data_3SUP
# 
_entry.id   3SUP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3SUP         
NDB   NA1216       
RCSB  RCSB066674   
WWPDB D_1000066674 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3SQ2 'RB69 DNA Polymerase Ternary Complex with dTTP Opposite 2AP (AT rich sequence)'         unspecified 
PDB 3SQ4 'RB69 DNA Polymerase Ternary Complex with dTTP Opposite 2AP (GC rich sequence)'         unspecified 
PDB 3SUN 'RB69 DNA Polymerase (Y567A) Ternary Complex with dTTP Opposite 2AP (AT rich sequence)' unspecified 
PDB 3SUO 'RB69 DNA Polymerase (Y567A) Ternary Complex with dTTP Opposite 2AP (GC rich sequence)' unspecified 
PDB 3SUQ 'RB69 DNA Polymerase (Y567A) Ternary Complex with dCTP Opposite 2AP (AT rich sequence)' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3SUP 
_pdbx_database_status.recvd_initial_deposition_date   2011-07-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xia, S.'          1 
'Konigsberg, W.H.' 2 
'Wang, J.'         3 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the 2-Aminopurine-Cytosine Base Pair Formed in the Polymerase Active Site of the RB69 Y567A-DNA Polymerase.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            50 
_citation.page_first                10136 
_citation.page_last                 10149 
_citation.year                      2011 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22023103 
_citation.pdbx_database_id_DOI      10.1021/bi2014618 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Reha-Krantz, L.J.' 1 
primary 'Hariharan, C.'     2 
primary 'Subuddhi, U.'      3 
primary 'Xia, S.'           4 
primary 'Zhao, C.'          5 
primary 'Beckman, J.'       6 
primary 'Christian, T.'     7 
primary 'Konigsberg, W.'    8 
# 
_cell.entry_id           3SUP 
_cell.length_a           74.756 
_cell.length_b           120.357 
_cell.length_c           130.823 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3SUP 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase'                                                104563.047 1   2.7.7.7 Y567A ? ?        
2 polymer     syn "5'-D(P*CP*(2PR)P*TP*CP*GP*CP*CP*GP*CP*CP*GP*CP*GP*CP*GP*G)-3'" 4861.131   1   ?       ?     ? template 
3 polymer     syn "5'-D(*CP*GP*CP*GP*CP*GP*GP*CP*GP*GP*CP*GP*(2DA))-3'"           4002.599   1   ?       ?     ? primer   
4 non-polymer syn "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"                              467.157    1   ?       ?     ? ?        
5 non-polymer syn 'CALCIUM ION'                                                   40.078     5   ?       ?     ? ?        
6 water       nat water                                                           18.015     263 ?       ?     ? ?        
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Gp43 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
A ? 
2 polydeoxyribonucleotide no yes '(DC)(2PR)(DT)(DC)(DG)(DC)(DC)(DG)(DC)(DC)(DG)(DC)(DG)(DC)(DG)(DG)' CGTCGCCGCCGCGCGG T ? 
3 polydeoxyribonucleotide no yes '(DC)(DG)(DC)(DG)(DC)(DG)(DG)(DC)(DG)(DG)(DC)(DG)(2DA)' CGCGCGGCGGCGA P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLU n 
1 4   PHE n 
1 5   TYR n 
1 6   LEU n 
1 7   THR n 
1 8   VAL n 
1 9   GLU n 
1 10  GLN n 
1 11  ILE n 
1 12  GLY n 
1 13  ASP n 
1 14  SER n 
1 15  ILE n 
1 16  PHE n 
1 17  GLU n 
1 18  ARG n 
1 19  TYR n 
1 20  ILE n 
1 21  ASP n 
1 22  SER n 
1 23  ASN n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ARG n 
1 28  THR n 
1 29  ARG n 
1 30  GLU n 
1 31  VAL n 
1 32  GLU n 
1 33  TYR n 
1 34  LYS n 
1 35  PRO n 
1 36  SER n 
1 37  LEU n 
1 38  PHE n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  PRO n 
1 43  GLU n 
1 44  SER n 
1 45  GLN n 
1 46  ALA n 
1 47  THR n 
1 48  LYS n 
1 49  TYR n 
1 50  PHE n 
1 51  ASP n 
1 52  ILE n 
1 53  TYR n 
1 54  GLY n 
1 55  LYS n 
1 56  PRO n 
1 57  CYS n 
1 58  THR n 
1 59  ARG n 
1 60  LYS n 
1 61  LEU n 
1 62  PHE n 
1 63  ALA n 
1 64  ASN n 
1 65  MET n 
1 66  ARG n 
1 67  ASP n 
1 68  ALA n 
1 69  SER n 
1 70  GLN n 
1 71  TRP n 
1 72  ILE n 
1 73  LYS n 
1 74  ARG n 
1 75  MET n 
1 76  GLU n 
1 77  ASP n 
1 78  ILE n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ALA n 
1 83  LEU n 
1 84  GLY n 
1 85  MET n 
1 86  ASP n 
1 87  ASP n 
1 88  PHE n 
1 89  LYS n 
1 90  LEU n 
1 91  ALA n 
1 92  TYR n 
1 93  LEU n 
1 94  SER n 
1 95  ASP n 
1 96  THR n 
1 97  TYR n 
1 98  ASN n 
1 99  TYR n 
1 100 GLU n 
1 101 ILE n 
1 102 LYS n 
1 103 TYR n 
1 104 ASP n 
1 105 HIS n 
1 106 THR n 
1 107 LYS n 
1 108 ILE n 
1 109 ARG n 
1 110 VAL n 
1 111 ALA n 
1 112 ASN n 
1 113 PHE n 
1 114 ASP n 
1 115 ILE n 
1 116 GLU n 
1 117 VAL n 
1 118 THR n 
1 119 SER n 
1 120 PRO n 
1 121 ASP n 
1 122 GLY n 
1 123 PHE n 
1 124 PRO n 
1 125 GLU n 
1 126 PRO n 
1 127 SER n 
1 128 GLN n 
1 129 ALA n 
1 130 LYS n 
1 131 HIS n 
1 132 PRO n 
1 133 ILE n 
1 134 ASP n 
1 135 ALA n 
1 136 ILE n 
1 137 THR n 
1 138 HIS n 
1 139 TYR n 
1 140 ASP n 
1 141 SER n 
1 142 ILE n 
1 143 ASP n 
1 144 ASP n 
1 145 ARG n 
1 146 PHE n 
1 147 TYR n 
1 148 VAL n 
1 149 PHE n 
1 150 ASP n 
1 151 LEU n 
1 152 LEU n 
1 153 ASN n 
1 154 SER n 
1 155 PRO n 
1 156 TYR n 
1 157 GLY n 
1 158 ASN n 
1 159 VAL n 
1 160 GLU n 
1 161 GLU n 
1 162 TRP n 
1 163 SER n 
1 164 ILE n 
1 165 GLU n 
1 166 ILE n 
1 167 ALA n 
1 168 ALA n 
1 169 LYS n 
1 170 LEU n 
1 171 GLN n 
1 172 GLU n 
1 173 GLN n 
1 174 GLY n 
1 175 GLY n 
1 176 ASP n 
1 177 GLU n 
1 178 VAL n 
1 179 PRO n 
1 180 SER n 
1 181 GLU n 
1 182 ILE n 
1 183 ILE n 
1 184 ASP n 
1 185 LYS n 
1 186 ILE n 
1 187 ILE n 
1 188 TYR n 
1 189 MET n 
1 190 PRO n 
1 191 PHE n 
1 192 ASP n 
1 193 ASN n 
1 194 GLU n 
1 195 LYS n 
1 196 GLU n 
1 197 LEU n 
1 198 LEU n 
1 199 MET n 
1 200 GLU n 
1 201 TYR n 
1 202 LEU n 
1 203 ASN n 
1 204 PHE n 
1 205 TRP n 
1 206 GLN n 
1 207 GLN n 
1 208 LYS n 
1 209 THR n 
1 210 PRO n 
1 211 VAL n 
1 212 ILE n 
1 213 LEU n 
1 214 THR n 
1 215 GLY n 
1 216 TRP n 
1 217 ASN n 
1 218 VAL n 
1 219 GLU n 
1 220 SER n 
1 221 PHE n 
1 222 ALA n 
1 223 ILE n 
1 224 PRO n 
1 225 TYR n 
1 226 VAL n 
1 227 TYR n 
1 228 ASN n 
1 229 ARG n 
1 230 ILE n 
1 231 LYS n 
1 232 ASN n 
1 233 ILE n 
1 234 PHE n 
1 235 GLY n 
1 236 GLU n 
1 237 SER n 
1 238 THR n 
1 239 ALA n 
1 240 LYS n 
1 241 ARG n 
1 242 LEU n 
1 243 SER n 
1 244 PRO n 
1 245 HIS n 
1 246 ARG n 
1 247 LYS n 
1 248 THR n 
1 249 ARG n 
1 250 VAL n 
1 251 LYS n 
1 252 VAL n 
1 253 ILE n 
1 254 GLU n 
1 255 ASN n 
1 256 MET n 
1 257 TYR n 
1 258 GLY n 
1 259 SER n 
1 260 ARG n 
1 261 GLU n 
1 262 ILE n 
1 263 ILE n 
1 264 THR n 
1 265 LEU n 
1 266 PHE n 
1 267 GLY n 
1 268 ILE n 
1 269 SER n 
1 270 VAL n 
1 271 LEU n 
1 272 ASP n 
1 273 TYR n 
1 274 ILE n 
1 275 ASP n 
1 276 LEU n 
1 277 TYR n 
1 278 LYS n 
1 279 LYS n 
1 280 PHE n 
1 281 SER n 
1 282 PHE n 
1 283 THR n 
1 284 ASN n 
1 285 GLN n 
1 286 PRO n 
1 287 SER n 
1 288 TYR n 
1 289 SER n 
1 290 LEU n 
1 291 ASP n 
1 292 TYR n 
1 293 ILE n 
1 294 SER n 
1 295 GLU n 
1 296 PHE n 
1 297 GLU n 
1 298 LEU n 
1 299 ASN n 
1 300 VAL n 
1 301 GLY n 
1 302 LYS n 
1 303 LEU n 
1 304 LYS n 
1 305 TYR n 
1 306 ASP n 
1 307 GLY n 
1 308 PRO n 
1 309 ILE n 
1 310 SER n 
1 311 LYS n 
1 312 LEU n 
1 313 ARG n 
1 314 GLU n 
1 315 SER n 
1 316 ASN n 
1 317 HIS n 
1 318 GLN n 
1 319 ARG n 
1 320 TYR n 
1 321 ILE n 
1 322 SER n 
1 323 TYR n 
1 324 ASN n 
1 325 ILE n 
1 326 ILE n 
1 327 ALA n 
1 328 VAL n 
1 329 TYR n 
1 330 ARG n 
1 331 VAL n 
1 332 LEU n 
1 333 GLN n 
1 334 ILE n 
1 335 ASP n 
1 336 ALA n 
1 337 LYS n 
1 338 ARG n 
1 339 GLN n 
1 340 PHE n 
1 341 ILE n 
1 342 ASN n 
1 343 LEU n 
1 344 SER n 
1 345 LEU n 
1 346 ASP n 
1 347 MET n 
1 348 GLY n 
1 349 TYR n 
1 350 TYR n 
1 351 ALA n 
1 352 LYS n 
1 353 ILE n 
1 354 GLN n 
1 355 ILE n 
1 356 GLN n 
1 357 SER n 
1 358 VAL n 
1 359 PHE n 
1 360 SER n 
1 361 PRO n 
1 362 ILE n 
1 363 LYS n 
1 364 THR n 
1 365 TRP n 
1 366 ASP n 
1 367 ALA n 
1 368 ILE n 
1 369 ILE n 
1 370 PHE n 
1 371 ASN n 
1 372 SER n 
1 373 LEU n 
1 374 LYS n 
1 375 GLU n 
1 376 GLN n 
1 377 ASN n 
1 378 LYS n 
1 379 VAL n 
1 380 ILE n 
1 381 PRO n 
1 382 GLN n 
1 383 GLY n 
1 384 ARG n 
1 385 SER n 
1 386 HIS n 
1 387 PRO n 
1 388 VAL n 
1 389 GLN n 
1 390 PRO n 
1 391 TYR n 
1 392 PRO n 
1 393 GLY n 
1 394 ALA n 
1 395 PHE n 
1 396 VAL n 
1 397 LYS n 
1 398 GLU n 
1 399 PRO n 
1 400 ILE n 
1 401 PRO n 
1 402 ASN n 
1 403 ARG n 
1 404 TYR n 
1 405 LYS n 
1 406 TYR n 
1 407 VAL n 
1 408 MET n 
1 409 SER n 
1 410 PHE n 
1 411 ASP n 
1 412 LEU n 
1 413 THR n 
1 414 SER n 
1 415 LEU n 
1 416 TYR n 
1 417 PRO n 
1 418 SER n 
1 419 ILE n 
1 420 ILE n 
1 421 ARG n 
1 422 GLN n 
1 423 VAL n 
1 424 ASN n 
1 425 ILE n 
1 426 SER n 
1 427 PRO n 
1 428 GLU n 
1 429 THR n 
1 430 ILE n 
1 431 ALA n 
1 432 GLY n 
1 433 THR n 
1 434 PHE n 
1 435 LYS n 
1 436 VAL n 
1 437 ALA n 
1 438 PRO n 
1 439 LEU n 
1 440 HIS n 
1 441 ASP n 
1 442 TYR n 
1 443 ILE n 
1 444 ASN n 
1 445 ALA n 
1 446 VAL n 
1 447 ALA n 
1 448 GLU n 
1 449 ARG n 
1 450 PRO n 
1 451 SER n 
1 452 ASP n 
1 453 VAL n 
1 454 TYR n 
1 455 SER n 
1 456 CYS n 
1 457 SER n 
1 458 PRO n 
1 459 ASN n 
1 460 GLY n 
1 461 MET n 
1 462 MET n 
1 463 TYR n 
1 464 TYR n 
1 465 LYS n 
1 466 ASP n 
1 467 ARG n 
1 468 ASP n 
1 469 GLY n 
1 470 VAL n 
1 471 VAL n 
1 472 PRO n 
1 473 THR n 
1 474 GLU n 
1 475 ILE n 
1 476 THR n 
1 477 LYS n 
1 478 VAL n 
1 479 PHE n 
1 480 ASN n 
1 481 GLN n 
1 482 ARG n 
1 483 LYS n 
1 484 GLU n 
1 485 HIS n 
1 486 LYS n 
1 487 GLY n 
1 488 TYR n 
1 489 MET n 
1 490 LEU n 
1 491 ALA n 
1 492 ALA n 
1 493 GLN n 
1 494 ARG n 
1 495 ASN n 
1 496 GLY n 
1 497 GLU n 
1 498 ILE n 
1 499 ILE n 
1 500 LYS n 
1 501 GLU n 
1 502 ALA n 
1 503 LEU n 
1 504 HIS n 
1 505 ASN n 
1 506 PRO n 
1 507 ASN n 
1 508 LEU n 
1 509 SER n 
1 510 VAL n 
1 511 ASP n 
1 512 GLU n 
1 513 PRO n 
1 514 LEU n 
1 515 ASP n 
1 516 VAL n 
1 517 ASP n 
1 518 TYR n 
1 519 ARG n 
1 520 PHE n 
1 521 ASP n 
1 522 PHE n 
1 523 SER n 
1 524 ASP n 
1 525 GLU n 
1 526 ILE n 
1 527 LYS n 
1 528 GLU n 
1 529 LYS n 
1 530 ILE n 
1 531 LYS n 
1 532 LYS n 
1 533 LEU n 
1 534 SER n 
1 535 ALA n 
1 536 LYS n 
1 537 SER n 
1 538 LEU n 
1 539 ASN n 
1 540 GLU n 
1 541 MET n 
1 542 LEU n 
1 543 PHE n 
1 544 ARG n 
1 545 ALA n 
1 546 GLN n 
1 547 ARG n 
1 548 THR n 
1 549 GLU n 
1 550 VAL n 
1 551 ALA n 
1 552 GLY n 
1 553 MET n 
1 554 THR n 
1 555 ALA n 
1 556 GLN n 
1 557 ILE n 
1 558 ASN n 
1 559 ARG n 
1 560 LYS n 
1 561 LEU n 
1 562 LEU n 
1 563 ILE n 
1 564 ASN n 
1 565 SER n 
1 566 LEU n 
1 567 ALA n 
1 568 GLY n 
1 569 ALA n 
1 570 LEU n 
1 571 GLY n 
1 572 ASN n 
1 573 VAL n 
1 574 TRP n 
1 575 PHE n 
1 576 ARG n 
1 577 TYR n 
1 578 TYR n 
1 579 ASP n 
1 580 LEU n 
1 581 ARG n 
1 582 ASN n 
1 583 ALA n 
1 584 THR n 
1 585 ALA n 
1 586 ILE n 
1 587 THR n 
1 588 THR n 
1 589 PHE n 
1 590 GLY n 
1 591 GLN n 
1 592 MET n 
1 593 ALA n 
1 594 LEU n 
1 595 GLN n 
1 596 TRP n 
1 597 ILE n 
1 598 GLU n 
1 599 ARG n 
1 600 LYS n 
1 601 VAL n 
1 602 ASN n 
1 603 GLU n 
1 604 TYR n 
1 605 LEU n 
1 606 ASN n 
1 607 GLU n 
1 608 VAL n 
1 609 CYS n 
1 610 GLY n 
1 611 THR n 
1 612 GLU n 
1 613 GLY n 
1 614 GLU n 
1 615 ALA n 
1 616 PHE n 
1 617 VAL n 
1 618 LEU n 
1 619 TYR n 
1 620 GLY n 
1 621 ASP n 
1 622 THR n 
1 623 ASP n 
1 624 SER n 
1 625 ILE n 
1 626 TYR n 
1 627 VAL n 
1 628 SER n 
1 629 ALA n 
1 630 ASP n 
1 631 LYS n 
1 632 ILE n 
1 633 ILE n 
1 634 ASP n 
1 635 LYS n 
1 636 VAL n 
1 637 GLY n 
1 638 GLU n 
1 639 SER n 
1 640 LYS n 
1 641 PHE n 
1 642 ARG n 
1 643 ASP n 
1 644 THR n 
1 645 ASN n 
1 646 HIS n 
1 647 TRP n 
1 648 VAL n 
1 649 ASP n 
1 650 PHE n 
1 651 LEU n 
1 652 ASP n 
1 653 LYS n 
1 654 PHE n 
1 655 ALA n 
1 656 ARG n 
1 657 GLU n 
1 658 ARG n 
1 659 MET n 
1 660 GLU n 
1 661 PRO n 
1 662 ALA n 
1 663 ILE n 
1 664 ASP n 
1 665 ARG n 
1 666 GLY n 
1 667 PHE n 
1 668 ARG n 
1 669 GLU n 
1 670 MET n 
1 671 CYS n 
1 672 GLU n 
1 673 TYR n 
1 674 MET n 
1 675 ASN n 
1 676 ASN n 
1 677 LYS n 
1 678 GLN n 
1 679 HIS n 
1 680 LEU n 
1 681 MET n 
1 682 PHE n 
1 683 MET n 
1 684 ASP n 
1 685 ARG n 
1 686 GLU n 
1 687 ALA n 
1 688 ILE n 
1 689 ALA n 
1 690 GLY n 
1 691 PRO n 
1 692 PRO n 
1 693 LEU n 
1 694 GLY n 
1 695 SER n 
1 696 LYS n 
1 697 GLY n 
1 698 ILE n 
1 699 GLY n 
1 700 GLY n 
1 701 PHE n 
1 702 TRP n 
1 703 THR n 
1 704 GLY n 
1 705 LYS n 
1 706 LYS n 
1 707 ARG n 
1 708 TYR n 
1 709 ALA n 
1 710 LEU n 
1 711 ASN n 
1 712 VAL n 
1 713 TRP n 
1 714 ASP n 
1 715 MET n 
1 716 GLU n 
1 717 GLY n 
1 718 THR n 
1 719 ARG n 
1 720 TYR n 
1 721 ALA n 
1 722 GLU n 
1 723 PRO n 
1 724 LYS n 
1 725 LEU n 
1 726 LYS n 
1 727 ILE n 
1 728 MET n 
1 729 GLY n 
1 730 LEU n 
1 731 GLU n 
1 732 THR n 
1 733 GLN n 
1 734 LYS n 
1 735 SER n 
1 736 SER n 
1 737 THR n 
1 738 PRO n 
1 739 LYS n 
1 740 ALA n 
1 741 VAL n 
1 742 GLN n 
1 743 LYS n 
1 744 ALA n 
1 745 LEU n 
1 746 LYS n 
1 747 GLU n 
1 748 CYS n 
1 749 ILE n 
1 750 ARG n 
1 751 ARG n 
1 752 MET n 
1 753 LEU n 
1 754 GLN n 
1 755 GLU n 
1 756 GLY n 
1 757 GLU n 
1 758 GLU n 
1 759 SER n 
1 760 LEU n 
1 761 GLN n 
1 762 GLU n 
1 763 TYR n 
1 764 PHE n 
1 765 LYS n 
1 766 GLU n 
1 767 PHE n 
1 768 GLU n 
1 769 LYS n 
1 770 GLU n 
1 771 PHE n 
1 772 ARG n 
1 773 GLN n 
1 774 LEU n 
1 775 ASN n 
1 776 TYR n 
1 777 ILE n 
1 778 SER n 
1 779 ILE n 
1 780 ALA n 
1 781 SER n 
1 782 VAL n 
1 783 SER n 
1 784 SER n 
1 785 ALA n 
1 786 ASN n 
1 787 ASN n 
1 788 ILE n 
1 789 ALA n 
1 790 LYS n 
1 791 TYR n 
1 792 ASP n 
1 793 VAL n 
1 794 GLY n 
1 795 GLY n 
1 796 PHE n 
1 797 PRO n 
1 798 GLY n 
1 799 PRO n 
1 800 LYS n 
1 801 CYS n 
1 802 PRO n 
1 803 PHE n 
1 804 HIS n 
1 805 ILE n 
1 806 ARG n 
1 807 GLY n 
1 808 ILE n 
1 809 LEU n 
1 810 THR n 
1 811 TYR n 
1 812 ASN n 
1 813 ARG n 
1 814 ALA n 
1 815 ILE n 
1 816 LYS n 
1 817 GLY n 
1 818 ASN n 
1 819 ILE n 
1 820 ASP n 
1 821 ALA n 
1 822 PRO n 
1 823 GLN n 
1 824 VAL n 
1 825 VAL n 
1 826 GLU n 
1 827 GLY n 
1 828 GLU n 
1 829 LYS n 
1 830 VAL n 
1 831 TYR n 
1 832 VAL n 
1 833 LEU n 
1 834 PRO n 
1 835 LEU n 
1 836 ARG n 
1 837 GLU n 
1 838 GLY n 
1 839 ASN n 
1 840 PRO n 
1 841 PHE n 
1 842 GLY n 
1 843 ASP n 
1 844 LYS n 
1 845 CYS n 
1 846 ILE n 
1 847 ALA n 
1 848 TRP n 
1 849 PRO n 
1 850 SER n 
1 851 GLY n 
1 852 THR n 
1 853 GLU n 
1 854 ILE n 
1 855 THR n 
1 856 ASP n 
1 857 LEU n 
1 858 ILE n 
1 859 LYS n 
1 860 ASP n 
1 861 ASP n 
1 862 VAL n 
1 863 LEU n 
1 864 HIS n 
1 865 TRP n 
1 866 MET n 
1 867 ASP n 
1 868 TYR n 
1 869 THR n 
1 870 VAL n 
1 871 LEU n 
1 872 LEU n 
1 873 GLU n 
1 874 LYS n 
1 875 THR n 
1 876 PHE n 
1 877 ILE n 
1 878 LYS n 
1 879 PRO n 
1 880 LEU n 
1 881 GLU n 
1 882 GLY n 
1 883 PHE n 
1 884 THR n 
1 885 SER n 
1 886 ALA n 
1 887 ALA n 
1 888 LYS n 
1 889 LEU n 
1 890 ASP n 
1 891 TYR n 
1 892 GLU n 
1 893 LYS n 
1 894 LYS n 
1 895 ALA n 
1 896 SER n 
1 897 LEU n 
1 898 PHE n 
1 899 ASP n 
1 900 MET n 
1 901 PHE n 
1 902 ASP n 
1 903 PHE n 
2 1   DC  n 
2 2   2PR n 
2 3   DT  n 
2 4   DC  n 
2 5   DG  n 
2 6   DC  n 
2 7   DC  n 
2 8   DG  n 
2 9   DC  n 
2 10  DC  n 
2 11  DG  n 
2 12  DC  n 
2 13  DG  n 
2 14  DC  n 
2 15  DG  n 
2 16  DG  n 
3 1   DC  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DC  n 
3 6   DG  n 
3 7   DG  n 
3 8   DC  n 
3 9   DG  n 
3 10  DG  n 
3 11  DC  n 
3 12  DG  n 
3 13  2DA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 43 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage RB69' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12353 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPR69 Q38087 1 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFDIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
1 ? 
2 PDB 3SUP       3SUP   2 'C(2PR)TCGCCGCCGCGCGG' ? ? 
3 PDB 3SUP       3SUP   3 'CGCGCGGCGGCG(2DA)' ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3SUP A 1 ? 903 ? Q38087 1   ? 903 ? 1   903 
2 2 3SUP T 1 ? 16  ? 3SUP   3   ? 18  ? 3   18  
3 3 3SUP P 1 ? 13  ? 3SUP   103 ? 115 ? 103 115 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3SUP ALA A 222 ? UNP Q38087 ASP 222 'ENGINEERED MUTATION' 222 1 
1 3SUP ALA A 327 ? UNP Q38087 ASP 327 'ENGINEERED MUTATION' 327 2 
1 3SUP ALA A 567 ? UNP Q38087 TYR 567 'ENGINEERED MUTATION' 567 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2DA 'DNA linking'       n "2',3'-DIDEOXYADENOSINE-5'-MONOPHOSPHATE"                     ? 'C10 H14 N5 O5 P'  315.222 
2PR 'DNA linking'       n "2-AMINO-9-[2-DEOXYRIBOFURANOSYL]-9H-PURINE-5'-MONOPHOSPHATE" 
"2-AMINOPURINE-2'-DEOXYRIBO-5'-MONOPHOSPHATE" 'C10 H14 N5 O6 P'  331.222 
ALA 'L-peptide linking' y ALANINE                                                       ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                      ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                    ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                               ? 'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                                                 ? 'Ca 2'             40.078  
CYS 'L-peptide linking' y CYSTEINE                                                      ? 'C3 H7 N O2 S'     121.158 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                           ? 'C9 H14 N3 O7 P'   307.197 
DCP non-polymer         . "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"                            ? 'C9 H16 N3 O13 P3' 467.157 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                          ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                  ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                     ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                               ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                       ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                                     ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                         ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                    ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                       ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                        ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                    ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                 ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                       ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                        ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                                     ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                    ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                      ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                        ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          3SUP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.59 
_exptl_crystal.density_percent_sol   52.59 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'150 mM calcium chloride, 15% w/v PEG350 MME, 100 mM sodium cacodylate, pH 6.5, VAPOR DIFFUSION, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2011-04-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(220)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
# 
_reflns.entry_id                     3SUP 
_reflns.observed_criterion_sigma_I   1.1 
_reflns.observed_criterion_sigma_F   2.2 
_reflns.d_resolution_low             88.575 
_reflns.d_resolution_high            2.32 
_reflns.number_obs                   48550 
_reflns.number_all                   51377 
_reflns.percent_possible_obs         94.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.32 
_reflns_shell.d_res_low              2.36 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3SUP 
_refine.ls_number_reflns_obs                     48550 
_refine.ls_number_reflns_all                     51377 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             88.57 
_refine.ls_d_res_high                            2.32 
_refine.ls_percent_reflns_obs                    98.94 
_refine.ls_R_factor_obs                          0.20312 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20010 
_refine.ls_R_factor_R_free                       0.26082 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2607 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.946 
_refine.correlation_coeff_Fo_to_Fc_free          0.912 
_refine.B_iso_mean                               43.258 
_refine.aniso_B[1][1]                            -0.41 
_refine.aniso_B[2][2]                            0.77 
_refine.aniso_B[3][3]                            -0.36 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS 
U VALUES      : RESIDUAL ONLY
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.255 
_refine.overall_SU_ML                            0.177 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             16.066 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       0.347 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7367 
_refine_hist.pdbx_number_atoms_nucleic_acid   591 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             263 
_refine_hist.number_atoms_total               8254 
_refine_hist.d_res_high                       2.32 
_refine_hist.d_res_low                        88.57 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.008  0.022  ? 8256  ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.124  2.056  ? 11287 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.076  5.000  ? 906   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       35.323 24.122 ? 376   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       14.727 15.000 ? 1351  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       13.725 15.000 ? 47    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.080  0.200  ? 1194  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.004  0.021  ? 6107  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  1.479  4.000  ? 4512  ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 2.584  6.000  ? 7316  ? 'X-RAY DIFFRACTION' 
r_scbond_it                  2.939  6.000  ? 3744  ? 'X-RAY DIFFRACTION' 
r_scangle_it                 4.291  9.000  ? 3969  ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.322 
_refine_ls_shell.d_res_low                        2.382 
_refine_ls_shell.number_reflns_R_work             3279 
_refine_ls_shell.R_factor_R_work                  0.247 
_refine_ls_shell.percent_reflns_obs               92.07 
_refine_ls_shell.R_factor_R_free                  0.301 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             180 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3SUP 
_struct.title                     'RB69 DNA Polymerase (Y567A) Ternary Complex with dCTP Opposite 2AP (GC rich sequence)' 
_struct.pdbx_descriptor           'DNA polymerase (E.C.2.7.7.7)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3SUP 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            '2-aminopurine, GC rich, RB69pol, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 64  ? GLY A 79  ? ASN A 64  GLY A 79  1 ? 16 
HELX_P HELX_P2  2  ASP A 87  ? TYR A 97  ? ASP A 87  TYR A 97  1 ? 11 
HELX_P HELX_P3  3  ASP A 104 ? ILE A 108 ? ASP A 104 ILE A 108 5 ? 5  
HELX_P HELX_P4  4  SER A 163 ? LYS A 169 ? SER A 163 LYS A 169 1 ? 7  
HELX_P HELX_P5  5  LEU A 170 ? GLY A 174 ? LEU A 170 GLY A 174 5 ? 5  
HELX_P HELX_P6  6  PRO A 179 ? ASP A 184 ? PRO A 179 ASP A 184 1 ? 6  
HELX_P HELX_P7  7  ASN A 193 ? LYS A 208 ? ASN A 193 LYS A 208 1 ? 16 
HELX_P HELX_P8  8  PHE A 221 ? GLY A 235 ? PHE A 221 GLY A 235 1 ? 15 
HELX_P HELX_P9  9  GLY A 235 ? LYS A 240 ? GLY A 235 LYS A 240 1 ? 6  
HELX_P HELX_P10 10 ARG A 241 ? SER A 243 ? ARG A 241 SER A 243 5 ? 3  
HELX_P HELX_P11 11 ASP A 272 ? SER A 281 ? ASP A 272 SER A 281 1 ? 10 
HELX_P HELX_P12 12 SER A 289 ? ASN A 299 ? SER A 289 ASN A 299 1 ? 11 
HELX_P HELX_P13 13 PRO A 308 ? ASN A 316 ? PRO A 308 ASN A 316 1 ? 9  
HELX_P HELX_P14 14 ASN A 316 ? GLN A 339 ? ASN A 316 GLN A 339 1 ? 24 
HELX_P HELX_P15 15 GLN A 339 ? LYS A 352 ? GLN A 339 LYS A 352 1 ? 14 
HELX_P HELX_P16 16 GLN A 354 ? PHE A 359 ? GLN A 354 PHE A 359 5 ? 6  
HELX_P HELX_P17 17 SER A 360 ? GLN A 376 ? SER A 360 GLN A 376 1 ? 17 
HELX_P HELX_P18 18 SER A 414 ? ASN A 424 ? SER A 414 ASN A 424 1 ? 11 
HELX_P HELX_P19 19 SER A 426 ? GLU A 428 ? SER A 426 GLU A 428 5 ? 3  
HELX_P HELX_P20 20 PRO A 438 ? ASN A 444 ? PRO A 438 ASN A 444 1 ? 7  
HELX_P HELX_P21 21 GLY A 469 ? LEU A 503 ? GLY A 469 LEU A 503 1 ? 35 
HELX_P HELX_P22 22 SER A 523 ? LYS A 531 ? SER A 523 LYS A 531 1 ? 9  
HELX_P HELX_P23 23 SER A 534 ? LEU A 570 ? SER A 534 LEU A 570 1 ? 37 
HELX_P HELX_P24 24 ASP A 579 ? GLY A 610 ? ASP A 579 GLY A 610 1 ? 32 
HELX_P HELX_P25 25 ALA A 629 ? GLY A 637 ? ALA A 629 GLY A 637 1 ? 9  
HELX_P HELX_P26 26 GLU A 638 ? PHE A 641 ? GLU A 638 PHE A 641 5 ? 4  
HELX_P HELX_P27 27 ASP A 643 ? ARG A 658 ? ASP A 643 ARG A 658 1 ? 16 
HELX_P HELX_P28 28 ARG A 658 ? MET A 674 ? ARG A 658 MET A 674 1 ? 17 
HELX_P HELX_P29 29 LEU A 730 ? LYS A 734 ? LEU A 730 LYS A 734 5 ? 5  
HELX_P HELX_P30 30 PRO A 738 ? GLU A 755 ? PRO A 738 GLU A 755 1 ? 18 
HELX_P HELX_P31 31 GLY A 756 ? PHE A 771 ? GLY A 756 PHE A 771 1 ? 16 
HELX_P HELX_P32 32 ARG A 772 ? LEU A 774 ? ARG A 772 LEU A 774 5 ? 3  
HELX_P HELX_P33 33 ASN A 775 ? ALA A 780 ? ASN A 775 ALA A 780 5 ? 6  
HELX_P HELX_P34 34 ILE A 788 ? LYS A 790 ? ILE A 788 LYS A 790 5 ? 3  
HELX_P HELX_P35 35 PRO A 802 ? ILE A 815 ? PRO A 802 ILE A 815 1 ? 14 
HELX_P HELX_P36 36 THR A 855 ? MET A 866 ? THR A 855 MET A 866 1 ? 12 
HELX_P HELX_P37 37 ASP A 867 ? PHE A 876 ? ASP A 867 PHE A 876 1 ? 10 
HELX_P HELX_P38 38 PHE A 876 ? ALA A 887 ? PHE A 876 ALA A 887 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B DC  1   "O3'" ? ? ? 1_555 B 2PR 2  P  ? ? T DC  3   T 2PR 4    1_555 ? ? ? ? ? ? ?            1.600 ? 
covale2  covale ? ? B 2PR 2   "O3'" ? ? ? 1_555 B DT  3  P  ? ? T 2PR 4   T DT  5    1_555 ? ? ? ? ? ? ?            1.588 ? 
covale3  covale ? ? C DG  12  "O3'" ? ? ? 1_555 C 2DA 13 P  ? ? P DG  114 P 2DA 115  1_555 ? ? ? ? ? ? ?            1.604 ? 
metalc1  metalc ? ? A ASP 623 OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 623 A CA  905  1_555 ? ? ? ? ? ? ?            2.138 ? 
metalc2  metalc ? ? A LYS 531 O     ? ? ? 1_555 G CA  .  CA ? ? A LYS 531 A CA  907  1_555 ? ? ? ? ? ? ?            2.303 ? 
metalc3  metalc ? ? D DCP .   O1G   ? ? ? 1_555 E CA  .  CA ? ? A DCP 904 A CA  905  1_555 ? ? ? ? ? ? ?            2.305 ? 
metalc4  metalc ? ? D DCP .   O2B   ? ? ? 1_555 E CA  .  CA ? ? A DCP 904 A CA  905  1_555 ? ? ? ? ? ? ?            2.306 ? 
metalc5  metalc ? ? A LEU 412 O     ? ? ? 1_555 E CA  .  CA ? ? A LEU 412 A CA  905  1_555 ? ? ? ? ? ? ?            2.328 ? 
metalc6  metalc ? ? A ASN 507 OD1   ? ? ? 1_555 G CA  .  CA ? ? A ASN 507 A CA  907  1_555 ? ? ? ? ? ? ?            2.390 ? 
metalc7  metalc ? ? A ASN 505 O     ? ? ? 1_555 G CA  .  CA ? ? A ASN 505 A CA  907  1_555 ? ? ? ? ? ? ?            2.403 ? 
metalc8  metalc ? ? D DCP .   O2A   ? ? ? 1_555 F CA  .  CA ? ? A DCP 904 A CA  906  1_555 ? ? ? ? ? ? ?            2.493 ? 
metalc9  metalc ? ? A ASP 411 OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 411 A CA  905  1_555 ? ? ? ? ? ? ?            2.501 ? 
metalc10 metalc ? ? A ASP 411 OD2   ? ? ? 1_555 E CA  .  CA ? ? A ASP 411 A CA  905  1_555 ? ? ? ? ? ? ?            2.539 ? 
metalc11 metalc ? ? D DCP .   O2A   ? ? ? 1_555 E CA  .  CA ? ? A DCP 904 A CA  905  1_555 ? ? ? ? ? ? ?            2.627 ? 
metalc12 metalc ? ? A ASP 623 OD2   ? ? ? 1_555 F CA  .  CA ? ? A ASP 623 A CA  906  1_555 ? ? ? ? ? ? ?            2.737 ? 
metalc13 metalc ? ? A ASP 411 OD2   ? ? ? 1_555 F CA  .  CA ? ? A ASP 411 A CA  906  1_555 ? ? ? ? ? ? ?            2.740 ? 
metalc14 metalc ? ? A GLU 116 OE1   ? ? ? 1_555 I CA  .  CA ? ? A GLU 116 A CA  909  1_555 ? ? ? ? ? ? ?            2.752 ? 
metalc15 metalc ? ? A GLU 116 OE2   ? ? ? 1_555 I CA  .  CA ? ? A GLU 116 A CA  909  1_555 ? ? ? ? ? ? ?            3.016 ? 
metalc16 metalc ? ? G CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  907 A HOH 1060 1_555 ? ? ? ? ? ? ?            2.323 ? 
metalc17 metalc ? ? H CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  908 A HOH 1087 1_555 ? ? ? ? ? ? ?            2.411 ? 
metalc18 metalc ? ? I CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  909 A HOH 998  1_555 ? ? ? ? ? ? ?            2.511 ? 
metalc19 metalc ? ? H CA  .   CA    ? ? ? 1_555 J HOH .  O  ? ? A CA  908 A HOH 1068 1_555 ? ? ? ? ? ? ?            3.191 ? 
hydrog1  hydrog ? ? B DT  3   N3    ? ? ? 1_555 C 2DA 13 N1 ? ? T DT  5   P 2DA 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DT  3   O4    ? ? ? 1_555 C 2DA 13 N6 ? ? T DT  5   P 2DA 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  4   N3    ? ? ? 1_555 C DG  12 N1 ? ? T DC  6   P DG  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DC  4   N4    ? ? ? 1_555 C DG  12 O6 ? ? T DC  6   P DG  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DC  4   O2    ? ? ? 1_555 C DG  12 N2 ? ? T DC  6   P DG  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  5   N1    ? ? ? 1_555 C DC  11 N3 ? ? T DG  7   P DC  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  5   N2    ? ? ? 1_555 C DC  11 O2 ? ? T DG  7   P DC  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  5   O6    ? ? ? 1_555 C DC  11 N4 ? ? T DG  7   P DC  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DC  6   N3    ? ? ? 1_555 C DG  10 N1 ? ? T DC  8   P DG  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  6   N4    ? ? ? 1_555 C DG  10 O6 ? ? T DC  8   P DG  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  6   O2    ? ? ? 1_555 C DG  10 N2 ? ? T DC  8   P DG  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  7   N3    ? ? ? 1_555 C DG  9  N1 ? ? T DC  9   P DG  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  7   N4    ? ? ? 1_555 C DG  9  O6 ? ? T DC  9   P DG  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  7   O2    ? ? ? 1_555 C DG  9  N2 ? ? T DC  9   P DG  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  8   N1    ? ? ? 1_555 C DC  8  N3 ? ? T DG  10  P DC  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  8   N2    ? ? ? 1_555 C DC  8  O2 ? ? T DG  10  P DC  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  8   O6    ? ? ? 1_555 C DC  8  N4 ? ? T DG  10  P DC  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  7  N1 ? ? T DC  11  P DG  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  7  O6 ? ? T DC  11  P DG  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  7  N2 ? ? T DC  11  P DG  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DC  10  N3    ? ? ? 1_555 C DG  6  N1 ? ? T DC  12  P DG  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DC  10  N4    ? ? ? 1_555 C DG  6  O6 ? ? T DC  12  P DG  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DC  10  O2    ? ? ? 1_555 C DG  6  N2 ? ? T DC  12  P DG  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DG  11  N1    ? ? ? 1_555 C DC  5  N3 ? ? T DG  13  P DC  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DG  11  N2    ? ? ? 1_555 C DC  5  O2 ? ? T DG  13  P DC  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DG  11  O6    ? ? ? 1_555 C DC  5  N4 ? ? T DG  13  P DC  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DC  12  N3    ? ? ? 1_555 C DG  4  N1 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DC  12  N4    ? ? ? 1_555 C DG  4  O6 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DC  12  O2    ? ? ? 1_555 C DG  4  N2 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DG  13  N1    ? ? ? 1_555 C DC  3  N3 ? ? T DG  15  P DC  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DG  13  N2    ? ? ? 1_555 C DC  3  O2 ? ? T DG  15  P DC  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DG  13  O6    ? ? ? 1_555 C DC  3  N4 ? ? T DG  15  P DC  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DC  14  N3    ? ? ? 1_555 C DG  2  N1 ? ? T DC  16  P DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DC  14  N4    ? ? ? 1_555 C DG  2  O6 ? ? T DC  16  P DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DC  14  O2    ? ? ? 1_555 C DG  2  N2 ? ? T DC  16  P DG  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASP 
_struct_mon_prot_cis.label_seq_id           899 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASP 
_struct_mon_prot_cis.auth_seq_id            899 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   MET 
_struct_mon_prot_cis.pdbx_label_seq_id_2    900 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    MET 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     900 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -4.06 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 6 ? 
D ? 2 ? 
E ? 2 ? 
F ? 7 ? 
G ? 4 ? 
H ? 3 ? 
I ? 3 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 4   ? ILE A 11  ? PHE A 4   ILE A 11  
A 2 SER A 14  ? ILE A 20  ? SER A 14  ILE A 20  
A 3 GLU A 26  ? VAL A 31  ? GLU A 26  VAL A 31  
B 1 SER A 36  ? HIS A 40  ? SER A 36  HIS A 40  
B 2 PRO A 56  ? LEU A 61  ? PRO A 56  LEU A 61  
B 3 TYR A 49  ? ASP A 51  ? TYR A 49  ASP A 51  
B 4 LYS A 378 ? VAL A 379 ? LYS A 378 VAL A 379 
C 1 ILE A 186 ? PHE A 191 ? ILE A 186 PHE A 191 
C 2 ARG A 145 ? LEU A 151 ? ARG A 145 LEU A 151 
C 3 ALA A 135 ? ASP A 140 ? ALA A 135 ASP A 140 
C 4 VAL A 110 ? GLU A 116 ? VAL A 110 GLU A 116 
C 5 ILE A 212 ? THR A 214 ? ILE A 212 THR A 214 
C 6 SER A 269 ? VAL A 270 ? SER A 269 VAL A 270 
D 1 ASN A 153 ? SER A 154 ? ASN A 153 SER A 154 
D 2 GLY A 157 ? ASN A 158 ? GLY A 157 ASN A 158 
E 1 THR A 248 ? VAL A 252 ? THR A 248 VAL A 252 
E 2 GLU A 261 ? LEU A 265 ? GLU A 261 LEU A 265 
F 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
F 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
F 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
F 4 MET A 683 ? ALA A 689 ? MET A 683 ALA A 689 
F 5 VAL A 407 ? LEU A 412 ? VAL A 407 LEU A 412 
F 6 SER A 624 ? SER A 628 ? SER A 624 SER A 628 
F 7 VAL A 617 ? ASP A 621 ? VAL A 617 ASP A 621 
G 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
G 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
G 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
G 4 THR A 718 ? MET A 728 ? THR A 718 MET A 728 
H 1 ILE A 430 ? THR A 433 ? ILE A 430 THR A 433 
H 2 MET A 461 ? TYR A 463 ? MET A 461 TYR A 463 
H 3 SER A 455 ? SER A 457 ? SER A 455 SER A 457 
I 1 SER A 781 ? SER A 784 ? SER A 781 SER A 784 
I 2 LYS A 829 ? PRO A 834 ? LYS A 829 PRO A 834 
I 3 CYS A 845 ? PRO A 849 ? CYS A 845 PRO A 849 
J 1 ASP A 792 ? VAL A 793 ? ASP A 792 VAL A 793 
J 2 PHE A 796 ? PRO A 797 ? PHE A 796 PRO A 797 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 4   ? N PHE A 4   O ILE A 20  ? O ILE A 20  
A 2 3 N TYR A 19  ? N TYR A 19  O ARG A 27  ? O ARG A 27  
B 1 2 N LEU A 37  ? N LEU A 37  O LYS A 60  ? O LYS A 60  
B 2 3 O CYS A 57  ? O CYS A 57  N TYR A 49  ? N TYR A 49  
B 3 4 N PHE A 50  ? N PHE A 50  O VAL A 379 ? O VAL A 379 
C 1 2 O ILE A 187 ? O ILE A 187 N PHE A 146 ? N PHE A 146 
C 2 3 O PHE A 149 ? O PHE A 149 N ILE A 136 ? N ILE A 136 
C 3 4 O TYR A 139 ? O TYR A 139 N ASN A 112 ? N ASN A 112 
C 4 5 N ALA A 111 ? N ALA A 111 O THR A 214 ? O THR A 214 
C 5 6 N LEU A 213 ? N LEU A 213 O SER A 269 ? O SER A 269 
D 1 2 N SER A 154 ? N SER A 154 O GLY A 157 ? O GLY A 157 
E 1 2 N ARG A 249 ? N ARG A 249 O THR A 264 ? O THR A 264 
F 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
F 2 3 N PHE A 701 ? N PHE A 701 O ALA A 709 ? O ALA A 709 
F 3 4 O TRP A 713 ? O TRP A 713 N ILE A 688 ? N ILE A 688 
F 4 5 O ALA A 689 ? O ALA A 689 N VAL A 407 ? N VAL A 407 
F 5 6 N MET A 408 ? N MET A 408 O VAL A 627 ? O VAL A 627 
F 6 7 O TYR A 626 ? O TYR A 626 N LEU A 618 ? N LEU A 618 
G 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
G 2 3 N PHE A 701 ? N PHE A 701 O ALA A 709 ? O ALA A 709 
G 3 4 N TYR A 708 ? N TYR A 708 O MET A 728 ? O MET A 728 
H 1 2 N ALA A 431 ? N ALA A 431 O MET A 462 ? O MET A 462 
H 2 3 O TYR A 463 ? O TYR A 463 N SER A 455 ? N SER A 455 
I 1 2 N SER A 783 ? N SER A 783 O VAL A 830 ? O VAL A 830 
I 2 3 N TYR A 831 ? N TYR A 831 O TRP A 848 ? O TRP A 848 
J 1 2 N VAL A 793 ? N VAL A 793 O PHE A 796 ? O PHE A 796 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE DCP A 904' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 905'  
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA A 906'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 907'  
AC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA A 908'  
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA A 909'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 ASP A 411 ? ASP A 411  . ? 1_555 ? 
2  AC1 17 LEU A 412 ? LEU A 412  . ? 1_555 ? 
3  AC1 17 SER A 414 ? SER A 414  . ? 1_555 ? 
4  AC1 17 LEU A 415 ? LEU A 415  . ? 1_555 ? 
5  AC1 17 TYR A 416 ? TYR A 416  . ? 1_555 ? 
6  AC1 17 ARG A 482 ? ARG A 482  . ? 1_555 ? 
7  AC1 17 LYS A 560 ? LYS A 560  . ? 1_555 ? 
8  AC1 17 ASN A 564 ? ASN A 564  . ? 1_555 ? 
9  AC1 17 THR A 622 ? THR A 622  . ? 1_555 ? 
10 AC1 17 ASP A 623 ? ASP A 623  . ? 1_555 ? 
11 AC1 17 CA  E .   ? CA  A 905  . ? 1_555 ? 
12 AC1 17 CA  F .   ? CA  A 906  . ? 1_555 ? 
13 AC1 17 HOH J .   ? HOH A 942  . ? 1_555 ? 
14 AC1 17 HOH J .   ? HOH A 1124 . ? 1_555 ? 
15 AC1 17 HOH J .   ? HOH A 1141 . ? 1_555 ? 
16 AC1 17 2DA C 13  ? 2DA P 115  . ? 1_555 ? 
17 AC1 17 2PR B 2   ? 2PR T 4    . ? 1_555 ? 
18 AC2 4  ASP A 411 ? ASP A 411  . ? 1_555 ? 
19 AC2 4  LEU A 412 ? LEU A 412  . ? 1_555 ? 
20 AC2 4  ASP A 623 ? ASP A 623  . ? 1_555 ? 
21 AC2 4  DCP D .   ? DCP A 904  . ? 1_555 ? 
22 AC3 3  ASP A 411 ? ASP A 411  . ? 1_555 ? 
23 AC3 3  ASP A 623 ? ASP A 623  . ? 1_555 ? 
24 AC3 3  DCP D .   ? DCP A 904  . ? 1_555 ? 
25 AC4 4  ASN A 505 ? ASN A 505  . ? 1_555 ? 
26 AC4 4  ASN A 507 ? ASN A 507  . ? 1_555 ? 
27 AC4 4  LYS A 531 ? LYS A 531  . ? 1_555 ? 
28 AC4 4  HOH J .   ? HOH A 1060 . ? 1_555 ? 
29 AC5 2  GLU A 716 ? GLU A 716  . ? 1_555 ? 
30 AC5 2  HOH J .   ? HOH A 1087 . ? 1_555 ? 
31 AC6 2  GLU A 116 ? GLU A 116  . ? 1_555 ? 
32 AC6 2  HOH J .   ? HOH A 998  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3SUP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3SUP 
_atom_sites.fract_transf_matrix[1][1]   0.013377 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008309 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007644 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? -37.787 18.139  29.749  1.00 57.30  ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? -36.467 17.646  29.266  1.00 58.16  ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? -36.353 16.128  29.419  1.00 55.53  ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? -37.103 15.517  30.183  1.00 55.02  ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? -35.324 18.359  30.004  1.00 60.62  ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? -35.144 17.967  31.487  1.00 66.99  ? 1    MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? -33.796 18.847  32.338  1.00 73.98  ? 1    MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? -32.385 18.433  31.310  1.00 73.43  ? 1    MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? -35.425 15.529  28.676  1.00 53.28  ? 2    LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? -35.115 14.107  28.822  1.00 52.43  ? 2    LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? -34.330 13.873  30.109  1.00 48.58  ? 2    LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? -33.380 14.599  30.405  1.00 47.86  ? 2    LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? -34.323 13.580  27.614  1.00 53.79  ? 2    LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? -35.172 12.972  26.493  1.00 60.09  ? 2    LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? -35.791 11.633  26.916  1.00 64.37  ? 2    LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? -36.524 10.933  25.772  1.00 65.01  ? 2    LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? -35.603 10.169  24.877  1.00 62.31  ? 2    LYS A NZ    1 
ATOM   18   N  N     . GLU A 1 3   ? -34.741 12.861  30.867  1.00 44.02  ? 3    GLU A N     1 
ATOM   19   C  CA    . GLU A 1 3   ? -34.080 12.499  32.118  1.00 41.56  ? 3    GLU A CA    1 
ATOM   20   C  C     . GLU A 1 3   ? -32.640 12.012  31.919  1.00 38.56  ? 3    GLU A C     1 
ATOM   21   O  O     . GLU A 1 3   ? -32.309 11.447  30.877  1.00 39.35  ? 3    GLU A O     1 
ATOM   22   C  CB    . GLU A 1 3   ? -34.900 11.446  32.862  1.00 39.46  ? 3    GLU A CB    1 
ATOM   23   C  CG    . GLU A 1 3   ? -36.317 11.900  33.116  1.00 45.51  ? 3    GLU A CG    1 
ATOM   24   C  CD    . GLU A 1 3   ? -37.054 11.080  34.158  1.00 47.94  ? 3    GLU A CD    1 
ATOM   25   O  OE1   . GLU A 1 3   ? -38.185 11.480  34.497  1.00 55.44  ? 3    GLU A OE1   1 
ATOM   26   O  OE2   . GLU A 1 3   ? -36.528 10.056  34.643  1.00 46.02  ? 3    GLU A OE2   1 
ATOM   27   N  N     . PHE A 1 4   ? -31.788 12.273  32.906  1.00 34.89  ? 4    PHE A N     1 
ATOM   28   C  CA    . PHE A 1 4   ? -30.444 11.703  32.936  1.00 34.02  ? 4    PHE A CA    1 
ATOM   29   C  C     . PHE A 1 4   ? -29.999 11.367  34.353  1.00 31.83  ? 4    PHE A C     1 
ATOM   30   O  O     . PHE A 1 4   ? -30.424 11.996  35.316  1.00 32.71  ? 4    PHE A O     1 
ATOM   31   C  CB    . PHE A 1 4   ? -29.419 12.586  32.209  1.00 33.47  ? 4    PHE A CB    1 
ATOM   32   C  CG    . PHE A 1 4   ? -29.302 13.983  32.755  1.00 33.63  ? 4    PHE A CG    1 
ATOM   33   C  CD1   . PHE A 1 4   ? -30.211 14.967  32.392  1.00 32.20  ? 4    PHE A CD1   1 
ATOM   34   C  CD2   . PHE A 1 4   ? -28.258 14.322  33.606  1.00 30.22  ? 4    PHE A CD2   1 
ATOM   35   C  CE1   . PHE A 1 4   ? -30.088 16.279  32.894  1.00 32.59  ? 4    PHE A CE1   1 
ATOM   36   C  CE2   . PHE A 1 4   ? -28.133 15.619  34.103  1.00 30.31  ? 4    PHE A CE2   1 
ATOM   37   C  CZ    . PHE A 1 4   ? -29.050 16.599  33.738  1.00 27.20  ? 4    PHE A CZ    1 
ATOM   38   N  N     . TYR A 1 5   ? -29.166 10.341  34.467  1.00 32.91  ? 5    TYR A N     1 
ATOM   39   C  CA    . TYR A 1 5   ? -28.620 9.937   35.756  1.00 32.73  ? 5    TYR A CA    1 
ATOM   40   C  C     . TYR A 1 5   ? -27.553 10.910  36.219  1.00 30.69  ? 5    TYR A C     1 
ATOM   41   O  O     . TYR A 1 5   ? -26.952 11.620  35.417  1.00 29.20  ? 5    TYR A O     1 
ATOM   42   C  CB    . TYR A 1 5   ? -28.053 8.509   35.693  1.00 34.63  ? 5    TYR A CB    1 
ATOM   43   C  CG    . TYR A 1 5   ? -26.804 8.350   34.839  1.00 33.94  ? 5    TYR A CG    1 
ATOM   44   C  CD1   . TYR A 1 5   ? -26.900 8.114   33.470  1.00 33.57  ? 5    TYR A CD1   1 
ATOM   45   C  CD2   . TYR A 1 5   ? -25.526 8.425   35.408  1.00 33.33  ? 5    TYR A CD2   1 
ATOM   46   C  CE1   . TYR A 1 5   ? -25.750 7.962   32.681  1.00 35.99  ? 5    TYR A CE1   1 
ATOM   47   C  CE2   . TYR A 1 5   ? -24.372 8.276   34.627  1.00 32.47  ? 5    TYR A CE2   1 
ATOM   48   C  CZ    . TYR A 1 5   ? -24.497 8.049   33.264  1.00 33.44  ? 5    TYR A CZ    1 
ATOM   49   O  OH    . TYR A 1 5   ? -23.381 7.901   32.480  1.00 35.36  ? 5    TYR A OH    1 
ATOM   50   N  N     . LEU A 1 6   ? -27.341 10.947  37.528  1.00 32.39  ? 6    LEU A N     1 
ATOM   51   C  CA    . LEU A 1 6   ? -26.233 11.680  38.118  1.00 28.49  ? 6    LEU A CA    1 
ATOM   52   C  C     . LEU A 1 6   ? -25.196 10.682  38.624  1.00 28.70  ? 6    LEU A C     1 
ATOM   53   O  O     . LEU A 1 6   ? -24.032 10.734  38.221  1.00 26.93  ? 6    LEU A O     1 
ATOM   54   C  CB    . LEU A 1 6   ? -26.738 12.569  39.254  1.00 31.86  ? 6    LEU A CB    1 
ATOM   55   C  CG    . LEU A 1 6   ? -27.735 13.676  38.885  1.00 31.37  ? 6    LEU A CG    1 
ATOM   56   C  CD1   . LEU A 1 6   ? -28.375 14.224  40.132  1.00 34.85  ? 6    LEU A CD1   1 
ATOM   57   C  CD2   . LEU A 1 6   ? -27.042 14.792  38.118  1.00 32.21  ? 6    LEU A CD2   1 
ATOM   58   N  N     . THR A 1 7   ? -25.629 9.768   39.495  1.00 28.70  ? 7    THR A N     1 
ATOM   59   C  CA    . THR A 1 7   ? -24.769 8.715   40.047  1.00 28.10  ? 7    THR A CA    1 
ATOM   60   C  C     . THR A 1 7   ? -25.512 7.396   40.127  1.00 29.05  ? 7    THR A C     1 
ATOM   61   O  O     . THR A 1 7   ? -26.738 7.378   40.218  1.00 32.86  ? 7    THR A O     1 
ATOM   62   C  CB    . THR A 1 7   ? -24.303 9.038   41.480  1.00 28.93  ? 7    THR A CB    1 
ATOM   63   O  OG1   . THR A 1 7   ? -25.439 9.081   42.351  1.00 30.90  ? 7    THR A OG1   1 
ATOM   64   C  CG2   . THR A 1 7   ? -23.547 10.358  41.548  1.00 24.20  ? 7    THR A CG2   1 
ATOM   65   N  N     . VAL A 1 8   ? -24.776 6.289   40.116  1.00 30.02  ? 8    VAL A N     1 
ATOM   66   C  CA    . VAL A 1 8   ? -25.392 4.970   40.242  1.00 30.45  ? 8    VAL A CA    1 
ATOM   67   C  C     . VAL A 1 8   ? -24.501 4.039   41.061  1.00 33.23  ? 8    VAL A C     1 
ATOM   68   O  O     . VAL A 1 8   ? -23.278 4.054   40.921  1.00 34.08  ? 8    VAL A O     1 
ATOM   69   C  CB    . VAL A 1 8   ? -25.749 4.358   38.844  1.00 32.28  ? 8    VAL A CB    1 
ATOM   70   C  CG1   . VAL A 1 8   ? -24.506 3.876   38.089  1.00 31.77  ? 8    VAL A CG1   1 
ATOM   71   C  CG2   . VAL A 1 8   ? -26.753 3.240   38.981  1.00 28.18  ? 8    VAL A CG2   1 
ATOM   72   N  N     . GLU A 1 9   ? -25.118 3.246   41.932  1.00 33.21  ? 9    GLU A N     1 
ATOM   73   C  CA    . GLU A 1 9   ? -24.379 2.299   42.755  1.00 35.32  ? 9    GLU A CA    1 
ATOM   74   C  C     . GLU A 1 9   ? -25.161 1.014   42.936  1.00 36.79  ? 9    GLU A C     1 
ATOM   75   O  O     . GLU A 1 9   ? -26.393 1.024   42.938  1.00 41.43  ? 9    GLU A O     1 
ATOM   76   C  CB    . GLU A 1 9   ? -24.075 2.894   44.138  1.00 33.79  ? 9    GLU A CB    1 
ATOM   77   C  CG    . GLU A 1 9   ? -23.386 4.258   44.115  1.00 34.81  ? 9    GLU A CG    1 
ATOM   78   C  CD    . GLU A 1 9   ? -21.887 4.194   43.818  1.00 33.31  ? 9    GLU A CD    1 
ATOM   79   O  OE1   . GLU A 1 9   ? -21.371 3.114   43.476  1.00 37.73  ? 9    GLU A OE1   1 
ATOM   80   O  OE2   . GLU A 1 9   ? -21.213 5.236   43.939  1.00 35.09  ? 9    GLU A OE2   1 
ATOM   81   N  N     . GLN A 1 10  ? -24.440 -0.088  43.088  1.00 36.18  ? 10   GLN A N     1 
ATOM   82   C  CA    . GLN A 1 10  ? -25.046 -1.332  43.509  1.00 36.74  ? 10   GLN A CA    1 
ATOM   83   C  C     . GLN A 1 10  ? -24.713 -1.560  44.975  1.00 38.92  ? 10   GLN A C     1 
ATOM   84   O  O     . GLN A 1 10  ? -23.541 -1.579  45.364  1.00 40.21  ? 10   GLN A O     1 
ATOM   85   C  CB    . GLN A 1 10  ? -24.557 -2.508  42.665  1.00 36.92  ? 10   GLN A CB    1 
ATOM   86   C  CG    . GLN A 1 10  ? -25.225 -3.825  43.038  1.00 38.29  ? 10   GLN A CG    1 
ATOM   87   C  CD    . GLN A 1 10  ? -24.520 -5.058  42.482  1.00 43.07  ? 10   GLN A CD    1 
ATOM   88   O  OE1   . GLN A 1 10  ? -23.753 -4.987  41.512  1.00 42.12  ? 10   GLN A OE1   1 
ATOM   89   N  NE2   . GLN A 1 10  ? -24.787 -6.203  43.102  1.00 40.75  ? 10   GLN A NE2   1 
ATOM   90   N  N     . ILE A 1 11  ? -25.757 -1.710  45.780  1.00 40.14  ? 11   ILE A N     1 
ATOM   91   C  CA    . ILE A 1 11  ? -25.627 -2.093  47.179  1.00 41.46  ? 11   ILE A CA    1 
ATOM   92   C  C     . ILE A 1 11  ? -26.515 -3.315  47.413  1.00 41.53  ? 11   ILE A C     1 
ATOM   93   O  O     . ILE A 1 11  ? -27.754 -3.217  47.453  1.00 39.44  ? 11   ILE A O     1 
ATOM   94   C  CB    . ILE A 1 11  ? -26.007 -0.934  48.141  1.00 42.79  ? 11   ILE A CB    1 
ATOM   95   C  CG1   . ILE A 1 11  ? -25.105 0.288   47.899  1.00 45.33  ? 11   ILE A CG1   1 
ATOM   96   C  CG2   . ILE A 1 11  ? -25.896 -1.393  49.588  1.00 43.62  ? 11   ILE A CG2   1 
ATOM   97   C  CD1   . ILE A 1 11  ? -25.567 1.573   48.587  1.00 47.18  ? 11   ILE A CD1   1 
ATOM   98   N  N     . GLY A 1 12  ? -25.868 -4.468  47.554  1.00 43.02  ? 12   GLY A N     1 
ATOM   99   C  CA    . GLY A 1 12  ? -26.576 -5.737  47.663  1.00 44.36  ? 12   GLY A CA    1 
ATOM   100  C  C     . GLY A 1 12  ? -27.463 -5.965  46.454  1.00 43.36  ? 12   GLY A C     1 
ATOM   101  O  O     . GLY A 1 12  ? -26.982 -6.022  45.324  1.00 45.44  ? 12   GLY A O     1 
ATOM   102  N  N     . ASP A 1 13  ? -28.764 -6.071  46.696  1.00 42.18  ? 13   ASP A N     1 
ATOM   103  C  CA    . ASP A 1 13  ? -29.719 -6.334  45.628  1.00 40.52  ? 13   ASP A CA    1 
ATOM   104  C  C     . ASP A 1 13  ? -30.459 -5.078  45.193  1.00 38.86  ? 13   ASP A C     1 
ATOM   105  O  O     . ASP A 1 13  ? -31.439 -5.147  44.459  1.00 35.88  ? 13   ASP A O     1 
ATOM   106  C  CB    . ASP A 1 13  ? -30.697 -7.439  46.044  1.00 41.03  ? 13   ASP A CB    1 
ATOM   107  C  CG    . ASP A 1 13  ? -30.046 -8.807  46.061  1.00 42.76  ? 13   ASP A CG    1 
ATOM   108  O  OD1   . ASP A 1 13  ? -30.322 -9.589  46.994  1.00 47.73  ? 13   ASP A OD1   1 
ATOM   109  O  OD2   . ASP A 1 13  ? -29.249 -9.096  45.142  1.00 39.29  ? 13   ASP A OD2   1 
ATOM   110  N  N     . SER A 1 14  ? -29.966 -3.928  45.638  1.00 38.81  ? 14   SER A N     1 
ATOM   111  C  CA    . SER A 1 14  ? -30.552 -2.664  45.245  1.00 40.10  ? 14   SER A CA    1 
ATOM   112  C  C     . SER A 1 14  ? -29.613 -1.867  44.357  1.00 39.84  ? 14   SER A C     1 
ATOM   113  O  O     . SER A 1 14  ? -28.390 -1.913  44.526  1.00 38.78  ? 14   SER A O     1 
ATOM   114  C  CB    . SER A 1 14  ? -30.949 -1.854  46.482  1.00 40.30  ? 14   SER A CB    1 
ATOM   115  O  OG    . SER A 1 14  ? -32.147 -2.371  47.044  1.00 42.69  ? 14   SER A OG    1 
ATOM   116  N  N     . ILE A 1 15  ? -30.202 -1.169  43.391  1.00 39.78  ? 15   ILE A N     1 
ATOM   117  C  CA    . ILE A 1 15  ? -29.512 -0.127  42.646  1.00 37.83  ? 15   ILE A CA    1 
ATOM   118  C  C     . ILE A 1 15  ? -29.923 1.199   43.271  1.00 37.83  ? 15   ILE A C     1 
ATOM   119  O  O     . ILE A 1 15  ? -31.116 1.502   43.383  1.00 37.70  ? 15   ILE A O     1 
ATOM   120  C  CB    . ILE A 1 15  ? -29.889 -0.127  41.133  1.00 37.22  ? 15   ILE A CB    1 
ATOM   121  C  CG1   . ILE A 1 15  ? -29.214 -1.285  40.366  1.00 33.98  ? 15   ILE A CG1   1 
ATOM   122  C  CG2   . ILE A 1 15  ? -29.542 1.213   40.488  1.00 36.86  ? 15   ILE A CG2   1 
ATOM   123  C  CD1   . ILE A 1 15  ? -27.681 -1.267  40.356  1.00 35.62  ? 15   ILE A CD1   1 
ATOM   124  N  N     . PHE A 1 16  ? -28.938 1.983   43.691  1.00 37.33  ? 16   PHE A N     1 
ATOM   125  C  CA    . PHE A 1 16  ? -29.212 3.327   44.186  1.00 35.37  ? 16   PHE A CA    1 
ATOM   126  C  C     . PHE A 1 16  ? -28.829 4.335   43.113  1.00 34.77  ? 16   PHE A C     1 
ATOM   127  O  O     . PHE A 1 16  ? -27.678 4.376   42.678  1.00 35.08  ? 16   PHE A O     1 
ATOM   128  C  CB    . PHE A 1 16  ? -28.462 3.594   45.492  1.00 33.31  ? 16   PHE A CB    1 
ATOM   129  C  CG    . PHE A 1 16  ? -29.070 2.918   46.692  1.00 37.07  ? 16   PHE A CG    1 
ATOM   130  C  CD1   . PHE A 1 16  ? -29.998 3.590   47.493  1.00 41.23  ? 16   PHE A CD1   1 
ATOM   131  C  CD2   . PHE A 1 16  ? -28.714 1.616   47.033  1.00 38.14  ? 16   PHE A CD2   1 
ATOM   132  C  CE1   . PHE A 1 16  ? -30.564 2.968   48.615  1.00 42.14  ? 16   PHE A CE1   1 
ATOM   133  C  CE2   . PHE A 1 16  ? -29.274 0.983   48.153  1.00 40.42  ? 16   PHE A CE2   1 
ATOM   134  C  CZ    . PHE A 1 16  ? -30.199 1.660   48.945  1.00 42.20  ? 16   PHE A CZ    1 
ATOM   135  N  N     . GLU A 1 17  ? -29.806 5.131   42.680  1.00 33.22  ? 17   GLU A N     1 
ATOM   136  C  CA    . GLU A 1 17  ? -29.595 6.089   41.607  1.00 32.83  ? 17   GLU A CA    1 
ATOM   137  C  C     . GLU A 1 17  ? -30.012 7.494   42.007  1.00 33.58  ? 17   GLU A C     1 
ATOM   138  O  O     . GLU A 1 17  ? -31.131 7.707   42.456  1.00 34.86  ? 17   GLU A O     1 
ATOM   139  C  CB    . GLU A 1 17  ? -30.371 5.688   40.347  1.00 31.76  ? 17   GLU A CB    1 
ATOM   140  C  CG    . GLU A 1 17  ? -29.936 6.479   39.119  1.00 33.65  ? 17   GLU A CG    1 
ATOM   141  C  CD    . GLU A 1 17  ? -30.929 6.463   37.965  1.00 36.61  ? 17   GLU A CD    1 
ATOM   142  O  OE1   . GLU A 1 17  ? -30.686 7.204   36.990  1.00 35.27  ? 17   GLU A OE1   1 
ATOM   143  O  OE2   . GLU A 1 17  ? -31.946 5.736   38.020  1.00 36.45  ? 17   GLU A OE2   1 
ATOM   144  N  N     . ARG A 1 18  ? -29.103 8.446   41.834  1.00 33.46  ? 18   ARG A N     1 
ATOM   145  C  CA    . ARG A 1 18  ? -29.463 9.852   41.860  1.00 34.05  ? 18   ARG A CA    1 
ATOM   146  C  C     . ARG A 1 18  ? -29.610 10.249  40.405  1.00 33.58  ? 18   ARG A C     1 
ATOM   147  O  O     . ARG A 1 18  ? -28.836 9.797   39.568  1.00 34.93  ? 18   ARG A O     1 
ATOM   148  C  CB    . ARG A 1 18  ? -28.380 10.689  42.547  1.00 32.86  ? 18   ARG A CB    1 
ATOM   149  C  CG    . ARG A 1 18  ? -28.128 10.306  44.002  1.00 35.64  ? 18   ARG A CG    1 
ATOM   150  C  CD    . ARG A 1 18  ? -26.859 10.973  44.532  1.00 35.89  ? 18   ARG A CD    1 
ATOM   151  N  NE    . ARG A 1 18  ? -27.038 12.408  44.727  1.00 31.57  ? 18   ARG A NE    1 
ATOM   152  C  CZ    . ARG A 1 18  ? -26.048 13.273  44.938  1.00 31.44  ? 18   ARG A CZ    1 
ATOM   153  N  NH1   . ARG A 1 18  ? -24.784 12.857  44.987  1.00 28.55  ? 18   ARG A NH1   1 
ATOM   154  N  NH2   . ARG A 1 18  ? -26.323 14.564  45.101  1.00 25.57  ? 18   ARG A NH2   1 
ATOM   155  N  N     . TYR A 1 19  ? -30.606 11.076  40.099  1.00 34.10  ? 19   TYR A N     1 
ATOM   156  C  CA    . TYR A 1 19  ? -30.903 11.422  38.714  1.00 32.92  ? 19   TYR A CA    1 
ATOM   157  C  C     . TYR A 1 19  ? -31.637 12.751  38.612  1.00 34.88  ? 19   TYR A C     1 
ATOM   158  O  O     . TYR A 1 19  ? -32.135 13.283  39.610  1.00 36.26  ? 19   TYR A O     1 
ATOM   159  C  CB    . TYR A 1 19  ? -31.713 10.304  38.036  1.00 34.24  ? 19   TYR A CB    1 
ATOM   160  C  CG    . TYR A 1 19  ? -33.128 10.127  38.564  1.00 32.74  ? 19   TYR A CG    1 
ATOM   161  C  CD1   . TYR A 1 19  ? -33.373 9.476   39.777  1.00 34.48  ? 19   TYR A CD1   1 
ATOM   162  C  CD2   . TYR A 1 19  ? -34.223 10.612  37.844  1.00 32.78  ? 19   TYR A CD2   1 
ATOM   163  C  CE1   . TYR A 1 19  ? -34.698 9.315   40.268  1.00 36.10  ? 19   TYR A CE1   1 
ATOM   164  C  CE2   . TYR A 1 19  ? -35.542 10.449  38.313  1.00 31.23  ? 19   TYR A CE2   1 
ATOM   165  C  CZ    . TYR A 1 19  ? -35.769 9.800   39.519  1.00 32.53  ? 19   TYR A CZ    1 
ATOM   166  O  OH    . TYR A 1 19  ? -37.062 9.653   39.976  1.00 34.29  ? 19   TYR A OH    1 
ATOM   167  N  N     . ILE A 1 20  ? -31.682 13.286  37.398  1.00 34.66  ? 20   ILE A N     1 
ATOM   168  C  CA    . ILE A 1 20  ? -32.455 14.479  37.104  1.00 35.80  ? 20   ILE A CA    1 
ATOM   169  C  C     . ILE A 1 20  ? -33.727 14.066  36.355  1.00 36.70  ? 20   ILE A C     1 
ATOM   170  O  O     . ILE A 1 20  ? -33.658 13.491  35.262  1.00 33.60  ? 20   ILE A O     1 
ATOM   171  C  CB    . ILE A 1 20  ? -31.632 15.507  36.266  1.00 34.87  ? 20   ILE A CB    1 
ATOM   172  C  CG1   . ILE A 1 20  ? -30.411 16.026  37.052  1.00 34.04  ? 20   ILE A CG1   1 
ATOM   173  C  CG2   . ILE A 1 20  ? -32.519 16.644  35.771  1.00 34.32  ? 20   ILE A CG2   1 
ATOM   174  C  CD1   . ILE A 1 20  ? -30.720 16.764  38.358  1.00 34.85  ? 20   ILE A CD1   1 
ATOM   175  N  N     . ASP A 1 21  ? -34.883 14.361  36.947  1.00 37.90  ? 21   ASP A N     1 
ATOM   176  C  CA    . ASP A 1 21  ? -36.161 14.021  36.328  1.00 39.86  ? 21   ASP A CA    1 
ATOM   177  C  C     . ASP A 1 21  ? -36.540 14.975  35.187  1.00 42.31  ? 21   ASP A C     1 
ATOM   178  O  O     . ASP A 1 21  ? -35.834 15.952  34.910  1.00 41.12  ? 21   ASP A O     1 
ATOM   179  C  CB    . ASP A 1 21  ? -37.271 13.936  37.382  1.00 40.01  ? 21   ASP A CB    1 
ATOM   180  C  CG    . ASP A 1 21  ? -37.638 15.292  37.984  1.00 40.53  ? 21   ASP A CG    1 
ATOM   181  O  OD1   . ASP A 1 21  ? -37.248 16.362  37.448  1.00 41.52  ? 21   ASP A OD1   1 
ATOM   182  O  OD2   . ASP A 1 21  ? -38.338 15.275  39.018  1.00 36.81  ? 21   ASP A OD2   1 
ATOM   183  N  N     . SER A 1 22  ? -37.671 14.694  34.547  1.00 44.13  ? 22   SER A N     1 
ATOM   184  C  CA    . SER A 1 22  ? -38.117 15.452  33.376  1.00 46.72  ? 22   SER A CA    1 
ATOM   185  C  C     . SER A 1 22  ? -38.408 16.931  33.653  1.00 47.04  ? 22   SER A C     1 
ATOM   186  O  O     . SER A 1 22  ? -38.712 17.687  32.732  1.00 47.94  ? 22   SER A O     1 
ATOM   187  C  CB    . SER A 1 22  ? -39.332 14.775  32.737  1.00 46.62  ? 22   SER A CB    1 
ATOM   188  O  OG    . SER A 1 22  ? -40.347 14.560  33.699  1.00 49.30  ? 22   SER A OG    1 
ATOM   189  N  N     . ASN A 1 23  ? -38.284 17.342  34.910  1.00 46.97  ? 23   ASN A N     1 
ATOM   190  C  CA    . ASN A 1 23  ? -38.525 18.733  35.300  1.00 48.34  ? 23   ASN A CA    1 
ATOM   191  C  C     . ASN A 1 23  ? -37.257 19.435  35.771  1.00 48.00  ? 23   ASN A C     1 
ATOM   192  O  O     . ASN A 1 23  ? -37.277 20.619  36.129  1.00 47.41  ? 23   ASN A O     1 
ATOM   193  C  CB    . ASN A 1 23  ? -39.621 18.803  36.368  1.00 48.73  ? 23   ASN A CB    1 
ATOM   194  C  CG    . ASN A 1 23  ? -40.967 18.343  35.841  1.00 50.17  ? 23   ASN A CG    1 
ATOM   195  O  OD1   . ASN A 1 23  ? -41.447 18.848  34.829  1.00 51.37  ? 23   ASN A OD1   1 
ATOM   196  N  ND2   . ASN A 1 23  ? -41.577 17.376  36.517  1.00 52.00  ? 23   ASN A ND2   1 
ATOM   197  N  N     . GLY A 1 24  ? -36.152 18.698  35.753  1.00 46.63  ? 24   GLY A N     1 
ATOM   198  C  CA    . GLY A 1 24  ? -34.874 19.240  36.173  1.00 45.70  ? 24   GLY A CA    1 
ATOM   199  C  C     . GLY A 1 24  ? -34.696 19.176  37.676  1.00 44.55  ? 24   GLY A C     1 
ATOM   200  O  O     . GLY A 1 24  ? -33.778 19.785  38.217  1.00 45.65  ? 24   GLY A O     1 
ATOM   201  N  N     . ARG A 1 25  ? -35.576 18.439  38.349  1.00 43.43  ? 25   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 25  ? -35.418 18.176  39.776  1.00 43.62  ? 25   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 25  ? -34.469 17.003  40.015  1.00 40.66  ? 25   ARG A C     1 
ATOM   204  O  O     . ARG A 1 25  ? -34.594 15.958  39.381  1.00 40.96  ? 25   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 25  ? -36.766 17.872  40.441  1.00 43.49  ? 25   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 25  ? -37.526 19.080  40.989  1.00 45.15  ? 25   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 25  ? -38.455 19.691  39.954  1.00 43.59  ? 25   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 25  ? -39.368 20.671  40.549  1.00 44.32  ? 25   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 25  ? -40.662 20.470  40.797  1.00 42.25  ? 25   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 25  ? -41.248 19.310  40.504  1.00 40.08  ? 25   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 25  ? -41.374 21.445  41.346  1.00 42.93  ? 25   ARG A NH2   1 
ATOM   212  N  N     . GLU A 1 26  ? -33.528 17.191  40.932  1.00 37.74  ? 26   GLU A N     1 
ATOM   213  C  CA    . GLU A 1 26  ? -32.736 16.091  41.457  1.00 38.31  ? 26   GLU A CA    1 
ATOM   214  C  C     . GLU A 1 26  ? -33.606 15.161  42.304  1.00 39.74  ? 26   GLU A C     1 
ATOM   215  O  O     . GLU A 1 26  ? -34.363 15.613  43.178  1.00 37.98  ? 26   GLU A O     1 
ATOM   216  C  CB    . GLU A 1 26  ? -31.542 16.598  42.282  1.00 37.06  ? 26   GLU A CB    1 
ATOM   217  C  CG    . GLU A 1 26  ? -30.694 15.452  42.858  1.00 36.38  ? 26   GLU A CG    1 
ATOM   218  C  CD    . GLU A 1 26  ? -29.368 15.889  43.454  1.00 35.33  ? 26   GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1 26  ? -28.885 16.999  43.140  1.00 36.47  ? 26   GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1 26  ? -28.798 15.104  44.235  1.00 36.18  ? 26   GLU A OE2   1 
ATOM   221  N  N     . ARG A 1 27  ? -33.488 13.862  42.031  1.00 39.37  ? 27   ARG A N     1 
ATOM   222  C  CA    . ARG A 1 27  ? -34.214 12.836  42.768  1.00 41.12  ? 27   ARG A CA    1 
ATOM   223  C  C     . ARG A 1 27  ? -33.297 11.660  43.062  1.00 40.23  ? 27   ARG A C     1 
ATOM   224  O  O     . ARG A 1 27  ? -32.203 11.551  42.498  1.00 40.74  ? 27   ARG A O     1 
ATOM   225  C  CB    . ARG A 1 27  ? -35.413 12.335  41.955  1.00 44.17  ? 27   ARG A CB    1 
ATOM   226  C  CG    . ARG A 1 27  ? -36.382 13.388  41.478  1.00 48.83  ? 27   ARG A CG    1 
ATOM   227  C  CD    . ARG A 1 27  ? -37.603 13.483  42.367  1.00 59.08  ? 27   ARG A CD    1 
ATOM   228  N  NE    . ARG A 1 27  ? -38.744 13.969  41.595  1.00 67.36  ? 27   ARG A NE    1 
ATOM   229  C  CZ    . ARG A 1 27  ? -39.616 13.186  40.961  1.00 71.78  ? 27   ARG A CZ    1 
ATOM   230  N  NH1   . ARG A 1 27  ? -39.500 11.865  41.019  1.00 73.35  ? 27   ARG A NH1   1 
ATOM   231  N  NH2   . ARG A 1 27  ? -40.613 13.724  40.271  1.00 74.88  ? 27   ARG A NH2   1 
ATOM   232  N  N     . THR A 1 28  ? -33.759 10.777  43.938  1.00 40.97  ? 28   THR A N     1 
ATOM   233  C  CA    . THR A 1 28  ? -33.058 9.546   44.274  1.00 41.57  ? 28   THR A CA    1 
ATOM   234  C  C     . THR A 1 28  ? -34.090 8.434   44.314  1.00 42.27  ? 28   THR A C     1 
ATOM   235  O  O     . THR A 1 28  ? -35.247 8.667   44.670  1.00 45.24  ? 28   THR A O     1 
ATOM   236  C  CB    . THR A 1 28  ? -32.383 9.622   45.665  1.00 43.00  ? 28   THR A CB    1 
ATOM   237  O  OG1   . THR A 1 28  ? -31.903 10.948  45.909  1.00 46.97  ? 28   THR A OG1   1 
ATOM   238  C  CG2   . THR A 1 28  ? -31.220 8.637   45.766  1.00 42.11  ? 28   THR A CG2   1 
ATOM   239  N  N     . ARG A 1 29  ? -33.675 7.228   43.951  1.00 40.14  ? 29   ARG A N     1 
ATOM   240  C  CA    . ARG A 1 29  ? -34.554 6.069   44.006  1.00 40.77  ? 29   ARG A CA    1 
ATOM   241  C  C     . ARG A 1 29  ? -33.749 4.796   44.230  1.00 42.97  ? 29   ARG A C     1 
ATOM   242  O  O     . ARG A 1 29  ? -32.572 4.713   43.862  1.00 42.97  ? 29   ARG A O     1 
ATOM   243  C  CB    . ARG A 1 29  ? -35.393 5.950   42.727  1.00 40.66  ? 29   ARG A CB    1 
ATOM   244  C  CG    . ARG A 1 29  ? -34.580 5.794   41.441  1.00 37.12  ? 29   ARG A CG    1 
ATOM   245  C  CD    . ARG A 1 29  ? -35.497 5.720   40.256  1.00 35.30  ? 29   ARG A CD    1 
ATOM   246  N  NE    . ARG A 1 29  ? -34.789 5.933   39.005  1.00 36.14  ? 29   ARG A NE    1 
ATOM   247  C  CZ    . ARG A 1 29  ? -35.339 6.476   37.924  1.00 39.63  ? 29   ARG A CZ    1 
ATOM   248  N  NH1   . ARG A 1 29  ? -36.608 6.871   37.947  1.00 40.24  ? 29   ARG A NH1   1 
ATOM   249  N  NH2   . ARG A 1 29  ? -34.619 6.636   36.822  1.00 39.80  ? 29   ARG A NH2   1 
ATOM   250  N  N     . GLU A 1 30  ? -34.394 3.818   44.848  1.00 43.75  ? 30   GLU A N     1 
ATOM   251  C  CA    . GLU A 1 30  ? -33.797 2.528   45.096  1.00 45.01  ? 30   GLU A CA    1 
ATOM   252  C  C     . GLU A 1 30  ? -34.603 1.543   44.280  1.00 46.34  ? 30   GLU A C     1 
ATOM   253  O  O     . GLU A 1 30  ? -35.832 1.500   44.383  1.00 47.82  ? 30   GLU A O     1 
ATOM   254  C  CB    . GLU A 1 30  ? -33.872 2.194   46.583  1.00 46.64  ? 30   GLU A CB    1 
ATOM   255  C  CG    . GLU A 1 30  ? -33.123 0.937   46.998  1.00 49.59  ? 30   GLU A CG    1 
ATOM   256  C  CD    . GLU A 1 30  ? -33.517 0.440   48.387  1.00 51.56  ? 30   GLU A CD    1 
ATOM   257  O  OE1   . GLU A 1 30  ? -33.998 1.256   49.210  1.00 53.25  ? 30   GLU A OE1   1 
ATOM   258  O  OE2   . GLU A 1 30  ? -33.349 -0.772  48.654  1.00 48.42  ? 30   GLU A OE2   1 
ATOM   259  N  N     . VAL A 1 31  ? -33.920 0.772   43.442  1.00 46.31  ? 31   VAL A N     1 
ATOM   260  C  CA    . VAL A 1 31  ? -34.611 -0.157  42.557  1.00 45.41  ? 31   VAL A CA    1 
ATOM   261  C  C     . VAL A 1 31  ? -34.070 -1.560  42.752  1.00 44.27  ? 31   VAL A C     1 
ATOM   262  O  O     . VAL A 1 31  ? -32.857 -1.771  42.733  1.00 45.16  ? 31   VAL A O     1 
ATOM   263  C  CB    . VAL A 1 31  ? -34.503 0.276   41.079  1.00 44.77  ? 31   VAL A CB    1 
ATOM   264  C  CG1   . VAL A 1 31  ? -35.393 -0.574  40.207  1.00 46.24  ? 31   VAL A CG1   1 
ATOM   265  C  CG2   . VAL A 1 31  ? -34.902 1.741   40.925  1.00 46.97  ? 31   VAL A CG2   1 
ATOM   266  N  N     . GLU A 1 32  ? -34.976 -2.509  42.972  1.00 44.48  ? 32   GLU A N     1 
ATOM   267  C  CA    . GLU A 1 32  ? -34.607 -3.917  43.069  1.00 46.81  ? 32   GLU A CA    1 
ATOM   268  C  C     . GLU A 1 32  ? -34.445 -4.467  41.647  1.00 45.99  ? 32   GLU A C     1 
ATOM   269  O  O     . GLU A 1 32  ? -35.300 -5.199  41.139  1.00 45.09  ? 32   GLU A O     1 
ATOM   270  C  CB    . GLU A 1 32  ? -35.654 -4.708  43.856  1.00 48.24  ? 32   GLU A CB    1 
ATOM   271  C  CG    . GLU A 1 32  ? -35.788 -4.309  45.320  1.00 54.61  ? 32   GLU A CG    1 
ATOM   272  C  CD    . GLU A 1 32  ? -36.903 -5.068  46.031  1.00 59.17  ? 32   GLU A CD    1 
ATOM   273  O  OE1   . GLU A 1 32  ? -36.730 -6.279  46.294  1.00 62.00  ? 32   GLU A OE1   1 
ATOM   274  O  OE2   . GLU A 1 32  ? -37.950 -4.453  46.328  1.00 58.04  ? 32   GLU A OE2   1 
ATOM   275  N  N     . TYR A 1 33  ? -33.342 -4.076  41.013  1.00 44.42  ? 33   TYR A N     1 
ATOM   276  C  CA    . TYR A 1 33  ? -33.078 -4.370  39.608  1.00 41.50  ? 33   TYR A CA    1 
ATOM   277  C  C     . TYR A 1 33  ? -32.998 -5.868  39.357  1.00 40.29  ? 33   TYR A C     1 
ATOM   278  O  O     . TYR A 1 33  ? -32.386 -6.612  40.128  1.00 41.07  ? 33   TYR A O     1 
ATOM   279  C  CB    . TYR A 1 33  ? -31.783 -3.672  39.167  1.00 39.73  ? 33   TYR A CB    1 
ATOM   280  C  CG    . TYR A 1 33  ? -31.423 -3.829  37.699  1.00 37.37  ? 33   TYR A CG    1 
ATOM   281  C  CD1   . TYR A 1 33  ? -32.306 -3.432  36.689  1.00 36.69  ? 33   TYR A CD1   1 
ATOM   282  C  CD2   . TYR A 1 33  ? -30.194 -4.359  37.322  1.00 32.40  ? 33   TYR A CD2   1 
ATOM   283  C  CE1   . TYR A 1 33  ? -31.972 -3.571  35.342  1.00 35.04  ? 33   TYR A CE1   1 
ATOM   284  C  CE2   . TYR A 1 33  ? -29.849 -4.496  35.975  1.00 35.30  ? 33   TYR A CE2   1 
ATOM   285  C  CZ    . TYR A 1 33  ? -30.741 -4.100  34.997  1.00 34.45  ? 33   TYR A CZ    1 
ATOM   286  O  OH    . TYR A 1 33  ? -30.401 -4.243  33.676  1.00 32.63  ? 33   TYR A OH    1 
ATOM   287  N  N     . LYS A 1 34  ? -33.643 -6.295  38.281  1.00 39.02  ? 34   LYS A N     1 
ATOM   288  C  CA    . LYS A 1 34  ? -33.653 -7.691  37.884  1.00 40.14  ? 34   LYS A CA    1 
ATOM   289  C  C     . LYS A 1 34  ? -32.779 -7.827  36.644  1.00 38.39  ? 34   LYS A C     1 
ATOM   290  O  O     . LYS A 1 34  ? -33.214 -7.514  35.531  1.00 39.53  ? 34   LYS A O     1 
ATOM   291  C  CB    . LYS A 1 34  ? -35.080 -8.159  37.591  1.00 42.18  ? 34   LYS A CB    1 
ATOM   292  C  CG    . LYS A 1 34  ? -36.114 -7.702  38.612  1.00 46.99  ? 34   LYS A CG    1 
ATOM   293  C  CD    . LYS A 1 34  ? -36.515 -8.803  39.569  1.00 52.13  ? 34   LYS A CD    1 
ATOM   294  C  CE    . LYS A 1 34  ? -37.515 -9.747  38.918  1.00 55.08  ? 34   LYS A CE    1 
ATOM   295  N  NZ    . LYS A 1 34  ? -38.662 -10.026 39.834  1.00 58.34  ? 34   LYS A NZ    1 
ATOM   296  N  N     . PRO A 1 35  ? -31.534 -8.284  36.833  1.00 35.86  ? 35   PRO A N     1 
ATOM   297  C  CA    . PRO A 1 35  ? -30.579 -8.339  35.742  1.00 32.81  ? 35   PRO A CA    1 
ATOM   298  C  C     . PRO A 1 35  ? -30.784 -9.568  34.861  1.00 32.11  ? 35   PRO A C     1 
ATOM   299  O  O     . PRO A 1 35  ? -31.383 -10.564 35.290  1.00 29.07  ? 35   PRO A O     1 
ATOM   300  C  CB    . PRO A 1 35  ? -29.233 -8.430  36.465  1.00 32.05  ? 35   PRO A CB    1 
ATOM   301  C  CG    . PRO A 1 35  ? -29.538 -9.021  37.806  1.00 35.29  ? 35   PRO A CG    1 
ATOM   302  C  CD    . PRO A 1 35  ? -31.030 -8.969  38.036  1.00 36.30  ? 35   PRO A CD    1 
ATOM   303  N  N     . SER A 1 36  ? -30.296 -9.489  33.630  1.00 30.43  ? 36   SER A N     1 
ATOM   304  C  CA    . SER A 1 36  ? -30.285 -10.648 32.764  1.00 33.31  ? 36   SER A CA    1 
ATOM   305  C  C     . SER A 1 36  ? -28.873 -11.016 32.381  1.00 34.27  ? 36   SER A C     1 
ATOM   306  O  O     . SER A 1 36  ? -28.025 -10.142 32.150  1.00 36.15  ? 36   SER A O     1 
ATOM   307  C  CB    . SER A 1 36  ? -31.106 -10.406 31.507  1.00 32.94  ? 36   SER A CB    1 
ATOM   308  O  OG    . SER A 1 36  ? -32.462 -10.208 31.826  1.00 36.94  ? 36   SER A OG    1 
ATOM   309  N  N     . LEU A 1 37  ? -28.622 -12.320 32.336  1.00 33.51  ? 37   LEU A N     1 
ATOM   310  C  CA    . LEU A 1 37  ? -27.386 -12.850 31.772  1.00 31.81  ? 37   LEU A CA    1 
ATOM   311  C  C     . LEU A 1 37  ? -27.767 -13.901 30.744  1.00 31.55  ? 37   LEU A C     1 
ATOM   312  O  O     . LEU A 1 37  ? -28.954 -14.165 30.550  1.00 33.98  ? 37   LEU A O     1 
ATOM   313  C  CB    . LEU A 1 37  ? -26.463 -13.393 32.862  1.00 29.99  ? 37   LEU A CB    1 
ATOM   314  C  CG    . LEU A 1 37  ? -25.933 -12.326 33.809  1.00 32.44  ? 37   LEU A CG    1 
ATOM   315  C  CD1   . LEU A 1 37  ? -25.183 -12.962 34.974  1.00 32.28  ? 37   LEU A CD1   1 
ATOM   316  C  CD2   . LEU A 1 37  ? -25.055 -11.294 33.081  1.00 36.27  ? 37   LEU A CD2   1 
ATOM   317  N  N     . PHE A 1 38  ? -26.785 -14.474 30.056  1.00 31.54  ? 38   PHE A N     1 
ATOM   318  C  CA    . PHE A 1 38  ? -27.094 -15.285 28.882  1.00 32.71  ? 38   PHE A CA    1 
ATOM   319  C  C     . PHE A 1 38  ? -26.289 -16.574 28.809  1.00 33.38  ? 38   PHE A C     1 
ATOM   320  O  O     . PHE A 1 38  ? -25.158 -16.647 29.295  1.00 33.22  ? 38   PHE A O     1 
ATOM   321  C  CB    . PHE A 1 38  ? -26.905 -14.466 27.595  1.00 33.17  ? 38   PHE A CB    1 
ATOM   322  C  CG    . PHE A 1 38  ? -27.797 -13.243 27.510  1.00 37.50  ? 38   PHE A CG    1 
ATOM   323  C  CD1   . PHE A 1 38  ? -27.487 -12.079 28.220  1.00 36.85  ? 38   PHE A CD1   1 
ATOM   324  C  CD2   . PHE A 1 38  ? -28.942 -13.255 26.716  1.00 35.01  ? 38   PHE A CD2   1 
ATOM   325  C  CE1   . PHE A 1 38  ? -28.312 -10.958 28.152  1.00 35.46  ? 38   PHE A CE1   1 
ATOM   326  C  CE2   . PHE A 1 38  ? -29.763 -12.140 26.636  1.00 34.41  ? 38   PHE A CE2   1 
ATOM   327  C  CZ    . PHE A 1 38  ? -29.446 -10.988 27.357  1.00 37.24  ? 38   PHE A CZ    1 
ATOM   328  N  N     . ALA A 1 39  ? -26.899 -17.589 28.205  1.00 32.09  ? 39   ALA A N     1 
ATOM   329  C  CA    . ALA A 1 39  ? -26.224 -18.835 27.918  1.00 31.75  ? 39   ALA A CA    1 
ATOM   330  C  C     . ALA A 1 39  ? -26.456 -19.230 26.467  1.00 32.75  ? 39   ALA A C     1 
ATOM   331  O  O     . ALA A 1 39  ? -27.559 -19.071 25.938  1.00 33.95  ? 39   ALA A O     1 
ATOM   332  C  CB    . ALA A 1 39  ? -26.715 -19.923 28.856  1.00 31.27  ? 39   ALA A CB    1 
ATOM   333  N  N     . HIS A 1 40  ? -25.409 -19.725 25.817  1.00 33.38  ? 40   HIS A N     1 
ATOM   334  C  CA    . HIS A 1 40  ? -25.563 -20.371 24.525  1.00 37.39  ? 40   HIS A CA    1 
ATOM   335  C  C     . HIS A 1 40  ? -26.675 -21.426 24.610  1.00 37.49  ? 40   HIS A C     1 
ATOM   336  O  O     . HIS A 1 40  ? -26.816 -22.102 25.626  1.00 34.98  ? 40   HIS A O     1 
ATOM   337  C  CB    . HIS A 1 40  ? -24.246 -21.014 24.097  1.00 36.77  ? 40   HIS A CB    1 
ATOM   338  C  CG    . HIS A 1 40  ? -23.204 -20.025 23.675  1.00 38.30  ? 40   HIS A CG    1 
ATOM   339  N  ND1   . HIS A 1 40  ? -21.908 -20.064 24.142  1.00 40.10  ? 40   HIS A ND1   1 
ATOM   340  C  CD2   . HIS A 1 40  ? -23.268 -18.968 22.831  1.00 39.85  ? 40   HIS A CD2   1 
ATOM   341  C  CE1   . HIS A 1 40  ? -21.217 -19.077 23.599  1.00 41.38  ? 40   HIS A CE1   1 
ATOM   342  N  NE2   . HIS A 1 40  ? -22.020 -18.394 22.804  1.00 39.52  ? 40   HIS A NE2   1 
ATOM   343  N  N     . CYS A 1 41  ? -27.485 -21.529 23.564  1.00 39.90  ? 41   CYS A N     1 
ATOM   344  C  CA    . CYS A 1 41  ? -28.577 -22.501 23.536  1.00 45.94  ? 41   CYS A CA    1 
ATOM   345  C  C     . CYS A 1 41  ? -28.582 -23.261 22.201  1.00 48.89  ? 41   CYS A C     1 
ATOM   346  O  O     . CYS A 1 41  ? -27.860 -22.873 21.283  1.00 47.72  ? 41   CYS A O     1 
ATOM   347  C  CB    . CYS A 1 41  ? -29.919 -21.809 23.814  1.00 45.92  ? 41   CYS A CB    1 
ATOM   348  S  SG    . CYS A 1 41  ? -30.369 -20.523 22.632  1.00 49.43  ? 41   CYS A SG    1 
ATOM   349  N  N     . PRO A 1 42  ? -29.373 -24.360 22.093  1.00 53.76  ? 42   PRO A N     1 
ATOM   350  C  CA    . PRO A 1 42  ? -29.395 -25.137 20.841  1.00 55.91  ? 42   PRO A CA    1 
ATOM   351  C  C     . PRO A 1 42  ? -29.852 -24.315 19.639  1.00 58.78  ? 42   PRO A C     1 
ATOM   352  O  O     . PRO A 1 42  ? -30.711 -23.431 19.767  1.00 57.27  ? 42   PRO A O     1 
ATOM   353  C  CB    . PRO A 1 42  ? -30.398 -26.260 21.132  1.00 56.20  ? 42   PRO A CB    1 
ATOM   354  C  CG    . PRO A 1 42  ? -30.390 -26.401 22.608  1.00 57.65  ? 42   PRO A CG    1 
