.978 1.00 54.19  ? 239 ARG C CA  1 
ATOM 5842  C C   . ARG C 1 239 ? -64.897 48.879  -54.729 1.00 58.76  ? 239 ARG C C   1 
ATOM 5843  O O   . ARG C 1 239 ? -65.834 48.842  -55.522 1.00 58.94  ? 239 ARG C O   1 
ATOM 5844  C CB  . ARG C 1 239 ? -65.821 50.594  -53.180 1.00 53.63  ? 239 ARG C CB  1 
ATOM 5845  C CG  . ARG C 1 239 ? -66.093 49.802  -51.889 1.00 50.57  ? 239 ARG C CG  1 
ATOM 5846  C CD  . ARG C 1 239 ? -65.751 50.641  -50.682 1.00 46.60  ? 239 ARG C CD  1 
ATOM 5847  N NE  . ARG C 1 239 ? -64.316 50.926  -50.643 1.00 50.53  ? 239 ARG C NE  1 
ATOM 5848  C CZ  . ARG C 1 239 ? -63.742 51.886  -49.927 1.00 61.79  ? 239 ARG C CZ  1 
ATOM 5849  N NH1 . ARG C 1 239 ? -64.480 52.688  -49.164 1.00 44.47  ? 239 ARG C NH1 1 
ATOM 5850  N NH2 . ARG C 1 239 ? -62.431 52.076  -49.992 1.00 49.28  ? 239 ARG C NH2 1 
ATOM 5851  N N   . GLY C 1 240 ? -64.132 47.839  -54.434 1.00 55.52  ? 240 GLY C N   1 
ATOM 5852  C CA  . GLY C 1 240 ? -64.313 46.525  -55.036 1.00 54.71  ? 240 GLY C CA  1 
ATOM 5853  C C   . GLY C 1 240 ? -65.315 45.663  -54.293 1.00 57.01  ? 240 GLY C C   1 
ATOM 5854  O O   . GLY C 1 240 ? -65.516 45.842  -53.093 1.00 56.31  ? 240 GLY C O   1 
ATOM 5855  N N   . LEU C 1 241 ? -65.998 44.756  -55.009 1.00 54.29  ? 241 LEU C N   1 
ATOM 5856  C CA  . LEU C 1 241 ? -66.902 43.805  -54.374 1.00 54.53  ? 241 LEU C CA  1 
ATOM 5857  C C   . LEU C 1 241 ? -66.828 42.439  -55.039 1.00 53.75  ? 241 LEU C C   1 
ATOM 5858  O O   . LEU C 1 241 ? -66.611 42.340  -56.241 1.00 53.71  ? 241 LEU C O   1 
ATOM 5859  C CB  . LEU C 1 241 ? -68.364 44.266  -54.184 1.00 56.37  ? 241 LEU C CB  1 
ATOM 5860  C CG  . LEU C 1 241 ? -69.306 44.522  -55.348 1.00 64.72  ? 241 LEU C CG  1 
ATOM 5861  C CD1 . LEU C 1 241 ? -69.857 43.229  -55.934 1.00 66.09  ? 241 LEU C CD1 1 
ATOM 5862  C CD2 . LEU C 1 241 ? -70.529 45.218  -54.843 1.00 69.25  ? 241 LEU C CD2 1 
ATOM 5863  N N   . LEU C 1 242 ? -66.978 41.388  -54.227 1.00 48.20  ? 242 LEU C N   1 
ATOM 5864  C CA  . LEU C 1 242 ? -66.987 39.999  -54.652 1.00 47.58  ? 242 LEU C CA  1 
ATOM 5865  C C   . LEU C 1 242 ? -68.329 39.600  -55.308 1.00 52.16  ? 242 LEU C C   1 
ATOM 5866  O O   . LEU C 1 242 ? -68.339 38.875  -56.307 1.00 51.57  ? 242 LEU C O   1 
ATOM 5867  C CB  . LEU C 1 242 ? -66.741 39.097  -53.431 1.00 47.06  ? 242 LEU C CB  1 
ATOM 5868  C CG  . LEU C 1 242 ? -65.320 38.902  -52.944 1.00 50.00  ? 242 LEU C CG  1 
ATOM 5869  C CD1 . LEU C 1 242 ? -65.320 38.120  -51.641 1.00 47.94  ? 242 LEU C CD1 1 
ATOM 5870  C CD2 . LEU C 1 242 ? -64.465 38.157  -53.983 1.00 50.96  ? 242 LEU C CD2 1 
ATOM 5871  N N   . GLY C 1 243 ? -69.429 40.053  -54.707 1.00 49.92  ? 243 GLY C N   1 
ATOM 5872  C CA  . GLY C 1 243 ? -70.798 39.720  -55.084 1.00 50.32  ? 243 GLY C CA  1 
ATOM 5873  C C   . GLY C 1 243 ? -71.263 38.559  -54.228 1.00 55.32  ? 243 GLY C C   1 
ATOM 5874  O O   . GLY C 1 243 ? -71.894 37.616  -54.715 1.00 56.51  ? 243 GLY C O   1 
ATOM 5875  N N   . ILE C 1 244 ? -70.907 38.627  -52.940 1.00 50.82  ? 244 ILE C N   1 
ATOM 5876  C CA  . ILE C 1 244 ? -71.137 37.619  -51.922 1.00 50.96  ? 244 ILE C CA  1 
ATOM 5877  C C   . ILE C 1 244 ? -71.948 38.230  -50.776 1.00 54.94  ? 244 ILE C C   1 
ATOM 5878  O O   . ILE C 1 244 ? -71.793 39.403  -50.447 1.00 53.09  ? 244 ILE C O   1 
ATOM 5879  C CB  . ILE C 1 244 ? -69.712 37.121  -51.464 1.00 54.70  ? 244 ILE C CB  1 
ATOM 5880  C CG1 . ILE C 1 244 ? -69.091 36.117  -52.453 1.00 56.94  ? 244 ILE C CG1 1 
ATOM 5881  C CG2 . ILE C 1 244 ? -69.558 36.670  -50.011 1.00 53.74  ? 244 ILE C CG2 1 
ATOM 5882  C CD1 . ILE C 1 244 ? -69.938 34.993  -52.886 1.00 69.82  ? 244 ILE C CD1 1 
ATOM 5883  N N   . LYS C 1 245 ? -72.827 37.421  -50.195 1.00 52.05  ? 245 LYS C N   1 
ATOM 5884  C CA  . LYS C 1 245 ? -73.602 37.730  -49.007 1.00 51.47  ? 245 LYS C CA  1 
ATOM 5885  C C   . LYS C 1 245 ? -73.320 36.607  -48.064 1.00 55.50  ? 245 LYS C C   1 
ATOM 5886  O O   . LYS C 1 245 ? -73.371 35.434  -48.440 1.00 53.25  ? 245 LYS C O   1 
ATOM 5887  C CB  . LYS C 1 245 ? -75.109 37.923  -49.276 1.00 53.95  ? 245 LYS C CB  1 
ATOM 5888  C CG  . LYS C 1 245 ? -75.534 39.385  -49.302 1.00 71.21  ? 245 LYS C CG  1 
ATOM 5889  C CD  . LYS C 1 245 ? -77.047 39.555  -49.145 1.00 85.48  ? 245 LYS C CD  1 
ATOM 5890  C CE  . LYS C 1 245 ? -77.737 39.863  -50.454 1.00 99.46  ? 245 LYS C CE  1 
ATOM 5891  N NZ  . LYS C 1 245 ? -79.218 39.896  -50.307 1.00 108.31 ? 245 LYS C NZ  1 
ATOM 5892  N N   . GLY C 1 246 ? -72.922 36.963  -46.859 1.00 55.15  ? 246 GLY C N   1 
ATOM 5893  C CA  . GLY C 1 246 ? -72.602 35.950  -45.871 1.00 54.33  ? 246 GLY C CA  1 
ATOM 5894  C C   . GLY C 1 246 ? -72.560 36.420  -44.448 1.00 55.93  ? 246 GLY C C   1 
ATOM 5895  O O   . GLY C 1 246 ? -72.778 37.598  -44.146 1.00 54.31  ? 246 GLY C O   1 
ATOM 5896  N N   . THR C 1 247 ? -72.278 35.455  -43.576 1.00 52.43  ? 247 THR C N   1 
ATOM 5897  C CA  . THR C 1 247 ? -72.131 35.619  -42.145 1.00 51.14  ? 247 THR C CA  1 
ATOM 5898  C C   . THR C 1 247 ? -70.748 35.161  -41.731 1.00 52.99  ? 247 THR C C   1 
ATOM 5899  O O   . THR C 1 247 ? -69.972 34.664  -42.548 1.00 51.68  ? 247 THR C O   1 
ATOM 5900  C CB  . THR C 1 247 ? -73.220 34.855  -41.383 1.00 58.78  ? 247 THR C CB  1 
ATOM 5901  O OG1 . THR C 1 247 ? -73.180 33.468  -41.703 1.00 58.26  ? 247 THR C OG1 1 
ATOM 5902  C CG2 . THR C 1 247 ? -74.594 35.439  -41.574 1.00 59.42  ? 247 THR C CG2 1 
ATOM 5903  N N   . GLU C 1 248 ? -70.439 35.353  -40.450 1.00 49.13  ? 248 GLU C N   1 
ATOM 5904  C CA  . GLU C 1 248 ? -69.194 34.921  -39.853 1.00 47.78  ? 248 GLU C CA  1 
ATOM 5905  C C   . GLU C 1 248 ? -69.217 33.418  -39.695 1.00 52.39  ? 248 GLU C C   1 
ATOM 5906  O O   . GLU C 1 248 ? -70.223 32.836  -39.270 1.00 52.48  ? 248 GLU C O   1 
ATOM 5907  C CB  . GLU C 1 248 ? -68.971 35.603  -38.479 1.00 47.87  ? 248 GLU C CB  1 
ATOM 5908  C CG  . GLU C 1 248 ? -68.553 37.063  -38.568 1.00 46.14  ? 248 GLU C CG  1 
ATOM 5909  C CD  . GLU C 1 248 ? -67.146 37.344  -39.058 1.00 72.04  ? 248 GLU C CD  1 
ATOM 5910  O OE1 . GLU C 1 248 ? -66.334 36.389  -39.152 1.00 68.50  ? 248 GLU C OE1 1 
ATOM 5911  O OE2 . GLU C 1 248 ? -66.863 38.525  -39.368 1.00 68.63  ? 248 GLU C OE2 1 
ATOM 5912  N N   . MET C 1 249 ? -68.115 32.793  -40.059 1.00 48.84  ? 249 MET C N   1 
ATOM 5913  C CA  . MET C 1 249 ? -67.913 31.367  -39.857 1.00 48.15  ? 249 MET C CA  1 
ATOM 5914  C C   . MET C 1 249 ? -67.722 31.172  -38.333 1.00 51.80  ? 249 MET C C   1 
ATOM 5915  O O   . MET C 1 249 ? -67.095 32.008  -37.688 1.00 52.29  ? 249 MET C O   1 
ATOM 5916  C CB  . MET C 1 249 ? -66.705 30.895  -40.700 1.00 49.75  ? 249 MET C CB  1 
ATOM 5917  C CG  . MET C 1 249 ? -66.266 29.451  -40.485 1.00 52.88  ? 249 MET C CG  1 
ATOM 5918  S SD  . MET C 1 249 ? -67.496 28.101  -40.485 1.00 56.74  ? 249 MET C SD  1 
ATOM 5919  C CE  . MET C 1 249 ? -68.607 28.666  -41.622 1.00 54.05  ? 249 MET C CE  1 
ATOM 5920  N N   . SER C 1 250 ? -68.331 30.137  -37.764 1.00 46.88  ? 250 SER C N   1 
ATOM 5921  C CA  . SER C 1 250 ? -68.259 29.865  -36.336 1.00 45.36  ? 250 SER C CA  1 
ATOM 5922  C C   . SER C 1 250 ? -67.871 28.418  -36.077 1.00 49.69  ? 250 SER C C   1 
ATOM 5923  O O   . SER C 1 250 ? -67.908 27.582  -36.984 1.00 49.62  ? 250 SER C O   1 
ATOM 5924  C CB  . SER C 1 250 ? -69.594 30.178  -35.658 1.00 44.86  ? 250 SER C CB  1 
ATOM 5925  O OG  . SER C 1 250 ? -70.652 29.354  -36.114 1.00 50.28  ? 250 SER C OG  1 
ATOM 5926  N N   . ALA C 1 251 ? -67.520 28.131  -34.815 1.00 45.30  ? 251 ALA C N   1 
ATOM 5927  C CA  . ALA C 1 251 ? -67.209 26.803  -34.312 1.00 45.11  ? 251 ALA C CA  1 
ATOM 5928  C C   . ALA C 1 251 ? -68.435 25.901  -34.414 1.00 49.33  ? 251 ALA C C   1 
ATOM 5929  O O   . ALA C 1 251 ? -68.301 24.691  -34.520 1.00 49.40  ? 251 ALA C O   1 
ATOM 5930  C CB  . ALA C 1 251 ? -66.746 26.893  -32.856 1.00 45.75  ? 251 ALA C CB  1 
ATOM 5931  N N   . ASP C 1 252 ? -69.626 26.501  -34.374 1.00 48.01  ? 252 ASP C N   1 
ATOM 5932  C CA  . ASP C 1 252 ? -70.939 25.842  -34.425 1.00 48.28  ? 252 ASP C CA  1 
ATOM 5933  C C   . ASP C 1 252 ? -71.183 25.289  -35.811 1.00 50.21  ? 252 ASP C C   1 
ATOM 5934  O O   . ASP C 1 252 ? -71.522 24.117  -35.917 1.00 49.04  ? 252 ASP C O   1 
ATOM 5935  C CB  . ASP C 1 252 ? -72.043 26.831  -33.998 1.00 50.44  ? 252 ASP C CB  1 
ATOM 5936  C CG  . ASP C 1 252 ? -71.740 27.466  -32.648 1.00 64.16  ? 252 ASP C CG  1 
ATOM 5937  O OD1 . ASP C 1 252 ? -71.654 26.710  -31.643 1.00 61.93  ? 252 ASP C OD1 1 
ATOM 5938  O OD2 . ASP C 1 252 ? -71.459 28.701  -32.616 1.00 73.33  ? 252 ASP C OD2 1 
ATOM 5939  N N   . ILE C 1 253 ? -70.940 26.100  -36.874 1.00 46.61  ? 253 ILE C N   1 
ATOM 5940  C CA  . ILE C 1 253 ? -71.043 25.647  -38.258 1.00 45.85  ? 253 ILE C CA  1 
ATOM 5941  C C   . ILE C 1 253 ? -70.013 24.535  -38.468 1.00 52.22  ? 253 ILE C C   1 
ATOM 5942  O O   . ILE C 1 253 ? -70.361 23.471  -38.976 1.00 53.05  ? 253 ILE C O   1 
ATOM 5943  C CB  . ILE C 1 253 ? -70.845 26.796  -39.292 1.00 49.01  ? 253 ILE C CB  1 
ATOM 5944  C CG1 . ILE C 1 253 ? -71.635 28.108  -38.977 1.00 48.57  ? 253 ILE C CG1 1 
ATOM 5945  C CG2 . ILE C 1 253 ? -71.052 26.297  -40.733 1.00 49.45  ? 253 ILE C CG2 1 
ATOM 5946  C CD1 . ILE C 1 253 ? -73.139 27.985  -38.988 1.00 59.09  ? 253 ILE C CD1 1 
ATOM 5947  N N   . ALA C 1 254 ? -68.752 24.777  -38.040 1.00 49.95  ? 254 ALA C N   1 
ATOM 5948  C CA  . ALA C 1 254 ? -67.636 23.841  -38.154 1.00 49.88  ? 254 ALA C CA  1 
ATOM 5949  C C   . ALA C 1 254 ? -67.956 22.482  -37.523 1.00 53.38  ? 254 ALA C C   1 
ATOM 5950  O O   . ALA C 1 254 ? -67.719 21.475  -38.178 1.00 54.91  ? 254 ALA C O   1 
ATOM 5951  C CB  . ALA C 1 254 ? -66.387 24.435  -37.526 1.00 50.71  ? 254 ALA C CB  1 
ATOM 5952  N N   . LYS C 1 255 ? -68.511 22.443  -36.292 1.00 48.83  ? 255 LYS C N   1 
ATOM 5953  C CA  . LYS C 1 255 ? -68.880 21.198  -35.598 1.00 49.06  ? 255 LYS C CA  1 
ATOM 5954  C C   . LYS C 1 255 ? -69.987 20.442  -36.363 1.00 56.20  ? 255 LYS C C   1 
ATOM 5955  O O   . LYS C 1 255 ? -69.881 19.227  -36.557 1.00 56.65  ? 255 LYS C O   1 
ATOM 5956  C CB  . LYS C 1 255 ? -69.318 21.464  -34.148 1.00 50.22  ? 255 LYS C CB  1 
ATOM 5957  C CG  . LYS C 1 255 ? -68.247 21.105  -33.142 1.00 65.78  ? 255 LYS C CG  1 
ATOM 5958  C CD  . LYS C 1 255 ? -68.530 21.791  -31.803 1.00 86.56  ? 255 LYS C CD  1 
ATOM 5959  C CE  . LYS C 1 255 ? -67.283 22.245  -31.078 1.00 101.39 ? 255 LYS C CE  1 
ATOM 5960  N NZ  . LYS C 1 255 ? -67.081 21.498  -29.801 1.00 108.81 ? 255 LYS C NZ  1 
ATOM 5961  N N   . ALA C 1 256 ? -71.017 21.171  -36.826 1.00 54.06  ? 256 ALA C N   1 
ATOM 5962  C CA  . ALA C 1 256 ? -72.155 20.629  -37.577 1.00 54.32  ? 256 ALA C CA  1 
ATOM 5963  C C   . ALA C 1 256 ? -71.724 19.902  -38.867 1.00 61.64  ? 256 ALA C C   1 
ATOM 5964  O O   . ALA C 1 256 ? -72.363 18.910  -39.240 1.00 61.14  ? 256 ALA C O   1 
ATOM 5965  C CB  . ALA C 1 256 ? -73.123 21.745  -37.924 1.00 54.03  ? 256 ALA C CB  1 
ATOM 5966  N N   . PHE C 1 257 ? -70.641 20.386  -39.532 1.00 58.78  ? 257 PHE C N   1 
ATOM 5967  C CA  . PHE C 1 257 ? -70.169 19.826  -40.795 1.00 58.82  ? 257 PHE C CA  1 
ATOM 5968  C C   . PHE C 1 257 ? -68.800 19.145  -40.699 1.00 62.97  ? 257 PHE C C   1 
ATOM 5969  O O   . PHE C 1 257 ? -68.179 18.885  -41.732 1.00 63.11  ? 257 PHE C O   1 
ATOM 5970  C CB  . PHE C 1 257 ? -70.156 20.912  -41.870 1.00 60.75  ? 257 PHE C CB  1 
ATOM 5971  C CG  . PHE C 1 257 ? -71.507 21.553  -42.066 1.00 63.41  ? 257 PHE C CG  1 
ATOM 5972  C CD1 . PHE C 1 257 ? -71.654 22.931  -41.995 1.00 67.41  ? 257 PHE C CD1 1 
ATOM 5973  C CD2 . PHE C 1 257 ? -72.646 20.774  -42.271 1.00 66.12  ? 257 PHE C CD2 1 
ATOM 5974  C CE1 . PHE C 1 257 ? -72.906 23.527  -42.168 1.00 68.50  ? 257 PHE C CE1 1 
ATOM 5975  C CE2 . PHE C 1 257 ? -73.901 21.371  -42.436 1.00 69.56  ? 257 PHE C CE2 1 
ATOM 5976  C CZ  . PHE C 1 257 ? -74.019 22.744  -42.393 1.00 68.19  ? 257 PHE C CZ  1 
ATOM 5977  N N   . ASN C 1 258 ? -68.362 18.810  -39.472 1.00 59.97  ? 258 ASN C N   1 
ATOM 5978  C CA  . ASN C 1 258 ? -67.100 18.127  -39.163 1.00 60.38  ? 258 ASN C CA  1 
ATOM 5979  C C   . ASN C 1 258 ? -65.885 18.785  -39.886 1.00 64.72  ? 258 ASN C C   1 
ATOM 5980  O O   . ASN C 1 258 ? -65.064 18.090  -40.503 1.00 65.10  ? 258 ASN C O   1 
ATOM 5981  C CB  . ASN C 1 258 ? -67.201 16.631  -39.499 1.00 62.46  ? 258 ASN C CB  1 
ATOM 5982  C CG  . ASN C 1 258 ? -66.560 15.748  -38.465 1.00 104.83 ? 258 ASN C CG  1 
ATOM 5983  O OD1 . ASN C 1 258 ? -65.332 15.636  -38.376 1.00 105.30 ? 258 ASN C OD1 1 
ATOM 5984  N ND2 . ASN C 1 258 ? -67.382 15.097  -37.654 1.00 102.01 ? 258 ASN C ND2 1 
ATOM 5985  N N   . LEU C 1 259 ? -65.777 20.130  -39.785 1.00 59.30  ? 259 LEU C N   1 
ATOM 5986  C CA  . LEU C 1 259 ? -64.710 20.915  -40.413 1.00 58.29  ? 259 LEU C CA  1 
ATOM 5987  C C   . LEU C 1 259 ? -63.627 21.289  -39.411 1.00 63.55  ? 259 LEU C C   1 
ATOM 5988  O O   . LEU C 1 259 ? -63.917 21.398  -38.214 1.00 64.06  ? 259 LEU C O   1 
ATOM 5989  C CB  . LEU C 1 259 ? -65.287 22.179  -41.056 1.00 57.86  ? 259 LEU C CB  1 
ATOM 5990  C CG  . LEU C 1 259 ? -66.477 21.977  -41.995 1.00 61.43  ? 259 LEU C CG  1 
ATOM 5991  C CD1 . LEU C 1 259 ? -67.107 23.287  -42.332 1.00 61.10  ? 259 LEU C CD1 1 
ATOM 5992  C CD2 . LEU C 1 259 ? -66.095 21.208  -43.263 1.00 61.69  ? 259 LEU C CD2 1 
ATOM 5993  N N   . ASP C 1 260 ? -62.384 21.496  -39.895 1.00 60.04  ? 260 ASP C N   1 
ATOM 5994  C CA  . ASP C 1 260 ? -61.240 21.819  -39.034 1.00 60.16  ? 260 ASP C CA  1 
ATOM 5995  C C   . ASP C 1 260 ? -60.872 23.312  -39.047 1.00 61.99  ? 260 ASP C C   1 
ATOM 5996  O O   . ASP C 1 260 ? -59.818 23.692  -38.536 1.00 62.58  ? 260 ASP C O   1 
ATOM 5997  C CB  . ASP C 1 260 ? -60.024 20.954  -39.394 1.00 63.53  ? 260 ASP C CB  1 
ATOM 5998  C CG  . ASP C 1 260 ? -60.169 19.517  -38.905 1.00 91.63  ? 260 ASP C CG  1 
ATOM 5999  O OD1 . ASP C 1 260 ? -59.489 19.151  -37.907 1.00 95.18  ? 260 ASP C OD1 1 
ATOM 6000  O OD2 . ASP C 1 260 ? -60.990 18.763  -39.495 1.00 102.98 ? 260 ASP C OD2 1 
ATOM 6001  N N   . VAL C 1 261 ? -61.760 24.156  -39.574 1.00 56.81  ? 261 VAL C N   1 
ATOM 6002  C CA  . VAL C 1 261 ? -61.601 25.613  -39.615 1.00 55.46  ? 261 VAL C CA  1 
ATOM 6003  C C   . VAL C 1 261 ? -62.872 26.241  -39.002 1.00 56.82  ? 261 VAL C C   1 
ATOM 6004  O O   . VAL C 1 261 ? -63.968 25.730  -39.231 1.00 56.40  ? 261 VAL C O   1 
ATOM 6005  C CB  . VAL C 1 261 ? -61.267 26.152  -41.036 1.00 59.37  ? 261 VAL C CB  1 
ATOM 6006  C CG1 . VAL C 1 261 ? -62.389 25.853  -42.033 1.00 58.91  ? 261 VAL C CG1 1 
ATOM 6007  C CG2 . VAL C 1 261 ? -60.927 27.652  -40.995 1.00 59.23  ? 261 VAL C CG2 1 
ATOM 6008  N N   . GLN C 1 262 ? -62.718 27.306  -38.188 1.00 51.07  ? 262 GLN C N   1 
ATOM 6009  C CA  . GLN C 1 262 ? -63.857 27.928  -37.517 1.00 48.67  ? 262 GLN C CA  1 
ATOM 6010  C C   . GLN C 1 262 ? -63.865 29.446  -37.690 1.00 50.47  ? 262 GLN C C   1 
ATOM 6011  O O   . GLN C 1 262 ? -64.744 30.108  -37.156 1.00 50.69  ? 262 GLN C O   1 
ATOM 6012  C CB  . GLN C 1 262 ? -63.939 27.544  -36.022 1.00 48.98  ? 262 GLN C CB  1 
ATOM 6013  C CG  . GLN C 1 262 ? -62.645 27.127  -35.370 1.00 55.91  ? 262 GLN C CG  1 
ATOM 6014  C CD  . GLN C 1 262 ? -62.200 25.728  -35.654 1.00 68.61  ? 262 GLN C CD  1 
ATOM 6015  O OE1 . GLN C 1 262 ? -61.024 25.507  -35.942 1.00 67.17  ? 262 GLN C OE1 1 
ATOM 6016  N NE2 . GLN C 1 262 ? -63.095 24.747  -35.522 1.00 55.84  ? 262 GLN C NE2 1 
ATOM 6017  N N   . ARG C 1 263 ? -62.931 29.991  -38.474 1.00 45.80  ? 263 ARG C N   1 
ATOM 6018  C CA  . ARG C 1 263 ? -62.875 31.431  -38.741 1.00 45.95  ? 263 ARG C CA  1 
ATOM 6019  C C   . ARG C 1 263 ? -62.852 31.666  -40.242 1.00 50.45  ? 263 ARG C C   1 
ATOM 6020  O O   . ARG C 1 263 ? -62.160 30.939  -40.953 1.00 50.72  ? 263 ARG C O   1 
ATOM 6021  C CB  . ARG C 1 263 ? -61.660 32.096  -38.066 1.00 46.78  ? 263 ARG C CB  1 
ATOM 6022  C CG  . ARG C 1 263 ? -61.738 32.069  -36.546 1.00 61.78  ? 263 ARG C CG  1 
ATOM 6023  C CD  . ARG C 1 263 ? -60.843 33.081  -35.874 1.00 77.61  ? 263 ARG C CD  1 
ATOM 6024  N NE  . ARG C 1 263 ? -59.429 32.825  -36.146 1.00 92.40  ? 263 ARG C NE  1 
ATOM 6025  C CZ  . ARG C 1 263 ? -58.433 33.365  -35.457 1.00 109.83 ? 263 ARG C CZ  1 
ATOM 6026  N NH1 . ARG C 1 263 ? -58.686 34.171  -34.432 1.00 94.31  ? 263 ARG C NH1 1 
ATOM 6027  N NH2 . ARG C 1 263 ? -57.174 33.082  -35.769 1.00 100.14 ? 263 ARG C NH2 1 
ATOM 6028  N N   . GLY C 1 264 ? -63.646 32.629  -40.694 1.00 45.58  ? 264 GLY C N   1 
ATOM 6029  C CA  . GLY C 1 264 ? -63.760 32.979  -42.092 1.00 45.81  ? 264 GLY C CA  1 
ATOM 6030  C C   . GLY C 1 264 ? -65.116 33.530  -42.465 1.00 53.25  ? 264 GLY C C   1 
ATOM 6031  O O   . GLY C 1 264 ? -65.812 34.135  -41.634 1.00 54.49  ? 264 GLY C O   1 
ATOM 6032  N N   . ALA C 1 265 ? -65.496 33.324  -43.738 1.00 50.13  ? 265 ALA C N   1 
ATOM 6033  C CA  . ALA C 1 265 ? -66.796 33.750  -44.254 1.00 50.06  ? 265 ALA C CA  1 
ATOM 6034  C C   . ALA C 1 265 ? -67.655 32.566  -44.686 1.00 53.36  ? 265 ALA C C   1 
ATOM 6035  O O   . ALA C 1 265 ? -67.221 31.716  -45.466 1.00 52.94  ? 265 ALA C O   1 
ATOM 6036  C CB  . ALA C 1 265 ? -66.615 34.702  -45.418 1.00 50.55  ? 265 ALA C CB  1 
ATOM 6037  N N   . PHE C 1 266 ? -68.873 32.526  -44.178 1.00 49.25  ? 266 PHE C N   1 
ATOM 6038  C CA  . PHE C 1 266 ? -69.854 31.524  -44.564 1.00 48.59  ? 266 PHE C CA  1 
ATOM 6039  C C   . PHE C 1 266 ? -70.732 32.172  -45.643 1.00 49.71  ? 266 PHE C C   1 
ATOM 6040  O O   . PHE C 1 266 ? -71.385 33.168  -45.363 1.00 48.24  ? 266 PHE C O   1 
ATOM 6041  C CB  . PHE C 1 266 ? -70.657 31.057  -43.344 1.00 50.37  ? 266 PHE C CB  1 
ATOM 6042  C CG  . PHE C 1 266 ? -71.715 30.049  -43.678 1.00 52.80  ? 266 PHE C CG  1 
ATOM 6043  C CD1 . PHE C 1 266 ? -73.055 30.414  -43.718 1.00 57.49  ? 266 PHE C CD1 1 
ATOM 6044  C CD2 . PHE C 1 266 ? -71.371 28.745  -44.021 1.00 56.23  ? 266 PHE C CD2 1 
ATOM 6045  C CE1 . PHE C 1 266 ? -74.035 29.481  -44.065 1.00 59.46  ? 266 PHE C CE1 1 
ATOM 6046  C CE2 . PHE C 1 266 ? -72.350 27.813  -44.370 1.00 59.73  ? 266 PHE C CE2 1 
ATOM 6047  C CZ  . PHE C 1 266 ? -73.674 28.182  -44.384 1.00 58.81  ? 266 PHE C CZ  1 
ATOM 6048  N N   . VAL C 1 267 ? -70.697 31.653  -46.874 1.00 46.66  ? 267 VAL C N   1 
ATOM 6049  C CA  . VAL C 1 267 ? -71.431 32.225  -48.005 1.00 46.21  ? 267 VAL C CA  1 
ATOM 6050  C C   . VAL C 1 267 ? -72.859 31.718  -47.993 1.00 50.47  ? 267 VAL C C   1 
ATOM 6051  O O   . VAL C 1 267 ? -73.092 30.523  -48.003 1.00 49.62  ? 267 VAL C O   1 
ATOM 6052  C CB  . VAL C 1 267 ? -70.747 31.967  -49.381 1.00 48.98  ? 267 VAL C CB  1 
ATOM 6053  C CG1 . VAL C 1 267 ? -71.492 32.674  -50.498 1.00 48.23  ? 267 VAL C CG1 1 
ATOM 6054  C CG2 . VAL C 1 267 ? -69.282 32.396  -49.376 1.00 48.43  ? 267 VAL C CG2 1 
ATOM 6055  N N   . SER C 1 268 ? -73.809 32.640  -47.964 1.00 49.86  ? 268 SER C N   1 
ATOM 6056  C CA  . SER C 1 268 ? -75.227 32.313  -47.974 1.00 51.39  ? 268 SER C CA  1 
ATOM 6057  C C   . SER C 1 268 ? -75.833 32.612  -49.345 1.00 56.73  ? 268 SER C C   1 
ATOM 6058  O O   . SER C 1 268 ? -76.793 31.960  -49.762 1.00 57.77  ? 268 SER C O   1 
ATOM 6059  C CB  . SER C 1 268 ? -75.969 33.084  -46.876 1.00 55.70  ? 268 SER C CB  1 
ATOM 6060  O OG  . SER C 1 268 ? -75.960 34.492  -47.059 1.00 63.25  ? 268 SER C OG  1 
ATOM 6061  N N   . GLU C 1 269 ? -75.270 33.592  -50.047 1.00 52.61  ? 269 GLU C N   1 
ATOM 6062  C CA  . GLU C 1 269 ? -75.788 34.013  -51.333 1.00 52.16  ? 269 GLU C CA  1 
ATOM 6063  C C   . GLU C 1 269 ? -74.676 34.521  -52.242 1.00 55.96  ? 269 GLU C C   1 
ATOM 6064  O O   . GLU C 1 269 ? -73.824 35.292  -51.813 1.00 54.87  ? 269 GLU C O   1 
ATOM 6065  C CB  . GLU C 1 269 ? -76.825 35.117  -51.092 1.00 53.28  ? 269 GLU C CB  1 
ATOM 6066  C CG  . GLU C 1 269 ? -77.721 35.465  -52.263 1.00 63.47  ? 269 GLU C CG  1 
ATOM 6067  C CD  . GLU C 1 269 ? -78.750 36.536  -51.964 1.00 83.50  ? 269 GLU C CD  1 
ATOM 6068  O OE1 . GLU C 1 269 ? -79.025 37.359  -52.866 1.00 89.11  ? 269 GLU C OE1 1 
ATOM 6069  O OE2 . GLU C 1 269 ? -79.280 36.561  -50.829 1.00 76.50  ? 269 GLU C OE2 1 
ATOM 6070  N N   . VAL C 1 270 ? -74.706 34.093  -53.503 1.00 53.70  ? 270 VAL C N   1 
ATOM 6071  C CA  . VAL C 1 270 ? -73.790 34.539  -54.550 1.00 54.35  ? 270 VAL C CA  1 
ATOM 6072  C C   . VAL C 1 270 ? -74.650 35.327  -55.526 1.00 63.15  ? 270 VAL C C   1 
ATOM 6073  O O   . VAL C 1 270 ? -75.605 34.773  -56.091 1.00 62.46  ? 270 VAL C O   1 
ATOM 6074  C CB  . VAL C 1 270 ? -73.008 33.379  -55.218 1.00 56.94  ? 270 VAL C CB  1 
ATOM 6075  C CG1 . VAL C 1 270 ? -71.950 33.913  -56.178 1.00 57.03  ? 270 VAL C CG1 1 
ATOM 6076  C CG2 . VAL C 1 270 ? -72.377 32.476  -54.167 1.00 56.24  ? 270 VAL C CG2 1 
ATOM 6077  N N   . LEU C 1 271 ? -74.370 36.631  -55.664 1.00 63.33  ? 271 LEU C N   1 
ATOM 6078  C CA  . LEU C 1 271 ? -75.176 37.496  -56.524 1.00 64.80  ? 271 LEU C CA  1 
ATOM 6079  C C   . LEU C 1 271 ? -74.957 37.151  -58.012 1.00 71.38  ? 271 LEU C C   1 
ATOM 6080  O O   . LEU C 1 271 ? -73.816 36.955  -58.431 1.00 70.58  ? 271 LEU C O   1 
ATOM 6081  C CB  . LEU C 1 271 ? -74.908 38.977  -56.234 1.00 64.88  ? 271 LEU C CB  1 
ATOM 6082  C CG  . LEU C 1 271 ? -75.042 39.392  -54.750 1.00 70.26  ? 271 LEU C CG  1 
ATOM 6083  C CD1 . LEU C 1 271 ? -74.509 40.794  -54.523 1.00 71.15  ? 271 LEU C CD1 1 
ATOM 6084  C CD2 . LEU C 1 271 ? -76.483 39.262  -54.230 1.00 71.38  ? 271 LEU C CD2 1 
ATOM 6085  N N   . PRO C 1 272 ? -76.045 36.955  -58.799 1.00 69.26  ? 272 PRO C N   1 
ATOM 6086  C CA  . PRO C 1 272 ? -75.862 36.569  -60.207 1.00 69.05  ? 272 PRO C CA  1 
ATOM 6087  C C   . PRO C 1 272 ? -75.277 37.713  -61.026 1.00 71.69  ? 272 PRO C C   1 
ATOM 6088  O O   . PRO C 1 272 ? -75.642 38.880  -60.809 1.00 71.49  ? 272 PRO C O   1 
ATOM 6089  C CB  . PRO C 1 272 ? -77.283 36.202  -60.666 1.00 71.01  ? 272 PRO C CB  1 
ATOM 6090  C CG  . PRO C 1 272 ? -78.107 36.096  -59.402 1.00 74.91  ? 272 PRO C CG  1 
ATOM 6091  C CD  . PRO C 1 272 ? -77.478 37.080  -58.469 1.00 70.64  ? 272 PRO C CD  1 
ATOM 6092  N N   . GLY C 1 273 ? -74.339 37.369  -61.914 1.00 66.43  ? 273 GLY C N   1 
ATOM 6093  C CA  . GLY C 1 273 ? -73.660 38.333  -62.776 1.00 65.32  ? 273 GLY C CA  1 
ATOM 6094  C C   . GLY C 1 273 ? -72.391 38.896  -62.184 1.00 67.89  ? 273 GLY C C   1 
ATOM 6095  O O   . GLY C 1 273 ? -71.661 39.631  -62.860 1.00 69.28  ? 273 GLY C O   1 
ATOM 6096  N N   . SER C 1 274 ? -72.120 38.554  -60.908 1.00 60.74  ? 274 SER C N   1 
ATOM 6097  C CA  . SER C 1 274 ? -70.939 38.996  -60.179 1.00 57.79  ? 274 SER C CA  1 
ATOM 6098  C C   . SER C 1 274 ? -69.725 38.138  -60.556 1.00 58.56  ? 274 SER C C   1 
ATOM 6099  O O   . SER C 1 274 ? -69.887 37.054  -61.130 1.00 57.79  ? 274 SER C O   1 
ATOM 6100  C CB  . SER C 1 274 ? -71.193 38.929  -58.678 1.00 59.04  ? 274 SER C CB  1 
ATOM 6101  O OG  . SER C 1 274 ? -71.283 37.582  -58.238 1.00 66.15  ? 274 SER C OG  1 
ATOM 6102  N N   . GLY C 1 275 ? -68.529 38.621  -60.199 1.00 52.24  ? 275 GLY C N   1 
ATOM 6103  C CA  . GLY C 1 275 ? -67.284 37.907  -60.415 1.00 50.69  ? 275 GLY C CA  1 
ATOM 6104  C C   . GLY C 1 275 ? -67.282 36.550  -59.730 1.00 54.48  ? 275 GLY C C   1 
ATOM 6105  O O   . GLY C 1 275 ? -66.695 35.595  -60.250 1.00 55.16  ? 275 GLY C O   1 
ATOM 6106  N N   . SER C 1 276 ? -67.946 36.456  -58.549 1.00 49.30  ? 276 SER C N   1 
ATOM 6107  C CA  . SER C 1 276 ? -68.062 35.232  -57.735 1.00 47.71  ? 276 SER C CA  1 
ATOM 6108  C C   . SER C 1 276 ? -68.920 34.205  -58.408 1.00 49.57  ? 276 SER C C   1 
ATOM 6109  O O   . SER C 1 276 ? -68.673 33.001  -58.254 1.00 49.56  ? 276 SER C O   1 
ATOM 6110  C CB  . SER C 1 276 ? -68.651 35.536  -56.360 1.00 48.77  ? 276 SER C CB  1 
ATOM 6111  O OG  . SER C 1 276 ? -67.698 36.083  -55.469 1.00 52.77  ? 276 SER C OG  1 
ATOM 6112  N N   . ALA C 1 277 ? -69.983 34.676  -59.090 1.00 45.24  ? 277 ALA C N   1 
ATOM 6113  C CA  . ALA C 1 277 ? -70.918 33.822  -59.842 1.00 44.01  ? 277 ALA C CA  1 
ATOM 6114  C C   . ALA C 1 277 ? -70.152 33.199  -61.025 1.00 45.08  ? 277 ALA C C   1 
ATOM 6115  O O   . ALA C 1 277 ? -70.008 31.959  -61.089 1.00 42.27  ? 277 ALA C O   1 
ATOM 6116  C CB  . ALA C 1 277 ? -72.116 34.640  -60.308 1.00 44.24  ? 277 ALA C CB  1 
ATOM 6117  N N   . LYS C 1 278 ? -69.499 34.084  -61.835 1.00 40.83  ? 278 LYS C N   1 
ATOM 6118  C CA  . LYS C 1 278 ? -68.667 33.733  -62.989 1.00 40.66  ? 278 LYS C CA  1 
ATOM 6119  C C   . LYS C 1 278 ? -67.499 32.772  -62.641 1.00 48.34  ? 278 LYS C C   1 
ATOM 6120  O O   . LYS C 1 278 ? -67.091 32.007  -63.518 1.00 49.53  ? 278 LYS C O   1 
ATOM 6121  C CB  . LYS C 1 278 ? -68.104 35.006  -63.635 1.00 42.28  ? 278 LYS C CB  1 
ATOM 6122  C CG  . LYS C 1 278 ? -69.155 35.855  -64.349 1.00 50.26  ? 278 LYS C CG  1 
ATOM 6123  C CD  . LYS C 1 278 ? -68.686 37.282  -64.528 1.00 58.35  ? 278 LYS C CD  1 
ATOM 6124  C CE  . LYS C 1 278 ? -69.717 38.138  -65.223 1.00 78.01  ? 278 LYS C CE  1 
ATOM 6125  N NZ  . LYS C 1 278 ? -69.311 39.571  -65.243 1.00 88.74  ? 278 LYS C NZ  1 
ATOM 6126  N N   . ALA C 1 279 ? -66.976 32.787  -61.378 1.00 44.63  ? 279 ALA C N   1 
ATOM 6127  C CA  . ALA C 1 279 ? -65.849 31.937  -60.943 1.00 43.76  ? 279 ALA C CA  1 
ATOM 6128  C C   . ALA C 1 279 ? -66.282 30.624  -60.313 1.00 48.67  ? 279 ALA C C   1 
ATOM 6129  O O   . ALA C 1 279 ? -65.433 29.763  -60.054 1.00 47.69  ? 279 ALA C O   1 
ATOM 6130  C CB  . ALA C 1 279 ? -64.969 32.691  -59.962 1.00 44.42  ? 279 ALA C CB  1 
ATOM 6131  N N   . GLY C 1 280 ? -67.586 30.483  -60.053 1.00 47.18  ? 280 GLY C N   1 
ATOM 6132  C CA  . GLY C 1 280 ? -68.143 29.280  -59.450 1.00 46.29  ? 280 GLY C CA  1 
ATOM 6133  C C   . GLY C 1 280 ? -68.209 29.292  -57.939 1.00 51.73  ? 280 GLY C C   1 
ATOM 6134  O O   . GLY C 1 280 ? -68.254 28.220  -57.332 1.00 50.88  ? 280 GLY C O   1 
ATOM 6135  N N   . VAL C 1 281 ? -68.247 30.493  -57.297 1.00 50.56  ? 281 VAL C N   1 
ATOM 6136  C CA  . VAL C 1 281 ? -68.459 30.530  -55.831 1.00 50.56  ? 281 VAL C CA  1 
ATOM 6137  C C   . VAL C 1 281 ? -69.924 30.157  -55.622 1.00 52.60  ? 281 VAL C C   1 
ATOM 6138  O O   . VAL C 1 281 ? -70.776 30.733  -56.291 1.00 51.99  ? 281 VAL C O   1 
ATOM 6139  C CB  . VAL C 1 281 ? -68.102 31.861  -55.121 1.00 54.00  ? 281 VAL C CB  1 
ATOM 6140  C CG1 . VAL C 1 281 ? -68.204 31.704  -53.604 1.00 53.81  ? 281 VAL C CG1 1 
ATOM 6141  C CG2 . VAL C 1 281 ? -66.714 32.344  -55.516 1.00 53.65  ? 281 VAL C CG2 1 
ATOM 6142  N N   . LYS C 1 282 ? -70.198 29.142  -54.805 1.00 48.78  ? 282 LYS C N   1 
ATOM 6143  C CA  . LYS C 1 282 ? -71.560 28.681  -54.516 1.00 49.17  ? 282 LYS C CA  1 
ATOM 6144  C C   . LYS C 1 282 ? -71.952 28.991  -53.076 1.00 54.27  ? 282 LYS C C   1 
ATOM 6145  O O   . LYS C 1 282 ? -71.096 29.061  -52.198 1.00 54.69  ? 282 LYS C O   1 
ATOM 6146  C CB  . LYS C 1 282 ? -71.695 27.157  -54.752 1.00 51.86  ? 282 LYS C CB  1 
ATOM 6147  C CG  . LYS C 1 282 ? -71.514 26.680  -56.197 1.00 66.87  ? 282 LYS C CG  1 
ATOM 6148  C CD  . LYS C 1 282 ? -71.604 25.144  -56.247 1.00 77.18  ? 282 LYS C CD  1 
ATOM 6149  C CE  . LYS C 1 282 ? -70.789 24.502  -57.355 1.00 77.96  ? 282 LYS C CE  1 
ATOM 6150  N NZ  . LYS C 1 282 ? -70.454 23.077  -57.054 1.00 76.76  ? 282 LYS C NZ  1 
ATOM 6151  N N   . ALA C 1 283 ? -73.251 29.135  -52.818 1.00 51.24  ? 283 ALA C N   1 
ATOM 6152  C CA  . ALA C 1 283 ? -73.794 29.305  -51.462 1.00 49.97  ? 283 ALA C CA  1 
ATOM 6153  C C   . ALA C 1 283 ? -73.476 28.046  -50.634 1.00 51.46  ? 283 ALA C C   1 
ATOM 6154  O O   . ALA C 1 283 ? -73.532 26.938  -51.159 1.00 50.99  ? 283 ALA C O   1 
ATOM 6155  C CB  . ALA C 1 283 ? -75.290 29.544  -51.524 1.00 50.63  ? 283 ALA C CB  1 
ATOM 6156  N N   . GLY C 1 284 ? -73.069 28.244  -49.383 1.00 46.99  ? 284 GLY C N   1 
ATOM 6157  C CA  . GLY C 1 284 ? -72.649 27.182  -48.477 1.00 46.24  ? 284 GLY C CA  1 
ATOM 6158  C C   . GLY C 1 284 ? -71.135 27.029  -48.413 1.00 48.95  ? 284 GLY C C   1 
ATOM 6159  O O   . GLY C 1 284 ? -70.623 26.236  -47.621 1.00 47.16  ? 284 GLY C O   1 
ATOM 6160  N N   . ASP C 1 285 ? -70.402 27.757  -49.270 1.00 47.30  ? 285 ASP C N   1 
ATOM 6161  C CA  . ASP C 1 285 ? -68.935 27.718  -49.266 1.00 48.09  ? 285 ASP C CA  1 
ATOM 6162  C C   . ASP C 1 285 ? -68.398 28.468  -48.058 1.00 50.75  ? 285 ASP C C   1 
ATOM 6163  O O   . ASP C 1 285 ? -69.053 29.389  -47.550 1.00 48.65  ? 285 ASP C O   1 
ATOM 6164  C CB  . ASP C 1 285 ? -68.329 28.327  -50.561 1.00 49.90  ? 285 ASP C CB  1 
ATOM 6165  C CG  . ASP C 1 285 ? -68.525 27.546  -51.855 1.00 60.16  ? 285 ASP C CG  1 
ATOM 6166  O OD1 . ASP C 1 285 ? -69.109 26.424  -51.802 1.00 62.27  ? 285 ASP C OD1 1 
ATOM 6167  O OD2 . ASP C 1 285 ? -68.149 28.079  -52.928 1.00 59.66  ? 285 ASP C OD2 1 
ATOM 6168  N N   . ILE C 1 286 ? -67.193 28.082  -47.613 1.00 47.53  ? 286 ILE C N   1 
ATOM 6169  C CA  . ILE C 1 286 ? -66.542 28.735  -46.484 1.00 47.45  ? 286 ILE C CA  1 
ATOM 6170  C C   . ILE C 1 286 ? -65.221 29.303  -46.950 1.00 47.53  ? 286 ILE C C   1 
ATOM 6171  O O   . ILE C 1 286 ? -64.275 28.553  -47.173 1.00 47.42  ? 286 ILE C O   1 
ATOM 6172  C CB  . ILE C 1 286 ? -66.410 27.788  -45.251 1.00 51.15  ? 286 ILE C CB  1 
ATOM 6173  C CG1 . ILE C 1 286 ? -67.830 27.395  -44.766 1.00 51.62  ? 286 ILE C CG1 1 
ATOM 6174  C CG2 . ILE C 1 286 ? -65.608 28.461  -44.118 1.00 51.11  ? 286 ILE C CG2 1 
ATOM 6175  C CD1 . ILE C 1 286 ? -67.941 26.078  -44.290 1.00 64.25  ? 286 ILE C CD1 1 
ATOM 6176  N N   . ILE C 1 287 ? -65.174 30.632  -47.120 1.00 43.18  ? 287 ILE C N   1 
ATOM 6177  C CA  . ILE C 1 287 ? -63.954 31.335  -47.523 1.00 43.84  ? 287 ILE C CA  1 
ATOM 6178  C C   . ILE C 1 287 ? -63.012 31.394  -46.304 1.00 50.37  ? 287 ILE C C   1 
ATOM 6179  O O   . ILE C 1 287 ? -63.345 31.971  -45.271 1.00 50.75  ? 287 ILE C O   1 
ATOM 6180  C CB  . ILE C 1 287 ? -64.231 32.719  -48.140 1.00 46.02  ? 287 ILE C CB  1 
ATOM 6181  C CG1 . ILE C 1 287 ? -65.318 32.606  -49.266 1.00 45.65  ? 287 ILE C CG1 1 
ATOM 6182  C CG2 . ILE C 1 287 ? -62.919 33.331  -48.652 1.00 43.95  ? 287 ILE C CG2 1 
ATOM 6183  C CD1 . ILE C 1 287 ? -65.923 33.947  -49.736 1.00 48.13  ? 287 ILE C CD1 1 
ATOM 6184  N N   . THR C 1 288 ? -61.865 30.736  -46.434 1.00 47.43  ? 288 THR C N   1 
ATOM 6185  C CA  . THR C 1 288 ? -60.822 30.528  -45.419 1.00 46.79  ? 288 THR C CA  1 
ATOM 6186  C C   . THR C 1 288 ? -59.599 31.455  -45.630 1.00 47.79  ? 288 THR C C   1 
ATOM 6187  O O   . THR C 1 288 ? -58.923 31.822  -44.670 1.00 48.37  ? 288 THR C O   1 
ATOM 6188  C CB  . THR C 1 288 ? -60.412 29.038  -45.539 1.00 60.46  ? 288 THR C CB  1 
ATOM 6189  O OG1 . THR C 1 288 ? -61.492 28.232  -45.073 1.00 64.29  ? 288 THR C OG1 1 
ATOM 6190  C CG2 . THR C 1 288 ? -59.142 28.692  -44.780 1.00 64.44  ? 288 THR C CG2 1 
ATOM 6191  N N   . SER C 1 289 ? -59.298 31.779  -46.885 1.00 42.69  ? 289 SER C N   1 
ATOM 6192  C CA  . SER C 1 289 ? -58.125 32.555  -47.261 1.00 42.44  ? 289 SER C CA  1 
ATOM 6193  C C   . SER C 1 289 ? -58.420 33.562  -48.319 1.00 45.32  ? 289 SER C C   1 
ATOM 6194  O O   . SER C 1 289 ? -59.360 33.411  -49.094 1.00 46.37  ? 289 SER C O   1 
ATOM 6195  C CB  . SER C 1 289 ? -57.030 31.629  -47.793 1.00 48.13  ? 289 SER C CB  1 
ATOM 6196  O OG  . SER C 1 289 ? -56.556 30.762  -46.777 1.00 66.45  ? 289 SER C OG  1 
ATOM 6197  N N   . LEU C 1 290 ? -57.580 34.582  -48.367 1.00 40.68  ? 290 LEU C N   1 
ATOM 6198  C CA  . LEU C 1 290 ? -57.563 35.606  -49.393 1.00 40.01  ? 290 LEU C CA  1 
ATOM 6199  C C   . LEU C 1 290 ? -56.104 35.750  -49.801 1.00 47.63  ? 290 LEU C C   1 
ATOM 6200  O O   . LEU C 1 290 ? -55.260 36.053  -48.952 1.00 48.13  ? 290 LEU C O   1 
ATOM 6201  C CB  . LEU C 1 290 ? -58.189 36.926  -48.918 1.00 38.95  ? 290 LEU C CB  1 
ATOM 6202  C CG  . LEU C 1 290 ? -58.179 38.079  -49.911 1.00 42.56  ? 290 LEU C CG  1 
ATOM 6203  C CD1 . LEU C 1 290 ? -58.983 37.746  -51.180 1.00 44.28  ? 290 LEU C CD1 1 
ATOM 6204  C CD2 . LEU C 1 290 ? -58.702 39.313  -49.270 1.00 38.56  ? 290 LEU C CD2 1 
ATOM 6205  N N   . ASN C 1 291 ? -55.797 35.425  -51.076 1.00 44.77  ? 291 ASN C N   1 
ATOM 6206  C CA  . ASN C 1 291 ? -54.457 35.493  -51.673 1.00 43.46  ? 291 ASN C CA  1 
ATOM 6207  C C   . ASN C 1 291 ? -53.423 34.728  -50.810 1.00 45.84  ? 291 ASN C C   1 
ATOM 6208  O O   . ASN C 1 291 ? -52.336 35.248  -50.514 1.00 43.17  ? 291 ASN C O   1 
ATOM 6209  C CB  . ASN C 1 291 ? -54.033 36.965  -51.898 1.00 39.06  ? 291 ASN C CB  1 
ATOM 6210  C CG  . ASN C 1 291 ? -54.919 37.710  -52.879 1.00 62.03  ? 291 ASN C CG  1 
ATOM 6211  O OD1 . ASN C 1 291 ? -55.482 37.143  -53.820 1.00 57.21  ? 291 ASN C OD1 1 
ATOM 6212  N ND2 . ASN C 1 291 ? -55.077 39.006  -52.674 1.00 50.24  ? 291 ASN C ND2 1 
ATOM 6213  N N   . GLY C 1 292 ? -53.820 33.522  -50.374 1.00 43.51  ? 292 GLY C N   1 
ATOM 6214  C CA  . GLY C 1 292 ? -53.012 32.611  -49.564 1.00 43.56  ? 292 GLY C CA  1 
ATOM 6215  C C   . GLY C 1 292 ? -52.904 32.953  -48.088 1.00 51.65  ? 292 GLY C C   1 
ATOM 6216  O O   . GLY C 1 292 ? -52.344 32.166  -47.311 1.00 52.71  ? 292 GLY C O   1 
ATOM 6217  N N   . LYS C 1 293 ? -53.418 34.136  -47.677 1.00 48.07  ? 293 LYS C N   1 
ATOM 6218  C CA  . LYS C 1 293 ? -53.353 34.564  -46.285 1.00 47.63  ? 293 LYS C CA  1 
ATOM 6219  C C   . LYS C 1 293 ? -54.658 34.200  -45.571 1.00 52.92  ? 293 LYS C C   1 
ATOM 6220  O O   . LYS C 1 293 ? -55.734 34.623  -46.014 1.00 52.42  ? 293 LYS C O   1 
ATOM 6221  C CB  . LYS C 1 293 ? -53.064 36.074  -46.181 1.00 49.08  ? 293 LYS C CB  1 
ATOM 6222  C CG  . LYS C 1 293 ? -52.693 36.538  -44.781 1.00 45.00  ? 293 LYS C CG  1 
ATOM 6223  C CD  . LYS C 1 293 ? -52.448 38.043  -44.693 1.00 38.11  ? 293 LYS C CD  1 
ATOM 6224  C CE  . LYS C 1 293 ? -52.240 38.437  -43.251 1.00 49.72  ? 293 LYS C CE  1 
ATOM 6225  N NZ  . LYS C 1 293 ? -50.915 37.933  -42.726 1.00 48.28  ? 293 LYS C NZ  1 
ATOM 6226  N N   . PRO C 1 294 ? -54.577 33.410  -44.474 1.00 49.17  ? 294 PRO C N   1 
ATOM 6227  C CA  . PRO C 1 294 ? -55.799 33.044  -43.731 1.00 48.86  ? 294 PRO C CA  1 
ATOM 6228  C C   . PRO C 1 294 ? -56.585 34.240  -43.211 1.00 54.49  ? 294 PRO C C   1 
ATOM 6229  O O   . PRO C 1 294 ? -56.011 35.257  -42.816 1.00 54.97  ? 294 PRO C O   1 
ATOM 6230  C CB  . PRO C 1 294 ? -55.269 32.223  -42.551 1.00 50.28  ? 294 PRO C CB  1 
ATOM 6231  C CG  . PRO C 1 294 ? -53.910 31.757  -42.968 1.00 54.05  ? 294 PRO C CG  1 
ATOM 6232  C CD  . PRO C 1 294 ? -53.368 32.834  -43.846 1.00 50.26  ? 294 PRO C CD  1 
ATOM 6233  N N   . LEU C 1 295 ? -57.916 34.123  -43.258 1.00 52.89  ? 295 LEU C N   1 
ATOM 6234  C CA  . LEU C 1 295 ? -58.847 35.148  -42.792 1.00 52.15  ? 295 LEU C CA  1 
ATOM 6235  C C   . LEU C 1 295 ? -59.267 34.838  -41.384 1.00 54.47  ? 295 LEU C C   1 
ATOM 6236  O O   . LEU C 1 295 ? -59.640 33.690  -41.106 1.00 52.61  ? 295 LEU C O   1 
ATOM 6237  C CB  . LEU C 1 295 ? -60.099 35.199  -43.692 1.00 51.98  ? 295 LEU C CB  1 
ATOM 6238  C CG  . LEU C 1 295 ? -59.947 35.725  -45.098 1.00 54.94  ? 295 LEU C CG  1 
ATOM 6239  C CD1 . LEU C 1 295 ? -61.129 35.268  -45.943 1.00 54.54  ? 295 LEU C CD1 1 
ATOM 6240  C CD2 . LEU C 1 295 ? -59.796 37.255  -45.116 1.00 54.25  ? 295 LEU C CD2 1 
ATOM 6241  N N   . ASN C 1 296 ? -59.241 35.847  -40.495 1.00 52.02  ? 296 ASN C N   1 
ATOM 6242  C CA  . ASN C 1 296 ? -59.705 35.599  -39.128 1.00 51.79  ? 296 ASN C CA  1 
ATOM 6243  C C   . ASN C 1 296 ? -61.198 35.926  -39.002 1.00 53.74  ? 296 ASN C C   1 
ATOM 6244  O O   . ASN C 1 296 ? -61.813 35.538  -38.020 1.00 54.05  ? 296 ASN C O   1 
ATOM 6245  C CB  . ASN C 1 296 ? -58.850 36.310  -38.051 1.00 54.76  ? 296 ASN C CB  1 
ATOM 6246  C CG  . ASN C 1 296 ? -58.586 37.784  -38.218 1.00 86.29  ? 296 ASN C CG  1 
ATOM 6247  O OD1 . ASN C 1 296 ? -59.500 38.593  -38.436 1.00 87.12  ? 296 ASN C OD1 1 
ATOM 6248  N ND2 . ASN C 1 296 ? -57.328 38.173  -38.011 1.00 76.07  ? 296 ASN C ND2 1 
ATOM 6249  N N   . SER C 1 297 ? -61.796 36.562  -40.027 1.00 48.93  ? 297 SER C N   1 
ATOM 6250  C CA  . SER C 1 297 ? -63.214 36.930  -40.038 1.00 47.03  ? 297 SER C CA  1 
ATOM 6251  C C   . SER C 1 297 ? -63.732 37.289  -41.430 1.00 49.82  ? 297 SER C C   1 
ATOM 6252  O O   . SER C 1 297 ? -62.953 37.552  -42.339 1.00 48.98  ? 297 SER C O   1 
ATOM 6253  C CB  . SER C 1 297 ? -63.465 38.120  -39.106 1.00 46.91  ? 297 SER C CB  1 
ATOM 6254  O OG  . SER C 1 297 ? -62.873 39.317  -39.588 1.00 52.48  ? 297 SER C OG  1 
ATOM 6255  N N   . PHE C 1 298 ? -65.063 37.364  -41.549 1.00 47.25  ? 298 PHE C N   1 
ATOM 6256  C CA  . PHE C 1 298 ? -65.783 37.820  -42.719 1.00 48.10  ? 298 PHE C CA  1 
ATOM 6257  C C   . PHE C 1 298 ? -65.571 39.346  -42.848 1.00 51.89  ? 298 PHE C C   1 
ATOM 6258  O O   . PHE C 1 298 ? -65.470 39.894  -43.950 1.00 51.54  ? 298 PHE C O   1 
ATOM 6259  C CB  . PHE C 1 298 ? -67.288 37.440  -42.602 1.00 51.02  ? 298 PHE C CB  1 
ATOM 6260  C CG  . PHE C 1 298 ? -68.174 38.072  -43.651 1.00 54.74  ? 298 PHE C CG  1 
ATOM 6261  C CD1 . PHE C 1 298 ? -68.168 37.611  -44.956 1.00 59.04  ? 298 PHE C CD1 1 
ATOM 6262  C CD2 . PHE C 1 298 ? -68.976 39.165  -43.342 1.00 59.55  ? 298 PHE C CD2 1 
ATOM 6263  C CE1 . PHE C 1 298 ? -68.951 38.219  -45.930 1.00 60.68  ? 298 PHE C CE1 1 
ATOM 6264  C CE2 . PHE C 1 298 ? -69.752 39.782  -44.322 1.00 62.83  ? 298 PHE C CE2 1 
ATOM 6265  C CZ  . PHE C 1 298 ? -69.731 39.305  -45.610 1.00 60.64  ? 298 PHE C CZ  1 
ATOM 6266  N N   . ALA C 1 299 ? -65.503 40.024  -41.702 1.00 48.41  ? 299 ALA C N   1 
ATOM 6267  C CA  . ALA C 1 299 ? -65.303 41.470  -41.620 1.00 46.75  ? 299 ALA C CA  1 
ATOM 6268  C C   . ALA C 1 299 ? -63.934 41.876  -42.196 1.00 47.44  ? 299 ALA C C   1 
ATOM 6269  O O   . ALA C 1 299 ? -63.826 42.931  -42.844 1.00 45.93  ? 299 ALA C O   1 
ATOM 6270  C CB  . ALA C 1 299 ? -65.452 41.928  -40.189 1.00 46.70  ? 299 ALA C CB  1 
ATOM 6271  N N   . GLU C 1 300 ? -62.906 41.015  -41.990 1.00 41.58  ? 300 GLU C N   1 
ATOM 6272  C CA  . GLU C 1 300 ? -61.556 41.200  -42.540 1.00 39.25  ? 300 GLU C CA  1 
ATOM 6273  C C   . GLU C 1 300 ? -61.624 41.077  -44.060 1.00 45.20  ? 300 GLU C C   1 
ATOM 6274  O O   . GLU C 1 300 ? -61.072 41.917  -44.770 1.00 45.00  ? 300 GLU C O   1 
ATOM 6275  C CB  . GLU C 1 300 ? -60.573 40.183  -41.948 1.00 39.58  ? 300 GLU C CB  1 
ATOM 6276  C CG  . GLU C 1 300 ? -59.140 40.385  -42.431 1.00 42.85  ? 300 GLU C CG  1 
ATOM 6277  C CD  . GLU C 1 300 ? -58.104 39.344  -42.065 1.00 51.00  ? 300 GLU C CD  1 
ATOM 6278  O OE1 . GLU C 1 300 ? -58.403 38.445  -41.243 1.00 42.49  ? 300 GLU C OE1 1 
ATOM 6279  O OE2 . GLU C 1 300 ? -56.988 39.423  -42.630 1.00 52.85  ? 300 GLU C OE2 1 
ATOM 6280  N N   . LEU C 1 301 ? -62.332 40.033  -44.552 1.00 42.85  ? 301 LEU C N   1 
ATOM 6281  C CA  . LEU C 1 301 ? -62.577 39.765  -45.963 1.00 42.64  ? 301 LEU C CA  1 
ATOM 6282  C C   . LEU C 1 301 ? -63.241 40.975  -46.595 1.00 47.98  ? 301 LEU C C   1 
ATOM 6283  O O   . LEU C 1 301 ? -62.722 41.516  -47.554 1.00 48.36  ? 301 LEU C O   1 
ATOM 6284  C CB  . LEU C 1 301 ? -63.458 38.499  -46.098 1.00 42.87  ? 301 LEU C CB  1 
ATOM 6285  C CG  . LEU C 1 301 ? -63.521 37.709  -47.433 1.00 49.39  ? 301 LEU C CG  1 
ATOM 6286  C CD1 . LEU C 1 301 ? -64.890 37.708  -47.984 1.00 50.42  ? 301 LEU C CD1 1 
ATOM 6287  C CD2 . LEU C 1 301 ? -62.427 38.100  -48.456 1.00 51.61  ? 301 LEU C CD2 1 
ATOM 6288  N N   . ARG C 1 302 ? -64.314 41.463  -45.981 1.00 46.07  ? 302 ARG C N   1 
ATOM 6289  C CA  . ARG C 1 302 ? -65.080 42.613  -46.431 1.00 46.02  ? 302 ARG C CA  1 
ATOM 6290  C C   . ARG C 1 302 ? -64.165 43.844  -46.618 1.00 52.23  ? 302 ARG C C   1 
ATOM 6291  O O   . ARG C 1 302 ? -64.126 44.399  -47.721 1.00 53.11  ? 302 ARG C O   1 
ATOM 6292  C CB  . ARG C 1 302 ? -66.244 42.881  -45.453 1.00 45.32  ? 302 ARG C CB  1 
ATOM 6293  C CG  . ARG C 1 302 ? -67.268 43.869  -45.969 1.00 61.47  ? 302 ARG C CG  1 
ATOM 6294  C CD  . ARG C 1 302 ? -68.415 44.080  -45.000 1.00 79.84  ? 302 ARG C CD  1 
ATOM 6295  N NE  . ARG C 1 302 ? -68.993 45.419  -45.159 1.00 92.30  ? 302 ARG C NE  1 
ATOM 6296  C CZ  . ARG C 1 302 ? -68.628 46.486  -44.447 1.00 102.26 ? 302 ARG C CZ  1 
ATOM 6297  N NH1 . ARG C 1 302 ? -67.692 46.382  -43.510 1.00 78.50  ? 302 ARG C NH1 1 
ATOM 6298  N NH2 . ARG C 1 302 ? -69.200 47.663  -44.664 1.00 92.31  ? 302 ARG C NH2 1 
ATOM 6299  N N   . SER C 1 303 ? -63.391 44.228  -45.585 1.00 49.89  ? 303 SER C N   1 
ATOM 6300  C CA  . SER C 1 303 ? -62.489 45.402  -45.615 1.00 48.89  ? 303 SER C CA  1 
ATOM 6301  C C   . SER C 1 303 ? -61.327 45.230  -46.613 1.00 49.78  ? 303 SER C C   1 
ATOM 6302  O O   . SER C 1 303 ? -60.944 46.205  -47.258 1.00 50.70  ? 303 SER C O   1 
ATOM 6303  C CB  . SER C 1 303 ? -61.926 45.676  -44.229 1.00 54.13  ? 303 SER C CB  1 
ATOM 6304  O OG  . SER C 1 303 ? -60.901 44.736  -43.942 1.00 69.67  ? 303 SER C OG  1 
ATOM 6305  N N   . ARG C 1 304 ? -60.763 44.012  -46.730 1.00 43.28  ? 304 ARG C N   1 
ATOM 6306  C CA  . ARG C 1 304 ? -59.677 43.744  -47.680 1.00 42.79  ? 304 ARG C CA  1 
ATOM 6307  C C   . ARG C 1 304 ? -60.171 43.817  -49.136 1.00 48.76  ? 304 ARG C C   1 
ATOM 6308  O O   . ARG C 1 304 ? -59.461 44.372  -49.968 1.00 49.50  ? 304 ARG C O   1 
ATOM 6309  C CB  . ARG C 1 304 ? -59.036 42.396  -47.413 1.00 41.20  ? 304 ARG C CB  1 
ATOM 6310  C CG  . ARG C 1 304 ? -58.114 42.398  -46.210 1.00 45.74  ? 304 ARG C CG  1 
ATOM 6311  C CD  . ARG C 1 304 ? -57.472 41.059  -46.058 1.00 39.14  ? 304 ARG C CD  1 
ATOM 6312  N NE  . ARG C 1 304 ? -56.455 41.034  -45.008 1.00 42.91  ? 304 ARG C NE  1 
ATOM 6313  C CZ  . ARG C 1 304 ? -55.166 41.326  -45.185 1.00 54.31  ? 304 ARG C CZ  1 
ATOM 6314  N NH1 . ARG C 1 304 ? -54.729 41.760  -46.360 1.00 44.62  ? 304 ARG C NH1 1 
ATOM 6315  N NH2 . ARG C 1 304 ? -54.309 41.196  -44.187 1.00 43.57  ? 304 ARG C NH2 1 
ATOM 6316  N N   . ILE C 1 305 ? -61.400 43.305  -49.432 1.00 44.06  ? 305 ILE C N   1 
ATOM 6317  C CA  . ILE C 1 305 ? -62.034 43.353  -50.765 1.00 42.59  ? 305 ILE C CA  1 
ATOM 6318  C C   . ILE C 1 305 ? -62.432 44.807  -51.155 1.00 48.92  ? 305 ILE C C   1 
ATOM 6319  O O   . ILE C 1 305 ? -62.149 45.211  -52.278 1.00 50.66  ? 305 ILE C O   1 
ATOM 6320  C CB  . ILE C 1 305 ? -63.262 42.396  -50.841 1.00 43.76  ? 305 ILE C CB  1 
ATOM 6321  C CG1 . ILE C 1 305 ? -62.892 40.889  -50.667 1.00 41.95  ? 305 ILE C CG1 1 
ATOM 6322  C CG2 . ILE C 1 305 ? -64.151 42.669  -52.068 1.00 44.09  ? 305 ILE C CG2 1 
ATOM 6323  C CD1 . ILE C 1 305 ? -61.929 40.235  -51.639 1.00 35.81  ? 305 ILE C CD1 1 
ATOM 6324  N N   . ALA C 1 306 ? -63.076 45.571  -50.250 1.00 45.75  ? 306 ALA C N   1 
ATOM 6325  C CA  . ALA C 1 306 ? -63.521 46.941  -50.524 1.00 46.88  ? 306 ALA C CA  1 
ATOM 6326  C C   . ALA C 1 306 ? -62.363 47.923  -50.738 1.00 53.26  ? 306 ALA C C   1 
ATOM 6327  O O   . ALA C 1 306 ? -62.540 48.914  -51.436 1.00 53.17  ? 306 ALA C O   1 
ATOM 6328  C CB  . ALA C 1 306 ? -64.414 47.435  -49.403 1.00 47.88  ? 306 ALA C CB  1 
ATOM 6329  N N   . THR C 1 307 ? -61.190 47.644  -50.148 1.00 52.89  ? 307 THR C N   1 
ATOM 6330  C CA  . THR C 1 307 ? -59.942 48.429  -50.249 1.00 53.34  ? 307 THR C CA  1 
ATOM 6331  C C   . THR C 1 307 ? -59.169 48.069  -51.576 1.00 57.07  ? 307 THR C C   1 
ATOM 6332  O O   . THR C 1 307 ? -58.325 48.851  -52.053 1.00 56.40  ? 307 THR C O   1 
ATOM 6333  C CB  . THR C 1 307 ? -59.158 48.204  -48.955 1.00 60.50  ? 307 THR C CB  1 
ATOM 6334  O OG1 . THR C 1 307 ? -59.666 49.155  -48.025 1.00 57.01  ? 307 THR C OG1 1 
ATOM 6335  C CG2 . THR C 1 307 ? -57.651 48.356  -49.105 1.00 63.10  ? 307 THR C CG2 1 
ATOM 6336  N N   . THR C 1 308 ? -59.504 46.906  -52.170 1.00 52.93  ? 308 THR C N   1 
ATOM 6337  C CA  . THR C 1 308 ? -58.932 46.458  -53.429 1.00 53.15  ? 308 THR C CA  1 
ATOM 6338  C C   . THR C 1 308 ? -59.767 47.062  -54.560 1.00 59.59  ? 308 THR C C   1 
ATOM 6339  O O   . THR C 1 308 ? -61.008 47.121  -54.483 1.00 59.91  ? 308 THR C O   1 
ATOM 6340  C CB  . THR C 1 308 ? -58.835 44.927  -53.487 1.00 59.89  ? 308 THR C CB  1 
ATOM 6341  O OG1 . THR C 1 308 ? -58.301 44.418  -52.261 1.00 62.48  ? 308 THR C OG1 1 
ATOM 6342  C CG2 . THR C 1 308 ? -57.958 44.444  -54.621 1.00 55.64  ? 308 THR C CG2 1 
ATOM 6343  N N   . GLU C 1 309 ? -59.064 47.540  -55.590 1.00 56.96  ? 309 GLU C N   1 
ATOM 6344  C CA  . GLU C 1 309 ? -59.613 48.181  -56.785 1.00 56.92  ? 309 GLU C CA  1 
ATOM 6345  C C   . GLU C 1 309 ? -60.482 47.225  -57.661 1.00 57.47  ? 309 GLU C C   1 
ATOM 6346  O O   . GLU C 1 309 ? -60.063 46.098  -57.934 1.00 54.65  ? 309 GLU C O   1 
ATOM 6347  C CB  . GLU C 1 309 ? -58.439 48.709  -57.618 1.00 58.89  ? 309 GLU C CB  1 
ATOM 6348  C CG  . GLU C 1 309 ? -58.744 49.997  -58.342 1.00 79.09  ? 309 GLU C CG  1 
ATOM 6349  C CD  . GLU C 1 309 ? -57.650 50.445  -59.288 1.00 109.17 ? 309 GLU C CD  1 
ATOM 6350  O OE1 . GLU C 1 309 ? -57.871 50.400  -60.520 1.00 116.06 ? 309 GLU C OE1 1 
ATOM 6351  O OE2 . GLU C 1 309 ? -56.570 50.844  -58.797 1.00 101.05 ? 309 GLU C OE2 1 
ATOM 6352  N N   . PRO C 1 310 ? -61.672 47.663  -58.145 1.00 54.55  ? 310 PRO C N   1 
ATOM 6353  C CA  . PRO C 1 310 ? -62.469 46.800  -59.056 1.00 54.38  ? 310 PRO C CA  1 
ATOM 6354  C C   . PRO C 1 310 ? -61.665 46.404  -60.295 1.00 58.76  ? 310 PRO C C   1 
ATOM 6355  O O   . PRO C 1 310 ? -60.859 47.200  -60.795 1.00 58.92  ? 310 PRO C O   1 
ATOM 6356  C CB  . PRO C 1 310 ? -63.656 47.689  -59.436 1.00 55.64  ? 310 PRO C CB  1 
ATOM 6357  C CG  . PRO C 1 310 ? -63.752 48.682  -58.323 1.00 60.24  ? 310 PRO C CG  1 
ATOM 6358  C CD  . PRO C 1 310 ? -62.329 48.967  -57.951 1.00 55.64  ? 310 PRO C CD  1 
ATOM 6359  N N   . GLY C 1 311 ? -61.846 45.167  -60.738 1.00 55.48  ? 311 GLY C N   1 
ATOM 6360  C CA  . GLY C 1 311 ? -61.114 44.612  -61.872 1.00 55.67  ? 311 GLY C CA  1 
ATOM 6361  C C   . GLY C 1 311 ? -59.962 43.715  -61.455 1.00 61.10  ? 311 GLY C C   1 
ATOM 6362  O O   . GLY C 1 311 ? -59.505 42.878  -62.242 1.00 62.04  ? 311 GLY C O   1 
ATOM 6363  N N   . THR C 1 312 ? -59.492 43.878  -60.200 1.00 56.40  ? 312 THR C N   1 
ATOM 6364  C CA  . THR C 1 312 ? -58.414 43.085  -59.626 1.00 54.72  ? 312 THR C CA  1 
ATOM 6365  C C   . THR C 1 312 ? -58.886 41.649  -59.420 1.00 55.87  ? 312 THR C C   1 
ATOM 6366  O O   . THR C 1 312 ? -60.023 41.429  -59.027 1.00 55.28  ? 312 THR C O   1 
ATOM 6367  C CB  . THR C 1 312 ? -57.920 43.714  -58.299 1.00 60.07  ? 312 THR C CB  1 
ATOM 6368  O OG1 . THR C 1 312 ? -57.683 45.121  -58.478 1.00 54.02  ? 312 THR C OG1 1 
ATOM 6369  C CG2 . THR C 1 312 ? -56.656 43.043  -57.765 1.00 59.56  ? 312 THR C CG2 1 
ATOM 6370  N N   . LYS C 1 313 ? -58.008 40.679  -59.707 1.00 51.15  ? 313 LYS C N   1 
ATOM 6371  C CA  . LYS C 1 313 ? -58.275 39.261  -59.503 1.00 49.58  ? 313 LYS C CA  1 
ATOM 6372  C C   . LYS C 1 313 ? -57.718 38.872  -58.148 1.00 56.30  ? 313 LYS C C   1 
ATOM 6373  O O   . LYS C 1 313 ? -56.594 39.243  -57.803 1.00 58.26  ? 313 LYS C O   1 
ATOM 6374  C CB  . LYS C 1 313 ? -57.694 38.382  -60.624 1.00 50.15  ? 313 LYS C CB  1 
ATOM 6375  C CG  . LYS C 1 313 ? -58.478 38.451  -61.911 1.00 48.15  ? 313 LYS C CG  1 
ATOM 6376  C CD  . LYS C 1 313 ? -58.077 37.347  -62.876 1.00 38.75  ? 313 LYS C CD  1 
ATOM 6377  C CE  . LYS C 1 313 ? -58.778 37.501  -64.190 1.00 44.25  ? 313 LYS C CE  1 
ATOM 6378  N NZ  . LYS C 1 313 ? -58.819 36.220  -64.929 1.00 59.92  ? 313 LYS C NZ  1 
ATOM 6379  N N   . VAL C 1 314 ? -58.522 38.165  -57.352 1.00 51.87  ? 314 VAL C N   1 
ATOM 6380  C CA  . VAL C 1 314 ? -58.140 37.707  -56.014 1.00 49.60  ? 314 VAL C CA  1 
ATOM 6381  C C   . VAL C 1 314 ? -58.287 36.210  -55.968 1.00 49.62  ? 314 VAL C C   1 
ATOM 6382  O O   . VAL C 1 314 ? -59.118 35.657  -56.689 1.00 48.78  ? 314 VAL C O   1 
ATOM 6383  C CB  . VAL C 1 314 ? -58.933 38.402  -54.860 1.00 53.29  ? 314 VAL C CB  1 
ATOM 6384  C CG1 . VAL C 1 314 ? -58.622 39.896  -54.791 1.00 53.12  ? 314 VAL C CG1 1 
ATOM 6385  C CG2 . VAL C 1 314 ? -60.443 38.167  -54.978 1.00 52.91  ? 314 VAL C CG2 1 
ATOM 6386  N N   . LYS C 1 315 ? -57.474 35.550  -55.133 1.00 45.80  ? 315 LYS C N   1 
ATOM 6387  C CA  . LYS C 1 315 ? -57.542 34.117  -54.946 1.00 45.73  ? 315 LYS C CA  1 
ATOM 6388  C C   . LYS C 1 315 ? -58.230 33.842  -53.617 1.00 52.56  ? 315 LYS C C   1 
ATOM 6389  O O   . LYS C 1 315 ? -57.826 34.357  -52.570 1.00 53.42  ? 315 LYS C O   1 
ATOM 6390  C CB  . LYS C 1 315 ? -56.166 33.455  -55.051 1.00 48.27  ? 315 LYS C CB  1 
ATOM 6391  C CG  . LYS C 1 315 ? -55.813 33.107  -56.498 1.00 75.15  ? 315 LYS C CG  1 
ATOM 6392  C CD  . LYS C 1 315 ? -54.327 32.780  -56.704 1.00 86.72  ? 315 LYS C CD  1 
ATOM 6393  C CE  . LYS C 1 315 ? -53.946 32.800  -58.166 1.00 103.05 ? 315 LYS C CE  1 
ATOM 6394  N NZ  . LYS C 1 315 ? -52.482 32.609  -58.382 1.00 115.69 ? 315 LYS C NZ  1 
ATOM 6395  N N   . LEU C 1 316 ? -59.303 33.051  -53.678 1.00 49.23  ? 316 LEU C N   1 
ATOM 6396  C CA  . LEU C 1 316 ? -60.140 32.699  -52.550 1.00 48.72  ? 316 LEU C CA  1 
ATOM 6397  C C   . LEU C 1 316 ? -59.916 31.275  -52.088 1.00 52.52  ? 316 LEU C C   1 
ATOM 6398  O O   . LEU C 1 316 ? -60.203 30.338  -52.819 1.00 52.47  ? 316 LEU C O   1 
ATOM 6399  C CB  . LEU C 1 316 ? -61.617 32.886  -52.968 1.00 48.72  ? 316 LEU C CB  1 
ATOM 6400  C CG  . LEU C 1 316 ? -62.403 34.081  -52.406 1.00 52.54  ? 316 LEU C CG  1 
ATOM 6401  C CD1 . LEU C 1 316 ? -61.694 35.403  -52.638 1.00 52.41  ? 316 LEU C CD1 1 
ATOM 6402  C CD2 . LEU C 1 316 ? -63.788 34.137  -53.034 1.00 53.34  ? 316 LEU C CD2 1 
ATOM 6403  N N   . GLY C 1 317 ? -59.424 31.133  -50.865 1.00 49.91  ? 317 GLY C N   1 
ATOM 6404  C CA  . GLY C 1 317 ? -59.249 29.860  -50.178 1.00 49.12  ? 317 GLY C CA  1 
ATOM 6405  C C   . GLY C 1 317 ? -60.633 29.486  -49.713 1.00 52.45  ? 317 GLY C C   1 
ATOM 6406  O O   . GLY C 1 317 ? -61.258 30.212  -48.938 1.00 51.11  ? 317 GLY C O   1 
ATOM 6407  N N   . LEU C 1 318 ? -61.150 28.416  -50.268 1.00 50.46  ? 318 LEU C N   1 
ATOM 6408  C CA  . LEU C 1 318 ? -62.530 27.991  -50.113 1.00 50.41  ? 318 LEU C CA  1 
ATOM 6409  C C   . LEU C 1 318 ? -62.637 26.584  -49.542 1.00 53.26  ? 318 LEU C C   1 
ATOM 6410  O O   . LEU C 1 318 ? -61.656 25.850  -49.526 1.00 50.74  ? 318 LEU C O   1 
ATOM 6411  C CB  . LEU C 1 318 ? -63.082 28.031  -51.543 1.00 50.09  ? 318 LEU C CB  1 
ATOM 6412  C CG  . LEU C 1 318 ? -64.520 28.186  -51.766 1.00 53.30  ? 318 LEU C CG  1 
ATOM 6413  C CD1 . LEU C 1 318 ? -64.771 29.297  -52.717 1.00 52.14  ? 318 LEU C CD1 1 
ATOM 6414  C CD2 . LEU C 1 318 ? -65.060 26.912  -52.308 1.00 58.06  ? 318 LEU C CD2 1 
ATOM 6415  N N   . LEU C 1 319 ? -63.843 26.201  -49.099 1.00 52.14  ? 319 LEU C N   1 
ATOM 6416  C CA  . LEU C 1 319 ? -64.110 24.877  -48.552 1.00 52.75  ? 319 LEU C CA  1 
ATOM 6417  C C   . LEU C 1 319 ? -65.548 24.459  -48.840 1.00 60.35  ? 319 LEU C C   1 
ATOM 6418  O O   . LEU C 1 319 ? -66.474 24.950  -48.179 1.00 58.94  ? 319 LEU C O   1 
ATOM 6419  C CB  . LEU C 1 319 ? -63.838 24.885  -47.046 1.00 52.75  ? 319 LEU C CB  1 
ATOM 6420  C CG  . LEU C 1 319 ? -63.231 23.629  -46.445 1.00 56.98  ? 319 LEU C CG  1 
ATOM 6421  C CD1 . LEU C 1 319 ? -61.732 23.506  -46.776 1.00 55.52  ? 319 LEU C CD1 1 
ATOM 6422  C CD2 . LEU C 1 319 ? -63.404 23.650  -44.931 1.00 59.28  ? 319 LEU C CD2 1 
ATOM 6423  N N   . ARG C 1 320 ? -65.745 23.585  -49.875 1.00 60.29  ? 320 ARG C N   1 
ATOM 6424  C CA  . ARG C 1 320 ? -67.085 23.097  -50.179 1.00 60.92  ? 320 ARG C CA  1 
ATOM 6425  C C   . ARG C 1 320 ? -67.154 21.590  -49.990 1.00 68.48  ? 320 ARG C C   1 
ATOM 6426  O O   . ARG C 1 320 ? -66.301 20.829  -50.456 1.00 68.24  ? 320 ARG C O   1 
ATOM 6427  C CB  . ARG C 1 320 ? -67.664 23.573  -51.519 1.00 58.40  ? 320 ARG C CB  1 
ATOM 6428  C CG  . ARG C 1 320 ? -67.263 22.872  -52.790 1.00 61.51  ? 320 ARG C CG  1 
ATOM 6429  C CD  . ARG C 1 320 ? -68.138 23.330  -53.958 1.00 57.64  ? 320 ARG C CD  1 
ATOM 6430  N NE  . ARG C 1 320 ? -68.053 24.773  -54.219 1.00 51.31  ? 320 ARG C NE  1 
ATOM 6431  C CZ  . ARG C 1 320 ? -67.712 25.317  -55.382 1.00 56.00  ? 320 ARG C CZ  1 
ATOM 6432  N NH1 . ARG C 1 320 ? -67.408 24.552  -56.419 1.00 55.45  ? 320 ARG C NH1 1 
ATOM 6433  N NH2 . ARG C 1 320 ? -67.678 26.627  -55.519 1.00 38.75  ? 320 ARG C NH2 1 
ATOM 6434  N N   . ASN C 1 321 ? -68.156 21.196  -49.195 1.00 67.65  ? 321 ASN C N   1 
ATOM 6435  C CA  . ASN C 1 321 ? -68.457 19.843  -48.748 1.00 68.30  ? 321 ASN C CA  1 
ATOM 6436  C C   . ASN C 1 321 ? -67.234 19.233  -48.045 1.00 71.07  ? 321 ASN C C   1 
ATOM 6437  O O   . ASN C 1 321 ? -66.992 18.028  -48.137 1.00 72.88  ? 321 ASN C O   1 
ATOM 6438  C CB  . ASN C 1 321 ? -69.000 18.982  -49.894 1.00 72.64  ? 321 ASN C CB  1 
ATOM 6439  C CG  . ASN C 1 321 ? -70.450 19.312  -50.192 1.00 105.50 ? 321 ASN C CG  1 
ATOM 6440  O OD1 . ASN C 1 321 ? -70.774 19.877  -51.240 1.00 99.40  ? 321 ASN C OD1 1 
ATOM 6441  N ND2 . ASN C 1 321 ? -71.352 19.033  -49.244 1.00 100.96 ? 321 ASN C ND2 1 
ATOM 6442  N N   . GLY C 1 322 ? -66.511 20.088  -47.312 1.00 64.26  ? 322 GLY C N   1 
ATOM 6443  C CA  . GLY C 1 322 ? -65.316 19.742  -46.549 1.00 62.41  ? 322 GLY C CA  1 
ATOM 6444  C C   . GLY C 1 322 ? -64.053 19.588  -47.371 1.00 62.83  ? 322 GLY C C   1 
ATOM 6445  O O   . GLY C 1 322 ? -63.014 19.192  -46.838 1.00 62.32  ? 322 GLY C O   1 
ATOM 6446  N N   . LYS C 1 323 ? -64.126 19.907  -48.669 1.00 57.30  ? 323 LYS C N   1 
ATOM 6447  C CA  . LYS C 1 323 ? -63.007 19.764  -49.597 1.00 55.48  ? 323 LYS C CA  1 
ATOM 6448  C C   . LYS C 1 323 ? -62.427 21.127  -49.968 1.00 55.14  ? 323 LYS C C   1 
ATOM 6449  O O   . LYS C 1 323 ? -63.174 22.043  -50.325 1.00 54.71  ? 323 LYS C O   1 
ATOM 6450  C CB  . LYS C 1 323 ? -63.430 18.978  -50.871 1.00 58.38  ? 323 LYS C CB  1 
ATOM 6451  C CG  . LYS C 1 323 ? -64.092 17.608  -50.618 1.00 74.85  ? 323 LYS C CG  1 
ATOM 6452  C CD  . LYS C 1 323 ? -63.162 16.578  -49.974 1.00 89.82  ? 323 LYS C CD  1 
ATOM 6453  C CE  . LYS C 1 323 ? -63.923 15.518  -49.212 1.00 108.79 ? 323 LYS C CE  1 
ATOM 6454  N NZ  . LYS C 1 323 ? -63.009 14.630  -48.441 1.00 121.15 ? 323 LYS C NZ  1 
ATOM 6455  N N   . PRO C 1 324 ? -61.090 21.267  -49.921 1.00 50.83  ? 324 PRO C N   1 
ATOM 6456  C CA  . PRO C 1 324 ? -60.466 22.558  -50.264 1.00 50.67  ? 324 PRO C CA  1 
ATOM 6457  C C   . PRO C 1 324 ? -60.473 22.858  -51.758 1.00 54.05  ? 324 PRO C C   1 
ATOM 6458  O O   . PRO C 1 324 ? -60.353 21.952  -52.580 1.00 56.09  ? 324 PRO C O   1 
ATOM 6459  C CB  . PRO C 1 324 ? -59.016 22.408  -49.770 1.00 52.49  ? 324 PRO C CB  1 
ATOM 6460  C CG  . PRO C 1 324 ? -58.965 21.143  -49.000 1.00 57.06  ? 324 PRO C CG  1 
ATOM 6461  C CD  . PRO C 1 324 ? -60.070 20.282  -49.524 1.00 52.70  ? 324 PRO C CD  1 
ATOM 6462  N N   . LEU C 1 325 ? -60.613 24.137  -52.089 1.00 47.98  ? 325 LEU C N   1 
ATOM 6463  C CA  . LEU C 1 325 ? -60.603 24.707  -53.431 1.00 47.06  ? 325 LEU C CA  1 
ATOM 6464  C C   . LEU C 1 325 ? -59.989 26.100  -53.396 1.00 51.78  ? 325 LEU C C   1 
ATOM 6465  O O   . LEU C 1 325 ? -60.110 26.804  -52.399 1.00 48.57  ? 325 LEU C O   1 
ATOM 6466  C CB  . LEU C 1 325 ? -62.021 24.821  -54.037 1.00 46.41  ? 325 LEU C CB  1 
ATOM 6467  C CG  . LEU C 1 325 ? -62.899 23.582  -54.189 1.00 50.89  ? 325 LEU C CG  1 
ATOM 6468  C CD1 . LEU C 1 325 ? -64.272 23.991  -54.677 1.00 49.86  ? 325 LEU C CD1 1 
ATOM 6469  C CD2 . LEU C 1 325 ? -62.280 22.534  -55.139 1.00 53.68  ? 325 LEU C CD2 1 
ATOM 6470  N N   . GLU C 1 326 ? -59.367 26.503  -54.500 1.00 51.21  ? 326 GLU C N   1 
ATOM 6471  C CA  . GLU C 1 326 ? -58.844 27.848  -54.715 1.00 51.21  ? 326 GLU C CA  1 
ATOM 6472  C C   . GLU C 1 326 ? -59.600 28.411  -55.893 1.00 53.64  ? 326 GLU C C   1 
ATOM 6473  O O   . GLU C 1 326 ? -59.695 27.755  -56.939 1.00 54.99  ? 326 GLU C O   1 
ATOM 6474  C CB  . GLU C 1 326 ? -57.328 27.857  -54.939 1.00 53.33  ? 326 GLU C CB  1 
ATOM 6475  C CG  . GLU C 1 326 ? -56.534 28.337  -53.732 1.00 71.04  ? 326 GLU C CG  1 
ATOM 6476  C CD  . GLU C 1 326 ? -56.045 29.769  -53.812 1.00 107.99 ? 326 GLU C CD  1 
ATOM 6477  O OE1 . GLU C 1 326 ? -55.528 30.157  -54.886 1.00 107.91 ? 326 GLU C OE1 1 
ATOM 6478  O OE2 . GLU C 1 326 ? -56.132 30.489  -52.789 1.00 108.51 ? 326 GLU C OE2 1 
ATOM 6479  N N   . VAL C 1 327 ? -60.205 29.583  -55.714 1.00 46.95  ? 327 VAL C N   1 
ATOM 6480  C CA  . VAL C 1 327 ? -61.023 30.181  -56.759 1.00 45.35  ? 327 VAL C CA  1 
ATOM 6481  C C   . VAL C 1 327 ? -60.533 31.597  -57.021 1.00 48.55  ? 327 VAL C C   1 
ATOM 6482  O O   . VAL C 1 327 ? -60.301 32.367  -56.096 1.00 46.88  ? 327 VAL C O   1 
ATOM 6483  C CB  . VAL C 1 327 ? -62.530 30.095  -56.388 1.00 47.64  ? 327 VAL C CB  1 
ATOM 6484  C CG1 . VAL C 1 327 ? -63.397 31.011  -57.242 1.00 47.02  ? 327 VAL C CG1 1 
ATOM 6485  C CG2 . VAL C 1 327 ? -63.017 28.655  -56.500 1.00 46.46  ? 327 VAL C CG2 1 
ATOM 6486  N N   . GLU C 1 328 ? -60.322 31.909  -58.292 1.00 46.70  ? 328 GLU C N   1 