ATOM   355  C  CD    . PRO A 1 42  ? -30.194 -25.000 23.140  1.00 55.02  ? 42   PRO A CD    1 
ATOM   356  N  N     . GLU A 1 43  ? -29.263 -24.614 18.484  1.00 64.05  ? 43   GLU A N     1 
ATOM   357  C  CA    . GLU A 1 43  ? -29.546 -23.900 17.234  1.00 69.11  ? 43   GLU A CA    1 
ATOM   358  C  C     . GLU A 1 43  ? -31.030 -23.960 16.887  1.00 70.79  ? 43   GLU A C     1 
ATOM   359  O  O     . GLU A 1 43  ? -31.544 -23.085 16.191  1.00 70.61  ? 43   GLU A O     1 
ATOM   360  C  CB    . GLU A 1 43  ? -28.725 -24.484 16.072  1.00 71.58  ? 43   GLU A CB    1 
ATOM   361  C  CG    . GLU A 1 43  ? -27.257 -24.829 16.397  1.00 75.05  ? 43   GLU A CG    1 
ATOM   362  C  CD    . GLU A 1 43  ? -26.407 -23.608 16.738  1.00 79.05  ? 43   GLU A CD    1 
ATOM   363  O  OE1   . GLU A 1 43  ? -26.329 -22.670 15.907  1.00 78.65  ? 43   GLU A OE1   1 
ATOM   364  O  OE2   . GLU A 1 43  ? -25.810 -23.597 17.841  1.00 79.94  ? 43   GLU A OE2   1 
ATOM   365  N  N     . SER A 1 44  ? -31.703 -25.000 17.382  1.00 73.12  ? 44   SER A N     1 
ATOM   366  C  CA    . SER A 1 44  ? -33.118 -25.228 17.104  1.00 76.00  ? 44   SER A CA    1 
ATOM   367  C  C     . SER A 1 44  ? -34.017 -24.842 18.282  1.00 76.29  ? 44   SER A C     1 
ATOM   368  O  O     . SER A 1 44  ? -34.783 -25.669 18.793  1.00 76.75  ? 44   SER A O     1 
ATOM   369  C  CB    . SER A 1 44  ? -33.361 -26.686 16.681  1.00 77.44  ? 44   SER A CB    1 
ATOM   370  O  OG    . SER A 1 44  ? -33.084 -27.585 17.744  1.00 79.54  ? 44   SER A OG    1 
ATOM   371  N  N     . GLN A 1 45  ? -33.893 -23.588 18.720  1.00 75.26  ? 45   GLN A N     1 
ATOM   372  C  CA    . GLN A 1 45  ? -34.875 -22.972 19.619  1.00 73.87  ? 45   GLN A CA    1 
ATOM   373  C  C     . GLN A 1 45  ? -34.920 -21.456 19.433  1.00 72.66  ? 45   GLN A C     1 
ATOM   374  O  O     . GLN A 1 45  ? -33.882 -20.779 19.455  1.00 72.04  ? 45   GLN A O     1 
ATOM   375  C  CB    . GLN A 1 45  ? -34.684 -23.373 21.094  1.00 73.66  ? 45   GLN A CB    1 
ATOM   376  C  CG    . GLN A 1 45  ? -33.412 -22.893 21.774  1.00 73.60  ? 45   GLN A CG    1 
ATOM   377  C  CD    . GLN A 1 45  ? -33.663 -22.457 23.211  1.00 73.73  ? 45   GLN A CD    1 
ATOM   378  O  OE1   . GLN A 1 45  ? -34.178 -21.362 23.455  1.00 71.78  ? 45   GLN A OE1   1 
ATOM   379  N  NE2   . GLN A 1 45  ? -33.297 -23.308 24.169  1.00 71.87  ? 45   GLN A NE2   1 
ATOM   380  N  N     . ALA A 1 46  ? -36.138 -20.948 19.245  1.00 70.73  ? 46   ALA A N     1 
ATOM   381  C  CA    . ALA A 1 46  ? -36.380 -19.556 18.866  1.00 67.58  ? 46   ALA A CA    1 
ATOM   382  C  C     . ALA A 1 46  ? -35.871 -18.550 19.892  1.00 64.46  ? 46   ALA A C     1 
ATOM   383  O  O     . ALA A 1 46  ? -36.193 -18.628 21.083  1.00 64.19  ? 46   ALA A O     1 
ATOM   384  C  CB    . ALA A 1 46  ? -37.872 -19.328 18.583  1.00 69.19  ? 46   ALA A CB    1 
ATOM   385  N  N     . THR A 1 47  ? -35.068 -17.608 19.409  1.00 59.59  ? 47   THR A N     1 
ATOM   386  C  CA    . THR A 1 47  ? -34.556 -16.526 20.236  1.00 56.22  ? 47   THR A CA    1 
ATOM   387  C  C     . THR A 1 47  ? -34.248 -15.293 19.386  1.00 52.64  ? 47   THR A C     1 
ATOM   388  O  O     . THR A 1 47  ? -34.041 -15.393 18.173  1.00 51.99  ? 47   THR A O     1 
ATOM   389  C  CB    . THR A 1 47  ? -33.294 -16.958 21.044  1.00 56.04  ? 47   THR A CB    1 
ATOM   390  O  OG1   . THR A 1 47  ? -32.882 -15.893 21.908  1.00 51.23  ? 47   THR A OG1   1 
ATOM   391  C  CG2   . THR A 1 47  ? -32.142 -17.325 20.115  1.00 56.15  ? 47   THR A CG2   1 
ATOM   392  N  N     . LYS A 1 48  ? -34.228 -14.132 20.031  1.00 48.28  ? 48   LYS A N     1 
ATOM   393  C  CA    . LYS A 1 48  ? -33.811 -12.905 19.369  1.00 45.46  ? 48   LYS A CA    1 
ATOM   394  C  C     . LYS A 1 48  ? -32.425 -12.454 19.851  1.00 42.33  ? 48   LYS A C     1 
ATOM   395  O  O     . LYS A 1 48  ? -31.917 -11.412 19.426  1.00 41.18  ? 48   LYS A O     1 
ATOM   396  C  CB    . LYS A 1 48  ? -34.866 -11.800 19.550  1.00 45.30  ? 48   LYS A CB    1 
ATOM   397  C  CG    . LYS A 1 48  ? -34.988 -11.231 20.964  1.00 43.15  ? 48   LYS A CG    1 
ATOM   398  C  CD    . LYS A 1 48  ? -36.053 -10.130 21.028  1.00 41.60  ? 48   LYS A CD    1 
ATOM   399  C  CE    . LYS A 1 48  ? -36.199 -9.589  22.437  1.00 41.48  ? 48   LYS A CE    1 
ATOM   400  N  NZ    . LYS A 1 48  ? -37.399 -8.715  22.595  1.00 39.82  ? 48   LYS A NZ    1 
ATOM   401  N  N     . TYR A 1 49  ? -31.822 -13.240 20.740  1.00 41.27  ? 49   TYR A N     1 
ATOM   402  C  CA    . TYR A 1 49  ? -30.516 -12.906 21.304  1.00 39.89  ? 49   TYR A CA    1 
ATOM   403  C  C     . TYR A 1 49  ? -29.413 -13.768 20.711  1.00 39.26  ? 49   TYR A C     1 
ATOM   404  O  O     . TYR A 1 49  ? -29.485 -14.997 20.738  1.00 38.80  ? 49   TYR A O     1 
ATOM   405  C  CB    . TYR A 1 49  ? -30.517 -13.026 22.829  1.00 39.11  ? 49   TYR A CB    1 
ATOM   406  C  CG    . TYR A 1 49  ? -31.639 -12.277 23.509  1.00 38.75  ? 49   TYR A CG    1 
ATOM   407  C  CD1   . TYR A 1 49  ? -32.763 -12.951 23.985  1.00 33.14  ? 49   TYR A CD1   1 
ATOM   408  C  CD2   . TYR A 1 49  ? -31.572 -10.896 23.689  1.00 37.52  ? 49   TYR A CD2   1 
ATOM   409  C  CE1   . TYR A 1 49  ? -33.790 -12.272 24.611  1.00 35.11  ? 49   TYR A CE1   1 
ATOM   410  C  CE2   . TYR A 1 49  ? -32.601 -10.203 24.308  1.00 34.83  ? 49   TYR A CE2   1 
ATOM   411  C  CZ    . TYR A 1 49  ? -33.707 -10.894 24.768  1.00 37.89  ? 49   TYR A CZ    1 
ATOM   412  O  OH    . TYR A 1 49  ? -34.730 -10.209 25.391  1.00 37.99  ? 49   TYR A OH    1 
ATOM   413  N  N     . PHE A 1 50  ? -28.390 -13.105 20.179  1.00 39.26  ? 50   PHE A N     1 
ATOM   414  C  CA    . PHE A 1 50  ? -27.240 -13.787 19.596  1.00 40.26  ? 50   PHE A CA    1 
ATOM   415  C  C     . PHE A 1 50  ? -25.933 -13.213 20.124  1.00 40.26  ? 50   PHE A C     1 
ATOM   416  O  O     . PHE A 1 50  ? -25.825 -12.005 20.354  1.00 39.34  ? 50   PHE A O     1 
ATOM   417  C  CB    . PHE A 1 50  ? -27.286 -13.692 18.068  1.00 40.61  ? 50   PHE A CB    1 
ATOM   418  C  CG    . PHE A 1 50  ? -28.440 -14.432 17.457  1.00 42.23  ? 50   PHE A CG    1 
ATOM   419  C  CD1   . PHE A 1 50  ? -29.686 -13.821 17.318  1.00 41.42  ? 50   PHE A CD1   1 
ATOM   420  C  CD2   . PHE A 1 50  ? -28.291 -15.749 17.040  1.00 43.71  ? 50   PHE A CD2   1 
ATOM   421  C  CE1   . PHE A 1 50  ? -30.762 -14.517 16.766  1.00 42.71  ? 50   PHE A CE1   1 
ATOM   422  C  CE2   . PHE A 1 50  ? -29.369 -16.456 16.480  1.00 44.33  ? 50   PHE A CE2   1 
ATOM   423  C  CZ    . PHE A 1 50  ? -30.599 -15.838 16.344  1.00 42.04  ? 50   PHE A CZ    1 
ATOM   424  N  N     . ASP A 1 51  ? -24.937 -14.075 20.323  1.00 38.36  ? 51   ASP A N     1 
ATOM   425  C  CA    . ASP A 1 51  ? -23.620 -13.573 20.687  1.00 36.67  ? 51   ASP A CA    1 
ATOM   426  C  C     . ASP A 1 51  ? -22.995 -12.892 19.462  1.00 36.03  ? 51   ASP A C     1 
ATOM   427  O  O     . ASP A 1 51  ? -23.615 -12.844 18.400  1.00 36.80  ? 51   ASP A O     1 
ATOM   428  C  CB    . ASP A 1 51  ? -22.751 -14.669 21.324  1.00 36.46  ? 51   ASP A CB    1 
ATOM   429  C  CG    . ASP A 1 51  ? -22.208 -15.684 20.322  1.00 38.09  ? 51   ASP A CG    1 
ATOM   430  O  OD1   . ASP A 1 51  ? -22.387 -15.525 19.092  1.00 34.02  ? 51   ASP A OD1   1 
ATOM   431  O  OD2   . ASP A 1 51  ? -21.574 -16.653 20.792  1.00 35.92  ? 51   ASP A OD2   1 
ATOM   432  N  N     . ILE A 1 52  ? -21.794 -12.345 19.599  1.00 36.40  ? 52   ILE A N     1 
ATOM   433  C  CA    . ILE A 1 52  ? -21.231 -11.523 18.524  1.00 34.42  ? 52   ILE A CA    1 
ATOM   434  C  C     . ILE A 1 52  ? -20.834 -12.330 17.283  1.00 37.15  ? 52   ILE A C     1 
ATOM   435  O  O     . ILE A 1 52  ? -20.678 -11.768 16.198  1.00 38.18  ? 52   ILE A O     1 
ATOM   436  C  CB    . ILE A 1 52  ? -20.052 -10.644 19.010  1.00 34.92  ? 52   ILE A CB    1 
ATOM   437  C  CG1   . ILE A 1 52  ? -18.935 -11.507 19.608  1.00 30.82  ? 52   ILE A CG1   1 
ATOM   438  C  CG2   . ILE A 1 52  ? -20.556 -9.593  19.996  1.00 30.86  ? 52   ILE A CG2   1 
ATOM   439  C  CD1   . ILE A 1 52  ? -17.591 -10.799 19.737  1.00 28.80  ? 52   ILE A CD1   1 
ATOM   440  N  N     . TYR A 1 53  ? -20.696 -13.642 17.457  1.00 37.63  ? 53   TYR A N     1 
ATOM   441  C  CA    . TYR A 1 53  ? -20.392 -14.574 16.372  1.00 37.74  ? 53   TYR A CA    1 
ATOM   442  C  C     . TYR A 1 53  ? -21.651 -15.144 15.705  1.00 39.79  ? 53   TYR A C     1 
ATOM   443  O  O     . TYR A 1 53  ? -21.553 -15.967 14.796  1.00 40.30  ? 53   TYR A O     1 
ATOM   444  C  CB    . TYR A 1 53  ? -19.508 -15.706 16.900  1.00 38.05  ? 53   TYR A CB    1 
ATOM   445  C  CG    . TYR A 1 53  ? -18.346 -15.195 17.715  1.00 42.04  ? 53   TYR A CG    1 
ATOM   446  C  CD1   . TYR A 1 53  ? -18.352 -15.279 19.106  1.00 40.93  ? 53   TYR A CD1   1 
ATOM   447  C  CD2   . TYR A 1 53  ? -17.256 -14.588 17.095  1.00 43.99  ? 53   TYR A CD2   1 
ATOM   448  C  CE1   . TYR A 1 53  ? -17.292 -14.790 19.859  1.00 43.65  ? 53   TYR A CE1   1 
ATOM   449  C  CE2   . TYR A 1 53  ? -16.190 -14.098 17.835  1.00 46.51  ? 53   TYR A CE2   1 
ATOM   450  C  CZ    . TYR A 1 53  ? -16.213 -14.198 19.213  1.00 46.40  ? 53   TYR A CZ    1 
ATOM   451  O  OH    . TYR A 1 53  ? -15.154 -13.704 19.936  1.00 44.66  ? 53   TYR A OH    1 
ATOM   452  N  N     . GLY A 1 54  ? -22.828 -14.703 16.147  1.00 39.66  ? 54   GLY A N     1 
ATOM   453  C  CA    . GLY A 1 54  ? -24.085 -15.160 15.555  1.00 40.14  ? 54   GLY A CA    1 
ATOM   454  C  C     . GLY A 1 54  ? -24.643 -16.445 16.151  1.00 41.91  ? 54   GLY A C     1 
ATOM   455  O  O     . GLY A 1 54  ? -25.534 -17.070 15.569  1.00 42.00  ? 54   GLY A O     1 
ATOM   456  N  N     . LYS A 1 55  ? -24.132 -16.834 17.317  1.00 41.76  ? 55   LYS A N     1 
ATOM   457  C  CA    . LYS A 1 55  ? -24.621 -18.020 18.008  1.00 42.78  ? 55   LYS A CA    1 
ATOM   458  C  C     . LYS A 1 55  ? -25.790 -17.685 18.936  1.00 41.42  ? 55   LYS A C     1 
ATOM   459  O  O     . LYS A 1 55  ? -25.707 -16.738 19.731  1.00 41.65  ? 55   LYS A O     1 
ATOM   460  C  CB    . LYS A 1 55  ? -23.485 -18.739 18.748  1.00 45.03  ? 55   LYS A CB    1 
ATOM   461  C  CG    . LYS A 1 55  ? -22.388 -19.260 17.804  1.00 50.61  ? 55   LYS A CG    1 
ATOM   462  C  CD    . LYS A 1 55  ? -21.482 -20.311 18.451  1.00 57.05  ? 55   LYS A CD    1 
ATOM   463  C  CE    . LYS A 1 55  ? -22.070 -21.728 18.352  1.00 62.41  ? 55   LYS A CE    1 
ATOM   464  N  NZ    . LYS A 1 55  ? -22.317 -22.195 16.943  1.00 61.83  ? 55   LYS A NZ    1 
ATOM   465  N  N     . PRO A 1 56  ? -26.893 -18.454 18.826  1.00 40.19  ? 56   PRO A N     1 
ATOM   466  C  CA    . PRO A 1 56  ? -28.126 -18.191 19.577  1.00 39.29  ? 56   PRO A CA    1 
ATOM   467  C  C     . PRO A 1 56  ? -27.927 -18.278 21.084  1.00 37.77  ? 56   PRO A C     1 
ATOM   468  O  O     . PRO A 1 56  ? -27.182 -19.133 21.564  1.00 37.26  ? 56   PRO A O     1 
ATOM   469  C  CB    . PRO A 1 56  ? -29.069 -19.308 19.106  1.00 40.60  ? 56   PRO A CB    1 
ATOM   470  C  CG    . PRO A 1 56  ? -28.158 -20.414 18.679  1.00 38.53  ? 56   PRO A CG    1 
ATOM   471  C  CD    . PRO A 1 56  ? -26.980 -19.710 18.057  1.00 40.34  ? 56   PRO A CD    1 
ATOM   472  N  N     . CYS A 1 57  ? -28.593 -17.388 21.812  1.00 37.40  ? 57   CYS A N     1 
ATOM   473  C  CA    . CYS A 1 57  ? -28.488 -17.335 23.266  1.00 37.90  ? 57   CYS A CA    1 
ATOM   474  C  C     . CYS A 1 57  ? -29.861 -17.294 23.912  1.00 37.66  ? 57   CYS A C     1 
ATOM   475  O  O     . CYS A 1 57  ? -30.785 -16.675 23.393  1.00 39.44  ? 57   CYS A O     1 
ATOM   476  C  CB    . CYS A 1 57  ? -27.673 -16.118 23.714  1.00 37.92  ? 57   CYS A CB    1 
ATOM   477  S  SG    . CYS A 1 57  ? -25.889 -16.205 23.362  1.00 41.78  ? 57   CYS A SG    1 
ATOM   478  N  N     . THR A 1 58  ? -29.988 -17.966 25.048  1.00 37.61  ? 58   THR A N     1 
ATOM   479  C  CA    . THR A 1 58  ? -31.192 -17.864 25.857  1.00 38.60  ? 58   THR A CA    1 
ATOM   480  C  C     . THR A 1 58  ? -30.945 -16.832 26.952  1.00 36.72  ? 58   THR A C     1 
ATOM   481  O  O     . THR A 1 58  ? -29.866 -16.794 27.546  1.00 35.95  ? 58   THR A O     1 
ATOM   482  C  CB    . THR A 1 58  ? -31.651 -19.248 26.437  1.00 39.41  ? 58   THR A CB    1 
ATOM   483  O  OG1   . THR A 1 58  ? -32.645 -19.045 27.449  1.00 43.44  ? 58   THR A OG1   1 
ATOM   484  C  CG2   . THR A 1 58  ? -30.487 -20.020 27.050  1.00 38.99  ? 58   THR A CG2   1 
ATOM   485  N  N     . ARG A 1 59  ? -31.933 -15.969 27.183  1.00 39.07  ? 59   ARG A N     1 
ATOM   486  C  CA    . ARG A 1 59  ? -31.868 -14.983 28.261  1.00 37.73  ? 59   ARG A CA    1 
ATOM   487  C  C     . ARG A 1 59  ? -32.276 -15.618 29.588  1.00 39.69  ? 59   ARG A C     1 
ATOM   488  O  O     . ARG A 1 59  ? -33.279 -16.329 29.662  1.00 39.68  ? 59   ARG A O     1 
ATOM   489  C  CB    . ARG A 1 59  ? -32.770 -13.772 27.962  1.00 37.28  ? 59   ARG A CB    1 
ATOM   490  C  CG    . ARG A 1 59  ? -32.985 -12.866 29.181  1.00 38.99  ? 59   ARG A CG    1 
ATOM   491  C  CD    . ARG A 1 59  ? -33.337 -11.441 28.822  1.00 41.29  ? 59   ARG A CD    1 
ATOM   492  N  NE    . ARG A 1 59  ? -34.771 -11.227 28.662  1.00 45.29  ? 59   ARG A NE    1 
ATOM   493  C  CZ    . ARG A 1 59  ? -35.528 -10.485 29.466  1.00 45.75  ? 59   ARG A CZ    1 
ATOM   494  N  NH1   . ARG A 1 59  ? -35.004 -9.870  30.519  1.00 42.34  ? 59   ARG A NH1   1 
ATOM   495  N  NH2   . ARG A 1 59  ? -36.822 -10.357 29.207  1.00 46.41  ? 59   ARG A NH2   1 
ATOM   496  N  N     . LYS A 1 60  ? -31.502 -15.349 30.634  1.00 41.21  ? 60   LYS A N     1 
ATOM   497  C  CA    . LYS A 1 60  ? -31.878 -15.746 31.983  1.00 42.20  ? 60   LYS A CA    1 
ATOM   498  C  C     . LYS A 1 60  ? -32.105 -14.528 32.870  1.00 42.79  ? 60   LYS A C     1 
ATOM   499  O  O     . LYS A 1 60  ? -31.164 -13.789 33.183  1.00 40.53  ? 60   LYS A O     1 
ATOM   500  C  CB    . LYS A 1 60  ? -30.836 -16.694 32.572  1.00 44.16  ? 60   LYS A CB    1 
ATOM   501  C  CG    . LYS A 1 60  ? -30.962 -18.114 32.036  1.00 49.30  ? 60   LYS A CG    1 
ATOM   502  C  CD    . LYS A 1 60  ? -29.623 -18.816 31.974  1.00 51.34  ? 60   LYS A CD    1 
ATOM   503  C  CE    . LYS A 1 60  ? -29.748 -20.203 31.335  1.00 56.12  ? 60   LYS A CE    1 
ATOM   504  N  NZ    . LYS A 1 60  ? -30.395 -21.221 32.226  1.00 54.61  ? 60   LYS A NZ    1 
ATOM   505  N  N     . LEU A 1 61  ? -33.371 -14.321 33.238  1.00 44.20  ? 61   LEU A N     1 
ATOM   506  C  CA    . LEU A 1 61  ? -33.801 -13.230 34.112  1.00 44.96  ? 61   LEU A CA    1 
ATOM   507  C  C     . LEU A 1 61  ? -33.695 -13.664 35.574  1.00 44.48  ? 61   LEU A C     1 
ATOM   508  O  O     . LEU A 1 61  ? -34.262 -14.686 35.970  1.00 43.64  ? 61   LEU A O     1 
ATOM   509  C  CB    . LEU A 1 61  ? -35.244 -12.813 33.777  1.00 45.98  ? 61   LEU A CB    1 
ATOM   510  C  CG    . LEU A 1 61  ? -35.925 -11.585 34.426  1.00 49.68  ? 61   LEU A CG    1 
ATOM   511  C  CD1   . LEU A 1 61  ? -36.537 -11.911 35.784  1.00 54.38  ? 61   LEU A CD1   1 
ATOM   512  C  CD2   . LEU A 1 61  ? -35.009 -10.360 34.529  1.00 42.99  ? 61   LEU A CD2   1 
ATOM   513  N  N     . PHE A 1 62  ? -32.981 -12.875 36.373  1.00 40.86  ? 62   PHE A N     1 
ATOM   514  C  CA    . PHE A 1 62  ? -32.731 -13.235 37.761  1.00 40.62  ? 62   PHE A CA    1 
ATOM   515  C  C     . PHE A 1 62  ? -33.632 -12.493 38.757  1.00 41.48  ? 62   PHE A C     1 
ATOM   516  O  O     . PHE A 1 62  ? -33.969 -11.318 38.558  1.00 42.59  ? 62   PHE A O     1 
ATOM   517  C  CB    . PHE A 1 62  ? -31.234 -13.099 38.089  1.00 39.81  ? 62   PHE A CB    1 
ATOM   518  C  CG    . PHE A 1 62  ? -30.364 -14.062 37.316  1.00 39.76  ? 62   PHE A CG    1 
ATOM   519  C  CD1   . PHE A 1 62  ? -29.741 -13.669 36.134  1.00 40.31  ? 62   PHE A CD1   1 
ATOM   520  C  CD2   . PHE A 1 62  ? -30.195 -15.373 37.754  1.00 38.93  ? 62   PHE A CD2   1 
ATOM   521  C  CE1   . PHE A 1 62  ? -28.950 -14.566 35.400  1.00 40.22  ? 62   PHE A CE1   1 
ATOM   522  C  CE2   . PHE A 1 62  ? -29.411 -16.279 37.028  1.00 44.75  ? 62   PHE A CE2   1 
ATOM   523  C  CZ    . PHE A 1 62  ? -28.785 -15.873 35.848  1.00 40.45  ? 62   PHE A CZ    1 
ATOM   524  N  N     . ALA A 1 63  ? -34.034 -13.198 39.812  1.00 39.76  ? 63   ALA A N     1 
ATOM   525  C  CA    . ALA A 1 63  ? -34.866 -12.624 40.868  1.00 41.01  ? 63   ALA A CA    1 
ATOM   526  C  C     . ALA A 1 63  ? -34.217 -11.398 41.504  1.00 40.23  ? 63   ALA A C     1 
ATOM   527  O  O     . ALA A 1 63  ? -34.905 -10.466 41.902  1.00 41.51  ? 63   ALA A O     1 
ATOM   528  C  CB    . ALA A 1 63  ? -35.183 -13.679 41.938  1.00 40.68  ? 63   ALA A CB    1 
ATOM   529  N  N     . ASN A 1 64  ? -32.891 -11.420 41.600  1.00 41.18  ? 64   ASN A N     1 
ATOM   530  C  CA    . ASN A 1 64  ? -32.106 -10.346 42.213  1.00 40.92  ? 64   ASN A CA    1 
ATOM   531  C  C     . ASN A 1 64  ? -30.656 -10.414 41.725  1.00 39.71  ? 64   ASN A C     1 
ATOM   532  O  O     . ASN A 1 64  ? -30.287 -11.361 41.032  1.00 40.55  ? 64   ASN A O     1 
ATOM   533  C  CB    . ASN A 1 64  ? -32.189 -10.412 43.747  1.00 39.60  ? 64   ASN A CB    1 
ATOM   534  C  CG    . ASN A 1 64  ? -31.824 -11.783 44.303  1.00 42.11  ? 64   ASN A CG    1 
ATOM   535  O  OD1   . ASN A 1 64  ? -30.727 -12.290 44.067  1.00 42.67  ? 64   ASN A OD1   1 
ATOM   536  N  ND2   . ASN A 1 64  ? -32.748 -12.386 45.058  1.00 41.01  ? 64   ASN A ND2   1 
ATOM   537  N  N     . MET A 1 65  ? -29.838 -9.426  42.088  1.00 39.66  ? 65   MET A N     1 
ATOM   538  C  CA    . MET A 1 65  ? -28.462 -9.347  41.585  1.00 39.08  ? 65   MET A CA    1 
ATOM   539  C  C     . MET A 1 65  ? -27.502 -10.373 42.190  1.00 41.29  ? 65   MET A C     1 
ATOM   540  O  O     . MET A 1 65  ? -26.563 -10.825 41.519  1.00 40.74  ? 65   MET A O     1 
ATOM   541  C  CB    . MET A 1 65  ? -27.907 -7.934  41.732  1.00 36.70  ? 65   MET A CB    1 
ATOM   542  C  CG    . MET A 1 65  ? -28.502 -6.964  40.730  1.00 34.84  ? 65   MET A CG    1 
ATOM   543  S  SD    . MET A 1 65  ? -27.799 -5.319  40.828  1.00 36.52  ? 65   MET A SD    1 
ATOM   544  C  CE    . MET A 1 65  ? -28.698 -4.624  42.218  1.00 34.50  ? 65   MET A CE    1 
ATOM   545  N  N     . ARG A 1 66  ? -27.737 -10.745 43.445  1.00 44.22  ? 66   ARG A N     1 
ATOM   546  C  CA    . ARG A 1 66  ? -26.911 -11.769 44.090  1.00 46.87  ? 66   ARG A CA    1 
ATOM   547  C  C     . ARG A 1 66  ? -27.032 -13.114 43.366  1.00 43.90  ? 66   ARG A C     1 
ATOM   548  O  O     . ARG A 1 66  ? -26.025 -13.751 43.079  1.00 41.79  ? 66   ARG A O     1 
ATOM   549  C  CB    . ARG A 1 66  ? -27.213 -11.881 45.589  1.00 49.87  ? 66   ARG A CB    1 
ATOM   550  C  CG    . ARG A 1 66  ? -26.575 -10.731 46.397  1.00 59.73  ? 66   ARG A CG    1 
ATOM   551  C  CD    . ARG A 1 66  ? -27.108 -10.630 47.826  1.00 66.69  ? 66   ARG A CD    1 
ATOM   552  N  NE    . ARG A 1 66  ? -26.549 -9.476  48.538  1.00 69.32  ? 66   ARG A NE    1 
ATOM   553  C  CZ    . ARG A 1 66  ? -26.982 -9.028  49.718  1.00 75.38  ? 66   ARG A CZ    1 
ATOM   554  N  NH1   . ARG A 1 66  ? -27.993 -9.627  50.344  1.00 75.64  ? 66   ARG A NH1   1 
ATOM   555  N  NH2   . ARG A 1 66  ? -26.403 -7.969  50.278  1.00 76.71  ? 66   ARG A NH2   1 
ATOM   556  N  N     . ASP A 1 67  ? -28.259 -13.505 43.034  1.00 42.83  ? 67   ASP A N     1 
ATOM   557  C  CA    . ASP A 1 67  ? -28.505 -14.726 42.266  1.00 43.65  ? 67   ASP A CA    1 
ATOM   558  C  C     . ASP A 1 67  ? -27.712 -14.731 40.959  1.00 41.44  ? 67   ASP A C     1 
ATOM   559  O  O     . ASP A 1 67  ? -27.011 -15.693 40.669  1.00 41.95  ? 67   ASP A O     1 
ATOM   560  C  CB    . ASP A 1 67  ? -30.005 -14.917 42.005  1.00 44.40  ? 67   ASP A CB    1 
ATOM   561  C  CG    . ASP A 1 67  ? -30.754 -15.442 43.225  1.00 47.03  ? 67   ASP A CG    1 
ATOM   562  O  OD1   . ASP A 1 67  ? -30.119 -15.752 44.258  1.00 50.61  ? 67   ASP A OD1   1 
ATOM   563  O  OD2   . ASP A 1 67  ? -31.993 -15.548 43.151  1.00 51.44  ? 67   ASP A OD2   1 
ATOM   564  N  N     . ALA A 1 68  ? -27.794 -13.633 40.207  1.00 39.54  ? 68   ALA A N     1 
ATOM   565  C  CA    . ALA A 1 68  ? -27.036 -13.461 38.964  1.00 37.04  ? 68   ALA A CA    1 
ATOM   566  C  C     . ALA A 1 68  ? -25.531 -13.721 39.133  1.00 39.36  ? 68   ALA A C     1 
ATOM   567  O  O     . ALA A 1 68  ? -24.914 -14.420 38.309  1.00 38.55  ? 68   ALA A O     1 
ATOM   568  C  CB    . ALA A 1 68  ? -27.271 -12.072 38.403  1.00 34.95  ? 68   ALA A CB    1 
ATOM   569  N  N     . SER A 1 69  ? -24.957 -13.152 40.196  1.00 37.33  ? 69   SER A N     1 
ATOM   570  C  CA    . SER A 1 69  ? -23.549 -13.334 40.532  1.00 38.91  ? 69   SER A CA    1 
ATOM   571  C  C     . SER A 1 69  ? -23.217 -14.781 40.881  1.00 40.74  ? 69   SER A C     1 
ATOM   572  O  O     . SER A 1 69  ? -22.185 -15.304 40.457  1.00 39.44  ? 69   SER A O     1 
ATOM   573  C  CB    . SER A 1 69  ? -23.149 -12.419 41.695  1.00 38.87  ? 69   SER A CB    1 
ATOM   574  O  OG    . SER A 1 69  ? -22.868 -11.114 41.231  1.00 39.77  ? 69   SER A OG    1 
ATOM   575  N  N     . GLN A 1 70  ? -24.095 -15.418 41.653  1.00 42.70  ? 70   GLN A N     1 
ATOM   576  C  CA    . GLN A 1 70  ? -23.895 -16.804 42.052  1.00 43.62  ? 70   GLN A CA    1 
ATOM   577  C  C     . GLN A 1 70  ? -24.032 -17.764 40.870  1.00 42.06  ? 70   GLN A C     1 
ATOM   578  O  O     . GLN A 1 70  ? -23.430 -18.843 40.876  1.00 41.11  ? 70   GLN A O     1 
ATOM   579  C  CB    . GLN A 1 70  ? -24.844 -17.193 43.191  1.00 44.90  ? 70   GLN A CB    1 
ATOM   580  C  CG    . GLN A 1 70  ? -24.655 -16.385 44.482  1.00 53.42  ? 70   GLN A CG    1 
ATOM   581  C  CD    . GLN A 1 70  ? -23.188 -16.084 44.808  1.00 59.95  ? 70   GLN A CD    1 
ATOM   582  O  OE1   . GLN A 1 70  ? -22.728 -14.942 44.666  1.00 61.85  ? 70   GLN A OE1   1 
ATOM   583  N  NE2   . GLN A 1 70  ? -22.448 -17.108 45.234  1.00 61.65  ? 70   GLN A NE2   1 
ATOM   584  N  N     . TRP A 1 71  ? -24.814 -17.365 39.866  1.00 39.83  ? 71   TRP A N     1 
ATOM   585  C  CA    . TRP A 1 71  ? -24.977 -18.159 38.645  1.00 40.92  ? 71   TRP A CA    1 
ATOM   586  C  C     . TRP A 1 71  ? -23.697 -18.106 37.824  1.00 40.78  ? 71   TRP A C     1 
ATOM   587  O  O     . TRP A 1 71  ? -23.287 -19.108 37.237  1.00 41.78  ? 71   TRP A O     1 
ATOM   588  C  CB    . TRP A 1 71  ? -26.175 -17.676 37.810  1.00 39.24  ? 71   TRP A CB    1 
ATOM   589  C  CG    . TRP A 1 71  ? -26.386 -18.466 36.525  1.00 37.76  ? 71   TRP A CG    1 
ATOM   590  C  CD1   . TRP A 1 71  ? -26.950 -19.714 36.408  1.00 37.21  ? 71   TRP A CD1   1 
ATOM   591  C  CD2   . TRP A 1 71  ? -26.039 -18.062 35.187  1.00 33.94  ? 71   TRP A CD2   1 
ATOM   592  N  NE1   . TRP A 1 71  ? -26.969 -20.108 35.086  1.00 37.23  ? 71   TRP A NE1   1 
ATOM   593  C  CE2   . TRP A 1 71  ? -26.416 -19.115 34.318  1.00 34.90  ? 71   TRP A CE2   1 
ATOM   594  C  CE3   . TRP A 1 71  ? -25.441 -16.917 34.640  1.00 34.43  ? 71   TRP A CE3   1 
ATOM   595  C  CZ2   . TRP A 1 71  ? -26.215 -19.054 32.933  1.00 34.16  ? 71   TRP A CZ2   1 
ATOM   596  C  CZ3   . TRP A 1 71  ? -25.240 -16.862 33.256  1.00 32.97  ? 71   TRP A CZ3   1 
ATOM   597  C  CH2   . TRP A 1 71  ? -25.628 -17.923 32.424  1.00 32.64  ? 71   TRP A CH2   1 
ATOM   598  N  N     . ILE A 1 72  ? -23.070 -16.934 37.792  1.00 41.85  ? 72   ILE A N     1 
ATOM   599  C  CA    . ILE A 1 72  ? -21.783 -16.763 37.116  1.00 43.14  ? 72   ILE A CA    1 
ATOM   600  C  C     . ILE A 1 72  ? -20.750 -17.736 37.690  1.00 43.85  ? 72   ILE A C     1 
ATOM   601  O  O     . ILE A 1 72  ? -20.033 -18.402 36.939  1.00 42.35  ? 72   ILE A O     1 
ATOM   602  C  CB    . ILE A 1 72  ? -21.276 -15.312 37.213  1.00 42.57  ? 72   ILE A CB    1 
ATOM   603  C  CG1   . ILE A 1 72  ? -22.118 -14.390 36.321  1.00 41.85  ? 72   ILE A CG1   1 
ATOM   604  C  CG2   . ILE A 1 72  ? -19.781 -15.212 36.837  1.00 45.00  ? 72   ILE A CG2   1 
ATOM   605  C  CD1   . ILE A 1 72  ? -21.887 -12.880 36.590  1.00 36.86  ? 72   ILE A CD1   1 
ATOM   606  N  N     . LYS A 1 73  ? -20.697 -17.817 39.019  1.00 45.71  ? 73   LYS A N     1 
ATOM   607  C  CA    . LYS A 1 73  ? -19.791 -18.732 39.716  1.00 48.24  ? 73   LYS A CA    1 
ATOM   608  C  C     . LYS A 1 73  ? -20.073 -20.192 39.375  1.00 48.24  ? 73   LYS A C     1 
ATOM   609  O  O     . LYS A 1 73  ? -19.145 -20.966 39.151  1.00 48.74  ? 73   LYS A O     1 
ATOM   610  C  CB    . LYS A 1 73  ? -19.847 -18.521 41.228  1.00 48.98  ? 73   LYS A CB    1 
ATOM   611  C  CG    . LYS A 1 73  ? -19.021 -17.336 41.717  1.00 56.84  ? 73   LYS A CG    1 
ATOM   612  C  CD    . LYS A 1 73  ? -19.267 -17.061 43.201  1.00 62.41  ? 73   LYS A CD    1 
ATOM   613  C  CE    . LYS A 1 73  ? -18.484 -15.842 43.685  1.00 64.93  ? 73   LYS A CE    1 
ATOM   614  N  NZ    . LYS A 1 73  ? -17.045 -16.152 43.963  1.00 64.41  ? 73   LYS A NZ    1 
ATOM   615  N  N     . ARG A 1 74  ? -21.349 -20.560 39.319  1.00 48.10  ? 74   ARG A N     1 
ATOM   616  C  CA    . ARG A 1 74  ? -21.718 -21.936 38.991  1.00 50.00  ? 74   ARG A CA    1 
ATOM   617  C  C     . ARG A 1 74  ? -21.323 -22.317 37.568  1.00 48.49  ? 74   ARG A C     1 
ATOM   618  O  O     . ARG A 1 74  ? -20.902 -23.446 37.334  1.00 49.54  ? 74   ARG A O     1 
ATOM   619  C  CB    . ARG A 1 74  ? -23.206 -22.198 39.241  1.00 50.82  ? 74   ARG A CB    1 
ATOM   620  C  CG    . ARG A 1 74  ? -23.584 -22.214 40.714  1.00 54.95  ? 74   ARG A CG    1 
ATOM   621  C  CD    . ARG A 1 74  ? -25.016 -22.690 40.904  1.00 60.74  ? 74   ARG A CD    1 
ATOM   622  N  NE    . ARG A 1 74  ? -25.710 -21.902 41.922  1.00 64.35  ? 74   ARG A NE    1 
ATOM   623  C  CZ    . ARG A 1 74  ? -26.701 -21.046 41.676  1.00 64.00  ? 74   ARG A CZ    1 
ATOM   624  N  NH1   . ARG A 1 74  ? -27.147 -20.861 40.436  1.00 61.88  ? 74   ARG A NH1   1 
ATOM   625  N  NH2   . ARG A 1 74  ? -27.256 -20.377 42.679  1.00 65.69  ? 74   ARG A NH2   1 
ATOM   626  N  N     . MET A 1 75  ? -21.432 -21.365 36.639  1.00 47.60  ? 75   MET A N     1 
ATOM   627  C  CA    . MET A 1 75  ? -21.075 -21.594 35.236  1.00 46.47  ? 75   MET A CA    1 
ATOM   628  C  C     . MET A 1 75  ? -19.577 -21.794 35.079  1.00 48.95  ? 75   MET A C     1 
ATOM   629  O  O     . MET A 1 75  ? -19.130 -22.458 34.139  1.00 49.81  ? 75   MET A O     1 
ATOM   630  C  CB    . MET A 1 75  ? -21.548 -20.446 34.339  1.00 43.12  ? 75   MET A CB    1 
ATOM   631  C  CG    . MET A 1 75  ? -23.057 -20.318 34.221  1.00 41.64  ? 75   MET A CG    1 
ATOM   632  S  SD    . MET A 1 75  ? -23.878 -21.793 33.553  1.00 41.05  ? 75   MET A SD    1 
ATOM   633  C  CE    . MET A 1 75  ? -23.594 -21.568 31.798  1.00 25.73  ? 75   MET A CE    1 
ATOM   634  N  N     . GLU A 1 76  ? -18.813 -21.202 35.996  1.00 50.89  ? 76   GLU A N     1 
ATOM   635  C  CA    . GLU A 1 76  ? -17.368 -21.409 36.078  1.00 52.40  ? 76   GLU A CA    1 
ATOM   636  C  C     . GLU A 1 76  ? -17.077 -22.826 36.593  1.00 51.18  ? 76   GLU A C     1 
ATOM   637  O  O     . GLU A 1 76  ? -16.296 -23.558 35.984  1.00 50.53  ? 76   GLU A O     1 
ATOM   638  C  CB    . GLU A 1 76  ? -16.729 -20.346 36.978  1.00 54.03  ? 76   GLU A CB    1 
ATOM   639  C  CG    . GLU A 1 76  ? -15.215 -20.214 36.839  1.00 60.89  ? 76   GLU A CG    1 
ATOM   640  C  CD    . GLU A 1 76  ? -14.565 -19.420 37.976  1.00 65.33  ? 76   GLU A CD    1 
ATOM   641  O  OE1   . GLU A 1 76  ? -13.320 -19.503 38.110  1.00 66.64  ? 76   GLU A OE1   1 
ATOM   642  O  OE2   . GLU A 1 76  ? -15.283 -18.722 38.734  1.00 64.26  ? 76   GLU A OE2   1 
ATOM   643  N  N     . ASP A 1 77  ? -17.725 -23.207 37.699  1.00 49.69  ? 77   ASP A N     1 
ATOM   644  C  CA    . ASP A 1 77  ? -17.651 -24.574 38.234  1.00 50.47  ? 77   ASP A CA    1 
ATOM   645  C  C     . ASP A 1 77  ? -18.021 -25.635 37.187  1.00 49.72  ? 77   ASP A C     1 
ATOM   646  O  O     . ASP A 1 77  ? -17.381 -26.681 37.112  1.00 51.68  ? 77   ASP A O     1 
ATOM   647  C  CB    . ASP A 1 77  ? -18.569 -24.746 39.455  1.00 51.01  ? 77   ASP A CB    1 
ATOM   648  C  CG    . ASP A 1 77  ? -18.167 -23.878 40.643  1.00 53.28  ? 77   ASP A CG    1 
ATOM   649  O  OD1   . ASP A 1 77  ? -16.988 -23.456 40.726  1.00 50.82  ? 77   ASP A OD1   1 
ATOM   650  O  OD2   . ASP A 1 77  ? -19.046 -23.627 41.505  1.00 51.89  ? 77   ASP A OD2   1 
ATOM   651  N  N     . ILE A 1 78  ? -19.061 -25.368 36.397  1.00 47.14  ? 78   ILE A N     1 
ATOM   652  C  CA    . ILE A 1 78  ? -19.470 -26.280 35.323  1.00 45.70  ? 78   ILE A CA    1 
ATOM   653  C  C     . ILE A 1 78  ? -18.513 -26.214 34.124  1.00 45.27  ? 78   ILE A C     1 
ATOM   654  O  O     . ILE A 1 78  ? -18.260 -27.225 33.483  1.00 46.48  ? 78   ILE A O     1 
ATOM   655  C  CB    . ILE A 1 78  ? -20.938 -26.037 34.873  1.00 45.33  ? 78   ILE A CB    1 
ATOM   656  C  CG1   . ILE A 1 78  ? -21.906 -26.291 36.034  1.00 45.23  ? 78   ILE A CG1   1 
ATOM   657  C  CG2   . ILE A 1 78  ? -21.307 -26.947 33.717  1.00 43.75  ? 78   ILE A CG2   1 
ATOM   658  C  CD1   . ILE A 1 78  ? -23.249 -25.605 35.894  1.00 40.93  ? 78   ILE A CD1   1 
ATOM   659  N  N     . GLY A 1 79  ? -17.981 -25.028 33.832  1.00 43.83  ? 79   GLY A N     1 
ATOM   660  C  CA    . GLY A 1 79  ? -17.031 -24.856 32.728  1.00 44.72  ? 79   GLY A CA    1 
ATOM   661  C  C     . GLY A 1 79  ? -17.646 -24.332 31.440  1.00 44.86  ? 79   GLY A C     1 
ATOM   662  O  O     . GLY A 1 79  ? -17.189 -24.659 30.338  1.00 44.60  ? 79   GLY A O     1 
ATOM   663  N  N     . LEU A 1 80  ? -18.683 -23.511 31.585  1.00 43.53  ? 80   LEU A N     1 
ATOM   664  C  CA    . LEU A 1 80  ? -19.418 -22.960 30.451  1.00 43.01  ? 80   LEU A CA    1 
ATOM   665  C  C     . LEU A 1 80  ? -19.483 -21.442 30.541  1.00 42.39  ? 80   LEU A C     1 
ATOM   666  O  O     . LEU A 1 80  ? -19.498 -20.877 31.639  1.00 42.17  ? 80   LEU A O     1 
ATOM   667  C  CB    . LEU A 1 80  ? -20.838 -23.523 30.413  1.00 42.02  ? 80   LEU A CB    1 
ATOM   668  C  CG    . LEU A 1 80  ? -21.005 -24.998 30.060  1.00 43.76  ? 80   LEU A CG    1 
ATOM   669  C  CD1   . LEU A 1 80  ? -22.340 -25.503 30.569  1.00 39.62  ? 80   LEU A CD1   1 
ATOM   670  C  CD2   . LEU A 1 80  ? -20.870 -25.203 28.552  1.00 40.05  ? 80   LEU A CD2   1 
ATOM   671  N  N     . GLU A 1 81  ? -19.551 -20.793 29.384  1.00 39.31  ? 81   GLU A N     1 
ATOM   672  C  CA    . GLU A 1 81  ? -19.525 -19.342 29.325  1.00 37.68  ? 81   GLU A CA    1 
ATOM   673  C  C     . GLU A 1 81  ? -20.822 -18.702 29.844  1.00 36.88  ? 81   GLU A C     1 
ATOM   674  O  O     . GLU A 1 81  ? -21.926 -19.067 29.424  1.00 36.76  ? 81   GLU A O     1 
ATOM   675  C  CB    . GLU A 1 81  ? -19.215 -18.880 27.899  1.00 36.85  ? 81   GLU A CB    1 
ATOM   676  C  CG    . GLU A 1 81  ? -18.954 -17.390 27.781  1.00 36.31  ? 81   GLU A CG    1 
ATOM   677  C  CD    . GLU A 1 81  ? -18.659 -16.944 26.363  1.00 36.46  ? 81   GLU A CD    1 
ATOM   678  O  OE1   . GLU A 1 81  ? -18.555 -17.793 25.450  1.00 40.34  ? 81   GLU A OE1   1 
ATOM   679  O  OE2   . GLU A 1 81  ? -18.529 -15.728 26.161  1.00 36.75  ? 81   GLU A OE2   1 
ATOM   680  N  N     . ALA A 1 82  ? -20.664 -17.770 30.785  1.00 33.83  ? 82   ALA A N     1 
ATOM   681  C  CA    . ALA A 1 82  ? -21.754 -16.926 31.257  1.00 31.59  ? 82   ALA A CA    1 
ATOM   682  C  C     . ALA A 1 82  ? -21.620 -15.587 30.548  1.00 32.55  ? 82   ALA A C     1 
ATOM   683  O  O     . ALA A 1 82  ? -20.700 -14.809 30.837  1.00 33.48  ? 82   ALA A O     1 
ATOM   684  C  CB    . ALA A 1 82  ? -21.679 -16.752 32.764  1.00 29.66  ? 82   ALA A CB    1 
ATOM   685  N  N     . LEU A 1 83  ? -22.521 -15.337 29.601  1.00 31.84  ? 83   LEU A N     1 
ATOM   686  C  CA    . LEU A 1 83  ? -22.444 -14.165 28.734  1.00 31.05  ? 83   LEU A CA    1 
ATOM   687  C  C     . LEU A 1 83  ? -23.287 -13.020 29.286  1.00 31.20  ? 83   LEU A C     1 
ATOM   688  O  O     . LEU A 1 83  ? -24.162 -13.238 30.128  1.00 31.81  ? 83   LEU A O     1 
ATOM   689  C  CB    . LEU A 1 83  ? -22.896 -14.520 27.311  1.00 30.89  ? 83   LEU A CB    1 
ATOM   690  C  CG    . LEU A 1 83  ? -22.087 -15.583 26.561  1.00 32.93  ? 83   LEU A CG    1 
ATOM   691  C  CD1   . LEU A 1 83  ? -22.743 -16.965 26.687  1.00 33.42  ? 83   LEU A CD1   1 
ATOM   692  C  CD2   . LEU A 1 83  ? -21.938 -15.211 25.101  1.00 31.52  ? 83   LEU A CD2   1 
ATOM   693  N  N     . GLY A 1 84  ? -23.021 -11.803 28.813  1.00 29.90  ? 84   GLY A N     1 
ATOM   694  C  CA    . GLY A 1 84  ? -23.786 -10.629 29.228  1.00 29.86  ? 84   GLY A CA    1 
ATOM   695  C  C     . GLY A 1 84  ? -23.018 -9.711  30.160  1.00 29.75  ? 84   GLY A C     1 
ATOM   696  O  O     . GLY A 1 84  ? -21.934 -10.050 30.627  1.00 30.27  ? 84   GLY A O     1 
ATOM   697  N  N     . MET A 1 85  ? -23.592 -8.544  30.428  1.00 31.25  ? 85   MET A N     1 
ATOM   698  C  CA    . MET A 1 85  ? -22.943 -7.518  31.232  1.00 30.83  ? 85   MET A CA    1 
ATOM   699  C  C     . MET A 1 85  ? -23.003 -7.852  32.711  1.00 31.97  ? 85   MET A C     1 
ATOM   700  O  O     . MET A 1 85  ? -24.039 -7.702  33.358  1.00 32.79  ? 85   MET A O     1 
ATOM   701  C  CB    . MET A 1 85  ? -23.547 -6.140  30.933  1.00 30.94  ? 85   MET A CB    1 
ATOM   702  C  CG    . MET A 1 85  ? -23.024 -4.999  31.810  1.00 32.85  ? 85   MET A CG    1 
ATOM   703  S  SD    . MET A 1 85  ? -21.230 -4.856  31.881  1.00 36.12  ? 85   MET A SD    1 
ATOM   704  C  CE    . MET A 1 85  ? -20.926 -4.039  30.313  1.00 29.88  ? 85   MET A CE    1 
ATOM   705  N  N     . ASP A 1 86  ? -21.870 -8.317  33.226  1.00 33.75  ? 86   ASP A N     1 
ATOM   706  C  CA    . ASP A 1 86  ? -21.731 -8.732  34.614  1.00 34.97  ? 86   ASP A CA    1 
ATOM   707  C  C     . ASP A 1 86  ? -21.570 -7.555  35.594  1.00 34.78  ? 86   ASP A C     1 
ATOM   708  O  O     . ASP A 1 86  ? -21.635 -7.742  36.809  1.00 35.08  ? 86   ASP A O     1 
ATOM   709  C  CB    . ASP A 1 86  ? -20.565 -9.723  34.748  1.00 37.93  ? 86   ASP A CB    1 
ATOM   710  C  CG    . ASP A 1 86  ? -19.239 -9.161  34.213  1.00 42.72  ? 86   ASP A CG    1 
ATOM   711  O  OD1   . ASP A 1 86  ? -18.250 -9.176  34.973  1.00 44.80  ? 86   ASP A OD1   1 
ATOM   712  O  OD2   . ASP A 1 86  ? -19.180 -8.709  33.042  1.00 42.94  ? 86   ASP A OD2   1 
ATOM   713  N  N     . ASP A 1 87  ? -21.351 -6.348  35.077  1.00 33.79  ? 87   ASP A N     1 
ATOM   714  C  CA    . ASP A 1 87  ? -21.405 -5.152  35.929  1.00 34.15  ? 87   ASP A CA    1 
ATOM   715  C  C     . ASP A 1 87  ? -22.828 -4.599  35.844  1.00 32.68  ? 87   ASP A C     1 
ATOM   716  O  O     . ASP A 1 87  ? -23.194 -3.903  34.889  1.00 33.14  ? 87   ASP A O     1 
ATOM   717  C  CB    . ASP A 1 87  ? -20.338 -4.106  35.544  1.00 34.48  ? 87   ASP A CB    1 
ATOM   718  C  CG    . ASP A 1 87  ? -20.326 -2.887  36.487  1.00 38.58  ? 87   ASP A CG    1 
ATOM   719  O  OD1   . ASP A 1 87  ? -21.267 -2.733  37.296  1.00 41.08  ? 87   ASP A OD1   1 
ATOM   720  O  OD2   . ASP A 1 87  ? -19.376 -2.071  36.412  1.00 38.28  ? 87   ASP A OD2   1 
ATOM   721  N  N     . PHE A 1 88  ? -23.622 -4.930  36.855  1.00 31.47  ? 88   PHE A N     1 
ATOM   722  C  CA    . PHE A 1 88  ? -25.067 -4.770  36.791  1.00 32.35  ? 88   PHE A CA    1 
ATOM   723  C  C     . PHE A 1 88  ? -25.528 -3.326  36.726  1.00 34.63  ? 88   PHE A C     1 
ATOM   724  O  O     . PHE A 1 88  ? -26.546 -3.037  36.100  1.00 38.08  ? 88   PHE A O     1 
ATOM   725  C  CB    . PHE A 1 88  ? -25.750 -5.519  37.936  1.00 31.86  ? 88   PHE A CB    1 
ATOM   726  C  CG    . PHE A 1 88  ? -25.463 -6.990  37.942  1.00 33.99  ? 88   PHE A CG    1 
ATOM   727  C  CD1   . PHE A 1 88  ? -25.658 -7.756  36.790  1.00 34.92  ? 88   PHE A CD1   1 
ATOM   728  C  CD2   . PHE A 1 88  ? -25.005 -7.615  39.097  1.00 33.24  ? 88   PHE A CD2   1 
ATOM   729  C  CE1   . PHE A 1 88  ? -25.396 -9.117  36.791  1.00 37.31  ? 88   PHE A CE1   1 
ATOM   730  C  CE2   . PHE A 1 88  ? -24.741 -8.976  39.113  1.00 35.98  ? 88   PHE A CE2   1 
ATOM   731  C  CZ    . PHE A 1 88  ? -24.928 -9.731  37.958  1.00 37.42  ? 88   PHE A CZ    1 
ATOM   732  N  N     . LYS A 1 89  ? -24.777 -2.420  37.339  1.00 33.46  ? 89   LYS A N     1 
ATOM   733  C  CA    . LYS A 1 89  ? -25.117 -1.007  37.241  1.00 36.59  ? 89   LYS A CA    1 
ATOM   734  C  C     . LYS A 1 89  ? -24.986 -0.437  35.820  1.00 34.70  ? 89   LYS A C     1 
ATOM   735  O  O     . LYS A 1 89  ? -25.690 0.504   35.473  1.00 34.74  ? 89   LYS A O     1 
ATOM   736  C  CB    . LYS A 1 89  ? -24.382 -0.155  38.291  1.00 36.19  ? 89   LYS A CB    1 
ATOM   737  C  CG    . LYS A 1 89  ? -22.902 0.008   38.124  1.00 37.09  ? 89   LYS A CG    1 
ATOM   738  C  CD    . LYS A 1 89  ? -22.326 0.524   39.436  1.00 41.15  ? 89   LYS A CD    1 
ATOM   739  C  CE    . LYS A 1 89  ? -20.830 0.318   39.528  1.00 40.23  ? 89   LYS A CE    1 
ATOM   740  N  NZ    . LYS A 1 89  ? -20.479 -1.093  39.789  1.00 38.94  ? 89   LYS A NZ    1 
ATOM   741  N  N     . LEU A 1 90  ? -24.113 -1.025  35.003  1.00 34.39  ? 90   LEU A N     1 
ATOM   742  C  CA    . LEU A 1 90  ? -23.994 -0.623  33.605  1.00 33.44  ? 90   LEU A CA    1 
ATOM   743  C  C     . LEU A 1 90  ? -25.196 -1.096  32.788  1.00 32.89  ? 90   LEU A C     1 
ATOM   744  O  O     . LEU A 1 90  ? -25.669 -0.387  31.904  1.00 34.41  ? 90   LEU A O     1 
ATOM   745  C  CB    . LEU A 1 90  ? -22.692 -1.146  32.988  1.00 35.01  ? 90   LEU A CB    1 
ATOM   746  C  CG    . LEU A 1 90  ? -21.354 -0.601  33.497  1.00 35.80  ? 90   LEU A CG    1 
ATOM   747  C  CD1   . LEU A 1 90  ? -20.218 -1.173  32.665  1.00 35.18  ? 90   LEU A CD1   1 
ATOM   748  C  CD2   . LEU A 1 90  ? -21.309 0.930   33.493  1.00 37.94  ? 90   LEU A CD2   1 
ATOM   749  N  N     . ALA A 1 91  ? -25.684 -2.296  33.093  1.00 31.31  ? 91   ALA A N     1 
ATOM   750  C  CA    . ALA A 1 91  ? -26.883 -2.829  32.453  1.00 30.11  ? 91   ALA A CA    1 
ATOM   751  C  C     . ALA A 1 91  ? -28.127 -2.046  32.873  1.00 29.65  ? 91   ALA A C     1 
ATOM   752  O  O     . ALA A 1 91  ? -29.041 -1.845  32.069  1.00 29.03  ? 91   ALA A O     1 
ATOM   753  C  CB    . ALA A 1 91  ? -27.045 -4.313  32.768  1.00 28.79  ? 91   ALA A CB    1 
ATOM   754  N  N     . TYR A 1 92  ? -28.152 -1.602  34.130  1.00 30.95  ? 92   TYR A N     1 
ATOM   755  C  CA    . TYR A 1 92  ? -29.232 -0.754  34.631  1.00 32.75  ? 92   TYR A CA    1 
ATOM   756  C  C     . TYR A 1 92  ? -29.296 0.565   33.870  1.00 32.66  ? 92   TYR A C     1 
ATOM   757  O  O     . TYR A 1 92  ? -30.365 0.972   33.406  1.00 34.29  ? 92   TYR A O     1 
ATOM   758  C  CB    . TYR A 1 92  ? -29.070 -0.468  36.126  1.00 33.62  ? 92   TYR A CB    1 
ATOM   759  C  CG    . TYR A 1 92  ? -30.052 0.571   36.636  1.00 35.79  ? 92   TYR A CG    1 
ATOM   760  C  CD1   . TYR A 1 92  ? -29.651 1.884   36.873  1.00 34.11  ? 92   TYR A CD1   1 
ATOM   761  C  CD2   . TYR A 1 92  ? -31.389 0.241   36.862  1.00 37.85  ? 92   TYR A CD2   1 
ATOM   762  C  CE1   . TYR A 1 92  ? -30.555 2.836   37.342  1.00 38.11  ? 92   TYR A CE1   1 
ATOM   763  C  CE2   . TYR A 1 92  ? -32.300 1.187   37.322  1.00 36.78  ? 92   TYR A CE2   1 
ATOM   764  C  CZ    . TYR A 1 92  ? -31.878 2.478   37.559  1.00 39.35  ? 92   TYR A CZ    1 
ATOM   765  O  OH    . TYR A 1 92  ? -32.784 3.407   38.015  1.00 40.62  ? 92   TYR A OH    1 
ATOM   766  N  N     . LEU A 1 93  ? -28.152 1.229   33.755  1.00 31.85  ? 93   LEU A N     1 
ATOM   767  C  CA    . LEU A 1 93  ? -28.075 2.506   33.054  1.00 32.46  ? 93   LEU A CA    1 
ATOM   768  C  C     . LEU A 1 93  ? -28.499 2.362   31.593  1.00 33.25  ? 93   LEU A C     1 
ATOM   769  O  O     . LEU A 1 93  ? -29.125 3.262   31.025  1.00 31.65  ? 93   LEU A O     1 
ATOM   770  C  CB    . LEU A 1 93  ? -26.664 3.096   33.143  1.00 29.46  ? 93   LEU A CB    1 
ATOM   771  C  CG    . LEU A 1 93  ? -26.249 3.823   34.423  1.00 29.18  ? 93   LEU A CG    1 
ATOM   772  C  CD1   . LEU A 1 93  ? -24.885 4.448   34.232  1.00 24.62  ? 93   LEU A CD1   1 
ATOM   773  C  CD2   . LEU A 1 93  ? -27.253 4.895   34.844  1.00 24.86  ? 93   LEU A CD2   1 
ATOM   774  N  N     . SER A 1 94  ? -28.166 1.216   31.008  1.00 34.12  ? 94   SER A N     1 
ATOM   775  C  CA    . SER A 1 94  ? -28.475 0.934   29.613  1.00 35.67  ? 94   SER A CA    1 
ATOM   776  C  C     . SER A 1 94  ? -29.976 0.676   29.402  1.00 36.48  ? 94   SER A C     1 
ATOM   777  O  O     . SER A 1 94  ? -30.545 1.091   28.394  1.00 35.91  ? 94   SER A O     1 
ATOM   778  C  CB    . SER A 1 94  ? -27.646 -0.258  29.134  1.00 35.30  ? 94   SER A CB    1 
ATOM   779  O  OG    . SER A 1 94  ? -27.828 -0.465  27.750  1.00 36.64  ? 94   SER A OG    1 
ATOM   780  N  N     . ASP A 1 95  ? -30.604 -0.007  30.358  1.00 35.11  ? 95   ASP A N     1 
ATOM   781  C  CA    . ASP A 1 95  ? -32.048 -0.225  30.340  1.00 34.73  ? 95   ASP A CA    1 
ATOM   782  C  C     . ASP A 1 95  ? -32.833 1.042   30.640  1.00 36.27  ? 95   ASP A C     1 
ATOM   783  O  O     . ASP A 1 95  ? -33.878 1.292   30.026  1.00 35.07  ? 95   ASP A O     1 
ATOM   784  C  CB    . ASP A 1 95  ? -32.436 -1.304  31.349  1.00 33.93  ? 95   ASP A CB    1 
ATOM   785  C  CG    . ASP A 1 95  ? -32.090 -2.691  30.867  1.00 31.11  ? 95   ASP A CG    1 
ATOM   786  O  OD1   . ASP A 1 95  ? -31.692 -3.532  31.698  1.00 29.03  ? 95   ASP A OD1   1 
ATOM   787  O  OD2   . ASP A 1 95  ? -32.213 -2.934  29.653  1.00 29.68  ? 95   ASP A OD2   1 
ATOM   788  N  N     . THR A 1 96  ? -32.325 1.837   31.583  1.00 35.04  ? 96   THR A N     1 
ATOM   789  C  CA    . THR A 1 96  ? -33.037 3.025   32.051  1.00 33.47  ? 96   THR A CA    1 
ATOM   790  C  C     . THR A 1 96  ? -32.931 4.212   31.087  1.00 33.39  ? 96   THR A C     1 
ATOM   791  O  O     . THR A 1 96  ? -33.853 5.024   31.000  1.00 34.41  ? 96   THR A O     1 
ATOM   792  C  CB    . THR A 1 96  ? -32.588 3.412   33.474  1.00 32.88  ? 96   THR A CB    1 
ATOM   793  O  OG1   . THR A 1 96  ? -32.568 2.231   34.289  1.00 31.93  ? 96   THR A OG1   1 
ATOM   794  C  CG2   . THR A 1 96  ? -33.551 4.427   34.094  1.00 31.11  ? 96   THR A CG2   1 
ATOM   795  N  N     . TYR A 1 97  ? -31.821 4.290   30.362  1.00 32.34  ? 97   TYR A N     1 
ATOM   796  C  CA    . TYR A 1 97  ? -31.564 5.383   29.420  1.00 34.51  ? 97   TYR A CA    1 
ATOM   797  C  C     . TYR A 1 97  ? -31.263 4.779   28.050  1.00 37.19  ? 97   TYR A C     1 
ATOM   798  O  O     . TYR A 1 97  ? -30.129 4.806   27.565  1.00 34.62  ? 97   TYR A O     1 
ATOM   799  C  CB    . TYR A 1 97  ? -30.426 6.301   29.927  1.00 32.72  ? 97   TYR A CB    1 
ATOM   800  C  CG    . TYR A 1 97  ? -30.720 6.855   31.305  1.00 33.05  ? 97   TYR A CG    1 
ATOM   801  C  CD1   . TYR A 1 97  ? -30.255 6.211   32.450  1.00 33.83  ? 97   TYR A CD1   1 
ATOM   802  C  CD2   . TYR A 1 97  ? -31.509 7.994   31.467  1.00 33.47  ? 97   TYR A CD2   1 
ATOM   803  C  CE1   . TYR A 1 97  ? -30.560 6.695   33.722  1.00 34.22  ? 97   TYR A CE1   1 
ATOM   804  C  CE2   . TYR A 1 97  ? -31.811 8.492   32.733  1.00 33.21  ? 97   TYR A CE2   1 
ATOM   805  C  CZ    . TYR A 1 97  ? -31.338 7.834   33.855  1.00 35.51  ? 97   TYR A CZ    1 
ATOM   806  O  OH    . TYR A 1 97  ? -31.626 8.321   35.107  1.00 34.42  ? 97   TYR A OH    1 
ATOM   807  N  N     . ASN A 1 98  ? -32.303 4.208   27.449  1.00 39.11  ? 98   ASN A N     1 
ATOM   808  C  CA    . ASN A 1 98  ? -32.189 3.541   26.169  1.00 44.21  ? 98   ASN A CA    1 
ATOM   809  C  C     . ASN A 1 98  ? -32.284 4.554   25.023  1.00 45.50  ? 98   ASN A C     1 
ATOM   810  O  O     . ASN A 1 98  ? -33.073 4.389   24.091  1.00 48.92  ? 98   ASN A O     1 
ATOM   811  C  CB    . ASN A 1 98  ? -33.251 2.433   26.050  1.00 46.15  ? 98   ASN A CB    1 
ATOM   812  C  CG    . ASN A 1 98  ? -32.940 1.435   24.940  1.00 53.97  ? 98   ASN A CG    1 
ATOM   813  O  OD1   . ASN A 1 98  ? -31.895 1.520   24.277  1.00 57.99  ? 98   ASN A OD1   1 
ATOM   814  N  ND2   . ASN A 1 98  ? -33.850 0.478   24.731  1.00 55.84  ? 98   ASN A ND2   1 
ATOM   815  N  N     . TYR A 1 99  ? -31.464 5.599   25.119  1.00 43.45  ? 99   TYR A N     1 
ATOM   816  C  CA    . TYR A 1 99  ? -31.437 6.709   24.172  1.00 42.48  ? 99   TYR A CA    1 
ATOM   817  C  C     . TYR A 1 99  ? -30.136 7.485   24.379  1.00 42.61  ? 99   TYR A C     1 
ATOM   818  O  O     . TYR A 1 99  ? -29.471 7.310   25.405  1.00 42.31  ? 99   TYR A O     1 
ATOM   819  C  CB    . TYR A 1 99  ? -32.654 7.633   24.367  1.00 42.70  ? 99   TYR A CB    1 
ATOM   820  C  CG    . TYR A 1 99  ? -32.914 8.113   25.803  1.00 42.19  ? 99   TYR A CG    1 
ATOM   821  C  CD1   . TYR A 1 99  ? -33.827 7.448   26.628  1.00 41.84  ? 99   TYR A CD1   1 
ATOM   822  C  CD2   . TYR A 1 99  ? -32.268 9.245   26.320  1.00 42.90  ? 99   TYR A CD2   1 
ATOM   823  C  CE1   . TYR A 1 99  ? -34.082 7.885   27.938  1.00 42.33  ? 99   TYR A CE1   1 
ATOM   824  C  CE2   . TYR A 1 99  ? -32.515 9.696   27.623  1.00 40.77  ? 99   TYR A CE2   1 
ATOM   825  C  CZ    . TYR A 1 99  ? -33.423 9.008   28.427  1.00 45.92  ? 99   TYR A CZ    1 
ATOM   826  O  OH    . TYR A 1 99  ? -33.679 9.439   29.713  1.00 44.95  ? 99   TYR A OH    1 
ATOM   827  N  N     . GLU A 1 100 ? -29.764 8.315   23.403  1.00 41.99  ? 100  GLU A N     1 
ATOM   828  C  CA    . GLU A 1 100 ? -28.606 9.199   23.534  1.00 43.93  ? 100  GLU A CA    1 
ATOM   829  C  C     . GLU A 1 100 ? -28.879 10.217  24.639  1.00 44.31  ? 100  GLU A C     1 
ATOM   830  O  O     . GLU A 1 100 ? -29.879 10.949  24.587  1.00 47.09  ? 100  GLU A O     1 
ATOM   831  C  CB    . GLU A 1 100 ? -28.321 9.922   22.216  1.00 45.30  ? 100  GLU A CB    1 
ATOM   832  C  CG    . GLU A 1 100 ? -27.015 10.727  22.196  1.00 52.44  ? 100  GLU A CG    1 
ATOM   833  C  CD    . GLU A 1 100 ? -26.790 11.487  20.883  1.00 60.10  ? 100  GLU A CD    1 
ATOM   834  O  OE1   . GLU A 1 100 ? -25.612 11.709  20.522  1.00 61.35  ? 100  GLU A OE1   1 
ATOM   835  O  OE2   . GLU A 1 100 ? -27.781 11.862  20.211  1.00 62.86  ? 100  GLU A OE2   1 
ATOM   836  N  N     . ILE A 1 101 ? -28.001 10.256  25.637  1.00 41.00  ? 101  ILE A N     1 
ATOM   837  C  CA    . ILE A 1 101 ? -28.199 11.131  26.792  1.00 40.84  ? 101  ILE A CA    1 
ATOM   838  C  C     . ILE A 1 101 ? -27.906 12.582  26.458  1.00 42.63  ? 101  ILE A C     1 
ATOM   839  O  O     . ILE A 1 101 ? -26.815 12.920  25.999  1.00 44.92  ? 101  ILE A O     1 
ATOM   840  C  CB    . ILE A 1 101 ? -27.357 10.678  28.011  1.00 38.31  ? 101  ILE A CB    1 
ATOM   841  C  CG1   . ILE A 1 101 ? -27.937 9.390   28.590  1.00 37.08  ? 101  ILE A CG1   1 
ATOM   842  C  CG2   . ILE A 1 101 ? -27.304 11.771  29.091  1.00 36.84  ? 101  ILE A CG2   1 
ATOM   843  C  CD1   . ILE A 1 101 ? -26.965 8.604   29.423  1.00 38.49  ? 101  ILE A CD1   1 
ATOM   844  N  N     . LYS A 1 102 ? -28.904 13.428  26.682  1.00 45.25  ? 102  LYS A N     1 
ATOM   845  C  CA    . LYS A 1 102 ? -28.731 14.866  26.636  1.00 47.84  ? 102  LYS A CA    1 
ATOM   846  C  C     . LYS A 1 102 ? -28.701 15.350  28.076  1.00 47.18  ? 102  LYS A C     1 
ATOM   847  O  O     . LYS A 1 102 ? -29.687 15.214  28.808  1.00 47.45  ? 102  LYS A O     1 
ATOM   848  C  CB    . LYS A 1 102 ? -29.884 15.527  25.868  1.00 52.35  ? 102  LYS A CB    1 
ATOM   849  C  CG    . LYS A 1 102 ? -29.549 16.905  25.276  1.00 59.45  ? 102  LYS A CG    1 
ATOM   850  C  CD    . LYS A 1 102 ? -28.519 16.788  24.136  1.00 66.88  ? 102  LYS A CD    1 
ATOM   851  C  CE    . LYS A 1 102 ? -28.135 18.155  23.566  1.00 71.08  ? 102  LYS A CE    1 
ATOM   852  N  NZ    . LYS A 1 102 ? -26.943 18.080  22.663  1.00 71.16  ? 102  LYS A NZ    1 
ATOM   853  N  N     . TYR A 1 103 ? -27.560 15.887  28.498  1.00 45.53  ? 103  TYR A N     1 
ATOM   854  C  CA    . TYR A 1 103 ? -27.412 16.309  29.882  1.00 42.06  ? 103  TYR A CA    1 
ATOM   855  C  C     . TYR A 1 103 ? -27.380 17.820  29.989  1.00 41.09  ? 103  TYR A C     1 
ATOM   856  O  O     . TYR A 1 103 ? -27.038 18.511  29.031  1.00 41.63  ? 103  TYR A O     1 
ATOM   857  C  CB    . TYR A 1 103 ? -26.201 15.633  30.559  1.00 39.21  ? 103  TYR A CB    1 
ATOM   858  C  CG    . TYR A 1 103 ? -24.829 16.130  30.135  1.00 36.76  ? 103  TYR A CG    1 
ATOM   859  C  CD1   . TYR A 1 103 ? -24.125 15.530  29.076  1.00 33.67  ? 103  TYR A CD1   1 
ATOM   860  C  CD2   . TYR A 1 103 ? -24.222 17.185  30.813  1.00 31.60  ? 103  TYR A CD2   1 
ATOM   861  C  CE1   . TYR A 1 103 ? -22.842 15.994  28.698  1.00 32.15  ? 103  TYR A CE1   1 
ATOM   862  C  CE2   . TYR A 1 103 ? -22.970 17.656  30.448  1.00 32.90  ? 103  TYR A CE2   1 
ATOM   863  C  CZ    . TYR A 1 103 ? -22.278 17.063  29.402  1.00 33.65  ? 103  TYR A CZ    1 
ATOM   864  O  OH    . TYR A 1 103 ? -21.033 17.564  29.090  1.00 32.43  ? 103  TYR A OH    1 
ATOM   865  N  N     . ASP A 1 104 ? -27.786 18.327  31.149  1.00 38.28  ? 104  ASP A N     1 
ATOM   866  C  CA    . ASP A 1 104 ? -27.748 19.752  31.417  1.00 36.10  ? 104  ASP A CA    1 
ATOM   867  C  C     . ASP A 1 104 ? -26.822 19.992  32.589  1.00 34.54  ? 104  ASP A C     1 
ATOM   868  O  O     . ASP A 1 104 ? -27.215 19.797  33.738  1.00 36.68  ? 104  ASP A O     1 
ATOM   869  C  CB    . ASP A 1 104 ? -29.151 20.284  31.722  1.00 36.39  ? 104  ASP A CB    1 
ATOM   870  C  CG    . ASP A 1 104 ? -29.167 21.784  31.986  1.00 40.97  ? 104  ASP A CG    1 
ATOM   871  O  OD1   . ASP A 1 104 ? -28.090 22.418  32.038  1.00 40.82  ? 104  ASP A OD1   1 
ATOM   872  O  OD2   . ASP A 1 104 ? -30.272 22.340  32.136  1.00 46.45  ? 104  ASP A OD2   1 
ATOM   873  N  N     . HIS A 1 105 ? -25.600 20.431  32.298  1.00 34.39  ? 105  HIS A N     1 
ATOM   874  C  CA    . HIS A 1 105 ? -24.575 20.619  33.325  1.00 35.31  ? 105  HIS A CA    1 
ATOM   875  C  C     . HIS A 1 105 ? -25.002 21.545  34.468  1.00 34.99  ? 105  HIS A C     1 
ATOM   876  O  O     . HIS A 1 105 ? -24.493 21.425  35.578  1.00 33.91  ? 105  HIS A O     1 
ATOM   877  C  CB    . HIS A 1 105 ? -23.251 21.094  32.709  1.00 35.70  ? 105  HIS A CB    1 
ATOM   878  C  CG    . HIS A 1 105 ? -23.276 22.506  32.214  1.00 38.25  ? 105  HIS A CG    1 
ATOM   879  N  ND1   . HIS A 1 105 ? -22.880 23.575  32.993  1.00 41.38  ? 105  HIS A ND1   1 
ATOM   880  C  CD2   . HIS A 1 105 ? -23.631 23.026  31.014  1.00 40.39  ? 105  HIS A CD2   1 
ATOM   881  C  CE1   . HIS A 1 105 ? -22.997 24.693  32.295  1.00 44.09  ? 105  HIS A CE1   1 
ATOM   882  N  NE2   . HIS A 1 105 ? -23.453 24.388  31.091  1.00 42.81  ? 105  HIS A NE2   1 
ATOM   883  N  N     . THR A 1 106 ? -25.945 22.449  34.197  1.00 36.72  ? 106  THR A N     1 
ATOM   884  C  CA    . THR A 1 106 ? -26.395 23.429  35.198  1.00 36.54  ? 106  THR A CA    1 
ATOM   885  C  C     . THR A 1 106 ? -27.256 22.781  36.278  1.00 35.64  ? 106  THR A C     1 
ATOM   886  O  O     . THR A 1 106 ? -27.528 23.391  37.310  1.00 34.65  ? 106  THR A O     1 
ATOM   887  C  CB    . THR A 1 106 ? -27.173 24.615  34.562  1.00 37.16  ? 106  THR A CB    1 
ATOM   888  O  OG1   . THR A 1 106 ? -28.434 24.151  34.052  1.00 38.09  ? 106  THR A OG1   1 
ATOM   889  C  CG2   . THR A 1 106 ? -26.365 25.254  33.417  1.00 38.02  ? 106  THR A CG2   1 
ATOM   890  N  N     . LYS A 1 107 ? -27.683 21.545  36.037  1.00 35.71  ? 107  LYS A N     1 
ATOM   891  C  CA    . LYS A 1 107 ? -28.456 20.804  37.028  1.00 36.28  ? 107  LYS A CA    1 
ATOM   892  C  C     . LYS A 1 107 ? -27.578 19.872  37.849  1.00 35.24  ? 107  LYS A C     1 
ATOM   893  O  O     . LYS A 1 107 ? -28.025 19.300  38.845  1.00 36.75  ? 107  LYS A O     1 
ATOM   894  C  CB    . LYS A 1 107 ? -29.596 20.026  36.365  1.00 38.41  ? 107  LYS A CB    1 
ATOM   895  C  CG    . LYS A 1 107 ? -30.592 20.896  35.615  1.00 42.36  ? 107  LYS A CG    1 
ATOM   896  C  CD    . LYS A 1 107 ? -31.195 21.971  36.511  1.00 48.10  ? 107  LYS A CD    1 
ATOM   897  C  CE    . LYS A 1 107 ? -32.107 22.914  35.723  1.00 56.08  ? 107  LYS A CE    1 
ATOM   898  N  NZ    . LYS A 1 107 ? -33.195 22.184  35.005  1.00 56.49  ? 107  LYS A NZ    1 
ATOM   899  N  N     . ILE A 1 108 ? -26.328 19.721  37.427  1.00 34.63  ? 108  ILE A N     1 
ATOM   900  C  CA    . ILE A 1 108 ? -25.380 18.864  38.128  1.00 33.09  ? 108  ILE A CA    1 
ATOM   901  C  C     . ILE A 1 108 ? -24.619 19.682  39.169  1.00 33.91  ? 108  ILE A C     1 
ATOM   902  O  O     . ILE A 1 108 ? -24.103 20.772  38.870  1.00 35.81  ? 108  ILE A O     1 
ATOM   903  C  CB    . ILE A 1 108 ? -24.419 18.160  37.148  1.00 34.05  ? 108  ILE A CB    1 
ATOM   904  C  CG1   . ILE A 1 108 ? -25.222 17.344  36.124  1.00 33.39  ? 108  ILE A CG1   1 
ATOM   905  C  CG2   . ILE A 1 108 ? -23.434 17.278  37.908  1.00 31.97  ? 108  ILE A CG2   1 
ATOM   906  C  CD1   . ILE A 1 108 ? -24.411 16.740  34.995  1.00 34.16  ? 108  ILE A CD1   1 
ATOM   907  N  N     . ARG A 1 109 ? -24.579 19.163  40.395  1.00 29.40  ? 109  ARG A N     1 
ATOM   908  C  CA    . ARG A 1 109 ? -23.927 19.847  41.498  1.00 28.06  ? 109  ARG A CA    1 
ATOM   909  C  C     . ARG A 1 109 ? -22.460 19.471  41.531  1.00 28.80  ? 109  ARG A C     1 
ATOM   910  O  O     . ARG A 1 109 ? -22.107 18.341  41.899  1.00 28.41  ? 109  ARG A O     1 
ATOM   911  C  CB    . ARG A 1 109 ? -24.603 19.499  42.838  1.00 29.00  ? 109  ARG A CB    1 
ATOM   912  C  CG    . ARG A 1 109 ? -24.251 20.449  43.981  1.00 28.79  ? 109  ARG A CG    1 
ATOM   913  C  CD    . ARG A 1 109 ? -25.030 20.129  45.256  1.00 25.91  ? 109  ARG A CD    1 
ATOM   914  N  NE    . ARG A 1 109 ? -26.464 20.296  45.049  1.00 29.92  ? 109  ARG A NE    1 
ATOM   915  C  CZ    . ARG A 1 109 ? -27.114 21.449  45.199  1.00 30.63  ? 109  ARG A CZ    1 
ATOM   916  N  NH1   . ARG A 1 109 ? -26.462 22.540  45.584  1.00 26.80  ? 109  ARG A NH1   1 
ATOM   917  N  NH2   . ARG A 1 109 ? -28.421 21.505  44.972  1.00 29.56  ? 109  ARG A NH2   1 
ATOM   918  N  N     . VAL A 1 110 ? -21.615 20.418  41.129  1.00 27.30  ? 110  VAL A N     1 
ATOM   919  C  CA    . VAL A 1 110 ? -20.177 20.218  41.141  1.00 27.75  ? 110  VAL A CA    1 
ATOM   920  C  C     . VAL A 1 110 ? -19.633 20.920  42.375  1.00 30.02  ? 110  VAL A C     1 
ATOM   921  O  O     . VAL A 1 110 ? -19.847 22.121  42.573  1.00 29.44  ? 110  VAL A O     1 
ATOM   922  C  CB    . VAL A 1 110 ? -19.484 20.713  39.835  1.00 26.79  ? 110  VAL A CB    1 
ATOM   923  C  CG1   . VAL A 1 110 ? -17.984 20.410  39.868  1.00 27.02  ? 110  VAL A CG1   1 
ATOM   924  C  CG2   . VAL A 1 110 ? -20.089 20.034  38.621  1.00 28.98  ? 110  VAL A CG2   1 
ATOM   925  N  N     . ALA A 1 111 ? -18.963 20.146  43.222  1.00 29.57  ? 111  ALA A N     1 
ATOM   926  C  CA    . ALA A 1 111 ? -18.429 20.663  44.464  1.00 29.96  ? 111  ALA A CA    1 
ATOM   927  C  C     . ALA A 1 111 ? -16.915 20.647  44.417  1.00 28.60  ? 111  ALA A C     1 
ATOM   928  O  O     . ALA A 1 111 ? -16.300 19.665  43.999  1.00 26.34  ? 111  ALA A O     1 
ATOM   929  C  CB    . ALA A 1 111 ? -18.934 19.870  45.643  1.00 28.89  ? 111  ALA A CB    1 
ATOM   930  N  N     . ASN A 1 112 ? -16.340 21.756  44.861  1.00 29.18  ? 112  ASN A N     1 
ATOM   931  C  CA    . ASN A 1 112 ? -14.914 22.001  44.818  1.00 29.75  ? 112  ASN A CA    1 
ATOM   932  C  C     . ASN A 1 112 ? -14.518 22.463  46.202  1.00 28.36  ? 112  ASN A C     1 
ATOM   933  O  O     . ASN A 1 112 ? -14.924 23.543  46.629  1.00 27.34  ? 112  ASN A O     1 
ATOM   934  C  CB    . ASN A 1 112 ? -14.655 23.118  43.801  1.00 31.75  ? 112  ASN A CB    1 
ATOM   935  C  CG    . ASN A 1 112 ? -13.249 23.121  43.272  1.00 39.90  ? 112  ASN A CG    1 
ATOM   936  O  OD1   . ASN A 1 112 ? -12.275 23.349  44.013  1.00 42.94  ? 112  ASN A OD1   1 
ATOM   937  N  ND2   . ASN A 1 112 ? -13.124 22.901  41.967  1.00 40.81  ? 112  ASN A ND2   1 
ATOM   938  N  N     . PHE A 1 113 ? -13.765 21.644  46.928  1.00 30.68  ? 113  PHE A N     1 
ATOM   939  C  CA    . PHE A 1 113 ? -13.372 22.028  48.285  1.00 32.06  ? 113  PHE A CA    1 
ATOM   940  C  C     . PHE A 1 113 ? -11.911 21.792  48.640  1.00 33.62  ? 113  PHE A C     1 
ATOM   941  O  O     . PHE A 1 113 ? -11.223 20.988  48.012  1.00 33.45  ? 113  PHE A O     1 
ATOM   942  C  CB    . PHE A 1 113 ? -14.326 21.442  49.356  1.00 30.71  ? 113  PHE A CB    1 
ATOM   943  C  CG    . PHE A 1 113 ? -13.982 20.046  49.823  1.00 28.71  ? 113  PHE A CG    1 
ATOM   944  C  CD1   . PHE A 1 113 ? -13.878 18.988  48.927  1.00 33.63  ? 113  PHE A CD1   1 
ATOM   945  C  CD2   . PHE A 1 113 ? -13.810 19.787  51.173  1.00 32.56  ? 113  PHE A CD2   1 
ATOM   946  C  CE1   . PHE A 1 113 ? -13.573 17.693  49.374  1.00 33.41  ? 113  PHE A CE1   1 
ATOM   947  C  CE2   . PHE A 1 113 ? -13.518 18.495  51.633  1.00 32.84  ? 113  PHE A CE2   1 
ATOM   948  C  CZ    . PHE A 1 113 ? -13.399 17.448  50.727  1.00 30.74  ? 113  PHE A CZ    1 
ATOM   949  N  N     . ASP A 1 114 ? -11.470 22.510  49.668  1.00 34.88  ? 114  ASP A N     1 
ATOM   950  C  CA    . ASP A 1 114 ? -10.142 22.369  50.243  1.00 36.52  ? 114  ASP A CA    1 
ATOM   951  C  C     . ASP A 1 114 ? -10.271 22.537  51.751  1.00 34.87  ? 114  ASP A C     1 
ATOM   952  O  O     . ASP A 1 114 ? -11.114 23.298  52.229  1.00 34.49  ? 114  ASP A O     1 
ATOM   953  C  CB    . ASP A 1 114 ? -9.205  23.434  49.670  1.00 37.96  ? 114  ASP A CB    1 
ATOM   954  C  CG    . ASP A 1 114 ? -7.753  23.198  50.037  1.00 46.82  ? 114  ASP A CG    1 
ATOM   955  O  OD1   . ASP A 1 114 ? -7.155  22.239  49.505  1.00 47.31  ? 114  ASP A OD1   1 
ATOM   956  O  OD2   . ASP A 1 114 ? -7.206  23.978  50.857  1.00 53.94  ? 114  ASP A OD2   1 
ATOM   957  N  N     . ILE A 1 115 ? -9.449  21.820  52.505  1.00 34.65  ? 115  ILE A N     1 
ATOM   958  C  CA    . ILE A 1 115 ? -9.478  21.940  53.960  1.00 33.79  ? 115  ILE A CA    1 
ATOM   959  C  C     . ILE A 1 115 ? -8.120  22.376  54.510  1.00 34.14  ? 115  ILE A C     1 
ATOM   960  O  O     . ILE A 1 115 ? -7.102  22.195  53.859  1.00 34.63  ? 115  ILE A O     1 
ATOM   961  C  CB    . ILE A 1 115 ? -9.938  20.625  54.644  1.00 33.27  ? 115  ILE A CB    1 
ATOM   962  C  CG1   . ILE A 1 115 ? -8.854  19.539  54.539  1.00 33.38  ? 115  ILE A CG1   1 
ATOM   963  C  CG2   . ILE A 1 115 ? -11.283 20.153  54.068  1.00 29.22  ? 115  ILE A CG2   1 
ATOM   964  C  CD1   . ILE A 1 115 ? -9.000  18.422  55.547  1.00 28.17  ? 115  ILE A CD1   1 
ATOM   965  N  N     . GLU A 1 116 ? -8.120  22.963  55.705  1.00 33.32  ? 116  GLU A N     1 
ATOM   966  C  CA    . GLU A 1 116 ? -6.886  23.310  56.383  1.00 31.82  ? 116  GLU A CA    1 
ATOM   967  C  C     . GLU A 1 116 ? -6.807  22.558  57.705  1.00 32.39  ? 116  GLU A C     1 
ATOM   968  O  O     . GLU A 1 116 ? -7.801  22.459  58.421  1.00 34.46  ? 116  GLU A O     1 
ATOM   969  C  CB    . GLU A 1 116 ? -6.795  24.820  56.619  1.00 32.97  ? 116  GLU A CB    1 
ATOM   970  C  CG    . GLU A 1 116 ? -6.863  25.707  55.362  1.00 35.60  ? 116  GLU A CG    1 
ATOM   971  C  CD    . GLU A 1 116 ? -5.739  25.463  54.353  1.00 42.52  ? 116  GLU A CD    1 
ATOM   972  O  OE1   . GLU A 1 116 ? -4.718  24.828  54.703  1.00 47.33  ? 116  GLU A OE1   1 
ATOM   973  O  OE2   . GLU A 1 116 ? -5.876  25.914  53.192  1.00 43.82  ? 116  GLU A OE2   1 
ATOM   974  N  N     . VAL A 1 117 ? -5.635  21.997  57.995  1.00 32.90  ? 117  VAL A N     1 
ATOM   975  C  CA    . VAL A 1 117 ? -5.360  21.306  59.254  1.00 32.84  ? 117  VAL A CA    1 
ATOM   976  C  C     . VAL A 1 117 ? -3.997  21.754  59.788  1.00 33.02  ? 117  VAL A C     1 
ATOM   977  O  O     . VAL A 1 117 ? -2.964  21.389  59.224  1.00 31.86  ? 117  VAL A O     1 
ATOM   978  C  CB    . VAL A 1 117 ? -5.325  19.758  59.085  1.00 33.42  ? 117  VAL A CB    1 
ATOM   979  C  CG1   . VAL A 1 117 ? -5.004  19.064  60.417  1.00 30.19  ? 117  VAL A CG1   1 
ATOM   980  C  CG2   . VAL A 1 117 ? -6.631  19.218  58.499  1.00 35.44  ? 117  VAL A CG2   1 
ATOM   981  N  N     . THR A 1 118 ? -3.998  22.530  60.873  1.00 33.51  ? 118  THR A N     1 
ATOM   982  C  CA    . THR A 1 118 ? -2.759  22.919  61.565  1.00 37.27  ? 118  THR A CA    1 
ATOM   983  C  C     . THR A 1 118 ? -2.112  21.691  62.231  1.00 41.81  ? 118  THR A C     1 
ATOM   984  O  O     . THR A 1 118 ? -2.777  20.948  62.954  1.00 41.44  ? 118  THR A O     1 
ATOM   985  C  CB    . THR A 1 118 ? -3.030  24.039  62.621  1.00 37.50  ? 118  THR A CB    1 
ATOM   986  O  OG1   . THR A 1 118 ? -3.504  25.219  61.955  1.00 35.71  ? 118  THR A OG1   1 
ATOM   987  C  CG2   . THR A 1 118 ? -1.763  24.384  63.429  1.00 31.95  ? 118  THR A CG2   1 
ATOM   988  N  N     . SER A 1 119 ? -0.819  21.482  61.977  1.00 47.48  ? 119  SER A N     1 
ATOM   989  C  CA    . SER A 1 119 ? -0.100  20.331  62.537  1.00 51.56  ? 119  SER A CA    1 
ATOM   990  C  C     . SER A 1 119 ? 1.360   20.633  62.897  1.00 54.67  ? 119  SER A C     1 
ATOM   991  O  O     . SER A 1 119 ? 2.199   20.787  62.007  1.00 55.25  ? 119  SER A O     1 
ATOM   992  C  CB    . SER A 1 119 ? -0.172  19.131  61.587  1.00 51.39  ? 119  SER A CB    1 
ATOM   993  O  OG    . SER A 1 119 ? 0.707   18.103  62.016  1.00 53.82  ? 119  SER A OG    1 
ATOM   994  N  N     . PRO A 1 120 ? 1.666   20.699  64.209  1.00 58.27  ? 120  PRO A N     1 
ATOM   995  C  CA    . PRO A 1 120 ? 3.031   20.962  64.688  1.00 60.54  ? 120  PRO A CA    1 
ATOM   996  C  C     . PRO A 1 120 ? 3.997   19.783  64.506  1.00 61.49  ? 120  PRO A C     1 
ATOM   997  O  O     . PRO A 1 120 ? 5.187   19.999  64.269  1.00 63.46  ? 120  PRO A O     1 
ATOM   998  C  CB    . PRO A 1 120 ? 2.832   21.261  66.182  1.00 60.48  ? 120  PRO A CB    1 
ATOM   999  C  CG    . PRO A 1 120 ? 1.568   20.550  66.549  1.00 60.27  ? 120  PRO A CG    1 
ATOM   1000 C  CD    . PRO A 1 120 ? 0.701   20.574  65.321  1.00 59.38  ? 120  PRO A CD    1 
ATOM   1001 N  N     . ASP A 1 121 ? 3.490   18.557  64.612  1.00 60.57  ? 121  ASP A N     1 
ATOM   1002 C  CA    . ASP A 1 121 ? 4.342   17.369  64.558  1.00 62.17  ? 121  ASP A CA    1 
ATOM   1003 C  C     . ASP A 1 121 ? 4.449   16.753  63.158  1.00 61.29  ? 121  ASP A C     1 
ATOM   1004 O  O     . ASP A 1 121 ? 4.462   15.530  63.005  1.00 61.23  ? 121  ASP A O     1 
ATOM   1005 C  CB    . ASP A 1 121 ? 3.874   16.324  65.585  1.00 64.43  ? 121  ASP A CB    1 
ATOM   1006 C  CG    . ASP A 1 121 ? 2.377   16.050  65.507  1.00 66.00  ? 121  ASP A CG    1 
ATOM   1007 O  OD1   . ASP A 1 121 ? 1.801   15.591  66.519  1.00 66.14  ? 121  ASP A OD1   1 
ATOM   1008 O  OD2   . ASP A 1 121 ? 1.777   16.296  64.438  1.00 68.38  ? 121  ASP A OD2   1 
ATOM   1009 N  N     . GLY A 1 122 ? 4.529   17.606  62.140  1.00 60.67  ? 122  GLY A N     1 
ATOM   1010 C  CA    . GLY A 1 122 ? 4.728   17.144  60.769  1.00 59.31  ? 122  GLY A CA    1 
ATOM   1011 C  C     . GLY A 1 122 ? 3.441   16.950  59.998  1.00 57.46  ? 122  GLY A C     1 
ATOM   1012 O  O     . GLY A 1 122 ? 2.406   17.514  60.360  1.00 56.85  ? 122  GLY A O     1 
ATOM   1013 N  N     . PHE A 1 123 ? 3.511   16.149  58.936  1.00 55.50  ? 123  PHE A N     1 
ATOM   1014 C  CA    . PHE A 1 123 ? 2.377   15.958  58.027  1.00 54.12  ? 123  PHE A CA    1 
ATOM   1015 C  C     . PHE A 1 123 ? 1.177   15.292  58.704  1.00 51.07  ? 123  PHE A C     1 
ATOM   1016 O  O     . PHE A 1 123 ? 1.333   14.258  59.357  1.00 52.18  ? 123  PHE A O     1 
ATOM   1017 C  CB    . PHE A 1 123 ? 2.790   15.156  56.789  1.00 55.21  ? 123  PHE A CB    1 
ATOM   1018 C  CG    . PHE A 1 123 ? 1.754   15.151  55.703  1.00 56.95  ? 123  PHE A CG    1 
ATOM   1019 C  CD1   . PHE A 1 123 ? 1.698   16.188  54.776  1.00 57.05  ? 123  PHE A CD1   1 
ATOM   1020 C  CD2   . PHE A 1 123 ? 0.823   14.116  55.613  1.00 58.32  ? 123  PHE A CD2   1 
ATOM   1021 C  CE1   . PHE A 1 123 ? 0.730   16.193  53.769  1.00 59.70  ? 123  PHE A CE1   1 
ATOM   1022 C  CE2   . PHE A 1 123 ? -0.144  14.111  54.615  1.00 58.03  ? 123  PHE A CE2   1 
ATOM   1023 C  CZ    . PHE A 1 123 ? -0.191  15.152  53.687  1.00 58.34  ? 123  PHE A CZ    1 
ATOM   1024 N  N     . PRO A 1 124 ? -0.022  15.884  58.538  1.00 47.36  ? 124  PRO A N     1 
ATOM   1025 C  CA    . PRO A 1 124 ? -1.234  15.357  59.159  1.00 47.65  ? 124  PRO A CA    1 
ATOM   1026 C  C     . PRO A 1 124 ? -1.789  14.167  58.379  1.00 48.36  ? 124  PRO A C     1 
ATOM   1027 O  O     . PRO A 1 124 ? -2.475  14.351  57.370  1.00 50.57  ? 124  PRO A O     1 
ATOM   1028 C  CB    . PRO A 1 124 ? -2.201  16.544  59.106  1.00 45.73  ? 124  PRO A CB    1 
ATOM   1029 C  CG    . PRO A 1 124 ? -1.746  17.365  57.950  1.00 44.01  ? 124  PRO A CG    1 
ATOM   1030 C  CD    . PRO A 1 124 ? -0.285  17.098  57.740  1.00 44.94  ? 124  PRO A CD    1 
ATOM   1031 N  N     . GLU A 1 125 ? -1.481  12.959  58.841  1.00 48.92  ? 125  GLU A N     1 
ATOM   1032 C  CA    . GLU A 1 125 ? -1.912  11.739  58.159  1.00 48.20  ? 125  GLU A CA    1 
ATOM   1033 C  C     . GLU A 1 125 ? -3.426  11.576  58.223  1.00 45.66  ? 125  GLU A C     1 
ATOM   1034 O  O     . GLU A 1 125 ? -4.002  11.546  59.313  1.00 44.94  ? 125  GLU A O     1 
ATOM   1035 C  CB    . GLU A 1 125 ? -1.201  10.500  58.723  1.00 50.39  ? 125  GLU A CB    1 
ATOM   1036 C  CG    . GLU A 1 125 ? 0.246   10.318  58.244  1.00 54.27  ? 125  GLU A CG    1 
ATOM   1037 C  CD    . GLU A 1 125 ? 0.359   9.958   56.760  1.00 59.09  ? 125  GLU A CD    1 
ATOM   1038 O  OE1   . GLU A 1 125 ? -0.594  9.377   56.195  1.00 59.58  ? 125  GLU A OE1   1 
ATOM   1039 O  OE2   . GLU A 1 125 ? 1.413   10.250  56.156  1.00 60.17  ? 125  GLU A OE2   1 
ATOM   1040 N  N     . PRO A 1 126 ? -4.076  11.485  57.048  1.00 44.19  ? 126  PRO A N     1 
ATOM   1041 C  CA    . PRO A 1 126 ? -5.529  11.350  56.948  1.00 42.59  ? 126  PRO A CA    1 
ATOM   1042 C  C     . PRO A 1 126 ? -6.077  10.144  57.696  1.00 42.56  ? 126  PRO A C     1 
ATOM   1043 O  O     . PRO A 1 126 ? -7.147  10.245  58.283  1.00 43.71  ? 126  PRO A O     1 
ATOM   1044 C  CB    . PRO A 1 126 ? -5.765  11.189  55.447  1.00 41.46  ? 126  PRO A CB    1 
ATOM   1045 C  CG    . PRO A 1 126 ? -4.618  11.874  54.819  1.00 42.56  ? 126  PRO A CG    1 
ATOM   1046 C  CD    . PRO A 1 126 ? -3.451  11.605  55.717  1.00 44.00  ? 126  PRO A CD    1 
ATOM   1047 N  N     . SER A 1 127 ? -5.354  9.025   57.694  1.00 42.59  ? 127  SER A N     1 
ATOM   1048 C  CA    . SER A 1 127 ? -5.833  7.814   58.376  1.00 44.96  ? 127  SER A CA    1 
ATOM   1049 C  C     . SER A 1 127 ? -5.835  7.959   59.899  1.00 44.75  ? 127  SER A C     1 
ATOM   1050 O  O     . SER A 1 127 ? -6.587  7.272   60.590  1.00 47.08  ? 127  SER A O     1 
ATOM   1051 C  CB    . SER A 1 127 ? -5.042  6.567   57.945  1.00 45.29  ? 127  SER A CB    1 
ATOM   1052 O  OG    . SER A 1 127 ? -3.767  6.530   58.559  1.00 46.95  ? 127  SER A OG    1 
ATOM   1053 N  N     . GLN A 1 128 ? -4.997  8.856   60.412  1.00 45.25  ? 128  GLN A N     1 
ATOM   1054 C  CA    . GLN A 1 128 ? -4.957  9.148   61.842  1.00 46.51  ? 128  GLN A CA    1 
ATOM   1055 C  C     . GLN A 1 128 ? -5.940  10.260  62.221  1.00 44.49  ? 128  GLN A C     1 
ATOM   1056 O  O     . GLN A 1 128 ? -6.684  10.129  63.192  1.00 43.15  ? 128  GLN A O     1 
ATOM   1057 C  CB    . GLN A 1 128 ? -3.532  9.503   62.294  1.00 49.54  ? 128  GLN A CB    1 
ATOM   1058 C  CG    . GLN A 1 128 ? -2.493  8.384   62.104  1.00 56.11  ? 128  GLN A CG    1 
ATOM   1059 C  CD    . GLN A 1 128 ? -2.896  7.068   62.778  1.00 62.47  ? 128  GLN A CD    1 
ATOM   1060 O  OE1   . GLN A 1 128 ? -3.151  6.065   62.104  1.00 61.63  ? 128  GLN A OE1   1 
ATOM   1061 N  NE2   . GLN A 1 128 ? -2.958  7.072   64.112  1.00 62.85  ? 128  GLN A NE2   1 
ATOM   1062 N  N     . ALA A 1 129 ? -5.937  11.338  61.436  1.00 42.50  ? 129  ALA A N     1 
ATOM   1063 C  CA    . ALA A 1 129 ? -6.763  12.537  61.666  1.00 40.74  ? 129  ALA A CA    1 
ATOM   1064 C  C     . ALA A 1 129 ? -6.777  13.028  63.121  1.00 41.03  ? 129  ALA A C     1 
ATOM   1065 O  O     . ALA A 1 129 ? -7.838  13.279  63.698  1.00 40.67  ? 129  ALA A O     1 
ATOM   1066 C  CB    . ALA A 1 129 ? -8.187  12.343  61.117  1.00 37.22  ? 129  ALA A CB    1 
ATOM   1067 N  N     . LYS A 1 130 ? -5.592  13.173  63.705  1.00 41.95  ? 130  LYS A N     1 
ATOM   1068 C  CA    . LYS A 1 130 ? -5.498  13.518  65.124  1.00 43.65  ? 130  LYS A CA    1 
ATOM   1069 C  C     . LYS A 1 130 ? -5.479  15.015  65.396  1.00 42.00  ? 130  LYS A C     1 
ATOM   1070 O  O     . LYS A 1 130 ? -5.407  15.433  66.548  1.00 41.02  ? 130  LYS A O     1 
ATOM   1071 C  CB    . LYS A 1 130 ? -4.316  12.805  65.807  1.00 46.10  ? 130  LYS A CB    1 
ATOM   1072 C  CG    . LYS A 1 130 ? -2.962  12.954  65.129  1.00 52.23  ? 130  LYS A CG    1 
ATOM   1073 C  CD    . LYS A 1 130 ? -1.901  12.108  65.845  1.00 57.01  ? 130  LYS A CD    1 
ATOM   1074 C  CE    . LYS A 1 130 ? -0.486  12.488  65.407  1.00 60.04  ? 130  LYS A CE    1 
ATOM   1075 N  NZ    . LYS A 1 130 ? 0.566   11.714  66.129  1.00 62.10  ? 130  LYS A NZ    1 
ATOM   1076 N  N     . HIS A 1 131 ? -5.564  15.819  64.337  1.00 40.63  ? 131  HIS A N     1 
ATOM   1077 C  CA    . HIS A 1 131 ? -5.573  17.272  64.484  1.00 39.56  ? 131  HIS A CA    1 
ATOM   1078 C  C     . HIS A 1 131 ? -6.877  17.912  63.994  1.00 38.50  ? 131  HIS A C     1 
ATOM   1079 O  O     . HIS A 1 131 ? -7.481  17.449  63.022  1.00 39.29  ? 131  HIS A O     1 
ATOM   1080 C  CB    . HIS A 1 131 ? -4.365  17.894  63.784  1.00 40.42  ? 131  HIS A CB    1 
ATOM   1081 C  CG    . HIS A 1 131 ? -3.056  17.320  64.223  1.00 41.83  ? 131  HIS A CG    1 
ATOM   1082 N  ND1   . HIS A 1 131 ? -2.264  16.559  63.393  1.00 42.23  ? 131  HIS A ND1   1 
ATOM   1083 C  CD2   . HIS A 1 131 ? -2.413  17.372  65.412  1.00 44.91  ? 131  HIS A CD2   1 
ATOM   1084 C  CE1   . HIS A 1 131 ? -1.182  16.179  64.047  1.00 42.89  ? 131  HIS A CE1   1 
ATOM   1085 N  NE2   . HIS A 1 131 ? -1.249  16.656  65.275  1.00 44.47  ? 131  HIS A NE2   1 
ATOM   1086 N  N     . PRO A 1 132 ? -7.323  18.970  64.685  1.00 38.02  ? 132  PRO A N     1 
ATOM   1087 C  CA    . PRO A 1 132 ? -8.552  19.665  64.331  1.00 36.78  ? 132  PRO A CA    1 
ATOM   1088 C  C     . PRO A 1 132 ? -8.558  20.159  62.895  1.00 35.62  ? 132  PRO A C     1 
ATOM   1089 O  O     . PRO A 1 132 ? -7.527  20.597  62.382  1.00 36.47  ? 132  PRO A O     1 
ATOM   1090 C  CB    . PRO A 1 132 ? -8.560  20.862  65.288  1.00 36.76  ? 132  PRO A CB    1 
ATOM   1091 C  CG    . PRO A 1 132 ? -7.826  20.371  66.481  1.00 38.96  ? 132  PRO A CG    1 
ATOM   1092 C  CD    . PRO A 1 132 ? -6.760  19.464  65.960  1.00 38.15  ? 132  PRO A CD    1 
ATOM   1093 N  N     . ILE A 1 133 ? -9.718  20.072  62.253  1.00 34.59  ? 133  ILE A N     1 
ATOM   1094 C  CA    . ILE A 1 133 ? -9.928  20.738  60.979  1.00 33.66  ? 133  ILE A CA    1 
ATOM   1095 C  C     . ILE A 1 133 ? -10.291 22.185  61.294  1.00 33.68  ? 133  ILE A C     1 
ATOM   1096 O  O     . ILE A 1 133 ? -11.291 22.442  61.964  1.00 33.18  ? 133  ILE A O     1 
ATOM   1097 C  CB    . ILE A 1 133 ? -11.046 20.071  60.153  1.00 31.93  ? 133  ILE A CB    1 
ATOM   1098 C  CG1   . ILE A 1 133 ? -10.654 18.631  59.796  1.00 31.83  ? 133  ILE A CG1   1 
ATOM   1099 C  CG2   . ILE A 1 133 ? -11.349 20.906  58.903  1.00 31.97  ? 133  ILE A CG2   1 
ATOM   1100 C  CD1   . ILE A 1 133 ? -11.780 17.788  59.195  1.00 26.20  ? 133  ILE A CD1   1 
ATOM   1101 N  N     . ASP A 1 134 ? -9.481  23.128  60.819  1.00 33.26  ? 134  ASP A N     1 
ATOM   1102 C  CA    . ASP A 1 134 ? -9.686  24.534  61.191  1.00 34.19  ? 134  ASP A CA    1 
ATOM   1103 C  C     . ASP A 1 134 ? -10.175 25.450  60.063  1.00 33.44  ? 134  ASP A C     1 
ATOM   1104 O  O     . ASP A 1 134 ? -10.295 26.656  60.251  1.00 34.94  ? 134  ASP A O     1 
ATOM   1105 C  CB    . ASP A 1 134 ? -8.441  25.106  61.886  1.00 31.15  ? 134  ASP A CB    1 
ATOM   1106 C  CG    . ASP A 1 134 ? -7.160  24.854  61.113  1.00 32.01  ? 134  ASP A CG    1 
ATOM   1107 O  OD1   . ASP A 1 134 ? -7.167  24.965  59.869  1.00 37.68  ? 134  ASP A OD1   1 
ATOM   1108 O  OD2   . ASP A 1 134 ? -6.132  24.561  61.754  1.00 28.81  ? 134  ASP A OD2   1 
ATOM   1109 N  N     . ALA A 1 135 ? -10.446 24.876  58.894  1.00 31.34  ? 135  ALA A N     1 
ATOM   1110 C  CA    . ALA A 1 135 ? -11.010 25.629  57.776  1.00 29.55  ? 135  ALA A CA    1 
ATOM   1111 C  C     . ALA A 1 135 ? -11.499 24.712  56.664  1.00 29.48  ? 135  ALA A C     1 
ATOM   1112 O  O     . ALA A 1 135 ? -10.821 23.760  56.281  1.00 29.18  ? 135  ALA A O     1 
ATOM   1113 C  CB    . ALA A 1 135 ? -10.003 26.634  57.219  1.00 28.50  ? 135  ALA A CB    1 
ATOM   1114 N  N     . ILE A 1 136 ? -12.687 25.007  56.153  1.00 29.03  ? 136  ILE A N     1 