ATOM 6487  C CA  . GLU C 1 328 ? -59.862 33.221  -58.705 1.00 47.27  ? 328 GLU C CA  1 
ATOM 6488  C C   . GLU C 1 328 ? -61.081 34.034  -59.107 1.00 48.83  ? 328 GLU C C   1 
ATOM 6489  O O   . GLU C 1 328 ? -61.870 33.582  -59.941 1.00 50.34  ? 328 GLU C O   1 
ATOM 6490  C CB  . GLU C 1 328 ? -58.826 33.087  -59.832 1.00 49.63  ? 328 GLU C CB  1 
ATOM 6491  C CG  . GLU C 1 328 ? -58.041 34.355  -60.116 1.00 67.27  ? 328 GLU C CG  1 
ATOM 6492  C CD  . GLU C 1 328 ? -56.933 34.175  -61.142 1.00 94.70  ? 328 GLU C CD  1 
ATOM 6493  O OE1 . GLU C 1 328 ? -55.748 34.304  -60.759 1.00 90.88  ? 328 GLU C OE1 1 
ATOM 6494  O OE2 . GLU C 1 328 ? -57.244 33.906  -62.327 1.00 90.78  ? 328 GLU C OE2 1 
ATOM 6495  N N   . VAL C 1 329 ? -61.285 35.184  -58.445 1.00 41.60  ? 329 VAL C N   1 
ATOM 6496  C CA  . VAL C 1 329 ? -62.456 36.043  -58.659 1.00 39.08  ? 329 VAL C CA  1 
ATOM 6497  C C   . VAL C 1 329 ? -62.025 37.415  -59.122 1.00 46.18  ? 329 VAL C C   1 
ATOM 6498  O O   . VAL C 1 329 ? -61.106 37.986  -58.547 1.00 46.13  ? 329 VAL C O   1 
ATOM 6499  C CB  . VAL C 1 329 ? -63.341 36.161  -57.363 1.00 39.28  ? 329 VAL C CB  1 
ATOM 6500  C CG1 . VAL C 1 329 ? -64.574 37.022  -57.603 1.00 37.67  ? 329 VAL C CG1 1 
ATOM 6501  C CG2 . VAL C 1 329 ? -63.740 34.794  -56.792 1.00 37.93  ? 329 VAL C CG2 1 
ATOM 6502  N N   . THR C 1 330 ? -62.720 37.969  -60.135 1.00 45.50  ? 330 THR C N   1 
ATOM 6503  C CA  . THR C 1 330 ? -62.482 39.336  -60.626 1.00 44.97  ? 330 THR C CA  1 
ATOM 6504  C C   . THR C 1 330 ? -63.460 40.243  -59.899 1.00 52.45  ? 330 THR C C   1 
ATOM 6505  O O   . THR C 1 330 ? -64.674 40.000  -59.894 1.00 52.40  ? 330 THR C O   1 
ATOM 6506  C CB  . THR C 1 330 ? -62.601 39.425  -62.149 1.00 45.15  ? 330 THR C CB  1 
ATOM 6507  O OG1 . THR C 1 330 ? -61.772 38.427  -62.744 1.00 55.47  ? 330 THR C OG1 1 
ATOM 6508  C CG2 . THR C 1 330 ? -62.226 40.776  -62.671 1.00 36.45  ? 330 THR C CG2 1 
ATOM 6509  N N   . LEU C 1 331 ? -62.934 41.275  -59.257 1.00 50.56  ? 331 LEU C N   1 
ATOM 6510  C CA  . LEU C 1 331 ? -63.750 42.172  -58.459 1.00 49.76  ? 331 LEU C CA  1 
ATOM 6511  C C   . LEU C 1 331 ? -64.578 43.115  -59.305 1.00 55.84  ? 331 LEU C C   1 
ATOM 6512  O O   . LEU C 1 331 ? -64.094 43.671  -60.287 1.00 55.32  ? 331 LEU C O   1 
ATOM 6513  C CB  . LEU C 1 331 ? -62.893 42.980  -57.460 1.00 48.59  ? 331 LEU C CB  1 
ATOM 6514  C CG  . LEU C 1 331 ? -62.098 42.179  -56.435 1.00 50.85  ? 331 LEU C CG  1 
ATOM 6515  C CD1 . LEU C 1 331 ? -61.385 43.105  -55.474 1.00 49.69  ? 331 LEU C CD1 1 
ATOM 6516  C CD2 . LEU C 1 331 ? -62.974 41.152  -55.705 1.00 48.44  ? 331 LEU C CD2 1 
ATOM 6517  N N   . ASP C 1 332 ? -65.835 43.295  -58.887 1.00 54.42  ? 332 ASP C N   1 
ATOM 6518  C CA  . ASP C 1 332 ? -66.783 44.221  -59.481 1.00 55.23  ? 332 ASP C CA  1 
ATOM 6519  C C   . ASP C 1 332 ? -66.666 45.557  -58.760 1.00 61.21  ? 332 ASP C C   1 
ATOM 6520  O O   . ASP C 1 332 ? -65.815 45.700  -57.881 1.00 61.42  ? 332 ASP C O   1 
ATOM 6521  C CB  . ASP C 1 332 ? -68.213 43.660  -59.379 1.00 57.32  ? 332 ASP C CB  1 
ATOM 6522  C CG  . ASP C 1 332 ? -68.407 42.274  -59.968 1.00 70.01  ? 332 ASP C CG  1 
ATOM 6523  O OD1 . ASP C 1 332 ? -68.736 41.348  -59.198 1.00 70.66  ? 332 ASP C OD1 1 
ATOM 6524  O OD2 . ASP C 1 332 ? -68.253 42.123  -61.208 1.00 76.56  ? 332 ASP C OD2 1 
ATOM 6525  N N   . THR C 1 333 ? -67.502 46.538  -59.127 1.00 58.77  ? 333 THR C N   1 
ATOM 6526  C CA  . THR C 1 333 ? -67.526 47.845  -58.464 1.00 58.36  ? 333 THR C CA  1 
ATOM 6527  C C   . THR C 1 333 ? -68.721 47.848  -57.512 1.00 64.67  ? 333 THR C C   1 
ATOM 6528  O O   . THR C 1 333 ? -69.703 47.143  -57.767 1.00 65.89  ? 333 THR C O   1 
ATOM 6529  C CB  . THR C 1 333 ? -67.555 48.988  -59.498 1.00 59.41  ? 333 THR C CB  1 
ATOM 6530  O OG1 . THR C 1 333 ? -66.651 48.686  -60.573 1.00 55.26  ? 333 THR C OG1 1 
ATOM 6531  C CG2 . THR C 1 333 ? -67.218 50.359  -58.882 1.00 53.45  ? 333 THR C CG2 1 
ATOM 6532  N N   . SER C 1 334 ? -68.632 48.603  -56.404 1.00 62.17  ? 334 SER C N   1 
ATOM 6533  C CA  . SER C 1 334 ? -69.702 48.705  -55.406 1.00 64.10  ? 334 SER C CA  1 
ATOM 6534  C C   . SER C 1 334 ? -70.581 49.954  -55.654 1.00 78.11  ? 334 SER C C   1 
ATOM 6535  O O   . SER C 1 334 ? -70.008 51.035  -55.941 1.00 74.00  ? 334 SER C O   1 
ATOM 6536  C CB  . SER C 1 334 ? -69.110 48.722  -54.001 1.00 66.62  ? 334 SER C CB  1 
ATOM 6537  O OG  . SER C 1 334 ? -70.125 48.709  -53.010 1.00 72.00  ? 334 SER C OG  1 
ATOM 6538  N N   . PRO D 1 11  ? -31.916 21.403  -25.344 1.00 88.58  ? 11  PRO D N   1 
ATOM 6539  C CA  . PRO D 1 11  ? -30.887 22.083  -24.548 1.00 87.77  ? 11  PRO D CA  1 
ATOM 6540  C C   . PRO D 1 11  ? -29.910 21.095  -23.903 1.00 88.00  ? 11  PRO D C   1 
ATOM 6541  O O   . PRO D 1 11  ? -28.717 21.417  -23.775 1.00 88.59  ? 11  PRO D O   1 
ATOM 6542  C CB  . PRO D 1 11  ? -31.701 22.853  -23.496 1.00 89.86  ? 11  PRO D CB  1 
ATOM 6543  C CG  . PRO D 1 11  ? -33.079 23.010  -24.087 1.00 94.87  ? 11  PRO D CG  1 
ATOM 6544  C CD  . PRO D 1 11  ? -33.192 22.144  -25.326 1.00 90.61  ? 11  PRO D CD  1 
ATOM 6545  N N   . LEU D 1 12  ? -30.409 19.898  -23.492 1.00 78.54  ? 12  LEU D N   1 
ATOM 6546  C CA  . LEU D 1 12  ? -29.568 18.867  -22.880 1.00 74.49  ? 12  LEU D CA  1 
ATOM 6547  C C   . LEU D 1 12  ? -28.733 18.136  -23.937 1.00 69.52  ? 12  LEU D C   1 
ATOM 6548  O O   . LEU D 1 12  ? -29.281 17.738  -24.970 1.00 67.09  ? 12  LEU D O   1 
ATOM 6549  C CB  . LEU D 1 12  ? -30.398 17.830  -22.086 1.00 74.35  ? 12  LEU D CB  1 
ATOM 6550  C CG  . LEU D 1 12  ? -30.819 18.162  -20.645 1.00 78.66  ? 12  LEU D CG  1 
ATOM 6551  C CD1 . LEU D 1 12  ? -31.576 16.989  -20.025 1.00 78.23  ? 12  LEU D CD1 1 
ATOM 6552  C CD2 . LEU D 1 12  ? -29.619 18.543  -19.776 1.00 80.48  ? 12  LEU D CD2 1 
ATOM 6553  N N   . PRO D 1 13  ? -27.415 17.913  -23.676 1.00 61.28  ? 13  PRO D N   1 
ATOM 6554  C CA  . PRO D 1 13  ? -26.604 17.098  -24.611 1.00 58.96  ? 13  PRO D CA  1 
ATOM 6555  C C   . PRO D 1 13  ? -27.156 15.668  -24.719 1.00 57.66  ? 13  PRO D C   1 
ATOM 6556  O O   . PRO D 1 13  ? -27.605 15.096  -23.706 1.00 55.96  ? 13  PRO D O   1 
ATOM 6557  C CB  . PRO D 1 13  ? -25.204 17.097  -23.981 1.00 60.46  ? 13  PRO D CB  1 
ATOM 6558  C CG  . PRO D 1 13  ? -25.239 18.108  -22.906 1.00 64.83  ? 13  PRO D CG  1 
ATOM 6559  C CD  . PRO D 1 13  ? -26.642 18.283  -22.469 1.00 61.06  ? 13  PRO D CD  1 
ATOM 6560  N N   . SER D 1 14  ? -27.166 15.113  -25.955 1.00 50.46  ? 14  SER D N   1 
ATOM 6561  C CA  . SER D 1 14  ? -27.737 13.801  -26.248 1.00 48.19  ? 14  SER D CA  1 
ATOM 6562  C C   . SER D 1 14  ? -27.250 13.237  -27.576 1.00 52.28  ? 14  SER D C   1 
ATOM 6563  O O   . SER D 1 14  ? -26.914 13.999  -28.473 1.00 52.77  ? 14  SER D O   1 
ATOM 6564  C CB  . SER D 1 14  ? -29.259 13.901  -26.285 1.00 48.26  ? 14  SER D CB  1 
ATOM 6565  O OG  . SER D 1 14  ? -29.871 12.653  -26.570 1.00 52.60  ? 14  SER D OG  1 
ATOM 6566  N N   . LEU D 1 15  ? -27.245 11.899  -27.713 1.00 47.88  ? 15  LEU D N   1 
ATOM 6567  C CA  . LEU D 1 15  ? -26.882 11.206  -28.949 1.00 47.50  ? 15  LEU D CA  1 
ATOM 6568  C C   . LEU D 1 15  ? -28.153 10.870  -29.733 1.00 50.25  ? 15  LEU D C   1 
ATOM 6569  O O   . LEU D 1 15  ? -28.066 10.394  -30.874 1.00 48.92  ? 15  LEU D O   1 
ATOM 6570  C CB  . LEU D 1 15  ? -26.073 9.915   -28.682 1.00 48.21  ? 15  LEU D CB  1 
ATOM 6571  C CG  . LEU D 1 15  ? -24.873 9.986   -27.748 1.00 53.87  ? 15  LEU D CG  1 
ATOM 6572  C CD1 . LEU D 1 15  ? -24.296 8.602   -27.520 1.00 53.62  ? 15  LEU D CD1 1 
ATOM 6573  C CD2 . LEU D 1 15  ? -23.809 10.931  -28.293 1.00 57.27  ? 15  LEU D CD2 1 
ATOM 6574  N N   . ALA D 1 16  ? -29.330 11.130  -29.127 1.00 48.11  ? 16  ALA D N   1 
ATOM 6575  C CA  . ALA D 1 16  ? -30.670 10.894  -29.700 1.00 49.95  ? 16  ALA D CA  1 
ATOM 6576  C C   . ALA D 1 16  ? -30.911 11.662  -31.029 1.00 57.17  ? 16  ALA D C   1 
ATOM 6577  O O   . ALA D 1 16  ? -31.417 11.006  -31.946 1.00 57.62  ? 16  ALA D O   1 
ATOM 6578  C CB  . ALA D 1 16  ? -31.757 11.228  -28.693 1.00 50.78  ? 16  ALA D CB  1 
ATOM 6579  N N   . PRO D 1 17  ? -30.528 12.975  -31.212 1.00 54.59  ? 17  PRO D N   1 
ATOM 6580  C CA  . PRO D 1 17  ? -30.693 13.608  -32.539 1.00 54.62  ? 17  PRO D CA  1 
ATOM 6581  C C   . PRO D 1 17  ? -29.936 12.877  -33.657 1.00 57.53  ? 17  PRO D C   1 
ATOM 6582  O O   . PRO D 1 17  ? -30.508 12.673  -34.728 1.00 56.72  ? 17  PRO D O   1 
ATOM 6583  C CB  . PRO D 1 17  ? -30.123 15.020  -32.335 1.00 56.21  ? 17  PRO D CB  1 
ATOM 6584  C CG  . PRO D 1 17  ? -30.241 15.269  -30.885 1.00 60.18  ? 17  PRO D CG  1 
ATOM 6585  C CD  . PRO D 1 17  ? -29.930 13.942  -30.262 1.00 55.73  ? 17  PRO D CD  1 
ATOM 6586  N N   . MET D 1 18  ? -28.683 12.442  -33.404 1.00 54.89  ? 18  MET D N   1 
ATOM 6587  C CA  . MET D 1 18  ? -27.943 11.746  -34.448 1.00 55.62  ? 18  MET D CA  1 
ATOM 6588  C C   . MET D 1 18  ? -28.443 10.302  -34.623 1.00 59.26  ? 18  MET D C   1 
ATOM 6589  O O   . MET D 1 18  ? -28.524 9.849   -35.765 1.00 59.30  ? 18  MET D O   1 
ATOM 6590  C CB  . MET D 1 18  ? -26.406 11.830  -34.267 1.00 58.43  ? 18  MET D CB  1 
ATOM 6591  C CG  . MET D 1 18  ? -25.772 10.788  -33.364 1.00 63.13  ? 18  MET D CG  1 
ATOM 6592  S SD  . MET D 1 18  ? -25.351 9.228   -34.213 1.00 67.33  ? 18  MET D SD  1 
ATOM 6593  C CE  . MET D 1 18  ? -24.326 8.480   -32.986 1.00 63.47  ? 18  MET D CE  1 
ATOM 6594  N N   . LEU D 1 19  ? -28.799 9.594   -33.532 1.00 54.87  ? 19  LEU D N   1 
ATOM 6595  C CA  . LEU D 1 19  ? -29.229 8.192   -33.665 1.00 54.27  ? 19  LEU D CA  1 
ATOM 6596  C C   . LEU D 1 19  ? -30.606 8.038   -34.330 1.00 60.88  ? 19  LEU D C   1 
ATOM 6597  O O   . LEU D 1 19  ? -30.824 7.041   -35.016 1.00 58.57  ? 19  LEU D O   1 
ATOM 6598  C CB  . LEU D 1 19  ? -29.196 7.453   -32.331 1.00 53.16  ? 19  LEU D CB  1 
ATOM 6599  C CG  . LEU D 1 19  ? -27.808 7.233   -31.733 1.00 54.92  ? 19  LEU D CG  1 
ATOM 6600  C CD1 . LEU D 1 19  ? -27.919 6.973   -30.247 1.00 54.34  ? 19  LEU D CD1 1 
ATOM 6601  C CD2 . LEU D 1 19  ? -27.062 6.113   -32.448 1.00 51.61  ? 19  LEU D CD2 1 
ATOM 6602  N N   . GLU D 1 20  ? -31.502 9.046   -34.174 1.00 61.66  ? 20  GLU D N   1 
ATOM 6603  C CA  . GLU D 1 20  ? -32.835 9.136   -34.803 1.00 63.02  ? 20  GLU D CA  1 
ATOM 6604  C C   . GLU D 1 20  ? -32.757 8.898   -36.330 1.00 67.68  ? 20  GLU D C   1 
ATOM 6605  O O   . GLU D 1 20  ? -33.565 8.140   -36.877 1.00 67.31  ? 20  GLU D O   1 
ATOM 6606  C CB  . GLU D 1 20  ? -33.400 10.541  -34.557 1.00 64.82  ? 20  GLU D CB  1 
ATOM 6607  C CG  . GLU D 1 20  ? -34.814 10.600  -34.016 1.00 80.76  ? 20  GLU D CG  1 
ATOM 6608  C CD  . GLU D 1 20  ? -35.193 11.958  -33.446 1.00 113.70 ? 20  GLU D CD  1 
ATOM 6609  O OE1 . GLU D 1 20  ? -34.531 12.967  -33.793 1.00 103.88 ? 20  GLU D OE1 1 
ATOM 6610  O OE2 . GLU D 1 20  ? -36.135 12.007  -32.620 1.00 114.40 ? 20  GLU D OE2 1 
ATOM 6611  N N   . LYS D 1 21  ? -31.757 9.540   -36.993 1.00 63.52  ? 21  LYS D N   1 
ATOM 6612  C CA  . LYS D 1 21  ? -31.493 9.473   -38.435 1.00 63.05  ? 21  LYS D CA  1 
ATOM 6613  C C   . LYS D 1 21  ? -30.859 8.157   -38.885 1.00 68.16  ? 21  LYS D C   1 
ATOM 6614  O O   . LYS D 1 21  ? -31.216 7.625   -39.931 1.00 68.58  ? 21  LYS D O   1 
ATOM 6615  C CB  . LYS D 1 21  ? -30.536 10.601  -38.882 1.00 64.33  ? 21  LYS D CB  1 
ATOM 6616  C CG  . LYS D 1 21  ? -30.746 11.993  -38.299 1.00 76.07  ? 21  LYS D CG  1 
ATOM 6617  C CD  . LYS D 1 21  ? -29.558 12.923  -38.668 1.00 83.75  ? 21  LYS D CD  1 
ATOM 6618  C CE  . LYS D 1 21  ? -29.557 14.225  -37.887 1.00 85.05  ? 21  LYS D CE  1 
ATOM 6619  N NZ  . LYS D 1 21  ? -28.177 14.712  -37.563 1.00 82.03  ? 21  LYS D NZ  1 
ATOM 6620  N N   . VAL D 1 22  ? -29.874 7.682   -38.116 1.00 65.16  ? 22  VAL D N   1 
ATOM 6621  C CA  . VAL D 1 22  ? -28.965 6.562   -38.384 1.00 64.53  ? 22  VAL D CA  1 
ATOM 6622  C C   . VAL D 1 22  ? -29.476 5.148   -37.971 1.00 67.93  ? 22  VAL D C   1 
ATOM 6623  O O   . VAL D 1 22  ? -29.284 4.227   -38.765 1.00 67.54  ? 22  VAL D O   1 
ATOM 6624  C CB  . VAL D 1 22  ? -27.639 6.911   -37.679 1.00 68.83  ? 22  VAL D CB  1 
ATOM 6625  C CG1 . VAL D 1 22  ? -26.670 5.752   -37.692 1.00 69.46  ? 22  VAL D CG1 1 
ATOM 6626  C CG2 . VAL D 1 22  ? -27.003 8.149   -38.311 1.00 68.46  ? 22  VAL D CG2 1 
ATOM 6627  N N   . LEU D 1 23  ? -30.122 4.969   -36.778 1.00 64.88  ? 23  LEU D N   1 
ATOM 6628  C CA  . LEU D 1 23  ? -30.618 3.662   -36.274 1.00 64.74  ? 23  LEU D CA  1 
ATOM 6629  C C   . LEU D 1 23  ? -31.382 2.790   -37.325 1.00 64.48  ? 23  LEU D C   1 
ATOM 6630  O O   . LEU D 1 23  ? -31.107 1.590   -37.353 1.00 62.60  ? 23  LEU D O   1 
ATOM 6631  C CB  . LEU D 1 23  ? -31.507 3.810   -35.015 1.00 65.49  ? 23  LEU D CB  1 
ATOM 6632  C CG  . LEU D 1 23  ? -30.810 4.198   -33.686 1.00 71.47  ? 23  LEU D CG  1 
ATOM 6633  C CD1 . LEU D 1 23  ? -31.827 4.543   -32.618 1.00 71.42  ? 23  LEU D CD1 1 
ATOM 6634  C CD2 . LEU D 1 23  ? -29.867 3.103   -33.176 1.00 74.59  ? 23  LEU D CD2 1 
ATOM 6635  N N   . PRO D 1 24  ? -32.275 3.316   -38.216 1.00 59.40  ? 24  PRO D N   1 
ATOM 6636  C CA  . PRO D 1 24  ? -32.977 2.416   -39.161 1.00 58.69  ? 24  PRO D CA  1 
ATOM 6637  C C   . PRO D 1 24  ? -32.061 1.677   -40.149 1.00 60.22  ? 24  PRO D C   1 
ATOM 6638  O O   . PRO D 1 24  ? -32.489 0.674   -40.724 1.00 59.41  ? 24  PRO D O   1 
ATOM 6639  C CB  . PRO D 1 24  ? -33.936 3.353   -39.897 1.00 60.50  ? 24  PRO D CB  1 
ATOM 6640  C CG  . PRO D 1 24  ? -34.122 4.510   -38.951 1.00 64.77  ? 24  PRO D CG  1 
ATOM 6641  C CD  . PRO D 1 24  ? -32.776 4.702   -38.353 1.00 60.41  ? 24  PRO D CD  1 
ATOM 6642  N N   . ALA D 1 25  ? -30.801 2.135   -40.306 1.00 54.20  ? 25  ALA D N   1 
ATOM 6643  C CA  . ALA D 1 25  ? -29.814 1.484   -41.160 1.00 52.42  ? 25  ALA D CA  1 
ATOM 6644  C C   . ALA D 1 25  ? -29.236 0.207   -40.489 1.00 54.64  ? 25  ALA D C   1 
ATOM 6645  O O   . ALA D 1 25  ? -28.699 -0.657  -41.183 1.00 54.13  ? 25  ALA D O   1 
ATOM 6646  C CB  . ALA D 1 25  ? -28.695 2.463   -41.510 1.00 52.85  ? 25  ALA D CB  1 
ATOM 6647  N N   . VAL D 1 26  ? -29.330 0.089   -39.148 1.00 51.08  ? 26  VAL D N   1 
ATOM 6648  C CA  . VAL D 1 26  ? -28.817 -1.098  -38.433 1.00 50.02  ? 26  VAL D CA  1 
ATOM 6649  C C   . VAL D 1 26  ? -29.972 -2.057  -38.281 1.00 53.11  ? 26  VAL D C   1 
ATOM 6650  O O   . VAL D 1 26  ? -31.047 -1.671  -37.797 1.00 53.53  ? 26  VAL D O   1 
ATOM 6651  C CB  . VAL D 1 26  ? -28.128 -0.783  -37.084 1.00 53.58  ? 26  VAL D CB  1 
ATOM 6652  C CG1 . VAL D 1 26  ? -27.415 -2.015  -36.532 1.00 53.49  ? 26  VAL D CG1 1 
ATOM 6653  C CG2 . VAL D 1 26  ? -27.142 0.372   -37.223 1.00 53.27  ? 26  VAL D CG2 1 
ATOM 6654  N N   . VAL D 1 27  ? -29.771 -3.293  -38.759 1.00 48.38  ? 27  VAL D N   1 
ATOM 6655  C CA  . VAL D 1 27  ? -30.803 -4.343  -38.790 1.00 46.75  ? 27  VAL D CA  1 
ATOM 6656  C C   . VAL D 1 27  ? -30.447 -5.559  -37.916 1.00 47.91  ? 27  VAL D C   1 
ATOM 6657  O O   . VAL D 1 27  ? -29.291 -5.753  -37.520 1.00 45.28  ? 27  VAL D O   1 
ATOM 6658  C CB  . VAL D 1 27  ? -31.091 -4.796  -40.255 1.00 49.62  ? 27  VAL D CB  1 
ATOM 6659  C CG1 . VAL D 1 27  ? -31.452 -3.596  -41.113 1.00 49.74  ? 27  VAL D CG1 1 
ATOM 6660  C CG2 . VAL D 1 27  ? -29.910 -5.564  -40.871 1.00 48.70  ? 27  VAL D CG2 1 
ATOM 6661  N N   . SER D 1 28  ? -31.469 -6.386  -37.681 1.00 45.06  ? 28  SER D N   1 
ATOM 6662  C CA  . SER D 1 28  ? -31.420 -7.649  -36.969 1.00 46.07  ? 28  SER D CA  1 
ATOM 6663  C C   . SER D 1 28  ? -31.363 -8.761  -38.020 1.00 54.20  ? 28  SER D C   1 
ATOM 6664  O O   . SER D 1 28  ? -32.126 -8.729  -38.985 1.00 55.09  ? 28  SER D O   1 
ATOM 6665  C CB  . SER D 1 28  ? -32.642 -7.773  -36.065 1.00 49.53  ? 28  SER D CB  1 
ATOM 6666  O OG  . SER D 1 28  ? -32.978 -9.121  -35.797 1.00 61.23  ? 28  SER D OG  1 
ATOM 6667  N N   . VAL D 1 29  ? -30.434 -9.705  -37.872 1.00 52.32  ? 29  VAL D N   1 
ATOM 6668  C CA  . VAL D 1 29  ? -30.259 -10.792 -38.829 1.00 52.59  ? 29  VAL D CA  1 
ATOM 6669  C C   . VAL D 1 29  ? -30.677 -12.099 -38.164 1.00 57.99  ? 29  VAL D C   1 
ATOM 6670  O O   . VAL D 1 29  ? -30.086 -12.512 -37.180 1.00 58.35  ? 29  VAL D O   1 
ATOM 6671  C CB  . VAL D 1 29  ? -28.803 -10.826 -39.380 1.00 56.44  ? 29  VAL D CB  1 
ATOM 6672  C CG1 . VAL D 1 29  ? -28.587 -12.021 -40.296 1.00 55.64  ? 29  VAL D CG1 1 
ATOM 6673  C CG2 . VAL D 1 29  ? -28.461 -9.522  -40.108 1.00 56.44  ? 29  VAL D CG2 1 
ATOM 6674  N N   . ARG D 1 30  ? -31.742 -12.701 -38.664 1.00 57.78  ? 30  ARG D N   1 
ATOM 6675  C CA  . ARG D 1 30  ? -32.302 -13.959 -38.157 1.00 58.38  ? 30  ARG D CA  1 
ATOM 6676  C C   . ARG D 1 30  ? -31.948 -15.043 -39.145 1.00 61.69  ? 30  ARG D C   1 
ATOM 6677  O O   . ARG D 1 30  ? -32.127 -14.881 -40.364 1.00 60.95  ? 30  ARG D O   1 
ATOM 6678  C CB  . ARG D 1 30  ? -33.823 -13.839 -37.934 1.00 61.41  ? 30  ARG D CB  1 
ATOM 6679  C CG  . ARG D 1 30  ? -34.413 -14.940 -37.058 1.00 81.39  ? 30  ARG D CG  1 
ATOM 6680  C CD  . ARG D 1 30  ? -35.929 -14.941 -37.155 1.00 106.08 ? 30  ARG D CD  1 
ATOM 6681  N NE  . ARG D 1 30  ? -36.539 -16.012 -36.364 1.00 123.66 ? 30  ARG D NE  1 
ATOM 6682  C CZ  . ARG D 1 30  ? -37.851 -16.206 -36.249 1.00 137.24 ? 30  ARG D CZ  1 
ATOM 6683  N NH1 . ARG D 1 30  ? -38.705 -15.409 -36.882 1.00 118.77 ? 30  ARG D NH1 1 
ATOM 6684  N NH2 . ARG D 1 30  ? -38.319 -17.201 -35.504 1.00 123.62 ? 30  ARG D NH2 1 
ATOM 6685  N N   . VAL D 1 31  ? -31.396 -16.130 -38.619 1.00 58.42  ? 31  VAL D N   1 
ATOM 6686  C CA  . VAL D 1 31  ? -30.875 -17.220 -39.428 1.00 58.21  ? 31  VAL D CA  1 
ATOM 6687  C C   . VAL D 1 31  ? -31.481 -18.572 -38.976 1.00 64.12  ? 31  VAL D C   1 
ATOM 6688  O O   . VAL D 1 31  ? -31.689 -18.807 -37.784 1.00 61.91  ? 31  VAL D O   1 
ATOM 6689  C CB  . VAL D 1 31  ? -29.309 -17.160 -39.331 1.00 60.85  ? 31  VAL D CB  1 
ATOM 6690  C CG1 . VAL D 1 31  ? -28.647 -18.539 -39.352 1.00 60.97  ? 31  VAL D CG1 1 
ATOM 6691  C CG2 . VAL D 1 31  ? -28.719 -16.237 -40.401 1.00 59.73  ? 31  VAL D CG2 1 
ATOM 6692  N N   . GLU D 1 32  ? -31.779 -19.436 -39.966 1.00 63.42  ? 32  GLU D N   1 
ATOM 6693  C CA  . GLU D 1 32  ? -32.300 -20.790 -39.788 1.00 63.93  ? 32  GLU D CA  1 
ATOM 6694  C C   . GLU D 1 32  ? -31.470 -21.740 -40.621 1.00 71.02  ? 32  GLU D C   1 
ATOM 6695  O O   . GLU D 1 32  ? -31.202 -21.447 -41.785 1.00 70.96  ? 32  GLU D O   1 
ATOM 6696  C CB  . GLU D 1 32  ? -33.780 -20.875 -40.193 1.00 65.27  ? 32  GLU D CB  1 
ATOM 6697  C CG  . GLU D 1 32  ? -34.733 -20.246 -39.197 1.00 78.90  ? 32  GLU D CG  1 
ATOM 6698  C CD  . GLU D 1 32  ? -36.197 -20.535 -39.452 1.00 114.17 ? 32  GLU D CD  1 
ATOM 6699  O OE1 . GLU D 1 32  ? -36.711 -20.125 -40.519 1.00 115.10 ? 32  GLU D OE1 1 
ATOM 6700  O OE2 . GLU D 1 32  ? -36.840 -21.148 -38.568 1.00 115.73 ? 32  GLU D OE2 1 
ATOM 6701  N N   . GLY D 1 33  ? -31.067 -22.861 -40.038 1.00 70.40  ? 33  GLY D N   1 
ATOM 6702  C CA  . GLY D 1 33  ? -30.277 -23.851 -40.759 1.00 71.65  ? 33  GLY D CA  1 
ATOM 6703  C C   . GLY D 1 33  ? -30.298 -25.241 -40.158 1.00 79.66  ? 33  GLY D C   1 
ATOM 6704  O O   . GLY D 1 33  ? -31.312 -25.664 -39.592 1.00 79.13  ? 33  GLY D O   1 
ATOM 6705  N N   . THR D 1 34  ? -29.153 -25.954 -40.281 1.00 78.85  ? 34  THR D N   1 
ATOM 6706  C CA  . THR D 1 34  ? -28.940 -27.317 -39.783 1.00 118.12 ? 34  THR D CA  1 
ATOM 6707  C C   . THR D 1 34  ? -27.737 -27.343 -38.821 1.00 132.98 ? 34  THR D C   1 
ATOM 6708  O O   . THR D 1 34  ? -27.379 -28.389 -38.279 1.00 92.82  ? 34  THR D O   1 
ATOM 6709  C CB  . THR D 1 34  ? -28.767 -28.292 -40.964 1.00 129.35 ? 34  THR D CB  1 
ATOM 6710  O OG1 . THR D 1 34  ? -28.771 -29.625 -40.457 1.00 130.57 ? 34  THR D OG1 1 
ATOM 6711  C CG2 . THR D 1 34  ? -27.479 -28.038 -41.780 1.00 128.33 ? 34  THR D CG2 1 
ATOM 6712  N N   . GLN D 1 59  ? -29.537 -31.430 -37.319 1.00 97.85  ? 59  GLN D N   1 
ATOM 6713  C CA  . GLN D 1 59  ? -30.571 -30.904 -36.425 1.00 97.66  ? 59  GLN D CA  1 
ATOM 6714  C C   . GLN D 1 59  ? -30.825 -29.394 -36.687 1.00 98.51  ? 59  GLN D C   1 
ATOM 6715  O O   . GLN D 1 59  ? -29.859 -28.624 -36.756 1.00 97.20  ? 59  GLN D O   1 
ATOM 6716  C CB  . GLN D 1 59  ? -30.202 -31.144 -34.942 1.00 99.49  ? 59  GLN D CB  1 
ATOM 6717  C CG  . GLN D 1 59  ? -31.395 -31.019 -33.980 1.00 118.13 ? 59  GLN D CG  1 
ATOM 6718  C CD  . GLN D 1 59  ? -30.992 -30.854 -32.537 1.00 139.11 ? 59  GLN D CD  1 
ATOM 6719  O OE1 . GLN D 1 59  ? -31.007 -31.808 -31.754 1.00 133.28 ? 59  GLN D OE1 1 
ATOM 6720  N NE2 . GLN D 1 59  ? -30.679 -29.626 -32.140 1.00 132.56 ? 59  GLN D NE2 1 
ATOM 6721  N N   . PRO D 1 60  ? -32.114 -28.957 -36.804 1.00 93.29  ? 60  PRO D N   1 
ATOM 6722  C CA  . PRO D 1 60  ? -32.391 -27.528 -37.061 1.00 92.04  ? 60  PRO D CA  1 
ATOM 6723  C C   . PRO D 1 60  ? -32.001 -26.585 -35.915 1.00 91.21  ? 60  PRO D C   1 
ATOM 6724  O O   . PRO D 1 60  ? -32.056 -26.954 -34.734 1.00 90.30  ? 60  PRO D O   1 
ATOM 6725  C CB  . PRO D 1 60  ? -33.914 -27.488 -37.280 1.00 93.99  ? 60  PRO D CB  1 
ATOM 6726  C CG  . PRO D 1 60  ? -34.332 -28.899 -37.515 1.00 98.51  ? 60  PRO D CG  1 
ATOM 6727  C CD  . PRO D 1 60  ? -33.371 -29.739 -36.753 1.00 94.25  ? 60  PRO D CD  1 
ATOM 6728  N N   . PHE D 1 61  ? -31.616 -25.350 -36.288 1.00 84.71  ? 61  PHE D N   1 
ATOM 6729  C CA  . PHE D 1 61  ? -31.227 -24.297 -35.351 1.00 83.11  ? 61  PHE D CA  1 
ATOM 6730  C C   . PHE D 1 61  ? -31.753 -22.911 -35.800 1.00 84.96  ? 61  PHE D C   1 
ATOM 6731  O O   . PHE D 1 61  ? -32.027 -22.688 -36.987 1.00 83.93  ? 61  PHE D O   1 
ATOM 6732  C CB  . PHE D 1 61  ? -29.690 -24.259 -35.164 1.00 84.40  ? 61  PHE D CB  1 
ATOM 6733  C CG  . PHE D 1 61  ? -28.911 -23.578 -36.269 1.00 85.59  ? 61  PHE D CG  1 
ATOM 6734  C CD1 . PHE D 1 61  ? -28.675 -22.205 -36.233 1.00 88.49  ? 61  PHE D CD1 1 
ATOM 6735  C CD2 . PHE D 1 61  ? -28.410 -24.307 -37.341 1.00 87.58  ? 61  PHE D CD2 1 
ATOM 6736  C CE1 . PHE D 1 61  ? -27.981 -21.570 -37.268 1.00 89.48  ? 61  PHE D CE1 1 
ATOM 6737  C CE2 . PHE D 1 61  ? -27.691 -23.675 -38.365 1.00 90.54  ? 61  PHE D CE2 1 
ATOM 6738  C CZ  . PHE D 1 61  ? -27.491 -22.309 -38.328 1.00 88.76  ? 61  PHE D CZ  1 
ATOM 6739  N N   . GLU D 1 62  ? -31.829 -21.980 -34.835 1.00 80.25  ? 62  GLU D N   1 
ATOM 6740  C CA  . GLU D 1 62  ? -32.214 -20.589 -35.031 1.00 79.47  ? 62  GLU D CA  1 
ATOM 6741  C C   . GLU D 1 62  ? -31.152 -19.695 -34.394 1.00 81.21  ? 62  GLU D C   1 
ATOM 6742  O O   . GLU D 1 62  ? -30.930 -19.763 -33.182 1.00 80.80  ? 62  GLU D O   1 
ATOM 6743  C CB  . GLU D 1 62  ? -33.616 -20.296 -34.472 1.00 81.18  ? 62  GLU D CB  1 
ATOM 6744  C CG  . GLU D 1 62  ? -34.730 -20.498 -35.492 1.00 98.68  ? 62  GLU D CG  1 
ATOM 6745  C CD  . GLU D 1 62  ? -36.162 -20.307 -35.013 1.00 131.90 ? 62  GLU D CD  1 
ATOM 6746  O OE1 . GLU D 1 62  ? -36.428 -19.323 -34.284 1.00 136.37 ? 62  GLU D OE1 1 
ATOM 6747  O OE2 . GLU D 1 62  ? -37.031 -21.114 -35.418 1.00 126.63 ? 62  GLU D OE2 1 
ATOM 6748  N N   . GLY D 1 63  ? -30.472 -18.912 -35.231 1.00 76.02  ? 63  GLY D N   1 
ATOM 6749  C CA  . GLY D 1 63  ? -29.433 -17.976 -34.812 1.00 74.58  ? 63  GLY D CA  1 
ATOM 6750  C C   . GLY D 1 63  ? -29.848 -16.519 -34.943 1.00 75.54  ? 63  GLY D C   1 
ATOM 6751  O O   . GLY D 1 63  ? -30.677 -16.172 -35.787 1.00 75.71  ? 63  GLY D O   1 
ATOM 6752  N N   . LEU D 1 64  ? -29.275 -15.651 -34.109 1.00 69.66  ? 64  LEU D N   1 
ATOM 6753  C CA  . LEU D 1 64  ? -29.585 -14.234 -34.173 1.00 68.46  ? 64  LEU D CA  1 
ATOM 6754  C C   . LEU D 1 64  ? -28.339 -13.359 -34.055 1.00 68.55  ? 64  LEU D C   1 
ATOM 6755  O O   . LEU D 1 64  ? -27.487 -13.587 -33.199 1.00 69.31  ? 64  LEU D O   1 
ATOM 6756  C CB  . LEU D 1 64  ? -30.604 -13.842 -33.114 1.00 69.08  ? 64  LEU D CB  1 
ATOM 6757  C CG  . LEU D 1 64  ? -31.672 -12.893 -33.641 1.00 76.02  ? 64  LEU D CG  1 
ATOM 6758  C CD1 . LEU D 1 64  ? -33.057 -13.335 -33.205 1.00 76.82  ? 64  LEU D CD1 1 
ATOM 6759  C CD2 . LEU D 1 64  ? -31.357 -11.404 -33.300 1.00 79.40  ? 64  LEU D CD2 1 
ATOM 6760  N N   . GLY D 1 65  ? -28.256 -12.373 -34.939 1.00 61.05  ? 65  GLY D N   1 
ATOM 6761  C CA  . GLY D 1 65  ? -27.181 -11.396 -34.983 1.00 58.96  ? 65  GLY D CA  1 
ATOM 6762  C C   . GLY D 1 65  ? -27.677 -10.049 -35.450 1.00 60.05  ? 65  GLY D C   1 
ATOM 6763  O O   . GLY D 1 65  ? -28.871 -9.740  -35.350 1.00 60.62  ? 65  GLY D O   1 
ATOM 6764  N N   . SER D 1 66  ? -26.756 -9.248  -35.976 1.00 54.32  ? 66  SER D N   1 
ATOM 6765  C CA  . SER D 1 66  ? -27.004 -7.906  -36.489 1.00 52.46  ? 66  SER D CA  1 
ATOM 6766  C C   . SER D 1 66  ? -26.419 -7.726  -37.897 1.00 57.72  ? 66  SER D C   1 
ATOM 6767  O O   . SER D 1 66  ? -25.653 -8.573  -38.377 1.00 57.30  ? 66  SER D O   1 
ATOM 6768  C CB  . SER D 1 66  ? -26.391 -6.879  -35.545 1.00 51.97  ? 66  SER D CB  1 
ATOM 6769  O OG  . SER D 1 66  ? -27.145 -6.724  -34.362 1.00 51.62  ? 66  SER D OG  1 
ATOM 6770  N N   . GLY D 1 67  ? -26.788 -6.611  -38.530 1.00 55.20  ? 67  GLY D N   1 
ATOM 6771  C CA  . GLY D 1 67  ? -26.322 -6.201  -39.850 1.00 54.33  ? 67  GLY D CA  1 
ATOM 6772  C C   . GLY D 1 67  ? -26.396 -4.702  -40.062 1.00 55.18  ? 67  GLY D C   1 
ATOM 6773  O O   . GLY D 1 67  ? -27.044 -3.984  -39.295 1.00 51.30  ? 67  GLY D O   1 
ATOM 6774  N N   . VAL D 1 68  ? -25.719 -4.224  -41.124 1.00 53.60  ? 68  VAL D N   1 
ATOM 6775  C CA  . VAL D 1 68  ? -25.690 -2.797  -41.494 1.00 53.48  ? 68  VAL D CA  1 
ATOM 6776  C C   . VAL D 1 68  ? -26.037 -2.637  -42.983 1.00 57.58  ? 68  VAL D C   1 
ATOM 6777  O O   . VAL D 1 68  ? -25.373 -3.242  -43.835 1.00 56.91  ? 68  VAL D O   1 
ATOM 6778  C CB  . VAL D 1 68  ? -24.334 -2.105  -41.155 1.00 56.09  ? 68  VAL D CB  1 
ATOM 6779  C CG1 . VAL D 1 68  ? -24.401 -0.609  -41.416 1.00 55.65  ? 68  VAL D CG1 1 
ATOM 6780  C CG2 . VAL D 1 68  ? -23.942 -2.348  -39.708 1.00 55.46  ? 68  VAL D CG2 1 
ATOM 6781  N N   . ILE D 1 69  ? -27.071 -1.805  -43.284 1.00 54.65  ? 69  ILE D N   1 
ATOM 6782  C CA  . ILE D 1 69  ? -27.482 -1.499  -44.660 1.00 54.66  ? 69  ILE D CA  1 
ATOM 6783  C C   . ILE D 1 69  ? -26.446 -0.533  -45.219 1.00 59.58  ? 69  ILE D C   1 
ATOM 6784  O O   . ILE D 1 69  ? -26.303 0.600   -44.753 1.00 58.46  ? 69  ILE D O   1 
ATOM 6785  C CB  . ILE D 1 69  ? -28.935 -0.985  -44.835 1.00 57.20  ? 69  ILE D CB  1 
ATOM 6786  C CG1 . ILE D 1 69  ? -29.971 -1.996  -44.292 1.00 56.48  ? 69  ILE D CG1 1 
ATOM 6787  C CG2 . ILE D 1 69  ? -29.210 -0.652  -46.325 1.00 57.72  ? 69  ILE D CG2 1 
ATOM 6788  C CD1 . ILE D 1 69  ? -31.329 -1.373  -44.000 1.00 51.29  ? 69  ILE D CD1 1 
ATOM 6789  N N   . ILE D 1 70  ? -25.701 -1.034  -46.199 1.00 57.97  ? 70  ILE D N   1 
ATOM 6790  C CA  . ILE D 1 70  ? -24.598 -0.345  -46.827 1.00 58.93  ? 70  ILE D CA  1 
ATOM 6791  C C   . ILE D 1 70  ? -25.073 0.323   -48.138 1.00 64.93  ? 70  ILE D C   1 
ATOM 6792  O O   . ILE D 1 70  ? -24.539 1.369   -48.501 1.00 65.96  ? 70  ILE D O   1 
ATOM 6793  C CB  . ILE D 1 70  ? -23.446 -1.379  -46.977 1.00 62.12  ? 70  ILE D CB  1 
ATOM 6794  C CG1 . ILE D 1 70  ? -22.122 -0.840  -46.473 1.00 63.32  ? 70  ILE D CG1 1 
ATOM 6795  C CG2 . ILE D 1 70  ? -23.379 -2.133  -48.310 1.00 62.02  ? 70  ILE D CG2 1 
ATOM 6796  C CD1 . ILE D 1 70  ? -20.826 -1.463  -47.154 1.00 79.55  ? 70  ILE D CD1 1 
ATOM 6797  N N   . ASN D 1 71  ? -26.114 -0.249  -48.793 1.00 61.24  ? 71  ASN D N   1 
ATOM 6798  C CA  . ASN D 1 71  ? -26.750 0.250   -50.016 1.00 60.55  ? 71  ASN D CA  1 
ATOM 6799  C C   . ASN D 1 71  ? -28.260 0.035   -49.938 1.00 63.31  ? 71  ASN D C   1 
ATOM 6800  O O   . ASN D 1 71  ? -28.735 -1.087  -50.153 1.00 61.20  ? 71  ASN D O   1 
ATOM 6801  C CB  . ASN D 1 71  ? -26.172 -0.431  -51.274 1.00 63.14  ? 71  ASN D CB  1 
ATOM 6802  C CG  . ASN D 1 71  ? -26.605 0.175   -52.601 1.00 76.06  ? 71  ASN D CG  1 
ATOM 6803  O OD1 . ASN D 1 71  ? -27.768 0.558   -52.823 1.00 69.41  ? 71  ASN D OD1 1 
ATOM 6804  N ND2 . ASN D 1 71  ? -25.679 0.230   -53.535 1.00 62.84  ? 71  ASN D ND2 1 
ATOM 6805  N N   . ALA D 1 72  ? -29.007 1.127   -49.670 1.00 61.24  ? 72  ALA D N   1 
ATOM 6806  C CA  . ALA D 1 72  ? -30.472 1.150   -49.549 1.00 61.51  ? 72  ALA D CA  1 
ATOM 6807  C C   . ALA D 1 72  ? -31.188 0.736   -50.854 1.00 68.87  ? 72  ALA D C   1 
ATOM 6808  O O   . ALA D 1 72  ? -32.181 0.004   -50.783 1.00 69.07  ? 72  ALA D O   1 
ATOM 6809  C CB  . ALA D 1 72  ? -30.936 2.535   -49.117 1.00 61.76  ? 72  ALA D CB  1 
ATOM 6810  N N   . SER D 1 73  ? -30.682 1.193   -52.034 1.00 67.56  ? 73  SER D N   1 
ATOM 6811  C CA  . SER D 1 73  ? -31.265 0.912   -53.361 1.00 68.53  ? 73  SER D CA  1 
ATOM 6812  C C   . SER D 1 73  ? -31.211 -0.587  -53.711 1.00 70.18  ? 73  SER D C   1 
ATOM 6813  O O   . SER D 1 73  ? -32.232 -1.165  -54.100 1.00 68.46  ? 73  SER D O   1 
ATOM 6814  C CB  . SER D 1 73  ? -30.559 1.720   -54.454 1.00 74.56  ? 73  SER D CB  1 
ATOM 6815  O OG  . SER D 1 73  ? -30.198 3.028   -54.035 1.00 87.24  ? 73  SER D OG  1 
ATOM 6816  N N   . LYS D 1 74  ? -30.024 -1.205  -53.554 1.00 66.09  ? 74  LYS D N   1 
ATOM 6817  C CA  . LYS D 1 74  ? -29.789 -2.617  -53.879 1.00 65.31  ? 74  LYS D CA  1 
ATOM 6818  C C   . LYS D 1 74  ? -30.127 -3.563  -52.708 1.00 64.73  ? 74  LYS D C   1 
ATOM 6819  O O   . LYS D 1 74  ? -30.233 -4.777  -52.913 1.00 60.24  ? 74  LYS D O   1 
ATOM 6820  C CB  . LYS D 1 74  ? -28.327 -2.819  -54.309 1.00 68.55  ? 74  LYS D CB  1 
ATOM 6821  C CG  . LYS D 1 74  ? -27.886 -1.969  -55.494 1.00 84.82  ? 74  LYS D CG  1 
ATOM 6822  C CD  . LYS D 1 74  ? -28.026 -2.727  -56.812 1.00 97.10  ? 74  LYS D CD  1 
ATOM 6823  C CE  . LYS D 1 74  ? -27.549 -1.920  -57.997 1.00 110.54 ? 74  LYS D CE  1 
ATOM 6824  N NZ  . LYS D 1 74  ? -26.072 -1.748  -58.002 1.00 121.57 ? 74  LYS D NZ  1 
ATOM 6825  N N   . GLY D 1 75  ? -30.289 -2.993  -51.510 1.00 62.39  ? 75  GLY D N   1 
ATOM 6826  C CA  . GLY D 1 75  ? -30.576 -3.743  -50.294 1.00 62.73  ? 75  GLY D CA  1 
ATOM 6827  C C   . GLY D 1 75  ? -29.376 -4.542  -49.817 1.00 68.06  ? 75  GLY D C   1 
ATOM 6828  O O   . GLY D 1 75  ? -29.540 -5.666  -49.339 1.00 67.69  ? 75  GLY D O   1 
ATOM 6829  N N   . TYR D 1 76  ? -28.155 -3.969  -49.955 1.00 64.55  ? 76  TYR D N   1 
ATOM 6830  C CA  . TYR D 1 76  ? -26.910 -4.621  -49.545 1.00 63.59  ? 76  TYR D CA  1 
ATOM 6831  C C   . TYR D 1 76  ? -26.671 -4.458  -48.024 1.00 65.04  ? 76  TYR D C   1 
ATOM 6832  O O   . TYR D 1 76  ? -26.550 -3.326  -47.510 1.00 63.24  ? 76  TYR D O   1 
ATOM 6833  C CB  . TYR D 1 76  ? -25.699 -4.101  -50.349 1.00 65.04  ? 76  TYR D CB  1 
ATOM 6834  C CG  . TYR D 1 76  ? -25.628 -4.518  -51.803 1.00 66.66  ? 76  TYR D CG  1 
ATOM 6835  C CD1 . TYR D 1 76  ? -25.104 -3.664  -52.768 1.00 69.25  ? 76  TYR D CD1 1 
ATOM 6836  C CD2 . TYR D 1 76  ? -26.013 -5.793  -52.202 1.00 67.11  ? 76  TYR D CD2 1 
ATOM 6837  C CE1 . TYR D 1 76  ? -24.998 -4.057  -54.104 1.00 70.92  ? 76  TYR D CE1 1 
ATOM 6838  C CE2 . TYR D 1 76  ? -25.919 -6.194  -53.532 1.00 67.96  ? 76  TYR D CE2 1 
ATOM 6839  C CZ  . TYR D 1 76  ? -25.421 -5.318  -54.483 1.00 75.95  ? 76  TYR D CZ  1 
ATOM 6840  O OH  . TYR D 1 76  ? -25.329 -5.694  -55.799 1.00 77.89  ? 76  TYR D OH  1 
ATOM 6841  N N   . VAL D 1 77  ? -26.589 -5.623  -47.323 1.00 59.55  ? 77  VAL D N   1 
ATOM 6842  C CA  . VAL D 1 77  ? -26.377 -5.713  -45.875 1.00 57.68  ? 77  VAL D CA  1 
ATOM 6843  C C   . VAL D 1 77  ? -25.009 -6.337  -45.563 1.00 59.32  ? 77  VAL D C   1 
ATOM 6844  O O   . VAL D 1 77  ? -24.735 -7.455  -45.994 1.00 57.26  ? 77  VAL D O   1 
ATOM 6845  C CB  . VAL D 1 77  ? -27.519 -6.499  -45.160 1.00 60.27  ? 77  VAL D CB  1 
ATOM 6846  C CG1 . VAL D 1 77  ? -27.280 -6.576  -43.654 1.00 59.47  ? 77  VAL D CG1 1 
ATOM 6847  C CG2 . VAL D 1 77  ? -28.880 -5.871  -45.437 1.00 59.97  ? 77  VAL D CG2 1 
ATOM 6848  N N   . LEU D 1 78  ? -24.178 -5.604  -44.789 1.00 56.54  ? 78  LEU D N   1 
ATOM 6849  C CA  . LEU D 1 78  ? -22.891 -6.068  -44.249 1.00 57.27  ? 78  LEU D CA  1 
ATOM 6850  C C   . LEU D 1 78  ? -23.120 -6.762  -42.894 1.00 64.27  ? 78  LEU D C   1 
ATOM 6851  O O   . LEU D 1 78  ? -23.778 -6.196  -42.010 1.00 65.45  ? 78  LEU D O   1 
ATOM 6852  C CB  . LEU D 1 78  ? -21.895 -4.900  -44.053 1.00 56.42  ? 78  LEU D CB  1 
ATOM 6853  C CG  . LEU D 1 78  ? -20.692 -4.802  -44.992 1.00 58.17  ? 78  LEU D CG  1 
ATOM 6854  C CD1 . LEU D 1 78  ? -19.806 -3.681  -44.562 1.00 57.30  ? 78  LEU D CD1 1 
ATOM 6855  C CD2 . LEU D 1 78  ? -19.875 -6.085  -45.018 1.00 56.68  ? 78  LEU D CD2 1 
ATOM 6856  N N   . THR D 1 79  ? -22.602 -7.982  -42.743 1.00 59.74  ? 79  THR D N   1 
ATOM 6857  C CA  . THR D 1 79  ? -22.729 -8.749  -41.506 1.00 58.92  ? 79  THR D CA  1 
ATOM 6858  C C   . THR D 1 79  ? -21.430 -9.549  -41.315 1.00 61.63  ? 79  THR D C   1 
ATOM 6859  O O   . THR D 1 79  ? -20.489 -9.366  -42.080 1.00 60.52  ? 79  THR D O   1 
ATOM 6860  C CB  . THR D 1 79  ? -24.030 -9.617  -41.505 1.00 61.81  ? 79  THR D CB  1 
ATOM 6861  O OG1 . THR D 1 79  ? -24.248 -10.145 -40.193 1.00 59.30  ? 79  THR D OG1 1 
ATOM 6862  C CG2 . THR D 1 79  ? -24.007 -10.755 -42.522 1.00 57.74  ? 79  THR D CG2 1 
ATOM 6863  N N   . ASN D 1 80  ? -21.363 -10.390 -40.268 1.00 57.69  ? 80  ASN D N   1 
ATOM 6864  C CA  . ASN D 1 80  ? -20.193 -11.219 -40.019 1.00 56.45  ? 80  ASN D CA  1 
ATOM 6865  C C   . ASN D 1 80  ? -20.448 -12.545 -40.644 1.00 60.38  ? 80  ASN D C   1 
ATOM 6866  O O   . ASN D 1 80  ? -21.600 -12.956 -40.694 1.00 61.77  ? 80  ASN D O   1 
ATOM 6867  C CB  . ASN D 1 80  ? -19.897 -11.368 -38.518 1.00 52.52  ? 80  ASN D CB  1 
ATOM 6868  C CG  . ASN D 1 80  ? -19.200 -10.204 -37.838 1.00 67.01  ? 80  ASN D CG  1 
ATOM 6869  O OD1 . ASN D 1 80  ? -19.453 -9.938  -36.667 1.00 52.44  ? 80  ASN D OD1 1 
ATOM 6870  N ND2 . ASN D 1 80  ? -18.261 -9.525  -38.507 1.00 58.81  ? 80  ASN D ND2 1 
ATOM 6871  N N   . ASN D 1 81  ? -19.404 -13.223 -41.121 1.00 55.94  ? 81  ASN D N   1 
ATOM 6872  C CA  . ASN D 1 81  ? -19.529 -14.543 -41.729 1.00 55.88  ? 81  ASN D CA  1 
ATOM 6873  C C   . ASN D 1 81  ? -20.046 -15.578 -40.708 1.00 60.23  ? 81  ASN D C   1 
ATOM 6874  O O   . ASN D 1 81  ? -20.916 -16.381 -41.053 1.00 61.21  ? 81  ASN D O   1 
ATOM 6875  C CB  . ASN D 1 81  ? -18.186 -14.981 -42.319 1.00 56.52  ? 81  ASN D CB  1 
ATOM 6876  C CG  . ASN D 1 81  ? -18.196 -16.356 -42.916 1.00 69.36  ? 81  ASN D CG  1 
ATOM 6877  O OD1 . ASN D 1 81  ? -18.934 -16.637 -43.856 1.00 64.37  ? 81  ASN D OD1 1 
ATOM 6878  N ND2 . ASN D 1 81  ? -17.384 -17.243 -42.373 1.00 64.06  ? 81  ASN D ND2 1 
ATOM 6879  N N   . HIS D 1 82  ? -19.566 -15.521 -39.449 1.00 56.34  ? 82  HIS D N   1 
ATOM 6880  C CA  . HIS D 1 82  ? -19.954 -16.479 -38.405 1.00 55.82  ? 82  HIS D CA  1 
ATOM 6881  C C   . HIS D 1 82  ? -21.458 -16.405 -38.044 1.00 58.77  ? 82  HIS D C   1 
ATOM 6882  O O   . HIS D 1 82  ? -21.995 -17.374 -37.496 1.00 57.41  ? 82  HIS D O   1 
ATOM 6883  C CB  . HIS D 1 82  ? -19.067 -16.343 -37.152 1.00 56.59  ? 82  HIS D CB  1 
ATOM 6884  C CG  . HIS D 1 82  ? -19.275 -15.097 -36.349 1.00 59.98  ? 82  HIS D CG  1 
ATOM 6885  N ND1 . HIS D 1 82  ? -18.369 -14.063 -36.387 1.00 61.82  ? 82  HIS D ND1 1 
ATOM 6886  C CD2 . HIS D 1 82  ? -20.245 -14.791 -35.459 1.00 61.60  ? 82  HIS D CD2 1 
ATOM 6887  C CE1 . HIS D 1 82  ? -18.824 -13.150 -35.545 1.00 61.18  ? 82  HIS D CE1 1 
ATOM 6888  N NE2 . HIS D 1 82  ? -19.961 -13.536 -34.980 1.00 61.41  ? 82  HIS D NE2 1 
ATOM 6889  N N   . VAL D 1 83  ? -22.131 -15.287 -38.390 1.00 55.62  ? 83  VAL D N   1 
ATOM 6890  C CA  . VAL D 1 83  ? -23.576 -15.081 -38.179 1.00 54.91  ? 83  VAL D CA  1 
ATOM 6891  C C   . VAL D 1 83  ? -24.348 -15.933 -39.186 1.00 62.46  ? 83  VAL D C   1 
ATOM 6892  O O   . VAL D 1 83  ? -25.358 -16.547 -38.854 1.00 62.74  ? 83  VAL D O   1 
ATOM 6893  C CB  . VAL D 1 83  ? -23.965 -13.570 -38.307 1.00 56.95  ? 83  VAL D CB  1 
ATOM 6894  C CG1 . VAL D 1 83  ? -25.474 -13.346 -38.204 1.00 56.22  ? 83  VAL D CG1 1 
ATOM 6895  C CG2 . VAL D 1 83  ? -23.237 -12.719 -37.287 1.00 56.69  ? 83  VAL D CG2 1 
ATOM 6896  N N   . ILE D 1 84  ? -23.827 -15.994 -40.400 1.00 62.73  ? 84  ILE D N   1 
ATOM 6897  C CA  . ILE D 1 84  ? -24.428 -16.574 -41.582 1.00 64.81  ? 84  ILE D CA  1 
ATOM 6898  C C   . ILE D 1 84  ? -23.906 -17.970 -41.965 1.00 74.85  ? 84  ILE D C   1 
ATOM 6899  O O   . ILE D 1 84  ? -24.542 -18.644 -42.772 1.00 74.75  ? 84  ILE D O   1 
ATOM 6900  C CB  . ILE D 1 84  ? -24.118 -15.497 -42.666 1.00 67.96  ? 84  ILE D CB  1 
ATOM 6901  C CG1 . ILE D 1 84  ? -25.378 -14.832 -43.168 1.00 69.17  ? 84  ILE D CG1 1 
ATOM 6902  C CG2 . ILE D 1 84  ? -23.087 -15.865 -43.761 1.00 67.28  ? 84  ILE D CG2 1 
ATOM 6903  C CD1 . ILE D 1 84  ? -26.038 -13.945 -42.153 1.00 77.77  ? 84  ILE D CD1 1 
ATOM 6904  N N   . ASN D 1 85  ? -22.766 -18.388 -41.391 1.00 75.44  ? 85  ASN D N   1 
ATOM 6905  C CA  . ASN D 1 85  ? -22.027 -19.627 -41.653 1.00 76.90  ? 85  ASN D CA  1 
ATOM 6906  C C   . ASN D 1 85  ? -22.867 -20.869 -42.052 1.00 83.04  ? 85  ASN D C   1 
ATOM 6907  O O   . ASN D 1 85  ? -22.577 -21.461 -43.089 1.00 83.27  ? 85  ASN D O   1 
ATOM 6908  C CB  . ASN D 1 85  ? -21.174 -19.990 -40.445 1.00 81.51  ? 85  ASN D CB  1 
ATOM 6909  C CG  . ASN D 1 85  ? -19.714 -20.142 -40.774 1.00 115.35 ? 85  ASN D CG  1 
ATOM 6910  O OD1 . ASN D 1 85  ? -19.340 -20.544 -41.886 1.00 109.27 ? 85  ASN D OD1 1 
ATOM 6911  N ND2 . ASN D 1 85  ? -18.853 -19.830 -39.808 1.00 110.08 ? 85  ASN D ND2 1 
ATOM 6912  N N   . GLN D 1 86  ? -23.862 -21.278 -41.250 1.00 80.41  ? 86  GLN D N   1 
ATOM 6913  C CA  . GLN D 1 86  ? -24.605 -22.509 -41.552 1.00 81.44  ? 86  GLN D CA  1 
ATOM 6914  C C   . GLN D 1 86  ? -26.065 -22.246 -42.004 1.00 85.03  ? 86  GLN D C   1 
ATOM 6915  O O   . GLN D 1 86  ? -26.878 -23.188 -42.058 1.00 84.84  ? 86  GLN D O   1 
ATOM 6916  C CB  . GLN D 1 86  ? -24.594 -23.444 -40.314 1.00 83.63  ? 86  GLN D CB  1 
ATOM 6917  C CG  . GLN D 1 86  ? -23.195 -23.814 -39.784 1.00 112.68 ? 86  GLN D CG  1 
ATOM 6918  C CD  . GLN D 1 86  ? -22.921 -23.261 -38.395 1.00 143.77 ? 86  GLN D CD  1 
ATOM 6919  O OE1 . GLN D 1 86  ? -22.857 -22.046 -38.176 1.00 142.31 ? 86  GLN D OE1 1 
ATOM 6920  N NE2 . GLN D 1 86  ? -22.707 -24.144 -37.428 1.00 139.20 ? 86  GLN D NE2 1 
ATOM 6921  N N   . ALA D 1 87  ? -26.373 -20.978 -42.362 1.00 79.74  ? 87  ALA D N   1 
ATOM 6922  C CA  . ALA D 1 87  ? -27.712 -20.524 -42.739 1.00 78.60  ? 87  ALA D CA  1 
ATOM 6923  C C   . ALA D 1 87  ? -28.249 -21.132 -44.027 1.00 80.30  ? 87  ALA D C   1 
ATOM 6924  O O   . ALA D 1 87  ? -27.548 -21.206 -45.039 1.00 80.16  ? 87  ALA D O   1 
ATOM 6925  C CB  . ALA D 1 87  ? -27.741 -19.017 -42.860 1.00 79.21  ? 87  ALA D CB  1 
ATOM 6926  N N   . GLN D 1 88  ? -29.527 -21.525 -43.971 1.00 74.69  ? 88  GLN D N   1 
ATOM 6927  C CA  . GLN D 1 88  ? -30.325 -22.055 -45.068 1.00 73.84  ? 88  GLN D CA  1 
ATOM 6928  C C   . GLN D 1 88  ? -31.377 -21.015 -45.425 1.00 74.63  ? 88  GLN D C   1 
ATOM 6929  O O   . GLN D 1 88  ? -31.731 -20.857 -46.596 1.00 74.61  ? 88  GLN D O   1 
ATOM 6930  C CB  . GLN D 1 88  ? -30.960 -23.396 -44.685 1.00 75.73  ? 88  GLN D CB  1 
ATOM 6931  C CG  . GLN D 1 88  ? -29.946 -24.536 -44.557 1.00 104.06 ? 88  GLN D CG  1 
ATOM 6932  C CD  . GLN D 1 88  ? -30.532 -25.822 -44.017 1.00 136.72 ? 88  GLN D CD  1 
ATOM 6933  O OE1 . GLN D 1 88  ? -31.671 -25.885 -43.528 1.00 134.57 ? 88  GLN D OE1 1 
ATOM 6934  N NE2 . GLN D 1 88  ? -29.744 -26.883 -44.080 1.00 133.58 ? 88  GLN D NE2 1 
ATOM 6935  N N   . LYS D 1 89  ? -31.841 -20.277 -44.407 1.00 68.53  ? 89  LYS D N   1 
ATOM 6936  C CA  . LYS D 1 89  ? -32.795 -19.174 -44.517 1.00 67.52  ? 89  LYS D CA  1 
ATOM 6937  C C   . LYS D 1 89  ? -32.267 -17.975 -43.712 1.00 68.60  ? 89  LYS D C   1 
ATOM 6938  O O   . LYS D 1 89  ? -31.818 -18.141 -42.575 1.00 69.28  ? 89  LYS D O   1 
ATOM 6939  C CB  . LYS D 1 89  ? -34.203 -19.594 -44.056 1.00 70.60  ? 89  LYS D CB  1 
ATOM 6940  C CG  . LYS D 1 89  ? -34.948 -20.423 -45.099 1.00 93.81  ? 89  LYS D CG  1 
ATOM 6941  C CD  . LYS D 1 89  ? -36.280 -21.001 -44.586 1.00 105.64 ? 89  LYS D CD  1 
ATOM 6942  C CE  . LYS D 1 89  ? -36.935 -21.934 -45.593 1.00 105.01 ? 89  LYS D CE  1 
ATOM 6943  N NZ  . LYS D 1 89  ? -38.040 -22.719 -44.991 1.00 100.98 ? 89  LYS D NZ  1 
ATOM 6944  N N   . ILE D 1 90  ? -32.237 -16.792 -44.344 1.00 61.91  ? 90  ILE D N   1 
ATOM 6945  C CA  . ILE D 1 90  ? -31.782 -15.540 -43.745 1.00 60.29  ? 90  ILE D CA  1 
ATOM 6946  C C   . ILE D 1 90  ? -32.883 -14.506 -43.879 1.00 66.75  ? 90  ILE D C   1 
ATOM 6947  O O   . ILE D 1 90  ? -33.367 -14.252 -44.990 1.00 67.31  ? 90  ILE D O   1 
ATOM 6948  C CB  . ILE D 1 90  ? -30.452 -15.011 -44.349 1.00 61.78  ? 90  ILE D CB  1 
ATOM 6949  C CG1 . ILE D 1 90  ? -29.334 -16.066 -44.289 1.00 60.85  ? 90  ILE D CG1 1 
ATOM 6950  C CG2 . ILE D 1 90  ? -30.016 -13.690 -43.664 1.00 61.16  ? 90  ILE D CG2 1 
ATOM 6951  C CD1 . ILE D 1 90  ? -28.225 -15.877 -45.282 1.00 62.49  ? 90  ILE D CD1 1 
ATOM 6952  N N   . SER D 1 91  ? -33.279 -13.909 -42.739 1.00 63.48  ? 91  SER D N   1 
ATOM 6953  C CA  . SER D 1 91  ? -34.278 -12.841 -42.692 1.00 62.55  ? 91  SER D CA  1 
ATOM 6954  C C   . SER D 1 91  ? -33.687 -11.634 -41.984 1.00 63.95  ? 91  SER D C   1 
ATOM 6955  O O   . SER D 1 91  ? -32.854 -11.781 -41.083 1.00 62.55  ? 91  SER D O   1 
ATOM 6956  C CB  . SER D 1 91  ? -35.584 -13.290 -42.030 1.00 66.00  ? 91  SER D CB  1 
ATOM 6957  O OG  . SER D 1 91  ? -35.445 -14.410 -41.170 1.00 78.27  ? 91  SER D OG  1 
ATOM 6958  N N   . ILE D 1 92  ? -34.087 -10.441 -42.434 1.00 59.49  ? 92  ILE D N   1 
ATOM 6959  C CA  . ILE D 1 92  ? -33.644 -9.168  -41.876 1.00 58.49  ? 92  ILE D CA  1 
ATOM 6960  C C   . ILE D 1 92  ? -34.852 -8.498  -41.238 1.00 60.18  ? 92  ILE D C   1 
ATOM 6961  O O   . ILE D 1 92  ? -35.939 -8.549  -41.801 1.00 58.02  ? 92  ILE D O   1 
ATOM 6962  C CB  . ILE D 1 92  ? -32.952 -8.297  -42.990 1.00 61.47  ? 92  ILE D CB  1 
ATOM 6963  C CG1 . ILE D 1 92  ? -31.417 -8.485  -42.993 1.00 62.05  ? 92  ILE D CG1 1 
ATOM 6964  C CG2 . ILE D 1 92  ? -33.262 -6.796  -42.864 1.00 61.83  ? 92  ILE D CG2 1 
ATOM 6965  C CD1 . ILE D 1 92  ? -30.877 -9.830  -43.337 1.00 67.15  ? 92  ILE D CD1 1 
ATOM 6966  N N   . GLN D 1 93  ? -34.675 -7.908  -40.051 1.00 57.07  ? 93  GLN D N   1 
ATOM 6967  C CA  . GLN D 1 93  ? -35.764 -7.177  -39.410 1.00 56.14  ? 93  GLN D CA  1 
ATOM 6968  C C   . GLN D 1 93  ? -35.310 -5.757  -39.129 1.00 58.49  ? 93  GLN D C   1 
ATOM 6969  O O   . GLN D 1 93  ? -34.233 -5.548  -38.558 1.00 57.58  ? 93  GLN D O   1 
ATOM 6970  C CB  . GLN D 1 93  ? -36.300 -7.853  -38.141 1.00 57.02  ? 93  GLN D CB  1 
ATOM 6971  C CG  . GLN D 1 93  ? -37.575 -7.160  -37.652 1.00 75.23  ? 93  GLN D CG  1 
ATOM 6972  C CD  . GLN D 1 93  ? -38.122 -7.684  -36.357 1.00 98.72  ? 93  GLN D CD  1 
ATOM 6973  O OE1 . GLN D 1 93  ? -39.213 -8.254  -36.315 1.00 91.73  ? 93  GLN D OE1 1 
ATOM 6974  N NE2 . GLN D 1 93  ? -37.415 -7.443  -35.258 1.00 97.87  ? 93  GLN D NE2 1 
ATOM 6975  N N   . LEU D 1 94  ? -36.117 -4.787  -39.572 1.00 54.31  ? 94  LEU D N   1 
ATOM 6976  C CA  . LEU D 1 94  ? -35.832 -3.369  -39.365 1.00 53.57  ? 94  LEU D CA  1 
ATOM 6977  C C   . LEU D 1 94  ? -36.363 -2.957  -37.999 1.00 57.63  ? 94  LEU D C   1 
ATOM 6978  O O   . LEU D 1 94  ? -37.213 -3.656  -37.439 1.00 56.51  ? 94  LEU D O   1 
ATOM 6979  C CB  . LEU D 1 94  ? -36.441 -2.488  -40.490 1.00 52.92  ? 94  LEU D CB  1 
ATOM 6980  C CG  . LEU D 1 94  ? -36.222 -2.868  -41.959 1.00 55.70  ? 94  LEU D CG  1 
ATOM 6981  C CD1 . LEU D 1 94  ? -36.688 -1.760  -42.852 1.00 56.14  ? 94  LEU D CD1 1 
ATOM 6982  C CD2 . LEU D 1 94  ? -34.768 -3.156  -42.270 1.00 53.49  ? 94  LEU D CD2 1 
ATOM 6983  N N   . ASN D 1 95  ? -35.889 -1.816  -37.471 1.00 55.61  ? 95  ASN D N   1 
ATOM 6984  C CA  . ASN D 1 95  ? -36.302 -1.332  -36.153 1.00 55.96  ? 95  ASN D CA  1 
ATOM 6985  C C   . ASN D 1 95  ? -37.785 -0.860  -36.137 1.00 62.15  ? 95  ASN D C   1 
ATOM 6986  O O   . ASN D 1 95  ? -38.324 -0.633  -35.054 1.00 62.58  ? 95  ASN D O   1 
ATOM 6987  C CB  . ASN D 1 95  ? -35.337 -0.243  -35.620 1.00 55.69  ? 95  ASN D CB  1 
ATOM 6988  C CG  . ASN D 1 95  ? -35.277 1.056   -36.385 1.00 84.29  ? 95  ASN D CG  1 
ATOM 6989  O OD1 . ASN D 1 95  ? -35.865 1.224   -37.454 1.00 89.36  ? 95  ASN D OD1 1 
ATOM 6990  N ND2 . ASN D 1 95  ? -34.558 2.017   -35.842 1.00 74.35  ? 95  ASN D ND2 1 
ATOM 6991  N N   . ASP D 1 96  ? -38.449 -0.775  -37.313 1.00 59.07  ? 96  ASP D N   1 
ATOM 6992  C CA  . ASP D 1 96  ? -39.860 -0.399  -37.441 1.00 59.01  ? 96  ASP D CA  1 
ATOM 6993  C C   . ASP D 1 96  ? -40.776 -1.648  -37.449 1.00 63.81  ? 96  ASP D C   1 
ATOM 6994  O O   . ASP D 1 96  ? -42.009 -1.515  -37.439 1.00 63.37  ? 96  ASP D O   1 
ATOM 6995  C CB  . ASP D 1 96  ? -40.094 0.460   -38.703 1.00 61.26  ? 96  ASP D CB  1 
ATOM 6996  C CG  . ASP D 1 96  ? -39.815 -0.173  -40.066 1.00 71.52  ? 96  ASP D CG  1 
ATOM 6997  O OD1 . ASP D 1 96  ? -39.543 -1.400  -40.118 1.00 69.82  ? 96  ASP D OD1 1 
ATOM 6998  O OD2 . ASP D 1 96  ? -39.913 0.553   -41.087 1.00 80.18  ? 96  ASP D OD2 1 
ATOM 6999  N N   . GLY D 1 97  ? -40.158 -2.833  -37.489 1.00 60.47  ? 97  GLY D N   1 
ATOM 7000  C CA  . GLY D 1 97  ? -40.855 -4.114  -37.498 1.00 59.56  ? 97  GLY D CA  1 
ATOM 7001  C C   . GLY D 1 97  ? -40.910 -4.824  -38.841 1.00 63.16  ? 97  GLY D C   1 
ATOM 7002  O O   . GLY D 1 97  ? -41.329 -5.983  -38.902 1.00 63.96  ? 97  GLY D O   1 
ATOM 7003  N N   . ARG D 1 98  ? -40.519 -4.140  -39.937 1.00 58.25  ? 98  ARG D N   1 
ATOM 7004  C CA  . ARG D 1 98  ? -40.560 -4.739  -41.276 1.00 57.61  ? 98  ARG D CA  1 
ATOM 7005  C C   . ARG D 1 98  ? -39.541 -5.866  -41.421 1.00 62.26  ? 98  ARG D C   1 
ATOM 7006  O O   . ARG D 1 98  ? -38.381 -5.719  -41.027 1.00 61.12  ? 98  ARG D O   1 
ATOM 7007  C CB  . ARG D 1 98  ? -40.325 -3.687  -42.366 1.00 55.70  ? 98  ARG D CB  1 
ATOM 7008  C CG  . ARG D 1 98  ? -41.511 -2.770  -42.587 1.00 57.89  ? 98  ARG D CG  1 
ATOM 7009  C CD  . ARG D 1 98  ? -41.343 -1.929  -43.816 1.00 58.67  ? 98  ARG D CD  1 
ATOM 7010  N NE  . ARG D 1 98  ? -40.342 -0.875  -43.630 1.00 71.41  ? 98  ARG D NE  1 
ATOM 7011  C CZ  . ARG D 1 98  ? -39.565 -0.407  -44.599 1.00 83.67  ? 98  ARG D CZ  1 
ATOM 7012  N NH1 . ARG D 1 98  ? -39.652 -0.906  -45.828 1.00 68.29  ? 98  ARG D NH1 1 
ATOM 7013  N NH2 . ARG D 1 98  ? -38.695 0.562   -44.349 1.00 70.68  ? 98  ARG D NH2 1 
ATOM 7014  N N   . GLU D 1 99  ? -40.001 -6.991  -41.980 1.00 59.82  ? 99  GLU D N   1 
ATOM 7015  C CA  . GLU D 1 99  ? -39.214 -8.194  -42.231 1.00 60.09  ? 99  GLU D CA  1 
ATOM 7016  C C   . GLU D 1 99  ? -39.004 -8.389  -43.733 1.00 65.76  ? 99  GLU D C   1 
ATOM 7017  O O   . GLU D 1 99  ? -39.914 -8.158  -44.536 1.00 65.83  ? 99  GLU D O   1 
ATOM 7018  C CB  . GLU D 1 99  ? -39.875 -9.441  -41.627 1.00 61.28  ? 99  GLU D CB  1 
ATOM 7019  C CG  . GLU D 1 99  ? -39.845 -9.504  -40.108 1.00 74.77  ? 99  GLU D CG  1 
ATOM 7020  C CD  . GLU D 1 99  ? -40.972 -10.280 -39.441 1.00 106.45 ? 99  GLU D CD  1 
ATOM 7021  O OE1 . GLU D 1 99  ? -41.472 -11.263 -40.037 1.00 106.58 ? 99  GLU D OE1 1 
ATOM 7022  O OE2 . GLU D 1 99  ? -41.353 -9.902  -38.310 1.00 106.71 ? 99  GLU D OE2 1 
ATOM 7023  N N   . PHE D 1 100 ? -37.789 -8.807  -44.099 1.00 62.14  ? 100 PHE D N   1 
ATOM 7024  C CA  . PHE D 1 100 ? -37.367 -9.065  -45.459 1.00 61.58  ? 100 PHE D CA  1 
ATOM 7025  C C   . PHE D 1 100 ? -36.586 -10.336 -45.545 1.00 66.69  ? 100 PHE D C   1 
ATOM 7026  O O   . PHE D 1 100 ? -35.874 -10.685 -44.604 1.00 65.72  ? 100 PHE D O   1 
ATOM 7027  C CB  . PHE D 1 100 ? -36.468 -7.938  -45.968 1.00 63.38  ? 100 PHE D CB  1 
ATOM 7028  C CG  . PHE D 1 100 ? -37.104 -6.587  -46.127 1.00 65.37  ? 100 PHE D CG  1 
ATOM 7029  C CD1 . PHE D 1 100 ? -37.118 -5.681  -45.071 1.00 69.24  ? 100 PHE D CD1 1 
ATOM 7030  C CD2 . PHE D 1 100 ? -37.652 -6.197  -47.347 1.00 66.75  ? 100 PHE D CD2 1 
ATOM 7031  C CE1 . PHE D 1 100 ? -37.697 -4.421  -45.219 1.00 70.19  ? 100 PHE D CE1 1 
ATOM 7032  C CE2 . PHE D 1 100 ? -38.218 -4.930  -47.501 1.00 69.94  ? 100 PHE D CE2 1 
ATOM 7033  C CZ  . PHE D 1 100 ? -38.236 -4.048  -46.438 1.00 68.82  ? 100 PHE D CZ  1 
ATOM 7034  N N   . ASP D 1 101 ? -36.644 -10.999 -46.701 1.00 65.04  ? 101 ASP D N   1 
ATOM 7035  C CA  . ASP D 1 101 ? -35.798 -12.153 -46.921 1.00 65.29  ? 101 ASP D CA  1 
ATOM 7036  C C   . ASP D 1 101 ? -34.465 -11.651 -47.464 1.00 68.49  ? 101 ASP D C   1 
ATOM 7037  O O   . ASP D 1 101 ? -34.385 -10.540 -48.010 1.00 67.69  ? 101 ASP D O   1 
ATOM 7038  C CB  . ASP D 1 101 ? -36.449 -13.184 -47.837 1.00 67.61  ? 101 ASP D CB  1 
ATOM 7039  C CG  . ASP D 1 101 ? -36.903 -14.381 -47.042 1.00 89.82  ? 101 ASP D CG  1 
ATOM 7040  O OD1 . ASP D 1 101 ? -36.046 -15.246 -46.727 1.00 92.30  ? 101 ASP D OD1 1 
ATOM 7041  O OD2 . ASP D 1 101 ? -38.090 -14.407 -46.638 1.00 100.38 ? 101 ASP D OD2 1 
ATOM 7042  N N   . ALA D 1 102 ? -33.410 -12.418 -47.240 1.00 64.12  ? 102 ALA D N   1 
ATOM 7043  C CA  . ALA D 1 102 ? -32.094 -12.028 -47.700 1.00 64.13  ? 102 ALA D CA  1 
ATOM 7044  C C   . ALA D 1 102 ? -31.355 -13.212 -48.270 1.00 68.44  ? 102 ALA D C   1 
ATOM 7045  O O   . ALA D 1 102 ? -31.572 -14.360 -47.850 1.00 67.75  ? 102 ALA D O   1 
ATOM 7046  C CB  . ALA D 1 102 ? -31.296 -11.414 -46.564 1.00 65.21  ? 102 ALA D CB  1 
ATOM 7047  N N   . LYS D 1 103 ? -30.489 -12.928 -49.248 1.00 64.89  ? 103 LYS D N   1 
ATOM 7048  C CA  . LYS D 1 103 ? -29.676 -13.946 -49.896 1.00 64.73  ? 103 LYS D CA  1 
ATOM 7049  C C   . LYS D 1 103 ? -28.212 -13.594 -49.704 1.00 69.12  ? 103 LYS D C   1 
ATOM 7050  O O   . LYS D 1 103 ? -27.848 -12.414 -49.736 1.00 68.63  ? 103 LYS D O   1 
ATOM 7051  C CB  . LYS D 1 103 ? -30.033 -14.081 -51.390 1.00 66.74  ? 103 LYS D CB  1 
ATOM 7052  C CG  . LYS D 1 103 ? -31.313 -14.870 -51.662 1.00 76.01  ? 103 LYS D CG  1 
ATOM 7053  C CD  . LYS D 1 103 ? -31.615 -14.921 -53.152 1.00 89.33  ? 103 LYS D CD  1 
ATOM 7054  C CE  . LYS D 1 103 ? -32.844 -15.735 -53.471 1.00 103.60 ? 103 LYS D CE  1 
ATOM 7055  N NZ  . LYS D 1 103 ? -33.089 -15.796 -54.937 1.00 112.01 ? 103 LYS D NZ  1 
ATOM 7056  N N   . LEU D 1 104 ? -27.377 -14.613 -49.481 1.00 65.91  ? 104 LEU D N   1 
ATOM 7057  C CA  . LEU D 1 104 ? -25.951 -14.409 -49.321 1.00 65.83  ? 104 LEU D CA  1 
ATOM 7058  C C   . LEU D 1 104 ? -25.326 -14.103 -50.681 1.00 70.90  ? 104 LEU D C   1 
ATOM 7059  O O   . LEU D 1 104 ? -25.446 -14.903 -51.611 1.00 69.33  ? 104 LEU D O   1 
ATOM 7060  C CB  . LEU D 1 104 ? -25.296 -15.645 -48.674 1.00 65.57  ? 104 LEU D CB  1 
ATOM 7061  C CG  . LEU D 1 104 ? -23.770 -15.587 -48.474 1.00 69.17  ? 104 LEU D CG  1 
ATOM 7062  C CD1 . LEU D 1 104 ? -23.374 -14.528 -47.465 1.00 68.56  ? 104 LEU D CD1 1 
ATOM 7063  C CD2 . LEU D 1 104 ? -23.230 -16.931 -48.068 1.00 71.08  ? 104 LEU D CD2 1 
ATOM 7064  N N   . ILE D 1 105 ? -24.708 -12.922 -50.799 1.00 69.40  ? 105 ILE D N   1 
ATOM 7065  C CA  . ILE D 1 105 ? -24.027 -12.496 -52.018 1.00 69.94  ? 105 ILE D CA  1 
ATOM 7066  C C   . ILE D 1 105 ? -22.628 -13.150 -52.039 1.00 75.27  ? 105 ILE D C   1 
ATOM 7067  O O   . ILE D 1 105 ? -22.221 -13.727 -53.053 1.00 76.25  ? 105 ILE D O   1 
ATOM 7068  C CB  . ILE D 1 105 ? -23.985 -10.939 -52.135 1.00 72.88  ? 105 ILE D CB  1 
ATOM 7069  C CG1 . ILE D 1 105 ? -25.384 -10.338 -52.394 1.00 73.81  ? 105 ILE D CG1 1 
ATOM 7070  C CG2 . ILE D 1 105 ? -22.978 -10.458 -53.175 1.00 73.22  ? 105 ILE D CG2 1 
ATOM 7071  C CD1 . ILE D 1 105 ? -26.275 -11.050 -53.475 1.00 84.56  ? 105 ILE D CD1 1 
ATOM 7072  N N   . GLY D 1 106 ? -21.934 -13.068 -50.912 1.00 70.07  ? 106 GLY D N   1 
ATOM 7073  C CA  . GLY D 1 106 ? -20.605 -13.632 -50.739 1.00 69.31  ? 106 GLY D CA  1 
ATOM 7074  C C   . GLY D 1 106 ? -20.101 -13.431 -49.330 1.00 72.59  ? 106 GLY D C   1 
ATOM 7075  O O   . GLY D 1 106 ? -20.684 -12.663 -48.557 1.00 71.80  ? 106 GLY D O   1 
ATOM 7076  N N   . SER D 1 107 ? -19.011 -14.122 -48.992 1.00 68.94  ? 107 SER D N   1 
ATOM 7077  C CA  . SER D 1 107 ? -18.403 -14.050 -47.669 1.00 68.19  ? 107 SER D CA  1 
ATOM 7078  C C   . SER D 1 107 ? -16.898 -14.311 -47.710 1.00 72.54  ? 107 SER D C   1 
ATOM 7079  O O   . SER D 1 107 ? -16.396 -14.884 -48.674 1.00 72.46  ? 107 SER D O   1 
ATOM 7080  C CB  . SER D 1 107 ? -19.064 -15.066 -46.748 1.00 69.94  ? 107 SER D CB  1 
ATOM 7081  O OG  . SER D 1 107 ? -18.808 -16.382 -47.204 1.00 76.68  ? 107 SER D OG  1 
ATOM 7082  N N   . ASP D 1 108 ? -16.193 -13.904 -46.641 1.00 69.00  ? 108 ASP D N   1 
ATOM 7083  C CA  . ASP D 1 108 ? -14.772 -14.137 -46.423 1.00 68.38  ? 108 ASP D CA  1 
ATOM 7084  C C   . ASP D 1 108 ? -14.582 -14.723 -45.032 1.00 73.22  ? 108 ASP D C   1 
ATOM 7085  O O   . ASP D 1 108 ? -14.822 -14.041 -44.036 1.00 72.82  ? 108 ASP D O   1 
ATOM 7086  C CB  . ASP D 1 108 ? -13.944 -12.854 -46.609 1.00 69.72  ? 108 ASP D CB  1 
ATOM 7087  C CG  . ASP D 1 108 ? -12.433 -13.020 -46.429 1.00 75.43  ? 108 ASP D CG  1 
ATOM 7088  O OD1 . ASP D 1 108 ? -11.946 -14.185 -46.436 1.00 75.03  ? 108 ASP D OD1 1 
ATOM 7089  O OD2 . ASP D 1 108 ? -11.733 -11.988 -46.321 1.00 76.26  ? 108 ASP D OD2 1 
ATOM 7090  N N   . ASP D 1 109 ? -14.170 -15.998 -44.975 1.00 71.13  ? 109 ASP D N   1 
ATOM 7091  C CA  . ASP D 1 109 ? -13.900 -16.758 -43.744 1.00 71.51  ? 109 ASP D CA  1 
ATOM 7092  C C   . ASP D 1 109 ? -12.753 -16.148 -42.938 1.00 73.42  ? 109 ASP D C   1 
ATOM 7093  O O   . ASP D 1 109 ? -12.827 -16.110 -41.710 1.00 74.17  ? 109 ASP D O   1 
ATOM 7094  C CB  . ASP D 1 109 ? -13.515 -18.224 -44.059 1.00 74.45  ? 109 ASP D CB  1 
ATOM 7095  C CG  . ASP D 1 109 ? -14.288 -18.966 -45.140 1.00 100.94 ? 109 ASP D CG  1 
ATOM 7096  O OD1 . ASP D 1 109 ? -14.299 -20.224 -45.103 1.00 102.93 ? 109 ASP D OD1 1 
ATOM 7097  O OD2 . ASP D 1 109 ? -14.813 -18.297 -46.078 1.00 114.69 ? 109 ASP D OD2 1 
ATOM 7098  N N   . GLN D 1 110 ? -11.678 -15.726 -43.630 1.00 66.70  ? 110 GLN D N   1 
ATOM 7099  C CA  . GLN D 1 110 ? -10.460 -15.196 -43.028 1.00 65.84  ? 110 GLN D CA  1 
ATOM 7100  C C   . GLN D 1 110 ? -10.650 -13.851 -42.309 1.00 66.14  ? 110 GLN D C   1 
ATOM 7101  O O   . GLN D 1 110 ? -10.073 -13.656 -41.241 1.00 64.62  ? 110 GLN D O   1 
ATOM 7102  C CB  . GLN D 1 110 ? -9.371  -15.057 -44.087 1.00 67.51  ? 110 GLN D CB  1 
ATOM 7103  C CG  . GLN D 1 110 ? -8.718  -16.372 -44.471 1.00 82.00  ? 110 GLN D CG  1 
ATOM 7104  C CD  . GLN D 1 110 ? -7.567  -16.132 -45.422 1.00 105.36 ? 110 GLN D CD  1 
ATOM 7105  O OE1 . GLN D 1 110 ? -6.455  -15.744 -45.018 1.00 96.80  ? 110 GLN D OE1 1 
ATOM 7106  N NE2 . GLN D 1 110 ? -7.821  -16.330 -46.713 1.00 99.90  ? 110 GLN D NE2 1 
ATOM 7107  N N   . SER D 1 111 ? -11.434 -12.932 -42.883 1.00 61.60  ? 111 SER D N   1 
ATOM 7108  C CA  . SER D 1 111 ? -11.653 -11.626 -42.256 1.00 61.73  ? 111 SER D CA  1 
ATOM 7109  C C   . SER D 1 111 ? -12.971 -11.560 -41.462 1.00 65.59  ? 111 SER D C   1 
ATOM 7110  O O   . SER D 1 111 ? -13.125 -10.654 -40.641 1.00 64.32  ? 111 SER D O   1 
ATOM 7111  C CB  . SER D 1 111 ? -11.613 -10.511 -43.292 1.00 64.82  ? 111 SER D CB  1 
ATOM 7112  O OG  . SER D 1 111 ? -12.617 -10.739 -44.264 1.00 73.97  ? 111 SER D OG  1 
ATOM 7113  N N   . ASP D 1 112 ? -13.888 -12.537 -41.683 1.00 62.67  ? 112 ASP D N   1 
ATOM 7114  C CA  . ASP D 1 112 ? -15.209 -12.690 -41.045 1.00 62.54  ? 112 ASP D CA  1 
ATOM 7115  C C   . ASP D 1 112 ? -16.217 -11.630 -41.553 1.00 65.47  ? 112 ASP D C   1 
ATOM 7116  O O   . ASP D 1 112 ? -17.001 -11.070 -40.780 1.00 65.35  ? 112 ASP D O   1 
ATOM 7117  C CB  . ASP D 1 112 ? -15.120 -12.673 -39.502 1.00 64.20  ? 112 ASP D CB  1 
ATOM 7118  C CG  . ASP D 1 112 ? -16.249 -13.346 -38.734 1.00 70.92  ? 112 ASP D CG  1 
ATOM 7119  O OD1 . ASP D 1 112 ? -17.204 -13.841 -39.376 1.00 69.07  ? 112 ASP D OD1 1 
ATOM 7120  O OD2 . ASP D 1 112 ? -16.172 -13.386 -37.493 1.00 78.26  ? 112 ASP D OD2 1 
ATOM 7121  N N   . ILE D 1 113 ? -16.216 -11.389 -42.865 1.00 60.54  ? 113 ILE D N   1 
ATOM 7122  C CA  . ILE D 1 113 ? -17.160 -10.461 -43.461 1.00 59.01  ? 113 ILE D CA  1 
ATOM 7123  C C   . ILE D 1 113 ? -18.045 -11.213 -44.442 1.00 57.66  ? 113 ILE D C   1 
ATOM 7124  O O   . ILE D 1 113 ? -17.570 -12.073 -45.167 1.00 57.22  ? 113 ILE D O   1 
ATOM 7125  C CB  . ILE D 1 113 ? -16.454 -9.232  -44.060 1.00 62.51  ? 113 ILE D CB  1 
ATOM 7126  C CG1 . ILE D 1 113 ? -16.453 -8.126  -43.001 1.00 62.85  ? 113 ILE D CG1 1 
ATOM 7127  C CG2 . ILE D 1 113 ? -17.127 -8.725  -45.364 1.00 64.97  ? 113 ILE D CG2 1 
ATOM 7128  C CD1 . ILE D 1 113 ? -15.301 -7.351  -43.001 1.00 70.48  ? 113 ILE D CD1 1 
ATOM 7129  N N   . ALA D 1 114 ? -19.343 -10.918 -44.402 1.00 50.49  ? 114 ALA D N   1 
ATOM 7130  C CA  . ALA D 1 114 ? -20.345 -11.477 -45.287 1.00 49.17  ? 114 ALA D CA  1 
ATOM 7131  C C   . ALA D 1 114 ? -21.183 -10.352 -45.837 1.00 52.66  ? 114 ALA D C   1 
ATOM 7132  O O   . ALA D 1 114 ? -21.403 -9.347  -45.153 1.00 51.58  ? 114 ALA D O   1 
ATOM 7133  C CB  . ALA D 1 114 ? -21.219 -12.488 -44.552 1.00 49.66  ? 114 ALA D CB  1 
ATOM 7134  N N   . LEU D 1 115 ? -21.651 -10.508 -47.075 1.00 49.99  ? 115 LEU D N   1 
ATOM 7135  C CA  . LEU D 1 115 ? -22.527 -9.519  -47.680 1.00 50.33  ? 115 LEU D CA  1 
ATOM 7136  C C   . LEU D 1 115 ? -23.815 -10.189 -48.097 1.00 52.60  ? 115 LEU D C   1 
ATOM 7137  O O   . LEU D 1 115 ? -23.788 -11.256 -48.713 1.00 52.41  ? 115 LEU D O   1 
ATOM 7138  C CB  . LEU D 1 115 ? -21.866 -8.788  -48.859 1.00 51.09  ? 115 LEU D CB  1 
ATOM 7139  C CG  . LEU D 1 115 ? -22.702 -7.670  -49.491 1.00 57.09  ? 115 LEU D CG  1 
ATOM 7140  C CD1 . LEU D 1 115 ? -22.490 -6.332  -48.779 1.00 57.71  ? 115 LEU D CD1 1 
ATOM 7141  C CD2 . LEU D 1 115 ? -22.411 -7.553  -50.938 1.00 59.74  ? 115 LEU D CD2 1 
ATOM 7142  N N   . LEU D 1 116 ? -24.940 -9.578  -47.722 1.00 48.56  ? 116 LEU D N   1 
ATOM 7143  C CA  . LEU D 1 116 ? -26.258 -10.080 -48.069 1.00 48.40  ? 116 LEU D CA  1 
ATOM 7144  C C   . LEU D 1 116 ? -27.023 -9.079  -48.943 1.00 54.96  ? 116 LEU D C   1 
ATOM 7145  O O   . LEU D 1 116 ? -26.699 -7.881  -48.998 1.00 54.01  ? 116 LEU D O   1 
ATOM 7146  C CB  . LEU D 1 116 ? -27.080 -10.382 -46.809 1.00 48.36  ? 116 LEU D CB  1 
ATOM 7147  C CG  . LEU D 1 116 ? -26.411 -11.062 -45.613 1.00 52.24  ? 116 LEU D CG  1 
ATOM 7148  C CD1 . LEU D 1 116 ? -27.336 -10.991 -44.367 1.00 51.41  ? 116 LEU D CD1 1 
ATOM 7149  C CD2 . LEU D 1 116 ? -26.024 -12.501 -45.946 1.00 52.74  ? 116 LEU D CD2 1 
ATOM 7150  N N   . GLN D 1 117 ? -28.044 -9.574  -49.621 1.00 54.15  ? 117 GLN D N   1 
ATOM 7151  C CA  . GLN D 1 117 ? -28.918 -8.733  -50.414 1.00 55.59  ? 117 GLN D CA  1 
ATOM 7152  C C   . GLN D 1 117 ? -30.355 -8.987  -50.028 1.00 60.43  ? 117 GLN D C   1 
ATOM 7153  O O   . GLN D 1 117 ? -30.827 -10.127 -50.101 1.00 59.90  ? 117 GLN D O   1 
ATOM 7154  C CB  . GLN D 1 117 ? -28.718 -8.948  -51.907 1.00 57.87  ? 117 GLN D CB  1 
ATOM 7155  C CG  . GLN D 1 117 ? -29.535 -7.973  -52.759 1.00 71.66  ? 117 GLN D CG  1 
ATOM 7156  C CD  . GLN D 1 117 ? -29.106 -7.964  -54.203 1.00 74.17  ? 117 GLN D CD  1 
ATOM 7157  O OE1 . GLN D 1 117 ? -28.775 -8.999  -54.799 1.00 60.39  ? 117 GLN D OE1 1 
ATOM 7158  N NE2 . GLN D 1 117 ? -29.137 -6.785  -54.804 1.00 64.96  ? 117 GLN D NE2 1 
ATOM 7159  N N   . ILE D 1 118 ? -31.032 -7.922  -49.590 1.00 58.94  ? 118 ILE D N   1 
ATOM 7160  C CA  . ILE D 1 118 ? -32.442 -7.941  -49.222 1.00 60.70  ? 118 ILE D CA  1 
ATOM 7161  C C   . ILE D 1 118 ? -33.273 -8.194  -50.489 1.00 68.64  ? 118 ILE D C   1 
ATOM 7162  O O   . ILE D 1 118 ? -33.058 -7.533  -51.517 1.00 69.41  ? 118 ILE D O   1 
ATOM 7163  C CB  . ILE D 1 118 ? -32.840 -6.614  -48.508 1.00 64.07  ? 118 ILE D CB  1 
ATOM 7164  C CG1 . ILE D 1 118 ? -32.264 -6.547  -47.073 1.00 64.07  ? 118 ILE D CG1 1 
ATOM 7165  C CG2 . ILE D 1 118 ? -34.356 -6.409  -48.503 1.00 65.59  ? 118 ILE D CG2 1 
ATOM 7166  C CD1 . ILE D 1 118 ? -32.255 -5.164  -46.469 1.00 69.73  ? 118 ILE D CD1 1 
ATOM 7167  N N   . GLN D 1 119 ? -34.187 -9.171  -50.412 1.00 66.84  ? 119 GLN D N   1 
ATOM 7168  C CA  . GLN D 1 119 ? -35.108 -9.516  -51.500 1.00 67.08  ? 119 GLN D CA  1 
ATOM 7169  C C   . GLN D 1 119 ? -36.276 -8.529  -51.459 1.00 74.58  ? 119 GLN D C   1 
ATOM 7170  O O   . GLN D 1 119 ? -36.925 -8.365  -50.410 1.00 75.84  ? 119 GLN D O   1 
ATOM 7171  C CB  . GLN D 1 119 ? -35.572 -10.981 -51.407 1.00 67.64  ? 119 GLN D CB  1 
ATOM 7172  C CG  . GLN D 1 119 ? -34.416 -11.998 -51.418 1.00 82.90  ? 119 GLN D CG  1 
ATOM 7173  C CD  . GLN D 1 119 ? -33.533 -11.886 -52.643 1.00 101.72 ? 119 GLN D CD  1 
ATOM 7174  O OE1 . GLN D 1 119 ? -33.908 -12.291 -53.747 1.00 98.73  ? 119 GLN D OE1 1 
ATOM 7175  N NE2 . GLN D 1 119 ? -32.336 -11.335 -52.475 1.00 90.68  ? 119 GLN D NE2 1 
ATOM 7176  N N   . ASN D 1 120 ? -36.494 -7.825  -52.592 1.00 70.82  ? 120 ASN D N   1 
ATOM 7177  C CA  . ASN D 1 120 ? -37.510 -6.773  -52.790 1.00 69.88  ? 120 ASN D CA  1 
ATOM 7178  C C   . ASN D 1 120 ? -37.343 -5.648  -51.738 1.00 70.59  ? 120 ASN D C   1 
ATOM 7179  O O   . ASN D 1 120 ? -38.261 -5.408  -50.951 1.00 68.43  ? 120 ASN D O   1 
ATOM 7180  C CB  . ASN D 1 120 ? -38.951 -7.333  -52.810 1.00 71.97  ? 120 ASN D CB  1 
ATOM 7181  C CG  . ASN D 1 120 ? -39.168 -8.395  -53.862 1.00 115.09 ? 120 ASN D CG  1 
ATOM 7182  O OD1 . ASN D 1 120 ? -39.398 -9.570  -53.558 1.00 115.00 ? 120 ASN D OD1 1 
ATOM 7183  N ND2 . ASN D 1 120 ? -39.081 -8.017  -55.130 1.00 111.90 ? 120 ASN D ND2 1 
ATOM 7184  N N   . PRO D 1 121 ? -36.175 -4.947  -51.724 1.00 67.43  ? 121 PRO D N   1 
ATOM 7185  C CA  . PRO D 1 121 ? -35.987 -3.846  -50.760 1.00 67.40  ? 121 PRO D CA  1 
ATOM 7186  C C   . PRO D 1 121 ? -36.911 -2.675  -51.045 1.00 72.84  ? 121 PRO D C   1 
ATOM 7187  O O   . PRO D 1 121 ? -37.277 -2.463  -52.197 1.00 74.95  ? 121 PRO D O   1 
ATOM 7188  C CB  . PRO D 1 121 ? -34.520 -3.450  -50.952 1.00 69.03  ? 121 PRO D CB  1 
ATOM 7189  C CG  . PRO D 1 121 ? -34.174 -3.872  -52.311 1.00 73.01  ? 121 PRO D CG  1 
ATOM 7190  C CD  . PRO D 1 121 ? -34.987 -5.096  -52.594 1.00 68.62  ? 121 PRO D CD  1 
ATOM 7191  N N   . SER D 1 122 ? -37.288 -1.927  -50.004 1.00 68.67  ? 122 SER D N   1 
ATOM 7192  C CA  . SER D 1 122 ? -38.215 -0.801  -50.094 1.00 68.08  ? 122 SER D CA  1 
ATOM 7193  C C   . SER D 1 122 ? -38.045 0.141   -48.893 1.00 71.46  ? 122 SER D C   1 
ATOM 7194  O O   . SER D 1 122 ? -37.988 -0.323  -47.756 1.00 70.57  ? 122 SER D O   1 
ATOM 7195  C CB  . SER D 1 122 ? -39.654 -1.327  -50.166 1.00 71.41  ? 122 SER D CB  1 
ATOM 7196  O OG  . SER D 1 122 ? -40.635 -0.358  -49.829 1.00 81.58  ? 122 SER D OG  1 
ATOM 7197  N N   . LYS D 1 123 ? -37.993 1.463   -49.154 1.00 68.69  ? 123 LYS D N   1 
ATOM 7198  C CA  . LYS D 1 123 ? -37.882 2.553   -48.162 1.00 68.60  ? 123 LYS D CA  1 
ATOM 7199  C C   . LYS D 1 123 ? -36.820 2.231   -47.060 1.00 69.68  ? 123 LYS D C   1 
ATOM 7200  O O   . LYS D 1 123 ? -37.097 2.299   -45.857 1.00 68.76  ? 123 LYS D O   1 
ATOM 7201  C CB  . LYS D 1 123 ? -39.261 2.851   -47.532 1.00 71.91  ? 123 LYS D CB  1 
ATOM 7202  C CG  . LYS D 1 123 ? -40.307 3.422   -48.483 1.00 86.75  ? 123 LYS D CG  1 
ATOM 7203  C CD  . LYS D 1 123 ? -41.666 3.496   -47.793 1.00 99.38  ? 123 LYS D CD  1 
ATOM 7204  C CE  . LYS D 1 123 ? -42.739 4.124   -48.655 1.00 109.82 ? 123 LYS D CE  1 
ATOM 7205  N NZ  . LYS D 1 123 ? -43.973 4.439   -47.874 1.00 114.20 ? 123 LYS D NZ  1 
ATOM 7206  N N   . LEU D 1 124 ? -35.618 1.856   -47.509 1.00 62.98  ? 124 LEU D N   1 
ATOM 7207  C CA  . LEU D 1 124 ? -34.492 1.485   -46.668 1.00 60.87  ? 124 LEU D CA  1 
ATOM 7208  C C   . LEU D 1 124 ? -33.602 2.687   -46.376 1.00 65.09  ? 124 LEU D C   1 
ATOM 7209  O O   . LEU D 1 124 ? -33.531 3.634   -47.179 1.00 65.84  ? 124 LEU D O   1 
ATOM 7210  C CB  . LEU D 1 124 ? -33.682 0.417   -47.408 1.00 60.24  ? 124 LEU D CB  1 
ATOM 7211  C CG  . LEU D 1 124 ? -33.761 -1.044  -46.969 1.00 64.12  ? 124 LEU D CG  1 
ATOM 7212  C CD1 . LEU D 1 124 ? -35.170 -1.495  -46.624 1.00 64.15  ? 124 LEU D CD1 1 
ATOM 7213  C CD2 . LEU D 1 124 ? -33.160 -1.930  -48.011 1.00 64.79  ? 124 LEU D CD2 1 
ATOM 7214  N N   . THR D 1 125 ? -32.922 2.649   -45.216 1.00 59.94  ? 125 THR D N   1 
ATOM 7215  C CA  . THR D 1 125 ? -31.975 3.673   -44.800 1.00 59.30  ? 125 THR D CA  1 
ATOM 7216  C C   . THR D 1 125 ? -30.599 3.058   -44.889 1.00 64.04  ? 125 THR D C   1 
ATOM 7217  O O   . THR D 1 125 ? -30.419 1.924   -44.459 1.00 64.90  ? 125 THR D O   1 
ATOM 7218  C CB  . THR D 1 125 ? -32.305 4.200   -43.399 1.00 64.98  ? 125 THR D CB  1 
ATOM 7219  O OG1 . THR D 1 125 ? -33.679 4.583   -43.351 1.00 68.22  ? 125 THR D OG1 1 
ATOM 7220  C CG2 . THR D 1 125 ? -31.425 5.397   -42.995 1.00 60.99  ? 125 THR D CG2 1 
ATOM 7221  N N   . GLN D 1 126 ? -29.640 3.768   -45.479 1.00 59.73  ? 126 GLN D N   1 
ATOM 7222  C CA  . GLN D 1 126 ? -28.286 3.258   -45.569 1.00 58.86  ? 126 GLN D CA  1 
ATOM 7223  C C   . GLN D 1 126 ? -27.366 4.098   -44.707 1.00 62.79  ? 126 GLN D C   1 
ATOM 7224  O O   . GLN D 1 126 ? -27.666 5.250   -44.360 1.00 60.72  ? 126 GLN D O   1 
ATOM 7225  C CB  . GLN D 1 126 ? -27.777 3.179   -47.009 1.00 60.18  ? 126 GLN D CB  1 
ATOM 7226  C CG  . GLN D 1 126 ? -27.727 4.521   -47.746 1.00 69.24  ? 126 GLN D CG  1 
ATOM 7227  C CD  . GLN D 1 126 ? -26.948 4.405   -49.026 1.00 76.82  ? 126 GLN D CD  1 
ATOM 7228  O OE1 . GLN D 1 126 ? -25.881 4.998   -49.185 1.00 69.11  ? 126 GLN D OE1 1 
ATOM 7229  N NE2 . GLN D 1 126 ? -27.448 3.619   -49.956 1.00 62.60  ? 126 GLN D NE2 1 
ATOM 7230  N N   . ILE D 1 127 ? -26.236 3.492   -44.354 1.00 60.23  ? 127 ILE D N   1 
ATOM 7231  C CA  . ILE D 1 127 ? -25.245 4.100   -43.508 1.00 59.14  ? 127 ILE D CA  1 
ATOM 7232  C C   . ILE D 1 127 ? -24.184 4.825   -44.330 1.00 63.16  ? 127 ILE D C   1 
ATOM 7233  O O   . ILE D 1 127 ? -23.849 4.408   -45.447 1.00 63.22  ? 127 ILE D O   1 
ATOM 7234  C CB  . ILE D 1 127 ? -24.654 2.967   -42.632 1.00 62.00  ? 127 ILE D CB  1 
ATOM 7235  C CG1 . ILE D 1 127 ? -24.939 3.132   -41.111 1.00 62.04  ? 127 ILE D CG1 1 
ATOM 7236  C CG2 . ILE D 1 127 ? -23.237 2.502   -43.001 1.00 62.31  ? 127 ILE D CG2 1 
ATOM 7237  C CD1 . ILE D 1 127 ? -24.687 4.408   -40.491 1.00 61.01  ? 127 ILE D CD1 1 
ATOM 7238  N N   . ALA D 1 128 ? -23.673 5.928   -43.766 1.00 59.22  ? 128 ALA D N   1 
ATOM 7239  C CA  . ALA D 1 128 ? -22.542 6.659   -44.314 1.00 59.11  ? 128 ALA D CA  1 
ATOM 7240  C C   . ALA D 1 128 ? -21.288 5.998   -43.741 1.00 64.31  ? 128 ALA D C   1 
ATOM 7241  O O   . ALA D 1 128 ? -21.302 5.622   -42.568 1.00 65.42  ? 128 ALA D O   1 
ATOM 7242  C CB  . ALA D 1 128 ? -22.621 8.128   -43.937 1.00 59.78  ? 128 ALA D CB  1 
ATOM 7243  N N   . ILE D 1 129 ? -20.240 5.780   -44.555 1.00 59.22  ? 129 ILE D N   1 
ATOM 7244  C CA  . ILE D 1 129 ? -19.028 5.112   -44.082 1.00 57.74  ? 129 ILE D CA  1 
ATOM 7245  C C   . ILE D 1 129 ? -17.911 6.146   -43.896 1.00 63.91  ? 129 ILE D C   1 
ATOM 7246  O O   . ILE D 1 129 ? -17.615 6.911   -44.822 1.00 64.74  ? 129 ILE D O   1 
ATOM 7247  C CB  . ILE D 1 129 ? -18.616 3.944   -45.028 1.00 59.53  ? 129 ILE D CB  1 
ATOM 7248  C CG1 . ILE D 1 129 ? -19.764 2.933   -45.161 1.00 59.42  ? 129 ILE D CG1 1 
ATOM 7249  C CG2 . ILE D 1 129 ? -17.333 3.257   -44.556 1.00 59.21  ? 129 ILE D CG2 1 
ATOM 7250  C CD1 . ILE D 1 129 ? -19.636 1.977   -46.276 1.00 61.38  ? 129 ILE D CD1 1 
ATOM 7251  N N   . ALA D 1 130 ? -17.302 6.163   -42.691 1.00 59.66  ? 130 ALA D N   1 
ATOM 7252  C CA  . ALA D 1 130 ? -16.198 7.053   -42.345 1.00 59.07  ? 130 ALA D CA  1 
ATOM 7253  C C   . ALA D 1 130 ? -14.853 6.389   -42.657 1.00 64.31  ? 130 ALA D C   1 
ATOM 7254  O O   . ALA D 1 130 ? -14.796 5.177   -42.872 1.00 65.07  ? 130 ALA D O   1 
ATOM 7255  C CB  . ALA D 1 130 ? -16.273 7.431   -40.872 1.00 59.53  ? 130 ALA D CB  1 
ATOM 7256  N N   . ASP D 1 131 ? -13.780 7.192   -42.711 1.00 61.94  ? 131 ASP D N   1 
ATOM 7257  C CA  . ASP D 1 131 ? -12.427 6.711   -42.927 1.00 62.69  ? 131 ASP D CA  1 
ATOM 7258  C C   . ASP D 1 131 ? -11.898 6.245   -41.577 1.00 66.82  ? 131 ASP D C   1 
ATOM 7259  O O   . ASP D 1 131 ? -11.566 7.082   -40.723 1.00 65.76  ? 131 ASP D O   1 
ATOM 7260  C CB  . ASP D 1 131 ? -11.532 7.810   -43.556 1.00 65.09  ? 131 ASP D CB  1 
ATOM 7261  C CG  . ASP D 1 131 ? -10.093 7.399   -43.900 1.00 77.54  ? 131 ASP D CG  1 
ATOM 7262  O OD1 . ASP D 1 131 ? -9.344  8.249   -44.423 1.00 79.11  ? 131 ASP D OD1 1 
ATOM 7263  O OD2 . ASP D 1 131 ? -9.717  6.229   -43.637 1.00 82.12  ? 131 ASP D OD2 1 
ATOM 7264  N N   . SER D 1 132 ? -11.831 4.902   -41.387 1.00 63.78  ? 132 SER D N   1 
ATOM 7265  C CA  . SER D 1 132 ? -11.375 4.279   -40.142 1.00 63.35  ? 132 SER D CA  1 
ATOM 7266  C C   . SER D 1 132 ? -9.881  4.540   -39.879 1.00 68.81  ? 132 SER D C   1 
ATOM 7267  O O   . SER D 1 132 ? -9.450  4.489   -38.726 1.00 68.18  ? 132 SER D O   1 
ATOM 7268  C CB  . SER D 1 132 ? -11.677 2.790   -40.136 1.00 65.13  ? 132 SER D CB  1 
ATOM 7269  O OG  . SER D 1 132 ? -11.048 2.107   -41.201 1.00 71.65  ? 132 SER D OG  1 
ATOM 7270  N N   . ASP D 1 133 ? -9.103  4.894   -40.926 1.00 66.21  ? 133 ASP D N   1 
ATOM 7271  C CA  . ASP D 1 133 ? -7.680  5.214   -40.762 1.00 65.74  ? 133 ASP D CA  1 
ATOM 7272  C C   . ASP D 1 133 ? -7.499  6.588   -40.090 1.00 69.11  ? 133 ASP D C   1 
ATOM 7273  O O   . ASP D 1 133 ? -6.413  6.882   -39.589 1.00 70.33  ? 133 ASP D O   1 
ATOM 7274  C CB  . ASP D 1 133 ? -6.941  5.139   -42.109 1.00 67.94  ? 133 ASP D CB  1 
ATOM 7275  C CG  . ASP D 1 133 ? -6.767  3.716   -42.639 1.00 80.29  ? 133 ASP D CG  1 
ATOM 7276  O OD1 . ASP D 1 133 ? -6.703  2.773   -41.810 1.00 82.34  ? 133 ASP D OD1 1 
ATOM 7277  O OD2 . ASP D 1 133 ? -6.685  3.544   -43.883 1.00 80.64  ? 133 ASP D OD2 1 
ATOM 7278  N N   . LYS D 1 134 ? -8.573  7.393   -40.017 1.00 64.45  ? 134 LYS D N   1 
ATOM 7279  C CA  . LYS D 1 134 ? -8.552  8.713   -39.371 1.00 64.29  ? 134 LYS D CA  1 
ATOM 7280  C C   . LYS D 1 134 ? -8.983  8.636   -37.881 1.00 66.50  ? 134 LYS D C   1 
ATOM 7281  O O   . LYS D 1 134 ? -8.998  9.652   -37.179 1.00 65.75  ? 134 LYS D O   1 
ATOM 7282  C CB  . LYS D 1 134 ? -9.423  9.711   -40.145 1.00 67.21  ? 134 LYS D CB  1 
ATOM 7283  C CG  . LYS D 1 134 ? -8.747  10.214  -41.426 1.00 84.44  ? 134 LYS D CG  1 
ATOM 7284  C CD  . LYS D 1 134 ? -9.724  10.906  -42.375 1.00 92.79  ? 134 LYS D CD  1 
ATOM 7285  C CE  . LYS D 1 134 ? -9.495  12.398  -42.473 1.00 101.32 ? 134 LYS D CE  1 
ATOM 7286  N NZ  . LYS D 1 134 ? -8.219  12.741  -43.167 1.00 109.27 ? 134 LYS D NZ  1 
ATOM 7287  N N   . LEU D 1 135 ? -9.263  7.413   -37.387 1.00 61.38  ? 135 LEU D N   1 
ATOM 7288  C CA  . LEU D 1 135 ? -9.636  7.175   -35.991 1.00 59.10  ? 135 LEU D CA  1 
ATOM 7289  C C   . LEU D 1 135 ? -8.457  7.307   -35.054 1.00 61.97  ? 135 LEU D C   1 
ATOM 7290  O O   . LEU D 1 135 ? -7.322  7.008   -35.424 1.00 61.02  ? 135 LEU D O   1 
ATOM 7291  C CB  . LEU D 1 135 ? -10.236 5.777   -35.812 1.00 58.33  ? 135 LEU D CB  1 
ATOM 7292  C CG  . LEU D 1 135 ? -11.637 5.532   -36.346 1.00 61.50  ? 135 LEU D CG  1 
ATOM 7293  C CD1 . LEU D 1 135 ? -11.993 4.068   -36.203 1.00 60.66  ? 135 LEU D CD1 1 
ATOM 7294  C CD2 . LEU D 1 135 ? -12.669 6.410   -35.634 1.00 62.58  ? 135 LEU D CD2 1 
ATOM 7295  N N   . ARG D 1 136 ? -8.742  7.713   -33.817 1.00 58.53  ? 136 ARG D N   1 
ATOM 7296  C CA  . ARG D 1 136 ? -7.755  7.860   -32.760 1.00 57.22  ? 136 ARG D CA  1 
ATOM 7297  C C   . ARG D 1 136 ? -8.312  7.355   -31.455 1.00 58.02  ? 136 ARG D C   1 
ATOM 7298  O O   . ARG D 1 136 ? -9.525  7.417   -31.224 1.00 57.90  ? 136 ARG D O   1 
ATOM 7299  C CB  . ARG D 1 136 ? -7.318  9.316   -32.602 1.00 57.70  ? 136 ARG D CB  1 
ATOM 7300  C CG  . ARG D 1 136 ? -6.324  9.806   -33.649 1.00 68.99  ? 136 ARG D CG  1 
ATOM 7301  C CD  . ARG D 1 136 ? -5.933  11.247  -33.375 1.00 71.44  ? 136 ARG D CD  1 
ATOM 7302  N NE  . ARG D 1 136 ? -7.091  12.145  -33.394 1.00 71.74  ? 136 ARG D NE  1 
ATOM 7303  C CZ  . ARG D 1 136 ? -7.119  13.358  -32.843 1.00 87.95  ? 136 ARG D CZ  1 
ATOM 7304  N NH1 . ARG D 1 136 ? -6.053  13.833  -32.203 1.00 67.94  ? 136 ARG D NH1 1 
ATOM 7305  N NH2 . ARG D 1 136 ? -8.224  14.091  -32.897 1.00 80.14  ? 136 ARG D NH2 1 
ATOM 7306  N N   . VAL D 1 137 ? -7.421  6.865   -30.596 1.00 51.66  ? 137 VAL D N   1 
ATOM 7307  C CA  . VAL D 1 137 ? -7.755  6.383   -29.271 1.00 51.54  ? 137 VAL D CA  1 
ATOM 7308  C C   . VAL D 1 137 ? -8.317  7.595   -28.496 1.00 58.24  ? 137 VAL D C   1 
ATOM 7309  O O   . VAL D 1 137 ? -7.647  8.624   -28.402 1.00 58.36  ? 137 VAL D O   1 
ATOM 7310  C CB  . VAL D 1 137 ? -6.510  5.718   -28.590 1.00 53.58  ? 137 VAL D CB  1 
ATOM 7311  C CG1 . VAL D 1 137 ? -6.770  5.401   -27.127 1.00 53.27  ? 137 VAL D CG1 1 
ATOM 7312  C CG2 . VAL D 1 137 ? -6.091  4.462   -29.330 1.00 52.51  ? 137 VAL D CG2 1 
ATOM 7313  N N   . GLY D 1 138 ? -9.552  7.473   -28.018 1.00 55.44  ? 138 GLY D N   1 
ATOM 7314  C CA  . GLY D 1 138 ? -10.242 8.538   -27.297 1.00 54.57  ? 138 GLY D CA  1 
ATOM 7315  C C   . GLY D 1 138 ? -11.478 9.033   -28.022 1.00 56.42  ? 138 GLY D C   1 
ATOM 7316  O O   . GLY D 1 138 ? -12.340 9.677   -27.412 1.00 55.47  ? 138 GLY D O   1 
ATOM 7317  N N   . ASP D 1 139 ? -11.575 8.734   -29.337 1.00 51.38  ? 139 ASP D N   1 
ATOM 7318  C CA  . ASP D 1 139 ? -12.740 9.096   -30.136 1.00 50.81  ? 139 ASP D CA  1 
ATOM 7319  C C   . ASP D 1 139 ? -13.955 8.365   -29.603 1.00 54.44  ? 139 ASP D C   1 
ATOM 7320  O O   . ASP D 1 139 ? -13.830 7.238   -29.138 1.00 55.16  ? 139 ASP D O   1 
ATOM 7321  C CB  . ASP D 1 139 ? -12.531 8.791   -31.631 1.00 52.87  ? 139 ASP D CB  1 
ATOM 7322  C CG  . ASP D 1 139 ? -11.523 9.680   -32.369 1.00 72.63  ? 139 ASP D CG  1 
ATOM 7323  O OD1 . ASP D 1 139 ? -11.270 10.823  -31.902 1.00 72.87  ? 139 ASP D OD1 1 
ATOM 7324  O OD2 . ASP D 1 139 ? -11.019 9.248   -33.440 1.00 83.26  ? 139 ASP D OD2 1 
ATOM 7325  N N   . PHE D 1 140 ? -15.113 9.021   -29.607 1.00 50.16  ? 140 PHE D N   1 
ATOM 7326  C CA  . PHE D 1 140 ? -16.340 8.423   -29.103 1.00 49.17  ? 140 PHE D CA  1 
ATOM 7327  C C   . PHE D 1 140 ? -16.948 7.483   -30.125 1.00 52.25  ? 140 PHE D C   1 
ATOM 7328  O O   . PHE D 1 140 ? -16.868 7.738   -31.314 1.00 52.20  ? 140 PHE D O   1 
ATOM 7329  C CB  . PHE D 1 140 ? -17.334 9.496   -28.659 1.00 50.58  ? 140 PHE D CB  1 
ATOM 7330  C CG  . PHE D 1 140 ? -16.847 10.243  -27.444 1.00 51.81  ? 140 PHE D CG  1 
ATOM 7331  C CD1 . PHE D 1 140 ? -16.344 11.532  -27.558 1.00 54.67  ? 140 PHE D CD1 1 
ATOM 7332  C CD2 . PHE D 1 140 ? -16.870 9.647   -26.185 1.00 54.67  ? 140 PHE D CD2 1 
ATOM 7333  C CE1 . PHE D 1 140 ? -15.899 12.229  -26.431 1.00 56.29  ? 140 PHE D CE1 1 
ATOM 7334  C CE2 . PHE D 1 140 ? -16.402 10.335  -25.058 1.00 58.02  ? 140 PHE D CE2 1 
ATOM 7335  C CZ  . PHE D 1 140 ? -15.915 11.622  -25.190 1.00 56.39  ? 140 PHE D CZ  1 
ATOM 7336  N N   . ALA D 1 141 ? -17.506 6.358   -29.653 1.00 49.16  ? 141 ALA D N   1 
ATOM 7337  C CA  . ALA D 1 141 ? -18.125 5.335   -30.506 1.00 47.93  ? 141 ALA D CA  1 
ATOM 7338  C C   . ALA D 1 141 ? -19.442 4.865   -29.931 1.00 50.23  ? 141 ALA D C   1 
ATOM 7339  O O   . ALA D 1 141 ? -19.581 4.779   -28.708 1.00 51.89  ? 141 ALA D O   1 
ATOM 7340  C CB  . ALA D 1 141 ? -17.183 4.145   -30.680 1.00 48.19  ? 141 ALA D CB  1 
ATOM 7341  N N   . VAL D 1 142 ? -20.403 4.564   -30.810 1.00 43.59  ? 142 VAL D N   1 
ATOM 7342  C CA  . VAL D 1 142 ? -21.718 4.038   -30.453 1.00 43.21  ? 142 VAL D CA  1 
ATOM 7343  C C   . VAL D 1 142 ? -21.897 2.687   -31.151 1.00 50.08  ? 142 VAL D C   1 
ATOM 7344  O O   . VAL D 1 142 ? -21.781 2.601   -32.378 1.00 51.70  ? 142 VAL D O   1 
ATOM 7345  C CB  . VAL D 1 142 ? -22.896 5.009   -30.757 1.00 45.94  ? 142 VAL D CB  1 
ATOM 7346  C CG1 . VAL D 1 142 ? -24.237 4.425   -30.303 1.00 44.75  ? 142 VAL D CG1 1 
ATOM 7347  C CG2 . VAL D 1 142 ? -22.661 6.375   -30.106 1.00 45.82  ? 142 VAL D CG2 1 
ATOM 7348  N N   . ALA D 1 143 ? -22.126 1.628   -30.360 1.00 45.73  ? 143 ALA D N   1 
ATOM 7349  C CA  . ALA D 1 143 ? -22.353 0.284   -30.874 1.00 45.41  ? 143 ALA D CA  1 
ATOM 7350  C C   . ALA D 1 143 ? -23.851 0.055   -30.975 1.00 49.43  ? 143 ALA D C   1 
ATOM 7351  O O   . ALA D 1 143 ? -24.593 0.380   -30.039 1.00 49.37  ? 143 ALA D O   1 
ATOM 7352  C CB  . ALA D 1 143 ? -21.693 -0.755  -29.969 1.00 46.24  ? 143 ALA D CB  1 
ATOM 7353  N N   . VAL D 1 144 ? -24.307 -0.412  -32.144 1.00 45.34  ? 144 VAL D N   1 
ATOM 7354  C CA  . VAL D 1 144 ? -25.713 -0.687  -32.411 1.00 43.88  ? 144 VAL D CA  1 
ATOM 7355  C C   . VAL D 1 144 ? -25.795 -2.119  -32.881 1.00 48.30  ? 144 VAL D C   1 
ATOM 7356  O O   . VAL D 1 144 ? -25.064 -2.529  -33.790 1.00 50.73  ? 144 VAL D O   1 
ATOM 7357  C CB  . VAL D 1 144 ? -26.382 0.301   -33.402 1.00 47.45  ? 144 VAL D CB  1 
ATOM 7358  C CG1 . VAL D 1 144 ? -27.877 0.029   -33.502 1.00 46.58  ? 144 VAL D CG1 1 
ATOM 7359  C CG2 . VAL D 1 144 ? -26.135 1.761   -33.008 1.00 47.30  ? 144 VAL D CG2 1 
ATOM 7360  N N   . GLY D 1 145 ? -26.642 -2.883  -32.219 1.00 41.89  ? 145 GLY D N   1 
ATOM 7361  C CA  . GLY D 1 145 ? -26.821 -4.289  -32.525 1.00 41.17  ? 145 GLY D CA  1 
ATOM 7362  C C   . GLY D 1 145 ? -27.999 -4.898  -31.813 1.00 45.11  ? 145 GLY D C   1 
ATOM 7363  O O   . GLY D 1 145 ? -28.793 -4.179  -31.205 1.00 41.89  ? 145 GLY D O   1 
ATOM 7364  N N   . ASN D 1 146 ? -28.080 -6.241  -31.848 1.00 46.70  ? 146 ASN D N   1 
ATOM 7365  C CA  . ASN D 1 146 ? -29.181 -7.026  -31.265 1.00 48.15  ? 146 ASN D CA  1 
ATOM 7366  C C   . ASN D 1 146 ? -28.701 -8.031  -30.163 1.00 50.29  ? 146 ASN D C   1 
ATOM 7367  O O   . ASN D 1 146 ? -28.953 -9.237  -30.286 1.00 47.76  ? 146 ASN D O   1 
ATOM 7368  C CB  . ASN D 1 146 ? -29.931 -7.764  -32.383 1.00 53.44  ? 146 ASN D CB  1 
ATOM 7369  C CG  . ASN D 1 146 ? -31.406 -7.860  -32.134 1.00 89.88  ? 146 ASN D CG  1 
ATOM 7370  O OD1 . ASN D 1 146 ? -32.213 -7.206  -32.806 1.00 85.54  ? 146 ASN D OD1 1 
ATOM 7371  N ND2 . ASN D 1 146 ? -31.790 -8.643  -31.136 1.00 84.03  ? 146 ASN D ND2 1 
ATOM 7372  N N   . PRO D 1 147 ? -28.084 -7.533  -29.046 1.00 47.49  ? 147 PRO D N   1 
ATOM 7373  C CA  . PRO D 1 147 ? -27.604 -8.445  -27.988 1.00 47.37  ? 147 PRO D CA  1 
ATOM 7374  C C   . PRO D 1 147 ? -28.679 -9.294  -27.332 1.00 53.12  ? 147 PRO D C   1 
ATOM 7375  O O   . PRO D 1 147 ? -29.760 -8.786  -27.000 1.00 53.72  ? 147 PRO D O   1 
ATOM 7376  C CB  . PRO D 1 147 ? -27.000 -7.502  -26.949 1.00 48.87  ? 147 PRO D CB  1 
ATOM 7377  C CG  . PRO D 1 147 ? -27.598 -6.184  -27.232 1.00 52.54  ? 147 PRO D CG  1 
ATOM 7378  C CD  . PRO D 1 147 ? -27.761 -6.135  -28.706 1.00 47.87  ? 147 PRO D CD  1 
ATOM 7379  N N   . PHE D 1 148 ? -28.372 -10.605 -27.166 1.00 49.97  ? 148 PHE D N   1 
ATOM 7380  C CA  . PHE D 1 148 ? -29.212 -11.630 -26.548 1.00 50.05  ? 148 PHE D CA  1 
ATOM 7381  C C   . PHE D 1 148 ? -30.652 -11.720 -27.171 1.00 54.02  ? 148 PHE D C   1 
ATOM 7382  O O   . PHE D 1 148 ? -31.568 -12.242 -26.542 1.00 54.09  ? 148 PHE D O   1 
ATOM 7383  C CB  . PHE D 1 148 ? -29.274 -11.391 -25.018 1.00 52.27  ? 148 PHE D CB  1 
ATOM 7384  C CG  . PHE D 1 148 ? -27.920 -11.215 -24.350 1.00 53.93  ? 148 PHE D CG  1 
ATOM 7385  C CD1 . PHE D 1 148 ? -27.576 -10.012 -23.742 1.00 57.75  ? 148 PHE D CD1 1 
ATOM 7386  C CD2 . PHE D 1 148 ? -26.997 -12.257 -24.316 1.00 54.83  ? 148 PHE D CD2 1 
ATOM 7387  C CE1 . PHE D 1 148 ? -26.333 -9.861  -23.103 1.00 58.08  ? 148 PHE D CE1 1 
ATOM 7388  C CE2 . PHE D 1 148 ? -25.756 -12.103 -23.687 1.00 56.98  ? 148 PHE D CE2 1 
ATOM 7389  C CZ  . PHE D 1 148 ? -25.438 -10.914 -23.075 1.00 55.52  ? 148 PHE D CZ  1 
ATOM 7390  N N   . GLY D 1 149 ? -30.811 -11.233 -28.402 1.00 51.06  ? 149 GLY D N   1 
ATOM 7391  C CA  . GLY D 1 149 ? -32.070 -11.249 -29.142 1.00 50.91  ? 149 GLY D CA  1 
ATOM 7392  C C   . GLY D 1 149 ? -33.144 -10.324 -28.615 1.00 53.92  ? 149 GLY D C   1 
ATOM 7393  O O   . GLY D 1 149 ? -34.336 -10.593 -28.794 1.00 53.93  ? 149 GLY D O   1 
ATOM 7394  N N   . LEU D 1 150 ? -32.740 -9.212  -28.004 1.00 49.86  ? 150 LEU D N   1 
ATOM 7395  C CA  . LEU D 1 150 ? -33.696 -8.312  -27.362 1.00 50.33  ? 150 LEU D CA  1 
ATOM 7396  C C   . LEU D 1 150 ? -34.379 -7.350  -28.310 1.00 54.24  ? 150 LEU D C   1 
ATOM 7397  O O   . LEU D 1 150 ? -35.507 -6.898  -28.047 1.00 56.05  ? 150 LEU D O   1 
ATOM 7398  C CB  . LEU D 1 150 ? -33.013 -7.473  -26.252 1.00 50.40  ? 150 LEU D CB  1 
ATOM 7399  C CG  . LEU D 1 150 ? -32.412 -8.195  -25.077 1.00 54.52  ? 150 LEU D CG  1 
ATOM 7400  C CD1 . LEU D 1 150 ? -31.527 -7.280  -24.317 1.00 55.21  ? 150 LEU D CD1 1 
ATOM 7401  C CD2 . LEU D 1 150 ? -33.465 -8.708  -24.177 1.00 56.64  ? 150 LEU D CD2 1 
ATOM 7402  N N   . GLY D 1 151 ? -33.662 -6.968  -29.339 1.00 47.34  ? 151 GLY D N   1 
ATOM 7403  C CA  . GLY D 1 151 ? -34.101 -5.926  -30.242 1.00 46.42  ? 151 GLY D CA  1 
ATOM 7404  C C   . GLY D 1 151 ? -32.977 -4.921  -30.308 1.00 49.70  ? 151 GLY D C   1 
ATOM 7405  O O   . GLY D 1 151 ? -32.017 -5.004  -29.528 1.00 49.08  ? 151 GLY D O   1 
ATOM 7406  N N   . GLN D 1 152 ? -33.069 -3.987  -31.251 1.00 46.11  ? 152 GLN D N   1 
ATOM 7407  C CA  . GLN D 1 152 ? -32.037 -2.988  -31.459 1.00 45.95  ? 152 GLN D CA  1 
ATOM 7408  C C   . GLN D 1 152 ? -31.663 -2.276  -30.142 1.00 53.19  ? 152 GLN D C   1 
ATOM 7409  O O   . GLN D 1 152 ? -32.516 -1.690  -29.438 1.00 54.31  ? 152 GLN D O   1 
ATOM 7410  C CB  . GLN D 1 152 ? -32.459 -1.988  -32.523 1.00 46.66  ? 152 GLN D CB  1 
ATOM 7411  C CG  . GLN D 1 152 ? -31.351 -1.019  -32.895 1.00 57.72  ? 152 GLN D CG  1 
ATOM 7412  C CD  . GLN D 1 152 ? -31.730 -0.186  -34.063 1.00 70.97  ? 152 GLN D CD  1 
ATOM 7413  O OE1 . GLN D 1 152 ? -31.363 -0.492  -35.198 1.00 69.78  ? 152 GLN D OE1 1 
ATOM 7414  N NE2 . GLN D 1 152 ? -32.505 0.855   -33.810 1.00 58.78  ? 152 GLN D NE2 1 
ATOM 7415  N N   . THR D 1 153 ? -30.360 -2.348  -29.841 1.00 48.83  ? 153 THR D N   1 
ATOM 7416  C CA  . THR D 1 153 ? -29.747 -1.787  -28.651 1.00 47.96  ? 153 THR D CA  1 
ATOM 7417  C C   . THR D 1 153 ? -28.572 -0.934  -29.049 1.00 51.22  ? 153 THR D C   1 
ATOM 7418  O O   . THR D 1 153 ? -27.752 -1.381  -29.838 1.00 51.88  ? 153 THR D O   1 
ATOM 7419  C CB  . THR D 1 153 ? -29.325 -2.931  -27.735 1.00 48.09  ? 153 THR D CB  1 
ATOM 7420  O OG1 . THR D 1 153 ? -30.498 -3.639  -27.311 1.00 55.14  ? 153 THR D OG1 1 
ATOM 7421  C CG2 . THR D 1 153 ? -28.458 -2.483  -26.562 1.00 37.86  ? 153 THR D CG2 1 
ATOM 7422  N N   . ALA D 1 154 ? -28.470 0.267   -28.464 1.00 46.02  ? 154 ALA D N   1 
ATOM 7423  C CA  . ALA D 1 154 ? -27.370 1.189   -28.666 1.00 44.92  ? 154 ALA D CA  1 
ATOM 7424  C C   . ALA D 1 154 ? -26.558 1.316   -27.372 1.00 49.31  ? 154 ALA D C   1 
ATOM 7425  O O   . ALA D 1 154 ? -27.123 1.492   -26.298 1.00 48.17  ? 154 ALA D O   1 
ATOM 7426  C CB  . ALA D 1 154 ? -27.901 2.545   -29.102 1.00 45.45  ? 154 ALA D CB  1 
ATOM 7427  N N   . THR D 1 155 ? -25.235 1.183   -27.464 1.00 46.42  ? 155 THR D N   1 
ATOM 7428  C CA  . THR D 1 155 ? -24.360 1.338   -26.299 1.00 45.78  ? 155 THR D CA  1 
ATOM 7429  C C   . THR D 1 155 ? -23.256 2.313   -26.696 1.00 48.41  ? 155 THR D C   1 
ATOM 7430  O O   . THR D 1 155 ? -22.919 2.406   -27.867 1.00 47.08  ? 155 THR D O   1 
ATOM 7431  C CB  . THR D 1 155 ? -23.849 -0.012  -25.759 1.00 47.77  ? 155 THR D CB  1 
ATOM 7432  O OG1 . THR D 1 155 ? -23.190 -0.737  -26.807 1.00 47.25  ? 155 THR D OG1 1 
ATOM 7433  C CG2 . THR D 1 155 ? -24.963 -0.852  -25.126 1.00 41.69  ? 155 THR D CG2 1 
ATOM 7434  N N   . SER D 1 156 ? -22.750 3.072   -25.742 1.00 45.10  ? 156 SER D N   1 
ATOM 7435  C CA  . SER D 1 156 ? -21.756 4.104   -25.967 1.00 45.83  ? 156 SER D CA  1 
ATOM 7436  C C   . SER D 1 156 ? -20.428 3.814   -25.239 1.00 50.35  ? 156 SER D C   1 
ATOM 7437  O O   . SER D 1 156 ? -20.397 3.230   -24.166 1.00 48.83  ? 156 SER D O   1 
ATOM 7438  C CB  . SER D 1 156 ? -22.310 5.452   -25.504 1.00 52.49  ? 156 SER D CB  1 
ATOM 7439  O OG  . SER D 1 156 ? -21.462 6.534   -25.864 1.00 69.96  ? 156 SER D OG  1 
ATOM 7440  N N   . GLY D 1 157 ? -19.349 4.277   -25.830 1.00 50.21  ? 157 GLY D N   1 
ATOM 7441  C CA  . GLY D 1 157 ? -18.005 4.144   -25.288 1.00 51.23  ? 157 GLY D CA  1 
ATOM 7442  C C   . GLY D 1 157 ? -17.001 4.945   -26.086 1.00 56.54  ? 157 GLY D C   1 
ATOM 7443  O O   . GLY D 1 157 ? -17.374 5.892   -26.793 1.00 58.04  ? 157 GLY D O   1 
ATOM 7444  N N   . ILE D 1 158 ? -15.728 4.573   -25.975 1.00 50.64  ? 158 ILE D N   1 
ATOM 7445  C CA  . ILE D 1 158 ? -14.642 5.229   -26.698 1.00 49.49  ? 158 ILE D CA  1 
ATOM 7446  C C   . ILE D 1 158 ? -13.880 4.214   -27.546 1.00 53.58  ? 158 ILE D C   1 
ATOM 7447  O O   . ILE D 1 158 ? -14.082 3.008   -27.406 1.00 53.88  ? 158 ILE D O   1 
ATOM 7448  C CB  . ILE D 1 158 ? -13.662 5.997   -25.754 1.00 51.46  ? 158 ILE D CB  1 
ATOM 7449  C CG1 . ILE D 1 158 ? -12.954 5.088   -24.734 1.00 50.15  ? 158 ILE D CG1 1 
ATOM 7450  C CG2 . ILE D 1 158 ? -14.295 7.227   -25.124 1.00 52.46  ? 158 ILE D CG2 1 
ATOM 7451  C CD1 . ILE D 1 158 ? -11.642 5.676   -24.133 1.00 46.30  ? 158 ILE D CD1 1 
ATOM 7452  N N   . VAL D 1 159 ? -12.992 4.717   -28.425 1.00 48.76  ? 159 VAL D N   1 
ATOM 7453  C CA  . VAL D 1 159 ? -12.051 3.894   -29.175 1.00 47.03  ? 159 VAL D CA  1 
ATOM 7454  C C   . VAL D 1 159 ? -10.914 3.685   -28.178 1.00 49.41  ? 159 VAL D C   1 
ATOM 7455  O O   . VAL D 1 159 ? -10.272 4.655   -27.744 1.00 48.70  ? 159 VAL D O   1 
ATOM 7456  C CB  . VAL D 1 159 ? -11.611 4.501   -30.537 1.00 49.66  ? 159 VAL D CB  1 
ATOM 7457  C CG1 . VAL D 1 159 ? -10.478 3.690   -31.161 1.00 48.25  ? 159 VAL D CG1 1 
ATOM 7458  C CG2 . VAL D 1 159 ? -12.795 4.611   -31.503 1.00 49.33  ? 159 VAL D CG2 1 
ATOM 7459  N N   . SER D 1 160 ? -10.779 2.440   -27.706 1.00 45.04  ? 160 SER D N   1 
ATOM 7460  C CA  . SER D 1 160 ? -9.813  2.029   -26.690 1.00 44.37  ? 160 SER D CA  1 
ATOM 7461  C C   . SER D 1 160 ? -8.430  1.759   -27.261 1.00 48.16  ? 160 SER D C   1 
ATOM 7462  O O   . SER D 1 160 ? -7.434  2.043   -26.585 1.00 49.21  ? 160 SER D O   1 
ATOM 7463  C CB  . SER D 1 160 ? -10.311 0.785   -25.973 1.00 46.82  ? 160 SER D CB  1 
ATOM 7464  O OG  . SER D 1 160 ? -11.435 1.119   -25.177 1.00 53.44  ? 160 SER D OG  1 
ATOM 7465  N N   . ALA D 1 161 ? -8.372  1.193   -28.486 1.00 42.31  ? 161 ALA D N   1 
ATOM 7466  C CA  . ALA D 1 161 ? -7.154  0.816   -29.199 1.00 42.41  ? 161 ALA D CA  1 
ATOM 7467  C C   . ALA D 1 161 ? -7.460  0.604   -30.667 1.00 49.60  ? 161 ALA D C   1 
ATOM 7468  O O   . ALA D 1 161 ? -8.627  0.488   -31.042 1.00 49.96  ? 161 ALA D O   1 
ATOM 7469  C CB  . ALA D 1 161 ? -6.561  -0.448  -28.605 1.00 43.13  ? 161 ALA D CB  1 
ATOM 7470  N N   . LEU D 1 162 ? -6.410  0.578   -31.506 1.00 46.80  ? 162 LEU D N   1 
ATOM 7471  C CA  . LEU D 1 162 ? -6.501  0.410   -32.957 1.00 45.79  ? 162 LEU D CA  1 
ATOM 7472  C C   . LEU D 1 162 ? -5.435  -0.544  -33.460 1.00 54.22  ? 162 LEU D C   1 
ATOM 7473  O O   . LEU D 1 162 ? -4.389  -0.698  -32.816 1.00 55.30  ? 162 LEU D O   1 
ATOM 7474  C CB  . LEU D 1 162 ? -6.339  1.776   -33.643 1.00 44.72  ? 162 LEU D CB  1 
ATOM 7475  C CG  . LEU D 1 162 ? -7.444  2.811   -33.392 1.00 46.16  ? 162 LEU D CG  1 
ATOM 7476  C CD1 . LEU D 1 162 ? -6.908  4.206   -33.524 1.00 44.79  ? 162 LEU D CD1 1 
ATOM 7477  C CD2 . LEU D 1 162 ? -8.686  2.539   -34.258 1.00 41.33  ? 162 LEU D CD2 1 
ATOM 7478  N N   . GLY D 1 163 ? -5.692  -1.163  -34.609 1.00 53.19  ? 163 GLY D N   1 
ATOM 7479  C CA  . GLY D 1 163 ? -4.767  -2.111  -35.231 1.00 53.95  ? 163 GLY D CA  1 
ATOM 7480  C C   . GLY D 1 163 ? -4.463  -3.343  -34.399 1.00 60.90  ? 163 GLY D C   1 
ATOM 7481  O O   . GLY D 1 163 ? -3.318  -3.810  -34.388 1.00 62.19  ? 163 GLY D O   1 
ATOM 7482  N N   . ARG D 1 164 ? -5.489  -3.878  -33.697 1.00 57.94  ? 164 ARG D N   1 
ATOM 7483  C CA  . ARG D 1 164 ? -5.360  -5.028  -32.807 1.00 58.12  ? 164 ARG D CA  1 
ATOM 7484  C C   . ARG D 1 164 ? -5.354  -6.333  -33.563 1.00 67.00  ? 164 ARG D C   1 
ATOM 7485  O O   . ARG D 1 164 ? -6.323  -6.668  -34.263 1.00 67.25  ? 164 ARG D O   1 
ATOM 7486  C CB  . ARG D 1 164 ? -6.468  -5.034  -31.748 1.00 54.53  ? 164 ARG D CB  1 
ATOM 7487  C CG  . ARG D 1 164 ? -6.191  -4.108  -30.565 1.00 55.87  ? 164 ARG D CG  1 
ATOM 7488  C CD  . ARG D 1 164 ? -5.091  -4.613  -29.666 1.00 52.43  ? 164 ARG D CD  1 
ATOM 7489  N NE  . ARG D 1 164 ? -5.305  -4.160  -28.297 1.00 63.38  ? 164 ARG D NE  1 
ATOM 7490  C CZ  . ARG D 1 164 ? -4.677  -3.140  -27.720 1.00 75.32  ? 164 ARG D CZ  1 
ATOM 7491  N NH1 . ARG D 1 164 ? -3.760  -2.450  -28.386 1.00 57.12  ? 164 ARG D NH1 1 
ATOM 7492  N NH2 . ARG D 1 164 ? -4.959  -2.804  -26.470 1.00 64.89  ? 164 ARG D NH2 1 
ATOM 7493  N N   . SER D 1 165 ? -4.264  -7.090  -33.394 1.00 66.80  ? 165 SER D N   1 
ATOM 7494  C CA  . SER D 1 165 ? -4.071  -8.381  -34.055 1.00 68.27  ? 165 SER D CA  1 
ATOM 7495  C C   . SER D 1 165 ? -3.543  -9.416  -33.042 1.00 75.89  ? 165 SER D C   1 
ATOM 7496  O O   . SER D 1 165 ? -3.511  -9.132  -31.833 1.00 76.84  ? 165 SER D O   1 
ATOM 7497  C CB  . SER D 1 165 ? -3.127  -8.224  -35.244 1.00 72.56  ? 165 SER D CB  1 
ATOM 7498  O OG  . SER D 1 165 ? -3.484  -7.125  -36.078 1.00 85.05  ? 165 SER D OG  1 
ATOM 7499  N N   . GLY D 1 166 ? -3.202  -10.612 -33.532 1.00 72.50  ? 166 GLY D N   1 
ATOM 7500  C CA  . GLY D 1 166 ? -2.675  -11.709 -32.728 1.00 72.00  ? 166 GLY D CA  1 
ATOM 7501  C C   . GLY D 1 166 ? -3.584  -12.173 -31.613 1.00 75.48  ? 166 GLY D C   1 
ATOM 7502  O O   . GLY D 1 166 ? -3.093  -12.626 -30.571 1.00 75.97  ? 166 GLY D O   1 
ATOM 7503  N N   . LEU D 1 167 ? -4.907  -12.059 -31.822 1.00 70.34  ? 167 LEU D N   1 
ATOM 7504  C CA  . LEU D 1 167 ? -5.910  -12.451 -30.829 1.00 69.87  ? 167 LEU D CA  1 
ATOM 7505  C C   . LEU D 1 167 ? -6.426  -13.857 -31.127 1.00 74.83  ? 167 LEU D C   1 
ATOM 7506  O O   . LEU D 1 167 ? -7.203  -14.415 -30.341 1.00 74.00  ? 167 LEU D O   1 
ATOM 7507  C CB  . LEU D 1 167 ? -7.079  -11.438 -30.774 1.00 69.59  ? 167 LEU D CB  1 
ATOM 7508  C CG  . LEU D 1 167 ? -6.741  -9.943  -30.815 1.00 74.92  ? 167 LEU D CG  1 
ATOM 7509  C CD1 . LEU D 1 167 ? -7.981  -9.105  -31.021 1.00 75.65  ? 167 LEU D CD1 1 
ATOM 7510  C CD2 . LEU D 1 167 ? -6.020  -9.483  -29.565 1.00 77.11  ? 167 LEU D CD2 1 
ATOM 7511  N N   . ASN D 1 168 ? -5.991  -14.421 -32.272 1.00 72.09  ? 168 ASN D N   1 
ATOM 7512  C CA  . ASN D 1 168 ? -6.362  -15.747 -32.777 1.00 72.10  ? 168 ASN D CA  1 
ATOM 7513  C C   . ASN D 1 168 ? -7.893  -15.923 -32.798 1.00 74.37  ? 168 ASN D C   1 
ATOM 7514  O O   . ASN D 1 168 ? -8.433  -16.965 -32.411 1.00 74.00  ? 168 ASN D O   1 
ATOM 7515  C CB  . ASN D 1 168 ? -5.639  -16.865 -31.998 1.00 76.69  ? 168 ASN D CB  1 
ATOM 7516  C CG  . ASN D 1 168 ? -4.236  -17.150 -32.516 1.00 106.80 ? 168 ASN D CG  1 
ATOM 7517  O OD1 . ASN D 1 168 ? -3.515  -16.267 -33.028 1.00 100.10 ? 168 ASN D OD1 1 
ATOM 7518  N ND2 . ASN D 1 168 ? -3.822  -18.405 -32.414 1.00 99.47  ? 168 ASN D ND2 1 
ATOM 7519  N N   . LEU D 1 169 ? -8.578  -14.873 -33.272 1.00 70.07  ? 169 LEU D N   1 
ATOM 7520  C CA  . LEU D 1 169 ? -10.035 -14.822 -33.430 1.00 68.91  ? 169 LEU D CA  1 
ATOM 7521  C C   . LEU D 1 169 ? -10.370 -15.072 -34.878 1.00 71.21  ? 169 LEU D C   1 
ATOM 7522  O O   . LEU D 1 169 ? -11.238 -15.884 -35.201 1.00 71.14  ? 169 LEU D O   1 
ATOM 7523  C CB  . LEU D 1 169 ? -10.573 -13.450 -32.985 1.00 68.74  ? 169 LEU D CB  1 
ATOM 7524  C CG  . LEU D 1 169 ? -10.460 -13.111 -31.496 1.00 73.99  ? 169 LEU D CG  1 
ATOM 7525  C CD1 . LEU D 1 169 ? -10.660 -11.628 -31.259 1.00 73.76  ? 169 LEU D CD1 1 
ATOM 7526  C CD2 . LEU D 1 169 ? -11.475 -13.908 -30.656 1.00 77.35  ? 169 LEU D CD2 1 
ATOM 7527  N N   . GLU D 1 170 ? -9.623  -14.388 -35.751 1.00 66.56  ? 170 GLU D N   1 
ATOM 7528  C CA  . GLU D 1 170 ? -9.748  -14.392 -37.199 1.00 65.22  ? 170 GLU D CA  1 
ATOM 7529  C C   . GLU D 1 170 ? -8.417  -14.691 -37.864 1.00 67.19  ? 170 GLU D C   1 
ATOM 7530  O O   . GLU D 1 170 ? -7.368  -14.549 -37.236 1.00 67.30  ? 170 GLU D O   1 
ATOM 7531  C CB  . GLU D 1 170 ? -10.246 -13.003 -37.638 1.00 65.95  ? 170 GLU D CB  1 
ATOM 7532  C CG  . GLU D 1 170 ? -11.633 -13.001 -38.224 1.00 71.06  ? 170 GLU D CG  1 
ATOM 7533  C CD  . GLU D 1 170 ? -12.704 -13.581 -37.328 1.00 85.94  ? 170 GLU D CD  1 
ATOM 7534  O OE1 . GLU D 1 170 ? -13.163 -12.868 -36.407 1.00 61.85  ? 170 GLU D OE1 1 
ATOM 7535  O OE2 . GLU D 1 170 ? -13.133 -14.727 -37.594 1.00 86.43  ? 170 GLU D OE2 1 
ATOM 7536  N N   . GLY D 1 171 ? -8.473  -15.089 -39.129 1.00 61.70  ? 171 GLY D N   1 
ATOM 7537  C CA  . GLY D 1 171 ? -7.284  -15.304 -39.939 1.00 60.35  ? 171 GLY D CA  1 
ATOM 7538  C C   . GLY D 1 171 ? -6.599  -13.974 -40.224 1.00 61.55  ? 171 GLY D C   1 
ATOM 7539  O O   . GLY D 1 171 ? -5.374  -13.872 -40.134 1.00 62.19  ? 171 GLY D O   1 
ATOM 7540  N N   . LEU D 1 172 ? -7.400  -12.928 -40.510 1.00 54.75  ? 172 LEU D N   1 
ATOM 7541  C CA  . LEU D 1 172 ? -6.950  -11.557 -40.773 1.00 53.36  ? 172 LEU D CA  1 
ATOM 7542  C C   . LEU D 1 172 ? -7.618  -10.610 -39.791 1.00 55.96  ? 172 LEU D C   1 
ATOM 7543  O O   . LEU D 1 172 ? -8.848  -10.520 -39.738 1.00 54.62  ? 172 LEU D O   1 
ATOM 7544  C CB  . LEU D 1 172 ? -7.264  -11.139 -42.225 1.00 53.27  ? 172 LEU D CB  1 
ATOM 7545  C CG  . LEU D 1 172 ? -6.766  -12.069 -43.340 1.00 56.57  ? 172 LEU D CG  1 
ATOM 7546  C CD1 . LEU D 1 172 ? -7.482  -11.769 -44.624 1.00 55.58  ? 172 LEU D CD1 1 
ATOM 7547  C CD2 . LEU D 1 172 ? -5.236  -12.009 -43.498 1.00 58.70  ? 172 LEU D CD2 1 
ATOM 7548  N N   . GLU D 1 173 ? -6.807  -9.931  -38.989 1.00 54.12  ? 173 GLU D N   1 
ATOM 7549  C CA  . GLU D 1 173 ? -7.267  -9.027  -37.934 1.00 55.14  ? 173 GLU D CA  1 
ATOM 7550  C C   . GLU D 1 173 ? -6.567  -7.686  -37.981 1.00 60.12  ? 173 GLU D C   1 
ATOM 7551  O O   . GLU D 1 173 ? -5.332  -7.615  -38.079 1.00 60.85  ? 173 GLU D O   1 
ATOM 7552  C CB  . GLU D 1 173 ? -6.999  -9.631  -36.531 1.00 57.13  ? 173 GLU D CB  1 
ATOM 7553  C CG  . GLU D 1 173 ? -7.468  -11.056 -36.272 1.00 70.38  ? 173 GLU D CG  1 
ATOM 7554  C CD  . GLU D 1 173 ? -6.992  -11.701 -34.979 1.00 91.18  ? 173 GLU D CD  1 
ATOM 7555  O OE1 . GLU D 1 173 ? -6.101  -11.138 -34.304 1.00 77.32  ? 173 GLU D OE1 1 
ATOM 7556  O OE2 . GLU D 1 173 ? -7.504  -12.794 -34.649 1.00 89.72  ? 173 GLU D OE2 1 
ATOM 7557  N N   . ASN D 1 174 ? -7.353  -6.623  -37.827 1.00 55.58  ? 174 ASN D N   1 
ATOM 7558  C CA  . ASN D 1 174 ? -6.875  -5.239  -37.729 1.00 54.99  ? 174 ASN D CA  1 
ATOM 7559  C C   . ASN D 1 174 ? -7.937  -4.469  -36.961 1.00 58.53  ? 174 ASN D C   1 
ATOM 7560  O O   . ASN D 1 174 ? -8.346  -3.367  -37.325 1.00 60.32  ? 174 ASN D O   1 
ATOM 7561  C CB  . ASN D 1 174 ? -6.592  -4.656  -39.110 1.00 54.10  ? 174 ASN D CB  1 
ATOM 7562  C CG  . ASN D 1 174 ? -5.955  -3.300  -39.104 1.00 63.71  ? 174 ASN D CG  1 
ATOM 7563  O OD1 . ASN D 1 174 ? -6.325  -2.424  -39.876 1.00 60.83  ? 174 ASN D OD1 1 
ATOM 7564  N ND2 . ASN D 1 174 ? -5.045  -3.074  -38.193 1.00 48.94  ? 174 ASN D ND2 1 
ATOM 7565  N N   . PHE D 1 175 ? -8.366  -5.078  -35.863 1.00 51.64  ? 175 PHE D N   1 
ATOM 7566  C CA  . PHE D 1 175 ? -9.467  -4.653  -35.033 1.00 49.87  ? 175 PHE D CA  1 
ATOM 7567  C C   . PHE D 1 175 ? -9.339  -3.305  -34.341 1.00 51.59  ? 175 PHE D C   1 
ATOM 7568  O O   . PHE D 1 175 ? -8.268  -2.914  -33.858 1.00 50.13  ? 175 PHE D O   1 
ATOM 7569  C CB  . PHE D 1 175 ? -9.703  -5.699  -33.943 1.00 51.10  ? 175 PHE D CB  1 
ATOM 7570  C CG  . PHE D 1 175 ? -10.288 -7.011  -34.417 1.00 52.46  ? 175 PHE D CG  1 
ATOM 7571  C CD1 . PHE D 1 175 ? -9.659  -8.216  -34.130 1.00 54.69  ? 175 PHE D CD1 1 
ATOM 7572  C CD2 . PHE D 1 175 ? -11.495 -7.046  -35.110 1.00 54.10  ? 175 PHE D CD2 1 
ATOM 7573  C CE1 . PHE D 1 175 ? -10.222 -9.429  -34.529 1.00 55.14  ? 175 PHE D CE1 1 
ATOM 7574  C CE2 . PHE D 1 175 ? -12.065 -8.266  -35.494 1.00 56.16  ? 175 PHE D CE2 1 
ATOM 7575  C CZ  . PHE D 1 175 ? -11.417 -9.446  -35.216 1.00 53.69  ? 175 PHE D CZ  1 
ATOM 7576  N N   . ILE D 1 176 ? -10.493 -2.625  -34.265 1.00 46.74  ? 176 ILE D N   1 
ATOM 7577  C CA  . ILE D 1 176 ? -10.744 -1.455  -33.435 1.00 46.04  ? 176 ILE D CA  1 
ATOM 7578  C C   . ILE D 1 176 ? -11.180 -2.045  -32.102 1.00 49.90  ? 176 ILE D C   1 
ATOM 7579  O O   . ILE D 1 176 ? -11.989 -2.985  -32.084 1.00 48.75  ? 176 ILE D O   1 
ATOM 7580  C CB  . ILE D 1 176 ? -11.829 -0.497  -34.026 1.00 49.14  ? 176 ILE D CB  1 
ATOM 7581  C CG1 . ILE D 1 176 ? -11.434 0.054   -35.407 1.00 49.33  ? 176 ILE D CG1 1 
ATOM 7582  C CG2 . ILE D 1 176 ? -12.189 0.645   -33.051 1.00 48.87  ? 176 ILE D CG2 1 
ATOM 7583  C CD1 . ILE D 1 176 ? -12.601 0.408   -36.202 1.00 50.17  ? 176 ILE D CD1 1 
ATOM 7584  N N   . GLN D 1 177 ? -10.619 -1.554  -31.003 1.00 47.33  ? 177 GLN D N   1 
ATOM 7585  C CA  . GLN D 1 177 ? -11.032 -2.010  -29.691 1.00 47.68  ? 177 GLN D CA  1 
ATOM 7586  C C   . GLN D 1 177 ? -11.887 -0.916  -29.039 1.00 50.24  ? 177 GLN D C   1 
ATOM 7587  O O   . GLN D 1 177 ? -11.530 0.251   -29.103 1.00 50.37  ? 177 GLN D O   1 
ATOM 7588  C CB  . GLN D 1 177 ? -9.822  -2.372  -28.837 1.00 49.24  ? 177 GLN D CB  1 
ATOM 7589  C CG  . GLN D 1 177 ? -10.195 -3.173  -27.591 1.00 47.91  ? 177 GLN D CG  1 
ATOM 7590  C CD  . GLN D 1 177 ? -8.971  -3.415  -26.777 1.00 60.37  ? 177 GLN D CD  1 
ATOM 7591  O OE1 . GLN D 1 177 ? -7.953  -3.903  -27.279 1.00 57.02  ? 177 GLN D OE1 1 
ATOM 7592  N NE2 . GLN D 1 177 ? -9.023  -3.046  -25.509 1.00 47.21  ? 177 GLN D NE2 1 
ATOM 7593  N N   . THR D 1 178 ? -13.023 -1.280  -28.455 1.00 46.17  ? 178 THR D N   1 
ATOM 7594  C CA  . THR D 1 178 ? -13.923 -0.299  -27.837 1.00 44.88  ? 178 THR D CA  1 
ATOM 7595  C C   . THR D 1 178 ? -14.433 -0.795  -26.483 1.00 48.37  ? 178 THR D C   1 
ATOM 7596  O O   . THR D 1 178 ? -14.506 -2.003  -26.247 1.00 46.25  ? 178 THR D O   1 
ATOM 7597  C CB  . THR D 1 178 ? -15.083 0.049   -28.807 1.00 46.43  ? 178 THR D CB  1 
ATOM 7598  O OG1 . THR D 1 178 ? -15.941 1.009   -28.215 1.00 49.71  ? 178 THR D OG1 1 
ATOM 7599  C CG2 . THR D 1 178 ? -15.887 -1.152  -29.240 1.00 41.13  ? 178 THR D CG2 1 
ATOM 7600  N N   . ASP D 1 179 ? -14.799 0.153   -25.601 1.00 47.37  ? 179 ASP D N   1 
ATOM 7601  C CA  . ASP D 1 179 ? -15.353 -0.190  -24.289 1.00 47.90  ? 179 ASP D CA  1 
ATOM 7602  C C   . ASP D 1 179 ? -16.887 -0.072  -24.294 1.00 52.75  ? 179 ASP D C   1 
ATOM 7603  O O   . ASP D 1 179 ? -17.519 -0.261  -23.249 1.00 53.23  ? 179 ASP D O   1 
ATOM 7604  C CB  . ASP D 1 179 ? -14.708 0.592   -23.130 1.00 49.32  ? 179 ASP D CB  1 
ATOM 7605  C CG  . ASP D 1 179 ? -14.968 2.073   -23.073 1.00 67.29  ? 179 ASP D CG  1 
ATOM 7606  O OD1 . ASP D 1 179 ? -15.273 2.662   -24.129 1.00 68.14  ? 179 ASP D OD1 1 
ATOM 7607  O OD2 . ASP D 1 179 ? -14.822 2.659   -21.971 1.00 79.90  ? 179 ASP D OD2 1 
ATOM 7608  N N   . ALA D 1 180 ? -17.484 0.172   -25.479 1.00 48.67  ? 180 ALA D N   1 
ATOM 7609  C CA  . ALA D 1 180 ? -18.936 0.170   -25.654 1.00 48.80  ? 180 ALA D CA  1 
ATOM 7610  C C   . ALA D 1 180 ? -19.397 -1.271  -25.408 1.00 54.85  ? 180 ALA D C   1 
ATOM 7611  O O   . ALA D 1 180 ? -18.745 -2.197  -25.910 1.00 56.39  ? 180 ALA D O   1 
ATOM 7612  C CB  . ALA D 1 180 ? -19.303 0.639   -27.061 1.00 49.11  ? 180 ALA D CB  1 
ATOM 7613  N N   . SER D 1 181 ? -20.428 -1.482  -24.571 1.00 50.12  ? 181 SER D N   1 
ATOM 7614  C CA  . SER D 1 181 ? -20.896 -2.831  -24.247 1.00 48.81  ? 181 SER D CA  1 
ATOM 7615  C C   . SER D 1 181 ? -21.318 -3.562  -25.492 1.00 51.56  ? 181 SER D C   1 
ATOM 7616  O O   . SER D 1 181 ? -22.208 -3.118  -26.199 1.00 53.61  ? 181 SER D O   1 
ATOM 7617  C CB  . SER D 1 181 ? -22.029 -2.796  -23.227 1.00 52.41  ? 181 SER D CB  1 
ATOM 7618  O OG  . SER D 1 181 ? -21.526 -2.324  -21.986 1.00 64.19  ? 181 SER D OG  1 
ATOM 7619  N N   . ILE D 1 182 ? -20.596 -4.631  -25.802 1.00 45.23  ? 182 ILE D N   1 
ATOM 7620  C CA  . ILE D 1 182 ? -20.802 -5.520  -26.936 1.00 43.74  ? 182 ILE D CA  1 
ATOM 7621  C C   . ILE D 1 182 ? -20.950 -6.918  -26.350 1.00 45.39  ? 182 ILE D C   1 
ATOM 7622  O O   . ILE D 1 182 ? -20.104 -7.364  -25.587 1.00 43.26  ? 182 ILE D O   1 
ATOM 7623  C CB  . ILE D 1 182 ? -19.671 -5.379  -27.996 1.00 46.96  ? 182 ILE D CB  1 
ATOM 7624  C CG1 . ILE D 1 182 ? -19.717 -3.979  -28.633 1.00 48.16  ? 182 ILE D CG1 1 
ATOM 7625  C CG2 . ILE D 1 182 ? -19.758 -6.448  -29.076 1.00 47.01  ? 182 ILE D CG2 1 
ATOM 7626  C CD1 . ILE D 1 182 ? -18.418 -3.550  -29.241 1.00 58.50  ? 182 ILE D CD1 1 
ATOM 7627  N N   . ASN D 1 183 ? -22.074 -7.557  -26.647 1.00 43.30  ? 183 ASN D N   1 
ATOM 7628  C CA  . ASN D 1 183 ? -22.445 -8.850  -26.134 1.00 43.51  ? 183 ASN D CA  1 
ATOM 7629  C C   . ASN D 1 183 ? -22.872 -9.753  -27.271 1.00 51.49  ? 183 ASN D C   1 
ATOM 7630  O O   . ASN D 1 183 ? -22.944 -9.285  -28.404 1.00 52.82  ? 183 ASN D O   1 
ATOM 7631  C CB  . ASN D 1 183 ? -23.581 -8.653  -25.127 1.00 36.63  ? 183 ASN D CB  1 
ATOM 7632  C CG  . ASN D 1 183 ? -23.113 -8.225  -23.765 1.00 47.37  ? 183 ASN D CG  1 
ATOM 7633  O OD1 . ASN D 1 183 ? -22.532 -9.001  -23.005 1.00 45.30  ? 183 ASN D OD1 1 
ATOM 7634  N ND2 . ASN D 1 183 ? -23.334 -6.969  -23.436 1.00 43.46  ? 183 ASN D ND2 1 
ATOM 7635  N N   . ARG D 1 184 ? -23.180 -11.037 -26.972 1.00 48.43  ? 184 ARG D N   1 
ATOM 7636  C CA  . ARG D 1 184 ? -23.696 -12.012 -27.933 1.00 47.62  ? 184 ARG D CA  1 
ATOM 7637  C C   . ARG D 1 184 ? -24.936 -11.434 -28.583 1.00 50.34  ? 184 ARG D C   1 
ATOM 7638  O O   . ARG D 1 184 ? -25.825 -10.987 -27.878 1.00 50.21  ? 184 ARG D O   1 
ATOM 7639  C CB  . ARG D 1 184 ? -23.997 -13.353 -27.244 1.00 48.95  ? 184 ARG D CB  1 
ATOM 7640  C CG  . ARG D 1 184 ? -22.753 -14.183 -26.978 1.00 66.94  ? 184 ARG D CG  1 
ATOM 7641  C CD  . ARG D 1 184 ? -23.097 -15.578 -26.500 1.00 89.79  ? 184 ARG D CD  1 
ATOM 7642  N NE  . ARG D 1 184 ? -23.497 -15.585 -25.094 1.00 107.34 ? 184 ARG D NE  1 
ATOM 7643  C CZ  . ARG D 1 184 ? -22.780 -16.115 -24.107 1.00 129.12 ? 184 ARG D CZ  1 
ATOM 7644  N NH1 . ARG D 1 184 ? -21.616 -16.705 -24.362 1.00 118.86 ? 184 ARG D NH1 1 
ATOM 7645  N NH2 . ARG D 1 184 ? -23.227 -16.071 -22.858 1.00 117.07 ? 184 ARG D NH2 1 
ATOM 7646  N N   . GLY D 1 185 ? -24.914 -11.352 -29.905 1.00 48.05  ? 185 GLY D N   1 
ATOM 7647  C CA  . GLY D 1 185 ? -25.967 -10.789 -30.738 1.00 48.02  ? 185 GLY D CA  1 
ATOM 7648  C C   . GLY D 1 185 ? -25.555 -9.515  -31.450 1.00 52.67  ? 185 GLY D C   1 
ATOM 7649  O O   . GLY D 1 185 ? -26.128 -9.173  -32.482 1.00 53.77  ? 185 GLY D O   1 
ATOM 7650  N N   . ASN D 1 186 ? -24.562 -8.802  -30.920 1.00 49.01  ? 186 ASN D N   1 
ATOM 7651  C CA  . ASN D 1 186 ? -24.071 -7.552  -31.492 1.00 49.19  ? 186 ASN D CA  1 
ATOM 7652  C C   . ASN D 1 186 ? -23.291 -7.771  -32.807 1.00 56.17  ? 186 ASN D C   1 
ATOM 7653  O O   . ASN D 1 186 ? -23.065 -6.813  -33.549 1.00 57.63  ? 186 ASN D O   1 
ATOM 7654  C CB  . ASN D 1 186 ? -23.198 -6.824  -30.471 1.00 47.85  ? 186 ASN D CB  1 
ATOM 7655  C CG  . ASN D 1 186 ? -23.929 -5.877  -29.539 1.00 50.32  ? 186 ASN D CG  1 
ATOM 7656  O OD1 . ASN D 1 186 ? -24.336 -4.782  -29.920 1.00 43.51  ? 186 ASN D OD1 1 
ATOM 7657  N ND2 . ASN D 1 186 ? -24.016 -6.220  -28.270 1.00 36.77  ? 186 ASN D ND2 1 
ATOM 7658  N N   . SER D 1 187 ? -22.903 -9.025  -33.089 1.00 53.71  ? 187 SER D N   1 
ATOM 7659  C CA  . SER D 1 187 ? -22.169 -9.502  -34.267 1.00 53.27  ? 187 SER D CA  1 
ATOM 7660  C C   . SER D 1 187 ? -22.791 -9.090  -35.615 1.00 57.27  ? 187 SER D C   1 
ATOM 7661  O O   . SER D 1 187 ? -23.917 -9.474  -35.932 1.00 57.25  ? 187 SER D O   1 
ATOM 7662  C CB  . SER D 1 187 ? -22.067 -11.022 -34.229 1.00 55.58  ? 187 SER D CB  1 
ATOM 7663  O OG  . SER D 1 187 ? -21.009 -11.451 -33.390 1.00 66.69  ? 187 SER D OG  1 
ATOM 7664  N N   . GLY D 1 188 ? -22.013 -8.369  -36.417 1.00 53.20  ? 188 GLY D N   1 
ATOM 7665  C CA  . GLY D 1 188 ? -22.431 -7.898  -37.736 1.00 52.73  ? 188 GLY D CA  1 
ATOM 7666  C C   . GLY D 1 188 ? -22.991 -6.493  -37.673 1.00 55.26  ? 188 GLY D C   1 
ATOM 7667  O O   . GLY D 1 188 ? -23.201 -5.853  -38.699 1.00 55.38  ? 188 GLY D O   1 
ATOM 7668  N N   . GLY D 1 189 ? -23.216 -6.025  -36.452 1.00 49.25  ? 189 GLY D N   1 
ATOM 7669  C CA  . GLY D 1 189 ? -23.744 -4.711  -36.155 1.00 47.44  ? 189 GLY D CA  1 
ATOM 7670  C C   . GLY D 1 189 ? -22.742 -3.608  -36.337 1.00 49.47  ? 189 GLY D C   1 
ATOM 7671  O O   . GLY D 1 189 ? -21.546 -3.844  -36.526 1.00 47.81  ? 189 GLY D O   1 
ATOM 7672  N N   . ALA D 1 190 ? -23.241 -2.393  -36.160 1.00 47.13  ? 190 ALA D N   1 
ATOM 7673  C CA  . ALA D 1 190 ? -22.542 -1.153  -36.386 1.00 47.67  ? 190 ALA D CA  1 
ATOM 7674  C C   . ALA D 1 190 ? -21.823 -0.578  -35.215 1.00 52.15  ? 190 ALA D C   1 
ATOM 7675  O O   . ALA D 1 190 ? -22.378 -0.463  -34.117 1.00 53.60  ? 190 ALA D O   1 
ATOM 7676  C CB  . ALA D 1 190 ? -23.532 -0.106  -36.884 1.00 48.77  ? 190 ALA D CB  1 
ATOM 7677  N N   . LEU D 1 191 ? -20.601 -0.114  -35.501 1.00 46.82  ? 191 LEU D N   1 
ATOM 7678  C CA  . LEU D 1 191 ? -19.812 0.726   -34.629 1.00 46.24  ? 191 LEU D CA  1 
ATOM 7679  C C   . LEU D 1 191 ? -19.789 2.096   -35.345 1.00 49.38  ? 191 LEU D C   1 
ATOM 7680  O O   . LEU D 1 191 ? -19.370 2.166   -36.500 1.00 49.52  ? 191 LEU D O   1 
ATOM 7681  C CB  . LEU D 1 191 ? -18.419 0.155   -34.330 1.00 45.80  ? 191 LEU D CB  1 
ATOM 7682  C CG  . LEU D 1 191 ? -17.669 0.883   -33.213 1.00 50.79  ? 191 LEU D CG  1 
ATOM 7683  C CD1 . LEU D 1 191 ? -18.283 0.603   -31.838 1.00 51.11  ? 191 LEU D CD1 1 
ATOM 7684  C CD2 . LEU D 1 191 ? -16.188 0.536   -33.236 1.00 53.09  ? 191 LEU D CD2 1 
ATOM 7685  N N   . LEU D 1 192 ? -20.345 3.134   -34.709 1.00 43.76  ? 192 LEU D N   1 
ATOM 7686  C CA  . LEU D 1 192 ? -20.502 4.461   -35.298 1.00 42.65  ? 192 LEU D CA  1 
ATOM 7687  C C   . LEU D 1 192 ? -19.759 5.560   -34.565 1.00 49.47  ? 192 LEU D C   1 
ATOM 7688  O O   . LEU D 1 192 ? -19.568 5.470   -33.355 1.00 48.24  ? 192 LEU D O   1 
ATOM 7689  C CB  . LEU D 1 192 ? -21.990 4.859   -35.296 1.00 41.62  ? 192 LEU D CB  1 
ATOM 7690  C CG  . LEU D 1 192 ? -23.014 3.846   -35.750 1.00 45.25  ? 192 LEU D CG  1 
ATOM 7691  C CD1 . LEU D 1 192 ? -24.387 4.285   -35.338 1.00 45.32  ? 192 LEU D CD1 1 
ATOM 7692  C CD2 . LEU D 1 192 ? -22.921 3.565   -37.257 1.00 44.87  ? 192 LEU D CD2 1 
ATOM 7693  N N   . ASN D 1 193 ? -19.447 6.662   -35.276 1.00 48.53  ? 193 ASN D N   1 
ATOM 7694  C CA  . ASN D 1 193 ? -18.875 7.850   -34.644 1.00 48.95  ? 193 ASN D CA  1 
ATOM 7695  C C   . ASN D 1 193 ? -20.031 8.775   -34.217 1.00 53.76  ? 193 ASN D C   1 
ATOM 7696  O O   . ASN D 1 193 ? -21.194 8.384   -34.358 1.00 52.86  ? 193 ASN D O   1 
ATOM 7697  C CB  . ASN D 1 193 ? -17.870 8.554   -35.545 1.00 50.76  ? 193 ASN D CB  1 
ATOM 7698  C CG  . ASN D 1 193 ? -18.380 9.034   -36.885 1.00 69.57  ? 193 ASN D CG  1 
ATOM 7699  O OD1 . ASN D 1 193 ? -19.569 9.280   -37.097 1.00 55.74  ? 193 ASN D OD1 1 
ATOM 7700  N ND2 . ASN D 1 193 ? -17.459 9.201   -37.820 1.00 65.28  ? 193 ASN D ND2 1 
ATOM 7701  N N   . LEU D 1 194 ? -19.720 9.987   -33.702 1.00 51.10  ? 194 LEU D N   1 
ATOM 7702  C CA  . LEU D 1 194 ? -20.741 10.939  -33.250 1.00 50.65  ? 194 LEU D CA  1 
ATOM 7703  C C   . LEU D 1 194 ? -21.558 11.574  -34.413 1.00 57.33  ? 194 LEU D C   1 
ATOM 7704  O O   . LEU D 1 194 ? -22.579 12.221  -34.155 1.00 58.52  ? 194 LEU D O   1 
ATOM 7705  C CB  . LEU D 1 194 ? -20.124 12.019  -32.354 1.00 50.37  ? 194 LEU D CB  1 
ATOM 7706  C CG  . LEU D 1 194 ? -19.597 11.523  -30.981 1.00 54.58  ? 194 LEU D CG  1 
ATOM 7707  C CD1 . LEU D 1 194 ? -18.998 12.635  -30.190 1.00 53.58  ? 194 LEU D CD1 1 
ATOM 7708  C CD2 . LEU D 1 194 ? -20.686 10.802  -30.159 1.00 56.58  ? 194 LEU D CD2 1 
ATOM 7709  N N   . ASN D 1 195 ? -21.162 11.335  -35.679 1.00 53.85  ? 195 ASN D N   1 
ATOM 7710  C CA  . ASN D 1 195 ? -21.888 11.798  -36.862 1.00 53.87  ? 195 ASN D CA  1 
ATOM 7711  C C   . ASN D 1 195 ? -22.790 10.695  -37.391 1.00 59.45  ? 195 ASN D C   1 
ATOM 7712  O O   . ASN D 1 195 ? -23.495 10.897  -38.396 1.00 61.00  ? 195 ASN D O   1 
ATOM 7713  C CB  . ASN D 1 195 ? -20.927 12.245  -37.972 1.00 57.13  ? 195 ASN D CB  1 
ATOM 7714  C CG  . ASN D 1 195 ? -20.230 13.551  -37.727 1.00 88.73  ? 195 ASN D CG  1 
ATOM 7715  O OD1 . ASN D 1 195 ? -20.810 14.515  -37.203 1.00 87.55  ? 195 ASN D OD1 1 
ATOM 7716  N ND2 . ASN D 1 195 ? -18.980 13.621  -38.158 1.00 82.45  ? 195 ASN D ND2 1 
ATOM 7717  N N   . GLY D 1 196 ? -22.746 9.531   -36.735 1.00 53.49  ? 196 GLY D N   1 
ATOM 7718  C CA  . GLY D 1 196 ? -23.541 8.374   -37.120 1.00 51.37  ? 196 GLY D CA  1 
ATOM 7719  C C   . GLY D 1 196 ? -22.996 7.670   -38.337 1.00 53.81  ? 196 GLY D C   1 
ATOM 7720  O O   . GLY D 1 196 ? -23.731 6.967   -39.026 1.00 53.38  ? 196 GLY D O   1 
ATOM 7721  N N   . GLU D 1 197 ? -21.700 7.851   -38.603 1.00 50.21  ? 197 GLU D N   1 
ATOM 7722  C CA  . GLU D 1 197 ? -21.002 7.226   -39.719 1.00 50.00  ? 197 GLU D CA  1 
ATOM 7723  C C   . GLU D 1 197 ? -20.364 5.947   -39.238 1.00 53.30  ? 197 GLU D C   1 
ATOM 7724  O O   . GLU D 1 197 ? -19.859 5.910   -38.106 1.00 51.46  ? 197 GLU D O   1 
ATOM 7725  C CB  . GLU D 1 197 ? -19.931 8.172   -40.312 1.00 51.41  ? 197 GLU D CB  1 
ATOM 7726  C CG  . GLU D 1 197 ? -20.491 9.450   -40.923 1.00 63.56  ? 197 GLU D CG  1 
ATOM 7727  C CD  . GLU D 1 197 ? -19.548 10.640  -41.028 1.00 88.35  ? 197 GLU D CD  1 
ATOM 7728  O OE1 . GLU D 1 197 ? -19.974 11.670  -41.596 1.00 105.92 ? 197 GLU D OE1 1 
ATOM 7729  O OE2 . GLU D 1 197 ? -18.402 10.565  -40.528 1.00 72.00  ? 197 GLU D OE2 1 
ATOM 7730  N N   . LEU D 1 198 ? -20.361 4.903   -40.101 1.00 49.39  ? 198 LEU D N   1 
ATOM 7731  C CA  . LEU D 1 198 ? -19.766 3.606   -39.797 1.00 49.02  ? 198 LEU D CA  1 
ATOM 7732  C C   . LEU D 1 198 ? -18.250 3.705   -39.651 1.00 53.84  ? 198 LEU D C   1 
ATOM 7733  O O   . LEU D 1 198 ? -17.563 4.176   -40.548 1.00 55.69  ? 198 LEU D O   1 
ATOM 7734  C CB  . LEU D 1 198 ? -20.127 2.578   -40.881 1.00 49.24  ? 198 LEU D CB  1 
ATOM 7735  C CG  . LEU D 1 198 ? -19.909 1.097   -40.531 1.00 54.46  ? 198 LEU D CG  1 
ATOM 7736  C CD1 . LEU D 1 198 ? -20.972 0.590   -39.565 1.00 54.66  ? 198 LEU D CD1 1 
ATOM 7737  C CD2 . LEU D 1 198 ? -19.924 0.233   -41.779 1.00 56.61  ? 198 LEU D CD2 1 
ATOM 7738  N N   . ILE D 1 199 ? -17.737 3.281   -38.508 1.00 50.30  ? 199 ILE D N   1 
ATOM 7739  C CA  . ILE D 1 199 ? -16.303 3.228   -38.259 1.00 50.08  ? 199 ILE D CA  1 
ATOM 7740  C C   . ILE D 1 199 ? -15.870 1.755   -38.149 1.00 54.08  ? 199 ILE D C   1 
ATOM 7741  O O   . ILE D 1 199 ? -14.690 1.460   -38.308 1.00 54.27  ? 199 ILE D O   1 
ATOM 7742  C CB  . ILE D 1 199 ? -15.830 4.080   -37.068 1.00 53.13  ? 199 ILE D CB  1 
ATOM 7743  C CG1 . ILE D 1 199 ? -16.530 3.692   -35.741 1.00 53.18  ? 199 ILE D CG1 1 
ATOM 7744  C CG2 . ILE D 1 199 ? -15.971 5.580   -37.415 1.00 54.53  ? 199 ILE D CG2 1 
ATOM 7745  C CD1 . ILE D 1 199 ? -15.820 4.190   -34.470 1.00 57.95  ? 199 ILE D CD1 1 
ATOM 7746  N N   . GLY D 1 200 ? -16.833 0.850   -37.958 1.00 48.63  ? 200 GLY D N   1 
ATOM 7747  C CA  . GLY D 1 200 ? -16.535 -0.564  -37.902 1.00 47.74  ? 200 GLY D CA  1 
ATOM 7748  C C   . GLY D 1 200 ? -17.722 -1.474  -37.784 1.00 51.87  ? 200 GLY D C   1 
ATOM 7749  O O   . GLY D 1 200 ? -18.840 -1.025  -37.526 1.00 51.76  ? 200 GLY D O   1 
ATOM 7750  N N   . ILE D 1 201 ? -17.460 -2.767  -37.967 1.00 50.01  ? 201 ILE D N   1 
ATOM 7751  C CA  . ILE D 1 201 ? -18.439 -3.834  -37.785 1.00 51.06  ? 201 ILE D CA  1 
ATOM 7752  C C   . ILE D 1 201 ? -18.049 -4.652  -36.536 1.00 54.31  ? 201 ILE D C   1 
ATOM 7753  O O   . ILE D 1 201 ? -16.999 -5.298  -36.531 1.00 53.52  ? 201 ILE D O   1 
ATOM 7754  C CB  . ILE D 1 201 ? -18.594 -4.740  -39.045 1.00 54.16  ? 201 ILE D CB  1 
ATOM 7755  C CG1 . ILE D 1 201 ? -19.050 -3.940  -40.299 1.00 54.51  ? 201 ILE D CG1 1 
ATOM 7756  C CG2 . ILE D 1 201 ? -19.498 -5.954  -38.752 1.00 53.23  ? 201 ILE D CG2 1 
ATOM 7757  C CD1 . ILE D 1 201 ? -20.532 -3.359  -40.309 1.00 60.50  ? 201 ILE D CD1 1 
ATOM 7758  N N   . ASN D 1 202 ? -18.910 -4.628  -35.501 1.00 50.57  ? 202 ASN D N   1 
ATOM 7759  C CA  . ASN D 1 202 ? -18.750 -5.372  -34.237 1.00 49.28  ? 202 ASN D CA  1 
ATOM 7760  C C   . ASN D 1 202 ? -18.676 -6.870  -34.531 1.00 50.04  ? 202 ASN D C   1 
ATOM 7761  O O   . ASN D 1 202 ? -19.608 -7.415  -35.117 1.00 47.56  ? 202 ASN D O   1 
ATOM 7762  C CB  . ASN D 1 202 ? -19.913 -5.060  -33.287 1.00 45.60  ? 202 ASN D CB  1 
ATOM 7763  C CG  . ASN D 1 202 ? -20.030 -3.608  -32.943 1.00 57.61  ? 202 ASN D CG  1 
ATOM 7764  O OD1 . ASN D 1 202 ? -21.133 -3.075  -32.718 1.00 66.61  ? 202 ASN D OD1 1 
ATOM 7765  N ND2 . ASN D 1 202 ? -18.893 -2.945  -32.859 1.00 37.55  ? 202 ASN D ND2 1 
ATOM 7766  N N   . THR D 1 203 ? -17.568 -7.519  -34.128 1.00 47.90  ? 203 THR D N   1 
ATOM 7767  C CA  . THR D 1 203 ? -17.291 -8.904  -34.481 1.00 48.92  ? 203 THR D CA  1 
ATOM 7768  C C   . THR D 1 203 ? -17.037 -9.865  -33.320 1.00 54.81  ? 203 THR D C   1 
ATOM 7769  O O   . THR D 1 203 ? -17.497 -11.018 -33.398 1.00 55.16  ? 203 THR D O   1 
ATOM 7770  C CB  . THR D 1 203 ? -16.058 -8.901  -35.397 1.00 55.55  ? 203 THR D CB  1 
ATOM 7771  O OG1 . THR D 1 203 ? -16.346 -8.021  -36.480 1.00 57.55  ? 203 THR D OG1 1 
ATOM 7772  C CG2 . THR D 1 203 ? -15.687 -10.291 -35.919 1.00 52.01  ? 203 THR D CG2 1 
ATOM 7773  N N   . ALA D 1 204 ? -16.216 -9.449  -32.319 1.00 50.19  ? 204 ALA D N   1 
ATOM 7774  C CA  . ALA D 1 204 ? -15.793 -10.335 -31.230 1.00 48.47  ? 204 ALA D CA  1 
ATOM 7775  C C   . ALA D 1 204 ? -15.589 -9.579  -29.933 1.00 52.32  ? 204 ALA D C   1 
ATOM 7776  O O   . ALA D 1 204 ? -15.523 -8.359  -29.940 1.00 52.95  ? 204 ALA D O   1 