ATOM   1115 C  CA    . ILE A 1 136 ? -13.173 24.363  54.948  1.00 28.20  ? 136  ILE A CA    1 
ATOM   1116 C  C     . ILE A 1 136 ? -13.753 25.443  54.068  1.00 30.30  ? 136  ILE A C     1 
ATOM   1117 O  O     . ILE A 1 136 ? -14.620 26.204  54.512  1.00 30.81  ? 136  ILE A O     1 
ATOM   1118 C  CB    . ILE A 1 136 ? -14.290 23.326  55.231  1.00 27.28  ? 136  ILE A CB    1 
ATOM   1119 C  CG1   . ILE A 1 136 ? -13.812 22.250  56.213  1.00 27.77  ? 136  ILE A CG1   1 
ATOM   1120 C  CG2   . ILE A 1 136 ? -14.793 22.718  53.921  1.00 23.84  ? 136  ILE A CG2   1 
ATOM   1121 C  CD1   . ILE A 1 136 ? -14.916 21.329  56.715  1.00 27.35  ? 136  ILE A CD1   1 
ATOM   1122 N  N     . THR A 1 137 ? -13.255 25.523  52.833  1.00 30.24  ? 137  THR A N     1 
ATOM   1123 C  CA    . THR A 1 137 ? -13.915 26.284  51.784  1.00 27.44  ? 137  THR A CA    1 
ATOM   1124 C  C     . THR A 1 137 ? -14.476 25.275  50.800  1.00 27.76  ? 137  THR A C     1 
ATOM   1125 O  O     . THR A 1 137 ? -13.734 24.462  50.243  1.00 25.46  ? 137  THR A O     1 
ATOM   1126 C  CB    . THR A 1 137 ? -12.960 27.264  51.065  1.00 26.92  ? 137  THR A CB    1 
ATOM   1127 O  OG1   . THR A 1 137 ? -12.463 28.217  52.008  1.00 28.36  ? 137  THR A OG1   1 
ATOM   1128 C  CG2   . THR A 1 137 ? -13.690 28.010  49.939  1.00 25.13  ? 137  THR A CG2   1 
ATOM   1129 N  N     . HIS A 1 138 ? -15.791 25.350  50.606  1.00 26.85  ? 138  HIS A N     1 
ATOM   1130 C  CA    . HIS A 1 138 ? -16.547 24.452  49.750  1.00 27.76  ? 138  HIS A CA    1 
ATOM   1131 C  C     . HIS A 1 138 ? -17.288 25.312  48.724  1.00 28.11  ? 138  HIS A C     1 
ATOM   1132 O  O     . HIS A 1 138 ? -18.208 26.033  49.091  1.00 28.16  ? 138  HIS A O     1 
ATOM   1133 C  CB    . HIS A 1 138 ? -17.533 23.668  50.639  1.00 29.63  ? 138  HIS A CB    1 
ATOM   1134 C  CG    . HIS A 1 138 ? -18.386 22.670  49.913  1.00 29.98  ? 138  HIS A CG    1 
ATOM   1135 N  ND1   . HIS A 1 138 ? -18.275 21.311  50.117  1.00 29.31  ? 138  HIS A ND1   1 
ATOM   1136 C  CD2   . HIS A 1 138 ? -19.389 22.834  49.015  1.00 31.35  ? 138  HIS A CD2   1 
ATOM   1137 C  CE1   . HIS A 1 138 ? -19.158 20.680  49.361  1.00 27.17  ? 138  HIS A CE1   1 
ATOM   1138 N  NE2   . HIS A 1 138 ? -19.854 21.583  48.692  1.00 27.47  ? 138  HIS A NE2   1 
ATOM   1139 N  N     . TYR A 1 139 ? -16.867 25.273  47.454  1.00 27.82  ? 139  TYR A N     1 
ATOM   1140 C  CA    . TYR A 1 139 ? -17.602 25.970  46.394  1.00 26.83  ? 139  TYR A CA    1 
ATOM   1141 C  C     . TYR A 1 139 ? -18.666 25.060  45.787  1.00 29.45  ? 139  TYR A C     1 
ATOM   1142 O  O     . TYR A 1 139 ? -18.395 23.907  45.443  1.00 32.45  ? 139  TYR A O     1 
ATOM   1143 C  CB    . TYR A 1 139 ? -16.671 26.511  45.301  1.00 24.10  ? 139  TYR A CB    1 
ATOM   1144 C  CG    . TYR A 1 139 ? -17.405 27.041  44.075  1.00 25.81  ? 139  TYR A CG    1 
ATOM   1145 C  CD1   . TYR A 1 139 ? -17.655 26.218  42.971  1.00 30.02  ? 139  TYR A CD1   1 
ATOM   1146 C  CD2   . TYR A 1 139 ? -17.847 28.359  44.015  1.00 26.08  ? 139  TYR A CD2   1 
ATOM   1147 C  CE1   . TYR A 1 139 ? -18.324 26.700  41.838  1.00 24.32  ? 139  TYR A CE1   1 
ATOM   1148 C  CE2   . TYR A 1 139 ? -18.510 28.849  42.895  1.00 27.29  ? 139  TYR A CE2   1 
ATOM   1149 C  CZ    . TYR A 1 139 ? -18.754 28.015  41.812  1.00 30.80  ? 139  TYR A CZ    1 
ATOM   1150 O  OH    . TYR A 1 139 ? -19.422 28.509  40.699  1.00 29.63  ? 139  TYR A OH    1 
ATOM   1151 N  N     . ASP A 1 140 ? -19.873 25.597  45.650  1.00 29.71  ? 140  ASP A N     1 
ATOM   1152 C  CA    . ASP A 1 140 ? -20.998 24.879  45.072  1.00 29.56  ? 140  ASP A CA    1 
ATOM   1153 C  C     . ASP A 1 140 ? -21.346 25.511  43.721  1.00 31.66  ? 140  ASP A C     1 
ATOM   1154 O  O     . ASP A 1 140 ? -21.569 26.719  43.643  1.00 30.93  ? 140  ASP A O     1 
ATOM   1155 C  CB    . ASP A 1 140 ? -22.185 24.950  46.033  1.00 28.08  ? 140  ASP A CB    1 
ATOM   1156 C  CG    . ASP A 1 140 ? -23.387 24.200  45.528  1.00 31.85  ? 140  ASP A CG    1 
ATOM   1157 O  OD1   . ASP A 1 140 ? -24.122 24.752  44.675  1.00 32.74  ? 140  ASP A OD1   1 
ATOM   1158 O  OD2   . ASP A 1 140 ? -23.607 23.066  46.002  1.00 34.89  ? 140  ASP A OD2   1 
ATOM   1159 N  N     . SER A 1 141 ? -21.389 24.691  42.669  1.00 31.13  ? 141  SER A N     1 
ATOM   1160 C  CA    . SER A 1 141 ? -21.541 25.183  41.296  1.00 33.27  ? 141  SER A CA    1 
ATOM   1161 C  C     . SER A 1 141 ? -22.952 25.673  40.989  1.00 35.03  ? 141  SER A C     1 
ATOM   1162 O  O     . SER A 1 141 ? -23.142 26.529  40.124  1.00 34.57  ? 141  SER A O     1 
ATOM   1163 C  CB    . SER A 1 141 ? -21.131 24.110  40.280  1.00 33.32  ? 141  SER A CB    1 
ATOM   1164 O  OG    . SER A 1 141 ? -22.079 23.048  40.240  1.00 34.72  ? 141  SER A OG    1 
ATOM   1165 N  N     . ILE A 1 142 ? -23.935 25.119  41.694  1.00 36.09  ? 142  ILE A N     1 
ATOM   1166 C  CA    . ILE A 1 142 ? -25.331 25.507  41.509  1.00 36.46  ? 142  ILE A CA    1 
ATOM   1167 C  C     . ILE A 1 142 ? -25.685 26.841  42.201  1.00 37.99  ? 142  ILE A C     1 
ATOM   1168 O  O     . ILE A 1 142 ? -26.367 27.688  41.614  1.00 38.43  ? 142  ILE A O     1 
ATOM   1169 C  CB    . ILE A 1 142 ? -26.292 24.348  41.896  1.00 37.07  ? 142  ILE A CB    1 
ATOM   1170 C  CG1   . ILE A 1 142 ? -26.218 23.247  40.827  1.00 32.66  ? 142  ILE A CG1   1 
ATOM   1171 C  CG2   . ILE A 1 142 ? -27.752 24.847  42.068  1.00 35.64  ? 142  ILE A CG2   1 
ATOM   1172 C  CD1   . ILE A 1 142 ? -26.988 21.990  41.154  1.00 35.95  ? 142  ILE A CD1   1 
ATOM   1173 N  N     . ASP A 1 143 ? -25.215 27.029  43.433  1.00 37.55  ? 143  ASP A N     1 
ATOM   1174 C  CA    . ASP A 1 143 ? -25.385 28.309  44.135  1.00 38.65  ? 143  ASP A CA    1 
ATOM   1175 C  C     . ASP A 1 143 ? -24.408 29.356  43.625  1.00 38.12  ? 143  ASP A C     1 
ATOM   1176 O  O     . ASP A 1 143 ? -24.671 30.562  43.731  1.00 38.70  ? 143  ASP A O     1 
ATOM   1177 C  CB    . ASP A 1 143 ? -25.163 28.147  45.643  1.00 39.89  ? 143  ASP A CB    1 
ATOM   1178 C  CG    . ASP A 1 143 ? -26.221 27.298  46.307  1.00 40.85  ? 143  ASP A CG    1 
ATOM   1179 O  OD1   . ASP A 1 143 ? -27.298 27.076  45.710  1.00 45.18  ? 143  ASP A OD1   1 
ATOM   1180 O  OD2   . ASP A 1 143 ? -25.968 26.859  47.443  1.00 39.80  ? 143  ASP A OD2   1 
ATOM   1181 N  N     . ASP A 1 144 ? -23.278 28.887  43.085  1.00 37.49  ? 144  ASP A N     1 
ATOM   1182 C  CA    . ASP A 1 144 ? -22.176 29.756  42.650  1.00 35.97  ? 144  ASP A CA    1 
ATOM   1183 C  C     . ASP A 1 144 ? -21.630 30.536  43.845  1.00 34.50  ? 144  ASP A C     1 
ATOM   1184 O  O     . ASP A 1 144 ? -21.425 31.751  43.778  1.00 36.93  ? 144  ASP A O     1 
ATOM   1185 C  CB    . ASP A 1 144 ? -22.637 30.694  41.518  1.00 38.23  ? 144  ASP A CB    1 
ATOM   1186 C  CG    . ASP A 1 144 ? -21.493 31.475  40.886  1.00 39.88  ? 144  ASP A CG    1 
ATOM   1187 O  OD1   . ASP A 1 144 ? -20.328 31.021  40.938  1.00 42.46  ? 144  ASP A OD1   1 
ATOM   1188 O  OD2   . ASP A 1 144 ? -21.775 32.549  40.326  1.00 42.29  ? 144  ASP A OD2   1 
ATOM   1189 N  N     . ARG A 1 145 ? -21.407 29.825  44.945  1.00 32.08  ? 145  ARG A N     1 
ATOM   1190 C  CA    . ARG A 1 145 ? -20.962 30.452  46.188  1.00 33.54  ? 145  ARG A CA    1 
ATOM   1191 C  C     . ARG A 1 145 ? -19.837 29.665  46.834  1.00 32.45  ? 145  ARG A C     1 
ATOM   1192 O  O     . ARG A 1 145 ? -19.783 28.435  46.725  1.00 31.41  ? 145  ARG A O     1 
ATOM   1193 C  CB    . ARG A 1 145 ? -22.120 30.582  47.184  1.00 33.08  ? 145  ARG A CB    1 
ATOM   1194 C  CG    . ARG A 1 145 ? -23.296 31.443  46.704  1.00 36.04  ? 145  ARG A CG    1 
ATOM   1195 C  CD    . ARG A 1 145 ? -22.985 32.930  46.798  1.00 35.59  ? 145  ARG A CD    1 
ATOM   1196 N  NE    . ARG A 1 145 ? -24.111 33.764  46.385  1.00 38.09  ? 145  ARG A NE    1 
ATOM   1197 C  CZ    . ARG A 1 145 ? -24.316 34.210  45.148  1.00 40.94  ? 145  ARG A CZ    1 
ATOM   1198 N  NH1   . ARG A 1 145 ? -23.477 33.908  44.166  1.00 40.71  ? 145  ARG A NH1   1 
ATOM   1199 N  NH2   . ARG A 1 145 ? -25.373 34.968  44.892  1.00 42.81  ? 145  ARG A NH2   1 
ATOM   1200 N  N     . PHE A 1 146 ? -18.942 30.391  47.496  1.00 31.37  ? 146  PHE A N     1 
ATOM   1201 C  CA    . PHE A 1 146 ? -17.860 29.808  48.281  1.00 30.33  ? 146  PHE A CA    1 
ATOM   1202 C  C     . PHE A 1 146 ? -18.306 29.800  49.740  1.00 30.22  ? 146  PHE A C     1 
ATOM   1203 O  O     . PHE A 1 146 ? -18.402 30.854  50.377  1.00 30.27  ? 146  PHE A O     1 
ATOM   1204 C  CB    . PHE A 1 146 ? -16.574 30.640  48.143  1.00 28.83  ? 146  PHE A CB    1 
ATOM   1205 C  CG    . PHE A 1 146 ? -16.003 30.671  46.752  1.00 30.25  ? 146  PHE A CG    1 
ATOM   1206 C  CD1   . PHE A 1 146 ? -16.489 31.570  45.806  1.00 27.85  ? 146  PHE A CD1   1 
ATOM   1207 C  CD2   . PHE A 1 146 ? -14.964 29.809  46.392  1.00 29.47  ? 146  PHE A CD2   1 
ATOM   1208 C  CE1   . PHE A 1 146 ? -15.969 31.600  44.510  1.00 30.29  ? 146  PHE A CE1   1 
ATOM   1209 C  CE2   . PHE A 1 146 ? -14.424 29.834  45.094  1.00 31.24  ? 146  PHE A CE2   1 
ATOM   1210 C  CZ    . PHE A 1 146 ? -14.930 30.724  44.151  1.00 30.32  ? 146  PHE A CZ    1 
ATOM   1211 N  N     . TYR A 1 147 ? -18.600 28.617  50.265  1.00 29.41  ? 147  TYR A N     1 
ATOM   1212 C  CA    . TYR A 1 147 ? -18.977 28.500  51.668  1.00 28.09  ? 147  TYR A CA    1 
ATOM   1213 C  C     . TYR A 1 147 ? -17.731 28.230  52.488  1.00 27.72  ? 147  TYR A C     1 
ATOM   1214 O  O     . TYR A 1 147 ? -17.034 27.237  52.274  1.00 27.34  ? 147  TYR A O     1 
ATOM   1215 C  CB    . TYR A 1 147 ? -20.015 27.401  51.864  1.00 29.13  ? 147  TYR A CB    1 
ATOM   1216 C  CG    . TYR A 1 147 ? -21.325 27.648  51.140  1.00 29.20  ? 147  TYR A CG    1 
ATOM   1217 C  CD1   . TYR A 1 147 ? -21.540 27.168  49.844  1.00 30.34  ? 147  TYR A CD1   1 
ATOM   1218 C  CD2   . TYR A 1 147 ? -22.349 28.344  51.754  1.00 29.67  ? 147  TYR A CD2   1 
ATOM   1219 C  CE1   . TYR A 1 147 ? -22.757 27.386  49.185  1.00 27.16  ? 147  TYR A CE1   1 
ATOM   1220 C  CE2   . TYR A 1 147 ? -23.566 28.563  51.111  1.00 31.71  ? 147  TYR A CE2   1 
ATOM   1221 C  CZ    . TYR A 1 147 ? -23.760 28.091  49.831  1.00 31.00  ? 147  TYR A CZ    1 
ATOM   1222 O  OH    . TYR A 1 147 ? -24.971 28.322  49.219  1.00 30.52  ? 147  TYR A OH    1 
ATOM   1223 N  N     . VAL A 1 148 ? -17.452 29.137  53.417  1.00 29.41  ? 148  VAL A N     1 
ATOM   1224 C  CA    . VAL A 1 148 ? -16.232 29.117  54.211  1.00 28.64  ? 148  VAL A CA    1 
ATOM   1225 C  C     . VAL A 1 148 ? -16.598 28.749  55.652  1.00 31.98  ? 148  VAL A C     1 
ATOM   1226 O  O     . VAL A 1 148 ? -17.414 29.425  56.289  1.00 31.92  ? 148  VAL A O     1 
ATOM   1227 C  CB    . VAL A 1 148 ? -15.507 30.499  54.158  1.00 29.53  ? 148  VAL A CB    1 
ATOM   1228 C  CG1   . VAL A 1 148 ? -14.118 30.431  54.790  1.00 27.82  ? 148  VAL A CG1   1 
ATOM   1229 C  CG2   . VAL A 1 148 ? -15.402 31.006  52.712  1.00 30.37  ? 148  VAL A CG2   1 
ATOM   1230 N  N     . PHE A 1 149 ? -16.014 27.661  56.147  1.00 30.71  ? 149  PHE A N     1 
ATOM   1231 C  CA    . PHE A 1 149 ? -16.224 27.218  57.516  1.00 31.98  ? 149  PHE A CA    1 
ATOM   1232 C  C     . PHE A 1 149 ? -14.919 27.454  58.250  1.00 32.65  ? 149  PHE A C     1 
ATOM   1233 O  O     . PHE A 1 149 ? -13.913 26.816  57.959  1.00 35.56  ? 149  PHE A O     1 
ATOM   1234 C  CB    . PHE A 1 149 ? -16.619 25.732  57.561  1.00 31.93  ? 149  PHE A CB    1 
ATOM   1235 C  CG    . PHE A 1 149 ? -17.886 25.405  56.800  1.00 31.92  ? 149  PHE A CG    1 
ATOM   1236 C  CD1   . PHE A 1 149 ? -17.909 25.416  55.406  1.00 33.74  ? 149  PHE A CD1   1 
ATOM   1237 C  CD2   . PHE A 1 149 ? -19.052 25.069  57.479  1.00 33.14  ? 149  PHE A CD2   1 
ATOM   1238 C  CE1   . PHE A 1 149 ? -19.076 25.108  54.706  1.00 32.95  ? 149  PHE A CE1   1 
ATOM   1239 C  CE2   . PHE A 1 149 ? -20.225 24.760  56.785  1.00 28.87  ? 149  PHE A CE2   1 
ATOM   1240 C  CZ    . PHE A 1 149 ? -20.232 24.779  55.398  1.00 32.74  ? 149  PHE A CZ    1 
ATOM   1241 N  N     . ASP A 1 150 ? -14.939 28.385  59.194  1.00 33.41  ? 150  ASP A N     1 
ATOM   1242 C  CA    . ASP A 1 150 ? -13.726 28.844  59.851  1.00 33.69  ? 150  ASP A CA    1 
ATOM   1243 C  C     . ASP A 1 150 ? -13.777 28.560  61.351  1.00 32.92  ? 150  ASP A C     1 
ATOM   1244 O  O     . ASP A 1 150 ? -14.730 28.955  62.021  1.00 30.91  ? 150  ASP A O     1 
ATOM   1245 C  CB    . ASP A 1 150 ? -13.548 30.349  59.597  1.00 33.52  ? 150  ASP A CB    1 
ATOM   1246 C  CG    . ASP A 1 150 ? -12.283 30.913  60.230  1.00 38.24  ? 150  ASP A CG    1 
ATOM   1247 O  OD1   . ASP A 1 150 ? -11.411 30.131  60.686  1.00 36.55  ? 150  ASP A OD1   1 
ATOM   1248 O  OD2   . ASP A 1 150 ? -12.161 32.157  60.256  1.00 38.87  ? 150  ASP A OD2   1 
ATOM   1249 N  N     . LEU A 1 151 ? -12.747 27.883  61.865  1.00 31.37  ? 151  LEU A N     1 
ATOM   1250 C  CA    . LEU A 1 151 ? -12.669 27.557  63.286  1.00 31.33  ? 151  LEU A CA    1 
ATOM   1251 C  C     . LEU A 1 151 ? -11.907 28.645  64.036  1.00 34.27  ? 151  LEU A C     1 
ATOM   1252 O  O     . LEU A 1 151 ? -10.755 28.956  63.708  1.00 34.92  ? 151  LEU A O     1 
ATOM   1253 C  CB    . LEU A 1 151 ? -12.006 26.192  63.495  1.00 29.55  ? 151  LEU A CB    1 
ATOM   1254 C  CG    . LEU A 1 151 ? -11.841 25.656  64.923  1.00 29.35  ? 151  LEU A CG    1 
ATOM   1255 C  CD1   . LEU A 1 151 ? -13.194 25.491  65.606  1.00 26.12  ? 151  LEU A CD1   1 
ATOM   1256 C  CD2   . LEU A 1 151 ? -11.082 24.334  64.948  1.00 32.65  ? 151  LEU A CD2   1 
ATOM   1257 N  N     . LEU A 1 152 ? -12.546 29.220  65.047  1.00 37.68  ? 152  LEU A N     1 
ATOM   1258 C  CA    . LEU A 1 152 ? -11.934 30.336  65.795  1.00 39.42  ? 152  LEU A CA    1 
ATOM   1259 C  C     . LEU A 1 152 ? -11.189 29.878  67.028  1.00 37.52  ? 152  LEU A C     1 
ATOM   1260 O  O     . LEU A 1 152 ? -10.261 30.553  67.474  1.00 39.05  ? 152  LEU A O     1 
ATOM   1261 C  CB    . LEU A 1 152 ? -12.967 31.412  66.177  1.00 37.81  ? 152  LEU A CB    1 
ATOM   1262 C  CG    . LEU A 1 152 ? -13.719 32.138  65.055  1.00 39.99  ? 152  LEU A CG    1 
ATOM   1263 C  CD1   . LEU A 1 152 ? -14.402 33.371  65.638  1.00 42.61  ? 152  LEU A CD1   1 
ATOM   1264 C  CD2   . LEU A 1 152 ? -12.814 32.535  63.880  1.00 36.53  ? 152  LEU A CD2   1 
ATOM   1265 N  N     . ASN A 1 153 ? -11.604 28.743  67.578  1.00 36.93  ? 153  ASN A N     1 
ATOM   1266 C  CA    . ASN A 1 153 ? -10.992 28.209  68.793  1.00 41.12  ? 153  ASN A CA    1 
ATOM   1267 C  C     . ASN A 1 153 ? -10.505 26.783  68.611  1.00 42.38  ? 153  ASN A C     1 
ATOM   1268 O  O     . ASN A 1 153 ? -11.272 25.897  68.211  1.00 41.19  ? 153  ASN A O     1 
ATOM   1269 C  CB    . ASN A 1 153 ? -11.957 28.286  69.980  1.00 43.15  ? 153  ASN A CB    1 
ATOM   1270 C  CG    . ASN A 1 153 ? -12.418 29.707  70.279  1.00 47.08  ? 153  ASN A CG    1 
ATOM   1271 O  OD1   . ASN A 1 153 ? -11.707 30.682  70.022  1.00 50.66  ? 153  ASN A OD1   1 
ATOM   1272 N  ND2   . ASN A 1 153 ? -13.618 29.825  70.830  1.00 51.77  ? 153  ASN A ND2   1 
ATOM   1273 N  N     . SER A 1 154 ? -9.227  26.573  68.926  1.00 44.29  ? 154  SER A N     1 
ATOM   1274 C  CA    . SER A 1 154 ? -8.542  25.301  68.707  1.00 43.22  ? 154  SER A CA    1 
ATOM   1275 C  C     . SER A 1 154 ? -7.470  25.113  69.775  1.00 43.33  ? 154  SER A C     1 
ATOM   1276 O  O     . SER A 1 154 ? -6.978  26.098  70.312  1.00 45.88  ? 154  SER A O     1 
ATOM   1277 C  CB    . SER A 1 154 ? -7.898  25.315  67.318  1.00 42.34  ? 154  SER A CB    1 
ATOM   1278 O  OG    . SER A 1 154 ? -6.874  24.343  67.207  1.00 45.63  ? 154  SER A OG    1 
ATOM   1279 N  N     . PRO A 1 155 ? -7.098  23.853  70.086  1.00 43.59  ? 155  PRO A N     1 
ATOM   1280 C  CA    . PRO A 1 155 ? -5.949  23.621  70.968  1.00 44.47  ? 155  PRO A CA    1 
ATOM   1281 C  C     . PRO A 1 155 ? -4.639  24.227  70.443  1.00 45.61  ? 155  PRO A C     1 
ATOM   1282 O  O     . PRO A 1 155 ? -3.681  24.366  71.207  1.00 45.78  ? 155  PRO A O     1 
ATOM   1283 C  CB    . PRO A 1 155 ? -5.844  22.089  71.029  1.00 43.18  ? 155  PRO A CB    1 
ATOM   1284 C  CG    . PRO A 1 155 ? -6.685  21.587  69.888  1.00 44.08  ? 155  PRO A CG    1 
ATOM   1285 C  CD    . PRO A 1 155 ? -7.778  22.589  69.743  1.00 43.42  ? 155  PRO A CD    1 
ATOM   1286 N  N     . TYR A 1 156 ? -4.605  24.600  69.163  1.00 45.69  ? 156  TYR A N     1 
ATOM   1287 C  CA    . TYR A 1 156 ? -3.405  25.197  68.574  1.00 46.48  ? 156  TYR A CA    1 
ATOM   1288 C  C     . TYR A 1 156 ? -3.479  26.723  68.443  1.00 46.84  ? 156  TYR A C     1 
ATOM   1289 O  O     . TYR A 1 156 ? -2.549  27.354  67.931  1.00 46.86  ? 156  TYR A O     1 
ATOM   1290 C  CB    . TYR A 1 156 ? -3.040  24.513  67.246  1.00 46.46  ? 156  TYR A CB    1 
ATOM   1291 C  CG    . TYR A 1 156 ? -2.813  23.022  67.399  1.00 49.18  ? 156  TYR A CG    1 
ATOM   1292 C  CD1   . TYR A 1 156 ? -2.083  22.515  68.480  1.00 53.24  ? 156  TYR A CD1   1 
ATOM   1293 C  CD2   . TYR A 1 156 ? -3.329  22.117  66.474  1.00 48.42  ? 156  TYR A CD2   1 
ATOM   1294 C  CE1   . TYR A 1 156 ? -1.880  21.147  68.637  1.00 53.84  ? 156  TYR A CE1   1 
ATOM   1295 C  CE2   . TYR A 1 156 ? -3.125  20.745  66.619  1.00 49.37  ? 156  TYR A CE2   1 
ATOM   1296 C  CZ    . TYR A 1 156 ? -2.402  20.270  67.701  1.00 53.32  ? 156  TYR A CZ    1 
ATOM   1297 O  OH    . TYR A 1 156 ? -2.196  18.918  67.854  1.00 56.25  ? 156  TYR A OH    1 
ATOM   1298 N  N     . GLY A 1 157 ? -4.578  27.304  68.923  1.00 46.02  ? 157  GLY A N     1 
ATOM   1299 C  CA    . GLY A 1 157 ? -4.702  28.756  69.031  1.00 45.53  ? 157  GLY A CA    1 
ATOM   1300 C  C     . GLY A 1 157 ? -6.119  29.276  68.868  1.00 45.45  ? 157  GLY A C     1 
ATOM   1301 O  O     . GLY A 1 157 ? -6.902  28.728  68.087  1.00 45.01  ? 157  GLY A O     1 
ATOM   1302 N  N     . ASN A 1 158 ? -6.446  30.327  69.621  1.00 43.54  ? 158  ASN A N     1 
ATOM   1303 C  CA    . ASN A 1 158 ? -7.711  31.041  69.474  1.00 44.18  ? 158  ASN A CA    1 
ATOM   1304 C  C     . ASN A 1 158 ? -7.502  32.304  68.632  1.00 44.67  ? 158  ASN A C     1 
ATOM   1305 O  O     . ASN A 1 158 ? -6.582  33.088  68.890  1.00 44.26  ? 158  ASN A O     1 
ATOM   1306 C  CB    . ASN A 1 158 ? -8.311  31.402  70.840  1.00 46.39  ? 158  ASN A CB    1 
ATOM   1307 C  CG    . ASN A 1 158 ? -8.597  30.179  71.709  1.00 48.70  ? 158  ASN A CG    1 
ATOM   1308 O  OD1   . ASN A 1 158 ? -8.887  29.088  71.216  1.00 50.95  ? 158  ASN A OD1   1 
ATOM   1309 N  ND2   . ASN A 1 158 ? -8.520  30.366  73.014  1.00 52.58  ? 158  ASN A ND2   1 
ATOM   1310 N  N     . VAL A 1 159 ? -8.349  32.487  67.622  1.00 43.41  ? 159  VAL A N     1 
ATOM   1311 C  CA    . VAL A 1 159 ? -8.164  33.561  66.648  1.00 44.35  ? 159  VAL A CA    1 
ATOM   1312 C  C     . VAL A 1 159 ? -9.397  34.449  66.500  1.00 45.34  ? 159  VAL A C     1 
ATOM   1313 O  O     . VAL A 1 159 ? -10.487 34.093  66.949  1.00 46.77  ? 159  VAL A O     1 
ATOM   1314 C  CB    . VAL A 1 159 ? -7.751  33.004  65.254  1.00 44.11  ? 159  VAL A CB    1 
ATOM   1315 C  CG1   . VAL A 1 159 ? -6.375  32.345  65.319  1.00 42.84  ? 159  VAL A CG1   1 
ATOM   1316 C  CG2   . VAL A 1 159 ? -8.791  32.036  64.715  1.00 41.17  ? 159  VAL A CG2   1 
ATOM   1317 N  N     . GLU A 1 160 ? -9.207  35.608  65.874  1.00 46.29  ? 160  GLU A N     1 
ATOM   1318 C  CA    . GLU A 1 160 ? -10.300 36.521  65.542  1.00 45.43  ? 160  GLU A CA    1 
ATOM   1319 C  C     . GLU A 1 160 ? -10.958 36.133  64.211  1.00 42.09  ? 160  GLU A C     1 
ATOM   1320 O  O     . GLU A 1 160 ? -10.377 35.389  63.424  1.00 39.19  ? 160  GLU A O     1 
ATOM   1321 C  CB    . GLU A 1 160 ? -9.788  37.968  65.495  1.00 46.79  ? 160  GLU A CB    1 
ATOM   1322 C  CG    . GLU A 1 160 ? -9.339  38.527  66.859  1.00 56.16  ? 160  GLU A CG    1 
ATOM   1323 C  CD    . GLU A 1 160 ? -10.466 38.560  67.889  1.00 62.63  ? 160  GLU A CD    1 
ATOM   1324 O  OE1   . GLU A 1 160 ? -11.544 39.112  67.576  1.00 66.10  ? 160  GLU A OE1   1 
ATOM   1325 O  OE2   . GLU A 1 160 ? -10.278 38.036  69.011  1.00 65.04  ? 160  GLU A OE2   1 
ATOM   1326 N  N     . GLU A 1 161 ? -12.165 36.643  63.966  1.00 41.73  ? 161  GLU A N     1 
ATOM   1327 C  CA    . GLU A 1 161 ? -12.878 36.387  62.714  1.00 42.27  ? 161  GLU A CA    1 
ATOM   1328 C  C     . GLU A 1 161 ? -12.116 36.927  61.517  1.00 41.41  ? 161  GLU A C     1 
ATOM   1329 O  O     . GLU A 1 161 ? -11.414 37.931  61.614  1.00 41.48  ? 161  GLU A O     1 
ATOM   1330 C  CB    . GLU A 1 161 ? -14.277 37.007  62.738  1.00 43.17  ? 161  GLU A CB    1 
ATOM   1331 C  CG    . GLU A 1 161 ? -15.334 36.151  63.418  1.00 41.68  ? 161  GLU A CG    1 
ATOM   1332 C  CD    . GLU A 1 161 ? -16.734 36.753  63.367  1.00 44.44  ? 161  GLU A CD    1 
ATOM   1333 O  OE1   . GLU A 1 161 ? -17.092 37.423  62.372  1.00 43.69  ? 161  GLU A OE1   1 
ATOM   1334 O  OE2   . GLU A 1 161 ? -17.494 36.535  64.332  1.00 51.11  ? 161  GLU A OE2   1 
ATOM   1335 N  N     . TRP A 1 162 ? -12.259 36.234  60.396  1.00 41.14  ? 162  TRP A N     1 
ATOM   1336 C  CA    . TRP A 1 162 ? -11.703 36.663  59.117  1.00 40.16  ? 162  TRP A CA    1 
ATOM   1337 C  C     . TRP A 1 162 ? -12.437 37.904  58.628  1.00 39.79  ? 162  TRP A C     1 
ATOM   1338 O  O     . TRP A 1 162 ? -13.634 38.061  58.858  1.00 38.20  ? 162  TRP A O     1 
ATOM   1339 C  CB    . TRP A 1 162 ? -11.832 35.514  58.123  1.00 39.35  ? 162  TRP A CB    1 
ATOM   1340 C  CG    . TRP A 1 162 ? -11.545 35.814  56.688  1.00 37.12  ? 162  TRP A CG    1 
ATOM   1341 C  CD1   . TRP A 1 162 ? -10.320 35.870  56.090  1.00 37.38  ? 162  TRP A CD1   1 
ATOM   1342 C  CD2   . TRP A 1 162 ? -12.509 36.042  55.656  1.00 34.35  ? 162  TRP A CD2   1 
ATOM   1343 N  NE1   . TRP A 1 162 ? -10.461 36.126  54.746  1.00 37.16  ? 162  TRP A NE1   1 
ATOM   1344 C  CE2   . TRP A 1 162 ? -11.796 36.244  54.455  1.00 35.34  ? 162  TRP A CE2   1 
ATOM   1345 C  CE3   . TRP A 1 162 ? -13.909 36.108  55.632  1.00 33.40  ? 162  TRP A CE3   1 
ATOM   1346 C  CZ2   . TRP A 1 162 ? -12.435 36.508  53.237  1.00 34.27  ? 162  TRP A CZ2   1 
ATOM   1347 C  CZ3   . TRP A 1 162 ? -14.546 36.361  54.424  1.00 34.81  ? 162  TRP A CZ3   1 
ATOM   1348 C  CH2   . TRP A 1 162 ? -13.806 36.559  53.240  1.00 35.98  ? 162  TRP A CH2   1 
ATOM   1349 N  N     . SER A 1 163 ? -11.704 38.794  57.973  1.00 40.84  ? 163  SER A N     1 
ATOM   1350 C  CA    . SER A 1 163 ? -12.274 40.048  57.503  1.00 41.95  ? 163  SER A CA    1 
ATOM   1351 C  C     . SER A 1 163 ? -12.263 40.107  55.990  1.00 41.96  ? 163  SER A C     1 
ATOM   1352 O  O     . SER A 1 163 ? -11.197 40.159  55.366  1.00 43.31  ? 163  SER A O     1 
ATOM   1353 C  CB    . SER A 1 163 ? -11.525 41.241  58.090  1.00 40.78  ? 163  SER A CB    1 
ATOM   1354 O  OG    . SER A 1 163 ? -11.802 42.412  57.344  1.00 45.98  ? 163  SER A OG    1 
ATOM   1355 N  N     . ILE A 1 164 ? -13.461 40.097  55.417  1.00 41.97  ? 164  ILE A N     1 
ATOM   1356 C  CA    . ILE A 1 164 ? -13.660 40.173  53.971  1.00 41.44  ? 164  ILE A CA    1 
ATOM   1357 C  C     . ILE A 1 164 ? -13.145 41.501  53.405  1.00 43.46  ? 164  ILE A C     1 
ATOM   1358 O  O     . ILE A 1 164 ? -12.683 41.557  52.260  1.00 45.52  ? 164  ILE A O     1 
ATOM   1359 C  CB    . ILE A 1 164 ? -15.161 39.919  53.588  1.00 40.77  ? 164  ILE A CB    1 
ATOM   1360 C  CG1   . ILE A 1 164 ? -15.342 39.786  52.066  1.00 40.33  ? 164  ILE A CG1   1 
ATOM   1361 C  CG2   . ILE A 1 164 ? -16.089 41.002  54.183  1.00 41.17  ? 164  ILE A CG2   1 
ATOM   1362 C  CD1   . ILE A 1 164 ? -16.635 39.061  51.642  1.00 36.06  ? 164  ILE A CD1   1 
ATOM   1363 N  N     . GLU A 1 165 ? -13.205 42.562  54.211  1.00 43.83  ? 165  GLU A N     1 
ATOM   1364 C  CA    . GLU A 1 165 ? -12.740 43.880  53.776  1.00 43.00  ? 165  GLU A CA    1 
ATOM   1365 C  C     . GLU A 1 165 ? -11.236 43.860  53.570  1.00 39.53  ? 165  GLU A C     1 
ATOM   1366 O  O     . GLU A 1 165 ? -10.738 44.395  52.580  1.00 39.95  ? 165  GLU A O     1 
ATOM   1367 C  CB    . GLU A 1 165 ? -13.119 44.988  54.778  1.00 47.45  ? 165  GLU A CB    1 
ATOM   1368 C  CG    . GLU A 1 165 ? -14.621 45.149  55.044  1.00 54.25  ? 165  GLU A CG    1 
ATOM   1369 C  CD    . GLU A 1 165 ? -15.157 44.151  56.073  1.00 59.92  ? 165  GLU A CD    1 
ATOM   1370 O  OE1   . GLU A 1 165 ? -14.379 43.295  56.557  1.00 59.98  ? 165  GLU A OE1   1 
ATOM   1371 O  OE2   . GLU A 1 165 ? -16.365 44.220  56.399  1.00 63.35  ? 165  GLU A OE2   1 
ATOM   1372 N  N     . ILE A 1 166 ? -10.515 43.250  54.507  1.00 38.84  ? 166  ILE A N     1 
ATOM   1373 C  CA    . ILE A 1 166 ? -9.055  43.157  54.404  1.00 37.74  ? 166  ILE A CA    1 
ATOM   1374 C  C     . ILE A 1 166 ? -8.660  42.186  53.296  1.00 35.29  ? 166  ILE A C     1 
ATOM   1375 O  O     . ILE A 1 166 ? -7.702  42.427  52.576  1.00 36.22  ? 166  ILE A O     1 
ATOM   1376 C  CB    . ILE A 1 166 ? -8.380  42.760  55.750  1.00 37.73  ? 166  ILE A CB    1 
ATOM   1377 C  CG1   . ILE A 1 166 ? -8.625  43.836  56.812  1.00 37.50  ? 166  ILE A CG1   1 
ATOM   1378 C  CG2   . ILE A 1 166 ? -6.872  42.546  55.563  1.00 36.71  ? 166  ILE A CG2   1 
ATOM   1379 C  CD1   . ILE A 1 166 ? -8.108  43.482  58.208  1.00 37.93  ? 166  ILE A CD1   1 
ATOM   1380 N  N     . ALA A 1 167 ? -9.421  41.105  53.163  1.00 34.32  ? 167  ALA A N     1 
ATOM   1381 C  CA    . ALA A 1 167 ? -9.186  40.090  52.146  1.00 35.02  ? 167  ALA A CA    1 
ATOM   1382 C  C     . ALA A 1 167 ? -9.315  40.647  50.725  1.00 37.31  ? 167  ALA A C     1 
ATOM   1383 O  O     . ALA A 1 167 ? -8.594  40.215  49.819  1.00 36.42  ? 167  ALA A O     1 
ATOM   1384 C  CB    . ALA A 1 167 ? -10.137 38.916  52.346  1.00 32.61  ? 167  ALA A CB    1 
ATOM   1385 N  N     . ALA A 1 168 ? -10.231 41.598  50.538  1.00 39.08  ? 168  ALA A N     1 
ATOM   1386 C  CA    . ALA A 1 168 ? -10.418 42.245  49.238  1.00 41.91  ? 168  ALA A CA    1 
ATOM   1387 C  C     . ALA A 1 168 ? -9.282  43.198  48.880  1.00 44.06  ? 168  ALA A C     1 
ATOM   1388 O  O     . ALA A 1 168 ? -9.014  43.416  47.698  1.00 45.22  ? 168  ALA A O     1 
ATOM   1389 C  CB    . ALA A 1 168 ? -11.749 42.979  49.185  1.00 42.94  ? 168  ALA A CB    1 
ATOM   1390 N  N     . LYS A 1 169 ? -8.620  43.759  49.893  1.00 45.23  ? 169  LYS A N     1 
ATOM   1391 C  CA    . LYS A 1 169 ? -7.587  44.784  49.671  1.00 46.02  ? 169  LYS A CA    1 
ATOM   1392 C  C     . LYS A 1 169 ? -6.338  44.227  48.992  1.00 45.58  ? 169  LYS A C     1 
ATOM   1393 O  O     . LYS A 1 169 ? -6.019  43.042  49.132  1.00 44.90  ? 169  LYS A O     1 
ATOM   1394 C  CB    . LYS A 1 169 ? -7.194  45.471  50.985  1.00 45.82  ? 169  LYS A CB    1 
ATOM   1395 C  CG    . LYS A 1 169 ? -8.272  46.333  51.610  1.00 48.53  ? 169  LYS A CG    1 
ATOM   1396 C  CD    . LYS A 1 169 ? -7.682  47.243  52.685  1.00 54.46  ? 169  LYS A CD    1 
ATOM   1397 C  CE    . LYS A 1 169 ? -8.765  47.899  53.545  1.00 59.37  ? 169  LYS A CE    1 
ATOM   1398 N  NZ    . LYS A 1 169 ? -9.700  48.752  52.751  1.00 59.25  ? 169  LYS A NZ    1 
ATOM   1399 N  N     . LEU A 1 170 ? -5.629  45.097  48.272  1.00 46.36  ? 170  LEU A N     1 
ATOM   1400 C  CA    . LEU A 1 170 ? -4.366  44.732  47.621  1.00 46.69  ? 170  LEU A CA    1 
ATOM   1401 C  C     . LEU A 1 170 ? -3.324  44.329  48.654  1.00 46.34  ? 170  LEU A C     1 
ATOM   1402 O  O     . LEU A 1 170 ? -3.360  44.799  49.792  1.00 47.27  ? 170  LEU A O     1 
ATOM   1403 C  CB    . LEU A 1 170 ? -3.821  45.912  46.820  1.00 48.02  ? 170  LEU A CB    1 
ATOM   1404 C  CG    . LEU A 1 170 ? -4.756  46.736  45.930  1.00 51.67  ? 170  LEU A CG    1 
ATOM   1405 C  CD1   . LEU A 1 170 ? -4.036  48.005  45.472  1.00 55.44  ? 170  LEU A CD1   1 
ATOM   1406 C  CD2   . LEU A 1 170 ? -5.256  45.931  44.737  1.00 49.61  ? 170  LEU A CD2   1 
ATOM   1407 N  N     . GLN A 1 171 ? -2.387  43.476  48.259  1.00 46.29  ? 171  GLN A N     1 
ATOM   1408 C  CA    . GLN A 1 171 ? -1.307  43.076  49.159  1.00 49.22  ? 171  GLN A CA    1 
ATOM   1409 C  C     . GLN A 1 171 ? -0.477  44.275  49.642  1.00 49.45  ? 171  GLN A C     1 
ATOM   1410 O  O     . GLN A 1 171 ? 0.107   44.242  50.722  1.00 48.68  ? 171  GLN A O     1 
ATOM   1411 C  CB    . GLN A 1 171 ? -0.424  41.994  48.524  1.00 51.36  ? 171  GLN A CB    1 
ATOM   1412 C  CG    . GLN A 1 171 ? -1.167  40.672  48.290  1.00 58.00  ? 171  GLN A CG    1 
ATOM   1413 C  CD    . GLN A 1 171 ? -0.280  39.434  48.377  1.00 65.14  ? 171  GLN A CD    1 
ATOM   1414 O  OE1   . GLN A 1 171 ? 0.948   39.514  48.272  1.00 68.44  ? 171  GLN A OE1   1 
ATOM   1415 N  NE2   . GLN A 1 171 ? -0.911  38.274  48.570  1.00 65.56  ? 171  GLN A NE2   1 
ATOM   1416 N  N     . GLU A 1 172 ? -0.479  45.343  48.847  1.00 49.32  ? 172  GLU A N     1 
ATOM   1417 C  CA    . GLU A 1 172 ? 0.266   46.559  49.134  1.00 49.24  ? 172  GLU A CA    1 
ATOM   1418 C  C     . GLU A 1 172 ? -0.472  47.434  50.145  1.00 50.59  ? 172  GLU A C     1 
ATOM   1419 O  O     . GLU A 1 172 ? 0.099   48.375  50.711  1.00 50.01  ? 172  GLU A O     1 
ATOM   1420 C  CB    . GLU A 1 172 ? 0.521   47.330  47.833  1.00 51.45  ? 172  GLU A CB    1 
ATOM   1421 C  CG    . GLU A 1 172 ? 1.434   46.606  46.830  1.00 54.17  ? 172  GLU A CG    1 
ATOM   1422 C  CD    . GLU A 1 172 ? 0.710   45.587  45.944  1.00 59.39  ? 172  GLU A CD    1 
ATOM   1423 O  OE1   . GLU A 1 172 ? 1.391   44.871  45.171  1.00 58.93  ? 172  GLU A OE1   1 
ATOM   1424 O  OE2   . GLU A 1 172 ? -0.534  45.501  46.014  1.00 60.71  ? 172  GLU A OE2   1 
ATOM   1425 N  N     . GLN A 1 173 ? -1.748  47.124  50.364  1.00 49.92  ? 173  GLN A N     1 
ATOM   1426 C  CA    . GLN A 1 173 ? -2.538  47.785  51.397  1.00 49.14  ? 173  GLN A CA    1 
ATOM   1427 C  C     . GLN A 1 173 ? -2.590  46.913  52.638  1.00 47.02  ? 173  GLN A C     1 
ATOM   1428 O  O     . GLN A 1 173 ? -3.259  47.256  53.617  1.00 47.86  ? 173  GLN A O     1 
ATOM   1429 C  CB    . GLN A 1 173 ? -3.963  48.043  50.913  1.00 50.93  ? 173  GLN A CB    1 
ATOM   1430 C  CG    . GLN A 1 173 ? -4.124  49.187  49.949  1.00 53.00  ? 173  GLN A CG    1 
ATOM   1431 C  CD    . GLN A 1 173 ? -5.560  49.341  49.514  1.00 57.27  ? 173  GLN A CD    1 
ATOM   1432 O  OE1   . GLN A 1 173 ? -6.020  48.650  48.600  1.00 58.49  ? 173  GLN A OE1   1 
ATOM   1433 N  NE2   . GLN A 1 173 ? -6.289  50.243  50.175  1.00 57.17  ? 173  GLN A NE2   1 
ATOM   1434 N  N     . GLY A 1 174 ? -1.882  45.788  52.589  1.00 43.87  ? 174  GLY A N     1 
ATOM   1435 C  CA    . GLY A 1 174 ? -1.847  44.848  53.703  1.00 42.30  ? 174  GLY A CA    1 
ATOM   1436 C  C     . GLY A 1 174 ? -2.887  43.755  53.571  1.00 41.37  ? 174  GLY A C     1 
ATOM   1437 O  O     . GLY A 1 174 ? -3.011  42.900  54.449  1.00 39.46  ? 174  GLY A O     1 
ATOM   1438 N  N     . GLY A 1 175 ? -3.634  43.789  52.468  1.00 40.64  ? 175  GLY A N     1 
ATOM   1439 C  CA    . GLY A 1 175 ? -4.703  42.828  52.221  1.00 39.83  ? 175  GLY A CA    1 
ATOM   1440 C  C     . GLY A 1 175 ? -4.222  41.534  51.598  1.00 38.93  ? 175  GLY A C     1 
ATOM   1441 O  O     . GLY A 1 175 ? -3.021  41.326  51.426  1.00 36.76  ? 175  GLY A O     1 
ATOM   1442 N  N     . ASP A 1 176 ? -5.171  40.671  51.244  1.00 40.41  ? 176  ASP A N     1 
ATOM   1443 C  CA    . ASP A 1 176 ? -4.862  39.323  50.751  1.00 41.40  ? 176  ASP A CA    1 
ATOM   1444 C  C     . ASP A 1 176 ? -5.092  39.165  49.251  1.00 43.39  ? 176  ASP A C     1 
ATOM   1445 O  O     . ASP A 1 176 ? -4.798  38.110  48.681  1.00 43.84  ? 176  ASP A O     1 
ATOM   1446 C  CB    . ASP A 1 176 ? -5.682  38.284  51.514  1.00 39.99  ? 176  ASP A CB    1 
ATOM   1447 C  CG    . ASP A 1 176 ? -5.496  38.384  53.027  1.00 40.16  ? 176  ASP A CG    1 
ATOM   1448 O  OD1   . ASP A 1 176 ? -4.347  38.574  53.477  1.00 37.68  ? 176  ASP A OD1   1 
ATOM   1449 O  OD2   . ASP A 1 176 ? -6.503  38.270  53.761  1.00 39.45  ? 176  ASP A OD2   1 
ATOM   1450 N  N     . GLU A 1 177 ? -5.634  40.207  48.625  1.00 45.40  ? 177  GLU A N     1 
ATOM   1451 C  CA    . GLU A 1 177 ? -5.815  40.249  47.174  1.00 48.77  ? 177  GLU A CA    1 
ATOM   1452 C  C     . GLU A 1 177 ? -6.676  39.080  46.665  1.00 47.69  ? 177  GLU A C     1 
ATOM   1453 O  O     . GLU A 1 177 ? -6.375  38.477  45.633  1.00 47.47  ? 177  GLU A O     1 
ATOM   1454 C  CB    . GLU A 1 177 ? -4.445  40.267  46.487  1.00 51.30  ? 177  GLU A CB    1 
ATOM   1455 C  CG    . GLU A 1 177 ? -4.337  41.143  45.256  1.00 57.38  ? 177  GLU A CG    1 
ATOM   1456 C  CD    . GLU A 1 177 ? -2.889  41.371  44.852  1.00 62.52  ? 177  GLU A CD    1 
ATOM   1457 O  OE1   . GLU A 1 177 ? -2.416  40.693  43.912  1.00 63.56  ? 177  GLU A OE1   1 
ATOM   1458 O  OE2   . GLU A 1 177 ? -2.220  42.217  45.489  1.00 62.82  ? 177  GLU A OE2   1 
ATOM   1459 N  N     . VAL A 1 178 ? -7.736  38.757  47.409  1.00 46.37  ? 178  VAL A N     1 
ATOM   1460 C  CA    . VAL A 1 178 ? -8.753  37.808  46.946  1.00 44.19  ? 178  VAL A CA    1 
ATOM   1461 C  C     . VAL A 1 178 ? -9.483  38.457  45.766  1.00 44.41  ? 178  VAL A C     1 
ATOM   1462 O  O     . VAL A 1 178 ? -10.059 39.535  45.922  1.00 44.95  ? 178  VAL A O     1 
ATOM   1463 C  CB    . VAL A 1 178 ? -9.758  37.442  48.067  1.00 42.17  ? 178  VAL A CB    1 
ATOM   1464 C  CG1   . VAL A 1 178 ? -10.888 36.583  47.532  1.00 40.96  ? 178  VAL A CG1   1 
ATOM   1465 C  CG2   . VAL A 1 178 ? -9.054  36.724  49.208  1.00 40.97  ? 178  VAL A CG2   1 
ATOM   1466 N  N     . PRO A 1 179 ? -9.445  37.812  44.580  1.00 44.40  ? 179  PRO A N     1 
ATOM   1467 C  CA    . PRO A 1 179 ? -9.997  38.384  43.346  1.00 43.13  ? 179  PRO A CA    1 
ATOM   1468 C  C     . PRO A 1 179 ? -11.375 38.991  43.576  1.00 43.31  ? 179  PRO A C     1 
ATOM   1469 O  O     . PRO A 1 179 ? -12.248 38.337  44.153  1.00 44.70  ? 179  PRO A O     1 
ATOM   1470 C  CB    . PRO A 1 179 ? -10.099 37.172  42.425  1.00 43.31  ? 179  PRO A CB    1 
ATOM   1471 C  CG    . PRO A 1 179 ? -8.982  36.298  42.854  1.00 44.48  ? 179  PRO A CG    1 
ATOM   1472 C  CD    . PRO A 1 179 ? -8.899  36.460  44.353  1.00 43.54  ? 179  PRO A CD    1 
ATOM   1473 N  N     . SER A 1 180 ? -11.555 40.238  43.152  1.00 41.19  ? 180  SER A N     1 
ATOM   1474 C  CA    . SER A 1 180 ? -12.791 40.964  43.413  1.00 43.15  ? 180  SER A CA    1 
ATOM   1475 C  C     . SER A 1 180 ? -14.031 40.274  42.840  1.00 43.08  ? 180  SER A C     1 
ATOM   1476 O  O     . SER A 1 180 ? -15.129 40.421  43.382  1.00 42.50  ? 180  SER A O     1 
ATOM   1477 C  CB    . SER A 1 180 ? -12.701 42.419  42.914  1.00 47.25  ? 180  SER A CB    1 
ATOM   1478 O  OG    . SER A 1 180 ? -12.272 42.505  41.562  1.00 46.10  ? 180  SER A OG    1 
ATOM   1479 N  N     . GLU A 1 181 ? -13.852 39.512  41.763  1.00 41.06  ? 181  GLU A N     1 
ATOM   1480 C  CA    . GLU A 1 181 ? -14.988 38.886  41.083  1.00 42.03  ? 181  GLU A CA    1 
ATOM   1481 C  C     . GLU A 1 181 ? -15.665 37.759  41.878  1.00 39.76  ? 181  GLU A C     1 
ATOM   1482 O  O     . GLU A 1 181 ? -16.716 37.272  41.471  1.00 42.59  ? 181  GLU A O     1 
ATOM   1483 C  CB    . GLU A 1 181 ? -14.606 38.420  39.665  1.00 43.04  ? 181  GLU A CB    1 
ATOM   1484 C  CG    . GLU A 1 181 ? -13.697 37.198  39.597  1.00 45.38  ? 181  GLU A CG    1 
ATOM   1485 C  CD    . GLU A 1 181 ? -12.211 37.542  39.610  1.00 48.21  ? 181  GLU A CD    1 
ATOM   1486 O  OE1   . GLU A 1 181 ? -11.854 38.716  39.844  1.00 45.47  ? 181  GLU A OE1   1 
ATOM   1487 O  OE2   . GLU A 1 181 ? -11.393 36.623  39.377  1.00 48.86  ? 181  GLU A OE2   1 
ATOM   1488 N  N     . ILE A 1 182 ? -15.064 37.345  42.995  1.00 35.50  ? 182  ILE A N     1 
ATOM   1489 C  CA    . ILE A 1 182 ? -15.665 36.332  43.862  1.00 34.94  ? 182  ILE A CA    1 
ATOM   1490 C  C     . ILE A 1 182 ? -16.037 36.838  45.266  1.00 34.65  ? 182  ILE A C     1 
ATOM   1491 O  O     . ILE A 1 182 ? -16.720 36.141  46.007  1.00 37.20  ? 182  ILE A O     1 
ATOM   1492 C  CB    . ILE A 1 182 ? -14.785 35.045  44.004  1.00 34.84  ? 182  ILE A CB    1 
ATOM   1493 C  CG1   . ILE A 1 182 ? -13.584 35.291  44.932  1.00 34.17  ? 182  ILE A CG1   1 
ATOM   1494 C  CG2   . ILE A 1 182 ? -14.375 34.484  42.625  1.00 34.58  ? 182  ILE A CG2   1 
ATOM   1495 C  CD1   . ILE A 1 182 ? -13.014 34.019  45.546  1.00 33.55  ? 182  ILE A CD1   1 
ATOM   1496 N  N     . ILE A 1 183 ? -15.591 38.038  45.623  1.00 34.79  ? 183  ILE A N     1 
ATOM   1497 C  CA    . ILE A 1 183 ? -15.853 38.608  46.945  1.00 38.60  ? 183  ILE A CA    1 
ATOM   1498 C  C     . ILE A 1 183 ? -17.339 38.556  47.328  1.00 40.97  ? 183  ILE A C     1 
ATOM   1499 O  O     . ILE A 1 183 ? -17.692 38.202  48.461  1.00 41.47  ? 183  ILE A O     1 
ATOM   1500 C  CB    . ILE A 1 183 ? -15.307 40.066  47.048  1.00 40.11  ? 183  ILE A CB    1 
ATOM   1501 C  CG1   . ILE A 1 183 ? -13.773 40.064  47.161  1.00 40.80  ? 183  ILE A CG1   1 
ATOM   1502 C  CG2   . ILE A 1 183 ? -15.978 40.841  48.197  1.00 37.98  ? 183  ILE A CG2   1 
ATOM   1503 C  CD1   . ILE A 1 183 ? -13.205 39.480  48.476  1.00 40.58  ? 183  ILE A CD1   1 
ATOM   1504 N  N     . ASP A 1 184 ? -18.198 38.895  46.368  1.00 41.86  ? 184  ASP A N     1 
ATOM   1505 C  CA    . ASP A 1 184 ? -19.640 38.909  46.574  1.00 41.58  ? 184  ASP A CA    1 
ATOM   1506 C  C     . ASP A 1 184 ? -20.221 37.504  46.682  1.00 39.09  ? 184  ASP A C     1 
ATOM   1507 O  O     . ASP A 1 184 ? -21.375 37.347  47.056  1.00 38.81  ? 184  ASP A O     1 
ATOM   1508 C  CB    . ASP A 1 184 ? -20.333 39.684  45.441  1.00 44.95  ? 184  ASP A CB    1 
ATOM   1509 C  CG    . ASP A 1 184 ? -20.234 41.207  45.611  1.00 51.23  ? 184  ASP A CG    1 
ATOM   1510 O  OD1   . ASP A 1 184 ? -20.040 41.682  46.753  1.00 56.66  ? 184  ASP A OD1   1 
ATOM   1511 O  OD2   . ASP A 1 184 ? -20.363 41.935  44.602  1.00 54.42  ? 184  ASP A OD2   1 
ATOM   1512 N  N     . LYS A 1 185 ? -19.415 36.491  46.362  1.00 37.23  ? 185  LYS A N     1 
ATOM   1513 C  CA    . LYS A 1 185 ? -19.877 35.097  46.323  1.00 35.30  ? 185  LYS A CA    1 
ATOM   1514 C  C     . LYS A 1 185 ? -19.487 34.299  47.574  1.00 33.74  ? 185  LYS A C     1 
ATOM   1515 O  O     . LYS A 1 185 ? -19.741 33.090  47.663  1.00 31.14  ? 185  LYS A O     1 
ATOM   1516 C  CB    . LYS A 1 185 ? -19.365 34.398  45.056  1.00 33.52  ? 185  LYS A CB    1 
ATOM   1517 C  CG    . LYS A 1 185 ? -19.741 35.135  43.776  1.00 36.67  ? 185  LYS A CG    1 
ATOM   1518 C  CD    . LYS A 1 185 ? -19.363 34.370  42.530  1.00 33.54  ? 185  LYS A CD    1 
ATOM   1519 C  CE    . LYS A 1 185 ? -19.871 35.090  41.281  1.00 37.95  ? 185  LYS A CE    1 
ATOM   1520 N  NZ    . LYS A 1 185 ? -19.753 34.234  40.057  1.00 39.04  ? 185  LYS A NZ    1 
ATOM   1521 N  N     . ILE A 1 186 ? -18.868 34.976  48.535  1.00 33.70  ? 186  ILE A N     1 
ATOM   1522 C  CA    . ILE A 1 186 ? -18.404 34.311  49.754  1.00 34.83  ? 186  ILE A CA    1 
ATOM   1523 C  C     . ILE A 1 186 ? -19.450 34.346  50.867  1.00 34.62  ? 186  ILE A C     1 
ATOM   1524 O  O     . ILE A 1 186 ? -19.957 35.403  51.236  1.00 34.42  ? 186  ILE A O     1 
ATOM   1525 C  CB    . ILE A 1 186 ? -17.030 34.859  50.236  1.00 33.67  ? 186  ILE A CB    1 
ATOM   1526 C  CG1   . ILE A 1 186 ? -15.948 34.552  49.196  1.00 34.06  ? 186  ILE A CG1   1 
ATOM   1527 C  CG2   . ILE A 1 186 ? -16.637 34.254  51.586  1.00 32.78  ? 186  ILE A CG2   1 
ATOM   1528 C  CD1   . ILE A 1 186 ? -14.632 35.306  49.413  1.00 32.86  ? 186  ILE A CD1   1 
ATOM   1529 N  N     . ILE A 1 187 ? -19.776 33.166  51.378  1.00 34.82  ? 187  ILE A N     1 
ATOM   1530 C  CA    . ILE A 1 187 ? -20.653 33.044  52.522  1.00 33.60  ? 187  ILE A CA    1 
ATOM   1531 C  C     . ILE A 1 187 ? -19.796 32.499  53.649  1.00 35.22  ? 187  ILE A C     1 
ATOM   1532 O  O     . ILE A 1 187 ? -19.361 31.342  53.626  1.00 34.92  ? 187  ILE A O     1 
ATOM   1533 C  CB    . ILE A 1 187 ? -21.896 32.167  52.209  1.00 35.30  ? 187  ILE A CB    1 
ATOM   1534 C  CG1   . ILE A 1 187 ? -22.729 32.842  51.100  1.00 35.53  ? 187  ILE A CG1   1 
ATOM   1535 C  CG2   . ILE A 1 187 ? -22.737 31.972  53.467  1.00 35.53  ? 187  ILE A CG2   1 
ATOM   1536 C  CD1   . ILE A 1 187 ? -23.942 32.080  50.618  1.00 34.50  ? 187  ILE A CD1   1 
ATOM   1537 N  N     . TYR A 1 188 ? -19.545 33.367  54.625  1.00 33.23  ? 188  TYR A N     1 
ATOM   1538 C  CA    . TYR A 1 188 ? -18.562 33.129  55.654  1.00 31.96  ? 188  TYR A CA    1 
ATOM   1539 C  C     . TYR A 1 188 ? -19.228 32.729  56.958  1.00 33.85  ? 188  TYR A C     1 
ATOM   1540 O  O     . TYR A 1 188 ? -20.118 33.427  57.446  1.00 35.21  ? 188  TYR A O     1 
ATOM   1541 C  CB    . TYR A 1 188 ? -17.722 34.396  55.867  1.00 32.64  ? 188  TYR A CB    1 
ATOM   1542 C  CG    . TYR A 1 188 ? -16.764 34.300  57.032  1.00 31.81  ? 188  TYR A CG    1 
ATOM   1543 C  CD1   . TYR A 1 188 ? -15.638 33.474  56.964  1.00 26.81  ? 188  TYR A CD1   1 
ATOM   1544 C  CD2   . TYR A 1 188 ? -16.991 35.019  58.210  1.00 35.56  ? 188  TYR A CD2   1 
ATOM   1545 C  CE1   . TYR A 1 188 ? -14.755 33.371  58.032  1.00 28.05  ? 188  TYR A CE1   1 
ATOM   1546 C  CE2   . TYR A 1 188 ? -16.105 34.930  59.299  1.00 33.33  ? 188  TYR A CE2   1 
ATOM   1547 C  CZ    . TYR A 1 188 ? -14.991 34.099  59.199  1.00 31.99  ? 188  TYR A CZ    1 
ATOM   1548 O  OH    . TYR A 1 188 ? -14.110 34.002  60.250  1.00 29.50  ? 188  TYR A OH    1 
ATOM   1549 N  N     . MET A 1 189 ? -18.778 31.618  57.529  1.00 33.12  ? 189  MET A N     1 
ATOM   1550 C  CA    . MET A 1 189 ? -19.363 31.086  58.756  1.00 35.72  ? 189  MET A CA    1 
ATOM   1551 C  C     . MET A 1 189 ? -18.258 30.726  59.735  1.00 35.43  ? 189  MET A C     1 
ATOM   1552 O  O     . MET A 1 189 ? -17.566 29.721  59.540  1.00 38.30  ? 189  MET A O     1 
ATOM   1553 C  CB    . MET A 1 189 ? -20.233 29.855  58.461  1.00 36.89  ? 189  MET A CB    1 
ATOM   1554 C  CG    . MET A 1 189 ? -21.437 30.138  57.553  1.00 38.20  ? 189  MET A CG    1 
ATOM   1555 S  SD    . MET A 1 189 ? -22.095 28.696  56.672  1.00 42.33  ? 189  MET A SD    1 
ATOM   1556 C  CE    . MET A 1 189 ? -20.717 28.303  55.582  1.00 38.91  ? 189  MET A CE    1 
ATOM   1557 N  N     . PRO A 1 190 ? -18.069 31.557  60.778  1.00 34.85  ? 190  PRO A N     1 
ATOM   1558 C  CA    . PRO A 1 190 ? -17.119 31.254  61.845  1.00 34.50  ? 190  PRO A CA    1 
ATOM   1559 C  C     . PRO A 1 190 ? -17.739 30.352  62.912  1.00 36.72  ? 190  PRO A C     1 
ATOM   1560 O  O     . PRO A 1 190 ? -18.951 30.394  63.122  1.00 37.60  ? 190  PRO A O     1 
ATOM   1561 C  CB    . PRO A 1 190 ? -16.786 32.636  62.419  1.00 36.73  ? 190  PRO A CB    1 
ATOM   1562 C  CG    . PRO A 1 190 ? -17.993 33.480  62.133  1.00 36.88  ? 190  PRO A CG    1 
ATOM   1563 C  CD    . PRO A 1 190 ? -18.723 32.869  60.961  1.00 35.05  ? 190  PRO A CD    1 
ATOM   1564 N  N     . PHE A 1 191 ? -16.916 29.550  63.583  1.00 36.33  ? 191  PHE A N     1 
ATOM   1565 C  CA    . PHE A 1 191 ? -17.409 28.588  64.573  1.00 36.23  ? 191  PHE A CA    1 
ATOM   1566 C  C     . PHE A 1 191 ? -16.608 28.625  65.874  1.00 38.45  ? 191  PHE A C     1 
ATOM   1567 O  O     . PHE A 1 191 ? -15.379 28.742  65.856  1.00 37.26  ? 191  PHE A O     1 
ATOM   1568 C  CB    . PHE A 1 191 ? -17.395 27.168  63.983  1.00 35.82  ? 191  PHE A CB    1 
ATOM   1569 C  CG    . PHE A 1 191 ? -18.421 26.953  62.903  1.00 36.09  ? 191  PHE A CG    1 
ATOM   1570 C  CD1   . PHE A 1 191 ? -18.112 27.207  61.568  1.00 33.44  ? 191  PHE A CD1   1 
ATOM   1571 C  CD2   . PHE A 1 191 ? -19.711 26.524  63.224  1.00 36.48  ? 191  PHE A CD2   1 
ATOM   1572 C  CE1   . PHE A 1 191 ? -19.065 27.027  60.567  1.00 35.90  ? 191  PHE A CE1   1 
ATOM   1573 C  CE2   . PHE A 1 191 ? -20.676 26.344  62.227  1.00 36.00  ? 191  PHE A CE2   1 
ATOM   1574 C  CZ    . PHE A 1 191 ? -20.348 26.594  60.894  1.00 35.26  ? 191  PHE A CZ    1 
ATOM   1575 N  N     . ASP A 1 192 ? -17.310 28.524  66.999  1.00 42.77  ? 192  ASP A N     1 
ATOM   1576 C  CA    . ASP A 1 192 ? -16.672 28.505  68.321  1.00 46.33  ? 192  ASP A CA    1 
ATOM   1577 C  C     . ASP A 1 192 ? -15.858 27.235  68.571  1.00 43.70  ? 192  ASP A C     1 
ATOM   1578 O  O     . ASP A 1 192 ? -14.845 27.270  69.271  1.00 44.13  ? 192  ASP A O     1 
ATOM   1579 C  CB    . ASP A 1 192 ? -17.718 28.656  69.433  1.00 51.06  ? 192  ASP A CB    1 
ATOM   1580 C  CG    . ASP A 1 192 ? -18.334 30.045  69.475  1.00 60.23  ? 192  ASP A CG    1 
ATOM   1581 O  OD1   . ASP A 1 192 ? -17.574 31.039  69.549  1.00 63.29  ? 192  ASP A OD1   1 
ATOM   1582 O  OD2   . ASP A 1 192 ? -19.584 30.141  69.444  1.00 64.56  ? 192  ASP A OD2   1 
ATOM   1583 N  N     . ASN A 1 193 ? -16.318 26.115  68.016  1.00 40.34  ? 193  ASN A N     1 
ATOM   1584 C  CA    . ASN A 1 193 ? -15.663 24.823  68.234  1.00 39.35  ? 193  ASN A CA    1 
ATOM   1585 C  C     . ASN A 1 193 ? -15.765 23.888  67.026  1.00 37.01  ? 193  ASN A C     1 
ATOM   1586 O  O     . ASN A 1 193 ? -16.675 24.010  66.209  1.00 35.78  ? 193  ASN A O     1 
ATOM   1587 C  CB    . ASN A 1 193 ? -16.210 24.147  69.500  1.00 40.40  ? 193  ASN A CB    1 
ATOM   1588 C  CG    . ASN A 1 193 ? -17.687 23.808  69.387  1.00 44.13  ? 193  ASN A CG    1 
ATOM   1589 O  OD1   . ASN A 1 193 ? -18.050 22.705  68.977  1.00 43.60  ? 193  ASN A OD1   1 
ATOM   1590 N  ND2   . ASN A 1 193 ? -18.548 24.768  69.721  1.00 47.92  ? 193  ASN A ND2   1 
ATOM   1591 N  N     . GLU A 1 194 ? -14.821 22.954  66.929  1.00 38.32  ? 194  GLU A N     1 
ATOM   1592 C  CA    . GLU A 1 194 ? -14.734 22.020  65.811  1.00 36.01  ? 194  GLU A CA    1 
ATOM   1593 C  C     . GLU A 1 194 ? -15.977 21.146  65.642  1.00 37.21  ? 194  GLU A C     1 
ATOM   1594 O  O     . GLU A 1 194 ? -16.386 20.855  64.512  1.00 36.13  ? 194  GLU A O     1 
ATOM   1595 C  CB    . GLU A 1 194 ? -13.487 21.137  65.944  1.00 35.95  ? 194  GLU A CB    1 
ATOM   1596 C  CG    . GLU A 1 194 ? -13.164 20.335  64.674  1.00 34.21  ? 194  GLU A CG    1 
ATOM   1597 C  CD    . GLU A 1 194 ? -12.076 19.297  64.872  1.00 38.15  ? 194  GLU A CD    1 
ATOM   1598 O  OE1   . GLU A 1 194 ? -11.733 18.609  63.882  1.00 39.69  ? 194  GLU A OE1   1 
ATOM   1599 O  OE2   . GLU A 1 194 ? -11.556 19.167  66.003  1.00 41.64  ? 194  GLU A OE2   1 
ATOM   1600 N  N     . LYS A 1 195 ? -16.567 20.716  66.755  1.00 38.86  ? 195  LYS A N     1 
ATOM   1601 C  CA    . LYS A 1 195 ? -17.730 19.833  66.697  1.00 39.87  ? 195  LYS A CA    1 
ATOM   1602 C  C     . LYS A 1 195 ? -18.873 20.495  65.944  1.00 38.97  ? 195  LYS A C     1 
ATOM   1603 O  O     . LYS A 1 195 ? -19.415 19.910  65.002  1.00 37.44  ? 195  LYS A O     1 
ATOM   1604 C  CB    . LYS A 1 195 ? -18.179 19.391  68.087  1.00 42.24  ? 195  LYS A CB    1 
ATOM   1605 C  CG    . LYS A 1 195 ? -17.304 18.311  68.706  1.00 48.34  ? 195  LYS A CG    1 
ATOM   1606 C  CD    . LYS A 1 195 ? -17.948 17.732  69.961  1.00 51.14  ? 195  LYS A CD    1 
ATOM   1607 C  CE    . LYS A 1 195 ? -16.994 16.804  70.694  1.00 55.79  ? 195  LYS A CE    1 
ATOM   1608 N  NZ    . LYS A 1 195 ? -15.931 17.567  71.408  1.00 58.84  ? 195  LYS A NZ    1 
ATOM   1609 N  N     . GLU A 1 196 ? -19.217 21.719  66.339  1.00 39.37  ? 196  GLU A N     1 
ATOM   1610 C  CA    . GLU A 1 196 ? -20.298 22.440  65.673  1.00 41.25  ? 196  GLU A CA    1 
ATOM   1611 C  C     . GLU A 1 196 ? -19.959 22.739  64.205  1.00 38.19  ? 196  GLU A C     1 
ATOM   1612 O  O     . GLU A 1 196 ? -20.839 22.652  63.344  1.00 39.92  ? 196  GLU A O     1 
ATOM   1613 C  CB    . GLU A 1 196 ? -20.774 23.676  66.469  1.00 43.11  ? 196  GLU A CB    1 
ATOM   1614 C  CG    . GLU A 1 196 ? -19.895 24.920  66.394  1.00 52.44  ? 196  GLU A CG    1 
ATOM   1615 C  CD    . GLU A 1 196 ? -20.507 26.147  67.104  1.00 58.35  ? 196  GLU A CD    1 
ATOM   1616 O  OE1   . GLU A 1 196 ? -20.275 27.292  66.633  1.00 55.67  ? 196  GLU A OE1   1 
ATOM   1617 O  OE2   . GLU A 1 196 ? -21.206 25.969  68.132  1.00 60.67  ? 196  GLU A OE2   1 
ATOM   1618 N  N     . LEU A 1 197 ? -18.689 23.045  63.925  1.00 33.26  ? 197  LEU A N     1 
ATOM   1619 C  CA    . LEU A 1 197 ? -18.219 23.245  62.554  1.00 33.56  ? 197  LEU A CA    1 
ATOM   1620 C  C     . LEU A 1 197 ? -18.517 22.008  61.687  1.00 32.77  ? 197  LEU A C     1 
ATOM   1621 O  O     . LEU A 1 197 ? -19.085 22.122  60.599  1.00 31.00  ? 197  LEU A O     1 
ATOM   1622 C  CB    . LEU A 1 197 ? -16.713 23.602  62.518  1.00 31.58  ? 197  LEU A CB    1 
ATOM   1623 C  CG    . LEU A 1 197 ? -16.041 23.925  61.168  1.00 32.05  ? 197  LEU A CG    1 
ATOM   1624 C  CD1   . LEU A 1 197 ? -14.769 24.739  61.344  1.00 29.40  ? 197  LEU A CD1   1 
ATOM   1625 C  CD2   . LEU A 1 197 ? -15.717 22.673  60.365  1.00 30.52  ? 197  LEU A CD2   1 
ATOM   1626 N  N     . LEU A 1 198 ? -18.142 20.833  62.181  1.00 32.27  ? 198  LEU A N     1 
ATOM   1627 C  CA    . LEU A 1 198 ? -18.318 19.611  61.419  1.00 33.63  ? 198  LEU A CA    1 
ATOM   1628 C  C     . LEU A 1 198 ? -19.790 19.209  61.331  1.00 35.36  ? 198  LEU A C     1 
ATOM   1629 O  O     . LEU A 1 198 ? -20.226 18.693  60.305  1.00 36.71  ? 198  LEU A O     1 
ATOM   1630 C  CB    . LEU A 1 198 ? -17.435 18.483  61.972  1.00 32.85  ? 198  LEU A CB    1 
ATOM   1631 C  CG    . LEU A 1 198 ? -15.914 18.703  61.870  1.00 31.13  ? 198  LEU A CG    1 
ATOM   1632 C  CD1   . LEU A 1 198 ? -15.146 17.645  62.651  1.00 25.39  ? 198  LEU A CD1   1 
ATOM   1633 C  CD2   . LEU A 1 198 ? -15.436 18.727  60.415  1.00 29.14  ? 198  LEU A CD2   1 
ATOM   1634 N  N     . MET A 1 199 ? -20.555 19.469  62.388  1.00 37.13  ? 199  MET A N     1 
ATOM   1635 C  CA    . MET A 1 199 ? -21.983 19.150  62.392  1.00 39.30  ? 199  MET A CA    1 
ATOM   1636 C  C     . MET A 1 199 ? -22.734 20.019  61.389  1.00 38.81  ? 199  MET A C     1 
ATOM   1637 O  O     . MET A 1 199 ? -23.563 19.524  60.618  1.00 38.90  ? 199  MET A O     1 
ATOM   1638 C  CB    . MET A 1 199 ? -22.586 19.287  63.799  1.00 41.75  ? 199  MET A CB    1 
ATOM   1639 C  CG    . MET A 1 199 ? -22.212 18.142  64.742  1.00 43.50  ? 199  MET A CG    1 
ATOM   1640 S  SD    . MET A 1 199 ? -23.047 18.176  66.341  1.00 51.04  ? 199  MET A SD    1 
ATOM   1641 C  CE    . MET A 1 199 ? -22.217 19.534  67.171  1.00 47.34  ? 199  MET A CE    1 
ATOM   1642 N  N     . GLU A 1 200 ? -22.418 21.311  61.385  1.00 38.50  ? 200  GLU A N     1 
ATOM   1643 C  CA    . GLU A 1 200 ? -23.006 22.231  60.421  1.00 40.08  ? 200  GLU A CA    1 
ATOM   1644 C  C     . GLU A 1 200 ? -22.576 21.888  58.986  1.00 38.17  ? 200  GLU A C     1 
ATOM   1645 O  O     . GLU A 1 200 ? -23.391 21.966  58.064  1.00 38.97  ? 200  GLU A O     1 
ATOM   1646 C  CB    . GLU A 1 200 ? -22.685 23.688  60.777  1.00 41.26  ? 200  GLU A CB    1 
ATOM   1647 C  CG    . GLU A 1 200 ? -23.324 24.733  59.852  1.00 47.57  ? 200  GLU A CG    1 
ATOM   1648 C  CD    . GLU A 1 200 ? -24.838 24.553  59.666  1.00 56.77  ? 200  GLU A CD    1 
ATOM   1649 O  OE1   . GLU A 1 200 ? -25.560 24.342  60.678  1.00 55.43  ? 200  GLU A OE1   1 
ATOM   1650 O  OE2   . GLU A 1 200 ? -25.298 24.634  58.497  1.00 57.87  ? 200  GLU A OE2   1 
ATOM   1651 N  N     . TYR A 1 201 ? -21.318 21.489  58.807  1.00 34.44  ? 201  TYR A N     1 
ATOM   1652 C  CA    . TYR A 1 201 ? -20.832 21.088  57.481  1.00 34.30  ? 201  TYR A CA    1 
ATOM   1653 C  C     . TYR A 1 201 ? -21.579 19.862  56.951  1.00 34.56  ? 201  TYR A C     1 
ATOM   1654 O  O     . TYR A 1 201 ? -21.976 19.822  55.781  1.00 32.78  ? 201  TYR A O     1 
ATOM   1655 C  CB    . TYR A 1 201 ? -19.319 20.843  57.488  1.00 33.04  ? 201  TYR A CB    1 
ATOM   1656 C  CG    . TYR A 1 201 ? -18.753 20.551  56.117  1.00 32.69  ? 201  TYR A CG    1 
ATOM   1657 C  CD1   . TYR A 1 201 ? -18.816 21.508  55.099  1.00 32.65  ? 201  TYR A CD1   1 
ATOM   1658 C  CD2   . TYR A 1 201 ? -18.156 19.315  55.828  1.00 32.61  ? 201  TYR A CD2   1 
ATOM   1659 C  CE1   . TYR A 1 201 ? -18.306 21.243  53.816  1.00 29.41  ? 201  TYR A CE1   1 
ATOM   1660 C  CE2   . TYR A 1 201 ? -17.636 19.045  54.544  1.00 31.46  ? 201  TYR A CE2   1 
ATOM   1661 C  CZ    . TYR A 1 201 ? -17.717 20.024  53.549  1.00 29.16  ? 201  TYR A CZ    1 
ATOM   1662 O  OH    . TYR A 1 201 ? -17.220 19.786  52.290  1.00 27.10  ? 201  TYR A OH    1 
ATOM   1663 N  N     . LEU A 1 202 ? -21.786 18.874  57.821  1.00 33.92  ? 202  LEU A N     1 
ATOM   1664 C  CA    . LEU A 1 202 ? -22.532 17.681  57.444  1.00 33.99  ? 202  LEU A CA    1 
ATOM   1665 C  C     . LEU A 1 202 ? -23.971 18.011  57.048  1.00 34.50  ? 202  LEU A C     1 
ATOM   1666 O  O     . LEU A 1 202 ? -24.479 17.481  56.052  1.00 33.82  ? 202  LEU A O     1 
ATOM   1667 C  CB    . LEU A 1 202 ? -22.514 16.649  58.563  1.00 34.53  ? 202  LEU A CB    1 
ATOM   1668 C  CG    . LEU A 1 202 ? -21.260 15.792  58.724  1.00 35.69  ? 202  LEU A CG    1 
ATOM   1669 C  CD1   . LEU A 1 202 ? -21.427 14.920  59.947  1.00 31.19  ? 202  LEU A CD1   1 
ATOM   1670 C  CD2   . LEU A 1 202 ? -20.964 14.929  57.483  1.00 31.72  ? 202  LEU A CD2   1 
ATOM   1671 N  N     . ASN A 1 203 ? -24.614 18.886  57.824  1.00 34.69  ? 203  ASN A N     1 
ATOM   1672 C  CA    . ASN A 1 203 ? -25.968 19.348  57.518  1.00 36.56  ? 203  ASN A CA    1 
ATOM   1673 C  C     . ASN A 1 203 ? -26.021 20.110  56.201  1.00 35.62  ? 203  ASN A C     1 
ATOM   1674 O  O     . ASN A 1 203 ? -26.969 19.980  55.433  1.00 36.27  ? 203  ASN A O     1 
ATOM   1675 C  CB    . ASN A 1 203 ? -26.525 20.209  58.654  1.00 37.14  ? 203  ASN A CB    1 
ATOM   1676 C  CG    . ASN A 1 203 ? -26.931 19.381  59.865  1.00 39.27  ? 203  ASN A CG    1 
ATOM   1677 O  OD1   . ASN A 1 203 ? -26.844 19.840  61.005  1.00 43.91  ? 203  ASN A OD1   1 
ATOM   1678 N  ND2   . ASN A 1 203 ? -27.386 18.162  59.624  1.00 34.78  ? 203  ASN A ND2   1 
ATOM   1679 N  N     . PHE A 1 204 ? -24.978 20.892  55.953  1.00 34.90  ? 204  PHE A N     1 
ATOM   1680 C  CA    . PHE A 1 204 ? -24.822 21.637  54.715  1.00 33.79  ? 204  PHE A CA    1 
ATOM   1681 C  C     . PHE A 1 204 ? -24.702 20.646  53.561  1.00 32.18  ? 204  PHE A C     1 
ATOM   1682 O  O     . PHE A 1 204 ? -25.422 20.756  52.570  1.00 32.20  ? 204  PHE A O     1 
ATOM   1683 C  CB    . PHE A 1 204 ? -23.596 22.563  54.841  1.00 31.58  ? 204  PHE A CB    1 
ATOM   1684 C  CG    . PHE A 1 204 ? -23.035 23.034  53.535  1.00 32.78  ? 204  PHE A CG    1 
ATOM   1685 C  CD1   . PHE A 1 204 ? -23.498 24.208  52.947  1.00 31.74  ? 204  PHE A CD1   1 
ATOM   1686 C  CD2   . PHE A 1 204 ? -22.012 22.327  52.907  1.00 30.74  ? 204  PHE A CD2   1 
ATOM   1687 C  CE1   . PHE A 1 204 ? -22.967 24.657  51.750  1.00 32.36  ? 204  PHE A CE1   1 
ATOM   1688 C  CE2   . PHE A 1 204 ? -21.480 22.769  51.705  1.00 30.39  ? 204  PHE A CE2   1 
ATOM   1689 C  CZ    . PHE A 1 204 ? -21.966 23.930  51.118  1.00 28.42  ? 204  PHE A CZ    1 
ATOM   1690 N  N     . TRP A 1 205 ? -23.813 19.667  53.727  1.00 31.73  ? 205  TRP A N     1 
ATOM   1691 C  CA    . TRP A 1 205 ? -23.551 18.620  52.744  1.00 32.48  ? 205  TRP A CA    1 
ATOM   1692 C  C     . TRP A 1 205 ? -24.830 17.882  52.394  1.00 36.28  ? 205  TRP A C     1 
ATOM   1693 O  O     . TRP A 1 205 ? -25.075 17.590  51.223  1.00 37.59  ? 205  TRP A O     1 
ATOM   1694 C  CB    . TRP A 1 205 ? -22.515 17.641  53.304  1.00 31.22  ? 205  TRP A CB    1 
ATOM   1695 C  CG    . TRP A 1 205 ? -21.952 16.576  52.360  1.00 30.84  ? 205  TRP A CG    1 
ATOM   1696 C  CD1   . TRP A 1 205 ? -22.539 15.382  52.009  1.00 32.03  ? 205  TRP A CD1   1 
ATOM   1697 C  CD2   . TRP A 1 205 ? -20.657 16.575  51.739  1.00 29.90  ? 205  TRP A CD2   1 
ATOM   1698 N  NE1   . TRP A 1 205 ? -21.696 14.654  51.186  1.00 28.08  ? 205  TRP A NE1   1 
ATOM   1699 C  CE2   . TRP A 1 205 ? -20.538 15.363  51.007  1.00 29.49  ? 205  TRP A CE2   1 
ATOM   1700 C  CE3   . TRP A 1 205 ? -19.589 17.488  51.713  1.00 30.35  ? 205  TRP A CE3   1 
ATOM   1701 C  CZ2   . TRP A 1 205 ? -19.394 15.045  50.260  1.00 29.86  ? 205  TRP A CZ2   1 
ATOM   1702 C  CZ3   . TRP A 1 205 ? -18.444 17.165  50.962  1.00 30.33  ? 205  TRP A CZ3   1 
ATOM   1703 C  CH2   . TRP A 1 205 ? -18.360 15.952  50.256  1.00 27.88  ? 205  TRP A CH2   1 
ATOM   1704 N  N     . GLN A 1 206 ? -25.641 17.594  53.411  1.00 38.42  ? 206  GLN A N     1 
ATOM   1705 C  CA    . GLN A 1 206 ? -26.930 16.944  53.216  1.00 41.91  ? 206  GLN A CA    1 
ATOM   1706 C  C     . GLN A 1 206 ? -27.849 17.761  52.312  1.00 41.88  ? 206  GLN A C     1 
ATOM   1707 O  O     . GLN A 1 206 ? -28.447 17.209  51.385  1.00 41.64  ? 206  GLN A O     1 
ATOM   1708 C  CB    . GLN A 1 206 ? -27.613 16.656  54.553  1.00 44.48  ? 206  GLN A CB    1 
ATOM   1709 C  CG    . GLN A 1 206 ? -28.832 15.744  54.428  1.00 52.19  ? 206  GLN A CG    1 
ATOM   1710 C  CD    . GLN A 1 206 ? -29.443 15.362  55.772  1.00 58.86  ? 206  GLN A CD    1 
ATOM   1711 O  OE1   . GLN A 1 206 ? -29.750 14.193  56.008  1.00 60.64  ? 206  GLN A OE1   1 
ATOM   1712 N  NE2   . GLN A 1 206 ? -29.625 16.347  56.655  1.00 62.10  ? 206  GLN A NE2   1 
ATOM   1713 N  N     . GLN A 1 207 ? -27.952 19.064  52.572  1.00 42.86  ? 207  GLN A N     1 
ATOM   1714 C  CA    . GLN A 1 207 ? -28.768 19.949  51.732  1.00 45.98  ? 207  GLN A CA    1 
ATOM   1715 C  C     . GLN A 1 207 ? -28.194 20.105  50.332  1.00 43.96  ? 207  GLN A C     1 
ATOM   1716 O  O     . GLN A 1 207 ? -28.941 20.228  49.365  1.00 46.60  ? 207  GLN A O     1 
ATOM   1717 C  CB    . GLN A 1 207 ? -28.947 21.333  52.361  1.00 47.03  ? 207  GLN A CB    1 
ATOM   1718 C  CG    . GLN A 1 207 ? -30.238 21.512  53.161  1.00 60.54  ? 207  GLN A CG    1 
ATOM   1719 C  CD    . GLN A 1 207 ? -31.493 21.633  52.287  1.00 68.10  ? 207  GLN A CD    1 
ATOM   1720 O  OE1   . GLN A 1 207 ? -32.043 22.724  52.124  1.00 70.60  ? 207  GLN A OE1   1 
ATOM   1721 N  NE2   . GLN A 1 207 ? -31.949 20.508  51.728  1.00 71.17  ? 207  GLN A NE2   1 
ATOM   1722 N  N     . LYS A 1 208 ? -26.869 20.105  50.233  1.00 40.39  ? 208  LYS A N     1 
ATOM   1723 C  CA    . LYS A 1 208 ? -26.195 20.398  48.976  1.00 37.37  ? 208  LYS A CA    1 
ATOM   1724 C  C     . LYS A 1 208 ? -25.188 19.295  48.665  1.00 35.99  ? 208  LYS A C     1 
ATOM   1725 O  O     . LYS A 1 208 ? -23.974 19.531  48.627  1.00 34.49  ? 208  LYS A O     1 
ATOM   1726 C  CB    . LYS A 1 208 ? -25.514 21.767  49.058  1.00 37.17  ? 208  LYS A CB    1 
ATOM   1727 C  CG    . LYS A 1 208 ? -26.479 22.937  49.197  1.00 39.94  ? 208  LYS A CG    1 
ATOM   1728 C  CD    . LYS A 1 208 ? -25.742 24.240  49.480  1.00 42.17  ? 208  LYS A CD    1 
ATOM   1729 C  CE    . LYS A 1 208 ? -26.671 25.286  50.091  1.00 43.34  ? 208  LYS A CE    1 
ATOM   1730 N  NZ    . LYS A 1 208 ? -27.720 25.730  49.128  1.00 40.76  ? 208  LYS A NZ    1 
ATOM   1731 N  N     . THR A 1 209 ? -25.715 18.088  48.460  1.00 33.16  ? 209  THR A N     1 
ATOM   1732 C  CA    . THR A 1 209 ? -24.913 16.892  48.272  1.00 33.97  ? 209  THR A CA    1 
ATOM   1733 C  C     . THR A 1 209 ? -24.198 16.931  46.929  1.00 32.65  ? 209  THR A C     1 
ATOM   1734 O  O     . THR A 1 209 ? -24.833 17.032  45.885  1.00 32.89  ? 209  THR A O     1 
ATOM   1735 C  CB    . THR A 1 209 ? -25.761 15.605  48.404  1.00 34.82  ? 209  THR A CB    1 
ATOM   1736 O  OG1   . THR A 1 209 ? -26.451 15.623  49.658  1.00 39.00  ? 209  THR A OG1   1 
ATOM   1737 C  CG2   . THR A 1 209 ? -24.879 14.350  48.338  1.00 33.17  ? 209  THR A CG2   1 
ATOM   1738 N  N     . PRO A 1 210 ? -22.861 16.861  46.961  1.00 32.55  ? 210  PRO A N     1 
ATOM   1739 C  CA    . PRO A 1 210 ? -22.091 16.908  45.720  1.00 31.86  ? 210  PRO A CA    1 
ATOM   1740 C  C     . PRO A 1 210 ? -22.452 15.726  44.834  1.00 32.49  ? 210  PRO A C     1 
ATOM   1741 O  O     . PRO A 1 210 ? -22.700 14.626  45.340  1.00 32.91  ? 210  PRO A O     1 
ATOM   1742 C  CB    . PRO A 1 210 ? -20.645 16.777  46.199  1.00 31.35  ? 210  PRO A CB    1 
ATOM   1743 C  CG    . PRO A 1 210 ? -20.671 17.245  47.641  1.00 32.90  ? 210  PRO A CG    1 
ATOM   1744 C  CD    . PRO A 1 210 ? -22.004 16.827  48.164  1.00 30.41  ? 210  PRO A CD    1 
ATOM   1745 N  N     . VAL A 1 211 ? -22.509 15.965  43.530  1.00 29.17  ? 211  VAL A N     1 
ATOM   1746 C  CA    . VAL A 1 211 ? -22.632 14.885  42.563  1.00 29.72  ? 211  VAL A CA    1 
ATOM   1747 C  C     . VAL A 1 211 ? -21.227 14.586  42.058  1.00 31.04  ? 211  VAL A C     1 
ATOM   1748 O  O     . VAL A 1 211 ? -20.739 13.460  42.182  1.00 31.39  ? 211  VAL A O     1 
ATOM   1749 C  CB    . VAL A 1 211 ? -23.549 15.289  41.398  1.00 30.15  ? 211  VAL A CB    1 
ATOM   1750 C  CG1   . VAL A 1 211 ? -23.388 14.330  40.214  1.00 27.65  ? 211  VAL A CG1   1 
ATOM   1751 C  CG2   . VAL A 1 211 ? -24.995 15.351  41.878  1.00 28.78  ? 211  VAL A CG2   1 
ATOM   1752 N  N     . ILE A 1 212 ? -20.590 15.613  41.496  1.00 30.00  ? 212  ILE A N     1 
ATOM   1753 C  CA    . ILE A 1 212 ? -19.179 15.571  41.153  1.00 29.49  ? 212  ILE A CA    1 
ATOM   1754 C  C     . ILE A 1 212 ? -18.419 16.254  42.274  1.00 30.25  ? 212  ILE A C     1 
ATOM   1755 O  O     . ILE A 1 212 ? -18.715 17.395  42.633  1.00 31.56  ? 212  ILE A O     1 
ATOM   1756 C  CB    . ILE A 1 212 ? -18.875 16.305  39.819  1.00 27.98  ? 212  ILE A CB    1 
ATOM   1757 C  CG1   . ILE A 1 212 ? -19.731 15.763  38.667  1.00 27.75  ? 212  ILE A CG1   1 
ATOM   1758 C  CG2   . ILE A 1 212 ? -17.382 16.240  39.504  1.00 23.83  ? 212  ILE A CG2   1 
ATOM   1759 C  CD1   . ILE A 1 212 ? -19.546 14.264  38.313  1.00 27.50  ? 212  ILE A CD1   1 
ATOM   1760 N  N     . LEU A 1 213 ? -17.445 15.550  42.835  1.00 31.11  ? 213  LEU A N     1 
ATOM   1761 C  CA    . LEU A 1 213 ? -16.652 16.100  43.913  1.00 31.22  ? 213  LEU A CA    1 
ATOM   1762 C  C     . LEU A 1 213 ? -15.223 16.237  43.435  1.00 31.47  ? 213  LEU A C     1 
ATOM   1763 O  O     . LEU A 1 213 ? -14.604 15.263  43.014  1.00 33.37  ? 213  LEU A O     1 
ATOM   1764 C  CB    . LEU A 1 213 ? -16.747 15.220  45.169  1.00 31.88  ? 213  LEU A CB    1 
ATOM   1765 C  CG    . LEU A 1 213 ? -16.109 15.784  46.450  1.00 32.51  ? 213  LEU A CG    1 
ATOM   1766 C  CD1   . LEU A 1 213 ? -16.590 17.209  46.752  1.00 26.36  ? 213  LEU A CD1   1 
ATOM   1767 C  CD2   . LEU A 1 213 ? -16.353 14.860  47.638  1.00 26.97  ? 213  LEU A CD2   1 
ATOM   1768 N  N     . THR A 1 214 ? -14.706 17.458  43.467  1.00 30.84  ? 214  THR A N     1 
ATOM   1769 C  CA    . THR A 1 214 ? -13.364 17.699  42.977  1.00 31.09  ? 214  THR A CA    1 
ATOM   1770 C  C     . THR A 1 214 ? -12.602 18.652  43.891  1.00 31.02  ? 214  THR A C     1 
ATOM   1771 O  O     . THR A 1 214 ? -13.105 19.049  44.941  1.00 28.77  ? 214  THR A O     1 
ATOM   1772 C  CB    . THR A 1 214 ? -13.356 18.164  41.477  1.00 32.94  ? 214  THR A CB    1 
ATOM   1773 O  OG1   . THR A 1 214 ? -12.002 18.283  41.017  1.00 32.00  ? 214  THR A OG1   1 
ATOM   1774 C  CG2   . THR A 1 214 ? -14.074 19.495  41.297  1.00 28.79  ? 214  THR A CG2   1 
ATOM   1775 N  N     . GLY A 1 215 ? -11.381 18.995  43.483  1.00 31.71  ? 215  GLY A N     1 
ATOM   1776 C  CA    . GLY A 1 215 ? -10.482 19.832  44.272  1.00 32.63  ? 215  GLY A CA    1 
ATOM   1777 C  C     . GLY A 1 215 ? -9.068  19.379  43.994  1.00 34.15  ? 215  GLY A C     1 
ATOM   1778 O  O     . GLY A 1 215 ? -8.843  18.595  43.072  1.00 38.62  ? 215  GLY A O     1 
ATOM   1779 N  N     . TRP A 1 216 ? -8.113  19.857  44.781  1.00 31.54  ? 216  TRP A N     1 
ATOM   1780 C  CA    . TRP A 1 216 ? -6.722  19.493  44.571  1.00 32.01  ? 216  TRP A CA    1 
ATOM   1781 C  C     . TRP A 1 216 ? -6.235  18.522  45.651  1.00 32.90  ? 216  TRP A C     1 
ATOM   1782 O  O     . TRP A 1 216 ? -6.109  18.892  46.818  1.00 30.85  ? 216  TRP A O     1 
ATOM   1783 C  CB    . TRP A 1 216 ? -5.837  20.743  44.499  1.00 31.81  ? 216  TRP A CB    1 
ATOM   1784 C  CG    . TRP A 1 216 ? -4.515  20.458  43.846  1.00 36.03  ? 216  TRP A CG    1 
ATOM   1785 C  CD1   . TRP A 1 216 ? -3.334  20.187  44.473  1.00 35.23  ? 216  TRP A CD1   1 
ATOM   1786 C  CD2   . TRP A 1 216 ? -4.247  20.385  42.435  1.00 34.42  ? 216  TRP A CD2   1 
ATOM   1787 N  NE1   . TRP A 1 216 ? -2.347  19.959  43.546  1.00 37.47  ? 216  TRP A NE1   1 
ATOM   1788 C  CE2   . TRP A 1 216 ? -2.876  20.073  42.288  1.00 35.32  ? 216  TRP A CE2   1 
ATOM   1789 C  CE3   . TRP A 1 216 ? -5.028  20.559  41.286  1.00 37.13  ? 216  TRP A CE3   1 
ATOM   1790 C  CZ2   . TRP A 1 216 ? -2.263  19.931  41.032  1.00 35.04  ? 216  TRP A CZ2   1 
ATOM   1791 C  CZ3   . TRP A 1 216 ? -4.415  20.416  40.027  1.00 38.10  ? 216  TRP A CZ3   1 
ATOM   1792 C  CH2   . TRP A 1 216 ? -3.045  20.107  39.918  1.00 34.37  ? 216  TRP A CH2   1 
ATOM   1793 N  N     . ASN A 1 217 ? -5.972  17.278  45.244  1.00 34.83  ? 217  ASN A N     1 
ATOM   1794 C  CA    . ASN A 1 217 ? -5.615  16.183  46.160  1.00 35.53  ? 217  ASN A CA    1 
ATOM   1795 C  C     . ASN A 1 217 ? -6.731  15.748  47.114  1.00 33.68  ? 217  ASN A C     1 
ATOM   1796 O  O     . ASN A 1 217 ? -6.465  15.138  48.145  1.00 34.44  ? 217  ASN A O     1 
ATOM   1797 C  CB    . ASN A 1 217 ? -4.348  16.510  46.966  1.00 38.21  ? 217  ASN A CB    1 
ATOM   1798 C  CG    . ASN A 1 217 ? -3.087  16.104  46.257  1.00 43.20  ? 217  ASN A CG    1 
ATOM   1799 O  OD1   . ASN A 1 217 ? -2.980  14.985  45.734  1.00 43.10  ? 217  ASN A OD1   1 
ATOM   1800 N  ND2   . ASN A 1 217 ? -2.108  17.009  46.238  1.00 42.08  ? 217  ASN A ND2   1 
ATOM   1801 N  N     . VAL A 1 218 ? -7.977  16.035  46.769  1.00 32.82  ? 218  VAL A N     1 
ATOM   1802 C  CA    . VAL A 1 218 ? -9.095  15.671  47.651  1.00 34.89  ? 218  VAL A CA    1 
ATOM   1803 C  C     . VAL A 1 218 ? -9.235  14.175  47.905  1.00 36.35  ? 218  VAL A C     1 
ATOM   1804 O  O     . VAL A 1 218 ? -9.626  13.776  49.001  1.00 35.87  ? 218  VAL A O     1 
ATOM   1805 C  CB    . VAL A 1 218 ? -10.434 16.250  47.172  1.00 34.17  ? 218  VAL A CB    1 
ATOM   1806 C  CG1   . VAL A 1 218 ? -10.377 17.770  47.221  1.00 33.77  ? 218  VAL A CG1   1 
ATOM   1807 C  CG2   . VAL A 1 218 ? -10.786 15.744  45.759  1.00 29.29  ? 218  VAL A CG2   1 
ATOM   1808 N  N     . GLU A 1 219 ? -8.900  13.356  46.903  1.00 38.96  ? 219  GLU A N     1 
ATOM   1809 C  CA    . GLU A 1 219 ? -8.993  11.902  47.026  1.00 41.94  ? 219  GLU A CA    1 
ATOM   1810 C  C     . GLU A 1 219 ? -7.962  11.353  48.005  1.00 42.82  ? 219  GLU A C     1 
ATOM   1811 O  O     . GLU A 1 219 ? -8.265  10.451  48.789  1.00 44.51  ? 219  GLU A O     1 
ATOM   1812 C  CB    . GLU A 1 219 ? -8.848  11.200  45.670  1.00 43.58  ? 219  GLU A CB    1 
ATOM   1813 C  CG    . GLU A 1 219 ? -9.168  9.697   45.740  1.00 48.80  ? 219  GLU A CG    1 
ATOM   1814 C  CD    . GLU A 1 219 ? -8.978  8.960   44.424  1.00 53.64  ? 219  GLU A CD    1 
ATOM   1815 O  OE1   . GLU A 1 219 ? -9.904  8.217   44.030  1.00 50.69  ? 219  GLU A OE1   1 
ATOM   1816 O  OE2   . GLU A 1 219 ? -7.909  9.113   43.789  1.00 56.85  ? 219  GLU A OE2   1 
ATOM   1817 N  N     . SER A 1 220 ? -6.749  11.895  47.959  1.00 40.68  ? 220  SER A N     1 
ATOM   1818 C  CA    . SER A 1 220 ? -5.678  11.391  48.808  1.00 39.95  ? 220  SER A CA    1 
ATOM   1819 C  C     . SER A 1 220 ? -5.609  12.086  50.167  1.00 38.43  ? 220  SER A C     1 
ATOM   1820 O  O     . SER A 1 220 ? -5.083  11.514  51.123  1.00 39.97  ? 220  SER A O     1 
ATOM   1821 C  CB    . SER A 1 220 ? -4.321  11.434  48.083  1.00 39.97  ? 220  SER A CB    1 
ATOM   1822 O  OG    . SER A 1 220 ? -4.057  12.707  47.524  1.00 40.03  ? 220  SER A OG    1 
ATOM   1823 N  N     . PHE A 1 221 ? -6.138  13.305  50.261  1.00 33.08  ? 221  PHE A N     1 
ATOM   1824 C  CA    . PHE A 1 221 ? -6.055  14.039  51.514  1.00 32.63  ? 221  PHE A CA    1 
ATOM   1825 C  C     . PHE A 1 221 ? -7.380  14.514  52.115  1.00 33.60  ? 221  PHE A C     1 
ATOM   1826 O  O     . PHE A 1 221 ? -7.787  14.018  53.169  1.00 35.13  ? 221  PHE A O     1 
ATOM   1827 C  CB    . PHE A 1 221 ? -5.056  15.204  51.438  1.00 33.40  ? 221  PHE A CB    1 
ATOM   1828 C  CG    . PHE A 1 221 ? -4.959  15.972  52.721  1.00 33.17  ? 221  PHE A CG    1 
ATOM   1829 C  CD1   . PHE A 1 221 ? -5.579  17.205  52.857  1.00 31.66  ? 221  PHE A CD1   1 
ATOM   1830 C  CD2   . PHE A 1 221 ? -4.292  15.430  53.822  1.00 33.30  ? 221  PHE A CD2   1 
ATOM   1831 C  CE1   . PHE A 1 221 ? -5.526  17.896  54.060  1.00 31.14  ? 221  PHE A CE1   1 
ATOM   1832 C  CE2   . PHE A 1 221 ? -4.226  16.126  55.032  1.00 28.18  ? 221  PHE A CE2   1 
ATOM   1833 C  CZ    . PHE A 1 221 ? -4.842  17.352  55.149  1.00 30.93  ? 221  PHE A CZ    1 
ATOM   1834 N  N     . ALA A 1 222 ? -8.026  15.486  51.471  1.00 31.76  ? 222  ALA A N     1 
ATOM   1835 C  CA    . ALA A 1 222 ? -9.221  16.129  52.036  1.00 32.88  ? 222  ALA A CA    1 
ATOM   1836 C  C     . ALA A 1 222 ? -10.343 15.150  52.398  1.00 32.29  ? 222  ALA A C     1 
ATOM   1837 O  O     . ALA A 1 222 ? -10.899 15.208  53.494  1.00 31.35  ? 222  ALA A O     1 
ATOM   1838 C  CB    . ALA A 1 222 ? -9.749  17.213  51.091  1.00 30.60  ? 222  ALA A CB    1 
ATOM   1839 N  N     . ILE A 1 223 ? -10.687 14.267  51.471  1.00 32.28  ? 223  ILE A N     1 
ATOM   1840 C  CA    . ILE A 1 223 ? -11.812 13.365  51.692  1.00 32.87  ? 223  ILE A CA    1 
ATOM   1841 C  C     . ILE A 1 223 ? -11.539 12.421  52.867  1.00 34.18  ? 223  ILE A C     1 
ATOM   1842 O  O     . ILE A 1 223 ? -12.345 12.375  53.802  1.00 36.21  ? 223  ILE A O     1 
ATOM   1843 C  CB    . ILE A 1 223 ? -12.245 12.626  50.404  1.00 31.66  ? 223  ILE A CB    1 
ATOM   1844 C  CG1   . ILE A 1 223 ? -12.949 13.610  49.459  1.00 30.71  ? 223  ILE A CG1   1 
ATOM   1845 C  CG2   . ILE A 1 223 ? -13.163 11.437  50.734  1.00 31.95  ? 223  ILE A CG2   1 
ATOM   1846 C  CD1   . ILE A 1 223 ? -12.876 13.230  47.988  1.00 27.00  ? 223  ILE A CD1   1 
ATOM   1847 N  N     . PRO A 1 224 ? -10.398 11.694  52.843  1.00 33.75  ? 224  PRO A N     1 
ATOM   1848 C  CA    . PRO A 1 224 ? -10.118 10.818  53.979  1.00 34.13  ? 224  PRO A CA    1 
ATOM   1849 C  C     . PRO A 1 224 ? -9.867  11.538  55.303  1.00 34.86  ? 224  PRO A C     1 
ATOM   1850 O  O     . PRO A 1 224 ? -10.193 10.986  56.359  1.00 33.88  ? 224  PRO A O     1 
ATOM   1851 C  CB    . PRO A 1 224 ? -8.867  10.035  53.543  1.00 35.80  ? 224  PRO A CB    1 
ATOM   1852 C  CG    . PRO A 1 224 ? -8.327  10.753  52.354  1.00 34.89  ? 224  PRO A CG    1 
ATOM   1853 C  CD    . PRO A 1 224 ? -9.468  11.457  51.721  1.00 32.97  ? 224  PRO A CD    1 
ATOM   1854 N  N     . TYR A 1 225 ? -9.303  12.746  55.267  1.00 32.67  ? 225  TYR A N     1 
ATOM   1855 C  CA    . TYR A 1 225 ? -9.103  13.473  56.520  1.00 33.88  ? 225  TYR A CA    1 
ATOM   1856 C  C     . TYR A 1 225 ? -10.437 13.842  57.156  1.00 32.36  ? 225  TYR A C     1 
ATOM   1857 O  O     . TYR A 1 225 ? -10.641 13.621  58.352  1.00 32.65  ? 225  TYR A O     1 
ATOM   1858 C  CB    . TYR A 1 225 ? -8.203  14.716  56.391  1.00 32.60  ? 225  TYR A CB    1 
ATOM   1859 C  CG    . TYR A 1 225 ? -7.623  15.078  57.739  1.00 32.08  ? 225  TYR A CG    1 
ATOM   1860 C  CD1   . TYR A 1 225 ? -8.388  15.759  58.687  1.00 33.40  ? 225  TYR A CD1   1 
ATOM   1861 C  CD2   . TYR A 1 225 ? -6.327  14.694  58.094  1.00 32.27  ? 225  TYR A CD2   1 
ATOM   1862 C  CE1   . TYR A 1 225 ? -7.879  16.056  59.951  1.00 30.25  ? 225  TYR A CE1   1 
ATOM   1863 C  CE2   . TYR A 1 225 ? -5.805  14.993  59.356  1.00 31.18  ? 225  TYR A CE2   1 
ATOM   1864 C  CZ    . TYR A 1 225 ? -6.589  15.676  60.274  1.00 33.29  ? 225  TYR A CZ    1 
ATOM   1865 O  OH    . TYR A 1 225 ? -6.097  15.980  61.526  1.00 36.50  ? 225  TYR A OH    1 
ATOM   1866 N  N     . VAL A 1 226 ? -11.329 14.408  56.350  1.00 30.54  ? 226  VAL A N     1 
ATOM   1867 C  CA    . VAL A 1 226 ? -12.656 14.782  56.810  1.00 30.49  ? 226  VAL A CA    1 
ATOM   1868 C  C     . VAL A 1 226 ? -13.409 13.555  57.331  1.00 31.05  ? 226  VAL A C     1 
ATOM   1869 O  O     . VAL A 1 226 ? -13.961 13.594  58.427  1.00 32.14  ? 226  VAL A O     1 
ATOM   1870 C  CB    . VAL A 1 226 ? -13.449 15.511  55.698  1.00 29.08  ? 226  VAL A CB    1 
ATOM   1871 C  CG1   . VAL A 1 226 ? -14.941 15.518  55.982  1.00 28.67  ? 226  VAL A CG1   1 
ATOM   1872 C  CG2   . VAL A 1 226 ? -12.942 16.927  55.540  1.00 27.67  ? 226  VAL A CG2   1 
ATOM   1873 N  N     . TYR A 1 227 ? -13.398 12.470  56.555  1.00 31.00  ? 227  TYR A N     1 