ATOM 7777  C CB  . ALA D 1 204 ? -14.485 -11.030 -31.631 1.00 48.74  ? 204 ALA D CB  1 
ATOM 7778  N N   . ILE D 1 205 ? -15.457 -10.305 -28.819 1.00 49.37  ? 205 ILE D N   1 
ATOM 7779  C CA  . ILE D 1 205 ? -15.194 -9.720  -27.497 1.00 49.50  ? 205 ILE D CA  1 
ATOM 7780  C C   . ILE D 1 205 ? -14.227 -10.605 -26.688 1.00 54.27  ? 205 ILE D C   1 
ATOM 7781  O O   . ILE D 1 205 ? -14.082 -11.783 -26.987 1.00 52.98  ? 205 ILE D O   1 
ATOM 7782  C CB  . ILE D 1 205 ? -16.510 -9.457  -26.681 1.00 51.98  ? 205 ILE D CB  1 
ATOM 7783  C CG1 . ILE D 1 205 ? -17.219 -10.769 -26.234 1.00 50.66  ? 205 ILE D CG1 1 
ATOM 7784  C CG2 . ILE D 1 205 ? -17.464 -8.513  -27.409 1.00 53.10  ? 205 ILE D CG2 1 
ATOM 7785  C CD1 . ILE D 1 205 ? -18.316 -10.576 -25.214 1.00 44.58  ? 205 ILE D CD1 1 
ATOM 7786  N N   . LEU D 1 206 ? -13.554 -10.016 -25.687 1.00 53.39  ? 206 LEU D N   1 
ATOM 7787  C CA  . LEU D 1 206 ? -12.761 -10.720 -24.685 1.00 55.32  ? 206 LEU D CA  1 
ATOM 7788  C C   . LEU D 1 206 ? -13.614 -10.696 -23.440 1.00 64.28  ? 206 LEU D C   1 
ATOM 7789  O O   . LEU D 1 206 ? -13.941 -9.609  -22.944 1.00 63.38  ? 206 LEU D O   1 
ATOM 7790  C CB  . LEU D 1 206 ? -11.380 -10.112 -24.422 1.00 56.02  ? 206 LEU D CB  1 
ATOM 7791  C CG  . LEU D 1 206 ? -10.212 -10.448 -25.345 1.00 62.47  ? 206 LEU D CG  1 
ATOM 7792  C CD1 . LEU D 1 206 ? -8.914  -10.358 -24.589 1.00 62.94  ? 206 LEU D CD1 1 
ATOM 7793  C CD2 . LEU D 1 206 ? -10.329 -11.851 -25.964 1.00 67.52  ? 206 LEU D CD2 1 
ATOM 7794  N N   . ALA D 1 207 ? -14.095 -11.874 -23.012 1.00 64.08  ? 207 ALA D N   1 
ATOM 7795  C CA  . ALA D 1 207 ? -15.007 -11.984 -21.884 1.00 64.92  ? 207 ALA D CA  1 
ATOM 7796  C C   . ALA D 1 207 ? -14.777 -13.278 -21.113 1.00 71.49  ? 207 ALA D C   1 
ATOM 7797  O O   . ALA D 1 207 ? -15.151 -14.351 -21.605 1.00 71.96  ? 207 ALA D O   1 
ATOM 7798  C CB  . ALA D 1 207 ? -16.440 -11.934 -22.384 1.00 65.62  ? 207 ALA D CB  1 
ATOM 7799  N N   . PRO D 1 208 ? -14.213 -13.202 -19.884 1.00 67.99  ? 208 PRO D N   1 
ATOM 7800  C CA  . PRO D 1 208 ? -14.006 -14.437 -19.097 1.00 67.65  ? 208 PRO D CA  1 
ATOM 7801  C C   . PRO D 1 208 ? -15.290 -15.273 -18.903 1.00 72.25  ? 208 PRO D C   1 
ATOM 7802  O O   . PRO D 1 208 ? -15.242 -16.496 -19.040 1.00 71.67  ? 208 PRO D O   1 
ATOM 7803  C CB  . PRO D 1 208 ? -13.481 -13.919 -17.754 1.00 69.17  ? 208 PRO D CB  1 
ATOM 7804  C CG  . PRO D 1 208 ? -12.940 -12.560 -18.041 1.00 73.44  ? 208 PRO D CG  1 
ATOM 7805  C CD  . PRO D 1 208 ? -13.742 -12.000 -19.160 1.00 68.98  ? 208 PRO D CD  1 
ATOM 7806  N N   . GLY D 1 209 ? -16.422 -14.609 -18.635 1.00 68.72  ? 209 GLY D N   1 
ATOM 7807  C CA  . GLY D 1 209 ? -17.691 -15.283 -18.387 1.00 67.92  ? 209 GLY D CA  1 
ATOM 7808  C C   . GLY D 1 209 ? -18.799 -15.074 -19.398 1.00 71.92  ? 209 GLY D C   1 
ATOM 7809  O O   . GLY D 1 209 ? -19.967 -14.996 -19.008 1.00 72.41  ? 209 GLY D O   1 
ATOM 7810  N N   . GLY D 1 210 ? -18.443 -15.000 -20.684 1.00 66.91  ? 210 GLY D N   1 
ATOM 7811  C CA  . GLY D 1 210 ? -19.403 -14.859 -21.773 1.00 65.77  ? 210 GLY D CA  1 
ATOM 7812  C C   . GLY D 1 210 ? -20.140 -13.538 -21.907 1.00 68.05  ? 210 GLY D C   1 
ATOM 7813  O O   . GLY D 1 210 ? -20.949 -13.386 -22.825 1.00 70.56  ? 210 GLY D O   1 
ATOM 7814  N N   . GLY D 1 211 ? -19.878 -12.590 -21.008 1.00 58.85  ? 211 GLY D N   1 
ATOM 7815  C CA  . GLY D 1 211 ? -20.478 -11.264 -21.050 1.00 55.79  ? 211 GLY D CA  1 
ATOM 7816  C C   . GLY D 1 211 ? -19.438 -10.159 -21.113 1.00 54.74  ? 211 GLY D C   1 
ATOM 7817  O O   . GLY D 1 211 ? -18.314 -10.317 -20.613 1.00 52.87  ? 211 GLY D O   1 
ATOM 7818  N N   . SER D 1 212 ? -19.828 -9.007  -21.686 1.00 47.84  ? 212 SER D N   1 
ATOM 7819  C CA  . SER D 1 212 ? -18.999 -7.811  -21.834 1.00 45.47  ? 212 SER D CA  1 
ATOM 7820  C C   . SER D 1 212 ? -18.360 -7.339  -20.527 1.00 48.96  ? 212 SER D C   1 
ATOM 7821  O O   . SER D 1 212 ? -19.019 -7.228  -19.470 1.00 49.55  ? 212 SER D O   1 
ATOM 7822  C CB  . SER D 1 212 ? -19.819 -6.668  -22.419 1.00 47.05  ? 212 SER D CB  1 
ATOM 7823  O OG  . SER D 1 212 ? -19.015 -5.517  -22.625 1.00 54.03  ? 212 SER D OG  1 
ATOM 7824  N N   . VAL D 1 213 ? -17.056 -7.054  -20.627 1.00 44.89  ? 213 VAL D N   1 
ATOM 7825  C CA  . VAL D 1 213 ? -16.194 -6.533  -19.558 1.00 43.36  ? 213 VAL D CA  1 
ATOM 7826  C C   . VAL D 1 213 ? -15.530 -5.222  -20.059 1.00 47.00  ? 213 VAL D C   1 
ATOM 7827  O O   . VAL D 1 213 ? -14.605 -4.714  -19.419 1.00 47.31  ? 213 VAL D O   1 
ATOM 7828  C CB  . VAL D 1 213 ? -15.139 -7.571  -19.026 1.00 45.51  ? 213 VAL D CB  1 
ATOM 7829  C CG1 . VAL D 1 213 ? -15.803 -8.800  -18.413 1.00 44.24  ? 213 VAL D CG1 1 
ATOM 7830  C CG2 . VAL D 1 213 ? -14.115 -7.958  -20.090 1.00 44.93  ? 213 VAL D CG2 1 
ATOM 7831  N N   . GLY D 1 214 ? -16.007 -4.721  -21.205 1.00 42.71  ? 214 GLY D N   1 
ATOM 7832  C CA  . GLY D 1 214 ? -15.506 -3.525  -21.876 1.00 41.57  ? 214 GLY D CA  1 
ATOM 7833  C C   . GLY D 1 214 ? -14.353 -3.731  -22.839 1.00 45.21  ? 214 GLY D C   1 
ATOM 7834  O O   . GLY D 1 214 ? -13.624 -2.773  -23.105 1.00 47.73  ? 214 GLY D O   1 
ATOM 7835  N N   . ILE D 1 215 ? -14.154 -4.975  -23.364 1.00 39.44  ? 215 ILE D N   1 
ATOM 7836  C CA  . ILE D 1 215 ? -13.093 -5.294  -24.349 1.00 37.85  ? 215 ILE D CA  1 
ATOM 7837  C C   . ILE D 1 215 ? -13.768 -5.886  -25.599 1.00 40.23  ? 215 ILE D C   1 
ATOM 7838  O O   . ILE D 1 215 ? -13.936 -7.101  -25.700 1.00 40.44  ? 215 ILE D O   1 
ATOM 7839  C CB  . ILE D 1 215 ? -11.966 -6.230  -23.795 1.00 40.07  ? 215 ILE D CB  1 
ATOM 7840  C CG1 . ILE D 1 215 ? -11.474 -5.893  -22.354 1.00 40.14  ? 215 ILE D CG1 1 
ATOM 7841  C CG2 . ILE D 1 215 ? -10.827 -6.409  -24.802 1.00 38.73  ? 215 ILE D CG2 1 
ATOM 7842  C CD1 . ILE D 1 215 ? -10.574 -4.648  -22.202 1.00 54.55  ? 215 ILE D CD1 1 
ATOM 7843  N N   . GLY D 1 216 ? -14.197 -5.017  -26.503 1.00 37.33  ? 216 GLY D N   1 
ATOM 7844  C CA  . GLY D 1 216 ? -14.905 -5.391  -27.728 1.00 37.44  ? 216 GLY D CA  1 
ATOM 7845  C C   . GLY D 1 216 ? -14.114 -5.074  -28.974 1.00 43.04  ? 216 GLY D C   1 
ATOM 7846  O O   . GLY D 1 216 ? -13.343 -4.105  -28.977 1.00 43.51  ? 216 GLY D O   1 
ATOM 7847  N N   . PHE D 1 217 ? -14.294 -5.892  -30.039 1.00 39.43  ? 217 PHE D N   1 
ATOM 7848  C CA  . PHE D 1 217 ? -13.539 -5.748  -31.281 1.00 39.69  ? 217 PHE D CA  1 
ATOM 7849  C C   . PHE D 1 217 ? -14.434 -5.601  -32.500 1.00 44.28  ? 217 PHE D C   1 
ATOM 7850  O O   . PHE D 1 217 ? -15.408 -6.340  -32.675 1.00 43.93  ? 217 PHE D O   1 
ATOM 7851  C CB  . PHE D 1 217 ? -12.554 -6.924  -31.489 1.00 40.69  ? 217 PHE D CB  1 
ATOM 7852  C CG  . PHE D 1 217 ? -11.620 -7.092  -30.326 1.00 42.29  ? 217 PHE D CG  1 
ATOM 7853  C CD1 . PHE D 1 217 ? -10.521 -6.255  -30.166 1.00 45.65  ? 217 PHE D CD1 1 
ATOM 7854  C CD2 . PHE D 1 217 ? -11.850 -8.068  -29.370 1.00 45.73  ? 217 PHE D CD2 1 
ATOM 7855  C CE1 . PHE D 1 217 ? -9.664  -6.392  -29.072 1.00 47.18  ? 217 PHE D CE1 1 
ATOM 7856  C CE2 . PHE D 1 217 ? -10.990 -8.211  -28.280 1.00 49.33  ? 217 PHE D CE2 1 
ATOM 7857  C CZ  . PHE D 1 217 ? -9.906  -7.362  -28.131 1.00 47.30  ? 217 PHE D CZ  1 
ATOM 7858  N N   . ALA D 1 218 ? -14.049 -4.661  -33.361 1.00 40.83  ? 218 ALA D N   1 
ATOM 7859  C CA  . ALA D 1 218 ? -14.753 -4.368  -34.592 1.00 42.21  ? 218 ALA D CA  1 
ATOM 7860  C C   . ALA D 1 218 ? -13.812 -4.400  -35.778 1.00 46.61  ? 218 ALA D C   1 
ATOM 7861  O O   . ALA D 1 218 ? -12.689 -3.910  -35.674 1.00 45.95  ? 218 ALA D O   1 
ATOM 7862  C CB  . ALA D 1 218 ? -15.426 -2.996  -34.505 1.00 43.05  ? 218 ALA D CB  1 
ATOM 7863  N N   . ILE D 1 219 ? -14.270 -4.963  -36.906 1.00 44.28  ? 219 ILE D N   1 
ATOM 7864  C CA  . ILE D 1 219 ? -13.530 -4.926  -38.166 1.00 44.99  ? 219 ILE D CA  1 
ATOM 7865  C C   . ILE D 1 219 ? -13.613 -3.466  -38.647 1.00 52.30  ? 219 ILE D C   1 
ATOM 7866  O O   . ILE D 1 219 ? -14.740 -2.953  -38.748 1.00 52.20  ? 219 ILE D O   1 
ATOM 7867  C CB  . ILE D 1 219 ? -14.091 -5.914  -39.226 1.00 47.67  ? 219 ILE D CB  1 
ATOM 7868  C CG1 . ILE D 1 219 ? -13.984 -7.375  -38.760 1.00 47.10  ? 219 ILE D CG1 1 
ATOM 7869  C CG2 . ILE D 1 219 ? -13.369 -5.685  -40.576 1.00 49.35  ? 219 ILE D CG2 1 
ATOM 7870  C CD1 . ILE D 1 219 ? -14.956 -8.300  -39.401 1.00 55.81  ? 219 ILE D CD1 1 
ATOM 7871  N N   . PRO D 1 220 ? -12.485 -2.768  -38.922 1.00 49.97  ? 220 PRO D N   1 
ATOM 7872  C CA  . PRO D 1 220 ? -12.592 -1.353  -39.359 1.00 50.02  ? 220 PRO D CA  1 
ATOM 7873  C C   . PRO D 1 220 ? -13.360 -1.182  -40.671 1.00 56.83  ? 220 PRO D C   1 
ATOM 7874  O O   . PRO D 1 220 ? -13.333 -2.071  -41.524 1.00 57.33  ? 220 PRO D O   1 
ATOM 7875  C CB  . PRO D 1 220 ? -11.145 -0.877  -39.465 1.00 51.05  ? 220 PRO D CB  1 
ATOM 7876  C CG  . PRO D 1 220 ? -10.322 -2.074  -39.447 1.00 55.70  ? 220 PRO D CG  1 
ATOM 7877  C CD  . PRO D 1 220 ? -11.083 -3.211  -38.832 1.00 51.28  ? 220 PRO D CD  1 
ATOM 7878  N N   . SER D 1 221 ? -14.123 -0.074  -40.777 1.00 56.14  ? 221 SER D N   1 
ATOM 7879  C CA  . SER D 1 221 ? -14.994 0.280   -41.919 1.00 56.85  ? 221 SER D CA  1 
ATOM 7880  C C   . SER D 1 221 ? -14.266 0.235   -43.265 1.00 63.28  ? 221 SER D C   1 
ATOM 7881  O O   . SER D 1 221 ? -14.854 -0.248  -44.231 1.00 64.17  ? 221 SER D O   1 
ATOM 7882  C CB  . SER D 1 221 ? -15.621 1.663   -41.721 1.00 59.31  ? 221 SER D CB  1 
ATOM 7883  O OG  . SER D 1 221 ? -14.665 2.684   -41.459 1.00 60.31  ? 221 SER D OG  1 
ATOM 7884  N N   . ASN D 1 222 ? -12.991 0.701   -43.333 1.00 60.13  ? 222 ASN D N   1 
ATOM 7885  C CA  . ASN D 1 222 ? -12.215 0.693   -44.586 1.00 59.08  ? 222 ASN D CA  1 
ATOM 7886  C C   . ASN D 1 222 ? -12.001 -0.731  -45.073 1.00 63.88  ? 222 ASN D C   1 
ATOM 7887  O O   . ASN D 1 222 ? -12.182 -0.996  -46.257 1.00 64.23  ? 222 ASN D O   1 
ATOM 7888  C CB  . ASN D 1 222 ? -10.883 1.403   -44.425 1.00 54.39  ? 222 ASN D CB  1 
ATOM 7889  C CG  . ASN D 1 222 ? -10.932 2.901   -44.239 1.00 60.55  ? 222 ASN D CG  1 
ATOM 7890  O OD1 . ASN D 1 222 ? -9.889  3.536   -44.105 1.00 60.35  ? 222 ASN D OD1 1 
ATOM 7891  N ND2 . ASN D 1 222 ? -12.112 3.507   -44.163 1.00 45.35  ? 222 ASN D ND2 1 
ATOM 7892  N N   . MET D 1 223 ? -11.673 -1.650  -44.153 1.00 61.54  ? 223 MET D N   1 
ATOM 7893  C CA  . MET D 1 223 ? -11.490 -3.067  -44.438 1.00 62.41  ? 223 MET D CA  1 
ATOM 7894  C C   . MET D 1 223 ? -12.821 -3.692  -44.854 1.00 67.49  ? 223 MET D C   1 
ATOM 7895  O O   . MET D 1 223 ? -12.880 -4.398  -45.862 1.00 67.37  ? 223 MET D O   1 
ATOM 7896  C CB  . MET D 1 223 ? -10.907 -3.769  -43.210 1.00 65.56  ? 223 MET D CB  1 
ATOM 7897  C CG  . MET D 1 223 ? -10.610 -5.240  -43.436 1.00 70.55  ? 223 MET D CG  1 
ATOM 7898  S SD  . MET D 1 223 ? -9.658  -5.998  -42.102 1.00 75.27  ? 223 MET D SD  1 
ATOM 7899  C CE  . MET D 1 223 ? -8.104  -5.091  -42.294 1.00 72.64  ? 223 MET D CE  1 
ATOM 7900  N N   . ALA D 1 224 ? -13.890 -3.397  -44.103 1.00 64.92  ? 224 ALA D N   1 
ATOM 7901  C CA  . ALA D 1 224 ? -15.225 -3.905  -44.387 1.00 65.17  ? 224 ALA D CA  1 
ATOM 7902  C C   . ALA D 1 224 ? -15.749 -3.393  -45.750 1.00 68.84  ? 224 ALA D C   1 
ATOM 7903  O O   . ALA D 1 224 ? -16.292 -4.196  -46.513 1.00 68.65  ? 224 ALA D O   1 
ATOM 7904  C CB  . ALA D 1 224 ? -16.180 -3.516  -43.265 1.00 66.07  ? 224 ALA D CB  1 
ATOM 7905  N N   . ARG D 1 225 ? -15.551 -2.084  -46.067 1.00 64.26  ? 225 ARG D N   1 
ATOM 7906  C CA  . ARG D 1 225 ? -15.975 -1.444  -47.329 1.00 63.89  ? 225 ARG D CA  1 
ATOM 7907  C C   . ARG D 1 225 ? -15.295 -2.106  -48.550 1.00 64.13  ? 225 ARG D C   1 
ATOM 7908  O O   . ARG D 1 225 ? -15.982 -2.513  -49.484 1.00 62.73  ? 225 ARG D O   1 
ATOM 7909  C CB  . ARG D 1 225 ? -15.655 0.062   -47.298 1.00 67.54  ? 225 ARG D CB  1 
ATOM 7910  C CG  . ARG D 1 225 ? -16.377 0.901   -48.353 1.00 83.39  ? 225 ARG D CG  1 
ATOM 7911  C CD  . ARG D 1 225 ? -15.572 2.121   -48.775 1.00 97.35  ? 225 ARG D CD  1 
ATOM 7912  N NE  . ARG D 1 225 ? -15.497 3.158   -47.738 1.00 112.40 ? 225 ARG D NE  1 
ATOM 7913  C CZ  . ARG D 1 225 ? -14.385 3.477   -47.080 1.00 128.60 ? 225 ARG D CZ  1 
ATOM 7914  N NH1 . ARG D 1 225 ? -13.245 2.845   -47.340 1.00 123.32 ? 225 ARG D NH1 1 
ATOM 7915  N NH2 . ARG D 1 225 ? -14.401 4.435   -46.160 1.00 108.30 ? 225 ARG D NH2 1 
ATOM 7916  N N   . THR D 1 226 ? -13.961 -2.241  -48.514 1.00 59.32  ? 226 THR D N   1 
ATOM 7917  C CA  . THR D 1 226 ? -13.148 -2.864  -49.556 1.00 58.92  ? 226 THR D CA  1 
ATOM 7918  C C   . THR D 1 226 ? -13.596 -4.310  -49.817 1.00 66.61  ? 226 THR D C   1 
ATOM 7919  O O   . THR D 1 226 ? -13.811 -4.688  -50.973 1.00 66.51  ? 226 THR D O   1 
ATOM 7920  C CB  . THR D 1 226 ? -11.676 -2.803  -49.150 1.00 61.82  ? 226 THR D CB  1 
ATOM 7921  O OG1 . THR D 1 226 ? -11.330 -1.445  -48.908 1.00 61.73  ? 226 THR D OG1 1 
ATOM 7922  C CG2 . THR D 1 226 ? -10.745 -3.407  -50.198 1.00 62.05  ? 226 THR D CG2 1 
ATOM 7923  N N   . LEU D 1 227 ? -13.736 -5.117  -48.749 1.00 65.88  ? 227 LEU D N   1 
ATOM 7924  C CA  . LEU D 1 227 ? -14.151 -6.511  -48.873 1.00 66.31  ? 227 LEU D CA  1 
ATOM 7925  C C   . LEU D 1 227 ? -15.569 -6.594  -49.437 1.00 71.73  ? 227 LEU D C   1 
ATOM 7926  O O   . LEU D 1 227 ? -15.812 -7.414  -50.323 1.00 71.42  ? 227 LEU D O   1 
ATOM 7927  C CB  . LEU D 1 227 ? -14.023 -7.254  -47.534 1.00 66.74  ? 227 LEU D CB  1 
ATOM 7928  C CG  . LEU D 1 227 ? -12.579 -7.440  -47.019 1.00 72.14  ? 227 LEU D CG  1 
ATOM 7929  C CD1 . LEU D 1 227 ? -12.558 -7.695  -45.532 1.00 72.59  ? 227 LEU D CD1 1 
ATOM 7930  C CD2 . LEU D 1 227 ? -11.843 -8.539  -47.771 1.00 73.67  ? 227 LEU D CD2 1 
ATOM 7931  N N   . ALA D 1 228 ? -16.478 -5.690  -48.996 1.00 69.80  ? 228 ALA D N   1 
ATOM 7932  C CA  . ALA D 1 228 ? -17.854 -5.619  -49.501 1.00 70.29  ? 228 ALA D CA  1 
ATOM 7933  C C   . ALA D 1 228 ? -17.870 -5.350  -51.015 1.00 74.02  ? 228 ALA D C   1 
ATOM 7934  O O   . ALA D 1 228 ? -18.610 -6.028  -51.734 1.00 73.70  ? 228 ALA D O   1 
ATOM 7935  C CB  . ALA D 1 228 ? -18.637 -4.540  -48.770 1.00 71.32  ? 228 ALA D CB  1 
ATOM 7936  N N   . GLN D 1 229 ? -17.014 -4.407  -51.498 1.00 69.30  ? 229 GLN D N   1 
ATOM 7937  C CA  . GLN D 1 229 ? -16.896 -4.075  -52.925 1.00 68.10  ? 229 GLN D CA  1 
ATOM 7938  C C   . GLN D 1 229 ? -16.483 -5.291  -53.735 1.00 69.99  ? 229 GLN D C   1 
ATOM 7939  O O   . GLN D 1 229 ? -17.094 -5.549  -54.766 1.00 69.52  ? 229 GLN D O   1 
ATOM 7940  C CB  . GLN D 1 229 ? -15.923 -2.909  -53.185 1.00 68.83  ? 229 GLN D CB  1 
ATOM 7941  C CG  . GLN D 1 229 ? -16.627 -1.563  -53.422 1.00 86.76  ? 229 GLN D CG  1 
ATOM 7942  C CD  . GLN D 1 229 ? -17.736 -1.581  -54.468 1.00 102.59 ? 229 GLN D CD  1 
ATOM 7943  O OE1 . GLN D 1 229 ? -17.599 -2.148  -55.563 1.00 98.31  ? 229 GLN D OE1 1 
ATOM 7944  N NE2 . GLN D 1 229 ? -18.861 -0.937  -54.154 1.00 89.74  ? 229 GLN D NE2 1 
ATOM 7945  N N   . GLN D 1 230 ? -15.504 -6.072  -53.235 1.00 64.84  ? 230 GLN D N   1 
ATOM 7946  C CA  . GLN D 1 230 ? -15.031 -7.295  -53.891 1.00 64.25  ? 230 GLN D CA  1 
ATOM 7947  C C   . GLN D 1 230 ? -16.150 -8.322  -54.006 1.00 68.23  ? 230 GLN D C   1 
ATOM 7948  O O   . GLN D 1 230 ? -16.221 -9.034  -54.998 1.00 67.22  ? 230 GLN D O   1 
ATOM 7949  C CB  . GLN D 1 230 ? -13.835 -7.884  -53.135 1.00 65.48  ? 230 GLN D CB  1 
ATOM 7950  C CG  . GLN D 1 230 ? -12.528 -7.169  -53.457 1.00 79.40  ? 230 GLN D CG  1 
ATOM 7951  C CD  . GLN D 1 230 ? -11.414 -7.459  -52.487 1.00 93.85  ? 230 GLN D CD  1 
ATOM 7952  O OE1 . GLN D 1 230 ? -10.783 -6.543  -51.954 1.00 90.91  ? 230 GLN D OE1 1 
ATOM 7953  N NE2 . GLN D 1 230 ? -11.128 -8.728  -52.251 1.00 78.27  ? 230 GLN D NE2 1 
ATOM 7954  N N   . LEU D 1 231 ? -17.045 -8.379  -53.011 1.00 66.64  ? 231 LEU D N   1 
ATOM 7955  C CA  . LEU D 1 231 ? -18.164 -9.323  -53.022 1.00 66.47  ? 231 LEU D CA  1 
ATOM 7956  C C   . LEU D 1 231 ? -19.302 -8.830  -53.939 1.00 72.81  ? 231 LEU D C   1 
ATOM 7957  O O   . LEU D 1 231 ? -19.966 -9.668  -54.548 1.00 71.70  ? 231 LEU D O   1 
ATOM 7958  C CB  . LEU D 1 231 ? -18.685 -9.623  -51.602 1.00 65.91  ? 231 LEU D CB  1 
ATOM 7959  C CG  . LEU D 1 231 ? -17.677 -10.231 -50.599 1.00 69.49  ? 231 LEU D CG  1 
ATOM 7960  C CD1 . LEU D 1 231 ? -18.197 -10.142 -49.176 1.00 69.07  ? 231 LEU D CD1 1 
ATOM 7961  C CD2 . LEU D 1 231 ? -17.326 -11.669 -50.940 1.00 70.09  ? 231 LEU D CD2 1 
ATOM 7962  N N   . ILE D 1 232 ? -19.526 -7.496  -54.064 1.00 72.20  ? 232 ILE D N   1 
ATOM 7963  C CA  . ILE D 1 232 ? -20.571 -6.998  -54.975 1.00 73.18  ? 232 ILE D CA  1 
ATOM 7964  C C   . ILE D 1 232 ? -20.073 -7.200  -56.429 1.00 79.16  ? 232 ILE D C   1 
ATOM 7965  O O   . ILE D 1 232 ? -20.853 -7.632  -57.276 1.00 79.84  ? 232 ILE D O   1 
ATOM 7966  C CB  . ILE D 1 232 ? -21.106 -5.537  -54.718 1.00 76.76  ? 232 ILE D CB  1 
ATOM 7967  C CG1 . ILE D 1 232 ? -20.263 -4.427  -55.387 1.00 77.47  ? 232 ILE D CG1 1 
ATOM 7968  C CG2 . ILE D 1 232 ? -21.396 -5.226  -53.244 1.00 77.19  ? 232 ILE D CG2 1 
ATOM 7969  C CD1 . ILE D 1 232 ? -21.086 -3.150  -55.812 1.00 87.42  ? 232 ILE D CD1 1 
ATOM 7970  N N   . ASP D 1 233 ? -18.766 -6.967  -56.680 1.00 76.13  ? 233 ASP D N   1 
ATOM 7971  C CA  . ASP D 1 233 ? -18.124 -7.073  -57.988 1.00 76.79  ? 233 ASP D CA  1 
ATOM 7972  C C   . ASP D 1 233 ? -17.842 -8.506  -58.456 1.00 83.90  ? 233 ASP D C   1 
ATOM 7973  O O   . ASP D 1 233 ? -18.062 -8.780  -59.634 1.00 84.99  ? 233 ASP D O   1 
ATOM 7974  C CB  . ASP D 1 233 ? -16.776 -6.315  -58.006 1.00 78.50  ? 233 ASP D CB  1 
ATOM 7975  C CG  . ASP D 1 233 ? -16.821 -4.800  -57.850 1.00 87.73  ? 233 ASP D CG  1 
ATOM 7976  O OD1 . ASP D 1 233 ? -17.934 -4.225  -57.884 1.00 87.00  ? 233 ASP D OD1 1 
ATOM 7977  O OD2 . ASP D 1 233 ? -15.735 -4.185  -57.701 1.00 94.27  ? 233 ASP D OD2 1 
ATOM 7978  N N   . PHE D 1 234 ? -17.260 -9.386  -57.600 1.00 80.85  ? 234 PHE D N   1 
ATOM 7979  C CA  . PHE D 1 234 ? -16.828 -10.720 -58.045 1.00 80.67  ? 234 PHE D CA  1 
ATOM 7980  C C   . PHE D 1 234 ? -17.476 -11.904 -57.306 1.00 83.73  ? 234 PHE D C   1 
ATOM 7981  O O   . PHE D 1 234 ? -17.138 -13.055 -57.609 1.00 83.04  ? 234 PHE D O   1 
ATOM 7982  C CB  . PHE D 1 234 ? -15.292 -10.852 -57.936 1.00 82.88  ? 234 PHE D CB  1 
ATOM 7983  C CG  . PHE D 1 234 ? -14.495 -9.587  -58.156 1.00 85.42  ? 234 PHE D CG  1 
ATOM 7984  C CD1 . PHE D 1 234 ? -13.791 -9.002  -57.115 1.00 89.56  ? 234 PHE D CD1 1 
ATOM 7985  C CD2 . PHE D 1 234 ? -14.460 -8.974  -59.403 1.00 88.33  ? 234 PHE D CD2 1 
ATOM 7986  C CE1 . PHE D 1 234 ? -13.066 -7.822  -57.316 1.00 90.89  ? 234 PHE D CE1 1 
ATOM 7987  C CE2 . PHE D 1 234 ? -13.743 -7.792  -59.601 1.00 91.27  ? 234 PHE D CE2 1 
ATOM 7988  C CZ  . PHE D 1 234 ? -13.048 -7.226  -58.558 1.00 89.75  ? 234 PHE D CZ  1 
ATOM 7989  N N   . GLY D 1 235 ? -18.364 -11.631 -56.349 1.00 79.85  ? 235 GLY D N   1 
ATOM 7990  C CA  . GLY D 1 235 ? -19.051 -12.671 -55.582 1.00 80.00  ? 235 GLY D CA  1 
ATOM 7991  C C   . GLY D 1 235 ? -18.146 -13.518 -54.705 1.00 85.05  ? 235 GLY D C   1 
ATOM 7992  O O   . GLY D 1 235 ? -18.566 -14.551 -54.169 1.00 85.12  ? 235 GLY D O   1 
ATOM 7993  N N   . GLU D 1 236 ? -16.885 -13.069 -54.570 1.00 81.25  ? 236 GLU D N   1 
ATOM 7994  C CA  . GLU D 1 236 ? -15.789 -13.649 -53.792 1.00 80.42  ? 236 GLU D CA  1 
ATOM 7995  C C   . GLU D 1 236 ? -14.712 -12.592 -53.617 1.00 81.27  ? 236 GLU D C   1 
ATOM 7996  O O   . GLU D 1 236 ? -14.700 -11.598 -54.345 1.00 79.78  ? 236 GLU D O   1 
ATOM 7997  C CB  . GLU D 1 236 ? -15.215 -14.917 -54.458 1.00 81.97  ? 236 GLU D CB  1 
ATOM 7998  C CG  . GLU D 1 236 ? -14.682 -14.690 -55.866 1.00 93.97  ? 236 GLU D CG  1 
ATOM 7999  C CD  . GLU D 1 236 ? -13.852 -15.818 -56.439 1.00 117.96 ? 236 GLU D CD  1 
ATOM 8000  O OE1 . GLU D 1 236 ? -14.144 -17.000 -56.139 1.00 102.02 ? 236 GLU D OE1 1 
ATOM 8001  O OE2 . GLU D 1 236 ? -12.923 -15.514 -57.222 1.00 117.94 ? 236 GLU D OE2 1 
ATOM 8002  N N   . ILE D 1 237 ? -13.815 -12.804 -52.654 1.00 77.08  ? 237 ILE D N   1 
ATOM 8003  C CA  . ILE D 1 237 ? -12.724 -11.872 -52.403 1.00 76.96  ? 237 ILE D CA  1 
ATOM 8004  C C   . ILE D 1 237 ? -11.539 -12.212 -53.308 1.00 83.15  ? 237 ILE D C   1 
ATOM 8005  O O   . ILE D 1 237 ? -11.392 -13.356 -53.759 1.00 83.30  ? 237 ILE D O   1 
ATOM 8006  C CB  . ILE D 1 237 ? -12.304 -11.804 -50.897 1.00 79.47  ? 237 ILE D CB  1 
ATOM 8007  C CG1 . ILE D 1 237 ? -11.912 -13.186 -50.312 1.00 79.55  ? 237 ILE D CG1 1 
ATOM 8008  C CG2 . ILE D 1 237 ? -13.371 -11.099 -50.052 1.00 79.32  ? 237 ILE D CG2 1 
ATOM 8009  C CD1 . ILE D 1 237 ? -10.444 -13.664 -50.580 1.00 83.46  ? 237 ILE D CD1 1 
ATOM 8010  N N   . LYS D 1 238 ? -10.688 -11.208 -53.545 1.00 80.55  ? 238 LYS D N   1 
ATOM 8011  C CA  . LYS D 1 238 ? -9.459  -11.327 -54.320 1.00 80.30  ? 238 LYS D CA  1 
ATOM 8012  C C   . LYS D 1 238 ? -8.305  -10.985 -53.382 1.00 81.16  ? 238 LYS D C   1 
ATOM 8013  O O   . LYS D 1 238 ? -8.142  -9.838  -52.962 1.00 79.96  ? 238 LYS D O   1 
ATOM 8014  C CB  . LYS D 1 238 ? -9.515  -10.454 -55.585 1.00 83.85  ? 238 LYS D CB  1 
ATOM 8015  C CG  . LYS D 1 238 ? -10.322 -11.100 -56.711 1.00 95.94  ? 238 LYS D CG  1 
ATOM 8016  C CD  . LYS D 1 238 ? -10.325 -10.258 -57.965 1.00 104.65 ? 238 LYS D CD  1 
ATOM 8017  C CE  . LYS D 1 238 ? -11.201 -10.857 -59.037 1.00 114.32 ? 238 LYS D CE  1 
ATOM 8018  N NZ  . LYS D 1 238 ? -11.015 -10.168 -60.343 1.00 121.90 ? 238 LYS D NZ  1 
ATOM 8019  N N   . ARG D 1 239 ? -7.574  -12.028 -52.978 1.00 77.20  ? 239 ARG D N   1 
ATOM 8020  C CA  . ARG D 1 239 ? -6.484  -11.949 -52.010 1.00 76.59  ? 239 ARG D CA  1 
ATOM 8021  C C   . ARG D 1 239 ? -5.182  -11.463 -52.646 1.00 78.69  ? 239 ARG D C   1 
ATOM 8022  O O   . ARG D 1 239 ? -4.618  -12.144 -53.505 1.00 78.57  ? 239 ARG D O   1 
ATOM 8023  C CB  . ARG D 1 239 ? -6.277  -13.329 -51.359 1.00 75.87  ? 239 ARG D CB  1 
ATOM 8024  C CG  . ARG D 1 239 ? -5.706  -13.273 -49.952 1.00 82.17  ? 239 ARG D CG  1 
ATOM 8025  C CD  . ARG D 1 239 ? -6.772  -13.531 -48.912 1.00 85.04  ? 239 ARG D CD  1 
ATOM 8026  N NE  . ARG D 1 239 ? -7.598  -12.348 -48.684 1.00 86.62  ? 239 ARG D NE  1 
ATOM 8027  C CZ  . ARG D 1 239 ? -8.711  -12.347 -47.961 1.00 96.09  ? 239 ARG D CZ  1 
ATOM 8028  N NH1 . ARG D 1 239 ? -9.155  -13.473 -47.408 1.00 67.57  ? 239 ARG D NH1 1 
ATOM 8029  N NH2 . ARG D 1 239 ? -9.406  -11.228 -47.806 1.00 90.48  ? 239 ARG D NH2 1 
ATOM 8030  N N   . GLY D 1 240 ? -4.710  -10.306 -52.201 1.00 73.46  ? 240 GLY D N   1 
ATOM 8031  C CA  . GLY D 1 240 ? -3.462  -9.740  -52.688 1.00 72.92  ? 240 GLY D CA  1 
ATOM 8032  C C   . GLY D 1 240 ? -2.275  -10.168 -51.861 1.00 76.20  ? 240 GLY D C   1 
ATOM 8033  O O   . GLY D 1 240 ? -2.436  -10.479 -50.678 1.00 76.18  ? 240 GLY D O   1 
ATOM 8034  N N   . LEU D 1 241 ? -1.077  -10.225 -52.477 1.00 72.15  ? 241 LEU D N   1 
ATOM 8035  C CA  . LEU D 1 241 ? 0.146   -10.545 -51.734 1.00 71.29  ? 241 LEU D CA  1 
ATOM 8036  C C   . LEU D 1 241 ? 1.343   -9.735  -52.229 1.00 72.97  ? 241 LEU D C   1 
ATOM 8037  O O   . LEU D 1 241 ? 1.434   -9.412  -53.413 1.00 74.09  ? 241 LEU D O   1 
ATOM 8038  C CB  . LEU D 1 241 ? 0.488   -12.058 -51.635 1.00 71.15  ? 241 LEU D CB  1 
ATOM 8039  C CG  . LEU D 1 241 ? 0.870   -12.901 -52.844 1.00 75.72  ? 241 LEU D CG  1 
ATOM 8040  C CD1 . LEU D 1 241 ? 2.294   -12.666 -53.268 1.00 76.43  ? 241 LEU D CD1 1 
ATOM 8041  C CD2 . LEU D 1 241 ? 0.867   -14.337 -52.459 1.00 77.86  ? 241 LEU D CD2 1 
ATOM 8042  N N   . LEU D 1 242 ? 2.252   -9.403  -51.297 1.00 66.70  ? 242 LEU D N   1 
ATOM 8043  C CA  . LEU D 1 242 ? 3.497   -8.678  -51.563 1.00 65.32  ? 242 LEU D CA  1 
ATOM 8044  C C   . LEU D 1 242 ? 4.571   -9.598  -52.163 1.00 70.25  ? 242 LEU D C   1 
ATOM 8045  O O   . LEU D 1 242 ? 5.290   -9.177  -53.066 1.00 70.54  ? 242 LEU D O   1 
ATOM 8046  C CB  . LEU D 1 242 ? 4.054   -8.062  -50.269 1.00 64.46  ? 242 LEU D CB  1 
ATOM 8047  C CG  . LEU D 1 242 ? 3.417   -6.805  -49.721 1.00 67.55  ? 242 LEU D CG  1 
ATOM 8048  C CD1 . LEU D 1 242 ? 3.968   -6.502  -48.351 1.00 66.99  ? 242 LEU D CD1 1 
ATOM 8049  C CD2 . LEU D 1 242 ? 3.684   -5.619  -50.612 1.00 68.59  ? 242 LEU D CD2 1 
ATOM 8050  N N   . GLY D 1 243 ? 4.671   -10.822 -51.634 1.00 66.51  ? 243 GLY D N   1 
ATOM 8051  C CA  . GLY D 1 243 ? 5.683   -11.814 -51.977 1.00 66.54  ? 243 GLY D CA  1 
ATOM 8052  C C   . GLY D 1 243 ? 6.843   -11.694 -51.005 1.00 70.50  ? 243 GLY D C   1 
ATOM 8053  O O   . GLY D 1 243 ? 8.015   -11.764 -51.387 1.00 69.69  ? 243 GLY D O   1 
ATOM 8054  N N   . ILE D 1 244 ? 6.490   -11.482 -49.732 1.00 66.60  ? 244 ILE D N   1 
ATOM 8055  C CA  . ILE D 1 244 ? 7.366   -11.257 -48.597 1.00 65.94  ? 244 ILE D CA  1 
ATOM 8056  C C   . ILE D 1 244 ? 7.147   -12.345 -47.545 1.00 71.08  ? 244 ILE D C   1 
ATOM 8057  O O   . ILE D 1 244 ? 6.022   -12.816 -47.353 1.00 71.22  ? 244 ILE D O   1 
ATOM 8058  C CB  . ILE D 1 244 ? 7.018   -9.818  -48.066 1.00 68.87  ? 244 ILE D CB  1 
ATOM 8059  C CG1 . ILE D 1 244 ? 7.661   -8.706  -48.917 1.00 69.44  ? 244 ILE D CG1 1 
ATOM 8060  C CG2 . ILE D 1 244 ? 7.201   -9.577  -46.552 1.00 69.31  ? 244 ILE D CG2 1 
ATOM 8061  C CD1 . ILE D 1 244 ? 9.114   -8.860  -49.233 1.00 80.77  ? 244 ILE D CD1 1 
ATOM 8062  N N   . LYS D 1 245 ? 8.232   -12.753 -46.886 1.00 67.99  ? 245 LYS D N   1 
ATOM 8063  C CA  . LYS D 1 245 ? 8.215   -13.665 -45.752 1.00 68.01  ? 245 LYS D CA  1 
ATOM 8064  C C   . LYS D 1 245 ? 8.938   -12.960 -44.649 1.00 72.77  ? 245 LYS D C   1 
ATOM 8065  O O   . LYS D 1 245 ? 10.026  -12.426 -44.874 1.00 73.70  ? 245 LYS D O   1 
ATOM 8066  C CB  . LYS D 1 245 ? 8.816   -15.042 -46.064 1.00 70.11  ? 245 LYS D CB  1 
ATOM 8067  C CG  . LYS D 1 245 ? 7.749   -16.120 -46.264 1.00 84.95  ? 245 LYS D CG  1 
ATOM 8068  C CD  . LYS D 1 245 ? 8.320   -17.532 -46.132 1.00 98.32  ? 245 LYS D CD  1 
ATOM 8069  C CE  . LYS D 1 245 ? 8.534   -18.202 -47.465 1.00 110.95 ? 245 LYS D CE  1 
ATOM 8070  N NZ  . LYS D 1 245 ? 9.206   -19.519 -47.305 1.00 115.72 ? 245 LYS D NZ  1 
ATOM 8071  N N   . GLY D 1 246 ? 8.298   -12.862 -43.497 1.00 68.58  ? 246 GLY D N   1 
ATOM 8072  C CA  . GLY D 1 246 ? 8.895   -12.155 -42.375 1.00 67.24  ? 246 GLY D CA  1 
ATOM 8073  C C   . GLY D 1 246 ? 8.318   -12.435 -41.013 1.00 68.17  ? 246 GLY D C   1 
ATOM 8074  O O   . GLY D 1 246 ? 7.384   -13.226 -40.856 1.00 66.45  ? 246 GLY D O   1 
ATOM 8075  N N   . THR D 1 247 ? 8.918   -11.781 -40.021 1.00 63.98  ? 247 THR D N   1 
ATOM 8076  C CA  . THR D 1 247 ? 8.552   -11.853 -38.617 1.00 62.85  ? 247 THR D CA  1 
ATOM 8077  C C   . THR D 1 247 ? 8.225   -10.456 -38.112 1.00 66.74  ? 247 THR D C   1 
ATOM 8078  O O   . THR D 1 247 ? 8.351   -9.477  -38.841 1.00 65.64  ? 247 THR D O   1 
ATOM 8079  C CB  . THR D 1 247 ? 9.677   -12.500 -37.785 1.00 66.25  ? 247 THR D CB  1 
ATOM 8080  O OG1 . THR D 1 247 ? 10.887  -11.771 -37.930 1.00 65.09  ? 247 THR D OG1 1 
ATOM 8081  C CG2 . THR D 1 247 ? 9.870   -13.970 -38.081 1.00 64.72  ? 247 THR D CG2 1 
ATOM 8082  N N   . GLU D 1 248 ? 7.788   -10.375 -36.863 1.00 64.66  ? 248 GLU D N   1 
ATOM 8083  C CA  . GLU D 1 248 ? 7.503   -9.125  -36.193 1.00 64.32  ? 248 GLU D CA  1 
ATOM 8084  C C   . GLU D 1 248 ? 8.792   -8.406  -35.865 1.00 68.34  ? 248 GLU D C   1 
ATOM 8085  O O   . GLU D 1 248 ? 9.761   -9.012  -35.408 1.00 69.73  ? 248 GLU D O   1 
ATOM 8086  C CB  . GLU D 1 248 ? 6.697   -9.368  -34.901 1.00 65.32  ? 248 GLU D CB  1 
ATOM 8087  C CG  . GLU D 1 248 ? 5.227   -9.686  -35.139 1.00 75.06  ? 248 GLU D CG  1 
ATOM 8088  C CD  . GLU D 1 248 ? 4.334   -8.555  -35.634 1.00 83.71  ? 248 GLU D CD  1 
ATOM 8089  O OE1 . GLU D 1 248 ? 4.777   -7.380  -35.621 1.00 68.43  ? 248 GLU D OE1 1 
ATOM 8090  O OE2 . GLU D 1 248 ? 3.189   -8.853  -36.048 1.00 59.98  ? 248 GLU D OE2 1 
ATOM 8091  N N   . MET D 1 249 ? 8.797   -7.115  -36.106 1.00 63.50  ? 249 MET D N   1 
ATOM 8092  C CA  . MET D 1 249 ? 9.895   -6.244  -35.746 1.00 63.12  ? 249 MET D CA  1 
ATOM 8093  C C   . MET D 1 249 ? 9.837   -6.082  -34.226 1.00 67.57  ? 249 MET D C   1 
ATOM 8094  O O   . MET D 1 249 ? 8.743   -5.970  -33.671 1.00 67.79  ? 249 MET D O   1 
ATOM 8095  C CB  . MET D 1 249 ? 9.764   -4.901  -36.519 1.00 65.05  ? 249 MET D CB  1 
ATOM 8096  C CG  . MET D 1 249 ? 10.750  -3.802  -36.136 1.00 67.92  ? 249 MET D CG  1 
ATOM 8097  S SD  . MET D 1 249 ? 12.517  -4.200  -36.000 1.00 71.93  ? 249 MET D SD  1 
ATOM 8098  C CE  . MET D 1 249 ? 12.721  -5.372  -37.242 1.00 67.79  ? 249 MET D CE  1 
ATOM 8099  N N   . SER D 1 250 ? 10.988  -6.144  -33.554 1.00 64.79  ? 250 SER D N   1 
ATOM 8100  C CA  . SER D 1 250 ? 11.035  -6.039  -32.100 1.00 65.12  ? 250 SER D CA  1 
ATOM 8101  C C   . SER D 1 250 ? 12.024  -4.977  -31.639 1.00 69.25  ? 250 SER D C   1 
ATOM 8102  O O   . SER D 1 250 ? 12.846  -4.508  -32.429 1.00 69.02  ? 250 SER D O   1 
ATOM 8103  C CB  . SER D 1 250 ? 11.404  -7.393  -31.487 1.00 69.12  ? 250 SER D CB  1 
ATOM 8104  O OG  . SER D 1 250 ? 12.698  -7.845  -31.864 1.00 75.10  ? 250 SER D OG  1 
ATOM 8105  N N   . ALA D 1 251 ? 11.956  -4.630  -30.339 1.00 66.09  ? 251 ALA D N   1 
ATOM 8106  C CA  . ALA D 1 251 ? 12.871  -3.701  -29.673 1.00 66.16  ? 251 ALA D CA  1 
ATOM 8107  C C   . ALA D 1 251 ? 14.284  -4.277  -29.670 1.00 72.02  ? 251 ALA D C   1 
ATOM 8108  O O   . ALA D 1 251 ? 15.254  -3.525  -29.639 1.00 72.12  ? 251 ALA D O   1 
ATOM 8109  C CB  . ALA D 1 251 ? 12.407  -3.438  -28.246 1.00 66.48  ? 251 ALA D CB  1 
ATOM 8110  N N   . ASP D 1 252 ? 14.386  -5.614  -29.721 1.00 69.99  ? 252 ASP D N   1 
ATOM 8111  C CA  . ASP D 1 252 ? 15.631  -6.377  -29.713 1.00 70.59  ? 252 ASP D CA  1 
ATOM 8112  C C   . ASP D 1 252 ? 16.367  -6.210  -31.046 1.00 72.88  ? 252 ASP D C   1 
ATOM 8113  O O   . ASP D 1 252 ? 17.568  -5.912  -31.031 1.00 71.88  ? 252 ASP D O   1 
ATOM 8114  C CB  . ASP D 1 252 ? 15.339  -7.852  -29.395 1.00 73.19  ? 252 ASP D CB  1 
ATOM 8115  C CG  . ASP D 1 252 ? 14.484  -8.010  -28.148 1.00 89.15  ? 252 ASP D CG  1 
ATOM 8116  O OD1 . ASP D 1 252 ? 14.960  -7.638  -27.056 1.00 88.36  ? 252 ASP D OD1 1 
ATOM 8117  O OD2 . ASP D 1 252 ? 13.306  -8.438  -28.280 1.00 100.25 ? 252 ASP D OD2 1 
ATOM 8118  N N   . ILE D 1 253 ? 15.644  -6.341  -32.190 1.00 67.66  ? 253 ILE D N   1 
ATOM 8119  C CA  . ILE D 1 253 ? 16.225  -6.103  -33.514 1.00 66.81  ? 253 ILE D CA  1 
ATOM 8120  C C   . ILE D 1 253 ? 16.675  -4.643  -33.569 1.00 70.15  ? 253 ILE D C   1 
ATOM 8121  O O   . ILE D 1 253 ? 17.816  -4.377  -33.935 1.00 70.11  ? 253 ILE D O   1 
ATOM 8122  C CB  . ILE D 1 253 ? 15.253  -6.437  -34.688 1.00 69.83  ? 253 ILE D CB  1 
ATOM 8123  C CG1 . ILE D 1 253 ? 14.522  -7.797  -34.546 1.00 70.94  ? 253 ILE D CG1 1 
ATOM 8124  C CG2 . ILE D 1 253 ? 15.932  -6.307  -36.048 1.00 69.87  ? 253 ILE D CG2 1 
ATOM 8125  C CD1 . ILE D 1 253 ? 15.392  -9.067  -34.543 1.00 80.75  ? 253 ILE D CD1 1 
ATOM 8126  N N   . ALA D 1 254 ? 15.788  -3.717  -33.145 1.00 66.18  ? 254 ALA D N   1 
ATOM 8127  C CA  . ALA D 1 254 ? 16.023  -2.274  -33.120 1.00 65.96  ? 254 ALA D CA  1 
ATOM 8128  C C   . ALA D 1 254 ? 17.285  -1.908  -32.343 1.00 70.20  ? 254 ALA D C   1 
ATOM 8129  O O   . ALA D 1 254 ? 18.090  -1.143  -32.871 1.00 71.89  ? 254 ALA D O   1 
ATOM 8130  C CB  . ALA D 1 254 ? 14.822  -1.536  -32.541 1.00 66.51  ? 254 ALA D CB  1 
ATOM 8131  N N   . LYS D 1 255 ? 17.481  -2.462  -31.126 1.00 64.72  ? 255 LYS D N   1 
ATOM 8132  C CA  . LYS D 1 255 ? 18.660  -2.182  -30.281 1.00 63.60  ? 255 LYS D CA  1 
ATOM 8133  C C   . LYS D 1 255 ? 19.944  -2.666  -30.951 1.00 69.49  ? 255 LYS D C   1 
ATOM 8134  O O   . LYS D 1 255 ? 20.932  -1.921  -30.986 1.00 69.19  ? 255 LYS D O   1 
ATOM 8135  C CB  . LYS D 1 255 ? 18.526  -2.808  -28.882 1.00 63.78  ? 255 LYS D CB  1 
ATOM 8136  C CG  . LYS D 1 255 ? 18.157  -1.801  -27.801 1.00 70.70  ? 255 LYS D CG  1 
ATOM 8137  C CD  . LYS D 1 255 ? 17.585  -2.501  -26.576 1.00 85.28  ? 255 LYS D CD  1 
ATOM 8138  C CE  . LYS D 1 255 ? 16.461  -1.732  -25.916 1.00 91.54  ? 255 LYS D CE  1 
ATOM 8139  N NZ  . LYS D 1 255 ? 15.415  -2.644  -25.359 1.00 79.69  ? 255 LYS D NZ  1 
ATOM 8140  N N   . ALA D 1 256 ? 19.904  -3.890  -31.522 1.00 67.04  ? 256 ALA D N   1 
ATOM 8141  C CA  . ALA D 1 256 ? 21.027  -4.531  -32.200 1.00 67.07  ? 256 ALA D CA  1 
ATOM 8142  C C   . ALA D 1 256 ? 21.545  -3.715  -33.384 1.00 73.02  ? 256 ALA D C   1 
ATOM 8143  O O   . ALA D 1 256 ? 22.751  -3.708  -33.623 1.00 74.19  ? 256 ALA D O   1 
ATOM 8144  C CB  . ALA D 1 256 ? 20.622  -5.912  -32.671 1.00 67.79  ? 256 ALA D CB  1 
ATOM 8145  N N   . PHE D 1 257 ? 20.658  -3.010  -34.102 1.00 69.72  ? 257 PHE D N   1 
ATOM 8146  C CA  . PHE D 1 257 ? 21.033  -2.240  -35.292 1.00 69.45  ? 257 PHE D CA  1 
ATOM 8147  C C   . PHE D 1 257 ? 20.882  -0.721  -35.120 1.00 73.35  ? 257 PHE D C   1 
ATOM 8148  O O   . PHE D 1 257 ? 20.876  0.003   -36.121 1.00 72.57  ? 257 PHE D O   1 
ATOM 8149  C CB  . PHE D 1 257 ? 20.215  -2.725  -36.496 1.00 71.27  ? 257 PHE D CB  1 
ATOM 8150  C CG  . PHE D 1 257 ? 20.388  -4.205  -36.754 1.00 73.19  ? 257 PHE D CG  1 
ATOM 8151  C CD1 . PHE D 1 257 ? 19.285  -5.050  -36.821 1.00 76.45  ? 257 PHE D CD1 1 
ATOM 8152  C CD2 . PHE D 1 257 ? 21.658  -4.765  -36.879 1.00 75.55  ? 257 PHE D CD2 1 
ATOM 8153  C CE1 . PHE D 1 257 ? 19.447  -6.426  -37.043 1.00 77.34  ? 257 PHE D CE1 1 
ATOM 8154  C CE2 . PHE D 1 257 ? 21.819  -6.137  -37.094 1.00 78.19  ? 257 PHE D CE2 1 
ATOM 8155  C CZ  . PHE D 1 257 ? 20.713  -6.956  -37.174 1.00 76.41  ? 257 PHE D CZ  1 
ATOM 8156  N N   . ASN D 1 258 ? 20.814  -0.245  -33.854 1.00 70.50  ? 258 ASN D N   1 
ATOM 8157  C CA  . ASN D 1 258 ? 20.705  1.162   -33.450 1.00 70.75  ? 258 ASN D CA  1 
ATOM 8158  C C   . ASN D 1 258 ? 19.602  1.903   -34.235 1.00 76.51  ? 258 ASN D C   1 
ATOM 8159  O O   . ASN D 1 258 ? 19.844  2.994   -34.771 1.00 76.85  ? 258 ASN D O   1 
ATOM 8160  C CB  . ASN D 1 258 ? 22.056  1.868   -33.611 1.00 72.20  ? 258 ASN D CB  1 
ATOM 8161  C CG  . ASN D 1 258 ? 22.381  2.806   -32.477 1.00 92.50  ? 258 ASN D CG  1 
ATOM 8162  O OD1 . ASN D 1 258 ? 21.786  3.885   -32.314 1.00 83.90  ? 258 ASN D OD1 1 
ATOM 8163  N ND2 . ASN D 1 258 ? 23.344  2.416   -31.670 1.00 83.45  ? 258 ASN D ND2 1 
ATOM 8164  N N   . LEU D 1 259 ? 18.391  1.298   -34.302 1.00 73.64  ? 259 LEU D N   1 
ATOM 8165  C CA  . LEU D 1 259 ? 17.237  1.840   -35.029 1.00 73.74  ? 259 LEU D CA  1 
ATOM 8166  C C   . LEU D 1 259 ? 16.274  2.543   -34.085 1.00 80.22  ? 259 LEU D C   1 
ATOM 8167  O O   . LEU D 1 259 ? 16.225  2.221   -32.899 1.00 80.37  ? 259 LEU D O   1 
ATOM 8168  C CB  . LEU D 1 259 ? 16.515  0.744   -35.821 1.00 73.73  ? 259 LEU D CB  1 
ATOM 8169  C CG  . LEU D 1 259 ? 17.395  -0.131  -36.720 1.00 78.86  ? 259 LEU D CG  1 
ATOM 8170  C CD1 . LEU D 1 259 ? 16.644  -1.325  -37.207 1.00 78.57  ? 259 LEU D CD1 1 
ATOM 8171  C CD2 . LEU D 1 259 ? 17.960  0.649   -37.892 1.00 81.87  ? 259 LEU D CD2 1 
ATOM 8172  N N   . ASP D 1 260 ? 15.522  3.516   -34.612 1.00 78.68  ? 260 ASP D N   1 
ATOM 8173  C CA  . ASP D 1 260 ? 14.582  4.348   -33.857 1.00 79.30  ? 260 ASP D CA  1 
ATOM 8174  C C   . ASP D 1 260 ? 13.124  3.871   -34.001 1.00 83.85  ? 260 ASP D C   1 
ATOM 8175  O O   . ASP D 1 260 ? 12.214  4.557   -33.520 1.00 84.99  ? 260 ASP D O   1 
ATOM 8176  C CB  . ASP D 1 260 ? 14.720  5.823   -34.302 1.00 81.35  ? 260 ASP D CB  1 
ATOM 8177  C CG  . ASP D 1 260 ? 15.989  6.491   -33.797 1.00 92.84  ? 260 ASP D CG  1 
ATOM 8178  O OD1 . ASP D 1 260 ? 15.884  7.367   -32.917 1.00 92.92  ? 260 ASP D OD1 1 
ATOM 8179  O OD2 . ASP D 1 260 ? 17.095  6.130   -34.286 1.00 98.91  ? 260 ASP D OD2 1 
ATOM 8180  N N   . VAL D 1 261 ? 12.908  2.689   -34.622 1.00 77.80  ? 261 VAL D N   1 
ATOM 8181  C CA  . VAL D 1 261 ? 11.587  2.085   -34.809 1.00 76.66  ? 261 VAL D CA  1 
ATOM 8182  C C   . VAL D 1 261 ? 11.640  0.652   -34.257 1.00 77.43  ? 261 VAL D C   1 
ATOM 8183  O O   . VAL D 1 261 ? 12.653  -0.023  -34.437 1.00 77.79  ? 261 VAL D O   1 
ATOM 8184  C CB  . VAL D 1 261 ? 11.111  2.165   -36.286 1.00 80.89  ? 261 VAL D CB  1 
ATOM 8185  C CG1 . VAL D 1 261 ? 12.046  1.416   -37.232 1.00 80.95  ? 261 VAL D CG1 1 
ATOM 8186  C CG2 . VAL D 1 261 ? 9.670   1.683   -36.445 1.00 80.70  ? 261 VAL D CG2 1 
ATOM 8187  N N   . GLN D 1 262 ? 10.578  0.204   -33.559 1.00 70.95  ? 262 GLN D N   1 
ATOM 8188  C CA  . GLN D 1 262 ? 10.559  -1.140  -32.966 1.00 70.01  ? 262 GLN D CA  1 
ATOM 8189  C C   . GLN D 1 262 ? 9.296   -1.925  -33.331 1.00 73.19  ? 262 GLN D C   1 
ATOM 8190  O O   . GLN D 1 262 ? 9.132   -3.060  -32.891 1.00 73.29  ? 262 GLN D O   1 
ATOM 8191  C CB  . GLN D 1 262 ? 10.766  -1.122  -31.431 1.00 70.73  ? 262 GLN D CB  1 
ATOM 8192  C CG  . GLN D 1 262 ? 10.427  0.178   -30.724 1.00 81.63  ? 262 GLN D CG  1 
ATOM 8193  C CD  . GLN D 1 262 ? 11.457  1.275   -30.866 1.00 101.90 ? 262 GLN D CD  1 
ATOM 8194  O OE1 . GLN D 1 262 ? 11.116  2.428   -31.121 1.00 98.16  ? 262 GLN D OE1 1 
ATOM 8195  N NE2 . GLN D 1 262 ? 12.728  0.971   -30.642 1.00 94.65  ? 262 GLN D NE2 1 
ATOM 8196  N N   . ARG D 1 263 ? 8.441   -1.352  -34.173 1.00 69.16  ? 263 ARG D N   1 
ATOM 8197  C CA  . ARG D 1 263 ? 7.206   -1.992  -34.620 1.00 68.81  ? 263 ARG D CA  1 
ATOM 8198  C C   . ARG D 1 263 ? 7.149   -1.985  -36.143 1.00 72.10  ? 263 ARG D C   1 
ATOM 8199  O O   . ARG D 1 263 ? 7.501   -0.990  -36.775 1.00 72.65  ? 263 ARG D O   1 
ATOM 8200  C CB  . ARG D 1 263 ? 5.970   -1.295  -34.021 1.00 69.98  ? 263 ARG D CB  1 
ATOM 8201  C CG  . ARG D 1 263 ? 5.910   -1.362  -32.496 1.00 82.36  ? 263 ARG D CG  1 
ATOM 8202  C CD  . ARG D 1 263 ? 4.527   -1.131  -31.943 1.00 95.79  ? 263 ARG D CD  1 
ATOM 8203  N NE  . ARG D 1 263 ? 4.071   0.237   -32.171 1.00 110.85 ? 263 ARG D NE  1 
ATOM 8204  C CZ  . ARG D 1 263 ? 3.040   0.789   -31.541 1.00 125.65 ? 263 ARG D CZ  1 
ATOM 8205  N NH1 . ARG D 1 263 ? 2.366   0.102   -30.625 1.00 108.94 ? 263 ARG D NH1 1 
ATOM 8206  N NH2 . ARG D 1 263 ? 2.691   2.042   -31.801 1.00 112.56 ? 263 ARG D NH2 1 
ATOM 8207  N N   . GLY D 1 264 ? 6.711   -3.097  -36.708 1.00 67.04  ? 264 GLY D N   1 
ATOM 8208  C CA  . GLY D 1 264 ? 6.607   -3.271  -38.146 1.00 66.30  ? 264 GLY D CA  1 
ATOM 8209  C C   . GLY D 1 264 ? 6.923   -4.690  -38.566 1.00 69.34  ? 264 GLY D C   1 
ATOM 8210  O O   . GLY D 1 264 ? 6.802   -5.614  -37.759 1.00 69.40  ? 264 GLY D O   1 
ATOM 8211  N N   . ALA D 1 265 ? 7.360   -4.864  -39.824 1.00 64.71  ? 265 ALA D N   1 
ATOM 8212  C CA  . ALA D 1 265 ? 7.713   -6.160  -40.392 1.00 63.77  ? 265 ALA D CA  1 
ATOM 8213  C C   . ALA D 1 265 ? 9.200   -6.273  -40.690 1.00 67.21  ? 265 ALA D C   1 
ATOM 8214  O O   . ALA D 1 265 ? 9.778   -5.404  -41.344 1.00 66.55  ? 265 ALA D O   1 
ATOM 8215  C CB  . ALA D 1 265 ? 6.932   -6.394  -41.668 1.00 64.43  ? 265 ALA D CB  1 
ATOM 8216  N N   . PHE D 1 266 ? 9.809   -7.353  -40.213 1.00 63.15  ? 266 PHE D N   1 
ATOM 8217  C CA  . PHE D 1 266 ? 11.193  -7.679  -40.487 1.00 62.53  ? 266 PHE D CA  1 
ATOM 8218  C C   . PHE D 1 266 ? 11.194  -8.680  -41.637 1.00 64.34  ? 266 PHE D C   1 
ATOM 8219  O O   . PHE D 1 266 ? 10.642  -9.761  -41.488 1.00 63.39  ? 266 PHE D O   1 
ATOM 8220  C CB  . PHE D 1 266 ? 11.875  -8.224  -39.233 1.00 64.85  ? 266 PHE D CB  1 
ATOM 8221  C CG  . PHE D 1 266 ? 13.315  -8.607  -39.461 1.00 67.48  ? 266 PHE D CG  1 
ATOM 8222  C CD1 . PHE D 1 266 ? 13.690  -9.945  -39.539 1.00 71.40  ? 266 PHE D CD1 1 
ATOM 8223  C CD2 . PHE D 1 266 ? 14.296  -7.630  -39.635 1.00 70.20  ? 266 PHE D CD2 1 
ATOM 8224  C CE1 . PHE D 1 266 ? 15.026  -10.299 -39.761 1.00 72.41  ? 266 PHE D CE1 1 
ATOM 8225  C CE2 . PHE D 1 266 ? 15.630  -7.983  -39.857 1.00 72.81  ? 266 PHE D CE2 1 
ATOM 8226  C CZ  . PHE D 1 266 ? 15.987  -9.313  -39.913 1.00 71.05  ? 266 PHE D CZ  1 
ATOM 8227  N N   . VAL D 1 267 ? 11.744  -8.302  -42.799 1.00 61.43  ? 267 VAL D N   1 
ATOM 8228  C CA  . VAL D 1 267 ? 11.738  -9.151  -43.997 1.00 61.60  ? 267 VAL D CA  1 
ATOM 8229  C C   . VAL D 1 267 ? 12.891  -10.130 -43.946 1.00 68.67  ? 267 VAL D C   1 
ATOM 8230  O O   . VAL D 1 267 ? 14.047  -9.725  -43.824 1.00 69.80  ? 267 VAL D O   1 
ATOM 8231  C CB  . VAL D 1 267 ? 11.746  -8.337  -45.324 1.00 64.62  ? 267 VAL D CB  1 
ATOM 8232  C CG1 . VAL D 1 267 ? 11.651  -9.261  -46.539 1.00 63.63  ? 267 VAL D CG1 1 
ATOM 8233  C CG2 . VAL D 1 267 ? 10.619  -7.296  -45.345 1.00 64.43  ? 267 VAL D CG2 1 
ATOM 8234  N N   . SER D 1 268 ? 12.571  -11.418 -44.038 1.00 66.10  ? 268 SER D N   1 
ATOM 8235  C CA  . SER D 1 268 ? 13.569  -12.479 -44.024 1.00 66.97  ? 268 SER D CA  1 
ATOM 8236  C C   . SER D 1 268 ? 13.759  -13.061 -45.430 1.00 72.12  ? 268 SER D C   1 
ATOM 8237  O O   . SER D 1 268 ? 14.835  -13.580 -45.741 1.00 73.07  ? 268 SER D O   1 
ATOM 8238  C CB  . SER D 1 268 ? 13.168  -13.582 -43.040 1.00 70.56  ? 268 SER D CB  1 
ATOM 8239  O OG  . SER D 1 268 ? 11.967  -14.250 -43.401 1.00 78.71  ? 268 SER D OG  1 
ATOM 8240  N N   . GLU D 1 269 ? 12.720  -12.991 -46.265 1.00 68.24  ? 269 GLU D N   1 
ATOM 8241  C CA  . GLU D 1 269 ? 12.753  -13.571 -47.597 1.00 69.36  ? 269 GLU D CA  1 
ATOM 8242  C C   . GLU D 1 269 ? 11.837  -12.804 -48.560 1.00 77.11  ? 269 GLU D C   1 
ATOM 8243  O O   . GLU D 1 269 ? 10.690  -12.492 -48.223 1.00 76.75  ? 269 GLU D O   1 
ATOM 8244  C CB  . GLU D 1 269 ? 12.317  -15.045 -47.491 1.00 70.80  ? 269 GLU D CB  1 
ATOM 8245  C CG  . GLU D 1 269 ? 12.529  -15.915 -48.715 1.00 81.01  ? 269 GLU D CG  1 
ATOM 8246  C CD  . GLU D 1 269 ? 12.059  -17.353 -48.552 1.00 106.37 ? 269 GLU D CD  1 
ATOM 8247  O OE1 . GLU D 1 269 ? 11.563  -17.930 -49.548 1.00 110.69 ? 269 GLU D OE1 1 
ATOM 8248  O OE2 . GLU D 1 269 ? 12.177  -17.902 -47.431 1.00 95.70  ? 269 GLU D OE2 1 
ATOM 8249  N N   . VAL D 1 270 ? 12.355  -12.515 -49.763 1.00 76.42  ? 270 VAL D N   1 
ATOM 8250  C CA  . VAL D 1 270 ? 11.611  -11.877 -50.852 1.00 77.13  ? 270 VAL D CA  1 
ATOM 8251  C C   . VAL D 1 270 ? 11.459  -12.946 -51.936 1.00 83.35  ? 270 VAL D C   1 
ATOM 8252  O O   . VAL D 1 270 ? 12.460  -13.478 -52.426 1.00 82.41  ? 270 VAL D O   1 
ATOM 8253  C CB  . VAL D 1 270 ? 12.263  -10.564 -51.362 1.00 80.93  ? 270 VAL D CB  1 
ATOM 8254  C CG1 . VAL D 1 270 ? 11.360  -9.847  -52.370 1.00 80.62  ? 270 VAL D CG1 1 
ATOM 8255  C CG2 . VAL D 1 270 ? 12.606  -9.635  -50.196 1.00 80.77  ? 270 VAL D CG2 1 
ATOM 8256  N N   . LEU D 1 271 ? 10.213  -13.331 -52.236 1.00 83.07  ? 271 LEU D N   1 
ATOM 8257  C CA  . LEU D 1 271 ? 9.949   -14.388 -53.217 1.00 84.37  ? 271 LEU D CA  1 
ATOM 8258  C C   . LEU D 1 271 ? 10.283  -13.903 -54.642 1.00 89.57  ? 271 LEU D C   1 
ATOM 8259  O O   . LEU D 1 271 ? 9.925   -12.778 -55.003 1.00 89.12  ? 271 LEU D O   1 
ATOM 8260  C CB  . LEU D 1 271 ? 8.502   -14.906 -53.114 1.00 84.74  ? 271 LEU D CB  1 
ATOM 8261  C CG  . LEU D 1 271 ? 8.052   -15.327 -51.688 1.00 90.42  ? 271 LEU D CG  1 
ATOM 8262  C CD1 . LEU D 1 271 ? 6.557   -15.567 -51.635 1.00 90.71  ? 271 LEU D CD1 1 
ATOM 8263  C CD2 . LEU D 1 271 ? 8.832   -16.556 -51.154 1.00 93.14  ? 271 LEU D CD2 1 
ATOM 8264  N N   . PRO D 1 272 ? 11.062  -14.692 -55.422 1.00 86.70  ? 272 PRO D N   1 
ATOM 8265  C CA  . PRO D 1 272 ? 11.446  -14.242 -56.773 1.00 86.46  ? 272 PRO D CA  1 
ATOM 8266  C C   . PRO D 1 272 ? 10.254  -14.203 -57.729 1.00 90.43  ? 272 PRO D C   1 
ATOM 8267  O O   . PRO D 1 272 ? 9.410   -15.099 -57.711 1.00 89.36  ? 272 PRO D O   1 
ATOM 8268  C CB  . PRO D 1 272 ? 12.488  -15.279 -57.216 1.00 88.05  ? 272 PRO D CB  1 
ATOM 8269  C CG  . PRO D 1 272 ? 12.831  -16.061 -55.987 1.00 92.53  ? 272 PRO D CG  1 
ATOM 8270  C CD  . PRO D 1 272 ? 11.613  -16.030 -55.137 1.00 88.14  ? 272 PRO D CD  1 
ATOM 8271  N N   . GLY D 1 273 ? 10.191  -13.141 -58.529 1.00 87.96  ? 273 GLY D N   1 
ATOM 8272  C CA  . GLY D 1 273 ? 9.123   -12.925 -59.502 1.00 88.16  ? 273 GLY D CA  1 
ATOM 8273  C C   . GLY D 1 273 ? 7.927   -12.171 -58.953 1.00 92.01  ? 273 GLY D C   1 
ATOM 8274  O O   . GLY D 1 273 ? 6.987   -11.869 -59.697 1.00 92.28  ? 273 GLY D O   1 
ATOM 8275  N N   . SER D 1 274 ? 7.956   -11.875 -57.641 1.00 86.57  ? 274 SER D N   1 
ATOM 8276  C CA  . SER D 1 274 ? 6.906   -11.142 -56.951 1.00 84.85  ? 274 SER D CA  1 
ATOM 8277  C C   . SER D 1 274 ? 7.054   -9.641  -57.190 1.00 86.63  ? 274 SER D C   1 
ATOM 8278  O O   . SER D 1 274 ? 8.122   -9.181  -57.607 1.00 85.02  ? 274 SER D O   1 
ATOM 8279  C CB  . SER D 1 274 ? 6.954   -11.448 -55.457 1.00 86.76  ? 274 SER D CB  1 
ATOM 8280  O OG  . SER D 1 274 ? 8.124   -10.912 -54.857 1.00 90.53  ? 274 SER D OG  1 
ATOM 8281  N N   . GLY D 1 275 ? 5.987   -8.898  -56.891 1.00 82.94  ? 275 GLY D N   1 
ATOM 8282  C CA  . GLY D 1 275 ? 5.954   -7.444  -56.994 1.00 82.80  ? 275 GLY D CA  1 
ATOM 8283  C C   . GLY D 1 275 ? 7.024   -6.797  -56.139 1.00 86.16  ? 275 GLY D C   1 
ATOM 8284  O O   . GLY D 1 275 ? 7.592   -5.778  -56.536 1.00 86.54  ? 275 GLY D O   1 
ATOM 8285  N N   . SER D 1 276 ? 7.312   -7.408  -54.962 1.00 81.09  ? 276 SER D N   1 
ATOM 8286  C CA  . SER D 1 276 ? 8.323   -6.960  -53.992 1.00 79.73  ? 276 SER D CA  1 
ATOM 8287  C C   . SER D 1 276 ? 9.736   -7.155  -54.542 1.00 78.98  ? 276 SER D C   1 
ATOM 8288  O O   . SER D 1 276 ? 10.601  -6.332  -54.262 1.00 76.98  ? 276 SER D O   1 
ATOM 8289  C CB  . SER D 1 276 ? 8.170   -7.691  -52.657 1.00 82.80  ? 276 SER D CB  1 
ATOM 8290  O OG  . SER D 1 276 ? 7.011   -7.271  -51.956 1.00 89.00  ? 276 SER D OG  1 
ATOM 8291  N N   . ALA D 1 277 ? 9.963   -8.233  -55.327 1.00 73.76  ? 277 ALA D N   1 
ATOM 8292  C CA  . ALA D 1 277 ? 11.260  -8.495  -55.965 1.00 72.62  ? 277 ALA D CA  1 
ATOM 8293  C C   . ALA D 1 277 ? 11.494  -7.414  -57.015 1.00 75.34  ? 277 ALA D C   1 
ATOM 8294  O O   . ALA D 1 277 ? 12.454  -6.641  -56.916 1.00 73.90  ? 277 ALA D O   1 
ATOM 8295  C CB  . ALA D 1 277 ? 11.273  -9.886  -56.599 1.00 72.97  ? 277 ALA D CB  1 
ATOM 8296  N N   . LYS D 1 278 ? 10.524  -7.280  -57.936 1.00 72.04  ? 278 LYS D N   1 
ATOM 8297  C CA  . LYS D 1 278 ? 10.527  -6.294  -59.011 1.00 72.03  ? 278 LYS D CA  1 
ATOM 8298  C C   . LYS D 1 278 ? 10.701  -4.860  -58.463 1.00 77.82  ? 278 LYS D C   1 
ATOM 8299  O O   . LYS D 1 278 ? 11.435  -4.068  -59.052 1.00 78.27  ? 278 LYS D O   1 
ATOM 8300  C CB  . LYS D 1 278 ? 9.236   -6.402  -59.827 1.00 73.63  ? 278 LYS D CB  1 
ATOM 8301  C CG  . LYS D 1 278 ? 9.126   -7.688  -60.643 1.00 78.94  ? 278 LYS D CG  1 
ATOM 8302  C CD  . LYS D 1 278 ? 7.671   -7.983  -61.002 1.00 85.28  ? 278 LYS D CD  1 
ATOM 8303  C CE  . LYS D 1 278 ? 7.520   -9.247  -61.809 1.00 95.92  ? 278 LYS D CE  1 
ATOM 8304  N NZ  . LYS D 1 278 ? 6.089   -9.607  -62.006 1.00 102.94 ? 278 LYS D NZ  1 
ATOM 8305  N N   . ALA D 1 279 ? 10.081  -4.559  -57.309 1.00 74.07  ? 279 ALA D N   1 
ATOM 8306  C CA  . ALA D 1 279 ? 10.144  -3.259  -56.648 1.00 73.92  ? 279 ALA D CA  1 
ATOM 8307  C C   . ALA D 1 279 ? 11.481  -3.015  -55.913 1.00 77.67  ? 279 ALA D C   1 
ATOM 8308  O O   . ALA D 1 279 ? 11.755  -1.886  -55.490 1.00 76.67  ? 279 ALA D O   1 
ATOM 8309  C CB  . ALA D 1 279 ? 8.993   -3.141  -55.671 1.00 74.80  ? 279 ALA D CB  1 
ATOM 8310  N N   . GLY D 1 280 ? 12.293  -4.063  -55.771 1.00 74.91  ? 280 GLY D N   1 
ATOM 8311  C CA  . GLY D 1 280 ? 13.588  -3.985  -55.110 1.00 74.80  ? 280 GLY D CA  1 
ATOM 8312  C C   . GLY D 1 280 ? 13.570  -4.128  -53.599 1.00 79.32  ? 280 GLY D C   1 
ATOM 8313  O O   . GLY D 1 280 ? 14.472  -3.613  -52.928 1.00 79.14  ? 280 GLY D O   1 
ATOM 8314  N N   . VAL D 1 281 ? 12.564  -4.848  -53.043 1.00 75.48  ? 281 VAL D N   1 
ATOM 8315  C CA  . VAL D 1 281 ? 12.507  -5.121  -51.598 1.00 74.81  ? 281 VAL D CA  1 
ATOM 8316  C C   . VAL D 1 281 ? 13.566  -6.208  -51.333 1.00 75.29  ? 281 VAL D C   1 
ATOM 8317  O O   . VAL D 1 281 ? 13.710  -7.141  -52.132 1.00 74.80  ? 281 VAL D O   1 
ATOM 8318  C CB  . VAL D 1 281 ? 11.096  -5.499  -51.044 1.00 78.99  ? 281 VAL D CB  1 
ATOM 8319  C CG1 . VAL D 1 281 ? 11.117  -5.614  -49.517 1.00 78.71  ? 281 VAL D CG1 1 
ATOM 8320  C CG2 . VAL D 1 281 ? 10.030  -4.493  -51.483 1.00 78.76  ? 281 VAL D CG2 1 
ATOM 8321  N N   . LYS D 1 282 ? 14.356  -6.040  -50.268 1.00 68.66  ? 282 LYS D N   1 
ATOM 8322  C CA  . LYS D 1 282 ? 15.428  -6.984  -49.983 1.00 67.10  ? 282 LYS D CA  1 
ATOM 8323  C C   . LYS D 1 282 ? 15.299  -7.595  -48.586 1.00 67.53  ? 282 LYS D C   1 
ATOM 8324  O O   . LYS D 1 282 ? 14.814  -6.932  -47.671 1.00 66.84  ? 282 LYS D O   1 
ATOM 8325  C CB  . LYS D 1 282 ? 16.799  -6.282  -50.133 1.00 69.20  ? 282 LYS D CB  1 
ATOM 8326  C CG  . LYS D 1 282 ? 17.074  -5.727  -51.540 1.00 80.09  ? 282 LYS D CG  1 
ATOM 8327  C CD  . LYS D 1 282 ? 18.526  -5.736  -51.992 1.00 91.33  ? 282 LYS D CD  1 
ATOM 8328  C CE  . LYS D 1 282 ? 19.585  -5.148  -51.085 1.00 102.45 ? 282 LYS D CE  1 
ATOM 8329  N NZ  . LYS D 1 282 ? 20.914  -5.746  -51.375 1.00 112.75 ? 282 LYS D NZ  1 
ATOM 8330  N N   . ALA D 1 283 ? 15.764  -8.851  -48.413 1.00 61.89  ? 283 ALA D N   1 
ATOM 8331  C CA  . ALA D 1 283 ? 15.786  -9.511  -47.107 1.00 61.50  ? 283 ALA D CA  1 
ATOM 8332  C C   . ALA D 1 283 ? 16.624  -8.657  -46.132 1.00 68.82  ? 283 ALA D C   1 
ATOM 8333  O O   . ALA D 1 283 ? 17.649  -8.088  -46.531 1.00 67.56  ? 283 ALA D O   1 
ATOM 8334  C CB  . ALA D 1 283 ? 16.352  -10.912 -47.231 1.00 61.65  ? 283 ALA D CB  1 
ATOM 8335  N N   . GLY D 1 284 ? 16.118  -8.483  -44.911 1.00 68.23  ? 284 GLY D N   1 
ATOM 8336  C CA  . GLY D 1 284 ? 16.744  -7.644  -43.890 1.00 68.38  ? 284 GLY D CA  1 
ATOM 8337  C C   . GLY D 1 284 ? 16.096  -6.277  -43.769 1.00 72.27  ? 284 GLY D C   1 
ATOM 8338  O O   . GLY D 1 284 ? 16.417  -5.519  -42.848 1.00 71.48  ? 284 GLY D O   1 
ATOM 8339  N N   . ASP D 1 285 ? 15.186  -5.945  -44.707 1.00 70.02  ? 285 ASP D N   1 
ATOM 8340  C CA  . ASP D 1 285 ? 14.463  -4.666  -44.678 1.00 70.72  ? 285 ASP D CA  1 
ATOM 8341  C C   . ASP D 1 285 ? 13.412  -4.658  -43.564 1.00 71.19  ? 285 ASP D C   1 
ATOM 8342  O O   . ASP D 1 285 ? 12.898  -5.712  -43.177 1.00 69.55  ? 285 ASP D O   1 
ATOM 8343  C CB  . ASP D 1 285 ? 13.776  -4.358  -46.031 1.00 73.93  ? 285 ASP D CB  1 
ATOM 8344  C CG  . ASP D 1 285 ? 14.683  -4.043  -47.215 1.00 89.76  ? 285 ASP D CG  1 
ATOM 8345  O OD1 . ASP D 1 285 ? 15.923  -3.997  -47.026 1.00 91.50  ? 285 ASP D OD1 1 
ATOM 8346  O OD2 . ASP D 1 285 ? 14.161  -3.924  -48.344 1.00 95.63  ? 285 ASP D OD2 1 
ATOM 8347  N N   . ILE D 1 286 ? 13.087  -3.462  -43.066 1.00 65.80  ? 286 ILE D N   1 
ATOM 8348  C CA  . ILE D 1 286 ? 12.089  -3.294  -42.025 1.00 64.14  ? 286 ILE D CA  1 
ATOM 8349  C C   . ILE D 1 286 ? 10.982  -2.399  -42.562 1.00 67.67  ? 286 ILE D C   1 
ATOM 8350  O O   . ILE D 1 286 ? 11.171  -1.180  -42.692 1.00 66.82  ? 286 ILE D O   1 
ATOM 8351  C CB  . ILE D 1 286 ? 12.711  -2.788  -40.702 1.00 66.27  ? 286 ILE D CB  1 
ATOM 8352  C CG1 . ILE D 1 286 ? 13.722  -3.833  -40.184 1.00 66.32  ? 286 ILE D CG1 1 
ATOM 8353  C CG2 . ILE D 1 286 ? 11.616  -2.500  -39.651 1.00 66.18  ? 286 ILE D CG2 1 
ATOM 8354  C CD1 . ILE D 1 286 ? 14.867  -3.306  -39.516 1.00 73.95  ? 286 ILE D CD1 1 
ATOM 8355  N N   . ILE D 1 287 ? 9.826   -3.021  -42.898 1.00 64.14  ? 287 ILE D N   1 
ATOM 8356  C CA  . ILE D 1 287 ? 8.657   -2.290  -43.389 1.00 63.82  ? 287 ILE D CA  1 
ATOM 8357  C C   . ILE D 1 287 ? 8.023   -1.574  -42.185 1.00 70.77  ? 287 ILE D C   1 
ATOM 8358  O O   . ILE D 1 287 ? 7.587   -2.213  -41.233 1.00 69.78  ? 287 ILE D O   1 
ATOM 8359  C CB  . ILE D 1 287 ? 7.669   -3.168  -44.171 1.00 65.90  ? 287 ILE D CB  1 
ATOM 8360  C CG1 . ILE D 1 287 ? 8.396   -3.970  -45.260 1.00 65.64  ? 287 ILE D CG1 1 
ATOM 8361  C CG2 . ILE D 1 287 ? 6.559   -2.298  -44.769 1.00 66.87  ? 287 ILE D CG2 1 
ATOM 8362  C CD1 . ILE D 1 287 ? 7.610   -5.106  -45.893 1.00 70.40  ? 287 ILE D CD1 1 
ATOM 8363  N N   . THR D 1 288 ? 8.044   -0.238  -42.226 1.00 70.83  ? 288 THR D N   1 
ATOM 8364  C CA  . THR D 1 288 ? 7.599   0.714   -41.200 1.00 71.71  ? 288 THR D CA  1 
ATOM 8365  C C   . THR D 1 288 ? 6.211   1.317   -41.519 1.00 75.16  ? 288 THR D C   1 
ATOM 8366  O O   . THR D 1 288 ? 5.458   1.649   -40.601 1.00 74.97  ? 288 THR D O   1 
ATOM 8367  C CB  . THR D 1 288 ? 8.686   1.812   -41.125 1.00 86.64  ? 288 THR D CB  1 
ATOM 8368  O OG1 . THR D 1 288 ? 9.858   1.244   -40.540 1.00 88.94  ? 288 THR D OG1 1 
ATOM 8369  C CG2 . THR D 1 288 ? 8.269   3.048   -40.338 1.00 88.25  ? 288 THR D CG2 1 
ATOM 8370  N N   . SER D 1 289 ? 5.904   1.498   -42.808 1.00 71.08  ? 289 SER D N   1 
ATOM 8371  C CA  . SER D 1 289 ? 4.667   2.125   -43.250 1.00 70.83  ? 289 SER D CA  1 
ATOM 8372  C C   . SER D 1 289 ? 4.040   1.425   -44.424 1.00 72.30  ? 289 SER D C   1 
ATOM 8373  O O   . SER D 1 289 ? 4.712   0.739   -45.195 1.00 72.05  ? 289 SER D O   1 
ATOM 8374  C CB  . SER D 1 289 ? 4.934   3.574   -43.657 1.00 76.58  ? 289 SER D CB  1 
ATOM 8375  O OG  . SER D 1 289 ? 5.363   4.364   -42.560 1.00 90.72  ? 289 SER D OG  1 
ATOM 8376  N N   . LEU D 1 290 ? 2.736   1.635   -44.564 1.00 66.83  ? 290 LEU D N   1 
ATOM 8377  C CA  . LEU D 1 290 ? 1.935   1.210   -45.691 1.00 65.76  ? 290 LEU D CA  1 
ATOM 8378  C C   . LEU D 1 290 ? 1.092   2.414   -46.084 1.00 70.43  ? 290 LEU D C   1 
ATOM 8379  O O   . LEU D 1 290 ? 0.308   2.921   -45.260 1.00 69.39  ? 290 LEU D O   1 
ATOM 8380  C CB  . LEU D 1 290 ? 1.095   -0.038  -45.401 1.00 65.10  ? 290 LEU D CB  1 
ATOM 8381  C CG  . LEU D 1 290 ? 0.210   -0.544  -46.549 1.00 68.87  ? 290 LEU D CG  1 
ATOM 8382  C CD1 . LEU D 1 290 ? 1.034   -0.965  -47.756 1.00 69.32  ? 290 LEU D CD1 1 
ATOM 8383  C CD2 . LEU D 1 290 ? -0.626  -1.709  -46.115 1.00 68.59  ? 290 LEU D CD2 1 
ATOM 8384  N N   . ASN D 1 291 ? 1.345   2.932   -47.316 1.00 66.48  ? 291 ASN D N   1 
ATOM 8385  C CA  . ASN D 1 291 ? 0.693   4.106   -47.913 1.00 65.25  ? 291 ASN D CA  1 
ATOM 8386  C C   . ASN D 1 291 ? 0.788   5.331   -46.968 1.00 68.98  ? 291 ASN D C   1 
ATOM 8387  O O   . ASN D 1 291 ? -0.201  6.032   -46.734 1.00 67.98  ? 291 ASN D O   1 
ATOM 8388  C CB  . ASN D 1 291 ? -0.760  3.779   -48.297 1.00 60.90  ? 291 ASN D CB  1 
ATOM 8389  C CG  . ASN D 1 291 ? -0.876  2.693   -49.346 1.00 79.92  ? 291 ASN D CG  1 
ATOM 8390  O OD1 . ASN D 1 291 ? -0.030  2.549   -50.234 1.00 77.17  ? 291 ASN D OD1 1 
ATOM 8391  N ND2 . ASN D 1 291 ? -1.932  1.902   -49.278 1.00 69.80  ? 291 ASN D ND2 1 
ATOM 8392  N N   . GLY D 1 292 ? 1.977   5.536   -46.406 1.00 66.04  ? 292 GLY D N   1 
ATOM 8393  C CA  . GLY D 1 292 ? 2.253   6.642   -45.501 1.00 67.22  ? 292 GLY D CA  1 
ATOM 8394  C C   . GLY D 1 292 ? 1.771   6.484   -44.073 1.00 74.48  ? 292 GLY D C   1 
ATOM 8395  O O   . GLY D 1 292 ? 2.122   7.305   -43.216 1.00 75.33  ? 292 GLY D O   1 
ATOM 8396  N N   . LYS D 1 293 ? 0.963   5.440   -43.796 1.00 71.55  ? 293 LYS D N   1 
ATOM 8397  C CA  . LYS D 1 293 ? 0.443   5.183   -42.451 1.00 70.62  ? 293 LYS D CA  1 
ATOM 8398  C C   . LYS D 1 293 ? 1.367   4.204   -41.713 1.00 73.49  ? 293 LYS D C   1 
ATOM 8399  O O   . LYS D 1 293 ? 1.588   3.093   -42.211 1.00 74.12  ? 293 LYS D O   1 
ATOM 8400  C CB  . LYS D 1 293 ? -1.007  4.657   -42.492 1.00 71.75  ? 293 LYS D CB  1 
ATOM 8401  C CG  . LYS D 1 293 ? -1.693  4.725   -41.138 1.00 66.17  ? 293 LYS D CG  1 
ATOM 8402  C CD  . LYS D 1 293 ? -3.101  4.147   -41.146 1.00 67.76  ? 293 LYS D CD  1 
ATOM 8403  C CE  . LYS D 1 293 ? -3.630  3.977   -39.736 1.00 73.12  ? 293 LYS D CE  1 
ATOM 8404  N NZ  . LYS D 1 293 ? -3.941  5.284   -39.072 1.00 78.06  ? 293 LYS D NZ  1 
ATOM 8405  N N   . PRO D 1 294 ? 1.898   4.595   -40.526 1.00 68.24  ? 294 PRO D N   1 
ATOM 8406  C CA  . PRO D 1 294 ? 2.781   3.680   -39.776 1.00 67.72  ? 294 PRO D CA  1 
ATOM 8407  C C   . PRO D 1 294 ? 2.101   2.364   -39.395 1.00 72.00  ? 294 PRO D C   1 
ATOM 8408  O O   . PRO D 1 294 ? 0.900   2.340   -39.088 1.00 72.70  ? 294 PRO D O   1 
ATOM 8409  C CB  . PRO D 1 294 ? 3.150   4.479   -38.521 1.00 68.82  ? 294 PRO D CB  1 
ATOM 8410  C CG  . PRO D 1 294 ? 2.886   5.898   -38.865 1.00 72.96  ? 294 PRO D CG  1 
ATOM 8411  C CD  . PRO D 1 294 ? 1.729   5.879   -39.811 1.00 68.96  ? 294 PRO D CD  1 
ATOM 8412  N N   . LEU D 1 295 ? 2.878   1.267   -39.458 1.00 66.86  ? 295 LEU D N   1 
ATOM 8413  C CA  . LEU D 1 295 ? 2.445   -0.081  -39.097 1.00 65.77  ? 295 LEU D CA  1 
ATOM 8414  C C   . LEU D 1 295 ? 2.789   -0.368  -37.646 1.00 70.52  ? 295 LEU D C   1 
ATOM 8415  O O   . LEU D 1 295 ? 3.937   -0.147  -37.245 1.00 70.90  ? 295 LEU D O   1 
ATOM 8416  C CB  . LEU D 1 295 ? 3.105   -1.136  -39.991 1.00 64.97  ? 295 LEU D CB  1 
ATOM 8417  C CG  . LEU D 1 295 ? 2.702   -1.164  -41.440 1.00 69.40  ? 295 LEU D CG  1 
ATOM 8418  C CD1 . LEU D 1 295 ? 3.729   -1.901  -42.232 1.00 69.78  ? 295 LEU D CD1 1 
ATOM 8419  C CD2 . LEU D 1 295 ? 1.330   -1.813  -41.634 1.00 71.78  ? 295 LEU D CD2 1 
ATOM 8420  N N   . ASN D 1 296 ? 1.817   -0.868  -36.857 1.00 66.86  ? 296 ASN D N   1 
ATOM 8421  C CA  . ASN D 1 296 ? 2.128   -1.218  -35.473 1.00 67.02  ? 296 ASN D CA  1 
ATOM 8422  C C   . ASN D 1 296 ? 2.564   -2.703  -35.380 1.00 67.78  ? 296 ASN D C   1 
ATOM 8423  O O   . ASN D 1 296 ? 3.082   -3.121  -34.341 1.00 67.14  ? 296 ASN D O   1 
ATOM 8424  C CB  . ASN D 1 296 ? 0.995   -0.871  -34.479 1.00 70.87  ? 296 ASN D CB  1 
ATOM 8425  C CG  . ASN D 1 296 ? -0.382  -1.386  -34.806 1.00 102.19 ? 296 ASN D CG  1 
ATOM 8426  O OD1 . ASN D 1 296 ? -0.588  -2.571  -35.115 1.00 97.85  ? 296 ASN D OD1 1 
ATOM 8427  N ND2 . ASN D 1 296 ? -1.371  -0.508  -34.651 1.00 94.92  ? 296 ASN D ND2 1 
ATOM 8428  N N   . SER D 1 297 ? 2.422   -3.469  -36.484 1.00 61.74  ? 297 SER D N   1 
ATOM 8429  C CA  . SER D 1 297 ? 2.818   -4.880  -36.538 1.00 60.59  ? 297 SER D CA  1 
ATOM 8430  C C   . SER D 1 297 ? 2.911   -5.429  -37.968 1.00 62.18  ? 297 SER D C   1 
ATOM 8431  O O   . SER D 1 297 ? 2.395   -4.826  -38.909 1.00 61.30  ? 297 SER D O   1 
ATOM 8432  C CB  . SER D 1 297 ? 1.828   -5.744  -35.748 1.00 63.85  ? 297 SER D CB  1 
ATOM 8433  O OG  . SER D 1 297 ? 0.539   -5.802  -36.342 1.00 71.44  ? 297 SER D OG  1 
ATOM 8434  N N   . PHE D 1 298 ? 3.520   -6.618  -38.097 1.00 57.71  ? 298 PHE D N   1 
ATOM 8435  C CA  . PHE D 1 298 ? 3.599   -7.396  -39.327 1.00 57.55  ? 298 PHE D CA  1 
ATOM 8436  C C   . PHE D 1 298 ? 2.211   -7.958  -39.616 1.00 61.38  ? 298 PHE D C   1 
ATOM 8437  O O   . PHE D 1 298 ? 1.815   -8.057  -40.770 1.00 62.45  ? 298 PHE D O   1 
ATOM 8438  C CB  . PHE D 1 298 ? 4.652   -8.525  -39.191 1.00 59.60  ? 298 PHE D CB  1 
ATOM 8439  C CG  . PHE D 1 298 ? 4.635   -9.529  -40.324 1.00 61.80  ? 298 PHE D CG  1 
ATOM 8440  C CD1 . PHE D 1 298 ? 5.161   -9.209  -41.569 1.00 64.47  ? 298 PHE D CD1 1 
ATOM 8441  C CD2 . PHE D 1 298 ? 4.069   -10.787 -40.152 1.00 65.02  ? 298 PHE D CD2 1 
ATOM 8442  C CE1 . PHE D 1 298 ? 5.122   -10.125 -42.623 1.00 65.71  ? 298 PHE D CE1 1 
ATOM 8443  C CE2 . PHE D 1 298 ? 4.024   -11.703 -41.214 1.00 67.82  ? 298 PHE D CE2 1 
ATOM 8444  C CZ  . PHE D 1 298 ? 4.552   -11.364 -42.440 1.00 65.46  ? 298 PHE D CZ  1 
ATOM 8445  N N   . ALA D 1 299 ? 1.477   -8.326  -38.561 1.00 57.27  ? 299 ALA D N   1 
ATOM 8446  C CA  . ALA D 1 299 ? 0.121   -8.865  -38.618 1.00 56.65  ? 299 ALA D CA  1 
ATOM 8447  C C   . ALA D 1 299 ? -0.834  -7.863  -39.237 1.00 59.40  ? 299 ALA D C   1 
ATOM 8448  O O   . ALA D 1 299 ? -1.709  -8.266  -40.006 1.00 59.44  ? 299 ALA D O   1 
ATOM 8449  C CB  . ALA D 1 299 ? -0.339  -9.240  -37.217 1.00 57.40  ? 299 ALA D CB  1 
ATOM 8450  N N   . GLU D 1 300 ? -0.647  -6.550  -38.924 1.00 55.62  ? 300 GLU D N   1 
ATOM 8451  C CA  . GLU D 1 300 ? -1.419  -5.437  -39.493 1.00 54.90  ? 300 GLU D CA  1 
ATOM 8452  C C   . GLU D 1 300 ? -1.132  -5.362  -40.997 1.00 58.51  ? 300 GLU D C   1 
ATOM 8453  O O   . GLU D 1 300 ? -2.070  -5.311  -41.786 1.00 59.25  ? 300 GLU D O   1 
ATOM 8454  C CB  . GLU D 1 300 ? -1.094  -4.105  -38.791 1.00 55.69  ? 300 GLU D CB  1 
ATOM 8455  C CG  . GLU D 1 300 ? -1.932  -2.943  -39.297 1.00 61.33  ? 300 GLU D CG  1 
ATOM 8456  C CD  . GLU D 1 300 ? -1.586  -1.546  -38.812 1.00 85.17  ? 300 GLU D CD  1 
ATOM 8457  O OE1 . GLU D 1 300 ? -0.757  -1.405  -37.883 1.00 66.09  ? 300 GLU D OE1 1 
ATOM 8458  O OE2 . GLU D 1 300 ? -2.151  -0.580  -39.375 1.00 89.36  ? 300 GLU D OE2 1 
ATOM 8459  N N   . LEU D 1 301 ? 0.159   -5.402  -41.377 1.00 54.14  ? 301 LEU D N   1 
ATOM 8460  C CA  . LEU D 1 301 ? 0.648   -5.405  -42.754 1.00 53.77  ? 301 LEU D CA  1 
ATOM 8461  C C   . LEU D 1 301 ? 0.063   -6.586  -43.499 1.00 57.06  ? 301 LEU D C   1 
ATOM 8462  O O   . LEU D 1 301 ? -0.577  -6.402  -44.530 1.00 56.97  ? 301 LEU D O   1 
ATOM 8463  C CB  . LEU D 1 301 ? 2.190   -5.469  -42.750 1.00 54.25  ? 301 LEU D CB  1 
ATOM 8464  C CG  . LEU D 1 301 ? 3.007   -5.099  -44.014 1.00 59.63  ? 301 LEU D CG  1 
ATOM 8465  C CD1 . LEU D 1 301 ? 3.690   -6.294  -44.608 1.00 59.62  ? 301 LEU D CD1 1 
ATOM 8466  C CD2 . LEU D 1 301 ? 2.224   -4.289  -45.042 1.00 63.61  ? 301 LEU D CD2 1 
ATOM 8467  N N   . ARG D 1 302 ? 0.239   -7.792  -42.942 1.00 53.72  ? 302 ARG D N   1 
ATOM 8468  C CA  . ARG D 1 302 ? -0.294  -9.037  -43.475 1.00 53.74  ? 302 ARG D CA  1 
ATOM 8469  C C   . ARG D 1 302 ? -1.818  -8.929  -43.719 1.00 61.53  ? 302 ARG D C   1 
ATOM 8470  O O   . ARG D 1 302 ? -2.291  -9.370  -44.758 1.00 62.73  ? 302 ARG D O   1 
ATOM 8471  C CB  . ARG D 1 302 ? 0.030   -10.171 -42.502 1.00 51.64  ? 302 ARG D CB  1 
ATOM 8472  C CG  . ARG D 1 302 ? -0.176  -11.567 -43.043 1.00 65.71  ? 302 ARG D CG  1 
ATOM 8473  C CD  . ARG D 1 302 ? 0.239   -12.602 -42.012 1.00 83.63  ? 302 ARG D CD  1 
ATOM 8474  N NE  . ARG D 1 302 ? -0.348  -13.917 -42.287 1.00 100.60 ? 302 ARG D NE  1 
ATOM 8475  C CZ  . ARG D 1 302 ? -1.562  -14.301 -41.895 1.00 119.20 ? 302 ARG D CZ  1 
ATOM 8476  N NH1 . ARG D 1 302 ? -2.336  -13.475 -41.194 1.00 104.21 ? 302 ARG D NH1 1 
ATOM 8477  N NH2 . ARG D 1 302 ? -2.016  -15.510 -42.206 1.00 106.28 ? 302 ARG D NH2 1 
ATOM 8478  N N   . SER D 1 303 ? -2.569  -8.309  -42.795 1.00 60.24  ? 303 SER D N   1 
ATOM 8479  C CA  . SER D 1 303 ? -4.033  -8.210  -42.900 1.00 61.00  ? 303 SER D CA  1 
ATOM 8480  C C   . SER D 1 303 ? -4.474  -7.201  -43.967 1.00 63.56  ? 303 SER D C   1 
ATOM 8481  O O   . SER D 1 303 ? -5.290  -7.564  -44.813 1.00 64.77  ? 303 SER D O   1 
ATOM 8482  C CB  . SER D 1 303 ? -4.665  -7.876  -41.547 1.00 66.01  ? 303 SER D CB  1 
ATOM 8483  O OG  . SER D 1 303 ? -5.047  -6.513  -41.450 1.00 77.30  ? 303 SER D OG  1 
ATOM 8484  N N   . ARG D 1 304 ? -3.960  -5.948  -43.908 1.00 57.06  ? 304 ARG D N   1 
ATOM 8485  C CA  . ARG D 1 304 ? -4.244  -4.869  -44.864 1.00 55.88  ? 304 ARG D CA  1 
ATOM 8486  C C   . ARG D 1 304 ? -3.904  -5.272  -46.295 1.00 59.62  ? 304 ARG D C   1 
ATOM 8487  O O   . ARG D 1 304 ? -4.614  -4.864  -47.198 1.00 60.04  ? 304 ARG D O   1 
ATOM 8488  C CB  . ARG D 1 304 ? -3.461  -3.598  -44.519 1.00 53.61  ? 304 ARG D CB  1 
ATOM 8489  C CG  . ARG D 1 304 ? -3.897  -2.849  -43.262 1.00 58.65  ? 304 ARG D CG  1 
ATOM 8490  C CD  . ARG D 1 304 ? -3.040  -1.597  -43.175 1.00 60.25  ? 304 ARG D CD  1 
ATOM 8491  N NE  . ARG D 1 304 ? -3.379  -0.658  -42.098 1.00 63.87  ? 304 ARG D NE  1 
ATOM 8492  C CZ  . ARG D 1 304 ? -4.448  0.145   -42.075 1.00 70.17  ? 304 ARG D CZ  1 
ATOM 8493  N NH1 . ARG D 1 304 ? -5.382  0.056   -43.024 1.00 48.24  ? 304 ARG D NH1 1 
ATOM 8494  N NH2 . ARG D 1 304 ? -4.615  1.008   -41.082 1.00 48.96  ? 304 ARG D NH2 1 
ATOM 8495  N N   . ILE D 1 305 ? -2.843  -6.091  -46.501 1.00 55.52  ? 305 ILE D N   1 
ATOM 8496  C CA  . ILE D 1 305 ? -2.395  -6.537  -47.821 1.00 54.51  ? 305 ILE D CA  1 
ATOM 8497  C C   . ILE D 1 305 ? -3.373  -7.535  -48.395 1.00 58.55  ? 305 ILE D C   1 
ATOM 8498  O O   . ILE D 1 305 ? -3.760  -7.372  -49.549 1.00 58.34  ? 305 ILE D O   1 
ATOM 8499  C CB  . ILE D 1 305 ? -0.918  -7.087  -47.815 1.00 56.79  ? 305 ILE D CB  1 
ATOM 8500  C CG1 . ILE D 1 305 ? 0.129   -5.961  -47.564 1.00 56.60  ? 305 ILE D CG1 1 
ATOM 8501  C CG2 . ILE D 1 305 ? -0.565  -7.921  -49.060 1.00 54.98  ? 305 ILE D CG2 1 
ATOM 8502  C CD1 . ILE D 1 305 ? 0.104   -4.739  -48.492 1.00 59.71  ? 305 ILE D CD1 1 
ATOM 8503  N N   . ALA D 1 306 ? -3.775  -8.554  -47.617 1.00 56.79  ? 306 ALA D N   1 
ATOM 8504  C CA  . ALA D 1 306 ? -4.690  -9.604  -48.083 1.00 57.83  ? 306 ALA D CA  1 
ATOM 8505  C C   . ALA D 1 306 ? -6.104  -9.058  -48.354 1.00 67.80  ? 306 ALA D C   1 
ATOM 8506  O O   . ALA D 1 306 ? -6.864  -9.646  -49.136 1.00 67.79  ? 306 ALA D O   1 
ATOM 8507  C CB  . ALA D 1 306 ? -4.739  -10.725 -47.073 1.00 58.41  ? 306 ALA D CB  1 
ATOM 8508  N N   . THR D 1 307 ? -6.429  -7.915  -47.714 1.00 68.85  ? 307 THR D N   1 
ATOM 8509  C CA  . THR D 1 307 ? -7.667  -7.140  -47.835 1.00 70.45  ? 307 THR D CA  1 
ATOM 8510  C C   . THR D 1 307 ? -7.695  -6.514  -49.235 1.00 77.92  ? 307 THR D C   1 
ATOM 8511  O O   . THR D 1 307 ? -8.656  -6.717  -49.978 1.00 78.69  ? 307 THR D O   1 
ATOM 8512  C CB  . THR D 1 307 ? -7.703  -6.106  -46.688 1.00 78.53  ? 307 THR D CB  1 
ATOM 8513  O OG1 . THR D 1 307 ? -8.009  -6.800  -45.480 1.00 77.12  ? 307 THR D OG1 1 
ATOM 8514  C CG2 . THR D 1 307 ? -8.698  -4.972  -46.918 1.00 77.54  ? 307 THR D CG2 1 
ATOM 8515  N N   . THR D 1 308 ? -6.604  -5.806  -49.592 1.00 75.85  ? 308 THR D N   1 
ATOM 8516  C CA  . THR D 1 308 ? -6.368  -5.133  -50.869 1.00 76.47  ? 308 THR D CA  1 
ATOM 8517  C C   . THR D 1 308 ? -6.349  -6.152  -52.036 1.00 82.50  ? 308 THR D C   1 
ATOM 8518  O O   . THR D 1 308 ? -5.856  -7.273  -51.893 1.00 82.93  ? 308 THR D O   1 
ATOM 8519  C CB  . THR D 1 308 ? -5.064  -4.314  -50.788 1.00 86.30  ? 308 THR D CB  1 
ATOM 8520  O OG1 . THR D 1 308 ? -4.962  -3.697  -49.501 1.00 88.44  ? 308 THR D OG1 1 
ATOM 8521  C CG2 . THR D 1 308 ? -4.988  -3.229  -51.842 1.00 84.00  ? 308 THR D CG2 1 
ATOM 8522  N N   . GLU D 1 309 ? -6.909  -5.733  -53.182 1.00 80.17  ? 309 GLU D N   1 
ATOM 8523  C CA  . GLU D 1 309 ? -7.080  -6.470  -54.442 1.00 79.95  ? 309 GLU D CA  1 
ATOM 8524  C C   . GLU D 1 309 ? -5.763  -6.647  -55.225 1.00 82.66  ? 309 GLU D C   1 
ATOM 8525  O O   . GLU D 1 309 ? -5.011  -5.678  -55.339 1.00 81.17  ? 309 GLU D O   1 
ATOM 8526  C CB  . GLU D 1 309 ? -8.072  -5.688  -55.312 1.00 81.62  ? 309 GLU D CB  1 
ATOM 8527  C CG  . GLU D 1 309 ? -8.961  -6.541  -56.190 1.00 94.80  ? 309 GLU D CG  1 
ATOM 8528  C CD  . GLU D 1 309 ? -9.822  -5.741  -57.152 1.00 116.49 ? 309 GLU D CD  1 
ATOM 8529  O OE1 . GLU D 1 309 ? -9.601  -5.865  -58.378 1.00 121.15 ? 309 GLU D OE1 1 
ATOM 8530  O OE2 . GLU D 1 309 ? -10.701 -4.980  -56.684 1.00 102.16 ? 309 GLU D OE2 1 
ATOM 8531  N N   . PRO D 1 310 ? -5.485  -7.848  -55.815 1.00 80.02  ? 310 PRO D N   1 
ATOM 8532  C CA  . PRO D 1 310 ? -4.266  -8.010  -56.637 1.00 79.73  ? 310 PRO D CA  1 
ATOM 8533  C C   . PRO D 1 310 ? -4.248  -7.023  -57.802 1.00 83.75  ? 310 PRO D C   1 
ATOM 8534  O O   . PRO D 1 310 ? -5.306  -6.735  -58.381 1.00 84.25  ? 310 PRO D O   1 
ATOM 8535  C CB  . PRO D 1 310 ? -4.375  -9.452  -57.150 1.00 81.29  ? 310 PRO D CB  1 
ATOM 8536  C CG  . PRO D 1 310 ? -5.272  -10.134 -56.207 1.00 85.64  ? 310 PRO D CG  1 
ATOM 8537  C CD  . PRO D 1 310 ? -6.270  -9.099  -55.802 1.00 81.45  ? 310 PRO D CD  1 
ATOM 8538  N N   . GLY D 1 311 ? -3.064  -6.494  -58.103 1.00 78.99  ? 311 GLY D N   1 
ATOM 8539  C CA  . GLY D 1 311 ? -2.881  -5.506  -59.158 1.00 78.14  ? 311 GLY D CA  1 
ATOM 8540  C C   . GLY D 1 311 ? -2.777  -4.095  -58.617 1.00 80.41  ? 311 GLY D C   1 
ATOM 8541  O O   . GLY D 1 311 ? -2.249  -3.211  -59.300 1.00 80.23  ? 311 GLY D O   1 
ATOM 8542  N N   . THR D 1 312 ? -3.268  -3.877  -57.375 1.00 75.31  ? 312 THR D N   1 
ATOM 8543  C CA  . THR D 1 312 ? -3.208  -2.586  -56.693 1.00 74.73  ? 312 THR D CA  1 
ATOM 8544  C C   . THR D 1 312 ? -1.757  -2.249  -56.354 1.00 79.11  ? 312 THR D C   1 
ATOM 8545  O O   . THR D 1 312 ? -0.980  -3.132  -55.977 1.00 78.10  ? 312 THR D O   1 
ATOM 8546  C CB  . THR D 1 312 ? -4.093  -2.579  -55.425 1.00 79.29  ? 312 THR D CB  1 
ATOM 8547  O OG1 . THR D 1 312 ? -5.392  -3.096  -55.734 1.00 79.29  ? 312 THR D OG1 1 
ATOM 8548  C CG2 . THR D 1 312 ? -4.233  -1.187  -54.799 1.00 75.07  ? 312 THR D CG2 1 
ATOM 8549  N N   . LYS D 1 313 ? -1.401  -0.969  -56.507 1.00 76.71  ? 313 LYS D N   1 
ATOM 8550  C CA  . LYS D 1 313 ? -0.079  -0.466  -56.170 1.00 76.63  ? 313 LYS D CA  1 
ATOM 8551  C C   . LYS D 1 313 ? -0.117  0.110   -54.761 1.00 79.47  ? 313 LYS D C   1 
ATOM 8552  O O   . LYS D 1 313 ? -1.048  0.846   -54.422 1.00 78.59  ? 313 LYS D O   1 
ATOM 8553  C CB  . LYS D 1 313 ? 0.404   0.573   -57.194 1.00 79.42  ? 313 LYS D CB  1 
ATOM 8554  C CG  . LYS D 1 313 ? 0.811   -0.049  -58.521 1.00 101.55 ? 313 LYS D CG  1 
ATOM 8555  C CD  . LYS D 1 313 ? 1.596   0.925   -59.378 1.00 117.39 ? 313 LYS D CD  1 
ATOM 8556  C CE  . LYS D 1 313 ? 1.917   0.339   -60.729 1.00 127.33 ? 313 LYS D CE  1 
ATOM 8557  N NZ  . LYS D 1 313 ? 2.961   1.129   -61.429 1.00 134.81 ? 313 LYS D NZ  1 
ATOM 8558  N N   . VAL D 1 314 ? 0.863   -0.272  -53.927 1.00 75.65  ? 314 VAL D N   1 
ATOM 8559  C CA  . VAL D 1 314 ? 0.975   0.188   -52.538 1.00 75.43  ? 314 VAL D CA  1 
ATOM 8560  C C   . VAL D 1 314 ? 2.349   0.814   -52.317 1.00 80.48  ? 314 VAL D C   1 
ATOM 8561  O O   . VAL D 1 314 ? 3.309   0.433   -52.985 1.00 79.52  ? 314 VAL D O   1 
ATOM 8562  C CB  . VAL D 1 314 ? 0.686   -0.933  -51.491 1.00 78.58  ? 314 VAL D CB  1 
ATOM 8563  C CG1 . VAL D 1 314 ? -0.759  -1.426  -51.587 1.00 78.09  ? 314 VAL D CG1 1 
ATOM 8564  C CG2 . VAL D 1 314 ? 1.676   -2.098  -51.600 1.00 78.08  ? 314 VAL D CG2 1 
ATOM 8565  N N   . LYS D 1 315 ? 2.438   1.769   -51.385 1.00 78.54  ? 315 LYS D N   1 
ATOM 8566  C CA  . LYS D 1 315 ? 3.703   2.413   -51.044 1.00 78.89  ? 315 LYS D CA  1 
ATOM 8567  C C   . LYS D 1 315 ? 4.193   1.857   -49.704 1.00 81.75  ? 315 LYS D C   1 
ATOM 8568  O O   . LYS D 1 315 ? 3.460   1.867   -48.713 1.00 81.15  ? 315 LYS D O   1 
ATOM 8569  C CB  . LYS D 1 315 ? 3.589   3.947   -51.044 1.00 81.97  ? 315 LYS D CB  1 
ATOM 8570  C CG  . LYS D 1 315 ? 3.822   4.528   -52.436 1.00 106.53 ? 315 LYS D CG  1 
ATOM 8571  C CD  . LYS D 1 315 ? 3.380   5.982   -52.558 1.00 118.92 ? 315 LYS D CD  1 
ATOM 8572  C CE  . LYS D 1 315 ? 3.223   6.401   -54.000 1.00 125.25 ? 315 LYS D CE  1 
ATOM 8573  N NZ  . LYS D 1 315 ? 2.417   7.644   -54.106 1.00 130.35 ? 315 LYS D NZ  1 
ATOM 8574  N N   . LEU D 1 316 ? 5.429   1.346   -49.702 1.00 76.47  ? 316 LEU D N   1 
ATOM 8575  C CA  . LEU D 1 316 ? 6.063   0.713   -48.562 1.00 75.25  ? 316 LEU D CA  1 
ATOM 8576  C C   . LEU D 1 316 ? 7.132   1.584   -47.910 1.00 78.75  ? 316 LEU D C   1 
ATOM 8577  O O   . LEU D 1 316 ? 8.165   1.858   -48.516 1.00 77.79  ? 316 LEU D O   1 
ATOM 8578  C CB  . LEU D 1 316 ? 6.692   -0.614  -49.030 1.00 74.84  ? 316 LEU D CB  1 
ATOM 8579  C CG  . LEU D 1 316 ? 6.014   -1.927  -48.611 1.00 78.63  ? 316 LEU D CG  1 
ATOM 8580  C CD1 . LEU D 1 316 ? 4.538   -1.968  -48.988 1.00 78.53  ? 316 LEU D CD1 1 
ATOM 8581  C CD2 . LEU D 1 316 ? 6.705   -3.093  -49.241 1.00 79.05  ? 316 LEU D CD2 1 
ATOM 8582  N N   . GLY D 1 317 ? 6.865   1.995   -46.671 1.00 75.82  ? 317 GLY D N   1 
ATOM 8583  C CA  . GLY D 1 317 ? 7.802   2.725   -45.826 1.00 76.12  ? 317 GLY D CA  1 
ATOM 8584  C C   . GLY D 1 317 ? 8.781   1.682   -45.338 1.00 82.29  ? 317 GLY D C   1 
ATOM 8585  O O   . GLY D 1 317 ? 8.390   0.724   -44.669 1.00 83.81  ? 317 GLY D O   1 
ATOM 8586  N N   . LEU D 1 318 ? 10.031  1.806   -45.752 1.00 77.91  ? 318 LEU D N   1 
ATOM 8587  C CA  . LEU D 1 318 ? 11.066  0.800   -45.555 1.00 76.72  ? 318 LEU D CA  1 
ATOM 8588  C C   . LEU D 1 318 ? 12.273  1.356   -44.809 1.00 80.81  ? 318 LEU D C   1 
ATOM 8589  O O   . LEU D 1 318 ? 12.401  2.573   -44.670 1.00 80.87  ? 318 LEU D O   1 
ATOM 8590  C CB  . LEU D 1 318 ? 11.446  0.406   -46.983 1.00 76.39  ? 318 LEU D CB  1 
ATOM 8591  C CG  . LEU D 1 318 ? 12.061  -0.905  -47.239 1.00 80.97  ? 318 LEU D CG  1 
ATOM 8592  C CD1 . LEU D 1 318 ? 11.344  -1.586  -48.363 1.00 80.99  ? 318 LEU D CD1 1 
ATOM 8593  C CD2 . LEU D 1 318 ? 13.498  -0.710  -47.593 1.00 84.80  ? 318 LEU D CD2 1 
ATOM 8594  N N   . LEU D 1 319 ? 13.153  0.471   -44.319 1.00 77.98  ? 319 LEU D N   1 
ATOM 8595  C CA  . LEU D 1 319 ? 14.364  0.868   -43.597 1.00 78.04  ? 319 LEU D CA  1 
ATOM 8596  C C   . LEU D 1 319 ? 15.489  -0.143  -43.829 1.00 82.59  ? 319 LEU D C   1 
ATOM 8597  O O   . LEU D 1 319 ? 15.465  -1.223  -43.235 1.00 81.90  ? 319 LEU D O   1 
ATOM 8598  C CB  . LEU D 1 319 ? 14.060  1.007   -42.096 1.00 78.15  ? 319 LEU D CB  1 
ATOM 8599  C CG  . LEU D 1 319 ? 14.797  2.100   -41.345 1.00 83.22  ? 319 LEU D CG  1 
ATOM 8600  C CD1 . LEU D 1 319 ? 14.192  3.455   -41.625 1.00 83.49  ? 319 LEU D CD1 1 
ATOM 8601  C CD2 . LEU D 1 319 ? 14.715  1.868   -39.872 1.00 86.37  ? 319 LEU D CD2 1 
ATOM 8602  N N   . ARG D 1 320 ? 16.454  0.180   -44.726 1.00 80.08  ? 320 ARG D N   1 
ATOM 8603  C CA  . ARG D 1 320 ? 17.574  -0.729  -44.957 1.00 79.89  ? 320 ARG D CA  1 
ATOM 8604  C C   . ARG D 1 320 ? 18.884  -0.065  -44.566 1.00 84.65  ? 320 ARG D C   1 
ATOM 8605  O O   . ARG D 1 320 ? 19.148  1.087   -44.920 1.00 85.23  ? 320 ARG D O   1 
ATOM 8606  C CB  . ARG D 1 320 ? 17.599  -1.347  -46.363 1.00 78.77  ? 320 ARG D CB  1 
ATOM 8607  C CG  . ARG D 1 320 ? 18.106  -0.534  -47.534 1.00 84.47  ? 320 ARG D CG  1 
ATOM 8608  C CD  . ARG D 1 320 ? 18.277  -1.432  -48.745 1.00 82.40  ? 320 ARG D CD  1 
ATOM 8609  N NE  . ARG D 1 320 ? 17.007  -2.019  -49.171 1.00 87.41  ? 320 ARG D NE  1 
ATOM 8610  C CZ  . ARG D 1 320 ? 16.529  -1.968  -50.408 1.00 108.45 ? 320 ARG D CZ  1 
ATOM 8611  N NH1 . ARG D 1 320 ? 17.217  -1.368  -51.370 1.00 103.31 ? 320 ARG D NH1 1 
ATOM 8612  N NH2 . ARG D 1 320 ? 15.368  -2.534  -50.698 1.00 97.26  ? 320 ARG D NH2 1 
ATOM 8613  N N   . ASN D 1 321 ? 19.657  -0.796  -43.747 1.00 80.86  ? 321 ASN D N   1 
ATOM 8614  C CA  . ASN D 1 321 ? 20.932  -0.410  -43.143 1.00 80.68  ? 321 ASN D CA  1 
ATOM 8615  C C   . ASN D 1 321 ? 20.787  0.923   -42.376 1.00 85.25  ? 321 ASN D C   1 
ATOM 8616  O O   . ASN D 1 321 ? 21.713  1.738   -42.330 1.00 84.83  ? 321 ASN D O   1 
ATOM 8617  C CB  . ASN D 1 321 ? 22.057  -0.381  -44.172 1.00 82.27  ? 321 ASN D CB  1 
ATOM 8618  C CG  . ASN D 1 321 ? 22.523  -1.766  -44.556 1.00 110.51 ? 321 ASN D CG  1 
ATOM 8619  O OD1 . ASN D 1 321 ? 22.290  -2.245  -45.675 1.00 101.67 ? 321 ASN D OD1 1 
ATOM 8620  N ND2 . ASN D 1 321 ? 23.176  -2.455  -43.626 1.00 104.37 ? 321 ASN D ND2 1 
ATOM 8621  N N   . GLY D 1 322 ? 19.611  1.091   -41.761 1.00 82.23  ? 322 GLY D N   1 
ATOM 8622  C CA  . GLY D 1 322 ? 19.235  2.243   -40.954 1.00 81.76  ? 322 GLY D CA  1 
ATOM 8623  C C   . GLY D 1 322 ? 18.794  3.449   -41.746 1.00 85.99  ? 322 GLY D C   1 
ATOM 8624  O O   . GLY D 1 322 ? 18.551  4.508   -41.155 1.00 85.91  ? 322 GLY D O   1 
ATOM 8625  N N   . LYS D 1 323 ? 18.687  3.302   -43.082 1.00 82.30  ? 323 LYS D N   1 
ATOM 8626  C CA  . LYS D 1 323 ? 18.333  4.410   -43.970 1.00 81.99  ? 323 LYS D CA  1 
ATOM 8627  C C   . LYS D 1 323 ? 16.902  4.267   -44.508 1.00 84.94  ? 323 LYS D C   1 
ATOM 8628  O O   . LYS D 1 323 ? 16.538  3.196   -45.004 1.00 84.22  ? 323 LYS D O   1 
ATOM 8629  C CB  . LYS D 1 323 ? 19.345  4.549   -45.137 1.00 84.44  ? 323 LYS D CB  1 
ATOM 8630  C CG  . LYS D 1 323 ? 20.827  4.628   -44.727 1.00 99.22  ? 323 LYS D CG  1 
ATOM 8631  C CD  . LYS D 1 323 ? 21.184  5.891   -43.932 1.00 110.93 ? 323 LYS D CD  1 
ATOM 8632  C CE  . LYS D 1 323 ? 22.427  5.692   -43.098 1.00 125.38 ? 323 LYS D CE  1 
ATOM 8633  N NZ  . LYS D 1 323 ? 22.666  6.832   -42.173 1.00 135.11 ? 323 LYS D NZ  1 
ATOM 8634  N N   . PRO D 1 324 ? 16.095  5.357   -44.441 1.00 80.56  ? 324 PRO D N   1 
ATOM 8635  C CA  . PRO D 1 324 ? 14.711  5.289   -44.948 1.00 79.73  ? 324 PRO D CA  1 
ATOM 8636  C C   . PRO D 1 324 ? 14.611  5.252   -46.473 1.00 83.02  ? 324 PRO D C   1 
ATOM 8637  O O   . PRO D 1 324 ? 15.420  5.877   -47.162 1.00 82.54  ? 324 PRO D O   1 
ATOM 8638  C CB  . PRO D 1 324 ? 14.062  6.573   -44.411 1.00 81.36  ? 324 PRO D CB  1 
ATOM 8639  C CG  . PRO D 1 324 ? 15.047  7.172   -43.451 1.00 85.95  ? 324 PRO D CG  1 
ATOM 8640  C CD  . PRO D 1 324 ? 16.392  6.690   -43.877 1.00 81.84  ? 324 PRO D CD  1 
ATOM 8641  N N   . LEU D 1 325 ? 13.599  4.520   -46.984 1.00 79.08  ? 325 LEU D N   1 
ATOM 8642  C CA  . LEU D 1 325 ? 13.256  4.347   -48.398 1.00 78.90  ? 325 LEU D CA  1 
ATOM 8643  C C   . LEU D 1 325 ? 11.763  4.182   -48.558 1.00 84.72  ? 325 LEU D C   1 
ATOM 8644  O O   . LEU D 1 325 ? 11.104  3.657   -47.661 1.00 84.99  ? 325 LEU D O   1 
ATOM 8645  C CB  . LEU D 1 325 ? 13.935  3.109   -49.023 1.00 79.03  ? 325 LEU D CB  1 
ATOM 8646  C CG  . LEU D 1 325 ? 15.457  2.973   -49.011 1.00 84.54  ? 325 LEU D CG  1 
ATOM 8647  C CD1 . LEU D 1 325 ? 15.862  1.614   -49.547 1.00 84.68  ? 325 LEU D CD1 1 
ATOM 8648  C CD2 . LEU D 1 325 ? 16.145  4.082   -49.824 1.00 88.23  ? 325 LEU D CD2 1 
ATOM 8649  N N   . GLU D 1 326 ? 11.230  4.592   -49.714 1.00 81.54  ? 326 GLU D N   1 
ATOM 8650  C CA  . GLU D 1 326 ? 9.826   4.414   -50.079 1.00 81.11  ? 326 GLU D CA  1 
ATOM 8651  C C   . GLU D 1 326 ? 9.826   3.585   -51.347 1.00 83.19  ? 326 GLU D C   1 
ATOM 8652  O O   . GLU D 1 326 ? 10.591  3.878   -52.264 1.00 83.09  ? 326 GLU D O   1 
ATOM 8653  C CB  . GLU D 1 326 ? 9.098   5.758   -50.249 1.00 82.63  ? 326 GLU D CB  1 
ATOM 8654  C CG  . GLU D 1 326 ? 8.121   6.081   -49.131 1.00 95.66  ? 326 GLU D CG  1 
ATOM 8655  C CD  . GLU D 1 326 ? 6.653   5.796   -49.404 1.00 134.63 ? 326 GLU D CD  1 
ATOM 8656  O OE1 . GLU D 1 326 ? 6.163   6.140   -50.506 1.00 136.80 ? 326 GLU D OE1 1 
ATOM 8657  O OE2 . GLU D 1 326 ? 5.975   5.283   -48.482 1.00 139.99 ? 326 GLU D OE2 1 
ATOM 8658  N N   . VAL D 1 327 ? 9.054   2.504   -51.371 1.00 78.38  ? 327 VAL D N   1 
ATOM 8659  C CA  . VAL D 1 327 ? 9.024   1.589   -52.505 1.00 77.75  ? 327 VAL D CA  1 
ATOM 8660  C C   . VAL D 1 327 ? 7.557   1.351   -52.921 1.00 83.80  ? 327 VAL D C   1 
ATOM 8661  O O   . VAL D 1 327 ? 6.716   1.067   -52.068 1.00 84.55  ? 327 VAL D O   1 
ATOM 8662  C CB  . VAL D 1 327 ? 9.782   0.272   -52.134 1.00 80.48  ? 327 VAL D CB  1 
ATOM 8663  C CG1 . VAL D 1 327 ? 9.502   -0.850  -53.117 1.00 80.16  ? 327 VAL D CG1 1 
ATOM 8664  C CG2 . VAL D 1 327 ? 11.285  0.504   -52.013 1.00 80.13  ? 327 VAL D CG2 1 
ATOM 8665  N N   . GLU D 1 328 ? 7.256   1.484   -54.225 1.00 80.56  ? 328 GLU D N   1 
ATOM 8666  C CA  . GLU D 1 328 ? 5.920   1.226   -54.769 1.00 80.42  ? 328 GLU D CA  1 
ATOM 8667  C C   . GLU D 1 328 ? 5.879   -0.219  -55.268 1.00 82.81  ? 328 GLU D C   1 
ATOM 8668  O O   . GLU D 1 328 ? 6.715   -0.610  -56.089 1.00 83.24  ? 328 GLU D O   1 
ATOM 8669  C CB  . GLU D 1 328 ? 5.550   2.236   -55.872 1.00 82.14  ? 328 GLU D CB  1 
ATOM 8670  C CG  . GLU D 1 328 ? 4.076   2.231   -56.256 1.00 96.67  ? 328 GLU D CG  1 
ATOM 8671  C CD  . GLU D 1 328 ? 3.658   3.329   -57.216 1.00 126.46 ? 328 GLU D CD  1 
ATOM 8672  O OE1 . GLU D 1 328 ? 2.916   4.243   -56.789 1.00 124.72 ? 328 GLU D OE1 1 
ATOM 8673  O OE2 . GLU D 1 328 ? 4.075   3.281   -58.396 1.00 123.60 ? 328 GLU D OE2 1 
ATOM 8674  N N   . VAL D 1 329 ? 4.946   -1.024  -54.727 1.00 77.33  ? 329 VAL D N   1 
ATOM 8675  C CA  . VAL D 1 329 ? 4.826   -2.452  -55.047 1.00 76.26  ? 329 VAL D CA  1 
ATOM 8676  C C   . VAL D 1 329 ? 3.463   -2.732  -55.677 1.00 78.74  ? 329 VAL D C   1 
ATOM 8677  O O   . VAL D 1 329 ? 2.450   -2.256  -55.172 1.00 78.01  ? 329 VAL D O   1 
ATOM 8678  C CB  . VAL D 1 329 ? 5.054   -3.351  -53.775 1.00 79.52  ? 329 VAL D CB  1 
ATOM 8679  C CG1 . VAL D 1 329 ? 5.006   -4.843  -54.107 1.00 79.09  ? 329 VAL D CG1 1 
ATOM 8680  C CG2 . VAL D 1 329 ? 6.353   -3.013  -53.055 1.00 79.05  ? 329 VAL D CG2 1 
ATOM 8681  N N   . THR D 1 330 ? 3.442   -3.536  -56.745 1.00 75.01  ? 330 THR D N   1 
ATOM 8682  C CA  . THR D 1 330 ? 2.208   -3.986  -57.380 1.00 74.94  ? 330 THR D CA  1 
ATOM 8683  C C   . THR D 1 330 ? 1.896   -5.351  -56.782 1.00 78.34  ? 330 THR D C   1 
ATOM 8684  O O   . THR D 1 330 ? 2.740   -6.259  -56.811 1.00 77.67  ? 330 THR D O   1 
ATOM 8685  C CB  . THR D 1 330 ? 2.319   -3.997  -58.918 1.00 82.58  ? 330 THR D CB  1 
ATOM 8686  O OG1 . THR D 1 330 ? 2.740   -2.704  -59.368 1.00 82.81  ? 330 THR D OG1 1 
ATOM 8687  C CG2 . THR D 1 330 ? 0.995   -4.379  -59.597 1.00 78.22  ? 330 THR D CG2 1 
ATOM 8688  N N   . LEU D 1 331 ? 0.686   -5.488  -56.234 1.00 74.29  ? 331 LEU D N   1 
ATOM 8689  C CA  . LEU D 1 331 ? 0.288   -6.715  -55.563 1.00 73.64  ? 331 LEU D CA  1 
ATOM 8690  C C   . LEU D 1 331 ? -0.004  -7.844  -56.524 1.00 78.08  ? 331 LEU D C   1 
ATOM 8691  O O   . LEU D 1 331 ? -0.641  -7.646  -57.557 1.00 78.63  ? 331 LEU D O   1 
ATOM 8692  C CB  . LEU D 1 331 ? -0.924  -6.480  -54.651 1.00 73.21  ? 331 LEU D CB  1 
ATOM 8693  C CG  . LEU D 1 331 ? -0.748  -5.451  -53.522 1.00 77.56  ? 331 LEU D CG  1 
ATOM 8694  C CD1 . LEU D 1 331 ? -1.961  -5.417  -52.644 1.00 77.39  ? 331 LEU D CD1 1 
ATOM 8695  C CD2 . LEU D 1 331 ? 0.501   -5.724  -52.682 1.00 80.01  ? 331 LEU D CD2 1 
ATOM 8696  N N   . ASP D 1 332 ? 0.464   -9.037  -56.159 1.00 74.16  ? 332 ASP D N   1 
ATOM 8697  C CA  . ASP D 1 332 ? 0.227   -10.282 -56.880 1.00 74.02  ? 332 ASP D CA  1 
ATOM 8698  C C   . ASP D 1 332 ? -1.039  -10.936 -56.320 1.00 77.66  ? 332 ASP D C   1 
ATOM 8699  O O   . ASP D 1 332 ? -1.681  -10.364 -55.441 1.00 77.74  ? 332 ASP D O   1 
ATOM 8700  C CB  . ASP D 1 332 ? 1.441   -11.220 -56.730 1.00 76.36  ? 332 ASP D CB  1 
ATOM 8701  C CG  . ASP D 1 332 ? 2.774   -10.626 -57.134 1.00 91.60  ? 332 ASP D CG  1 
ATOM 8702  O OD1 . ASP D 1 332 ? 3.653   -10.492 -56.255 1.00 92.38  ? 332 ASP D OD1 1 
ATOM 8703  O OD2 . ASP D 1 332 ? 2.949   -10.322 -58.337 1.00 101.40 ? 332 ASP D OD2 1 
ATOM 8704  N N   . THR D 1 333 ? -1.395  -12.125 -56.811 1.00 74.47  ? 333 THR D N   1 
ATOM 8705  C CA  . THR D 1 333 ? -2.543  -12.887 -56.311 1.00 74.54  ? 333 THR D CA  1 
ATOM 8706  C C   . THR D 1 333 ? -2.020  -13.982 -55.362 1.00 79.34  ? 333 THR D C   1 
ATOM 8707  O O   . THR D 1 333 ? -0.890  -14.450 -55.531 1.00 78.93  ? 333 THR D O   1 
ATOM 8708  C CB  . THR D 1 333 ? -3.374  -13.444 -57.472 1.00 81.27  ? 333 THR D CB  1 
ATOM 8709  O OG1 . THR D 1 333 ? -3.516  -12.424 -58.469 1.00 79.13  ? 333 THR D OG1 1 
ATOM 8710  C CG2 . THR D 1 333 ? -4.757  -13.933 -57.025 1.00 80.70  ? 333 THR D CG2 1 
ATOM 8711  N N   . SER D 1 334 ? -2.831  -14.362 -54.355 1.00 76.55  ? 334 SER D N   1 
ATOM 8712  C CA  . SER D 1 334 ? -2.483  -15.388 -53.364 1.00 79.04  ? 334 SER D CA  1 
ATOM 8713  C C   . SER D 1 334 ? -3.066  -16.762 -53.743 1.00 75.80  ? 334 SER D C   1 
ATOM 8714  O O   . SER D 1 334 ? -4.258  -16.805 -54.119 1.00 80.70  ? 334 SER D O   1 
ATOM 8715  C CB  . SER D 1 334 ? -2.956  -14.960 -51.975 1.00 82.12  ? 334 SER D CB  1 
ATOM 8716  O OG  . SER D 1 334 ? -2.525  -15.839 -50.951 1.00 89.69  ? 334 SER D OG  1 
ATOM 8717  N N   . PRO E 1 11  ? -13.961 24.413  -15.016 1.00 75.72  ? 11  PRO E N   1 
ATOM 8718  C CA  . PRO E 1 11  ? -13.886 24.553  -16.479 1.00 74.86  ? 11  PRO E CA  1 
ATOM 8719  C C   . PRO E 1 11  ? -14.112 23.225  -17.209 1.00 75.00  ? 11  PRO E C   1 
ATOM 8720  O O   . PRO E 1 11  ? -14.644 23.221  -18.335 1.00 75.01  ? 11  PRO E O   1 
ATOM 8721  C CB  . PRO E 1 11  ? -12.466 25.093  -16.715 1.00 76.89  ? 11  PRO E CB  1 
ATOM 8722  C CG  . PRO E 1 11  ? -11.978 25.611  -15.344 1.00 81.60  ? 11  PRO E CG  1 
ATOM 8723  C CD  . PRO E 1 11  ? -13.066 25.365  -14.332 1.00 77.25  ? 11  PRO E CD  1 
ATOM 8724  N N   . LEU E 1 12  ? -13.697 22.092  -16.581 1.00 67.55  ? 12  LEU E N   1 
ATOM 8725  C CA  . LEU E 1 12  ? -13.862 20.752  -17.174 1.00 64.62  ? 12  LEU E CA  1 
ATOM 8726  C C   . LEU E 1 12  ? -15.327 20.298  -17.128 1.00 60.97  ? 12  LEU E C   1 
ATOM 8727  O O   . LEU E 1 12  ? -15.972 20.474  -16.089 1.00 59.86  ? 12  LEU E O   1 
ATOM 8728  C CB  . LEU E 1 12  ? -12.979 19.698  -16.463 1.00 64.43  ? 12  LEU E CB  1 
ATOM 8729  C CG  . LEU E 1 12  ? -11.496 19.591  -16.887 1.00 68.17  ? 12  LEU E CG  1 
ATOM 8730  C CD1 . LEU E 1 12  ? -10.813 18.434  -16.178 1.00 66.41  ? 12  LEU E CD1 1 
ATOM 8731  C CD2 . LEU E 1 12  ? -11.327 19.461  -18.416 1.00 69.74  ? 12  LEU E CD2 1 
ATOM 8732  N N   . PRO E 1 13  ? -15.876 19.710  -18.216 1.00 51.92  ? 13  PRO E N   1 
ATOM 8733  C CA  . PRO E 1 13  ? -17.255 19.172  -18.134 1.00 50.82  ? 13  PRO E CA  1 
ATOM 8734  C C   . PRO E 1 13  ? -17.349 18.053  -17.072 1.00 55.74  ? 13  PRO E C   1 
ATOM 8735  O O   . PRO E 1 13  ? -16.411 17.247  -16.935 1.00 57.56  ? 13  PRO E O   1 
ATOM 8736  C CB  . PRO E 1 13  ? -17.546 18.659  -19.543 1.00 51.77  ? 13  PRO E CB  1 
ATOM 8737  C CG  . PRO E 1 13  ? -16.258 18.686  -20.284 1.00 55.38  ? 13  PRO E CG  1 
ATOM 8738  C CD  . PRO E 1 13  ? -15.220 19.398  -19.503 1.00 51.61  ? 13  PRO E CD  1 
ATOM 8739  N N   . SER E 1 14  ? -18.429 18.059  -16.264 1.00 49.77  ? 14  SER E N   1 
ATOM 8740  C CA  . SER E 1 14  ? -18.595 17.139  -15.137 1.00 48.13  ? 14  SER E CA  1 
ATOM 8741  C C   . SER E 1 14  ? -20.062 16.960  -14.747 1.00 51.91  ? 14  SER E C   1 
ATOM 8742  O O   . SER E 1 14  ? -20.872 17.888  -14.916 1.00 52.84  ? 14  SER E O   1 
ATOM 8743  C CB  . SER E 1 14  ? -17.814 17.671  -13.936 1.00 48.92  ? 14  SER E CB  1 
ATOM 8744  O OG  . SER E 1 14  ? -17.975 16.865  -12.787 1.00 57.00  ? 14  SER E OG  1 
ATOM 8745  N N   . LEU E 1 15  ? -20.387 15.785  -14.164 1.00 44.67  ? 15  LEU E N   1 
ATOM 8746  C CA  . LEU E 1 15  ? -21.723 15.494  -13.680 1.00 43.34  ? 15  LEU E CA  1 
ATOM 8747  C C   . LEU E 1 15  ? -21.845 15.868  -12.189 1.00 46.09  ? 15  LEU E C   1 
ATOM 8748  O O   . LEU E 1 15  ? -22.959 15.913  -11.635 1.00 43.94  ? 15  LEU E O   1 
ATOM 8749  C CB  . LEU E 1 15  ? -22.079 14.014  -13.909 1.00 43.32  ? 15  LEU E CB  1 
ATOM 8750  C CG  . LEU E 1 15  ? -22.068 13.517  -15.346 1.00 46.80  ? 15  LEU E CG  1 
ATOM 8751  C CD1 . LEU E 1 15  ? -22.368 12.020  -15.399 1.00 46.54  ? 15  LEU E CD1 1 
ATOM 8752  C CD2 . LEU E 1 15  ? -23.021 14.323  -16.220 1.00 45.95  ? 15  LEU E CD2 1 
ATOM 8753  N N   . ALA E 1 16  ? -20.694 16.178  -11.567 1.00 43.54  ? 16  ALA E N   1 
ATOM 8754  C CA  . ALA E 1 16  ? -20.565 16.563  -10.157 1.00 44.76  ? 16  ALA E CA  1 
ATOM 8755  C C   . ALA E 1 16  ? -21.496 17.724  -9.744  1.00 52.63  ? 16  ALA E C   1 
ATOM 8756  O O   . ALA E 1 16  ? -22.130 17.601  -8.684  1.00 51.97  ? 16  ALA E O   1 
ATOM 8757  C CB  . ALA E 1 16  ? -19.117 16.917  -9.824  1.00 44.75  ? 16  ALA E CB  1 
ATOM 8758  N N   . PRO E 1 17  ? -21.653 18.828  -10.529 1.00 51.99  ? 17  PRO E N   1 
ATOM 8759  C CA  . PRO E 1 17  ? -22.517 19.920  -10.049 1.00 52.53  ? 17  PRO E CA  1 
ATOM 8760  C C   . PRO E 1 17  ? -23.968 19.484  -9.890  1.00 58.58  ? 17  PRO E C   1 
ATOM 8761  O O   . PRO E 1 17  ? -24.570 19.816  -8.859  1.00 59.63  ? 17  PRO E O   1 
ATOM 8762  C CB  . PRO E 1 17  ? -22.341 21.008  -11.110 1.00 53.70  ? 17  PRO E CB  1 
ATOM 8763  C CG  . PRO E 1 17  ? -21.015 20.701  -11.733 1.00 58.23  ? 17  PRO E CG  1 
ATOM 8764  C CD  . PRO E 1 17  ? -21.011 19.211  -11.808 1.00 53.77  ? 17  PRO E CD  1 
ATOM 8765  N N   . MET E 1 18  ? -24.506 18.691  -10.849 1.00 54.52  ? 18  MET E N   1 
ATOM 8766  C CA  . MET E 1 18  ? -25.885 18.244  -10.716 1.00 53.98  ? 18  MET E CA  1 
ATOM 8767  C C   . MET E 1 18  ? -26.007 17.134  -9.644  1.00 53.44  ? 18  MET E C   1 
ATOM 8768  O O   . MET E 1 18  ? -26.977 17.148  -8.881  1.00 52.67  ? 18  MET E O   1 
ATOM 8769  C CB  . MET E 1 18  ? -26.494 17.844  -12.068 1.00 57.00  ? 18  MET E CB  1 
ATOM 8770  C CG  . MET E 1 18  ? -26.186 16.466  -12.524 1.00 61.98  ? 18  MET E CG  1 
ATOM 8771  S SD  . MET E 1 18  ? -27.361 15.231  -11.907 1.00 66.72  ? 18  MET E SD  1 
ATOM 8772  C CE  . MET E 1 18  ? -26.969 13.866  -13.062 1.00 63.48  ? 18  MET E CE  1 
ATOM 8773  N N   . LEU E 1 19  ? -25.009 16.227  -9.546  1.00 46.04  ? 19  LEU E N   1 
ATOM 8774  C CA  . LEU E 1 19  ? -25.073 15.132  -8.592  1.00 44.90  ? 19  LEU E CA  1 
ATOM 8775  C C   . LEU E 1 19  ? -24.962 15.609  -7.155  1.00 51.08  ? 19  LEU E C   1 
ATOM 8776  O O   . LEU E 1 19  ? -25.593 15.018  -6.289  1.00 51.54  ? 19  LEU E O   1 
ATOM 8777  C CB  . LEU E 1 19  ? -24.063 14.020  -8.894  1.00 44.71  ? 19  LEU E CB  1 
ATOM 8778  C CG  . LEU E 1 19  ? -24.411 13.096  -10.099 1.00 48.68  ? 19  LEU E CG  1 
ATOM 8779  C CD1 . LEU E 1 19  ? -23.217 12.273  -10.509 1.00 49.32  ? 19  LEU E CD1 1 
ATOM 8780  C CD2 . LEU E 1 19  ? -25.604 12.186  -9.819  1.00 47.06  ? 19  LEU E CD2 1 
ATOM 8781  N N   . GLU E 1 20  ? -24.249 16.713  -6.906  1.00 49.95  ? 20  GLU E N   1 
ATOM 8782  C CA  . GLU E 1 20  ? -24.119 17.368  -5.598  1.00 50.03  ? 20  GLU E CA  1 
ATOM 8783  C C   . GLU E 1 20  ? -25.504 17.654  -5.001  1.00 54.58  ? 20  GLU E C   1 
ATOM 8784  O O   . GLU E 1 20  ? -25.745 17.359  -3.817  1.00 54.08  ? 20  GLU E O   1 
ATOM 8785  C CB  . GLU E 1 20  ? -23.383 18.695  -5.808  1.00 52.04  ? 20  GLU E CB  1 
ATOM 8786  C CG  . GLU E 1 20  ? -22.225 18.981  -4.868  1.00 69.37  ? 20  GLU E CG  1 
ATOM 8787  C CD  . GLU E 1 20  ? -21.249 20.044  -5.363  1.00 104.05 ? 20  GLU E CD  1 
ATOM 8788  O OE1 . GLU E 1 20  ? -21.613 20.842  -6.261  1.00 101.15 ? 20  GLU E OE1 1 
ATOM 8789  O OE2 . GLU E 1 20  ? -20.100 20.058  -4.864  1.00 102.06 ? 20  GLU E OE2 1 
ATOM 8790  N N   . LYS E 1 21  ? -26.425 18.187  -5.856  1.00 51.01  ? 21  LYS E N   1 
ATOM 8791  C CA  . LYS E 1 21  ? -27.796 18.573  -5.503  1.00 51.12  ? 21  LYS E CA  1 
ATOM 8792  C C   . LYS E 1 21  ? -28.756 17.408  -5.304  1.00 55.95  ? 21  LYS E C   1 
ATOM 8793  O O   . LYS E 1 21  ? -29.648 17.474  -4.451  1.00 56.84  ? 21  LYS E O   1 
ATOM 8794  C CB  . LYS E 1 21  ? -28.420 19.470  -6.599  1.00 52.65  ? 21  LYS E CB  1 
ATOM 8795  C CG  . LYS E 1 21  ? -27.607 20.666  -7.072  1.00 55.06  ? 21  LYS E CG  1 
ATOM 8796  C CD  . LYS E 1 21  ? -28.266 21.286  -8.326  1.00 59.43  ? 21  LYS E CD  1 
ATOM 8797  C CE  . LYS E 1 21  ? -27.309 22.082  -9.195  1.00 76.70  ? 21  LYS E CE  1 
ATOM 8798  N NZ  . LYS E 1 21  ? -27.833 22.318  -10.576 1.00 86.54  ? 21  LYS E NZ  1 
ATOM 8799  N N   . VAL E 1 22  ? -28.602 16.373  -6.129  1.00 51.65  ? 22  VAL E N   1 
ATOM 8800  C CA  . VAL E 1 22  ? -29.518 15.260  -6.312  1.00 50.21  ? 22  VAL E CA  1 
ATOM 8801  C C   . VAL E 1 22  ? -29.185 13.970  -5.517  1.00 54.71  ? 22  VAL E C   1 
ATOM 8802  O O   . VAL E 1 22  ? -30.119 13.316  -5.040  1.00 54.96  ? 22  VAL E O   1 
ATOM 8803  C CB  . VAL E 1 22  ? -29.513 15.056  -7.836  1.00 53.46  ? 22  VAL E CB  1 
ATOM 8804  C CG1 . VAL E 1 22  ? -29.735 13.624  -8.255  1.00 53.50  ? 22  VAL E CG1 1 
ATOM 8805  C CG2 . VAL E 1 22  ? -30.513 15.989  -8.493  1.00 53.35  ? 22  VAL E CG2 1 
ATOM 8806  N N   . LEU E 1 23  ? -27.895 13.613  -5.348  1.00 49.74  ? 23  LEU E N   1 
ATOM 8807  C CA  . LEU E 1 23  ? -27.516 12.376  -4.653  1.00 48.80  ? 23  LEU E CA  1 
ATOM 8808  C C   . LEU E 1 23  ? -28.188 12.198  -3.261  1.00 51.07  ? 23  LEU E C   1 
ATOM 8809  O O   . LEU E 1 23  ? -28.581 11.063  -2.958  1.00 50.27  ? 23  LEU E O   1 
ATOM 8810  C CB  . LEU E 1 23  ? -25.990 12.238  -4.518  1.00 49.11  ? 23  LEU E CB  1 
ATOM 8811  C CG  . LEU E 1 23  ? -25.195 11.970  -5.816  1.00 54.14  ? 23  LEU E CG  1 
ATOM 8812  C CD1 . LEU E 1 23  ? -23.728 12.090  -5.578  1.00 54.00  ? 23  LEU E CD1 1 
ATOM 8813  C CD2 . LEU E 1 23  ? -25.497 10.617  -6.411  1.00 57.22  ? 23  LEU E CD2 1 
ATOM 8814  N N   . PRO E 1 24  ? -28.399 13.252  -2.417  1.00 46.47  ? 24  PRO E N   1 
ATOM 8815  C CA  . PRO E 1 24  ? -29.049 13.009  -1.100  1.00 45.15  ? 24  PRO E CA  1 
ATOM 8816  C C   . PRO E 1 24  ? -30.476 12.409  -1.177  1.00 44.92  ? 24  PRO E C   1 
ATOM 8817  O O   . PRO E 1 24  ? -30.919 11.815  -0.184  1.00 44.45  ? 24  PRO E O   1 
ATOM 8818  C CB  . PRO E 1 24  ? -29.073 14.401  -0.460  1.00 46.82  ? 24  PRO E CB  1 
ATOM 8819  C CG  . PRO E 1 24  ? -27.936 15.141  -1.130  1.00 50.78  ? 24  PRO E CG  1 
ATOM 8820  C CD  . PRO E 1 24  ? -27.982 14.671  -2.546  1.00 46.89  ? 24  PRO E CD  1 
ATOM 8821  N N   . ALA E 1 25  ? -31.140 12.478  -2.366  1.00 38.81  ? 25  ALA E N   1 
ATOM 8822  C CA  . ALA E 1 25  ? -32.491 11.948  -2.625  1.00 38.84  ? 25  ALA E CA  1 
ATOM 8823  C C   . ALA E 1 25  ? -32.516 10.397  -2.806  1.00 44.26  ? 25  ALA E C   1 
ATOM 8824  O O   . ALA E 1 25  ? -33.565 9.754   -2.702  1.00 42.86  ? 25  ALA E O   1 
ATOM 8825  C CB  . ALA E 1 25  ? -33.056 12.609  -3.864  1.00 39.19  ? 25  ALA E CB  1 
ATOM 8826  N N   . VAL E 1 26  ? -31.352 9.817   -3.130  1.00 41.60  ? 26  VAL E N   1 
ATOM 8827  C CA  . VAL E 1 26  ? -31.200 8.388   -3.342  1.00 40.48  ? 26  VAL E CA  1 
ATOM 8828  C C   . VAL E 1 26  ? -30.648 7.819   -2.045  1.00 48.94  ? 26  VAL E C   1 
ATOM 8829  O O   . VAL E 1 26  ? -29.696 8.368   -1.468  1.00 50.66  ? 26  VAL E O   1 
ATOM 8830  C CB  . VAL E 1 26  ? -30.334 8.069   -4.583  1.00 42.12  ? 26  VAL E CB  1 
ATOM 8831  C CG1 . VAL E 1 26  ? -30.390 6.583   -4.920  1.00 41.78  ? 26  VAL E CG1 1 
ATOM 8832  C CG2 . VAL E 1 26  ? -30.771 8.902   -5.789  1.00 40.66  ? 26  VAL E CG2 1 
ATOM 8833  N N   . VAL E 1 27  ? -31.308 6.760   -1.547  1.00 45.16  ? 27  VAL E N   1 
ATOM 8834  C CA  . VAL E 1 27  ? -31.007 6.109   -0.273  1.00 43.47  ? 27  VAL E CA  1 
ATOM 8835  C C   . VAL E 1 27  ? -30.674 4.613   -0.452  1.00 45.47  ? 27  VAL E C   1 
ATOM 8836  O O   . VAL E 1 27  ? -30.965 4.013   -1.483  1.00 44.83  ? 27  VAL E O   1 
ATOM 8837  C CB  . VAL E 1 27  ? -32.206 6.289   0.723   1.00 46.27  ? 27  VAL E CB  1 
ATOM 8838  C CG1 . VAL E 1 27  ? -32.547 7.768   0.901   1.00 45.92  ? 27  VAL E CG1 1 
ATOM 8839  C CG2 . VAL E 1 27  ? -33.450 5.491   0.292   1.00 45.49  ? 27  VAL E CG2 1 
ATOM 8840  N N   . SER E 1 28  ? -30.108 4.038   0.593   1.00 41.33  ? 28  SER E N   1 
ATOM 8841  C CA  . SER E 1 28  ? -29.758 2.643   0.760   1.00 42.24  ? 28  SER E CA  1 
ATOM 8842  C C   . SER E 1 28  ? -30.887 1.991   1.570   1.00 49.22  ? 28  SER E C   1 
ATOM 8843  O O   . SER E 1 28  ? -31.344 2.564   2.556   1.00 50.43  ? 28  SER E O   1 
ATOM 8844  C CB  . SER E 1 28  ? -28.407 2.543   1.463   1.00 46.89  ? 28  SER E CB  1 
ATOM 8845  O OG  . SER E 1 28  ? -28.254 1.336   2.189   1.00 65.34  ? 28  SER E OG  1 
ATOM 8846  N N   . VAL E 1 29  ? -31.388 0.840   1.123   1.00 46.42  ? 29  VAL E N   1 
ATOM 8847  C CA  . VAL E 1 29  ? -32.513 0.168   1.795   1.00 45.64  ? 29  VAL E CA  1 
ATOM 8848  C C   . VAL E 1 29  ? -31.998 -1.154  2.401   1.00 53.86  ? 29  VAL E C   1 
ATOM 8849  O O   . VAL E 1 29  ? -31.564 -2.039  1.673   1.00 53.93  ? 29  VAL E O   1 
ATOM 8850  C CB  . VAL E 1 29  ? -33.719 -0.022  0.837   1.00 46.74  ? 29  VAL E CB  1 
ATOM 8851  C CG1 . VAL E 1 29  ? -34.821 -0.829  1.496   1.00 47.08  ? 29  VAL E CG1 1 
ATOM 8852  C CG2 . VAL E 1 29  ? -34.268 1.316   0.374   1.00 45.81  ? 29  VAL E CG2 1 
ATOM 8853  N N   . ARG E 1 30  ? -31.971 -1.241  3.722   1.00 53.27  ? 30  ARG E N   1 
ATOM 8854  C CA  . ARG E 1 30  ? -31.494 -2.418  4.449   1.00 55.21  ? 30  ARG E CA  1 
ATOM 8855  C C   . ARG E 1 30  ? -32.699 -3.173  4.984   1.00 61.12  ? 30  ARG E C   1 
ATOM 8856  O O   . ARG E 1 30  ? -33.608 -2.581  5.574   1.00 60.87  ? 30  ARG E O   1 
ATOM 8857  C CB  . ARG E 1 30  ? -30.520 -2.018  5.564   1.00 60.28  ? 30  ARG E CB  1 
ATOM 8858  C CG  . ARG E 1 30  ? -29.677 -3.169  6.111   1.00 85.71  ? 30  ARG E CG  1 
ATOM 8859  C CD  . ARG E 1 30  ? -29.018 -2.776  7.429   1.00 108.78 ? 30  ARG E CD  1 
ATOM 8860  N NE  . ARG E 1 30  ? -28.246 -3.869  8.025   1.00 122.35 ? 30  ARG E NE  1 
ATOM 8861  C CZ  . ARG E 1 30  ? -27.542 -3.761  9.148   1.00 137.31 ? 30  ARG E CZ  1 
ATOM 8862  N NH1 . ARG E 1 30  ? -27.510 -2.611  9.813   1.00 120.15 ? 30  ARG E NH1 1 
ATOM 8863  N NH2 . ARG E 1 30  ? -26.863 -4.801  9.614   1.00 127.73 ? 30  ARG E NH2 1 
ATOM 8864  N N   . VAL E 1 31  ? -32.731 -4.475  4.723   1.00 59.06  ? 31  VAL E N   1 
ATOM 8865  C CA  . VAL E 1 31  ? -33.860 -5.329  5.053   1.00 58.91  ? 31  VAL E CA  1 
ATOM 8866  C C   . VAL E 1 31  ? -33.402 -6.553  5.881   1.00 62.06  ? 31  VAL E C   1 
ATOM 8867  O O   . VAL E 1 31  ? -32.328 -7.101  5.653   1.00 58.43  ? 31  VAL E O   1 
ATOM 8868  C CB  . VAL E 1 31  ? -34.556 -5.700  3.705   1.00 62.67  ? 31  VAL E CB  1 
ATOM 8869  C CG1 . VAL E 1 31  ? -35.163 -7.092  3.707   1.00 62.69  ? 31  VAL E CG1 1 
ATOM 8870  C CG2 . VAL E 1 31  ? -35.595 -4.661  3.311   1.00 62.54  ? 31  VAL E CG2 1 
ATOM 8871  N N   . GLU E 1 32  ? -34.232 -6.936  6.865   1.00 62.63  ? 32  GLU E N   1 
ATOM 8872  C CA  . GLU E 1 32  ? -34.064 -8.118  7.724   1.00 64.00  ? 32  GLU E CA  1 
ATOM 8873  C C   . GLU E 1 32  ? -35.348 -8.913  7.740   1.00 70.39  ? 32  GLU E C   1 
ATOM 8874  O O   . GLU E 1 32  ? -36.431 -8.336  7.898   1.00 68.53  ? 32  GLU E O   1 
ATOM 8875  C CB  . GLU E 1 32  ? -33.671 -7.738  9.155   1.00 65.42  ? 32  GLU E CB  1 
ATOM 8876  C CG  . GLU E 1 32  ? -32.228 -7.290  9.287   1.00 81.11  ? 32  GLU E CG  1 
ATOM 8877  C CD  . GLU E 1 32  ? -31.733 -7.138  10.710  1.00 111.92 ? 32  GLU E CD  1 
ATOM 8878  O OE1 . GLU E 1 32  ? -32.276 -6.278  11.443  1.00 112.75 ? 32  GLU E OE1 1 
ATOM 8879  O OE2 . GLU E 1 32  ? -30.778 -7.858  11.079  1.00 111.78 ? 32  GLU E OE2 1 
ATOM 8880  N N   . GLY E 1 33  ? -35.217 -10.225 7.581   1.00 71.45  ? 33  GLY E N   1 
ATOM 8881  C CA  . GLY E 1 33  ? -36.363 -11.129 7.599   1.00 73.48  ? 33  GLY E CA  1 
ATOM 8882  C C   . GLY E 1 33  ? -36.035 -12.600 7.751   1.00 81.29  ? 33  GLY E C   1 
ATOM 8883  O O   . GLY E 1 33  ? -34.999 -12.960 8.329   1.00 80.73  ? 33  GLY E O   1 
ATOM 8884  N N   . THR E 1 34  ? -36.936 -13.458 7.200   1.00 80.45  ? 34  THR E N   1 
ATOM 8885  C CA  . THR E 1 34  ? -36.864 -14.931 7.222   1.00 125.34 ? 34  THR E CA  1 
ATOM 8886  C C   . THR E 1 34  ? -36.714 -15.515 5.800   1.00 132.03 ? 34  THR E C   1 
ATOM 8887  O O   . THR E 1 34  ? -37.354 -15.070 4.851   1.00 82.49  ? 34  THR E O   1 
ATOM 8888  C CB  . THR E 1 34  ? -38.076 -15.553 7.967   1.00 136.24 ? 34  THR E CB  1 
ATOM 8889  O OG1 . THR E 1 34  ? -37.919 -16.975 8.016   1.00 137.24 ? 34  THR E OG1 1 
ATOM 8890  C CG2 . THR E 1 34  ? -39.441 -15.180 7.362   1.00 135.41 ? 34  THR E CG2 1 
ATOM 8891  N N   . GLN E 1 59  ? -35.165 -19.434 7.749   1.00 109.32 ? 59  GLN E N   1 
ATOM 8892  C CA  . GLN E 1 59  ? -33.775 -19.037 7.968   1.00 109.12 ? 59  GLN E CA  1 
ATOM 8893  C C   . GLN E 1 59  ? -33.639 -17.502 7.915   1.00 111.05 ? 59  GLN E C   1 
ATOM 8894  O O   . GLN E 1 59  ? -34.124 -16.897 6.956   1.00 110.46 ? 59  GLN E O   1 
ATOM 8895  C CB  . GLN E 1 59  ? -32.839 -19.700 6.928   1.00 110.92 ? 59  GLN E CB  1 
ATOM 8896  C CG  . GLN E 1 59  ? -31.356 -19.677 7.319   1.00 133.28 ? 59  GLN E CG  1 
ATOM 8897  C CD  . GLN E 1 59  ? -30.433 -19.925 6.149   1.00 155.82 ? 59  GLN E CD  1 
ATOM 8898  O OE1 . GLN E 1 59  ? -30.055 -21.062 5.841   1.00 153.48 ? 59  GLN E OE1 1 
ATOM 8899  N NE2 . GLN E 1 59  ? -30.028 -18.858 5.484   1.00 146.18 ? 59  GLN E NE2 1 
ATOM 8900  N N   . PRO E 1 60  ? -32.955 -16.859 8.899   1.00 105.51 ? 60  PRO E N   1 
ATOM 8901  C CA  . PRO E 1 60  ? -32.822 -15.385 8.856   1.00 103.92 ? 60  PRO E CA  1 
ATOM 8902  C C   . PRO E 1 60  ? -31.898 -14.874 7.746   1.00 102.35 ? 60  PRO E C   1 
ATOM 8903  O O   . PRO E 1 60  ? -30.919 -15.547 7.380   1.00 101.09 ? 60  PRO E O   1 
ATOM 8904  C CB  . PRO E 1 60  ? -32.273 -15.014 10.232  1.00 105.95 ? 60  PRO E CB  1 
ATOM 8905  C CG  . PRO E 1 60  ? -31.803 -16.252 10.829  1.00 110.76 ? 60  PRO E CG  1 
ATOM 8906  C CD  . PRO E 1 60  ? -32.313 -17.435 10.099  1.00 106.71 ? 60  PRO E CD  1 
ATOM 8907  N N   . PHE E 1 61  ? -32.224 -13.669 7.216   1.00 94.27  ? 61  PHE E N   1 
ATOM 8908  C CA  . PHE E 1 61  ? -31.458 -13.044 6.146   1.00 91.40  ? 61  PHE E CA  1 
ATOM 8909  C C   . PHE E 1 61  ? -31.354 -11.512 6.320   1.00 88.98  ? 61  PHE E C   1 
ATOM 8910  O O   . PHE E 1 61  ? -32.175 -10.880 6.998   1.00 87.72  ? 61  PHE E O   1 
ATOM 8911  C CB  . PHE E 1 61  ? -32.077 -13.393 4.764   1.00 92.95  ? 61  PHE E CB  1 
ATOM 8912  C CG  . PHE E 1 61  ? -33.302 -12.594 4.370   1.00 94.19  ? 61  PHE E CG  1 
ATOM 8913  C CD1 . PHE E 1 61  ? -33.176 -11.400 3.671   1.00 96.97  ? 61  PHE E CD1 1 
ATOM 8914  C CD2 . PHE E 1 61  ? -34.577 -13.038 4.692   1.00 95.89  ? 61  PHE E CD2 1 
ATOM 8915  C CE1 . PHE E 1 61  ? -34.302 -10.657 3.322   1.00 97.78  ? 61  PHE E CE1 1 
ATOM 8916  C CE2 . PHE E 1 61  ? -35.703 -12.297 4.333   1.00 98.74  ? 61  PHE E CE2 1 
ATOM 8917  C CZ  . PHE E 1 61  ? -35.559 -11.112 3.652   1.00 96.97  ? 61  PHE E CZ  1 
ATOM 8918  N N   . GLU E 1 62  ? -30.350 -10.938 5.635   1.00 81.68  ? 62  GLU E N   1 
ATOM 8919  C CA  . GLU E 1 62  ? -30.069 -9.514  5.533   1.00 79.85  ? 62  GLU E CA  1 
ATOM 8920  C C   . GLU E 1 62  ? -29.924 -9.158  4.047   1.00 80.74  ? 62  GLU E C   1 
ATOM 8921  O O   . GLU E 1 62  ? -29.032 -9.663  3.357   1.00 81.27  ? 62  GLU E O   1 
ATOM 8922  C CB  . GLU E 1 62  ? -28.824 -9.118  6.345   1.00 81.29  ? 62  GLU E CB  1 
ATOM 8923  C CG  . GLU E 1 62  ? -29.151 -8.701  7.770   1.00 96.69  ? 62  GLU E CG  1 
ATOM 8924  C CD  . GLU E 1 62  ? -27.984 -8.325  8.671   1.00 131.30 ? 62  GLU E CD  1 
ATOM 8925  O OE1 . GLU E 1 62  ? -27.087 -7.577  8.216   1.00 135.96 ? 62  GLU E OE1 1 
ATOM 8926  O OE2 . GLU E 1 62  ? -28.002 -8.733  9.857   1.00 124.05 ? 62  GLU E OE2 1 
ATOM 8927  N N   . GLY E 1 63  ? -30.843 -8.335  3.559   1.00 73.41  ? 63  GLY E N   1 
ATOM 8928  C CA  . GLY E 1 63  ? -30.874 -7.891  2.171   1.00 70.83  ? 63  GLY E CA  1 
ATOM 8929  C C   . GLY E 1 63  ? -30.532 -6.429  2.014   1.00 69.05  ? 63  GLY E C   1 
ATOM 8930  O O   . GLY E 1 63  ? -30.735 -5.638  2.942   1.00 68.21  ? 63  GLY E O   1 
ATOM 8931  N N   . LEU E 1 64  ? -30.003 -6.056  0.837   1.00 61.90  ? 64  LEU E N   1 
ATOM 8932  C CA  . LEU E 1 64  ? -29.624 -4.671  0.588   1.00 59.55  ? 64  LEU E CA  1 
ATOM 8933  C C   . LEU E 1 64  ? -29.946 -4.232  -0.828  1.00 57.78  ? 64  LEU E C   1 
ATOM 8934  O O   . LEU E 1 64  ? -29.563 -4.886  -1.784  1.00 58.69  ? 64  LEU E O   1 
ATOM 8935  C CB  . LEU E 1 64  ? -28.141 -4.449  0.881   1.00 60.07  ? 64  LEU E CB  1 
ATOM 8936  C CG  . LEU E 1 64  ? -27.852 -3.177  1.650   1.00 67.00  ? 64  LEU E CG  1 
ATOM 8937  C CD1 . LEU E 1 64  ? -26.869 -3.434  2.800   1.00 67.65  ? 64  LEU E CD1 1 
ATOM 8938  C CD2 . LEU E 1 64  ? -27.446 -2.013  0.702   1.00 70.23  ? 64  LEU E CD2 1 
ATOM 8939  N N   . GLY E 1 65  ? -30.696 -3.146  -0.933  1.00 49.56  ? 65  GLY E N   1 
ATOM 8940  C CA  . GLY E 1 65  ? -31.064 -2.485  -2.179  1.00 46.04  ? 65  GLY E CA  1 
ATOM 8941  C C   . GLY E 1 65  ? -30.890 -0.982  -2.081  1.00 41.93  ? 65  GLY E C   1 
ATOM 8942  O O   . GLY E 1 65  ? -30.089 -0.463  -1.303  1.00 39.61  ? 65  GLY E O   1 
ATOM 8943  N N   . SER E 1 66  ? -31.653 -0.284  -2.858  1.00 36.56  ? 66  SER E N   1 
ATOM 8944  C CA  . SER E 1 66  ? -31.653 1.164   -2.864  1.00 36.20  ? 66  SER E CA  1 
ATOM 8945  C C   . SER E 1 66  ? -33.085 1.648   -2.886  1.00 40.59  ? 66  SER E C   1 
ATOM 8946  O O   . SER E 1 66  ? -33.994 0.844   -3.019  1.00 39.31  ? 66  SER E O   1 
ATOM 8947  C CB  . SER E 1 66  ? -30.888 1.701   -4.075  1.00 37.99  ? 66  SER E CB  1 
ATOM 8948  O OG  . SER E 1 66  ? -29.579 1.172   -4.155  1.00 41.00  ? 66  SER E OG  1 
ATOM 8949  N N   . GLY E 1 67  ? -33.261 2.957   -2.783  1.00 39.75  ? 67  GLY E N   1 
ATOM 8950  C CA  . GLY E 1 67  ? -34.555 3.625   -2.815  1.00 39.84  ? 67  GLY E CA  1 
ATOM 8951  C C   . GLY E 1 67  ? -34.408 5.084   -3.188  1.00 43.89  ? 67  GLY E C   1 
ATOM 8952  O O   . GLY E 1 67  ? -33.311 5.637   -3.091  1.00 44.96  ? 67  GLY E O   1 
ATOM 8953  N N   . VAL E 1 68  ? -35.509 5.713   -3.610  1.00 38.87  ? 68  VAL E N   1 
ATOM 8954  C CA  . VAL E 1 68  ? -35.551 7.125   -4.011  1.00 38.84  ? 68  VAL E CA  1 
ATOM 8955  C C   . VAL E 1 68  ? -36.623 7.889   -3.205  1.00 40.59  ? 68  VAL E C   1 
ATOM 8956  O O   . VAL E 1 68  ? -37.788 7.461   -3.188  1.00 37.32  ? 68  VAL E O   1 
ATOM 8957  C CB  . VAL E 1 68  ? -35.817 7.263   -5.539  1.00 42.38  ? 68  VAL E CB  1 
ATOM 8958  C CG1 . VAL E 1 68  ? -35.742 8.725   -5.979  1.00 40.58  ? 68  VAL E CG1 1 
ATOM 8959  C CG2 . VAL E 1 68  ? -34.840 6.402   -6.343  1.00 42.42  ? 68  VAL E CG2 1 
ATOM 8960  N N   . ILE E 1 69  ? -36.222 9.019   -2.553  1.00 38.33  ? 69  ILE E N   1 
ATOM 8961  C CA  . ILE E 1 69  ? -37.141 9.865   -1.792  1.00 38.93  ? 69  ILE E CA  1 
ATOM 8962  C C   . ILE E 1 69  ? -37.962 10.658  -2.809  1.00 46.20  ? 69  ILE E C   1 
ATOM 8963  O O   . ILE E 1 69  ? -37.437 11.483  -3.574  1.00 45.74  ? 69  ILE E O   1 
ATOM 8964  C CB  . ILE E 1 69  ? -36.504 10.759  -0.699  1.00 42.58  ? 69  ILE E CB  1 
ATOM 8965  C CG1 . ILE E 1 69  ? -35.712 9.927   0.355   1.00 42.84  ? 69  ILE E CG1 1 
ATOM 8966  C CG2 . ILE E 1 69  ? -37.576 11.665  -0.017  1.00 43.45  ? 69  ILE E CG2 1 
ATOM 8967  C CD1 . ILE E 1 69  ? -34.664 10.776  1.106   1.00 49.46  ? 69  ILE E CD1 1 
ATOM 8968  N N   . ILE E 1 70  ? -39.256 10.344  -2.832  1.00 44.20  ? 70  ILE E N   1 
ATOM 8969  C CA  . ILE E 1 70  ? -40.216 10.890  -3.754  1.00 45.26  ? 70  ILE E CA  1 
ATOM 8970  C C   . ILE E 1 70  ? -41.011 12.042  -3.070  1.00 49.52  ? 70  ILE E C   1 
ATOM 8971  O O   . ILE E 1 70  ? -41.467 12.956  -3.775  1.00 51.13  ? 70  ILE E O   1 
ATOM 8972  C CB  . ILE E 1 70  ? -41.070 9.702   -4.248  1.00 49.58  ? 70  ILE E CB  1 
ATOM 8973  C CG1 . ILE E 1 70  ? -41.150 9.663   -5.771  1.00 51.67  ? 70  ILE E CG1 1 
ATOM 8974  C CG2 . ILE E 1 70  ? -42.402 9.423   -3.468  1.00 47.64  ? 70  ILE E CG2 1 
ATOM 8975  C CD1 . ILE E 1 70  ? -42.471 8.967   -6.325  1.00 73.62  ? 70  ILE E CD1 1 
ATOM 8976  N N   . ASN E 1 71  ? -41.117 12.017  -1.701  1.00 42.70  ? 71  ASN E N   1 
ATOM 8977  C CA  . ASN E 1 71  ? -41.769 13.050  -0.880  1.00 41.55  ? 71  ASN E CA  1 
ATOM 8978  C C   . ASN E 1 71  ? -41.008 13.294  0.454   1.00 43.27  ? 71  ASN E C   1 
ATOM 8979  O O   . ASN E 1 71  ? -41.200 12.575  1.449   1.00 39.03  ? 71  ASN E O   1 
ATOM 8980  C CB  . ASN E 1 71  ? -43.221 12.707  -0.610  1.00 40.25  ? 71  ASN E CB  1 
ATOM 8981  C CG  . ASN E 1 71  ? -44.014 13.787  0.088   1.00 58.50  ? 71  ASN E CG  1 
ATOM 8982  O OD1 . ASN E 1 71  ? -43.570 14.451  1.044   1.00 54.10  ? 71  ASN E OD1 1 
ATOM 8983  N ND2 . ASN E 1 71  ? -45.244 13.936  -0.343  1.00 49.61  ? 71  ASN E ND2 1 
ATOM 8984  N N   . ALA E 1 72  ? -40.203 14.365  0.474   1.00 42.21  ? 72  ALA E N   1 
ATOM 8985  C CA  . ALA E 1 72  ? -39.362 14.736  1.614   1.00 42.48  ? 72  ALA E CA  1 
ATOM 8986  C C   . ALA E 1 72  ? -40.171 14.973  2.911   1.00 50.12  ? 72  ALA E C   1 
ATOM 8987  O O   . ALA E 1 72  ? -39.753 14.491  3.972   1.00 52.24  ? 72  ALA E O   1 
ATOM 8988  C CB  . ALA E 1 72  ? -38.544 15.960  1.271   1.00 42.22  ? 72  ALA E CB  1 
ATOM 8989  N N   . SER E 1 73  ? -41.324 15.675  2.827   1.00 46.93  ? 73  SER E N   1 
ATOM 8990  C CA  . SER E 1 73  ? -42.176 15.992  4.002   1.00 46.73  ? 73  SER E CA  1 
ATOM 8991  C C   . SER E 1 73  ? -42.745 14.731  4.681   1.00 49.82  ? 73  SER E C   1 
ATOM 8992  O O   . SER E 1 73  ? -42.603 14.576  5.894   1.00 48.30  ? 73  SER E O   1 
ATOM 8993  C CB  . SER E 1 73  ? -43.322 16.927  3.612   1.00 49.31  ? 73  SER E CB  1 
ATOM 8994  O OG  . SER E 1 73  ? -42.880 17.950  2.732   1.00 56.51  ? 73  SER E OG  1 
ATOM 8995  N N   . LYS E 1 74  ? -43.342 13.824  3.885   1.00 47.48  ? 74  LYS E N   1 
ATOM 8996  C CA  . LYS E 1 74  ? -43.962 12.577  4.342   1.00 47.41  ? 74  LYS E CA  1 
ATOM 8997  C C   . LYS E 1 74  ? -42.953 11.410  4.494   1.00 51.20  ? 74  LYS E C   1 
ATOM 8998  O O   . LYS E 1 74  ? -43.274 10.412  5.151   1.00 50.81  ? 74  LYS E O   1 
ATOM 8999  C CB  . LYS E 1 74  ? -45.078 12.179  3.368   1.00 50.64  ? 74  LYS E CB  1 
ATOM 9000  C CG  . LYS E 1 74  ? -46.181 13.226  3.211   1.00 60.61  ? 74  LYS E CG  1 
ATOM 9001  C CD  . LYS E 1 74  ? -47.327 13.007  4.221   1.00 75.25  ? 74  LYS E CD  1 
ATOM 9002  C CE  . LYS E 1 74  ? -48.454 13.999  4.086   1.00 96.64  ? 74  LYS E CE  1 
ATOM 9003  N NZ  . LYS E 1 74  ? -49.208 13.813  2.817   1.00 114.39 ? 74  LYS E NZ  1 
ATOM 9004  N N   . GLY E 1 75  ? -41.758 11.553  3.905   1.00 46.99  ? 75  GLY E N   1 
ATOM 9005  C CA  . GLY E 1 75  ? -40.726 10.528  3.941   1.00 46.03  ? 75  GLY E CA  1 
ATOM 9006  C C   . GLY E 1 75  ? -41.070 9.325   3.074   1.00 48.90  ? 75  GLY E C   1 
ATOM 9007  O O   . GLY E 1 75  ? -40.778 8.184   3.452   1.00 47.49  ? 75  GLY E O   1 
ATOM 9008  N N   . TYR E 1 76  ? -41.700 9.575   1.901   1.00 44.92  ? 76  TYR E N   1 
ATOM 9009  C CA  . TYR E 1 76  ? -42.100 8.539   0.945   1.00 44.33  ? 76  TYR E CA  1 
ATOM 9010  C C   . TYR E 1 76  ? -40.910 8.122   0.059   1.00 47.97  ? 76  TYR E C   1 
ATOM 9011  O O   . TYR E 1 76  ? -40.343 8.931   -0.682  1.00 47.80  ? 76  TYR E O   1 
ATOM 9012  C CB  . TYR E 1 76  ? -43.294 8.992   0.080   1.00 46.00  ? 76  TYR E CB  1 
ATOM 9013  C CG  . TYR E 1 76  ? -44.640 9.082   0.789   1.00 50.39  ? 76  TYR E CG  1 
ATOM 9014  C CD1 . TYR E 1 76  ? -45.584 10.038  0.429   1.00 52.07  ? 76  TYR E CD1 1 
ATOM 9015  C CD2 . TYR E 1 76  ? -44.991 8.163   1.783   1.00 52.67  ? 76  TYR E CD2 1 
ATOM 9016  C CE1 . TYR E 1 76  ? -46.822 10.124  1.074   1.00 53.42  ? 76  TYR E CE1 1 
ATOM 9017  C CE2 . TYR E 1 76  ? -46.226 8.238   2.436   1.00 54.27  ? 76  TYR E CE2 1 
ATOM 9018  C CZ  . TYR E 1 76  ? -47.142 9.219   2.080   1.00 61.77  ? 76  TYR E CZ  1 
ATOM 9019  O OH  . TYR E 1 76  ? -48.375 9.268   2.711   1.00 59.15  ? 76  TYR E OH  1 
ATOM 9020  N N   . VAL E 1 77  ? -40.536 6.844   0.155   1.00 43.66  ? 77  VAL E N   1 
ATOM 9021  C CA  . VAL E 1 77  ? -39.442 6.244   -0.588  1.00 42.39  ? 77  VAL E CA  1 
ATOM 9022  C C   . VAL E 1 77  ? -39.970 5.175   -1.570  1.00 46.11  ? 77  VAL E C   1 
ATOM 9023  O O   . VAL E 1 77  ? -40.648 4.224   -1.179  1.00 43.68  ? 77  VAL E O   1 
ATOM 9024  C CB  . VAL E 1 77  ? -38.363 5.661   0.374   1.00 46.22  ? 77  VAL E CB  1 
ATOM 9025  C CG1 . VAL E 1 77  ? -37.260 4.917   -0.380  1.00 45.78  ? 77  VAL E CG1 1 
ATOM 9026  C CG2 . VAL E 1 77  ? -37.745 6.751   1.236   1.00 46.12  ? 77  VAL E CG2 1 
ATOM 9027  N N   . LEU E 1 78  ? -39.629 5.355   -2.863  1.00 45.52  ? 78  LEU E N   1 
ATOM 9028  C CA  . LEU E 1 78  ? -39.868 4.393   -3.943  1.00 44.35  ? 78  LEU E CA  1 
ATOM 9029  C C   . LEU E 1 78  ? -38.721 3.389   -3.981  1.00 45.14  ? 78  LEU E C   1 
ATOM 9030  O O   . LEU E 1 78  ? -37.565 3.786   -3.876  1.00 41.52  ? 78  LEU E O   1 
ATOM 9031  C CB  . LEU E 1 78  ? -39.946 5.098   -5.294  1.00 44.30  ? 78  LEU E CB  1 
ATOM 9032  C CG  . LEU E 1 78  ? -41.297 5.184   -5.994  1.00 50.29  ? 78  LEU E CG  1 
ATOM 9033  C CD1 . LEU E 1 78  ? -41.138 5.818   -7.366  1.00 50.18  ? 78  LEU E CD1 1 
ATOM 9034  C CD2 . LEU E 1 78  ? -41.995 3.829   -6.104  1.00 52.15  ? 78  LEU E CD2 1 
ATOM 9035  N N   . THR E 1 79  ? -39.028 2.100   -4.125  1.00 43.09  ? 79  THR E N   1 
ATOM 9036  C CA  . THR E 1 79  ? -38.033 1.024   -4.228  1.00 41.65  ? 79  THR E CA  1 
ATOM 9037  C C   . THR E 1 79  ? -38.674 -0.118  -5.049  1.00 44.23  ? 79  THR E C   1 
ATOM 9038  O O   . THR E 1 79  ? -39.785 0.060   -5.560  1.00 43.90  ? 79  THR E O   1 
ATOM 9039  C CB  . THR E 1 79  ? -37.567 0.622   -2.809  1.00 39.89  ? 79  THR E CB  1 
ATOM 9040  O OG1 . THR E 1 79  ? -36.498 -0.334  -2.904  1.00 39.02  ? 79  THR E OG1 1 
ATOM 9041  C CG2 . THR E 1 79  ? -38.693 0.086   -1.956  1.00 38.82  ? 79  THR E CG2 1 
ATOM 9042  N N   . ASN E 1 80  ? -38.004 -1.279  -5.159  1.00 39.87  ? 80  ASN E N   1 
ATOM 9043  C CA  . ASN E 1 80  ? -38.586 -2.458  -5.803  1.00 39.02  ? 80  ASN E CA  1 
ATOM 9044  C C   . ASN E 1 80  ? -39.264 -3.331  -4.789  1.00 42.60  ? 80  ASN E C   1 
ATOM 9045  O O   . ASN E 1 80  ? -38.768 -3.469  -3.672  1.00 43.58  ? 80  ASN E O   1 
ATOM 9046  C CB  . ASN E 1 80  ? -37.521 -3.305  -6.507  1.00 40.29  ? 80  ASN E CB  1 
ATOM 9047  C CG  . ASN E 1 80  ? -37.002 -2.776  -7.806  1.00 50.26  ? 80  ASN E CG  1 
ATOM 9048  O OD1 . ASN E 1 80  ? -35.795 -2.755  -8.009  1.00 49.00  ? 80  ASN E OD1 1 
ATOM 9049  N ND2 . ASN E 1 80  ? -37.880 -2.406  -8.738  1.00 32.43  ? 80  ASN E ND2 1 
ATOM 9050  N N   . ASN E 1 81  ? -40.306 -4.027  -5.206  1.00 40.38  ? 81  ASN E N   1 
ATOM 9051  C CA  . ASN E 1 81  ? -41.012 -4.991  -4.368  1.00 40.63  ? 81  ASN E CA  1 
ATOM 9052  C C   . ASN E 1 81  ? -40.078 -6.137  -3.958  1.00 46.40  ? 81  ASN E C   1 
ATOM 9053  O O   . ASN E 1 81  ? -40.085 -6.508  -2.787  1.00 46.33  ? 81  ASN E O   1 
ATOM 9054  C CB  . ASN E 1 81  ? -42.253 -5.547  -5.093  1.00 40.93  ? 81  ASN E CB  1 
ATOM 9055  C CG  . ASN E 1 81  ? -43.026 -6.564  -4.292  1.00 65.30  ? 81  ASN E CG  1 
ATOM 9056  O OD1 . ASN E 1 81  ? -43.518 -6.285  -3.196  1.00 51.76  ? 81  ASN E OD1 1 
ATOM 9057  N ND2 . ASN E 1 81  ? -43.137 -7.772  -4.819  1.00 64.88  ? 81  ASN E ND2 1 
ATOM 9058  N N   . HIS E 1 82  ? -39.249 -6.669  -4.898  1.00 44.00  ? 82  HIS E N   1 
ATOM 9059  C CA  . HIS E 1 82  ? -38.348 -7.796  -4.621  1.00 43.35  ? 82  HIS E CA  1 
ATOM 9060  C C   . HIS E 1 82  ? -37.267 -7.444  -3.570  1.00 51.02  ? 82  HIS E C   1 
ATOM 9061  O O   . HIS E 1 82  ? -36.700 -8.360  -2.969  1.00 51.82  ? 82  HIS E O   1 
ATOM 9062  C CB  . HIS E 1 82  ? -37.718 -8.347  -5.910  1.00 43.25  ? 82  HIS E CB  1 
ATOM 9063  C CG  . HIS E 1 82  ? -36.695 -7.461  -6.566  1.00 45.93  ? 82  HIS E CG  1 
ATOM 9064  N ND1 . HIS E 1 82  ? -36.989 -6.748  -7.711  1.00 47.12  ? 82  HIS E ND1 1 
ATOM 9065  C CD2 . HIS E 1 82  ? -35.395 -7.261  -6.249  1.00 46.88  ? 82  HIS E CD2 1 
ATOM 9066  C CE1 . HIS E 1 82  ? -35.872 -6.127  -8.043  1.00 46.39  ? 82  HIS E CE1 1 