ATOM   1874 C  CA    . TYR A 1 227 ? -14.085 11.233  56.928  1.00 31.45  ? 227  TYR A CA    1 
ATOM   1875 C  C     . TYR A 1 227 ? -13.576 10.636  58.246  1.00 33.90  ? 227  TYR A C     1 
ATOM   1876 O  O     . TYR A 1 227 ? -14.369 10.227  59.093  1.00 33.64  ? 227  TYR A O     1 
ATOM   1877 C  CB    . TYR A 1 227 ? -13.954 10.194  55.817  1.00 30.80  ? 227  TYR A CB    1 
ATOM   1878 C  CG    . TYR A 1 227 ? -14.666 8.896   56.116  1.00 33.43  ? 227  TYR A CG    1 
ATOM   1879 C  CD1   . TYR A 1 227 ? -16.006 8.722   55.775  1.00 31.95  ? 227  TYR A CD1   1 
ATOM   1880 C  CD2   . TYR A 1 227 ? -13.996 7.836   56.735  1.00 34.54  ? 227  TYR A CD2   1 
ATOM   1881 C  CE1   . TYR A 1 227 ? -16.659 7.533   56.039  1.00 36.79  ? 227  TYR A CE1   1 
ATOM   1882 C  CE2   . TYR A 1 227 ? -14.641 6.640   57.006  1.00 35.59  ? 227  TYR A CE2   1 
ATOM   1883 C  CZ    . TYR A 1 227 ? -15.972 6.498   56.653  1.00 36.65  ? 227  TYR A CZ    1 
ATOM   1884 O  OH    . TYR A 1 227 ? -16.621 5.330   56.913  1.00 37.85  ? 227  TYR A OH    1 
ATOM   1885 N  N     . ASN A 1 228 ? -12.255 10.585  58.397  1.00 35.83  ? 228  ASN A N     1 
ATOM   1886 C  CA    . ASN A 1 228 ? -11.615 10.014  59.578  1.00 35.14  ? 228  ASN A CA    1 
ATOM   1887 C  C     . ASN A 1 228 ? -11.715 10.887  60.816  1.00 36.49  ? 228  ASN A C     1 
ATOM   1888 O  O     . ASN A 1 228 ? -11.827 10.371  61.932  1.00 35.63  ? 228  ASN A O     1 
ATOM   1889 C  CB    . ASN A 1 228 ? -10.158 9.673   59.288  1.00 34.65  ? 228  ASN A CB    1 
ATOM   1890 C  CG    . ASN A 1 228 ? -10.011 8.383   58.502  1.00 36.06  ? 228  ASN A CG    1 
ATOM   1891 O  OD1   . ASN A 1 228 ? -10.362 7.313   58.982  1.00 41.70  ? 228  ASN A OD1   1 
ATOM   1892 N  ND2   . ASN A 1 228 ? -9.492  8.482   57.288  1.00 36.48  ? 228  ASN A ND2   1 
ATOM   1893 N  N     . ARG A 1 229 ? -11.679 12.203  60.614  1.00 36.16  ? 229  ARG A N     1 
ATOM   1894 C  CA    . ARG A 1 229 ? -11.801 13.154  61.716  1.00 35.26  ? 229  ARG A CA    1 
ATOM   1895 C  C     . ARG A 1 229 ? -13.205 13.102  62.296  1.00 35.80  ? 229  ARG A C     1 
ATOM   1896 O  O     . ARG A 1 229 ? -13.380 13.118  63.516  1.00 35.68  ? 229  ARG A O     1 
ATOM   1897 C  CB    . ARG A 1 229 ? -11.466 14.580  61.254  1.00 34.28  ? 229  ARG A CB    1 
ATOM   1898 C  CG    . ARG A 1 229 ? -11.502 15.628  62.355  1.00 33.93  ? 229  ARG A CG    1 
ATOM   1899 C  CD    . ARG A 1 229 ? -10.328 15.474  63.325  1.00 35.64  ? 229  ARG A CD    1 
ATOM   1900 N  NE    . ARG A 1 229 ? -10.447 16.352  64.490  1.00 34.36  ? 229  ARG A NE    1 
ATOM   1901 C  CZ    . ARG A 1 229 ? -9.690  16.257  65.584  1.00 38.81  ? 229  ARG A CZ    1 
ATOM   1902 N  NH1   . ARG A 1 229 ? -8.754  15.312  65.675  1.00 32.31  ? 229  ARG A NH1   1 
ATOM   1903 N  NH2   . ARG A 1 229 ? -9.876  17.102  66.599  1.00 37.06  ? 229  ARG A NH2   1 
ATOM   1904 N  N     . ILE A 1 230 ? -14.202 13.043  61.414  1.00 36.20  ? 230  ILE A N     1 
ATOM   1905 C  CA    . ILE A 1 230 ? -15.597 12.917  61.842  1.00 34.66  ? 230  ILE A CA    1 
ATOM   1906 C  C     . ILE A 1 230 ? -15.807 11.561  62.510  1.00 34.66  ? 230  ILE A C     1 
ATOM   1907 O  O     . ILE A 1 230 ? -16.430 11.487  63.580  1.00 36.52  ? 230  ILE A O     1 
ATOM   1908 C  CB    . ILE A 1 230 ? -16.599 13.180  60.686  1.00 33.36  ? 230  ILE A CB    1 
ATOM   1909 C  CG1   . ILE A 1 230 ? -16.537 14.656  60.263  1.00 29.77  ? 230  ILE A CG1   1 
ATOM   1910 C  CG2   . ILE A 1 230 ? -18.019 12.815  61.102  1.00 34.50  ? 230  ILE A CG2   1 
ATOM   1911 C  CD1   . ILE A 1 230 ? -17.303 14.983  58.982  1.00 31.19  ? 230  ILE A CD1   1 
ATOM   1912 N  N     . LYS A 1 231 ? -15.252 10.510  61.903  1.00 34.39  ? 231  LYS A N     1 
ATOM   1913 C  CA    . LYS A 1 231 ? -15.271 9.168   62.485  1.00 36.49  ? 231  LYS A CA    1 
ATOM   1914 C  C     . LYS A 1 231 ? -14.664 9.129   63.893  1.00 37.57  ? 231  LYS A C     1 
ATOM   1915 O  O     . LYS A 1 231 ? -15.259 8.566   64.809  1.00 38.86  ? 231  LYS A O     1 
ATOM   1916 C  CB    . LYS A 1 231 ? -14.570 8.155   61.574  1.00 37.00  ? 231  LYS A CB    1 
ATOM   1917 C  CG    . LYS A 1 231 ? -14.725 6.698   62.050  1.00 40.68  ? 231  LYS A CG    1 
ATOM   1918 C  CD    . LYS A 1 231 ? -14.053 5.688   61.122  1.00 42.88  ? 231  LYS A CD    1 
ATOM   1919 C  CE    . LYS A 1 231 ? -12.580 5.488   61.470  1.00 50.53  ? 231  LYS A CE    1 
ATOM   1920 N  NZ    . LYS A 1 231 ? -11.979 4.349   60.718  1.00 51.76  ? 231  LYS A NZ    1 
ATOM   1921 N  N     . ASN A 1 232 ? -13.488 9.733   64.057  1.00 37.83  ? 232  ASN A N     1 
ATOM   1922 C  CA    . ASN A 1 232 ? -12.814 9.784   65.355  1.00 41.21  ? 232  ASN A CA    1 
ATOM   1923 C  C     . ASN A 1 232 ? -13.573 10.569  66.430  1.00 41.90  ? 232  ASN A C     1 
ATOM   1924 O  O     . ASN A 1 232 ? -13.499 10.232  67.609  1.00 45.16  ? 232  ASN A O     1 
ATOM   1925 C  CB    . ASN A 1 232 ? -11.396 10.343  65.206  1.00 41.37  ? 232  ASN A CB    1 
ATOM   1926 C  CG    . ASN A 1 232 ? -10.435 9.363   64.538  1.00 43.66  ? 232  ASN A CG    1 
ATOM   1927 O  OD1   . ASN A 1 232 ? -10.736 8.177   64.361  1.00 45.48  ? 232  ASN A OD1   1 
ATOM   1928 N  ND2   . ASN A 1 232 ? -9.265  9.861   64.168  1.00 43.76  ? 232  ASN A ND2   1 
ATOM   1929 N  N     . ILE A 1 233 ? -14.302 11.607  66.017  1.00 41.57  ? 233  ILE A N     1 
ATOM   1930 C  CA    . ILE A 1 233 ? -15.046 12.467  66.943  1.00 38.99  ? 233  ILE A CA    1 
ATOM   1931 C  C     . ILE A 1 233 ? -16.463 11.959  67.234  1.00 40.14  ? 233  ILE A C     1 
ATOM   1932 O  O     . ILE A 1 233 ? -16.915 12.003  68.379  1.00 41.73  ? 233  ILE A O     1 
ATOM   1933 C  CB    . ILE A 1 233 ? -15.101 13.937  66.446  1.00 38.09  ? 233  ILE A CB    1 
ATOM   1934 C  CG1   . ILE A 1 233 ? -13.702 14.568  66.464  1.00 38.46  ? 233  ILE A CG1   1 
ATOM   1935 C  CG2   . ILE A 1 233 ? -16.045 14.781  67.305  1.00 35.91  ? 233  ILE A CG2   1 
ATOM   1936 C  CD1   . ILE A 1 233 ? -13.596 15.864  65.674  1.00 37.23  ? 233  ILE A CD1   1 
ATOM   1937 N  N     . PHE A 1 234 ? -17.150 11.468  66.205  1.00 39.37  ? 234  PHE A N     1 
ATOM   1938 C  CA    . PHE A 1 234 ? -18.574 11.154  66.320  1.00 38.74  ? 234  PHE A CA    1 
ATOM   1939 C  C     . PHE A 1 234 ? -18.883 9.674   66.164  1.00 38.48  ? 234  PHE A C     1 
ATOM   1940 O  O     . PHE A 1 234 ? -19.904 9.207   66.653  1.00 37.00  ? 234  PHE A O     1 
ATOM   1941 C  CB    . PHE A 1 234 ? -19.380 11.946  65.283  1.00 37.38  ? 234  PHE A CB    1 
ATOM   1942 C  CG    . PHE A 1 234 ? -19.316 13.440  65.463  1.00 36.99  ? 234  PHE A CG    1 
ATOM   1943 C  CD1   . PHE A 1 234 ? -18.529 14.223  64.619  1.00 35.21  ? 234  PHE A CD1   1 
ATOM   1944 C  CD2   . PHE A 1 234 ? -20.048 14.070  66.475  1.00 36.77  ? 234  PHE A CD2   1 
ATOM   1945 C  CE1   . PHE A 1 234 ? -18.472 15.619  64.777  1.00 36.32  ? 234  PHE A CE1   1 
ATOM   1946 C  CE2   . PHE A 1 234 ? -20.001 15.460  66.637  1.00 35.89  ? 234  PHE A CE2   1 
ATOM   1947 C  CZ    . PHE A 1 234 ? -19.215 16.234  65.788  1.00 34.93  ? 234  PHE A CZ    1 
ATOM   1948 N  N     . GLY A 1 235 ? -18.002 8.946   65.481  1.00 39.78  ? 235  GLY A N     1 
ATOM   1949 C  CA    . GLY A 1 235 ? -18.243 7.541   65.158  1.00 40.89  ? 235  GLY A CA    1 
ATOM   1950 C  C     . GLY A 1 235 ? -18.500 7.349   63.679  1.00 41.30  ? 235  GLY A C     1 
ATOM   1951 O  O     . GLY A 1 235 ? -18.676 8.321   62.946  1.00 42.23  ? 235  GLY A O     1 
ATOM   1952 N  N     . GLU A 1 236 ? -18.531 6.092   63.246  1.00 43.62  ? 236  GLU A N     1 
ATOM   1953 C  CA    . GLU A 1 236 ? -18.677 5.747   61.832  1.00 46.75  ? 236  GLU A CA    1 
ATOM   1954 C  C     . GLU A 1 236 ? -19.970 6.254   61.173  1.00 47.45  ? 236  GLU A C     1 
ATOM   1955 O  O     . GLU A 1 236 ? -19.927 6.784   60.059  1.00 48.35  ? 236  GLU A O     1 
ATOM   1956 C  CB    . GLU A 1 236 ? -18.522 4.237   61.622  1.00 50.09  ? 236  GLU A CB    1 
ATOM   1957 C  CG    . GLU A 1 236 ? -17.092 3.805   61.294  1.00 57.77  ? 236  GLU A CG    1 
ATOM   1958 C  CD    . GLU A 1 236 ? -16.959 2.312   60.980  1.00 64.75  ? 236  GLU A CD    1 
ATOM   1959 O  OE1   . GLU A 1 236 ? -17.814 1.761   60.245  1.00 64.44  ? 236  GLU A OE1   1 
ATOM   1960 O  OE2   . GLU A 1 236 ? -15.982 1.690   61.463  1.00 68.28  ? 236  GLU A OE2   1 
ATOM   1961 N  N     . SER A 1 237 ? -21.107 6.087   61.854  1.00 46.32  ? 237  SER A N     1 
ATOM   1962 C  CA    . SER A 1 237 ? -22.422 6.431   61.285  1.00 44.63  ? 237  SER A CA    1 
ATOM   1963 C  C     . SER A 1 237 ? -22.513 7.897   60.869  1.00 42.46  ? 237  SER A C     1 
ATOM   1964 O  O     . SER A 1 237 ? -23.148 8.239   59.866  1.00 40.69  ? 237  SER A O     1 
ATOM   1965 C  CB    . SER A 1 237 ? -23.545 6.112   62.275  1.00 45.54  ? 237  SER A CB    1 
ATOM   1966 O  OG    . SER A 1 237 ? -23.700 7.149   63.237  1.00 47.25  ? 237  SER A OG    1 
ATOM   1967 N  N     . THR A 1 238 ? -21.882 8.760   61.657  1.00 38.34  ? 238  THR A N     1 
ATOM   1968 C  CA    . THR A 1 238 ? -21.860 10.174  61.351  1.00 35.13  ? 238  THR A CA    1 
ATOM   1969 C  C     . THR A 1 238 ? -20.943 10.436  60.142  1.00 34.20  ? 238  THR A C     1 
ATOM   1970 O  O     . THR A 1 238 ? -21.323 11.169  59.234  1.00 35.78  ? 238  THR A O     1 
ATOM   1971 C  CB    . THR A 1 238 ? -21.450 11.000  62.590  1.00 35.49  ? 238  THR A CB    1 
ATOM   1972 O  OG1   . THR A 1 238 ? -22.262 10.617  63.710  1.00 37.30  ? 238  THR A OG1   1 
ATOM   1973 C  CG2   . THR A 1 238 ? -21.633 12.483  62.345  1.00 33.23  ? 238  THR A CG2   1 
ATOM   1974 N  N     . ALA A 1 239 ? -19.761 9.821   60.122  1.00 31.99  ? 239  ALA A N     1 
ATOM   1975 C  CA    . ALA A 1 239 ? -18.839 9.955   58.985  1.00 35.12  ? 239  ALA A CA    1 
ATOM   1976 C  C     . ALA A 1 239 ? -19.487 9.525   57.675  1.00 35.02  ? 239  ALA A C     1 
ATOM   1977 O  O     . ALA A 1 239 ? -19.281 10.155  56.637  1.00 34.24  ? 239  ALA A O     1 
ATOM   1978 C  CB    . ALA A 1 239 ? -17.553 9.163   59.221  1.00 32.77  ? 239  ALA A CB    1 
ATOM   1979 N  N     . LYS A 1 240 ? -20.282 8.459   57.742  1.00 36.44  ? 240  LYS A N     1 
ATOM   1980 C  CA    . LYS A 1 240 ? -20.940 7.896   56.564  1.00 38.31  ? 240  LYS A CA    1 
ATOM   1981 C  C     . LYS A 1 240 ? -22.053 8.784   55.990  1.00 38.29  ? 240  LYS A C     1 
ATOM   1982 O  O     . LYS A 1 240 ? -22.615 8.475   54.938  1.00 41.35  ? 240  LYS A O     1 
ATOM   1983 C  CB    . LYS A 1 240 ? -21.459 6.493   56.869  1.00 39.76  ? 240  LYS A CB    1 
ATOM   1984 C  CG    . LYS A 1 240 ? -20.351 5.487   57.139  1.00 42.62  ? 240  LYS A CG    1 
ATOM   1985 C  CD    . LYS A 1 240 ? -20.909 4.124   57.505  1.00 45.76  ? 240  LYS A CD    1 
ATOM   1986 C  CE    . LYS A 1 240 ? -19.842 3.054   57.389  1.00 47.80  ? 240  LYS A CE    1 
ATOM   1987 N  NZ    . LYS A 1 240 ? -20.443 1.695   57.484  1.00 49.39  ? 240  LYS A NZ    1 
ATOM   1988 N  N     . ARG A 1 241 ? -22.352 9.891   56.661  1.00 36.17  ? 241  ARG A N     1 
ATOM   1989 C  CA    . ARG A 1 241 ? -23.311 10.866  56.136  1.00 35.30  ? 241  ARG A CA    1 
ATOM   1990 C  C     . ARG A 1 241 ? -22.757 11.623  54.919  1.00 33.65  ? 241  ARG A C     1 
ATOM   1991 O  O     . ARG A 1 241 ? -23.498 12.305  54.212  1.00 34.77  ? 241  ARG A O     1 
ATOM   1992 C  CB    . ARG A 1 241 ? -23.766 11.834  57.233  1.00 34.12  ? 241  ARG A CB    1 
ATOM   1993 C  CG    . ARG A 1 241 ? -24.757 11.207  58.229  1.00 36.56  ? 241  ARG A CG    1 
ATOM   1994 C  CD    . ARG A 1 241 ? -25.063 12.151  59.383  1.00 33.90  ? 241  ARG A CD    1 
ATOM   1995 N  NE    . ARG A 1 241 ? -25.651 13.406  58.921  1.00 38.56  ? 241  ARG A NE    1 
ATOM   1996 C  CZ    . ARG A 1 241 ? -25.604 14.563  59.580  1.00 37.59  ? 241  ARG A CZ    1 
ATOM   1997 N  NH1   . ARG A 1 241 ? -24.992 14.653  60.754  1.00 38.67  ? 241  ARG A NH1   1 
ATOM   1998 N  NH2   . ARG A 1 241 ? -26.172 15.636  59.055  1.00 32.11  ? 241  ARG A NH2   1 
ATOM   1999 N  N     . LEU A 1 242 ? -21.455 11.495  54.689  1.00 32.06  ? 242  LEU A N     1 
ATOM   2000 C  CA    . LEU A 1 242 ? -20.816 12.001  53.470  1.00 32.63  ? 242  LEU A CA    1 
ATOM   2001 C  C     . LEU A 1 242 ? -21.262 11.238  52.221  1.00 31.80  ? 242  LEU A C     1 
ATOM   2002 O  O     . LEU A 1 242 ? -21.113 11.731  51.110  1.00 31.87  ? 242  LEU A O     1 
ATOM   2003 C  CB    . LEU A 1 242 ? -19.287 11.965  53.604  1.00 30.95  ? 242  LEU A CB    1 
ATOM   2004 C  CG    . LEU A 1 242 ? -18.718 12.920  54.660  1.00 31.17  ? 242  LEU A CG    1 
ATOM   2005 C  CD1   . LEU A 1 242 ? -17.260 12.589  54.963  1.00 32.53  ? 242  LEU A CD1   1 
ATOM   2006 C  CD2   . LEU A 1 242 ? -18.861 14.370  54.205  1.00 32.86  ? 242  LEU A CD2   1 
ATOM   2007 N  N     . SER A 1 243 ? -21.810 10.042  52.409  1.00 32.33  ? 243  SER A N     1 
ATOM   2008 C  CA    . SER A 1 243 ? -22.437 9.312   51.317  1.00 34.64  ? 243  SER A CA    1 
ATOM   2009 C  C     . SER A 1 243 ? -23.951 9.445   51.390  1.00 36.70  ? 243  SER A C     1 
ATOM   2010 O  O     . SER A 1 243 ? -24.543 9.127   52.431  1.00 39.82  ? 243  SER A O     1 
ATOM   2011 C  CB    . SER A 1 243 ? -22.053 7.833   51.357  1.00 33.02  ? 243  SER A CB    1 
ATOM   2012 O  OG    . SER A 1 243 ? -23.003 7.046   50.664  1.00 30.27  ? 243  SER A OG    1 
ATOM   2013 N  N     . PRO A 1 244 ? -24.589 9.878   50.279  1.00 35.63  ? 244  PRO A N     1 
ATOM   2014 C  CA    . PRO A 1 244 ? -26.046 10.056  50.250  1.00 36.52  ? 244  PRO A CA    1 
ATOM   2015 C  C     . PRO A 1 244 ? -26.820 8.766   50.515  1.00 37.26  ? 244  PRO A C     1 
ATOM   2016 O  O     . PRO A 1 244 ? -28.010 8.824   50.810  1.00 38.68  ? 244  PRO A O     1 
ATOM   2017 C  CB    . PRO A 1 244 ? -26.324 10.554  48.828  1.00 35.13  ? 244  PRO A CB    1 
ATOM   2018 C  CG    . PRO A 1 244 ? -25.099 10.201  48.037  1.00 36.90  ? 244  PRO A CG    1 
ATOM   2019 C  CD    . PRO A 1 244 ? -23.964 10.263  49.003  1.00 35.75  ? 244  PRO A CD    1 
ATOM   2020 N  N     . HIS A 1 245 ? -26.150 7.623   50.410  1.00 36.97  ? 245  HIS A N     1 
ATOM   2021 C  CA    . HIS A 1 245 ? -26.768 6.331   50.704  1.00 36.46  ? 245  HIS A CA    1 
ATOM   2022 C  C     . HIS A 1 245 ? -26.223 5.738   52.002  1.00 38.24  ? 245  HIS A C     1 
ATOM   2023 O  O     . HIS A 1 245 ? -26.531 4.598   52.344  1.00 38.30  ? 245  HIS A O     1 
ATOM   2024 C  CB    . HIS A 1 245 ? -26.532 5.353   49.555  1.00 34.49  ? 245  HIS A CB    1 
ATOM   2025 C  CG    . HIS A 1 245 ? -26.727 5.951   48.198  1.00 31.66  ? 245  HIS A CG    1 
ATOM   2026 N  ND1   . HIS A 1 245 ? -27.884 6.602   47.829  1.00 32.16  ? 245  HIS A ND1   1 
ATOM   2027 C  CD2   . HIS A 1 245 ? -25.915 5.983   47.115  1.00 31.07  ? 245  HIS A CD2   1 
ATOM   2028 C  CE1   . HIS A 1 245 ? -27.773 7.017   46.580  1.00 32.97  ? 245  HIS A CE1   1 
ATOM   2029 N  NE2   . HIS A 1 245 ? -26.588 6.654   46.123  1.00 31.62  ? 245  HIS A NE2   1 
ATOM   2030 N  N     . ARG A 1 246 ? -25.405 6.516   52.710  1.00 39.05  ? 246  ARG A N     1 
ATOM   2031 C  CA    . ARG A 1 246 ? -24.793 6.095   53.984  1.00 41.29  ? 246  ARG A CA    1 
ATOM   2032 C  C     . ARG A 1 246 ? -23.942 4.821   53.869  1.00 41.30  ? 246  ARG A C     1 
ATOM   2033 O  O     . ARG A 1 246 ? -23.877 4.013   54.802  1.00 38.62  ? 246  ARG A O     1 
ATOM   2034 C  CB    . ARG A 1 246 ? -25.847 5.943   55.101  1.00 42.58  ? 246  ARG A CB    1 
ATOM   2035 C  CG    . ARG A 1 246 ? -26.852 7.094   55.226  1.00 48.06  ? 246  ARG A CG    1 
ATOM   2036 C  CD    . ARG A 1 246 ? -26.188 8.409   55.651  1.00 53.99  ? 246  ARG A CD    1 
ATOM   2037 N  NE    . ARG A 1 246 ? -27.184 9.439   55.951  1.00 60.97  ? 246  ARG A NE    1 
ATOM   2038 C  CZ    . ARG A 1 246 ? -27.626 10.348  55.081  1.00 63.58  ? 246  ARG A CZ    1 
ATOM   2039 N  NH1   . ARG A 1 246 ? -27.161 10.383  53.837  1.00 63.32  ? 246  ARG A NH1   1 
ATOM   2040 N  NH2   . ARG A 1 246 ? -28.540 11.231  55.463  1.00 66.44  ? 246  ARG A NH2   1 
ATOM   2041 N  N     . LYS A 1 247 ? -23.293 4.636   52.724  1.00 41.74  ? 247  LYS A N     1 
ATOM   2042 C  CA    . LYS A 1 247 ? -22.359 3.525   52.579  1.00 44.54  ? 247  LYS A CA    1 
ATOM   2043 C  C     . LYS A 1 247 ? -20.982 3.996   52.109  1.00 44.74  ? 247  LYS A C     1 
ATOM   2044 O  O     . LYS A 1 247 ? -20.864 4.748   51.139  1.00 43.59  ? 247  LYS A O     1 
ATOM   2045 C  CB    . LYS A 1 247 ? -22.909 2.426   51.663  1.00 44.81  ? 247  LYS A CB    1 
ATOM   2046 C  CG    . LYS A 1 247 ? -22.177 1.098   51.860  1.00 50.07  ? 247  LYS A CG    1 
ATOM   2047 C  CD    . LYS A 1 247 ? -22.379 0.119   50.709  1.00 53.11  ? 247  LYS A CD    1 
ATOM   2048 C  CE    . LYS A 1 247 ? -21.375 -1.037  50.769  1.00 53.22  ? 247  LYS A CE    1 
ATOM   2049 N  NZ    . LYS A 1 247 ? -21.287 -1.688  52.112  1.00 53.59  ? 247  LYS A NZ    1 
ATOM   2050 N  N     . THR A 1 248 ? -19.948 3.570   52.829  1.00 45.43  ? 248  THR A N     1 
ATOM   2051 C  CA    . THR A 1 248 ? -18.576 3.856   52.437  1.00 48.71  ? 248  THR A CA    1 
ATOM   2052 C  C     . THR A 1 248 ? -17.745 2.582   52.440  1.00 53.14  ? 248  THR A C     1 
ATOM   2053 O  O     . THR A 1 248 ? -18.116 1.584   53.067  1.00 54.78  ? 248  THR A O     1 
ATOM   2054 C  CB    . THR A 1 248 ? -17.896 4.913   53.343  1.00 47.26  ? 248  THR A CB    1 
ATOM   2055 O  OG1   . THR A 1 248 ? -17.607 4.342   54.623  1.00 44.19  ? 248  THR A OG1   1 
ATOM   2056 C  CG2   . THR A 1 248 ? -18.771 6.155   53.509  1.00 46.18  ? 248  THR A CG2   1 
ATOM   2057 N  N     . ARG A 1 249 ? -16.622 2.628   51.734  1.00 57.80  ? 249  ARG A N     1 
ATOM   2058 C  CA    . ARG A 1 249 ? -15.684 1.519   51.688  1.00 63.02  ? 249  ARG A CA    1 
ATOM   2059 C  C     . ARG A 1 249 ? -14.278 2.063   51.891  1.00 65.55  ? 249  ARG A C     1 
ATOM   2060 O  O     . ARG A 1 249 ? -13.853 2.989   51.193  1.00 64.43  ? 249  ARG A O     1 
ATOM   2061 C  CB    . ARG A 1 249 ? -15.792 0.792   50.343  1.00 64.35  ? 249  ARG A CB    1 
ATOM   2062 C  CG    . ARG A 1 249 ? -15.266 -0.644  50.336  1.00 71.22  ? 249  ARG A CG    1 
ATOM   2063 C  CD    . ARG A 1 249 ? -16.193 -1.612  51.095  1.00 78.34  ? 249  ARG A CD    1 
ATOM   2064 N  NE    . ARG A 1 249 ? -17.516 -1.754  50.475  1.00 81.47  ? 249  ARG A NE    1 
ATOM   2065 C  CZ    . ARG A 1 249 ? -17.875 -2.749  49.664  1.00 83.55  ? 249  ARG A CZ    1 
ATOM   2066 N  NH1   . ARG A 1 249 ? -17.015 -3.715  49.356  1.00 84.27  ? 249  ARG A NH1   1 
ATOM   2067 N  NH2   . ARG A 1 249 ? -19.101 -2.782  49.157  1.00 83.34  ? 249  ARG A NH2   1 
ATOM   2068 N  N     . VAL A 1 250 ? -13.569 1.500   52.864  1.00 70.49  ? 250  VAL A N     1 
ATOM   2069 C  CA    . VAL A 1 250 ? -12.176 1.858   53.109  1.00 75.28  ? 250  VAL A CA    1 
ATOM   2070 C  C     . VAL A 1 250 ? -11.300 0.830   52.394  1.00 80.53  ? 250  VAL A C     1 
ATOM   2071 O  O     . VAL A 1 250 ? -11.185 -0.319  52.833  1.00 80.83  ? 250  VAL A O     1 
ATOM   2072 C  CB    . VAL A 1 250 ? -11.853 1.935   54.627  1.00 74.96  ? 250  VAL A CB    1 
ATOM   2073 C  CG1   . VAL A 1 250 ? -10.458 2.499   54.855  1.00 74.69  ? 250  VAL A CG1   1 
ATOM   2074 C  CG2   . VAL A 1 250 ? -12.884 2.788   55.357  1.00 73.87  ? 250  VAL A CG2   1 
ATOM   2075 N  N     . LYS A 1 251 ? -10.698 1.249   51.282  1.00 86.90  ? 251  LYS A N     1 
ATOM   2076 C  CA    . LYS A 1 251 ? -10.012 0.326   50.377  1.00 94.14  ? 251  LYS A CA    1 
ATOM   2077 C  C     . LYS A 1 251 ? -8.693  0.876   49.820  1.00 97.95  ? 251  LYS A C     1 
ATOM   2078 O  O     . LYS A 1 251 ? -8.626  2.021   49.363  1.00 97.53  ? 251  LYS A O     1 
ATOM   2079 C  CB    . LYS A 1 251 ? -10.944 -0.071  49.224  1.00 95.01  ? 251  LYS A CB    1 
ATOM   2080 C  CG    . LYS A 1 251 ? -10.456 -1.258  48.404  1.00 96.95  ? 251  LYS A CG    1 
ATOM   2081 C  CD    . LYS A 1 251 ? -10.733 -1.054  46.925  1.00 97.75  ? 251  LYS A CD    1 
ATOM   2082 C  CE    . LYS A 1 251 ? -9.903  -2.011  46.085  1.00 99.24  ? 251  LYS A CE    1 
ATOM   2083 N  NZ    . LYS A 1 251 ? -9.959  -1.667  44.640  1.00 100.00 ? 251  LYS A NZ    1 
ATOM   2084 N  N     . VAL A 1 252 ? -7.660  0.032   49.860  1.00 103.60 ? 252  VAL A N     1 
ATOM   2085 C  CA    . VAL A 1 252 ? -6.320  0.358   49.351  1.00 108.08 ? 252  VAL A CA    1 
ATOM   2086 C  C     . VAL A 1 252 ? -6.195  0.225   47.832  1.00 110.95 ? 252  VAL A C     1 
ATOM   2087 O  O     . VAL A 1 252 ? -6.921  -0.551  47.200  1.00 111.04 ? 252  VAL A O     1 
ATOM   2088 C  CB    . VAL A 1 252 ? -5.200  -0.516  50.013  1.00 109.03 ? 252  VAL A CB    1 
ATOM   2089 C  CG1   . VAL A 1 252 ? -4.423  0.273   51.061  1.00 108.96 ? 252  VAL A CG1   1 
ATOM   2090 C  CG2   . VAL A 1 252 ? -5.762  -1.820  50.589  1.00 110.44 ? 252  VAL A CG2   1 
ATOM   2091 N  N     . ILE A 1 253 ? -5.267  0.995   47.263  1.00 114.63 ? 253  ILE A N     1 
ATOM   2092 C  CA    . ILE A 1 253 ? -4.871  0.864   45.859  1.00 118.32 ? 253  ILE A CA    1 
ATOM   2093 C  C     . ILE A 1 253 ? -3.672  -0.087  45.783  1.00 121.18 ? 253  ILE A C     1 
ATOM   2094 O  O     . ILE A 1 253 ? -2.665  0.116   46.471  1.00 121.65 ? 253  ILE A O     1 
ATOM   2095 C  CB    . ILE A 1 253 ? -4.506  2.248   45.220  1.00 118.13 ? 253  ILE A CB    1 
ATOM   2096 C  CG1   . ILE A 1 253 ? -5.668  3.254   45.337  1.00 117.80 ? 253  ILE A CG1   1 
ATOM   2097 C  CG2   . ILE A 1 253 ? -4.034  2.091   43.763  1.00 118.24 ? 253  ILE A CG2   1 
ATOM   2098 C  CD1   . ILE A 1 253 ? -6.886  2.973   44.444  1.00 117.97 ? 253  ILE A CD1   1 
ATOM   2099 N  N     . GLU A 1 254 ? -3.797  -1.128  44.958  1.00 124.08 ? 254  GLU A N     1 
ATOM   2100 C  CA    . GLU A 1 254 ? -2.734  -2.124  44.777  1.00 127.05 ? 254  GLU A CA    1 
ATOM   2101 C  C     . GLU A 1 254 ? -1.666  -1.647  43.784  1.00 128.58 ? 254  GLU A C     1 
ATOM   2102 O  O     . GLU A 1 254 ? -1.784  -1.869  42.573  1.00 128.93 ? 254  GLU A O     1 
ATOM   2103 C  CB    . GLU A 1 254 ? -3.315  -3.474  44.325  1.00 127.70 ? 254  GLU A CB    1 
ATOM   2104 C  CG    . GLU A 1 254 ? -4.105  -4.235  45.391  1.00 127.68 ? 254  GLU A CG    1 
ATOM   2105 C  CD    . GLU A 1 254 ? -4.647  -5.572  44.893  1.00 128.16 ? 254  GLU A CD    1 
ATOM   2106 O  OE1   . GLU A 1 254 ? -4.826  -5.740  43.667  1.00 127.88 ? 254  GLU A OE1   1 
ATOM   2107 O  OE2   . GLU A 1 254 ? -4.903  -6.458  45.736  1.00 128.37 ? 254  GLU A OE2   1 
ATOM   2108 N  N     . ASN A 1 255 ? -0.630  -0.990  44.306  1.00 130.06 ? 255  ASN A N     1 
ATOM   2109 C  CA    . ASN A 1 255 ? 0.503   -0.531  43.493  1.00 131.53 ? 255  ASN A CA    1 
ATOM   2110 C  C     . ASN A 1 255 ? 1.753   -1.410  43.670  1.00 132.60 ? 255  ASN A C     1 
ATOM   2111 O  O     . ASN A 1 255 ? 1.638   -2.599  43.985  1.00 133.22 ? 255  ASN A O     1 
ATOM   2112 C  CB    . ASN A 1 255 ? 0.796   0.969   43.726  1.00 131.75 ? 255  ASN A CB    1 
ATOM   2113 C  CG    . ASN A 1 255 ? 1.277   1.278   45.146  1.00 132.67 ? 255  ASN A CG    1 
ATOM   2114 O  OD1   . ASN A 1 255 ? 2.408   1.727   45.341  1.00 133.02 ? 255  ASN A OD1   1 
ATOM   2115 N  ND2   . ASN A 1 255 ? 0.414   1.057   46.136  1.00 132.44 ? 255  ASN A ND2   1 
ATOM   2116 N  N     . MET A 1 256 ? 2.935   -0.832  43.460  1.00 133.00 ? 256  MET A N     1 
ATOM   2117 C  CA    . MET A 1 256 ? 4.190   -1.581  43.554  1.00 134.01 ? 256  MET A CA    1 
ATOM   2118 C  C     . MET A 1 256 ? 5.261   -0.831  44.368  1.00 133.66 ? 256  MET A C     1 
ATOM   2119 O  O     . MET A 1 256 ? 6.448   -1.170  44.318  1.00 134.67 ? 256  MET A O     1 
ATOM   2120 C  CB    . MET A 1 256 ? 4.696   -1.930  42.147  1.00 134.83 ? 256  MET A CB    1 
ATOM   2121 C  CG    . MET A 1 256 ? 5.479   -3.238  42.054  1.00 136.48 ? 256  MET A CG    1 
ATOM   2122 S  SD    . MET A 1 256 ? 5.554   -3.922  40.382  1.00 137.49 ? 256  MET A SD    1 
ATOM   2123 C  CE    . MET A 1 256 ? 6.497   -2.668  39.512  1.00 137.22 ? 256  MET A CE    1 
ATOM   2124 N  N     . TYR A 1 257 ? 4.827   0.177   45.125  1.00 132.04 ? 257  TYR A N     1 
ATOM   2125 C  CA    . TYR A 1 257 ? 5.734   0.998   45.934  1.00 131.06 ? 257  TYR A CA    1 
ATOM   2126 C  C     . TYR A 1 257 ? 5.272   1.131   47.394  1.00 129.16 ? 257  TYR A C     1 
ATOM   2127 O  O     . TYR A 1 257 ? 5.942   1.774   48.209  1.00 129.36 ? 257  TYR A O     1 
ATOM   2128 C  CB    . TYR A 1 257 ? 5.916   2.389   45.301  1.00 131.34 ? 257  TYR A CB    1 
ATOM   2129 C  CG    . TYR A 1 257 ? 6.230   2.384   43.814  1.00 132.49 ? 257  TYR A CG    1 
ATOM   2130 C  CD1   . TYR A 1 257 ? 5.347   2.955   42.893  1.00 132.50 ? 257  TYR A CD1   1 
ATOM   2131 C  CD2   . TYR A 1 257 ? 7.408   1.810   43.326  1.00 133.86 ? 257  TYR A CD2   1 
ATOM   2132 C  CE1   . TYR A 1 257 ? 5.629   2.954   41.525  1.00 132.57 ? 257  TYR A CE1   1 
ATOM   2133 C  CE2   . TYR A 1 257 ? 7.698   1.802   41.962  1.00 133.89 ? 257  TYR A CE2   1 
ATOM   2134 C  CZ    . TYR A 1 257 ? 6.806   2.375   41.069  1.00 133.25 ? 257  TYR A CZ    1 
ATOM   2135 O  OH    . TYR A 1 257 ? 7.092   2.368   39.723  1.00 133.04 ? 257  TYR A OH    1 
ATOM   2136 N  N     . GLY A 1 258 ? 4.133   0.517   47.713  1.00 126.71 ? 258  GLY A N     1 
ATOM   2137 C  CA    . GLY A 1 258 ? 3.556   0.569   49.058  1.00 123.62 ? 258  GLY A CA    1 
ATOM   2138 C  C     . GLY A 1 258 ? 2.047   0.399   49.034  1.00 120.73 ? 258  GLY A C     1 
ATOM   2139 O  O     . GLY A 1 258 ? 1.522   -0.412  48.266  1.00 121.04 ? 258  GLY A O     1 
ATOM   2140 N  N     . SER A 1 259 ? 1.353   1.161   49.883  1.00 117.29 ? 259  SER A N     1 
ATOM   2141 C  CA    . SER A 1 259 ? -0.116  1.159   49.930  1.00 113.24 ? 259  SER A CA    1 
ATOM   2142 C  C     . SER A 1 259 ? -0.686  2.440   50.541  1.00 109.79 ? 259  SER A C     1 
ATOM   2143 O  O     . SER A 1 259 ? -0.198  2.922   51.568  1.00 109.88 ? 259  SER A O     1 
ATOM   2144 C  CB    . SER A 1 259 ? -0.645  -0.066  50.693  1.00 113.76 ? 259  SER A CB    1 
ATOM   2145 O  OG    . SER A 1 259 ? -0.295  -0.021  52.067  1.00 113.46 ? 259  SER A OG    1 
ATOM   2146 N  N     . ARG A 1 260 ? -1.714  2.987   49.895  1.00 105.45 ? 260  ARG A N     1 
ATOM   2147 C  CA    . ARG A 1 260 ? -2.481  4.110   50.446  1.00 100.98 ? 260  ARG A CA    1 
ATOM   2148 C  C     . ARG A 1 260 ? -3.986  3.826   50.389  1.00 96.48  ? 260  ARG A C     1 
ATOM   2149 O  O     . ARG A 1 260 ? -4.481  3.261   49.409  1.00 96.30  ? 260  ARG A O     1 
ATOM   2150 C  CB    . ARG A 1 260 ? -2.129  5.440   49.751  1.00 101.65 ? 260  ARG A CB    1 
ATOM   2151 C  CG    . ARG A 1 260 ? -2.487  5.544   48.263  1.00 102.15 ? 260  ARG A CG    1 
ATOM   2152 C  CD    . ARG A 1 260 ? -2.241  6.957   47.742  1.00 102.66 ? 260  ARG A CD    1 
ATOM   2153 N  NE    . ARG A 1 260 ? -2.669  7.133   46.353  1.00 103.41 ? 260  ARG A NE    1 
ATOM   2154 C  CZ    . ARG A 1 260 ? -3.773  7.774   45.970  1.00 103.19 ? 260  ARG A CZ    1 
ATOM   2155 N  NH1   . ARG A 1 260 ? -4.587  8.316   46.867  1.00 102.53 ? 260  ARG A NH1   1 
ATOM   2156 N  NH2   . ARG A 1 260 ? -4.066  7.878   44.680  1.00 102.36 ? 260  ARG A NH2   1 
ATOM   2157 N  N     . GLU A 1 261 ? -4.699  4.205   51.450  1.00 90.56  ? 261  GLU A N     1 
ATOM   2158 C  CA    . GLU A 1 261 ? -6.142  3.963   51.543  1.00 84.20  ? 261  GLU A CA    1 
ATOM   2159 C  C     . GLU A 1 261 ? -7.001  5.192   51.246  1.00 77.47  ? 261  GLU A C     1 
ATOM   2160 O  O     . GLU A 1 261 ? -6.867  6.242   51.884  1.00 76.11  ? 261  GLU A O     1 
ATOM   2161 C  CB    . GLU A 1 261 ? -6.518  3.325   52.889  1.00 86.36  ? 261  GLU A CB    1 
ATOM   2162 C  CG    . GLU A 1 261 ? -7.068  1.896   52.752  1.00 87.95  ? 261  GLU A CG    1 
ATOM   2163 C  CD    . GLU A 1 261 ? -6.586  0.935   53.835  1.00 89.69  ? 261  GLU A CD    1 
ATOM   2164 O  OE1   . GLU A 1 261 ? -6.234  1.389   54.946  1.00 90.16  ? 261  GLU A OE1   1 
ATOM   2165 O  OE2   . GLU A 1 261 ? -6.565  -0.287  53.569  1.00 89.34  ? 261  GLU A OE2   1 
ATOM   2166 N  N     . ILE A 1 262 ? -7.868  5.042   50.249  1.00 69.79  ? 262  ILE A N     1 
ATOM   2167 C  CA    . ILE A 1 262 ? -8.840  6.069   49.888  1.00 61.43  ? 262  ILE A CA    1 
ATOM   2168 C  C     . ILE A 1 262 ? -10.233 5.653   50.368  1.00 55.87  ? 262  ILE A C     1 
ATOM   2169 O  O     . ILE A 1 262 ? -10.489 4.468   50.625  1.00 54.20  ? 262  ILE A O     1 
ATOM   2170 C  CB    . ILE A 1 262 ? -8.845  6.368   48.354  1.00 62.03  ? 262  ILE A CB    1 
ATOM   2171 C  CG1   . ILE A 1 262 ? -9.421  5.193   47.552  1.00 63.72  ? 262  ILE A CG1   1 
ATOM   2172 C  CG2   . ILE A 1 262 ? -7.439  6.713   47.863  1.00 62.06  ? 262  ILE A CG2   1 
ATOM   2173 C  CD1   . ILE A 1 262 ? -10.072 5.600   46.228  1.00 62.02  ? 262  ILE A CD1   1 
ATOM   2174 N  N     . ILE A 1 263 ? -11.126 6.629   50.494  1.00 49.28  ? 263  ILE A N     1 
ATOM   2175 C  CA    . ILE A 1 263 ? -12.484 6.360   50.947  1.00 44.74  ? 263  ILE A CA    1 
ATOM   2176 C  C     . ILE A 1 263 ? -13.455 6.488   49.783  1.00 42.88  ? 263  ILE A C     1 
ATOM   2177 O  O     . ILE A 1 263 ? -13.545 7.540   49.144  1.00 43.31  ? 263  ILE A O     1 
ATOM   2178 C  CB    . ILE A 1 263 ? -12.918 7.291   52.117  1.00 42.82  ? 263  ILE A CB    1 
ATOM   2179 C  CG1   . ILE A 1 263 ? -11.847 7.353   53.220  1.00 43.61  ? 263  ILE A CG1   1 
ATOM   2180 C  CG2   . ILE A 1 263 ? -14.282 6.874   52.675  1.00 42.81  ? 263  ILE A CG2   1 
ATOM   2181 C  CD1   . ILE A 1 263 ? -11.475 6.017   53.859  1.00 40.30  ? 263  ILE A CD1   1 
ATOM   2182 N  N     . THR A 1 264 ? -14.178 5.407   49.512  1.00 39.16  ? 264  THR A N     1 
ATOM   2183 C  CA    . THR A 1 264 ? -15.159 5.396   48.452  1.00 35.85  ? 264  THR A CA    1 
ATOM   2184 C  C     . THR A 1 264 ? -16.511 5.792   49.034  1.00 36.26  ? 264  THR A C     1 
ATOM   2185 O  O     . THR A 1 264 ? -17.037 5.120   49.927  1.00 36.04  ? 264  THR A O     1 
ATOM   2186 C  CB    . THR A 1 264 ? -15.237 4.020   47.772  1.00 36.05  ? 264  THR A CB    1 
ATOM   2187 O  OG1   . THR A 1 264 ? -13.996 3.751   47.103  1.00 34.69  ? 264  THR A OG1   1 
ATOM   2188 C  CG2   . THR A 1 264 ? -16.384 3.984   46.766  1.00 31.57  ? 264  THR A CG2   1 
ATOM   2189 N  N     . LEU A 1 265 ? -17.046 6.901   48.531  1.00 33.12  ? 265  LEU A N     1 
ATOM   2190 C  CA    . LEU A 1 265 ? -18.316 7.430   48.988  1.00 31.51  ? 265  LEU A CA    1 
ATOM   2191 C  C     . LEU A 1 265 ? -19.378 7.041   47.973  1.00 30.54  ? 265  LEU A C     1 
ATOM   2192 O  O     . LEU A 1 265 ? -19.451 7.615   46.894  1.00 28.05  ? 265  LEU A O     1 
ATOM   2193 C  CB    . LEU A 1 265 ? -18.244 8.955   49.143  1.00 28.96  ? 265  LEU A CB    1 
ATOM   2194 C  CG    . LEU A 1 265 ? -17.116 9.552   49.992  1.00 30.21  ? 265  LEU A CG    1 
ATOM   2195 C  CD1   . LEU A 1 265 ? -16.976 11.035  49.710  1.00 26.00  ? 265  LEU A CD1   1 
ATOM   2196 C  CD2   . LEU A 1 265 ? -17.326 9.317   51.489  1.00 25.72  ? 265  LEU A CD2   1 
ATOM   2197 N  N     . PHE A 1 266 ? -20.181 6.043   48.316  1.00 31.60  ? 266  PHE A N     1 
ATOM   2198 C  CA    . PHE A 1 266 ? -21.262 5.600   47.448  1.00 34.28  ? 266  PHE A CA    1 
ATOM   2199 C  C     . PHE A 1 266 ? -22.245 6.735   47.173  1.00 33.96  ? 266  PHE A C     1 
ATOM   2200 O  O     . PHE A 1 266 ? -22.642 7.456   48.084  1.00 30.50  ? 266  PHE A O     1 
ATOM   2201 C  CB    . PHE A 1 266 ? -21.953 4.378   48.044  1.00 36.09  ? 266  PHE A CB    1 
ATOM   2202 C  CG    . PHE A 1 266 ? -21.186 3.090   47.830  1.00 40.78  ? 266  PHE A CG    1 
ATOM   2203 C  CD1   . PHE A 1 266 ? -20.015 2.827   48.542  1.00 36.89  ? 266  PHE A CD1   1 
ATOM   2204 C  CD2   . PHE A 1 266 ? -21.635 2.144   46.907  1.00 44.16  ? 266  PHE A CD2   1 
ATOM   2205 C  CE1   . PHE A 1 266 ? -19.298 1.644   48.335  1.00 42.88  ? 266  PHE A CE1   1 
ATOM   2206 C  CE2   . PHE A 1 266 ? -20.925 0.946   46.691  1.00 46.05  ? 266  PHE A CE2   1 
ATOM   2207 C  CZ    . PHE A 1 266 ? -19.754 0.699   47.404  1.00 44.25  ? 266  PHE A CZ    1 
ATOM   2208 N  N     . GLY A 1 267 ? -22.597 6.911   45.901  1.00 34.49  ? 267  GLY A N     1 
ATOM   2209 C  CA    . GLY A 1 267 ? -23.508 7.984   45.496  1.00 33.77  ? 267  GLY A CA    1 
ATOM   2210 C  C     . GLY A 1 267 ? -22.826 9.317   45.222  1.00 34.24  ? 267  GLY A C     1 
ATOM   2211 O  O     . GLY A 1 267 ? -23.487 10.340  45.016  1.00 37.24  ? 267  GLY A O     1 
ATOM   2212 N  N     . ILE A 1 268 ? -21.501 9.319   45.221  1.00 32.15  ? 268  ILE A N     1 
ATOM   2213 C  CA    . ILE A 1 268 ? -20.749 10.495  44.791  1.00 29.52  ? 268  ILE A CA    1 
ATOM   2214 C  C     . ILE A 1 268 ? -19.703 10.076  43.763  1.00 30.35  ? 268  ILE A C     1 
ATOM   2215 O  O     . ILE A 1 268 ? -19.166 8.967   43.831  1.00 30.83  ? 268  ILE A O     1 
ATOM   2216 C  CB    . ILE A 1 268 ? -20.128 11.227  45.991  1.00 29.55  ? 268  ILE A CB    1 
ATOM   2217 C  CG1   . ILE A 1 268 ? -21.254 11.773  46.885  1.00 26.94  ? 268  ILE A CG1   1 
ATOM   2218 C  CG2   . ILE A 1 268 ? -19.184 12.361  45.534  1.00 24.48  ? 268  ILE A CG2   1 
ATOM   2219 C  CD1   . ILE A 1 268 ? -20.829 12.197  48.227  1.00 28.40  ? 268  ILE A CD1   1 
ATOM   2220 N  N     . SER A 1 269 ? -19.457 10.954  42.792  1.00 28.63  ? 269  SER A N     1 
ATOM   2221 C  CA    . SER A 1 269 ? -18.422 10.746  41.800  1.00 29.54  ? 269  SER A CA    1 
ATOM   2222 C  C     . SER A 1 269 ? -17.266 11.698  42.043  1.00 29.94  ? 269  SER A C     1 
ATOM   2223 O  O     . SER A 1 269 ? -17.335 12.890  41.730  1.00 31.07  ? 269  SER A O     1 
ATOM   2224 C  CB    . SER A 1 269 ? -18.977 10.914  40.390  1.00 30.10  ? 269  SER A CB    1 
ATOM   2225 O  OG    . SER A 1 269 ? -19.711 9.759   40.024  1.00 31.93  ? 269  SER A OG    1 
ATOM   2226 N  N     . VAL A 1 270 ? -16.197 11.150  42.601  1.00 30.04  ? 270  VAL A N     1 
ATOM   2227 C  CA    . VAL A 1 270 ? -15.027 11.922  42.963  1.00 27.56  ? 270  VAL A CA    1 
ATOM   2228 C  C     . VAL A 1 270 ? -14.113 12.037  41.744  1.00 28.28  ? 270  VAL A C     1 
ATOM   2229 O  O     . VAL A 1 270 ? -13.663 11.033  41.208  1.00 28.21  ? 270  VAL A O     1 
ATOM   2230 C  CB    . VAL A 1 270 ? -14.293 11.268  44.159  1.00 27.39  ? 270  VAL A CB    1 
ATOM   2231 C  CG1   . VAL A 1 270 ? -12.999 12.010  44.488  1.00 23.57  ? 270  VAL A CG1   1 
ATOM   2232 C  CG2   . VAL A 1 270 ? -15.207 11.224  45.363  1.00 23.87  ? 270  VAL A CG2   1 
ATOM   2233 N  N     . LEU A 1 271 ? -13.890 13.266  41.285  1.00 30.36  ? 271  LEU A N     1 
ATOM   2234 C  CA    . LEU A 1 271 ? -12.929 13.532  40.222  1.00 31.64  ? 271  LEU A CA    1 
ATOM   2235 C  C     . LEU A 1 271 ? -11.869 14.459  40.767  1.00 30.01  ? 271  LEU A C     1 
ATOM   2236 O  O     . LEU A 1 271 ? -11.955 15.671  40.569  1.00 29.42  ? 271  LEU A O     1 
ATOM   2237 C  CB    . LEU A 1 271 ? -13.584 14.187  38.999  1.00 32.49  ? 271  LEU A CB    1 
ATOM   2238 C  CG    . LEU A 1 271 ? -14.745 13.529  38.236  1.00 36.92  ? 271  LEU A CG    1 
ATOM   2239 C  CD1   . LEU A 1 271 ? -15.249 14.487  37.161  1.00 31.07  ? 271  LEU A CD1   1 
ATOM   2240 C  CD2   . LEU A 1 271 ? -14.343 12.199  37.607  1.00 37.58  ? 271  LEU A CD2   1 
ATOM   2241 N  N     . ASP A 1 272 ? -10.875 13.895  41.455  1.00 29.18  ? 272  ASP A N     1 
ATOM   2242 C  CA    . ASP A 1 272 ? -9.771  14.696  42.001  1.00 31.74  ? 272  ASP A CA    1 
ATOM   2243 C  C     . ASP A 1 272 ? -9.121  15.431  40.830  1.00 30.31  ? 272  ASP A C     1 
ATOM   2244 O  O     . ASP A 1 272 ? -8.735  14.794  39.844  1.00 29.42  ? 272  ASP A O     1 
ATOM   2245 C  CB    . ASP A 1 272 ? -8.760  13.787  42.716  1.00 32.65  ? 272  ASP A CB    1 
ATOM   2246 C  CG    . ASP A 1 272 ? -7.721  14.560  43.537  1.00 35.45  ? 272  ASP A CG    1 
ATOM   2247 O  OD1   . ASP A 1 272 ? -7.346  15.702  43.176  1.00 38.36  ? 272  ASP A OD1   1 
ATOM   2248 O  OD2   . ASP A 1 272 ? -7.254  13.993  44.552  1.00 36.52  ? 272  ASP A OD2   1 
ATOM   2249 N  N     . TYR A 1 273 ? -9.014  16.758  40.917  1.00 29.89  ? 273  TYR A N     1 
ATOM   2250 C  CA    . TYR A 1 273 ? -8.502  17.526  39.778  1.00 30.03  ? 273  TYR A CA    1 
ATOM   2251 C  C     . TYR A 1 273 ? -7.054  17.192  39.421  1.00 32.32  ? 273  TYR A C     1 
ATOM   2252 O  O     . TYR A 1 273 ? -6.679  17.271  38.245  1.00 31.93  ? 273  TYR A O     1 
ATOM   2253 C  CB    . TYR A 1 273 ? -8.707  19.037  39.925  1.00 30.90  ? 273  TYR A CB    1 
ATOM   2254 C  CG    . TYR A 1 273 ? -9.018  19.676  38.593  1.00 30.31  ? 273  TYR A CG    1 
ATOM   2255 C  CD1   . TYR A 1 273 ? -7.996  20.087  37.730  1.00 30.24  ? 273  TYR A CD1   1 
ATOM   2256 C  CD2   . TYR A 1 273 ? -10.341 19.837  38.175  1.00 31.26  ? 273  TYR A CD2   1 
ATOM   2257 C  CE1   . TYR A 1 273 ? -8.288  20.650  36.497  1.00 31.02  ? 273  TYR A CE1   1 
ATOM   2258 C  CE2   . TYR A 1 273 ? -10.643 20.400  36.953  1.00 30.28  ? 273  TYR A CE2   1 
ATOM   2259 C  CZ    . TYR A 1 273 ? -9.613  20.801  36.115  1.00 32.69  ? 273  TYR A CZ    1 
ATOM   2260 O  OH    . TYR A 1 273 ? -9.915  21.353  34.898  1.00 33.24  ? 273  TYR A OH    1 
ATOM   2261 N  N     . ILE A 1 274 ? -6.246  16.800  40.411  1.00 31.70  ? 274  ILE A N     1 
ATOM   2262 C  CA    . ILE A 1 274 ? -4.862  16.396  40.117  1.00 32.80  ? 274  ILE A CA    1 
ATOM   2263 C  C     . ILE A 1 274 ? -4.829  15.198  39.153  1.00 33.45  ? 274  ILE A C     1 
ATOM   2264 O  O     . ILE A 1 274 ? -4.050  15.182  38.196  1.00 36.84  ? 274  ILE A O     1 
ATOM   2265 C  CB    . ILE A 1 274 ? -4.015  16.143  41.402  1.00 33.92  ? 274  ILE A CB    1 
ATOM   2266 C  CG1   . ILE A 1 274 ? -2.519  16.177  41.077  1.00 34.96  ? 274  ILE A CG1   1 
ATOM   2267 C  CG2   . ILE A 1 274 ? -4.403  14.823  42.090  1.00 32.68  ? 274  ILE A CG2   1 
ATOM   2268 C  CD1   . ILE A 1 274 ? -1.615  16.135  42.313  1.00 40.45  ? 274  ILE A CD1   1 
ATOM   2269 N  N     . ASP A 1 275 ? -5.711  14.229  39.382  1.00 33.12  ? 275  ASP A N     1 
ATOM   2270 C  CA    . ASP A 1 275 ? -5.804  13.041  38.539  1.00 33.83  ? 275  ASP A CA    1 
ATOM   2271 C  C     . ASP A 1 275 ? -6.377  13.370  37.168  1.00 32.41  ? 275  ASP A C     1 
ATOM   2272 O  O     . ASP A 1 275 ? -5.940  12.800  36.166  1.00 32.87  ? 275  ASP A O     1 
ATOM   2273 C  CB    . ASP A 1 275 ? -6.632  11.933  39.210  1.00 35.42  ? 275  ASP A CB    1 
ATOM   2274 C  CG    . ASP A 1 275 ? -6.033  11.457  40.522  1.00 37.14  ? 275  ASP A CG    1 
ATOM   2275 O  OD1   . ASP A 1 275 ? -4.799  11.485  40.677  1.00 40.44  ? 275  ASP A OD1   1 
ATOM   2276 O  OD2   . ASP A 1 275 ? -6.807  11.046  41.409  1.00 48.19  ? 275  ASP A OD2   1 
ATOM   2277 N  N     . LEU A 1 276 ? -7.364  14.268  37.127  1.00 30.49  ? 276  LEU A N     1 
ATOM   2278 C  CA    . LEU A 1 276 ? -7.867  14.795  35.853  1.00 29.45  ? 276  LEU A CA    1 
ATOM   2279 C  C     . LEU A 1 276 ? -6.739  15.485  35.085  1.00 29.33  ? 276  LEU A C     1 
ATOM   2280 O  O     . LEU A 1 276 ? -6.542  15.238  33.893  1.00 28.25  ? 276  LEU A O     1 
ATOM   2281 C  CB    . LEU A 1 276 ? -9.012  15.788  36.073  1.00 27.41  ? 276  LEU A CB    1 
ATOM   2282 C  CG    . LEU A 1 276 ? -10.395 15.318  36.529  1.00 29.94  ? 276  LEU A CG    1 
ATOM   2283 C  CD1   . LEU A 1 276 ? -11.269 16.529  36.732  1.00 21.22  ? 276  LEU A CD1   1 
ATOM   2284 C  CD2   . LEU A 1 276 ? -11.076 14.325  35.553  1.00 25.96  ? 276  LEU A CD2   1 
ATOM   2285 N  N     . TYR A 1 277 ? -6.004  16.353  35.776  1.00 29.70  ? 277  TYR A N     1 
ATOM   2286 C  CA    . TYR A 1 277 ? -4.891  17.075  35.166  1.00 30.31  ? 277  TYR A CA    1 
ATOM   2287 C  C     . TYR A 1 277 ? -3.842  16.107  34.615  1.00 31.63  ? 277  TYR A C     1 
ATOM   2288 O  O     . TYR A 1 277 ? -3.383  16.262  33.483  1.00 33.77  ? 277  TYR A O     1 
ATOM   2289 C  CB    . TYR A 1 277 ? -4.269  18.058  36.165  1.00 30.84  ? 277  TYR A CB    1 
ATOM   2290 C  CG    . TYR A 1 277 ? -3.271  19.011  35.554  1.00 31.46  ? 277  TYR A CG    1 
ATOM   2291 C  CD1   . TYR A 1 277 ? -3.664  20.282  35.127  1.00 30.39  ? 277  TYR A CD1   1 
ATOM   2292 C  CD2   . TYR A 1 277 ? -1.934  18.642  35.397  1.00 29.10  ? 277  TYR A CD2   1 
ATOM   2293 C  CE1   . TYR A 1 277 ? -2.758  21.153  34.554  1.00 29.42  ? 277  TYR A CE1   1 
ATOM   2294 C  CE2   . TYR A 1 277 ? -1.014  19.510  34.831  1.00 29.85  ? 277  TYR A CE2   1 
ATOM   2295 C  CZ    . TYR A 1 277 ? -1.431  20.760  34.414  1.00 31.95  ? 277  TYR A CZ    1 
ATOM   2296 O  OH    . TYR A 1 277 ? -0.520  21.617  33.861  1.00 27.54  ? 277  TYR A OH    1 
ATOM   2297 N  N     . LYS A 1 278 ? -3.478  15.097  35.399  1.00 32.37  ? 278  LYS A N     1 
ATOM   2298 C  CA    . LYS A 1 278 ? -2.429  14.155  34.983  1.00 31.57  ? 278  LYS A CA    1 
ATOM   2299 C  C     . LYS A 1 278 ? -2.829  13.291  33.783  1.00 32.65  ? 278  LYS A C     1 
ATOM   2300 O  O     . LYS A 1 278 ? -1.975  12.901  32.987  1.00 33.30  ? 278  LYS A O     1 
ATOM   2301 C  CB    . LYS A 1 278 ? -1.977  13.263  36.145  1.00 29.90  ? 278  LYS A CB    1 
ATOM   2302 C  CG    . LYS A 1 278 ? -1.003  13.929  37.112  1.00 34.43  ? 278  LYS A CG    1 
ATOM   2303 C  CD    . LYS A 1 278 ? -0.755  13.040  38.337  1.00 33.88  ? 278  LYS A CD    1 
ATOM   2304 C  CE    . LYS A 1 278 ? 0.109   13.722  39.374  1.00 36.59  ? 278  LYS A CE    1 
ATOM   2305 N  NZ    . LYS A 1 278 ? 0.391   12.815  40.533  1.00 39.53  ? 278  LYS A NZ    1 
ATOM   2306 N  N     . LYS A 1 279 ? -4.114  12.978  33.652  1.00 33.75  ? 279  LYS A N     1 
ATOM   2307 C  CA    . LYS A 1 279 ? -4.537  12.130  32.545  1.00 34.93  ? 279  LYS A CA    1 
ATOM   2308 C  C     . LYS A 1 279 ? -4.842  12.911  31.268  1.00 34.70  ? 279  LYS A C     1 
ATOM   2309 O  O     . LYS A 1 279 ? -4.663  12.386  30.163  1.00 36.90  ? 279  LYS A O     1 
ATOM   2310 C  CB    . LYS A 1 279 ? -5.724  11.242  32.931  1.00 36.68  ? 279  LYS A CB    1 
ATOM   2311 C  CG    . LYS A 1 279 ? -5.962  10.093  31.935  1.00 38.94  ? 279  LYS A CG    1 
ATOM   2312 C  CD    . LYS A 1 279 ? -7.311  9.417   32.144  1.00 42.23  ? 279  LYS A CD    1 
ATOM   2313 C  CE    . LYS A 1 279 ? -7.549  8.311   31.116  1.00 45.11  ? 279  LYS A CE    1 
ATOM   2314 N  NZ    . LYS A 1 279 ? -6.492  7.242   31.150  1.00 48.94  ? 279  LYS A NZ    1 
ATOM   2315 N  N     . PHE A 1 280 ? -5.276  14.161  31.407  1.00 31.48  ? 280  PHE A N     1 
ATOM   2316 C  CA    . PHE A 1 280 ? -5.787  14.897  30.251  1.00 31.65  ? 280  PHE A CA    1 
ATOM   2317 C  C     . PHE A 1 280 ? -5.001  16.135  29.817  1.00 31.01  ? 280  PHE A C     1 
ATOM   2318 O  O     . PHE A 1 280 ? -5.290  16.695  28.756  1.00 33.48  ? 280  PHE A O     1 
ATOM   2319 C  CB    . PHE A 1 280 ? -7.257  15.276  30.470  1.00 32.06  ? 280  PHE A CB    1 
ATOM   2320 C  CG    . PHE A 1 280 ? -8.170  14.101  30.708  1.00 34.23  ? 280  PHE A CG    1 
ATOM   2321 C  CD1   . PHE A 1 280 ? -9.027  14.083  31.806  1.00 30.51  ? 280  PHE A CD1   1 
ATOM   2322 C  CD2   . PHE A 1 280 ? -8.194  13.020  29.826  1.00 33.69  ? 280  PHE A CD2   1 
ATOM   2323 C  CE1   . PHE A 1 280 ? -9.884  13.007  32.021  1.00 28.86  ? 280  PHE A CE1   1 
ATOM   2324 C  CE2   . PHE A 1 280 ? -9.046  11.945  30.040  1.00 32.21  ? 280  PHE A CE2   1 
ATOM   2325 C  CZ    . PHE A 1 280 ? -9.888  11.939  31.139  1.00 31.46  ? 280  PHE A CZ    1 
ATOM   2326 N  N     . SER A 1 281 ? -4.035  16.579  30.619  1.00 28.92  ? 281  SER A N     1 
ATOM   2327 C  CA    . SER A 1 281 ? -3.281  17.805  30.287  1.00 31.41  ? 281  SER A CA    1 
ATOM   2328 C  C     . SER A 1 281 ? -2.164  17.620  29.260  1.00 31.75  ? 281  SER A C     1 
ATOM   2329 O  O     . SER A 1 281 ? -1.758  18.584  28.610  1.00 32.43  ? 281  SER A O     1 
ATOM   2330 C  CB    . SER A 1 281 ? -2.708  18.483  31.540  1.00 29.74  ? 281  SER A CB    1 
ATOM   2331 O  OG    . SER A 1 281 ? -1.568  17.787  32.021  1.00 34.07  ? 281  SER A OG    1 
ATOM   2332 N  N     . PHE A 1 282 ? -1.664  16.394  29.127  1.00 33.14  ? 282  PHE A N     1 
ATOM   2333 C  CA    . PHE A 1 282 ? -0.497  16.110  28.280  1.00 34.96  ? 282  PHE A CA    1 
ATOM   2334 C  C     . PHE A 1 282 ? 0.702   16.971  28.685  1.00 35.91  ? 282  PHE A C     1 
ATOM   2335 O  O     . PHE A 1 282 ? 1.356   17.626  27.864  1.00 34.31  ? 282  PHE A O     1 
ATOM   2336 C  CB    . PHE A 1 282 ? -0.837  16.213  26.790  1.00 35.42  ? 282  PHE A CB    1 
ATOM   2337 C  CG    . PHE A 1 282 ? -1.670  15.069  26.299  1.00 39.14  ? 282  PHE A CG    1 
ATOM   2338 C  CD1   . PHE A 1 282 ? -1.084  14.015  25.605  1.00 41.55  ? 282  PHE A CD1   1 
ATOM   2339 C  CD2   . PHE A 1 282 ? -3.036  15.024  26.563  1.00 36.90  ? 282  PHE A CD2   1 
ATOM   2340 C  CE1   . PHE A 1 282 ? -1.847  12.949  25.174  1.00 42.12  ? 282  PHE A CE1   1 
ATOM   2341 C  CE2   . PHE A 1 282 ? -3.804  13.960  26.136  1.00 36.68  ? 282  PHE A CE2   1 
ATOM   2342 C  CZ    . PHE A 1 282 ? -3.210  12.921  25.443  1.00 40.66  ? 282  PHE A CZ    1 
ATOM   2343 N  N     . THR A 1 283 ? 0.952   16.967  29.988  1.00 35.88  ? 283  THR A N     1 
ATOM   2344 C  CA    . THR A 1 283 ? 2.139   17.559  30.558  1.00 36.62  ? 283  THR A CA    1 
ATOM   2345 C  C     . THR A 1 283 ? 2.815   16.497  31.412  1.00 38.98  ? 283  THR A C     1 
ATOM   2346 O  O     . THR A 1 283 ? 2.212   15.460  31.721  1.00 38.63  ? 283  THR A O     1 
ATOM   2347 C  CB    . THR A 1 283 ? 1.795   18.787  31.423  1.00 37.11  ? 283  THR A CB    1 
ATOM   2348 O  OG1   . THR A 1 283 ? 1.008   18.382  32.555  1.00 34.35  ? 283  THR A OG1   1 
ATOM   2349 C  CG2   . THR A 1 283 ? 1.038   19.841  30.599  1.00 31.94  ? 283  THR A CG2   1 
ATOM   2350 N  N     . ASN A 1 284 ? 4.084   16.725  31.732  1.00 40.75  ? 284  ASN A N     1 
ATOM   2351 C  CA    . ASN A 1 284 ? 4.727   16.069  32.866  1.00 40.96  ? 284  ASN A CA    1 
ATOM   2352 C  C     . ASN A 1 284 ? 5.412   17.205  33.599  1.00 39.52  ? 284  ASN A C     1 
ATOM   2353 O  O     . ASN A 1 284 ? 6.282   17.873  33.043  1.00 40.98  ? 284  ASN A O     1 
ATOM   2354 C  CB    . ASN A 1 284 ? 5.724   14.968  32.444  1.00 43.06  ? 284  ASN A CB    1 
ATOM   2355 C  CG    . ASN A 1 284 ? 6.092   13.998  33.610  1.00 45.33  ? 284  ASN A CG    1 
ATOM   2356 O  OD1   . ASN A 1 284 ? 5.473   14.014  34.677  1.00 45.86  ? 284  ASN A OD1   1 
ATOM   2357 N  ND2   . ASN A 1 284 ? 7.093   13.151  33.386  1.00 42.30  ? 284  ASN A ND2   1 
ATOM   2358 N  N     . GLN A 1 285 ? 4.982   17.443  34.832  1.00 36.44  ? 285  GLN A N     1 
ATOM   2359 C  CA    . GLN A 1 285 ? 5.414   18.607  35.580  1.00 34.80  ? 285  GLN A CA    1 
ATOM   2360 C  C     . GLN A 1 285 ? 6.529   18.288  36.566  1.00 35.27  ? 285  GLN A C     1 
ATOM   2361 O  O     . GLN A 1 285 ? 6.558   17.195  37.136  1.00 34.87  ? 285  GLN A O     1 
ATOM   2362 C  CB    . GLN A 1 285 ? 4.227   19.216  36.328  1.00 32.91  ? 285  GLN A CB    1 
ATOM   2363 C  CG    . GLN A 1 285 ? 3.145   19.775  35.429  1.00 36.22  ? 285  GLN A CG    1 
ATOM   2364 C  CD    . GLN A 1 285 ? 3.585   20.997  34.638  1.00 39.02  ? 285  GLN A CD    1 
ATOM   2365 O  OE1   . GLN A 1 285 ? 4.755   21.389  34.668  1.00 41.12  ? 285  GLN A OE1   1 
ATOM   2366 N  NE2   . GLN A 1 285 ? 2.642   21.606  33.919  1.00 37.03  ? 285  GLN A NE2   1 
ATOM   2367 N  N     . PRO A 1 286 ? 7.445   19.250  36.783  1.00 33.57  ? 286  PRO A N     1 
ATOM   2368 C  CA    . PRO A 1 286 ? 8.429   19.117  37.855  1.00 33.70  ? 286  PRO A CA    1 
ATOM   2369 C  C     . PRO A 1 286 ? 7.775   19.060  39.239  1.00 35.32  ? 286  PRO A C     1 
ATOM   2370 O  O     . PRO A 1 286 ? 8.340   18.482  40.168  1.00 35.87  ? 286  PRO A O     1 
ATOM   2371 C  CB    . PRO A 1 286 ? 9.261   20.391  37.724  1.00 33.46  ? 286  PRO A CB    1 
ATOM   2372 C  CG    . PRO A 1 286 ? 9.097   20.808  36.305  1.00 32.50  ? 286  PRO A CG    1 
ATOM   2373 C  CD    . PRO A 1 286 ? 7.697   20.438  35.948  1.00 32.64  ? 286  PRO A CD    1 
ATOM   2374 N  N     . SER A 1 287 ? 6.590   19.647  39.367  1.00 34.62  ? 287  SER A N     1 
ATOM   2375 C  CA    . SER A 1 287 ? 5.890   19.693  40.639  1.00 34.86  ? 287  SER A CA    1 
ATOM   2376 C  C     . SER A 1 287 ? 4.380   19.690  40.443  1.00 34.39  ? 287  SER A C     1 
ATOM   2377 O  O     . SER A 1 287 ? 3.868   20.222  39.456  1.00 35.59  ? 287  SER A O     1 
ATOM   2378 C  CB    . SER A 1 287 ? 6.318   20.932  41.434  1.00 35.09  ? 287  SER A CB    1 
ATOM   2379 O  OG    . SER A 1 287 ? 5.494   21.114  42.574  1.00 37.40  ? 287  SER A OG    1 
ATOM   2380 N  N     . TYR A 1 288 ? 3.675   19.096  41.397  1.00 34.69  ? 288  TYR A N     1 
ATOM   2381 C  CA    . TYR A 1 288 ? 2.215   19.054  41.365  1.00 36.11  ? 288  TYR A CA    1 
ATOM   2382 C  C     . TYR A 1 288 ? 1.526   19.742  42.540  1.00 35.35  ? 288  TYR A C     1 
ATOM   2383 O  O     . TYR A 1 288 ? 0.359   19.473  42.823  1.00 35.85  ? 288  TYR A O     1 
ATOM   2384 C  CB    . TYR A 1 288 ? 1.713   17.622  41.172  1.00 33.54  ? 288  TYR A CB    1 
ATOM   2385 C  CG    . TYR A 1 288 ? 1.937   17.152  39.758  1.00 36.61  ? 288  TYR A CG    1 
ATOM   2386 C  CD1   . TYR A 1 288 ? 3.040   16.367  39.430  1.00 34.57  ? 288  TYR A CD1   1 
ATOM   2387 C  CD2   . TYR A 1 288 ? 1.064   17.525  38.736  1.00 32.68  ? 288  TYR A CD2   1 
ATOM   2388 C  CE1   . TYR A 1 288 ? 3.257   15.946  38.127  1.00 32.06  ? 288  TYR A CE1   1 
ATOM   2389 C  CE2   . TYR A 1 288 ? 1.277   17.115  37.434  1.00 34.47  ? 288  TYR A CE2   1 
ATOM   2390 C  CZ    . TYR A 1 288 ? 2.371   16.324  37.135  1.00 34.89  ? 288  TYR A CZ    1 
ATOM   2391 O  OH    . TYR A 1 288 ? 2.578   15.921  35.838  1.00 35.38  ? 288  TYR A OH    1 
ATOM   2392 N  N     . SER A 1 289 ? 2.243   20.642  43.207  1.00 37.49  ? 289  SER A N     1 
ATOM   2393 C  CA    . SER A 1 289 ? 1.619   21.537  44.174  1.00 38.99  ? 289  SER A CA    1 
ATOM   2394 C  C     . SER A 1 289 ? 0.697   22.481  43.403  1.00 39.97  ? 289  SER A C     1 
ATOM   2395 O  O     . SER A 1 289 ? 0.924   22.741  42.216  1.00 42.72  ? 289  SER A O     1 
ATOM   2396 C  CB    . SER A 1 289 ? 2.679   22.331  44.933  1.00 38.17  ? 289  SER A CB    1 
ATOM   2397 O  OG    . SER A 1 289 ? 3.330   23.248  44.071  1.00 43.63  ? 289  SER A OG    1 
ATOM   2398 N  N     . LEU A 1 290 ? -0.333  22.994  44.067  1.00 39.33  ? 290  LEU A N     1 
ATOM   2399 C  CA    . LEU A 1 290 ? -1.307  23.863  43.408  1.00 37.09  ? 290  LEU A CA    1 
ATOM   2400 C  C     . LEU A 1 290 ? -0.705  25.204  42.979  1.00 37.40  ? 290  LEU A C     1 
ATOM   2401 O  O     . LEU A 1 290 ? -1.082  25.741  41.937  1.00 39.14  ? 290  LEU A O     1 
ATOM   2402 C  CB    . LEU A 1 290 ? -2.540  24.065  44.295  1.00 36.86  ? 290  LEU A CB    1 
ATOM   2403 C  CG    . LEU A 1 290 ? -3.754  24.766  43.673  1.00 37.58  ? 290  LEU A CG    1 
ATOM   2404 C  CD1   . LEU A 1 290 ? -4.211  24.068  42.398  1.00 30.87  ? 290  LEU A CD1   1 
ATOM   2405 C  CD2   . LEU A 1 290 ? -4.889  24.836  44.684  1.00 35.26  ? 290  LEU A CD2   1 
ATOM   2406 N  N     . ASP A 1 291 ? 0.219   25.731  43.784  1.00 36.45  ? 291  ASP A N     1 
ATOM   2407 C  CA    . ASP A 1 291 ? 0.998   26.928  43.450  1.00 38.67  ? 291  ASP A CA    1 
ATOM   2408 C  C     . ASP A 1 291 ? 1.660   26.781  42.097  1.00 36.18  ? 291  ASP A C     1 
ATOM   2409 O  O     . ASP A 1 291 ? 1.556   27.653  41.241  1.00 35.96  ? 291  ASP A O     1 
ATOM   2410 C  CB    . ASP A 1 291 ? 2.124   27.139  44.466  1.00 43.04  ? 291  ASP A CB    1 
ATOM   2411 C  CG    . ASP A 1 291 ? 1.772   28.128  45.554  1.00 51.67  ? 291  ASP A CG    1 
ATOM   2412 O  OD1   . ASP A 1 291 ? 0.761   28.859  45.419  1.00 55.74  ? 291  ASP A OD1   1 
ATOM   2413 O  OD2   . ASP A 1 291 ? 2.530   28.171  46.552  1.00 55.97  ? 291  ASP A OD2   1 
ATOM   2414 N  N     . TYR A 1 292 ? 2.354   25.661  41.929  1.00 34.43  ? 292  TYR A N     1 
ATOM   2415 C  CA    . TYR A 1 292 ? 3.169   25.425  40.760  1.00 32.32  ? 292  TYR A CA    1 
ATOM   2416 C  C     . TYR A 1 292 ? 2.298   25.258  39.516  1.00 31.97  ? 292  TYR A C     1 
ATOM   2417 O  O     . TYR A 1 292 ? 2.567   25.886  38.498  1.00 28.71  ? 292  TYR A O     1 
ATOM   2418 C  CB    . TYR A 1 292 ? 4.080   24.211  40.969  1.00 32.39  ? 292  TYR A CB    1 
ATOM   2419 C  CG    . TYR A 1 292 ? 5.122   24.087  39.896  1.00 30.93  ? 292  TYR A CG    1 
ATOM   2420 C  CD1   . TYR A 1 292 ? 4.826   23.469  38.685  1.00 29.53  ? 292  TYR A CD1   1 
ATOM   2421 C  CD2   . TYR A 1 292 ? 6.402   24.610  40.079  1.00 30.55  ? 292  TYR A CD2   1 
ATOM   2422 C  CE1   . TYR A 1 292 ? 5.784   23.356  37.685  1.00 33.81  ? 292  TYR A CE1   1 
ATOM   2423 C  CE2   . TYR A 1 292 ? 7.373   24.510  39.075  1.00 32.85  ? 292  TYR A CE2   1 
ATOM   2424 C  CZ    . TYR A 1 292 ? 7.051   23.878  37.884  1.00 33.57  ? 292  TYR A CZ    1 
ATOM   2425 O  OH    . TYR A 1 292 ? 7.986   23.766  36.885  1.00 36.83  ? 292  TYR A OH    1 
ATOM   2426 N  N     . ILE A 1 293 ? 1.250   24.434  39.613  1.00 30.08  ? 293  ILE A N     1 
ATOM   2427 C  CA    . ILE A 1 293 ? 0.346   24.200  38.484  1.00 29.38  ? 293  ILE A CA    1 
ATOM   2428 C  C     . ILE A 1 293 ? -0.445  25.470  38.134  1.00 30.12  ? 293  ILE A C     1 
ATOM   2429 O  O     . ILE A 1 293 ? -0.621  25.788  36.951  1.00 30.32  ? 293  ILE A O     1 
ATOM   2430 C  CB    . ILE A 1 293 ? -0.609  23.005  38.750  1.00 29.14  ? 293  ILE A CB    1 
ATOM   2431 C  CG1   . ILE A 1 293 ? 0.183   21.724  39.040  1.00 31.05  ? 293  ILE A CG1   1 
ATOM   2432 C  CG2   . ILE A 1 293 ? -1.581  22.799  37.594  1.00 29.56  ? 293  ILE A CG2   1 
ATOM   2433 C  CD1   . ILE A 1 293 ? 0.896   21.112  37.842  1.00 27.79  ? 293  ILE A CD1   1 
ATOM   2434 N  N     . SER A 1 294 ? -0.901  26.194  39.156  1.00 29.18  ? 294  SER A N     1 
ATOM   2435 C  CA    . SER A 1 294 ? -1.565  27.486  38.949  1.00 31.56  ? 294  SER A CA    1 
ATOM   2436 C  C     . SER A 1 294 ? -0.704  28.486  38.195  1.00 32.68  ? 294  SER A C     1 
ATOM   2437 O  O     . SER A 1 294 ? -1.196  29.170  37.304  1.00 32.13  ? 294  SER A O     1 
ATOM   2438 C  CB    . SER A 1 294 ? -1.994  28.125  40.274  1.00 30.22  ? 294  SER A CB    1 
ATOM   2439 O  OG    . SER A 1 294 ? -3.041  27.396  40.851  1.00 33.32  ? 294  SER A OG    1 
ATOM   2440 N  N     . GLU A 1 295 ? 0.567   28.599  38.579  1.00 35.16  ? 295  GLU A N     1 
ATOM   2441 C  CA    . GLU A 1 295 ? 1.461   29.560  37.932  1.00 38.35  ? 295  GLU A CA    1 
ATOM   2442 C  C     . GLU A 1 295 ? 1.705   29.164  36.473  1.00 37.26  ? 295  GLU A C     1 
ATOM   2443 O  O     . GLU A 1 295 ? 1.767   30.021  35.590  1.00 37.63  ? 295  GLU A O     1 
ATOM   2444 C  CB    . GLU A 1 295 ? 2.765   29.742  38.738  1.00 41.66  ? 295  GLU A CB    1 
ATOM   2445 C  CG    . GLU A 1 295 ? 4.060   29.965  37.921  1.00 54.92  ? 295  GLU A CG    1 
ATOM   2446 C  CD    . GLU A 1 295 ? 4.289   31.401  37.464  1.00 63.16  ? 295  GLU A CD    1 
ATOM   2447 O  OE1   . GLU A 1 295 ? 3.359   32.024  36.904  1.00 67.21  ? 295  GLU A OE1   1 
ATOM   2448 O  OE2   . GLU A 1 295 ? 5.423   31.902  37.646  1.00 65.69  ? 295  GLU A OE2   1 
ATOM   2449 N  N     . PHE A 1 296 ? 1.806   27.862  36.226  1.00 35.17  ? 296  PHE A N     1 
ATOM   2450 C  CA    . PHE A 1 296 ? 1.994   27.358  34.874  1.00 35.54  ? 296  PHE A CA    1 
ATOM   2451 C  C     . PHE A 1 296 ? 0.751   27.619  34.017  1.00 33.72  ? 296  PHE A C     1 
ATOM   2452 O  O     . PHE A 1 296 ? 0.847   28.149  32.914  1.00 34.18  ? 296  PHE A O     1 
ATOM   2453 C  CB    . PHE A 1 296 ? 2.327   25.862  34.912  1.00 35.88  ? 296  PHE A CB    1 
ATOM   2454 C  CG    . PHE A 1 296 ? 2.529   25.242  33.552  1.00 36.79  ? 296  PHE A CG    1 
ATOM   2455 C  CD1   . PHE A 1 296 ? 3.785   25.267  32.939  1.00 36.34  ? 296  PHE A CD1   1 
ATOM   2456 C  CD2   . PHE A 1 296 ? 1.471   24.615  32.893  1.00 32.99  ? 296  PHE A CD2   1 
ATOM   2457 C  CE1   . PHE A 1 296 ? 3.984   24.693  31.679  1.00 36.52  ? 296  PHE A CE1   1 
ATOM   2458 C  CE2   . PHE A 1 296 ? 1.660   24.025  31.635  1.00 37.10  ? 296  PHE A CE2   1 
ATOM   2459 C  CZ    . PHE A 1 296 ? 2.919   24.068  31.024  1.00 34.48  ? 296  PHE A CZ    1 
ATOM   2460 N  N     . GLU A 1 297 ? -0.413  27.258  34.539  1.00 32.35  ? 297  GLU A N     1 
ATOM   2461 C  CA    . GLU A 1 297 ? -1.647  27.314  33.772  1.00 33.12  ? 297  GLU A CA    1 
ATOM   2462 C  C     . GLU A 1 297 ? -2.199  28.726  33.613  1.00 33.75  ? 297  GLU A C     1 
ATOM   2463 O  O     . GLU A 1 297 ? -2.741  29.059  32.562  1.00 33.62  ? 297  GLU A O     1 
ATOM   2464 C  CB    . GLU A 1 297 ? -2.710  26.421  34.414  1.00 32.07  ? 297  GLU A CB    1 
ATOM   2465 C  CG    . GLU A 1 297 ? -2.445  24.928  34.275  1.00 34.13  ? 297  GLU A CG    1 
ATOM   2466 C  CD    . GLU A 1 297 ? -2.399  24.450  32.827  1.00 35.72  ? 297  GLU A CD    1 
ATOM   2467 O  OE1   . GLU A 1 297 ? -3.216  24.909  31.992  1.00 37.12  ? 297  GLU A OE1   1 
ATOM   2468 O  OE2   . GLU A 1 297 ? -1.546  23.594  32.530  1.00 37.12  ? 297  GLU A OE2   1 
ATOM   2469 N  N     . LEU A 1 298 ? -2.051  29.544  34.653  1.00 33.25  ? 298  LEU A N     1 
ATOM   2470 C  CA    . LEU A 1 298 ? -2.767  30.813  34.756  1.00 33.24  ? 298  LEU A CA    1 
ATOM   2471 C  C     . LEU A 1 298 ? -1.871  32.044  34.780  1.00 36.91  ? 298  LEU A C     1 
ATOM   2472 O  O     . LEU A 1 298 ? -2.354  33.156  34.562  1.00 34.98  ? 298  LEU A O     1 
ATOM   2473 C  CB    . LEU A 1 298 ? -3.629  30.824  36.017  1.00 31.77  ? 298  LEU A CB    1 
ATOM   2474 C  CG    . LEU A 1 298 ? -4.569  29.643  36.255  1.00 27.02  ? 298  LEU A CG    1 
ATOM   2475 C  CD1   . LEU A 1 298 ? -5.057  29.643  37.686  1.00 21.94  ? 298  LEU A CD1   1 
ATOM   2476 C  CD2   . LEU A 1 298 ? -5.734  29.683  35.270  1.00 27.51  ? 298  LEU A CD2   1 
ATOM   2477 N  N     . ASN A 1 299 ? -0.578  31.850  35.047  1.00 40.15  ? 299  ASN A N     1 
ATOM   2478 C  CA    . ASN A 1 299 ? 0.342   32.969  35.259  1.00 44.12  ? 299  ASN A CA    1 
ATOM   2479 C  C     . ASN A 1 299 ? 0.030   33.827  36.487  1.00 45.33  ? 299  ASN A C     1 
ATOM   2480 O  O     . ASN A 1 299 ? 0.186   35.056  36.454  1.00 46.76  ? 299  ASN A O     1 
ATOM   2481 C  CB    . ASN A 1 299 ? 0.430   33.858  34.019  1.00 47.21  ? 299  ASN A CB    1 
ATOM   2482 C  CG    . ASN A 1 299 ? 1.801   33.880  33.438  1.00 54.00  ? 299  ASN A CG    1 
ATOM   2483 O  OD1   . ASN A 1 299 ? 2.603   34.758  33.765  1.00 58.83  ? 299  ASN A OD1   1 
ATOM   2484 N  ND2   . ASN A 1 299 ? 2.106   32.897  32.595  1.00 56.94  ? 299  ASN A ND2   1 
ATOM   2485 N  N     . VAL A 1 300 ? -0.408  33.183  37.563  1.00 44.16  ? 300  VAL A N     1 
ATOM   2486 C  CA    . VAL A 1 300 ? -0.624  33.880  38.827  1.00 46.81  ? 300  VAL A CA    1 
ATOM   2487 C  C     . VAL A 1 300 ? 0.543   33.587  39.761  1.00 48.87  ? 300  VAL A C     1 
ATOM   2488 O  O     . VAL A 1 300 ? 1.069   32.473  39.767  1.00 49.44  ? 300  VAL A O     1 
ATOM   2489 C  CB    . VAL A 1 300 ? -1.974  33.507  39.502  1.00 45.96  ? 300  VAL A CB    1 
ATOM   2490 C  CG1   . VAL A 1 300 ? -3.138  34.029  38.681  1.00 44.95  ? 300  VAL A CG1   1 
ATOM   2491 C  CG2   . VAL A 1 300 ? -2.095  31.995  39.727  1.00 46.39  ? 300  VAL A CG2   1 
ATOM   2492 N  N     . GLY A 1 301 ? 0.958   34.590  40.528  1.00 49.90  ? 301  GLY A N     1 
ATOM   2493 C  CA    . GLY A 1 301 ? 2.076   34.429  41.457  1.00 53.43  ? 301  GLY A CA    1 
ATOM   2494 C  C     . GLY A 1 301 ? 1.731   33.492  42.599  1.00 55.06  ? 301  GLY A C     1 
ATOM   2495 O  O     . GLY A 1 301 ? 0.561   33.374  42.974  1.00 54.22  ? 301  GLY A O     1 
ATOM   2496 N  N     . LYS A 1 302 ? 2.747   32.822  43.144  1.00 58.65  ? 302  LYS A N     1 
ATOM   2497 C  CA    . LYS A 1 302 ? 2.580   31.937  44.309  1.00 62.07  ? 302  LYS A CA    1 
ATOM   2498 C  C     . LYS A 1 302 ? 1.916   32.660  45.495  1.00 63.90  ? 302  LYS A C     1 
ATOM   2499 O  O     . LYS A 1 302 ? 2.000   33.891  45.615  1.00 64.64  ? 302  LYS A O     1 
ATOM   2500 C  CB    . LYS A 1 302 ? 3.931   31.347  44.747  1.00 62.44  ? 302  LYS A CB    1 
ATOM   2501 C  CG    . LYS A 1 302 ? 4.931   32.388  45.276  1.00 66.68  ? 302  LYS A CG    1 
ATOM   2502 C  CD    . LYS A 1 302 ? 5.744   31.871  46.465  1.00 69.02  ? 302  LYS A CD    1 
ATOM   2503 C  CE    . LYS A 1 302 ? 7.114   31.342  46.039  1.00 71.04  ? 302  LYS A CE    1 
ATOM   2504 N  NZ    . LYS A 1 302 ? 7.921   30.886  47.209  1.00 67.40  ? 302  LYS A NZ    1 
ATOM   2505 N  N     . LEU A 1 303 ? 1.252   31.898  46.360  1.00 65.15  ? 303  LEU A N     1 
ATOM   2506 C  CA    . LEU A 1 303 ? 0.731   32.459  47.604  1.00 67.94  ? 303  LEU A CA    1 
ATOM   2507 C  C     . LEU A 1 303 ? 1.878   32.611  48.601  1.00 69.82  ? 303  LEU A C     1 
ATOM   2508 O  O     . LEU A 1 303 ? 2.449   31.614  49.058  1.00 70.66  ? 303  LEU A O     1 
ATOM   2509 C  CB    . LEU A 1 303 ? -0.396  31.597  48.191  1.00 67.36  ? 303  LEU A CB    1 
ATOM   2510 C  CG    . LEU A 1 303 ? -1.794  31.554  47.550  1.00 66.59  ? 303  LEU A CG    1 
ATOM   2511 C  CD1   . LEU A 1 303 ? -2.111  32.782  46.695  1.00 65.20  ? 303  LEU A CD1   1 
ATOM   2512 C  CD2   . LEU A 1 303 ? -2.000  30.263  46.767  1.00 68.02  ? 303  LEU A CD2   1 
ATOM   2513 N  N     . LYS A 1 304 ? 2.213   33.861  48.920  1.00 71.45  ? 304  LYS A N     1 
ATOM   2514 C  CA    . LYS A 1 304 ? 3.384   34.168  49.737  1.00 73.28  ? 304  LYS A CA    1 
ATOM   2515 C  C     . LYS A 1 304 ? 3.007   34.392  51.198  1.00 72.56  ? 304  LYS A C     1 
ATOM   2516 O  O     . LYS A 1 304 ? 2.060   35.119  51.497  1.00 72.81  ? 304  LYS A O     1 
ATOM   2517 C  CB    . LYS A 1 304 ? 4.104   35.404  49.190  1.00 75.09  ? 304  LYS A CB    1 
ATOM   2518 C  CG    . LYS A 1 304 ? 5.612   35.234  49.064  1.00 79.67  ? 304  LYS A CG    1 
ATOM   2519 C  CD    . LYS A 1 304 ? 6.349   36.566  49.217  1.00 84.27  ? 304  LYS A CD    1 
ATOM   2520 C  CE    . LYS A 1 304 ? 7.081   36.673  50.562  1.00 85.96  ? 304  LYS A CE    1 
ATOM   2521 N  NZ    . LYS A 1 304 ? 6.186   36.599  51.756  1.00 87.29  ? 304  LYS A NZ    1 
ATOM   2522 N  N     . TYR A 1 305 ? 3.754   33.756  52.098  1.00 71.97  ? 305  TYR A N     1 
ATOM   2523 C  CA    . TYR A 1 305 ? 3.587   33.950  53.539  1.00 71.15  ? 305  TYR A CA    1 
ATOM   2524 C  C     . TYR A 1 305 ? 4.893   33.688  54.290  1.00 70.48  ? 305  TYR A C     1 
ATOM   2525 O  O     . TYR A 1 305 ? 5.813   33.072  53.748  1.00 69.73  ? 305  TYR A O     1 
ATOM   2526 C  CB    . TYR A 1 305 ? 2.455   33.071  54.086  1.00 72.17  ? 305  TYR A CB    1 
ATOM   2527 C  CG    . TYR A 1 305 ? 2.631   31.581  53.860  1.00 73.97  ? 305  TYR A CG    1 
ATOM   2528 C  CD1   . TYR A 1 305 ? 3.322   30.794  54.781  1.00 75.14  ? 305  TYR A CD1   1 
ATOM   2529 C  CD2   . TYR A 1 305 ? 2.091   30.956  52.736  1.00 74.58  ? 305  TYR A CD2   1 
ATOM   2530 C  CE1   . TYR A 1 305 ? 3.485   29.428  54.586  1.00 75.93  ? 305  TYR A CE1   1 
ATOM   2531 C  CE2   . TYR A 1 305 ? 2.247   29.584  52.530  1.00 76.57  ? 305  TYR A CE2   1 
ATOM   2532 C  CZ    . TYR A 1 305 ? 2.946   28.828  53.462  1.00 77.45  ? 305  TYR A CZ    1 
ATOM   2533 O  OH    . TYR A 1 305 ? 3.107   27.473  53.276  1.00 79.01  ? 305  TYR A OH    1 
ATOM   2534 N  N     . ASP A 1 306 ? 4.962   34.161  55.535  1.00 69.99  ? 306  ASP A N     1 
ATOM   2535 C  CA    . ASP A 1 306 ? 6.151   34.005  56.382  1.00 70.27  ? 306  ASP A CA    1 
ATOM   2536 C  C     . ASP A 1 306 ? 5.996   32.854  57.377  1.00 68.69  ? 306  ASP A C     1 
ATOM   2537 O  O     . ASP A 1 306 ? 4.909   32.630  57.920  1.00 67.23  ? 306  ASP A O     1 
ATOM   2538 C  CB    . ASP A 1 306 ? 6.449   35.299  57.151  1.00 71.83  ? 306  ASP A CB    1 
ATOM   2539 C  CG    . ASP A 1 306 ? 6.618   36.513  56.241  1.00 74.14  ? 306  ASP A CG    1 
ATOM   2540 O  OD1   . ASP A 1 306 ? 6.691   37.637  56.781  1.00 75.67  ? 306  ASP A OD1   1 
ATOM   2541 O  OD2   . ASP A 1 306 ? 6.679   36.357  54.999  1.00 74.05  ? 306  ASP A OD2   1 
ATOM   2542 N  N     . GLY A 1 307 ? 7.093   32.139  57.618  1.00 67.57  ? 307  GLY A N     1 
ATOM   2543 C  CA    . GLY A 1 307 ? 7.101   31.001  58.540  1.00 64.71  ? 307  GLY A CA    1 
ATOM   2544 C  C     . GLY A 1 307 ? 6.428   29.764  57.967  1.00 63.08  ? 307  GLY A C     1 
ATOM   2545 O  O     . GLY A 1 307 ? 5.849   29.817  56.873  1.00 62.01  ? 307  GLY A O     1 
ATOM   2546 N  N     . PRO A 1 308 ? 6.499   28.633  58.696  1.00 61.97  ? 308  PRO A N     1 
ATOM   2547 C  CA    . PRO A 1 308 ? 5.876   27.400  58.211  1.00 60.42  ? 308  PRO A CA    1 
ATOM   2548 C  C     . PRO A 1 308 ? 4.351   27.471  58.281  1.00 58.91  ? 308  PRO A C     1 
ATOM   2549 O  O     . PRO A 1 308 ? 3.803   28.158  59.146  1.00 57.44  ? 308  PRO A O     1 
ATOM   2550 C  CB    . PRO A 1 308 ? 6.403   26.337  59.180  1.00 61.73  ? 308  PRO A CB    1 
ATOM   2551 C  CG    . PRO A 1 308 ? 6.683   27.085  60.444  1.00 61.43  ? 308  PRO A CG    1 
ATOM   2552 C  CD    . PRO A 1 308 ? 7.140   28.451  60.014  1.00 62.40  ? 308  PRO A CD    1 
ATOM   2553 N  N     . ILE A 1 309 ? 3.687   26.757  57.375  1.00 58.07  ? 309  ILE A N     1 
ATOM   2554 C  CA    . ILE A 1 309 ? 2.224   26.682  57.334  1.00 57.14  ? 309  ILE A CA    1 
ATOM   2555 C  C     . ILE A 1 309 ? 1.645   26.212  58.680  1.00 55.61  ? 309  ILE A C     1 
ATOM   2556 O  O     . ILE A 1 309 ? 0.507   26.536  59.027  1.00 54.10  ? 309  ILE A O     1 
ATOM   2557 C  CB    . ILE A 1 309 ? 1.744   25.786  56.138  1.00 57.69  ? 309  ILE A CB    1 
ATOM   2558 C  CG1   . ILE A 1 309 ? 0.395   26.274  55.568  1.00 60.68  ? 309  ILE A CG1   1 
ATOM   2559 C  CG2   . ILE A 1 309 ? 1.784   24.297  56.491  1.00 57.09  ? 309  ILE A CG2   1 
ATOM   2560 C  CD1   . ILE A 1 309 ? -0.862  25.650  56.177  1.00 62.96  ? 309  ILE A CD1   1 
ATOM   2561 N  N     . SER A 1 310 ? 2.455   25.474  59.440  1.00 53.90  ? 310  SER A N     1 
ATOM   2562 C  CA    . SER A 1 310 ? 2.069   24.985  60.760  1.00 53.01  ? 310  SER A CA    1 
ATOM   2563 C  C     . SER A 1 310 ? 1.982   26.097  61.810  1.00 52.01  ? 310  SER A C     1 
ATOM   2564 O  O     . SER A 1 310 ? 1.528   25.862  62.931  1.00 52.17  ? 310  SER A O     1 
ATOM   2565 C  CB    . SER A 1 310 ? 3.031   23.883  61.218  1.00 55.32  ? 310  SER A CB    1 
ATOM   2566 O  OG    . SER A 1 310 ? 4.385   24.303  61.145  1.00 59.18  ? 310  SER A OG    1 
ATOM   2567 N  N     . LYS A 1 311 ? 2.407   27.303  61.441  1.00 50.25  ? 311  LYS A N     1 
ATOM   2568 C  CA    . LYS A 1 311 ? 2.304   28.466  62.322  1.00 50.43  ? 311  LYS A CA    1 
ATOM   2569 C  C     . LYS A 1 311 ? 1.515   29.612  61.689  1.00 49.55  ? 311  LYS A C     1 
ATOM   2570 O  O     . LYS A 1 311 ? 1.328   30.659  62.313  1.00 49.68  ? 311  LYS A O     1 
ATOM   2571 C  CB    . LYS A 1 311 ? 3.694   28.955  62.741  1.00 51.77  ? 311  LYS A CB    1 
ATOM   2572 C  CG    . LYS A 1 311 ? 4.415   28.023  63.702  1.00 55.76  ? 311  LYS A CG    1 
ATOM   2573 C  CD    . LYS A 1 311 ? 5.704   28.648  64.218  1.00 62.95  ? 311  LYS A CD    1 
ATOM   2574 C  CE    . LYS A 1 311 ? 6.501   27.665  65.082  1.00 66.75  ? 311  LYS A CE    1 
ATOM   2575 N  NZ    . LYS A 1 311 ? 7.775   28.264  65.594  1.00 69.61  ? 311  LYS A NZ    1 
ATOM   2576 N  N     . LEU A 1 312 ? 1.039   29.402  60.463  1.00 46.11  ? 312  LEU A N     1 
ATOM   2577 C  CA    . LEU A 1 312 ? 0.335   30.443  59.717  1.00 44.96  ? 312  LEU A CA    1 
ATOM   2578 C  C     . LEU A 1 312 ? -1.013  30.829  60.321  1.00 43.19  ? 312  LEU A C     1 
ATOM   2579 O  O     . LEU A 1 312 ? -1.353  32.007  60.363  1.00 42.14  ? 312  LEU A O     1 
ATOM   2580 C  CB    . LEU A 1 312 ? 0.163   30.049  58.245  1.00 43.41  ? 312  LEU A CB    1 
ATOM   2581 C  CG    . LEU A 1 312 ? -0.377  31.132  57.305  1.00 46.62  ? 312  LEU A CG    1 
ATOM   2582 C  CD1   . LEU A 1 312 ? 0.544   32.353  57.262  1.00 46.67  ? 312  LEU A CD1   1 
ATOM   2583 C  CD2   . LEU A 1 312 ? -0.593  30.576  55.896  1.00 43.29  ? 312  LEU A CD2   1 
ATOM   2584 N  N     . ARG A 1 313 ? -1.779  29.844  60.778  1.00 41.20  ? 313  ARG A N     1 
ATOM   2585 C  CA    . ARG A 1 313 ? -3.081  30.137  61.364  1.00 40.67  ? 313  ARG A CA    1 
ATOM   2586 C  C     . ARG A 1 313 ? -2.951  31.059  62.577  1.00 40.12  ? 313  ARG A C     1 
ATOM   2587 O  O     . ARG A 1 313 ? -3.659  32.063  62.666  1.00 39.72  ? 313  ARG A O     1 
ATOM   2588 C  CB    . ARG A 1 313 ? -3.846  28.857  61.728  1.00 40.21  ? 313  ARG A CB    1 
ATOM   2589 C  CG    . ARG A 1 313 ? -5.214  29.120  62.351  1.00 39.29  ? 313  ARG A CG    1 
ATOM   2590 C  CD    . ARG A 1 313 ? -5.947  27.826  62.722  1.00 39.94  ? 313  ARG A CD    1 
ATOM   2591 N  NE    . ARG A 1 313 ? -7.134  28.110  63.529  1.00 39.00  ? 313  ARG A NE    1 
ATOM   2592 C  CZ    . ARG A 1 313 ? -7.148  28.162  64.861  1.00 37.03  ? 313  ARG A CZ    1 
ATOM   2593 N  NH1   . ARG A 1 313 ? -6.042  27.939  65.554  1.00 35.07  ? 313  ARG A NH1   1 
ATOM   2594 N  NH2   . ARG A 1 313 ? -8.275  28.440  65.503  1.00 36.05  ? 313  ARG A NH2   1 
ATOM   2595 N  N     . GLU A 1 314 ? -2.042  30.733  63.492  1.00 40.10  ? 314  GLU A N     1 
ATOM   2596 C  CA    . GLU A 1 314 ? -1.902  31.517  64.724  1.00 43.76  ? 314  GLU A CA    1 
ATOM   2597 C  C     . GLU A 1 314 ? -1.179  32.841  64.514  1.00 42.03  ? 314  GLU A C     1 
ATOM   2598 O  O     . GLU A 1 314 ? -1.467  33.815  65.212  1.00 42.39  ? 314  GLU A O     1 
ATOM   2599 C  CB    . GLU A 1 314 ? -1.257  30.699  65.861  1.00 47.89  ? 314  GLU A CB    1 
ATOM   2600 C  CG    . GLU A 1 314 ? 0.277   30.713  65.921  1.00 54.05  ? 314  GLU A CG    1 
ATOM   2601 C  CD    . GLU A 1 314 ? 0.844   29.510  66.668  1.00 60.53  ? 314  GLU A CD    1 
ATOM   2602 O  OE1   . GLU A 1 314 ? 1.129   29.635  67.885  1.00 59.47  ? 314  GLU A OE1   1 
ATOM   2603 O  OE2   . GLU A 1 314 ? 0.990   28.436  66.033  1.00 61.91  ? 314  GLU A OE2   1 
ATOM   2604 N  N     . SER A 1 315 ? -0.250  32.877  63.562  1.00 40.36  ? 315  SER A N     1 
ATOM   2605 C  CA    . SER A 1 315 ? 0.486   34.103  63.277  1.00 41.58  ? 315  SER A CA    1 
ATOM   2606 C  C     . SER A 1 315 ? -0.287  35.049  62.356  1.00 41.70  ? 315  SER A C     1 
ATOM   2607 O  O     . SER A 1 315 ? -0.222  36.270  62.528  1.00 43.32  ? 315  SER A O     1 
ATOM   2608 C  CB    . SER A 1 315 ? 1.879   33.807  62.711  1.00 40.94  ? 315  SER A CB    1 
ATOM   2609 O  OG    . SER A 1 315 ? 1.811   33.159  61.456  1.00 42.83  ? 315  SER A OG    1 
ATOM   2610 N  N     . ASN A 1 316 ? -1.014  34.488  61.388  1.00 39.36  ? 316  ASN A N     1 
ATOM   2611 C  CA    . ASN A 1 316 ? -1.812  35.291  60.455  1.00 36.24  ? 316  ASN A CA    1 
ATOM   2612 C  C     . ASN A 1 316 ? -3.051  34.544  59.993  1.00 34.19  ? 316  ASN A C     1 
ATOM   2613 O  O     . ASN A 1 316 ? -3.092  34.017  58.883  1.00 35.75  ? 316  ASN A O     1 
ATOM   2614 C  CB    . ASN A 1 316 ? -0.964  35.724  59.251  1.00 35.78  ? 316  ASN A CB    1 
ATOM   2615 C  CG    . ASN A 1 316 ? -1.561  36.924  58.494  1.00 39.25  ? 316  ASN A CG    1 
ATOM   2616 O  OD1   . ASN A 1 316 ? -2.764  37.200  58.556  1.00 38.17  ? 316  ASN A OD1   1 
ATOM   2617 N  ND2   . ASN A 1 316 ? -0.708  37.627  57.758  1.00 39.28  ? 316  ASN A ND2   1 
ATOM   2618 N  N     . HIS A 1 317 ? -4.070  34.515  60.844  1.00 33.22  ? 317  HIS A N     1 
ATOM   2619 C  CA    . HIS A 1 317 ? -5.310  33.812  60.542  1.00 30.82  ? 317  HIS A CA    1 
ATOM   2620 C  C     . HIS A 1 317 ? -6.053  34.414  59.350  1.00 32.72  ? 317  HIS A C     1 
ATOM   2621 O  O     . HIS A 1 317 ? -6.730  33.693  58.598  1.00 32.75  ? 317  HIS A O     1 
ATOM   2622 C  CB    . HIS A 1 317 ? -6.224  33.779  61.765  1.00 29.50  ? 317  HIS A CB    1 
ATOM   2623 C  CG    . HIS A 1 317 ? -7.571  33.194  61.487  1.00 30.28  ? 317  HIS A CG    1 
ATOM   2624 N  ND1   . HIS A 1 317 ? -8.706  33.967  61.372  1.00 29.51  ? 317  HIS A ND1   1 
ATOM   2625 C  CD2   . HIS A 1 317 ? -7.959  31.916  61.260  1.00 27.34  ? 317  HIS A CD2   1 
ATOM   2626 C  CE1   . HIS A 1 317 ? -9.740  33.189  61.113  1.00 26.14  ? 317  HIS A CE1   1 
ATOM   2627 N  NE2   . HIS A 1 317 ? -9.313  31.940  61.034  1.00 28.43  ? 317  HIS A NE2   1 
ATOM   2628 N  N     . GLN A 1 318 ? -5.917  35.726  59.183  1.00 32.51  ? 318  GLN A N     1 
ATOM   2629 C  CA    . GLN A 1 318 ? -6.553  36.453  58.092  1.00 35.22  ? 318  GLN A CA    1 
ATOM   2630 C  C     . GLN A 1 318 ? -6.115  35.878  56.739  1.00 36.51  ? 318  GLN A C     1 
ATOM   2631 O  O     . GLN A 1 318 ? -6.945  35.479  55.930  1.00 39.64  ? 318  GLN A O     1 
ATOM   2632 C  CB    . GLN A 1 318 ? -6.222  37.955  58.193  1.00 34.60  ? 318  GLN A CB    1 
ATOM   2633 C  CG    . GLN A 1 318 ? -6.636  38.787  56.970  1.00 34.48  ? 318  GLN A CG    1 
ATOM   2634 C  CD    . GLN A 1 318 ? -8.143  38.852  56.757  1.00 34.39  ? 318  GLN A CD    1 
ATOM   2635 O  OE1   . GLN A 1 318 ? -8.916  38.880  57.709  1.00 33.53  ? 318  GLN A OE1   1 
ATOM   2636 N  NE2   . GLN A 1 318 ? -8.563  38.878  55.498  1.00 36.89  ? 318  GLN A NE2   1 
ATOM   2637 N  N     . ARG A 1 319 ? -4.803  35.821  56.528  1.00 37.81  ? 319  ARG A N     1 
ATOM   2638 C  CA    . ARG A 1 319 ? -4.203  35.244  55.335  1.00 38.00  ? 319  ARG A CA    1 
ATOM   2639 C  C     . ARG A 1 319 ? -4.491  33.750  55.179  1.00 36.10  ? 319  ARG A C     1 
ATOM   2640 O  O     . ARG A 1 319 ? -4.753  33.276  54.069  1.00 34.04  ? 319  ARG A O     1 
ATOM   2641 C  CB    . ARG A 1 319 ? -2.695  35.489  55.357  1.00 39.99  ? 319  ARG A CB    1 
ATOM   2642 C  CG    . ARG A 1 319 ? -1.972  34.997  54.125  1.00 42.77  ? 319  ARG A CG    1 
ATOM   2643 C  CD    . ARG A 1 319 ? -0.901  35.970  53.713  1.00 47.92  ? 319  ARG A CD    1 
ATOM   2644 N  NE    . ARG A 1 319 ? -1.475  37.250  53.302  1.00 48.94  ? 319  ARG A NE    1 
ATOM   2645 C  CZ    . ARG A 1 319 ? -0.754  38.300  52.931  1.00 50.93  ? 319  ARG A CZ    1 
ATOM   2646 N  NH1   . ARG A 1 319 ? 0.569   38.226  52.912  1.00 50.82  ? 319  ARG A NH1   1 
ATOM   2647 N  NH2   . ARG A 1 319 ? -1.359  39.423  52.579  1.00 52.86  ? 319  ARG A NH2   1 
ATOM   2648 N  N     . TYR A 1 320 ? -4.436  33.024  56.294  1.00 34.85  ? 320  TYR A N     1 
ATOM   2649 C  CA    . TYR A 1 320 ? -4.698  31.582  56.333  1.00 33.22  ? 320  TYR A CA    1 
ATOM   2650 C  C     . TYR A 1 320 ? -6.025  31.249  55.686  1.00 29.74  ? 320  TYR A C     1 
ATOM   2651 O  O     . TYR A 1 320 ? -6.097  30.382  54.820  1.00 30.90  ? 320  TYR A O     1 
ATOM   2652 C  CB    . TYR A 1 320 ? -4.712  31.122  57.783  1.00 35.84  ? 320  TYR A CB    1 
ATOM   2653 C  CG    . TYR A 1 320 ? -4.711  29.628  58.036  1.00 35.66  ? 320  TYR A CG    1 
ATOM   2654 C  CD1   . TYR A 1 320 ? -3.551  28.876  57.876  1.00 34.54  ? 320  TYR A CD1   1 
ATOM   2655 C  CD2   . TYR A 1 320 ? -5.851  28.987  58.523  1.00 36.68  ? 320  TYR A CD2   1 
ATOM   2656 C  CE1   . TYR A 1 320 ? -3.531  27.517  58.157  1.00 34.13  ? 320  TYR A CE1   1 
ATOM   2657 C  CE2   . TYR A 1 320 ? -5.843  27.627  58.807  1.00 36.49  ? 320  TYR A CE2   1 
ATOM   2658 C  CZ    . TYR A 1 320 ? -4.676  26.899  58.621  1.00 36.49  ? 320  TYR A CZ    1 
ATOM   2659 O  OH    . TYR A 1 320 ? -4.652  25.555  58.904  1.00 32.87  ? 320  TYR A OH    1 
ATOM   2660 N  N     . ILE A 1 321 ? -7.070  31.956  56.100  1.00 30.92  ? 321  ILE A N     1 
ATOM   2661 C  CA    . ILE A 1 321 ? -8.404  31.764  55.536  1.00 28.63  ? 321  ILE A CA    1 
ATOM   2662 C  C     . ILE A 1 321 ? -8.454  32.214  54.073  1.00 30.49  ? 321  ILE A C     1 
ATOM   2663 O  O     . ILE A 1 321 ? -8.987  31.496  53.225  1.00 29.70  ? 321  ILE A O     1 
ATOM   2664 C  CB    . ILE A 1 321 ? -9.505  32.462  56.374  1.00 28.50  ? 321  ILE A CB    1 
ATOM   2665 C  CG1   . ILE A 1 321 ? -9.589  31.859  57.786  1.00 29.75  ? 321  ILE A CG1   1 
ATOM   2666 C  CG2   . ILE A 1 321 ? -10.884 32.385  55.672  1.00 27.05  ? 321  ILE A CG2   1 
ATOM   2667 C  CD1   . ILE A 1 321 ? -9.832  30.328  57.849  1.00 31.02  ? 321  ILE A CD1   1 
ATOM   2668 N  N     . SER A 1 322 ? -7.881  33.381  53.777  1.00 29.14  ? 322  SER A N     1 
ATOM   2669 C  CA    . SER A 1 322 ? -7.904  33.912  52.414  1.00 32.30  ? 322  SER A CA    1 
ATOM   2670 C  C     . SER A 1 322 ? -7.218  32.984  51.414  1.00 33.44  ? 322  SER A C     1 
ATOM   2671 O  O     . SER A 1 322 ? -7.712  32.785  50.308  1.00 34.92  ? 322  SER A O     1 
ATOM   2672 C  CB    . SER A 1 322 ? -7.270  35.308  52.356  1.00 33.58  ? 322  SER A CB    1 
ATOM   2673 O  OG    . SER A 1 322 ? -8.127  36.288  52.919  1.00 32.52  ? 322  SER A OG    1 
ATOM   2674 N  N     . TYR A 1 323 ? -6.086  32.409  51.815  1.00 36.53  ? 323  TYR A N     1 
ATOM   2675 C  CA    . TYR A 1 323 ? -5.349  31.496  50.952  1.00 36.96  ? 323  TYR A CA    1 
ATOM   2676 C  C     . TYR A 1 323 ? -6.117  30.205  50.749  1.00 35.25  ? 323  TYR A C     1 
ATOM   2677 O  O     . TYR A 1 323 ? -6.006  29.584  49.696  1.00 37.67  ? 323  TYR A O     1 
ATOM   2678 C  CB    . TYR A 1 323 ? -3.934  31.249  51.490  1.00 38.29  ? 323  TYR A CB    1 
ATOM   2679 C  CG    . TYR A 1 323 ? -2.963  32.382  51.170  1.00 43.73  ? 323  TYR A CG    1 
ATOM   2680 C  CD1   . TYR A 1 323 ? -1.614  32.299  51.528  1.00 43.18  ? 323  TYR A CD1   1 
ATOM   2681 C  CD2   . TYR A 1 323 ? -3.392  33.533  50.489  1.00 46.28  ? 323  TYR A CD2   1 
ATOM   2682 C  CE1   . TYR A 1 323 ? -0.722  33.334  51.229  1.00 44.56  ? 323  TYR A CE1   1 
ATOM   2683 C  CE2   . TYR A 1 323 ? -2.510  34.571  50.185  1.00 46.58  ? 323  TYR A CE2   1 
ATOM   2684 C  CZ    . TYR A 1 323 ? -1.179  34.463  50.555  1.00 48.49  ? 323  TYR A CZ    1 
ATOM   2685 O  OH    . TYR A 1 323 ? -0.308  35.488  50.256  1.00 53.94  ? 323  TYR A OH    1 
ATOM   2686 N  N     . ASN A 1 324 ? -6.907  29.819  51.749  1.00 34.02  ? 324  ASN A N     1 
ATOM   2687 C  CA    . ASN A 1 324 ? -7.773  28.646  51.642  1.00 32.59  ? 324  ASN A CA    1 
ATOM   2688 C  C     . ASN A 1 324 ? -8.881  28.890  50.622  1.00 31.42  ? 324  ASN A C     1 
ATOM   2689 O  O     . ASN A 1 324 ? -9.172  28.016  49.818  1.00 31.61  ? 324  ASN A O     1 
ATOM   2690 C  CB    . ASN A 1 324 ? -8.358  28.252  53.009  1.00 32.58  ? 324  ASN A CB    1 
ATOM   2691 C  CG    . ASN A 1 324 ? -9.281  27.033  52.933  1.00 34.89  ? 324  ASN A CG    1 
ATOM   2692 O  OD1   . ASN A 1 324 ? -10.462 27.121  53.261  1.00 36.99  ? 324  ASN A OD1   1 
ATOM   2693 N  ND2   . ASN A 1 324 ? -8.744  25.895  52.495  1.00 34.91  ? 324  ASN A ND2   1 
ATOM   2694 N  N     . ILE A 1 325 ? -9.484  30.081  50.650  1.00 30.24  ? 325  ILE A N     1 
ATOM   2695 C  CA    . ILE A 1 325 ? -10.492 30.452  49.655  1.00 31.40  ? 325  ILE A CA    1 
ATOM   2696 C  C     . ILE A 1 325 ? -9.872  30.508  48.246  1.00 32.14  ? 325  ILE A C     1 
ATOM   2697 O  O     . ILE A 1 325 ? -10.444 29.984  47.287  1.00 31.65  ? 325  ILE A O     1 
ATOM   2698 C  CB    . ILE A 1 325 ? -11.172 31.806  49.988  1.00 31.87  ? 325  ILE A CB    1 
ATOM   2699 C  CG1   . ILE A 1 325 ? -11.891 31.742  51.342  1.00 30.64  ? 325  ILE A CG1   1 
ATOM   2700 C  CG2   . ILE A 1 325 ? -12.141 32.221  48.878  1.00 28.45  ? 325  ILE A CG2   1 
ATOM   2701 C  CD1   . ILE A 1 325 ? -12.234 33.123  51.936  1.00 23.00  ? 325  ILE A CD1   1 
ATOM   2702 N  N     . ILE A 1 326 ? -8.697  31.131  48.137  1.00 32.30  ? 326  ILE A N     1 
ATOM   2703 C  CA    . ILE A 1 326 ? -8.025  31.309  46.846  1.00 31.30  ? 326  ILE A CA    1 
ATOM   2704 C  C     . ILE A 1 326 ? -7.629  29.978  46.202  1.00 31.35  ? 326  ILE A C     1 
ATOM   2705 O  O     . ILE A 1 326 ? -7.765  29.808  44.983  1.00 32.10  ? 326  ILE A O     1 
ATOM   2706 C  CB    . ILE A 1 326 ? -6.805  32.256  46.969  1.00 32.99  ? 326  ILE A CB    1 
ATOM   2707 C  CG1   . ILE A 1 326 ? -7.289  33.691  47.234  1.00 31.25  ? 326  ILE A CG1   1 
ATOM   2708 C  CG2   . ILE A 1 326 ? -5.933  32.204  45.696  1.00 32.03  ? 326  ILE A CG2   1 
ATOM   2709 C  CD1   . ILE A 1 326 ? -6.209  34.658  47.685  1.00 30.41  ? 326  ILE A CD1   1 
ATOM   2710 N  N     . ALA A 1 327 ? -7.159  29.036  47.022  1.00 29.44  ? 327  ALA A N     1 
ATOM   2711 C  CA    . ALA A 1 327 ? -6.823  27.698  46.544  1.00 29.49  ? 327  ALA A CA    1 
ATOM   2712 C  C     . ALA A 1 327 ? -8.006  27.042  45.827  1.00 29.53  ? 327  ALA A C     1 
ATOM   2713 O  O     . ALA A 1 327 ? -7.842  26.429  44.767  1.00 29.91  ? 327  ALA A O     1 
ATOM   2714 C  CB    . ALA A 1 327 ? -6.336  26.824  47.690  1.00 28.91  ? 327  ALA A CB    1 
ATOM   2715 N  N     . VAL A 1 328 ? -9.198  27.193  46.389  1.00 29.76  ? 328  VAL A N     1 
ATOM   2716 C  CA    . VAL A 1 328 ? -10.396 26.615  45.784  1.00 30.88  ? 328  VAL A CA    1 
ATOM   2717 C  C     . VAL A 1 328 ? -10.674 27.271  44.436  1.00 30.41  ? 328  VAL A C     1 
ATOM   2718 O  O     . VAL A 1 328 ? -10.866 26.589  43.439  1.00 28.07  ? 328  VAL A O     1 
ATOM   2719 C  CB    . VAL A 1 328 ? -11.620 26.709  46.728  1.00 32.23  ? 328  VAL A CB    1 
ATOM   2720 C  CG1   . VAL A 1 328 ? -12.900 26.288  46.015  1.00 30.46  ? 328  VAL A CG1   1 
ATOM   2721 C  CG2   . VAL A 1 328 ? -11.395 25.826  47.952  1.00 33.48  ? 328  VAL A CG2   1 
ATOM   2722 N  N     . TYR A 1 329 ? -10.666 28.599  44.417  1.00 31.03  ? 329  TYR A N     1 
ATOM   2723 C  CA    . TYR A 1 329 ? -10.905 29.356  43.196  1.00 31.06  ? 329  TYR A CA    1 
ATOM   2724 C  C     . TYR A 1 329 ? -9.914  29.004  42.092  1.00 32.12  ? 329  TYR A C     1 
ATOM   2725 O  O     . TYR A 1 329 ? -10.278 28.955  40.919  1.00 34.48  ? 329  TYR A O     1 
ATOM   2726 C  CB    . TYR A 1 329 ? -10.852 30.857  43.487  1.00 30.69  ? 329  TYR A CB    1 
ATOM   2727 C  CG    . TYR A 1 329 ? -11.228 31.728  42.309  1.00 30.39  ? 329  TYR A CG    1 
ATOM   2728 C  CD1   . TYR A 1 329 ? -12.301 31.396  41.477  1.00 29.94  ? 329  TYR A CD1   1 
ATOM   2729 C  CD2   . TYR A 1 329 ? -10.520 32.890  42.035  1.00 32.26  ? 329  TYR A CD2   1 
ATOM   2730 C  CE1   . TYR A 1 329 ? -12.651 32.203  40.396  1.00 32.65  ? 329  TYR A CE1   1 
ATOM   2731 C  CE2   . TYR A 1 329 ? -10.860 33.703  40.958  1.00 36.24  ? 329  TYR A CE2   1 
ATOM   2732 C  CZ    . TYR A 1 329 ? -11.926 33.357  40.147  1.00 32.20  ? 329  TYR A CZ    1 
ATOM   2733 O  OH    . TYR A 1 329 ? -12.251 34.166  39.081  1.00 35.44  ? 329  TYR A OH    1 
ATOM   2734 N  N     . ARG A 1 330 ? -8.665  28.757  42.468  1.00 32.10  ? 330  ARG A N     1 
ATOM   2735 C  CA    . ARG A 1 330 ? -7.637  28.456  41.483  1.00 32.61  ? 330  ARG A CA    1 
ATOM   2736 C  C     . ARG A 1 330 ? -7.916  27.189  40.686  1.00 31.48  ? 330  ARG A C     1 
ATOM   2737 O  O     . ARG A 1 330 ? -7.705  27.161  39.477  1.00 33.74  ? 330  ARG A O     1 
ATOM   2738 C  CB    . ARG A 1 330 ? -6.244  28.483  42.116  1.00 33.53  ? 330  ARG A CB    1 
ATOM   2739 C  CG    . ARG A 1 330 ? -5.772  29.912  42.306  1.00 38.76  ? 330  ARG A CG    1 
ATOM   2740 C  CD    . ARG A 1 330 ? -4.408  30.003  42.931  1.00 48.37  ? 330  ARG A CD    1 
ATOM   2741 N  NE    . ARG A 1 330 ? -3.956  31.394  42.968  1.00 53.70  ? 330  ARG A NE    1 
ATOM   2742 C  CZ    . ARG A 1 330 ? -2.708  31.778  43.230  1.00 56.82  ? 330  ARG A CZ    1 
ATOM   2743 N  NH1   . ARG A 1 330 ? -1.756  30.878  43.468  1.00 54.16  ? 330  ARG A NH1   1 
ATOM   2744 N  NH2   . ARG A 1 330 ? -2.408  33.072  43.236  1.00 56.90  ? 330  ARG A NH2   1 
ATOM   2745 N  N     . VAL A 1 331 ? -8.438  26.161  41.346  1.00 29.72  ? 331  VAL A N     1 
ATOM   2746 C  CA    . VAL A 1 331 ? -8.883  24.958  40.643  1.00 29.86  ? 331  VAL A CA    1 
ATOM   2747 C  C     . VAL A 1 331 ? -10.020 25.271  39.657  1.00 30.39  ? 331  VAL A C     1 
ATOM   2748 O  O     . VAL A 1 331 ? -10.011 24.791  38.527  1.00 31.65  ? 331  VAL A O     1 
ATOM   2749 C  CB    . VAL A 1 331 ? -9.319  23.842  41.614  1.00 31.22  ? 331  VAL A CB    1 
ATOM   2750 C  CG1   . VAL A 1 331 ? -9.510  22.546  40.864  1.00 29.64  ? 331  VAL A CG1   1 
ATOM   2751 C  CG2   . VAL A 1 331 ? -8.290  23.656  42.723  1.00 32.20  ? 331  VAL A CG2   1 
ATOM   2752 N  N     . LEU A 1 332 ? -10.987 26.082  40.081  1.00 30.58  ? 332  LEU A N     1 
ATOM   2753 C  CA    . LEU A 1 332 ? -12.079 26.497  39.200  1.00 29.83  ? 332  LEU A CA    1 
ATOM   2754 C  C     . LEU A 1 332 ? -11.550 27.236  37.975  1.00 32.05  ? 332  LEU A C     1 
ATOM   2755 O  O     . LEU A 1 332 ? -12.057 27.046  36.871  1.00 34.61  ? 332  LEU A O     1 
ATOM   2756 C  CB    . LEU A 1 332 ? -13.063 27.400  39.946  1.00 29.07  ? 332  LEU A CB    1 
ATOM   2757 C  CG    . LEU A 1 332 ? -13.915 26.786  41.056  1.00 31.97  ? 332  LEU A CG    1 
ATOM   2758 C  CD1   . LEU A 1 332 ? -14.640 27.893  41.810  1.00 31.07  ? 332  LEU A CD1   1 
ATOM   2759 C  CD2   . LEU A 1 332 ? -14.903 25.754  40.487  1.00 30.00  ? 332  LEU A CD2   1 
ATOM   2760 N  N     . GLN A 1 333 ? -10.531 28.074  38.184  1.00 30.68  ? 333  GLN A N     1 
ATOM   2761 C  CA    . GLN A 1 333 ? -9.917  28.853  37.113  1.00 32.08  ? 333  GLN A CA    1 
ATOM   2762 C  C     . GLN A 1 333 ? -9.150  27.958  36.141  1.00 32.24  ? 333  GLN A C     1 
ATOM   2763 O  O     . GLN A 1 333 ? -9.200  28.156  34.928  1.00 34.05  ? 333  GLN A O     1 
ATOM   2764 C  CB    . GLN A 1 333 ? -8.974  29.903  37.691  1.00 31.54  ? 333  GLN A CB    1 
ATOM   2765 C  CG    . GLN A 1 333 ? -9.663  31.094  38.305  1.00 32.49  ? 333  GLN A CG    1 
ATOM   2766 C  CD    . GLN A 1 333 ? -8.670  32.086  38.891  1.00 38.11  ? 333  GLN A CD    1 
ATOM   2767 O  OE1   . GLN A 1 333 ? -8.570  33.221  38.427  1.00 38.22  ? 333  GLN A OE1   1 
ATOM   2768 N  NE2   . GLN A 1 333 ? -7.925  31.658  39.910  1.00 36.65  ? 333  GLN A NE2   1 
ATOM   2769 N  N     . ILE A 1 334 ? -8.438  26.977  36.682  1.00 30.98  ? 334  ILE A N     1 
ATOM   2770 C  CA    . ILE A 1 334 ? -7.780  25.976  35.857  1.00 32.88  ? 334  ILE A CA    1 
ATOM   2771 C  C     . ILE A 1 334 ? -8.826  25.236  35.012  1.00 33.92  ? 334  ILE A C     1 
ATOM   2772 O  O     . ILE A 1 334 ? -8.632  25.039  33.812  1.00 33.50  ? 334  ILE A O     1 
ATOM   2773 C  CB    . ILE A 1 334 ? -6.924  25.007  36.717  1.00 31.72  ? 334  ILE A CB    1 
ATOM   2774 C  CG1   . ILE A 1 334 ? -5.727  25.762  37.324  1.00 28.79  ? 334  ILE A CG1   1 
ATOM   2775 C  CG2   . ILE A 1 334 ? -6.474  23.796  35.897  1.00 29.29  ? 334  ILE A CG2   1 
ATOM   2776 C  CD1   . ILE A 1 334 ? -4.992  24.992  38.419  1.00 27.72  ? 334  ILE A CD1   1 
ATOM   2777 N  N     . ASP A 1 335 ? -9.941  24.854  35.635  1.00 34.21  ? 335  ASP A N     1 
ATOM   2778 C  CA    . ASP A 1 335 ? -11.022 24.215  34.897  1.00 34.15  ? 335  ASP A CA    1 
ATOM   2779 C  C     . ASP A 1 335 ? -11.696 25.104  33.847  1.00 33.32  ? 335  ASP A C     1 
ATOM   2780 O  O     . ASP A 1 335 ? -11.996 24.635  32.755  1.00 33.13  ? 335  ASP A O     1 
ATOM   2781 C  CB    . ASP A 1 335 ? -12.085 23.605  35.807  1.00 33.06  ? 335  ASP A CB    1 
ATOM   2782 C  CG    . ASP A 1 335 ? -12.937 22.583  35.063  1.00 36.77  ? 335  ASP A CG    1 
ATOM   2783 O  OD1   . ASP A 1 335 ? -12.355 21.606  34.534  1.00 35.64  ? 335  ASP A OD1   1 
ATOM   2784 O  OD2   . ASP A 1 335 ? -14.167 22.771  34.964  1.00 34.31  ? 335  ASP A OD2   1 
ATOM   2785 N  N     . ALA A 1 336 ? -11.943 26.369  34.178  1.00 30.23  ? 336  ALA A N     1 
ATOM   2786 C  CA    . ALA A 1 336 ? -12.487 27.324  33.206  1.00 30.62  ? 336  ALA A CA    1 
ATOM   2787 C  C     . ALA A 1 336 ? -11.681 27.316  31.911  1.00 31.15  ? 336  ALA A C     1 
ATOM   2788 O  O     . ALA A 1 336 ? -12.233 27.489  30.823  1.00 30.49  ? 336  ALA A O     1 
ATOM   2789 C  CB    . ALA A 1 336 ? -12.517 28.723  33.793  1.00 31.66  ? 336  ALA A CB    1 
ATOM   2790 N  N     . LYS A 1 337 ? -10.375 27.095  32.051  1.00 32.17  ? 337  LYS A N     1 
ATOM   2791 C  CA    . LYS A 1 337 ? -9.440  27.066  30.938  1.00 29.91  ? 337  LYS A CA    1 
ATOM   2792 C  C     . LYS A 1 337 ? -9.359  25.688  30.260  1.00 31.52  ? 337  LYS A C     1 
ATOM   2793 O  O     . LYS A 1 337 ? -9.528  25.580  29.034  1.00 31.24  ? 337  LYS A O     1 
ATOM   2794 C  CB    . LYS A 1 337 ? -8.058  27.512  31.427  1.00 29.31  ? 337  LYS A CB    1 
ATOM   2795 C  CG    . LYS A 1 337 ? -6.968  27.391  30.389  1.00 30.70  ? 337  LYS A CG    1 
ATOM   2796 C  CD    . LYS A 1 337 ? -5.601  27.698  30.974  1.00 35.38  ? 337  LYS A CD    1 
ATOM   2797 C  CE    . LYS A 1 337 ? -4.535  27.632  29.873  1.00 39.31  ? 337  LYS A CE    1 
ATOM   2798 N  NZ    . LYS A 1 337 ? -3.163  27.370  30.413  1.00 42.60  ? 337  LYS A NZ    1 
ATOM   2799 N  N     . ARG A 1 338 ? -9.096  24.645  31.053  1.00 28.52  ? 338  ARG A N     1 
ATOM   2800 C  CA    . ARG A 1 338 ? -8.839  23.309  30.525  1.00 26.82  ? 338  ARG A CA    1 
ATOM   2801 C  C     . ARG A 1 338 ? -10.102 22.536  30.194  1.00 28.74  ? 338  ARG A C     1 
ATOM   2802 O  O     . ARG A 1 338 ? -10.108 21.722  29.256  1.00 30.73  ? 338  ARG A O     1 
ATOM   2803 C  CB    . ARG A 1 338 ? -7.969  22.486  31.488  1.00 27.42  ? 338  ARG A CB    1 
ATOM   2804 C  CG    . ARG A 1 338 ? -6.493  22.899  31.559  1.00 25.66  ? 338  ARG A CG    1 
ATOM   2805 C  CD    . ARG A 1 338 ? -5.722  22.624  30.256  1.00 24.64  ? 338  ARG A CD    1 
ATOM   2806 N  NE    . ARG A 1 338 ? -4.281  22.669  30.491  1.00 26.51  ? 338  ARG A NE    1 
ATOM   2807 C  CZ    . ARG A 1 338 ? -3.366  21.973  29.816  1.00 28.53  ? 338  ARG A CZ    1 
ATOM   2808 N  NH1   . ARG A 1 338 ? -3.714  21.146  28.834  1.00 27.39  ? 338  ARG A NH1   1 
ATOM   2809 N  NH2   . ARG A 1 338 ? -2.083  22.095  30.142  1.00 29.16  ? 338  ARG A NH2   1 
ATOM   2810 N  N     . GLN A 1 339 ? -11.153 22.774  30.972  1.00 27.48  ? 339  GLN A N     1 
ATOM   2811 C  CA    . GLN A 1 339 ? -12.478 22.162  30.763  1.00 28.94  ? 339  GLN A CA    1 
ATOM   2812 C  C     . GLN A 1 339 ? -12.507 20.624  30.915  1.00 29.87  ? 339  GLN A C     1 
ATOM   2813 O  O     . GLN A 1 339 ? -13.208 19.930  30.176  1.00 30.54  ? 339  GLN A O     1 
ATOM   2814 C  CB    . GLN A 1 339 ? -13.081 22.642  29.431  1.00 27.52  ? 339  GLN A CB    1 
ATOM   2815 C  CG    . GLN A 1 339 ? -13.028 24.175  29.314  1.00 32.62  ? 339  GLN A CG    1 
ATOM   2816 C  CD    . GLN A 1 339 ? -13.673 24.764  28.057  1.00 36.94  ? 339  GLN A CD    1 
ATOM   2817 O  OE1   . GLN A 1 339 ? -13.530 25.958  27.794  1.00 41.91  ? 339  GLN A OE1   1 
ATOM   2818 N  NE2   . GLN A 1 339 ? -14.384 23.947  27.293  1.00 36.97  ? 339  GLN A NE2   1 
ATOM   2819 N  N     . PHE A 1 340 ? -11.771 20.108  31.904  1.00 31.09  ? 340  PHE A N     1 
ATOM   2820 C  CA    . PHE A 1 340 ? -11.702 18.661  32.136  1.00 30.33  ? 340  PHE A CA    1 
ATOM   2821 C  C     . PHE A 1 340 ? -12.982 18.077  32.736  1.00 32.35  ? 340  PHE A C     1 
ATOM   2822 O  O     . PHE A 1 340 ? -13.320 16.916  32.460  1.00 34.74  ? 340  PHE A O     1 
ATOM   2823 C  CB    . PHE A 1 340 ? -10.473 18.254  32.978  1.00 30.06  ? 340  PHE A CB    1 
ATOM   2824 C  CG    . PHE A 1 340 ? -9.134  18.566  32.333  1.00 30.07  ? 340  PHE A CG    1 
ATOM   2825 C  CD1   . PHE A 1 340 ? -8.975  18.565  30.946  1.00 28.96  ? 340  PHE A CD1   1 
ATOM   2826 C  CD2   . PHE A 1 340 ? -8.026  18.844  33.124  1.00 31.62  ? 340  PHE A CD2   1 
ATOM   2827 C  CE1   . PHE A 1 340 ? -7.744  18.864  30.367  1.00 29.85  ? 340  PHE A CE1   1 
ATOM   2828 C  CE2   . PHE A 1 340 ? -6.784  19.142  32.556  1.00 30.29  ? 340  PHE A CE2   1 
ATOM   2829 C  CZ    . PHE A 1 340 ? -6.641  19.141  31.172  1.00 31.86  ? 340  PHE A CZ    1 
ATOM   2830 N  N     . ILE A 1 341 ? -13.682 18.853  33.563  1.00 30.49  ? 341  ILE A N     1 
ATOM   2831 C  CA    . ILE A 1 341 ? -14.977 18.405  34.098  1.00 31.62  ? 341  ILE A CA    1 
ATOM   2832 C  C     . ILE A 1 341 ? -15.973 18.190  32.941  1.00 30.23  ? 341  ILE A C     1 
ATOM   2833 O  O     . ILE A 1 341 ? -16.619 17.144  32.850  1.00 29.98  ? 341  ILE A O     1 
ATOM   2834 C  CB    . ILE A 1 341 ? -15.585 19.394  35.143  1.00 31.57  ? 341  ILE A CB    1 
ATOM   2835 C  CG1   . ILE A 1 341 ? -14.577 19.779  36.241  1.00 34.19  ? 341  ILE A CG1   1 
ATOM   2836 C  CG2   . ILE A 1 341 ? -16.856 18.822  35.748  1.00 31.62  ? 341  ILE A CG2   1 
ATOM   2837 C  CD1   . ILE A 1 341 ? -14.008 18.638  37.032  1.00 34.29  ? 341  ILE A CD1   1 
ATOM   2838 N  N     . ASN A 1 342 ? -16.078 19.194  32.073  1.00 29.59  ? 342  ASN A N     1 
ATOM   2839 C  CA    . ASN A 1 342 ? -16.848 19.125  30.822  1.00 31.85  ? 342  ASN A CA    1 
ATOM   2840 C  C     . ASN A 1 342 ? -16.512 17.887  29.987  1.00 29.39  ? 342  ASN A C     1 
ATOM   2841 O  O     . ASN A 1 342 ? -17.396 17.145  29.580  1.00 30.00  ? 342  ASN A O     1 
ATOM   2842 C  CB    . ASN A 1 342 ? -16.603 20.402  30.003  1.00 32.97  ? 342  ASN A CB    1 
ATOM   2843 C  CG    . ASN A 1 342 ? -17.386 20.431  28.695  1.00 37.54  ? 342  ASN A CG    1 
ATOM   2844 O  OD1   . ASN A 1 342 ? -18.595 20.683  28.687  1.00 36.05  ? 342  ASN A OD1   1 
ATOM   2845 N  ND2   . ASN A 1 342 ? -16.688 20.199  27.577  1.00 32.82  ? 342  ASN A ND2   1 
ATOM   2846 N  N     . LEU A 1 343 ? -15.222 17.666  29.755  1.00 29.84  ? 343  LEU A N     1 
ATOM   2847 C  CA    . LEU A 1 343 ? -14.756 16.493  29.035  1.00 28.60  ? 343  LEU A CA    1 
ATOM   2848 C  C     . LEU A 1 343 ? -15.238 15.203  29.691  1.00 29.33  ? 343  LEU A C     1 
ATOM   2849 O  O     . LEU A 1 343 ? -15.769 14.316  29.016  1.00 32.66  ? 343  LEU A O     1 
ATOM   2850 C  CB    . LEU A 1 343 ? -13.235 16.503  28.938  1.00 27.08  ? 343  LEU A CB    1 
ATOM   2851 C  CG    . LEU A 1 343 ? -12.591 15.205  28.426  1.00 26.69  ? 343  LEU A CG    1 
ATOM   2852 C  CD1   . LEU A 1 343 ? -12.865 14.952  26.911  1.00 23.36  ? 343  LEU A CD1   1 
ATOM   2853 C  CD2   . LEU A 1 343 ? -11.112 15.254  28.739  1.00 21.27  ? 343  LEU A CD2   1 
ATOM   2854 N  N     . SER A 1 344 ? -15.060 15.120  31.004  1.00 28.88  ? 344  SER A N     1 
ATOM   2855 C  CA    . SER A 1 344 ? -15.460 13.960  31.794  1.00 29.48  ? 344  SER A CA    1 
ATOM   2856 C  C     . SER A 1 344 ? -16.940 13.675  31.674  1.00 28.59  ? 344  SER A C     1 
ATOM   2857 O  O     . SER A 1 344 ? -17.336 12.536  31.435  1.00 29.41  ? 344  SER A O     1 
ATOM   2858 C  CB    . SER A 1 344 ? -15.101 14.164  33.273  1.00 28.55  ? 344  SER A CB    1 
ATOM   2859 O  OG    . SER A 1 344 ? -13.699 14.235  33.441  1.00 25.56  ? 344  SER A OG    1 
ATOM   2860 N  N     . LEU A 1 345 ? -17.760 14.709  31.837  1.00 28.43  ? 345  LEU A N     1 
ATOM   2861 C  CA    . LEU A 1 345 ? -19.207 14.547  31.731  1.00 28.53  ? 345  LEU A CA    1 
ATOM   2862 C  C     . LEU A 1 345 ? -19.615 14.110  30.314  1.00 31.06  ? 345  LEU A C     1 
ATOM   2863 O  O     . LEU A 1 345 ? -20.453 13.219  30.159  1.00 32.11  ? 345  LEU A O     1 
ATOM   2864 C  CB    . LEU A 1 345 ? -19.932 15.824  32.173  1.00 29.93  ? 345  LEU A CB    1 
ATOM   2865 C  CG    . LEU A 1 345 ? -19.812 16.196  33.657  1.00 30.57  ? 345  LEU A CG    1 
ATOM   2866 C  CD1   . LEU A 1 345 ? -20.068 17.700  33.890  1.00 28.16  ? 345  LEU A CD1   1 
ATOM   2867 C  CD2   . LEU A 1 345 ? -20.733 15.343  34.515  1.00 23.70  ? 345  LEU A CD2   1 
ATOM   2868 N  N     . ASP A 1 346 ? -18.993 14.707  29.293  1.00 31.18  ? 346  ASP A N     1 
ATOM   2869 C  CA    . ASP A 1 346 ? -19.211 14.305  27.896  1.00 35.06  ? 346  ASP A CA    1 
ATOM   2870 C  C     . ASP A 1 346 ? -18.913 12.826  27.645  1.00 34.50  ? 346  ASP A C     1 
ATOM   2871 O  O     . ASP A 1 346 ? -19.735 12.133  27.065  1.00 36.45  ? 346  ASP A O     1 
ATOM   2872 C  CB    . ASP A 1 346 ? -18.365 15.153  26.929  1.00 38.04  ? 346  ASP A CB    1 
ATOM   2873 C  CG    . ASP A 1 346 ? -18.990 16.502  26.616  1.00 42.64  ? 346  ASP A CG    1 
ATOM   2874 O  OD1   . ASP A 1 346 ? -20.186 16.710  26.920  1.00 43.68  ? 346  ASP A OD1   1 
ATOM   2875 O  OD2   . ASP A 1 346 ? -18.279 17.358  26.046  1.00 44.79  ? 346  ASP A OD2   1 
ATOM   2876 N  N     . MET A 1 347 ? -17.729 12.361  28.055  1.00 34.84  ? 347  MET A N     1 
ATOM   2877 C  CA    . MET A 1 347 ? -17.329 10.959  27.877  1.00 33.95  ? 347  MET A CA    1 
ATOM   2878 C  C     . MET A 1 347 ? -18.207 10.046  28.718  1.00 30.28  ? 347  MET A C     1 
ATOM   2879 O  O     . MET A 1 347 ? -18.654 9.004   28.250  1.00 30.16  ? 347  MET A O     1 
ATOM   2880 C  CB    . MET A 1 347 ? -15.872 10.727  28.296  1.00 36.18  ? 347  MET A CB    1 
ATOM   2881 C  CG    . MET A 1 347 ? -14.784 11.180  27.328  1.00 46.44  ? 347  MET A CG    1 
ATOM   2882 S  SD    . MET A 1 347 ? -13.094 10.860  27.986  1.00 57.89  ? 347  MET A SD    1 
ATOM   2883 C  CE    . MET A 1 347 ? -13.198 9.134   28.475  1.00 48.50  ? 347  MET A CE    1 
ATOM   2884 N  N     . GLY A 1 348 ? -18.429 10.444  29.966  1.00 28.26  ? 348  GLY A N     1 
ATOM   2885 C  CA    . GLY A 1 348 ? -19.217 9.671   30.916  1.00 25.32  ? 348  GLY A CA    1 
ATOM   2886 C  C     . GLY A 1 348 ? -20.620 9.394   30.436  1.00 26.74  ? 348  GLY A C     1 
ATOM   2887 O  O     . GLY A 1 348 ? -21.059 8.242   30.425  1.00 29.37  ? 348  GLY A O     1 
ATOM   2888 N  N     . TYR A 1 349 ? -21.328 10.442  30.022  1.00 26.72  ? 349  TYR A N     1 
ATOM   2889 C  CA    . TYR A 1 349 ? -22.691 10.263  29.550  1.00 28.89  ? 349  TYR A CA    1 
ATOM   2890 C  C     . TYR A 1 349 ? -22.750 9.530   28.210  1.00 29.23  ? 349  TYR A C     1 
ATOM   2891 O  O     . TYR A 1 349 ? -23.683 8.764   27.961  1.00 29.70  ? 349  TYR A O     1 
ATOM   2892 C  CB    . TYR A 1 349 ? -23.458 11.583  29.511  1.00 26.20  ? 349  TYR A CB    1 
ATOM   2893 C  CG    . TYR A 1 349 ? -23.842 12.058  30.884  1.00 29.33  ? 349  TYR A CG    1 
ATOM   2894 C  CD1   . TYR A 1 349 ? -24.647 11.278  31.704  1.00 28.74  ? 349  TYR A CD1   1 
ATOM   2895 C  CD2   . TYR A 1 349 ? -23.388 13.281  31.375  1.00 28.19  ? 349  TYR A CD2   1 
ATOM   2896 C  CE1   . TYR A 1 349 ? -24.983 11.694  32.971  1.00 27.78  ? 349  TYR A CE1   1 
ATOM   2897 C  CE2   . TYR A 1 349 ? -23.736 13.714  32.641  1.00 29.08  ? 349  TYR A CE2   1 
ATOM   2898 C  CZ    . TYR A 1 349 ? -24.530 12.911  33.432  1.00 28.82  ? 349  TYR A CZ    1 
ATOM   2899 O  OH    . TYR A 1 349 ? -24.883 13.329  34.685  1.00 27.58  ? 349  TYR A OH    1 
ATOM   2900 N  N     . TYR A 1 350 ? -21.745 9.749   27.368  1.00 29.16  ? 350  TYR A N     1 
ATOM   2901 C  CA    . TYR A 1 350 ? -21.672 9.085   26.068  1.00 30.23  ? 350  TYR A CA    1 
ATOM   2902 C  C     . TYR A 1 350 ? -21.560 7.566   26.256  1.00 31.10  ? 350  TYR A C     1 
ATOM   2903 O  O     . TYR A 1 350 ? -22.288 6.805   25.626  1.00 29.05  ? 350  TYR A O     1 
ATOM   2904 C  CB    . TYR A 1 350 ? -20.503 9.641   25.236  1.00 31.88  ? 350  TYR A CB    1 
ATOM   2905 C  CG    . TYR A 1 350 ? -20.401 9.047   23.844  1.00 32.43  ? 350  TYR A CG    1 
ATOM   2906 C  CD1   . TYR A 1 350 ? -21.127 9.583   22.779  1.00 31.18  ? 350  TYR A CD1   1 
ATOM   2907 C  CD2   . TYR A 1 350 ? -19.592 7.941   23.598  1.00 31.05  ? 350  TYR A CD2   1 
ATOM   2908 C  CE1   . TYR A 1 350 ? -21.047 9.024   21.495  1.00 36.63  ? 350  TYR A CE1   1 
ATOM   2909 C  CE2   . TYR A 1 350 ? -19.497 7.379   22.328  1.00 34.60  ? 350  TYR A CE2   1 
ATOM   2910 C  CZ    . TYR A 1 350 ? -20.221 7.925   21.278  1.00 37.22  ? 350  TYR A CZ    1 
ATOM   2911 O  OH    . TYR A 1 350 ? -20.127 7.362   20.023  1.00 39.43  ? 350  TYR A OH    1 
ATOM   2912 N  N     . ALA A 1 351 ? -20.667 7.143   27.150  1.00 32.22  ? 351  ALA A N     1 
ATOM   2913 C  CA    . ALA A 1 351 ? -20.434 5.724   27.423  1.00 32.86  ? 351  ALA A CA    1 
ATOM   2914 C  C     . ALA A 1 351 ? -21.521 5.097   28.297  1.00 33.02  ? 351  ALA A C     1 
ATOM   2915 O  O     . ALA A 1 351 ? -21.723 3.875   28.271  1.00 31.35  ? 351  ALA A O     1 
ATOM   2916 C  CB    . ALA A 1 351 ? -19.059 5.533   28.068  1.00 32.56  ? 351  ALA A CB    1 
ATOM   2917 N  N     . LYS A 1 352 ? -22.212 5.951   29.057  1.00 33.35  ? 352  LYS A N     1 
ATOM   2918 C  CA    . LYS A 1 352 ? -23.210 5.547   30.058  1.00 33.01  ? 352  LYS A CA    1 
ATOM   2919 C  C     . LYS A 1 352 ? -22.552 4.784   31.204  1.00 31.40  ? 352  LYS A C     1 
ATOM   2920 O  O     . LYS A 1 352 ? -22.892 3.642   31.505  1.00 32.96  ? 352  LYS A O     1 
ATOM   2921 C  CB    . LYS A 1 352 ? -24.365 4.761   29.423  1.00 36.02  ? 352  LYS A CB    1 
ATOM   2922 C  CG    . LYS A 1 352 ? -25.181 5.573   28.437  1.00 35.82  ? 352  LYS A CG    1 
ATOM   2923 C  CD    . LYS A 1 352 ? -26.282 4.745   27.785  1.00 39.96  ? 352  LYS A CD    1 
ATOM   2924 C  CE    . LYS A 1 352 ? -27.011 5.580   26.738  1.00 40.97  ? 352  LYS A CE    1 
ATOM   2925 N  NZ    . LYS A 1 352 ? -27.941 4.780   25.899  1.00 38.71  ? 352  LYS A NZ    1 
ATOM   2926 N  N     . ILE A 1 353 ? -21.582 5.435   31.825  1.00 29.85  ? 353  ILE A N     1 
ATOM   2927 C  CA    . ILE A 1 353 ? -20.820 4.854   32.914  1.00 30.00  ? 353  ILE A CA    1 
ATOM   2928 C  C     . ILE A 1 353 ? -20.903 5.817   34.083  1.00 29.65  ? 353  ILE A C     1 
ATOM   2929 O  O     . ILE A 1 353 ? -21.400 6.943   33.929  1.00 29.86  ? 353  ILE A O     1 
ATOM   2930 C  CB    . ILE A 1 353 ? -19.330 4.654   32.516  1.00 28.80  ? 353  ILE A CB    1 
ATOM   2931 C  CG1   . ILE A 1 353 ? -18.677 6.002   32.131  1.00 29.36  ? 353  ILE A CG1   1 
ATOM   2932 C  CG2   . ILE A 1 353 ? -19.219 3.644   31.392  1.00 23.98  ? 353  ILE A CG2   1 
ATOM   2933 C  CD1   . ILE A 1 353 ? -17.272 5.892   31.569  1.00 21.50  ? 353  ILE A CD1   1 
ATOM   2934 N  N     . GLN A 1 354 ? -20.425 5.378   35.245  1.00 28.39  ? 354  GLN A N     1 
ATOM   2935 C  CA    . GLN A 1 354 ? -20.193 6.295   36.359  1.00 30.29  ? 354  GLN A CA    1 
ATOM   2936 C  C     . GLN A 1 354 ? -19.191 7.334   35.860  1.00 29.55  ? 354  GLN A C     1 
ATOM   2937 O  O     . GLN A 1 354 ? -18.234 6.982   35.168  1.00 29.44  ? 354  GLN A O     1 
ATOM   2938 C  CB    . GLN A 1 354 ? -19.619 5.559   37.568  1.00 29.72  ? 354  GLN A CB    1 
ATOM   2939 C  CG    . GLN A 1 354 ? -20.504 4.454   38.154  1.00 32.54  ? 354  GLN A CG    1 
ATOM   2940 C  CD    . GLN A 1 354 ? -19.905 3.850   39.428  1.00 36.62  ? 354  GLN A CD    1 
ATOM   2941 O  OE1   . GLN A 1 354 ? -20.540 3.827   40.484  1.00 37.11  ? 354  GLN A OE1   1 
ATOM   2942 N  NE2   . GLN A 1 354 ? -18.673 3.380   39.332  1.00 34.67  ? 354  GLN A NE2   1 
ATOM   2943 N  N     . ILE A 1 355 ? -19.405 8.605   36.186  1.00 30.31  ? 355  ILE A N     1 
ATOM   2944 C  CA    . ILE A 1 355 ? -18.514 9.658   35.666  1.00 30.41  ? 355  ILE A CA    1 
ATOM   2945 C  C     . ILE A 1 355 ? -17.050 9.393   36.024  1.00 29.37  ? 355  ILE A C     1 
ATOM   2946 O  O     . ILE A 1 355 ? -16.170 9.589   35.192  1.00 29.92  ? 355  ILE A O     1 
ATOM   2947 C  CB    . ILE A 1 355 ? -18.952 11.109  36.064  1.00 29.93  ? 355  ILE A CB    1 
ATOM   2948 C  CG1   . ILE A 1 355 ? -20.440 11.349  35.757  1.00 27.91  ? 355  ILE A CG1   1 
ATOM   2949 C  CG2   . ILE A 1 355 ? -18.092 12.162  35.341  1.00 27.05  ? 355  ILE A CG2   1 
ATOM   2950 C  CD1   . ILE A 1 355 ? -20.833 11.129  34.292  1.00 32.71  ? 355  ILE A CD1   1 
ATOM   2951 N  N     . GLN A 1 356 ? -16.787 8.918   37.238  1.00 30.60  ? 356  GLN A N     1 
ATOM   2952 C  CA    . GLN A 1 356 ? -15.400 8.661   37.651  1.00 29.86  ? 356  GLN A CA    1 
ATOM   2953 C  C     . GLN A 1 356 ? -14.707 7.551   36.839  1.00 29.13  ? 356  GLN A C     1 
ATOM   2954 O  O     . GLN A 1 356 ? -13.491 7.416   36.895  1.00 29.75  ? 356  GLN A O     1 
ATOM   2955 C  CB    . GLN A 1 356 ? -15.287 8.421   39.168  1.00 30.13  ? 356  GLN A CB    1 
ATOM   2956 C  CG    . GLN A 1 356 ? -15.935 7.125   39.715  1.00 27.68  ? 356  GLN A CG    1 
ATOM   2957 C  CD    . GLN A 1 356 ? -17.423 7.270   40.015  1.00 31.58  ? 356  GLN A CD    1 
ATOM   2958 O  OE1   . GLN A 1 356 ? -18.095 8.172   39.501  1.00 31.38  ? 356  GLN A OE1   1 
ATOM   2959 N  NE2   . GLN A 1 356 ? -17.948 6.369   40.841  1.00 29.59  ? 356  GLN A NE2   1 
ATOM   2960 N  N     . SER A 1 357 ? -15.472 6.780   36.068  1.00 29.69  ? 357  SER A N     1 
ATOM   2961 C  CA    . SER A 1 357 ? -14.877 5.734   35.220  1.00 29.16  ? 357  SER A CA    1 
ATOM   2962 C  C     . SER A 1 357 ? -14.174 6.265   33.972  1.00 29.89  ? 357  SER A C     1 
ATOM   2963 O  O     . SER A 1 357 ? -13.511 5.491   33.258  1.00 30.82  ? 357  SER A O     1 
ATOM   2964 C  CB    . SER A 1 357 ? -15.912 4.690   34.808  1.00 28.07  ? 357  SER A CB    1 
ATOM   2965 O  OG    . SER A 1 357 ? -16.368 3.965   35.923  1.00 28.76  ? 357  SER A OG    1 
ATOM   2966 N  N     . VAL A 1 358 ? -14.304 7.563   33.702  1.00 28.74  ? 358  VAL A N     1 
ATOM   2967 C  CA    . VAL A 1 358 ? -13.537 8.201   32.604  1.00 29.82  ? 358  VAL A CA    1 
ATOM   2968 C  C     . VAL A 1 358 ? -12.026 7.966   32.735  1.00 29.49  ? 358  VAL A C     1 
ATOM   2969 O  O     . VAL A 1 358 ? -11.322 7.987   31.736  1.00 31.06  ? 358  VAL A O     1 
ATOM   2970 C  CB    . VAL A 1 358 ? -13.817 9.723   32.461  1.00 30.62  ? 358  VAL A CB    1 
ATOM   2971 C  CG1   . VAL A 1 358 ? -15.297 9.962   32.168  1.00 32.35  ? 358  VAL A CG1   1 
ATOM   2972 C  CG2   . VAL A 1 358 ? -13.349 10.513  33.722  1.00 24.62  ? 358  VAL A CG2   1 
ATOM   2973 N  N     . PHE A 1 359 ? -11.541 7.738   33.958  1.00 27.50  ? 359  PHE A N     1 
ATOM   2974 C  CA    . PHE A 1 359 ? -10.126 7.394   34.185  1.00 31.05  ? 359  PHE A CA    1 
ATOM   2975 C  C     . PHE A 1 359 ? -9.740  6.033   33.614  1.00 30.57  ? 359  PHE A C     1 
ATOM   2976 O  O     . PHE A 1 359 ? -8.552  5.695   33.531  1.00 31.19  ? 359  PHE A O     1 
ATOM   2977 C  CB    . PHE A 1 359 ? -9.777  7.412   35.674  1.00 30.00  ? 359  PHE A CB    1 
ATOM   2978 C  CG    . PHE A 1 359 ? -9.764  8.786   36.272  1.00 30.81  ? 359  PHE A CG    1 
ATOM   2979 C  CD1   . PHE A 1 359 ? -8.854  9.744   35.822  1.00 27.25  ? 359  PHE A CD1   1 
ATOM   2980 C  CD2   . PHE A 1 359 ? -10.659 9.128   37.287  1.00 31.33  ? 359  PHE A CD2   1 
ATOM   2981 C  CE1   . PHE A 1 359 ? -8.831  11.018  36.362  1.00 22.32  ? 359  PHE A CE1   1 
ATOM   2982 C  CE2   . PHE A 1 359 ? -10.650 10.410  37.846  1.00 27.68  ? 359  PHE A CE2   1 
ATOM   2983 C  CZ    . PHE A 1 359 ? -9.734  11.359  37.375  1.00 27.55  ? 359  PHE A CZ    1 
ATOM   2984 N  N     . SER A 1 360 ? -10.749 5.267   33.220  1.00 28.09  ? 360  SER A N     1 
ATOM   2985 C  CA    . SER A 1 360 ? -10.549 3.921   32.731  1.00 27.07  ? 360  SER A CA    1 
ATOM   2986 C  C     . SER A 1 360 ? -11.127 3.765   31.314  1.00 27.89  ? 360  SER A C     1 
ATOM   2987 O  O     . SER A 1 360 ? -12.337 3.590   31.132  1.00 26.90  ? 360  SER A O     1 
ATOM   2988 C  CB    . SER A 1 360 ? -11.161 2.926   33.712  1.00 23.17  ? 360  SER A CB    1 
ATOM   2989 O  OG    . SER A 1 360 ? -11.363 1.680   33.097  1.00 25.69  ? 360  SER A OG    1 
ATOM   2990 N  N     . PRO A 1 361 ? -10.257 3.866   30.300  1.00 30.20  ? 361  PRO A N     1 
ATOM   2991 C  CA    . PRO A 1 361 ? -10.685 3.670   28.909  1.00 29.94  ? 361  PRO A CA    1 
ATOM   2992 C  C     . PRO A 1 361 ? -11.224 2.254   28.667  1.00 29.76  ? 361  PRO A C     1 
ATOM   2993 O  O     . PRO A 1 361 ? -12.164 2.084   27.884  1.00 30.81  ? 361  PRO A O     1 
ATOM   2994 C  CB    . PRO A 1 361 ? -9.408  3.938   28.100  1.00 29.88  ? 361  PRO A CB    1 
ATOM   2995 C  CG    . PRO A 1 361 ? -8.269  3.748   29.091  1.00 32.36  ? 361  PRO A CG    1 
ATOM   2996 C  CD    . PRO A 1 361 ? -8.836  4.260   30.392  1.00 31.01  ? 361  PRO A CD    1 
ATOM   2997 N  N     . ILE A 1 362 ? -10.664 1.259   29.357  1.00 28.96  ? 362  ILE A N     1 
ATOM   2998 C  CA    . ILE A 1 362 ? -11.200 -0.114  29.307  1.00 29.57  ? 362  ILE A CA    1 
ATOM   2999 C  C     . ILE A 1 362 ? -12.686 -0.158  29.741  1.00 29.61  ? 362  ILE A C     1 
ATOM   3000 O  O     . ILE A 1 362 ? -13.519 -0.774  29.081  1.00 30.21  ? 362  ILE A O     1 
ATOM   3001 C  CB    . ILE A 1 362 ? -10.298 -1.138  30.110  1.00 27.25  ? 362  ILE A CB    1 
ATOM   3002 C  CG1   . ILE A 1 362 ? -9.057  -1.523  29.290  1.00 24.40  ? 362  ILE A CG1   1 
ATOM   3003 C  CG2   . ILE A 1 362 ? -11.082 -2.397  30.535  1.00 24.83  ? 362  ILE A CG2   1 
ATOM   3004 C  CD1   . ILE A 1 362 ? -7.998  -2.344  30.055  1.00 19.76  ? 362  ILE A CD1   1 
ATOM   3005 N  N     . LYS A 1 363 ? -13.009 0.508   30.843  1.00 31.10  ? 363  LYS A N     1 
ATOM   3006 C  CA    . LYS A 1 363 ? -14.388 0.553   31.324  1.00 30.66  ? 363  LYS A CA    1 
ATOM   3007 C  C     . LYS A 1 363 ? -15.246 1.387   30.377  1.00 29.25  ? 363  LYS A C     1 
ATOM   3008 O  O     . LYS A 1 363 ? -16.419 1.069   30.130  1.00 28.06  ? 363  LYS A O     1 
ATOM   3009 C  CB    . LYS A 1 363 ? -14.449 1.112   32.756  1.00 28.59  ? 363  LYS A CB    1 
ATOM   3010 C  CG    . LYS A 1 363 ? -15.852 1.187   33.372  1.00 31.41  ? 363  LYS A CG    1 
ATOM   3011 C  CD    . LYS A 1 363 ? -16.558 -0.177  33.490  1.00 34.50  ? 363  LYS A CD    1 
ATOM   3012 C  CE    . LYS A 1 363 ? -15.902 -1.098  34.501  1.00 36.85  ? 363  LYS A CE    1 
ATOM   3013 N  NZ    . LYS A 1 363 ? -16.886 -2.081  35.062  1.00 40.03  ? 363  LYS A NZ    1 
ATOM   3014 N  N     . THR A 1 364 ? -14.648 2.452   29.851  1.00 26.68  ? 364  THR A N     1 
ATOM   3015 C  CA    . THR A 1 364 ? -15.338 3.351   28.935  1.00 25.76  ? 364  THR A CA    1 
ATOM   3016 C  C     . THR A 1 364 ? -15.738 2.612   27.664  1.00 27.43  ? 364  THR A C     1 
ATOM   3017 O  O     . THR A 1 364 ? -16.889 2.677   27.254  1.00 29.22  ? 364  THR A O     1 
ATOM   3018 C  CB    . THR A 1 364 ? -14.477 4.607   28.632  1.00 26.00  ? 364  THR A CB    1 
ATOM   3019 O  OG1   . THR A 1 364 ? -14.186 5.278   29.866  1.00 27.48  ? 364  THR A OG1   1 
ATOM   3020 C  CG2   . THR A 1 364 ? -15.206 5.594   27.696  1.00 22.24  ? 364  THR A CG2   1 
ATOM   3021 N  N     . TRP A 1 365 ? -14.794 1.892   27.062  1.00 28.38  ? 365  TRP A N     1 
ATOM   3022 C  CA    . TRP A 1 365 ? -15.054 1.169   25.830  1.00 27.93  ? 365  TRP A CA    1 
ATOM   3023 C  C     . TRP A 1 365 ? -15.914 -0.062  26.048  1.00 30.78  ? 365  TRP A C     1 
ATOM   3024 O  O     . TRP A 1 365 ? -16.745 -0.404  25.194  1.00 30.85  ? 365  TRP A O     1 
ATOM   3025 C  CB    . TRP A 1 365 ? -13.756 0.818   25.113  1.00 26.80  ? 365  TRP A CB    1 
ATOM   3026 C  CG    . TRP A 1 365 ? -13.184 1.993   24.371  1.00 30.93  ? 365  TRP A CG    1 
ATOM   3027 C  CD1   . TRP A 1 365 ? -12.030 2.667   24.663  1.00 27.35  ? 365  TRP A CD1   1 
ATOM   3028 C  CD2   . TRP A 1 365 ? -13.754 2.646   23.226  1.00 25.89  ? 365  TRP A CD2   1 
ATOM   3029 N  NE1   . TRP A 1 365 ? -11.843 3.682   23.763  1.00 30.43  ? 365  TRP A NE1   1 
ATOM   3030 C  CE2   . TRP A 1 365 ? -12.886 3.699   22.874  1.00 28.72  ? 365  TRP A CE2   1 
ATOM   3031 C  CE3   . TRP A 1 365 ? -14.910 2.434   22.459  1.00 27.06  ? 365  TRP A CE3   1 
ATOM   3032 C  CZ2   . TRP A 1 365 ? -13.133 4.548   21.782  1.00 27.88  ? 365  TRP A CZ2   1 
ATOM   3033 C  CZ3   . TRP A 1 365 ? -15.162 3.281   21.376  1.00 25.28  ? 365  TRP A CZ3   1 
ATOM   3034 C  CH2   . TRP A 1 365 ? -14.273 4.321   21.048  1.00 26.78  ? 365  TRP A CH2   1 
ATOM   3035 N  N     . ASP A 1 366 ? -15.738 -0.719  27.193  1.00 30.78  ? 366  ASP A N     1 
ATOM   3036 C  CA    . ASP A 1 366 ? -16.598 -1.841  27.523  1.00 32.69  ? 366  ASP A CA    1 
ATOM   3037 C  C     . ASP A 1 366 ? -18.076 -1.424  27.509  1.00 32.35  ? 366  ASP A C     1 
ATOM   3038 O  O     . ASP A 1 366 ? -18.915 -2.127  26.945  1.00 32.39  ? 366  ASP A O     1 
ATOM   3039 C  CB    . ASP A 1 366 ? -16.217 -2.449  28.874  1.00 35.67  ? 366  ASP A CB    1 
ATOM   3040 C  CG    . ASP A 1 366 ? -16.779 -3.834  29.058  1.00 34.96  ? 366  ASP A CG    1 
ATOM   3041 O  OD1   . ASP A 1 366 ? -16.647 -4.655  28.136  1.00 37.71  ? 366  ASP A OD1   1 
ATOM   3042 O  OD2   . ASP A 1 366 ? -17.366 -4.098  30.115  1.00 36.77  ? 366  ASP A OD2   1 
ATOM   3043 N  N     . ALA A 1 367 ? -18.386 -0.274  28.109  1.00 30.65  ? 367  ALA A N     1 
ATOM   3044 C  CA    . ALA A 1 367 ? -19.760 0.230   28.134  1.00 31.02  ? 367  ALA A CA    1 
ATOM   3045 C  C     . ALA A 1 367 ? -20.260 0.737   26.778  1.00 32.76  ? 367  ALA A C     1 
ATOM   3046 O  O     . ALA A 1 367 ? -21.409 0.501   26.422  1.00 34.80  ? 367  ALA A O     1 
ATOM   3047 C  CB    . ALA A 1 367 ? -19.912 1.294   29.171  1.00 31.04  ? 367  ALA A CB    1 
ATOM   3048 N  N     . ILE A 1 368 ? -19.413 1.442   26.032  1.00 32.65  ? 368  ILE A N     1 
ATOM   3049 C  CA    . ILE A 1 368 ? -19.773 1.868   24.679  1.00 33.58  ? 368  ILE A CA    1 
ATOM   3050 C  C     . ILE A 1 368 ? -20.150 0.657   23.793  1.00 34.63  ? 368  ILE A C     1 
ATOM   3051 O  O     . ILE A 1 368 ? -21.215 0.632   23.172  1.00 37.30  ? 368  ILE A O     1 
ATOM   3052 C  CB    . ILE A 1 368 ? -18.642 2.699   24.017  1.00 33.24  ? 368  ILE A CB    1 
ATOM   3053 C  CG1   . ILE A 1 368 ? -18.399 3.986   24.811  1.00 31.41  ? 368  ILE A CG1   1 
ATOM   3054 C  CG2   . ILE A 1 368 ? -18.989 3.012   22.552  1.00 28.53  ? 368  ILE A CG2   1 
ATOM   3055 C  CD1   . ILE A 1 368 ? -17.150 4.789   24.396  1.00 32.25  ? 368  ILE A CD1   1 
ATOM   3056 N  N     . ILE A 1 369 ? -19.281 -0.348  23.776  1.00 32.55  ? 369  ILE A N     1 
ATOM   3057 C  CA    . ILE A 1 369 ? -19.462 -1.527  22.947  1.00 30.45  ? 369  ILE A CA    1 
ATOM   3058 C  C     . ILE A 1 369 ? -20.684 -2.340  23.389  1.00 31.90  ? 369  ILE A C     1 
ATOM   3059 O  O     . ILE A 1 369 ? -21.469 -2.801  22.546  1.00 30.87  ? 369  ILE A O     1 
ATOM   3060 C  CB    . ILE A 1 369 ? -18.146 -2.363  22.877  1.00 29.64  ? 369  ILE A CB    1 
ATOM   3061 C  CG1   . ILE A 1 369 ? -17.070 -1.559  22.127  1.00 27.30  ? 369  ILE A CG1   1 
ATOM   3062 C  CG2   . ILE A 1 369 ? -18.379 -3.722  22.202  1.00 26.83  ? 369  ILE A CG2   1 
ATOM   3063 C  CD1   . ILE A 1 369 ? -15.631 -1.998  22.369  1.00 23.86  ? 369  ILE A CD1   1 
ATOM   3064 N  N     . PHE A 1 370 ? -20.861 -2.477  24.703  1.00 31.61  ? 370  PHE A N     1 
ATOM   3065 C  CA    . PHE A 1 370 ? -22.034 -3.156  25.266  1.00 30.92  ? 370  PHE A CA    1 
ATOM   3066 C  C     . PHE A 1 370 ? -23.356 -2.483  24.911  1.00 31.19  ? 370  PHE A C     1 
ATOM   3067 O  O     . PHE A 1 370 ? -24.311 -3.174  24.567  1.00 31.84  ? 370  PHE A O     1 
ATOM   3068 C  CB    . PHE A 1 370 ? -21.916 -3.328  26.788  1.00 29.62  ? 370  PHE A CB    1 
ATOM   3069 C  CG    . PHE A 1 370 ? -23.240 -3.555  27.485  1.00 29.41  ? 370  PHE A CG    1 
ATOM   3070 C  CD1   . PHE A 1 370 ? -23.746 -2.604  28.368  1.00 31.25  ? 370  PHE A CD1   1 
ATOM   3071 C  CD2   . PHE A 1 370 ? -23.982 -4.712  27.253  1.00 28.41  ? 370  PHE A CD2   1 
ATOM   3072 C  CE1   . PHE A 1 370 ? -24.963 -2.808  29.007  1.00 31.81  ? 370  PHE A CE1   1 
ATOM   3073 C  CE2   . PHE A 1 370 ? -25.197 -4.926  27.886  1.00 27.69  ? 370  PHE A CE2   1 
ATOM   3074 C  CZ    . PHE A 1 370 ? -25.689 -3.979  28.767  1.00 30.35  ? 370  PHE A CZ    1 
ATOM   3075 N  N     . ASN A 1 371 ? -23.420 -1.154  25.014  1.00 29.84  ? 371  ASN A N     1 
ATOM   3076 C  CA    . ASN A 1 371 ? -24.624 -0.411  24.606  1.00 31.54  ? 371  ASN A CA    1 
ATOM   3077 C  C     . ASN A 1 371 ? -24.890 -0.515  23.100  1.00 30.97  ? 371  ASN A C     1 
ATOM   3078 O  O     . ASN A 1 371 ? -26.028 -0.657  22.671  1.00 33.48  ? 371  ASN A O     1 
ATOM   3079 C  CB    . ASN A 1 371 ? -24.567 1.063   25.040  1.00 30.43  ? 371  ASN A CB    1 
ATOM   3080 C  CG    . ASN A 1 371 ? -24.847 1.248   26.522  1.00 36.68  ? 371  ASN A CG    1 
ATOM   3081 O  OD1   . ASN A 1 371 ? -26.005 1.262   26.951  1.00 37.66  ? 371  ASN A OD1   1 
ATOM   3082 N  ND2   . ASN A 1 371 ? -23.789 1.394   27.314  1.00 33.06  ? 371  ASN A ND2   1 
ATOM   3083 N  N     . SER A 1 372 ? -23.836 -0.458  22.301  1.00 31.47  ? 372  SER A N     1 
ATOM   3084 C  CA    . SER A 1 372 ? -23.978 -0.577  20.854  1.00 32.18  ? 372  SER A CA    1 
ATOM   3085 C  C     . SER A 1 372 ? -24.513 -1.965  20.463  1.00 32.53  ? 372  SER A C     1 
ATOM   3086 O  O     . SER A 1 372 ? -25.388 -2.079  19.611  1.00 33.42  ? 372  SER A O     1 
ATOM   3087 C  CB    . SER A 1 372 ? -22.643 -0.295  20.172  1.00 31.72  ? 372  SER A CB    1 
ATOM   3088 O  OG    . SER A 1 372 ? -22.740 -0.426  18.759  1.00 37.35  ? 372  SER A OG    1 
ATOM   3089 N  N     . LEU A 1 373 ? -24.003 -3.006  21.113  1.00 32.79  ? 373  LEU A N     1 
ATOM   3090 C  CA    . LEU A 1 373 ? -24.403 -4.379  20.808  1.00 32.60  ? 373  LEU A CA    1 
ATOM   3091 C  C     . LEU A 1 373 ? -25.813 -4.694  21.324  1.00 32.95  ? 373  LEU A C     1 
ATOM   3092 O  O     . LEU A 1 373 ? -26.611 -5.306  20.616  1.00 32.54  ? 373  LEU A O     1 
ATOM   3093 C  CB    . LEU A 1 373 ? -23.365 -5.380  21.343  1.00 28.95  ? 373  LEU A CB    1 
ATOM   3094 C  CG    . LEU A 1 373 ? -22.028 -5.452  20.589  1.00 30.01  ? 373  LEU A CG    1 
ATOM   3095 C  CD1   . LEU A 1 373 ? -21.069 -6.430  21.273  1.00 28.97  ? 373  LEU A CD1   1 
ATOM   3096 C  CD2   . LEU A 1 373 ? -22.203 -5.821  19.087  1.00 27.12  ? 373  LEU A CD2   1 
ATOM   3097 N  N     . LYS A 1 374 ? -26.112 -4.258  22.546  1.00 33.66  ? 374  LYS A N     1 
ATOM   3098 C  CA    . LYS A 1 374 ? -27.447 -4.393  23.128  1.00 35.94  ? 374  LYS A CA    1 
ATOM   3099 C  C     . LYS A 1 374 ? -28.555 -3.825  22.224  1.00 38.43  ? 374  LYS A C     1 
ATOM   3100 O  O     . LYS A 1 374 ? -29.620 -4.435  22.085  1.00 41.02  ? 374  LYS A O     1 
ATOM   3101 C  CB    . LYS A 1 374 ? -27.486 -3.762  24.522  1.00 35.41  ? 374  LYS A CB    1 
ATOM   3102 C  CG    . LYS A 1 374 ? -28.866 -3.740  25.163  1.00 38.26  ? 374  LYS A CG    1 
ATOM   3103 C  CD    . LYS A 1 374 ? -28.798 -3.559  26.675  1.00 35.26  ? 374  LYS A CD    1 
ATOM   3104 C  CE    . LYS A 1 374 ? -30.091 -2.948  27.178  1.00 33.47  ? 374  LYS A CE    1 
ATOM   3105 N  NZ    . LYS A 1 374 ? -30.128 -1.498  26.854  1.00 35.95  ? 374  LYS A NZ    1 
ATOM   3106 N  N     . GLU A 1 375 ? -28.295 -2.680  21.602  1.00 40.42  ? 375  GLU A N     1 
ATOM   3107 C  CA    . GLU A 1 375 ? -29.210 -2.093  20.608  1.00 45.09  ? 375  GLU A CA    1 
ATOM   3108 C  C     . GLU A 1 375 ? -29.639 -3.066  19.489  1.00 43.74  ? 375  GLU A C     1 
ATOM   3109 O  O     . GLU A 1 375 ? -30.760 -2.982  18.978  1.00 42.19  ? 375  GLU A O     1 
ATOM   3110 C  CB    . GLU A 1 375 ? -28.592 -0.827  19.997  1.00 47.09  ? 375  GLU A CB    1 
ATOM   3111 C  CG    . GLU A 1 375 ? -29.089 0.480   20.623  1.00 58.58  ? 375  GLU A CG    1 
ATOM   3112 C  CD    . GLU A 1 375 ? -30.423 0.955   20.025  1.00 68.28  ? 375  GLU A CD    1 
ATOM   3113 O  OE1   . GLU A 1 375 ? -30.528 1.058   18.778  1.00 68.64  ? 375  GLU A OE1   1 
ATOM   3114 O  OE2   . GLU A 1 375 ? -31.368 1.231   20.802  1.00 71.40  ? 375  GLU A OE2   1 
ATOM   3115 N  N     . GLN A 1 376 ? -28.750 -3.982  19.115  1.00 41.60  ? 376  GLN A N     1 
ATOM   3116 C  CA    . GLN A 1 376 ? -29.055 -4.954  18.065  1.00 42.61  ? 376  GLN A CA    1 
ATOM   3117 C  C     . GLN A 1 376 ? -29.465 -6.317  18.638  1.00 40.59  ? 376  GLN A C     1 
ATOM   3118 O  O     . GLN A 1 376 ? -29.515 -7.309  17.912  1.00 40.90  ? 376  GLN A O     1 
ATOM   3119 C  CB    . GLN A 1 376 ? -27.859 -5.109  17.120  1.00 45.11  ? 376  GLN A CB    1 
ATOM   3120 C  CG    . GLN A 1 376 ? -27.387 -3.807  16.463  1.00 50.31  ? 376  GLN A CG    1 
ATOM   3121 C  CD    . GLN A 1 376 ? -25.927 -3.870  16.042  1.00 54.51  ? 376  GLN A CD    1 
ATOM   3122 O  OE1   . GLN A 1 376 ? -25.056 -3.317  16.715  1.00 57.34  ? 376  GLN A OE1   1 
ATOM   3123 N  NE2   . GLN A 1 376 ? -25.649 -4.564  14.936  1.00 56.40  ? 376  GLN A NE2   1 
ATOM   3124 N  N     . ASN A 1 377 ? -29.754 -6.351  19.942  1.00 38.06  ? 377  ASN A N     1 
ATOM   3125 C  CA    . ASN A 1 377 ? -30.079 -7.584  20.671  1.00 36.37  ? 377  ASN A CA    1 
ATOM   3126 C  C     . ASN A 1 377 ? -28.929 -8.608  20.718  1.00 36.67  ? 377  ASN A C     1 
ATOM   3127 O  O     . ASN A 1 377 ? -29.142 -9.819  20.880  1.00 36.93  ? 377  ASN A O     1 
ATOM   3128 C  CB    . ASN A 1 377 ? -31.387 -8.205  20.158  1.00 36.28  ? 377  ASN A CB    1 
ATOM   3129 C  CG    . ASN A 1 377 ? -32.622 -7.397  20.561  1.00 37.56  ? 377  ASN A CG    1 
ATOM   3130 O  OD1   . ASN A 1 377 ? -32.698 -6.854  21.664  1.00 34.21  ? 377  ASN A OD1   1 
ATOM   3131 N  ND2   . ASN A 1 377 ? -33.603 -7.332  19.667  1.00 32.88  ? 377  ASN A ND2   1 
ATOM   3132 N  N     . LYS A 1 378 ? -27.704 -8.106  20.604  1.00 35.22  ? 378  LYS A N     1 
ATOM   3133 C  CA    . LYS A 1 378 ? -26.533 -8.955  20.660  1.00 35.26  ? 378  LYS A CA    1 
ATOM   3134 C  C     . LYS A 1 378 ? -25.985 -9.031  22.076  1.00 35.43  ? 378  LYS A C     1 
ATOM   3135 O  O     . LYS A 1 378 ? -26.196 -8.124  22.889  1.00 35.87  ? 378  LYS A O     1 
ATOM   3136 C  CB    . LYS A 1 378 ? -25.471 -8.472  19.674  1.00 38.58  ? 378  LYS A CB    1 
ATOM   3137 C  CG    . LYS A 1 378 ? -25.950 -8.446  18.229  1.00 37.41  ? 378  LYS A CG    1 
ATOM   3138 C  CD    . LYS A 1 378 ? -24.836 -8.027  17.289  1.00 42.09  ? 378  LYS A CD    1 
ATOM   3139 C  CE    . LYS A 1 378 ? -25.231 -8.232  15.823  1.00 45.07  ? 378  LYS A CE    1 
ATOM   3140 N  NZ    . LYS A 1 378 ? -24.033 -8.186  14.926  1.00 44.13  ? 378  LYS A NZ    1 
ATOM   3141 N  N     . VAL A 1 379 ? -25.293 -10.127 22.368  1.00 34.26  ? 379  VAL A N     1 
ATOM   3142 C  CA    . VAL A 1 379 ? -24.823 -10.416 23.714  1.00 34.73  ? 379  VAL A CA    1 
ATOM   3143 C  C     . VAL A 1 379 ? -23.300 -10.435 23.773  1.00 34.47  ? 379  VAL A C     1 
ATOM   3144 O  O     . VAL A 1 379 ? -22.655 -11.093 22.954  1.00 35.06  ? 379  VAL A O     1 
ATOM   3145 C  CB    . VAL A 1 379 ? -25.402 -11.754 24.226  1.00 36.10  ? 379  VAL A CB    1 
ATOM   3146 C  CG1   . VAL A 1 379 ? -24.885 -12.065 25.611  1.00 36.40  ? 379  VAL A CG1   1 
ATOM   3147 C  CG2   . VAL A 1 379 ? -26.923 -11.698 24.239  1.00 37.41  ? 379  VAL A CG2   1 
ATOM   3148 N  N     . ILE A 1 380 ? -22.737 -9.710  24.744  1.00 32.63  ? 380  ILE A N     1 
ATOM   3149 C  CA    . ILE A 1 380 ? -21.284 -9.607  24.899  1.00 31.65  ? 380  ILE A CA    1 
ATOM   3150 C  C     . ILE A 1 380 ? -20.694 -10.890 25.486  1.00 31.71  ? 380  ILE A C     1 
ATOM   3151 O  O     . ILE A 1 380 ? -21.336 -11.545 26.302  1.00 31.82  ? 380  ILE A O     1 
ATOM   3152 C  CB    . ILE A 1 380 ? -20.872 -8.378  25.775  1.00 30.78  ? 380  ILE A CB    1 
ATOM   3153 C  CG1   . ILE A 1 380 ? -21.217 -8.597  27.249  1.00 27.43  ? 380  ILE A CG1   1 
ATOM   3154 C  CG2   . ILE A 1 380 ? -21.514 -7.079  25.240  1.00 34.67  ? 380  ILE A CG2   1 
ATOM   3155 C  CD1   . ILE A 1 380 ? -21.012 -7.372  28.114  1.00 26.43  ? 380  ILE A CD1   1 
ATOM   3156 N  N     . PRO A 1 381 ? -19.464 -11.252 25.081  1.00 32.84  ? 381  PRO A N     1 
ATOM   3157 C  CA    . PRO A 1 381 ? -18.855 -12.458 25.670  1.00 33.63  ? 381  PRO A CA    1 
ATOM   3158 C  C     . PRO A 1 381 ? -18.399 -12.214 27.103  1.00 33.75  ? 381  PRO A C     1 
ATOM   3159 O  O     . PRO A 1 381 ? -18.195 -11.060 27.497  1.00 35.32  ? 381  PRO A O     1 
ATOM   3160 C  CB    . PRO A 1 381 ? -17.647 -12.721 24.766  1.00 31.83  ? 381  PRO A CB    1 
ATOM   3161 C  CG    . PRO A 1 381 ? -17.260 -11.375 24.239  1.00 33.38  ? 381  PRO A CG    1 
ATOM   3162 C  CD    . PRO A 1 381 ? -18.523 -10.519 24.213  1.00 32.68  ? 381  PRO A CD    1 
ATOM   3163 N  N     . GLN A 1 382 ? -18.255 -13.287 27.876  1.00 34.62  ? 382  GLN A N     1 
ATOM   3164 C  CA    . GLN A 1 382 ? -17.684 -13.202 29.220  1.00 36.68  ? 382  GLN A CA    1 
ATOM   3165 C  C     . GLN A 1 382 ? -16.221 -12.816 29.138  1.00 37.89  ? 382  GLN A C     1 
ATOM   3166 O  O     . GLN A 1 382 ? -15.510 -13.242 28.226  1.00 40.39  ? 382  GLN A O     1 
ATOM   3167 C  CB    . GLN A 1 382 ? -17.809 -14.550 29.931  1.00 39.59  ? 382  GLN A CB    1 
ATOM   3168 C  CG    . GLN A 1 382 ? -17.329 -14.582 31.384  1.00 38.93  ? 382  GLN A CG    1 
ATOM   3169 C  CD    . GLN A 1 382 ? -17.635 -15.902 32.079  1.00 42.10  ? 382  GLN A CD    1 
ATOM   3170 O  OE1   . GLN A 1 382 ? -17.509 -16.980 31.489  1.00 41.48  ? 382  GLN A OE1   1 
ATOM   3171 N  NE2   . GLN A 1 382 ? -18.040 -15.822 33.346  1.00 44.74  ? 382  GLN A NE2   1 
ATOM   3172 N  N     . GLY A 1 383 ? -15.767 -12.020 30.096  1.00 38.47  ? 383  GLY A N     1 
ATOM   3173 C  CA    . GLY A 1 383 ? -14.343 -11.742 30.238  1.00 39.21  ? 383  GLY A CA    1 
ATOM   3174 C  C     . GLY A 1 383 ? -13.584 -12.994 30.649  1.00 41.26  ? 383  GLY A C     1 
ATOM   3175 O  O     . GLY A 1 383 ? -14.036 -13.751 31.513  1.00 40.05  ? 383  GLY A O     1 
ATOM   3176 N  N     . ARG A 1 384 ? -12.433 -13.209 30.016  1.00 42.44  ? 384  ARG A N     1 
ATOM   3177 C  CA    . ARG A 1 384 ? -11.594 -14.374 30.269  1.00 44.67  ? 384  ARG A CA    1 
ATOM   3178 C  C     . ARG A 1 384 ? -10.240 -13.980 30.864  1.00 44.33  ? 384  ARG A C     1 
ATOM   3179 O  O     . ARG A 1 384 ? -9.847  -12.808 30.830  1.00 43.17  ? 384  ARG A O     1 
ATOM   3180 C  CB    . ARG A 1 384 ? -11.393 -15.166 28.980  1.00 46.40  ? 384  ARG A CB    1 
ATOM   3181 C  CG    . ARG A 1 384 ? -12.514 -16.133 28.672  1.00 54.09  ? 384  ARG A CG    1 
ATOM   3182 C  CD    . ARG A 1 384 ? -12.382 -16.704 27.260  1.00 63.52  ? 384  ARG A CD    1 
ATOM   3183 N  NE    . ARG A 1 384 ? -13.141 -17.948 27.073  1.00 71.85  ? 384  ARG A NE    1 
ATOM   3184 C  CZ    . ARG A 1 384 ? -14.465 -18.026 26.913  1.00 74.83  ? 384  ARG A CZ    1 
ATOM   3185 N  NH1   . ARG A 1 384 ? -15.220 -16.930 26.927  1.00 75.50  ? 384  ARG A NH1   1 
ATOM   3186 N  NH2   . ARG A 1 384 ? -15.043 -19.210 26.748  1.00 75.39  ? 384  ARG A NH2   1 
ATOM   3187 N  N     . SER A 1 385 ? -9.540  -14.970 31.411  1.00 43.04  ? 385  SER A N     1 
ATOM   3188 C  CA    . SER A 1 385 ? -8.229  -14.761 32.008  1.00 43.32  ? 385  SER A CA    1 
ATOM   3189 C  C     . SER A 1 385 ? -7.138  -14.942 30.953  1.00 40.53  ? 385  SER A C     1 
ATOM   3190 O  O     . SER A 1 385 ? -7.186  -15.880 30.157  1.00 37.36  ? 385  SER A O     1 
ATOM   3191 C  CB    . SER A 1 385 ? -8.021  -15.742 33.171  1.00 44.32  ? 385  SER A CB    1 
ATOM   3192 O  OG    . SER A 1 385 ? -7.123  -15.208 34.132  1.00 46.89  ? 385  SER A OG    1 
ATOM   3193 N  N     . HIS A 1 386 ? -6.154  -14.046 30.941  1.00 41.00  ? 386  HIS A N     1 
ATOM   3194 C  CA    . HIS A 1 386 ? -5.048  -14.173 29.984  1.00 40.44  ? 386  HIS A CA    1 
ATOM   3195 C  C     . HIS A 1 386 ? -3.711  -13.890 30.634  1.00 40.74  ? 386  HIS A C     1 
ATOM   3196 O  O     . HIS A 1 386 ? -3.607  -12.977 31.459  1.00 41.75  ? 386  HIS A O     1 
ATOM   3197 C  CB    . HIS A 1 386 ? -5.227  -13.251 28.769  1.00 39.02  ? 386  HIS A CB    1 
ATOM   3198 C  CG    . HIS A 1 386 ? -6.576  -13.340 28.131  1.00 37.13  ? 386  HIS A CG    1 
ATOM   3199 N  ND1   . HIS A 1 386 ? -6.959  -14.405 27.345  1.00 39.88  ? 386  HIS A ND1   1 
ATOM   3200 C  CD2   . HIS A 1 386 ? -7.636  -12.498 28.168  1.00 37.15  ? 386  HIS A CD2   1 
ATOM   3201 C  CE1   . HIS A 1 386 ? -8.198  -14.217 26.926  1.00 40.50  ? 386  HIS A CE1   1 
ATOM   3202 N  NE2   . HIS A 1 386 ? -8.632  -13.067 27.411  1.00 39.76  ? 386  HIS A NE2   1 
ATOM   3203 N  N     . PRO A 1 387 ? -2.679  -14.678 30.265  1.00 40.57  ? 387  PRO A N     1 
ATOM   3204 C  CA    . PRO A 1 387 ? -1.314  -14.335 30.643  1.00 39.14  ? 387  PRO A CA    1 
ATOM   3205 C  C     . PRO A 1 387 ? -0.864  -13.112 29.849  1.00 39.32  ? 387  PRO A C     1 
ATOM   3206 O  O     . PRO A 1 387 ? -1.182  -12.998 28.665  1.00 36.98  ? 387  PRO A O     1 
ATOM   3207 C  CB    . PRO A 1 387 ? -0.506  -15.575 30.234  1.00 38.98  ? 387  PRO A CB    1 
ATOM   3208 C  CG    . PRO A 1 387 ? -1.313  -16.230 29.162  1.00 38.33  ? 387  PRO A CG    1 
ATOM   3209 C  CD    . PRO A 1 387 ? -2.750  -15.949 29.517  1.00 40.45  ? 387  PRO A CD    1 
ATOM   3210 N  N     . VAL A 1 388 ? -0.154  -12.207 30.518  1.00 40.09  ? 388  VAL A N     1 
ATOM   3211 C  CA    . VAL A 1 388 ? 0.419   -11.019 29.893  1.00 40.77  ? 388  VAL A CA    1 
ATOM   3212 C  C     . VAL A 1 388 ? 1.524   -11.459 28.942  1.00 43.60  ? 388  VAL A C     1 
ATOM   3213 O  O     . VAL A 1 388 ? 2.412   -12.217 29.331  1.00 47.14  ? 388  VAL A O     1 
ATOM   3214 C  CB    . VAL A 1 388 ? 0.965   -10.026 30.967  1.00 40.13  ? 388  VAL A CB    1 
ATOM   3215 C  CG1   . VAL A 1 388 ? 1.815   -8.917  30.334  1.00 39.14  ? 388  VAL A CG1   1 
ATOM   3216 C  CG2   . VAL A 1 388 ? -0.187  -9.421  31.773  1.00 36.00  ? 388  VAL A CG2   1 
ATOM   3217 N  N     . GLN A 1 389 ? 1.441   -11.006 27.693  1.00 44.25  ? 389  GLN A N     1 
ATOM   3218 C  CA    . GLN A 1 389 ? 2.402   -11.378 26.643  1.00 45.24  ? 389  GLN A CA    1 
ATOM   3219 C  C     . GLN A 1 389 ? 2.878   -10.145 25.861  1.00 43.11  ? 389  GLN A C     1 
ATOM   3220 O  O     . GLN A 1 389 ? 2.062   -9.310  25.464  1.00 40.17  ? 389  GLN A O     1 
ATOM   3221 C  CB    . GLN A 1 389 ? 1.769   -12.368 25.661  1.00 46.41  ? 389  GLN A CB    1 
ATOM   3222 C  CG    . GLN A 1 389 ? 1.668   -13.810 26.132  1.00 53.60  ? 389  GLN A CG    1 
ATOM   3223 C  CD    . GLN A 1 389 ? 1.220   -14.755 25.011  1.00 59.46  ? 389  GLN A CD    1 
ATOM   3224 O  OE1   . GLN A 1 389 ? 0.084   -14.672 24.512  1.00 57.42  ? 389  GLN A OE1   1 
ATOM   3225 N  NE2   . GLN A 1 389 ? 2.118   -15.657 24.606  1.00 58.34  ? 389  GLN A NE2   1 
ATOM   3226 N  N     . PRO A 1 390 ? 4.197   -10.030 25.622  1.00 39.90  ? 390  PRO A N     1 
ATOM   3227 C  CA    . PRO A 1 390 ? 4.677   -8.883  24.843  1.00 38.97  ? 390  PRO A CA    1 
ATOM   3228 C  C     . PRO A 1 390 ? 4.271   -8.998  23.378  1.00 36.51  ? 390  PRO A C     1 
ATOM   3229 O  O     . PRO A 1 390 ? 4.030   -10.097 22.891  1.00 38.62  ? 390  PRO A O     1 
ATOM   3230 C  CB    . PRO A 1 390 ? 6.206   -8.969  24.981  1.00 39.02  ? 390  PRO A CB    1 
ATOM   3231 C  CG    . PRO A 1 390 ? 6.456   -9.907  26.127  1.00 41.60  ? 390  PRO A CG    1 
ATOM   3232 C  CD    . PRO A 1 390 ? 5.310   -10.874 26.094  1.00 40.05  ? 390  PRO A CD    1 
ATOM   3233 N  N     . TYR A 1 391 ? 4.182   -7.870  22.687  1.00 35.50  ? 391  TYR A N     1 
ATOM   3234 C  CA    . TYR A 1 391 ? 3.882   -7.870  21.253  1.00 33.86  ? 391  TYR A CA    1 
ATOM   3235 C  C     . TYR A 1 391 ? 4.480   -6.634  20.579  1.00 34.21  ? 391  TYR A C     1 
ATOM   3236 O  O     . TYR A 1 391 ? 4.728   -5.643  21.255  1.00 33.15  ? 391  TYR A O     1 
ATOM   3237 C  CB    . TYR A 1 391 ? 2.373   -7.992  20.997  1.00 31.71  ? 391  TYR A CB    1 
ATOM   3238 C  CG    . TYR A 1 391 ? 1.516   -6.809  21.408  1.00 32.28  ? 391  TYR A CG    1 
ATOM   3239 C  CD1   . TYR A 1 391 ? 1.119   -6.631  22.736  1.00 34.17  ? 391  TYR A CD1   1 
ATOM   3240 C  CD2   . TYR A 1 391 ? 1.073   -5.884  20.457  1.00 29.90  ? 391  TYR A CD2   1 
ATOM   3241 C  CE1   . TYR A 1 391 ? 0.310   -5.555  23.107  1.00 33.44  ? 391  TYR A CE1   1 
ATOM   3242 C  CE2   . TYR A 1 391 ? 0.273   -4.815  20.816  1.00 28.18  ? 391  TYR A CE2   1 
ATOM   3243 C  CZ    . TYR A 1 391 ? -0.113  -4.657  22.140  1.00 30.30  ? 391  TYR A CZ    1 
ATOM   3244 O  OH    . TYR A 1 391 ? -0.905  -3.588  22.497  1.00 31.37  ? 391  TYR A OH    1 
ATOM   3245 N  N     . PRO A 1 392 ? 4.718   -6.697  19.250  1.00 34.55  ? 392  PRO A N     1 
ATOM   3246 C  CA    . PRO A 1 392 ? 5.417   -5.614  18.556  1.00 34.33  ? 392  PRO A CA    1 
ATOM   3247 C  C     . PRO A 1 392 ? 4.553   -4.388  18.273  1.00 33.47  ? 392  PRO A C     1 
ATOM   3248 O  O     . PRO A 1 392 ? 3.340   -4.511  18.092  1.00 32.05  ? 392  PRO A O     1 
ATOM   3249 C  CB    . PRO A 1 392 ? 5.852   -6.266  17.241  1.00 33.91  ? 392  PRO A CB    1 
ATOM   3250 C  CG    . PRO A 1 392 ? 4.816   -7.296  16.982  1.00 34.52  ? 392  PRO A CG    1 
ATOM   3251 C  CD    . PRO A 1 392 ? 4.385   -7.808  18.338  1.00 34.94  ? 392  PRO A CD    1 
ATOM   3252 N  N     . GLY A 1 393 ? 5.202   -3.223  18.225  1.00 33.01  ? 393  GLY A N     1 
ATOM   3253 C  CA    . GLY A 1 393 ? 4.530   -1.956  17.970  1.00 30.83  ? 393  GLY A CA    1 
ATOM   3254 C  C     . GLY A 1 393 ? 4.953   -1.290  16.673  1.00 30.69  ? 393  GLY A C     1 
ATOM   3255 O  O     . GLY A 1 393 ? 5.030   -1.933  15.624  1.00 29.43  ? 393  GLY A O     1 
ATOM   3256 N  N     . ALA A 1 394 ? 5.238   0.006   16.751  1.00 30.54  ? 394  ALA A N     1 
ATOM   3257 C  CA    . ALA A 1 394 ? 5.474   0.811   15.562  1.00 31.49  ? 394  ALA A CA    1 
ATOM   3258 C  C     . ALA A 1 394 ? 6.885   0.655   15.003  1.00 32.76  ? 394  ALA A C     1 
ATOM   3259 O  O     . ALA A 1 394 ? 7.780   0.116   15.668  1.00 32.98  ? 394  ALA A O     1 
ATOM   3260 C  CB    . ALA A 1 394 ? 5.181   2.276   15.855  1.00 31.48  ? 394  ALA A CB    1 
ATOM   3261 N  N     . PHE A 1 395 ? 7.064   1.130   13.773  1.00 31.76  ? 395  PHE A N     1 
ATOM   3262 C  CA    . PHE A 1 395 ? 8.370   1.190   13.148  1.00 33.88  ? 395  PHE A CA    1 
ATOM   3263 C  C     . PHE A 1 395 ? 8.962   2.578   13.316  1.00 34.33  ? 395  PHE A C     1 
ATOM   3264 O  O     . PHE A 1 395 ? 8.266   3.587   13.131  1.00 32.90  ? 395  PHE A O     1 
ATOM   3265 C  CB    . PHE A 1 395 ? 8.290   0.848   11.657  1.00 33.64  ? 395  PHE A CB    1 
ATOM   3266 C  CG    . PHE A 1 395 ? 9.605   0.967   10.943  1.00 34.28  ? 395  PHE A CG    1 
ATOM   3267 C  CD1   . PHE A 1 395 ? 10.564  -0.034  11.058  1.00 34.88  ? 395  PHE A CD1   1 
ATOM   3268 C  CD2   . PHE A 1 395 ? 9.890   2.088   10.163  1.00 38.06  ? 395  PHE A CD2   1 
ATOM   3269 C  CE1   . PHE A 1 395 ? 11.792  0.077   10.405  1.00 36.21  ? 395  PHE A CE1   1 
ATOM   3270 C  CE2   . PHE A 1 395 ? 11.117  2.211   9.504   1.00 36.56  ? 395  PHE A CE2   1 
ATOM   3271 C  CZ    . PHE A 1 395 ? 12.070  1.203   9.630   1.00 35.23  ? 395  PHE A CZ    1 
ATOM   3272 N  N     . VAL A 1 396 ? 10.248  2.610   13.668  1.00 33.43  ? 396  VAL A N     1 
ATOM   3273 C  CA    . VAL A 1 396 ? 11.025  3.850   13.742  1.00 33.30  ? 396  VAL A CA    1 
ATOM   3274 C  C     . VAL A 1 396 ? 12.288  3.713   12.870  1.00 35.46  ? 396  VAL A C     1 
ATOM   3275 O  O     . VAL A 1 396 ? 13.070  2.761   13.026  1.00 35.03  ? 396  VAL A O     1 
ATOM   3276 C  CB    . VAL A 1 396 ? 11.406  4.224   15.208  1.00 33.27  ? 396  VAL A CB    1 
ATOM   3277 C  CG1   . VAL A 1 396 ? 11.979  5.637   15.275  1.00 29.39  ? 396  VAL A CG1   1 
ATOM   3278 C  CG2   . VAL A 1 396 ? 10.192  4.110   16.142  1.00 32.11  ? 396  VAL A CG2   1 
ATOM   3279 N  N     . LYS A 1 397 ? 12.464  4.656   11.945  1.00 34.41  ? 397  LYS A N     1 
ATOM   3280 C  CA    . LYS A 1 397 ? 13.613  4.656   11.041  1.00 34.09  ? 397  LYS A CA    1 
ATOM   3281 C  C     . LYS A 1 397 ? 14.814  5.284   11.740  1.00 33.70  ? 397  LYS A C     1 
ATOM   3282 O  O     . LYS A 1 397 ? 14.674  6.298   12.422  1.00 33.76  ? 397  LYS A O     1 
ATOM   3283 C  CB    . LYS A 1 397 ? 13.287  5.428   9.758   1.00 33.63  ? 397  LYS A CB    1 
ATOM   3284 C  CG    . LYS A 1 397 ? 14.420  5.459   8.729   1.00 37.19  ? 397  LYS A CG    1 
ATOM   3285 C  CD    . LYS A 1 397 ? 14.070  6.320   7.513   1.00 36.03  ? 397  LYS A CD    1 
ATOM   3286 C  CE    . LYS A 1 397 ? 15.267  6.490   6.574   1.00 37.20  ? 397  LYS A CE    1 
ATOM   3287 N  NZ    . LYS A 1 397 ? 15.647  5.218   5.905   1.00 40.60  ? 397  LYS A NZ    1 
ATOM   3288 N  N     . GLU A 1 398 ? 15.979  4.667   11.568  1.00 31.24  ? 398  GLU A N     1 
ATOM   3289 C  CA    . GLU A 1 398 ? 17.243  5.213   12.043  1.00 34.64  ? 398  GLU A CA    1 
ATOM   3290 C  C     . GLU A 1 398 ? 17.670  6.401   11.166  1.00 33.38  ? 398  GLU A C     1 
ATOM   3291 O  O     . GLU A 1 398 ? 18.021  6.222   9.996   1.00 36.68  ? 398  GLU A O     1 
ATOM   3292 C  CB    . GLU A 1 398 ? 18.329  4.119   12.050  1.00 34.17  ? 398  GLU A CB    1 
ATOM   3293 C  CG    . GLU A 1 398 ? 19.605  4.481   12.835  1.00 37.64  ? 398  GLU A CG    1 
ATOM   3294 C  CD    . GLU A 1 398 ? 19.417  4.462   14.359  1.00 40.15  ? 398  GLU A CD    1 
ATOM   3295 O  OE1   . GLU A 1 398 ? 19.188  3.371   14.933  1.00 39.44  ? 398  GLU A OE1   1 
ATOM   3296 O  OE2   . GLU A 1 398 ? 19.513  5.541   14.988  1.00 40.33  ? 398  GLU A OE2   1 
ATOM   3297 N  N     . PRO A 1 399 ? 17.639  7.623   11.716  1.00 32.29  ? 399  PRO A N     1 
ATOM   3298 C  CA    . PRO A 1 399 ? 18.089  8.734   10.868  1.00 32.17  ? 399  PRO A CA    1 
ATOM   3299 C  C     . PRO A 1 399 ? 19.619  8.842   10.827  1.00 35.51  ? 399  PRO A C     1 
ATOM   3300 O  O     . PRO A 1 399 ? 20.296  8.441   11.775  1.00 35.50  ? 399  PRO A O     1 
ATOM   3301 C  CB    . PRO A 1 399 ? 17.511  9.952   11.574  1.00 31.07  ? 399  PRO A CB    1 
ATOM   3302 C  CG    . PRO A 1 399 ? 17.530  9.559   13.037  1.00 27.47  ? 399  PRO A CG    1 
ATOM   3303 C  CD    . PRO A 1 399 ? 17.293  8.066   13.082  1.00 29.65  ? 399  PRO A CD    1 
ATOM   3304 N  N     . ILE A 1 400 ? 20.151  9.364   9.725   1.00 37.47  ? 400  ILE A N     1 
ATOM   3305 C  CA    . ILE A 1 400 ? 21.555  9.733   9.642   1.00 37.20  ? 400  ILE A CA    1 
ATOM   3306 C  C     . ILE A 1 400 ? 21.722  11.051  10.403  1.00 38.22  ? 400  ILE A C     1 
ATOM   3307 O  O     . ILE A 1 400 ? 21.188  12.084  9.976   1.00 38.03  ? 400  ILE A O     1 
ATOM   3308 C  CB    . ILE A 1 400 ? 22.011  9.904   8.167   1.00 38.06  ? 400  ILE A CB    1 
ATOM   3309 C  CG1   . ILE A 1 400 ? 21.908  8.574   7.417   1.00 37.84  ? 400  ILE A CG1   1 
ATOM   3310 C  CG2   . ILE A 1 400 ? 23.446  10.456  8.092   1.00 33.57  ? 400  ILE A CG2   1 
ATOM   3311 C  CD1   . ILE A 1 400 ? 21.950  8.721   5.906   1.00 44.37  ? 400  ILE A CD1   1 
ATOM   3312 N  N     . PRO A 1 401 ? 22.438  11.020  11.547  1.00 38.60  ? 401  PRO A N     1 
ATOM   3313 C  CA    . PRO A 1 401 ? 22.650  12.264  12.299  1.00 37.70  ? 401  PRO A CA    1 
ATOM   3314 C  C     . PRO A 1 401 ? 23.272  13.321  11.398  1.00 37.58  ? 401  PRO A C     1 
ATOM   3315 O  O     . PRO A 1 401 ? 24.306  13.078  10.766  1.00 38.27  ? 401  PRO A O     1 
ATOM   3316 C  CB    . PRO A 1 401 ? 23.629  11.859  13.406  1.00 37.19  ? 401  PRO A CB    1 
ATOM   3317 C  CG    . PRO A 1 401 ? 23.491  10.381  13.534  1.00 40.36  ? 401  PRO A CG    1 
ATOM   3318 C  CD    . PRO A 1 401 ? 23.109  9.867   12.174  1.00 39.87  ? 401  PRO A CD    1 
ATOM   3319 N  N     . ASN A 1 402 ? 22.626  14.479  11.335  1.00 37.19  ? 402  ASN A N     1 
ATOM   3320 C  CA    . ASN A 1 402 ? 23.039  15.557  10.455  1.00 37.93  ? 402  ASN A CA    1 
ATOM   3321 C  C     . ASN A 1 402 ? 22.169  16.780  10.668  1.00 36.22  ? 402  ASN A C     1 
ATOM   3322 O  O     . ASN A 1 402 ? 21.125  16.697  11.308  1.00 35.50  ? 402  ASN A O     1 
ATOM   3323 C  CB    . ASN A 1 402 ? 22.924  15.119  8.989   1.00 39.10  ? 402  ASN A CB    1 
ATOM   3324 C  CG    . ASN A 1 402 ? 23.988  15.749  8.100   1.00 42.82  ? 402  ASN A CG    1 
ATOM   3325 O  OD1   . ASN A 1 402 ? 24.573  16.786  8.432   1.00 42.97  ? 402  ASN A OD1   1 
ATOM   3326 N  ND2   . ASN A 1 402 ? 24.237  15.123  6.953   1.00 42.00  ? 402  ASN A ND2   1 
ATOM   3327 N  N     . ARG A 1 403 ? 22.619  17.913  10.143  1.00 36.20  ? 403  ARG A N     1 
ATOM   3328 C  CA    . ARG A 1 403 ? 21.744  19.043  9.891   1.00 37.65  ? 403  ARG A CA    1 
ATOM   3329 C  C     . ARG A 1 403 ? 20.893  18.726  8.661   1.00 37.88  ? 403  ARG A C     1 
ATOM   3330 O  O     . ARG A 1 403 ? 21.323  17.973  7.780   1.00 38.65  ? 403  ARG A O     1 
ATOM   3331 C  CB    . ARG A 1 403 ? 22.555  20.321  9.651   1.00 37.49  ? 403  ARG A CB    1 
ATOM   3332 C  CG    . ARG A 1 403 ? 23.486  20.268  8.437   1.00 39.22  ? 403  ARG A CG    1 
ATOM   3333 C  CD    . ARG A 1 403 ? 24.223  21.579  8.249   1.00 41.12  ? 403  ARG A CD    1 
ATOM   3334 N  NE    . ARG A 1 403 ? 25.340  21.727  9.174   1.00 42.32  ? 403  ARG A NE    1 
ATOM   3335 C  CZ    . ARG A 1 403 ? 26.189  22.755  9.171   1.00 45.61  ? 403  ARG A CZ    1 
ATOM   3336 N  NH1   . ARG A 1 403 ? 26.049  23.743  8.294   1.00 44.26  ? 403  ARG A NH1   1 
ATOM   3337 N  NH2   . ARG A 1 403 ? 27.183  22.799  10.048  1.00 42.96  ? 403  ARG A NH2   1 
ATOM   3338 N  N     . TYR A 1 404 ? 19.687  19.292  8.620   1.00 37.24  ? 404  TYR A N     1 
ATOM   3339 C  CA    . TYR A 1 404 ? 18.795  19.178  7.464   1.00 34.89  ? 404  TYR A CA    1 
ATOM   3340 C  C     . TYR A 1 404 ? 18.128  20.532  7.221   1.00 35.98  ? 404  TYR A C     1 
ATOM   3341 O  O     . TYR A 1 404 ? 17.360  21.019  8.067   1.00 32.53  ? 404  TYR A O     1 
ATOM   3342 C  CB    . TYR A 1 404 ? 17.756  18.070  7.681   1.00 32.78  ? 404  TYR A CB    1 
ATOM   3343 C  CG    . TYR A 1 404 ? 18.361  16.680  7.736   1.00 32.43  ? 404  TYR A CG    1 
ATOM   3344 C  CD1   . TYR A 1 404 ? 18.588  15.949  6.561   1.00 30.57  ? 404  TYR A CD1   1 
ATOM   3345 C  CD2   . TYR A 1 404 ? 18.719  16.100  8.961   1.00 25.66  ? 404  TYR A CD2   1 
ATOM   3346 C  CE1   . TYR A 1 404 ? 19.141  14.672  6.604   1.00 29.61  ? 404  TYR A CE1   1 
ATOM   3347 C  CE2   . TYR A 1 404 ? 19.284  14.826  9.016   1.00 28.62  ? 404  TYR A CE2   1 
ATOM   3348 C  CZ    . TYR A 1 404 ? 19.491  14.120  7.832   1.00 31.36  ? 404  TYR A CZ    1 
ATOM   3349 O  OH    . TYR A 1 404 ? 20.047  12.867  7.872   1.00 30.65  ? 404  TYR A OH    1 
ATOM   3350 N  N     . LYS A 1 405 ? 18.437  21.130  6.067   1.00 35.67  ? 405  LYS A N     1 
ATOM   3351 C  CA    . LYS A 1 405 ? 18.100  22.525  5.782   1.00 37.18  ? 405  LYS A CA    1 
ATOM   3352 C  C     . LYS A 1 405 ? 16.607  22.747  5.536   1.00 38.68  ? 405  LYS A C     1 
ATOM   3353 O  O     . LYS A 1 405 ? 15.964  23.510  6.264   1.00 39.50  ? 405  LYS A O     1 
ATOM   3354 C  CB    . LYS A 1 405 ? 18.926  23.039  4.603   1.00 37.45  ? 405  LYS A CB    1 
ATOM   3355 C  CG    . LYS A 1 405 ? 18.941  24.553  4.440   1.00 40.13  ? 405  LYS A CG    1 
ATOM   3356 C  CD    . LYS A 1 405 ? 19.907  24.947  3.321   1.00 45.55  ? 405  LYS A CD    1 
ATOM   3357 C  CE    . LYS A 1 405 ? 19.899  26.448  3.024   1.00 48.92  ? 405  LYS A CE    1 
ATOM   3358 N  NZ    . LYS A 1 405 ? 20.690  26.789  1.787   1.00 49.64  ? 405  LYS A NZ    1 
ATOM   3359 N  N     . TYR A 1 406 ? 16.071  22.070  4.522   1.00 38.02  ? 406  TYR A N     1 
ATOM   3360 C  CA    . TYR A 1 406 ? 14.682  22.198  4.129   1.00 39.20  ? 406  TYR A CA    1 
ATOM   3361 C  C     . TYR A 1 406 ? 13.971  20.873  4.374   1.00 39.58  ? 406  TYR A C     1 
ATOM   3362 O  O     . TYR A 1 406 ? 14.366  19.839  3.834   1.00 40.04  ? 406  TYR A O     1 
ATOM   3363 C  CB    . TYR A 1 406 ? 14.573  22.618  2.649   1.00 39.96  ? 406  TYR A CB    1 
ATOM   3364 C  CG    . TYR A 1 406 ? 15.006  24.047  2.389   1.00 43.09  ? 406  TYR A CG    1 
ATOM   3365 C  CD1   . TYR A 1 406 ? 16.233  24.326  1.788   1.00 46.67  ? 406  TYR A CD1   1 
ATOM   3366 C  CD2   . TYR A 1 406 ? 14.196  25.126  2.760   1.00 42.76  ? 406  TYR A CD2   1 
ATOM   3367 C  CE1   . TYR A 1 406 ? 16.643  25.638  1.549   1.00 44.92  ? 406  TYR A CE1   1 
ATOM   3368 C  CE2   . TYR A 1 406 ? 14.598  26.444  2.531   1.00 42.14  ? 406  TYR A CE2   1 
ATOM   3369 C  CZ    . TYR A 1 406 ? 15.823  26.689  1.925   1.00 45.88  ? 406  TYR A CZ    1 
ATOM   3370 O  OH    . TYR A 1 406 ? 16.235  27.983  1.694   1.00 47.62  ? 406  TYR A OH    1 
ATOM   3371 N  N     . VAL A 1 407 ? 12.929  20.899  5.201   1.00 38.09  ? 407  VAL A N     1 
ATOM   3372 C  CA    . VAL A 1 407 ? 12.227  19.669  5.565   1.00 37.01  ? 407  VAL A CA    1 
ATOM   3373 C  C     . VAL A 1 407 ? 10.716  19.828  5.459   1.00 37.75  ? 407  VAL A C     1 
ATOM   3374 O  O     . VAL A 1 407 ? 10.142  20.755  6.030   1.00 38.05  ? 407  VAL A O     1 
ATOM   3375 C  CB    . VAL A 1 407 ? 12.607  19.191  6.998   1.00 34.71  ? 407  VAL A CB    1 
ATOM   3376 C  CG1   . VAL A 1 407 ? 11.809  17.948  7.404   1.00 29.74  ? 407  VAL A CG1   1 
ATOM   3377 C  CG2   . VAL A 1 407 ? 14.092  18.913  7.098   1.00 32.49  ? 407  VAL A CG2   1 
ATOM   3378 N  N     . MET A 1 408 ? 10.085  18.916  4.722   1.00 37.80  ? 408  MET A N     1 
ATOM   3379 C  CA    . MET A 1 408 ? 8.630   18.778  4.737   1.00 38.14  ? 408  MET A CA    1 
ATOM   3380 C  C     . MET A 1 408 ? 8.245   17.463  5.387   1.00 35.80  ? 408  MET A C     1 
ATOM   3381 O  O     . MET A 1 408 ? 8.706   16.395  4.961   1.00 34.79  ? 408  MET A O     1 
ATOM   3382 C  CB    . MET A 1 408 ? 8.052   18.772  3.329   1.00 39.32  ? 408  MET A CB    1 
ATOM   3383 C  CG    . MET A 1 408 ? 8.629   19.788  2.384   1.00 49.19  ? 408  MET A CG    1 
ATOM   3384 S  SD    . MET A 1 408 ? 7.545   19.906  0.964   1.00 58.59  ? 408  MET A SD    1 
ATOM   3385 C  CE    . MET A 1 408 ? 6.172   20.738  1.763   1.00 54.16  ? 408  MET A CE    1 
ATOM   3386 N  N     . SER A 1 409 ? 7.379   17.528  6.391   1.00 33.00  ? 409  SER A N     1 
ATOM   3387 C  CA    . SER A 1 409 ? 6.871   16.308  7.008   1.00 33.26  ? 409  SER A CA    1 
ATOM   3388 C  C     . SER A 1 409 ? 5.462   15.985  6.516   1.00 36.18  ? 409  SER A C     1 
ATOM   3389 O  O     . SER A 1 409 ? 4.694   16.888  6.148   1.00 38.31  ? 409  SER A O     1 
ATOM   3390 C  CB    . SER A 1 409 ? 6.914   16.394  8.539   1.00 29.09  ? 409  SER A CB    1 
ATOM   3391 O  OG    . SER A 1 409 ? 5.958   17.315  9.032   1.00 25.55  ? 409  SER A OG    1 
ATOM   3392 N  N     . PHE A 1 410 ? 5.150   14.689  6.492   1.00 33.90  ? 410  PHE A N     1 