ATOM 9067  N NE2 . HIS E 1 82  ? -34.889 -6.394  -7.185  1.00 46.59  ? 82  HIS E NE2 1 
ATOM 9068  N N   . VAL E 1 83  ? -37.021 -6.134  -3.324  1.00 48.75  ? 83  VAL E N   1 
ATOM 9069  C CA  . VAL E 1 83  ? -36.077 -5.660  -2.305  1.00 49.46  ? 83  VAL E CA  1 
ATOM 9070  C C   . VAL E 1 83  ? -36.693 -5.877  -0.916  1.00 55.49  ? 83  VAL E C   1 
ATOM 9071  O O   . VAL E 1 83  ? -36.016 -6.293  0.020   1.00 54.17  ? 83  VAL E O   1 
ATOM 9072  C CB  . VAL E 1 83  ? -35.694 -4.162  -2.527  1.00 52.75  ? 83  VAL E CB  1 
ATOM 9073  C CG1 . VAL E 1 83  ? -34.810 -3.611  -1.397  1.00 51.48  ? 83  VAL E CG1 1 
ATOM 9074  C CG2 . VAL E 1 83  ? -35.023 -3.951  -3.882  1.00 52.59  ? 83  VAL E CG2 1 
ATOM 9075  N N   . ILE E 1 84  ? -37.991 -5.645  -0.827  1.00 55.84  ? 84  ILE E N   1 
ATOM 9076  C CA  . ILE E 1 84  ? -38.799 -5.622  0.383   1.00 58.02  ? 84  ILE E CA  1 
ATOM 9077  C C   . ILE E 1 84  ? -39.649 -6.892  0.648   1.00 66.95  ? 84  ILE E C   1 
ATOM 9078  O O   . ILE E 1 84  ? -40.146 -7.059  1.761   1.00 66.27  ? 84  ILE E O   1 
ATOM 9079  C CB  . ILE E 1 84  ? -39.676 -4.343  0.174   1.00 60.68  ? 84  ILE E CB  1 
ATOM 9080  C CG1 . ILE E 1 84  ? -39.337 -3.271  1.170   1.00 60.83  ? 84  ILE E CG1 1 
ATOM 9081  C CG2 . ILE E 1 84  ? -41.187 -4.542  -0.098  1.00 59.18  ? 84  ILE E CG2 1 
ATOM 9082  C CD1 . ILE E 1 84  ? -37.976 -2.663  0.946   1.00 67.56  ? 84  ILE E CD1 1 
ATOM 9083  N N   . ASN E 1 85  ? -39.800 -7.756  -0.359  1.00 67.31  ? 85  ASN E N   1 
ATOM 9084  C CA  . ASN E 1 85  ? -40.627 -8.959  -0.388  1.00 69.51  ? 85  ASN E CA  1 
ATOM 9085  C C   . ASN E 1 85  ? -40.802 -9.717  0.953   1.00 76.93  ? 85  ASN E C   1 
ATOM 9086  O O   . ASN E 1 85  ? -41.944 -9.938  1.368   1.00 76.71  ? 85  ASN E O   1 
ATOM 9087  C CB  . ASN E 1 85  ? -40.103 -9.939  -1.442  1.00 74.87  ? 85  ASN E CB  1 
ATOM 9088  C CG  . ASN E 1 85  ? -41.144 -10.331 -2.461  1.00 118.16 ? 85  ASN E CG  1 
ATOM 9089  O OD1 . ASN E 1 85  ? -42.348 -10.396 -2.176  1.00 118.33 ? 85  ASN E OD1 1 
ATOM 9090  N ND2 . ASN E 1 85  ? -40.698 -10.611 -3.680  1.00 114.28 ? 85  ASN E ND2 1 
ATOM 9091  N N   . GLN E 1 86  ? -39.707 -10.138 1.603   1.00 75.39  ? 86  GLN E N   1 
ATOM 9092  C CA  . GLN E 1 86  ? -39.822 -10.953 2.819   1.00 76.54  ? 86  GLN E CA  1 
ATOM 9093  C C   . GLN E 1 86  ? -39.374 -10.200 4.091   1.00 80.83  ? 86  GLN E C   1 
ATOM 9094  O O   . GLN E 1 86  ? -39.111 -10.835 5.122   1.00 81.33  ? 86  GLN E O   1 
ATOM 9095  C CB  . GLN E 1 86  ? -38.991 -12.251 2.656   1.00 78.73  ? 86  GLN E CB  1 
ATOM 9096  C CG  . GLN E 1 86  ? -39.339 -13.131 1.433   1.00 98.91  ? 86  GLN E CG  1 
ATOM 9097  C CD  . GLN E 1 86  ? -38.207 -13.219 0.417   1.00 117.07 ? 86  GLN E CD  1 
ATOM 9098  O OE1 . GLN E 1 86  ? -37.811 -12.229 -0.214  1.00 113.77 ? 86  GLN E OE1 1 
ATOM 9099  N NE2 . GLN E 1 86  ? -37.694 -14.417 0.197   1.00 103.29 ? 86  GLN E NE2 1 
ATOM 9100  N N   . ALA E 1 87  ? -39.327 -8.854  4.026   1.00 75.69  ? 87  ALA E N   1 
ATOM 9101  C CA  . ALA E 1 87  ? -38.862 -7.985  5.106   1.00 73.84  ? 87  ALA E CA  1 
ATOM 9102  C C   . ALA E 1 87  ? -39.784 -7.946  6.310   1.00 77.57  ? 87  ALA E C   1 
ATOM 9103  O O   . ALA E 1 87  ? -41.004 -7.825  6.184   1.00 77.64  ? 87  ALA E O   1 
ATOM 9104  C CB  . ALA E 1 87  ? -38.667 -6.575  4.594   1.00 74.02  ? 87  ALA E CB  1 
ATOM 9105  N N   . GLN E 1 88  ? -39.169 -8.019  7.490   1.00 73.21  ? 88  GLN E N   1 
ATOM 9106  C CA  . GLN E 1 88  ? -39.808 -7.854  8.791   1.00 71.94  ? 88  GLN E CA  1 
ATOM 9107  C C   . GLN E 1 88  ? -39.353 -6.488  9.306   1.00 71.47  ? 88  GLN E C   1 
ATOM 9108  O O   . GLN E 1 88  ? -40.167 -5.689  9.774   1.00 72.40  ? 88  GLN E O   1 
ATOM 9109  C CB  . GLN E 1 88  ? -39.444 -9.005  9.746   1.00 73.52  ? 88  GLN E CB  1 
ATOM 9110  C CG  . GLN E 1 88  ? -40.093 -10.337 9.362   1.00 97.42  ? 88  GLN E CG  1 
ATOM 9111  C CD  . GLN E 1 88  ? -39.705 -11.486 10.270  1.00 124.85 ? 88  GLN E CD  1 
ATOM 9112  O OE1 . GLN E 1 88  ? -39.813 -11.416 11.503  1.00 121.07 ? 88  GLN E OE1 1 
ATOM 9113  N NE2 . GLN E 1 88  ? -39.310 -12.602 9.671   1.00 119.07 ? 88  GLN E NE2 1 
ATOM 9114  N N   . LYS E 1 89  ? -38.066 -6.185  9.111   1.00 63.20  ? 89  LYS E N   1 
ATOM 9115  C CA  . LYS E 1 89  ? -37.478 -4.906  9.495   1.00 61.96  ? 89  LYS E CA  1 
ATOM 9116  C C   . LYS E 1 89  ? -36.885 -4.229  8.266   1.00 60.56  ? 89  LYS E C   1 
ATOM 9117  O O   . LYS E 1 89  ? -36.173 -4.881  7.493   1.00 59.51  ? 89  LYS E O   1 
ATOM 9118  C CB  . LYS E 1 89  ? -36.422 -5.074  10.616  1.00 64.96  ? 89  LYS E CB  1 
ATOM 9119  C CG  . LYS E 1 89  ? -37.062 -5.267  11.996  1.00 91.06  ? 89  LYS E CG  1 
ATOM 9120  C CD  . LYS E 1 89  ? -36.093 -5.766  13.074  1.00 104.66 ? 89  LYS E CD  1 
ATOM 9121  C CE  . LYS E 1 89  ? -36.794 -6.095  14.374  1.00 113.24 ? 89  LYS E CE  1 
ATOM 9122  N NZ  . LYS E 1 89  ? -35.950 -6.942  15.254  1.00 122.18 ? 89  LYS E NZ  1 
ATOM 9123  N N   . ILE E 1 90  ? -37.228 -2.933  8.060   1.00 53.08  ? 90  ILE E N   1 
ATOM 9124  C CA  . ILE E 1 90  ? -36.730 -2.112  6.952   1.00 50.66  ? 90  ILE E CA  1 
ATOM 9125  C C   . ILE E 1 90  ? -36.098 -0.847  7.522   1.00 53.05  ? 90  ILE E C   1 
ATOM 9126  O O   . ILE E 1 90  ? -36.740 -0.122  8.287   1.00 50.50  ? 90  ILE E O   1 
ATOM 9127  C CB  . ILE E 1 90  ? -37.814 -1.765  5.886   1.00 52.50  ? 90  ILE E CB  1 
ATOM 9128  C CG1 . ILE E 1 90  ? -38.504 -3.013  5.339   1.00 51.41  ? 90  ILE E CG1 1 
ATOM 9129  C CG2 . ILE E 1 90  ? -37.222 -0.931  4.732   1.00 53.97  ? 90  ILE E CG2 1 
ATOM 9130  C CD1 . ILE E 1 90  ? -39.868 -2.758  4.746   1.00 50.48  ? 90  ILE E CD1 1 
ATOM 9131  N N   . SER E 1 91  ? -34.844 -0.581  7.129   1.00 51.47  ? 91  SER E N   1 
ATOM 9132  C CA  . SER E 1 91  ? -34.103 0.632   7.501   1.00 51.40  ? 91  SER E CA  1 
ATOM 9133  C C   . SER E 1 91  ? -33.589 1.334   6.241   1.00 54.57  ? 91  SER E C   1 
ATOM 9134  O O   . SER E 1 91  ? -33.285 0.676   5.241   1.00 53.37  ? 91  SER E O   1 
ATOM 9135  C CB  . SER E 1 91  ? -32.965 0.344   8.482   1.00 54.58  ? 91  SER E CB  1 
ATOM 9136  O OG  . SER E 1 91  ? -32.530 -1.007  8.464   1.00 68.48  ? 91  SER E OG  1 
ATOM 9137  N N   . ILE E 1 92  ? -33.550 2.680   6.283   1.00 50.41  ? 92  ILE E N   1 
ATOM 9138  C CA  . ILE E 1 92  ? -33.072 3.532   5.191   1.00 48.98  ? 92  ILE E CA  1 
ATOM 9139  C C   . ILE E 1 92  ? -31.800 4.233   5.662   1.00 49.97  ? 92  ILE E C   1 
ATOM 9140  O O   . ILE E 1 92  ? -31.722 4.623   6.826   1.00 49.26  ? 92  ILE E O   1 
ATOM 9141  C CB  . ILE E 1 92  ? -34.211 4.514   4.747   1.00 52.11  ? 92  ILE E CB  1 
ATOM 9142  C CG1 . ILE E 1 92  ? -35.015 3.941   3.560   1.00 52.73  ? 92  ILE E CG1 1 
ATOM 9143  C CG2 . ILE E 1 92  ? -33.707 5.921   4.365   1.00 52.35  ? 92  ILE E CG2 1 
ATOM 9144  C CD1 . ILE E 1 92  ? -35.804 2.697   3.771   1.00 54.53  ? 92  ILE E CD1 1 
ATOM 9145  N N   . GLN E 1 93  ? -30.798 4.350   4.791   1.00 46.39  ? 93  GLN E N   1 
ATOM 9146  C CA  . GLN E 1 93  ? -29.584 5.081   5.133   1.00 47.22  ? 93  GLN E CA  1 
ATOM 9147  C C   . GLN E 1 93  ? -29.332 6.161   4.105   1.00 51.31  ? 93  GLN E C   1 
ATOM 9148  O O   . GLN E 1 93  ? -29.321 5.868   2.912   1.00 50.97  ? 93  GLN E O   1 
ATOM 9149  C CB  . GLN E 1 93  ? -28.345 4.195   5.307   1.00 48.80  ? 93  GLN E CB  1 
ATOM 9150  C CG  . GLN E 1 93  ? -27.187 4.995   5.919   1.00 65.45  ? 93  GLN E CG  1 
ATOM 9151  C CD  . GLN E 1 93  ? -25.859 4.296   5.983   1.00 77.57  ? 93  GLN E CD  1 
ATOM 9152  O OE1 . GLN E 1 93  ? -24.854 4.870   5.572   1.00 67.76  ? 93  GLN E OE1 1 
ATOM 9153  N NE2 . GLN E 1 93  ? -25.807 3.102   6.554   1.00 70.04  ? 93  GLN E NE2 1 
ATOM 9154  N N   . LEU E 1 94  ? -29.152 7.416   4.573   1.00 47.70  ? 94  LEU E N   1 
ATOM 9155  C CA  . LEU E 1 94  ? -28.876 8.566   3.708   1.00 46.45  ? 94  LEU E CA  1 
ATOM 9156  C C   . LEU E 1 94  ? -27.385 8.626   3.431   1.00 50.48  ? 94  LEU E C   1 
ATOM 9157  O O   . LEU E 1 94  ? -26.595 8.031   4.187   1.00 50.23  ? 94  LEU E O   1 
ATOM 9158  C CB  . LEU E 1 94  ? -29.370 9.886   4.315   1.00 46.08  ? 94  LEU E CB  1 
ATOM 9159  C CG  . LEU E 1 94  ? -30.789 9.967   4.895   1.00 50.30  ? 94  LEU E CG  1 
ATOM 9160  C CD1 . LEU E 1 94  ? -31.140 11.382  5.218   1.00 50.43  ? 94  LEU E CD1 1 
ATOM 9161  C CD2 . LEU E 1 94  ? -31.833 9.431   3.949   1.00 51.99  ? 94  LEU E CD2 1 
ATOM 9162  N N   . ASN E 1 95  ? -26.986 9.339   2.364   1.00 47.24  ? 95  ASN E N   1 
ATOM 9163  C CA  . ASN E 1 95  ? -25.566 9.417   1.997   1.00 48.58  ? 95  ASN E CA  1 
ATOM 9164  C C   . ASN E 1 95  ? -24.721 10.242  3.025   1.00 53.95  ? 95  ASN E C   1 
ATOM 9165  O O   . ASN E 1 95  ? -23.494 10.215  2.950   1.00 54.26  ? 95  ASN E O   1 
ATOM 9166  C CB  . ASN E 1 95  ? -25.379 9.929   0.546   1.00 50.02  ? 95  ASN E CB  1 
ATOM 9167  C CG  . ASN E 1 95  ? -25.817 11.342  0.272   1.00 69.60  ? 95  ASN E CG  1 
ATOM 9168  O OD1 . ASN E 1 95  ? -26.399 12.039  1.118   1.00 71.11  ? 95  ASN E OD1 1 
ATOM 9169  N ND2 . ASN E 1 95  ? -25.513 11.804  -0.926  1.00 59.66  ? 95  ASN E ND2 1 
ATOM 9170  N N   . ASP E 1 96  ? -25.373 10.919  4.001   1.00 50.55  ? 96  ASP E N   1 
ATOM 9171  C CA  . ASP E 1 96  ? -24.709 11.677  5.073   1.00 49.40  ? 96  ASP E CA  1 
ATOM 9172  C C   . ASP E 1 96  ? -24.463 10.790  6.306   1.00 52.97  ? 96  ASP E C   1 
ATOM 9173  O O   . ASP E 1 96  ? -23.782 11.223  7.247   1.00 53.78  ? 96  ASP E O   1 
ATOM 9174  C CB  . ASP E 1 96  ? -25.513 12.933  5.454   1.00 51.25  ? 96  ASP E CB  1 
ATOM 9175  C CG  . ASP E 1 96  ? -26.917 12.744  6.023   1.00 68.65  ? 96  ASP E CG  1 
ATOM 9176  O OD1 . ASP E 1 96  ? -27.306 11.582  6.300   1.00 68.21  ? 96  ASP E OD1 1 
ATOM 9177  O OD2 . ASP E 1 96  ? -27.611 13.766  6.240   1.00 81.21  ? 96  ASP E OD2 1 
ATOM 9178  N N   . GLY E 1 97  ? -25.027 9.569   6.284   1.00 46.61  ? 97  GLY E N   1 
ATOM 9179  C CA  . GLY E 1 97  ? -24.880 8.593   7.354   1.00 45.04  ? 97  GLY E CA  1 
ATOM 9180  C C   . GLY E 1 97  ? -26.092 8.417   8.234   1.00 49.12  ? 97  GLY E C   1 
ATOM 9181  O O   . GLY E 1 97  ? -26.120 7.483   9.037   1.00 50.29  ? 97  GLY E O   1 
ATOM 9182  N N   . ARG E 1 98  ? -27.103 9.296   8.105   1.00 45.17  ? 98  ARG E N   1 
ATOM 9183  C CA  . ARG E 1 98  ? -28.316 9.200   8.916   1.00 45.64  ? 98  ARG E CA  1 
ATOM 9184  C C   . ARG E 1 98  ? -29.142 7.951   8.575   1.00 50.69  ? 98  ARG E C   1 
ATOM 9185  O O   . ARG E 1 98  ? -29.363 7.642   7.399   1.00 50.51  ? 98  ARG E O   1 
ATOM 9186  C CB  . ARG E 1 98  ? -29.186 10.449  8.763   1.00 46.48  ? 98  ARG E CB  1 
ATOM 9187  C CG  . ARG E 1 98  ? -28.618 11.681  9.470   1.00 40.51  ? 98  ARG E CG  1 
ATOM 9188  C CD  . ARG E 1 98  ? -29.608 12.816  9.506   1.00 34.30  ? 98  ARG E CD  1 
ATOM 9189  N NE  . ARG E 1 98  ? -29.777 13.438  8.184   1.00 54.07  ? 98  ARG E NE  1 
ATOM 9190  C CZ  . ARG E 1 98  ? -30.912 13.986  7.760   1.00 67.01  ? 98  ARG E CZ  1 
ATOM 9191  N NH1 . ARG E 1 98  ? -31.990 13.982  8.537   1.00 44.57  ? 98  ARG E NH1 1 
ATOM 9192  N NH2 . ARG E 1 98  ? -30.979 14.539  6.551   1.00 54.07  ? 98  ARG E NH2 1 
ATOM 9193  N N   . GLU E 1 99  ? -29.571 7.238   9.622   1.00 47.15  ? 99  GLU E N   1 
ATOM 9194  C CA  . GLU E 1 99  ? -30.362 6.020   9.542   1.00 47.05  ? 99  GLU E CA  1 
ATOM 9195  C C   . GLU E 1 99  ? -31.764 6.265   10.060  1.00 52.85  ? 99  GLU E C   1 
ATOM 9196  O O   . GLU E 1 99  ? -31.944 6.957   11.054  1.00 51.43  ? 99  GLU E O   1 
ATOM 9197  C CB  . GLU E 1 99  ? -29.695 4.883   10.330  1.00 48.51  ? 99  GLU E CB  1 
ATOM 9198  C CG  . GLU E 1 99  ? -28.441 4.302   9.685   1.00 60.08  ? 99  GLU E CG  1 
ATOM 9199  C CD  . GLU E 1 99  ? -27.424 3.660   10.614  1.00 90.22  ? 99  GLU E CD  1 
ATOM 9200  O OE1 . GLU E 1 99  ? -27.821 3.101   11.664  1.00 86.23  ? 99  GLU E OE1 1 
ATOM 9201  O OE2 . GLU E 1 99  ? -26.219 3.704   10.273  1.00 90.22  ? 99  GLU E OE2 1 
ATOM 9202  N N   . PHE E 1 100 ? -32.760 5.693   9.377   1.00 51.89  ? 100 PHE E N   1 
ATOM 9203  C CA  . PHE E 1 100 ? -34.175 5.805   9.705   1.00 51.34  ? 100 PHE E CA  1 
ATOM 9204  C C   . PHE E 1 100 ? -34.870 4.476   9.591   1.00 56.99  ? 100 PHE E C   1 
ATOM 9205  O O   . PHE E 1 100 ? -34.484 3.651   8.767   1.00 57.15  ? 100 PHE E O   1 
ATOM 9206  C CB  . PHE E 1 100 ? -34.862 6.766   8.733   1.00 52.90  ? 100 PHE E CB  1 
ATOM 9207  C CG  . PHE E 1 100 ? -34.442 8.208   8.798   1.00 54.43  ? 100 PHE E CG  1 
ATOM 9208  C CD1 . PHE E 1 100 ? -33.400 8.680   8.011   1.00 56.19  ? 100 PHE E CD1 1 
ATOM 9209  C CD2 . PHE E 1 100 ? -35.120 9.113   9.615   1.00 55.88  ? 100 PHE E CD2 1 
ATOM 9210  C CE1 . PHE E 1 100 ? -33.029 10.030  8.055   1.00 56.27  ? 100 PHE E CE1 1 
ATOM 9211  C CE2 . PHE E 1 100 ? -34.753 10.463  9.648   1.00 57.84  ? 100 PHE E CE2 1 
ATOM 9212  C CZ  . PHE E 1 100 ? -33.714 10.911  8.865   1.00 55.43  ? 100 PHE E CZ  1 
ATOM 9213  N N   . ASP E 1 101 ? -35.944 4.288   10.352  1.00 54.41  ? 101 ASP E N   1 
ATOM 9214  C CA  . ASP E 1 101 ? -36.759 3.105   10.201  1.00 53.82  ? 101 ASP E CA  1 
ATOM 9215  C C   . ASP E 1 101 ? -37.791 3.387   9.140   1.00 55.01  ? 101 ASP E C   1 
ATOM 9216  O O   . ASP E 1 101 ? -38.087 4.551   8.853   1.00 55.07  ? 101 ASP E O   1 
ATOM 9217  C CB  . ASP E 1 101 ? -37.391 2.665   11.517  1.00 56.95  ? 101 ASP E CB  1 
ATOM 9218  C CG  . ASP E 1 101 ? -36.690 1.437   12.057  1.00 81.47  ? 101 ASP E CG  1 
ATOM 9219  O OD1 . ASP E 1 101 ? -36.989 0.305   11.562  1.00 83.56  ? 101 ASP E OD1 1 
ATOM 9220  O OD2 . ASP E 1 101 ? -35.767 1.604   12.891  1.00 91.52  ? 101 ASP E OD2 1 
ATOM 9221  N N   . ALA E 1 102 ? -38.276 2.335   8.486   1.00 49.50  ? 102 ALA E N   1 
ATOM 9222  C CA  . ALA E 1 102 ? -39.259 2.492   7.426   1.00 47.66  ? 102 ALA E CA  1 
ATOM 9223  C C   . ALA E 1 102 ? -40.335 1.443   7.520   1.00 48.97  ? 102 ALA E C   1 
ATOM 9224  O O   . ALA E 1 102 ? -40.101 0.325   7.989   1.00 46.85  ? 102 ALA E O   1 
ATOM 9225  C CB  . ALA E 1 102 ? -38.587 2.435   6.069   1.00 47.91  ? 102 ALA E CB  1 
ATOM 9226  N N   . LYS E 1 103 ? -41.530 1.824   7.089   1.00 46.34  ? 103 LYS E N   1 
ATOM 9227  C CA  . LYS E 1 103 ? -42.685 0.936   7.064   1.00 46.26  ? 103 LYS E CA  1 
ATOM 9228  C C   . LYS E 1 103 ? -43.180 0.815   5.634   1.00 50.38  ? 103 LYS E C   1 
ATOM 9229  O O   . LYS E 1 103 ? -43.180 1.793   4.888   1.00 48.22  ? 103 LYS E O   1 
ATOM 9230  C CB  . LYS E 1 103 ? -43.811 1.455   7.991   1.00 48.13  ? 103 LYS E CB  1 
ATOM 9231  C CG  . LYS E 1 103 ? -43.588 1.180   9.480   1.00 60.08  ? 103 LYS E CG  1 
ATOM 9232  C CD  . LYS E 1 103 ? -44.741 1.753   10.287  1.00 67.15  ? 103 LYS E CD  1 
ATOM 9233  C CE  . LYS E 1 103 ? -44.637 1.480   11.762  1.00 81.18  ? 103 LYS E CE  1 
ATOM 9234  N NZ  . LYS E 1 103 ? -45.790 2.056   12.506  1.00 92.80  ? 103 LYS E NZ  1 
ATOM 9235  N N   . LEU E 1 104 ? -43.604 -0.383  5.253   1.00 49.45  ? 104 LEU E N   1 
ATOM 9236  C CA  . LEU E 1 104 ? -44.164 -0.602  3.930   1.00 49.28  ? 104 LEU E CA  1 
ATOM 9237  C C   . LEU E 1 104 ? -45.561 0.013   3.854   1.00 53.75  ? 104 LEU E C   1 
ATOM 9238  O O   . LEU E 1 104 ? -46.428 -0.339  4.652   1.00 54.41  ? 104 LEU E O   1 
ATOM 9239  C CB  . LEU E 1 104 ? -44.197 -2.107  3.621   1.00 48.71  ? 104 LEU E CB  1 
ATOM 9240  C CG  . LEU E 1 104 ? -44.768 -2.512  2.264   1.00 52.97  ? 104 LEU E CG  1 
ATOM 9241  C CD1 . LEU E 1 104 ? -43.906 -2.010  1.112   1.00 52.36  ? 104 LEU E CD1 1 
ATOM 9242  C CD2 . LEU E 1 104 ? -44.977 -4.024  2.195   1.00 54.33  ? 104 LEU E CD2 1 
ATOM 9243  N N   . ILE E 1 105 ? -45.756 0.957   2.930   1.00 49.97  ? 105 ILE E N   1 
ATOM 9244  C CA  . ILE E 1 105 ? -47.057 1.587   2.702   1.00 50.44  ? 105 ILE E CA  1 
ATOM 9245  C C   . ILE E 1 105 ? -47.909 0.652   1.815   1.00 57.63  ? 105 ILE E C   1 
ATOM 9246  O O   . ILE E 1 105 ? -49.079 0.399   2.108   1.00 58.17  ? 105 ILE E O   1 
ATOM 9247  C CB  . ILE E 1 105 ? -46.900 3.021   2.100   1.00 53.09  ? 105 ILE E CB  1 
ATOM 9248  C CG1 . ILE E 1 105 ? -46.296 4.003   3.117   1.00 52.77  ? 105 ILE E CG1 1 
ATOM 9249  C CG2 . ILE E 1 105 ? -48.207 3.570   1.504   1.00 53.80  ? 105 ILE E CG2 1 
ATOM 9250  C CD1 . ILE E 1 105 ? -46.873 3.950   4.573   1.00 54.33  ? 105 ILE E CD1 1 
ATOM 9251  N N   . GLY E 1 106 ? -47.292 0.143   0.760   1.00 55.53  ? 106 GLY E N   1 
ATOM 9252  C CA  . GLY E 1 106 ? -47.918 -0.751  -0.196  1.00 55.61  ? 106 GLY E CA  1 
ATOM 9253  C C   . GLY E 1 106 ? -46.936 -1.198  -1.254  1.00 60.06  ? 106 GLY E C   1 
ATOM 9254  O O   . GLY E 1 106 ? -45.839 -0.645  -1.366  1.00 58.58  ? 106 GLY E O   1 
ATOM 9255  N N   . SER E 1 107 ? -47.330 -2.211  -2.032  1.00 58.15  ? 107 SER E N   1 
ATOM 9256  C CA  . SER E 1 107 ? -46.501 -2.764  -3.091  1.00 58.19  ? 107 SER E CA  1 
ATOM 9257  C C   . SER E 1 107 ? -47.341 -3.362  -4.217  1.00 61.08  ? 107 SER E C   1 
ATOM 9258  O O   . SER E 1 107 ? -48.517 -3.648  -4.029  1.00 60.93  ? 107 SER E O   1 
ATOM 9259  C CB  . SER E 1 107 ? -45.578 -3.834  -2.521  1.00 62.94  ? 107 SER E CB  1 
ATOM 9260  O OG  . SER E 1 107 ? -46.333 -4.927  -2.019  1.00 74.06  ? 107 SER E OG  1 
ATOM 9261  N N   . ASP E 1 108 ? -46.722 -3.540  -5.386  1.00 57.57  ? 108 ASP E N   1 
ATOM 9262  C CA  . ASP E 1 108 ? -47.290 -4.180  -6.554  1.00 57.29  ? 108 ASP E CA  1 
ATOM 9263  C C   . ASP E 1 108 ? -46.315 -5.245  -7.040  1.00 59.19  ? 108 ASP E C   1 
ATOM 9264  O O   . ASP E 1 108 ? -45.231 -4.914  -7.507  1.00 57.67  ? 108 ASP E O   1 
ATOM 9265  C CB  . ASP E 1 108 ? -47.624 -3.171  -7.659  1.00 60.07  ? 108 ASP E CB  1 
ATOM 9266  C CG  . ASP E 1 108 ? -48.268 -3.776  -8.912  1.00 80.61  ? 108 ASP E CG  1 
ATOM 9267  O OD1 . ASP E 1 108 ? -48.738 -4.946  -8.847  1.00 81.96  ? 108 ASP E OD1 1 
ATOM 9268  O OD2 . ASP E 1 108 ? -48.339 -3.071  -9.943  1.00 88.94  ? 108 ASP E OD2 1 
ATOM 9269  N N   . ASP E 1 109 ? -46.702 -6.521  -6.895  1.00 56.72  ? 109 ASP E N   1 
ATOM 9270  C CA  . ASP E 1 109 ? -45.950 -7.711  -7.312  1.00 56.89  ? 109 ASP E CA  1 
ATOM 9271  C C   . ASP E 1 109 ? -45.742 -7.755  -8.831  1.00 56.45  ? 109 ASP E C   1 
ATOM 9272  O O   . ASP E 1 109 ? -44.683 -8.176  -9.295  1.00 54.85  ? 109 ASP E O   1 
ATOM 9273  C CB  . ASP E 1 109 ? -46.705 -9.010  -6.917  1.00 60.47  ? 109 ASP E CB  1 
ATOM 9274  C CG  . ASP E 1 109 ? -47.384 -9.092  -5.563  1.00 87.60  ? 109 ASP E CG  1 
ATOM 9275  O OD1 . ASP E 1 109 ? -47.587 -10.231 -5.073  1.00 89.85  ? 109 ASP E OD1 1 
ATOM 9276  O OD2 . ASP E 1 109 ? -47.795 -8.022  -5.026  1.00 100.42 ? 109 ASP E OD2 1 
ATOM 9277  N N   . GLN E 1 110 ? -46.774 -7.369  -9.590  1.00 51.99  ? 110 GLN E N   1 
ATOM 9278  C CA  . GLN E 1 110 ? -46.807 -7.443  -11.044 1.00 52.66  ? 110 GLN E CA  1 
ATOM 9279  C C   . GLN E 1 110 ? -45.855 -6.473  -11.714 1.00 58.78  ? 110 GLN E C   1 
ATOM 9280  O O   . GLN E 1 110 ? -45.207 -6.856  -12.692 1.00 59.75  ? 110 GLN E O   1 
ATOM 9281  C CB  . GLN E 1 110 ? -48.232 -7.227  -11.564 1.00 53.67  ? 110 GLN E CB  1 
ATOM 9282  C CG  . GLN E 1 110 ? -49.140 -8.444  -11.400 1.00 69.38  ? 110 GLN E CG  1 
ATOM 9283  C CD  . GLN E 1 110 ? -50.486 -8.167  -12.042 1.00 109.00 ? 110 GLN E CD  1 
ATOM 9284  O OE1 . GLN E 1 110 ? -50.647 -8.226  -13.276 1.00 109.18 ? 110 GLN E OE1 1 
ATOM 9285  N NE2 . GLN E 1 110 ? -51.479 -7.828  -11.221 1.00 99.75  ? 110 GLN E NE2 1 
ATOM 9286  N N   . SER E 1 111 ? -45.770 -5.233  -11.222 1.00 55.87  ? 111 SER E N   1 
ATOM 9287  C CA  . SER E 1 111 ? -44.886 -4.228  -11.822 1.00 55.60  ? 111 SER E CA  1 
ATOM 9288  C C   . SER E 1 111 ? -43.537 -4.114  -11.077 1.00 56.53  ? 111 SER E C   1 
ATOM 9289  O O   . SER E 1 111 ? -42.605 -3.559  -11.645 1.00 56.57  ? 111 SER E O   1 
ATOM 9290  C CB  . SER E 1 111 ? -45.580 -2.875  -11.873 1.00 60.54  ? 111 SER E CB  1 
ATOM 9291  O OG  . SER E 1 111 ? -45.922 -2.463  -10.560 1.00 74.46  ? 111 SER E OG  1 
ATOM 9292  N N   . ASP E 1 112 ? -43.434 -4.672  -9.844  1.00 50.55  ? 112 ASP E N   1 
ATOM 9293  C CA  . ASP E 1 112 ? -42.253 -4.694  -8.951  1.00 50.40  ? 112 ASP E CA  1 
ATOM 9294  C C   . ASP E 1 112 ? -41.962 -3.295  -8.323  1.00 52.25  ? 112 ASP E C   1 
ATOM 9295  O O   . ASP E 1 112 ? -40.809 -2.870  -8.198  1.00 48.73  ? 112 ASP E O   1 
ATOM 9296  C CB  . ASP E 1 112 ? -41.000 -5.255  -9.655  1.00 52.13  ? 112 ASP E CB  1 
ATOM 9297  C CG  . ASP E 1 112 ? -39.900 -5.822  -8.764  1.00 56.69  ? 112 ASP E CG  1 
ATOM 9298  O OD1 . ASP E 1 112 ? -40.059 -5.801  -7.527  1.00 55.93  ? 112 ASP E OD1 1 
ATOM 9299  O OD2 . ASP E 1 112 ? -38.898 -6.316  -9.311  1.00 59.18  ? 112 ASP E OD2 1 
ATOM 9300  N N   . ILE E 1 113 ? -43.022 -2.612  -7.889  1.00 50.23  ? 113 ILE E N   1 
ATOM 9301  C CA  . ILE E 1 113 ? -42.883 -1.329  -7.227  1.00 50.07  ? 113 ILE E CA  1 
ATOM 9302  C C   . ILE E 1 113 ? -43.408 -1.434  -5.798  1.00 52.22  ? 113 ILE E C   1 
ATOM 9303  O O   . ILE E 1 113 ? -44.432 -2.072  -5.566  1.00 52.29  ? 113 ILE E O   1 
ATOM 9304  C CB  . ILE E 1 113 ? -43.527 -0.199  -8.049  1.00 53.46  ? 113 ILE E CB  1 
ATOM 9305  C CG1 . ILE E 1 113 ? -42.418 0.424   -8.906  1.00 55.20  ? 113 ILE E CG1 1 
ATOM 9306  C CG2 . ILE E 1 113 ? -44.196 0.886   -7.166  1.00 52.90  ? 113 ILE E CG2 1 
ATOM 9307  C CD1 . ILE E 1 113 ? -42.863 0.827   -10.164 1.00 73.86  ? 113 ILE E CD1 1 
ATOM 9308  N N   . ALA E 1 114 ? -42.631 -0.885  -4.837  1.00 46.38  ? 114 ALA E N   1 
ATOM 9309  C CA  . ALA E 1 114 ? -42.959 -0.796  -3.412  1.00 44.26  ? 114 ALA E CA  1 
ATOM 9310  C C   . ALA E 1 114 ? -42.824 0.641   -2.955  1.00 49.19  ? 114 ALA E C   1 
ATOM 9311  O O   . ALA E 1 114 ? -41.950 1.384   -3.430  1.00 48.29  ? 114 ALA E O   1 
ATOM 9312  C CB  . ALA E 1 114 ? -42.057 -1.690  -2.587  1.00 44.02  ? 114 ALA E CB  1 
ATOM 9313  N N   . LEU E 1 115 ? -43.712 1.049   -2.050  1.00 46.51  ? 115 LEU E N   1 
ATOM 9314  C CA  . LEU E 1 115 ? -43.627 2.373   -1.472  1.00 45.54  ? 115 LEU E CA  1 
ATOM 9315  C C   . LEU E 1 115 ? -43.436 2.235   0.017   1.00 46.52  ? 115 LEU E C   1 
ATOM 9316  O O   . LEU E 1 115 ? -44.165 1.498   0.674   1.00 45.15  ? 115 LEU E O   1 
ATOM 9317  C CB  . LEU E 1 115 ? -44.836 3.249   -1.813  1.00 45.58  ? 115 LEU E CB  1 
ATOM 9318  C CG  . LEU E 1 115 ? -44.726 4.700   -1.329  1.00 50.81  ? 115 LEU E CG  1 
ATOM 9319  C CD1 . LEU E 1 115 ? -43.983 5.595   -2.328  1.00 49.59  ? 115 LEU E CD1 1 
ATOM 9320  C CD2 . LEU E 1 115 ? -46.075 5.236   -1.039  1.00 58.28  ? 115 LEU E CD2 1 
ATOM 9321  N N   . LEU E 1 116 ? -42.420 2.928   0.533   1.00 42.71  ? 116 LEU E N   1 
ATOM 9322  C CA  . LEU E 1 116 ? -42.067 2.946   1.949   1.00 41.96  ? 116 LEU E CA  1 
ATOM 9323  C C   . LEU E 1 116 ? -42.265 4.325   2.539   1.00 44.30  ? 116 LEU E C   1 
ATOM 9324  O O   . LEU E 1 116 ? -42.263 5.326   1.815   1.00 41.32  ? 116 LEU E O   1 
ATOM 9325  C CB  . LEU E 1 116 ? -40.596 2.516   2.170   1.00 41.85  ? 116 LEU E CB  1 
ATOM 9326  C CG  . LEU E 1 116 ? -40.091 1.256   1.456   1.00 46.00  ? 116 LEU E CG  1 
ATOM 9327  C CD1 . LEU E 1 116 ? -38.614 1.114   1.654   1.00 46.45  ? 116 LEU E CD1 1 
ATOM 9328  C CD2 . LEU E 1 116 ? -40.797 0.014   1.967   1.00 45.09  ? 116 LEU E CD2 1 
ATOM 9329  N N   . GLN E 1 117 ? -42.437 4.372   3.867   1.00 42.17  ? 117 GLN E N   1 
ATOM 9330  C CA  . GLN E 1 117 ? -42.530 5.615   4.596   1.00 42.52  ? 117 GLN E CA  1 
ATOM 9331  C C   . GLN E 1 117 ? -41.519 5.610   5.704   1.00 50.64  ? 117 GLN E C   1 
ATOM 9332  O O   . GLN E 1 117 ? -41.515 4.700   6.547   1.00 50.98  ? 117 GLN E O   1 
ATOM 9333  C CB  . GLN E 1 117 ? -43.924 5.891   5.132   1.00 43.14  ? 117 GLN E CB  1 
ATOM 9334  C CG  . GLN E 1 117 ? -44.058 7.287   5.715   1.00 37.03  ? 117 GLN E CG  1 
ATOM 9335  C CD  . GLN E 1 117 ? -45.482 7.677   5.997   1.00 54.44  ? 117 GLN E CD  1 
ATOM 9336  O OE1 . GLN E 1 117 ? -46.324 6.858   6.404   1.00 50.63  ? 117 GLN E OE1 1 
ATOM 9337  N NE2 . GLN E 1 117 ? -45.760 8.959   5.845   1.00 46.91  ? 117 GLN E NE2 1 
ATOM 9338  N N   . ILE E 1 118 ? -40.641 6.629   5.690   1.00 49.08  ? 118 ILE E N   1 
ATOM 9339  C CA  . ILE E 1 118 ? -39.622 6.826   6.716   1.00 49.09  ? 118 ILE E CA  1 
ATOM 9340  C C   . ILE E 1 118 ? -40.332 7.231   8.005   1.00 53.52  ? 118 ILE E C   1 
ATOM 9341  O O   . ILE E 1 118 ? -41.198 8.123   7.988   1.00 53.30  ? 118 ILE E O   1 
ATOM 9342  C CB  . ILE E 1 118 ? -38.595 7.896   6.253   1.00 51.85  ? 118 ILE E CB  1 
ATOM 9343  C CG1 . ILE E 1 118 ? -37.657 7.351   5.156   1.00 51.61  ? 118 ILE E CG1 1 
ATOM 9344  C CG2 . ILE E 1 118 ? -37.800 8.453   7.428   1.00 51.96  ? 118 ILE E CG2 1 
ATOM 9345  C CD1 . ILE E 1 118 ? -36.926 8.416   4.362   1.00 47.45  ? 118 ILE E CD1 1 
ATOM 9346  N N   . GLN E 1 119 ? -39.987 6.550   9.105   1.00 49.74  ? 119 GLN E N   1 
ATOM 9347  C CA  . GLN E 1 119 ? -40.516 6.841   10.436  1.00 49.42  ? 119 GLN E CA  1 
ATOM 9348  C C   . GLN E 1 119 ? -39.720 8.010   11.011  1.00 55.36  ? 119 GLN E C   1 
ATOM 9349  O O   . GLN E 1 119 ? -38.481 7.963   11.051  1.00 55.51  ? 119 GLN E O   1 
ATOM 9350  C CB  . GLN E 1 119 ? -40.470 5.592   11.342  1.00 49.78  ? 119 GLN E CB  1 
ATOM 9351  C CG  . GLN E 1 119 ? -41.272 4.398   10.817  1.00 43.80  ? 119 GLN E CG  1 
ATOM 9352  C CD  . GLN E 1 119 ? -42.722 4.742   10.527  1.00 63.22  ? 119 GLN E CD  1 
ATOM 9353  O OE1 . GLN E 1 119 ? -43.548 4.904   11.436  1.00 65.38  ? 119 GLN E OE1 1 
ATOM 9354  N NE2 . GLN E 1 119 ? -43.073 4.884   9.253   1.00 45.29  ? 119 GLN E NE2 1 
ATOM 9355  N N   . ASN E 1 120 ? -40.444 9.083   11.398  1.00 51.80  ? 120 ASN E N   1 
ATOM 9356  C CA  . ASN E 1 120 ? -39.900 10.343  11.929  1.00 50.62  ? 120 ASN E CA  1 
ATOM 9357  C C   . ASN E 1 120 ? -38.910 10.963  10.914  1.00 52.54  ? 120 ASN E C   1 
ATOM 9358  O O   . ASN E 1 120 ? -37.721 11.134  11.241  1.00 53.18  ? 120 ASN E O   1 
ATOM 9359  C CB  . ASN E 1 120 ? -39.270 10.186  13.343  1.00 47.92  ? 120 ASN E CB  1 
ATOM 9360  C CG  . ASN E 1 120 ? -40.229 9.617   14.365  1.00 90.75  ? 120 ASN E CG  1 
ATOM 9361  O OD1 . ASN E 1 120 ? -40.026 8.507   14.883  1.00 93.14  ? 120 ASN E OD1 1 
ATOM 9362  N ND2 . ASN E 1 120 ? -41.317 10.340  14.661  1.00 81.45  ? 120 ASN E ND2 1 
ATOM 9363  N N   . PRO E 1 121 ? -39.380 11.324  9.686   1.00 46.33  ? 121 PRO E N   1 
ATOM 9364  C CA  . PRO E 1 121 ? -38.460 11.945  8.711   1.00 46.29  ? 121 PRO E CA  1 
ATOM 9365  C C   . PRO E 1 121 ? -38.041 13.337  9.177   1.00 53.30  ? 121 PRO E C   1 
ATOM 9366  O O   . PRO E 1 121 ? -38.755 13.971  9.967   1.00 54.45  ? 121 PRO E O   1 
ATOM 9367  C CB  . PRO E 1 121 ? -39.286 11.998  7.414   1.00 47.67  ? 121 PRO E CB  1 
ATOM 9368  C CG  . PRO E 1 121 ? -40.698 12.003  7.856   1.00 51.31  ? 121 PRO E CG  1 
ATOM 9369  C CD  . PRO E 1 121 ? -40.752 11.215  9.135   1.00 46.85  ? 121 PRO E CD  1 
ATOM 9370  N N   . SER E 1 122 ? -36.869 13.791  8.739   1.00 49.77  ? 122 SER E N   1 
ATOM 9371  C CA  . SER E 1 122 ? -36.315 15.088  9.118   1.00 48.63  ? 122 SER E CA  1 
ATOM 9372  C C   . SER E 1 122 ? -35.233 15.501  8.112   1.00 52.75  ? 122 SER E C   1 
ATOM 9373  O O   . SER E 1 122 ? -34.361 14.687  7.780   1.00 51.69  ? 122 SER E O   1 
ATOM 9374  C CB  . SER E 1 122 ? -35.747 15.008  10.541  1.00 49.83  ? 122 SER E CB  1 
ATOM 9375  O OG  . SER E 1 122 ? -34.802 16.019  10.837  1.00 59.99  ? 122 SER E OG  1 
ATOM 9376  N N   . LYS E 1 123 ? -35.281 16.774  7.650   1.00 50.28  ? 123 LYS E N   1 
ATOM 9377  C CA  . LYS E 1 123 ? -34.301 17.411  6.735   1.00 50.32  ? 123 LYS E CA  1 
ATOM 9378  C C   . LYS E 1 123 ? -33.951 16.499  5.525   1.00 54.35  ? 123 LYS E C   1 
ATOM 9379  O O   . LYS E 1 123 ? -32.781 16.226  5.231   1.00 55.25  ? 123 LYS E O   1 
ATOM 9380  C CB  . LYS E 1 123 ? -33.025 17.815  7.514   1.00 51.63  ? 123 LYS E CB  1 
ATOM 9381  C CG  . LYS E 1 123 ? -33.253 18.928  8.529   1.00 68.68  ? 123 LYS E CG  1 
ATOM 9382  C CD  . LYS E 1 123 ? -32.031 19.136  9.411   1.00 83.37  ? 123 LYS E CD  1 
ATOM 9383  C CE  . LYS E 1 123 ? -32.202 20.356  10.297  1.00 89.95  ? 123 LYS E CE  1 
ATOM 9384  N NZ  . LYS E 1 123 ? -31.062 20.538  11.237  1.00 94.25  ? 123 LYS E NZ  1 
ATOM 9385  N N   . LEU E 1 124 ? -34.993 16.027  4.843   1.00 47.84  ? 124 LEU E N   1 
ATOM 9386  C CA  . LEU E 1 124 ? -34.894 15.133  3.702   1.00 45.45  ? 124 LEU E CA  1 
ATOM 9387  C C   . LEU E 1 124 ? -34.912 15.897  2.382   1.00 48.74  ? 124 LEU E C   1 
ATOM 9388  O O   . LEU E 1 124 ? -35.497 16.960  2.306   1.00 49.94  ? 124 LEU E O   1 
ATOM 9389  C CB  . LEU E 1 124 ? -36.099 14.180  3.768   1.00 44.96  ? 124 LEU E CB  1 
ATOM 9390  C CG  . LEU E 1 124 ? -35.929 12.723  4.220   1.00 48.22  ? 124 LEU E CG  1 
ATOM 9391  C CD1 . LEU E 1 124 ? -35.014 12.544  5.424   1.00 46.62  ? 124 LEU E CD1 1 
ATOM 9392  C CD2 . LEU E 1 124 ? -37.261 12.112  4.476   1.00 51.28  ? 124 LEU E CD2 1 
ATOM 9393  N N   . THR E 1 125 ? -34.245 15.371  1.348   1.00 45.06  ? 125 THR E N   1 
ATOM 9394  C CA  . THR E 1 125 ? -34.231 15.904  -0.010  1.00 43.34  ? 125 THR E CA  1 
ATOM 9395  C C   . THR E 1 125 ? -35.062 14.948  -0.835  1.00 48.54  ? 125 THR E C   1 
ATOM 9396  O O   . THR E 1 125 ? -34.993 13.738  -0.617  1.00 47.98  ? 125 THR E O   1 
ATOM 9397  C CB  . THR E 1 125 ? -32.798 16.051  -0.522  1.00 47.47  ? 125 THR E CB  1 
ATOM 9398  O OG1 . THR E 1 125 ? -32.179 17.093  0.206   1.00 47.24  ? 125 THR E OG1 1 
ATOM 9399  C CG2 . THR E 1 125 ? -32.714 16.342  -2.039  1.00 43.88  ? 125 THR E CG2 1 
ATOM 9400  N N   . GLN E 1 126 ? -35.871 15.479  -1.752  1.00 46.63  ? 126 GLN E N   1 
ATOM 9401  C CA  . GLN E 1 126 ? -36.694 14.666  -2.641  1.00 45.98  ? 126 GLN E CA  1 
ATOM 9402  C C   . GLN E 1 126 ? -36.241 14.862  -4.078  1.00 52.54  ? 126 GLN E C   1 
ATOM 9403  O O   . GLN E 1 126 ? -35.566 15.840  -4.423  1.00 51.89  ? 126 GLN E O   1 
ATOM 9404  C CB  . GLN E 1 126 ? -38.195 14.927  -2.487  1.00 46.60  ? 126 GLN E CB  1 
ATOM 9405  C CG  . GLN E 1 126 ? -38.600 16.353  -2.749  1.00 56.33  ? 126 GLN E CG  1 
ATOM 9406  C CD  . GLN E 1 126 ? -40.077 16.480  -2.829  1.00 60.58  ? 126 GLN E CD  1 
ATOM 9407  O OE1 . GLN E 1 126 ? -40.613 16.806  -3.885  1.00 54.81  ? 126 GLN E OE1 1 
ATOM 9408  N NE2 . GLN E 1 126 ? -40.757 16.258  -1.709  1.00 50.58  ? 126 GLN E NE2 1 
ATOM 9409  N N   . ILE E 1 127 ? -36.587 13.894  -4.906  1.00 50.93  ? 127 ILE E N   1 
ATOM 9410  C CA  . ILE E 1 127 ? -36.214 13.900  -6.302  1.00 49.55  ? 127 ILE E CA  1 
ATOM 9411  C C   . ILE E 1 127 ? -37.311 14.560  -7.134  1.00 52.52  ? 127 ILE E C   1 
ATOM 9412  O O   . ILE E 1 127 ? -38.512 14.456  -6.808  1.00 52.64  ? 127 ILE E O   1 
ATOM 9413  C CB  . ILE E 1 127 ? -35.965 12.405  -6.712  1.00 51.74  ? 127 ILE E CB  1 
ATOM 9414  C CG1 . ILE E 1 127 ? -34.496 12.091  -7.182  1.00 50.74  ? 127 ILE E CG1 1 
ATOM 9415  C CG2 . ILE E 1 127 ? -37.089 11.734  -7.543  1.00 50.34  ? 127 ILE E CG2 1 
ATOM 9416  C CD1 . ILE E 1 127 ? -33.872 12.915  -8.131  1.00 43.42  ? 127 ILE E CD1 1 
ATOM 9417  N N   . ALA E 1 128 ? -36.885 15.207  -8.229  1.00 47.96  ? 128 ALA E N   1 
ATOM 9418  C CA  . ALA E 1 128 ? -37.796 15.739  -9.231  1.00 47.02  ? 128 ALA E CA  1 
ATOM 9419  C C   . ALA E 1 128 ? -38.045 14.598  -10.221 1.00 54.19  ? 128 ALA E C   1 
ATOM 9420  O O   . ALA E 1 128 ? -37.115 13.851  -10.534 1.00 55.71  ? 128 ALA E O   1 
ATOM 9421  C CB  . ALA E 1 128 ? -37.198 16.953  -9.914  1.00 46.87  ? 128 ALA E CB  1 
ATOM 9422  N N   . ILE E 1 129 ? -39.286 14.418  -10.668 1.00 50.74  ? 129 ILE E N   1 
ATOM 9423  C CA  . ILE E 1 129 ? -39.620 13.348  -11.608 1.00 49.11  ? 129 ILE E CA  1 
ATOM 9424  C C   . ILE E 1 129 ? -39.826 13.935  -13.002 1.00 53.11  ? 129 ILE E C   1 
ATOM 9425  O O   . ILE E 1 129 ? -40.606 14.882  -13.156 1.00 53.97  ? 129 ILE E O   1 
ATOM 9426  C CB  . ILE E 1 129 ? -40.856 12.534  -11.114 1.00 50.56  ? 129 ILE E CB  1 
ATOM 9427  C CG1 . ILE E 1 129 ? -40.583 11.969  -9.702  1.00 49.78  ? 129 ILE E CG1 1 
ATOM 9428  C CG2 . ILE E 1 129 ? -41.217 11.408  -12.104 1.00 49.70  ? 129 ILE E CG2 1 
ATOM 9429  C CD1 . ILE E 1 129 ? -41.739 11.455  -8.998  1.00 41.76  ? 129 ILE E CD1 1 
ATOM 9430  N N   . ALA E 1 130 ? -39.122 13.366  -14.005 1.00 47.78  ? 130 ALA E N   1 
ATOM 9431  C CA  . ALA E 1 130 ? -39.223 13.742  -15.415 1.00 46.27  ? 130 ALA E CA  1 
ATOM 9432  C C   . ALA E 1 130 ? -40.293 12.902  -16.134 1.00 52.10  ? 130 ALA E C   1 
ATOM 9433  O O   . ALA E 1 130 ? -40.732 11.868  -15.609 1.00 50.65  ? 130 ALA E O   1 
ATOM 9434  C CB  . ALA E 1 130 ? -37.885 13.550  -16.093 1.00 46.28  ? 130 ALA E CB  1 
ATOM 9435  N N   . ASP E 1 131 ? -40.730 13.372  -17.325 1.00 50.35  ? 131 ASP E N   1 
ATOM 9436  C CA  . ASP E 1 131 ? -41.667 12.647  -18.174 1.00 50.65  ? 131 ASP E CA  1 
ATOM 9437  C C   . ASP E 1 131 ? -40.846 11.604  -18.975 1.00 55.55  ? 131 ASP E C   1 
ATOM 9438  O O   . ASP E 1 131 ? -40.121 11.960  -19.913 1.00 56.33  ? 131 ASP E O   1 
ATOM 9439  C CB  . ASP E 1 131 ? -42.465 13.607  -19.090 1.00 51.97  ? 131 ASP E CB  1 
ATOM 9440  C CG  . ASP E 1 131 ? -43.527 12.960  -19.983 1.00 62.05  ? 131 ASP E CG  1 
ATOM 9441  O OD1 . ASP E 1 131 ? -44.212 13.697  -20.728 1.00 63.41  ? 131 ASP E OD1 1 
ATOM 9442  O OD2 . ASP E 1 131 ? -43.674 11.722  -19.940 1.00 67.20  ? 131 ASP E OD2 1 
ATOM 9443  N N   . SER E 1 132 ? -40.954 10.328  -18.577 1.00 51.09  ? 132 SER E N   1 
ATOM 9444  C CA  . SER E 1 132 ? -40.246 9.218   -19.202 1.00 50.94  ? 132 SER E CA  1 
ATOM 9445  C C   . SER E 1 132 ? -40.736 8.965   -20.659 1.00 55.97  ? 132 SER E C   1 
ATOM 9446  O O   . SER E 1 132 ? -40.000 8.383   -21.465 1.00 56.01  ? 132 SER E O   1 
ATOM 9447  C CB  . SER E 1 132 ? -40.377 7.954   -18.353 1.00 53.69  ? 132 SER E CB  1 
ATOM 9448  O OG  . SER E 1 132 ? -41.721 7.540   -18.177 1.00 61.93  ? 132 SER E OG  1 
ATOM 9449  N N   . ASP E 1 133 ? -41.947 9.439   -21.012 1.00 51.28  ? 133 ASP E N   1 
ATOM 9450  C CA  . ASP E 1 133 ? -42.461 9.277   -22.369 1.00 50.72  ? 133 ASP E CA  1 
ATOM 9451  C C   . ASP E 1 133 ? -41.748 10.229  -23.347 1.00 55.10  ? 133 ASP E C   1 
ATOM 9452  O O   . ASP E 1 133 ? -41.829 10.038  -24.562 1.00 55.44  ? 133 ASP E O   1 
ATOM 9453  C CB  . ASP E 1 133 ? -43.981 9.480   -22.398 1.00 52.99  ? 133 ASP E CB  1 
ATOM 9454  C CG  . ASP E 1 133 ? -44.784 8.326   -21.787 1.00 67.07  ? 133 ASP E CG  1 
ATOM 9455  O OD1 . ASP E 1 133 ? -44.279 7.168   -21.796 1.00 65.46  ? 133 ASP E OD1 1 
ATOM 9456  O OD2 . ASP E 1 133 ? -45.927 8.577   -21.314 1.00 74.09  ? 133 ASP E OD2 1 
ATOM 9457  N N   . LYS E 1 134 ? -41.002 11.211  -22.821 1.00 51.64  ? 134 LYS E N   1 
ATOM 9458  C CA  . LYS E 1 134 ? -40.243 12.166  -23.629 1.00 51.56  ? 134 LYS E CA  1 
ATOM 9459  C C   . LYS E 1 134 ? -38.773 11.675  -23.867 1.00 56.19  ? 134 LYS E C   1 
ATOM 9460  O O   . LYS E 1 134 ? -37.992 12.348  -24.557 1.00 57.96  ? 134 LYS E O   1 
ATOM 9461  C CB  . LYS E 1 134 ? -40.279 13.558  -22.976 1.00 53.91  ? 134 LYS E CB  1 
ATOM 9462  C CG  . LYS E 1 134 ? -41.595 14.287  -23.208 1.00 81.43  ? 134 LYS E CG  1 
ATOM 9463  C CD  . LYS E 1 134 ? -41.760 15.493  -22.282 1.00 100.65 ? 134 LYS E CD  1 
ATOM 9464  C CE  . LYS E 1 134 ? -41.777 16.809  -23.030 1.00 118.25 ? 134 LYS E CE  1 
ATOM 9465  N NZ  . LYS E 1 134 ? -43.055 17.033  -23.768 1.00 127.69 ? 134 LYS E NZ  1 
ATOM 9466  N N   . LEU E 1 135 ? -38.426 10.482  -23.335 1.00 49.61  ? 135 LEU E N   1 
ATOM 9467  C CA  . LEU E 1 135 ? -37.111 9.864   -23.509 1.00 47.79  ? 135 LEU E CA  1 
ATOM 9468  C C   . LEU E 1 135 ? -36.896 9.338   -24.923 1.00 50.98  ? 135 LEU E C   1 
ATOM 9469  O O   . LEU E 1 135 ? -37.833 8.891   -25.595 1.00 49.44  ? 135 LEU E O   1 
ATOM 9470  C CB  . LEU E 1 135 ? -36.915 8.692   -22.530 1.00 47.15  ? 135 LEU E CB  1 
ATOM 9471  C CG  . LEU E 1 135 ? -36.709 9.023   -21.069 1.00 50.60  ? 135 LEU E CG  1 
ATOM 9472  C CD1 . LEU E 1 135 ? -36.701 7.770   -20.253 1.00 49.48  ? 135 LEU E CD1 1 
ATOM 9473  C CD2 . LEU E 1 135 ? -35.426 9.785   -20.858 1.00 53.62  ? 135 LEU E CD2 1 
ATOM 9474  N N   . ARG E 1 136 ? -35.631 9.331   -25.341 1.00 47.77  ? 136 ARG E N   1 
ATOM 9475  C CA  . ARG E 1 136 ? -35.194 8.819   -26.631 1.00 46.71  ? 136 ARG E CA  1 
ATOM 9476  C C   . ARG E 1 136 ? -33.903 8.050   -26.485 1.00 49.61  ? 136 ARG E C   1 
ATOM 9477  O O   . ARG E 1 136 ? -33.084 8.362   -25.618 1.00 48.28  ? 136 ARG E O   1 
ATOM 9478  C CB  . ARG E 1 136 ? -34.995 9.957   -27.626 1.00 45.89  ? 136 ARG E CB  1 
ATOM 9479  C CG  . ARG E 1 136 ? -36.276 10.513  -28.221 1.00 56.19  ? 136 ARG E CG  1 
ATOM 9480  C CD  . ARG E 1 136 ? -35.955 11.614  -29.210 1.00 66.52  ? 136 ARG E CD  1 
ATOM 9481  N NE  . ARG E 1 136 ? -35.179 12.696  -28.596 1.00 69.54  ? 136 ARG E NE  1 
ATOM 9482  C CZ  . ARG E 1 136 ? -34.506 13.620  -29.274 1.00 77.30  ? 136 ARG E CZ  1 
ATOM 9483  N NH1 . ARG E 1 136 ? -34.506 13.610  -30.606 1.00 54.55  ? 136 ARG E NH1 1 
ATOM 9484  N NH2 . ARG E 1 136 ? -33.810 14.549  -28.626 1.00 64.40  ? 136 ARG E NH2 1 
ATOM 9485  N N   . VAL E 1 137 ? -33.714 7.047   -27.353 1.00 47.01  ? 137 VAL E N   1 
ATOM 9486  C CA  . VAL E 1 137 ? -32.500 6.229   -27.411 1.00 46.67  ? 137 VAL E CA  1 
ATOM 9487  C C   . VAL E 1 137 ? -31.350 7.183   -27.747 1.00 53.71  ? 137 VAL E C   1 
ATOM 9488  O O   . VAL E 1 137 ? -31.440 7.906   -28.740 1.00 56.77  ? 137 VAL E O   1 
ATOM 9489  C CB  . VAL E 1 137 ? -32.659 5.074   -28.436 1.00 49.37  ? 137 VAL E CB  1 
ATOM 9490  C CG1 . VAL E 1 137 ? -31.352 4.329   -28.645 1.00 48.89  ? 137 VAL E CG1 1 
ATOM 9491  C CG2 . VAL E 1 137 ? -33.756 4.110   -28.003 1.00 49.13  ? 137 VAL E CG2 1 
ATOM 9492  N N   . GLY E 1 138 ? -30.344 7.238   -26.875 1.00 47.89  ? 138 GLY E N   1 
ATOM 9493  C CA  . GLY E 1 138 ? -29.200 8.127   -27.030 1.00 46.31  ? 138 GLY E CA  1 
ATOM 9494  C C   . GLY E 1 138 ? -29.093 9.134   -25.915 1.00 48.92  ? 138 GLY E C   1 
ATOM 9495  O O   . GLY E 1 138 ? -28.020 9.687   -25.684 1.00 47.47  ? 138 GLY E O   1 
ATOM 9496  N N   . ASP E 1 139 ? -30.213 9.385   -25.212 1.00 46.65  ? 139 ASP E N   1 
ATOM 9497  C CA  . ASP E 1 139 ? -30.240 10.295  -24.061 1.00 46.25  ? 139 ASP E CA  1 
ATOM 9498  C C   . ASP E 1 139 ? -29.321 9.748   -22.959 1.00 46.84  ? 139 ASP E C   1 
ATOM 9499  O O   . ASP E 1 139 ? -29.216 8.537   -22.787 1.00 45.67  ? 139 ASP E O   1 
ATOM 9500  C CB  . ASP E 1 139 ? -31.674 10.492  -23.519 1.00 48.59  ? 139 ASP E CB  1 
ATOM 9501  C CG  . ASP E 1 139 ? -32.628 11.295  -24.383 1.00 69.61  ? 139 ASP E CG  1 
ATOM 9502  O OD1 . ASP E 1 139 ? -32.146 12.094  -25.221 1.00 72.45  ? 139 ASP E OD1 1 
ATOM 9503  O OD2 . ASP E 1 139 ? -33.864 11.170  -24.179 1.00 79.61  ? 139 ASP E OD2 1 
ATOM 9504  N N   . PHE E 1 140 ? -28.624 10.633  -22.265 1.00 42.22  ? 140 PHE E N   1 
ATOM 9505  C CA  . PHE E 1 140 ? -27.698 10.239  -21.222 1.00 41.36  ? 140 PHE E CA  1 
ATOM 9506  C C   . PHE E 1 140 ? -28.431 9.936   -19.943 1.00 46.45  ? 140 PHE E C   1 
ATOM 9507  O O   . PHE E 1 140 ? -29.423 10.573  -19.628 1.00 47.27  ? 140 PHE E O   1 
ATOM 9508  C CB  . PHE E 1 140 ? -26.616 11.307  -21.019 1.00 42.57  ? 140 PHE E CB  1 
ATOM 9509  C CG  . PHE E 1 140 ? -25.691 11.407  -22.205 1.00 43.65  ? 140 PHE E CG  1 
ATOM 9510  C CD1 . PHE E 1 140 ? -25.770 12.477  -23.077 1.00 47.38  ? 140 PHE E CD1 1 
ATOM 9511  C CD2 . PHE E 1 140 ? -24.760 10.408  -22.473 1.00 45.27  ? 140 PHE E CD2 1 
ATOM 9512  C CE1 . PHE E 1 140 ? -24.905 12.574  -24.175 1.00 48.01  ? 140 PHE E CE1 1 
ATOM 9513  C CE2 . PHE E 1 140 ? -23.914 10.494  -23.590 1.00 47.71  ? 140 PHE E CE2 1 
ATOM 9514  C CZ  . PHE E 1 140 ? -23.993 11.577  -24.431 1.00 45.86  ? 140 PHE E CZ  1 
ATOM 9515  N N   . ALA E 1 141 ? -27.971 8.916   -19.230 1.00 44.74  ? 141 ALA E N   1 
ATOM 9516  C CA  . ALA E 1 141 ? -28.564 8.461   -17.979 1.00 43.53  ? 141 ALA E CA  1 
ATOM 9517  C C   . ALA E 1 141 ? -27.491 8.180   -16.933 1.00 45.75  ? 141 ALA E C   1 
ATOM 9518  O O   . ALA E 1 141 ? -26.395 7.723   -17.272 1.00 46.75  ? 141 ALA E O   1 
ATOM 9519  C CB  . ALA E 1 141 ? -29.391 7.213   -18.227 1.00 43.72  ? 141 ALA E CB  1 
ATOM 9520  N N   . VAL E 1 142 ? -27.810 8.457   -15.672 1.00 39.43  ? 142 VAL E N   1 
ATOM 9521  C CA  . VAL E 1 142 ? -26.942 8.205   -14.522 1.00 37.55  ? 142 VAL E CA  1 
ATOM 9522  C C   . VAL E 1 142 ? -27.711 7.309   -13.559 1.00 40.11  ? 142 VAL E C   1 
ATOM 9523  O O   . VAL E 1 142 ? -28.832 7.647   -13.158 1.00 38.98  ? 142 VAL E O   1 
ATOM 9524  C CB  . VAL E 1 142 ? -26.426 9.503   -13.829 1.00 40.39  ? 142 VAL E CB  1 
ATOM 9525  C CG1 . VAL E 1 142 ? -25.485 9.172   -12.685 1.00 40.54  ? 142 VAL E CG1 1 
ATOM 9526  C CG2 . VAL E 1 142 ? -25.737 10.431  -14.815 1.00 39.57  ? 142 VAL E CG2 1 
ATOM 9527  N N   . ALA E 1 143 ? -27.120 6.153   -13.209 1.00 36.41  ? 143 ALA E N   1 
ATOM 9528  C CA  . ALA E 1 143 ? -27.686 5.186   -12.257 1.00 33.74  ? 143 ALA E CA  1 
ATOM 9529  C C   . ALA E 1 143 ? -27.082 5.436   -10.925 1.00 40.71  ? 143 ALA E C   1 
ATOM 9530  O O   . ALA E 1 143 ? -25.858 5.561   -10.815 1.00 42.51  ? 143 ALA E O   1 
ATOM 9531  C CB  . ALA E 1 143 ? -27.422 3.761   -12.703 1.00 33.51  ? 143 ALA E CB  1 
ATOM 9532  N N   . VAL E 1 144 ? -27.932 5.576   -9.906  1.00 37.85  ? 144 VAL E N   1 
ATOM 9533  C CA  . VAL E 1 144 ? -27.515 5.824   -8.524  1.00 37.13  ? 144 VAL E CA  1 
ATOM 9534  C C   . VAL E 1 144 ? -28.121 4.744   -7.670  1.00 42.13  ? 144 VAL E C   1 
ATOM 9535  O O   . VAL E 1 144 ? -29.331 4.507   -7.725  1.00 43.95  ? 144 VAL E O   1 
ATOM 9536  C CB  . VAL E 1 144 ? -27.853 7.249   -8.000  1.00 39.08  ? 144 VAL E CB  1 
ATOM 9537  C CG1 . VAL E 1 144 ? -27.243 7.476   -6.629  1.00 38.76  ? 144 VAL E CG1 1 
ATOM 9538  C CG2 . VAL E 1 144 ? -27.366 8.314   -8.963  1.00 38.30  ? 144 VAL E CG2 1 
ATOM 9539  N N   . GLY E 1 145 ? -27.262 4.090   -6.905  1.00 37.07  ? 145 GLY E N   1 
ATOM 9540  C CA  . GLY E 1 145 ? -27.651 3.002   -6.036  1.00 36.24  ? 145 GLY E CA  1 
ATOM 9541  C C   . GLY E 1 145 ? -26.531 2.462   -5.183  1.00 41.89  ? 145 GLY E C   1 
ATOM 9542  O O   . GLY E 1 145 ? -25.460 3.069   -5.068  1.00 39.86  ? 145 GLY E O   1 
ATOM 9543  N N   . ASN E 1 146 ? -26.798 1.297   -4.578  1.00 41.01  ? 146 ASN E N   1 
ATOM 9544  C CA  . ASN E 1 146 ? -25.933 0.616   -3.640  1.00 41.43  ? 146 ASN E CA  1 
ATOM 9545  C C   . ASN E 1 146 ? -25.493 -0.776  -4.113  1.00 46.15  ? 146 ASN E C   1 
ATOM 9546  O O   . ASN E 1 146 ? -25.754 -1.739  -3.389  1.00 46.81  ? 146 ASN E O   1 
ATOM 9547  C CB  . ASN E 1 146 ? -26.660 0.492   -2.309  1.00 44.51  ? 146 ASN E CB  1 
ATOM 9548  C CG  . ASN E 1 146 ? -25.839 1.004   -1.175  1.00 81.22  ? 146 ASN E CG  1 
ATOM 9549  O OD1 . ASN E 1 146 ? -26.041 2.127   -0.708  1.00 75.08  ? 146 ASN E OD1 1 
ATOM 9550  N ND2 . ASN E 1 146 ? -24.845 0.221   -0.765  1.00 74.54  ? 146 ASN E ND2 1 
ATOM 9551  N N   . PRO E 1 147 ? -24.752 -0.924  -5.252  1.00 40.79  ? 147 PRO E N   1 
ATOM 9552  C CA  . PRO E 1 147 ? -24.287 -2.270  -5.641  1.00 39.43  ? 147 PRO E CA  1 
ATOM 9553  C C   . PRO E 1 147 ? -23.371 -2.884  -4.611  1.00 44.91  ? 147 PRO E C   1 
ATOM 9554  O O   . PRO E 1 147 ? -22.555 -2.174  -4.007  1.00 46.12  ? 147 PRO E O   1 
ATOM 9555  C CB  . PRO E 1 147 ? -23.521 -2.037  -6.942  1.00 40.47  ? 147 PRO E CB  1 
ATOM 9556  C CG  . PRO E 1 147 ? -23.162 -0.567  -6.916  1.00 44.97  ? 147 PRO E CG  1 
ATOM 9557  C CD  . PRO E 1 147 ? -24.286 0.103   -6.212  1.00 40.83  ? 147 PRO E CD  1 
ATOM 9558  N N   . PHE E 1 148 ? -23.542 -4.198  -4.385  1.00 41.61  ? 148 PHE E N   1 
ATOM 9559  C CA  . PHE E 1 148 ? -22.740 -5.041  -3.496  1.00 41.24  ? 148 PHE E CA  1 
ATOM 9560  C C   . PHE E 1 148 ? -22.567 -4.432  -2.082  1.00 49.42  ? 148 PHE E C   1 
ATOM 9561  O O   . PHE E 1 148 ? -21.570 -4.728  -1.400  1.00 50.06  ? 148 PHE E O   1 
ATOM 9562  C CB  . PHE E 1 148 ? -21.363 -5.312  -4.143  1.00 42.23  ? 148 PHE E CB  1 
ATOM 9563  C CG  . PHE E 1 148 ? -21.454 -5.842  -5.562  1.00 43.76  ? 148 PHE E CG  1 
ATOM 9564  C CD1 . PHE E 1 148 ? -20.806 -5.197  -6.604  1.00 45.59  ? 148 PHE E CD1 1 
ATOM 9565  C CD2 . PHE E 1 148 ? -22.209 -6.986  -5.857  1.00 44.22  ? 148 PHE E CD2 1 
ATOM 9566  C CE1 . PHE E 1 148 ? -20.905 -5.691  -7.912  1.00 45.34  ? 148 PHE E CE1 1 
ATOM 9567  C CE2 . PHE E 1 148 ? -22.301 -7.471  -7.159  1.00 44.98  ? 148 PHE E CE2 1 
ATOM 9568  C CZ  . PHE E 1 148 ? -21.642 -6.828  -8.175  1.00 42.56  ? 148 PHE E CZ  1 
ATOM 9569  N N   . GLY E 1 149 ? -23.544 -3.603  -1.676  1.00 45.51  ? 149 GLY E N   1 
ATOM 9570  C CA  . GLY E 1 149 ? -23.568 -2.904  -0.396  1.00 44.63  ? 149 GLY E CA  1 
ATOM 9571  C C   . GLY E 1 149 ? -22.398 -1.982  -0.148  1.00 49.07  ? 149 GLY E C   1 
ATOM 9572  O O   . GLY E 1 149 ? -22.010 -1.795  1.000   1.00 48.91  ? 149 GLY E O   1 
ATOM 9573  N N   . LEU E 1 150 ? -21.824 -1.393  -1.205  1.00 47.41  ? 150 LEU E N   1 
ATOM 9574  C CA  . LEU E 1 150 ? -20.619 -0.554  -1.091  1.00 47.67  ? 150 LEU E CA  1 
ATOM 9575  C C   . LEU E 1 150 ? -20.870 0.839   -0.522  1.00 52.20  ? 150 LEU E C   1 
ATOM 9576  O O   . LEU E 1 150 ? -19.952 1.495   -0.013  1.00 52.12  ? 150 LEU E O   1 
ATOM 9577  C CB  . LEU E 1 150 ? -19.966 -0.391  -2.471  1.00 47.40  ? 150 LEU E CB  1 
ATOM 9578  C CG  . LEU E 1 150 ? -19.320 -1.623  -3.061  1.00 51.79  ? 150 LEU E CG  1 
ATOM 9579  C CD1 . LEU E 1 150 ? -19.003 -1.401  -4.499  1.00 51.25  ? 150 LEU E CD1 1 
ATOM 9580  C CD2 . LEU E 1 150 ? -18.057 -2.019  -2.296  1.00 52.28  ? 150 LEU E CD2 1 
ATOM 9581  N N   . GLY E 1 151 ? -22.100 1.282   -0.664  1.00 48.21  ? 151 GLY E N   1 
ATOM 9582  C CA  . GLY E 1 151 ? -22.533 2.626   -0.338  1.00 46.99  ? 151 GLY E CA  1 
ATOM 9583  C C   . GLY E 1 151 ? -22.986 3.223   -1.650  1.00 47.47  ? 151 GLY E C   1 
ATOM 9584  O O   . GLY E 1 151 ? -22.874 2.568   -2.699  1.00 47.82  ? 151 GLY E O   1 
ATOM 9585  N N   . GLN E 1 152 ? -23.480 4.464   -1.606  1.00 41.51  ? 152 GLN E N   1 
ATOM 9586  C CA  . GLN E 1 152 ? -23.953 5.180   -2.787  1.00 39.91  ? 152 GLN E CA  1 
ATOM 9587  C C   . GLN E 1 152 ? -22.891 5.190   -3.901  1.00 44.29  ? 152 GLN E C   1 
ATOM 9588  O O   . GLN E 1 152 ? -21.721 5.533   -3.677  1.00 45.35  ? 152 GLN E O   1 
ATOM 9589  C CB  . GLN E 1 152 ? -24.368 6.591   -2.435  1.00 39.62  ? 152 GLN E CB  1 
ATOM 9590  C CG  . GLN E 1 152 ? -25.190 7.212   -3.541  1.00 55.56  ? 152 GLN E CG  1 
ATOM 9591  C CD  . GLN E 1 152 ? -25.847 8.460   -3.058  1.00 78.29  ? 152 GLN E CD  1 
ATOM 9592  O OE1 . GLN E 1 152 ? -27.050 8.478   -2.778  1.00 79.39  ? 152 GLN E OE1 1 
ATOM 9593  N NE2 . GLN E 1 152 ? -25.058 9.513   -2.908  1.00 64.61  ? 152 GLN E NE2 1 
ATOM 9594  N N   . THR E 1 153 ? -23.313 4.748   -5.071  1.00 38.37  ? 153 THR E N   1 
ATOM 9595  C CA  . THR E 1 153 ? -22.499 4.635   -6.266  1.00 36.95  ? 153 THR E CA  1 
ATOM 9596  C C   . THR E 1 153 ? -23.260 5.211   -7.411  1.00 38.43  ? 153 THR E C   1 
ATOM 9597  O O   . THR E 1 153 ? -24.428 4.850   -7.609  1.00 37.48  ? 153 THR E O   1 
ATOM 9598  C CB  . THR E 1 153 ? -22.166 3.150   -6.521  1.00 43.08  ? 153 THR E CB  1 
ATOM 9599  O OG1 . THR E 1 153 ? -21.337 2.672   -5.468  1.00 43.20  ? 153 THR E OG1 1 
ATOM 9600  C CG2 . THR E 1 153 ? -21.520 2.893   -7.884  1.00 38.53  ? 153 THR E CG2 1 
ATOM 9601  N N   . ALA E 1 154 ? -22.587 6.070   -8.200  1.00 35.33  ? 154 ALA E N   1 
ATOM 9602  C CA  . ALA E 1 154 ? -23.154 6.646   -9.418  1.00 35.31  ? 154 ALA E CA  1 
ATOM 9603  C C   . ALA E 1 154 ? -22.430 6.093   -10.633 1.00 39.37  ? 154 ALA E C   1 
ATOM 9604  O O   . ALA E 1 154 ? -21.200 6.077   -10.656 1.00 37.74  ? 154 ALA E O   1 
ATOM 9605  C CB  . ALA E 1 154 ? -23.071 8.161   -9.384  1.00 36.34  ? 154 ALA E CB  1 
ATOM 9606  N N   . THR E 1 155 ? -23.187 5.609   -11.634 1.00 37.45  ? 155 THR E N   1 
ATOM 9607  C CA  . THR E 1 155 ? -22.604 5.080   -12.876 1.00 37.52  ? 155 THR E CA  1 
ATOM 9608  C C   . THR E 1 155 ? -23.306 5.770   -14.023 1.00 41.26  ? 155 THR E C   1 
ATOM 9609  O O   . THR E 1 155 ? -24.454 6.177   -13.880 1.00 40.72  ? 155 THR E O   1 
ATOM 9610  C CB  . THR E 1 155 ? -22.656 3.534   -12.947 1.00 40.70  ? 155 THR E CB  1 
ATOM 9611  O OG1 . THR E 1 155 ? -24.007 3.088   -12.804 1.00 42.55  ? 155 THR E OG1 1 
ATOM 9612  C CG2 . THR E 1 155 ? -21.762 2.875   -11.915 1.00 35.59  ? 155 THR E CG2 1 
ATOM 9613  N N   . SER E 1 156 ? -22.619 5.933   -15.137 1.00 37.93  ? 156 SER E N   1 
ATOM 9614  C CA  . SER E 1 156 ? -23.125 6.676   -16.275 1.00 38.53  ? 156 SER E CA  1 
ATOM 9615  C C   . SER E 1 156 ? -23.259 5.808   -17.536 1.00 45.79  ? 156 SER E C   1 
ATOM 9616  O O   . SER E 1 156 ? -22.468 4.899   -17.771 1.00 46.51  ? 156 SER E O   1 
ATOM 9617  C CB  . SER E 1 156 ? -22.182 7.848   -16.554 1.00 42.56  ? 156 SER E CB  1 
ATOM 9618  O OG  . SER E 1 156 ? -22.691 8.740   -17.532 1.00 59.33  ? 156 SER E OG  1 
ATOM 9619  N N   . GLY E 1 157 ? -24.239 6.139   -18.355 1.00 43.78  ? 157 GLY E N   1 
ATOM 9620  C CA  . GLY E 1 157 ? -24.483 5.472   -19.621 1.00 44.70  ? 157 GLY E CA  1 
ATOM 9621  C C   . GLY E 1 157 ? -25.483 6.227   -20.469 1.00 50.05  ? 157 GLY E C   1 
ATOM 9622  O O   . GLY E 1 157 ? -25.709 7.430   -20.263 1.00 50.02  ? 157 GLY E O   1 
ATOM 9623  N N   . ILE E 1 158 ? -26.093 5.523   -21.428 1.00 45.51  ? 158 ILE E N   1 
ATOM 9624  C CA  . ILE E 1 158 ? -27.125 6.082   -22.307 1.00 43.63  ? 158 ILE E CA  1 
ATOM 9625  C C   . ILE E 1 158 ? -28.410 5.276   -22.184 1.00 46.78  ? 158 ILE E C   1 
ATOM 9626  O O   . ILE E 1 158 ? -28.412 4.190   -21.583 1.00 44.37  ? 158 ILE E O   1 
ATOM 9627  C CB  . ILE E 1 158 ? -26.684 6.165   -23.798 1.00 45.56  ? 158 ILE E CB  1 
ATOM 9628  C CG1 . ILE E 1 158 ? -26.346 4.794   -24.407 1.00 44.83  ? 158 ILE E CG1 1 
ATOM 9629  C CG2 . ILE E 1 158 ? -25.592 7.193   -24.017 1.00 47.70  ? 158 ILE E CG2 1 
ATOM 9630  C CD1 . ILE E 1 158 ? -26.385 4.740   -25.973 1.00 50.08  ? 158 ILE E CD1 1 
ATOM 9631  N N   . VAL E 1 159 ? -29.502 5.815   -22.779 1.00 44.41  ? 159 VAL E N   1 
ATOM 9632  C CA  . VAL E 1 159 ? -30.760 5.105   -22.932 1.00 44.70  ? 159 VAL E CA  1 
ATOM 9633  C C   . VAL E 1 159 ? -30.524 4.250   -24.181 1.00 48.78  ? 159 VAL E C   1 
ATOM 9634  O O   . VAL E 1 159 ? -30.268 4.793   -25.264 1.00 47.97  ? 159 VAL E O   1 
ATOM 9635  C CB  . VAL E 1 159 ? -32.004 6.023   -23.008 1.00 48.54  ? 159 VAL E CB  1 
ATOM 9636  C CG1 . VAL E 1 159 ? -33.254 5.217   -23.372 1.00 48.09  ? 159 VAL E CG1 1 
ATOM 9637  C CG2 . VAL E 1 159 ? -32.206 6.760   -21.689 1.00 48.27  ? 159 VAL E CG2 1 
ATOM 9638  N N   . SER E 1 160 ? -30.444 2.922   -23.976 1.00 45.27  ? 160 SER E N   1 
ATOM 9639  C CA  . SER E 1 160 ? -30.126 1.923   -24.998 1.00 43.89  ? 160 SER E CA  1 
ATOM 9640  C C   . SER E 1 160 ? -31.330 1.509   -25.814 1.00 47.14  ? 160 SER E C   1 
ATOM 9641  O O   . SER E 1 160 ? -31.190 1.210   -26.997 1.00 47.06  ? 160 SER E O   1 
ATOM 9642  C CB  . SER E 1 160 ? -29.503 0.694   -24.348 1.00 45.73  ? 160 SER E CB  1 
ATOM 9643  O OG  . SER E 1 160 ? -28.222 0.997   -23.818 1.00 49.84  ? 160 SER E OG  1 
ATOM 9644  N N   . ALA E 1 161 ? -32.505 1.447   -25.167 1.00 44.26  ? 161 ALA E N   1 
ATOM 9645  C CA  . ALA E 1 161 ? -33.795 1.037   -25.734 1.00 43.48  ? 161 ALA E CA  1 
ATOM 9646  C C   . ALA E 1 161 ? -34.928 1.464   -24.818 1.00 47.81  ? 161 ALA E C   1 
ATOM 9647  O O   . ALA E 1 161 ? -34.696 1.776   -23.654 1.00 46.84  ? 161 ALA E O   1 
ATOM 9648  C CB  . ALA E 1 161 ? -33.829 -0.467  -25.941 1.00 43.68  ? 161 ALA E CB  1 
ATOM 9649  N N   . LEU E 1 162 ? -36.156 1.487   -25.350 1.00 46.24  ? 162 LEU E N   1 
ATOM 9650  C CA  . LEU E 1 162 ? -37.368 1.882   -24.629 1.00 46.34  ? 162 LEU E CA  1 
ATOM 9651  C C   . LEU E 1 162 ? -38.509 0.922   -24.932 1.00 53.12  ? 162 LEU E C   1 
ATOM 9652  O O   . LEU E 1 162 ? -38.507 0.282   -25.991 1.00 55.06  ? 162 LEU E O   1 
ATOM 9653  C CB  . LEU E 1 162 ? -37.769 3.312   -25.021 1.00 46.04  ? 162 LEU E CB  1 
ATOM 9654  C CG  . LEU E 1 162 ? -36.810 4.416   -24.616 1.00 50.60  ? 162 LEU E CG  1 
ATOM 9655  C CD1 . LEU E 1 162 ? -36.931 5.590   -25.539 1.00 50.56  ? 162 LEU E CD1 1 
ATOM 9656  C CD2 . LEU E 1 162 ? -36.996 4.803   -23.148 1.00 50.79  ? 162 LEU E CD2 1 
ATOM 9657  N N   . GLY E 1 163 ? -39.470 0.840   -24.012 1.00 48.98  ? 163 GLY E N   1 
ATOM 9658  C CA  . GLY E 1 163 ? -40.645 -0.018  -24.149 1.00 49.19  ? 163 GLY E CA  1 
ATOM 9659  C C   . GLY E 1 163 ? -40.334 -1.493  -24.246 1.00 56.75  ? 163 GLY E C   1 
ATOM 9660  O O   . GLY E 1 163 ? -40.988 -2.200  -25.010 1.00 58.07  ? 163 GLY E O   1 
ATOM 9661  N N   . ARG E 1 164 ? -39.328 -1.965  -23.479 1.00 54.78  ? 164 ARG E N   1 
ATOM 9662  C CA  . ARG E 1 164 ? -38.860 -3.345  -23.481 1.00 54.66  ? 164 ARG E CA  1 
ATOM 9663  C C   . ARG E 1 164 ? -39.762 -4.263  -22.662 1.00 63.71  ? 164 ARG E C   1 
ATOM 9664  O O   . ARG E 1 164 ? -39.934 -4.070  -21.451 1.00 63.59  ? 164 ARG E O   1 
ATOM 9665  C CB  . ARG E 1 164 ? -37.412 -3.426  -22.971 1.00 50.25  ? 164 ARG E CB  1 
ATOM 9666  C CG  . ARG E 1 164 ? -36.377 -3.108  -24.009 1.00 51.81  ? 164 ARG E CG  1 
ATOM 9667  C CD  . ARG E 1 164 ? -36.289 -4.162  -25.093 1.00 53.71  ? 164 ARG E CD  1 
ATOM 9668  N NE  . ARG E 1 164 ? -34.945 -4.215  -25.646 1.00 58.87  ? 164 ARG E NE  1 
ATOM 9669  C CZ  . ARG E 1 164 ? -34.575 -3.678  -26.795 1.00 64.54  ? 164 ARG E CZ  1 
ATOM 9670  N NH1 . ARG E 1 164 ? -35.463 -3.059  -27.558 1.00 47.44  ? 164 ARG E NH1 1 
ATOM 9671  N NH2 . ARG E 1 164 ? -33.319 -3.763  -27.199 1.00 65.52  ? 164 ARG E NH2 1 
ATOM 9672  N N   . SER E 1 165 ? -40.287 -5.300  -23.342 1.00 63.72  ? 165 SER E N   1 
ATOM 9673  C CA  . SER E 1 165 ? -41.200 -6.326  -22.825 1.00 64.04  ? 165 SER E CA  1 
ATOM 9674  C C   . SER E 1 165 ? -40.686 -7.733  -23.169 1.00 69.06  ? 165 SER E C   1 
ATOM 9675  O O   . SER E 1 165 ? -39.587 -7.882  -23.717 1.00 67.98  ? 165 SER E O   1 
ATOM 9676  C CB  . SER E 1 165 ? -42.589 -6.125  -23.426 1.00 67.78  ? 165 SER E CB  1 
ATOM 9677  O OG  . SER E 1 165 ? -43.011 -4.769  -23.390 1.00 79.91  ? 165 SER E OG  1 
ATOM 9678  N N   . GLY E 1 166 ? -41.490 -8.745  -22.829 1.00 66.30  ? 166 GLY E N   1 
ATOM 9679  C CA  . GLY E 1 166 ? -41.227 -10.154 -23.101 1.00 65.66  ? 166 GLY E CA  1 
ATOM 9680  C C   . GLY E 1 166 ? -39.915 -10.678 -22.575 1.00 71.36  ? 166 GLY E C   1 
ATOM 9681  O O   . GLY E 1 166 ? -39.322 -11.575 -23.182 1.00 73.34  ? 166 GLY E O   1 
ATOM 9682  N N   . LEU E 1 167 ? -39.453 -10.126 -21.449 1.00 67.06  ? 167 LEU E N   1 
ATOM 9683  C CA  . LEU E 1 167 ? -38.201 -10.540 -20.824 1.00 66.14  ? 167 LEU E CA  1 
ATOM 9684  C C   . LEU E 1 167 ? -38.481 -11.551 -19.714 1.00 68.88  ? 167 LEU E C   1 
ATOM 9685  O O   . LEU E 1 167 ? -37.536 -12.116 -19.147 1.00 69.51  ? 167 LEU E O   1 
ATOM 9686  C CB  . LEU E 1 167 ? -37.415 -9.330  -20.280 1.00 66.07  ? 167 LEU E CB  1 
ATOM 9687  C CG  . LEU E 1 167 ? -37.325 -8.076  -21.155 1.00 70.91  ? 167 LEU E CG  1 
ATOM 9688  C CD1 . LEU E 1 167 ? -36.741 -6.929  -20.391 1.00 70.96  ? 167 LEU E CD1 1 
ATOM 9689  C CD2 . LEU E 1 167 ? -36.498 -8.317  -22.398 1.00 73.98  ? 167 LEU E CD2 1 
ATOM 9690  N N   . ASN E 1 168 ? -39.783 -11.793 -19.418 1.00 63.78  ? 168 ASN E N   1 
ATOM 9691  C CA  . ASN E 1 168 ? -40.254 -12.725 -18.382 1.00 63.59  ? 168 ASN E CA  1 
ATOM 9692  C C   . ASN E 1 168 ? -39.575 -12.435 -17.024 1.00 65.30  ? 168 ASN E C   1 
ATOM 9693  O O   . ASN E 1 168 ? -39.143 -13.347 -16.315 1.00 65.01  ? 168 ASN E O   1 
ATOM 9694  C CB  . ASN E 1 168 ? -40.065 -14.207 -18.818 1.00 66.41  ? 168 ASN E CB  1 
ATOM 9695  C CG  . ASN E 1 168 ? -41.155 -14.735 -19.747 1.00 99.32  ? 168 ASN E CG  1 
ATOM 9696  O OD1 . ASN E 1 168 ? -41.792 -13.994 -20.526 1.00 96.15  ? 168 ASN E OD1 1 
ATOM 9697  N ND2 . ASN E 1 168 ? -41.377 -16.040 -19.702 1.00 89.79  ? 168 ASN E ND2 1 
ATOM 9698  N N   . LEU E 1 169 ? -39.471 -11.146 -16.691 1.00 60.15  ? 169 LEU E N   1 
ATOM 9699  C CA  . LEU E 1 169 ? -38.882 -10.669 -15.447 1.00 59.26  ? 169 LEU E CA  1 
ATOM 9700  C C   . LEU E 1 169 ? -39.992 -10.296 -14.505 1.00 61.03  ? 169 LEU E C   1 
ATOM 9701  O O   . LEU E 1 169 ? -39.992 -10.684 -13.337 1.00 59.07  ? 169 LEU E O   1 
ATOM 9702  C CB  . LEU E 1 169 ? -37.974 -9.444  -15.723 1.00 59.42  ? 169 LEU E CB  1 
ATOM 9703  C CG  . LEU E 1 169 ? -36.676 -9.697  -16.494 1.00 64.00  ? 169 LEU E CG  1 
ATOM 9704  C CD1 . LEU E 1 169 ? -36.100 -8.402  -17.031 1.00 63.76  ? 169 LEU E CD1 1 
ATOM 9705  C CD2 . LEU E 1 169 ? -35.642 -10.399 -15.609 1.00 65.42  ? 169 LEU E CD2 1 
ATOM 9706  N N   . GLU E 1 170 ? -40.967 -9.553  -15.051 1.00 57.99  ? 170 GLU E N   1 
ATOM 9707  C CA  . GLU E 1 170 ? -42.119 -9.017  -14.352 1.00 57.29  ? 170 GLU E CA  1 
ATOM 9708  C C   . GLU E 1 170 ? -43.412 -9.400  -15.045 1.00 59.31  ? 170 GLU E C   1 
ATOM 9709  O O   . GLU E 1 170 ? -43.394 -9.818  -16.202 1.00 57.63  ? 170 GLU E O   1 
ATOM 9710  C CB  . GLU E 1 170 ? -41.982 -7.482  -14.303 1.00 58.65  ? 170 GLU E CB  1 
ATOM 9711  C CG  . GLU E 1 170 ? -41.758 -6.911  -12.920 1.00 68.88  ? 170 GLU E CG  1 