ATOM   3393 C  CA    . PHE A 1 410 ? 3.816   14.207  6.185   1.00 32.87  ? 410  PHE A CA    1 
ATOM   3394 C  C     . PHE A 1 410 ? 3.328   13.259  7.286   1.00 33.31  ? 410  PHE A C     1 
ATOM   3395 O  O     . PHE A 1 410 ? 4.109   12.536  7.907   1.00 32.71  ? 410  PHE A O     1 
ATOM   3396 C  CB    . PHE A 1 410 ? 3.788   13.527  4.820   1.00 31.03  ? 410  PHE A CB    1 
ATOM   3397 C  CG    . PHE A 1 410 ? 4.039   14.465  3.664   1.00 31.99  ? 410  PHE A CG    1 
ATOM   3398 C  CD1   . PHE A 1 410 ? 5.333   14.858  3.332   1.00 31.04  ? 410  PHE A CD1   1 
ATOM   3399 C  CD2   . PHE A 1 410 ? 2.979   14.940  2.897   1.00 30.80  ? 410  PHE A CD2   1 
ATOM   3400 C  CE1   . PHE A 1 410 ? 5.563   15.713  2.261   1.00 34.88  ? 410  PHE A CE1   1 
ATOM   3401 C  CE2   . PHE A 1 410 ? 3.195   15.795  1.835   1.00 32.69  ? 410  PHE A CE2   1 
ATOM   3402 C  CZ    . PHE A 1 410 ? 4.493   16.185  1.511   1.00 36.11  ? 410  PHE A CZ    1 
ATOM   3403 N  N     . ASP A 1 411 ? 2.027   13.275  7.524   1.00 32.36  ? 411  ASP A N     1 
ATOM   3404 C  CA    . ASP A 1 411 ? 1.455   12.566  8.647   1.00 33.58  ? 411  ASP A CA    1 
ATOM   3405 C  C     . ASP A 1 411 ? 0.106   11.933  8.290   1.00 32.63  ? 411  ASP A C     1 
ATOM   3406 O  O     . ASP A 1 411 ? -0.709  12.546  7.606   1.00 33.31  ? 411  ASP A O     1 
ATOM   3407 C  CB    . ASP A 1 411 ? 1.278   13.537  9.816   1.00 33.78  ? 411  ASP A CB    1 
ATOM   3408 C  CG    . ASP A 1 411 ? 0.639   12.891  11.003  1.00 37.62  ? 411  ASP A CG    1 
ATOM   3409 O  OD1   . ASP A 1 411 ? -0.576  13.096  11.211  1.00 41.26  ? 411  ASP A OD1   1 
ATOM   3410 O  OD2   . ASP A 1 411 ? 1.336   12.132  11.708  1.00 45.98  ? 411  ASP A OD2   1 
ATOM   3411 N  N     . LEU A 1 412 ? -0.120  10.718  8.781   1.00 32.79  ? 412  LEU A N     1 
ATOM   3412 C  CA    . LEU A 1 412 ? -1.390  10.023  8.605   1.00 33.58  ? 412  LEU A CA    1 
ATOM   3413 C  C     . LEU A 1 412 ? -2.387  10.411  9.695   1.00 33.33  ? 412  LEU A C     1 
ATOM   3414 O  O     . LEU A 1 412 ? -2.049  10.430  10.881  1.00 36.27  ? 412  LEU A O     1 
ATOM   3415 C  CB    . LEU A 1 412 ? -1.166  8.506   8.610   1.00 33.51  ? 412  LEU A CB    1 
ATOM   3416 C  CG    . LEU A 1 412 ? -0.627  7.905   7.306   1.00 34.54  ? 412  LEU A CG    1 
ATOM   3417 C  CD1   . LEU A 1 412 ? 0.313   6.738   7.552   1.00 31.03  ? 412  LEU A CD1   1 
ATOM   3418 C  CD2   . LEU A 1 412 ? -1.790  7.486   6.406   1.00 31.66  ? 412  LEU A CD2   1 
ATOM   3419 N  N     . THR A 1 413 ? -3.607  10.729  9.277   1.00 30.56  ? 413  THR A N     1 
ATOM   3420 C  CA    . THR A 1 413 ? -4.698  11.087  10.170  1.00 31.37  ? 413  THR A CA    1 
ATOM   3421 C  C     . THR A 1 413 ? -5.143  9.876   10.995  1.00 32.18  ? 413  THR A C     1 
ATOM   3422 O  O     . THR A 1 413 ? -5.406  8.802   10.441  1.00 29.45  ? 413  THR A O     1 
ATOM   3423 C  CB    . THR A 1 413 ? -5.893  11.602  9.349   1.00 32.41  ? 413  THR A CB    1 
ATOM   3424 O  OG1   . THR A 1 413 ? -5.446  12.660  8.492   1.00 36.57  ? 413  THR A OG1   1 
ATOM   3425 C  CG2   . THR A 1 413 ? -7.010  12.113  10.255  1.00 28.62  ? 413  THR A CG2   1 
ATOM   3426 N  N     . SER A 1 414 ? -5.238  10.063  12.313  1.00 33.16  ? 414  SER A N     1 
ATOM   3427 C  CA    . SER A 1 414 ? -5.599  8.982   13.248  1.00 32.79  ? 414  SER A CA    1 
ATOM   3428 C  C     . SER A 1 414 ? -5.188  7.601   12.752  1.00 29.72  ? 414  SER A C     1 
ATOM   3429 O  O     . SER A 1 414 ? -6.046  6.772   12.433  1.00 31.99  ? 414  SER A O     1 
ATOM   3430 C  CB    . SER A 1 414 ? -7.102  8.988   13.537  1.00 32.35  ? 414  SER A CB    1 
ATOM   3431 O  OG    . SER A 1 414 ? -7.411  9.868   14.600  1.00 43.68  ? 414  SER A OG    1 
ATOM   3432 N  N     . LEU A 1 415 ? -3.886  7.346   12.692  1.00 27.61  ? 415  LEU A N     1 
ATOM   3433 C  CA    . LEU A 1 415 ? -3.404  6.112   12.067  1.00 27.58  ? 415  LEU A CA    1 
ATOM   3434 C  C     . LEU A 1 415 ? -4.055  4.830   12.592  1.00 26.24  ? 415  LEU A C     1 
ATOM   3435 O  O     . LEU A 1 415 ? -4.712  4.121   11.831  1.00 25.44  ? 415  LEU A O     1 
ATOM   3436 C  CB    . LEU A 1 415 ? -1.879  5.990   12.109  1.00 27.69  ? 415  LEU A CB    1 
ATOM   3437 C  CG    . LEU A 1 415 ? -1.458  4.700   11.395  1.00 26.85  ? 415  LEU A CG    1 
ATOM   3438 C  CD1   . LEU A 1 415 ? -1.857  4.736   9.911   1.00 23.83  ? 415  LEU A CD1   1 
ATOM   3439 C  CD2   . LEU A 1 415 ? 0.012   4.383   11.567  1.00 27.80  ? 415  LEU A CD2   1 
ATOM   3440 N  N     . TYR A 1 416 ? -3.876  4.525   13.875  1.00 26.20  ? 416  TYR A N     1 
ATOM   3441 C  CA    . TYR A 1 416 ? -4.352  3.241   14.382  1.00 25.92  ? 416  TYR A CA    1 
ATOM   3442 C  C     . TYR A 1 416 ? -5.863  3.065   14.254  1.00 26.60  ? 416  TYR A C     1 
ATOM   3443 O  O     . TYR A 1 416 ? -6.299  2.006   13.829  1.00 29.28  ? 416  TYR A O     1 
ATOM   3444 C  CB    . TYR A 1 416 ? -3.865  2.966   15.807  1.00 24.54  ? 416  TYR A CB    1 
ATOM   3445 C  CG    . TYR A 1 416 ? -2.442  2.451   15.883  1.00 24.98  ? 416  TYR A CG    1 
ATOM   3446 C  CD1   . TYR A 1 416 ? -1.545  2.642   14.823  1.00 22.47  ? 416  TYR A CD1   1 
ATOM   3447 C  CD2   . TYR A 1 416 ? -1.981  1.792   17.022  1.00 25.59  ? 416  TYR A CD2   1 
ATOM   3448 C  CE1   . TYR A 1 416 ? -0.234  2.190   14.892  1.00 22.85  ? 416  TYR A CE1   1 
ATOM   3449 C  CE2   . TYR A 1 416 ? -0.656  1.341   17.102  1.00 29.39  ? 416  TYR A CE2   1 
ATOM   3450 C  CZ    . TYR A 1 416 ? 0.208   1.548   16.033  1.00 28.07  ? 416  TYR A CZ    1 
ATOM   3451 O  OH    . TYR A 1 416 ? 1.510   1.101   16.101  1.00 29.26  ? 416  TYR A OH    1 
ATOM   3452 N  N     . PRO A 1 417 ? -6.661  4.102   14.605  1.00 29.26  ? 417  PRO A N     1 
ATOM   3453 C  CA    . PRO A 1 417 ? -8.104  3.974   14.430  1.00 29.10  ? 417  PRO A CA    1 
ATOM   3454 C  C     . PRO A 1 417 ? -8.509  3.867   12.960  1.00 30.09  ? 417  PRO A C     1 
ATOM   3455 O  O     . PRO A 1 417 ? -9.487  3.181   12.651  1.00 31.23  ? 417  PRO A O     1 
ATOM   3456 C  CB    . PRO A 1 417 ? -8.651  5.269   15.052  1.00 31.95  ? 417  PRO A CB    1 
ATOM   3457 C  CG    . PRO A 1 417 ? -7.590  5.692   16.026  1.00 30.96  ? 417  PRO A CG    1 
ATOM   3458 C  CD    . PRO A 1 417 ? -6.317  5.339   15.341  1.00 30.26  ? 417  PRO A CD    1 
ATOM   3459 N  N     . SER A 1 418 ? -7.769  4.537   12.072  1.00 28.96  ? 418  SER A N     1 
ATOM   3460 C  CA    . SER A 1 418 ? -7.997  4.429   10.627  1.00 27.61  ? 418  SER A CA    1 
ATOM   3461 C  C     . SER A 1 418 ? -7.665  3.045   10.089  1.00 27.96  ? 418  SER A C     1 
ATOM   3462 O  O     . SER A 1 418 ? -8.305  2.585   9.148   1.00 26.58  ? 418  SER A O     1 
ATOM   3463 C  CB    . SER A 1 418 ? -7.196  5.477   9.855   1.00 28.14  ? 418  SER A CB    1 
ATOM   3464 O  OG    . SER A 1 418 ? -7.542  6.779   10.299  1.00 32.56  ? 418  SER A OG    1 
ATOM   3465 N  N     . ILE A 1 419 ? -6.661  2.389   10.680  1.00 28.91  ? 419  ILE A N     1 
ATOM   3466 C  CA    . ILE A 1 419 ? -6.313  1.016   10.309  1.00 28.61  ? 419  ILE A CA    1 
ATOM   3467 C  C     . ILE A 1 419 ? -7.446  0.074   10.745  1.00 29.67  ? 419  ILE A C     1 
ATOM   3468 O  O     . ILE A 1 419 ? -7.875  -0.789  9.980   1.00 28.80  ? 419  ILE A O     1 
ATOM   3469 C  CB    . ILE A 1 419 ? -4.955  0.565   10.915  1.00 29.00  ? 419  ILE A CB    1 
ATOM   3470 C  CG1   . ILE A 1 419 ? -3.798  1.381   10.334  1.00 27.81  ? 419  ILE A CG1   1 
ATOM   3471 C  CG2   . ILE A 1 419 ? -4.707  -0.915  10.654  1.00 26.97  ? 419  ILE A CG2   1 
ATOM   3472 C  CD1   . ILE A 1 419 ? -2.455  1.165   11.054  1.00 27.66  ? 419  ILE A CD1   1 
ATOM   3473 N  N     . ILE A 1 420 ? -7.956  0.272   11.957  1.00 28.86  ? 420  ILE A N     1 
ATOM   3474 C  CA    . ILE A 1 420 ? -9.100  -0.517  12.435  1.00 29.33  ? 420  ILE A CA    1 
ATOM   3475 C  C     . ILE A 1 420 ? -10.284 -0.429  11.461  1.00 30.58  ? 420  ILE A C     1 
ATOM   3476 O  O     . ILE A 1 420 ? -10.974 -1.425  11.217  1.00 30.60  ? 420  ILE A O     1 
ATOM   3477 C  CB    . ILE A 1 420 ? -9.534  -0.102  13.867  1.00 27.31  ? 420  ILE A CB    1 
ATOM   3478 C  CG1   . ILE A 1 420 ? -8.438  -0.484  14.876  1.00 26.34  ? 420  ILE A CG1   1 
ATOM   3479 C  CG2   . ILE A 1 420 ? -10.883 -0.751  14.246  1.00 24.71  ? 420  ILE A CG2   1 
ATOM   3480 C  CD1   . ILE A 1 420 ? -8.691  -0.050  16.339  1.00 24.83  ? 420  ILE A CD1   1 
ATOM   3481 N  N     . ARG A 1 421 ? -10.490 0.760   10.899  1.00 30.27  ? 421  ARG A N     1 
ATOM   3482 C  CA    . ARG A 1 421 ? -11.610 1.023   9.999   1.00 30.69  ? 421  ARG A CA    1 
ATOM   3483 C  C     . ARG A 1 421 ? -11.325 0.492   8.591   1.00 31.71  ? 421  ARG A C     1 
ATOM   3484 O  O     . ARG A 1 421 ? -12.169 -0.178  7.999   1.00 33.09  ? 421  ARG A O     1 
ATOM   3485 C  CB    . ARG A 1 421 ? -11.927 2.518   9.964   1.00 29.65  ? 421  ARG A CB    1 
ATOM   3486 C  CG    . ARG A 1 421 ? -12.424 3.105   11.298  1.00 32.60  ? 421  ARG A CG    1 
ATOM   3487 C  CD    . ARG A 1 421 ? -12.554 4.629   11.230  1.00 33.71  ? 421  ARG A CD    1 
ATOM   3488 N  NE    . ARG A 1 421 ? -13.396 5.030   10.108  1.00 35.00  ? 421  ARG A NE    1 
ATOM   3489 C  CZ    . ARG A 1 421 ? -13.267 6.162   9.418   1.00 35.08  ? 421  ARG A CZ    1 
ATOM   3490 N  NH1   . ARG A 1 421 ? -12.320 7.047   9.722   1.00 32.61  ? 421  ARG A NH1   1 
ATOM   3491 N  NH2   . ARG A 1 421 ? -14.088 6.398   8.405   1.00 27.18  ? 421  ARG A NH2   1 
ATOM   3492 N  N     . GLN A 1 422 ? -10.133 0.789   8.074   1.00 29.96  ? 422  GLN A N     1 
ATOM   3493 C  CA    . GLN A 1 422 ? -9.683  0.308   6.769   1.00 29.78  ? 422  GLN A CA    1 
ATOM   3494 C  C     . GLN A 1 422 ? -9.681  -1.226  6.678   1.00 29.80  ? 422  GLN A C     1 
ATOM   3495 O  O     . GLN A 1 422 ? -10.194 -1.798  5.718   1.00 31.33  ? 422  GLN A O     1 
ATOM   3496 C  CB    . GLN A 1 422 ? -8.288  0.864   6.451   1.00 27.52  ? 422  GLN A CB    1 
ATOM   3497 C  CG    . GLN A 1 422 ? -7.586  0.166   5.288   1.00 28.15  ? 422  GLN A CG    1 
ATOM   3498 C  CD    . GLN A 1 422 ? -6.768  1.115   4.429   1.00 30.18  ? 422  GLN A CD    1 
ATOM   3499 O  OE1   . GLN A 1 422 ? -6.919  2.333   4.506   1.00 35.38  ? 422  GLN A OE1   1 
ATOM   3500 N  NE2   . GLN A 1 422 ? -5.899  0.556   3.600   1.00 31.66  ? 422  GLN A NE2   1 
ATOM   3501 N  N     . VAL A 1 423 ? -9.116  -1.880  7.685   1.00 28.38  ? 423  VAL A N     1 
ATOM   3502 C  CA    . VAL A 1 423 ? -8.976  -3.340  7.673   1.00 29.51  ? 423  VAL A CA    1 
ATOM   3503 C  C     . VAL A 1 423 ? -10.244 -4.061  8.154   1.00 28.96  ? 423  VAL A C     1 
ATOM   3504 O  O     . VAL A 1 423 ? -10.476 -5.201  7.777   1.00 30.47  ? 423  VAL A O     1 
ATOM   3505 C  CB    . VAL A 1 423 ? -7.754  -3.810  8.513   1.00 27.34  ? 423  VAL A CB    1 
ATOM   3506 C  CG1   . VAL A 1 423 ? -7.569  -5.318  8.390   1.00 29.48  ? 423  VAL A CG1   1 
ATOM   3507 C  CG2   . VAL A 1 423 ? -6.496  -3.084  8.065   1.00 25.52  ? 423  VAL A CG2   1 
ATOM   3508 N  N     . ASN A 1 424 ? -11.049 -3.382  8.974   1.00 27.43  ? 424  ASN A N     1 
ATOM   3509 C  CA    . ASN A 1 424 ? -12.224 -3.961  9.620   1.00 28.95  ? 424  ASN A CA    1 
ATOM   3510 C  C     . ASN A 1 424 ? -11.846 -4.947  10.737  1.00 29.98  ? 424  ASN A C     1 
ATOM   3511 O  O     . ASN A 1 424 ? -12.321 -6.085  10.786  1.00 29.61  ? 424  ASN A O     1 
ATOM   3512 C  CB    . ASN A 1 424 ? -13.197 -4.577  8.606   1.00 27.94  ? 424  ASN A CB    1 
ATOM   3513 C  CG    . ASN A 1 424 ? -14.617 -4.692  9.152   1.00 33.80  ? 424  ASN A CG    1 
ATOM   3514 O  OD1   . ASN A 1 424 ? -15.045 -3.894  10.002  1.00 29.97  ? 424  ASN A OD1   1 
ATOM   3515 N  ND2   . ASN A 1 424 ? -15.355 -5.695  8.671   1.00 31.16  ? 424  ASN A ND2   1 
ATOM   3516 N  N     . ILE A 1 425 ? -10.996 -4.470  11.639  1.00 30.86  ? 425  ILE A N     1 
ATOM   3517 C  CA    . ILE A 1 425 ? -10.499 -5.253  12.770  1.00 31.33  ? 425  ILE A CA    1 
ATOM   3518 C  C     . ILE A 1 425 ? -11.455 -5.115  13.943  1.00 30.15  ? 425  ILE A C     1 
ATOM   3519 O  O     . ILE A 1 425 ? -11.638 -4.029  14.480  1.00 27.63  ? 425  ILE A O     1 
ATOM   3520 C  CB    . ILE A 1 425 ? -9.077  -4.787  13.194  1.00 30.44  ? 425  ILE A CB    1 
ATOM   3521 C  CG1   . ILE A 1 425 ? -8.077  -5.052  12.069  1.00 32.23  ? 425  ILE A CG1   1 
ATOM   3522 C  CG2   . ILE A 1 425 ? -8.625  -5.483  14.473  1.00 28.09  ? 425  ILE A CG2   1 
ATOM   3523 C  CD1   . ILE A 1 425 ? -6.800  -4.253  12.181  1.00 32.26  ? 425  ILE A CD1   1 
ATOM   3524 N  N     . SER A 1 426 ? -12.054 -6.234  14.329  1.00 30.66  ? 426  SER A N     1 
ATOM   3525 C  CA    . SER A 1 426 ? -13.016 -6.293  15.418  1.00 30.89  ? 426  SER A CA    1 
ATOM   3526 C  C     . SER A 1 426 ? -12.980 -7.734  15.900  1.00 31.16  ? 426  SER A C     1 
ATOM   3527 O  O     . SER A 1 426 ? -12.505 -8.607  15.175  1.00 32.75  ? 426  SER A O     1 
ATOM   3528 C  CB    . SER A 1 426 ? -14.421 -5.933  14.912  1.00 30.16  ? 426  SER A CB    1 
ATOM   3529 O  OG    . SER A 1 426 ? -15.270 -5.497  15.971  1.00 31.57  ? 426  SER A OG    1 
ATOM   3530 N  N     . PRO A 1 427 ? -13.457 -8.001  17.125  1.00 32.47  ? 427  PRO A N     1 
ATOM   3531 C  CA    . PRO A 1 427 ? -13.437 -9.390  17.570  1.00 32.06  ? 427  PRO A CA    1 
ATOM   3532 C  C     . PRO A 1 427 ? -14.295 -10.312 16.706  1.00 34.18  ? 427  PRO A C     1 
ATOM   3533 O  O     . PRO A 1 427 ? -13.918 -11.464 16.487  1.00 36.17  ? 427  PRO A O     1 
ATOM   3534 C  CB    . PRO A 1 427 ? -14.003 -9.314  18.991  1.00 34.20  ? 427  PRO A CB    1 
ATOM   3535 C  CG    . PRO A 1 427 ? -14.710 -7.988  19.063  1.00 34.85  ? 427  PRO A CG    1 
ATOM   3536 C  CD    . PRO A 1 427 ? -13.904 -7.090  18.192  1.00 32.98  ? 427  PRO A CD    1 
ATOM   3537 N  N     . GLU A 1 428 ? -15.427 -9.814  16.207  1.00 33.47  ? 428  GLU A N     1 
ATOM   3538 C  CA    . GLU A 1 428 ? -16.381 -10.673 15.489  1.00 34.05  ? 428  GLU A CA    1 
ATOM   3539 C  C     . GLU A 1 428 ? -16.219 -10.665 13.962  1.00 34.56  ? 428  GLU A C     1 
ATOM   3540 O  O     . GLU A 1 428 ? -16.975 -11.336 13.248  1.00 35.36  ? 428  GLU A O     1 
ATOM   3541 C  CB    . GLU A 1 428 ? -17.827 -10.355 15.910  1.00 33.72  ? 428  GLU A CB    1 
ATOM   3542 C  CG    . GLU A 1 428 ? -18.492 -9.159  15.224  1.00 33.28  ? 428  GLU A CG    1 
ATOM   3543 C  CD    . GLU A 1 428 ? -17.905 -7.821  15.627  1.00 35.25  ? 428  GLU A CD    1 
ATOM   3544 O  OE1   . GLU A 1 428 ? -16.775 -7.785  16.153  1.00 32.94  ? 428  GLU A OE1   1 
ATOM   3545 O  OE2   . GLU A 1 428 ? -18.575 -6.793  15.397  1.00 41.88  ? 428  GLU A OE2   1 
ATOM   3546 N  N     . THR A 1 429 ? -15.230 -9.917  13.470  1.00 33.70  ? 429  THR A N     1 
ATOM   3547 C  CA    . THR A 1 429 ? -14.937 -9.872  12.034  1.00 34.21  ? 429  THR A CA    1 
ATOM   3548 C  C     . THR A 1 429 ? -13.779 -10.767 11.596  1.00 33.25  ? 429  THR A C     1 
ATOM   3549 O  O     . THR A 1 429 ? -13.457 -10.807 10.416  1.00 35.23  ? 429  THR A O     1 
ATOM   3550 C  CB    . THR A 1 429 ? -14.676 -8.435  11.518  1.00 33.89  ? 429  THR A CB    1 
ATOM   3551 O  OG1   . THR A 1 429 ? -13.733 -7.780  12.374  1.00 33.40  ? 429  THR A OG1   1 
ATOM   3552 C  CG2   . THR A 1 429 ? -15.965 -7.646  11.459  1.00 32.02  ? 429  THR A CG2   1 
ATOM   3553 N  N     . ILE A 1 430 ? -13.160 -11.480 12.534  1.00 36.15  ? 430  ILE A N     1 
ATOM   3554 C  CA    . ILE A 1 430 ? -12.069 -12.404 12.212  1.00 34.24  ? 430  ILE A CA    1 
ATOM   3555 C  C     . ILE A 1 430 ? -12.566 -13.489 11.262  1.00 36.90  ? 430  ILE A C     1 
ATOM   3556 O  O     . ILE A 1 430 ? -13.545 -14.188 11.564  1.00 40.36  ? 430  ILE A O     1 
ATOM   3557 C  CB    . ILE A 1 430 ? -11.469 -13.046 13.484  1.00 34.26  ? 430  ILE A CB    1 
ATOM   3558 C  CG1   . ILE A 1 430 ? -10.724 -11.995 14.314  1.00 35.29  ? 430  ILE A CG1   1 
ATOM   3559 C  CG2   . ILE A 1 430 ? -10.521 -14.196 13.122  1.00 33.40  ? 430  ILE A CG2   1 
ATOM   3560 C  CD1   . ILE A 1 430 ? -10.344 -12.464 15.717  1.00 34.33  ? 430  ILE A CD1   1 
ATOM   3561 N  N     . ALA A 1 431 ? -11.897 -13.624 10.117  1.00 35.39  ? 431  ALA A N     1 
ATOM   3562 C  CA    . ALA A 1 431 ? -12.309 -14.586 9.093   1.00 35.15  ? 431  ALA A CA    1 
ATOM   3563 C  C     . ALA A 1 431 ? -11.360 -15.773 8.977   1.00 35.62  ? 431  ALA A C     1 
ATOM   3564 O  O     . ALA A 1 431 ? -11.758 -16.844 8.526   1.00 37.00  ? 431  ALA A O     1 
ATOM   3565 C  CB    . ALA A 1 431 ? -12.461 -13.896 7.738   1.00 36.10  ? 431  ALA A CB    1 
ATOM   3566 N  N     . GLY A 1 432 ? -10.106 -15.577 9.372   1.00 34.83  ? 432  GLY A N     1 
ATOM   3567 C  CA    . GLY A 1 432 ? -9.094  -16.619 9.258   1.00 34.17  ? 432  GLY A CA    1 
ATOM   3568 C  C     . GLY A 1 432 ? -7.696  -16.047 9.168   1.00 35.07  ? 432  GLY A C     1 
ATOM   3569 O  O     . GLY A 1 432 ? -7.451  -14.922 9.608   1.00 35.08  ? 432  GLY A O     1 
ATOM   3570 N  N     . THR A 1 433 ? -6.781  -16.827 8.595   1.00 34.23  ? 433  THR A N     1 
ATOM   3571 C  CA    . THR A 1 433 ? -5.381  -16.424 8.453   1.00 33.63  ? 433  THR A CA    1 
ATOM   3572 C  C     . THR A 1 433 ? -4.818  -16.818 7.096   1.00 35.54  ? 433  THR A C     1 
ATOM   3573 O  O     . THR A 1 433 ? -5.338  -17.711 6.429   1.00 33.26  ? 433  THR A O     1 
ATOM   3574 C  CB    . THR A 1 433 ? -4.468  -17.078 9.532   1.00 34.31  ? 433  THR A CB    1 
ATOM   3575 O  OG1   . THR A 1 433 ? -4.501  -18.509 9.397   1.00 29.99  ? 433  THR A OG1   1 
ATOM   3576 C  CG2   . THR A 1 433 ? -4.897  -16.673 10.943  1.00 34.07  ? 433  THR A CG2   1 
ATOM   3577 N  N     . PHE A 1 434 ? -3.739  -16.155 6.704   1.00 35.68  ? 434  PHE A N     1 
ATOM   3578 C  CA    . PHE A 1 434 ? -2.996  -16.553 5.519   1.00 39.76  ? 434  PHE A CA    1 
ATOM   3579 C  C     . PHE A 1 434 ? -1.535  -16.776 5.895   1.00 39.52  ? 434  PHE A C     1 
ATOM   3580 O  O     . PHE A 1 434 ? -1.103  -16.409 6.986   1.00 40.18  ? 434  PHE A O     1 
ATOM   3581 C  CB    . PHE A 1 434 ? -3.138  -15.519 4.385   1.00 38.48  ? 434  PHE A CB    1 
ATOM   3582 C  CG    . PHE A 1 434 ? -2.604  -14.160 4.731   1.00 37.99  ? 434  PHE A CG    1 
ATOM   3583 C  CD1   . PHE A 1 434 ? -3.410  -13.225 5.381   1.00 34.87  ? 434  PHE A CD1   1 
ATOM   3584 C  CD2   . PHE A 1 434 ? -1.296  -13.810 4.409   1.00 35.32  ? 434  PHE A CD2   1 
ATOM   3585 C  CE1   . PHE A 1 434 ? -2.921  -11.963 5.704   1.00 31.54  ? 434  PHE A CE1   1 
ATOM   3586 C  CE2   . PHE A 1 434 ? -0.797  -12.555 4.739   1.00 33.62  ? 434  PHE A CE2   1 
ATOM   3587 C  CZ    . PHE A 1 434 ? -1.615  -11.625 5.380   1.00 32.69  ? 434  PHE A CZ    1 
ATOM   3588 N  N     . LYS A 1 435 ? -0.791  -17.392 4.985   1.00 42.31  ? 435  LYS A N     1 
ATOM   3589 C  CA    . LYS A 1 435 ? 0.621   -17.669 5.182   1.00 43.23  ? 435  LYS A CA    1 
ATOM   3590 C  C     . LYS A 1 435 ? 1.393   -16.374 4.989   1.00 43.17  ? 435  LYS A C     1 
ATOM   3591 O  O     . LYS A 1 435 ? 1.440   -15.834 3.877   1.00 42.32  ? 435  LYS A O     1 
ATOM   3592 C  CB    . LYS A 1 435 ? 1.074   -18.731 4.181   1.00 45.02  ? 435  LYS A CB    1 
ATOM   3593 C  CG    . LYS A 1 435 ? 2.351   -19.466 4.553   1.00 49.38  ? 435  LYS A CG    1 
ATOM   3594 C  CD    . LYS A 1 435 ? 2.357   -20.893 3.975   1.00 52.97  ? 435  LYS A CD    1 
ATOM   3595 C  CE    . LYS A 1 435 ? 2.684   -20.922 2.479   1.00 50.88  ? 435  LYS A CE    1 
ATOM   3596 N  NZ    . LYS A 1 435 ? 2.670   -22.299 1.929   1.00 45.08  ? 435  LYS A NZ    1 
ATOM   3597 N  N     . VAL A 1 436 ? 1.975   -15.871 6.078   1.00 42.15  ? 436  VAL A N     1 
ATOM   3598 C  CA    . VAL A 1 436 ? 2.724   -14.617 6.045   1.00 41.95  ? 436  VAL A CA    1 
ATOM   3599 C  C     . VAL A 1 436 ? 4.098   -14.768 5.405   1.00 42.73  ? 436  VAL A C     1 
ATOM   3600 O  O     . VAL A 1 436 ? 4.827   -15.727 5.668   1.00 41.55  ? 436  VAL A O     1 
ATOM   3601 C  CB    . VAL A 1 436 ? 2.890   -13.968 7.453   1.00 41.85  ? 436  VAL A CB    1 
ATOM   3602 C  CG1   . VAL A 1 436 ? 1.550   -13.685 8.060   1.00 43.21  ? 436  VAL A CG1   1 
ATOM   3603 C  CG2   . VAL A 1 436 ? 3.711   -14.855 8.391   1.00 45.26  ? 436  VAL A CG2   1 
ATOM   3604 N  N     . ALA A 1 437 ? 4.425   -13.808 4.551   1.00 42.18  ? 437  ALA A N     1 
ATOM   3605 C  CA    . ALA A 1 437 ? 5.766   -13.640 4.032   1.00 41.37  ? 437  ALA A CA    1 
ATOM   3606 C  C     . ALA A 1 437 ? 6.475   -12.635 4.953   1.00 42.18  ? 437  ALA A C     1 
ATOM   3607 O  O     . ALA A 1 437 ? 5.813   -11.952 5.734   1.00 39.94  ? 437  ALA A O     1 
ATOM   3608 C  CB    . ALA A 1 437 ? 5.701   -13.122 2.613   1.00 39.47  ? 437  ALA A CB    1 
ATOM   3609 N  N     . PRO A 1 438 ? 7.820   -12.558 4.889   1.00 43.68  ? 438  PRO A N     1 
ATOM   3610 C  CA    . PRO A 1 438 ? 8.539   -11.537 5.654   1.00 43.94  ? 438  PRO A CA    1 
ATOM   3611 C  C     . PRO A 1 438 ? 8.042   -10.141 5.314   1.00 43.01  ? 438  PRO A C     1 
ATOM   3612 O  O     . PRO A 1 438 ? 7.729   -9.872  4.156   1.00 44.29  ? 438  PRO A O     1 
ATOM   3613 C  CB    . PRO A 1 438 ? 9.980   -11.704 5.182   1.00 44.82  ? 438  PRO A CB    1 
ATOM   3614 C  CG    . PRO A 1 438 ? 10.077  -13.142 4.830   1.00 45.34  ? 438  PRO A CG    1 
ATOM   3615 C  CD    . PRO A 1 438 ? 8.745   -13.504 4.239   1.00 44.43  ? 438  PRO A CD    1 
ATOM   3616 N  N     . LEU A 1 439 ? 7.981   -9.271  6.319   1.00 42.20  ? 439  LEU A N     1 
ATOM   3617 C  CA    . LEU A 1 439 ? 7.357   -7.954  6.186   1.00 41.94  ? 439  LEU A CA    1 
ATOM   3618 C  C     . LEU A 1 439 ? 7.863   -7.122  5.004   1.00 42.16  ? 439  LEU A C     1 
ATOM   3619 O  O     . LEU A 1 439 ? 7.058   -6.499  4.302   1.00 43.45  ? 439  LEU A O     1 
ATOM   3620 C  CB    . LEU A 1 439 ? 7.476   -7.157  7.494   1.00 40.88  ? 439  LEU A CB    1 
ATOM   3621 C  CG    . LEU A 1 439 ? 6.744   -5.810  7.562   1.00 40.74  ? 439  LEU A CG    1 
ATOM   3622 C  CD1   . LEU A 1 439 ? 5.222   -5.984  7.694   1.00 37.37  ? 439  LEU A CD1   1 
ATOM   3623 C  CD2   . LEU A 1 439 ? 7.283   -4.971  8.706   1.00 41.54  ? 439  LEU A CD2   1 
ATOM   3624 N  N     . HIS A 1 440 ? 9.179   -7.112  4.781   1.00 42.33  ? 440  HIS A N     1 
ATOM   3625 C  CA    A HIS A 1 440 ? 9.752   -6.320  3.692   0.50 42.63  ? 440  HIS A CA    1 
ATOM   3626 C  CA    B HIS A 1 440 ? 9.767   -6.330  3.689   0.50 42.83  ? 440  HIS A CA    1 
ATOM   3627 C  C     . HIS A 1 440 ? 9.233   -6.758  2.318   1.00 42.75  ? 440  HIS A C     1 
ATOM   3628 O  O     . HIS A 1 440 ? 9.238   -5.973  1.366   1.00 43.65  ? 440  HIS A O     1 
ATOM   3629 C  CB    A HIS A 1 440 ? 11.290  -6.289  3.748   0.50 43.69  ? 440  HIS A CB    1 
ATOM   3630 C  CB    B HIS A 1 440 ? 11.305  -6.369  3.730   0.50 43.95  ? 440  HIS A CB    1 
ATOM   3631 C  CG    A HIS A 1 440 ? 11.948  -7.566  3.330   0.50 45.54  ? 440  HIS A CG    1 
ATOM   3632 C  CG    B HIS A 1 440 ? 11.916  -5.251  4.523   0.50 45.85  ? 440  HIS A CG    1 
ATOM   3633 N  ND1   A HIS A 1 440 ? 12.280  -8.560  4.226   0.50 47.36  ? 440  HIS A ND1   1 
ATOM   3634 N  ND1   B HIS A 1 440 ? 12.153  -4.002  3.988   0.50 45.09  ? 440  HIS A ND1   1 
ATOM   3635 C  CD2   A HIS A 1 440 ? 12.356  -8.003  2.115   0.50 47.11  ? 440  HIS A CD2   1 
ATOM   3636 C  CD2   B HIS A 1 440 ? 12.330  -5.192  5.812   0.50 46.35  ? 440  HIS A CD2   1 
ATOM   3637 C  CE1   A HIS A 1 440 ? 12.852  -9.560  3.578   0.50 49.01  ? 440  HIS A CE1   1 
ATOM   3638 C  CE1   B HIS A 1 440 ? 12.685  -3.222  4.913   0.50 45.92  ? 440  HIS A CE1   1 
ATOM   3639 N  NE2   A HIS A 1 440 ? 12.908  -9.248  2.295   0.50 47.85  ? 440  HIS A NE2   1 
ATOM   3640 N  NE2   B HIS A 1 440 ? 12.804  -3.920  6.028   0.50 45.91  ? 440  HIS A NE2   1 
ATOM   3641 N  N     . ASP A 1 441 ? 8.765   -8.005  2.229   1.00 40.83  ? 441  ASP A N     1 
ATOM   3642 C  CA    . ASP A 1 441 ? 8.167   -8.523  0.996   1.00 40.85  ? 441  ASP A CA    1 
ATOM   3643 C  C     . ASP A 1 441 ? 6.817   -7.869  0.700   1.00 39.10  ? 441  ASP A C     1 
ATOM   3644 O  O     . ASP A 1 441 ? 6.476   -7.635  -0.462  1.00 41.07  ? 441  ASP A O     1 
ATOM   3645 C  CB    . ASP A 1 441 ? 8.054   -10.051 1.028   1.00 40.27  ? 441  ASP A CB    1 
ATOM   3646 C  CG    . ASP A 1 441 ? 9.416   -10.745 0.908   1.00 44.16  ? 441  ASP A CG    1 
ATOM   3647 O  OD1   . ASP A 1 441 ? 10.445  -10.057 0.700   1.00 44.07  ? 441  ASP A OD1   1 
ATOM   3648 O  OD2   . ASP A 1 441 ? 9.459   -11.984 1.026   1.00 42.19  ? 441  ASP A OD2   1 
ATOM   3649 N  N     . TYR A 1 442 ? 6.062   -7.564  1.751   1.00 36.11  ? 442  TYR A N     1 
ATOM   3650 C  CA    . TYR A 1 442 ? 4.850   -6.780  1.596   1.00 34.60  ? 442  TYR A CA    1 
ATOM   3651 C  C     . TYR A 1 442 ? 5.220   -5.328  1.338   1.00 35.95  ? 442  TYR A C     1 
ATOM   3652 O  O     . TYR A 1 442 ? 4.672   -4.700  0.438   1.00 36.65  ? 442  TYR A O     1 
ATOM   3653 C  CB    . TYR A 1 442 ? 3.925   -6.937  2.805   1.00 33.63  ? 442  TYR A CB    1 
ATOM   3654 C  CG    . TYR A 1 442 ? 3.446   -8.358  2.987   1.00 32.13  ? 442  TYR A CG    1 
ATOM   3655 C  CD1   . TYR A 1 442 ? 2.583   -8.952  2.059   1.00 33.20  ? 442  TYR A CD1   1 
ATOM   3656 C  CD2   . TYR A 1 442 ? 3.873   -9.119  4.070   1.00 34.60  ? 442  TYR A CD2   1 
ATOM   3657 C  CE1   . TYR A 1 442 ? 2.148   -10.262 2.218   1.00 33.69  ? 442  TYR A CE1   1 
ATOM   3658 C  CE2   . TYR A 1 442 ? 3.448   -10.437 4.238   1.00 35.26  ? 442  TYR A CE2   1 
ATOM   3659 C  CZ    . TYR A 1 442 ? 2.589   -10.998 3.310   1.00 36.15  ? 442  TYR A CZ    1 
ATOM   3660 O  OH    . TYR A 1 442 ? 2.184   -12.299 3.477   1.00 38.60  ? 442  TYR A OH    1 
ATOM   3661 N  N     . ILE A 1 443 ? 6.187   -4.811  2.097   1.00 38.38  ? 443  ILE A N     1 
ATOM   3662 C  CA    . ILE A 1 443 ? 6.663   -3.443  1.897   1.00 38.67  ? 443  ILE A CA    1 
ATOM   3663 C  C     . ILE A 1 443 ? 7.067   -3.222  0.437   1.00 40.35  ? 443  ILE A C     1 
ATOM   3664 O  O     . ILE A 1 443 ? 6.701   -2.216  -0.170  1.00 39.77  ? 443  ILE A O     1 
ATOM   3665 C  CB    . ILE A 1 443 ? 7.820   -3.084  2.871   1.00 38.84  ? 443  ILE A CB    1 
ATOM   3666 C  CG1   . ILE A 1 443 ? 7.307   -3.063  4.320   1.00 39.82  ? 443  ILE A CG1   1 
ATOM   3667 C  CG2   . ILE A 1 443 ? 8.455   -1.742  2.500   1.00 35.18  ? 443  ILE A CG2   1 
ATOM   3668 C  CD1   . ILE A 1 443 ? 8.397   -3.125  5.380   1.00 42.21  ? 443  ILE A CD1   1 
ATOM   3669 N  N     . ASN A 1 444 ? 7.792   -4.180  -0.132  1.00 44.34  ? 444  ASN A N     1 
ATOM   3670 C  CA    . ASN A 1 444 ? 8.316   -4.029  -1.491  1.00 47.26  ? 444  ASN A CA    1 
ATOM   3671 C  C     . ASN A 1 444 ? 7.445   -4.613  -2.593  1.00 48.21  ? 444  ASN A C     1 
ATOM   3672 O  O     . ASN A 1 444 ? 7.857   -4.681  -3.753  1.00 51.17  ? 444  ASN A O     1 
ATOM   3673 C  CB    . ASN A 1 444 ? 9.760   -4.529  -1.563  1.00 49.91  ? 444  ASN A CB    1 
ATOM   3674 C  CG    . ASN A 1 444 ? 10.690  -3.697  -0.695  1.00 53.15  ? 444  ASN A CG    1 
ATOM   3675 O  OD1   . ASN A 1 444 ? 10.898  -2.511  -0.959  1.00 55.09  ? 444  ASN A OD1   1 
ATOM   3676 N  ND2   . ASN A 1 444 ? 11.224  -4.301  0.365   1.00 50.87  ? 444  ASN A ND2   1 
ATOM   3677 N  N     . ALA A 1 445 ? 6.236   -5.028  -2.219  1.00 47.79  ? 445  ALA A N     1 
ATOM   3678 C  CA    . ALA A 1 445 ? 5.224   -5.503  -3.165  1.00 48.32  ? 445  ALA A CA    1 
ATOM   3679 C  C     . ALA A 1 445 ? 5.656   -6.721  -3.988  1.00 50.30  ? 445  ALA A C     1 
ATOM   3680 O  O     . ALA A 1 445 ? 5.270   -6.857  -5.154  1.00 51.20  ? 445  ALA A O     1 
ATOM   3681 C  CB    . ALA A 1 445 ? 4.759   -4.355  -4.084  1.00 47.86  ? 445  ALA A CB    1 
ATOM   3682 N  N     . VAL A 1 446 ? 6.448   -7.605  -3.382  1.00 50.89  ? 446  VAL A N     1 
ATOM   3683 C  CA    . VAL A 1 446 ? 6.869   -8.842  -4.054  1.00 51.69  ? 446  VAL A CA    1 
ATOM   3684 C  C     . VAL A 1 446 ? 6.218   -10.094 -3.464  1.00 50.99  ? 446  VAL A C     1 
ATOM   3685 O  O     . VAL A 1 446 ? 6.216   -11.160 -4.087  1.00 51.93  ? 446  VAL A O     1 
ATOM   3686 C  CB    . VAL A 1 446 ? 8.414   -9.001  -4.117  1.00 52.97  ? 446  VAL A CB    1 
ATOM   3687 C  CG1   . VAL A 1 446 ? 9.025   -7.908  -4.994  1.00 52.88  ? 446  VAL A CG1   1 
ATOM   3688 C  CG2   . VAL A 1 446 ? 9.037   -9.010  -2.719  1.00 52.97  ? 446  VAL A CG2   1 
ATOM   3689 N  N     . ALA A 1 447 ? 5.667   -9.963  -2.264  1.00 49.50  ? 447  ALA A N     1 
ATOM   3690 C  CA    . ALA A 1 447 ? 4.896   -11.046 -1.671  1.00 48.56  ? 447  ALA A CA    1 
ATOM   3691 C  C     . ALA A 1 447 ? 3.599   -11.267 -2.452  1.00 47.53  ? 447  ALA A C     1 
ATOM   3692 O  O     . ALA A 1 447 ? 3.064   -10.337 -3.077  1.00 44.09  ? 447  ALA A O     1 
ATOM   3693 C  CB    . ALA A 1 447 ? 4.604   -10.753 -0.216  1.00 47.94  ? 447  ALA A CB    1 
ATOM   3694 N  N     . GLU A 1 448 ? 3.112   -12.505 -2.434  1.00 47.76  ? 448  GLU A N     1 
ATOM   3695 C  CA    . GLU A 1 448 ? 1.853   -12.818 -3.090  1.00 47.96  ? 448  GLU A CA    1 
ATOM   3696 C  C     . GLU A 1 448 ? 0.700   -12.159 -2.340  1.00 44.57  ? 448  GLU A C     1 
ATOM   3697 O  O     . GLU A 1 448 ? 0.791   -11.897 -1.132  1.00 42.51  ? 448  GLU A O     1 
ATOM   3698 C  CB    . GLU A 1 448 ? 1.648   -14.334 -3.254  1.00 50.94  ? 448  GLU A CB    1 
ATOM   3699 C  CG    . GLU A 1 448 ? 1.270   -15.112 -1.995  1.00 55.40  ? 448  GLU A CG    1 
ATOM   3700 C  CD    . GLU A 1 448 ? 1.093   -16.618 -2.258  1.00 62.55  ? 448  GLU A CD    1 
ATOM   3701 O  OE1   . GLU A 1 448 ? 0.846   -17.016 -3.427  1.00 63.43  ? 448  GLU A OE1   1 
ATOM   3702 O  OE2   . GLU A 1 448 ? 1.197   -17.402 -1.286  1.00 61.31  ? 448  GLU A OE2   1 
ATOM   3703 N  N     . ARG A 1 449 ? -0.369  -11.874 -3.072  1.00 41.77  ? 449  ARG A N     1 
ATOM   3704 C  CA    . ARG A 1 449 ? -1.537  -11.219 -2.510  1.00 41.38  ? 449  ARG A CA    1 
ATOM   3705 C  C     . ARG A 1 449 ? -2.175  -12.109 -1.433  1.00 39.39  ? 449  ARG A C     1 
ATOM   3706 O  O     . ARG A 1 449 ? -2.460  -13.286 -1.687  1.00 38.39  ? 449  ARG A O     1 
ATOM   3707 C  CB    . ARG A 1 449 ? -2.527  -10.864 -3.622  1.00 42.69  ? 449  ARG A CB    1 
ATOM   3708 C  CG    . ARG A 1 449 ? -3.525  -9.806  -3.230  1.00 44.69  ? 449  ARG A CG    1 
ATOM   3709 C  CD    . ARG A 1 449 ? -4.079  -9.069  -4.443  1.00 48.22  ? 449  ARG A CD    1 
ATOM   3710 N  NE    . ARG A 1 449 ? -5.151  -8.162  -4.038  1.00 47.35  ? 449  ARG A NE    1 
ATOM   3711 C  CZ    . ARG A 1 449 ? -6.447  -8.382  -4.246  1.00 44.81  ? 449  ARG A CZ    1 
ATOM   3712 N  NH1   . ARG A 1 449 ? -6.849  -9.471  -4.890  1.00 47.07  ? 449  ARG A NH1   1 
ATOM   3713 N  NH2   . ARG A 1 449 ? -7.342  -7.500  -3.829  1.00 40.54  ? 449  ARG A NH2   1 
ATOM   3714 N  N     . PRO A 1 450 ? -2.361  -11.558 -0.216  1.00 35.98  ? 450  PRO A N     1 
ATOM   3715 C  CA    . PRO A 1 450 ? -2.882  -12.323 0.922   1.00 35.15  ? 450  PRO A CA    1 
ATOM   3716 C  C     . PRO A 1 450 ? -4.237  -12.978 0.668   1.00 34.89  ? 450  PRO A C     1 
ATOM   3717 O  O     . PRO A 1 450 ? -4.383  -14.167 0.919   1.00 35.58  ? 450  PRO A O     1 
ATOM   3718 C  CB    . PRO A 1 450 ? -2.994  -11.269 2.029   1.00 34.05  ? 450  PRO A CB    1 
ATOM   3719 C  CG    . PRO A 1 450 ? -1.945  -10.288 1.704   1.00 34.41  ? 450  PRO A CG    1 
ATOM   3720 C  CD    . PRO A 1 450 ? -1.890  -10.224 0.199   1.00 34.25  ? 450  PRO A CD    1 
ATOM   3721 N  N     . SER A 1 451 ? -5.216  -12.212 0.182   1.00 36.75  ? 451  SER A N     1 
ATOM   3722 C  CA    . SER A 1 451 ? -6.565  -12.744 -0.047  1.00 35.58  ? 451  SER A CA    1 
ATOM   3723 C  C     . SER A 1 451 ? -7.288  -12.071 -1.200  1.00 36.67  ? 451  SER A C     1 
ATOM   3724 O  O     . SER A 1 451 ? -7.148  -10.866 -1.424  1.00 35.23  ? 451  SER A O     1 
ATOM   3725 C  CB    . SER A 1 451 ? -7.434  -12.650 1.216   1.00 32.82  ? 451  SER A CB    1 
ATOM   3726 O  OG    . SER A 1 451 ? -8.734  -13.180 0.967   1.00 30.35  ? 451  SER A OG    1 
ATOM   3727 N  N     . ASP A 1 452 ? -8.068  -12.875 -1.916  1.00 37.88  ? 452  ASP A N     1 
ATOM   3728 C  CA    . ASP A 1 452 ? -8.964  -12.381 -2.954  1.00 40.04  ? 452  ASP A CA    1 
ATOM   3729 C  C     . ASP A 1 452 ? -10.396 -12.230 -2.437  1.00 37.21  ? 452  ASP A C     1 
ATOM   3730 O  O     . ASP A 1 452 ? -11.290 -11.833 -3.180  1.00 36.29  ? 452  ASP A O     1 
ATOM   3731 C  CB    . ASP A 1 452 ? -8.926  -13.314 -4.162  1.00 43.45  ? 452  ASP A CB    1 
ATOM   3732 C  CG    . ASP A 1 452 ? -7.998  -12.818 -5.247  1.00 53.14  ? 452  ASP A CG    1 
ATOM   3733 O  OD1   . ASP A 1 452 ? -8.318  -11.775 -5.871  1.00 59.12  ? 452  ASP A OD1   1 
ATOM   3734 O  OD2   . ASP A 1 452 ? -6.957  -13.472 -5.481  1.00 55.11  ? 452  ASP A OD2   1 
ATOM   3735 N  N     . VAL A 1 453 ? -10.599 -12.540 -1.158  1.00 35.89  ? 453  VAL A N     1 
ATOM   3736 C  CA    . VAL A 1 453 ? -11.935 -12.558 -0.554  1.00 36.78  ? 453  VAL A CA    1 
ATOM   3737 C  C     . VAL A 1 453 ? -12.053 -11.611 0.638   1.00 36.04  ? 453  VAL A C     1 
ATOM   3738 O  O     . VAL A 1 453 ? -13.028 -10.868 0.754   1.00 38.83  ? 453  VAL A O     1 
ATOM   3739 C  CB    . VAL A 1 453 ? -12.332 -13.990 -0.102  1.00 35.89  ? 453  VAL A CB    1 
ATOM   3740 C  CG1   . VAL A 1 453 ? -13.645 -13.981 0.678   1.00 35.36  ? 453  VAL A CG1   1 
ATOM   3741 C  CG2   . VAL A 1 453 ? -12.439 -14.908 -1.300  1.00 37.32  ? 453  VAL A CG2   1 
ATOM   3742 N  N     . TYR A 1 454 ? -11.052 -11.642 1.511   1.00 34.43  ? 454  TYR A N     1 
ATOM   3743 C  CA    . TYR A 1 454 ? -11.121 -10.965 2.797   1.00 31.85  ? 454  TYR A CA    1 
ATOM   3744 C  C     . TYR A 1 454 ? -10.139 -9.800  2.884   1.00 31.13  ? 454  TYR A C     1 
ATOM   3745 O  O     . TYR A 1 454 ? -9.253  -9.666  2.047   1.00 32.12  ? 454  TYR A O     1 
ATOM   3746 C  CB    . TYR A 1 454 ? -10.844 -11.966 3.917   1.00 31.84  ? 454  TYR A CB    1 
ATOM   3747 C  CG    . TYR A 1 454 ? -11.795 -13.146 3.961   1.00 28.73  ? 454  TYR A CG    1 
ATOM   3748 C  CD1   . TYR A 1 454 ? -13.162 -12.967 4.216   1.00 32.16  ? 454  TYR A CD1   1 
ATOM   3749 C  CD2   . TYR A 1 454 ? -11.329 -14.442 3.767   1.00 29.66  ? 454  TYR A CD2   1 
ATOM   3750 C  CE1   . TYR A 1 454 ? -14.040 -14.056 4.264   1.00 32.47  ? 454  TYR A CE1   1 
ATOM   3751 C  CE2   . TYR A 1 454 ? -12.195 -15.536 3.815   1.00 32.03  ? 454  TYR A CE2   1 
ATOM   3752 C  CZ    . TYR A 1 454 ? -13.544 -15.336 4.069   1.00 34.72  ? 454  TYR A CZ    1 
ATOM   3753 O  OH    . TYR A 1 454 ? -14.392 -16.423 4.123   1.00 43.40  ? 454  TYR A OH    1 
ATOM   3754 N  N     . SER A 1 455 ? -10.320 -8.960  3.900   1.00 29.27  ? 455  SER A N     1 
ATOM   3755 C  CA    . SER A 1 455 ? -9.463  -7.809  4.149   1.00 30.44  ? 455  SER A CA    1 
ATOM   3756 C  C     . SER A 1 455 ? -8.315  -8.186  5.092   1.00 29.22  ? 455  SER A C     1 
ATOM   3757 O  O     . SER A 1 455 ? -8.545  -8.755  6.160   1.00 30.94  ? 455  SER A O     1 
ATOM   3758 C  CB    . SER A 1 455 ? -10.301 -6.669  4.740   1.00 29.43  ? 455  SER A CB    1 
ATOM   3759 O  OG    . SER A 1 455 ? -9.482  -5.717  5.385   1.00 31.81  ? 455  SER A OG    1 
ATOM   3760 N  N     . CYS A 1 456 ? -7.085  -7.851  4.715   1.00 28.88  ? 456  CYS A N     1 
ATOM   3761 C  CA    . CYS A 1 456 ? -5.921  -8.380  5.432   1.00 29.79  ? 456  CYS A CA    1 
ATOM   3762 C  C     . CYS A 1 456 ? -4.969  -7.382  6.080   1.00 28.60  ? 456  CYS A C     1 
ATOM   3763 O  O     . CYS A 1 456 ? -4.887  -6.214  5.686   1.00 30.20  ? 456  CYS A O     1 
ATOM   3764 C  CB    . CYS A 1 456 ? -5.116  -9.302  4.516   1.00 30.86  ? 456  CYS A CB    1 
ATOM   3765 S  SG    . CYS A 1 456 ? -6.138  -10.459 3.608   1.00 36.32  ? 456  CYS A SG    1 
ATOM   3766 N  N     . SER A 1 457 ? -4.245  -7.874  7.080   1.00 28.97  ? 457  SER A N     1 
ATOM   3767 C  CA    . SER A 1 457 ? -3.076  -7.191  7.621   1.00 28.84  ? 457  SER A CA    1 
ATOM   3768 C  C     . SER A 1 457 ? -1.891  -8.132  7.480   1.00 29.41  ? 457  SER A C     1 
ATOM   3769 O  O     . SER A 1 457 ? -2.065  -9.347  7.603   1.00 29.29  ? 457  SER A O     1 
ATOM   3770 C  CB    . SER A 1 457 ? -3.292  -6.826  9.087   1.00 28.28  ? 457  SER A CB    1 
ATOM   3771 O  OG    . SER A 1 457 ? -2.049  -6.673  9.758   1.00 33.55  ? 457  SER A OG    1 
ATOM   3772 N  N     . PRO A 1 458 ? -0.681  -7.581  7.227   1.00 30.95  ? 458  PRO A N     1 
ATOM   3773 C  CA    . PRO A 1 458 ? 0.529   -8.384  6.994   1.00 30.10  ? 458  PRO A CA    1 
ATOM   3774 C  C     . PRO A 1 458 ? 1.000   -9.226  8.188   1.00 32.95  ? 458  PRO A C     1 
ATOM   3775 O  O     . PRO A 1 458 ? 2.025   -9.901  8.086   1.00 35.62  ? 458  PRO A O     1 
ATOM   3776 C  CB    . PRO A 1 458 ? 1.586   -7.329  6.636   1.00 32.43  ? 458  PRO A CB    1 
ATOM   3777 C  CG    . PRO A 1 458 ? 1.078   -6.062  7.261   1.00 33.11  ? 458  PRO A CG    1 
ATOM   3778 C  CD    . PRO A 1 458 ? -0.404  -6.140  7.060   1.00 31.02  ? 458  PRO A CD    1 
ATOM   3779 N  N     . ASN A 1 459 ? 0.270   -9.196  9.301   1.00 31.44  ? 459  ASN A N     1 
ATOM   3780 C  CA    . ASN A 1 459 ? 0.557   -10.107 10.407  1.00 30.87  ? 459  ASN A CA    1 
ATOM   3781 C  C     . ASN A 1 459 ? -0.058  -11.479 10.165  1.00 31.30  ? 459  ASN A C     1 
ATOM   3782 O  O     . ASN A 1 459 ? 0.187   -12.414 10.923  1.00 31.09  ? 459  ASN A O     1 
ATOM   3783 C  CB    . ASN A 1 459 ? 0.073   -9.535  11.759  1.00 31.20  ? 459  ASN A CB    1 
ATOM   3784 C  CG    . ASN A 1 459 ? -1.421  -9.648  11.940  1.00 28.30  ? 459  ASN A CG    1 
ATOM   3785 O  OD1   . ASN A 1 459 ? -2.186  -9.505  10.989  1.00 36.24  ? 459  ASN A OD1   1 
ATOM   3786 N  ND2   . ASN A 1 459 ? -1.850  -9.906  13.167  1.00 29.51  ? 459  ASN A ND2   1 
ATOM   3787 N  N     . GLY A 1 460 ? -0.867  -11.589 9.112   1.00 29.97  ? 460  GLY A N     1 
ATOM   3788 C  CA    . GLY A 1 460 ? -1.505  -12.852 8.763   1.00 27.63  ? 460  GLY A CA    1 
ATOM   3789 C  C     . GLY A 1 460 ? -2.999  -12.929 8.985   1.00 27.94  ? 460  GLY A C     1 
ATOM   3790 O  O     . GLY A 1 460 ? -3.599  -13.956 8.726   1.00 28.58  ? 460  GLY A O     1 
ATOM   3791 N  N     . MET A 1 461 ? -3.613  -11.852 9.458   1.00 29.77  ? 461  MET A N     1 
ATOM   3792 C  CA    . MET A 1 461 ? -5.035  -11.905 9.790   1.00 29.55  ? 461  MET A CA    1 
ATOM   3793 C  C     . MET A 1 461 ? -5.918  -11.481 8.621   1.00 31.58  ? 461  MET A C     1 
ATOM   3794 O  O     . MET A 1 461 ? -5.550  -10.605 7.824   1.00 30.71  ? 461  MET A O     1 
ATOM   3795 C  CB    . MET A 1 461 ? -5.341  -11.071 11.037  1.00 30.09  ? 461  MET A CB    1 
ATOM   3796 C  CG    . MET A 1 461 ? -4.770  -11.641 12.348  1.00 29.51  ? 461  MET A CG    1 
ATOM   3797 S  SD    . MET A 1 461 ? -5.414  -13.267 12.836  1.00 35.84  ? 461  MET A SD    1 
ATOM   3798 C  CE    . MET A 1 461 ? -7.096  -12.852 13.286  1.00 32.22  ? 461  MET A CE    1 
ATOM   3799 N  N     . MET A 1 462 ? -7.077  -12.123 8.518   1.00 30.36  ? 462  MET A N     1 
ATOM   3800 C  CA    . MET A 1 462 ? -8.061  -11.793 7.499   1.00 31.65  ? 462  MET A CA    1 
ATOM   3801 C  C     . MET A 1 462 ? -9.357  -11.409 8.182   1.00 31.23  ? 462  MET A C     1 
ATOM   3802 O  O     . MET A 1 462 ? -9.702  -11.964 9.224   1.00 30.79  ? 462  MET A O     1 
ATOM   3803 C  CB    . MET A 1 462 ? -8.297  -12.981 6.562   1.00 34.50  ? 462  MET A CB    1 
ATOM   3804 C  CG    . MET A 1 462 ? -7.039  -13.478 5.866   1.00 36.48  ? 462  MET A CG    1 
ATOM   3805 S  SD    . MET A 1 462 ? -7.342  -14.716 4.601   1.00 39.04  ? 462  MET A SD    1 
ATOM   3806 C  CE    . MET A 1 462 ? -8.218  -15.988 5.521   1.00 43.96  ? 462  MET A CE    1 
ATOM   3807 N  N     . TYR A 1 463 ? -10.073 -10.455 7.597   1.00 31.38  ? 463  TYR A N     1 
ATOM   3808 C  CA    . TYR A 1 463 ? -11.332 -9.995  8.177   1.00 32.20  ? 463  TYR A CA    1 
ATOM   3809 C  C     . TYR A 1 463 ? -12.462 -9.949  7.156   1.00 32.64  ? 463  TYR A C     1 
ATOM   3810 O  O     . TYR A 1 463 ? -12.214 -9.814  5.952   1.00 31.72  ? 463  TYR A O     1 
ATOM   3811 C  CB    . TYR A 1 463 ? -11.135 -8.631  8.844   1.00 30.97  ? 463  TYR A CB    1 
ATOM   3812 C  CG    . TYR A 1 463 ? -10.051 -8.645  9.902   1.00 31.82  ? 463  TYR A CG    1 
ATOM   3813 C  CD1   . TYR A 1 463 ? -8.716  -8.405  9.563   1.00 31.21  ? 463  TYR A CD1   1 
ATOM   3814 C  CD2   . TYR A 1 463 ? -10.355 -8.922  11.229  1.00 28.55  ? 463  TYR A CD2   1 
ATOM   3815 C  CE1   . TYR A 1 463 ? -7.717  -8.424  10.518  1.00 32.49  ? 463  TYR A CE1   1 
ATOM   3816 C  CE2   . TYR A 1 463 ? -9.365  -8.936  12.202  1.00 31.87  ? 463  TYR A CE2   1 
ATOM   3817 C  CZ    . TYR A 1 463 ? -8.045  -8.686  11.838  1.00 33.97  ? 463  TYR A CZ    1 
ATOM   3818 O  OH    . TYR A 1 463 ? -7.059  -8.695  12.792  1.00 28.64  ? 463  TYR A OH    1 
ATOM   3819 N  N     . TYR A 1 464 ? -13.701 -10.069 7.638   1.00 32.83  ? 464  TYR A N     1 
ATOM   3820 C  CA    . TYR A 1 464 ? -14.875 -9.997  6.758   1.00 32.90  ? 464  TYR A CA    1 
ATOM   3821 C  C     . TYR A 1 464 ? -14.964 -8.630  6.096   1.00 32.75  ? 464  TYR A C     1 
ATOM   3822 O  O     . TYR A 1 464 ? -14.510 -7.626  6.653   1.00 32.43  ? 464  TYR A O     1 
ATOM   3823 C  CB    . TYR A 1 464 ? -16.175 -10.272 7.523   1.00 31.78  ? 464  TYR A CB    1 
ATOM   3824 C  CG    . TYR A 1 464 ? -16.262 -11.643 8.145   1.00 33.78  ? 464  TYR A CG    1 
ATOM   3825 C  CD1   . TYR A 1 464 ? -16.704 -11.806 9.453   1.00 32.08  ? 464  TYR A CD1   1 
ATOM   3826 C  CD2   . TYR A 1 464 ? -15.895 -12.784 7.425   1.00 37.13  ? 464  TYR A CD2   1 
ATOM   3827 C  CE1   . TYR A 1 464 ? -16.779 -13.081 10.036  1.00 38.84  ? 464  TYR A CE1   1 
ATOM   3828 C  CE2   . TYR A 1 464 ? -15.965 -14.055 7.992   1.00 38.89  ? 464  TYR A CE2   1 
ATOM   3829 C  CZ    . TYR A 1 464 ? -16.405 -14.200 9.297   1.00 40.93  ? 464  TYR A CZ    1 
ATOM   3830 O  OH    . TYR A 1 464 ? -16.474 -15.465 9.851   1.00 44.13  ? 464  TYR A OH    1 
ATOM   3831 N  N     . LYS A 1 465 ? -15.554 -8.597  4.912   1.00 33.53  ? 465  LYS A N     1 
ATOM   3832 C  CA    . LYS A 1 465 ? -15.749 -7.345  4.195   1.00 34.54  ? 465  LYS A CA    1 
ATOM   3833 C  C     . LYS A 1 465 ? -17.224 -6.996  3.986   1.00 35.76  ? 465  LYS A C     1 
ATOM   3834 O  O     . LYS A 1 465 ? -17.543 -5.922  3.457   1.00 36.32  ? 465  LYS A O     1 
ATOM   3835 C  CB    . LYS A 1 465 ? -15.026 -7.388  2.851   1.00 32.51  ? 465  LYS A CB    1 
ATOM   3836 C  CG    . LYS A 1 465 ? -13.516 -7.354  2.958   1.00 31.98  ? 465  LYS A CG    1 
ATOM   3837 C  CD    . LYS A 1 465 ? -12.853 -7.332  1.570   1.00 34.32  ? 465  LYS A CD    1 
ATOM   3838 C  CE    . LYS A 1 465 ? -12.797 -5.918  0.992   1.00 32.36  ? 465  LYS A CE    1 
ATOM   3839 N  NZ    . LYS A 1 465 ? -11.939 -5.861  -0.228  1.00 33.57  ? 465  LYS A NZ    1 
ATOM   3840 N  N     . ASP A 1 466 ? -18.121 -7.888  4.397   1.00 37.37  ? 466  ASP A N     1 
ATOM   3841 C  CA    . ASP A 1 466 ? -19.542 -7.699  4.100   1.00 41.72  ? 466  ASP A CA    1 
ATOM   3842 C  C     . ASP A 1 466 ? -20.198 -6.628  4.974   1.00 43.79  ? 466  ASP A C     1 
ATOM   3843 O  O     . ASP A 1 466 ? -21.096 -5.915  4.520   1.00 46.01  ? 466  ASP A O     1 
ATOM   3844 C  CB    . ASP A 1 466 ? -20.305 -9.022  4.194   1.00 41.65  ? 466  ASP A CB    1 
ATOM   3845 C  CG    . ASP A 1 466 ? -20.367 -9.568  5.612   1.00 45.92  ? 466  ASP A CG    1 
ATOM   3846 O  OD1   . ASP A 1 466 ? -19.300 -9.752  6.239   1.00 44.10  ? 466  ASP A OD1   1 
ATOM   3847 O  OD2   . ASP A 1 466 ? -21.492 -9.817  6.094   1.00 47.85  ? 466  ASP A OD2   1 
ATOM   3848 N  N     . ARG A 1 467 ? -19.732 -6.517  6.216   1.00 44.53  ? 467  ARG A N     1 
ATOM   3849 C  CA    . ARG A 1 467 ? -20.310 -5.614  7.205   1.00 46.62  ? 467  ARG A CA    1 
ATOM   3850 C  C     . ARG A 1 467 ? -19.241 -5.119  8.174   1.00 45.11  ? 467  ARG A C     1 
ATOM   3851 O  O     . ARG A 1 467 ? -18.254 -5.818  8.427   1.00 44.85  ? 467  ARG A O     1 
ATOM   3852 C  CB    . ARG A 1 467 ? -21.433 -6.319  7.985   1.00 48.68  ? 467  ARG A CB    1 
ATOM   3853 C  CG    . ARG A 1 467 ? -21.015 -7.630  8.659   1.00 55.82  ? 467  ARG A CG    1 
ATOM   3854 C  CD    . ARG A 1 467 ? -22.177 -8.304  9.391   1.00 66.05  ? 467  ARG A CD    1 
ATOM   3855 N  NE    . ARG A 1 467 ? -22.036 -9.765  9.415   1.00 71.73  ? 467  ARG A NE    1 
ATOM   3856 C  CZ    . ARG A 1 467 ? -21.472 -10.469 10.397  1.00 74.97  ? 467  ARG A CZ    1 
ATOM   3857 N  NH1   . ARG A 1 467 ? -20.982 -9.866  11.476  1.00 74.14  ? 467  ARG A NH1   1 
ATOM   3858 N  NH2   . ARG A 1 467 ? -21.400 -11.792 10.298  1.00 76.29  ? 467  ARG A NH2   1 
ATOM   3859 N  N     . ASP A 1 468 ? -19.453 -3.921  8.718   1.00 43.55  ? 468  ASP A N     1 
ATOM   3860 C  CA    . ASP A 1 468 ? -18.554 -3.329  9.713   1.00 41.60  ? 468  ASP A CA    1 
ATOM   3861 C  C     . ASP A 1 468 ? -18.685 -4.003  11.069  1.00 37.69  ? 468  ASP A C     1 
ATOM   3862 O  O     . ASP A 1 468 ? -19.789 -4.270  11.535  1.00 39.80  ? 468  ASP A O     1 
ATOM   3863 C  CB    . ASP A 1 468 ? -18.830 -1.831  9.868   1.00 43.01  ? 468  ASP A CB    1 
ATOM   3864 C  CG    . ASP A 1 468 ? -18.273 -1.003  8.719   1.00 48.28  ? 468  ASP A CG    1 
ATOM   3865 O  OD1   . ASP A 1 468 ? -17.222 -1.374  8.156   1.00 50.20  ? 468  ASP A OD1   1 
ATOM   3866 O  OD2   . ASP A 1 468 ? -18.875 0.043   8.390   1.00 53.82  ? 468  ASP A OD2   1 
ATOM   3867 N  N     . GLY A 1 469 ? -17.547 -4.281  11.694  1.00 40.30  ? 469  GLY A N     1 
ATOM   3868 C  CA    . GLY A 1 469 ? -17.520 -4.731  13.083  1.00 35.59  ? 469  GLY A CA    1 
ATOM   3869 C  C     . GLY A 1 469 ? -17.872 -3.608  14.043  1.00 33.90  ? 469  GLY A C     1 
ATOM   3870 O  O     . GLY A 1 469 ? -17.812 -2.422  13.683  1.00 32.51  ? 469  GLY A O     1 
ATOM   3871 N  N     . VAL A 1 470 ? -18.238 -3.984  15.267  1.00 32.60  ? 470  VAL A N     1 
ATOM   3872 C  CA    . VAL A 1 470 ? -18.628 -3.033  16.310  1.00 29.39  ? 470  VAL A CA    1 
ATOM   3873 C  C     . VAL A 1 470 ? -17.455 -2.151  16.769  1.00 30.30  ? 470  VAL A C     1 
ATOM   3874 O  O     . VAL A 1 470 ? -17.648 -0.996  17.145  1.00 32.81  ? 470  VAL A O     1 
ATOM   3875 C  CB    . VAL A 1 470 ? -19.322 -3.761  17.504  1.00 30.84  ? 470  VAL A CB    1 
ATOM   3876 C  CG1   . VAL A 1 470 ? -18.343 -4.622  18.295  1.00 28.79  ? 470  VAL A CG1   1 
ATOM   3877 C  CG2   . VAL A 1 470 ? -20.052 -2.779  18.415  1.00 30.63  ? 470  VAL A CG2   1 
ATOM   3878 N  N     . VAL A 1 471 ? -16.239 -2.680  16.722  1.00 29.90  ? 471  VAL A N     1 
ATOM   3879 C  CA    . VAL A 1 471 ? -15.067 -1.854  17.024  1.00 30.85  ? 471  VAL A CA    1 
ATOM   3880 C  C     . VAL A 1 471 ? -14.887 -0.733  15.984  1.00 28.81  ? 471  VAL A C     1 
ATOM   3881 O  O     . VAL A 1 471 ? -14.874 0.430   16.361  1.00 29.93  ? 471  VAL A O     1 
ATOM   3882 C  CB    . VAL A 1 471 ? -13.782 -2.694  17.260  1.00 31.61  ? 471  VAL A CB    1 
ATOM   3883 C  CG1   . VAL A 1 471 ? -12.534 -1.813  17.247  1.00 29.31  ? 471  VAL A CG1   1 
ATOM   3884 C  CG2   . VAL A 1 471 ? -13.887 -3.442  18.589  1.00 31.75  ? 471  VAL A CG2   1 
ATOM   3885 N  N     . PRO A 1 472 ? -14.790 -1.068  14.679  1.00 28.60  ? 472  PRO A N     1 
ATOM   3886 C  CA    . PRO A 1 472 ? -14.762 0.007   13.678  1.00 28.16  ? 472  PRO A CA    1 
ATOM   3887 C  C     . PRO A 1 472 ? -15.957 0.969   13.749  1.00 31.41  ? 472  PRO A C     1 
ATOM   3888 O  O     . PRO A 1 472 ? -15.779 2.190   13.658  1.00 32.88  ? 472  PRO A O     1 
ATOM   3889 C  CB    . PRO A 1 472 ? -14.770 -0.749  12.340  1.00 29.49  ? 472  PRO A CB    1 
ATOM   3890 C  CG    . PRO A 1 472 ? -14.130 -2.062  12.644  1.00 26.64  ? 472  PRO A CG    1 
ATOM   3891 C  CD    . PRO A 1 472 ? -14.469 -2.383  14.083  1.00 27.62  ? 472  PRO A CD    1 
ATOM   3892 N  N     . THR A 1 473 ? -17.158 0.432   13.924  1.00 31.86  ? 473  THR A N     1 
ATOM   3893 C  CA    . THR A 1 473 ? -18.358 1.264   13.960  1.00 33.06  ? 473  THR A CA    1 
ATOM   3894 C  C     . THR A 1 473 ? -18.257 2.316   15.063  1.00 32.90  ? 473  THR A C     1 
ATOM   3895 O  O     . THR A 1 473 ? -18.462 3.512   14.818  1.00 32.53  ? 473  THR A O     1 
ATOM   3896 C  CB    . THR A 1 473 ? -19.625 0.402   14.126  1.00 33.00  ? 473  THR A CB    1 
ATOM   3897 O  OG1   . THR A 1 473 ? -19.776 -0.430  12.971  1.00 36.64  ? 473  THR A OG1   1 
ATOM   3898 C  CG2   . THR A 1 473 ? -20.868 1.267   14.262  1.00 37.76  ? 473  THR A CG2   1 
ATOM   3899 N  N     . GLU A 1 474 ? -17.903 1.862   16.261  1.00 30.42  ? 474  GLU A N     1 
ATOM   3900 C  CA    . GLU A 1 474 ? -17.886 2.720   17.430  1.00 31.59  ? 474  GLU A CA    1 
ATOM   3901 C  C     . GLU A 1 474 ? -16.692 3.649   17.484  1.00 31.18  ? 474  GLU A C     1 
ATOM   3902 O  O     . GLU A 1 474 ? -16.812 4.760   17.980  1.00 28.65  ? 474  GLU A O     1 
ATOM   3903 C  CB    . GLU A 1 474 ? -17.975 1.890   18.711  1.00 31.14  ? 474  GLU A CB    1 
ATOM   3904 C  CG    . GLU A 1 474 ? -19.323 1.180   18.870  1.00 32.78  ? 474  GLU A CG    1 
ATOM   3905 C  CD    . GLU A 1 474 ? -20.502 2.142   18.794  1.00 36.11  ? 474  GLU A CD    1 
ATOM   3906 O  OE1   . GLU A 1 474 ? -21.516 1.772   18.167  1.00 36.18  ? 474  GLU A OE1   1 
ATOM   3907 O  OE2   . GLU A 1 474 ? -20.414 3.264   19.354  1.00 35.41  ? 474  GLU A OE2   1 
ATOM   3908 N  N     . ILE A 1 475 ? -15.548 3.193   16.976  1.00 31.55  ? 475  ILE A N     1 
ATOM   3909 C  CA    . ILE A 1 475 ? -14.347 4.018   16.959  1.00 29.93  ? 475  ILE A CA    1 
ATOM   3910 C  C     . ILE A 1 475 ? -14.516 5.192   15.979  1.00 31.69  ? 475  ILE A C     1 
ATOM   3911 O  O     . ILE A 1 475 ? -13.957 6.264   16.206  1.00 32.02  ? 475  ILE A O     1 
ATOM   3912 C  CB    . ILE A 1 475 ? -13.061 3.172   16.670  1.00 30.85  ? 475  ILE A CB    1 
ATOM   3913 C  CG1   . ILE A 1 475 ? -11.840 3.799   17.334  1.00 28.83  ? 475  ILE A CG1   1 
ATOM   3914 C  CG2   . ILE A 1 475 ? -12.850 2.951   15.162  1.00 29.38  ? 475  ILE A CG2   1 
ATOM   3915 C  CD1   . ILE A 1 475 ? -10.587 2.941   17.277  1.00 26.14  ? 475  ILE A CD1   1 
ATOM   3916 N  N     . THR A 1 476 ? -15.301 4.974   14.917  1.00 31.07  ? 476  THR A N     1 
ATOM   3917 C  CA    . THR A 1 476 ? -15.600 5.979   13.886  1.00 32.62  ? 476  THR A CA    1 
ATOM   3918 C  C     . THR A 1 476 ? -16.414 7.158   14.434  1.00 34.43  ? 476  THR A C     1 
ATOM   3919 O  O     . THR A 1 476 ? -16.157 8.312   14.080  1.00 35.66  ? 476  THR A O     1 
ATOM   3920 C  CB    . THR A 1 476 ? -16.385 5.340   12.694  1.00 34.31  ? 476  THR A CB    1 
ATOM   3921 O  OG1   . THR A 1 476 ? -15.595 4.315   12.079  1.00 31.84  ? 476  THR A OG1   1 
ATOM   3922 C  CG2   . THR A 1 476 ? -16.770 6.382   11.632  1.00 33.13  ? 476  THR A CG2   1 
ATOM   3923 N  N     . LYS A 1 477 ? -17.400 6.857   15.282  1.00 34.57  ? 477  LYS A N     1 
ATOM   3924 C  CA    . LYS A 1 477 ? -18.275 7.876   15.869  1.00 35.17  ? 477  LYS A CA    1 
ATOM   3925 C  C     . LYS A 1 477 ? -17.478 8.876   16.695  1.00 35.09  ? 477  LYS A C     1 
ATOM   3926 O  O     . LYS A 1 477 ? -17.643 10.081  16.534  1.00 36.96  ? 477  LYS A O     1 
ATOM   3927 C  CB    . LYS A 1 477 ? -19.375 7.235   16.725  1.00 35.47  ? 477  LYS A CB    1 
ATOM   3928 C  CG    . LYS A 1 477 ? -20.472 6.525   15.928  1.00 36.24  ? 477  LYS A CG    1 
ATOM   3929 C  CD    . LYS A 1 477 ? -21.404 5.764   16.852  1.00 37.95  ? 477  LYS A CD    1 
ATOM   3930 C  CE    . LYS A 1 477 ? -22.288 4.800   16.096  1.00 46.66  ? 477  LYS A CE    1 
ATOM   3931 N  NZ    . LYS A 1 477 ? -23.280 4.145   17.011  1.00 50.03  ? 477  LYS A NZ    1 
ATOM   3932 N  N     . VAL A 1 478 ? -16.606 8.366   17.562  1.00 33.72  ? 478  VAL A N     1 
ATOM   3933 C  CA    . VAL A 1 478 ? -15.769 9.209   18.416  1.00 32.94  ? 478  VAL A CA    1 
ATOM   3934 C  C     . VAL A 1 478 ? -14.683 9.894   17.601  1.00 33.74  ? 478  VAL A C     1 
ATOM   3935 O  O     . VAL A 1 478 ? -14.391 11.067  17.840  1.00 36.77  ? 478  VAL A O     1 
ATOM   3936 C  CB    . VAL A 1 478 ? -15.129 8.421   19.589  1.00 32.71  ? 478  VAL A CB    1 
ATOM   3937 C  CG1   . VAL A 1 478 ? -14.234 9.334   20.424  1.00 31.73  ? 478  VAL A CG1   1 
ATOM   3938 C  CG2   . VAL A 1 478 ? -16.198 7.788   20.462  1.00 27.86  ? 478  VAL A CG2   1 
ATOM   3939 N  N     . PHE A 1 479 ? -14.094 9.174   16.642  1.00 33.82  ? 479  PHE A N     1 
ATOM   3940 C  CA    . PHE A 1 479 ? -13.194 9.796   15.664  1.00 33.70  ? 479  PHE A CA    1 
ATOM   3941 C  C     . PHE A 1 479 ? -13.815 11.024  14.982  1.00 34.20  ? 479  PHE A C     1 
ATOM   3942 O  O     . PHE A 1 479 ? -13.155 12.057  14.850  1.00 35.07  ? 479  PHE A O     1 
ATOM   3943 C  CB    . PHE A 1 479 ? -12.720 8.815   14.582  1.00 33.68  ? 479  PHE A CB    1 
ATOM   3944 C  CG    . PHE A 1 479 ? -12.057 9.502   13.416  1.00 38.97  ? 479  PHE A CG    1 
ATOM   3945 C  CD1   . PHE A 1 479 ? -10.723 9.920   13.501  1.00 41.78  ? 479  PHE A CD1   1 
ATOM   3946 C  CD2   . PHE A 1 479 ? -12.777 9.795   12.259  1.00 36.37  ? 479  PHE A CD2   1 
ATOM   3947 C  CE1   . PHE A 1 479 ? -10.113 10.590  12.430  1.00 44.04  ? 479  PHE A CE1   1 
ATOM   3948 C  CE2   . PHE A 1 479 ? -12.177 10.465  11.187  1.00 37.40  ? 479  PHE A CE2   1 
ATOM   3949 C  CZ    . PHE A 1 479 ? -10.845 10.862  11.273  1.00 39.02  ? 479  PHE A CZ    1 
ATOM   3950 N  N     . ASN A 1 480 ? -15.059 10.893  14.525  1.00 34.44  ? 480  ASN A N     1 
ATOM   3951 C  CA    . ASN A 1 480 ? -15.770 12.004  13.873  1.00 37.39  ? 480  ASN A CA    1 
ATOM   3952 C  C     . ASN A 1 480 ? -15.980 13.207  14.798  1.00 37.97  ? 480  ASN A C     1 
ATOM   3953 O  O     . ASN A 1 480 ? -15.820 14.351  14.373  1.00 40.33  ? 480  ASN A O     1 
ATOM   3954 C  CB    . ASN A 1 480 ? -17.106 11.537  13.274  1.00 36.80  ? 480  ASN A CB    1 
ATOM   3955 C  CG    . ASN A 1 480 ? -16.937 10.788  11.949  1.00 38.41  ? 480  ASN A CG    1 
ATOM   3956 O  OD1   . ASN A 1 480 ? -15.955 10.978  11.227  1.00 41.04  ? 480  ASN A OD1   1 
ATOM   3957 N  ND2   . ASN A 1 480 ? -17.916 9.951   11.615  1.00 34.96  ? 480  ASN A ND2   1 
ATOM   3958 N  N     . GLN A 1 481 ? -16.339 12.941  16.056  1.00 39.09  ? 481  GLN A N     1 
ATOM   3959 C  CA    . GLN A 1 481 ? -16.421 13.976  17.091  1.00 39.27  ? 481  GLN A CA    1 
ATOM   3960 C  C     . GLN A 1 481 ? -15.073 14.678  17.262  1.00 38.06  ? 481  GLN A C     1 
ATOM   3961 O  O     . GLN A 1 481 ? -15.006 15.902  17.351  1.00 38.50  ? 481  GLN A O     1 
ATOM   3962 C  CB    . GLN A 1 481 ? -16.807 13.368  18.441  1.00 40.50  ? 481  GLN A CB    1 
ATOM   3963 C  CG    . GLN A 1 481 ? -18.191 12.750  18.528  1.00 44.15  ? 481  GLN A CG    1 
ATOM   3964 C  CD    . GLN A 1 481 ? -18.456 12.089  19.885  1.00 48.86  ? 481  GLN A CD    1 
ATOM   3965 O  OE1   . GLN A 1 481 ? -17.686 12.246  20.841  1.00 46.70  ? 481  GLN A OE1   1 
ATOM   3966 N  NE2   . GLN A 1 481 ? -19.548 11.339  19.966  1.00 53.54  ? 481  GLN A NE2   1 
ATOM   3967 N  N     . ARG A 1 482 ? -14.004 13.890  17.325  1.00 36.75  ? 482  ARG A N     1 
ATOM   3968 C  CA    . ARG A 1 482 ? -12.662 14.426  17.494  1.00 37.57  ? 482  ARG A CA    1 
ATOM   3969 C  C     . ARG A 1 482 ? -12.365 15.432  16.376  1.00 39.50  ? 482  ARG A C     1 
ATOM   3970 O  O     . ARG A 1 482 ? -11.911 16.547  16.640  1.00 39.23  ? 482  ARG A O     1 
ATOM   3971 C  CB    . ARG A 1 482 ? -11.638 13.284  17.525  1.00 35.85  ? 482  ARG A CB    1 
ATOM   3972 C  CG    . ARG A 1 482 ? -10.214 13.686  17.871  1.00 34.66  ? 482  ARG A CG    1 
ATOM   3973 C  CD    . ARG A 1 482 ? -9.349  13.781  16.633  1.00 37.17  ? 482  ARG A CD    1 
ATOM   3974 N  NE    . ARG A 1 482 ? -8.032  14.368  16.887  1.00 31.22  ? 482  ARG A NE    1 
ATOM   3975 C  CZ    . ARG A 1 482 ? -6.947  14.080  16.172  1.00 35.95  ? 482  ARG A CZ    1 
ATOM   3976 N  NH1   . ARG A 1 482 ? -7.021  13.188  15.182  1.00 37.33  ? 482  ARG A NH1   1 
ATOM   3977 N  NH2   . ARG A 1 482 ? -5.778  14.659  16.453  1.00 28.33  ? 482  ARG A NH2   1 
ATOM   3978 N  N     . LYS A 1 483 ? -12.668 15.040  15.143  1.00 39.04  ? 483  LYS A N     1 
ATOM   3979 C  CA    . LYS A 1 483 ? -12.408 15.864  13.967  1.00 42.83  ? 483  LYS A CA    1 
ATOM   3980 C  C     . LYS A 1 483 ? -13.113 17.226  14.025  1.00 42.86  ? 483  LYS A C     1 
ATOM   3981 O  O     . LYS A 1 483 ? -12.520 18.250  13.667  1.00 42.67  ? 483  LYS A O     1 
ATOM   3982 C  CB    . LYS A 1 483 ? -12.766 15.095  12.678  1.00 45.10  ? 483  LYS A CB    1 
ATOM   3983 C  CG    . LYS A 1 483 ? -12.254 15.750  11.397  1.00 50.41  ? 483  LYS A CG    1 
ATOM   3984 C  CD    . LYS A 1 483 ? -12.379 14.833  10.183  1.00 56.18  ? 483  LYS A CD    1 
ATOM   3985 C  CE    . LYS A 1 483 ? -12.187 15.628  8.891   1.00 59.87  ? 483  LYS A CE    1 
ATOM   3986 N  NZ    . LYS A 1 483 ? -12.358 14.795  7.668   1.00 63.61  ? 483  LYS A NZ    1 
ATOM   3987 N  N     . GLU A 1 484 ? -14.361 17.245  14.491  1.00 43.51  ? 484  GLU A N     1 
ATOM   3988 C  CA    . GLU A 1 484 ? -15.091 18.505  14.652  1.00 43.96  ? 484  GLU A CA    1 
ATOM   3989 C  C     . GLU A 1 484 ? -14.333 19.468  15.570  1.00 42.97  ? 484  GLU A C     1 
ATOM   3990 O  O     . GLU A 1 484 ? -14.112 20.632  15.218  1.00 44.40  ? 484  GLU A O     1 
ATOM   3991 C  CB    . GLU A 1 484 ? -16.508 18.266  15.189  1.00 46.30  ? 484  GLU A CB    1 
ATOM   3992 C  CG    . GLU A 1 484 ? -17.388 19.529  15.177  1.00 52.41  ? 484  GLU A CG    1 
ATOM   3993 C  CD    . GLU A 1 484 ? -18.666 19.407  16.015  1.00 59.09  ? 484  GLU A CD    1 
ATOM   3994 O  OE1   . GLU A 1 484 ? -18.791 18.451  16.810  1.00 61.96  ? 484  GLU A OE1   1 
ATOM   3995 O  OE2   . GLU A 1 484 ? -19.552 20.281  15.884  1.00 60.14  ? 484  GLU A OE2   1 
ATOM   3996 N  N     . HIS A 1 485 ? -13.924 18.967  16.737  1.00 40.01  ? 485  HIS A N     1 
ATOM   3997 C  CA    . HIS A 1 485 ? -13.251 19.785  17.742  1.00 36.74  ? 485  HIS A CA    1 
ATOM   3998 C  C     . HIS A 1 485 ? -11.860 20.211  17.323  1.00 35.57  ? 485  HIS A C     1 
ATOM   3999 O  O     . HIS A 1 485 ? -11.420 21.305  17.673  1.00 38.85  ? 485  HIS A O     1 
ATOM   4000 C  CB    . HIS A 1 485 ? -13.197 19.066  19.085  1.00 34.40  ? 485  HIS A CB    1 
ATOM   4001 C  CG    . HIS A 1 485 ? -14.531 18.938  19.743  1.00 37.10  ? 485  HIS A CG    1 
ATOM   4002 N  ND1   . HIS A 1 485 ? -15.160 19.999  20.356  1.00 38.81  ? 485  HIS A ND1   1 
ATOM   4003 C  CD2   . HIS A 1 485 ? -15.359 17.876  19.883  1.00 37.81  ? 485  HIS A CD2   1 
ATOM   4004 C  CE1   . HIS A 1 485 ? -16.324 19.599  20.837  1.00 39.08  ? 485  HIS A CE1   1 
ATOM   4005 N  NE2   . HIS A 1 485 ? -16.466 18.314  20.569  1.00 40.75  ? 485  HIS A NE2   1 
ATOM   4006 N  N     . LYS A 1 486 ? -11.167 19.352  16.584  1.00 35.30  ? 486  LYS A N     1 
ATOM   4007 C  CA    . LYS A 1 486 ? -9.856  19.710  16.054  1.00 35.11  ? 486  LYS A CA    1 
ATOM   4008 C  C     . LYS A 1 486 ? -9.986  20.849  15.045  1.00 33.72  ? 486  LYS A C     1 
ATOM   4009 O  O     . LYS A 1 486 ? -9.145  21.745  15.016  1.00 35.62  ? 486  LYS A O     1 
ATOM   4010 C  CB    . LYS A 1 486 ? -9.134  18.503  15.445  1.00 33.83  ? 486  LYS A CB    1 
ATOM   4011 C  CG    . LYS A 1 486 ? -7.675  18.784  15.127  1.00 36.31  ? 486  LYS A CG    1 
ATOM   4012 C  CD    . LYS A 1 486 ? -6.954  17.611  14.460  1.00 40.24  ? 486  LYS A CD    1 
ATOM   4013 C  CE    . LYS A 1 486 ? -5.574  18.075  13.963  1.00 44.37  ? 486  LYS A CE    1 
ATOM   4014 N  NZ    . LYS A 1 486 ? -4.574  16.991  13.698  1.00 45.11  ? 486  LYS A NZ    1 
ATOM   4015 N  N     . GLY A 1 487 ? -11.046 20.812  14.235  1.00 32.86  ? 487  GLY A N     1 
ATOM   4016 C  CA    . GLY A 1 487 ? -11.354 21.895  13.295  1.00 31.98  ? 487  GLY A CA    1 
ATOM   4017 C  C     . GLY A 1 487 ? -11.523 23.211  14.040  1.00 33.44  ? 487  GLY A C     1 
ATOM   4018 O  O     . GLY A 1 487 ? -10.943 24.231  13.658  1.00 34.87  ? 487  GLY A O     1 
ATOM   4019 N  N     . TYR A 1 488 ? -12.291 23.182  15.126  1.00 32.34  ? 488  TYR A N     1 
ATOM   4020 C  CA    . TYR A 1 488 ? -12.413 24.346  15.995  1.00 32.26  ? 488  TYR A CA    1 
ATOM   4021 C  C     . TYR A 1 488 ? -11.061 24.795  16.539  1.00 31.78  ? 488  TYR A C     1 
ATOM   4022 O  O     . TYR A 1 488 ? -10.772 25.988  16.547  1.00 32.00  ? 488  TYR A O     1 
ATOM   4023 C  CB    . TYR A 1 488 ? -13.388 24.106  17.150  1.00 33.59  ? 488  TYR A CB    1 
ATOM   4024 C  CG    . TYR A 1 488 ? -14.797 23.701  16.752  1.00 34.99  ? 488  TYR A CG    1 
ATOM   4025 C  CD1   . TYR A 1 488 ? -15.407 24.213  15.604  1.00 36.62  ? 488  TYR A CD1   1 
ATOM   4026 C  CD2   . TYR A 1 488 ? -15.529 22.814  17.548  1.00 38.94  ? 488  TYR A CD2   1 
ATOM   4027 C  CE1   . TYR A 1 488 ? -16.705 23.836  15.246  1.00 38.60  ? 488  TYR A CE1   1 
ATOM   4028 C  CE2   . TYR A 1 488 ? -16.825 22.435  17.207  1.00 40.28  ? 488  TYR A CE2   1 
ATOM   4029 C  CZ    . TYR A 1 488 ? -17.408 22.952  16.059  1.00 40.08  ? 488  TYR A CZ    1 
ATOM   4030 O  OH    . TYR A 1 488 ? -18.688 22.572  15.727  1.00 42.12  ? 488  TYR A OH    1 
ATOM   4031 N  N     . MET A 1 489 ? -10.226 23.848  16.969  1.00 32.95  ? 489  MET A N     1 
ATOM   4032 C  CA    . MET A 1 489 ? -8.930  24.199  17.564  1.00 32.93  ? 489  MET A CA    1 
ATOM   4033 C  C     . MET A 1 489 ? -7.968  24.836  16.571  1.00 32.02  ? 489  MET A C     1 
ATOM   4034 O  O     . MET A 1 489 ? -7.309  25.821  16.893  1.00 33.35  ? 489  MET A O     1 
ATOM   4035 C  CB    . MET A 1 489 ? -8.260  22.994  18.230  1.00 34.26  ? 489  MET A CB    1 
ATOM   4036 C  CG    . MET A 1 489 ? -6.839  23.285  18.727  1.00 34.04  ? 489  MET A CG    1 
ATOM   4037 S  SD    . MET A 1 489 ? -5.820  21.827  19.014  1.00 46.95  ? 489  MET A SD    1 
ATOM   4038 C  CE    . MET A 1 489 ? -5.381  21.360  17.337  1.00 40.14  ? 489  MET A CE    1 
ATOM   4039 N  N     . LEU A 1 490 ? -7.872  24.266  15.376  1.00 33.52  ? 490  LEU A N     1 
ATOM   4040 C  CA    . LEU A 1 490 ? -6.970  24.800  14.360  1.00 34.76  ? 490  LEU A CA    1 
ATOM   4041 C  C     . LEU A 1 490 ? -7.384  26.193  13.886  1.00 34.25  ? 490  LEU A C     1 
ATOM   4042 O  O     . LEU A 1 490 ? -6.529  27.073  13.709  1.00 33.89  ? 490  LEU A O     1 
ATOM   4043 C  CB    . LEU A 1 490 ? -6.833  23.835  13.177  1.00 35.56  ? 490  LEU A CB    1 
ATOM   4044 C  CG    . LEU A 1 490 ? -6.001  22.566  13.416  1.00 38.44  ? 490  LEU A CG    1 
ATOM   4045 C  CD1   . LEU A 1 490 ? -5.959  21.711  12.157  1.00 38.82  ? 490  LEU A CD1   1 
ATOM   4046 C  CD2   . LEU A 1 490 ? -4.577  22.892  13.886  1.00 38.71  ? 490  LEU A CD2   1 
ATOM   4047 N  N     . ALA A 1 491 ? -8.688  26.390  13.689  1.00 33.31  ? 491  ALA A N     1 
ATOM   4048 C  CA    . ALA A 1 491 ? -9.219  27.702  13.291  1.00 32.66  ? 491  ALA A CA    1 
ATOM   4049 C  C     . ALA A 1 491 ? -8.927  28.770  14.348  1.00 33.45  ? 491  ALA A C     1 
ATOM   4050 O  O     . ALA A 1 491 ? -8.566  29.895  14.005  1.00 34.10  ? 491  ALA A O     1 
ATOM   4051 C  CB    . ALA A 1 491 ? -10.709 27.618  13.014  1.00 33.22  ? 491  ALA A CB    1 
ATOM   4052 N  N     . ALA A 1 492 ? -9.055  28.409  15.630  1.00 31.32  ? 492  ALA A N     1 
ATOM   4053 C  CA    . ALA A 1 492 ? -8.718  29.326  16.723  1.00 33.11  ? 492  ALA A CA    1 
ATOM   4054 C  C     . ALA A 1 492 ? -7.225  29.678  16.733  1.00 32.34  ? 492  ALA A C     1 
ATOM   4055 O  O     . ALA A 1 492 ? -6.818  30.776  17.133  1.00 33.74  ? 492  ALA A O     1 
ATOM   4056 C  CB    . ALA A 1 492 ? -9.147  28.732  18.067  1.00 31.54  ? 492  ALA A CB    1 
ATOM   4057 N  N     . GLN A 1 493 ? -6.422  28.729  16.282  1.00 31.47  ? 493  GLN A N     1 
ATOM   4058 C  CA    . GLN A 1 493 ? -4.985  28.878  16.203  1.00 34.02  ? 493  GLN A CA    1 
ATOM   4059 C  C     . GLN A 1 493 ? -4.647  29.821  15.044  1.00 35.20  ? 493  GLN A C     1 
ATOM   4060 O  O     . GLN A 1 493 ? -3.920  30.798  15.223  1.00 33.96  ? 493  GLN A O     1 
ATOM   4061 C  CB    . GLN A 1 493 ? -4.383  27.489  15.997  1.00 34.67  ? 493  GLN A CB    1 
ATOM   4062 C  CG    . GLN A 1 493 ? -2.879  27.365  16.030  1.00 37.84  ? 493  GLN A CG    1 
ATOM   4063 C  CD    . GLN A 1 493 ? -2.455  25.918  15.854  1.00 41.58  ? 493  GLN A CD    1 
ATOM   4064 O  OE1   . GLN A 1 493 ? -2.145  25.485  14.743  1.00 43.10  ? 493  GLN A OE1   1 
ATOM   4065 N  NE2   . GLN A 1 493 ? -2.491  25.150  16.940  1.00 39.19  ? 493  GLN A NE2   1 
ATOM   4066 N  N     . ARG A 1 494 ? -5.204  29.537  13.866  1.00 36.82  ? 494  ARG A N     1 
ATOM   4067 C  CA    . ARG A 1 494 ? -5.008  30.387  12.690  1.00 38.76  ? 494  ARG A CA    1 
ATOM   4068 C  C     . ARG A 1 494 ? -5.457  31.821  12.959  1.00 39.58  ? 494  ARG A C     1 
ATOM   4069 O  O     . ARG A 1 494 ? -4.794  32.766  12.532  1.00 38.81  ? 494  ARG A O     1 
ATOM   4070 C  CB    . ARG A 1 494 ? -5.749  29.830  11.473  1.00 37.35  ? 494  ARG A CB    1 
ATOM   4071 C  CG    . ARG A 1 494 ? -5.155  28.563  10.894  1.00 35.61  ? 494  ARG A CG    1 
ATOM   4072 C  CD    . ARG A 1 494 ? -5.802  28.260  9.542   1.00 38.38  ? 494  ARG A CD    1 
ATOM   4073 N  NE    . ARG A 1 494 ? -7.232  27.991  9.682   1.00 35.15  ? 494  ARG A NE    1 
ATOM   4074 C  CZ    . ARG A 1 494 ? -7.746  26.792  9.934   1.00 34.32  ? 494  ARG A CZ    1 
ATOM   4075 N  NH1   . ARG A 1 494 ? -6.953  25.738  10.063  1.00 38.58  ? 494  ARG A NH1   1 
ATOM   4076 N  NH2   . ARG A 1 494 ? -9.056  26.646  10.052  1.00 33.26  ? 494  ARG A NH2   1 
ATOM   4077 N  N     . ASN A 1 495 ? -6.576  31.963  13.674  1.00 39.26  ? 495  ASN A N     1 
ATOM   4078 C  CA    . ASN A 1 495 ? -7.101  33.266  14.083  1.00 39.96  ? 495  ASN A CA    1 
ATOM   4079 C  C     . ASN A 1 495 ? -6.163  33.992  15.027  1.00 41.61  ? 495  ASN A C     1 
ATOM   4080 O  O     . ASN A 1 495 ? -6.071  35.224  14.992  1.00 43.89  ? 495  ASN A O     1 
ATOM   4081 C  CB    . ASN A 1 495 ? -8.487  33.127  14.728  1.00 39.15  ? 495  ASN A CB    1 
ATOM   4082 C  CG    . ASN A 1 495 ? -9.582  32.843  13.706  1.00 40.94  ? 495  ASN A CG    1 
ATOM   4083 O  OD1   . ASN A 1 495 ? -9.453  33.187  12.533  1.00 43.48  ? 495  ASN A OD1   1 
ATOM   4084 N  ND2   . ASN A 1 495 ? -10.667 32.214  14.151  1.00 40.96  ? 495  ASN A ND2   1 
ATOM   4085 N  N     . GLY A 1 496 ? -5.472  33.221  15.866  1.00 41.84  ? 496  GLY A N     1 
ATOM   4086 C  CA    . GLY A 1 496 ? -4.494  33.765  16.805  1.00 40.65  ? 496  GLY A CA    1 
ATOM   4087 C  C     . GLY A 1 496 ? -3.338  34.436  16.092  1.00 42.00  ? 496  GLY A C     1 
ATOM   4088 O  O     . GLY A 1 496 ? -2.881  35.498  16.517  1.00 44.70  ? 496  GLY A O     1 
ATOM   4089 N  N     . GLU A 1 497 ? -2.880  33.824  14.999  1.00 42.37  ? 497  GLU A N     1 
ATOM   4090 C  CA    . GLU A 1 497 ? -1.757  34.348  14.217  1.00 43.37  ? 497  GLU A CA    1 
ATOM   4091 C  C     . GLU A 1 497 ? -2.122  35.642  13.491  1.00 43.76  ? 497  GLU A C     1 
ATOM   4092 O  O     . GLU A 1 497 ? -1.267  36.501  13.279  1.00 42.29  ? 497  GLU A O     1 
ATOM   4093 C  CB    . GLU A 1 497 ? -1.241  33.303  13.221  1.00 43.43  ? 497  GLU A CB    1 
ATOM   4094 C  CG    . GLU A 1 497 ? -0.688  32.019  13.858  1.00 44.08  ? 497  GLU A CG    1 
ATOM   4095 C  CD    . GLU A 1 497 ? 0.380   32.270  14.928  1.00 44.42  ? 497  GLU A CD    1 
ATOM   4096 O  OE1   . GLU A 1 497 ? 1.394   32.939  14.638  1.00 46.64  ? 497  GLU A OE1   1 
ATOM   4097 O  OE2   . GLU A 1 497 ? 0.208   31.774  16.060  1.00 44.86  ? 497  GLU A OE2   1 
ATOM   4098 N  N     . ILE A 1 498 ? -3.397  35.769  13.121  1.00 43.78  ? 498  ILE A N     1 
ATOM   4099 C  CA    . ILE A 1 498 ? -3.909  36.983  12.489  1.00 45.62  ? 498  ILE A CA    1 
ATOM   4100 C  C     . ILE A 1 498 ? -3.875  38.146  13.480  1.00 46.91  ? 498  ILE A C     1 
ATOM   4101 O  O     . ILE A 1 498 ? -3.546  39.278  13.111  1.00 48.83  ? 498  ILE A O     1 
ATOM   4102 C  CB    . ILE A 1 498 ? -5.343  36.777  11.940  1.00 45.07  ? 498  ILE A CB    1 
ATOM   4103 C  CG1   . ILE A 1 498 ? -5.319  35.818  10.749  1.00 44.19  ? 498  ILE A CG1   1 
ATOM   4104 C  CG2   . ILE A 1 498 ? -5.965  38.104  11.519  1.00 43.68  ? 498  ILE A CG2   1 
ATOM   4105 C  CD1   . ILE A 1 498 ? -6.651  35.170  10.455  1.00 45.88  ? 498  ILE A CD1   1 
ATOM   4106 N  N     . ILE A 1 499 ? -4.211  37.854  14.735  1.00 45.99  ? 499  ILE A N     1 
ATOM   4107 C  CA    . ILE A 1 499 ? -4.167  38.842  15.800  1.00 46.15  ? 499  ILE A CA    1 
ATOM   4108 C  C     . ILE A 1 499 ? -2.723  39.230  16.122  1.00 47.92  ? 499  ILE A C     1 
ATOM   4109 O  O     . ILE A 1 499 ? -2.426  40.411  16.305  1.00 48.98  ? 499  ILE A O     1 
ATOM   4110 C  CB    . ILE A 1 499 ? -4.914  38.354  17.059  1.00 46.52  ? 499  ILE A CB    1 
ATOM   4111 C  CG1   . ILE A 1 499 ? -6.402  38.151  16.739  1.00 44.27  ? 499  ILE A CG1   1 
ATOM   4112 C  CG2   . ILE A 1 499 ? -4.735  39.344  18.211  1.00 43.86  ? 499  ILE A CG2   1 
ATOM   4113 C  CD1   . ILE A 1 499 ? -7.146  37.299  17.746  1.00 42.76  ? 499  ILE A CD1   1 
ATOM   4114 N  N     . LYS A 1 500 ? -1.833  38.240  16.176  1.00 48.92  ? 500  LYS A N     1 
ATOM   4115 C  CA    . LYS A 1 500 ? -0.399  38.499  16.370  1.00 50.06  ? 500  LYS A CA    1 
ATOM   4116 C  C     . LYS A 1 500 ? 0.175   39.418  15.281  1.00 51.93  ? 500  LYS A C     1 
ATOM   4117 O  O     . LYS A 1 500 ? 0.904   40.362  15.584  1.00 52.31  ? 500  LYS A O     1 
ATOM   4118 C  CB    . LYS A 1 500 ? 0.396   37.193  16.427  1.00 48.14  ? 500  LYS A CB    1 
ATOM   4119 C  CG    . LYS A 1 500 ? 0.173   36.380  17.679  1.00 46.56  ? 500  LYS A CG    1 
ATOM   4120 C  CD    . LYS A 1 500 ? 0.974   35.098  17.651  1.00 45.28  ? 500  LYS A CD    1 
ATOM   4121 C  CE    . LYS A 1 500 ? 0.403   34.083  18.627  1.00 44.25  ? 500  LYS A CE    1 
ATOM   4122 N  NZ    . LYS A 1 500 ? 1.138   32.784  18.580  1.00 44.07  ? 500  LYS A NZ    1 
ATOM   4123 N  N     . GLU A 1 501 ? -0.170  39.140  14.024  1.00 53.28  ? 501  GLU A N     1 
ATOM   4124 C  CA    . GLU A 1 501 ? 0.253   39.974  12.895  1.00 56.32  ? 501  GLU A CA    1 
ATOM   4125 C  C     . GLU A 1 501 ? -0.204  41.421  13.050  1.00 56.88  ? 501  GLU A C     1 
ATOM   4126 O  O     . GLU A 1 501 ? 0.576   42.344  12.831  1.00 57.41  ? 501  GLU A O     1 
ATOM   4127 C  CB    . GLU A 1 501 ? -0.245  39.400  11.562  1.00 57.11  ? 501  GLU A CB    1 
ATOM   4128 C  CG    . GLU A 1 501 ? 0.635   38.286  10.963  1.00 62.00  ? 501  GLU A CG    1 
ATOM   4129 C  CD    . GLU A 1 501 ? 1.950   38.791  10.355  1.00 67.67  ? 501  GLU A CD    1 
ATOM   4130 O  OE1   . GLU A 1 501 ? 2.171   40.026  10.296  1.00 68.72  ? 501  GLU A OE1   1 
ATOM   4131 O  OE2   . GLU A 1 501 ? 2.766   37.942  9.931   1.00 69.37  ? 501  GLU A OE2   1 
ATOM   4132 N  N     . ALA A 1 502 ? -1.460  41.604  13.449  1.00 57.04  ? 502  ALA A N     1 
ATOM   4133 C  CA    . ALA A 1 502 ? -2.030  42.931  13.647  1.00 59.00  ? 502  ALA A CA    1 
ATOM   4134 C  C     . ALA A 1 502 ? -1.386  43.695  14.808  1.00 61.84  ? 502  ALA A C     1 
ATOM   4135 O  O     . ALA A 1 502 ? -1.358  44.928  14.803  1.00 63.79  ? 502  ALA A O     1 
ATOM   4136 C  CB    . ALA A 1 502 ? -3.529  42.837  13.841  1.00 57.88  ? 502  ALA A CB    1 
ATOM   4137 N  N     . LEU A 1 503 ? -0.859  42.965  15.790  1.00 63.30  ? 503  LEU A N     1 
ATOM   4138 C  CA    . LEU A 1 503 ? -0.221  43.582  16.957  1.00 64.64  ? 503  LEU A CA    1 
ATOM   4139 C  C     . LEU A 1 503 ? 1.080   44.323  16.640  1.00 67.49  ? 503  LEU A C     1 
ATOM   4140 O  O     . LEU A 1 503 ? 1.553   45.120  17.457  1.00 68.72  ? 503  LEU A O     1 
ATOM   4141 C  CB    . LEU A 1 503 ? 0.013   42.546  18.060  1.00 62.74  ? 503  LEU A CB    1 
ATOM   4142 C  CG    . LEU A 1 503 ? -1.146  42.333  19.032  1.00 60.07  ? 503  LEU A CG    1 
ATOM   4143 C  CD1   . LEU A 1 503 ? -1.066  40.954  19.667  1.00 59.85  ? 503  LEU A CD1   1 
ATOM   4144 C  CD2   . LEU A 1 503 ? -1.170  43.426  20.096  1.00 60.24  ? 503  LEU A CD2   1 
ATOM   4145 N  N     . HIS A 1 504 ? 1.648   44.063  15.463  1.00 69.08  ? 504  HIS A N     1 
ATOM   4146 C  CA    . HIS A 1 504 ? 2.856   44.755  15.020  1.00 72.00  ? 504  HIS A CA    1 
ATOM   4147 C  C     . HIS A 1 504 ? 2.544   46.177  14.577  1.00 73.18  ? 504  HIS A C     1 
ATOM   4148 O  O     . HIS A 1 504 ? 3.428   47.036  14.561  1.00 75.21  ? 504  HIS A O     1 
ATOM   4149 C  CB    . HIS A 1 504 ? 3.557   43.984  13.902  1.00 72.93  ? 504  HIS A CB    1 
ATOM   4150 C  CG    . HIS A 1 504 ? 3.913   42.577  14.272  1.00 74.89  ? 504  HIS A CG    1 
ATOM   4151 N  ND1   . HIS A 1 504 ? 4.388   42.233  15.520  1.00 76.23  ? 504  HIS A ND1   1 
ATOM   4152 C  CD2   . HIS A 1 504 ? 3.874   41.430  13.555  1.00 74.98  ? 504  HIS A CD2   1 
ATOM   4153 C  CE1   . HIS A 1 504 ? 4.615   40.932  15.559  1.00 76.90  ? 504  HIS A CE1   1 
ATOM   4154 N  NE2   . HIS A 1 504 ? 4.313   40.422  14.379  1.00 76.29  ? 504  HIS A NE2   1 
ATOM   4155 N  N     . ASN A 1 505 ? 1.281   46.415  14.228  1.00 72.76  ? 505  ASN A N     1 
ATOM   4156 C  CA    . ASN A 1 505 ? 0.794   47.749  13.877  1.00 73.47  ? 505  ASN A CA    1 
ATOM   4157 C  C     . ASN A 1 505 ? -0.489  48.117  14.630  1.00 72.07  ? 505  ASN A C     1 
ATOM   4158 O  O     . ASN A 1 505 ? -1.550  48.257  14.010  1.00 70.76  ? 505  ASN A O     1 
ATOM   4159 C  CB    . ASN A 1 505 ? 0.570   47.862  12.361  1.00 74.56  ? 505  ASN A CB    1 
ATOM   4160 C  CG    . ASN A 1 505 ? 1.864   47.806  11.570  1.00 78.06  ? 505  ASN A CG    1 
ATOM   4161 O  OD1   . ASN A 1 505 ? 2.066   46.905  10.752  1.00 79.29  ? 505  ASN A OD1   1 
ATOM   4162 N  ND2   . ASN A 1 505 ? 2.752   48.768  11.813  1.00 79.50  ? 505  ASN A ND2   1 
ATOM   4163 N  N     . PRO A 1 506 ? -0.400  48.283  15.968  1.00 71.87  ? 506  PRO A N     1 
ATOM   4164 C  CA    . PRO A 1 506 ? -1.603  48.613  16.728  1.00 71.80  ? 506  PRO A CA    1 
ATOM   4165 C  C     . PRO A 1 506 ? -2.018  50.061  16.513  1.00 72.86  ? 506  PRO A C     1 
ATOM   4166 O  O     . PRO A 1 506 ? -1.166  50.929  16.323  1.00 74.95  ? 506  PRO A O     1 
ATOM   4167 C  CB    . PRO A 1 506 ? -1.174  48.391  18.180  1.00 71.49  ? 506  PRO A CB    1 
ATOM   4168 C  CG    . PRO A 1 506 ? 0.286   48.657  18.185  1.00 72.74  ? 506  PRO A CG    1 
ATOM   4169 C  CD    . PRO A 1 506 ? 0.800   48.246  16.827  1.00 73.11  ? 506  PRO A CD    1 
ATOM   4170 N  N     . ASN A 1 507 ? -3.321  50.310  16.527  1.00 73.82  ? 507  ASN A N     1 
ATOM   4171 C  CA    . ASN A 1 507 ? -3.840  51.665  16.408  1.00 75.88  ? 507  ASN A CA    1 
ATOM   4172 C  C     . ASN A 1 507 ? -3.907  52.333  17.773  1.00 78.50  ? 507  ASN A C     1 
ATOM   4173 O  O     . ASN A 1 507 ? -3.901  51.656  18.804  1.00 79.24  ? 507  ASN A O     1 
ATOM   4174 C  CB    . ASN A 1 507 ? -5.208  51.661  15.727  1.00 74.63  ? 507  ASN A CB    1 
ATOM   4175 C  CG    . ASN A 1 507 ? -5.160  51.058  14.336  1.00 73.00  ? 507  ASN A CG    1 
ATOM   4176 O  OD1   . ASN A 1 507 ? -4.718  49.920  14.148  1.00 69.14  ? 507  ASN A OD1   1 
ATOM   4177 N  ND2   . ASN A 1 507 ? -5.617  51.820  13.350  1.00 72.31  ? 507  ASN A ND2   1 
ATOM   4178 N  N     . LEU A 1 508 ? -3.948  53.662  17.780  1.00 80.89  ? 508  LEU A N     1 
ATOM   4179 C  CA    . LEU A 1 508 ? -3.926  54.413  19.031  1.00 83.18  ? 508  LEU A CA    1 
ATOM   4180 C  C     . LEU A 1 508 ? -5.307  54.986  19.316  1.00 83.65  ? 508  LEU A C     1 
ATOM   4181 O  O     . LEU A 1 508 ? -5.633  56.098  18.895  1.00 85.36  ? 508  LEU A O     1 
ATOM   4182 C  CB    . LEU A 1 508 ? -2.842  55.501  18.998  1.00 84.60  ? 508  LEU A CB    1 
ATOM   4183 C  CG    . LEU A 1 508 ? -1.395  55.023  18.792  1.00 86.50  ? 508  LEU A CG    1 
ATOM   4184 C  CD1   . LEU A 1 508 ? -0.480  56.175  18.386  1.00 88.67  ? 508  LEU A CD1   1 
ATOM   4185 C  CD2   . LEU A 1 508 ? -0.844  54.308  20.032  1.00 88.08  ? 508  LEU A CD2   1 
ATOM   4186 N  N     . SER A 1 509 ? -6.118  54.201  20.023  1.00 83.38  ? 509  SER A N     1 
ATOM   4187 C  CA    . SER A 1 509 ? -7.517  54.538  20.271  1.00 83.85  ? 509  SER A CA    1 
ATOM   4188 C  C     . SER A 1 509 ? -8.086  53.823  21.497  1.00 84.31  ? 509  SER A C     1 
ATOM   4189 O  O     . SER A 1 509 ? -7.428  52.970  22.100  1.00 84.57  ? 509  SER A O     1 
ATOM   4190 C  CB    . SER A 1 509 ? -8.368  54.201  19.041  1.00 83.07  ? 509  SER A CB    1 
ATOM   4191 O  OG    . SER A 1 509 ? -8.348  52.808  18.779  1.00 83.43  ? 509  SER A OG    1 
ATOM   4192 N  N     . VAL A 1 510 ? -9.312  54.195  21.861  1.00 84.64  ? 510  VAL A N     1 
ATOM   4193 C  CA    . VAL A 1 510 ? -10.076 53.491  22.883  1.00 84.32  ? 510  VAL A CA    1 
ATOM   4194 C  C     . VAL A 1 510 ? -11.215 52.747  22.190  1.00 82.95  ? 510  VAL A C     1 
ATOM   4195 O  O     . VAL A 1 510 ? -12.073 53.359  21.542  1.00 83.23  ? 510  VAL A O     1 
ATOM   4196 C  CB    . VAL A 1 510 ? -10.615 54.448  23.981  1.00 85.97  ? 510  VAL A CB    1 
ATOM   4197 C  CG1   . VAL A 1 510 ? -11.570 53.717  24.927  1.00 87.05  ? 510  VAL A CG1   1 
ATOM   4198 C  CG2   . VAL A 1 510 ? -9.462  55.064  24.765  1.00 86.60  ? 510  VAL A CG2   1 
ATOM   4199 N  N     . ASP A 1 511 ? -11.197 51.423  22.317  1.00 80.64  ? 511  ASP A N     1 
ATOM   4200 C  CA    . ASP A 1 511 ? -12.169 50.559  21.655  1.00 78.06  ? 511  ASP A CA    1 
ATOM   4201 C  C     . ASP A 1 511 ? -12.379 49.269  22.443  1.00 76.55  ? 511  ASP A C     1 
ATOM   4202 O  O     . ASP A 1 511 ? -11.743 49.047  23.477  1.00 76.37  ? 511  ASP A O     1 
ATOM   4203 C  CB    . ASP A 1 511 ? -11.718 50.247  20.222  1.00 76.62  ? 511  ASP A CB    1 
ATOM   4204 C  CG    . ASP A 1 511 ? -10.234 49.918  20.131  1.00 74.65  ? 511  ASP A CG    1 
ATOM   4205 O  OD1   . ASP A 1 511 ? -9.701  49.252  21.042  1.00 73.02  ? 511  ASP A OD1   1 
ATOM   4206 O  OD2   . ASP A 1 511 ? -9.598  50.331  19.141  1.00 75.00  ? 511  ASP A OD2   1 
ATOM   4207 N  N     . GLU A 1 512 ? -13.283 48.430  21.946  1.00 74.50  ? 512  GLU A N     1 
ATOM   4208 C  CA    . GLU A 1 512 ? -13.566 47.135  22.551  1.00 72.08  ? 512  GLU A CA    1 
ATOM   4209 C  C     . GLU A 1 512 ? -13.082 46.002  21.641  1.00 69.07  ? 512  GLU A C     1 
ATOM   4210 O  O     . GLU A 1 512 ? -12.945 46.200  20.431  1.00 68.05  ? 512  GLU A O     1 
ATOM   4211 C  CB    . GLU A 1 512 ? -15.070 46.987  22.827  1.00 73.06  ? 512  GLU A CB    1 
ATOM   4212 C  CG    . GLU A 1 512 ? -15.639 47.942  23.886  1.00 76.43  ? 512  GLU A CG    1 
ATOM   4213 C  CD    . GLU A 1 512 ? -15.154 47.647  25.309  1.00 78.67  ? 512  GLU A CD    1 
ATOM   4214 O  OE1   . GLU A 1 512 ? -15.205 48.571  26.149  1.00 78.89  ? 512  GLU A OE1   1 
ATOM   4215 O  OE2   . GLU A 1 512 ? -14.727 46.504  25.592  1.00 76.92  ? 512  GLU A OE2   1 
ATOM   4216 N  N     . PRO A 1 513 ? -12.796 44.818  22.223  1.00 67.45  ? 513  PRO A N     1 
ATOM   4217 C  CA    . PRO A 1 513 ? -12.559 43.624  21.416  1.00 65.35  ? 513  PRO A CA    1 
ATOM   4218 C  C     . PRO A 1 513 ? -13.820 43.218  20.648  1.00 65.54  ? 513  PRO A C     1 
ATOM   4219 O  O     . PRO A 1 513 ? -14.936 43.430  21.134  1.00 66.78  ? 513  PRO A O     1 
ATOM   4220 C  CB    . PRO A 1 513 ? -12.209 42.560  22.461  1.00 64.55  ? 513  PRO A CB    1 
ATOM   4221 C  CG    . PRO A 1 513 ? -12.741 43.082  23.742  1.00 65.88  ? 513  PRO A CG    1 
ATOM   4222 C  CD    . PRO A 1 513 ? -12.572 44.553  23.654  1.00 66.97  ? 513  PRO A CD    1 
ATOM   4223 N  N     . LEU A 1 514 ? -13.635 42.657  19.456  1.00 63.87  ? 514  LEU A N     1 
ATOM   4224 C  CA    . LEU A 1 514 ? -14.744 42.215  18.614  1.00 63.49  ? 514  LEU A CA    1 
ATOM   4225 C  C     . LEU A 1 514 ? -15.421 40.985  19.201  1.00 62.08  ? 514  LEU A C     1 
ATOM   4226 O  O     . LEU A 1 514 ? -14.753 40.031  19.581  1.00 61.64  ? 514  LEU A O     1 
ATOM   4227 C  CB    . LEU A 1 514 ? -14.239 41.890  17.204  1.00 63.70  ? 514  LEU A CB    1 
ATOM   4228 C  CG    . LEU A 1 514 ? -14.291 42.901  16.052  1.00 64.97  ? 514  LEU A CG    1 
ATOM   4229 C  CD1   . LEU A 1 514 ? -13.977 44.341  16.461  1.00 66.55  ? 514  LEU A CD1   1 
ATOM   4230 C  CD2   . LEU A 1 514 ? -13.346 42.439  14.957  1.00 65.73  ? 514  LEU A CD2   1 
ATOM   4231 N  N     . ASP A 1 515 ? -16.748 41.011  19.270  1.00 62.07  ? 515  ASP A N     1 
ATOM   4232 C  CA    . ASP A 1 515 ? -17.507 39.852  19.717  1.00 62.27  ? 515  ASP A CA    1 
ATOM   4233 C  C     . ASP A 1 515 ? -17.584 38.840  18.579  1.00 59.84  ? 515  ASP A C     1 
ATOM   4234 O  O     . ASP A 1 515 ? -18.454 38.929  17.706  1.00 60.61  ? 515  ASP A O     1 
ATOM   4235 C  CB    . ASP A 1 515 ? -18.906 40.265  20.185  1.00 66.14  ? 515  ASP A CB    1 
ATOM   4236 C  CG    . ASP A 1 515 ? -19.721 39.092  20.713  1.00 69.91  ? 515  ASP A CG    1 
ATOM   4237 O  OD1   . ASP A 1 515 ? -20.954 39.095  20.505  1.00 72.39  ? 515  ASP A OD1   1 
ATOM   4238 O  OD2   . ASP A 1 515 ? -19.136 38.173  21.333  1.00 69.82  ? 515  ASP A OD2   1 
ATOM   4239 N  N     . VAL A 1 516 ? -16.652 37.889  18.594  1.00 55.45  ? 516  VAL A N     1 
ATOM   4240 C  CA    . VAL A 1 516 ? -16.502 36.912  17.522  1.00 50.73  ? 516  VAL A CA    1 
ATOM   4241 C  C     . VAL A 1 516 ? -16.457 35.474  18.047  1.00 49.67  ? 516  VAL A C     1 
ATOM   4242 O  O     . VAL A 1 516 ? -16.130 35.230  19.214  1.00 47.72  ? 516  VAL A O     1 
ATOM   4243 C  CB    . VAL A 1 516 ? -15.219 37.182  16.680  1.00 51.00  ? 516  VAL A CB    1 
ATOM   4244 C  CG1   . VAL A 1 516 ? -15.371 38.442  15.836  1.00 51.66  ? 516  VAL A CG1   1 
ATOM   4245 C  CG2   . VAL A 1 516 ? -13.985 37.282  17.572  1.00 48.38  ? 516  VAL A CG2   1 
ATOM   4246 N  N     . ASP A 1 517 ? -16.781 34.524  17.174  1.00 47.79  ? 517  ASP A N     1 
ATOM   4247 C  CA    . ASP A 1 517 ? -16.637 33.115  17.499  1.00 45.34  ? 517  ASP A CA    1 
ATOM   4248 C  C     . ASP A 1 517 ? -15.273 32.627  16.993  1.00 43.82  ? 517  ASP A C     1 
ATOM   4249 O  O     . ASP A 1 517 ? -15.083 32.383  15.798  1.00 43.53  ? 517  ASP A O     1 
ATOM   4250 C  CB    . ASP A 1 517 ? -17.796 32.297  16.911  1.00 44.30  ? 517  ASP A CB    1 
ATOM   4251 C  CG    . ASP A 1 517 ? -17.826 30.859  17.424  1.00 42.36  ? 517  ASP A CG    1 
ATOM   4252 O  OD1   . ASP A 1 517 ? -18.928 30.279  17.488  1.00 43.45  ? 517  ASP A OD1   1 
ATOM   4253 O  OD2   . ASP A 1 517 ? -16.757 30.301  17.759  1.00 36.80  ? 517  ASP A OD2   1 
ATOM   4254 N  N     . TYR A 1 518 ? -14.329 32.481  17.917  1.00 40.15  ? 518  TYR A N     1 
ATOM   4255 C  CA    . TYR A 1 518 ? -12.959 32.105  17.568  1.00 39.71  ? 518  TYR A CA    1 
ATOM   4256 C  C     . TYR A 1 518 ? -12.794 30.694  16.975  1.00 38.49  ? 518  TYR A C     1 
ATOM   4257 O  O     . TYR A 1 518 ? -11.722 30.366  16.471  1.00 37.70  ? 518  TYR A O     1 
ATOM   4258 C  CB    . TYR A 1 518 ? -12.033 32.297  18.770  1.00 38.38  ? 518  TYR A CB    1 
ATOM   4259 C  CG    . TYR A 1 518 ? -11.953 33.724  19.250  1.00 37.73  ? 518  TYR A CG    1 
ATOM   4260 C  CD1   . TYR A 1 518 ? -12.793 34.185  20.255  1.00 39.32  ? 518  TYR A CD1   1 
ATOM   4261 C  CD2   . TYR A 1 518 ? -11.039 34.616  18.694  1.00 38.15  ? 518  TYR A CD2   1 
ATOM   4262 C  CE1   . TYR A 1 518 ? -12.730 35.505  20.696  1.00 41.32  ? 518  TYR A CE1   1 
ATOM   4263 C  CE2   . TYR A 1 518 ? -10.962 35.932  19.131  1.00 36.23  ? 518  TYR A CE2   1 
ATOM   4264 C  CZ    . TYR A 1 518 ? -11.810 36.370  20.130  1.00 38.72  ? 518  TYR A CZ    1 
ATOM   4265 O  OH    . TYR A 1 518 ? -11.748 37.678  20.568  1.00 44.38  ? 518  TYR A OH    1 
ATOM   4266 N  N     . ARG A 1 519 ? -13.854 29.886  17.016  1.00 37.35  ? 519  ARG A N     1 
ATOM   4267 C  CA    . ARG A 1 519 ? -13.838 28.533  16.451  1.00 39.64  ? 519  ARG A CA    1 
ATOM   4268 C  C     . ARG A 1 519 ? -13.927 28.521  14.923  1.00 40.59  ? 519  ARG A C     1 
ATOM   4269 O  O     . ARG A 1 519 ? -13.755 27.471  14.298  1.00 42.57  ? 519  ARG A O     1 
ATOM   4270 C  CB    . ARG A 1 519 ? -14.982 27.685  17.027  1.00 40.97  ? 519  ARG A CB    1 
ATOM   4271 C  CG    . ARG A 1 519 ? -15.002 27.549  18.556  1.00 42.08  ? 519  ARG A CG    1 
ATOM   4272 C  CD    . ARG A 1 519 ? -16.235 26.777  19.022  1.00 44.96  ? 519  ARG A CD    1 
ATOM   4273 N  NE    . ARG A 1 519 ? -17.476 27.517  18.778  1.00 45.41  ? 519  ARG A NE    1 
ATOM   4274 C  CZ    . ARG A 1 519 ? -18.702 26.994  18.821  1.00 46.02  ? 519  ARG A CZ    1 
ATOM   4275 N  NH1   . ARG A 1 519 ? -18.885 25.704  19.095  1.00 38.45  ? 519  ARG A NH1   1 
ATOM   4276 N  NH2   . ARG A 1 519 ? -19.751 27.770  18.582  1.00 43.30  ? 519  ARG A NH2   1 
ATOM   4277 N  N     . PHE A 1 520 ? -14.212 29.677  14.327  1.00 40.71  ? 520  PHE A N     1 
ATOM   4278 C  CA    . PHE A 1 520 ? -14.367 29.784  12.875  1.00 42.56  ? 520  PHE A CA    1 
ATOM   4279 C  C     . PHE A 1 520 ? -13.420 30.827  12.310  1.00 42.40  ? 520  PHE A C     1 
ATOM   4280 O  O     . PHE A 1 520 ? -13.176 31.859  12.940  1.00 42.43  ? 520  PHE A O     1 
ATOM   4281 C  CB    . PHE A 1 520 ? -15.822 30.090  12.501  1.00 43.40  ? 520  PHE A CB    1 
ATOM   4282 C  CG    . PHE A 1 520 ? -16.798 29.053  13.001  1.00 46.83  ? 520  PHE A CG    1 
ATOM   4283 C  CD1   . PHE A 1 520 ? -17.051 27.897  12.257  1.00 46.18  ? 520  PHE A CD1   1 
ATOM   4284 C  CD2   . PHE A 1 520 ? -17.435 29.210  14.232  1.00 43.38  ? 520  PHE A CD2   1 
ATOM   4285 C  CE1   . PHE A 1 520 ? -17.938 26.924  12.726  1.00 46.56  ? 520  PHE A CE1   1 
ATOM   4286 C  CE2   . PHE A 1 520 ? -18.322 28.243  14.708  1.00 43.15  ? 520  PHE A CE2   1 
ATOM   4287 C  CZ    . PHE A 1 520 ? -18.575 27.099  13.954  1.00 43.43  ? 520  PHE A CZ    1 
ATOM   4288 N  N     . ASP A 1 521 ? -12.866 30.537  11.136  1.00 42.16  ? 521  ASP A N     1 
ATOM   4289 C  CA    . ASP A 1 521 ? -11.919 31.436  10.477  1.00 42.14  ? 521  ASP A CA    1 
ATOM   4290 C  C     . ASP A 1 521 ? -12.511 32.831  10.343  1.00 41.57  ? 521  ASP A C     1 
ATOM   4291 O  O     . ASP A 1 521 ? -13.671 32.987  9.958   1.00 43.63  ? 521  ASP A O     1 
ATOM   4292 C  CB    . ASP A 1 521 ? -11.498 30.864  9.118   1.00 43.99  ? 521  ASP A CB    1 
ATOM   4293 C  CG    . ASP A 1 521 ? -10.487 29.730  9.260   1.00 46.67  ? 521  ASP A CG    1 
ATOM   4294 O  OD1   . ASP A 1 521 ? -9.289  30.028  9.461   1.00 49.22  ? 521  ASP A OD1   1 
ATOM   4295 O  OD2   . ASP A 1 521 ? -10.885 28.547  9.190   1.00 45.41  ? 521  ASP A OD2   1 
ATOM   4296 N  N     . PHE A 1 522 ? -11.738 33.845  10.708  1.00 40.02  ? 522  PHE A N     1 
ATOM   4297 C  CA    . PHE A 1 522 ? -12.247 35.207  10.626  1.00 41.20  ? 522  PHE A CA    1 
ATOM   4298 C  C     . PHE A 1 522 ? -12.621 35.545  9.193   1.00 42.49  ? 522  PHE A C     1 
ATOM   4299 O  O     . PHE A 1 522 ? -11.904 35.193  8.256   1.00 42.61  ? 522  PHE A O     1 
ATOM   4300 C  CB    . PHE A 1 522 ? -11.233 36.230  11.142  1.00 39.46  ? 522  PHE A CB    1 
ATOM   4301 C  CG    . PHE A 1 522 ? -11.005 36.173  12.626  1.00 39.73  ? 522  PHE A CG    1 
ATOM   4302 C  CD1   . PHE A 1 522 ? -11.998 35.713  13.488  1.00 38.72  ? 522  PHE A CD1   1 
ATOM   4303 C  CD2   . PHE A 1 522 ? -9.803  36.612  13.167  1.00 35.68  ? 522  PHE A CD2   1 
ATOM   4304 C  CE1   . PHE A 1 522 ? -11.774 35.663  14.863  1.00 39.99  ? 522  PHE A CE1   1 
ATOM   4305 C  CE2   . PHE A 1 522 ? -9.577  36.577  14.538  1.00 36.62  ? 522  PHE A CE2   1 
ATOM   4306 C  CZ    . PHE A 1 522 ? -10.558 36.101  15.388  1.00 36.66  ? 522  PHE A CZ    1 
ATOM   4307 N  N     . SER A 1 523 ? -13.756 36.217  9.039   1.00 43.82  ? 523  SER A N     1 
ATOM   4308 C  CA    . SER A 1 523 ? -14.165 36.776  7.760   1.00 45.82  ? 523  SER A CA    1 
ATOM   4309 C  C     . SER A 1 523 ? -13.255 37.954  7.377   1.00 46.95  ? 523  SER A C     1 
ATOM   4310 O  O     . SER A 1 523 ? -12.442 38.414  8.179   1.00 47.55  ? 523  SER A O     1 
ATOM   4311 C  CB    . SER A 1 523 ? -15.618 37.251  7.851   1.00 44.97  ? 523  SER A CB    1 
ATOM   4312 O  OG    . SER A 1 523 ? -15.713 38.362  8.726   1.00 45.16  ? 523  SER A OG    1 
ATOM   4313 N  N     . ASP A 1 524 ? -13.407 38.445  6.155   1.00 50.52  ? 524  ASP A N     1 
ATOM   4314 C  CA    . ASP A 1 524 ? -12.685 39.634  5.718   1.00 52.59  ? 524  ASP A CA    1 
ATOM   4315 C  C     . ASP A 1 524 ? -13.101 40.887  6.502   1.00 53.21  ? 524  ASP A C     1 
ATOM   4316 O  O     . ASP A 1 524 ? -12.256 41.726  6.828   1.00 52.41  ? 524  ASP A O     1 
ATOM   4317 C  CB    . ASP A 1 524 ? -12.861 39.835  4.212   1.00 54.49  ? 524  ASP A CB    1 
ATOM   4318 C  CG    . ASP A 1 524 ? -12.178 38.745  3.394   1.00 56.66  ? 524  ASP A CG    1 
ATOM   4319 O  OD1   . ASP A 1 524 ? -11.377 37.967  3.957   1.00 57.40  ? 524  ASP A OD1   1 
ATOM   4320 O  OD2   . ASP A 1 524 ? -12.442 38.665  2.179   1.00 61.64  ? 524  ASP A OD2   1 
ATOM   4321 N  N     . GLU A 1 525 ? -14.392 40.994  6.818   1.00 54.36  ? 525  GLU A N     1 
ATOM   4322 C  CA    . GLU A 1 525 ? -14.917 42.114  7.609   1.00 56.93  ? 525  GLU A CA    1 
ATOM   4323 C  C     . GLU A 1 525 ? -14.274 42.167  8.995   1.00 55.99  ? 525  GLU A C     1 
ATOM   4324 O  O     . GLU A 1 525 ? -13.905 43.246  9.476   1.00 55.81  ? 525  GLU A O     1 
ATOM   4325 C  CB    . GLU A 1 525 ? -16.437 42.019  7.742   1.00 59.22  ? 525  GLU A CB    1 
ATOM   4326 C  CG    . GLU A 1 525 ? -17.079 43.211  8.442   1.00 66.04  ? 525  GLU A CG    1 
ATOM   4327 C  CD    . GLU A 1 525 ? -18.568 43.024  8.710   1.00 72.06  ? 525  GLU A CD    1 
ATOM   4328 O  OE1   . GLU A 1 525 ? -19.058 41.871  8.712   1.00 72.62  ? 525  GLU A OE1   1 
ATOM   4329 O  OE2   . GLU A 1 525 ? -19.253 44.046  8.929   1.00 76.01  ? 525  GLU A OE2   1 
ATOM   4330 N  N     . ILE A 1 526 ? -14.149 40.999  9.625   1.00 54.25  ? 526  ILE A N     1 
ATOM   4331 C  CA    . ILE A 1 526 ? -13.501 40.881  10.927  1.00 52.90  ? 526  ILE A CA    1 
ATOM   4332 C  C     . ILE A 1 526 ? -12.009 41.210  10.817  1.00 52.90  ? 526  ILE A C     1 
ATOM   4333 O  O     . ILE A 1 526 ? -11.467 41.951  11.643  1.00 52.03  ? 526  ILE A O     1 
ATOM   4334 C  CB    . ILE A 1 526 ? -13.717 39.478  11.539  1.00 52.54  ? 526  ILE A CB    1 
ATOM   4335 C  CG1   . ILE A 1 526 ? -15.192 39.293  11.913  1.00 51.56  ? 526  ILE A CG1   1 
ATOM   4336 C  CG2   . ILE A 1 526 ? -12.814 39.268  12.759  1.00 50.22  ? 526  ILE A CG2   1 
ATOM   4337 C  CD1   . ILE A 1 526 ? -15.620 37.843  12.079  1.00 51.33  ? 526  ILE A CD1   1 
ATOM   4338 N  N     . LYS A 1 527 ? -11.363 40.672  9.784   1.00 53.02  ? 527  LYS A N     1 
ATOM   4339 C  CA    . LYS A 1 527 ? -9.947  40.931  9.535   1.00 55.18  ? 527  LYS A CA    1 
ATOM   4340 C  C     . LYS A 1 527 ? -9.617  42.423  9.405   1.00 57.75  ? 527  LYS A C     1 
ATOM   4341 O  O     . LYS A 1 527 ? -8.629  42.889  9.976   1.00 58.04  ? 527  LYS A O     1 
ATOM   4342 C  CB    . LYS A 1 527 ? -9.465  40.159  8.304   1.00 55.56  ? 527  LYS A CB    1 
ATOM   4343 C  CG    . LYS A 1 527 ? -8.876  38.797  8.636   1.00 55.24  ? 527  LYS A CG    1 
ATOM   4344 C  CD    . LYS A 1 527 ? -8.369  38.065  7.398   1.00 54.58  ? 527  LYS A CD    1 
ATOM   4345 C  CE    . LYS A 1 527 ? -9.374  37.031  6.923   1.00 53.83  ? 527  LYS A CE    1 
ATOM   4346 N  NZ    . LYS A 1 527 ? -8.753  36.069  5.980   1.00 53.62  ? 527  LYS A NZ    1 
ATOM   4347 N  N     . GLU A 1 528 ? -10.447 43.162  8.669   1.00 59.80  ? 528  GLU A N     1 
ATOM   4348 C  CA    . GLU A 1 528 ? -10.237 44.598  8.467   1.00 61.82  ? 528  GLU A CA    1 
ATOM   4349 C  C     . GLU A 1 528 ? -10.397 45.384  9.763   1.00 60.95  ? 528  GLU A C     1 
ATOM   4350 O  O     . GLU A 1 528 ? -9.609  46.290  10.038  1.00 61.04  ? 528  GLU A O     1 
ATOM   4351 C  CB    . GLU A 1 528 ? -11.179 45.159  7.391   1.00 64.13  ? 528  GLU A CB    1 
ATOM   4352 C  CG    . GLU A 1 528 ? -11.027 44.523  6.009   1.00 67.50  ? 528  GLU A CG    1 
ATOM   4353 C  CD    . GLU A 1 528 ? -9.648  44.729  5.410   1.00 70.13  ? 528  GLU A CD    1 
ATOM   4354 O  OE1   . GLU A 1 528 ? -8.831  43.782  5.470   1.00 70.33  ? 528  GLU A OE1   1 
ATOM   4355 O  OE2   . GLU A 1 528 ? -9.384  45.837  4.889   1.00 69.11  ? 528  GLU A OE2   1 
ATOM   4356 N  N     . LYS A 1 529 ? -11.415 45.031  10.549  1.00 59.96  ? 529  LYS A N     1 
ATOM   4357 C  CA    . LYS A 1 529 ? -11.676 45.685  11.829  1.00 59.53  ? 529  LYS A CA    1 
ATOM   4358 C  C     . LYS A 1 529 ? -10.530 45.483  12.813  1.00 58.06  ? 529  LYS A C     1 
ATOM   4359 O  O     . LYS A 1 529 ? -10.181 46.399  13.552  1.00 58.16  ? 529  LYS A O     1 
ATOM   4360 C  CB    . LYS A 1 529 ? -12.986 45.188  12.440  1.00 60.22  ? 529  LYS A CB    1 
ATOM   4361 C  CG    . LYS A 1 529 ? -14.222 45.925  11.964  1.00 62.09  ? 529  LYS A CG    1 
ATOM   4362 C  CD    . LYS A 1 529 ? -15.484 45.282  12.528  1.00 63.83  ? 529  LYS A CD    1 
ATOM   4363 C  CE    . LYS A 1 529 ? -16.730 45.715  11.768  1.00 63.12  ? 529  LYS A CE    1 
ATOM   4364 N  NZ    . LYS A 1 529 ? -17.876 44.782  11.985  1.00 63.49  ? 529  LYS A NZ    1 
ATOM   4365 N  N     . ILE A 1 530 ? -9.955  44.281  12.806  1.00 58.38  ? 530  ILE A N     1 
ATOM   4366 C  CA    . ILE A 1 530 ? -8.791  43.936  13.628  1.00 59.59  ? 530  ILE A CA    1 
ATOM   4367 C  C     . ILE A 1 530 ? -7.609  44.875  13.357  1.00 61.00  ? 530  ILE A C     1 
ATOM   4368 O  O     . ILE A 1 530 ? -6.929  45.320  14.289  1.00 60.30  ? 530  ILE A O     1 
ATOM   4369 C  CB    . ILE A 1 530 ? -8.381  42.453  13.413  1.00 59.58  ? 530  ILE A CB    1 
ATOM   4370 C  CG1   . ILE A 1 530 ? -9.289  41.523  14.218  1.00 58.61  ? 530  ILE A CG1   1 
ATOM   4371 C  CG2   . ILE A 1 530 ? -6.930  42.200  13.815  1.00 60.26  ? 530  ILE A CG2   1 
ATOM   4372 C  CD1   . ILE A 1 530 ? -9.225  40.077  13.764  1.00 59.14  ? 530  ILE A CD1   1 
ATOM   4373 N  N     . LYS A 1 531 ? -7.396  45.184  12.078  1.00 62.91  ? 531  LYS A N     1 
ATOM   4374 C  CA    . LYS A 1 531 ? -6.324  46.075  11.634  1.00 65.88  ? 531  LYS A CA    1 
ATOM   4375 C  C     . LYS A 1 531 ? -6.525  47.532  12.072  1.00 66.28  ? 531  LYS A C     1 
ATOM   4376 O  O     . LYS A 1 531 ? -5.654  48.378  11.841  1.00 67.47  ? 531  LYS A O     1 
ATOM   4377 C  CB    . LYS A 1 531 ? -6.174  46.002  10.109  1.00 67.64  ? 531  LYS A CB    1 
ATOM   4378 C  CG    . LYS A 1 531 ? -5.829  44.615  9.583   1.00 70.53  ? 531  LYS A CG    1 
ATOM   4379 C  CD    . LYS A 1 531 ? -5.479  44.659  8.109   1.00 73.55  ? 531  LYS A CD    1 
ATOM   4380 C  CE    . LYS A 1 531 ? -4.722  43.408  7.693   1.00 75.69  ? 531  LYS A CE    1 
ATOM   4381 N  NZ    . LYS A 1 531 ? -4.163  43.526  6.312   1.00 78.93  ? 531  LYS A NZ    1 
ATOM   4382 N  N     . LYS A 1 532 ? -7.658  47.816  12.709  1.00 65.03  ? 532  LYS A N     1 
ATOM   4383 C  CA    . LYS A 1 532 ? -7.964  49.164  13.189  1.00 65.08  ? 532  LYS A CA    1 
ATOM   4384 C  C     . LYS A 1 532 ? -8.085  49.214  14.712  1.00 64.81  ? 532  LYS A C     1 
ATOM   4385 O  O     . LYS A 1 532 ? -8.562  50.207  15.269  1.00 65.40  ? 532  LYS A O     1 
ATOM   4386 C  CB    . LYS A 1 532 ? -9.242  49.702  12.520  1.00 65.37  ? 532  LYS A CB    1 
ATOM   4387 C  CG    . LYS A 1 532 ? -9.090  49.955  11.021  1.00 67.84  ? 532  LYS A CG    1 
ATOM   4388 C  CD    . LYS A 1 532 ? -10.374 50.458  10.367  1.00 69.18  ? 532  LYS A CD    1 
ATOM   4389 C  CE    . LYS A 1 532 ? -10.186 50.593  8.856   1.00 71.59  ? 532  LYS A CE    1 
ATOM   4390 N  NZ    . LYS A 1 532 ? -11.369 51.186  8.160   1.00 72.59  ? 532  LYS A NZ    1 
ATOM   4391 N  N     . LEU A 1 533 ? -7.636  48.152  15.382  1.00 64.18  ? 533  LEU A N     1 
ATOM   4392 C  CA    . LEU A 1 533 ? -7.800  48.030  16.835  1.00 63.55  ? 533  LEU A CA    1 
ATOM   4393 C  C     . LEU A 1 533 ? -6.539  48.331  17.647  1.00 62.76  ? 533  LEU A C     1 
ATOM   4394 O  O     . LEU A 1 533 ? -5.415  48.147  17.174  1.00 62.72  ? 533  LEU A O     1 
ATOM   4395 C  CB    . LEU A 1 533 ? -8.363  46.648  17.212  1.00 63.11  ? 533  LEU A CB    1 
ATOM   4396 C  CG    . LEU A 1 533 ? -9.834  46.367  16.870  1.00 64.50  ? 533  LEU A CG    1 
ATOM   4397 C  CD1   . LEU A 1 533 ? -10.159 44.894  17.046  1.00 63.21  ? 533  LEU A CD1   1 
ATOM   4398 C  CD2   . LEU A 1 533 ? -10.801 47.236  17.687  1.00 66.09  ? 533  LEU A CD2   1 
ATOM   4399 N  N     . SER A 1 534 ? -6.760  48.800  18.874  1.00 62.21  ? 534  SER A N     1 
ATOM   4400 C  CA    . SER A 1 534 ? -5.701  49.093  19.835  1.00 61.33  ? 534  SER A CA    1 
ATOM   4401 C  C     . SER A 1 534 ? -5.002  47.824  20.306  1.00 61.71  ? 534  SER A C     1 
ATOM   4402 O  O     . SER A 1 534 ? -5.518  46.718  20.128  1.00 61.54  ? 534  SER A O     1 
ATOM   4403 C  CB    . SER A 1 534 ? -6.289  49.816  21.045  1.00 62.18  ? 534  SER A CB    1 
ATOM   4404 O  OG    . SER A 1 534 ? -7.240  49.001  21.710  1.00 59.54  ? 534  SER A OG    1 
ATOM   4405 N  N     . ALA A 1 535 ? -3.833  47.994  20.919  1.00 60.91  ? 535  ALA A N     1 
ATOM   4406 C  CA    . ALA A 1 535 ? -3.099  46.878  21.503  1.00 60.10  ? 535  ALA A CA    1 
ATOM   4407 C  C     . ALA A 1 535 ? -3.882  46.207  22.630  1.00 59.45  ? 535  ALA A C     1 
ATOM   4408 O  O     . ALA A 1 535 ? -3.868  44.983  22.751  1.00 59.50  ? 535  ALA A O     1 
ATOM   4409 C  CB    . ALA A 1 535 ? -1.728  47.331  21.994  1.00 61.00  ? 535  ALA A CB    1 
ATOM   4410 N  N     . LYS A 1 536 ? -4.570  47.010  23.441  1.00 59.21  ? 536  LYS A N     1 
ATOM   4411 C  CA    . LYS A 1 536 ? -5.323  46.499  24.585  1.00 58.82  ? 536  LYS A CA    1 
ATOM   4412 C  C     . LYS A 1 536 ? -6.414  45.527  24.142  1.00 56.81  ? 536  LYS A C     1 
ATOM   4413 O  O     . LYS A 1 536 ? -6.561  44.447  24.714  1.00 56.28  ? 536  LYS A O     1 
ATOM   4414 C  CB    . LYS A 1 536 ? -5.931  47.649  25.395  1.00 60.22  ? 536  LYS A CB    1 
ATOM   4415 C  CG    . LYS A 1 536 ? -6.600  47.200  26.691  1.00 63.12  ? 536  LYS A CG    1 
ATOM   4416 C  CD    . LYS A 1 536 ? -7.377  48.320  27.362  1.00 65.31  ? 536  LYS A CD    1 
ATOM   4417 C  CE    . LYS A 1 536 ? -8.177  47.780  28.537  1.00 66.89  ? 536  LYS A CE    1 
ATOM   4418 N  NZ    . LYS A 1 536 ? -9.009  48.831  29.180  1.00 72.55  ? 536  LYS A NZ    1 
ATOM   4419 N  N     . SER A 1 537 ? -7.167  45.925  23.118  1.00 55.70  ? 537  SER A N     1 
ATOM   4420 C  CA    . SER A 1 537 ? -8.237  45.108  22.562  1.00 53.23  ? 537  SER A CA    1 
ATOM   4421 C  C     . SER A 1 537 ? -7.710  43.893  21.802  1.00 50.81  ? 537  SER A C     1 
ATOM   4422 O  O     . SER A 1 537 ? -8.280  42.803  21.901  1.00 49.19  ? 537  SER A O     1 
ATOM   4423 C  CB    . SER A 1 537 ? -9.135  45.949  21.655  1.00 53.09  ? 537  SER A CB    1 
ATOM   4424 O  OG    . SER A 1 537 ? -9.836  46.917  22.411  1.00 56.21  ? 537  SER A OG    1 
ATOM   4425 N  N     . LEU A 1 538 ? -6.630  44.083  21.046  1.00 50.13  ? 538  LEU A N     1 
ATOM   4426 C  CA    . LEU A 1 538 ? -6.027  42.990  20.283  1.00 49.13  ? 538  LEU A CA    1 
ATOM   4427 C  C     . LEU A 1 538 ? -5.487  41.929  21.220  1.00 48.65  ? 538  LEU A C     1 
ATOM   4428 O  O     . LEU A 1 538 ? -5.696  40.739  20.991  1.00 47.35  ? 538  LEU A O     1 
ATOM   4429 C  CB    . LEU A 1 538 ? -4.927  43.493  19.344  1.00 49.25  ? 538  LEU A CB    1 
ATOM   4430 C  CG    . LEU A 1 538 ? -5.368  44.343  18.144  1.00 51.00  ? 538  LEU A CG    1 
ATOM   4431 C  CD1   . LEU A 1 538 ? -4.175  45.058  17.538  1.00 52.11  ? 538  LEU A CD1   1 
ATOM   4432 C  CD2   . LEU A 1 538 ? -6.100  43.526  17.085  1.00 50.12  ? 538  LEU A CD2   1 
ATOM   4433 N  N     . ASN A 1 539 ? -4.822  42.365  22.287  1.00 48.23  ? 539  ASN A N     1 
ATOM   4434 C  CA    . ASN A 1 539 ? -4.322  41.450  23.308  1.00 48.90  ? 539  ASN A CA    1 
ATOM   4435 C  C     . ASN A 1 539 ? -5.423  40.652  23.983  1.00 48.27  ? 539  ASN A C     1 
ATOM   4436 O  O     . ASN A 1 539 ? -5.259  39.456  24.222  1.00 46.37  ? 539  ASN A O     1 
ATOM   4437 C  CB    . ASN A 1 539 ? -3.496  42.183  24.364  1.00 50.34  ? 539  ASN A CB    1 
ATOM   4438 C  CG    . ASN A 1 539 ? -2.086  42.465  23.902  1.00 52.34  ? 539  ASN A CG    1 
ATOM   4439 O  OD1   . ASN A 1 539 ? -1.571  43.570  24.086  1.00 54.88  ? 539  ASN A OD1   1 
ATOM   4440 N  ND2   . ASN A 1 539 ? -1.456  41.472  23.281  1.00 51.64  ? 539  ASN A ND2   1 
ATOM   4441 N  N     . GLU A 1 540 ? -6.538  41.316  24.284  1.00 48.45  ? 540  GLU A N     1 
ATOM   4442 C  CA    . GLU A 1 540 ? -7.668  40.650  24.925  1.00 49.47  ? 540  GLU A CA    1 
ATOM   4443 C  C     . GLU A 1 540 ? -8.287  39.632  23.974  1.00 47.03  ? 540  GLU A C     1 
ATOM   4444 O  O     . GLU A 1 540 ? -8.700  38.549  24.398  1.00 47.19  ? 540  GLU A O     1 
ATOM   4445 C  CB    . GLU A 1 540 ? -8.709  41.662  25.427  1.00 50.09  ? 540  GLU A CB    1 
ATOM   4446 C  CG    . GLU A 1 540 ? -10.000 41.042  26.001  1.00 56.67  ? 540  GLU A CG    1 
ATOM   4447 C  CD    . GLU A 1 540 ? -9.769  40.087  27.184  1.00 62.69  ? 540  GLU A CD    1 
ATOM   4448 O  OE1   . GLU A 1 540 ? -8.815  40.302  27.963  1.00 67.84  ? 540  GLU A OE1   1 
ATOM   4449 O  OE2   . GLU A 1 540 ? -10.555 39.122  27.341  1.00 60.83  ? 540  GLU A OE2   1 
ATOM   4450 N  N     . MET A 1 541 ? -8.326  39.983  22.689  1.00 44.65  ? 541  MET A N     1 
ATOM   4451 C  CA    . MET A 1 541 ? -8.798  39.077  21.643  1.00 42.28  ? 541  MET A CA    1 
ATOM   4452 C  C     . MET A 1 541 ? -7.878  37.869  21.504  1.00 40.65  ? 541  MET A C     1 
ATOM   4453 O  O     . MET A 1 541 ? -8.348  36.747  21.315  1.00 40.70  ? 541  MET A O     1 
ATOM   4454 C  CB    . MET A 1 541 ? -8.941  39.808  20.303  1.00 41.90  ? 541  MET A CB    1 
ATOM   4455 C  CG    . MET A 1 541 ? -10.154 40.735  20.226  1.00 40.11  ? 541  MET A CG    1 
ATOM   4456 S  SD    . MET A 1 541 ? -10.486 41.392  18.575  1.00 44.20  ? 541  MET A SD    1 
ATOM   4457 C  CE    . MET A 1 541 ? -10.829 39.898  17.633  1.00 38.40  ? 541  MET A CE    1 
ATOM   4458 N  N     . LEU A 1 542 ? -6.572  38.109  21.614  1.00 39.38  ? 542  LEU A N     1 
ATOM   4459 C  CA    . LEU A 1 542 ? -5.573  37.056  21.508  1.00 38.54  ? 542  LEU A CA    1 
ATOM   4460 C  C     . LEU A 1 542 ? -5.743  36.088  22.668  1.00 39.91  ? 542  LEU A C     1 
ATOM   4461 O  O     . LEU A 1 542 ? -5.702  34.869  22.477  1.00 36.57  ? 542  LEU A O     1 
ATOM   4462 C  CB    . LEU A 1 542 ? -4.150  37.636  21.479  1.00 36.64  ? 542  LEU A CB    1 
ATOM   4463 C  CG    . LEU A 1 542 ? -2.978  36.639  21.434  1.00 37.43  ? 542  LEU A CG    1 
ATOM   4464 C  CD1   . LEU A 1 542 ? -3.062  35.707  20.230  1.00 35.52  ? 542  LEU A CD1   1 
ATOM   4465 C  CD2   . LEU A 1 542 ? -1.625  37.354  21.460  1.00 36.82  ? 542  LEU A CD2   1 
ATOM   4466 N  N     . PHE A 1 543 ? -5.950  36.649  23.860  1.00 40.67  ? 543  PHE A N     1 
ATOM   4467 C  CA    . PHE A 1 543 ? -6.203  35.865  25.057  1.00 41.37  ? 543  PHE A CA    1 
ATOM   4468 C  C     . PHE A 1 543 ? -7.395  34.936  24.850  1.00 41.71  ? 543  PHE A C     1 
ATOM   4469 O  O     . PHE A 1 543 ? -7.347  33.767  25.232  1.00 42.95  ? 543  PHE A O     1 
ATOM   4470 C  CB    . PHE A 1 543 ? -6.440  36.775  26.272  1.00 42.15  ? 543  PHE A CB    1 
ATOM   4471 C  CG    . PHE A 1 543 ? -6.800  36.023  27.535  1.00 44.46  ? 543  PHE A CG    1 
ATOM   4472 C  CD1   . PHE A 1 543 ? -5.810  35.429  28.316  1.00 47.90  ? 543  PHE A CD1   1 
ATOM   4473 C  CD2   . PHE A 1 543 ? -8.130  35.897  27.935  1.00 45.61  ? 543  PHE A CD2   1 
ATOM   4474 C  CE1   . PHE A 1 543 ? -6.140  34.718  29.480  1.00 49.60  ? 543  PHE A CE1   1 
ATOM   4475 C  CE2   . PHE A 1 543 ? -8.473  35.192  29.095  1.00 45.18  ? 543  PHE A CE2   1 
ATOM   4476 C  CZ    . PHE A 1 543 ? -7.475  34.604  29.868  1.00 48.68  ? 543  PHE A CZ    1 
ATOM   4477 N  N     . ARG A 1 544 ? -8.456  35.464  24.246  1.00 41.86  ? 544  ARG A N     1 
ATOM   4478 C  CA    . ARG A 1 544 ? -9.682  34.706  24.005  1.00 42.10  ? 544  ARG A CA    1 
ATOM   4479 C  C     . ARG A 1 544 ? -9.503  33.693  22.883  1.00 41.89  ? 544  ARG A C     1 
ATOM   4480 O  O     . ARG A 1 544 ? -10.055 32.594  22.942  1.00 41.21  ? 544  ARG A O     1 
ATOM   4481 C  CB    . ARG A 1 544 ? -10.840 35.648  23.681  1.00 41.57  ? 544  ARG A CB    1 
ATOM   4482 C  CG    . ARG A 1 544 ? -11.308 36.486  24.862  1.00 43.13  ? 544  ARG A CG    1 
ATOM   4483 C  CD    . ARG A 1 544 ? -12.307 37.524  24.417  1.00 45.14  ? 544  ARG A CD    1 
ATOM   4484 N  NE    . ARG A 1 544 ? -12.544 38.521  25.454  1.00 49.08  ? 544  ARG A NE    1 
ATOM   4485 C  CZ    . ARG A 1 544 ? -13.440 39.502  25.369  1.00 50.35  ? 544  ARG A CZ    1 
ATOM   4486 N  NH1   . ARG A 1 544 ? -14.204 39.630  24.290  1.00 46.80  ? 544  ARG A NH1   1 
ATOM   4487 N  NH2   . ARG A 1 544 ? -13.574 40.355  26.371  1.00 49.97  ? 544  ARG A NH2   1 
ATOM   4488 N  N     . ALA A 1 545 ? -8.743  34.079  21.858  1.00 40.75  ? 545  ALA A N     1 
ATOM   4489 C  CA    . ALA A 1 545 ? -8.400  33.166  20.780  1.00 39.08  ? 545  ALA A CA    1 
ATOM   4490 C  C     . ALA A 1 545 ? -7.680  31.960  21.382  1.00 37.15  ? 545  ALA A C     1 
ATOM   4491 O  O     . ALA A 1 545 ? -8.079  30.817  21.157  1.00 37.63  ? 545  ALA A O     1 
ATOM   4492 C  CB    . ALA A 1 545 ? -7.529  33.863  19.727  1.00 36.80  ? 545  ALA A CB    1 
ATOM   4493 N  N     . GLN A 1 546 ? -6.651  32.234  22.179  1.00 36.07  ? 546  GLN A N     1 
ATOM   4494 C  CA    . GLN A 1 546 ? -5.836  31.186  22.800  1.00 38.98  ? 546  GLN A CA    1 
ATOM   4495 C  C     . GLN A 1 546 ? -6.623  30.304  23.769  1.00 37.42  ? 546  GLN A C     1 
ATOM   4496 O  O     . GLN A 1 546 ? -6.351  29.112  23.861  1.00 38.47  ? 546  GLN A O     1 
ATOM   4497 C  CB    . GLN A 1 546 ? -4.597  31.782  23.478  1.00 40.48  ? 546  GLN A CB    1 
ATOM   4498 C  CG    . GLN A 1 546 ? -3.528  32.254  22.481  1.00 43.30  ? 546  GLN A CG    1 
ATOM   4499 C  CD    . GLN A 1 546 ? -2.430  33.113  23.106  1.00 48.66  ? 546  GLN A CD    1 
ATOM   4500 O  OE1   . GLN A 1 546 ? -1.369  33.297  22.509  1.00 52.72  ? 546  GLN A OE1   1 
ATOM   4501 N  NE2   . GLN A 1 546 ? -2.687  33.656  24.297  1.00 45.62  ? 546  GLN A NE2   1 
ATOM   4502 N  N     . ARG A 1 547 ? -7.595  30.887  24.476  1.00 36.57  ? 547  ARG A N     1 
ATOM   4503 C  CA    . ARG A 1 547 ? -8.513  30.114  25.318  1.00 37.10  ? 547  ARG A CA    1 
ATOM   4504 C  C     . ARG A 1 547 ? -9.447  29.209  24.508  1.00 36.91  ? 547  ARG A C     1 
ATOM   4505 O  O     . ARG A 1 547 ? -9.651  28.046  24.867  1.00 37.67  ? 547  ARG A O     1 
ATOM   4506 C  CB    . ARG A 1 547 ? -9.316  31.019  26.262  1.00 38.06  ? 547  ARG A CB    1 
ATOM   4507 C  CG    . ARG A 1 547 ? -8.528  31.510  27.494  1.00 40.58  ? 547  ARG A CG    1 
ATOM   4508 C  CD    . ARG A 1 547 ? -8.109  30.344  28.406  1.00 42.04  ? 547  ARG A CD    1 
ATOM   4509 N  NE    . ARG A 1 547 ? -7.384  30.771  29.605  1.00 45.07  ? 547  ARG A NE    1 
ATOM   4510 C  CZ    . ARG A 1 547 ? -7.965  31.179  30.733  1.00 49.47  ? 547  ARG A CZ    1 
ATOM   4511 N  NH1   . ARG A 1 547 ? -9.293  31.230  30.833  1.00 49.16  ? 547  ARG A NH1   1 
ATOM   4512 N  NH2   . ARG A 1 547 ? -7.217  31.535  31.770  1.00 50.31  ? 547  ARG A NH2   1 
ATOM   4513 N  N     . THR A 1 548 ? -10.006 29.733  23.420  1.00 35.58  ? 548  THR A N     1 
ATOM   4514 C  CA    . THR A 1 548 ? -10.817 28.919  22.513  1.00 36.73  ? 548  THR A CA    1 
ATOM   4515 C  C     . THR A 1 548 ? -9.989  27.744  21.994  1.00 35.80  ? 548  THR A C     1 
ATOM   4516 O  O     . THR A 1 548 ? -10.456 26.603  21.981  1.00 37.09  ? 548  THR A O     1 
ATOM   4517 C  CB    . THR A 1 548 ? -11.375 29.743  21.328  1.00 35.40  ? 548  THR A CB    1 
ATOM   4518 O  OG1   . THR A 1 548 ? -12.237 30.767  21.828  1.00 37.12  ? 548  THR A OG1   1 
ATOM   4519 C  CG2   . THR A 1 548 ? -12.168 28.861  20.388  1.00 34.06  ? 548  THR A CG2   1 
ATOM   4520 N  N     . GLU A 1 549 ? -8.758  28.034  21.591  1.00 35.71  ? 549  GLU A N     1 
ATOM   4521 C  CA    . GLU A 1 549 ? -7.822  27.004  21.160  1.00 37.46  ? 549  GLU A CA    1 
ATOM   4522 C  C     . GLU A 1 549 ? -7.589  25.924  22.218  1.00 36.61  ? 549  GLU A C     1 
ATOM   4523 O  O     . GLU A 1 549 ? -7.659  24.739  21.900  1.00 36.88  ? 549  GLU A O     1 
ATOM   4524 C  CB    . GLU A 1 549 ? -6.487  27.617  20.714  1.00 39.71  ? 549  GLU A CB    1 
ATOM   4525 C  CG    . GLU A 1 549 ? -5.510  26.578  20.151  1.00 42.70  ? 549  GLU A CG    1 
ATOM   4526 C  CD    . GLU A 1 549 ? -4.141  27.139  19.811  1.00 45.52  ? 549  GLU A CD    1 
ATOM   4527 O  OE1   . GLU A 1 549 ? -3.990  28.381  19.728  1.00 47.85  ? 549  GLU A OE1   1 
ATOM   4528 O  OE2   . GLU A 1 549 ? -3.213  26.320  19.617  1.00 44.59  ? 549  GLU A OE2   1 
ATOM   4529 N  N     . VAL A 1 550 ? -7.316  26.323  23.464  1.00 35.48  ? 550  VAL A N     1 
ATOM   4530 C  CA    . VAL A 1 550 ? -7.089  25.341  24.534  1.00 34.53  ? 550  VAL A CA    1 
ATOM   4531 C  C     . VAL A 1 550 ? -8.315  24.453  24.755  1.00 34.21  ? 550  VAL A C     1 
ATOM   4532 O  O     . VAL A 1 550 ? -8.174  23.249  24.984  1.00 34.76  ? 550  VAL A O     1 
ATOM   4533 C  CB    . VAL A 1 550 ? -6.626  25.978  25.872  1.00 35.17  ? 550  VAL A CB    1 
ATOM   4534 C  CG1   . VAL A 1 550 ? -6.642  24.932  27.002  1.00 30.33  ? 550  VAL A CG1   1 
ATOM   4535 C  CG2   . VAL A 1 550 ? -5.219  26.589  25.737  1.00 32.82  ? 550  VAL A CG2   1 
ATOM   4536 N  N     . ALA A 1 551 ? -9.505  25.048  24.674  1.00 33.38  ? 551  ALA A N     1 
ATOM   4537 C  CA    . ALA A 1 551 ? -10.762 24.306  24.810  1.00 34.35  ? 551  ALA A CA    1 
ATOM   4538 C  C     . ALA A 1 551 ? -10.889 23.238  23.719  1.00 33.73  ? 551  ALA A C     1 
ATOM   4539 O  O     . ALA A 1 551 ? -11.248 22.082  23.998  1.00 34.72  ? 551  ALA A O     1 
ATOM   4540 C  CB    . ALA A 1 551 ? -11.972 25.270  24.785  1.00 32.52  ? 551  ALA A CB    1 
ATOM   4541 N  N     . GLY A 1 552 ? -10.580 23.630  22.485  1.00 30.66  ? 552  GLY A N     1 
ATOM   4542 C  CA    . GLY A 1 552 ? -10.585 22.708  21.351  1.00 30.69  ? 552  GLY A CA    1 
ATOM   4543 C  C     . GLY A 1 552 ? -9.530  21.621  21.500  1.00 30.69  ? 552  GLY A C     1 
ATOM   4544 O  O     . GLY A 1 552 ? -9.778  20.454  21.174  1.00 29.83  ? 552  GLY A O     1 
ATOM   4545 N  N     . MET A 1 553 ? -8.358  22.010  21.995  1.00 27.48  ? 553  MET A N     1 
ATOM   4546 C  CA    . MET A 1 553 ? -7.288  21.059  22.304  1.00 30.82  ? 553  MET A CA    1 
ATOM   4547 C  C     . MET A 1 553 ? -7.739  20.016  23.322  1.00 30.31  ? 553  MET A C     1 
ATOM   4548 O  O     . MET A 1 553 ? -7.514  18.828  23.119  1.00 32.57  ? 553  MET A O     1 
ATOM   4549 C  CB    . MET A 1 553 ? -6.012  21.770  22.796  1.00 31.67  ? 553  MET A CB    1 
ATOM   4550 C  CG    . MET A 1 553 ? -4.864  20.811  23.199  1.00 36.29  ? 553  MET A CG    1 
ATOM   4551 S  SD    . MET A 1 553 ? -4.220  19.839  21.811  1.00 49.80  ? 553  MET A SD    1 
ATOM   4552 C  CE    . MET A 1 553 ? -2.711  20.724  21.408  1.00 44.39  ? 553  MET A CE    1 
ATOM   4553 N  N     . THR A 1 554 ? -8.375  20.444  24.409  1.00 29.77  ? 554  THR A N     1 
ATOM   4554 C  CA    . THR A 1 554 ? -8.836  19.471  25.404  1.00 32.10  ? 554  THR A CA    1 
ATOM   4555 C  C     . THR A 1 554 ? -9.802  18.478  24.760  1.00 31.16  ? 554  THR A C     1 
ATOM   4556 O  O     . THR A 1 554 ? -9.601  17.262  24.847  1.00 32.59  ? 554  THR A O     1 
ATOM   4557 C  CB    . THR A 1 554 ? -9.514  20.134  26.602  1.00 31.81  ? 554  THR A CB    1 
ATOM   4558 O  OG1   . THR A 1 554 ? -8.569  20.948  27.305  1.00 33.93  ? 554  THR A OG1   1 
ATOM   4559 C  CG2   . THR A 1 554 ? -10.060 19.091  27.535  1.00 33.19  ? 554  THR A CG2   1 
ATOM   4560 N  N     . ALA A 1 555 ? -10.819 19.011  24.089  1.00 30.30  ? 555  ALA A N     1 
ATOM   4561 C  CA    . ALA A 1 555 ? -11.864 18.192  23.485  1.00 32.50  ? 555  ALA A CA    1 
ATOM   4562 C  C     . ALA A 1 555 ? -11.348 17.246  22.400  1.00 32.50  ? 555  ALA A C     1 
ATOM   4563 O  O     . ALA A 1 555 ? -11.799 16.105  22.310  1.00 36.06  ? 555  ALA A O     1 
ATOM   4564 C  CB    . ALA A 1 555 ? -12.997 19.068  22.947  1.00 31.50  ? 555  ALA A CB    1 
ATOM   4565 N  N     . GLN A 1 556 ? -10.396 17.707  21.595  1.00 31.32  ? 556  GLN A N     1 
ATOM   4566 C  CA    . GLN A 1 556 ? -9.909  16.902  20.477  1.00 29.57  ? 556  GLN A CA    1 
ATOM   4567 C  C     . GLN A 1 556 ? -8.833  15.901  20.882  1.00 31.66  ? 556  GLN A C     1 
ATOM   4568 O  O     . GLN A 1 556 ? -8.893  14.746  20.480  1.00 33.17  ? 556  GLN A O     1 
ATOM   4569 C  CB    . GLN A 1 556 ? -9.462  17.780  19.293  1.00 27.14  ? 556  GLN A CB    1 
ATOM   4570 C  CG    . GLN A 1 556 ? -8.097  18.469  19.434  1.00 25.73  ? 556  GLN A CG    1 
ATOM   4571 C  CD    . GLN A 1 556 ? -6.916  17.564  19.074  1.00 26.72  ? 556  GLN A CD    1 
ATOM   4572 O  OE1   . GLN A 1 556 ? -7.078  16.515  18.446  1.00 28.58  ? 556  GLN A OE1   1 
ATOM   4573 N  NE2   . GLN A 1 556 ? -5.729  17.966  19.485  1.00 24.90  ? 556  GLN A NE2   1 
ATOM   4574 N  N     . ILE A 1 557 ? -7.854  16.328  21.682  1.00 33.93  ? 557  ILE A N     1 
ATOM   4575 C  CA    . ILE A 1 557 ? -6.740  15.436  22.003  1.00 33.13  ? 557  ILE A CA    1 
ATOM   4576 C  C     . ILE A 1 557 ? -7.143  14.274  22.908  1.00 33.76  ? 557  ILE A C     1 
ATOM   4577 O  O     . ILE A 1 557 ? -6.609  13.170  22.783  1.00 35.06  ? 557  ILE A O     1 
ATOM   4578 C  CB    . ILE A 1 557 ? -5.482  16.179  22.541  1.00 33.97  ? 557  ILE A CB    1 
ATOM   4579 C  CG1   . ILE A 1 557 ? -4.220  15.359  22.200  1.00 28.52  ? 557  ILE A CG1   1 
ATOM   4580 C  CG2   . ILE A 1 557 ? -5.618  16.528  24.036  1.00 30.27  ? 557  ILE A CG2   1 
ATOM   4581 C  CD1   . ILE A 1 557 ? -2.911  15.986  22.636  1.00 32.64  ? 557  ILE A CD1   1 
ATOM   4582 N  N     . ASN A 1 558 ? -8.104  14.515  23.793  1.00 32.19  ? 558  ASN A N     1 
ATOM   4583 C  CA    . ASN A 1 558 ? -8.555  13.473  24.710  1.00 31.62  ? 558  ASN A CA    1 
ATOM   4584 C  C     . ASN A 1 558 ? -9.538  12.520  24.051  1.00 31.21  ? 558  ASN A C     1 
ATOM   4585 O  O     . ASN A 1 558 ? -9.709  11.386  24.500  1.00 33.18  ? 558  ASN A O     1 
ATOM   4586 C  CB    . ASN A 1 558 ? -9.121  14.087  25.984  1.00 30.34  ? 558  ASN A CB    1 
ATOM   4587 C  CG    . ASN A 1 558 ? -8.048  14.770  26.804  1.00 32.30  ? 558  ASN A CG    1 
ATOM   4588 O  OD1   . ASN A 1 558 ? -7.060  14.141  27.180  1.00 30.31  ? 558  ASN A OD1   1 
ATOM   4589 N  ND2   . ASN A 1 558 ? -8.219  16.067  27.062  1.00 31.19  ? 558  ASN A ND2   1 
ATOM   4590 N  N     . ARG A 1 559 ? -10.163 12.968  22.968  1.00 30.21  ? 559  ARG A N     1 
ATOM   4591 C  CA    . ARG A 1 559 ? -10.962 12.051  22.164  1.00 32.39  ? 559  ARG A CA    1 
ATOM   4592 C  C     . ARG A 1 559 ? -10.035 11.146  21.355  1.00 31.64  ? 559  ARG A C     1 
ATOM   4593 O  O     . ARG A 1 559 ? -10.305 9.956   21.210  1.00 32.45  ? 559  ARG A O     1 
ATOM   4594 C  CB    . ARG A 1 559 ? -11.979 12.795  21.294  1.00 31.30  ? 559  ARG A CB    1 
ATOM   4595 C  CG    . ARG A 1 559 ? -13.249 13.116  22.063  1.00 31.34  ? 559  ARG A CG    1 
ATOM   4596 C  CD    . ARG A 1 559 ? -14.185 14.015  21.284  1.00 31.15  ? 559  ARG A CD    1 
ATOM   4597 N  NE    . ARG A 1 559 ? -15.395 14.314  22.053  1.00 35.33  ? 559  ARG A NE    1 
ATOM   4598 C  CZ    . ARG A 1 559 ? -15.473 15.229  23.018  1.00 31.72  ? 559  ARG A CZ    1 
ATOM   4599 N  NH1   . ARG A 1 559 ? -14.408 15.941  23.350  1.00 25.30  ? 559  ARG A NH1   1 
ATOM   4600 N  NH2   . ARG A 1 559 ? -16.623 15.432  23.653  1.00 31.70  ? 559  ARG A NH2   1 
ATOM   4601 N  N     . LYS A 1 560 ? -8.926  11.719  20.884  1.00 31.15  ? 560  LYS A N     1 
ATOM   4602 C  CA    . LYS A 1 560 ? -7.836  10.967  20.248  1.00 30.73  ? 560  LYS A CA    1 
ATOM   4603 C  C     . LYS A 1 560 ? -7.225  9.957   21.223  1.00 29.08  ? 560  LYS A C     1 
ATOM   4604 O  O     . LYS A 1 560 ? -6.980  8.805   20.863  1.00 28.57  ? 560  LYS A O     1 
ATOM   4605 C  CB    . LYS A 1 560 ? -6.767  11.934  19.708  1.00 29.38  ? 560  LYS A CB    1 
ATOM   4606 C  CG    . LYS A 1 560 ? -5.414  11.313  19.363  1.00 33.40  ? 560  LYS A CG    1 
ATOM   4607 C  CD    . LYS A 1 560 ? -4.393  12.390  18.952  1.00 34.90  ? 560  LYS A CD    1 
ATOM   4608 C  CE    . LYS A 1 560 ? -2.960  11.866  19.067  1.00 43.33  ? 560  LYS A CE    1 
ATOM   4609 N  NZ    . LYS A 1 560 ? -1.928  12.756  18.429  1.00 43.48  ? 560  LYS A NZ    1 
ATOM   4610 N  N     . LEU A 1 561 ? -6.990  10.392  22.459  1.00 28.69  ? 561  LEU A N     1 
ATOM   4611 C  CA    . LEU A 1 561 ? -6.472  9.491   23.487  1.00 30.85  ? 561  LEU A CA    1 
ATOM   4612 C  C     . LEU A 1 561 ? -7.400  8.290   23.684  1.00 29.60  ? 561  LEU A C     1 
ATOM   4613 O  O     . LEU A 1 561 ? -6.937  7.155   23.752  1.00 29.87  ? 561  LEU A O     1 
ATOM   4614 C  CB    . LEU A 1 561 ? -6.260  10.226  24.820  1.00 30.59  ? 561  LEU A CB    1 
ATOM   4615 C  CG    . LEU A 1 561 ? -5.778  9.373   26.002  1.00 35.78  ? 561  LEU A CG    1 
ATOM   4616 C  CD1   . LEU A 1 561 ? -4.453  8.646   25.688  1.00 34.58  ? 561  LEU A CD1   1 
ATOM   4617 C  CD2   . LEU A 1 561 ? -5.635  10.221  27.272  1.00 38.64  ? 561  LEU A CD2   1 
ATOM   4618 N  N     . LEU A 1 562 ? -8.701  8.559   23.765  1.00 26.96  ? 562  LEU A N     1 
ATOM   4619 C  CA    . LEU A 1 562 ? -9.703  7.519   23.935  1.00 29.71  ? 562  LEU A CA    1 
ATOM   4620 C  C     . LEU A 1 562 ? -9.688  6.477   22.807  1.00 30.18  ? 562  LEU A C     1 
ATOM   4621 O  O     . LEU A 1 562 ? -9.699  5.274   23.075  1.00 32.26  ? 562  LEU A O     1 
ATOM   4622 C  CB    . LEU A 1 562 ? -11.106 8.137   24.082  1.00 29.66  ? 562  LEU A CB    1 
ATOM   4623 C  CG    . LEU A 1 562 ? -12.228 7.146   24.415  1.00 30.37  ? 562  LEU A CG    1 
ATOM   4624 C  CD1   . LEU A 1 562 ? -12.010 6.477   25.799  1.00 29.26  ? 562  LEU A CD1   1 
ATOM   4625 C  CD2   . LEU A 1 562 ? -13.591 7.832   24.351  1.00 30.86  ? 562  LEU A CD2   1 
ATOM   4626 N  N     . ILE A 1 563 ? -9.653  6.931   21.555  1.00 29.04  ? 563  ILE A N     1 
ATOM   4627 C  CA    . ILE A 1 563 ? -9.705  5.997   20.423  1.00 27.34  ? 563  ILE A CA    1 
ATOM   4628 C  C     . ILE A 1 563 ? -8.391  5.237   20.246  1.00 28.70  ? 563  ILE A C     1 
ATOM   4629 O  O     . ILE A 1 563 ? -8.390  4.074   19.849  1.00 29.06  ? 563  ILE A O     1 
ATOM   4630 C  CB    . ILE A 1 563 ? -10.200 6.657   19.090  1.00 27.96  ? 563  ILE A CB    1 
ATOM   4631 C  CG1   . ILE A 1 563 ? -9.313  7.819   18.653  1.00 24.24  ? 563  ILE A CG1   1 
ATOM   4632 C  CG2   . ILE A 1 563 ? -11.665 7.125   19.226  1.00 26.44  ? 563  ILE A CG2   1 
ATOM   4633 C  CD1   . ILE A 1 563 ? -9.771  8.470   17.366  1.00 27.72  ? 563  ILE A CD1   1 
ATOM   4634 N  N     . ASN A 1 564 ? -7.280  5.895   20.564  1.00 27.33  ? 564  ASN A N     1 
ATOM   4635 C  CA    . ASN A 1 564 ? -5.987  5.234   20.572  1.00 29.00  ? 564  ASN A CA    1 
ATOM   4636 C  C     . ASN A 1 564 ? -5.869  4.245   21.737  1.00 30.51  ? 564  ASN A C     1 
ATOM   4637 O  O     . ASN A 1 564 ? -5.160  3.250   21.631  1.00 29.89  ? 564  ASN A O     1 
ATOM   4638 C  CB    . ASN A 1 564 ? -4.856  6.264   20.601  1.00 29.22  ? 564  ASN A CB    1 
ATOM   4639 C  CG    . ASN A 1 564 ? -4.609  6.901   19.235  1.00 29.29  ? 564  ASN A CG    1 
ATOM   4640 O  OD1   . ASN A 1 564 ? -5.173  6.482   18.231  1.00 29.60  ? 564  ASN A OD1   1 
ATOM   4641 N  ND2   . ASN A 1 564 ? -3.748  7.906   19.198  1.00 29.93  ? 564  ASN A ND2   1 
ATOM   4642 N  N     . SER A 1 565 ? -6.580  4.518   22.834  1.00 29.40  ? 565  SER A N     1 
ATOM   4643 C  CA    . SER A 1 565 ? -6.632  3.597   23.969  1.00 28.48  ? 565  SER A CA    1 
ATOM   4644 C  C     . SER A 1 565 ? -7.435  2.328   23.669  1.00 27.95  ? 565  SER A C     1 
ATOM   4645 O  O     . SER A 1 565 ? -7.175  1.285   24.266  1.00 28.55  ? 565  SER A O     1 
ATOM   4646 C  CB    . SER A 1 565 ? -7.188  4.291   25.209  1.00 29.12  ? 565  SER A CB    1 
ATOM   4647 O  OG    . SER A 1 565 ? -6.389  5.409   25.551  1.00 31.56  ? 565  SER A OG    1 
ATOM   4648 N  N     . LEU A 1 566 ? -8.395  2.414   22.747  1.00 26.32  ? 566  LEU A N     1 
ATOM   4649 C  CA    . LEU A 1 566 ? -9.139  1.235   22.302  1.00 28.36  ? 566  LEU A CA    1 
ATOM   4650 C  C     . LEU A 1 566 ? -8.199  0.244   21.623  1.00 29.31  ? 566  LEU A C     1 
ATOM   4651 O  O     . LEU A 1 566 ? -8.189  -0.937  21.973  1.00 28.11  ? 566  LEU A O     1 
ATOM   4652 C  CB    . LEU A 1 566 ? -10.295 1.619   21.365  1.00 28.54  ? 566  LEU A CB    1 
ATOM   4653 C  CG    . LEU A 1 566 ? -11.166 0.491   20.790  1.00 31.22  ? 566  LEU A CG    1 
ATOM   4654 C  CD1   . LEU A 1 566 ? -11.674 -0.484  21.867  1.00 28.96  ? 566  LEU A CD1   1 
ATOM   4655 C  CD2   . LEU A 1 566 ? -12.334 1.049   19.999  1.00 28.71  ? 566  LEU A CD2   1 
ATOM   4656 N  N     . ALA A 1 567 ? -7.408  0.743   20.666  1.00 28.75  ? 567  ALA A N     1 
ATOM   4657 C  CA    . ALA A 1 567 ? -6.360  -0.038  20.005  1.00 29.60  ? 567  ALA A CA    1 
ATOM   4658 C  C     . ALA A 1 567 ? -5.393  -0.634  21.029  1.00 30.54  ? 567  ALA A C     1 
ATOM   4659 O  O     . ALA A 1 567 ? -5.015  -1.807  20.933  1.00 29.27  ? 567  ALA A O     1 
ATOM   4660 C  CB    . ALA A 1 567 ? -5.601  0.833   19.010  1.00 30.71  ? 567  ALA A CB    1 
ATOM   4661 N  N     . GLY A 1 568 ? -5.003  0.175   22.014  1.00 28.18  ? 568  GLY A N     1 
ATOM   4662 C  CA    . GLY A 1 568 ? -4.152  -0.299  23.106  1.00 29.91  ? 568  GLY A CA    1 
ATOM   4663 C  C     . GLY A 1 568 ? -4.819  -1.362  23.968  1.00 31.05  ? 568  GLY A C     1 
ATOM   4664 O  O     . GLY A 1 568 ? -4.204  -2.372  24.298  1.00 32.34  ? 568  GLY A O     1 
ATOM   4665 N  N     . ALA A 1 569 ? -6.082  -1.135  24.322  1.00 30.60  ? 569  ALA A N     1 
ATOM   4666 C  CA    . ALA A 1 569 ? -6.831  -2.040  25.187  1.00 31.82  ? 569  ALA A CA    1 
ATOM   4667 C  C     . ALA A 1 569 ? -6.890  -3.451  24.612  1.00 34.00  ? 569  ALA A C     1 
ATOM   4668 O  O     . ALA A 1 569 ? -6.886  -4.431  25.359  1.00 37.92  ? 569  ALA A O     1 
ATOM   4669 C  CB    . ALA A 1 569 ? -8.222  -1.505  25.427  1.00 29.34  ? 569  ALA A CB    1 
ATOM   4670 N  N     . LEU A 1 570 ? -6.914  -3.546  23.284  1.00 33.82  ? 570  LEU A N     1 
ATOM   4671 C  CA    . LEU A 1 570 ? -6.839  -4.829  22.576  1.00 30.88  ? 570  LEU A CA    1 
ATOM   4672 C  C     . LEU A 1 570 ? -5.601  -5.633  22.969  1.00 29.64  ? 570  LEU A C     1 
ATOM   4673 O  O     . LEU A 1 570 ? -5.579  -6.858  22.820  1.00 26.83  ? 570  LEU A O     1 
ATOM   4674 C  CB    . LEU A 1 570 ? -6.878  -4.616  21.053  1.00 30.54  ? 570  LEU A CB    1 
ATOM   4675 C  CG    . LEU A 1 570 ? -8.179  -4.077  20.451  1.00 28.93  ? 570  LEU A CG    1 
ATOM   4676 C  CD1   . LEU A 1 570 ? -8.022  -3.781  18.967  1.00 29.62  ? 570  LEU A CD1   1 
ATOM   4677 C  CD2   . LEU A 1 570 ? -9.338  -5.043  20.672  1.00 32.95  ? 570  LEU A CD2   1 
ATOM   4678 N  N     . GLY A 1 571 ? -4.577  -4.932  23.458  1.00 29.54  ? 571  GLY A N     1 
ATOM   4679 C  CA    . GLY A 1 571 ? -3.384  -5.574  24.017  1.00 32.82  ? 571  GLY A CA    1 
ATOM   4680 C  C     . GLY A 1 571 ? -3.284  -5.590  25.545  1.00 32.87  ? 571  GLY A C     1 
ATOM   4681 O  O     . GLY A 1 571 ? -2.204  -5.805  26.079  1.00 31.49  ? 571  GLY A O     1 
ATOM   4682 N  N     . ASN A 1 572 ? -4.399  -5.348  26.245  1.00 34.55  ? 572  ASN A N     1 
ATOM   4683 C  CA    . ASN A 1 572 ? -4.459  -5.489  27.714  1.00 32.25  ? 572  ASN A CA    1 
ATOM   4684 C  C     . ASN A 1 572 ? -5.393  -6.611  28.165  1.00 31.54  ? 572  ASN A C     1 
ATOM   4685 O  O     . ASN A 1 572 ? -6.570  -6.635  27.786  1.00 29.79  ? 572  ASN A O     1 
ATOM   4686 C  CB    . ASN A 1 572 ? -4.849  -4.172  28.397  1.00 32.92  ? 572  ASN A CB    1 
ATOM   4687 C  CG    . ASN A 1 572 ? -4.967  -4.317  29.914  1.00 38.52  ? 572  ASN A CG    1 
ATOM   4688 O  OD1   . ASN A 1 572 ? -5.852  -5.012  30.414  1.00 38.71  ? 572  ASN A OD1   1 
ATOM   4689 N  ND2   . ASN A 1 572 ? -4.063  -3.669  30.649  1.00 36.64  ? 572  ASN A ND2   1 
ATOM   4690 N  N     . VAL A 1 573 ? -4.858  -7.521  28.989  1.00 32.53  ? 573  VAL A N     1 
ATOM   4691 C  CA    . VAL A 1 573 ? -5.539  -8.773  29.381  1.00 31.79  ? 573  VAL A CA    1 
ATOM   4692 C  C     . VAL A 1 573 ? -6.889  -8.584  30.083  1.00 33.59  ? 573  VAL A C     1 
ATOM   4693 O  O     . VAL A 1 573 ? -7.734  -9.476  30.046  1.00 33.80  ? 573  VAL A O     1 
ATOM   4694 C  CB    . VAL A 1 573 ? -4.626  -9.717  30.247  1.00 33.69  ? 573  VAL A CB    1 
ATOM   4695 C  CG1   . VAL A 1 573 ? -3.386  -10.165 29.453  1.00 34.00  ? 573  VAL A CG1   1 
ATOM   4696 C  CG2   . VAL A 1 573 ? -4.221  -9.065  31.576  1.00 26.97  ? 573  VAL A CG2   1 
ATOM   4697 N  N     . TRP A 1 574 ? -7.085  -7.424  30.707  1.00 34.32  ? 574  TRP A N     1 
ATOM   4698 C  CA    . TRP A 1 574 ? -8.339  -7.103  31.394  1.00 37.46  ? 574  TRP A CA    1 
ATOM   4699 C  C     . TRP A 1 574 ? -9.462  -6.587  30.477  1.00 35.90  ? 574  TRP A C     1 
ATOM   4700 O  O     . TRP A 1 574 ? -10.609 -6.474  30.900  1.00 36.15  ? 574  TRP A O     1 
ATOM   4701 C  CB    . TRP A 1 574 ? -8.065  -6.129  32.548  1.00 40.30  ? 574  TRP A CB    1 
ATOM   4702 C  CG    . TRP A 1 574 ? -7.141  -6.739  33.552  1.00 48.92  ? 574  TRP A CG    1 
ATOM   4703 C  CD1   . TRP A 1 574 ? -5.793  -6.524  33.670  1.00 50.80  ? 574  TRP A CD1   1 
ATOM   4704 C  CD2   . TRP A 1 574 ? -7.484  -7.702  34.557  1.00 49.97  ? 574  TRP A CD2   1 
ATOM   4705 N  NE1   . TRP A 1 574 ? -5.284  -7.280  34.698  1.00 52.46  ? 574  TRP A NE1   1 
ATOM   4706 C  CE2   . TRP A 1 574 ? -6.299  -8.011  35.260  1.00 52.12  ? 574  TRP A CE2   1 
ATOM   4707 C  CE3   . TRP A 1 574 ? -8.683  -8.322  34.942  1.00 53.29  ? 574  TRP A CE3   1 
ATOM   4708 C  CZ2   . TRP A 1 574 ? -6.274  -8.922  36.328  1.00 56.87  ? 574  TRP A CZ2   1 
ATOM   4709 C  CZ3   . TRP A 1 574 ? -8.661  -9.229  36.010  1.00 55.89  ? 574  TRP A CZ3   1 
ATOM   4710 C  CH2   . TRP A 1 574 ? -7.461  -9.521  36.685  1.00 55.76  ? 574  TRP A CH2   1 
ATOM   4711 N  N     . PHE A 1 575 ? -9.136  -6.287  29.221  1.00 35.47  ? 575  PHE A N     1 
ATOM   4712 C  CA    . PHE A 1 575 ? -10.149 -5.891  28.239  1.00 32.27  ? 575  PHE A CA    1 
ATOM   4713 C  C     . PHE A 1 575 ? -10.956 -7.096  27.783  1.00 32.68  ? 575  PHE A C     1 
ATOM   4714 O  O     . PHE A 1 575 ? -10.386 -8.105  27.375  1.00 35.64  ? 575  PHE A O     1 
ATOM   4715 C  CB    . PHE A 1 575 ? -9.489  -5.233  27.037  1.00 30.80  ? 575  PHE A CB    1 
ATOM   4716 C  CG    . PHE A 1 575 ? -10.442 -4.512  26.132  1.00 27.94  ? 575  PHE A CG    1 
ATOM   4717 C  CD1   . PHE A 1 575 ? -11.489 -3.759  26.647  1.00 29.26  ? 575  PHE A CD1   1 
ATOM   4718 C  CD2   . PHE A 1 575 ? -10.269 -4.557  24.760  1.00 30.34  ? 575  PHE A CD2   1 
ATOM   4719 C  CE1   . PHE A 1 575 ? -12.366 -3.076  25.803  1.00 26.36  ? 575  PHE A CE1   1 
ATOM   4720 C  CE2   . PHE A 1 575 ? -11.126 -3.860  23.911  1.00 28.78  ? 575  PHE A CE2   1 
ATOM   4721 C  CZ    . PHE A 1 575 ? -12.177 -3.131  24.434  1.00 27.29  ? 575  PHE A CZ    1 
ATOM   4722 N  N     . ARG A 1 576 ? -12.280 -6.984  27.856  1.00 31.18  ? 576  ARG A N     1 
ATOM   4723 C  CA    . ARG A 1 576 ? -13.198 -8.041  27.418  1.00 30.03  ? 576  ARG A CA    1 
ATOM   4724 C  C     . ARG A 1 576 ? -12.844 -8.547  26.006  1.00 30.72  ? 576  ARG A C     1 
ATOM   4725 O  O     . ARG A 1 576 ? -12.939 -9.750  25.709  1.00 30.44  ? 576  ARG A O     1 
ATOM   4726 C  CB    . ARG A 1 576 ? -14.640 -7.512  27.453  1.00 29.41  ? 576  ARG A CB    1 
ATOM   4727 C  CG    . ARG A 1 576 ? -15.733 -8.568  27.286  1.00 29.93  ? 576  ARG A CG    1 
ATOM   4728 C  CD    . ARG A 1 576 ? -17.128 -7.959  27.344  1.00 29.57  ? 576  ARG A CD    1 
ATOM   4729 N  NE    . ARG A 1 576 ? -17.401 -7.307  28.625  1.00 30.90  ? 576  ARG A NE    1 
ATOM   4730 C  CZ    . ARG A 1 576 ? -17.920 -7.902  29.695  1.00 34.51  ? 576  ARG A CZ    1 
ATOM   4731 N  NH1   . ARG A 1 576 ? -18.252 -9.189  29.663  1.00 32.41  ? 576  ARG A NH1   1 
ATOM   4732 N  NH2   . ARG A 1 576 ? -18.110 -7.198  30.809  1.00 33.15  ? 576  ARG A NH2   1 
ATOM   4733 N  N     . TYR A 1 577 ? -12.401 -7.628  25.155  1.00 29.01  ? 577  TYR A N     1 
ATOM   4734 C  CA    . TYR A 1 577 ? -12.101 -7.940  23.757  1.00 28.47  ? 577  TYR A CA    1 
ATOM   4735 C  C     . TYR A 1 577 ? -10.604 -8.021  23.464  1.00 26.92  ? 577  TYR A C     1 
ATOM   4736 O  O     . TYR A 1 577 ? -10.177 -7.878  22.317  1.00 27.87  ? 577  TYR A O     1 
ATOM   4737 C  CB    . TYR A 1 577 ? -12.814 -6.942  22.837  1.00 28.61  ? 577  TYR A CB    1 
ATOM   4738 C  CG    . TYR A 1 577 ? -14.274 -6.815  23.175  1.00 28.23  ? 577  TYR A CG    1 
ATOM   4739 C  CD1   . TYR A 1 577 ? -14.741 -5.752  23.945  1.00 28.01  ? 577  TYR A CD1   1 
ATOM   4740 C  CD2   . TYR A 1 577 ? -15.189 -7.783  22.756  1.00 30.62  ? 577  TYR A CD2   1 
ATOM   4741 C  CE1   . TYR A 1 577 ? -16.084 -5.651  24.281  1.00 26.47  ? 577  TYR A CE1   1 
ATOM   4742 C  CE2   . TYR A 1 577 ? -16.535 -7.686  23.083  1.00 27.64  ? 577  TYR A CE2   1 
ATOM   4743 C  CZ    . TYR A 1 577 ? -16.972 -6.623  23.844  1.00 25.31  ? 577  TYR A CZ    1 
ATOM   4744 O  OH    . TYR A 1 577 ? -18.305 -6.526  24.150  1.00 27.55  ? 577  TYR A OH    1 
ATOM   4745 N  N     . TYR A 1 578 ? -9.819  -8.241  24.514  1.00 27.67  ? 578  TYR A N     1 
ATOM   4746 C  CA    . TYR A 1 578 ? -8.402  -8.541  24.379  1.00 29.03  ? 578  TYR A CA    1 
ATOM   4747 C  C     . TYR A 1 578 ? -8.165  -9.631  23.349  1.00 30.05  ? 578  TYR A C     1 
ATOM   4748 O  O     . TYR A 1 578 ? -8.711  -10.731 23.455  1.00 29.05  ? 578  TYR A O     1 
ATOM   4749 C  CB    . TYR A 1 578 ? -7.862  -9.035  25.714  1.00 30.67  ? 578  TYR A CB    1 
ATOM   4750 C  CG    . TYR A 1 578 ? -6.444  -9.563  25.682  1.00 31.78  ? 578  TYR A CG    1 
ATOM   4751 C  CD1   . TYR A 1 578 ? -6.194  -10.931 25.660  1.00 30.52  ? 578  TYR A CD1   1 
ATOM   4752 C  CD2   . TYR A 1 578 ? -5.348  -8.691  25.704  1.00 33.16  ? 578  TYR A CD2   1 
ATOM   4753 C  CE1   . TYR A 1 578 ? -4.887  -11.429 25.655  1.00 29.48  ? 578  TYR A CE1   1 
ATOM   4754 C  CE2   . TYR A 1 578 ? -4.037  -9.174  25.698  1.00 31.18  ? 578  TYR A CE2   1 
ATOM   4755 C  CZ    . TYR A 1 578 ? -3.818  -10.544 25.674  1.00 34.13  ? 578  TYR A CZ    1 
ATOM   4756 O  OH    . TYR A 1 578 ? -2.534  -11.036 25.682  1.00 36.96  ? 578  TYR A OH    1 
ATOM   4757 N  N     . ASP A 1 579 ? -7.327  -9.317  22.371  1.00 31.35  ? 579  ASP A N     1 
ATOM   4758 C  CA    . ASP A 1 579 ? -6.888  -10.285 21.389  1.00 32.16  ? 579  ASP A CA    1 
ATOM   4759 C  C     . ASP A 1 579 ? -5.620  -9.766  20.716  1.00 32.26  ? 579  ASP A C     1 
ATOM   4760 O  O     . ASP A 1 579 ? -5.643  -8.721  20.053  1.00 32.31  ? 579  ASP A O     1 
ATOM   4761 C  CB    . ASP A 1 579 ? -7.996  -10.542 20.362  1.00 30.99  ? 579  ASP A CB    1 
ATOM   4762 C  CG    . ASP A 1 579 ? -7.729  -11.762 19.510  1.00 34.44  ? 579  ASP A CG    1 
ATOM   4763 O  OD1   . ASP A 1 579 ? -8.714  -12.404 19.080  1.00 34.60  ? 579  ASP A OD1   1 
ATOM   4764 O  OD2   . ASP A 1 579 ? -6.537  -12.082 19.271  1.00 35.60  ? 579  ASP A OD2   1 
ATOM   4765 N  N     . LEU A 1 580 ? -4.523  -10.505 20.894  1.00 32.15  ? 580  LEU A N     1 
ATOM   4766 C  CA    . LEU A 1 580 ? -3.208  -10.115 20.370  1.00 31.36  ? 580  LEU A CA    1 
ATOM   4767 C  C     . LEU A 1 580 ? -3.096  -10.213 18.844  1.00 31.36  ? 580  LEU A C     1 
ATOM   4768 O  O     . LEU A 1 580 ? -2.288  -9.508  18.229  1.00 27.64  ? 580  LEU A O     1 
ATOM   4769 C  CB    . LEU A 1 580 ? -2.102  -10.923 21.048  1.00 32.80  ? 580  LEU A CB    1 
ATOM   4770 C  CG    . LEU A 1 580 ? -1.164  -10.309 22.103  1.00 35.58  ? 580  LEU A CG    1 
ATOM   4771 C  CD1   . LEU A 1 580 ? -1.521  -8.895  22.591  1.00 29.19  ? 580  LEU A CD1   1 
ATOM   4772 C  CD2   . LEU A 1 580 ? -1.005  -11.249 23.274  1.00 36.85  ? 580  LEU A CD2   1 
ATOM   4773 N  N     . ARG A 1 581 ? -3.913  -11.075 18.241  1.00 31.17  ? 581  ARG A N     1 
ATOM   4774 C  CA    . ARG A 1 581 ? -4.040  -11.135 16.782  1.00 30.07  ? 581  ARG A CA    1 
ATOM   4775 C  C     . ARG A 1 581 ? -4.532  -9.784  16.240  1.00 29.89  ? 581  ARG A C     1 
ATOM   4776 O  O     . ARG A 1 581 ? -4.009  -9.285  15.249  1.00 30.86  ? 581  ARG A O     1 
ATOM   4777 C  CB    . ARG A 1 581 ? -5.007  -12.251 16.356  1.00 30.77  ? 581  ARG A CB    1 
ATOM   4778 C  CG    . ARG A 1 581 ? -4.679  -13.655 16.877  1.00 29.37  ? 581  ARG A CG    1 
ATOM   4779 C  CD    . ARG A 1 581 ? -5.798  -14.655 16.574  1.00 29.82  ? 581  ARG A CD    1 
ATOM   4780 N  NE    . ARG A 1 581 ? -6.999  -14.433 17.393  1.00 33.82  ? 581  ARG A NE    1 
ATOM   4781 C  CZ    . ARG A 1 581 ? -8.147  -15.092 17.237  1.00 35.46  ? 581  ARG A CZ    1 
ATOM   4782 N  NH1   . ARG A 1 581 ? -8.263  -16.018 16.295  1.00 34.87  ? 581  ARG A NH1   1 
ATOM   4783 N  NH2   . ARG A 1 581 ? -9.184  -14.825 18.016  1.00 33.18  ? 581  ARG A NH2   1 
ATOM   4784 N  N     . ASN A 1 582 ? -5.526  -9.196  16.906  1.00 29.33  ? 582  ASN A N     1 
ATOM   4785 C  CA    . ASN A 1 582 ? -6.057  -7.882  16.528  1.00 29.85  ? 582  ASN A CA    1 
ATOM   4786 C  C     . ASN A 1 582 ? -5.111  -6.708  16.819  1.00 28.19  ? 582  ASN A C     1 
ATOM   4787 O  O     . ASN A 1 582 ? -4.923  -5.841  15.957  1.00 31.06  ? 582  ASN A O     1 
ATOM   4788 C  CB    . ASN A 1 582 ? -7.446  -7.641  17.153  1.00 31.53  ? 582  ASN A CB    1 
ATOM   4789 C  CG    . ASN A 1 582 ? -8.544  -8.472  16.490  1.00 33.91  ? 582  ASN A CG    1 
ATOM   4790 O  OD1   . ASN A 1 582 ? -8.352  -9.038  15.412  1.00 33.67  ? 582  ASN A OD1   1 
ATOM   4791 N  ND2   . ASN A 1 582 ? -9.700  -8.549  17.140  1.00 33.11  ? 582  ASN A ND2   1 
ATOM   4792 N  N     . ALA A 1 583 ? -4.502  -6.686  18.007  1.00 26.02  ? 583  ALA A N     1 
ATOM   4793 C  CA    . ALA A 1 583 ? -3.534  -5.631  18.353  1.00 27.41  ? 583  ALA A CA    1 
ATOM   4794 C  C     . ALA A 1 583 ? -2.352  -5.634  17.374  1.00 30.05  ? 583  ALA A C     1 
ATOM   4795 O  O     . ALA A 1 583 ? -1.973  -4.587  16.833  1.00 31.24  ? 583  ALA A O     1 
ATOM   4796 C  CB    . ALA A 1 583 ? -3.053  -5.770  19.809  1.00 23.36  ? 583  ALA A CB    1 
ATOM   4797 N  N     . THR A 1 584 ? -1.810  -6.826  17.125  1.00 28.90  ? 584  THR A N     1 
ATOM   4798 C  CA    . THR A 1 584 ? -0.679  -7.003  16.221  1.00 30.53  ? 584  THR A CA    1 
ATOM   4799 C  C     . THR A 1 584 ? -1.060  -6.726  14.772  1.00 30.95  ? 584  THR A C     1 
ATOM   4800 O  O     . THR A 1 584 ? -0.251  -6.188  14.011  1.00 32.18  ? 584  THR A O     1 
ATOM   4801 C  CB    . THR A 1 584 ? -0.074  -8.415  16.365  1.00 30.29  ? 584  THR A CB    1 
ATOM   4802 O  OG1   . THR A 1 584 ? 0.232   -8.638  17.747  1.00 33.47  ? 584  THR A OG1   1 
ATOM   4803 C  CG2   . THR A 1 584 ? 1.213   -8.536  15.582  1.00 35.02  ? 584  THR A CG2   1 
ATOM   4804 N  N     . ALA A 1 585 ? -2.288  -7.077  14.394  1.00 28.42  ? 585  ALA A N     1 
ATOM   4805 C  CA    . ALA A 1 585 ? -2.783  -6.757  13.056  1.00 28.35  ? 585  ALA A CA    1 
ATOM   4806 C  C     . ALA A 1 585 ? -2.731  -5.244  12.801  1.00 28.52  ? 585  ALA A C     1 
ATOM   4807 O  O     . ALA A 1 585 ? -2.319  -4.814  11.727  1.00 30.91  ? 585  ALA A O     1 
ATOM   4808 C  CB    . ALA A 1 585 ? -4.201  -7.301  12.854  1.00 23.83  ? 585  ALA A CB    1 
ATOM   4809 N  N     . ILE A 1 586 ? -3.125  -4.452  13.800  1.00 26.53  ? 586  ILE A N     1 
ATOM   4810 C  CA    . ILE A 1 586 ? -3.020  -2.990  13.731  1.00 28.05  ? 586  ILE A CA    1 
ATOM   4811 C  C     . ILE A 1 586 ? -1.574  -2.520  13.598  1.00 29.82  ? 586  ILE A C     1 
ATOM   4812 O  O     . ILE A 1 586 ? -1.262  -1.733  12.697  1.00 33.13  ? 586  ILE A O     1 
ATOM   4813 C  CB    . ILE A 1 586 ? -3.641  -2.295  14.982  1.00 29.11  ? 586  ILE A CB    1 
ATOM   4814 C  CG1   . ILE A 1 586 ? -5.138  -2.617  15.105  1.00 28.34  ? 586  ILE A CG1   1 
ATOM   4815 C  CG2   . ILE A 1 586 ? -3.416  -0.793  14.934  1.00 22.36  ? 586  ILE A CG2   1 
ATOM   4816 C  CD1   . ILE A 1 586 ? -5.692  -2.319  16.472  1.00 30.20  ? 586  ILE A CD1   1 
ATOM   4817 N  N     . THR A 1 587 ? -0.704  -2.984  14.496  1.00 29.68  ? 587  THR A N     1 
ATOM   4818 C  CA    . THR A 1 587 ? 0.664   -2.445  14.590  1.00 31.32  ? 587  THR A CA    1 
ATOM   4819 C  C     . THR A 1 587 ? 1.563   -2.902  13.429  1.00 30.45  ? 587  THR A C     1 
ATOM   4820 O  O     . THR A 1 587 ? 2.414   -2.136  12.943  1.00 28.23  ? 587  THR A O     1 
ATOM   4821 C  CB    . THR A 1 587 ? 1.346   -2.750  15.962  1.00 31.99  ? 587  THR A CB    1 
ATOM   4822 O  OG1   . THR A 1 587 ? 1.605   -4.151  16.088  1.00 33.23  ? 587  THR A OG1   1 
ATOM   4823 C  CG2   . THR A 1 587 ? 0.469   -2.293  17.135  1.00 34.17  ? 587  THR A CG2   1 
ATOM   4824 N  N     . THR A 1 588 ? 1.356   -4.134  12.977  1.00 27.97  ? 588  THR A N     1 
ATOM   4825 C  CA    . THR A 1 588 ? 2.103   -4.651  11.837  1.00 28.42  ? 588  THR A CA    1 
ATOM   4826 C  C     . THR A 1 588 ? 1.698   -3.902  10.564  1.00 29.90  ? 588  THR A C     1 
ATOM   4827 O  O     . THR A 1 588 ? 2.571   -3.473  9.807   1.00 30.90  ? 588  THR A O     1 
ATOM   4828 C  CB    . THR A 1 588 ? 1.930   -6.166  11.694  1.00 29.62  ? 588  THR A CB    1 
ATOM   4829 O  OG1   . THR A 1 588 ? 2.154   -6.774  12.972  1.00 30.84  ? 588  THR A OG1   1 
ATOM   4830 C  CG2   . THR A 1 588 ? 2.922   -6.741  10.685  1.00 30.12  ? 588  THR A CG2   1 
ATOM   4831 N  N     . PHE A 1 589 ? 0.389   -3.722  10.353  1.00 29.38  ? 589  PHE A N     1 
ATOM   4832 C  CA    . PHE A 1 589 ? -0.132  -2.911  9.232   1.00 30.12  ? 589  PHE A CA    1 
ATOM   4833 C  C     . PHE A 1 589 ? 0.556   -1.553  9.220   1.00 30.26  ? 589  PHE A C     1 
ATOM   4834 O  O     . PHE A 1 589 ? 1.040   -1.102  8.183   1.00 31.82  ? 589  PHE A O     1 
ATOM   4835 C  CB    . PHE A 1 589 ? -1.663  -2.724  9.340   1.00 29.01  ? 589  PHE A CB    1 
ATOM   4836 C  CG    . PHE A 1 589 ? -2.326  -2.207  8.068   1.00 26.99  ? 589  PHE A CG    1 
ATOM   4837 C  CD1   . PHE A 1 589 ? -2.395  -0.838  7.797   1.00 26.47  ? 589  PHE A CD1   1 
ATOM   4838 C  CD2   . PHE A 1 589 ? -2.904  -3.093  7.155   1.00 27.87  ? 589  PHE A CD2   1 
ATOM   4839 C  CE1   . PHE A 1 589 ? -3.015  -0.361  6.625   1.00 24.73  ? 589  PHE A CE1   1 
ATOM   4840 C  CE2   . PHE A 1 589 ? -3.519  -2.629  5.976   1.00 27.39  ? 589  PHE A CE2   1 
ATOM   4841 C  CZ    . PHE A 1 589 ? -3.576  -1.261  5.713   1.00 26.03  ? 589  PHE A CZ    1 
ATOM   4842 N  N     . GLY A 1 590 ? 0.603   -0.915  10.387  1.00 30.46  ? 590  GLY A N     1 
ATOM   4843 C  CA    . GLY A 1 590 ? 1.238   0.392   10.546  1.00 30.49  ? 590  GLY A CA    1 
ATOM   4844 C  C     . GLY A 1 590 ? 2.687   0.400   10.094  1.00 31.52  ? 590  GLY A C     1 
ATOM   4845 O  O     . GLY A 1 590 ? 3.118   1.327   9.398   1.00 31.06  ? 590  GLY A O     1 
ATOM   4846 N  N     . GLN A 1 591 ? 3.427   -0.646  10.466  1.00 30.61  ? 591  GLN A N     1 
ATOM   4847 C  CA    . GLN A 1 591 ? 4.841   -0.767  10.102  1.00 32.00  ? 591  GLN A CA    1 
ATOM   4848 C  C     . GLN A 1 591 ? 4.987   -0.886  8.600   1.00 32.27  ? 591  GLN A C     1 
ATOM   4849 O  O     . GLN A 1 591 ? 5.922   -0.332  8.021   1.00 32.10  ? 591  GLN A O     1 
ATOM   4850 C  CB    . GLN A 1 591 ? 5.504   -1.975  10.779  1.00 32.40  ? 591  GLN A CB    1 
ATOM   4851 C  CG    . GLN A 1 591 ? 5.729   -1.830  12.285  1.00 33.80  ? 591  GLN A CG    1 
ATOM   4852 C  CD    . GLN A 1 591 ? 6.853   -2.728  12.814  1.00 40.27  ? 591  GLN A CD    1 
ATOM   4853 O  OE1   . GLN A 1 591 ? 7.418   -3.541  12.077  1.00 39.36  ? 591  GLN A OE1   1 
ATOM   4854 N  NE2   . GLN A 1 591 ? 7.185   -2.573  14.100  1.00 39.97  ? 591  GLN A NE2   1 
ATOM   4855 N  N     . MET A 1 592 ? 4.055   -1.618  7.987   1.00 32.23  ? 592  MET A N     1 
ATOM   4856 C  CA    . MET A 1 592 ? 4.018   -1.816  6.547   1.00 31.74  ? 592  MET A CA    1 
ATOM   4857 C  C     . MET A 1 592 ? 3.690   -0.513  5.844   1.00 32.91  ? 592  MET A C     1 
ATOM   4858 O  O     . MET A 1 592 ? 4.354   -0.148  4.879   1.00 34.51  ? 592  MET A O     1 
ATOM   4859 C  CB    . MET A 1 592 ? 2.979   -2.881  6.158   1.00 31.53  ? 592  MET A CB    1 
ATOM   4860 C  CG    . MET A 1 592 ? 2.873   -3.104  4.645   1.00 32.04  ? 592  MET A CG    1 
ATOM   4861 S  SD    . MET A 1 592 ? 1.465   -4.073  4.067   1.00 36.17  ? 592  MET A SD    1 
ATOM   4862 C  CE    . MET A 1 592 ? 0.088   -3.144  4.741   1.00 39.22  ? 592  MET A CE    1 
ATOM   4863 N  N     . ALA A 1 593 ? 2.666   0.177   6.339   1.00 32.85  ? 593  ALA A N     1 
ATOM   4864 C  CA    . ALA A 1 593 ? 2.135   1.370   5.689   1.00 33.81  ? 593  ALA A CA    1 
ATOM   4865 C  C     . ALA A 1 593 ? 3.169   2.484   5.629   1.00 35.35  ? 593  ALA A C     1 
ATOM   4866 O  O     . ALA A 1 593 ? 3.295   3.167   4.607   1.00 36.15  ? 593  ALA A O     1 
ATOM   4867 C  CB    . ALA A 1 593 ? 0.886   1.848   6.409   1.00 30.61  ? 593  ALA A CB    1 
ATOM   4868 N  N     . LEU A 1 594 ? 3.900   2.654   6.732   1.00 34.51  ? 594  LEU A N     1 
ATOM   4869 C  CA    . LEU A 1 594 ? 4.942   3.667   6.844   1.00 34.31  ? 594  LEU A CA    1 
ATOM   4870 C  C     . LEU A 1 594 ? 6.098   3.396   5.875   1.00 34.93  ? 594  LEU A C     1 
ATOM   4871 O  O     . LEU A 1 594 ? 6.557   4.298   5.170   1.00 33.88  ? 594  LEU A O     1 
ATOM   4872 C  CB    . LEU A 1 594 ? 5.467   3.727   8.285   1.00 34.23  ? 594  LEU A CB    1 
ATOM   4873 C  CG    . LEU A 1 594 ? 6.593   4.726   8.556   1.00 36.55  ? 594  LEU A CG    1 
ATOM   4874 C  CD1   . LEU A 1 594 ? 6.090   6.145   8.333   1.00 38.10  ? 594  LEU A CD1   1 
ATOM   4875 C  CD2   . LEU A 1 594 ? 7.142   4.557   9.953   1.00 34.98  ? 594  LEU A CD2   1 
ATOM   4876 N  N     . GLN A 1 595 ? 6.557   2.148   5.850   1.00 34.34  ? 595  GLN A N     1 
ATOM   4877 C  CA    . GLN A 1 595 ? 7.695   1.765   5.032   1.00 36.50  ? 595  GLN A CA    1 
ATOM   4878 C  C     . GLN A 1 595 ? 7.324   1.660   3.556   1.00 36.54  ? 595  GLN A C     1 
ATOM   4879 O  O     . GLN A 1 595 ? 8.139   1.992   2.698   1.00 39.14  ? 595  GLN A O     1 
ATOM   4880 C  CB    . GLN A 1 595 ? 8.347   0.491   5.573   1.00 35.62  ? 595  GLN A CB    1 
ATOM   4881 C  CG    . GLN A 1 595 ? 9.203   0.778   6.793   1.00 38.56  ? 595  GLN A CG    1 
ATOM   4882 C  CD    . GLN A 1 595 ? 9.589   -0.457  7.570   1.00 37.90  ? 595  GLN A CD    1 
ATOM   4883 O  OE1   . GLN A 1 595 ? 10.701  -0.963  7.429   1.00 38.12  ? 595  GLN A OE1   1 
ATOM   4884 N  NE2   . GLN A 1 595 ? 8.677   -0.946  8.405   1.00 37.21  ? 595  GLN A NE2   1 
ATOM   4885 N  N     . TRP A 1 596 ? 6.095   1.221   3.278   1.00 34.24  ? 596  TRP A N     1 
ATOM   4886 C  CA    . TRP A 1 596 ? 5.518   1.241   1.926   1.00 34.42  ? 596  TRP A CA    1 
ATOM   4887 C  C     . TRP A 1 596 ? 5.570   2.638   1.309   1.00 35.87  ? 596  TRP A C     1 
ATOM   4888 O  O     . TRP A 1 596 ? 6.046   2.809   0.183   1.00 35.66  ? 596  TRP A O     1 
ATOM   4889 C  CB    . TRP A 1 596 ? 4.068   0.733   1.955   1.00 32.14  ? 596  TRP A CB    1 
ATOM   4890 C  CG    . TRP A 1 596 ? 3.316   0.831   0.658   1.00 31.48  ? 596  TRP A CG    1 
ATOM   4891 C  CD1   . TRP A 1 596 ? 2.736   1.948   0.135   1.00 33.27  ? 596  TRP A CD1   1 
ATOM   4892 C  CD2   . TRP A 1 596 ? 3.040   -0.232  -0.271  1.00 34.78  ? 596  TRP A CD2   1 
ATOM   4893 N  NE1   . TRP A 1 596 ? 2.125   1.658   -1.062  1.00 33.17  ? 596  TRP A NE1   1 
ATOM   4894 C  CE2   . TRP A 1 596 ? 2.297   0.328   -1.339  1.00 36.02  ? 596  TRP A CE2   1 
ATOM   4895 C  CE3   . TRP A 1 596 ? 3.357   -1.599  -0.312  1.00 34.83  ? 596  TRP A CE3   1 
ATOM   4896 C  CZ2   . TRP A 1 596 ? 1.861   -0.434  -2.440  1.00 34.58  ? 596  TRP A CZ2   1 
ATOM   4897 C  CZ3   . TRP A 1 596 ? 2.926   -2.357  -1.408  1.00 34.26  ? 596  TRP A CZ3   1 
ATOM   4898 C  CH2   . TRP A 1 596 ? 2.181   -1.770  -2.453  1.00 35.01  ? 596  TRP A CH2   1 
ATOM   4899 N  N     . ILE A 1 597 ? 5.072   3.630   2.047   1.00 36.15  ? 597  ILE A N     1 
ATOM   4900 C  CA    . ILE A 1 597 ? 4.983   4.992   1.529   1.00 36.19  ? 597  ILE A CA    1 
ATOM   4901 C  C     . ILE A 1 597 ? 6.345   5.695   1.466   1.00 39.18  ? 597  ILE A C     1 
ATOM   4902 O  O     . ILE A 1 597 ? 6.533   6.621   0.670   1.00 39.82  ? 597  ILE A O     1 
ATOM   4903 C  CB    . ILE A 1 597 ? 3.935   5.835   2.290   1.00 34.45  ? 597  ILE A CB    1 
ATOM   4904 C  CG1   . ILE A 1 597 ? 3.272   6.837   1.341   1.00 34.03  ? 597  ILE A CG1   1 
ATOM   4905 C  CG2   . ILE A 1 597 ? 4.535   6.513   3.536   1.00 34.80  ? 597  ILE A CG2   1 
ATOM   4906 C  CD1   . ILE A 1 597 ? 2.427   6.185   0.266   1.00 32.06  ? 597  ILE A CD1   1 
ATOM   4907 N  N     . GLU A 1 598 ? 7.281   5.245   2.300   1.00 39.04  ? 598  GLU A N     1 
ATOM   4908 C  CA    . GLU A 1 598 ? 8.668   5.701   2.240   1.00 39.85  ? 598  GLU A CA    1 
ATOM   4909 C  C     . GLU A 1 598 ? 9.217   5.312   0.878   1.00 39.29  ? 598  GLU A C     1 
ATOM   4910 O  O     . GLU A 1 598 ? 9.777   6.147   0.169   1.00 42.45  ? 598  GLU A O     1 
ATOM   4911 C  CB    . GLU A 1 598 ? 9.503   5.069   3.370   1.00 38.72  ? 598  GLU A CB    1 