ATOM 9712  C CD  . GLU E 1 170 ? -40.580 -7.484  -12.163 1.00 91.90  ? 170 GLU E CD  1 
ATOM 9713  O OE1 . GLU E 1 170 ? -39.433 -7.061  -12.440 1.00 84.93  ? 170 GLU E OE1 1 
ATOM 9714  O OE2 . GLU E 1 170 ? -40.814 -8.306  -11.245 1.00 83.45  ? 170 GLU E OE2 1 
ATOM 9715  N N   . GLY E 1 171 ? -44.523 -9.252  -14.322 1.00 56.07  ? 171 GLY E N   1 
ATOM 9716  C CA  . GLY E 1 171 ? -45.864 -9.477  -14.850 1.00 54.80  ? 171 GLY E CA  1 
ATOM 9717  C C   . GLY E 1 171 ? -46.205 -8.368  -15.820 1.00 57.77  ? 171 GLY E C   1 
ATOM 9718  O O   . GLY E 1 171 ? -46.739 -8.630  -16.896 1.00 59.09  ? 171 GLY E O   1 
ATOM 9719  N N   . LEU E 1 172 ? -45.845 -7.122  -15.459 1.00 53.20  ? 172 LEU E N   1 
ATOM 9720  C CA  . LEU E 1 172 ? -46.042 -5.925  -16.279 1.00 52.88  ? 172 LEU E CA  1 
ATOM 9721  C C   . LEU E 1 172 ? -44.699 -5.264  -16.522 1.00 55.46  ? 172 LEU E C   1 
ATOM 9722  O O   . LEU E 1 172 ? -43.995 -4.911  -15.573 1.00 54.77  ? 172 LEU E O   1 
ATOM 9723  C CB  . LEU E 1 172 ? -47.030 -4.938  -15.629 1.00 53.07  ? 172 LEU E CB  1 
ATOM 9724  C CG  . LEU E 1 172 ? -48.390 -5.501  -15.234 1.00 57.04  ? 172 LEU E CG  1 
ATOM 9725  C CD1 . LEU E 1 172 ? -49.051 -4.617  -14.207 1.00 57.72  ? 172 LEU E CD1 1 
ATOM 9726  C CD2 . LEU E 1 172 ? -49.276 -5.721  -16.458 1.00 56.38  ? 172 LEU E CD2 1 
ATOM 9727  N N   . GLU E 1 173 ? -44.321 -5.154  -17.794 1.00 51.35  ? 173 GLU E N   1 
ATOM 9728  C CA  . GLU E 1 173 ? -43.032 -4.622  -18.203 1.00 49.85  ? 173 GLU E CA  1 
ATOM 9729  C C   . GLU E 1 173 ? -43.162 -3.592  -19.305 1.00 50.90  ? 173 GLU E C   1 
ATOM 9730  O O   . GLU E 1 173 ? -43.887 -3.804  -20.283 1.00 50.22  ? 173 GLU E O   1 
ATOM 9731  C CB  . GLU E 1 173 ? -42.101 -5.744  -18.706 1.00 51.50  ? 173 GLU E CB  1 
ATOM 9732  C CG  . GLU E 1 173 ? -41.940 -7.001  -17.857 1.00 61.28  ? 173 GLU E CG  1 
ATOM 9733  C CD  . GLU E 1 173 ? -41.123 -8.100  -18.517 1.00 74.17  ? 173 GLU E CD  1 
ATOM 9734  O OE1 . GLU E 1 173 ? -40.286 -7.780  -19.392 1.00 67.26  ? 173 GLU E OE1 1 
ATOM 9735  O OE2 . GLU E 1 173 ? -41.332 -9.285  -18.174 1.00 68.90  ? 173 GLU E OE2 1 
ATOM 9736  N N   . ASN E 1 174 ? -42.404 -2.499  -19.173 1.00 46.00  ? 174 ASN E N   1 
ATOM 9737  C CA  . ASN E 1 174 ? -42.313 -1.422  -20.157 1.00 46.01  ? 174 ASN E CA  1 
ATOM 9738  C C   . ASN E 1 174 ? -40.982 -0.703  -19.893 1.00 49.67  ? 174 ASN E C   1 
ATOM 9739  O O   . ASN E 1 174 ? -40.877 0.520   -19.855 1.00 47.54  ? 174 ASN E O   1 
ATOM 9740  C CB  . ASN E 1 174 ? -43.534 -0.514  -20.095 1.00 45.25  ? 174 ASN E CB  1 
ATOM 9741  C CG  . ASN E 1 174 ? -43.553 0.572   -21.134 1.00 66.90  ? 174 ASN E CG  1 
ATOM 9742  O OD1 . ASN E 1 174 ? -43.837 1.732   -20.836 1.00 66.28  ? 174 ASN E OD1 1 
ATOM 9743  N ND2 . ASN E 1 174 ? -43.171 0.247   -22.356 1.00 51.93  ? 174 ASN E ND2 1 
ATOM 9744  N N   . PHE E 1 175 ? -39.947 -1.526  -19.745 1.00 47.78  ? 175 PHE E N   1 
ATOM 9745  C CA  . PHE E 1 175 ? -38.609 -1.142  -19.337 1.00 47.14  ? 175 PHE E CA  1 
ATOM 9746  C C   . PHE E 1 175 ? -37.845 -0.207  -20.246 1.00 49.19  ? 175 PHE E C   1 
ATOM 9747  O O   . PHE E 1 175 ? -37.906 -0.292  -21.471 1.00 48.81  ? 175 PHE E O   1 
ATOM 9748  C CB  . PHE E 1 175 ? -37.762 -2.400  -19.163 1.00 49.07  ? 175 PHE E CB  1 
ATOM 9749  C CG  . PHE E 1 175 ? -38.120 -3.251  -17.970 1.00 51.65  ? 175 PHE E CG  1 
ATOM 9750  C CD1 . PHE E 1 175 ? -38.416 -4.599  -18.124 1.00 55.41  ? 175 PHE E CD1 1 
ATOM 9751  C CD2 . PHE E 1 175 ? -38.104 -2.721  -16.683 1.00 54.32  ? 175 PHE E CD2 1 
ATOM 9752  C CE1 . PHE E 1 175 ? -38.692 -5.399  -17.017 1.00 56.54  ? 175 PHE E CE1 1 
ATOM 9753  C CE2 . PHE E 1 175 ? -38.378 -3.524  -15.575 1.00 57.17  ? 175 PHE E CE2 1 
ATOM 9754  C CZ  . PHE E 1 175 ? -38.686 -4.852  -15.750 1.00 55.52  ? 175 PHE E CZ  1 
ATOM 9755  N N   . ILE E 1 176 ? -37.074 0.667   -19.593 1.00 44.78  ? 176 ILE E N   1 
ATOM 9756  C CA  . ILE E 1 176 ? -36.038 1.501   -20.180 1.00 43.94  ? 176 ILE E CA  1 
ATOM 9757  C C   . ILE E 1 176 ? -34.804 0.610   -20.114 1.00 49.78  ? 176 ILE E C   1 
ATOM 9758  O O   . ILE E 1 176 ? -34.569 -0.017  -19.066 1.00 50.31  ? 176 ILE E O   1 
ATOM 9759  C CB  . ILE E 1 176 ? -35.811 2.864   -19.431 1.00 45.39  ? 176 ILE E CB  1 
ATOM 9760  C CG1 . ILE E 1 176 ? -37.049 3.743   -19.430 1.00 44.04  ? 176 ILE E CG1 1 
ATOM 9761  C CG2 . ILE E 1 176 ? -34.589 3.623   -19.994 1.00 46.17  ? 176 ILE E CG2 1 
ATOM 9762  C CD1 . ILE E 1 176 ? -37.087 4.643   -18.319 1.00 47.66  ? 176 ILE E CD1 1 
ATOM 9763  N N   . GLN E 1 177 ? -34.047 0.512   -21.208 1.00 44.91  ? 177 GLN E N   1 
ATOM 9764  C CA  . GLN E 1 177 ? -32.827 -0.271  -21.191 1.00 44.76  ? 177 GLN E CA  1 
ATOM 9765  C C   . GLN E 1 177 ? -31.644 0.699   -21.171 1.00 48.10  ? 177 GLN E C   1 
ATOM 9766  O O   . GLN E 1 177 ? -31.652 1.687   -21.895 1.00 47.57  ? 177 GLN E O   1 
ATOM 9767  C CB  . GLN E 1 177 ? -32.776 -1.231  -22.378 1.00 46.60  ? 177 GLN E CB  1 
ATOM 9768  C CG  . GLN E 1 177 ? -31.689 -2.283  -22.259 1.00 47.04  ? 177 GLN E CG  1 
ATOM 9769  C CD  . GLN E 1 177 ? -31.646 -3.118  -23.501 1.00 52.47  ? 177 GLN E CD  1 
ATOM 9770  O OE1 . GLN E 1 177 ? -32.645 -3.643  -23.961 1.00 47.40  ? 177 GLN E OE1 1 
ATOM 9771  N NE2 . GLN E 1 177 ? -30.486 -3.250  -24.074 1.00 44.54  ? 177 GLN E NE2 1 
ATOM 9772  N N   . THR E 1 178 ? -30.649 0.448   -20.322 1.00 44.84  ? 178 THR E N   1 
ATOM 9773  C CA  . THR E 1 178 ? -29.504 1.350   -20.203 1.00 44.00  ? 178 THR E CA  1 
ATOM 9774  C C   . THR E 1 178 ? -28.211 0.559   -20.115 1.00 44.94  ? 178 THR E C   1 
ATOM 9775  O O   . THR E 1 178 ? -28.228 -0.578  -19.650 1.00 43.57  ? 178 THR E O   1 
ATOM 9776  C CB  . THR E 1 178 ? -29.680 2.327   -18.997 1.00 54.27  ? 178 THR E CB  1 
ATOM 9777  O OG1 . THR E 1 178 ? -28.555 3.196   -18.916 1.00 61.12  ? 178 THR E OG1 1 
ATOM 9778  C CG2 . THR E 1 178 ? -29.852 1.625   -17.662 1.00 48.02  ? 178 THR E CG2 1 
ATOM 9779  N N   . ASP E 1 179 ? -27.086 1.175   -20.546 1.00 42.18  ? 179 ASP E N   1 
ATOM 9780  C CA  . ASP E 1 179 ? -25.768 0.544   -20.463 1.00 41.66  ? 179 ASP E CA  1 
ATOM 9781  C C   . ASP E 1 179 ? -24.984 1.057   -19.250 1.00 44.30  ? 179 ASP E C   1 
ATOM 9782  O O   . ASP E 1 179 ? -23.828 0.667   -19.072 1.00 44.05  ? 179 ASP E O   1 
ATOM 9783  C CB  . ASP E 1 179 ? -24.960 0.658   -21.771 1.00 43.75  ? 179 ASP E CB  1 
ATOM 9784  C CG  . ASP E 1 179 ? -24.500 2.041   -22.184 1.00 60.06  ? 179 ASP E CG  1 
ATOM 9785  O OD1 . ASP E 1 179 ? -25.128 3.029   -21.756 1.00 61.07  ? 179 ASP E OD1 1 
ATOM 9786  O OD2 . ASP E 1 179 ? -23.541 2.133   -22.982 1.00 71.28  ? 179 ASP E OD2 1 
ATOM 9787  N N   . ALA E 1 180 ? -25.622 1.872   -18.386 1.00 41.50  ? 180 ALA E N   1 
ATOM 9788  C CA  . ALA E 1 180 ? -25.033 2.315   -17.119 1.00 42.28  ? 180 ALA E CA  1 
ATOM 9789  C C   . ALA E 1 180 ? -24.866 1.074   -16.254 1.00 46.94  ? 180 ALA E C   1 
ATOM 9790  O O   . ALA E 1 180 ? -25.806 0.269   -16.202 1.00 47.68  ? 180 ALA E O   1 
ATOM 9791  C CB  . ALA E 1 180 ? -25.946 3.335   -16.437 1.00 43.27  ? 180 ALA E CB  1 
ATOM 9792  N N   . SER E 1 181 ? -23.670 0.854   -15.664 1.00 42.03  ? 181 SER E N   1 
ATOM 9793  C CA  . SER E 1 181 ? -23.406 -0.328  -14.848 1.00 41.49  ? 181 SER E CA  1 
ATOM 9794  C C   . SER E 1 181 ? -24.391 -0.432  -13.701 1.00 47.40  ? 181 SER E C   1 
ATOM 9795  O O   . SER E 1 181 ? -24.441 0.444   -12.855 1.00 49.65  ? 181 SER E O   1 
ATOM 9796  C CB  . SER E 1 181 ? -21.973 -0.337  -14.326 1.00 45.38  ? 181 SER E CB  1 
ATOM 9797  O OG  . SER E 1 181 ? -21.049 -0.447  -15.400 1.00 56.16  ? 181 SER E OG  1 
ATOM 9798  N N   . ILE E 1 182 ? -25.232 -1.473  -13.737 1.00 42.57  ? 182 ILE E N   1 
ATOM 9799  C CA  . ILE E 1 182 ? -26.259 -1.792  -12.757 1.00 42.36  ? 182 ILE E CA  1 
ATOM 9800  C C   . ILE E 1 182 ? -25.965 -3.213  -12.317 1.00 46.67  ? 182 ILE E C   1 
ATOM 9801  O O   . ILE E 1 182 ? -25.828 -4.112  -13.146 1.00 49.30  ? 182 ILE E O   1 
ATOM 9802  C CB  . ILE E 1 182 ? -27.685 -1.583  -13.350 1.00 46.35  ? 182 ILE E CB  1 
ATOM 9803  C CG1 . ILE E 1 182 ? -27.946 -0.084  -13.564 1.00 47.33  ? 182 ILE E CG1 1 
ATOM 9804  C CG2 . ILE E 1 182 ? -28.783 -2.171  -12.465 1.00 48.91  ? 182 ILE E CG2 1 
ATOM 9805  C CD1 . ILE E 1 182 ? -29.055 0.191   -14.555 1.00 56.02  ? 182 ILE E CD1 1 
ATOM 9806  N N   . ASN E 1 183 ? -25.811 -3.403  -11.019 1.00 40.19  ? 183 ASN E N   1 
ATOM 9807  C CA  . ASN E 1 183 ? -25.438 -4.674  -10.419 1.00 38.39  ? 183 ASN E CA  1 
ATOM 9808  C C   . ASN E 1 183 ? -26.353 -4.975  -9.258  1.00 42.81  ? 183 ASN E C   1 
ATOM 9809  O O   . ASN E 1 183 ? -27.187 -4.149  -8.935  1.00 42.35  ? 183 ASN E O   1 
ATOM 9810  C CB  . ASN E 1 183 ? -23.979 -4.604  -9.963  1.00 31.06  ? 183 ASN E CB  1 
ATOM 9811  C CG  . ASN E 1 183 ? -22.986 -4.773  -11.064 1.00 48.37  ? 183 ASN E CG  1 
ATOM 9812  O OD1 . ASN E 1 183 ? -22.770 -5.875  -11.551 1.00 49.00  ? 183 ASN E OD1 1 
ATOM 9813  N ND2 . ASN E 1 183 ? -22.344 -3.685  -11.472 1.00 45.93  ? 183 ASN E ND2 1 
ATOM 9814  N N   . ARG E 1 184 ? -26.215 -6.150  -8.633  1.00 41.52  ? 184 ARG E N   1 
ATOM 9815  C CA  . ARG E 1 184 ? -26.999 -6.503  -7.442  1.00 42.01  ? 184 ARG E CA  1 
ATOM 9816  C C   . ARG E 1 184 ? -26.747 -5.450  -6.368  1.00 42.19  ? 184 ARG E C   1 
ATOM 9817  O O   . ARG E 1 184 ? -25.596 -5.151  -6.078  1.00 41.38  ? 184 ARG E O   1 
ATOM 9818  C CB  . ARG E 1 184 ? -26.622 -7.909  -6.916  1.00 45.37  ? 184 ARG E CB  1 
ATOM 9819  C CG  . ARG E 1 184 ? -27.187 -9.058  -7.729  1.00 61.97  ? 184 ARG E CG  1 
ATOM 9820  C CD  . ARG E 1 184 ? -26.849 -10.395 -7.094  1.00 83.59  ? 184 ARG E CD  1 
ATOM 9821  N NE  . ARG E 1 184 ? -25.445 -10.762 -7.308  1.00 105.51 ? 184 ARG E NE  1 
ATOM 9822  C CZ  . ARG E 1 184 ? -25.030 -11.709 -8.147  1.00 123.24 ? 184 ARG E CZ  1 
ATOM 9823  N NH1 . ARG E 1 184 ? -25.908 -12.423 -8.846  1.00 113.04 ? 184 ARG E NH1 1 
ATOM 9824  N NH2 . ARG E 1 184 ? -23.733 -11.962 -8.281  1.00 107.03 ? 184 ARG E NH2 1 
ATOM 9825  N N   . GLY E 1 185 ? -27.814 -4.901  -5.805  1.00 37.17  ? 185 GLY E N   1 
ATOM 9826  C CA  . GLY E 1 185 ? -27.759 -3.874  -4.774  1.00 35.79  ? 185 GLY E CA  1 
ATOM 9827  C C   . GLY E 1 185 ? -28.270 -2.568  -5.337  1.00 42.51  ? 185 GLY E C   1 
ATOM 9828  O O   . GLY E 1 185 ? -28.642 -1.674  -4.583  1.00 44.06  ? 185 GLY E O   1 
ATOM 9829  N N   . ASN E 1 186 ? -28.329 -2.465  -6.681  1.00 38.81  ? 186 ASN E N   1 
ATOM 9830  C CA  . ASN E 1 186 ? -28.816 -1.295  -7.398  1.00 38.13  ? 186 ASN E CA  1 
ATOM 9831  C C   . ASN E 1 186 ? -30.301 -1.177  -7.369  1.00 42.99  ? 186 ASN E C   1 
ATOM 9832  O O   . ASN E 1 186 ? -30.821 -0.061  -7.509  1.00 42.80  ? 186 ASN E O   1 
ATOM 9833  C CB  . ASN E 1 186 ? -28.371 -1.338  -8.857  1.00 35.46  ? 186 ASN E CB  1 
ATOM 9834  C CG  . ASN E 1 186 ? -27.205 -0.436  -9.073  1.00 51.09  ? 186 ASN E CG  1 
ATOM 9835  O OD1 . ASN E 1 186 ? -27.337 0.795   -8.997  1.00 45.05  ? 186 ASN E OD1 1 
ATOM 9836  N ND2 . ASN E 1 186 ? -26.025 -1.022  -9.233  1.00 34.97  ? 186 ASN E ND2 1 
ATOM 9837  N N   . SER E 1 187 ? -30.995 -2.332  -7.242  1.00 41.08  ? 187 SER E N   1 
ATOM 9838  C CA  . SER E 1 187 ? -32.453 -2.450  -7.295  1.00 41.84  ? 187 SER E CA  1 
ATOM 9839  C C   . SER E 1 187 ? -33.153 -1.444  -6.399  1.00 47.23  ? 187 SER E C   1 
ATOM 9840  O O   . SER E 1 187 ? -32.833 -1.332  -5.219  1.00 47.23  ? 187 SER E O   1 
ATOM 9841  C CB  . SER E 1 187 ? -32.920 -3.854  -6.938  1.00 46.21  ? 187 SER E CB  1 
ATOM 9842  O OG  . SER E 1 187 ? -32.071 -4.885  -7.419  1.00 64.27  ? 187 SER E OG  1 
ATOM 9843  N N   . GLY E 1 188 ? -34.097 -0.721  -6.984  1.00 44.72  ? 188 GLY E N   1 
ATOM 9844  C CA  . GLY E 1 188 ? -34.900 0.259   -6.269  1.00 45.48  ? 188 GLY E CA  1 
ATOM 9845  C C   . GLY E 1 188 ? -34.360 1.659   -6.388  1.00 50.50  ? 188 GLY E C   1 
ATOM 9846  O O   . GLY E 1 188 ? -35.045 2.612   -6.040  1.00 49.68  ? 188 GLY E O   1 
ATOM 9847  N N   . GLY E 1 189 ? -33.117 1.757   -6.849  1.00 47.97  ? 189 GLY E N   1 
ATOM 9848  C CA  . GLY E 1 189 ? -32.392 3.004   -7.039  1.00 46.37  ? 189 GLY E CA  1 
ATOM 9849  C C   . GLY E 1 189 ? -32.831 3.790   -8.254  1.00 46.14  ? 189 GLY E C   1 
ATOM 9850  O O   . GLY E 1 189 ? -33.627 3.332   -9.087  1.00 43.36  ? 189 GLY E O   1 
ATOM 9851  N N   . ALA E 1 190 ? -32.221 4.954   -8.381  1.00 41.96  ? 190 ALA E N   1 
ATOM 9852  C CA  . ALA E 1 190 ? -32.532 5.942   -9.375  1.00 42.11  ? 190 ALA E CA  1 
ATOM 9853  C C   . ALA E 1 190 ? -31.780 5.839   -10.681 1.00 44.31  ? 190 ALA E C   1 
ATOM 9854  O O   . ALA E 1 190 ? -30.567 5.687   -10.712 1.00 42.18  ? 190 ALA E O   1 
ATOM 9855  C CB  . ALA E 1 190 ? -32.274 7.326   -8.800  1.00 43.40  ? 190 ALA E CB  1 
ATOM 9856  N N   . LEU E 1 191 ? -32.533 6.034   -11.766 1.00 41.08  ? 191 LEU E N   1 
ATOM 9857  C CA  . LEU E 1 191 ? -32.051 6.274   -13.107 1.00 40.43  ? 191 LEU E CA  1 
ATOM 9858  C C   . LEU E 1 191 ? -32.428 7.720   -13.367 1.00 45.18  ? 191 LEU E C   1 
ATOM 9859  O O   . LEU E 1 191 ? -33.615 8.073   -13.275 1.00 43.94  ? 191 LEU E O   1 
ATOM 9860  C CB  . LEU E 1 191 ? -32.617 5.310   -14.160 1.00 39.97  ? 191 LEU E CB  1 
ATOM 9861  C CG  . LEU E 1 191 ? -31.905 5.364   -15.506 1.00 43.96  ? 191 LEU E CG  1 
ATOM 9862  C CD1 . LEU E 1 191 ? -30.501 4.741   -15.420 1.00 42.61  ? 191 LEU E CD1 1 
ATOM 9863  C CD2 . LEU E 1 191 ? -32.753 4.709   -16.597 1.00 47.60  ? 191 LEU E CD2 1 
ATOM 9864  N N   . LEU E 1 192 ? -31.407 8.577   -13.577 1.00 43.16  ? 192 LEU E N   1 
ATOM 9865  C CA  . LEU E 1 192 ? -31.574 10.025  -13.741 1.00 41.95  ? 192 LEU E CA  1 
ATOM 9866  C C   . LEU E 1 192 ? -31.131 10.546  -15.087 1.00 44.93  ? 192 LEU E C   1 
ATOM 9867  O O   . LEU E 1 192 ? -30.229 9.980   -15.696 1.00 46.39  ? 192 LEU E O   1 
ATOM 9868  C CB  . LEU E 1 192 ? -30.736 10.760  -12.684 1.00 41.62  ? 192 LEU E CB  1 
ATOM 9869  C CG  . LEU E 1 192 ? -30.786 10.289  -11.251 1.00 46.19  ? 192 LEU E CG  1 
ATOM 9870  C CD1 . LEU E 1 192 ? -29.669 10.905  -10.473 1.00 45.80  ? 192 LEU E CD1 1 
ATOM 9871  C CD2 . LEU E 1 192 ? -32.143 10.566  -10.600 1.00 50.06  ? 192 LEU E CD2 1 
ATOM 9872  N N   . ASN E 1 193 ? -31.692 11.693  -15.504 1.00 38.16  ? 193 ASN E N   1 
ATOM 9873  C CA  . ASN E 1 193 ? -31.248 12.378  -16.697 1.00 36.27  ? 193 ASN E CA  1 
ATOM 9874  C C   . ASN E 1 193 ? -30.127 13.353  -16.308 1.00 44.77  ? 193 ASN E C   1 
ATOM 9875  O O   . ASN E 1 193 ? -29.698 13.379  -15.147 1.00 44.86  ? 193 ASN E O   1 
ATOM 9876  C CB  . ASN E 1 193 ? -32.408 13.061  -17.403 1.00 35.07  ? 193 ASN E CB  1 
ATOM 9877  C CG  . ASN E 1 193 ? -33.180 14.108  -16.645 1.00 61.80  ? 193 ASN E CG  1 
ATOM 9878  O OD1 . ASN E 1 193 ? -32.709 14.729  -15.682 1.00 54.80  ? 193 ASN E OD1 1 
ATOM 9879  N ND2 . ASN E 1 193 ? -34.398 14.340  -17.096 1.00 52.89  ? 193 ASN E ND2 1 
ATOM 9880  N N   . LEU E 1 194 ? -29.654 14.163  -17.256 1.00 46.04  ? 194 LEU E N   1 
ATOM 9881  C CA  . LEU E 1 194 ? -28.565 15.116  -16.996 1.00 47.06  ? 194 LEU E CA  1 
ATOM 9882  C C   . LEU E 1 194 ? -28.981 16.295  -16.100 1.00 49.55  ? 194 LEU E C   1 
ATOM 9883  O O   . LEU E 1 194 ? -28.087 16.968  -15.568 1.00 50.00  ? 194 LEU E O   1 
ATOM 9884  C CB  . LEU E 1 194 ? -27.946 15.614  -18.319 1.00 47.45  ? 194 LEU E CB  1 
ATOM 9885  C CG  . LEU E 1 194 ? -27.126 14.564  -19.091 1.00 51.30  ? 194 LEU E CG  1 
ATOM 9886  C CD1 . LEU E 1 194 ? -26.571 15.133  -20.357 1.00 51.34  ? 194 LEU E CD1 1 
ATOM 9887  C CD2 . LEU E 1 194 ? -25.992 13.979  -18.240 1.00 52.75  ? 194 LEU E CD2 1 
ATOM 9888  N N   . ASN E 1 195 ? -30.306 16.482  -15.862 1.00 44.81  ? 195 ASN E N   1 
ATOM 9889  C CA  . ASN E 1 195 ? -30.840 17.505  -14.946 1.00 44.89  ? 195 ASN E CA  1 
ATOM 9890  C C   . ASN E 1 195 ? -31.015 16.946  -13.534 1.00 49.65  ? 195 ASN E C   1 
ATOM 9891  O O   . ASN E 1 195 ? -31.442 17.672  -12.635 1.00 47.82  ? 195 ASN E O   1 
ATOM 9892  C CB  . ASN E 1 195 ? -32.187 18.045  -15.446 1.00 47.63  ? 195 ASN E CB  1 
ATOM 9893  C CG  . ASN E 1 195 ? -32.100 18.930  -16.652 1.00 74.00  ? 195 ASN E CG  1 
ATOM 9894  O OD1 . ASN E 1 195 ? -31.166 19.729  -16.818 1.00 69.16  ? 195 ASN E OD1 1 
ATOM 9895  N ND2 . ASN E 1 195 ? -33.107 18.831  -17.504 1.00 65.57  ? 195 ASN E ND2 1 
ATOM 9896  N N   . GLY E 1 196 ? -30.737 15.650  -13.370 1.00 48.34  ? 196 GLY E N   1 
ATOM 9897  C CA  . GLY E 1 196 ? -30.861 14.969  -12.091 1.00 48.02  ? 196 GLY E CA  1 
ATOM 9898  C C   . GLY E 1 196 ? -32.282 14.623  -11.744 1.00 50.58  ? 196 GLY E C   1 
ATOM 9899  O O   . GLY E 1 196 ? -32.599 14.426  -10.573 1.00 51.31  ? 196 GLY E O   1 
ATOM 9900  N N   . GLU E 1 197 ? -33.137 14.549  -12.756 1.00 45.88  ? 197 GLU E N   1 
ATOM 9901  C CA  . GLU E 1 197 ? -34.546 14.202  -12.598 1.00 45.28  ? 197 GLU E CA  1 
ATOM 9902  C C   . GLU E 1 197 ? -34.715 12.709  -12.820 1.00 48.41  ? 197 GLU E C   1 
ATOM 9903  O O   . GLU E 1 197 ? -34.042 12.129  -13.696 1.00 48.56  ? 197 GLU E O   1 
ATOM 9904  C CB  . GLU E 1 197 ? -35.419 14.988  -13.593 1.00 46.67  ? 197 GLU E CB  1 
ATOM 9905  C CG  . GLU E 1 197 ? -35.402 16.496  -13.401 1.00 59.15  ? 197 GLU E CG  1 
ATOM 9906  C CD  . GLU E 1 197 ? -35.755 17.351  -14.611 1.00 91.06  ? 197 GLU E CD  1 
ATOM 9907  O OE1 . GLU E 1 197 ? -35.804 18.593  -14.454 1.00 104.09 ? 197 GLU E OE1 1 
ATOM 9908  O OE2 . GLU E 1 197 ? -35.959 16.793  -15.716 1.00 77.24  ? 197 GLU E OE2 1 
ATOM 9909  N N   . LEU E 1 198 ? -35.625 12.083  -12.043 1.00 41.76  ? 198 LEU E N   1 
ATOM 9910  C CA  . LEU E 1 198 ? -35.904 10.650  -12.137 1.00 38.99  ? 198 LEU E CA  1 
ATOM 9911  C C   . LEU E 1 198 ? -36.539 10.278  -13.481 1.00 44.83  ? 198 LEU E C   1 
ATOM 9912  O O   . LEU E 1 198 ? -37.573 10.833  -13.861 1.00 46.87  ? 198 LEU E O   1 
ATOM 9913  C CB  . LEU E 1 198 ? -36.813 10.213  -10.996 1.00 37.45  ? 198 LEU E CB  1 
ATOM 9914  C CG  . LEU E 1 198 ? -36.908 8.702   -10.706 1.00 38.19  ? 198 LEU E CG  1 
ATOM 9915  C CD1 . LEU E 1 198 ? -35.662 8.195   -10.024 1.00 35.51  ? 198 LEU E CD1 1 
ATOM 9916  C CD2 . LEU E 1 198 ? -38.112 8.394   -9.871  1.00 37.11  ? 198 LEU E CD2 1 
ATOM 9917  N N   . ILE E 1 199 ? -35.898 9.361   -14.209 1.00 39.88  ? 199 ILE E N   1 
ATOM 9918  C CA  . ILE E 1 199 ? -36.440 8.864   -15.470 1.00 39.51  ? 199 ILE E CA  1 
ATOM 9919  C C   . ILE E 1 199 ? -36.846 7.382   -15.302 1.00 43.46  ? 199 ILE E C   1 
ATOM 9920  O O   . ILE E 1 199 ? -37.594 6.859   -16.127 1.00 43.23  ? 199 ILE E O   1 
ATOM 9921  C CB  . ILE E 1 199 ? -35.525 9.093   -16.699 1.00 42.22  ? 199 ILE E CB  1 
ATOM 9922  C CG1 . ILE E 1 199 ? -34.122 8.448   -16.534 1.00 41.92  ? 199 ILE E CG1 1 
ATOM 9923  C CG2 . ILE E 1 199 ? -35.466 10.579  -17.033 1.00 42.24  ? 199 ILE E CG2 1 
ATOM 9924  C CD1 . ILE E 1 199 ? -33.338 8.267   -17.809 1.00 41.39  ? 199 ILE E CD1 1 
ATOM 9925  N N   . GLY E 1 200 ? -36.420 6.754   -14.206 1.00 38.40  ? 200 GLY E N   1 
ATOM 9926  C CA  . GLY E 1 200 ? -36.747 5.359   -13.947 1.00 37.34  ? 200 GLY E CA  1 
ATOM 9927  C C   . GLY E 1 200 ? -36.181 4.788   -12.668 1.00 41.07  ? 200 GLY E C   1 
ATOM 9928  O O   . GLY E 1 200 ? -35.232 5.342   -12.092 1.00 40.86  ? 200 GLY E O   1 
ATOM 9929  N N   . ILE E 1 201 ? -36.787 3.670   -12.210 1.00 37.05  ? 201 ILE E N   1 
ATOM 9930  C CA  . ILE E 1 201 ? -36.363 2.937   -11.017 1.00 36.77  ? 201 ILE E CA  1 
ATOM 9931  C C   . ILE E 1 201 ? -35.663 1.651   -11.503 1.00 43.04  ? 201 ILE E C   1 
ATOM 9932  O O   . ILE E 1 201 ? -36.353 0.778   -12.038 1.00 43.98  ? 201 ILE E O   1 
ATOM 9933  C CB  . ILE E 1 201 ? -37.589 2.656   -10.053 1.00 39.24  ? 201 ILE E CB  1 
ATOM 9934  C CG1 . ILE E 1 201 ? -38.208 3.954   -9.444  1.00 39.14  ? 201 ILE E CG1 1 
ATOM 9935  C CG2 . ILE E 1 201 ? -37.314 1.552   -8.980  1.00 37.36  ? 201 ILE E CG2 1 
ATOM 9936  C CD1 . ILE E 1 201 ? -37.322 4.732   -8.339  1.00 44.23  ? 201 ILE E CD1 1 
ATOM 9937  N N   . ASN E 1 202 ? -34.302 1.555   -11.361 1.00 40.23  ? 202 ASN E N   1 
ATOM 9938  C CA  . ASN E 1 202 ? -33.501 0.372   -11.769 1.00 40.37  ? 202 ASN E CA  1 
ATOM 9939  C C   . ASN E 1 202 ? -34.019 -0.875  -11.074 1.00 45.94  ? 202 ASN E C   1 
ATOM 9940  O O   . ASN E 1 202 ? -34.104 -0.913  -9.839  1.00 45.30  ? 202 ASN E O   1 
ATOM 9941  C CB  . ASN E 1 202 ? -32.006 0.547   -11.480 1.00 38.37  ? 202 ASN E CB  1 
ATOM 9942  C CG  . ASN E 1 202 ? -31.441 1.874   -11.905 1.00 54.06  ? 202 ASN E CG  1 
ATOM 9943  O OD1 . ASN E 1 202 ? -30.741 2.539   -11.142 1.00 54.50  ? 202 ASN E OD1 1 
ATOM 9944  N ND2 . ASN E 1 202 ? -31.717 2.280   -13.135 1.00 39.63  ? 202 ASN E ND2 1 
ATOM 9945  N N   . THR E 1 203 ? -34.360 -1.898  -11.874 1.00 43.40  ? 203 THR E N   1 
ATOM 9946  C CA  . THR E 1 203 ? -35.030 -3.094  -11.380 1.00 42.48  ? 203 THR E CA  1 
ATOM 9947  C C   . THR E 1 203 ? -34.328 -4.408  -11.669 1.00 47.32  ? 203 THR E C   1 
ATOM 9948  O O   . THR E 1 203 ? -34.339 -5.297  -10.805 1.00 47.37  ? 203 THR E O   1 
ATOM 9949  C CB  . THR E 1 203 ? -36.403 -3.095  -12.031 1.00 40.73  ? 203 THR E CB  1 
ATOM 9950  O OG1 . THR E 1 203 ? -37.082 -1.936  -11.551 1.00 45.20  ? 203 THR E OG1 1 
ATOM 9951  C CG2 . THR E 1 203 ? -37.212 -4.356  -11.757 1.00 34.30  ? 203 THR E CG2 1 
ATOM 9952  N N   . ALA E 1 204 ? -33.817 -4.581  -12.895 1.00 43.64  ? 204 ALA E N   1 
ATOM 9953  C CA  . ALA E 1 204 ? -33.285 -5.879  -13.303 1.00 43.88  ? 204 ALA E CA  1 
ATOM 9954  C C   . ALA E 1 204 ? -32.144 -5.740  -14.297 1.00 50.25  ? 204 ALA E C   1 
ATOM 9955  O O   . ALA E 1 204 ? -31.962 -4.674  -14.875 1.00 50.16  ? 204 ALA E O   1 
ATOM 9956  C CB  . ALA E 1 204 ? -34.419 -6.707  -13.931 1.00 43.81  ? 204 ALA E CB  1 
ATOM 9957  N N   . ILE E 1 205 ? -31.394 -6.826  -14.514 1.00 48.27  ? 205 ILE E N   1 
ATOM 9958  C CA  . ILE E 1 205 ? -30.312 -6.844  -15.497 1.00 49.76  ? 205 ILE E CA  1 
ATOM 9959  C C   . ILE E 1 205 ? -30.279 -8.185  -16.274 1.00 54.80  ? 205 ILE E C   1 
ATOM 9960  O O   . ILE E 1 205 ? -30.825 -9.179  -15.811 1.00 53.95  ? 205 ILE E O   1 
ATOM 9961  C CB  . ILE E 1 205 ? -28.916 -6.554  -14.853 1.00 53.15  ? 205 ILE E CB  1 
ATOM 9962  C CG1 . ILE E 1 205 ? -28.418 -7.703  -13.942 1.00 53.56  ? 205 ILE E CG1 1 
ATOM 9963  C CG2 . ILE E 1 205 ? -28.865 -5.197  -14.153 1.00 54.12  ? 205 ILE E CG2 1 
ATOM 9964  C CD1 . ILE E 1 205 ? -26.928 -7.604  -13.546 1.00 56.29  ? 205 ILE E CD1 1 
ATOM 9965  N N   . LEU E 1 206 ? -29.657 -8.181  -17.455 1.00 52.99  ? 206 LEU E N   1 
ATOM 9966  C CA  . LEU E 1 206 ? -29.329 -9.373  -18.223 1.00 54.68  ? 206 LEU E CA  1 
ATOM 9967  C C   . LEU E 1 206 ? -27.853 -9.569  -18.033 1.00 61.37  ? 206 LEU E C   1 
ATOM 9968  O O   . LEU E 1 206 ? -27.065 -8.675  -18.378 1.00 60.53  ? 206 LEU E O   1 
ATOM 9969  C CB  . LEU E 1 206 ? -29.678 -9.294  -19.713 1.00 55.28  ? 206 LEU E CB  1 
ATOM 9970  C CG  . LEU E 1 206 ? -31.102 -9.582  -20.170 1.00 61.98  ? 206 LEU E CG  1 
ATOM 9971  C CD1 . LEU E 1 206 ? -31.086 -10.117 -21.590 1.00 63.03  ? 206 LEU E CD1 1 
ATOM 9972  C CD2 . LEU E 1 206 ? -31.844 -10.564 -19.240 1.00 65.23  ? 206 LEU E CD2 1 
ATOM 9973  N N   . ALA E 1 207 ? -27.475 -10.665 -17.386 1.00 60.49  ? 207 ALA E N   1 
ATOM 9974  C CA  . ALA E 1 207 ? -26.071 -10.925 -17.117 1.00 61.74  ? 207 ALA E CA  1 
ATOM 9975  C C   . ALA E 1 207 ? -25.798 -12.404 -17.191 1.00 71.41  ? 207 ALA E C   1 
ATOM 9976  O O   . ALA E 1 207 ? -26.324 -13.161 -16.355 1.00 73.23  ? 207 ALA E O   1 
ATOM 9977  C CB  . ALA E 1 207 ? -25.687 -10.390 -15.742 1.00 62.16  ? 207 ALA E CB  1 
ATOM 9978  N N   . PRO E 1 208 ? -24.964 -12.852 -18.159 1.00 68.75  ? 208 PRO E N   1 
ATOM 9979  C CA  . PRO E 1 208 ? -24.600 -14.280 -18.199 1.00 68.13  ? 208 PRO E CA  1 
ATOM 9980  C C   . PRO E 1 208 ? -24.081 -14.789 -16.844 1.00 71.45  ? 208 PRO E C   1 
ATOM 9981  O O   . PRO E 1 208 ? -24.481 -15.877 -16.433 1.00 71.89  ? 208 PRO E O   1 
ATOM 9982  C CB  . PRO E 1 208 ? -23.504 -14.343 -19.264 1.00 69.61  ? 208 PRO E CB  1 
ATOM 9983  C CG  . PRO E 1 208 ? -23.729 -13.161 -20.114 1.00 74.66  ? 208 PRO E CG  1 
ATOM 9984  C CD  . PRO E 1 208 ? -24.281 -12.090 -19.223 1.00 70.42  ? 208 PRO E CD  1 
ATOM 9985  N N   . GLY E 1 209 ? -23.280 -13.988 -16.131 1.00 66.27  ? 209 GLY E N   1 
ATOM 9986  C CA  . GLY E 1 209 ? -22.751 -14.441 -14.853 1.00 65.84  ? 209 GLY E CA  1 
ATOM 9987  C C   . GLY E 1 209 ? -22.808 -13.538 -13.641 1.00 69.77  ? 209 GLY E C   1 
ATOM 9988  O O   . GLY E 1 209 ? -21.771 -13.331 -13.000 1.00 70.32  ? 209 GLY E O   1 
ATOM 9989  N N   . GLY E 1 210 ? -24.000 -13.057 -13.272 1.00 64.85  ? 210 GLY E N   1 
ATOM 9990  C CA  . GLY E 1 210 ? -24.206 -12.235 -12.074 1.00 64.13  ? 210 GLY E CA  1 
ATOM 9991  C C   . GLY E 1 210 ? -23.644 -10.816 -12.045 1.00 66.24  ? 210 GLY E C   1 
ATOM 9992  O O   . GLY E 1 210 ? -23.862 -10.072 -11.075 1.00 68.05  ? 210 GLY E O   1 
ATOM 9993  N N   . GLY E 1 211 ? -22.921 -10.428 -13.087 1.00 57.00  ? 211 GLY E N   1 
ATOM 9994  C CA  . GLY E 1 211 ? -22.386 -9.083  -13.141 1.00 54.29  ? 211 GLY E CA  1 
ATOM 9995  C C   . GLY E 1 211 ? -22.802 -8.341  -14.390 1.00 53.06  ? 211 GLY E C   1 
ATOM 9996  O O   . GLY E 1 211 ? -22.956 -8.955  -15.456 1.00 52.12  ? 211 GLY E O   1 
ATOM 9997  N N   . SER E 1 212 ? -22.923 -6.995  -14.262 1.00 44.69  ? 212 SER E N   1 
ATOM 9998  C CA  . SER E 1 212 ? -23.263 -6.063  -15.331 1.00 41.83  ? 212 SER E CA  1 
ATOM 9999  C C   . SER E 1 212 ? -22.397 -6.273  -16.611 1.00 42.95  ? 212 SER E C   1 
ATOM 10000 O O   . SER E 1 212 ? -21.137 -6.243  -16.581 1.00 44.38  ? 212 SER E O   1 
ATOM 10001 C CB  . SER E 1 212 ? -23.119 -4.624  -14.836 1.00 43.30  ? 212 SER E CB  1 
ATOM 10002 O OG  . SER E 1 212 ? -23.515 -3.645  -15.791 1.00 47.88  ? 212 SER E OG  1 
ATOM 10003 N N   . VAL E 1 213 ? -23.103 -6.494  -17.727 1.00 35.04  ? 213 VAL E N   1 
ATOM 10004 C CA  . VAL E 1 213 ? -22.541 -6.623  -19.078 1.00 32.96  ? 213 VAL E CA  1 
ATOM 10005 C C   . VAL E 1 213 ? -23.071 -5.421  -19.958 1.00 37.07  ? 213 VAL E C   1 
ATOM 10006 O O   . VAL E 1 213 ? -22.971 -5.455  -21.190 1.00 38.72  ? 213 VAL E O   1 
ATOM 10007 C CB  . VAL E 1 213 ? -22.840 -8.018  -19.709 1.00 34.35  ? 213 VAL E CB  1 
ATOM 10008 C CG1 . VAL E 1 213 ? -22.310 -9.133  -18.848 1.00 33.31  ? 213 VAL E CG1 1 
ATOM 10009 C CG2 . VAL E 1 213 ? -24.313 -8.225  -19.972 1.00 33.77  ? 213 VAL E CG2 1 
ATOM 10010 N N   . GLY E 1 214 ? -23.643 -4.401  -19.297 1.00 32.01  ? 214 GLY E N   1 
ATOM 10011 C CA  . GLY E 1 214 ? -24.251 -3.228  -19.923 1.00 32.57  ? 214 GLY E CA  1 
ATOM 10012 C C   . GLY E 1 214 ? -25.690 -3.365  -20.412 1.00 41.26  ? 214 GLY E C   1 
ATOM 10013 O O   . GLY E 1 214 ? -26.117 -2.588  -21.268 1.00 44.65  ? 214 GLY E O   1 
ATOM 10014 N N   . ILE E 1 215 ? -26.450 -4.362  -19.922 1.00 36.42  ? 215 ILE E N   1 
ATOM 10015 C CA  . ILE E 1 215 ? -27.862 -4.552  -20.275 1.00 35.56  ? 215 ILE E CA  1 
ATOM 10016 C C   . ILE E 1 215 ? -28.704 -4.450  -18.971 1.00 39.43  ? 215 ILE E C   1 
ATOM 10017 O O   . ILE E 1 215 ? -28.882 -5.445  -18.253 1.00 39.17  ? 215 ILE E O   1 
ATOM 10018 C CB  . ILE E 1 215 ? -28.109 -5.882  -21.016 1.00 38.64  ? 215 ILE E CB  1 
ATOM 10019 C CG1 . ILE E 1 215 ? -27.054 -6.180  -22.137 1.00 39.71  ? 215 ILE E CG1 1 
ATOM 10020 C CG2 . ILE E 1 215 ? -29.557 -5.990  -21.474 1.00 38.55  ? 215 ILE E CG2 1 
ATOM 10021 C CD1 . ILE E 1 215 ? -27.203 -5.427  -23.449 1.00 48.41  ? 215 ILE E CD1 1 
ATOM 10022 N N   . GLY E 1 216 ? -29.178 -3.243  -18.674 1.00 34.70  ? 216 GLY E N   1 
ATOM 10023 C CA  . GLY E 1 216 ? -29.926 -2.965  -17.455 1.00 34.82  ? 216 GLY E CA  1 
ATOM 10024 C C   . GLY E 1 216 ? -31.330 -2.498  -17.712 1.00 39.14  ? 216 GLY E C   1 
ATOM 10025 O O   . GLY E 1 216 ? -31.598 -1.879  -18.726 1.00 38.89  ? 216 GLY E O   1 
ATOM 10026 N N   . PHE E 1 217 ? -32.228 -2.761  -16.793 1.00 37.73  ? 217 PHE E N   1 
ATOM 10027 C CA  . PHE E 1 217 ? -33.612 -2.360  -16.999 1.00 38.52  ? 217 PHE E CA  1 
ATOM 10028 C C   . PHE E 1 217 ? -34.150 -1.547  -15.828 1.00 41.83  ? 217 PHE E C   1 
ATOM 10029 O O   . PHE E 1 217 ? -33.892 -1.856  -14.662 1.00 40.50  ? 217 PHE E O   1 
ATOM 10030 C CB  . PHE E 1 217 ? -34.495 -3.580  -17.262 1.00 40.23  ? 217 PHE E CB  1 
ATOM 10031 C CG  . PHE E 1 217 ? -33.990 -4.394  -18.421 1.00 41.76  ? 217 PHE E CG  1 
ATOM 10032 C CD1 . PHE E 1 217 ? -34.235 -3.995  -19.732 1.00 45.09  ? 217 PHE E CD1 1 
ATOM 10033 C CD2 . PHE E 1 217 ? -33.257 -5.560  -18.208 1.00 43.40  ? 217 PHE E CD2 1 
ATOM 10034 C CE1 . PHE E 1 217 ? -33.754 -4.747  -20.811 1.00 45.99  ? 217 PHE E CE1 1 
ATOM 10035 C CE2 . PHE E 1 217 ? -32.766 -6.304  -19.287 1.00 45.73  ? 217 PHE E CE2 1 
ATOM 10036 C CZ  . PHE E 1 217 ? -33.020 -5.893  -20.578 1.00 44.48  ? 217 PHE E CZ  1 
ATOM 10037 N N   . ALA E 1 218 ? -34.897 -0.504  -16.170 1.00 38.52  ? 218 ALA E N   1 
ATOM 10038 C CA  . ALA E 1 218 ? -35.534 0.406   -15.234 1.00 37.76  ? 218 ALA E CA  1 
ATOM 10039 C C   . ALA E 1 218 ? -37.023 0.541   -15.537 1.00 41.32  ? 218 ALA E C   1 
ATOM 10040 O O   . ALA E 1 218 ? -37.423 0.647   -16.700 1.00 38.45  ? 218 ALA E O   1 
ATOM 10041 C CB  . ALA E 1 218 ? -34.869 1.773   -15.295 1.00 37.90  ? 218 ALA E CB  1 
ATOM 10042 N N   . ILE E 1 219 ? -37.847 0.522   -14.480 1.00 39.76  ? 219 ILE E N   1 
ATOM 10043 C CA  . ILE E 1 219 ? -39.280 0.787   -14.621 1.00 40.30  ? 219 ILE E CA  1 
ATOM 10044 C C   . ILE E 1 219 ? -39.377 2.287   -14.936 1.00 47.15  ? 219 ILE E C   1 
ATOM 10045 O O   . ILE E 1 219 ? -38.795 3.076   -14.178 1.00 47.89  ? 219 ILE E O   1 
ATOM 10046 C CB  . ILE E 1 219 ? -40.086 0.404   -13.330 1.00 42.36  ? 219 ILE E CB  1 
ATOM 10047 C CG1 . ILE E 1 219 ? -40.036 -1.108  -13.043 1.00 40.82  ? 219 ILE E CG1 1 
ATOM 10048 C CG2 . ILE E 1 219 ? -41.534 0.921   -13.424 1.00 41.81  ? 219 ILE E CG2 1 
ATOM 10049 C CD1 . ILE E 1 219 ? -40.183 -1.448  -11.555 1.00 42.29  ? 219 ILE E CD1 1 
ATOM 10050 N N   . PRO E 1 220 ? -40.028 2.721   -16.033 1.00 44.90  ? 220 PRO E N   1 
ATOM 10051 C CA  . PRO E 1 220 ? -40.083 4.173   -16.319 1.00 44.26  ? 220 PRO E CA  1 
ATOM 10052 C C   . PRO E 1 220 ? -40.758 4.991   -15.188 1.00 47.30  ? 220 PRO E C   1 
ATOM 10053 O O   . PRO E 1 220 ? -41.641 4.492   -14.491 1.00 45.27  ? 220 PRO E O   1 
ATOM 10054 C CB  . PRO E 1 220 ? -40.831 4.261   -17.652 1.00 44.75  ? 220 PRO E CB  1 
ATOM 10055 C CG  . PRO E 1 220 ? -41.463 2.976   -17.848 1.00 49.22  ? 220 PRO E CG  1 
ATOM 10056 C CD  . PRO E 1 220 ? -40.751 1.937   -17.050 1.00 46.14  ? 220 PRO E CD  1 
ATOM 10057 N N   . SER E 1 221 ? -40.252 6.222   -14.961 1.00 45.04  ? 221 SER E N   1 
ATOM 10058 C CA  . SER E 1 221 ? -40.700 7.157   -13.921 1.00 45.38  ? 221 SER E CA  1 
ATOM 10059 C C   . SER E 1 221 ? -42.206 7.422   -13.955 1.00 51.80  ? 221 SER E C   1 
ATOM 10060 O O   . SER E 1 221 ? -42.804 7.508   -12.888 1.00 52.14  ? 221 SER E O   1 
ATOM 10061 C CB  . SER E 1 221 ? -39.954 8.487   -14.025 1.00 47.36  ? 221 SER E CB  1 
ATOM 10062 O OG  . SER E 1 221 ? -40.057 9.078   -15.309 1.00 48.43  ? 221 SER E OG  1 
ATOM 10063 N N   . ASN E 1 222 ? -42.821 7.539   -15.156 1.00 49.67  ? 222 ASN E N   1 
ATOM 10064 C CA  . ASN E 1 222 ? -44.267 7.770   -15.290 1.00 49.68  ? 222 ASN E CA  1 
ATOM 10065 C C   . ASN E 1 222 ? -45.053 6.608   -14.695 1.00 54.94  ? 222 ASN E C   1 
ATOM 10066 O O   . ASN E 1 222 ? -46.006 6.838   -13.939 1.00 57.34  ? 222 ASN E O   1 
ATOM 10067 C CB  . ASN E 1 222 ? -44.670 7.987   -16.748 1.00 49.66  ? 222 ASN E CB  1 
ATOM 10068 C CG  . ASN E 1 222 ? -44.218 9.275   -17.373 1.00 69.86  ? 222 ASN E CG  1 
ATOM 10069 O OD1 . ASN E 1 222 ? -44.526 9.527   -18.531 1.00 61.53  ? 222 ASN E OD1 1 
ATOM 10070 N ND2 . ASN E 1 222 ? -43.469 10.115  -16.649 1.00 64.47  ? 222 ASN E ND2 1 
ATOM 10071 N N   . MET E 1 223 ? -44.624 5.369   -14.992 1.00 48.94  ? 223 MET E N   1 
ATOM 10072 C CA  . MET E 1 223 ? -45.226 4.157   -14.449 1.00 49.29  ? 223 MET E CA  1 
ATOM 10073 C C   . MET E 1 223 ? -45.015 4.108   -12.921 1.00 52.11  ? 223 MET E C   1 
ATOM 10074 O O   . MET E 1 223 ? -45.968 3.859   -12.186 1.00 51.76  ? 223 MET E O   1 
ATOM 10075 C CB  . MET E 1 223 ? -44.631 2.925   -15.137 1.00 52.34  ? 223 MET E CB  1 
ATOM 10076 C CG  . MET E 1 223 ? -45.255 1.627   -14.708 1.00 58.32  ? 223 MET E CG  1 
ATOM 10077 S SD  . MET E 1 223 ? -44.687 0.226   -15.723 1.00 65.94  ? 223 MET E SD  1 
ATOM 10078 C CE  . MET E 1 223 ? -45.518 0.666   -17.363 1.00 63.55  ? 223 MET E CE  1 
ATOM 10079 N N   . ALA E 1 224 ? -43.782 4.374   -12.462 1.00 47.95  ? 224 ALA E N   1 
ATOM 10080 C CA  . ALA E 1 224 ? -43.430 4.368   -11.050 1.00 48.79  ? 224 ALA E CA  1 
ATOM 10081 C C   . ALA E 1 224 ? -44.212 5.438   -10.264 1.00 55.38  ? 224 ALA E C   1 
ATOM 10082 O O   . ALA E 1 224 ? -44.734 5.122   -9.192  1.00 53.63  ? 224 ALA E O   1 
ATOM 10083 C CB  . ALA E 1 224 ? -41.936 4.567   -10.881 1.00 49.42  ? 224 ALA E CB  1 
ATOM 10084 N N   . ARG E 1 225 ? -44.342 6.674   -10.825 1.00 54.58  ? 225 ARG E N   1 
ATOM 10085 C CA  . ARG E 1 225 ? -45.061 7.812   -10.219 1.00 54.70  ? 225 ARG E CA  1 
ATOM 10086 C C   . ARG E 1 225 ? -46.546 7.471   -10.006 1.00 58.15  ? 225 ARG E C   1 
ATOM 10087 O O   . ARG E 1 225 ? -47.051 7.617   -8.895  1.00 57.63  ? 225 ARG E O   1 
ATOM 10088 C CB  . ARG E 1 225 ? -44.914 9.069   -11.103 1.00 55.21  ? 225 ARG E CB  1 
ATOM 10089 C CG  . ARG E 1 225 ? -45.284 10.384  -10.415 1.00 69.33  ? 225 ARG E CG  1 
ATOM 10090 C CD  . ARG E 1 225 ? -45.847 11.417  -11.385 1.00 87.78  ? 225 ARG E CD  1 
ATOM 10091 N NE  . ARG E 1 225 ? -44.840 11.971  -12.295 1.00 103.44 ? 225 ARG E NE  1 
ATOM 10092 C CZ  . ARG E 1 225 ? -44.790 11.726  -13.604 1.00 125.91 ? 225 ARG E CZ  1 
ATOM 10093 N NH1 . ARG E 1 225 ? -45.697 10.941  -14.176 1.00 116.80 ? 225 ARG E NH1 1 
ATOM 10094 N NH2 . ARG E 1 225 ? -43.835 12.268  -14.351 1.00 114.84 ? 225 ARG E NH2 1 
ATOM 10095 N N   . THR E 1 226 ? -47.223 7.004   -11.071 1.00 54.51  ? 226 THR E N   1 
ATOM 10096 C CA  . THR E 1 226 ? -48.636 6.615   -11.073 1.00 53.80  ? 226 THR E CA  1 
ATOM 10097 C C   . THR E 1 226 ? -48.903 5.511   -10.034 1.00 56.99  ? 226 THR E C   1 
ATOM 10098 O O   . THR E 1 226 ? -49.838 5.626   -9.236  1.00 57.45  ? 226 THR E O   1 
ATOM 10099 C CB  . THR E 1 226 ? -49.035 6.155   -12.486 1.00 62.14  ? 226 THR E CB  1 
ATOM 10100 O OG1 . THR E 1 226 ? -48.733 7.196   -13.413 1.00 65.34  ? 226 THR E OG1 1 
ATOM 10101 C CG2 . THR E 1 226 ? -50.501 5.775   -12.589 1.00 56.87  ? 226 THR E CG2 1 
ATOM 10102 N N   . LEU E 1 227 ? -48.082 4.459   -10.037 1.00 52.93  ? 227 LEU E N   1 
ATOM 10103 C CA  . LEU E 1 227 ? -48.255 3.357   -9.097  1.00 53.29  ? 227 LEU E CA  1 
ATOM 10104 C C   . LEU E 1 227 ? -48.060 3.842   -7.657  1.00 56.77  ? 227 LEU E C   1 
ATOM 10105 O O   . LEU E 1 227 ? -48.860 3.484   -6.792  1.00 55.18  ? 227 LEU E O   1 
ATOM 10106 C CB  . LEU E 1 227 ? -47.325 2.178   -9.430  1.00 53.41  ? 227 LEU E CB  1 
ATOM 10107 C CG  . LEU E 1 227 ? -47.643 1.458   -10.746 1.00 58.79  ? 227 LEU E CG  1 
ATOM 10108 C CD1 . LEU E 1 227 ? -46.450 0.691   -11.245 1.00 59.07  ? 227 LEU E CD1 1 
ATOM 10109 C CD2 . LEU E 1 227 ? -48.861 0.565   -10.627 1.00 61.60  ? 227 LEU E CD2 1 
ATOM 10110 N N   . ALA E 1 228 ? -47.050 4.718   -7.426  1.00 54.23  ? 228 ALA E N   1 
ATOM 10111 C CA  . ALA E 1 228 ? -46.758 5.315   -6.121  1.00 53.76  ? 228 ALA E CA  1 
ATOM 10112 C C   . ALA E 1 228 ? -47.971 6.108   -5.607  1.00 59.47  ? 228 ALA E C   1 
ATOM 10113 O O   . ALA E 1 228 ? -48.341 5.929   -4.448  1.00 60.85  ? 228 ALA E O   1 
ATOM 10114 C CB  . ALA E 1 228 ? -45.526 6.201   -6.203  1.00 54.17  ? 228 ALA E CB  1 
ATOM 10115 N N   . GLN E 1 229 ? -48.638 6.906   -6.485  1.00 56.33  ? 229 GLN E N   1 
ATOM 10116 C CA  . GLN E 1 229 ? -49.853 7.668   -6.146  1.00 55.71  ? 229 GLN E CA  1 
ATOM 10117 C C   . GLN E 1 229 ? -50.975 6.756   -5.683  1.00 55.57  ? 229 GLN E C   1 
ATOM 10118 O O   . GLN E 1 229 ? -51.572 7.026   -4.650  1.00 55.64  ? 229 GLN E O   1 
ATOM 10119 C CB  . GLN E 1 229 ? -50.344 8.540   -7.313  1.00 57.75  ? 229 GLN E CB  1 
ATOM 10120 C CG  . GLN E 1 229 ? -49.964 10.020  -7.180  1.00 91.48  ? 229 GLN E CG  1 
ATOM 10121 C CD  . GLN E 1 229 ? -50.291 10.668  -5.846  1.00 116.32 ? 229 GLN E CD  1 
ATOM 10122 O OE1 . GLN E 1 229 ? -51.377 10.496  -5.261  1.00 113.85 ? 229 GLN E OE1 1 
ATOM 10123 N NE2 . GLN E 1 229 ? -49.351 11.459  -5.354  1.00 107.72 ? 229 GLN E NE2 1 
ATOM 10124 N N   . GLN E 1 230 ? -51.208 5.649   -6.395  1.00 50.57  ? 230 GLN E N   1 
ATOM 10125 C CA  . GLN E 1 230 ? -52.220 4.649   -6.037  1.00 50.45  ? 230 GLN E CA  1 
ATOM 10126 C C   . GLN E 1 230 ? -51.948 4.033   -4.669  1.00 53.81  ? 230 GLN E C   1 
ATOM 10127 O O   . GLN E 1 230 ? -52.888 3.750   -3.939  1.00 53.30  ? 230 GLN E O   1 
ATOM 10128 C CB  . GLN E 1 230 ? -52.288 3.540   -7.099  1.00 51.78  ? 230 GLN E CB  1 
ATOM 10129 C CG  . GLN E 1 230 ? -53.092 3.954   -8.331  1.00 60.96  ? 230 GLN E CG  1 
ATOM 10130 C CD  . GLN E 1 230 ? -52.870 3.076   -9.534  1.00 79.38  ? 230 GLN E CD  1 
ATOM 10131 O OE1 . GLN E 1 230 ? -52.560 3.556   -10.628 1.00 79.09  ? 230 GLN E OE1 1 
ATOM 10132 N NE2 . GLN E 1 230 ? -53.048 1.779   -9.377  1.00 65.33  ? 230 GLN E NE2 1 
ATOM 10133 N N   . LEU E 1 231 ? -50.667 3.855   -4.305  1.00 50.24  ? 231 LEU E N   1 
ATOM 10134 C CA  . LEU E 1 231 ? -50.312 3.271   -3.019  1.00 49.60  ? 231 LEU E CA  1 
ATOM 10135 C C   . LEU E 1 231 ? -50.447 4.302   -1.888  1.00 56.66  ? 231 LEU E C   1 
ATOM 10136 O O   . LEU E 1 231 ? -50.798 3.921   -0.770  1.00 55.33  ? 231 LEU E O   1 
ATOM 10137 C CB  . LEU E 1 231 ? -48.907 2.640   -3.033  1.00 48.67  ? 231 LEU E CB  1 
ATOM 10138 C CG  . LEU E 1 231 ? -48.665 1.483   -4.018  1.00 51.44  ? 231 LEU E CG  1 
ATOM 10139 C CD1 . LEU E 1 231 ? -47.182 1.208   -4.202  1.00 49.94  ? 231 LEU E CD1 1 
ATOM 10140 C CD2 . LEU E 1 231 ? -49.388 0.217   -3.591  1.00 53.54  ? 231 LEU E CD2 1 
ATOM 10141 N N   . ILE E 1 232 ? -50.218 5.594   -2.160  1.00 56.31  ? 232 ILE E N   1 
ATOM 10142 C CA  . ILE E 1 232 ? -50.370 6.559   -1.072  1.00 57.33  ? 232 ILE E CA  1 
ATOM 10143 C C   . ILE E 1 232 ? -51.870 6.780   -0.857  1.00 62.92  ? 232 ILE E C   1 
ATOM 10144 O O   . ILE E 1 232 ? -52.306 6.865   0.290   1.00 61.86  ? 232 ILE E O   1 
ATOM 10145 C CB  . ILE E 1 232 ? -49.549 7.885   -1.220  1.00 60.07  ? 232 ILE E CB  1 
ATOM 10146 C CG1 . ILE E 1 232 ? -50.238 8.945   -2.109  1.00 61.50  ? 232 ILE E CG1 1 
ATOM 10147 C CG2 . ILE E 1 232 ? -48.125 7.605   -1.678  1.00 58.67  ? 232 ILE E CG2 1 
ATOM 10148 C CD1 . ILE E 1 232 ? -49.626 10.417  -2.029  1.00 69.35  ? 232 ILE E CD1 1 
ATOM 10149 N N   . ASP E 1 233 ? -52.659 6.776   -1.957  1.00 60.37  ? 233 ASP E N   1 
ATOM 10150 C CA  . ASP E 1 233 ? -54.102 6.996   -1.909  1.00 60.23  ? 233 ASP E CA  1 
ATOM 10151 C C   . ASP E 1 233 ? -54.906 5.804   -1.379  1.00 64.29  ? 233 ASP E C   1 
ATOM 10152 O O   . ASP E 1 233 ? -55.905 6.034   -0.698  1.00 63.43  ? 233 ASP E O   1 
ATOM 10153 C CB  . ASP E 1 233 ? -54.644 7.368   -3.298  1.00 61.91  ? 233 ASP E CB  1 
ATOM 10154 C CG  . ASP E 1 233 ? -54.165 8.696   -3.863  1.00 77.00  ? 233 ASP E CG  1 
ATOM 10155 O OD1 . ASP E 1 233 ? -53.433 9.430   -3.145  1.00 77.54  ? 233 ASP E OD1 1 
ATOM 10156 O OD2 . ASP E 1 233 ? -54.486 8.989   -5.034  1.00 86.09  ? 233 ASP E OD2 1 
ATOM 10157 N N   . PHE E 1 234 ? -54.529 4.554   -1.718  1.00 61.41  ? 234 PHE E N   1 
ATOM 10158 C CA  . PHE E 1 234 ? -55.363 3.391   -1.368  1.00 61.18  ? 234 PHE E CA  1 
ATOM 10159 C C   . PHE E 1 234 ? -54.639 2.258   -0.637  1.00 64.17  ? 234 PHE E C   1 
ATOM 10160 O O   . PHE E 1 234 ? -55.312 1.309   -0.203  1.00 63.50  ? 234 PHE E O   1 
ATOM 10161 C CB  . PHE E 1 234 ? -56.012 2.794   -2.652  1.00 63.38  ? 234 PHE E CB  1 
ATOM 10162 C CG  . PHE E 1 234 ? -56.518 3.786   -3.678  1.00 65.56  ? 234 PHE E CG  1 
ATOM 10163 C CD1 . PHE E 1 234 ? -55.906 3.900   -4.917  1.00 69.83  ? 234 PHE E CD1 1 
ATOM 10164 C CD2 . PHE E 1 234 ? -57.591 4.627   -3.391  1.00 67.77  ? 234 PHE E CD2 1 
ATOM 10165 C CE1 . PHE E 1 234 ? -56.351 4.844   -5.854  1.00 70.99  ? 234 PHE E CE1 1 
ATOM 10166 C CE2 . PHE E 1 234 ? -58.038 5.563   -4.326  1.00 70.85  ? 234 PHE E CE2 1 
ATOM 10167 C CZ  . PHE E 1 234 ? -57.417 5.664   -5.554  1.00 69.34  ? 234 PHE E CZ  1 
ATOM 10168 N N   . GLY E 1 235 ? -53.305 2.332   -0.537  1.00 59.26  ? 235 GLY E N   1 
ATOM 10169 C CA  . GLY E 1 235 ? -52.513 1.287   0.107   1.00 58.41  ? 235 GLY E CA  1 
ATOM 10170 C C   . GLY E 1 235 ? -52.391 0.043   -0.758  1.00 63.57  ? 235 GLY E C   1 
ATOM 10171 O O   . GLY E 1 235 ? -51.783 -0.954  -0.352  1.00 62.98  ? 235 GLY E O   1 
ATOM 10172 N N   . GLU E 1 236 ? -52.975 0.106   -1.974  1.00 60.82  ? 236 GLU E N   1 
ATOM 10173 C CA  . GLU E 1 236 ? -52.987 -0.929  -2.999  1.00 60.67  ? 236 GLU E CA  1 
ATOM 10174 C C   . GLU E 1 236 ? -53.169 -0.293  -4.361  1.00 65.94  ? 236 GLU E C   1 
ATOM 10175 O O   . GLU E 1 236 ? -53.610 0.851   -4.459  1.00 66.19  ? 236 GLU E O   1 
ATOM 10176 C CB  . GLU E 1 236 ? -54.078 -1.981  -2.742  1.00 61.86  ? 236 GLU E CB  1 
ATOM 10177 C CG  . GLU E 1 236 ? -55.494 -1.425  -2.675  1.00 74.85  ? 236 GLU E CG  1 
ATOM 10178 C CD  . GLU E 1 236 ? -56.600 -2.458  -2.792  1.00 95.73  ? 236 GLU E CD  1 
ATOM 10179 O OE1 . GLU E 1 236 ? -56.406 -3.617  -2.350  1.00 82.89  ? 236 GLU E OE1 1 
ATOM 10180 O OE2 . GLU E 1 236 ? -57.660 -2.110  -3.359  1.00 88.15  ? 236 GLU E OE2 1 
ATOM 10181 N N   . ILE E 1 237 ? -52.837 -1.041  -5.412  1.00 63.22  ? 237 ILE E N   1 
ATOM 10182 C CA  . ILE E 1 237 ? -52.979 -0.592  -6.794  1.00 62.44  ? 237 ILE E CA  1 
ATOM 10183 C C   . ILE E 1 237 ? -54.384 -0.927  -7.311  1.00 66.59  ? 237 ILE E C   1 
ATOM 10184 O O   . ILE E 1 237 ? -55.037 -1.868  -6.842  1.00 64.37  ? 237 ILE E O   1 
ATOM 10185 C CB  . ILE E 1 237 ? -51.870 -1.160  -7.734  1.00 64.66  ? 237 ILE E CB  1 
ATOM 10186 C CG1 . ILE E 1 237 ? -51.841 -2.722  -7.786  1.00 65.47  ? 237 ILE E CG1 1 
ATOM 10187 C CG2 . ILE E 1 237 ? -50.504 -0.547  -7.443  1.00 63.39  ? 237 ILE E CG2 1 
ATOM 10188 C CD1 . ILE E 1 237 ? -51.359 -3.586  -6.397  1.00 79.65  ? 237 ILE E CD1 1 
ATOM 10189 N N   . LYS E 1 238 ? -54.827 -0.135  -8.291  1.00 65.41  ? 238 LYS E N   1 
ATOM 10190 C CA  . LYS E 1 238 ? -56.096 -0.275  -8.991  1.00 65.34  ? 238 LYS E CA  1 
ATOM 10191 C C   . LYS E 1 238 ? -55.772 -0.523  -10.458 1.00 64.91  ? 238 LYS E C   1 
ATOM 10192 O O   . LYS E 1 238 ? -55.258 0.361   -11.147 1.00 62.99  ? 238 LYS E O   1 
ATOM 10193 C CB  . LYS E 1 238 ? -56.994 0.961   -8.767  1.00 69.79  ? 238 LYS E CB  1 
ATOM 10194 C CG  . LYS E 1 238 ? -57.689 0.961   -7.401  1.00 92.93  ? 238 LYS E CG  1 
ATOM 10195 C CD  . LYS E 1 238 ? -58.579 2.173   -7.214  1.00 107.54 ? 238 LYS E CD  1 
ATOM 10196 C CE  . LYS E 1 238 ? -59.299 2.134   -5.888  1.00 123.52 ? 238 LYS E CE  1 
ATOM 10197 N NZ  . LYS E 1 238 ? -60.337 3.197   -5.784  1.00 133.73 ? 238 LYS E NZ  1 
ATOM 10198 N N   . ARG E 1 239 ? -56.009 -1.763  -10.899 1.00 60.92  ? 239 ARG E N   1 
ATOM 10199 C CA  . ARG E 1 239 ? -55.748 -2.262  -12.255 1.00 60.50  ? 239 ARG E CA  1 
ATOM 10200 C C   . ARG E 1 239 ? -56.881 -1.918  -13.224 1.00 63.52  ? 239 ARG E C   1 
ATOM 10201 O O   . ARG E 1 239 ? -58.021 -2.339  -13.025 1.00 62.27  ? 239 ARG E O   1 
ATOM 10202 C CB  . ARG E 1 239 ? -55.556 -3.795  -12.210 1.00 60.42  ? 239 ARG E CB  1 
ATOM 10203 C CG  . ARG E 1 239 ? -54.539 -4.338  -13.204 1.00 63.91  ? 239 ARG E CG  1 
ATOM 10204 C CD  . ARG E 1 239 ? -53.228 -4.677  -12.534 1.00 62.41  ? 239 ARG E CD  1 
ATOM 10205 N NE  . ARG E 1 239 ? -52.475 -3.479  -12.173 1.00 69.74  ? 239 ARG E NE  1 
ATOM 10206 C CZ  . ARG E 1 239 ? -51.384 -3.482  -11.414 1.00 84.53  ? 239 ARG E CZ  1 
ATOM 10207 N NH1 . ARG E 1 239 ? -50.910 -4.621  -10.922 1.00 71.15  ? 239 ARG E NH1 1 
ATOM 10208 N NH2 . ARG E 1 239 ? -50.761 -2.345  -11.136 1.00 66.53  ? 239 ARG E NH2 1 
ATOM 10209 N N   . GLY E 1 240 ? -56.542 -1.179  -14.273 1.00 61.19  ? 240 GLY E N   1 
ATOM 10210 C CA  . GLY E 1 240 ? -57.482 -0.799  -15.321 1.00 61.56  ? 240 GLY E CA  1 
ATOM 10211 C C   . GLY E 1 240 ? -57.482 -1.769  -16.492 1.00 66.93  ? 240 GLY E C   1 
ATOM 10212 O O   . GLY E 1 240 ? -56.461 -2.411  -16.768 1.00 64.83  ? 240 GLY E O   1 
ATOM 10213 N N   . LEU E 1 241 ? -58.645 -1.915  -17.171 1.00 65.15  ? 241 LEU E N   1 
ATOM 10214 C CA  . LEU E 1 241 ? -58.729 -2.750  -18.364 1.00 64.75  ? 241 LEU E CA  1 
ATOM 10215 C C   . LEU E 1 241 ? -59.588 -2.101  -19.439 1.00 67.50  ? 241 LEU E C   1 
ATOM 10216 O O   . LEU E 1 241 ? -60.542 -1.398  -19.134 1.00 67.45  ? 241 LEU E O   1 
ATOM 10217 C CB  . LEU E 1 241 ? -59.140 -4.220  -18.125 1.00 65.11  ? 241 LEU E CB  1 
ATOM 10218 C CG  . LEU E 1 241 ? -60.513 -4.629  -17.608 1.00 70.43  ? 241 LEU E CG  1 
ATOM 10219 C CD1 . LEU E 1 241 ? -61.560 -4.592  -18.692 1.00 71.09  ? 241 LEU E CD1 1 
ATOM 10220 C CD2 . LEU E 1 241 ? -60.481 -6.066  -17.221 1.00 73.49  ? 241 LEU E CD2 1 
ATOM 10221 N N   . LEU E 1 242 ? -59.221 -2.341  -20.707 1.00 63.31  ? 242 LEU E N   1 
ATOM 10222 C CA  . LEU E 1 242 ? -59.917 -1.864  -21.901 1.00 61.75  ? 242 LEU E CA  1 
ATOM 10223 C C   . LEU E 1 242 ? -61.133 -2.726  -22.196 1.00 66.94  ? 242 LEU E C   1 
ATOM 10224 O O   . LEU E 1 242 ? -62.172 -2.195  -22.572 1.00 66.20  ? 242 LEU E O   1 
ATOM 10225 C CB  . LEU E 1 242 ? -58.974 -1.908  -23.123 1.00 60.93  ? 242 LEU E CB  1 
ATOM 10226 C CG  . LEU E 1 242 ? -57.922 -0.820  -23.289 1.00 64.28  ? 242 LEU E CG  1 
ATOM 10227 C CD1 . LEU E 1 242 ? -56.996 -1.160  -24.453 1.00 64.19  ? 242 LEU E CD1 1 
ATOM 10228 C CD2 . LEU E 1 242 ? -58.558 0.526   -23.565 1.00 63.71  ? 242 LEU E CD2 1 
ATOM 10229 N N   . GLY E 1 243 ? -60.976 -4.048  -22.054 1.00 64.58  ? 243 GLY E N   1 
ATOM 10230 C CA  . GLY E 1 243 ? -61.982 -5.047  -22.395 1.00 64.40  ? 243 GLY E CA  1 
ATOM 10231 C C   . GLY E 1 243 ? -61.729 -5.533  -23.807 1.00 67.44  ? 243 GLY E C   1 
ATOM 10232 O O   . GLY E 1 243 ? -62.655 -5.712  -24.600 1.00 68.31  ? 243 GLY E O   1 
ATOM 10233 N N   . ILE E 1 244 ? -60.441 -5.730  -24.117 1.00 61.98  ? 244 ILE E N   1 
ATOM 10234 C CA  . ILE E 1 244 ? -59.890 -6.130  -25.410 1.00 60.20  ? 244 ILE E CA  1 
ATOM 10235 C C   . ILE E 1 244 ? -59.126 -7.450  -25.272 1.00 60.60  ? 244 ILE E C   1 
ATOM 10236 O O   . ILE E 1 244 ? -58.492 -7.687  -24.260 1.00 59.50  ? 244 ILE E O   1 
ATOM 10237 C CB  . ILE E 1 244 ? -58.978 -4.946  -25.882 1.00 62.65  ? 244 ILE E CB  1 
ATOM 10238 C CG1 . ILE E 1 244 ? -59.798 -3.775  -26.462 1.00 62.57  ? 244 ILE E CG1 1 
ATOM 10239 C CG2 . ILE E 1 244 ? -57.765 -5.322  -26.748 1.00 62.14  ? 244 ILE E CG2 1 
ATOM 10240 C CD1 . ILE E 1 244 ? -60.790 -4.116  -27.466 1.00 63.87  ? 244 ILE E CD1 1 
ATOM 10241 N N   . LYS E 1 245 ? -59.237 -8.313  -26.279 1.00 56.18  ? 245 LYS E N   1 
ATOM 10242 C CA  . LYS E 1 245 ? -58.493 -9.557  -26.416 1.00 55.41  ? 245 LYS E CA  1 
ATOM 10243 C C   . LYS E 1 245 ? -57.792 -9.470  -27.739 1.00 59.85  ? 245 LYS E C   1 
ATOM 10244 O O   . LYS E 1 245 ? -58.410 -9.137  -28.751 1.00 59.13  ? 245 LYS E O   1 
ATOM 10245 C CB  . LYS E 1 245 ? -59.367 -10.804 -26.298 1.00 57.97  ? 245 LYS E CB  1 
ATOM 10246 C CG  . LYS E 1 245 ? -59.232 -11.497 -24.948 1.00 85.44  ? 245 LYS E CG  1 
ATOM 10247 C CD  . LYS E 1 245 ? -59.754 -12.938 -24.978 1.00 104.74 ? 245 LYS E CD  1 
ATOM 10248 C CE  . LYS E 1 245 ? -61.123 -13.076 -24.351 1.00 121.22 ? 245 LYS E CE  1 
ATOM 10249 N NZ  . LYS E 1 245 ? -61.659 -14.458 -24.462 1.00 133.04 ? 245 LYS E NZ  1 
ATOM 10250 N N   . GLY E 1 246 ? -56.490 -9.646  -27.711 1.00 58.15  ? 246 GLY E N   1 
ATOM 10251 C CA  . GLY E 1 246 ? -55.707 -9.538  -28.920 1.00 58.90  ? 246 GLY E CA  1 
ATOM 10252 C C   . GLY E 1 246 ? -54.338 -10.176 -28.893 1.00 65.82  ? 246 GLY E C   1 
ATOM 10253 O O   . GLY E 1 246 ? -53.898 -10.744 -27.884 1.00 67.25  ? 246 GLY E O   1 
ATOM 10254 N N   . THR E 1 247 ? -53.666 -10.067 -30.036 1.00 61.04  ? 247 THR E N   1 
ATOM 10255 C CA  . THR E 1 247 ? -52.344 -10.592 -30.299 1.00 59.77  ? 247 THR E CA  1 
ATOM 10256 C C   . THR E 1 247 ? -51.457 -9.435  -30.728 1.00 62.65  ? 247 THR E C   1 
ATOM 10257 O O   . THR E 1 247 ? -51.917 -8.302  -30.901 1.00 62.08  ? 247 THR E O   1 
ATOM 10258 C CB  . THR E 1 247 ? -52.461 -11.692 -31.387 1.00 69.22  ? 247 THR E CB  1 
ATOM 10259 O OG1 . THR E 1 247 ? -53.366 -12.702 -30.941 1.00 72.69  ? 247 THR E OG1 1 
ATOM 10260 C CG2 . THR E 1 247 ? -51.129 -12.336 -31.758 1.00 70.01  ? 247 THR E CG2 1 
ATOM 10261 N N   . GLU E 1 248 ? -50.180 -9.731  -30.898 1.00 58.32  ? 248 GLU E N   1 
ATOM 10262 C CA  . GLU E 1 248 ? -49.212 -8.792  -31.391 1.00 58.63  ? 248 GLU E CA  1 
ATOM 10263 C C   . GLU E 1 248 ? -49.426 -8.546  -32.879 1.00 61.54  ? 248 GLU E C   1 
ATOM 10264 O O   . GLU E 1 248 ? -49.655 -9.492  -33.647 1.00 60.63  ? 248 GLU E O   1 
ATOM 10265 C CB  . GLU E 1 248 ? -47.780 -9.331  -31.155 1.00 60.24  ? 248 GLU E CB  1 
ATOM 10266 C CG  . GLU E 1 248 ? -47.283 -9.194  -29.725 1.00 71.32  ? 248 GLU E CG  1 
ATOM 10267 C CD  . GLU E 1 248 ? -47.007 -7.792  -29.209 1.00 88.79  ? 248 GLU E CD  1 
ATOM 10268 O OE1 . GLU E 1 248 ? -46.990 -6.829  -30.012 1.00 72.01  ? 248 GLU E OE1 1 
ATOM 10269 O OE2 . GLU E 1 248 ? -46.824 -7.662  -27.978 1.00 87.17  ? 248 GLU E OE2 1 
ATOM 10270 N N   . MET E 1 249 ? -49.335 -7.269  -33.274 1.00 56.43  ? 249 MET E N   1 
ATOM 10271 C CA  . MET E 1 249 ? -49.377 -6.846  -34.661 1.00 55.56  ? 249 MET E CA  1 
ATOM 10272 C C   . MET E 1 249 ? -48.010 -7.225  -35.264 1.00 58.33  ? 249 MET E C   1 
ATOM 10273 O O   . MET E 1 249 ? -46.973 -6.999  -34.619 1.00 57.68  ? 249 MET E O   1 
ATOM 10274 C CB  . MET E 1 249 ? -49.703 -5.334  -34.753 1.00 57.94  ? 249 MET E CB  1 
ATOM 10275 C CG  . MET E 1 249 ? -49.642 -4.719  -36.163 1.00 61.97  ? 249 MET E CG  1 
ATOM 10276 S SD  . MET E 1 249 ? -50.468 -5.548  -37.567 1.00 66.91  ? 249 MET E SD  1 
ATOM 10277 C CE  . MET E 1 249 ? -51.864 -6.235  -36.787 1.00 63.49  ? 249 MET E CE  1 
ATOM 10278 N N   . SER E 1 250 ? -48.019 -7.891  -36.443 1.00 53.16  ? 250 SER E N   1 
ATOM 10279 C CA  . SER E 1 250 ? -46.798 -8.365  -37.095 1.00 51.30  ? 250 SER E CA  1 
ATOM 10280 C C   . SER E 1 250 ? -46.675 -7.858  -38.520 1.00 52.92  ? 250 SER E C   1 
ATOM 10281 O O   . SER E 1 250 ? -47.629 -7.314  -39.090 1.00 49.65  ? 250 SER E O   1 
ATOM 10282 C CB  . SER E 1 250 ? -46.757 -9.890  -37.087 1.00 54.37  ? 250 SER E CB  1 
ATOM 10283 O OG  . SER E 1 250 ? -47.839 -10.453 -37.815 1.00 67.18  ? 250 SER E OG  1 
ATOM 10284 N N   . ALA E 1 251 ? -45.480 -8.066  -39.100 1.00 51.81  ? 251 ALA E N   1 
ATOM 10285 C CA  . ALA E 1 251 ? -45.151 -7.737  -40.490 1.00 52.29  ? 251 ALA E CA  1 
ATOM 10286 C C   . ALA E 1 251 ? -45.991 -8.593  -41.436 1.00 59.33  ? 251 ALA E C   1 
ATOM 10287 O O   . ALA E 1 251 ? -46.280 -8.167  -42.549 1.00 59.83  ? 251 ALA E O   1 
ATOM 10288 C CB  . ALA E 1 251 ? -43.666 -7.966  -40.741 1.00 52.57  ? 251 ALA E CB  1 
ATOM 10289 N N   . ASP E 1 252 ? -46.408 -9.776  -40.960 1.00 58.09  ? 252 ASP E N   1 
ATOM 10290 C CA  . ASP E 1 252 ? -47.207 -10.762 -41.677 1.00 59.89  ? 252 ASP E CA  1 
ATOM 10291 C C   . ASP E 1 252 ? -48.633 -10.266 -41.845 1.00 65.15  ? 252 ASP E C   1 
ATOM 10292 O O   . ASP E 1 252 ? -49.143 -10.304 -42.972 1.00 65.56  ? 252 ASP E O   1 
ATOM 10293 C CB  . ASP E 1 252 ? -47.153 -12.121 -40.952 1.00 63.25  ? 252 ASP E CB  1 
ATOM 10294 C CG  . ASP E 1 252 ? -45.725 -12.557 -40.628 1.00 85.84  ? 252 ASP E CG  1 
ATOM 10295 O OD1 . ASP E 1 252 ? -44.936 -12.761 -41.580 1.00 87.99  ? 252 ASP E OD1 1 
ATOM 10296 O OD2 . ASP E 1 252 ? -45.366 -12.584 -39.420 1.00 93.33  ? 252 ASP E OD2 1 
ATOM 10297 N N   . ILE E 1 253 ? -49.263 -9.755  -40.756 1.00 61.13  ? 253 ILE E N   1 
ATOM 10298 C CA  . ILE E 1 253 ? -50.599 -9.165  -40.825 1.00 60.97  ? 253 ILE E CA  1 
ATOM 10299 C C   . ILE E 1 253 ? -50.537 -7.936  -41.764 1.00 65.35  ? 253 ILE E C   1 
ATOM 10300 O O   . ILE E 1 253 ? -51.356 -7.838  -42.667 1.00 65.76  ? 253 ILE E O   1 
ATOM 10301 C CB  . ILE E 1 253 ? -51.181 -8.783  -39.421 1.00 64.69  ? 253 ILE E CB  1 
ATOM 10302 C CG1 . ILE E 1 253 ? -51.001 -9.863  -38.328 1.00 65.33  ? 253 ILE E CG1 1 
ATOM 10303 C CG2 . ILE E 1 253 ? -52.623 -8.258  -39.497 1.00 65.10  ? 253 ILE E CG2 1 
ATOM 10304 C CD1 . ILE E 1 253 ? -51.728 -11.172 -38.535 1.00 75.99  ? 253 ILE E CD1 1 
ATOM 10305 N N   . ALA E 1 254 ? -49.563 -7.024  -41.564 1.00 61.94  ? 254 ALA E N   1 
ATOM 10306 C CA  . ALA E 1 254 ? -49.383 -5.821  -42.389 1.00 62.53  ? 254 ALA E CA  1 
ATOM 10307 C C   . ALA E 1 254 ? -49.222 -6.142  -43.875 1.00 67.93  ? 254 ALA E C   1 
ATOM 10308 O O   . ALA E 1 254 ? -49.839 -5.447  -44.671 1.00 67.64  ? 254 ALA E O   1 
ATOM 10309 C CB  . ALA E 1 254 ? -48.184 -5.012  -41.915 1.00 63.39  ? 254 ALA E CB  1 
ATOM 10310 N N   . LYS E 1 255 ? -48.407 -7.170  -44.255 1.00 66.51  ? 255 LYS E N   1 
ATOM 10311 C CA  . LYS E 1 255 ? -48.214 -7.564  -45.668 1.00 66.93  ? 255 LYS E CA  1 
ATOM 10312 C C   . LYS E 1 255 ? -49.531 -8.061  -46.276 1.00 75.52  ? 255 LYS E C   1 
ATOM 10313 O O   . LYS E 1 255 ? -49.901 -7.632  -47.374 1.00 76.58  ? 255 LYS E O   1 
ATOM 10314 C CB  . LYS E 1 255 ? -47.126 -8.636  -45.827 1.00 67.69  ? 255 LYS E CB  1 
ATOM 10315 C CG  . LYS E 1 255 ? -45.826 -8.116  -46.410 1.00 74.98  ? 255 LYS E CG  1 
ATOM 10316 C CD  . LYS E 1 255 ? -44.679 -9.074  -46.103 1.00 87.82  ? 255 LYS E CD  1 
ATOM 10317 C CE  . LYS E 1 255 ? -43.393 -8.349  -45.756 1.00 97.69  ? 255 LYS E CE  1 
ATOM 10318 N NZ  . LYS E 1 255 ? -42.604 -9.056  -44.704 1.00 97.10  ? 255 LYS E NZ  1 
ATOM 10319 N N   . ALA E 1 256 ? -50.261 -8.913  -45.530 1.00 73.60  ? 256 ALA E N   1 
ATOM 10320 C CA  . ALA E 1 256 ? -51.537 -9.488  -45.946 1.00 73.87  ? 256 ALA E CA  1 
ATOM 10321 C C   . ALA E 1 256 ? -52.608 -8.431  -46.246 1.00 78.67  ? 256 ALA E C   1 
ATOM 10322 O O   . ALA E 1 256 ? -53.418 -8.648  -47.149 1.00 78.24  ? 256 ALA E O   1 
ATOM 10323 C CB  . ALA E 1 256 ? -52.041 -10.425 -44.873 1.00 74.60  ? 256 ALA E CB  1 
ATOM 10324 N N   . PHE E 1 257 ? -52.605 -7.293  -45.513 1.00 75.71  ? 257 PHE E N   1 
ATOM 10325 C CA  . PHE E 1 257 ? -53.613 -6.234  -45.670 1.00 75.20  ? 257 PHE E CA  1 
ATOM 10326 C C   . PHE E 1 257 ? -53.037 -4.921  -46.205 1.00 78.61  ? 257 PHE E C   1 
ATOM 10327 O O   . PHE E 1 257 ? -53.698 -3.885  -46.123 1.00 78.36  ? 257 PHE E O   1 
ATOM 10328 C CB  . PHE E 1 257 ? -54.335 -5.995  -44.335 1.00 77.06  ? 257 PHE E CB  1 
ATOM 10329 C CG  . PHE E 1 257 ? -54.960 -7.246  -43.768 1.00 78.59  ? 257 PHE E CG  1 
ATOM 10330 C CD1 . PHE E 1 257 ? -54.659 -7.670  -42.482 1.00 80.88  ? 257 PHE E CD1 1 
ATOM 10331 C CD2 . PHE E 1 257 ? -55.817 -8.026  -44.539 1.00 81.26  ? 257 PHE E CD2 1 
ATOM 10332 C CE1 . PHE E 1 257 ? -55.222 -8.840  -41.966 1.00 82.00  ? 257 PHE E CE1 1 
ATOM 10333 C CE2 . PHE E 1 257 ? -56.366 -9.206  -44.026 1.00 84.16  ? 257 PHE E CE2 1 
ATOM 10334 C CZ  . PHE E 1 257 ? -56.057 -9.608  -42.745 1.00 81.87  ? 257 PHE E CZ  1 
ATOM 10335 N N   . ASN E 1 258 ? -51.836 -4.978  -46.806 1.00 75.11  ? 258 ASN E N   1 
ATOM 10336 C CA  . ASN E 1 258 ? -51.122 -3.846  -47.414 1.00 74.81  ? 258 ASN E CA  1 
ATOM 10337 C C   . ASN E 1 258 ? -51.071 -2.606  -46.472 1.00 76.49  ? 258 ASN E C   1 
ATOM 10338 O O   . ASN E 1 258 ? -51.379 -1.484  -46.894 1.00 76.74  ? 258 ASN E O   1 
ATOM 10339 C CB  . ASN E 1 258 ? -51.739 -3.485  -48.780 1.00 76.81  ? 258 ASN E CB  1 
ATOM 10340 C CG  . ASN E 1 258 ? -50.699 -3.196  -49.834 1.00 100.63 ? 258 ASN E CG  1 
ATOM 10341 O OD1 . ASN E 1 258 ? -49.997 -2.171  -49.802 1.00 95.21  ? 258 ASN E OD1 1 
ATOM 10342 N ND2 . ASN E 1 258 ? -50.556 -4.117  -50.778 1.00 91.17  ? 258 ASN E ND2 1 
ATOM 10343 N N   . LEU E 1 259 ? -50.651 -2.824  -45.207 1.00 70.53  ? 259 LEU E N   1 
ATOM 10344 C CA  . LEU E 1 259 ? -50.552 -1.788  -44.172 1.00 69.46  ? 259 LEU E CA  1 
ATOM 10345 C C   . LEU E 1 259 ? -49.098 -1.309  -43.978 1.00 75.43  ? 259 LEU E C   1 
ATOM 10346 O O   . LEU E 1 259 ? -48.151 -2.082  -44.181 1.00 74.93  ? 259 LEU E O   1 
ATOM 10347 C CB  . LEU E 1 259 ? -51.136 -2.289  -42.840 1.00 68.73  ? 259 LEU E CB  1 
ATOM 10348 C CG  . LEU E 1 259 ? -52.571 -2.837  -42.879 1.00 72.28  ? 259 LEU E CG  1 
ATOM 10349 C CD1 . LEU E 1 259 ? -52.832 -3.748  -41.706 1.00 71.96  ? 259 LEU E CD1 1 
ATOM 10350 C CD2 . LEU E 1 259 ? -53.604 -1.722  -42.896 1.00 73.23  ? 259 LEU E CD2 1 
ATOM 10351 N N   . ASP E 1 260 ? -48.937 -0.019  -43.592 1.00 73.96  ? 260 ASP E N   1 
ATOM 10352 C CA  . ASP E 1 260 ? -47.641 0.649   -43.375 1.00 74.89  ? 260 ASP E CA  1 
ATOM 10353 C C   . ASP E 1 260 ? -47.232 0.721   -41.869 1.00 77.98  ? 260 ASP E C   1 
ATOM 10354 O O   . ASP E 1 260 ? -46.319 1.469   -41.503 1.00 77.35  ? 260 ASP E O   1 
ATOM 10355 C CB  . ASP E 1 260 ? -47.680 2.049   -43.991 1.00 77.72  ? 260 ASP E CB  1 
ATOM 10356 C CG  . ASP E 1 260 ? -47.581 2.036   -45.507 1.00 95.40  ? 260 ASP E CG  1 
ATOM 10357 O OD1 . ASP E 1 260 ? -46.519 2.449   -46.036 1.00 98.34  ? 260 ASP E OD1 1 
ATOM 10358 O OD2 . ASP E 1 260 ? -48.570 1.616   -46.168 1.00 99.12  ? 260 ASP E OD2 1 
ATOM 10359 N N   . VAL E 1 261 ? -47.898 -0.101  -41.028 1.00 73.25  ? 261 VAL E N   1 
ATOM 10360 C CA  . VAL E 1 261 ? -47.701 -0.292  -39.585 1.00 72.03  ? 261 VAL E CA  1 
ATOM 10361 C C   . VAL E 1 261 ? -47.600 -1.821  -39.322 1.00 72.79  ? 261 VAL E C   1 
ATOM 10362 O O   . VAL E 1 261 ? -48.335 -2.597  -39.936 1.00 72.79  ? 261 VAL E O   1 
ATOM 10363 C CB  . VAL E 1 261 ? -48.813 0.410   -38.738 1.00 75.79  ? 261 VAL E CB  1 
ATOM 10364 C CG1 . VAL E 1 261 ? -50.186 -0.252  -38.903 1.00 75.21  ? 261 VAL E CG1 1 
ATOM 10365 C CG2 . VAL E 1 261 ? -48.423 0.497   -37.265 1.00 75.71  ? 261 VAL E CG2 1 
ATOM 10366 N N   . GLN E 1 262 ? -46.669 -2.252  -38.464 1.00 66.42  ? 262 GLN E N   1 
ATOM 10367 C CA  . GLN E 1 262 ? -46.501 -3.690  -38.189 1.00 65.22  ? 262 GLN E CA  1 
ATOM 10368 C C   . GLN E 1 262 ? -46.180 -3.944  -36.698 1.00 65.51  ? 262 GLN E C   1 
ATOM 10369 O O   . GLN E 1 262 ? -45.678 -5.006  -36.327 1.00 65.51  ? 262 GLN E O   1 
ATOM 10370 C CB  . GLN E 1 262 ? -45.444 -4.339  -39.120 1.00 66.26  ? 262 GLN E CB  1 
ATOM 10371 C CG  . GLN E 1 262 ? -44.190 -3.516  -39.380 1.00 69.22  ? 262 GLN E CG  1 
ATOM 10372 C CD  . GLN E 1 262 ? -44.312 -2.605  -40.579 1.00 81.55  ? 262 GLN E CD  1 
ATOM 10373 O OE1 . GLN E 1 262 ? -44.791 -2.998  -41.651 1.00 74.94  ? 262 GLN E OE1 1 
ATOM 10374 N NE2 . GLN E 1 262 ? -43.803 -1.384  -40.447 1.00 73.14  ? 262 GLN E NE2 1 
ATOM 10375 N N   . ARG E 1 263 ? -46.516 -2.966  -35.857 1.00 58.62  ? 263 ARG E N   1 
ATOM 10376 C CA  . ARG E 1 263 ? -46.317 -2.973  -34.418 1.00 57.28  ? 263 ARG E CA  1 
ATOM 10377 C C   . ARG E 1 263 ? -47.528 -2.374  -33.754 1.00 59.87  ? 263 ARG E C   1 
ATOM 10378 O O   . ARG E 1 263 ? -48.061 -1.349  -34.215 1.00 59.45  ? 263 ARG E O   1 
ATOM 10379 C CB  . ARG E 1 263 ? -45.059 -2.181  -34.027 1.00 55.60  ? 263 ARG E CB  1 
ATOM 10380 C CG  . ARG E 1 263 ? -43.791 -2.701  -34.643 1.00 61.54  ? 263 ARG E CG  1 
ATOM 10381 C CD  . ARG E 1 263 ? -42.730 -2.884  -33.604 1.00 75.11  ? 263 ARG E CD  1 
ATOM 10382 N NE  . ARG E 1 263 ? -42.037 -1.633  -33.309 1.00 90.28  ? 263 ARG E NE  1 
ATOM 10383 C CZ  . ARG E 1 263 ? -40.714 -1.519  -33.243 1.00 107.03 ? 263 ARG E CZ  1 
ATOM 10384 N NH1 . ARG E 1 263 ? -39.935 -2.574  -33.471 1.00 80.30  ? 263 ARG E NH1 1 
ATOM 10385 N NH2 . ARG E 1 263 ? -40.156 -0.347  -32.958 1.00 101.59 ? 263 ARG E NH2 1 
ATOM 10386 N N   . GLY E 1 264 ? -47.937 -3.001  -32.668 1.00 54.69  ? 264 GLY E N   1 
ATOM 10387 C CA  . GLY E 1 264 ? -49.101 -2.578  -31.913 1.00 54.26  ? 264 GLY E CA  1 
ATOM 10388 C C   . GLY E 1 264 ? -49.950 -3.776  -31.570 1.00 59.60  ? 264 GLY E C   1 
ATOM 10389 O O   . GLY E 1 264 ? -49.438 -4.897  -31.510 1.00 60.89  ? 264 GLY E O   1 
ATOM 10390 N N   . ALA E 1 265 ? -51.250 -3.556  -31.365 1.00 55.24  ? 265 ALA E N   1 
ATOM 10391 C CA  . ALA E 1 265 ? -52.167 -4.610  -30.964 1.00 54.90  ? 265 ALA E CA  1 
ATOM 10392 C C   . ALA E 1 265 ? -53.192 -4.940  -32.037 1.00 59.80  ? 265 ALA E C   1 
ATOM 10393 O O   . ALA E 1 265 ? -53.889 -4.052  -32.537 1.00 60.50  ? 265 ALA E O   1 
ATOM 10394 C CB  . ALA E 1 265 ? -52.882 -4.197  -29.691 1.00 55.27  ? 265 ALA E CB  1 
ATOM 10395 N N   . PHE E 1 266 ? -53.315 -6.223  -32.356 1.00 54.77  ? 266 PHE E N   1 
ATOM 10396 C CA  . PHE E 1 266 ? -54.324 -6.709  -33.282 1.00 53.99  ? 266 PHE E CA  1 
ATOM 10397 C C   . PHE E 1 266 ? -55.496 -7.201  -32.441 1.00 57.16  ? 266 PHE E C   1 
ATOM 10398 O O   . PHE E 1 266 ? -55.319 -8.128  -31.658 1.00 57.75  ? 266 PHE E O   1 
ATOM 10399 C CB  . PHE E 1 266 ? -53.742 -7.805  -34.178 1.00 55.78  ? 266 PHE E CB  1 
ATOM 10400 C CG  . PHE E 1 266 ? -54.740 -8.382  -35.140 1.00 57.10  ? 266 PHE E CG  1 
ATOM 10401 C CD1 . PHE E 1 266 ? -55.304 -9.636  -34.916 1.00 60.42  ? 266 PHE E CD1 1 
ATOM 10402 C CD2 . PHE E 1 266 ? -55.155 -7.659  -36.249 1.00 59.47  ? 266 PHE E CD2 1 
ATOM 10403 C CE1 . PHE E 1 266 ? -56.234 -10.173 -35.807 1.00 61.24  ? 266 PHE E CE1 1 
ATOM 10404 C CE2 . PHE E 1 266 ? -56.100 -8.186  -37.131 1.00 62.66  ? 266 PHE E CE2 1 
ATOM 10405 C CZ  . PHE E 1 266 ? -56.627 -9.443  -36.907 1.00 60.81  ? 266 PHE E CZ  1 
ATOM 10406 N N   . VAL E 1 267 ? -56.666 -6.545  -32.546 1.00 51.89  ? 267 VAL E N   1 
ATOM 10407 C CA  . VAL E 1 267 ? -57.837 -6.873  -31.728 1.00 50.24  ? 267 VAL E CA  1 
ATOM 10408 C C   . VAL E 1 267 ? -58.590 -8.033  -32.359 1.00 56.60  ? 267 VAL E C   1 
ATOM 10409 O O   . VAL E 1 267 ? -58.987 -7.957  -33.520 1.00 56.64  ? 267 VAL E O   1 
ATOM 10410 C CB  . VAL E 1 267 ? -58.767 -5.654  -31.489 1.00 51.84  ? 267 VAL E CB  1 
ATOM 10411 C CG1 . VAL E 1 267 ? -59.929 -6.019  -30.570 1.00 51.07  ? 267 VAL E CG1 1 
ATOM 10412 C CG2 . VAL E 1 267 ? -57.994 -4.471  -30.929 1.00 51.12  ? 267 VAL E CG2 1 
ATOM 10413 N N   . SER E 1 268 ? -58.794 -9.097  -31.582 1.00 53.78  ? 268 SER E N   1 
ATOM 10414 C CA  . SER E 1 268 ? -59.535 -10.267 -32.031 1.00 54.25  ? 268 SER E CA  1 
ATOM 10415 C C   . SER E 1 268 ? -60.933 -10.302 -31.396 1.00 63.59  ? 268 SER E C   1 
ATOM 10416 O O   . SER E 1 268 ? -61.865 -10.875 -31.970 1.00 64.27  ? 268 SER E O   1 
ATOM 10417 C CB  . SER E 1 268 ? -58.769 -11.542 -31.698 1.00 55.71  ? 268 SER E CB  1 
ATOM 10418 O OG  . SER E 1 268 ? -58.592 -11.750 -30.306 1.00 63.08  ? 268 SER E OG  1 
ATOM 10419 N N   . GLU E 1 269 ? -61.083 -9.690  -30.216 1.00 62.29  ? 269 GLU E N   1 
ATOM 10420 C CA  . GLU E 1 269 ? -62.335 -9.722  -29.471 1.00 63.05  ? 269 GLU E CA  1 
ATOM 10421 C C   . GLU E 1 269 ? -62.494 -8.492  -28.595 1.00 68.86  ? 269 GLU E C   1 
ATOM 10422 O O   . GLU E 1 269 ? -61.561 -8.083  -27.903 1.00 68.99  ? 269 GLU E O   1 
ATOM 10423 C CB  . GLU E 1 269 ? -62.345 -10.989 -28.598 1.00 64.68  ? 269 GLU E CB  1 
ATOM 10424 C CG  . GLU E 1 269 ? -63.679 -11.391 -27.997 1.00 79.92  ? 269 GLU E CG  1 
ATOM 10425 C CD  . GLU E 1 269 ? -63.635 -12.662 -27.164 1.00 112.06 ? 269 GLU E CD  1 
ATOM 10426 O OE1 . GLU E 1 269 ? -64.347 -12.720 -26.135 1.00 114.84 ? 269 GLU E OE1 1 
ATOM 10427 O OE2 . GLU E 1 269 ? -62.888 -13.598 -27.531 1.00 109.73 ? 269 GLU E OE2 1 
ATOM 10428 N N   . VAL E 1 270 ? -63.692 -7.907  -28.621 1.00 67.02  ? 270 VAL E N   1 
ATOM 10429 C CA  . VAL E 1 270 ? -64.073 -6.764  -27.780 1.00 66.78  ? 270 VAL E CA  1 
ATOM 10430 C C   . VAL E 1 270 ? -65.138 -7.294  -26.812 1.00 71.15  ? 270 VAL E C   1 
ATOM 10431 O O   . VAL E 1 270 ? -66.187 -7.788  -27.249 1.00 70.88  ? 270 VAL E O   1 
ATOM 10432 C CB  . VAL E 1 270 ? -64.541 -5.539  -28.598 1.00 70.25  ? 270 VAL E CB  1 
ATOM 10433 C CG1 . VAL E 1 270 ? -64.769 -4.334  -27.688 1.00 70.11  ? 270 VAL E CG1 1 
ATOM 10434 C CG2 . VAL E 1 270 ? -63.546 -5.200  -29.713 1.00 69.72  ? 270 VAL E CG2 1 
ATOM 10435 N N   . LEU E 1 271 ? -64.828 -7.285  -25.516 1.00 68.63  ? 271 LEU E N   1 
ATOM 10436 C CA  . LEU E 1 271 ? -65.725 -7.850  -24.512 1.00 70.20  ? 271 LEU E CA  1 
ATOM 10437 C C   . LEU E 1 271 ? -66.983 -6.991  -24.347 1.00 76.64  ? 271 LEU E C   1 
ATOM 10438 O O   . LEU E 1 271 ? -66.878 -5.761  -24.301 1.00 76.91  ? 271 LEU E O   1 
ATOM 10439 C CB  . LEU E 1 271 ? -64.998 -8.058  -23.175 1.00 70.65  ? 271 LEU E CB  1 
ATOM 10440 C CG  . LEU E 1 271 ? -63.681 -8.861  -23.243 1.00 75.27  ? 271 LEU E CG  1 
ATOM 10441 C CD1 . LEU E 1 271 ? -62.931 -8.775  -21.932 1.00 76.21  ? 271 LEU E CD1 1 
ATOM 10442 C CD2 . LEU E 1 271 ? -63.918 -10.324 -23.647 1.00 75.24  ? 271 LEU E CD2 1 
ATOM 10443 N N   . PRO E 1 272 ? -68.188 -7.610  -24.365 1.00 74.23  ? 272 PRO E N   1 
ATOM 10444 C CA  . PRO E 1 272 ? -69.422 -6.806  -24.265 1.00 74.34  ? 272 PRO E CA  1 
ATOM 10445 C C   . PRO E 1 272 ? -69.596 -6.198  -22.874 1.00 77.89  ? 272 PRO E C   1 
ATOM 10446 O O   . PRO E 1 272 ? -69.315 -6.853  -21.859 1.00 76.20  ? 272 PRO E O   1 
ATOM 10447 C CB  . PRO E 1 272 ? -70.540 -7.808  -24.593 1.00 76.11  ? 272 PRO E CB  1 
ATOM 10448 C CG  . PRO E 1 272 ? -69.840 -9.054  -25.109 1.00 80.32  ? 272 PRO E CG  1 
ATOM 10449 C CD  . PRO E 1 272 ? -68.497 -9.050  -24.466 1.00 75.75  ? 272 PRO E CD  1 
ATOM 10450 N N   . GLY E 1 273 ? -70.013 -4.931  -22.861 1.00 75.28  ? 273 GLY E N   1 
ATOM 10451 C CA  . GLY E 1 273 ? -70.242 -4.156  -21.646 1.00 75.28  ? 273 GLY E CA  1 
ATOM 10452 C C   . GLY E 1 273 ? -69.018 -3.405  -21.164 1.00 79.43  ? 273 GLY E C   1 
ATOM 10453 O O   . GLY E 1 273 ? -69.088 -2.660  -20.172 1.00 79.97  ? 273 GLY E O   1 
ATOM 10454 N N   . SER E 1 274 ? -67.880 -3.604  -21.861 1.00 73.67  ? 274 SER E N   1 
ATOM 10455 C CA  . SER E 1 274 ? -66.617 -2.954  -21.540 1.00 72.08  ? 274 SER E CA  1 
ATOM 10456 C C   . SER E 1 274 ? -66.593 -1.531  -22.113 1.00 73.39  ? 274 SER E C   1 
ATOM 10457 O O   . SER E 1 274 ? -67.416 -1.202  -22.970 1.00 72.84  ? 274 SER E O   1 
ATOM 10458 C CB  . SER E 1 274 ? -65.453 -3.779  -22.077 1.00 74.55  ? 274 SER E CB  1 
ATOM 10459 O OG  . SER E 1 274 ? -65.442 -3.763  -23.495 1.00 84.37  ? 274 SER E OG  1 
ATOM 10460 N N   . GLY E 1 275 ? -65.637 -0.719  -21.648 1.00 68.46  ? 275 GLY E N   1 
ATOM 10461 C CA  . GLY E 1 275 ? -65.419 0.647   -22.115 1.00 67.23  ? 275 GLY E CA  1 
ATOM 10462 C C   . GLY E 1 275 ? -65.126 0.680   -23.597 1.00 69.73  ? 275 GLY E C   1 
ATOM 10463 O O   . GLY E 1 275 ? -65.544 1.613   -24.280 1.00 71.41  ? 275 GLY E O   1 
ATOM 10464 N N   . SER E 1 276 ? -64.420 -0.361  -24.104 1.00 63.62  ? 276 SER E N   1 
ATOM 10465 C CA  . SER E 1 276 ? -64.040 -0.534  -25.508 1.00 62.49  ? 276 SER E CA  1 
ATOM 10466 C C   . SER E 1 276 ? -65.259 -0.845  -26.372 1.00 64.00  ? 276 SER E C   1 
ATOM 10467 O O   . SER E 1 276 ? -65.329 -0.394  -27.525 1.00 61.91  ? 276 SER E O   1 
ATOM 10468 C CB  . SER E 1 276 ? -62.995 -1.635  -25.657 1.00 65.79  ? 276 SER E CB  1 
ATOM 10469 O OG  . SER E 1 276 ? -61.727 -1.225  -25.170 1.00 74.05  ? 276 SER E OG  1 
ATOM 10470 N N   . ALA E 1 277 ? -66.215 -1.622  -25.803 1.00 60.12  ? 277 ALA E N   1 
ATOM 10471 C CA  . ALA E 1 277 ? -67.483 -1.975  -26.435 1.00 59.96  ? 277 ALA E CA  1 
ATOM 10472 C C   . ALA E 1 277 ? -68.302 -0.701  -26.652 1.00 65.37  ? 277 ALA E C   1 
ATOM 10473 O O   . ALA E 1 277 ? -68.655 -0.367  -27.791 1.00 64.73  ? 277 ALA E O   1 
ATOM 10474 C CB  . ALA E 1 277 ? -68.241 -2.968  -25.566 1.00 60.51  ? 277 ALA E CB  1 
ATOM 10475 N N   . LYS E 1 278 ? -68.498 0.060   -25.556 1.00 62.95  ? 278 LYS E N   1 
ATOM 10476 C CA  . LYS E 1 278 ? -69.225 1.330   -25.502 1.00 62.57  ? 278 LYS E CA  1 
ATOM 10477 C C   . LYS E 1 278 ? -68.583 2.376   -26.424 1.00 69.43  ? 278 LYS E C   1 
ATOM 10478 O O   . LYS E 1 278 ? -69.299 3.055   -27.160 1.00 70.51  ? 278 LYS E O   1 
ATOM 10479 C CB  . LYS E 1 278 ? -69.290 1.849   -24.059 1.00 63.44  ? 278 LYS E CB  1 
ATOM 10480 C CG  . LYS E 1 278 ? -70.153 0.993   -23.131 1.00 68.51  ? 278 LYS E CG  1 
ATOM 10481 C CD  . LYS E 1 278 ? -69.756 1.165   -21.670 1.00 79.50  ? 278 LYS E CD  1 
ATOM 10482 C CE  . LYS E 1 278 ? -70.612 0.336   -20.741 1.00 95.56  ? 278 LYS E CE  1 
ATOM 10483 N NZ  . LYS E 1 278 ? -70.122 0.387   -19.337 1.00 106.62 ? 278 LYS E NZ  1 
ATOM 10484 N N   . ALA E 1 279 ? -67.236 2.468   -26.410 1.00 66.15  ? 279 ALA E N   1 
ATOM 10485 C CA  . ALA E 1 279 ? -66.438 3.387   -27.222 1.00 65.64  ? 279 ALA E CA  1 
ATOM 10486 C C   . ALA E 1 279 ? -66.602 3.141   -28.736 1.00 70.30  ? 279 ALA E C   1 
ATOM 10487 O O   . ALA E 1 279 ? -66.640 4.100   -29.501 1.00 70.12  ? 279 ALA E O   1 
ATOM 10488 C CB  . ALA E 1 279 ? -64.978 3.268   -26.840 1.00 66.06  ? 279 ALA E CB  1 
ATOM 10489 N N   . GLY E 1 280 ? -66.704 1.877   -29.143 1.00 67.38  ? 280 GLY E N   1 
ATOM 10490 C CA  . GLY E 1 280 ? -66.858 1.505   -30.547 1.00 67.09  ? 280 GLY E CA  1 
ATOM 10491 C C   . GLY E 1 280 ? -65.694 0.757   -31.188 1.00 70.43  ? 280 GLY E C   1 
ATOM 10492 O O   . GLY E 1 280 ? -65.712 0.535   -32.405 1.00 69.84  ? 280 GLY E O   1 
ATOM 10493 N N   . VAL E 1 281 ? -64.669 0.348   -30.387 1.00 65.24  ? 281 VAL E N   1 
ATOM 10494 C CA  . VAL E 1 281 ? -63.533 -0.410  -30.927 1.00 62.98  ? 281 VAL E CA  1 
ATOM 10495 C C   . VAL E 1 281 ? -64.089 -1.802  -31.307 1.00 64.70  ? 281 VAL E C   1 
ATOM 10496 O O   . VAL E 1 281 ? -64.922 -2.358  -30.586 1.00 63.64  ? 281 VAL E O   1 
ATOM 10497 C CB  . VAL E 1 281 ? -62.226 -0.421  -30.063 1.00 64.85  ? 281 VAL E CB  1 
ATOM 10498 C CG1 . VAL E 1 281 ? -62.388 0.289   -28.730 1.00 63.99  ? 281 VAL E CG1 1 
ATOM 10499 C CG2 . VAL E 1 281 ? -61.638 -1.809  -29.894 1.00 64.30  ? 281 VAL E CG2 1 
ATOM 10500 N N   . LYS E 1 282 ? -63.703 -2.285  -32.499 1.00 60.04  ? 282 LYS E N   1 
ATOM 10501 C CA  . LYS E 1 282 ? -64.216 -3.507  -33.106 1.00 59.60  ? 282 LYS E CA  1 
ATOM 10502 C C   . LYS E 1 282 ? -63.128 -4.548  -33.376 1.00 63.64  ? 282 LYS E C   1 
ATOM 10503 O O   . LYS E 1 282 ? -61.984 -4.180  -33.630 1.00 63.62  ? 282 LYS E O   1 
ATOM 10504 C CB  . LYS E 1 282 ? -64.916 -3.144  -34.430 1.00 61.21  ? 282 LYS E CB  1 
ATOM 10505 C CG  . LYS E 1 282 ? -66.161 -2.277  -34.256 1.00 76.05  ? 282 LYS E CG  1 
ATOM 10506 C CD  . LYS E 1 282 ? -66.987 -2.232  -35.535 1.00 87.85  ? 282 LYS E CD  1 
ATOM 10507 C CE  . LYS E 1 282 ? -68.294 -1.510  -35.345 1.00 92.74  ? 282 LYS E CE  1 
ATOM 10508 N NZ  . LYS E 1 282 ? -69.273 -1.871  -36.408 1.00 93.64  ? 282 LYS E NZ  1 
ATOM 10509 N N   . ALA E 1 283 ? -63.494 -5.854  -33.361 1.00 59.34  ? 283 ALA E N   1 
ATOM 10510 C CA  . ALA E 1 283 ? -62.560 -6.939  -33.703 1.00 58.64  ? 283 ALA E CA  1 
ATOM 10511 C C   . ALA E 1 283 ? -61.984 -6.699  -35.112 1.00 66.75  ? 283 ALA E C   1 
ATOM 10512 O O   . ALA E 1 283 ? -62.715 -6.282  -36.018 1.00 67.18  ? 283 ALA E O   1 
ATOM 10513 C CB  . ALA E 1 283 ? -63.258 -8.287  -33.637 1.00 58.24  ? 283 ALA E CB  1 
ATOM 10514 N N   . GLY E 1 284 ? -60.676 -6.888  -35.255 1.00 64.34  ? 284 GLY E N   1 
ATOM 10515 C CA  . GLY E 1 284 ? -59.962 -6.657  -36.506 1.00 64.09  ? 284 GLY E CA  1 
ATOM 10516 C C   . GLY E 1 284 ? -59.237 -5.322  -36.522 1.00 68.11  ? 284 GLY E C   1 
ATOM 10517 O O   . GLY E 1 284 ? -58.461 -5.050  -37.444 1.00 68.09  ? 284 GLY E O   1 
ATOM 10518 N N   . ASP E 1 285 ? -59.490 -4.471  -35.500 1.00 64.18  ? 285 ASP E N   1 
ATOM 10519 C CA  . ASP E 1 285 ? -58.825 -3.170  -35.382 1.00 63.78  ? 285 ASP E CA  1 
ATOM 10520 C C   . ASP E 1 285 ? -57.369 -3.344  -34.974 1.00 67.48  ? 285 ASP E C   1 
ATOM 10521 O O   . ASP E 1 285 ? -57.009 -4.331  -34.328 1.00 66.91  ? 285 ASP E O   1 
ATOM 10522 C CB  . ASP E 1 285 ? -59.540 -2.246  -34.371 1.00 65.56  ? 285 ASP E CB  1 
ATOM 10523 C CG  . ASP E 1 285 ? -60.925 -1.731  -34.762 1.00 78.37  ? 285 ASP E CG  1 
ATOM 10524 O OD1 . ASP E 1 285 ? -61.386 -2.038  -35.894 1.00 78.14  ? 285 ASP E OD1 1 
ATOM 10525 O OD2 . ASP E 1 285 ? -61.582 -1.088  -33.908 1.00 85.77  ? 285 ASP E OD2 1 
ATOM 10526 N N   . ILE E 1 286 ? -56.533 -2.370  -35.344 1.00 63.74  ? 286 ILE E N   1 
ATOM 10527 C CA  . ILE E 1 286 ? -55.121 -2.391  -35.000 1.00 62.33  ? 286 ILE E CA  1 
ATOM 10528 C C   . ILE E 1 286 ? -54.825 -1.149  -34.183 1.00 62.74  ? 286 ILE E C   1 
ATOM 10529 O O   . ILE E 1 286 ? -54.772 -0.051  -34.734 1.00 62.36  ? 286 ILE E O   1 
ATOM 10530 C CB  . ILE E 1 286 ? -54.205 -2.557  -36.249 1.00 65.33  ? 286 ILE E CB  1 
ATOM 10531 C CG1 . ILE E 1 286 ? -54.502 -3.917  -36.919 1.00 66.07  ? 286 ILE E CG1 1 
ATOM 10532 C CG2 . ILE E 1 286 ? -52.716 -2.454  -35.865 1.00 65.26  ? 286 ILE E CG2 1 
ATOM 10533 C CD1 . ILE E 1 286 ? -54.409 -3.947  -38.356 1.00 73.60  ? 286 ILE E CD1 1 
ATOM 10534 N N   . ILE E 1 287 ? -54.653 -1.329  -32.854 1.00 56.76  ? 287 ILE E N   1 
ATOM 10535 C CA  . ILE E 1 287 ? -54.308 -0.237  -31.943 1.00 54.57  ? 287 ILE E CA  1 
ATOM 10536 C C   . ILE E 1 287 ? -52.837 0.097   -32.176 1.00 57.53  ? 287 ILE E C   1 
ATOM 10537 O O   . ILE E 1 287 ? -51.973 -0.748  -31.969 1.00 57.88  ? 287 ILE E O   1 
ATOM 10538 C CB  . ILE E 1 287 ? -54.648 -0.530  -30.459 1.00 56.84  ? 287 ILE E CB  1 
ATOM 10539 C CG1 . ILE E 1 287 ? -56.115 -1.011  -30.323 1.00 57.06  ? 287 ILE E CG1 1 
ATOM 10540 C CG2 . ILE E 1 287 ? -54.376 0.706   -29.582 1.00 56.79  ? 287 ILE E CG2 1 
ATOM 10541 C CD1 . ILE E 1 287 ? -56.472 -1.614  -28.987 1.00 58.49  ? 287 ILE E CD1 1 
ATOM 10542 N N   . THR E 1 288 ? -52.583 1.309   -32.672 1.00 53.08  ? 288 THR E N   1 
ATOM 10543 C CA  . THR E 1 288 ? -51.292 1.879   -33.078 1.00 51.90  ? 288 THR E CA  1 
ATOM 10544 C C   . THR E 1 288 ? -50.728 2.841   -32.003 1.00 54.96  ? 288 THR E C   1 
ATOM 10545 O O   . THR E 1 288 ? -49.502 2.979   -31.879 1.00 53.83  ? 288 THR E O   1 
ATOM 10546 C CB  . THR E 1 288 ? -51.560 2.620   -34.412 1.00 57.44  ? 288 THR E CB  1 
ATOM 10547 O OG1 . THR E 1 288 ? -51.791 1.649   -35.425 1.00 58.41  ? 288 THR E OG1 1 
ATOM 10548 C CG2 . THR E 1 288 ? -50.447 3.581   -34.842 1.00 57.71  ? 288 THR E CG2 1 
ATOM 10549 N N   . SER E 1 289 ? -51.621 3.543   -31.282 1.00 50.48  ? 289 SER E N   1 
ATOM 10550 C CA  . SER E 1 289 ? -51.237 4.550   -30.313 1.00 50.32  ? 289 SER E CA  1 
ATOM 10551 C C   . SER E 1 289 ? -52.059 4.495   -29.055 1.00 52.75  ? 289 SER E C   1 
ATOM 10552 O O   . SER E 1 289 ? -53.208 4.048   -29.059 1.00 49.98  ? 289 SER E O   1 
ATOM 10553 C CB  . SER E 1 289 ? -51.410 5.943   -30.911 1.00 56.45  ? 289 SER E CB  1 
ATOM 10554 O OG  . SER E 1 289 ? -50.528 6.152   -32.000 1.00 79.34  ? 289 SER E OG  1 
ATOM 10555 N N   . LEU E 1 290 ? -51.468 5.021   -27.989 1.00 49.62  ? 290 LEU E N   1 
ATOM 10556 C CA  . LEU E 1 290 ? -52.104 5.242   -26.709 1.00 50.06  ? 290 LEU E CA  1 
ATOM 10557 C C   . LEU E 1 290 ? -51.761 6.676   -26.315 1.00 57.65  ? 290 LEU E C   1 
ATOM 10558 O O   . LEU E 1 290 ? -50.577 7.021   -26.223 1.00 57.96  ? 290 LEU E O   1 
ATOM 10559 C CB  . LEU E 1 290 ? -51.668 4.212   -25.655 1.00 49.43  ? 290 LEU E CB  1 
ATOM 10560 C CG  . LEU E 1 290 ? -52.266 4.379   -24.269 1.00 53.14  ? 290 LEU E CG  1 
ATOM 10561 C CD1 . LEU E 1 290 ? -53.790 4.264   -24.294 1.00 53.10  ? 290 LEU E CD1 1 
ATOM 10562 C CD2 . LEU E 1 290 ? -51.657 3.385   -23.300 1.00 55.52  ? 290 LEU E CD2 1 
ATOM 10563 N N   . ASN E 1 291 ? -52.799 7.528   -26.187 1.00 54.83  ? 291 ASN E N   1 
ATOM 10564 C CA  . ASN E 1 291 ? -52.713 8.946   -25.854 1.00 54.69  ? 291 ASN E CA  1 
ATOM 10565 C C   . ASN E 1 291 ? -51.726 9.687   -26.791 1.00 61.83  ? 291 ASN E C   1 
ATOM 10566 O O   . ASN E 1 291 ? -50.911 10.492  -26.335 1.00 62.91  ? 291 ASN E O   1 
ATOM 10567 C CB  . ASN E 1 291 ? -52.353 9.123   -24.379 1.00 52.27  ? 291 ASN E CB  1 
ATOM 10568 C CG  . ASN E 1 291 ? -53.394 8.564   -23.431 1.00 69.28  ? 291 ASN E CG  1 
ATOM 10569 O OD1 . ASN E 1 291 ? -54.601 8.573   -23.701 1.00 74.01  ? 291 ASN E OD1 1 
ATOM 10570 N ND2 . ASN E 1 291 ? -52.951 8.075   -22.292 1.00 49.26  ? 291 ASN E ND2 1 
ATOM 10571 N N   . GLY E 1 292 ? -51.812 9.390   -28.090 1.00 58.11  ? 292 GLY E N   1 
ATOM 10572 C CA  . GLY E 1 292 ? -50.955 9.996   -29.102 1.00 57.92  ? 292 GLY E CA  1 
ATOM 10573 C C   . GLY E 1 292 ? -49.549 9.436   -29.214 1.00 61.96  ? 292 GLY E C   1 
ATOM 10574 O O   . GLY E 1 292 ? -48.823 9.796   -30.148 1.00 61.83  ? 292 GLY E O   1 
ATOM 10575 N N   . LYS E 1 293 ? -49.140 8.560   -28.271 1.00 58.33  ? 293 LYS E N   1 
ATOM 10576 C CA  . LYS E 1 293 ? -47.806 7.962   -28.300 1.00 58.18  ? 293 LYS E CA  1 
ATOM 10577 C C   . LYS E 1 293 ? -47.849 6.598   -28.993 1.00 63.83  ? 293 LYS E C   1 
ATOM 10578 O O   . LYS E 1 293 ? -48.605 5.725   -28.542 1.00 64.33  ? 293 LYS E O   1 
ATOM 10579 C CB  . LYS E 1 293 ? -47.208 7.838   -26.894 1.00 60.00  ? 293 LYS E CB  1 
ATOM 10580 C CG  . LYS E 1 293 ? -45.717 7.551   -26.930 1.00 67.28  ? 293 LYS E CG  1 
ATOM 10581 C CD  . LYS E 1 293 ? -45.134 7.238   -25.557 1.00 72.22  ? 293 LYS E CD  1 
ATOM 10582 C CE  . LYS E 1 293 ? -43.727 6.695   -25.634 1.00 67.66  ? 293 LYS E CE  1 
ATOM 10583 N NZ  . LYS E 1 293 ? -42.767 7.690   -26.171 1.00 67.15  ? 293 LYS E NZ  1 
ATOM 10584 N N   . PRO E 1 294 ? -47.031 6.392   -30.071 1.00 59.94  ? 294 PRO E N   1 
ATOM 10585 C CA  . PRO E 1 294 ? -47.028 5.085   -30.763 1.00 59.61  ? 294 PRO E CA  1 
ATOM 10586 C C   . PRO E 1 294 ? -46.640 3.907   -29.865 1.00 64.88  ? 294 PRO E C   1 
ATOM 10587 O O   . PRO E 1 294 ? -45.740 4.022   -29.025 1.00 64.90  ? 294 PRO E O   1 
ATOM 10588 C CB  . PRO E 1 294 ? -45.980 5.265   -31.873 1.00 60.67  ? 294 PRO E CB  1 
ATOM 10589 C CG  . PRO E 1 294 ? -45.838 6.722   -32.046 1.00 64.78  ? 294 PRO E CG  1 
ATOM 10590 C CD  . PRO E 1 294 ? -46.087 7.336   -30.709 1.00 60.53  ? 294 PRO E CD  1 
ATOM 10591 N N   . LEU E 1 295 ? -47.324 2.772   -30.062 1.00 61.69  ? 295 LEU E N   1 
ATOM 10592 C CA  . LEU E 1 295 ? -47.076 1.529   -29.343 1.00 61.53  ? 295 LEU E CA  1 
ATOM 10593 C C   . LEU E 1 295 ? -46.103 0.639   -30.118 1.00 67.10  ? 295 LEU E C   1 
ATOM 10594 O O   . LEU E 1 295 ? -46.305 0.425   -31.327 1.00 68.02  ? 295 LEU E O   1 
ATOM 10595 C CB  . LEU E 1 295 ? -48.397 0.768   -29.131 1.00 61.38  ? 295 LEU E CB  1 
ATOM 10596 C CG  . LEU E 1 295 ? -49.412 1.359   -28.173 1.00 65.82  ? 295 LEU E CG  1 
ATOM 10597 C CD1 . LEU E 1 295 ? -50.761 0.760   -28.431 1.00 66.61  ? 295 LEU E CD1 1 
ATOM 10598 C CD2 . LEU E 1 295 ? -49.008 1.150   -26.715 1.00 66.78  ? 295 LEU E CD2 1 
ATOM 10599 N N   . ASN E 1 296 ? -45.069 0.092   -29.439 1.00 61.84  ? 296 ASN E N   1 
ATOM 10600 C CA  . ASN E 1 296 ? -44.152 -0.810  -30.132 1.00 60.54  ? 296 ASN E CA  1 
ATOM 10601 C C   . ASN E 1 296 ? -44.614 -2.268  -29.967 1.00 61.00  ? 296 ASN E C   1 
ATOM 10602 O O   . ASN E 1 296 ? -44.069 -3.165  -30.620 1.00 59.76  ? 296 ASN E O   1 
ATOM 10603 C CB  . ASN E 1 296 ? -42.674 -0.618  -29.727 1.00 62.77  ? 296 ASN E CB  1 
ATOM 10604 C CG  . ASN E 1 296 ? -42.337 -0.631  -28.258 1.00 96.93  ? 296 ASN E CG  1 
ATOM 10605 O OD1 . ASN E 1 296 ? -42.716 -1.539  -27.499 1.00 92.42  ? 296 ASN E OD1 1 
ATOM 10606 N ND2 . ASN E 1 296 ? -41.523 0.344   -27.848 1.00 91.04  ? 296 ASN E ND2 1 
ATOM 10607 N N   . SER E 1 297 ? -45.668 -2.499  -29.152 1.00 55.73  ? 297 SER E N   1 
ATOM 10608 C CA  . SER E 1 297 ? -46.187 -3.846  -28.891 1.00 54.79  ? 297 SER E CA  1 
ATOM 10609 C C   . SER E 1 297 ? -47.516 -3.851  -28.117 1.00 58.27  ? 297 SER E C   1 
ATOM 10610 O O   . SER E 1 297 ? -47.844 -2.900  -27.392 1.00 58.59  ? 297 SER E O   1 
ATOM 10611 C CB  . SER E 1 297 ? -45.161 -4.667  -28.097 1.00 56.87  ? 297 SER E CB  1 
ATOM 10612 O OG  . SER E 1 297 ? -44.834 -4.107  -26.833 1.00 59.39  ? 297 SER E OG  1 
ATOM 10613 N N   . PHE E 1 298 ? -48.233 -4.980  -28.215 1.00 53.69  ? 298 PHE E N   1 
ATOM 10614 C CA  . PHE E 1 298 ? -49.452 -5.254  -27.468 1.00 53.63  ? 298 PHE E CA  1 
ATOM 10615 C C   . PHE E 1 298 ? -49.092 -5.377  -25.966 1.00 58.32  ? 298 PHE E C   1 
ATOM 10616 O O   . PHE E 1 298 ? -49.858 -4.951  -25.099 1.00 59.03  ? 298 PHE E O   1 
ATOM 10617 C CB  . PHE E 1 298 ? -50.130 -6.528  -28.000 1.00 55.82  ? 298 PHE E CB  1 
ATOM 10618 C CG  . PHE E 1 298 ? -51.280 -7.005  -27.151 1.00 58.87  ? 298 PHE E CG  1 
ATOM 10619 C CD1 . PHE E 1 298 ? -52.509 -6.363  -27.193 1.00 62.07  ? 298 PHE E CD1 1 
ATOM 10620 C CD2 . PHE E 1 298 ? -51.126 -8.078  -26.280 1.00 63.54  ? 298 PHE E CD2 1 
ATOM 10621 C CE1 . PHE E 1 298 ? -53.566 -6.781  -26.392 1.00 63.64  ? 298 PHE E CE1 1 
ATOM 10622 C CE2 . PHE E 1 298 ? -52.186 -8.498  -25.469 1.00 66.80  ? 298 PHE E CE2 1 
ATOM 10623 C CZ  . PHE E 1 298 ? -53.399 -7.843  -25.531 1.00 64.80  ? 298 PHE E CZ  1 
ATOM 10624 N N   . ALA E 1 299 ? -47.907 -5.942  -25.682 1.00 53.91  ? 299 ALA E N   1 
ATOM 10625 C CA  . ALA E 1 299 ? -47.339 -6.097  -24.349 1.00 53.43  ? 299 ALA E CA  1 
ATOM 10626 C C   . ALA E 1 299 ? -47.146 -4.740  -23.669 1.00 57.19  ? 299 ALA E C   1 
ATOM 10627 O O   . ALA E 1 299 ? -47.385 -4.635  -22.462 1.00 58.39  ? 299 ALA E O   1 
ATOM 10628 C CB  . ALA E 1 299 ? -46.010 -6.826  -24.436 1.00 53.97  ? 299 ALA E CB  1 
ATOM 10629 N N   . GLU E 1 300 ? -46.741 -3.705  -24.446 1.00 51.47  ? 300 GLU E N   1 
ATOM 10630 C CA  . GLU E 1 300 ? -46.570 -2.335  -23.964 1.00 50.66  ? 300 GLU E CA  1 
ATOM 10631 C C   . GLU E 1 300 ? -47.937 -1.783  -23.611 1.00 57.75  ? 300 GLU E C   1 
ATOM 10632 O O   . GLU E 1 300 ? -48.100 -1.215  -22.522 1.00 58.21  ? 300 GLU E O   1 
ATOM 10633 C CB  . GLU E 1 300 ? -45.878 -1.455  -25.017 1.00 51.51  ? 300 GLU E CB  1 
ATOM 10634 C CG  . GLU E 1 300 ? -45.638 -0.024  -24.556 1.00 58.00  ? 300 GLU E CG  1 
ATOM 10635 C CD  . GLU E 1 300 ? -45.104 0.977   -25.562 1.00 77.01  ? 300 GLU E CD  1 
ATOM 10636 O OE1 . GLU E 1 300 ? -44.720 0.569   -26.681 1.00 69.73  ? 300 GLU E OE1 1 
ATOM 10637 O OE2 . GLU E 1 300 ? -45.075 2.184   -25.227 1.00 76.35  ? 300 GLU E OE2 1 
ATOM 10638 N N   . LEU E 1 301 ? -48.932 -1.988  -24.524 1.00 53.78  ? 301 LEU E N   1 
ATOM 10639 C CA  . LEU E 1 301 ? -50.313 -1.558  -24.341 1.00 52.67  ? 301 LEU E CA  1 
ATOM 10640 C C   . LEU E 1 301 ? -50.872 -2.184  -23.061 1.00 54.99  ? 301 LEU E C   1 
ATOM 10641 O O   . LEU E 1 301 ? -51.369 -1.446  -22.197 1.00 53.93  ? 301 LEU E O   1 
ATOM 10642 C CB  . LEU E 1 301 ? -51.139 -1.953  -25.573 1.00 52.73  ? 301 LEU E CB  1 
ATOM 10643 C CG  . LEU E 1 301 ? -52.525 -1.306  -25.855 1.00 56.91  ? 301 LEU E CG  1 
ATOM 10644 C CD1 . LEU E 1 301 ? -53.632 -2.308  -25.769 1.00 57.26  ? 301 LEU E CD1 1 
ATOM 10645 C CD2 . LEU E 1 301 ? -52.797 -0.027  -25.067 1.00 56.98  ? 301 LEU E CD2 1 
ATOM 10646 N N   . ARG E 1 302 ? -50.700 -3.514  -22.906 1.00 49.90  ? 302 ARG E N   1 
ATOM 10647 C CA  . ARG E 1 302 ? -51.162 -4.274  -21.752 1.00 50.40  ? 302 ARG E CA  1 
ATOM 10648 C C   . ARG E 1 302 ? -50.637 -3.656  -20.422 1.00 56.23  ? 302 ARG E C   1 
ATOM 10649 O O   . ARG E 1 302 ? -51.438 -3.322  -19.554 1.00 56.02  ? 302 ARG E O   1 
ATOM 10650 C CB  . ARG E 1 302 ? -50.751 -5.754  -21.899 1.00 52.35  ? 302 ARG E CB  1 
ATOM 10651 C CG  . ARG E 1 302 ? -51.388 -6.695  -20.872 1.00 65.01  ? 302 ARG E CG  1 
ATOM 10652 C CD  . ARG E 1 302 ? -50.906 -8.123  -21.030 1.00 78.09  ? 302 ARG E CD  1 
ATOM 10653 N NE  . ARG E 1 302 ? -50.916 -8.848  -19.750 1.00 95.92  ? 302 ARG E NE  1 
ATOM 10654 C CZ  . ARG E 1 302 ? -49.868 -8.978  -18.930 1.00 110.89 ? 302 ARG E CZ  1 
ATOM 10655 N NH1 . ARG E 1 302 ? -48.695 -8.432  -19.242 1.00 96.93  ? 302 ARG E NH1 1 
ATOM 10656 N NH2 . ARG E 1 302 ? -49.985 -9.662  -17.795 1.00 90.74  ? 302 ARG E NH2 1 
ATOM 10657 N N   . SER E 1 303 ? -49.320 -3.439  -20.302 1.00 54.49  ? 303 SER E N   1 
ATOM 10658 C CA  . SER E 1 303 ? -48.677 -2.881  -19.105 1.00 53.82  ? 303 SER E CA  1 
ATOM 10659 C C   . SER E 1 303 ? -48.988 -1.399  -18.898 1.00 57.24  ? 303 SER E C   1 
ATOM 10660 O O   . SER E 1 303 ? -49.042 -0.959  -17.762 1.00 57.98  ? 303 SER E O   1 
ATOM 10661 C CB  . SER E 1 303 ? -47.173 -3.104  -19.148 1.00 57.04  ? 303 SER E CB  1 
ATOM 10662 O OG  . SER E 1 303 ? -46.658 -2.609  -20.368 1.00 69.10  ? 303 SER E OG  1 
ATOM 10663 N N   . ARG E 1 304 ? -49.220 -0.630  -19.951 1.00 53.50  ? 304 ARG E N   1 
ATOM 10664 C CA  . ARG E 1 304 ? -49.579 0.773   -19.765 1.00 52.83  ? 304 ARG E CA  1 
ATOM 10665 C C   . ARG E 1 304 ? -51.018 0.910   -19.252 1.00 61.51  ? 304 ARG E C   1 
ATOM 10666 O O   . ARG E 1 304 ? -51.254 1.751   -18.384 1.00 64.06  ? 304 ARG E O   1 
ATOM 10667 C CB  . ARG E 1 304 ? -49.416 1.551   -21.060 1.00 50.15  ? 304 ARG E CB  1 
ATOM 10668 C CG  . ARG E 1 304 ? -47.987 1.917   -21.384 1.00 57.77  ? 304 ARG E CG  1 
ATOM 10669 C CD  . ARG E 1 304 ? -47.924 2.736   -22.650 1.00 47.33  ? 304 ARG E CD  1 
ATOM 10670 N NE  . ARG E 1 304 ? -46.577 3.234   -22.953 1.00 50.95  ? 304 ARG E NE  1 
ATOM 10671 C CZ  . ARG E 1 304 ? -46.058 4.375   -22.500 1.00 66.15  ? 304 ARG E CZ  1 
ATOM 10672 N NH1 . ARG E 1 304 ? -46.725 5.117   -21.620 1.00 50.80  ? 304 ARG E NH1 1 
ATOM 10673 N NH2 . ARG E 1 304 ? -44.848 4.759   -22.886 1.00 60.10  ? 304 ARG E NH2 1 
ATOM 10674 N N   . ILE E 1 305 ? -51.987 0.099   -19.760 1.00 57.70  ? 305 ILE E N   1 
ATOM 10675 C CA  . ILE E 1 305 ? -53.368 0.288   -19.310 1.00 56.90  ? 305 ILE E CA  1 
ATOM 10676 C C   . ILE E 1 305 ? -53.628 -0.376  -17.955 1.00 60.02  ? 305 ILE E C   1 
ATOM 10677 O O   . ILE E 1 305 ? -54.494 0.127   -17.242 1.00 60.07  ? 305 ILE E O   1 
ATOM 10678 C CB  . ILE E 1 305 ? -54.491 -0.049  -20.337 1.00 59.42  ? 305 ILE E CB  1 
ATOM 10679 C CG1 . ILE E 1 305 ? -54.626 -1.558  -20.605 1.00 60.01  ? 305 ILE E CG1 1 
ATOM 10680 C CG2 . ILE E 1 305 ? -54.459 0.880   -21.591 1.00 58.29  ? 305 ILE E CG2 1 
ATOM 10681 C CD1 . ILE E 1 305 ? -54.348 -2.063  -21.994 1.00 70.45  ? 305 ILE E CD1 1 
ATOM 10682 N N   . ALA E 1 306 ? -52.890 -1.459  -17.581 1.00 55.38  ? 306 ALA E N   1 
ATOM 10683 C CA  . ALA E 1 306 ? -53.073 -2.153  -16.286 1.00 54.57  ? 306 ALA E CA  1 
ATOM 10684 C C   . ALA E 1 306 ? -52.505 -1.328  -15.133 1.00 60.60  ? 306 ALA E C   1 
ATOM 10685 O O   . ALA E 1 306 ? -52.889 -1.507  -13.969 1.00 59.18  ? 306 ALA E O   1 
ATOM 10686 C CB  . ALA E 1 306 ? -52.416 -3.517  -16.320 1.00 54.88  ? 306 ALA E CB  1 
ATOM 10687 N N   . THR E 1 307 ? -51.612 -0.394  -15.496 1.00 59.99  ? 307 THR E N   1 
ATOM 10688 C CA  . THR E 1 307 ? -50.867 0.558   -14.672 1.00 60.72  ? 307 THR E CA  1 
ATOM 10689 C C   . THR E 1 307 ? -51.681 1.870   -14.475 1.00 66.87  ? 307 THR E C   1 
ATOM 10690 O O   . THR E 1 307 ? -51.438 2.605   -13.515 1.00 66.03  ? 307 THR E O   1 
ATOM 10691 C CB  . THR E 1 307 ? -49.511 0.721   -15.347 1.00 63.35  ? 307 THR E CB  1 
ATOM 10692 O OG1 . THR E 1 307 ? -48.589 -0.100  -14.646 1.00 61.32  ? 307 THR E OG1 1 
ATOM 10693 C CG2 . THR E 1 307 ? -49.038 2.168   -15.514 1.00 62.65  ? 307 THR E CG2 1 
ATOM 10694 N N   . THR E 1 308 ? -52.656 2.127   -15.378 1.00 64.75  ? 308 THR E N   1 
ATOM 10695 C CA  . THR E 1 308 ? -53.593 3.254   -15.346 1.00 64.06  ? 308 THR E CA  1 
ATOM 10696 C C   . THR E 1 308 ? -54.827 2.854   -14.497 1.00 65.80  ? 308 THR E C   1 
ATOM 10697 O O   . THR E 1 308 ? -55.304 1.716   -14.559 1.00 64.31  ? 308 THR E O   1 
ATOM 10698 C CB  . THR E 1 308 ? -53.958 3.688   -16.782 1.00 72.89  ? 308 THR E CB  1 
ATOM 10699 O OG1 . THR E 1 308 ? -52.775 3.700   -17.595 1.00 71.48  ? 308 THR E OG1 1 
ATOM 10700 C CG2 . THR E 1 308 ? -54.634 5.059   -16.827 1.00 68.92  ? 308 THR E CG2 1 
ATOM 10701 N N   . GLU E 1 309 ? -55.308 3.797   -13.692 1.00 63.37  ? 309 GLU E N   1 
ATOM 10702 C CA  . GLU E 1 309 ? -56.428 3.638   -12.762 1.00 64.06  ? 309 GLU E CA  1 
ATOM 10703 C C   . GLU E 1 309 ? -57.782 3.430   -13.470 1.00 68.53  ? 309 GLU E C   1 
ATOM 10704 O O   . GLU E 1 309 ? -58.079 4.172   -14.412 1.00 69.07  ? 309 GLU E O   1 
ATOM 10705 C CB  . GLU E 1 309 ? -56.518 4.895   -11.875 1.00 65.65  ? 309 GLU E CB  1 
ATOM 10706 C CG  . GLU E 1 309 ? -56.987 4.633   -10.456 1.00 76.29  ? 309 GLU E CG  1 
ATOM 10707 C CD  . GLU E 1 309 ? -57.226 5.888   -9.644  1.00 94.13  ? 309 GLU E CD  1 
ATOM 10708 O OE1 . GLU E 1 309 ? -58.399 6.141   -9.283  1.00 85.16  ? 309 GLU E OE1 1 
ATOM 10709 O OE2 . GLU E 1 309 ? -56.246 6.623   -9.379  1.00 82.08  ? 309 GLU E OE2 1 
ATOM 10710 N N   . PRO E 1 310 ? -58.652 2.486   -13.008 1.00 63.79  ? 310 PRO E N   1 
ATOM 10711 C CA  . PRO E 1 310 ? -59.990 2.357   -13.620 1.00 63.38  ? 310 PRO E CA  1 
ATOM 10712 C C   . PRO E 1 310 ? -60.774 3.674   -13.526 1.00 66.89  ? 310 PRO E C   1 
ATOM 10713 O O   . PRO E 1 310 ? -60.669 4.392   -12.528 1.00 66.38  ? 310 PRO E O   1 
ATOM 10714 C CB  . PRO E 1 310 ? -60.656 1.260   -12.778 1.00 65.17  ? 310 PRO E CB  1 
ATOM 10715 C CG  . PRO E 1 310 ? -59.531 0.499   -12.173 1.00 69.38  ? 310 PRO E CG  1 
ATOM 10716 C CD  . PRO E 1 310 ? -58.490 1.532   -11.892 1.00 64.86  ? 310 PRO E CD  1 
ATOM 10717 N N   . GLY E 1 311 ? -61.516 3.995   -14.574 1.00 63.12  ? 311 GLY E N   1 
ATOM 10718 C CA  . GLY E 1 311 ? -62.280 5.231   -14.652 1.00 62.48  ? 311 GLY E CA  1 
ATOM 10719 C C   . GLY E 1 311 ? -61.592 6.280   -15.501 1.00 65.96  ? 311 GLY E C   1 
ATOM 10720 O O   . GLY E 1 311 ? -62.247 7.204   -15.998 1.00 65.27  ? 311 GLY E O   1 
ATOM 10721 N N   . THR E 1 312 ? -60.258 6.133   -15.686 1.00 62.30  ? 312 THR E N   1 
ATOM 10722 C CA  . THR E 1 312 ? -59.451 7.040   -16.509 1.00 61.51  ? 312 THR E CA  1 
ATOM 10723 C C   . THR E 1 312 ? -59.836 6.885   -17.975 1.00 63.44  ? 312 THR E C   1 
ATOM 10724 O O   . THR E 1 312 ? -60.105 5.775   -18.436 1.00 62.34  ? 312 THR E O   1 
ATOM 10725 C CB  . THR E 1 312 ? -57.941 6.782   -16.310 1.00 68.97  ? 312 THR E CB  1 
ATOM 10726 O OG1 . THR E 1 312 ? -57.646 6.707   -14.916 1.00 71.86  ? 312 THR E OG1 1 
ATOM 10727 C CG2 . THR E 1 312 ? -57.062 7.856   -16.962 1.00 65.18  ? 312 THR E CG2 1 
ATOM 10728 N N   . LYS E 1 313 ? -59.876 8.005   -18.692 1.00 60.23  ? 313 LYS E N   1 
ATOM 10729 C CA  . LYS E 1 313 ? -60.172 8.023   -20.115 1.00 60.66  ? 313 LYS E CA  1 
ATOM 10730 C C   . LYS E 1 313 ? -58.871 8.035   -20.887 1.00 64.41  ? 313 LYS E C   1 
ATOM 10731 O O   . LYS E 1 313 ? -57.955 8.772   -20.529 1.00 65.63  ? 313 LYS E O   1 
ATOM 10732 C CB  . LYS E 1 313 ? -61.059 9.220   -20.481 1.00 64.50  ? 313 LYS E CB  1 
ATOM 10733 C CG  . LYS E 1 313 ? -62.500 9.065   -20.012 1.00 85.03  ? 313 LYS E CG  1 
ATOM 10734 C CD  . LYS E 1 313 ? -63.400 10.107  -20.636 1.00 97.85  ? 313 LYS E CD  1 
ATOM 10735 C CE  . LYS E 1 313 ? -64.799 10.021  -20.093 1.00 108.59 ? 313 LYS E CE  1 
ATOM 10736 N NZ  . LYS E 1 313 ? -65.743 10.796  -20.932 1.00 115.77 ? 313 LYS E NZ  1 
ATOM 10737 N N   . VAL E 1 314 ? -58.761 7.180   -21.905 1.00 60.29  ? 314 VAL E N   1 
ATOM 10738 C CA  . VAL E 1 314 ? -57.554 7.054   -22.733 1.00 60.22  ? 314 VAL E CA  1 
ATOM 10739 C C   . VAL E 1 314 ? -57.932 7.215   -24.189 1.00 64.52  ? 314 VAL E C   1 
ATOM 10740 O O   . VAL E 1 314 ? -59.047 6.880   -24.573 1.00 65.67  ? 314 VAL E O   1 
ATOM 10741 C CB  . VAL E 1 314 ? -56.756 5.731   -22.496 1.00 64.27  ? 314 VAL E CB  1 
ATOM 10742 C CG1 . VAL E 1 314 ? -56.191 5.659   -21.074 1.00 64.12  ? 314 VAL E CG1 1 
ATOM 10743 C CG2 . VAL E 1 314 ? -57.586 4.481   -22.822 1.00 63.97  ? 314 VAL E CG2 1 
ATOM 10744 N N   . LYS E 1 315 ? -57.014 7.728   -24.994 1.00 61.51  ? 315 LYS E N   1 
ATOM 10745 C CA  . LYS E 1 315 ? -57.236 7.901   -26.419 1.00 62.12  ? 315 LYS E CA  1 
ATOM 10746 C C   . LYS E 1 315 ? -56.473 6.808   -27.166 1.00 66.01  ? 315 LYS E C   1 
ATOM 10747 O O   . LYS E 1 315 ? -55.274 6.615   -26.952 1.00 66.19  ? 315 LYS E O   1 
ATOM 10748 C CB  . LYS E 1 315 ? -56.869 9.324   -26.890 1.00 64.98  ? 315 LYS E CB  1 
ATOM 10749 C CG  . LYS E 1 315 ? -58.053 10.285  -26.734 1.00 77.91  ? 315 LYS E CG  1 
ATOM 10750 C CD  . LYS E 1 315 ? -57.687 11.737  -26.903 1.00 90.45  ? 315 LYS E CD  1 
ATOM 10751 C CE  . LYS E 1 315 ? -58.784 12.657  -26.423 1.00 102.84 ? 315 LYS E CE  1 
ATOM 10752 N NZ  . LYS E 1 315 ? -58.279 14.046  -26.233 1.00 113.38 ? 315 LYS E NZ  1 
ATOM 10753 N N   . LEU E 1 316 ? -57.197 6.074   -28.008 1.00 61.67  ? 316 LEU E N   1 
ATOM 10754 C CA  . LEU E 1 316 ? -56.689 4.950   -28.764 1.00 61.43  ? 316 LEU E CA  1 
ATOM 10755 C C   . LEU E 1 316 ? -56.499 5.260   -30.247 1.00 65.03  ? 316 LEU E C   1 
ATOM 10756 O O   . LEU E 1 316 ? -57.469 5.484   -30.967 1.00 64.69  ? 316 LEU E O   1 
ATOM 10757 C CB  . LEU E 1 316 ? -57.667 3.774   -28.596 1.00 61.76  ? 316 LEU E CB  1 
ATOM 10758 C CG  . LEU E 1 316 ? -57.241 2.587   -27.729 1.00 66.95  ? 316 LEU E CG  1 
ATOM 10759 C CD1 . LEU E 1 316 ? -56.819 3.014   -26.328 1.00 66.98  ? 316 LEU E CD1 1 
ATOM 10760 C CD2 . LEU E 1 316 ? -58.374 1.591   -27.612 1.00 70.17  ? 316 LEU E CD2 1 
ATOM 10761 N N   . GLY E 1 317 ? -55.245 5.226   -30.686 1.00 62.45  ? 317 GLY E N   1 
ATOM 10762 C CA  . GLY E 1 317 ? -54.862 5.349   -32.088 1.00 62.47  ? 317 GLY E CA  1 
ATOM 10763 C C   . GLY E 1 317 ? -55.169 4.007   -32.715 1.00 66.14  ? 317 GLY E C   1 
ATOM 10764 O O   . GLY E 1 317 ? -54.613 2.986   -32.316 1.00 66.19  ? 317 GLY E O   1 
ATOM 10765 N N   . LEU E 1 318 ? -56.114 3.992   -33.624 1.00 62.22  ? 318 LEU E N   1 
ATOM 10766 C CA  . LEU E 1 318 ? -56.687 2.792   -34.205 1.00 61.98  ? 318 LEU E CA  1 
ATOM 10767 C C   . LEU E 1 318 ? -56.549 2.771   -35.738 1.00 67.56  ? 318 LEU E C   1 
ATOM 10768 O O   . LEU E 1 318 ? -56.227 3.792   -36.353 1.00 66.39  ? 318 LEU E O   1 
ATOM 10769 C CB  . LEU E 1 318 ? -58.151 2.878   -33.790 1.00 61.93  ? 318 LEU E CB  1 
ATOM 10770 C CG  . LEU E 1 318 ? -58.964 1.656   -33.723 1.00 66.32  ? 318 LEU E CG  1 
ATOM 10771 C CD1 . LEU E 1 318 ? -59.703 1.609   -32.408 1.00 65.19  ? 318 LEU E CD1 1 
ATOM 10772 C CD2 . LEU E 1 318 ? -59.938 1.644   -34.881 1.00 71.35  ? 318 LEU E CD2 1 
ATOM 10773 N N   . LEU E 1 319 ? -56.774 1.598   -36.352 1.00 65.85  ? 319 LEU E N   1 
ATOM 10774 C CA  . LEU E 1 319 ? -56.685 1.427   -37.804 1.00 65.81  ? 319 LEU E CA  1 
ATOM 10775 C C   . LEU E 1 319 ? -57.660 0.356   -38.270 1.00 72.09  ? 319 LEU E C   1 
ATOM 10776 O O   . LEU E 1 319 ? -57.381 -0.835  -38.087 1.00 71.41  ? 319 LEU E O   1 
ATOM 10777 C CB  . LEU E 1 319 ? -55.243 1.065   -38.205 1.00 65.47  ? 319 LEU E CB  1 
ATOM 10778 C CG  . LEU E 1 319 ? -54.736 1.608   -39.527 1.00 70.14  ? 319 LEU E CG  1 
ATOM 10779 C CD1 . LEU E 1 319 ? -54.373 3.095   -39.420 1.00 70.09  ? 319 LEU E CD1 1 
ATOM 10780 C CD2 . LEU E 1 319 ? -53.528 0.829   -39.988 1.00 72.13  ? 319 LEU E CD2 1 
ATOM 10781 N N   . ARG E 1 320 ? -58.831 0.764   -38.828 1.00 71.20  ? 320 ARG E N   1 
ATOM 10782 C CA  . ARG E 1 320 ? -59.786 -0.232  -39.323 1.00 71.71  ? 320 ARG E CA  1 
ATOM 10783 C C   . ARG E 1 320 ? -59.971 -0.094  -40.821 1.00 77.51  ? 320 ARG E C   1 
ATOM 10784 O O   . ARG E 1 320 ? -60.169 1.003   -41.348 1.00 77.49  ? 320 ARG E O   1 
ATOM 10785 C CB  . ARG E 1 320 ? -61.112 -0.287  -38.547 1.00 70.89  ? 320 ARG E CB  1 
ATOM 10786 C CG  . ARG E 1 320 ? -62.186 0.746   -38.813 1.00 75.99  ? 320 ARG E CG  1 
ATOM 10787 C CD  . ARG E 1 320 ? -63.480 0.323   -38.132 1.00 75.48  ? 320 ARG E CD  1 
ATOM 10788 N NE  . ARG E 1 320 ? -63.330 0.240   -36.679 1.00 86.70  ? 320 ARG E NE  1 
ATOM 10789 C CZ  . ARG E 1 320 ? -64.117 0.852   -35.803 1.00 103.22 ? 320 ARG E CZ  1 
ATOM 10790 N NH1 . ARG E 1 320 ? -65.142 1.586   -36.219 1.00 97.77  ? 320 ARG E NH1 1 
ATOM 10791 N NH2 . ARG E 1 320 ? -63.889 0.733   -34.504 1.00 87.66  ? 320 ARG E NH2 1 
ATOM 10792 N N   . ASN E 1 321 ? -59.795 -1.234  -41.502 1.00 75.73  ? 321 ASN E N   1 
ATOM 10793 C CA  . ASN E 1 321 ? -59.825 -1.422  -42.952 1.00 76.47  ? 321 ASN E CA  1 
ATOM 10794 C C   . ASN E 1 321 ? -58.832 -0.465  -43.630 1.00 81.94  ? 321 ASN E C   1 
ATOM 10795 O O   . ASN E 1 321 ? -59.090 0.043   -44.725 1.00 83.55  ? 321 ASN E O   1 
ATOM 10796 C CB  . ASN E 1 321 ? -61.247 -1.300  -43.509 1.00 78.08  ? 321 ASN E CB  1 
ATOM 10797 C CG  . ASN E 1 321 ? -62.080 -2.526  -43.203 1.00 105.09 ? 321 ASN E CG  1 
ATOM 10798 O OD1 . ASN E 1 321 ? -63.021 -2.484  -42.397 1.00 101.28 ? 321 ASN E OD1 1 
ATOM 10799 N ND2 . ASN E 1 321 ? -61.720 -3.662  -43.797 1.00 95.07  ? 321 ASN E ND2 1 
ATOM 10800 N N   . GLY E 1 322 ? -57.697 -0.255  -42.957 1.00 77.24  ? 322 GLY E N   1 
ATOM 10801 C CA  . GLY E 1 322 ? -56.593 0.591   -43.401 1.00 76.64  ? 322 GLY E CA  1 
ATOM 10802 C C   . GLY E 1 322 ? -56.793 2.079   -43.196 1.00 79.53  ? 322 GLY E C   1 
ATOM 10803 O O   . GLY E 1 322 ? -55.956 2.883   -43.629 1.00 78.03  ? 322 GLY E O   1 
ATOM 10804 N N   . LYS E 1 323 ? -57.892 2.455   -42.521 1.00 76.48  ? 323 LYS E N   1 
ATOM 10805 C CA  . LYS E 1 323 ? -58.229 3.857   -42.284 1.00 76.45  ? 323 LYS E CA  1 
ATOM 10806 C C   . LYS E 1 323 ? -58.000 4.251   -40.815 1.00 79.61  ? 323 LYS E C   1 
ATOM 10807 O O   . LYS E 1 323 ? -58.452 3.541   -39.909 1.00 78.54  ? 323 LYS E O   1 
ATOM 10808 C CB  . LYS E 1 323 ? -59.687 4.158   -42.711 1.00 79.60  ? 323 LYS E CB  1 
ATOM 10809 C CG  . LYS E 1 323 ? -60.075 3.703   -44.137 1.00 91.10  ? 323 LYS E CG  1 
ATOM 10810 C CD  . LYS E 1 323 ? -59.349 4.486   -45.234 1.00 101.89 ? 323 LYS E CD  1 
ATOM 10811 C CE  . LYS E 1 323 ? -59.276 3.718   -46.532 1.00 105.10 ? 323 LYS E CE  1 
ATOM 10812 N NZ  . LYS E 1 323 ? -58.430 4.416   -47.536 1.00 103.04 ? 323 LYS E NZ  1 
ATOM 10813 N N   . PRO E 1 324 ? -57.311 5.390   -40.573 1.00 76.95  ? 324 PRO E N   1 
ATOM 10814 C CA  . PRO E 1 324 ? -57.056 5.825   -39.185 1.00 77.71  ? 324 PRO E CA  1 
ATOM 10815 C C   . PRO E 1 324 ? -58.289 6.357   -38.455 1.00 83.80  ? 324 PRO E C   1 
ATOM 10816 O O   . PRO E 1 324 ? -59.147 6.990   -39.070 1.00 83.80  ? 324 PRO E O   1 
ATOM 10817 C CB  . PRO E 1 324 ? -56.023 6.951   -39.340 1.00 79.32  ? 324 PRO E CB  1 
ATOM 10818 C CG  . PRO E 1 324 ? -55.601 6.931   -40.784 1.00 83.02  ? 324 PRO E CG  1 
ATOM 10819 C CD  . PRO E 1 324 ? -56.717 6.328   -41.545 1.00 78.29  ? 324 PRO E CD  1 
ATOM 10820 N N   . LEU E 1 325 ? -58.355 6.098   -37.130 1.00 81.35  ? 325 LEU E N   1 
ATOM 10821 C CA  . LEU E 1 325 ? -59.399 6.541   -36.196 1.00 81.60  ? 325 LEU E CA  1 
ATOM 10822 C C   . LEU E 1 325 ? -58.815 6.793   -34.818 1.00 86.06  ? 325 LEU E C   1 
ATOM 10823 O O   . LEU E 1 325 ? -57.858 6.132   -34.438 1.00 86.48  ? 325 LEU E O   1 
ATOM 10824 C CB  . LEU E 1 325 ? -60.534 5.502   -36.050 1.00 81.70  ? 325 LEU E CB  1 
ATOM 10825 C CG  . LEU E 1 325 ? -61.333 5.060   -37.271 1.00 86.93  ? 325 LEU E CG  1 
ATOM 10826 C CD1 . LEU E 1 325 ? -62.285 3.942   -36.893 1.00 87.53  ? 325 LEU E CD1 1 
ATOM 10827 C CD2 . LEU E 1 325 ? -62.117 6.214   -37.887 1.00 89.24  ? 325 LEU E CD2 1 
ATOM 10828 N N   . GLU E 1 326 ? -59.416 7.708   -34.055 1.00 82.06  ? 326 GLU E N   1 
ATOM 10829 C CA  . GLU E 1 326 ? -59.061 7.992   -32.665 1.00 81.18  ? 326 GLU E CA  1 
ATOM 10830 C C   . GLU E 1 326 ? -60.300 7.705   -31.838 1.00 83.04  ? 326 GLU E C   1 
ATOM 10831 O O   . GLU E 1 326 ? -61.390 8.134   -32.205 1.00 83.04  ? 326 GLU E O   1 
ATOM 10832 C CB  . GLU E 1 326 ? -58.557 9.432   -32.485 1.00 82.71  ? 326 GLU E CB  1 
ATOM 10833 C CG  . GLU E 1 326 ? -57.057 9.542   -32.251 1.00 96.84  ? 326 GLU E CG  1 
ATOM 10834 C CD  . GLU E 1 326 ? -56.602 9.706   -30.808 1.00 129.04 ? 326 GLU E CD  1 
ATOM 10835 O OE1 . GLU E 1 326 ? -57.197 10.535  -30.080 1.00 124.26 ? 326 GLU E OE1 1 
ATOM 10836 O OE2 . GLU E 1 326 ? -55.609 9.047   -30.423 1.00 132.60 ? 326 GLU E OE2 1 
ATOM 10837 N N   . VAL E 1 327 ? -60.163 6.915   -30.778 1.00 77.86  ? 327 VAL E N   1 
ATOM 10838 C CA  . VAL E 1 327 ? -61.296 6.512   -29.952 1.00 76.47  ? 327 VAL E CA  1 
ATOM 10839 C C   . VAL E 1 327 ? -60.966 6.766   -28.475 1.00 79.76  ? 327 VAL E C   1 
ATOM 10840 O O   . VAL E 1 327 ? -59.884 6.393   -28.015 1.00 80.25  ? 327 VAL E O   1 
ATOM 10841 C CB  . VAL E 1 327 ? -61.645 5.020   -30.246 1.00 80.03  ? 327 VAL E CB  1 
ATOM 10842 C CG1 . VAL E 1 327 ? -62.568 4.432   -29.193 1.00 80.10  ? 327 VAL E CG1 1 
ATOM 10843 C CG2 . VAL E 1 327 ? -62.250 4.842   -31.636 1.00 79.63  ? 327 VAL E CG2 1 
ATOM 10844 N N   . GLU E 1 328 ? -61.895 7.405   -27.736 1.00 74.87  ? 328 GLU E N   1 
ATOM 10845 C CA  . GLU E 1 328 ? -61.728 7.656   -26.303 1.00 74.23  ? 328 GLU E CA  1 
ATOM 10846 C C   . GLU E 1 328 ? -62.416 6.525   -25.531 1.00 75.86  ? 328 GLU E C   1 
ATOM 10847 O O   . GLU E 1 328 ? -63.599 6.246   -25.764 1.00 76.16  ? 328 GLU E O   1 
ATOM 10848 C CB  . GLU E 1 328 ? -62.270 9.039   -25.905 1.00 75.97  ? 328 GLU E CB  1 
ATOM 10849 C CG  . GLU E 1 328 ? -61.857 9.507   -24.515 1.00 87.87  ? 328 GLU E CG  1 
ATOM 10850 C CD  . GLU E 1 328 ? -62.236 10.939  -24.187 1.00 121.06 ? 328 GLU E CD  1 
ATOM 10851 O OE1 . GLU E 1 328 ? -61.321 11.792  -24.113 1.00 125.20 ? 328 GLU E OE1 1 
ATOM 10852 O OE2 . GLU E 1 328 ? -63.447 11.213  -24.014 1.00 116.81 ? 328 GLU E OE2 1 
ATOM 10853 N N   . VAL E 1 329 ? -61.655 5.835   -24.662 1.00 69.44  ? 329 VAL E N   1 
ATOM 10854 C CA  . VAL E 1 329 ? -62.154 4.692   -23.896 1.00 68.22  ? 329 VAL E CA  1 
ATOM 10855 C C   . VAL E 1 329 ? -62.039 4.984   -22.396 1.00 70.91  ? 329 VAL E C   1 
ATOM 10856 O O   . VAL E 1 329 ? -61.001 5.468   -21.947 1.00 70.29  ? 329 VAL E O   1 
ATOM 10857 C CB  . VAL E 1 329 ? -61.402 3.370   -24.268 1.00 71.21  ? 329 VAL E CB  1 
ATOM 10858 C CG1 . VAL E 1 329 ? -61.986 2.165   -23.528 1.00 70.07  ? 329 VAL E CG1 1 
ATOM 10859 C CG2 . VAL E 1 329 ? -61.392 3.116   -25.777 1.00 71.08  ? 329 VAL E CG2 1 
ATOM 10860 N N   . THR E 1 330 ? -63.092 4.665   -21.627 1.00 66.46  ? 330 THR E N   1 
ATOM 10861 C CA  . THR E 1 330 ? -63.085 4.784   -20.171 1.00 65.61  ? 330 THR E CA  1 
ATOM 10862 C C   . THR E 1 330 ? -62.713 3.406   -19.647 1.00 69.77  ? 330 THR E C   1 
ATOM 10863 O O   . THR E 1 330 ? -63.348 2.403   -20.009 1.00 70.90  ? 330 THR E O   1 
ATOM 10864 C CB  . THR E 1 330 ? -64.415 5.317   -19.632 1.00 71.74  ? 330 THR E CB  1 
ATOM 10865 O OG1 . THR E 1 330 ? -64.730 6.555   -20.283 1.00 70.33  ? 330 THR E OG1 1 
ATOM 10866 C CG2 . THR E 1 330 ? -64.389 5.514   -18.115 1.00 70.08  ? 330 THR E CG2 1 
ATOM 10867 N N   . LEU E 1 331 ? -61.664 3.351   -18.826 1.00 64.91  ? 331 LEU E N   1 
ATOM 10868 C CA  . LEU E 1 331 ? -61.158 2.089   -18.314 1.00 64.18  ? 331 LEU E CA  1 
ATOM 10869 C C   . LEU E 1 331 ? -62.041 1.485   -17.243 1.00 67.82  ? 331 LEU E C   1 
ATOM 10870 O O   . LEU E 1 331 ? -62.561 2.188   -16.372 1.00 67.57  ? 331 LEU E O   1 
ATOM 10871 C CB  . LEU E 1 331 ? -59.731 2.245   -17.778 1.00 64.60  ? 331 LEU E CB  1 
ATOM 10872 C CG  . LEU E 1 331 ? -58.659 2.718   -18.772 1.00 69.77  ? 331 LEU E CG  1 
ATOM 10873 C CD1 . LEU E 1 331 ? -57.286 2.706   -18.127 1.00 69.72  ? 331 LEU E CD1 1 
ATOM 10874 C CD2 . LEU E 1 331 ? -58.657 1.876   -20.054 1.00 71.62  ? 331 LEU E CD2 1 
ATOM 10875 N N   . ASP E 1 332 ? -62.214 0.164   -17.334 1.00 64.67  ? 332 ASP E N   1 
ATOM 10876 C CA  . ASP E 1 332 ? -62.951 -0.642  -16.374 1.00 65.29  ? 332 ASP E CA  1 
ATOM 10877 C C   . ASP E 1 332 ? -61.963 -1.149  -15.312 1.00 70.56  ? 332 ASP E C   1 
ATOM 10878 O O   . ASP E 1 332 ? -60.775 -0.812  -15.358 1.00 68.65  ? 332 ASP E O   1 
ATOM 10879 C CB  . ASP E 1 332 ? -63.662 -1.818  -17.080 1.00 67.65  ? 332 ASP E CB  1 
ATOM 10880 C CG  . ASP E 1 332 ? -64.560 -1.440  -18.245 1.00 86.30  ? 332 ASP E CG  1 
ATOM 10881 O OD1 . ASP E 1 332 ? -64.249 -1.851  -19.389 1.00 88.08  ? 332 ASP E OD1 1 
ATOM 10882 O OD2 . ASP E 1 332 ? -65.590 -0.753  -18.012 1.00 93.31  ? 332 ASP E OD2 1 
ATOM 10883 N N   . THR E 1 333 ? -62.448 -1.960  -14.365 1.00 68.97  ? 333 THR E N   1 
ATOM 10884 C CA  . THR E 1 333 ? -61.612 -2.563  -13.333 1.00 69.23  ? 333 THR E CA  1 
ATOM 10885 C C   . THR E 1 333 ? -61.325 -4.016  -13.749 1.00 73.80  ? 333 THR E C   1 
ATOM 10886 O O   . THR E 1 333 ? -62.160 -4.642  -14.412 1.00 73.32  ? 333 THR E O   1 
ATOM 10887 C CB  . THR E 1 333 ? -62.284 -2.442  -11.951 1.00 78.61  ? 333 THR E CB  1 
ATOM 10888 O OG1 . THR E 1 333 ? -62.790 -1.118  -11.787 1.00 77.50  ? 333 THR E OG1 1 
ATOM 10889 C CG2 . THR E 1 333 ? -61.328 -2.730  -10.809 1.00 80.09  ? 333 THR E CG2 1 
ATOM 10890 N N   . SER E 1 334 ? -60.146 -4.540  -13.362 1.00 70.58  ? 334 SER E N   1 
ATOM 10891 C CA  . SER E 1 334 ? -59.708 -5.897  -13.665 1.00 72.96  ? 334 SER E CA  1 
ATOM 10892 C C   . SER E 1 334 ? -60.021 -6.868  -12.500 1.00 86.64  ? 334 SER E C   1 
ATOM 10893 O O   . SER E 1 334 ? -59.805 -6.496  -11.326 1.00 90.80  ? 334 SER E O   1 
ATOM 10894 C CB  . SER E 1 334 ? -58.219 -5.892  -13.994 1.00 76.33  ? 334 SER E CB  1 
ATOM 10895 O OG  . SER E 1 334 ? -57.777 -7.157  -14.454 1.00 86.58  ? 334 SER E OG  1 
ATOM 10896 N N   . PRO F 1 11  ? -13.551 18.317  -35.810 1.00 87.37  ? 11  PRO F N   1 
ATOM 10897 C CA  . PRO F 1 11  ? -14.750 19.061  -35.376 1.00 86.37  ? 11  PRO F CA  1 
ATOM 10898 C C   . PRO F 1 11  ? -15.573 18.288  -34.327 1.00 85.97  ? 11  PRO F C   1 
ATOM 10899 O O   . PRO F 1 11  ? -16.235 18.903  -33.478 1.00 85.12  ? 11  PRO F O   1 
ATOM 10900 C CB  . PRO F 1 11  ? -15.544 19.263  -36.678 1.00 88.33  ? 11  PRO F CB  1 
ATOM 10901 C CG  . PRO F 1 11  ? -14.555 19.011  -37.815 1.00 93.38  ? 11  PRO F CG  1 
ATOM 10902 C CD  . PRO F 1 11  ? -13.238 18.544  -37.235 1.00 89.04  ? 11  PRO F CD  1 
ATOM 10903 N N   . LEU F 1 12  ? -15.537 16.937  -34.391 1.00 78.87  ? 12  LEU F N   1 
ATOM 10904 C CA  . LEU F 1 12  ? -16.274 16.073  -33.461 1.00 76.36  ? 12  LEU F CA  1 
ATOM 10905 C C   . LEU F 1 12  ? -15.623 16.053  -32.083 1.00 75.07  ? 12  LEU F C   1 
ATOM 10906 O O   . LEU F 1 12  ? -14.396 15.942  -32.007 1.00 75.09  ? 12  LEU F O   1 
ATOM 10907 C CB  . LEU F 1 12  ? -16.385 14.622  -33.999 1.00 76.10  ? 12  LEU F CB  1 
ATOM 10908 C CG  . LEU F 1 12  ? -17.490 14.302  -35.024 1.00 80.39  ? 12  LEU F CG  1 
ATOM 10909 C CD1 . LEU F 1 12  ? -17.537 12.816  -35.309 1.00 79.95  ? 12  LEU F CD1 1 
ATOM 10910 C CD2 . LEU F 1 12  ? -18.882 14.775  -34.548 1.00 82.70  ? 12  LEU F CD2 1 
ATOM 10911 N N   . PRO F 1 13  ? -16.422 16.118  -30.986 1.00 68.06  ? 13  PRO F N   1 
ATOM 10912 C CA  . PRO F 1 13  ? -15.845 15.978  -29.624 1.00 66.10  ? 13  PRO F CA  1 
ATOM 10913 C C   . PRO F 1 13  ? -15.144 14.624  -29.448 1.00 65.86  ? 13  PRO F C   1 
ATOM 10914 O O   . PRO F 1 13  ? -15.586 13.599  -29.994 1.00 64.71  ? 13  PRO F O   1 
ATOM 10915 C CB  . PRO F 1 13  ? -17.055 16.092  -28.690 1.00 67.63  ? 13  PRO F CB  1 
ATOM 10916 C CG  . PRO F 1 13  ? -18.164 16.580  -29.515 1.00 72.55  ? 13  PRO F CG  1 
ATOM 10917 C CD  . PRO F 1 13  ? -17.894 16.209  -30.934 1.00 68.99  ? 13  PRO F CD  1 
ATOM 10918 N N   . SER F 1 14  ? -14.011 14.634  -28.739 1.00 60.25  ? 14  SER F N   1 
ATOM 10919 C CA  . SER F 1 14  ? -13.150 13.459  -28.581 1.00 59.02  ? 14  SER F CA  1 
ATOM 10920 C C   . SER F 1 14  ? -12.168 13.600  -27.403 1.00 60.37  ? 14  SER F C   1 
ATOM 10921 O O   . SER F 1 14  ? -11.801 14.721  -27.031 1.00 60.35  ? 14  SER F O   1 
ATOM 10922 C CB  . SER F 1 14  ? -12.356 13.253  -29.873 1.00 61.27  ? 14  SER F CB  1 
ATOM 10923 O OG  . SER F 1 14  ? -11.432 12.185  -29.789 1.00 71.53  ? 14  SER F OG  1 
ATOM 10924 N N   . LEU F 1 15  ? -11.699 12.461  -26.862 1.00 54.09  ? 15  LEU F N   1 
ATOM 10925 C CA  . LEU F 1 15  ? -10.681 12.439  -25.801 1.00 52.83  ? 15  LEU F CA  1 
ATOM 10926 C C   . LEU F 1 15  ? -9.274  12.288  -26.424 1.00 54.28  ? 15  LEU F C   1 
ATOM 10927 O O   . LEU F 1 15  ? -8.259  12.410  -25.729 1.00 51.52  ? 15  LEU F O   1 
ATOM 10928 C CB  . LEU F 1 15  ? -10.943 11.295  -24.793 1.00 52.73  ? 15  LEU F CB  1 
ATOM 10929 C CG  . LEU F 1 15  ? -12.296 11.252  -24.136 1.00 57.44  ? 15  LEU F CG  1 
ATOM 10930 C CD1 . LEU F 1 15  ? -12.424 10.047  -23.256 1.00 57.65  ? 15  LEU F CD1 1 
ATOM 10931 C CD2 . LEU F 1 15  ? -12.544 12.502  -23.338 1.00 60.09  ? 15  LEU F CD2 1 
ATOM 10932 N N   . ALA F 1 16  ? -9.238  12.009  -27.745 1.00 52.05  ? 16  ALA F N   1 
ATOM 10933 C CA  . ALA F 1 16  ? -8.032  11.801  -28.556 1.00 52.77  ? 16  ALA F CA  1 
ATOM 10934 C C   . ALA F 1 16  ? -7.031  12.973  -28.451 1.00 60.76  ? 16  ALA F C   1 
ATOM 10935 O O   . ALA F 1 16  ? -5.848  12.686  -28.203 1.00 59.59  ? 16  ALA F O   1 
ATOM 10936 C CB  . ALA F 1 16  ? -8.398  11.538  -30.015 1.00 52.63  ? 16  ALA F CB  1 
ATOM 10937 N N   . PRO F 1 17  ? -7.439  14.277  -28.582 1.00 60.09  ? 17  PRO F N   1 
ATOM 10938 C CA  . PRO F 1 17  ? -6.440  15.356  -28.482 1.00 60.34  ? 17  PRO F CA  1 
ATOM 10939 C C   . PRO F 1 17  ? -5.635  15.303  -27.182 1.00 67.02  ? 17  PRO F C   1 
ATOM 10940 O O   . PRO F 1 17  ? -4.409  15.468  -27.245 1.00 67.55  ? 17  PRO F O   1 
ATOM 10941 C CB  . PRO F 1 17  ? -7.288  16.625  -28.608 1.00 61.26  ? 17  PRO F CB  1 
ATOM 10942 C CG  . PRO F 1 17  ? -8.445  16.199  -29.444 1.00 64.80  ? 17  PRO F CG  1 
ATOM 10943 C CD  . PRO F 1 17  ? -8.772  14.840  -28.910 1.00 60.68  ? 17  PRO F CD  1 
ATOM 10944 N N   . MET F 1 18  ? -6.284  14.978  -26.032 1.00 64.39  ? 18  MET F N   1 
ATOM 10945 C CA  . MET F 1 18  ? -5.566  14.890  -24.753 1.00 64.25  ? 18  MET F CA  1 
ATOM 10946 C C   . MET F 1 18  ? -4.888  13.524  -24.542 1.00 67.08  ? 18  MET F C   1 
ATOM 10947 O O   . MET F 1 18  ? -3.976  13.435  -23.727 1.00 67.33  ? 18  MET F O   1 
ATOM 10948 C CB  . MET F 1 18  ? -6.479  15.238  -23.558 1.00 67.03  ? 18  MET F CB  1 
ATOM 10949 C CG  . MET F 1 18  ? -7.338  14.104  -23.035 1.00 71.37  ? 18  MET F CG  1 
ATOM 10950 S SD  . MET F 1 18  ? -6.624  13.268  -21.587 1.00 75.69  ? 18  MET F SD  1 
ATOM 10951 C CE  . MET F 1 18  ? -8.044  12.299  -21.068 1.00 72.17  ? 18  MET F CE  1 
ATOM 10952 N N   . LEU F 1 19  ? -5.346  12.458  -25.208 1.00 61.97  ? 19  LEU F N   1 
ATOM 10953 C CA  . LEU F 1 19  ? -4.711  11.173  -24.946 1.00 60.76  ? 19  LEU F CA  1 
ATOM 10954 C C   . LEU F 1 19  ? -3.435  11.078  -25.761 1.00 64.79  ? 19  LEU F C   1 
ATOM 10955 O O   . LEU F 1 19  ? -2.437  10.557  -25.264 1.00 63.93  ? 19  LEU F O   1 
ATOM 10956 C CB  . LEU F 1 19  ? -5.667  9.972   -25.165 1.00 59.86  ? 19  LEU F CB  1 
ATOM 10957 C CG  . LEU F 1 19  ? -6.784  9.815   -24.092 1.00 61.18  ? 19  LEU F CG  1 
ATOM 10958 C CD1 . LEU F 1 19  ? -7.786  8.808   -24.502 1.00 60.27  ? 19  LEU F CD1 1 
ATOM 10959 C CD2 . LEU F 1 19  ? -6.229  9.403   -22.757 1.00 60.98  ? 19  LEU F CD2 1 
ATOM 10960 N N   . GLU F 1 20  ? -3.430  11.726  -26.942 1.00 62.29  ? 20  GLU F N   1 
ATOM 10961 C CA  . GLU F 1 20  ? -2.278  11.834  -27.857 1.00 61.69  ? 20  GLU F CA  1 
ATOM 10962 C C   . GLU F 1 20  ? -1.010  12.270  -27.124 1.00 62.48  ? 20  GLU F C   1 
ATOM 10963 O O   . GLU F 1 20  ? 0.047   11.691  -27.332 1.00 61.31  ? 20  GLU F O   1 
ATOM 10964 C CB  . GLU F 1 20  ? -2.596  12.860  -28.952 1.00 63.21  ? 20  GLU F CB  1 
ATOM 10965 C CG  . GLU F 1 20  ? -2.515  12.303  -30.358 1.00 73.47  ? 20  GLU F CG  1 
ATOM 10966 C CD  . GLU F 1 20  ? -3.072  13.207  -31.441 1.00 96.92  ? 20  GLU F CD  1 
ATOM 10967 O OE1 . GLU F 1 20  ? -3.488  14.348  -31.132 1.00 99.53  ? 20  GLU F OE1 1 
ATOM 10968 O OE2 . GLU F 1 20  ? -3.108  12.762  -32.610 1.00 89.68  ? 20  GLU F OE2 1 
ATOM 10969 N N   . LYS F 1 21  ? -1.145  13.265  -26.230 1.00 58.92  ? 21  LYS F N   1 
ATOM 10970 C CA  . LYS F 1 21  ? -0.080  13.861  -25.414 1.00 57.98  ? 21  LYS F CA  1 
ATOM 10971 C C   . LYS F 1 21  ? 0.345   13.005  -24.257 1.00 60.94  ? 21  LYS F C   1 
ATOM 10972 O O   . LYS F 1 21  ? 1.527   12.989  -23.922 1.00 61.94  ? 21  LYS F O   1 
ATOM 10973 C CB  . LYS F 1 21  ? -0.537  15.213  -24.801 1.00 59.61  ? 21  LYS F CB  1 
ATOM 10974 C CG  . LYS F 1 21  ? -1.207  16.209  -25.731 1.00 69.42  ? 21  LYS F CG  1 
ATOM 10975 C CD  . LYS F 1 21  ? -1.576  17.478  -24.972 1.00 77.16  ? 21  LYS F CD  1 
ATOM 10976 C CE  . LYS F 1 21  ? -2.694  18.249  -25.633 1.00 84.76  ? 21  LYS F CE  1 
ATOM 10977 N NZ  . LYS F 1 21  ? -2.946  19.552  -24.963 1.00 88.45  ? 21  LYS F NZ  1 
ATOM 10978 N N   . VAL F 1 22  ? -0.628  12.359  -23.601 1.00 55.75  ? 22  VAL F N   1 
ATOM 10979 C CA  . VAL F 1 22  ? -0.498  11.690  -22.311 1.00 54.67  ? 22  VAL F CA  1 
ATOM 10980 C C   . VAL F 1 22  ? -0.248  10.161  -22.364 1.00 56.23  ? 22  VAL F C   1 
ATOM 10981 O O   . VAL F 1 22  ? 0.496   9.662   -21.509 1.00 55.42  ? 22  VAL F O   1 
ATOM 10982 C CB  . VAL F 1 22  ? -1.773  12.063  -21.510 1.00 58.50  ? 22  VAL F CB  1 
ATOM 10983 C CG1 . VAL F 1 22  ? -2.153  11.026  -20.463 1.00 58.81  ? 22  VAL F CG1 1 
ATOM 10984 C CG2 . VAL F 1 22  ? -1.638  13.447  -20.888 1.00 57.80  ? 22  VAL F CG2 1 
ATOM 10985 N N   . LEU F 1 23  ? -0.820  9.434   -23.336 1.00 52.04  ? 23  LEU F N   1 
ATOM 10986 C CA  . LEU F 1 23  ? -0.665  7.971   -23.415 1.00 52.13  ? 23  LEU F CA  1 
ATOM 10987 C C   . LEU F 1 23  ? 0.819   7.470   -23.318 1.00 57.12  ? 23  LEU F C   1 
ATOM 10988 O O   . LEU F 1 23  ? 1.037   6.524   -22.555 1.00 55.64  ? 23  LEU F O   1 
ATOM 10989 C CB  . LEU F 1 23  ? -1.342  7.400   -24.660 1.00 52.30  ? 23  LEU F CB  1 
ATOM 10990 C CG  . LEU F 1 23  ? -2.887  7.446   -24.705 1.00 56.59  ? 23  LEU F CG  1 
ATOM 10991 C CD1 . LEU F 1 23  ? -3.379  7.085   -26.065 1.00 56.72  ? 23  LEU F CD1 1 
ATOM 10992 C CD2 . LEU F 1 23  ? -3.531  6.524   -23.673 1.00 58.82  ? 23  LEU F CD2 1 
ATOM 10993 N N   . PRO F 1 24  ? 1.851   8.116   -23.961 1.00 55.24  ? 24  PRO F N   1 
ATOM 10994 C CA  . PRO F 1 24  ? 3.250   7.655   -23.798 1.00 53.46  ? 24  PRO F CA  1 
ATOM 10995 C C   . PRO F 1 24  ? 3.743   7.470   -22.358 1.00 53.77  ? 24  PRO F C   1 
ATOM 10996 O O   . PRO F 1 24  ? 4.551   6.567   -22.140 1.00 54.90  ? 24  PRO F O   1 
ATOM 10997 C CB  . PRO F 1 24  ? 4.045   8.762   -24.483 1.00 55.01  ? 24  PRO F CB  1 
ATOM 10998 C CG  . PRO F 1 24  ? 3.166   9.204   -25.573 1.00 60.18  ? 24  PRO F CG  1 
ATOM 10999 C CD  . PRO F 1 24  ? 1.799   9.217   -24.957 1.00 57.07  ? 24  PRO F CD  1 
ATOM 11000 N N   . ALA F 1 25  ? 3.245   8.272   -21.388 1.00 46.76  ? 25  ALA F N   1 
ATOM 11001 C CA  . ALA F 1 25  ? 3.581   8.214   -19.941 1.00 45.65  ? 25  ALA F CA  1 
ATOM 11002 C C   . ALA F 1 25  ? 3.091   6.907   -19.218 1.00 51