ATOM   4912 C  CG    . GLU A 1 598 ? 10.994  5.419   3.333   1.00 41.31  ? 598  GLU A CG    1 
ATOM   4913 C  CD    . GLU A 1 598 ? 11.843  4.632   4.332   1.00 42.93  ? 598  GLU A CD    1 
ATOM   4914 O  OE1   . GLU A 1 598 ? 11.345  3.657   4.939   1.00 44.64  ? 598  GLU A OE1   1 
ATOM   4915 O  OE2   . GLU A 1 598 ? 13.026  4.996   4.509   1.00 44.48  ? 598  GLU A OE2   1 
ATOM   4916 N  N     . ARG A 1 599 ? 9.030   4.043   0.519   1.00 39.16  ? 599  ARG A N     1 
ATOM   4917 C  CA    . ARG A 1 599 ? 9.440   3.517   -0.779  1.00 39.54  ? 599  ARG A CA    1 
ATOM   4918 C  C     . ARG A 1 599 ? 8.789   4.285   -1.936  1.00 40.04  ? 599  ARG A C     1 
ATOM   4919 O  O     . ARG A 1 599 ? 9.465   4.634   -2.900  1.00 40.97  ? 599  ARG A O     1 
ATOM   4920 C  CB    . ARG A 1 599 ? 9.143   2.014   -0.884  1.00 38.08  ? 599  ARG A CB    1 
ATOM   4921 C  CG    . ARG A 1 599 ? 9.595   1.405   -2.215  1.00 40.63  ? 599  ARG A CG    1 
ATOM   4922 C  CD    . ARG A 1 599 ? 9.228   -0.058  -2.360  1.00 38.39  ? 599  ARG A CD    1 
ATOM   4923 N  NE    . ARG A 1 599 ? 7.798   -0.330  -2.194  1.00 38.91  ? 599  ARG A NE    1 
ATOM   4924 C  CZ    . ARG A 1 599 ? 6.895   -0.323  -3.172  1.00 39.42  ? 599  ARG A CZ    1 
ATOM   4925 N  NH1   . ARG A 1 599 ? 7.241   -0.038  -4.420  1.00 38.85  ? 599  ARG A NH1   1 
ATOM   4926 N  NH2   . ARG A 1 599 ? 5.632   -0.608  -2.897  1.00 41.05  ? 599  ARG A NH2   1 
ATOM   4927 N  N     . LYS A 1 600 ? 7.487   4.558   -1.823  1.00 38.65  ? 600  LYS A N     1 
ATOM   4928 C  CA    . LYS A 1 600 ? 6.758   5.292   -2.865  1.00 38.16  ? 600  LYS A CA    1 
ATOM   4929 C  C     . LYS A 1 600 ? 7.205   6.739   -3.001  1.00 37.08  ? 600  LYS A C     1 
ATOM   4930 O  O     . LYS A 1 600 ? 7.406   7.218   -4.114  1.00 40.34  ? 600  LYS A O     1 
ATOM   4931 C  CB    . LYS A 1 600 ? 5.236   5.221   -2.647  1.00 37.14  ? 600  LYS A CB    1 
ATOM   4932 C  CG    . LYS A 1 600 ? 4.622   3.840   -2.867  1.00 36.68  ? 600  LYS A CG    1 
ATOM   4933 C  CD    . LYS A 1 600 ? 4.595   3.429   -4.336  1.00 36.05  ? 600  LYS A CD    1 
ATOM   4934 C  CE    . LYS A 1 600 ? 3.695   2.212   -4.547  1.00 37.67  ? 600  LYS A CE    1 
ATOM   4935 N  NZ    . LYS A 1 600 ? 3.485   1.898   -6.002  1.00 40.19  ? 600  LYS A NZ    1 
ATOM   4936 N  N     . VAL A 1 601 ? 7.357   7.426   -1.870  1.00 38.29  ? 601  VAL A N     1 
ATOM   4937 C  CA    . VAL A 1 601 ? 7.767   8.830   -1.857  1.00 38.40  ? 601  VAL A CA    1 
ATOM   4938 C  C     . VAL A 1 601 ? 9.155   8.977   -2.463  1.00 40.49  ? 601  VAL A C     1 
ATOM   4939 O  O     . VAL A 1 601 ? 9.374   9.846   -3.305  1.00 42.31  ? 601  VAL A O     1 
ATOM   4940 C  CB    . VAL A 1 601 ? 7.679   9.459   -0.435  1.00 37.74  ? 601  VAL A CB    1 
ATOM   4941 C  CG1   . VAL A 1 601 ? 8.470   10.759  -0.342  1.00 35.91  ? 601  VAL A CG1   1 
ATOM   4942 C  CG2   . VAL A 1 601 ? 6.227   9.726   -0.075  1.00 35.77  ? 601  VAL A CG2   1 
ATOM   4943 N  N     . ASN A 1 602 ? 10.077  8.111   -2.054  1.00 42.26  ? 602  ASN A N     1 
ATOM   4944 C  CA    . ASN A 1 602 ? 11.410  8.079   -2.654  1.00 43.13  ? 602  ASN A CA    1 
ATOM   4945 C  C     . ASN A 1 602 ? 11.356  7.864   -4.154  1.00 45.15  ? 602  ASN A C     1 
ATOM   4946 O  O     . ASN A 1 602 ? 11.950  8.631   -4.912  1.00 48.55  ? 602  ASN A O     1 
ATOM   4947 C  CB    . ASN A 1 602 ? 12.305  7.030   -1.983  1.00 41.07  ? 602  ASN A CB    1 
ATOM   4948 C  CG    . ASN A 1 602 ? 12.909  7.533   -0.677  1.00 41.68  ? 602  ASN A CG    1 
ATOM   4949 O  OD1   . ASN A 1 602 ? 12.969  8.746   -0.433  1.00 39.39  ? 602  ASN A OD1   1 
ATOM   4950 N  ND2   . ASN A 1 602 ? 13.360  6.605   0.168   1.00 33.26  ? 602  ASN A ND2   1 
ATOM   4951 N  N     . GLU A 1 603 ? 10.625  6.835   -4.576  1.00 45.75  ? 603  GLU A N     1 
ATOM   4952 C  CA    . GLU A 1 603 ? 10.466  6.517   -5.997  1.00 45.59  ? 603  GLU A CA    1 
ATOM   4953 C  C     . GLU A 1 603 ? 9.924   7.712   -6.782  1.00 45.28  ? 603  GLU A C     1 
ATOM   4954 O  O     . GLU A 1 603 ? 10.394  7.997   -7.883  1.00 46.97  ? 603  GLU A O     1 
ATOM   4955 C  CB    . GLU A 1 603 ? 9.546   5.305   -6.186  1.00 44.27  ? 603  GLU A CB    1 
ATOM   4956 C  CG    . GLU A 1 603 ? 10.164  3.963   -5.790  1.00 47.69  ? 603  GLU A CG    1 
ATOM   4957 C  CD    . GLU A 1 603 ? 9.215   2.774   -5.986  1.00 49.50  ? 603  GLU A CD    1 
ATOM   4958 O  OE1   . GLU A 1 603 ? 8.084   2.970   -6.486  1.00 48.79  ? 603  GLU A OE1   1 
ATOM   4959 O  OE2   . GLU A 1 603 ? 9.609   1.636   -5.643  1.00 49.24  ? 603  GLU A OE2   1 
ATOM   4960 N  N     . TYR A 1 604 ? 8.939   8.403   -6.206  1.00 43.84  ? 604  TYR A N     1 
ATOM   4961 C  CA    . TYR A 1 604 ? 8.337   9.575   -6.835  1.00 43.03  ? 604  TYR A CA    1 
ATOM   4962 C  C     . TYR A 1 604 ? 9.330   10.717  -7.022  1.00 43.86  ? 604  TYR A C     1 
ATOM   4963 O  O     . TYR A 1 604 ? 9.466   11.246  -8.127  1.00 45.63  ? 604  TYR A O     1 
ATOM   4964 C  CB    . TYR A 1 604 ? 7.119   10.067  -6.039  1.00 42.83  ? 604  TYR A CB    1 
ATOM   4965 C  CG    . TYR A 1 604 ? 6.481   11.314  -6.628  1.00 44.07  ? 604  TYR A CG    1 
ATOM   4966 C  CD1   . TYR A 1 604 ? 6.539   12.539  -5.957  1.00 44.37  ? 604  TYR A CD1   1 
ATOM   4967 C  CD2   . TYR A 1 604 ? 5.836   11.270  -7.867  1.00 45.64  ? 604  TYR A CD2   1 
ATOM   4968 C  CE1   . TYR A 1 604 ? 5.963   13.686  -6.503  1.00 45.40  ? 604  TYR A CE1   1 
ATOM   4969 C  CE2   . TYR A 1 604 ? 5.259   12.406  -8.419  1.00 47.70  ? 604  TYR A CE2   1 
ATOM   4970 C  CZ    . TYR A 1 604 ? 5.326   13.610  -7.736  1.00 47.84  ? 604  TYR A CZ    1 
ATOM   4971 O  OH    . TYR A 1 604 ? 4.752   14.730  -8.293  1.00 49.89  ? 604  TYR A OH    1 
ATOM   4972 N  N     . LEU A 1 605 ? 10.019  11.096  -5.946  1.00 43.24  ? 605  LEU A N     1 
ATOM   4973 C  CA    . LEU A 1 605 ? 10.925  12.245  -5.990  1.00 45.45  ? 605  LEU A CA    1 
ATOM   4974 C  C     . LEU A 1 605 ? 12.185  11.985  -6.822  1.00 46.65  ? 605  LEU A C     1 
ATOM   4975 O  O     . LEU A 1 605 ? 12.663  12.885  -7.519  1.00 45.50  ? 605  LEU A O     1 
ATOM   4976 C  CB    . LEU A 1 605 ? 11.272  12.747  -4.577  1.00 42.83  ? 605  LEU A CB    1 
ATOM   4977 C  CG    . LEU A 1 605 ? 10.153  13.461  -3.803  1.00 44.77  ? 605  LEU A CG    1 
ATOM   4978 C  CD1   . LEU A 1 605 ? 10.563  13.723  -2.369  1.00 43.92  ? 605  LEU A CD1   1 
ATOM   4979 C  CD2   . LEU A 1 605 ? 9.700   14.768  -4.461  1.00 45.24  ? 605  LEU A CD2   1 
ATOM   4980 N  N     . ASN A 1 606 ? 12.712  10.761  -6.741  1.00 47.85  ? 606  ASN A N     1 
ATOM   4981 C  CA    . ASN A 1 606 ? 13.816  10.326  -7.598  1.00 51.05  ? 606  ASN A CA    1 
ATOM   4982 C  C     . ASN A 1 606 ? 13.467  10.510  -9.077  1.00 55.35  ? 606  ASN A C     1 
ATOM   4983 O  O     . ASN A 1 606 ? 14.292  10.988  -9.862  1.00 56.49  ? 606  ASN A O     1 
ATOM   4984 C  CB    . ASN A 1 606 ? 14.179  8.859   -7.324  1.00 49.37  ? 606  ASN A CB    1 
ATOM   4985 C  CG    . ASN A 1 606 ? 15.245  8.704   -6.250  1.00 49.18  ? 606  ASN A CG    1 
ATOM   4986 O  OD1   . ASN A 1 606 ? 16.407  9.051   -6.467  1.00 49.76  ? 606  ASN A OD1   1 
ATOM   4987 N  ND2   . ASN A 1 606 ? 14.859  8.159   -5.090  1.00 41.66  ? 606  ASN A ND2   1 
ATOM   4988 N  N     . GLU A 1 607 ? 12.241  10.135  -9.442  1.00 57.96  ? 607  GLU A N     1 
ATOM   4989 C  CA    . GLU A 1 607 ? 11.735  10.307  -10.806 1.00 61.85  ? 607  GLU A CA    1 
ATOM   4990 C  C     . GLU A 1 607 ? 11.623  11.790  -11.162 1.00 61.62  ? 607  GLU A C     1 
ATOM   4991 O  O     . GLU A 1 607 ? 12.049  12.206  -12.244 1.00 63.17  ? 607  GLU A O     1 
ATOM   4992 C  CB    . GLU A 1 607 ? 10.382  9.598   -10.968 1.00 63.54  ? 607  GLU A CB    1 
ATOM   4993 C  CG    . GLU A 1 607 ? 9.515   10.083  -12.136 1.00 70.99  ? 607  GLU A CG    1 
ATOM   4994 C  CD    . GLU A 1 607 ? 8.019   9.965   -11.847 1.00 77.33  ? 607  GLU A CD    1 
ATOM   4995 O  OE1   . GLU A 1 607 ? 7.330   11.012  -11.831 1.00 79.03  ? 607  GLU A OE1   1 
ATOM   4996 O  OE2   . GLU A 1 607 ? 7.532   8.831   -11.625 1.00 78.93  ? 607  GLU A OE2   1 
ATOM   4997 N  N     . VAL A 1 608 ? 11.053  12.572  -10.246 1.00 59.94  ? 608  VAL A N     1 
ATOM   4998 C  CA    . VAL A 1 608 ? 10.882  14.019  -10.417 1.00 61.28  ? 608  VAL A CA    1 
ATOM   4999 C  C     . VAL A 1 608 ? 12.218  14.759  -10.579 1.00 62.40  ? 608  VAL A C     1 
ATOM   5000 O  O     . VAL A 1 608 ? 12.311  15.723  -11.350 1.00 62.90  ? 608  VAL A O     1 
ATOM   5001 C  CB    . VAL A 1 608 ? 10.044  14.621  -9.249  1.00 60.63  ? 608  VAL A CB    1 
ATOM   5002 C  CG1   . VAL A 1 608 ? 10.433  16.063  -8.946  1.00 59.75  ? 608  VAL A CG1   1 
ATOM   5003 C  CG2   . VAL A 1 608 ? 8.559   14.523  -9.564  1.00 62.98  ? 608  VAL A CG2   1 
ATOM   5004 N  N     . CYS A 1 609 ? 13.243  14.290  -9.865  1.00 61.63  ? 609  CYS A N     1 
ATOM   5005 C  CA    . CYS A 1 609 ? 14.568  14.910  -9.898  1.00 62.18  ? 609  CYS A CA    1 
ATOM   5006 C  C     . CYS A 1 609 ? 15.525  14.283  -10.928 1.00 62.97  ? 609  CYS A C     1 
ATOM   5007 O  O     . CYS A 1 609 ? 16.640  14.764  -11.125 1.00 62.41  ? 609  CYS A O     1 
ATOM   5008 C  CB    . CYS A 1 609 ? 15.182  14.902  -8.496  1.00 60.79  ? 609  CYS A CB    1 
ATOM   5009 S  SG    . CYS A 1 609 ? 14.276  15.945  -7.314  1.00 59.03  ? 609  CYS A SG    1 
ATOM   5010 N  N     . GLY A 1 610 ? 15.074  13.222  -11.587 1.00 64.15  ? 610  GLY A N     1 
ATOM   5011 C  CA    . GLY A 1 610 ? 15.883  12.503  -12.573 1.00 66.66  ? 610  GLY A CA    1 
ATOM   5012 C  C     . GLY A 1 610 ? 17.080  11.763  -11.993 1.00 67.70  ? 610  GLY A C     1 
ATOM   5013 O  O     . GLY A 1 610 ? 18.143  11.718  -12.619 1.00 67.50  ? 610  GLY A O     1 
ATOM   5014 N  N     . THR A 1 611 ? 16.907  11.182  -10.803 1.00 66.51  ? 611  THR A N     1 
ATOM   5015 C  CA    . THR A 1 611 ? 17.979  10.440  -10.130 1.00 67.05  ? 611  THR A CA    1 
ATOM   5016 C  C     . THR A 1 611 ? 17.611  8.970   -9.886  1.00 68.41  ? 611  THR A C     1 
ATOM   5017 O  O     . THR A 1 611 ? 16.595  8.488   -10.395 1.00 67.92  ? 611  THR A O     1 
ATOM   5018 C  CB    . THR A 1 611 ? 18.383  11.105  -8.794  1.00 65.61  ? 611  THR A CB    1 
ATOM   5019 O  OG1   . THR A 1 611 ? 17.220  11.320  -7.988  1.00 63.92  ? 611  THR A OG1   1 
ATOM   5020 C  CG2   . THR A 1 611 ? 19.083  12.437  -9.035  1.00 67.68  ? 611  THR A CG2   1 
ATOM   5021 N  N     . GLU A 1 612 ? 18.452  8.270   -9.119  1.00 70.05  ? 612  GLU A N     1 
ATOM   5022 C  CA    . GLU A 1 612 ? 18.234  6.861   -8.753  1.00 71.00  ? 612  GLU A CA    1 
ATOM   5023 C  C     . GLU A 1 612 ? 18.916  6.515   -7.419  1.00 69.47  ? 612  GLU A C     1 
ATOM   5024 O  O     . GLU A 1 612 ? 20.116  6.762   -7.239  1.00 68.64  ? 612  GLU A O     1 
ATOM   5025 C  CB    . GLU A 1 612 ? 18.738  5.926   -9.865  1.00 73.57  ? 612  GLU A CB    1 
ATOM   5026 C  CG    . GLU A 1 612 ? 18.571  4.430   -9.568  1.00 77.84  ? 612  GLU A CG    1 
ATOM   5027 C  CD    . GLU A 1 612 ? 19.434  3.534   -10.457 1.00 83.30  ? 612  GLU A CD    1 
ATOM   5028 O  OE1   . GLU A 1 612 ? 20.366  4.045   -11.123 1.00 84.95  ? 612  GLU A OE1   1 
ATOM   5029 O  OE2   . GLU A 1 612 ? 19.178  2.308   -10.482 1.00 84.33  ? 612  GLU A OE2   1 
ATOM   5030 N  N     . GLY A 1 613 ? 18.143  5.946   -6.494  1.00 66.63  ? 613  GLY A N     1 
ATOM   5031 C  CA    . GLY A 1 613 ? 18.677  5.486   -5.212  1.00 64.53  ? 613  GLY A CA    1 
ATOM   5032 C  C     . GLY A 1 613 ? 18.786  6.537   -4.114  1.00 62.12  ? 613  GLY A C     1 
ATOM   5033 O  O     . GLY A 1 613 ? 19.092  6.201   -2.964  1.00 61.84  ? 613  GLY A O     1 
ATOM   5034 N  N     . GLU A 1 614 ? 18.545  7.803   -4.462  1.00 59.29  ? 614  GLU A N     1 
ATOM   5035 C  CA    . GLU A 1 614 ? 18.568  8.902   -3.487  1.00 57.15  ? 614  GLU A CA    1 
ATOM   5036 C  C     . GLU A 1 614 ? 17.507  8.705   -2.407  1.00 52.99  ? 614  GLU A C     1 
ATOM   5037 O  O     . GLU A 1 614 ? 16.351  8.396   -2.705  1.00 49.98  ? 614  GLU A O     1 
ATOM   5038 C  CB    . GLU A 1 614 ? 18.341  10.251  -4.172  1.00 57.66  ? 614  GLU A CB    1 
ATOM   5039 C  CG    . GLU A 1 614 ? 19.278  10.536  -5.337  1.00 65.30  ? 614  GLU A CG    1 
ATOM   5040 C  CD    . GLU A 1 614 ? 20.607  11.140  -4.911  1.00 68.38  ? 614  GLU A CD    1 
ATOM   5041 O  OE1   . GLU A 1 614 ? 20.611  12.021  -4.016  1.00 70.63  ? 614  GLU A OE1   1 
ATOM   5042 O  OE2   . GLU A 1 614 ? 21.645  10.740  -5.484  1.00 68.74  ? 614  GLU A OE2   1 
ATOM   5043 N  N     . ALA A 1 615 ? 17.918  8.873   -1.158  1.00 49.85  ? 615  ALA A N     1 
ATOM   5044 C  CA    . ALA A 1 615 ? 17.002  8.786   -0.032  1.00 48.60  ? 615  ALA A CA    1 
ATOM   5045 C  C     . ALA A 1 615 ? 16.483  10.181  0.295   1.00 46.43  ? 615  ALA A C     1 
ATOM   5046 O  O     . ALA A 1 615 ? 17.191  10.983  0.892   1.00 48.61  ? 615  ALA A O     1 
ATOM   5047 C  CB    . ALA A 1 615 ? 17.699  8.172   1.179   1.00 48.07  ? 615  ALA A CB    1 
ATOM   5048 N  N     . PHE A 1 616 ? 15.256  10.471  -0.122  1.00 43.15  ? 616  PHE A N     1 
ATOM   5049 C  CA    . PHE A 1 616 ? 14.625  11.748  0.183   1.00 39.60  ? 616  PHE A CA    1 
ATOM   5050 C  C     . PHE A 1 616 ? 14.002  11.729  1.560   1.00 38.20  ? 616  PHE A C     1 
ATOM   5051 O  O     . PHE A 1 616 ? 13.988  12.752  2.244   1.00 37.84  ? 616  PHE A O     1 
ATOM   5052 C  CB    . PHE A 1 616 ? 13.545  12.080  -0.839  1.00 41.54  ? 616  PHE A CB    1 
ATOM   5053 C  CG    . PHE A 1 616 ? 14.074  12.564  -2.152  1.00 41.08  ? 616  PHE A CG    1 
ATOM   5054 C  CD1   . PHE A 1 616 ? 14.255  13.923  -2.385  1.00 42.00  ? 616  PHE A CD1   1 
ATOM   5055 C  CD2   . PHE A 1 616 ? 14.378  11.661  -3.168  1.00 43.04  ? 616  PHE A CD2   1 
ATOM   5056 C  CE1   . PHE A 1 616 ? 14.739  14.382  -3.621  1.00 43.10  ? 616  PHE A CE1   1 
ATOM   5057 C  CE2   . PHE A 1 616 ? 14.861  12.109  -4.399  1.00 44.74  ? 616  PHE A CE2   1 
ATOM   5058 C  CZ    . PHE A 1 616 ? 15.039  13.473  -4.624  1.00 39.55  ? 616  PHE A CZ    1 
ATOM   5059 N  N     . VAL A 1 617 ? 13.470  10.570  1.953   1.00 36.50  ? 617  VAL A N     1 
ATOM   5060 C  CA    . VAL A 1 617 ? 12.898  10.397  3.279   1.00 35.87  ? 617  VAL A CA    1 
ATOM   5061 C  C     . VAL A 1 617 ? 14.044  10.132  4.251   1.00 36.67  ? 617  VAL A C     1 
ATOM   5062 O  O     . VAL A 1 617 ? 14.762  9.136   4.126   1.00 38.62  ? 617  VAL A O     1 
ATOM   5063 C  CB    . VAL A 1 617 ? 11.837  9.267   3.325   1.00 34.72  ? 617  VAL A CB    1 
ATOM   5064 C  CG1   . VAL A 1 617 ? 11.224  9.157   4.724   1.00 31.62  ? 617  VAL A CG1   1 
ATOM   5065 C  CG2   . VAL A 1 617 ? 10.743  9.529   2.315   1.00 31.55  ? 617  VAL A CG2   1 
ATOM   5066 N  N     . LEU A 1 618 ? 14.221  11.047  5.200   1.00 32.77  ? 618  LEU A N     1 
ATOM   5067 C  CA    . LEU A 1 618 ? 15.365  11.007  6.105   1.00 33.34  ? 618  LEU A CA    1 
ATOM   5068 C  C     . LEU A 1 618 ? 14.999  10.311  7.409   1.00 33.20  ? 618  LEU A C     1 
ATOM   5069 O  O     . LEU A 1 618 ? 15.846  9.748   8.094   1.00 29.46  ? 618  LEU A O     1 
ATOM   5070 C  CB    . LEU A 1 618 ? 15.869  12.426  6.384   1.00 33.68  ? 618  LEU A CB    1 
ATOM   5071 C  CG    . LEU A 1 618 ? 14.944  13.407  7.127   1.00 34.10  ? 618  LEU A CG    1 
ATOM   5072 C  CD1   . LEU A 1 618 ? 15.378  13.527  8.548   1.00 34.66  ? 618  LEU A CD1   1 
ATOM   5073 C  CD2   . LEU A 1 618 ? 14.947  14.794  6.481   1.00 38.92  ? 618  LEU A CD2   1 
ATOM   5074 N  N     . TYR A 1 619 ? 13.718  10.360  7.745   1.00 33.97  ? 619  TYR A N     1 
ATOM   5075 C  CA    . TYR A 1 619 ? 13.265  9.842   9.009   1.00 32.31  ? 619  TYR A CA    1 
ATOM   5076 C  C     . TYR A 1 619 ? 11.805  9.501   8.923   1.00 32.99  ? 619  TYR A C     1 
ATOM   5077 O  O     . TYR A 1 619 ? 11.072  10.034  8.076   1.00 30.60  ? 619  TYR A O     1 
ATOM   5078 C  CB    . TYR A 1 619 ? 13.483  10.897  10.095  1.00 31.98  ? 619  TYR A CB    1 
ATOM   5079 C  CG    . TYR A 1 619 ? 13.112  10.458  11.493  1.00 28.88  ? 619  TYR A CG    1 
ATOM   5080 C  CD1   . TYR A 1 619 ? 12.073  11.085  12.192  1.00 21.98  ? 619  TYR A CD1   1 
ATOM   5081 C  CD2   . TYR A 1 619 ? 13.804  9.422   12.120  1.00 25.56  ? 619  TYR A CD2   1 
ATOM   5082 C  CE1   . TYR A 1 619 ? 11.744  10.687  13.482  1.00 25.19  ? 619  TYR A CE1   1 
ATOM   5083 C  CE2   . TYR A 1 619 ? 13.484  9.027   13.406  1.00 25.21  ? 619  TYR A CE2   1 
ATOM   5084 C  CZ    . TYR A 1 619 ? 12.461  9.653   14.078  1.00 22.52  ? 619  TYR A CZ    1 
ATOM   5085 O  OH    . TYR A 1 619 ? 12.168  9.246   15.351  1.00 30.39  ? 619  TYR A OH    1 
ATOM   5086 N  N     . GLY A 1 620 ? 11.395  8.621   9.830   1.00 33.13  ? 620  GLY A N     1 
ATOM   5087 C  CA    . GLY A 1 620 ? 10.011  8.235   9.992   1.00 32.37  ? 620  GLY A CA    1 
ATOM   5088 C  C     . GLY A 1 620 ? 9.808   7.588   11.347  1.00 33.45  ? 620  GLY A C     1 
ATOM   5089 O  O     . GLY A 1 620 ? 10.669  6.843   11.834  1.00 32.61  ? 620  GLY A O     1 
ATOM   5090 N  N     . ASP A 1 621 ? 8.662   7.881   11.953  1.00 32.66  ? 621  ASP A N     1 
ATOM   5091 C  CA    . ASP A 1 621 ? 8.287   7.298   13.221  1.00 33.02  ? 621  ASP A CA    1 
ATOM   5092 C  C     . ASP A 1 621 ? 6.785   7.007   13.237  1.00 33.25  ? 621  ASP A C     1 
ATOM   5093 O  O     . ASP A 1 621 ? 5.973   7.927   13.193  1.00 32.82  ? 621  ASP A O     1 
ATOM   5094 C  CB    . ASP A 1 621 ? 8.680   8.240   14.360  1.00 34.60  ? 621  ASP A CB    1 
ATOM   5095 C  CG    . ASP A 1 621 ? 8.349   7.677   15.743  1.00 36.07  ? 621  ASP A CG    1 
ATOM   5096 O  OD1   . ASP A 1 621 ? 7.600   6.678   15.852  1.00 34.96  ? 621  ASP A OD1   1 
ATOM   5097 O  OD2   . ASP A 1 621 ? 8.840   8.260   16.727  1.00 33.45  ? 621  ASP A OD2   1 
ATOM   5098 N  N     . THR A 1 622 ? 6.436   5.720   13.294  1.00 32.90  ? 622  THR A N     1 
ATOM   5099 C  CA    . THR A 1 622 ? 5.039   5.247   13.375  1.00 32.48  ? 622  THR A CA    1 
ATOM   5100 C  C     . THR A 1 622 ? 4.189   5.522   12.130  1.00 34.87  ? 622  THR A C     1 
ATOM   5101 O  O     . THR A 1 622 ? 3.804   4.581   11.428  1.00 35.39  ? 622  THR A O     1 
ATOM   5102 C  CB    . THR A 1 622 ? 4.294   5.796   14.621  1.00 30.48  ? 622  THR A CB    1 
ATOM   5103 O  OG1   . THR A 1 622 ? 5.085   5.576   15.800  1.00 35.74  ? 622  THR A OG1   1 
ATOM   5104 C  CG2   . THR A 1 622 ? 2.958   5.106   14.781  1.00 31.09  ? 622  THR A CG2   1 
ATOM   5105 N  N     . ASP A 1 623 ? 3.913   6.804   11.869  1.00 34.26  ? 623  ASP A N     1 
ATOM   5106 C  CA    . ASP A 1 623 ? 2.902   7.216   10.903  1.00 35.25  ? 623  ASP A CA    1 
ATOM   5107 C  C     . ASP A 1 623 ? 3.276   8.495   10.158  1.00 36.69  ? 623  ASP A C     1 
ATOM   5108 O  O     . ASP A 1 623 ? 2.459   9.055   9.425   1.00 35.26  ? 623  ASP A O     1 
ATOM   5109 C  CB    . ASP A 1 623 ? 1.574   7.451   11.623  1.00 35.28  ? 623  ASP A CB    1 
ATOM   5110 C  CG    . ASP A 1 623 ? 1.543   8.760   12.395  1.00 35.41  ? 623  ASP A CG    1 
ATOM   5111 O  OD1   . ASP A 1 623 ? 0.448   9.339   12.522  1.00 38.86  ? 623  ASP A OD1   1 
ATOM   5112 O  OD2   . ASP A 1 623 ? 2.595   9.222   12.883  1.00 38.73  ? 623  ASP A OD2   1 
ATOM   5113 N  N     . SER A 1 624 ? 4.496   8.971   10.374  1.00 35.92  ? 624  SER A N     1 
ATOM   5114 C  CA    . SER A 1 624 ? 4.933   10.211  9.761   1.00 36.67  ? 624  SER A CA    1 
ATOM   5115 C  C     . SER A 1 624 ? 6.269   10.015  9.069   1.00 36.32  ? 624  SER A C     1 
ATOM   5116 O  O     . SER A 1 624 ? 7.120   9.274   9.563   1.00 38.09  ? 624  SER A O     1 
ATOM   5117 C  CB    . SER A 1 624 ? 5.075   11.289  10.828  1.00 37.23  ? 624  SER A CB    1 
ATOM   5118 O  OG    . SER A 1 624 ? 6.177   10.980  11.660  1.00 41.50  ? 624  SER A OG    1 
ATOM   5119 N  N     . ILE A 1 625 ? 6.446   10.683  7.934   1.00 33.01  ? 625  ILE A N     1 
ATOM   5120 C  CA    . ILE A 1 625 ? 7.724   10.691  7.230   1.00 32.36  ? 625  ILE A CA    1 
ATOM   5121 C  C     . ILE A 1 625 ? 8.293   12.116  7.151   1.00 31.90  ? 625  ILE A C     1 
ATOM   5122 O  O     . ILE A 1 625 ? 7.546   13.095  7.146   1.00 31.41  ? 625  ILE A O     1 
ATOM   5123 C  CB    . ILE A 1 625 ? 7.626   10.061  5.804   1.00 33.00  ? 625  ILE A CB    1 
ATOM   5124 C  CG1   . ILE A 1 625 ? 6.498   10.697  4.984   1.00 31.37  ? 625  ILE A CG1   1 
ATOM   5125 C  CG2   . ILE A 1 625 ? 7.440   8.547   5.884   1.00 34.49  ? 625  ILE A CG2   1 
ATOM   5126 C  CD1   . ILE A 1 625 ? 6.680   10.549  3.481   1.00 29.21  ? 625  ILE A CD1   1 
ATOM   5127 N  N     . TYR A 1 626 ? 9.617   12.225  7.095   1.00 32.44  ? 626  TYR A N     1 
ATOM   5128 C  CA    . TYR A 1 626 ? 10.278  13.520  6.971   1.00 31.55  ? 626  TYR A CA    1 
ATOM   5129 C  C     . TYR A 1 626 ? 11.101  13.554  5.702   1.00 32.73  ? 626  TYR A C     1 
ATOM   5130 O  O     . TYR A 1 626 ? 11.989  12.721  5.508   1.00 31.85  ? 626  TYR A O     1 
ATOM   5131 C  CB    . TYR A 1 626 ? 11.138  13.813  8.203   1.00 32.22  ? 626  TYR A CB    1 
ATOM   5132 C  CG    . TYR A 1 626 ? 10.292  14.038  9.417   1.00 29.76  ? 626  TYR A CG    1 
ATOM   5133 C  CD1   . TYR A 1 626 ? 9.711   12.964  10.080  1.00 29.25  ? 626  TYR A CD1   1 
ATOM   5134 C  CD2   . TYR A 1 626 ? 10.037  15.324  9.891   1.00 31.84  ? 626  TYR A CD2   1 
ATOM   5135 C  CE1   . TYR A 1 626 ? 8.905   13.155  11.184  1.00 26.84  ? 626  TYR A CE1   1 
ATOM   5136 C  CE2   . TYR A 1 626 ? 9.232   15.525  11.006  1.00 30.03  ? 626  TYR A CE2   1 
ATOM   5137 C  CZ    . TYR A 1 626 ? 8.669   14.426  11.645  1.00 30.92  ? 626  TYR A CZ    1 
ATOM   5138 O  OH    . TYR A 1 626 ? 7.859   14.581  12.749  1.00 36.41  ? 626  TYR A OH    1 
ATOM   5139 N  N     . VAL A 1 627 ? 10.771  14.511  4.833   1.00 33.10  ? 627  VAL A N     1 
ATOM   5140 C  CA    . VAL A 1 627 ? 11.332  14.587  3.492   1.00 33.98  ? 627  VAL A CA    1 
ATOM   5141 C  C     . VAL A 1 627 ? 12.266  15.784  3.341   1.00 35.13  ? 627  VAL A C     1 
ATOM   5142 O  O     . VAL A 1 627 ? 11.906  16.922  3.651   1.00 37.46  ? 627  VAL A O     1 
ATOM   5143 C  CB    . VAL A 1 627 ? 10.218  14.660  2.412   1.00 36.81  ? 627  VAL A CB    1 
ATOM   5144 C  CG1   . VAL A 1 627 ? 10.811  14.581  1.005   1.00 37.84  ? 627  VAL A CG1   1 
ATOM   5145 C  CG2   . VAL A 1 627 ? 9.211   13.536  2.597   1.00 36.62  ? 627  VAL A CG2   1 
ATOM   5146 N  N     . SER A 1 628 ? 13.473  15.504  2.870   1.00 35.86  ? 628  SER A N     1 
ATOM   5147 C  CA    . SER A 1 628 ? 14.434  16.530  2.491   1.00 36.94  ? 628  SER A CA    1 
ATOM   5148 C  C     . SER A 1 628 ? 13.944  17.262  1.251   1.00 36.42  ? 628  SER A C     1 
ATOM   5149 O  O     . SER A 1 628 ? 13.636  16.640  0.235   1.00 37.56  ? 628  SER A O     1 
ATOM   5150 C  CB    . SER A 1 628 ? 15.791  15.888  2.210   1.00 37.97  ? 628  SER A CB    1 
ATOM   5151 O  OG    . SER A 1 628 ? 16.802  16.868  2.076   1.00 41.61  ? 628  SER A OG    1 
ATOM   5152 N  N     . ALA A 1 629 ? 13.877  18.584  1.344   1.00 36.99  ? 629  ALA A N     1 
ATOM   5153 C  CA    . ALA A 1 629 ? 13.322  19.421  0.279   1.00 38.07  ? 629  ALA A CA    1 
ATOM   5154 C  C     . ALA A 1 629 ? 14.401  20.305  -0.349  1.00 37.74  ? 629  ALA A C     1 
ATOM   5155 O  O     . ALA A 1 629 ? 14.118  21.135  -1.223  1.00 37.03  ? 629  ALA A O     1 
ATOM   5156 C  CB    . ALA A 1 629 ? 12.169  20.269  0.820   1.00 37.41  ? 629  ALA A CB    1 
ATOM   5157 N  N     . ASP A 1 630 ? 15.638  20.103  0.099   1.00 38.27  ? 630  ASP A N     1 
ATOM   5158 C  CA    . ASP A 1 630 ? 16.804  20.789  -0.439  1.00 39.63  ? 630  ASP A CA    1 
ATOM   5159 C  C     . ASP A 1 630 ? 16.783  20.839  -1.964  1.00 42.50  ? 630  ASP A C     1 
ATOM   5160 O  O     . ASP A 1 630 ? 16.812  21.923  -2.558  1.00 43.43  ? 630  ASP A O     1 
ATOM   5161 C  CB    . ASP A 1 630 ? 18.082  20.091  0.036   1.00 40.37  ? 630  ASP A CB    1 
ATOM   5162 C  CG    . ASP A 1 630 ? 18.424  20.402  1.484   1.00 43.89  ? 630  ASP A CG    1 
ATOM   5163 O  OD1   . ASP A 1 630 ? 17.520  20.791  2.264   1.00 36.15  ? 630  ASP A OD1   1 
ATOM   5164 O  OD2   . ASP A 1 630 ? 19.615  20.259  1.840   1.00 48.86  ? 630  ASP A OD2   1 
ATOM   5165 N  N     . LYS A 1 631 ? 16.722  19.663  -2.588  1.00 42.02  ? 631  LYS A N     1 
ATOM   5166 C  CA    . LYS A 1 631 ? 16.757  19.561  -4.044  1.00 45.49  ? 631  LYS A CA    1 
ATOM   5167 C  C     . LYS A 1 631 ? 15.593  20.289  -4.710  1.00 45.52  ? 631  LYS A C     1 
ATOM   5168 O  O     . LYS A 1 631 ? 15.761  20.862  -5.785  1.00 47.47  ? 631  LYS A O     1 
ATOM   5169 C  CB    . LYS A 1 631 ? 16.828  18.101  -4.505  1.00 45.21  ? 631  LYS A CB    1 
ATOM   5170 C  CG    . LYS A 1 631 ? 18.195  17.458  -4.295  1.00 46.08  ? 631  LYS A CG    1 
ATOM   5171 C  CD    . LYS A 1 631 ? 18.121  15.941  -4.447  1.00 51.02  ? 631  LYS A CD    1 
ATOM   5172 C  CE    . LYS A 1 631 ? 19.506  15.302  -4.462  1.00 54.86  ? 631  LYS A CE    1 
ATOM   5173 N  NZ    . LYS A 1 631 ? 20.264  15.572  -3.204  1.00 56.38  ? 631  LYS A NZ    1 
ATOM   5174 N  N     . ILE A 1 632 ? 14.432  20.291  -4.057  1.00 45.10  ? 632  ILE A N     1 
ATOM   5175 C  CA    . ILE A 1 632 ? 13.242  20.958  -4.602  1.00 45.60  ? 632  ILE A CA    1 
ATOM   5176 C  C     . ILE A 1 632 ? 13.447  22.467  -4.624  1.00 46.22  ? 632  ILE A C     1 
ATOM   5177 O  O     . ILE A 1 632 ? 13.218  23.114  -5.650  1.00 47.87  ? 632  ILE A O     1 
ATOM   5178 C  CB    . ILE A 1 632 ? 11.948  20.586  -3.824  1.00 44.39  ? 632  ILE A CB    1 
ATOM   5179 C  CG1   . ILE A 1 632 ? 11.772  19.063  -3.750  1.00 42.57  ? 632  ILE A CG1   1 
ATOM   5180 C  CG2   . ILE A 1 632 ? 10.715  21.274  -4.433  1.00 42.93  ? 632  ILE A CG2   1 
ATOM   5181 C  CD1   . ILE A 1 632 ? 11.804  18.344  -5.097  1.00 47.62  ? 632  ILE A CD1   1 
ATOM   5182 N  N     . ILE A 1 633 ? 13.894  23.012  -3.493  1.00 45.42  ? 633  ILE A N     1 
ATOM   5183 C  CA    . ILE A 1 633 ? 14.267  24.417  -3.402  1.00 46.15  ? 633  ILE A CA    1 
ATOM   5184 C  C     . ILE A 1 633 ? 15.364  24.766  -4.418  1.00 48.40  ? 633  ILE A C     1 
ATOM   5185 O  O     . ILE A 1 633 ? 15.289  25.800  -5.078  1.00 48.98  ? 633  ILE A O     1 
ATOM   5186 C  CB    . ILE A 1 633 ? 14.717  24.799  -1.963  1.00 44.43  ? 633  ILE A CB    1 
ATOM   5187 C  CG1   . ILE A 1 633 ? 13.523  24.813  -0.994  1.00 42.86  ? 633  ILE A CG1   1 
ATOM   5188 C  CG2   . ILE A 1 633 ? 15.462  26.143  -1.944  1.00 43.83  ? 633  ILE A CG2   1 
ATOM   5189 C  CD1   . ILE A 1 633 ? 12.442  25.830  -1.329  1.00 43.33  ? 633  ILE A CD1   1 
ATOM   5190 N  N     . ASP A 1 634 ? 16.361  23.892  -4.549  1.00 49.13  ? 634  ASP A N     1 
ATOM   5191 C  CA    . ASP A 1 634 ? 17.510  24.151  -5.415  1.00 51.53  ? 634  ASP A CA    1 
ATOM   5192 C  C     . ASP A 1 634 ? 17.165  24.163  -6.903  1.00 53.49  ? 634  ASP A C     1 
ATOM   5193 O  O     . ASP A 1 634 ? 17.789  24.894  -7.674  1.00 55.07  ? 634  ASP A O     1 
ATOM   5194 C  CB    . ASP A 1 634 ? 18.643  23.154  -5.140  1.00 51.57  ? 634  ASP A CB    1 
ATOM   5195 C  CG    . ASP A 1 634 ? 19.416  23.470  -3.858  1.00 52.93  ? 634  ASP A CG    1 
ATOM   5196 O  OD1   . ASP A 1 634 ? 19.143  24.502  -3.207  1.00 51.89  ? 634  ASP A OD1   1 
ATOM   5197 O  OD2   . ASP A 1 634 ? 20.306  22.674  -3.498  1.00 54.88  ? 634  ASP A OD2   1 
ATOM   5198 N  N     . LYS A 1 635 ? 16.175  23.360  -7.294  1.00 52.83  ? 635  LYS A N     1 
ATOM   5199 C  CA    . LYS A 1 635 ? 15.751  23.258  -8.690  1.00 55.15  ? 635  LYS A CA    1 
ATOM   5200 C  C     . LYS A 1 635 ? 15.233  24.580  -9.255  1.00 54.98  ? 635  LYS A C     1 
ATOM   5201 O  O     . LYS A 1 635 ? 15.290  24.804  -10.459 1.00 54.39  ? 635  LYS A O     1 
ATOM   5202 C  CB    . LYS A 1 635 ? 14.701  22.154  -8.869  1.00 56.31  ? 635  LYS A CB    1 
ATOM   5203 C  CG    . LYS A 1 635 ? 15.272  20.825  -9.343  1.00 61.88  ? 635  LYS A CG    1 
ATOM   5204 C  CD    . LYS A 1 635 ? 14.179  19.770  -9.518  1.00 66.14  ? 635  LYS A CD    1 
ATOM   5205 C  CE    . LYS A 1 635 ? 14.641  18.623  -10.414 1.00 71.34  ? 635  LYS A CE    1 
ATOM   5206 N  NZ    . LYS A 1 635 ? 14.678  18.990  -11.871 1.00 73.15  ? 635  LYS A NZ    1 
ATOM   5207 N  N     . VAL A 1 636 ? 14.725  25.448  -8.385  1.00 55.20  ? 636  VAL A N     1 
ATOM   5208 C  CA    . VAL A 1 636 ? 14.303  26.778  -8.810  1.00 56.37  ? 636  VAL A CA    1 
ATOM   5209 C  C     . VAL A 1 636 ? 15.384  27.803  -8.458  1.00 57.23  ? 636  VAL A C     1 
ATOM   5210 O  O     . VAL A 1 636 ? 15.533  28.822  -9.143  1.00 58.07  ? 636  VAL A O     1 
ATOM   5211 C  CB    . VAL A 1 636 ? 12.906  27.185  -8.242  1.00 56.24  ? 636  VAL A CB    1 
ATOM   5212 C  CG1   . VAL A 1 636 ? 12.095  25.964  -7.820  1.00 54.45  ? 636  VAL A CG1   1 
ATOM   5213 C  CG2   . VAL A 1 636 ? 13.028  28.171  -7.108  1.00 55.31  ? 636  VAL A CG2   1 
ATOM   5214 N  N     . GLY A 1 637 ? 16.147  27.507  -7.408  1.00 54.83  ? 637  GLY A N     1 
ATOM   5215 C  CA    . GLY A 1 637 ? 17.221  28.381  -6.956  1.00 56.56  ? 637  GLY A CA    1 
ATOM   5216 C  C     . GLY A 1 637 ? 16.721  29.354  -5.912  1.00 56.33  ? 637  GLY A C     1 
ATOM   5217 O  O     . GLY A 1 637 ? 15.660  29.952  -6.080  1.00 56.54  ? 637  GLY A O     1 
ATOM   5218 N  N     . GLU A 1 638 ? 17.485  29.510  -4.834  1.00 56.39  ? 638  GLU A N     1 
ATOM   5219 C  CA    . GLU A 1 638 ? 17.098  30.390  -3.728  1.00 58.14  ? 638  GLU A CA    1 
ATOM   5220 C  C     . GLU A 1 638 ? 16.907  31.841  -4.173  1.00 59.09  ? 638  GLU A C     1 
ATOM   5221 O  O     . GLU A 1 638 ? 15.968  32.510  -3.737  1.00 59.29  ? 638  GLU A O     1 
ATOM   5222 C  CB    . GLU A 1 638 ? 18.102  30.298  -2.567  1.00 58.01  ? 638  GLU A CB    1 
ATOM   5223 C  CG    . GLU A 1 638 ? 17.924  29.051  -1.685  1.00 59.89  ? 638  GLU A CG    1 
ATOM   5224 C  CD    . GLU A 1 638 ? 18.881  28.996  -0.495  1.00 63.14  ? 638  GLU A CD    1 
ATOM   5225 O  OE1   . GLU A 1 638 ? 18.601  28.248  0.470   1.00 60.86  ? 638  GLU A OE1   1 
ATOM   5226 O  OE2   . GLU A 1 638 ? 19.915  29.696  -0.520  1.00 68.01  ? 638  GLU A OE2   1 
ATOM   5227 N  N     . SER A 1 639 ? 17.786  32.298  -5.064  1.00 60.60  ? 639  SER A N     1 
ATOM   5228 C  CA    . SER A 1 639 ? 17.809  33.678  -5.562  1.00 60.85  ? 639  SER A CA    1 
ATOM   5229 C  C     . SER A 1 639 ? 16.509  34.125  -6.222  1.00 60.55  ? 639  SER A C     1 
ATOM   5230 O  O     . SER A 1 639 ? 16.297  35.323  -6.433  1.00 60.55  ? 639  SER A O     1 
ATOM   5231 C  CB    . SER A 1 639 ? 18.957  33.855  -6.566  1.00 62.69  ? 639  SER A CB    1 
ATOM   5232 O  OG    . SER A 1 639 ? 20.185  33.406  -6.027  1.00 63.72  ? 639  SER A OG    1 
ATOM   5233 N  N     . LYS A 1 640 ? 15.653  33.167  -6.562  1.00 59.95  ? 640  LYS A N     1 
ATOM   5234 C  CA    . LYS A 1 640 ? 14.379  33.469  -7.216  1.00 60.84  ? 640  LYS A CA    1 
ATOM   5235 C  C     . LYS A 1 640 ? 13.258  33.809  -6.227  1.00 59.42  ? 640  LYS A C     1 
ATOM   5236 O  O     . LYS A 1 640 ? 12.187  34.266  -6.638  1.00 59.64  ? 640  LYS A O     1 
ATOM   5237 C  CB    . LYS A 1 640 ? 13.964  32.325  -8.157  1.00 62.68  ? 640  LYS A CB    1 
ATOM   5238 C  CG    . LYS A 1 640 ? 14.211  32.573  -9.657  1.00 67.30  ? 640  LYS A CG    1 
ATOM   5239 C  CD    . LYS A 1 640 ? 15.652  33.012  -9.987  1.00 72.48  ? 640  LYS A CD    1 
ATOM   5240 C  CE    . LYS A 1 640 ? 16.595  31.829  -10.226 1.00 74.28  ? 640  LYS A CE    1 
ATOM   5241 N  NZ    . LYS A 1 640 ? 16.395  31.183  -11.561 1.00 74.78  ? 640  LYS A NZ    1 
ATOM   5242 N  N     . PHE A 1 641 ? 13.511  33.596  -4.933  1.00 56.93  ? 641  PHE A N     1 
ATOM   5243 C  CA    . PHE A 1 641 ? 12.516  33.876  -3.886  1.00 54.00  ? 641  PHE A CA    1 
ATOM   5244 C  C     . PHE A 1 641 ? 12.639  35.278  -3.315  1.00 53.80  ? 641  PHE A C     1 
ATOM   5245 O  O     . PHE A 1 641 ? 13.740  35.768  -3.067  1.00 54.05  ? 641  PHE A O     1 
ATOM   5246 C  CB    . PHE A 1 641 ? 12.576  32.837  -2.758  1.00 51.20  ? 641  PHE A CB    1 
ATOM   5247 C  CG    . PHE A 1 641 ? 12.265  31.444  -3.211  1.00 48.07  ? 641  PHE A CG    1 
ATOM   5248 C  CD1   . PHE A 1 641 ? 13.281  30.507  -3.361  1.00 45.04  ? 641  PHE A CD1   1 
ATOM   5249 C  CD2   . PHE A 1 641 ? 10.957  31.076  -3.525  1.00 47.07  ? 641  PHE A CD2   1 
ATOM   5250 C  CE1   . PHE A 1 641 ? 13.003  29.220  -3.806  1.00 43.64  ? 641  PHE A CE1   1 
ATOM   5251 C  CE2   . PHE A 1 641 ? 10.665  29.784  -3.970  1.00 44.17  ? 641  PHE A CE2   1 
ATOM   5252 C  CZ    . PHE A 1 641 ? 11.691  28.853  -4.105  1.00 41.94  ? 641  PHE A CZ    1 
ATOM   5253 N  N     . ARG A 1 642 ? 11.492  35.914  -3.117  1.00 54.48  ? 642  ARG A N     1 
ATOM   5254 C  CA    . ARG A 1 642 ? 11.427  37.269  -2.589  1.00 55.69  ? 642  ARG A CA    1 
ATOM   5255 C  C     . ARG A 1 642 ? 11.759  37.295  -1.105  1.00 53.86  ? 642  ARG A C     1 
ATOM   5256 O  O     . ARG A 1 642 ? 12.537  38.139  -0.653  1.00 54.70  ? 642  ARG A O     1 
ATOM   5257 C  CB    . ARG A 1 642 ? 10.037  37.862  -2.835  1.00 58.59  ? 642  ARG A CB    1 
ATOM   5258 C  CG    . ARG A 1 642 ? 9.761   38.186  -4.299  1.00 65.11  ? 642  ARG A CG    1 
ATOM   5259 C  CD    . ARG A 1 642 ? 8.317   38.617  -4.537  1.00 68.99  ? 642  ARG A CD    1 
ATOM   5260 N  NE    . ARG A 1 642 ? 7.391   37.485  -4.584  1.00 71.12  ? 642  ARG A NE    1 
ATOM   5261 C  CZ    . ARG A 1 642 ? 6.481   37.211  -3.652  1.00 71.03  ? 642  ARG A CZ    1 
ATOM   5262 N  NH1   . ARG A 1 642 ? 6.362   37.984  -2.578  1.00 72.58  ? 642  ARG A NH1   1 
ATOM   5263 N  NH2   . ARG A 1 642 ? 5.682   36.161  -3.795  1.00 67.75  ? 642  ARG A NH2   1 
ATOM   5264 N  N     . ASP A 1 643 ? 11.164  36.361  -0.361  1.00 50.71  ? 643  ASP A N     1 
ATOM   5265 C  CA    . ASP A 1 643 ? 11.363  36.228  1.078   1.00 47.84  ? 643  ASP A CA    1 
ATOM   5266 C  C     . ASP A 1 643 ? 11.041  34.797  1.545   1.00 46.64  ? 643  ASP A C     1 
ATOM   5267 O  O     . ASP A 1 643 ? 10.690  33.937  0.736   1.00 46.26  ? 643  ASP A O     1 
ATOM   5268 C  CB    . ASP A 1 643 ? 10.508  37.254  1.834   1.00 47.25  ? 643  ASP A CB    1 
ATOM   5269 C  CG    . ASP A 1 643 ? 9.054   37.265  1.378   1.00 49.58  ? 643  ASP A CG    1 
ATOM   5270 O  OD1   . ASP A 1 643 ? 8.557   36.247  0.843   1.00 50.94  ? 643  ASP A OD1   1 
ATOM   5271 O  OD2   . ASP A 1 643 ? 8.394   38.305  1.561   1.00 52.06  ? 643  ASP A OD2   1 
ATOM   5272 N  N     . THR A 1 644 ? 11.150  34.557  2.850   1.00 43.97  ? 644  THR A N     1 
ATOM   5273 C  CA    . THR A 1 644 ? 10.875  33.245  3.424   1.00 41.80  ? 644  THR A CA    1 
ATOM   5274 C  C     . THR A 1 644 ? 9.479   32.773  3.024   1.00 43.02  ? 644  THR A C     1 
ATOM   5275 O  O     . THR A 1 644 ? 9.322   31.684  2.454   1.00 41.83  ? 644  THR A O     1 
ATOM   5276 C  CB    . THR A 1 644 ? 11.022  33.257  4.971   1.00 41.26  ? 644  THR A CB    1 
ATOM   5277 O  OG1   . THR A 1 644 ? 12.319  33.753  5.335   1.00 35.73  ? 644  THR A OG1   1 
ATOM   5278 C  CG2   . THR A 1 644 ? 10.840  31.858  5.551   1.00 38.40  ? 644  THR A CG2   1 
ATOM   5279 N  N     . ASN A 1 645 ? 8.478   33.611  3.289   1.00 42.38  ? 645  ASN A N     1 
ATOM   5280 C  CA    . ASN A 1 645 ? 7.088   33.272  3.010   1.00 44.28  ? 645  ASN A CA    1 
ATOM   5281 C  C     . ASN A 1 645 ? 6.858   32.766  1.583   1.00 44.16  ? 645  ASN A C     1 
ATOM   5282 O  O     . ASN A 1 645 ? 5.963   31.951  1.352   1.00 45.39  ? 645  ASN A O     1 
ATOM   5283 C  CB    . ASN A 1 645 ? 6.168   34.458  3.314   1.00 46.48  ? 645  ASN A CB    1 
ATOM   5284 C  CG    . ASN A 1 645 ? 4.771   34.020  3.730   1.00 50.64  ? 645  ASN A CG    1 
ATOM   5285 O  OD1   . ASN A 1 645 ? 4.610   33.181  4.618   1.00 49.47  ? 645  ASN A OD1   1 
ATOM   5286 N  ND2   . ASN A 1 645 ? 3.753   34.587  3.085   1.00 50.08  ? 645  ASN A ND2   1 
ATOM   5287 N  N     . HIS A 1 646 ? 7.682   33.240  0.645   1.00 43.33  ? 646  HIS A N     1 
ATOM   5288 C  CA    . HIS A 1 646 ? 7.621   32.827  -0.760  1.00 41.71  ? 646  HIS A CA    1 
ATOM   5289 C  C     . HIS A 1 646 ? 8.009   31.358  -0.971  1.00 39.50  ? 646  HIS A C     1 
ATOM   5290 O  O     . HIS A 1 646 ? 7.223   30.590  -1.542  1.00 38.27  ? 646  HIS A O     1 
ATOM   5291 C  CB    . HIS A 1 646 ? 8.459   33.772  -1.631  1.00 44.94  ? 646  HIS A CB    1 
ATOM   5292 C  CG    . HIS A 1 646 ? 8.277   33.578  -3.107  1.00 47.55  ? 646  HIS A CG    1 
ATOM   5293 N  ND1   . HIS A 1 646 ? 9.099   34.181  -4.038  1.00 50.67  ? 646  HIS A ND1   1 
ATOM   5294 C  CD2   . HIS A 1 646 ? 7.385   32.843  -3.815  1.00 45.76  ? 646  HIS A CD2   1 
ATOM   5295 C  CE1   . HIS A 1 646 ? 8.717   33.834  -5.253  1.00 46.99  ? 646  HIS A CE1   1 
ATOM   5296 N  NE2   . HIS A 1 646 ? 7.682   33.019  -5.145  1.00 52.10  ? 646  HIS A NE2   1 
ATOM   5297 N  N     . TRP A 1 647 ? 9.190   30.950  -0.506  1.00 38.93  ? 647  TRP A N     1 
ATOM   5298 C  CA    . TRP A 1 647 ? 9.545   29.520  -0.586  1.00 39.25  ? 647  TRP A CA    1 
ATOM   5299 C  C     . TRP A 1 647 ? 8.624   28.618  0.251   1.00 39.29  ? 647  TRP A C     1 
ATOM   5300 O  O     . TRP A 1 647 ? 8.365   27.472  -0.127  1.00 39.99  ? 647  TRP A O     1 
ATOM   5301 C  CB    . TRP A 1 647 ? 11.045  29.229  -0.352  1.00 40.91  ? 647  TRP A CB    1 
ATOM   5302 C  CG    . TRP A 1 647 ? 11.615  29.405  1.063   1.00 40.01  ? 647  TRP A CG    1 
ATOM   5303 C  CD1   . TRP A 1 647 ? 12.424  30.425  1.496   1.00 41.65  ? 647  TRP A CD1   1 
ATOM   5304 C  CD2   . TRP A 1 647 ? 11.477  28.508  2.182   1.00 38.00  ? 647  TRP A CD2   1 
ATOM   5305 N  NE1   . TRP A 1 647 ? 12.770  30.236  2.818   1.00 39.05  ? 647  TRP A NE1   1 
ATOM   5306 C  CE2   . TRP A 1 647 ? 12.201  29.072  3.264   1.00 38.35  ? 647  TRP A CE2   1 
ATOM   5307 C  CE3   . TRP A 1 647 ? 10.798  27.298  2.383   1.00 35.83  ? 647  TRP A CE3   1 
ATOM   5308 C  CZ2   . TRP A 1 647 ? 12.262  28.466  4.525   1.00 39.07  ? 647  TRP A CZ2   1 
ATOM   5309 C  CZ3   . TRP A 1 647 ? 10.855  26.695  3.638   1.00 35.24  ? 647  TRP A CZ3   1 
ATOM   5310 C  CH2   . TRP A 1 647 ? 11.585  27.278  4.692   1.00 38.94  ? 647  TRP A CH2   1 
ATOM   5311 N  N     . VAL A 1 648 ? 8.109   29.146  1.362   1.00 38.88  ? 648  VAL A N     1 
ATOM   5312 C  CA    . VAL A 1 648 ? 7.138   28.412  2.171   1.00 37.89  ? 648  VAL A CA    1 
ATOM   5313 C  C     . VAL A 1 648 ? 5.830   28.168  1.397   1.00 39.54  ? 648  VAL A C     1 
ATOM   5314 O  O     . VAL A 1 648 ? 5.271   27.077  1.467   1.00 41.96  ? 648  VAL A O     1 
ATOM   5315 C  CB    . VAL A 1 648 ? 6.886   29.091  3.536   1.00 36.07  ? 648  VAL A CB    1 
ATOM   5316 C  CG1   . VAL A 1 648 ? 5.829   28.330  4.323   1.00 33.99  ? 648  VAL A CG1   1 
ATOM   5317 C  CG2   . VAL A 1 648 ? 8.184   29.166  4.341   1.00 33.91  ? 648  VAL A CG2   1 
ATOM   5318 N  N     . ASP A 1 649 ? 5.357   29.172  0.658   1.00 41.77  ? 649  ASP A N     1 
ATOM   5319 C  CA    . ASP A 1 649 ? 4.219   28.997  -0.258  1.00 43.43  ? 649  ASP A CA    1 
ATOM   5320 C  C     . ASP A 1 649 ? 4.581   28.031  -1.367  1.00 42.43  ? 649  ASP A C     1 
ATOM   5321 O  O     . ASP A 1 649 ? 3.770   27.191  -1.764  1.00 42.38  ? 649  ASP A O     1 
ATOM   5322 C  CB    . ASP A 1 649 ? 3.781   30.333  -0.885  1.00 46.85  ? 649  ASP A CB    1 
ATOM   5323 C  CG    . ASP A 1 649 ? 2.981   31.202  0.071   1.00 50.05  ? 649  ASP A CG    1 
ATOM   5324 O  OD1   . ASP A 1 649 ? 2.220   30.662  0.903   1.00 54.96  ? 649  ASP A OD1   1 
ATOM   5325 O  OD2   . ASP A 1 649 ? 3.109   32.435  -0.017  1.00 56.69  ? 649  ASP A OD2   1 
ATOM   5326 N  N     . PHE A 1 650 ? 5.806   28.151  -1.867  1.00 42.46  ? 650  PHE A N     1 
ATOM   5327 C  CA    . PHE A 1 650 ? 6.271   27.256  -2.911  1.00 42.40  ? 650  PHE A CA    1 
ATOM   5328 C  C     . PHE A 1 650 ? 6.191   25.793  -2.468  1.00 41.79  ? 650  PHE A C     1 
ATOM   5329 O  O     . PHE A 1 650 ? 5.647   24.960  -3.195  1.00 42.39  ? 650  PHE A O     1 
ATOM   5330 C  CB    . PHE A 1 650 ? 7.685   27.616  -3.375  1.00 42.02  ? 650  PHE A CB    1 
ATOM   5331 C  CG    . PHE A 1 650 ? 8.273   26.612  -4.309  1.00 44.06  ? 650  PHE A CG    1 
ATOM   5332 C  CD1   . PHE A 1 650 ? 7.746   26.442  -5.587  1.00 45.29  ? 650  PHE A CD1   1 
ATOM   5333 C  CD2   . PHE A 1 650 ? 9.336   25.810  -3.906  1.00 45.22  ? 650  PHE A CD2   1 
ATOM   5334 C  CE1   . PHE A 1 650 ? 8.278   25.496  -6.459  1.00 48.97  ? 650  PHE A CE1   1 
ATOM   5335 C  CE2   . PHE A 1 650 ? 9.877   24.860  -4.772  1.00 49.00  ? 650  PHE A CE2   1 
ATOM   5336 C  CZ    . PHE A 1 650 ? 9.341   24.702  -6.052  1.00 48.97  ? 650  PHE A CZ    1 
ATOM   5337 N  N     . LEU A 1 651 ? 6.698   25.492  -1.272  1.00 40.35  ? 651  LEU A N     1 
ATOM   5338 C  CA    . LEU A 1 651 ? 6.686   24.121  -0.751  1.00 40.40  ? 651  LEU A CA    1 
ATOM   5339 C  C     . LEU A 1 651 ? 5.282   23.637  -0.383  1.00 41.13  ? 651  LEU A C     1 
ATOM   5340 O  O     . LEU A 1 651 ? 4.928   22.486  -0.650  1.00 40.05  ? 651  LEU A O     1 
ATOM   5341 C  CB    . LEU A 1 651 ? 7.660   23.959  0.429   1.00 39.70  ? 651  LEU A CB    1 
ATOM   5342 C  CG    . LEU A 1 651 ? 9.161   24.049  0.108   1.00 41.20  ? 651  LEU A CG    1 
ATOM   5343 C  CD1   . LEU A 1 651 ? 9.999   23.880  1.366   1.00 38.12  ? 651  LEU A CD1   1 
ATOM   5344 C  CD2   . LEU A 1 651 ? 9.583   23.032  -0.964  1.00 40.44  ? 651  LEU A CD2   1 
ATOM   5345 N  N     . ASP A 1 652 ? 4.493   24.526  0.220   1.00 42.34  ? 652  ASP A N     1 
ATOM   5346 C  CA    . ASP A 1 652 ? 3.081   24.271  0.518   1.00 44.19  ? 652  ASP A CA    1 
ATOM   5347 C  C     . ASP A 1 652 ? 2.320   23.804  -0.734  1.00 44.97  ? 652  ASP A C     1 
ATOM   5348 O  O     . ASP A 1 652 ? 1.556   22.835  -0.685  1.00 43.50  ? 652  ASP A O     1 
ATOM   5349 C  CB    . ASP A 1 652 ? 2.446   25.539  1.111   1.00 44.77  ? 652  ASP A CB    1 
ATOM   5350 C  CG    . ASP A 1 652 ? 0.958   25.386  1.396   1.00 50.24  ? 652  ASP A CG    1 
ATOM   5351 O  OD1   . ASP A 1 652 ? 0.571   24.478  2.167   1.00 48.11  ? 652  ASP A OD1   1 
ATOM   5352 O  OD2   . ASP A 1 652 ? 0.171   26.190  0.845   1.00 53.74  ? 652  ASP A OD2   1 
ATOM   5353 N  N     . LYS A 1 653 ? 2.563   24.487  -1.852  1.00 47.37  ? 653  LYS A N     1 
ATOM   5354 C  CA    . LYS A 1 653 ? 1.939   24.161  -3.137  1.00 49.54  ? 653  LYS A CA    1 
ATOM   5355 C  C     . LYS A 1 653 ? 2.506   22.866  -3.732  1.00 49.32  ? 653  LYS A C     1 
ATOM   5356 O  O     . LYS A 1 653 ? 1.759   22.045  -4.257  1.00 48.45  ? 653  LYS A O     1 
ATOM   5357 C  CB    . LYS A 1 653 ? 2.098   25.334  -4.113  1.00 51.68  ? 653  LYS A CB    1 
ATOM   5358 C  CG    . LYS A 1 653 ? 1.166   25.302  -5.314  1.00 57.92  ? 653  LYS A CG    1 
ATOM   5359 C  CD    . LYS A 1 653 ? 1.137   26.650  -6.045  1.00 61.39  ? 653  LYS A CD    1 
ATOM   5360 C  CE    . LYS A 1 653 ? 0.193   26.607  -7.247  1.00 64.41  ? 653  LYS A CE    1 
ATOM   5361 N  NZ    . LYS A 1 653 ? -0.161  27.963  -7.770  1.00 65.34  ? 653  LYS A NZ    1 
ATOM   5362 N  N     . PHE A 1 654 ? 3.820   22.677  -3.645  1.00 49.14  ? 654  PHE A N     1 
ATOM   5363 C  CA    . PHE A 1 654 ? 4.422   21.426  -4.106  1.00 49.53  ? 654  PHE A CA    1 
ATOM   5364 C  C     . PHE A 1 654 ? 3.905   20.212  -3.315  1.00 48.40  ? 654  PHE A C     1 
ATOM   5365 O  O     . PHE A 1 654 ? 3.582   19.174  -3.902  1.00 46.93  ? 654  PHE A O     1 
ATOM   5366 C  CB    . PHE A 1 654 ? 5.952   21.491  -4.062  1.00 49.48  ? 654  PHE A CB    1 
ATOM   5367 C  CG    . PHE A 1 654 ? 6.623   20.315  -4.717  1.00 50.02  ? 654  PHE A CG    1 
ATOM   5368 C  CD1   . PHE A 1 654 ? 7.079   19.242  -3.955  1.00 48.60  ? 654  PHE A CD1   1 
ATOM   5369 C  CD2   . PHE A 1 654 ? 6.788   20.273  -6.096  1.00 50.21  ? 654  PHE A CD2   1 
ATOM   5370 C  CE1   . PHE A 1 654 ? 7.692   18.152  -4.555  1.00 47.61  ? 654  PHE A CE1   1 
ATOM   5371 C  CE2   . PHE A 1 654 ? 7.400   19.185  -6.707  1.00 49.82  ? 654  PHE A CE2   1 
ATOM   5372 C  CZ    . PHE A 1 654 ? 7.850   18.121  -5.934  1.00 49.24  ? 654  PHE A CZ    1 
ATOM   5373 N  N     . ALA A 1 655 ? 3.817   20.355  -1.994  1.00 46.77  ? 655  ALA A N     1 
ATOM   5374 C  CA    . ALA A 1 655 ? 3.336   19.272  -1.138  1.00 46.67  ? 655  ALA A CA    1 
ATOM   5375 C  C     . ALA A 1 655 ? 1.880   18.919  -1.408  1.00 46.29  ? 655  ALA A C     1 
ATOM   5376 O  O     . ALA A 1 655 ? 1.523   17.746  -1.415  1.00 46.35  ? 655  ALA A O     1 
ATOM   5377 C  CB    . ALA A 1 655 ? 3.518   19.622  0.319   1.00 45.13  ? 655  ALA A CB    1 
ATOM   5378 N  N     . ARG A 1 656 ? 1.055   19.935  -1.641  1.00 48.14  ? 656  ARG A N     1 
ATOM   5379 C  CA    . ARG A 1 656 ? -0.385  19.751  -1.810  1.00 49.53  ? 656  ARG A CA    1 
ATOM   5380 C  C     . ARG A 1 656 ? -0.792  19.368  -3.237  1.00 49.78  ? 656  ARG A C     1 
ATOM   5381 O  O     . ARG A 1 656 ? -1.753  18.625  -3.432  1.00 50.48  ? 656  ARG A O     1 
ATOM   5382 C  CB    . ARG A 1 656 ? -1.126  21.015  -1.363  1.00 52.11  ? 656  ARG A CB    1 
ATOM   5383 C  CG    . ARG A 1 656 ? -2.614  20.832  -1.071  1.00 57.94  ? 656  ARG A CG    1 
ATOM   5384 C  CD    . ARG A 1 656 ? -3.285  22.146  -0.657  1.00 63.96  ? 656  ARG A CD    1 
ATOM   5385 N  NE    . ARG A 1 656 ? -3.041  23.225  -1.620  1.00 69.57  ? 656  ARG A NE    1 
ATOM   5386 C  CZ    . ARG A 1 656 ? -2.280  24.291  -1.380  1.00 69.89  ? 656  ARG A CZ    1 
ATOM   5387 N  NH1   . ARG A 1 656 ? -1.691  24.445  -0.201  1.00 70.63  ? 656  ARG A NH1   1 
ATOM   5388 N  NH2   . ARG A 1 656 ? -2.110  25.209  -2.318  1.00 70.31  ? 656  ARG A NH2   1 
ATOM   5389 N  N     . GLU A 1 657 ? -0.068  19.863  -4.235  1.00 49.15  ? 657  GLU A N     1 
ATOM   5390 C  CA    . GLU A 1 657 ? -0.468  19.630  -5.623  1.00 50.17  ? 657  GLU A CA    1 
ATOM   5391 C  C     . GLU A 1 657 ? 0.292   18.494  -6.313  1.00 50.23  ? 657  GLU A C     1 
ATOM   5392 O  O     . GLU A 1 657 ? -0.185  17.945  -7.307  1.00 50.99  ? 657  GLU A O     1 
ATOM   5393 C  CB    . GLU A 1 657 ? -0.389  20.923  -6.442  1.00 51.73  ? 657  GLU A CB    1 
ATOM   5394 C  CG    . GLU A 1 657 ? -1.442  21.966  -6.061  1.00 54.94  ? 657  GLU A CG    1 
ATOM   5395 C  CD    . GLU A 1 657 ? -1.345  23.263  -6.870  1.00 60.28  ? 657  GLU A CD    1 
ATOM   5396 O  OE1   . GLU A 1 657 ? -0.490  23.358  -7.782  1.00 59.44  ? 657  GLU A OE1   1 
ATOM   5397 O  OE2   . GLU A 1 657 ? -2.134  24.193  -6.586  1.00 60.00  ? 657  GLU A OE2   1 
ATOM   5398 N  N     . ARG A 1 658 ? 1.456   18.135  -5.777  1.00 49.68  ? 658  ARG A N     1 
ATOM   5399 C  CA    . ARG A 1 658 ? 2.314   17.121  -6.402  1.00 50.25  ? 658  ARG A CA    1 
ATOM   5400 C  C     . ARG A 1 658 ? 2.560   15.890  -5.529  1.00 48.72  ? 658  ARG A C     1 
ATOM   5401 O  O     . ARG A 1 658 ? 2.492   14.759  -6.008  1.00 49.06  ? 658  ARG A O     1 
ATOM   5402 C  CB    . ARG A 1 658 ? 3.661   17.728  -6.815  1.00 48.63  ? 658  ARG A CB    1 
ATOM   5403 C  CG    . ARG A 1 658 ? 3.567   18.782  -7.898  1.00 55.27  ? 658  ARG A CG    1 
ATOM   5404 C  CD    . ARG A 1 658 ? 3.536   18.165  -9.290  1.00 59.67  ? 658  ARG A CD    1 
ATOM   5405 N  NE    . ARG A 1 658 ? 3.145   19.150  -10.294 1.00 66.89  ? 658  ARG A NE    1 
ATOM   5406 C  CZ    . ARG A 1 658 ? 1.912   19.289  -10.777 1.00 70.10  ? 658  ARG A CZ    1 
ATOM   5407 N  NH1   . ARG A 1 658 ? 0.930   18.498  -10.362 1.00 70.42  ? 658  ARG A NH1   1 
ATOM   5408 N  NH2   . ARG A 1 658 ? 1.661   20.220  -11.687 1.00 72.23  ? 658  ARG A NH2   1 
ATOM   5409 N  N     . MET A 1 659 ? 2.871   16.109  -4.258  1.00 46.19  ? 659  MET A N     1 
ATOM   5410 C  CA    . MET A 1 659 ? 3.251   14.999  -3.386  1.00 45.65  ? 659  MET A CA    1 
ATOM   5411 C  C     . MET A 1 659 ? 2.065   14.209  -2.830  1.00 44.90  ? 659  MET A C     1 
ATOM   5412 O  O     . MET A 1 659 ? 2.067   12.972  -2.855  1.00 44.59  ? 659  MET A O     1 
ATOM   5413 C  CB    . MET A 1 659 ? 4.166   15.484  -2.270  1.00 44.29  ? 659  MET A CB    1 
ATOM   5414 C  CG    . MET A 1 659 ? 5.505   15.954  -2.788  1.00 47.04  ? 659  MET A CG    1 
ATOM   5415 S  SD    . MET A 1 659 ? 6.712   16.203  -1.495  1.00 51.16  ? 659  MET A SD    1 
ATOM   5416 C  CE    . MET A 1 659 ? 7.029   14.502  -1.016  1.00 52.49  ? 659  MET A CE    1 
ATOM   5417 N  N     . GLU A 1 660 ? 1.056   14.927  -2.345  1.00 44.00  ? 660  GLU A N     1 
ATOM   5418 C  CA    . GLU A 1 660 ? -0.124  14.298  -1.771  1.00 43.73  ? 660  GLU A CA    1 
ATOM   5419 C  C     . GLU A 1 660 ? -0.898  13.432  -2.775  1.00 45.30  ? 660  GLU A C     1 
ATOM   5420 O  O     . GLU A 1 660 ? -1.328  12.336  -2.411  1.00 44.80  ? 660  GLU A O     1 
ATOM   5421 C  CB    . GLU A 1 660 ? -1.020  15.328  -1.072  1.00 44.75  ? 660  GLU A CB    1 
ATOM   5422 C  CG    . GLU A 1 660 ? -0.456  15.801  0.274   1.00 43.61  ? 660  GLU A CG    1 
ATOM   5423 C  CD    . GLU A 1 660 ? -1.298  16.876  0.959   1.00 49.63  ? 660  GLU A CD    1 
ATOM   5424 O  OE1   . GLU A 1 660 ? -2.522  16.959  0.714   1.00 54.32  ? 660  GLU A OE1   1 
ATOM   5425 O  OE2   . GLU A 1 660 ? -0.729  17.639  1.767   1.00 52.64  ? 660  GLU A OE2   1 
ATOM   5426 N  N     . PRO A 1 661 ? -1.060  13.891  -4.040  1.00 45.73  ? 661  PRO A N     1 
ATOM   5427 C  CA    . PRO A 1 661 ? -1.707  12.989  -4.998  1.00 46.26  ? 661  PRO A CA    1 
ATOM   5428 C  C     . PRO A 1 661 ? -0.909  11.713  -5.263  1.00 46.53  ? 661  PRO A C     1 
ATOM   5429 O  O     . PRO A 1 661 ? -1.503  10.645  -5.449  1.00 47.67  ? 661  PRO A O     1 
ATOM   5430 C  CB    . PRO A 1 661 ? -1.808  13.838  -6.271  1.00 47.55  ? 661  PRO A CB    1 
ATOM   5431 C  CG    . PRO A 1 661 ? -1.851  15.238  -5.771  1.00 47.26  ? 661  PRO A CG    1 
ATOM   5432 C  CD    . PRO A 1 661 ? -0.912  15.248  -4.600  1.00 46.52  ? 661  PRO A CD    1 
ATOM   5433 N  N     . ALA A 1 662 ? 0.419   11.819  -5.279  1.00 45.03  ? 662  ALA A N     1 
ATOM   5434 C  CA    . ALA A 1 662 ? 1.267   10.639  -5.450  1.00 43.06  ? 662  ALA A CA    1 
ATOM   5435 C  C     . ALA A 1 662 ? 1.201   9.729   -4.223  1.00 41.99  ? 662  ALA A C     1 
ATOM   5436 O  O     . ALA A 1 662 ? 1.189   8.501   -4.356  1.00 41.66  ? 662  ALA A O     1 
ATOM   5437 C  CB    . ALA A 1 662 ? 2.706   11.039  -5.755  1.00 42.54  ? 662  ALA A CB    1 
ATOM   5438 N  N     . ILE A 1 663 ? 1.159   10.343  -3.038  1.00 40.19  ? 663  ILE A N     1 
ATOM   5439 C  CA    . ILE A 1 663 ? 1.063   9.617   -1.772  1.00 36.81  ? 663  ILE A CA    1 
ATOM   5440 C  C     . ILE A 1 663 ? -0.276  8.876   -1.699  1.00 37.03  ? 663  ILE A C     1 
ATOM   5441 O  O     . ILE A 1 663 ? -0.321  7.707   -1.312  1.00 38.08  ? 663  ILE A O     1 
ATOM   5442 C  CB    . ILE A 1 663 ? 1.266   10.576  -0.561  1.00 36.68  ? 663  ILE A CB    1 
ATOM   5443 C  CG1   . ILE A 1 663 ? 2.758   10.866  -0.362  1.00 35.94  ? 663  ILE A CG1   1 
ATOM   5444 C  CG2   . ILE A 1 663 ? 0.641   10.015  0.720   1.00 31.61  ? 663  ILE A CG2   1 
ATOM   5445 C  CD1   . ILE A 1 663 ? 3.042   12.036  0.552   1.00 32.09  ? 663  ILE A CD1   1 
ATOM   5446 N  N     . ASP A 1 664 ? -1.355  9.559   -2.088  1.00 38.05  ? 664  ASP A N     1 
ATOM   5447 C  CA    . ASP A 1 664 ? -2.685  8.948   -2.187  1.00 40.65  ? 664  ASP A CA    1 
ATOM   5448 C  C     . ASP A 1 664 ? -2.674  7.719   -3.107  1.00 40.13  ? 664  ASP A C     1 
ATOM   5449 O  O     . ASP A 1 664 ? -3.177  6.662   -2.724  1.00 40.98  ? 664  ASP A O     1 
ATOM   5450 C  CB    . ASP A 1 664 ? -3.735  9.962   -2.673  1.00 42.21  ? 664  ASP A CB    1 
ATOM   5451 C  CG    . ASP A 1 664 ? -3.978  11.096  -1.678  1.00 48.07  ? 664  ASP A CG    1 
ATOM   5452 O  OD1   . ASP A 1 664 ? -4.634  12.085  -2.071  1.00 54.98  ? 664  ASP A OD1   1 
ATOM   5453 O  OD2   . ASP A 1 664 ? -3.529  11.019  -0.511  1.00 49.39  ? 664  ASP A OD2   1 
ATOM   5454 N  N     . ARG A 1 665 ? -2.085  7.858   -4.298  1.00 37.87  ? 665  ARG A N     1 
ATOM   5455 C  CA    . ARG A 1 665 ? -2.010  6.750   -5.262  1.00 38.49  ? 665  ARG A CA    1 
ATOM   5456 C  C     . ARG A 1 665 ? -1.278  5.546   -4.672  1.00 35.31  ? 665  ARG A C     1 
ATOM   5457 O  O     . ARG A 1 665 ? -1.751  4.410   -4.779  1.00 35.26  ? 665  ARG A O     1 
ATOM   5458 C  CB    . ARG A 1 665 ? -1.352  7.183   -6.584  1.00 39.20  ? 665  ARG A CB    1 
ATOM   5459 C  CG    . ARG A 1 665 ? -2.205  8.125   -7.425  1.00 46.14  ? 665  ARG A CG    1 
ATOM   5460 C  CD    . ARG A 1 665 ? -1.648  8.338   -8.841  1.00 51.26  ? 665  ARG A CD    1 
ATOM   5461 N  NE    . ARG A 1 665 ? -0.305  8.925   -8.854  1.00 56.37  ? 665  ARG A NE    1 
ATOM   5462 C  CZ    . ARG A 1 665 ? -0.045  10.235  -8.851  1.00 59.17  ? 665  ARG A CZ    1 
ATOM   5463 N  NH1   . ARG A 1 665 ? -1.036  11.126  -8.828  1.00 58.47  ? 665  ARG A NH1   1 
ATOM   5464 N  NH2   . ARG A 1 665 ? 1.216   10.658  -8.868  1.00 55.20  ? 665  ARG A NH2   1 
ATOM   5465 N  N     . GLY A 1 666 ? -0.138  5.807   -4.040  1.00 31.88  ? 666  GLY A N     1 
ATOM   5466 C  CA    . GLY A 1 666 ? 0.623   4.777   -3.342  1.00 32.60  ? 666  GLY A CA    1 
ATOM   5467 C  C     . GLY A 1 666 ? -0.173  4.038   -2.275  1.00 32.87  ? 666  GLY A C     1 
ATOM   5468 O  O     . GLY A 1 666 ? -0.056  2.814   -2.138  1.00 34.48  ? 666  GLY A O     1 
ATOM   5469 N  N     . PHE A 1 667 ? -0.996  4.759   -1.521  1.00 32.66  ? 667  PHE A N     1 
ATOM   5470 C  CA    . PHE A 1 667 ? -1.792  4.100   -0.475  1.00 33.35  ? 667  PHE A CA    1 
ATOM   5471 C  C     . PHE A 1 667 ? -3.020  3.386   -1.037  1.00 34.56  ? 667  PHE A C     1 
ATOM   5472 O  O     . PHE A 1 667 ? -3.401  2.322   -0.516  1.00 32.69  ? 667  PHE A O     1 
ATOM   5473 C  CB    . PHE A 1 667 ? -2.175  5.058   0.653   1.00 30.83  ? 667  PHE A CB    1 
ATOM   5474 C  CG    . PHE A 1 667 ? -1.130  5.182   1.735   1.00 31.98  ? 667  PHE A CG    1 
ATOM   5475 C  CD1   . PHE A 1 667 ? -0.633  4.051   2.384   1.00 30.35  ? 667  PHE A CD1   1 
ATOM   5476 C  CD2   . PHE A 1 667 ? -0.670  6.437   2.133   1.00 32.53  ? 667  PHE A CD2   1 
ATOM   5477 C  CE1   . PHE A 1 667 ? 0.325   4.166   3.391   1.00 31.06  ? 667  PHE A CE1   1 
ATOM   5478 C  CE2   . PHE A 1 667 ? 0.275   6.560   3.154   1.00 29.75  ? 667  PHE A CE2   1 
ATOM   5479 C  CZ    . PHE A 1 667 ? 0.775   5.426   3.776   1.00 28.34  ? 667  PHE A CZ    1 
ATOM   5480 N  N     . ARG A 1 668 ? -3.625  3.964   -2.088  1.00 33.40  ? 668  ARG A N     1 
ATOM   5481 C  CA    A ARG A 1 668 ? -4.740  3.308   -2.764  0.50 34.40  ? 668  ARG A CA    1 
ATOM   5482 C  CA    B ARG A 1 668 ? -4.732  3.326   -2.816  0.50 35.52  ? 668  ARG A CA    1 
ATOM   5483 C  C     . ARG A 1 668 ? -4.307  1.941   -3.281  1.00 34.62  ? 668  ARG A C     1 
ATOM   5484 O  O     . ARG A 1 668 ? -5.054  0.982   -3.178  1.00 35.75  ? 668  ARG A O     1 
ATOM   5485 C  CB    A ARG A 1 668 ? -5.307  4.171   -3.894  0.50 34.68  ? 668  ARG A CB    1 
ATOM   5486 C  CB    B ARG A 1 668 ? -5.145  4.163   -4.037  0.50 37.31  ? 668  ARG A CB    1 
ATOM   5487 C  CG    A ARG A 1 668 ? -6.349  5.174   -3.433  0.50 32.26  ? 668  ARG A CG    1 
ATOM   5488 C  CG    B ARG A 1 668 ? -6.027  5.367   -3.742  0.50 38.21  ? 668  ARG A CG    1 
ATOM   5489 C  CD    A ARG A 1 668 ? -7.163  5.726   -4.598  0.50 32.28  ? 668  ARG A CD    1 
ATOM   5490 C  CD    B ARG A 1 668 ? -5.739  6.527   -4.706  0.50 42.79  ? 668  ARG A CD    1 
ATOM   5491 N  NE    A ARG A 1 668 ? -8.438  6.277   -4.147  0.50 34.72  ? 668  ARG A NE    1 
ATOM   5492 N  NE    B ARG A 1 668 ? -6.576  6.534   -5.903  0.50 44.08  ? 668  ARG A NE    1 
ATOM   5493 C  CZ    A ARG A 1 668 ? -8.594  7.506   -3.660  0.50 39.25  ? 668  ARG A CZ    1 
ATOM   5494 C  CZ    B ARG A 1 668 ? -6.154  6.238   -7.131  0.50 44.12  ? 668  ARG A CZ    1 
ATOM   5495 N  NH1   A ARG A 1 668 ? -7.552  8.329   -3.563  0.50 38.33  ? 668  ARG A NH1   1 
ATOM   5496 N  NH1   B ARG A 1 668 ? -4.894  5.892   -7.351  0.50 42.17  ? 668  ARG A NH1   1 
ATOM   5497 N  NH2   A ARG A 1 668 ? -9.796  7.915   -3.269  0.50 37.43  ? 668  ARG A NH2   1 
ATOM   5498 N  NH2   B ARG A 1 668 ? -7.003  6.288   -8.146  0.50 45.02  ? 668  ARG A NH2   1 
ATOM   5499 N  N     . GLU A 1 669 ? -3.090  1.860   -3.809  1.00 36.85  ? 669  GLU A N     1 
ATOM   5500 C  CA    . GLU A 1 669 ? -2.522  0.593   -4.284  1.00 39.94  ? 669  GLU A CA    1 
ATOM   5501 C  C     . GLU A 1 669 ? -2.314  -0.396  -3.129  1.00 38.45  ? 669  GLU A C     1 
ATOM   5502 O  O     . GLU A 1 669 ? -2.574  -1.593  -3.275  1.00 38.31  ? 669  GLU A O     1 
ATOM   5503 C  CB    . GLU A 1 669 ? -1.203  0.837   -5.039  1.00 40.06  ? 669  GLU A CB    1 
ATOM   5504 C  CG    . GLU A 1 669 ? -0.633  -0.390  -5.761  1.00 46.84  ? 669  GLU A CG    1 
ATOM   5505 C  CD    . GLU A 1 669 ? 0.743   -0.136  -6.376  1.00 51.34  ? 669  GLU A CD    1 
ATOM   5506 O  OE1   . GLU A 1 669 ? 0.823   0.568   -7.407  1.00 56.16  ? 669  GLU A OE1   1 
ATOM   5507 O  OE2   . GLU A 1 669 ? 1.745   -0.650  -5.836  1.00 54.11  ? 669  GLU A OE2   1 
ATOM   5508 N  N     . MET A 1 670 ? -1.848  0.112   -1.989  1.00 36.70  ? 670  MET A N     1 
ATOM   5509 C  CA    . MET A 1 670 ? -1.621  -0.721  -0.812  1.00 37.62  ? 670  MET A CA    1 
ATOM   5510 C  C     . MET A 1 670 ? -2.935  -1.317  -0.299  1.00 37.13  ? 670  MET A C     1 
ATOM   5511 O  O     . MET A 1 670 ? -2.974  -2.480  0.109   1.00 36.13  ? 670  MET A O     1 
ATOM   5512 C  CB    . MET A 1 670 ? -0.929  0.081   0.296   1.00 37.90  ? 670  MET A CB    1 
ATOM   5513 C  CG    . MET A 1 670 ? -0.451  -0.754  1.469   1.00 37.23  ? 670  MET A CG    1 
ATOM   5514 S  SD    . MET A 1 670 ? 0.189   0.269   2.793   1.00 36.01  ? 670  MET A SD    1 
ATOM   5515 C  CE    . MET A 1 670 ? -1.330  0.738   3.622   1.00 30.89  ? 670  MET A CE    1 
ATOM   5516 N  N     . CYS A 1 671 ? -4.002  -0.516  -0.334  1.00 38.25  ? 671  CYS A N     1 
ATOM   5517 C  CA    . CYS A 1 671 ? -5.335  -0.963  0.086   1.00 38.02  ? 671  CYS A CA    1 
ATOM   5518 C  C     . CYS A 1 671 ? -5.829  -2.130  -0.766  1.00 38.03  ? 671  CYS A C     1 
ATOM   5519 O  O     . CYS A 1 671 ? -6.395  -3.087  -0.237  1.00 38.71  ? 671  CYS A O     1 
ATOM   5520 C  CB    . CYS A 1 671 ? -6.349  0.186   0.039   1.00 37.29  ? 671  CYS A CB    1 
ATOM   5521 S  SG    . CYS A 1 671 ? -8.063  -0.313  0.425   1.00 40.86  ? 671  CYS A SG    1 
ATOM   5522 N  N     . GLU A 1 672 ? -5.618  -2.044  -2.076  1.00 37.72  ? 672  GLU A N     1 
ATOM   5523 C  CA    . GLU A 1 672 ? -6.017  -3.109  -2.997  1.00 39.05  ? 672  GLU A CA    1 
ATOM   5524 C  C     . GLU A 1 672 ? -5.167  -4.360  -2.788  1.00 37.95  ? 672  GLU A C     1 
ATOM   5525 O  O     . GLU A 1 672 ? -5.669  -5.485  -2.801  1.00 37.25  ? 672  GLU A O     1 
ATOM   5526 C  CB    . GLU A 1 672 ? -5.898  -2.638  -4.445  1.00 42.36  ? 672  GLU A CB    1 
ATOM   5527 C  CG    . GLU A 1 672 ? -6.985  -1.666  -4.879  1.00 51.31  ? 672  GLU A CG    1 
ATOM   5528 C  CD    . GLU A 1 672 ? -6.982  -1.416  -6.381  1.00 60.39  ? 672  GLU A CD    1 
ATOM   5529 O  OE1   . GLU A 1 672 ? -7.808  -0.603  -6.857  1.00 62.74  ? 672  GLU A OE1   1 
ATOM   5530 O  OE2   . GLU A 1 672 ? -6.157  -2.037  -7.088  1.00 63.62  ? 672  GLU A OE2   1 
ATOM   5531 N  N     . TYR A 1 673 ? -3.872  -4.145  -2.594  1.00 36.61  ? 673  TYR A N     1 
ATOM   5532 C  CA    . TYR A 1 673 ? -2.934  -5.219  -2.320  1.00 35.13  ? 673  TYR A CA    1 
ATOM   5533 C  C     . TYR A 1 673 ? -3.376  -6.013  -1.088  1.00 35.29  ? 673  TYR A C     1 
ATOM   5534 O  O     . TYR A 1 673 ? -3.447  -7.245  -1.135  1.00 34.89  ? 673  TYR A O     1 
ATOM   5535 C  CB    . TYR A 1 673 ? -1.543  -4.620  -2.146  1.00 34.62  ? 673  TYR A CB    1 
ATOM   5536 C  CG    . TYR A 1 673 ? -0.405  -5.600  -1.985  1.00 37.74  ? 673  TYR A CG    1 
ATOM   5537 C  CD1   . TYR A 1 673 ? -0.385  -6.825  -2.675  1.00 36.69  ? 673  TYR A CD1   1 
ATOM   5538 C  CD2   . TYR A 1 673 ? 0.684   -5.284  -1.164  1.00 32.63  ? 673  TYR A CD2   1 
ATOM   5539 C  CE1   . TYR A 1 673 ? 0.684   -7.721  -2.520  1.00 38.86  ? 673  TYR A CE1   1 
ATOM   5540 C  CE2   . TYR A 1 673 ? 1.756   -6.163  -1.013  1.00 36.88  ? 673  TYR A CE2   1 
ATOM   5541 C  CZ    . TYR A 1 673 ? 1.752   -7.375  -1.692  1.00 38.85  ? 673  TYR A CZ    1 
ATOM   5542 O  OH    . TYR A 1 673 ? 2.818   -8.229  -1.529  1.00 41.38  ? 673  TYR A OH    1 
ATOM   5543 N  N     . MET A 1 674 ? -3.699  -5.305  -0.005  1.00 32.34  ? 674  MET A N     1 
ATOM   5544 C  CA    . MET A 1 674 ? -4.210  -5.937  1.213   1.00 32.28  ? 674  MET A CA    1 
ATOM   5545 C  C     . MET A 1 674 ? -5.696  -6.294  1.116   1.00 31.75  ? 674  MET A C     1 
ATOM   5546 O  O     . MET A 1 674 ? -6.240  -6.931  2.022   1.00 30.07  ? 674  MET A O     1 
ATOM   5547 C  CB    . MET A 1 674 ? -3.965  -5.053  2.451   1.00 33.04  ? 674  MET A CB    1 
ATOM   5548 C  CG    . MET A 1 674 ? -2.512  -4.990  2.945   1.00 34.92  ? 674  MET A CG    1 
ATOM   5549 S  SD    . MET A 1 674 ? -1.751  -6.583  3.372   1.00 37.43  ? 674  MET A SD    1 
ATOM   5550 C  CE    . MET A 1 674 ? -0.613  -6.810  2.008   1.00 34.30  ? 674  MET A CE    1 
ATOM   5551 N  N     . ASN A 1 675 ? -6.345  -5.890  0.018   1.00 33.20  ? 675  ASN A N     1 
ATOM   5552 C  CA    . ASN A 1 675 ? -7.788  -6.126  -0.192  1.00 31.99  ? 675  ASN A CA    1 
ATOM   5553 C  C     . ASN A 1 675 ? -8.662  -5.544  0.929   1.00 32.25  ? 675  ASN A C     1 
ATOM   5554 O  O     . ASN A 1 675 ? -9.630  -6.163  1.349   1.00 33.66  ? 675  ASN A O     1 
ATOM   5555 C  CB    . ASN A 1 675 ? -8.084  -7.633  -0.381  1.00 30.52  ? 675  ASN A CB    1 
ATOM   5556 C  CG    . ASN A 1 675 ? -9.466  -7.892  -0.988  1.00 29.34  ? 675  ASN A CG    1 
ATOM   5557 O  OD1   . ASN A 1 675 ? -9.911  -7.174  -1.883  1.00 28.35  ? 675  ASN A OD1   1 
ATOM   5558 N  ND2   . ASN A 1 675 ? -10.152 -8.913  -0.488  1.00 31.47  ? 675  ASN A ND2   1 
ATOM   5559 N  N     . ASN A 1 676 ? -8.318  -4.356  1.416   1.00 32.36  ? 676  ASN A N     1 
ATOM   5560 C  CA    . ASN A 1 676 ? -9.019  -3.794  2.569   1.00 33.67  ? 676  ASN A CA    1 
ATOM   5561 C  C     . ASN A 1 676 ? -10.434 -3.325  2.252   1.00 34.93  ? 676  ASN A C     1 
ATOM   5562 O  O     . ASN A 1 676 ? -10.801 -3.166  1.086   1.00 34.55  ? 676  ASN A O     1 
ATOM   5563 C  CB    . ASN A 1 676 ? -8.219  -2.658  3.195   1.00 33.64  ? 676  ASN A CB    1 
ATOM   5564 C  CG    . ASN A 1 676 ? -6.882  -3.108  3.729   1.00 30.97  ? 676  ASN A CG    1 
ATOM   5565 O  OD1   . ASN A 1 676 ? -5.894  -2.402  3.578   1.00 32.48  ? 676  ASN A OD1   1 
ATOM   5566 N  ND2   . ASN A 1 676 ? -6.844  -4.281  4.377   1.00 29.79  ? 676  ASN A ND2   1 
ATOM   5567 N  N     . LYS A 1 677 ? -11.221 -3.114  3.301   1.00 34.96  ? 677  LYS A N     1 
ATOM   5568 C  CA    . LYS A 1 677 ? -12.635 -2.805  3.145   1.00 34.99  ? 677  LYS A CA    1 
ATOM   5569 C  C     . LYS A 1 677 ? -12.851 -1.381  2.632   1.00 35.35  ? 677  LYS A C     1 
ATOM   5570 O  O     . LYS A 1 677 ? -13.753 -1.133  1.839   1.00 35.75  ? 677  LYS A O     1 
ATOM   5571 C  CB    . LYS A 1 677 ? -13.377 -3.045  4.463   1.00 35.69  ? 677  LYS A CB    1 
ATOM   5572 C  CG    . LYS A 1 677 ? -14.873 -2.754  4.408   1.00 38.39  ? 677  LYS A CG    1 
ATOM   5573 C  CD    . LYS A 1 677 ? -15.600 -3.279  5.636   1.00 38.46  ? 677  LYS A CD    1 
ATOM   5574 C  CE    . LYS A 1 677 ? -17.101 -3.106  5.495   1.00 38.85  ? 677  LYS A CE    1 
ATOM   5575 N  NZ    . LYS A 1 677 ? -17.483 -1.667  5.539   1.00 41.79  ? 677  LYS A NZ    1 
ATOM   5576 N  N     . GLN A 1 678 ? -12.006 -0.459  3.079   1.00 37.35  ? 678  GLN A N     1 
ATOM   5577 C  CA    . GLN A 1 678 ? -12.147 0.965   2.766   1.00 38.35  ? 678  GLN A CA    1 
ATOM   5578 C  C     . GLN A 1 678 ? -10.762 1.615   2.806   1.00 38.19  ? 678  GLN A C     1 
ATOM   5579 O  O     . GLN A 1 678 ? -9.966  1.335   3.702   1.00 36.02  ? 678  GLN A O     1 
ATOM   5580 C  CB    . GLN A 1 678 ? -13.071 1.608   3.805   1.00 36.99  ? 678  GLN A CB    1 
ATOM   5581 C  CG    . GLN A 1 678 ? -13.654 2.966   3.462   1.00 42.24  ? 678  GLN A CG    1 
ATOM   5582 C  CD    . GLN A 1 678 ? -14.499 3.519   4.609   1.00 43.90  ? 678  GLN A CD    1 
ATOM   5583 O  OE1   . GLN A 1 678 ? -14.797 2.815   5.575   1.00 45.78  ? 678  GLN A OE1   1 
ATOM   5584 N  NE2   . GLN A 1 678 ? -14.877 4.778   4.509   1.00 44.23  ? 678  GLN A NE2   1 
ATOM   5585 N  N     . HIS A 1 679 ? -10.467 2.469   1.832   1.00 38.64  ? 679  HIS A N     1 
ATOM   5586 C  CA    . HIS A 1 679 ? -9.207  3.209   1.830   1.00 36.90  ? 679  HIS A CA    1 
ATOM   5587 C  C     . HIS A 1 679 ? -9.282  4.392   2.798   1.00 36.26  ? 679  HIS A C     1 
ATOM   5588 O  O     . HIS A 1 679 ? -10.060 5.330   2.603   1.00 36.49  ? 679  HIS A O     1 
ATOM   5589 C  CB    . HIS A 1 679 ? -8.829  3.657   0.410   1.00 37.18  ? 679  HIS A CB    1 
ATOM   5590 C  CG    . HIS A 1 679 ? -7.856  4.793   0.374   1.00 33.85  ? 679  HIS A CG    1 
ATOM   5591 N  ND1   . HIS A 1 679 ? -6.613  4.726   0.963   1.00 34.19  ? 679  HIS A ND1   1 
ATOM   5592 C  CD2   . HIS A 1 679 ? -7.946  6.028   -0.176  1.00 36.01  ? 679  HIS A CD2   1 
ATOM   5593 C  CE1   . HIS A 1 679 ? -5.979  5.871   0.780   1.00 34.36  ? 679  HIS A CE1   1 
ATOM   5594 N  NE2   . HIS A 1 679 ? -6.763  6.678   0.089   1.00 32.46  ? 679  HIS A NE2   1 
ATOM   5595 N  N     . LEU A 1 680 ? -8.481  4.330   3.855   1.00 34.08  ? 680  LEU A N     1 
ATOM   5596 C  CA    . LEU A 1 680 ? -8.505  5.368   4.884   1.00 32.95  ? 680  LEU A CA    1 
ATOM   5597 C  C     . LEU A 1 680 ? -7.108  5.815   5.311   1.00 30.75  ? 680  LEU A C     1 
ATOM   5598 O  O     . LEU A 1 680 ? -6.953  6.501   6.311   1.00 29.21  ? 680  LEU A O     1 
ATOM   5599 C  CB    . LEU A 1 680 ? -9.343  4.922   6.085   1.00 32.38  ? 680  LEU A CB    1 
ATOM   5600 C  CG    . LEU A 1 680 ? -10.858 4.840   5.832   1.00 34.93  ? 680  LEU A CG    1 
ATOM   5601 C  CD1   . LEU A 1 680 ? -11.539 4.056   6.944   1.00 32.09  ? 680  LEU A CD1   1 
ATOM   5602 C  CD2   . LEU A 1 680 ? -11.498 6.241   5.663   1.00 28.69  ? 680  LEU A CD2   1 
ATOM   5603 N  N     . MET A 1 681 ? -6.100  5.439   4.532   1.00 30.01  ? 681  MET A N     1 
ATOM   5604 C  CA    . MET A 1 681 ? -4.750  5.940   4.759   1.00 31.82  ? 681  MET A CA    1 
ATOM   5605 C  C     . MET A 1 681 ? -4.600  7.331   4.148   1.00 32.12  ? 681  MET A C     1 
ATOM   5606 O  O     . MET A 1 681 ? -4.226  7.471   2.982   1.00 33.86  ? 681  MET A O     1 
ATOM   5607 C  CB    . MET A 1 681 ? -3.702  4.963   4.202   1.00 30.04  ? 681  MET A CB    1 
ATOM   5608 C  CG    . MET A 1 681 ? -3.711  3.583   4.859   1.00 28.38  ? 681  MET A CG    1 
ATOM   5609 S  SD    . MET A 1 681 ? -3.342  3.611   6.635   1.00 32.41  ? 681  MET A SD    1 
ATOM   5610 C  CE    . MET A 1 681 ? -4.980  3.548   7.376   1.00 28.24  ? 681  MET A CE    1 
ATOM   5611 N  N     . PHE A 1 682 ? -4.906  8.359   4.939   1.00 34.05  ? 682  PHE A N     1 
ATOM   5612 C  CA    . PHE A 1 682 ? -4.835  9.742   4.462   1.00 34.66  ? 682  PHE A CA    1 
ATOM   5613 C  C     . PHE A 1 682 ? -3.605  10.461  5.016   1.00 35.18  ? 682  PHE A C     1 
ATOM   5614 O  O     . PHE A 1 682 ? -3.592  10.903  6.171   1.00 31.33  ? 682  PHE A O     1 
ATOM   5615 C  CB    . PHE A 1 682 ? -6.110  10.528  4.816   1.00 35.93  ? 682  PHE A CB    1 
ATOM   5616 C  CG    . PHE A 1 682 ? -7.383  9.905   4.312   1.00 36.83  ? 682  PHE A CG    1 
ATOM   5617 C  CD1   . PHE A 1 682 ? -7.483  9.437   3.002   1.00 38.53  ? 682  PHE A CD1   1 
ATOM   5618 C  CD2   . PHE A 1 682 ? -8.497  9.812   5.144   1.00 36.96  ? 682  PHE A CD2   1 
ATOM   5619 C  CE1   . PHE A 1 682 ? -8.667  8.866   2.532   1.00 39.48  ? 682  PHE A CE1   1 
ATOM   5620 C  CE2   . PHE A 1 682 ? -9.688  9.243   4.688   1.00 36.83  ? 682  PHE A CE2   1 
ATOM   5621 C  CZ    . PHE A 1 682 ? -9.776  8.773   3.375   1.00 39.38  ? 682  PHE A CZ    1 
ATOM   5622 N  N     . MET A 1 683 ? -2.571  10.584  4.185   1.00 36.76  ? 683  MET A N     1 
ATOM   5623 C  CA    . MET A 1 683 ? -1.347  11.271  4.600   1.00 35.68  ? 683  MET A CA    1 
ATOM   5624 C  C     . MET A 1 683 ? -1.242  12.678  4.015   1.00 37.14  ? 683  MET A C     1 
ATOM   5625 O  O     . MET A 1 683 ? -0.988  12.865  2.820   1.00 38.29  ? 683  MET A O     1 
ATOM   5626 C  CB    . MET A 1 683 ? -0.118  10.423  4.271   1.00 35.23  ? 683  MET A CB    1 
ATOM   5627 C  CG    . MET A 1 683 ? 1.205   11.039  4.669   1.00 31.79  ? 683  MET A CG    1 
ATOM   5628 S  SD    . MET A 1 683 ? 2.612   9.937   4.401   1.00 33.18  ? 683  MET A SD    1 
ATOM   5629 C  CE    . MET A 1 683 ? 2.783   9.183   6.017   1.00 25.85  ? 683  MET A CE    1 
ATOM   5630 N  N     . ASP A 1 684 ? -1.433  13.665  4.880   1.00 37.10  ? 684  ASP A N     1 
ATOM   5631 C  CA    . ASP A 1 684 ? -1.338  15.068  4.501   1.00 41.13  ? 684  ASP A CA    1 
ATOM   5632 C  C     . ASP A 1 684 ? -0.002  15.648  4.948   1.00 41.45  ? 684  ASP A C     1 
ATOM   5633 O  O     . ASP A 1 684 ? 0.651   15.110  5.855   1.00 42.37  ? 684  ASP A O     1 
ATOM   5634 C  CB    . ASP A 1 684 ? -2.471  15.882  5.149   1.00 42.56  ? 684  ASP A CB    1 
ATOM   5635 C  CG    . ASP A 1 684 ? -3.840  15.536  4.595   1.00 47.75  ? 684  ASP A CG    1 
ATOM   5636 O  OD1   . ASP A 1 684 ? -3.921  14.975  3.477   1.00 49.45  ? 684  ASP A OD1   1 
ATOM   5637 O  OD2   . ASP A 1 684 ? -4.840  15.839  5.279   1.00 51.27  ? 684  ASP A OD2   1 
ATOM   5638 N  N     . ARG A 1 685 ? 0.387   16.754  4.318   1.00 40.00  ? 685  ARG A N     1 
ATOM   5639 C  CA    . ARG A 1 685 ? 1.543   17.525  4.749   1.00 38.23  ? 685  ARG A CA    1 
ATOM   5640 C  C     . ARG A 1 685 ? 1.281   18.079  6.142   1.00 37.44  ? 685  ARG A C     1 
ATOM   5641 O  O     . ARG A 1 685 ? 0.177   18.548  6.429   1.00 37.23  ? 685  ARG A O     1 
ATOM   5642 C  CB    . ARG A 1 685 ? 1.820   18.661  3.756   1.00 37.26  ? 685  ARG A CB    1 
ATOM   5643 C  CG    . ARG A 1 685 ? 3.162   19.364  3.937   1.00 36.48  ? 685  ARG A CG    1 
ATOM   5644 C  CD    . ARG A 1 685 ? 3.076   20.520  4.938   1.00 37.56  ? 685  ARG A CD    1 
ATOM   5645 N  NE    . ARG A 1 685 ? 2.238   21.613  4.453   1.00 37.97  ? 685  ARG A NE    1 
ATOM   5646 C  CZ    . ARG A 1 685 ? 1.906   22.683  5.166   1.00 37.74  ? 685  ARG A CZ    1 
ATOM   5647 N  NH1   . ARG A 1 685 ? 2.324   22.821  6.428   1.00 38.23  ? 685  ARG A NH1   1 
ATOM   5648 N  NH2   . ARG A 1 685 ? 1.142   23.610  4.620   1.00 31.85  ? 685  ARG A NH2   1 
ATOM   5649 N  N     . GLU A 1 686 ? 2.293   18.005  7.000   1.00 36.94  ? 686  GLU A N     1 
ATOM   5650 C  CA    . GLU A 1 686 ? 2.190   18.516  8.359   1.00 38.00  ? 686  GLU A CA    1 
ATOM   5651 C  C     . GLU A 1 686 ? 3.037   19.781  8.510   1.00 37.85  ? 686  GLU A C     1 
ATOM   5652 O  O     . GLU A 1 686 ? 2.486   20.877  8.637   1.00 39.04  ? 686  GLU A O     1 
ATOM   5653 C  CB    . GLU A 1 686 ? 2.588   17.448  9.385   1.00 38.42  ? 686  GLU A CB    1 
ATOM   5654 C  CG    . GLU A 1 686 ? 2.054   17.736  10.786  1.00 47.88  ? 686  GLU A CG    1 
ATOM   5655 C  CD    . GLU A 1 686 ? 2.241   16.584  11.760  1.00 53.53  ? 686  GLU A CD    1 
ATOM   5656 O  OE1   . GLU A 1 686 ? 1.233   16.154  12.369  1.00 51.98  ? 686  GLU A OE1   1 
ATOM   5657 O  OE2   . GLU A 1 686 ? 3.395   16.114  11.921  1.00 58.93  ? 686  GLU A OE2   1 
ATOM   5658 N  N     . ALA A 1 687 ? 4.363   19.635  8.463   1.00 34.74  ? 687  ALA A N     1 
ATOM   5659 C  CA    . ALA A 1 687 ? 5.271   20.762  8.699   1.00 34.35  ? 687  ALA A CA    1 
ATOM   5660 C  C     . ALA A 1 687 ? 6.124   21.171  7.494   1.00 33.86  ? 687  ALA A C     1 
ATOM   5661 O  O     . ALA A 1 687 ? 6.572   20.328  6.717   1.00 33.72  ? 687  ALA A O     1 
ATOM   5662 C  CB    . ALA A 1 687 ? 6.163   20.474  9.898   1.00 35.18  ? 687  ALA A CB    1 
ATOM   5663 N  N     . ILE A 1 688 ? 6.327   22.476  7.335   1.00 33.71  ? 688  ILE A N     1 
ATOM   5664 C  CA    . ILE A 1 688 ? 7.342   22.983  6.413   1.00 35.04  ? 688  ILE A CA    1 
ATOM   5665 C  C     . ILE A 1 688 ? 8.414   23.698  7.221   1.00 36.70  ? 688  ILE A C     1 
ATOM   5666 O  O     . ILE A 1 688 ? 8.129   24.643  7.965   1.00 38.61  ? 688  ILE A O     1 
ATOM   5667 C  CB    . ILE A 1 688 ? 6.763   23.906  5.331   1.00 36.89  ? 688  ILE A CB    1 
ATOM   5668 C  CG1   . ILE A 1 688 ? 5.719   23.160  4.499   1.00 37.41  ? 688  ILE A CG1   1 
ATOM   5669 C  CG2   . ILE A 1 688 ? 7.870   24.410  4.399   1.00 34.11  ? 688  ILE A CG2   1 
ATOM   5670 C  CD1   . ILE A 1 688 ? 4.924   24.066  3.578   1.00 41.03  ? 688  ILE A CD1   1 
ATOM   5671 N  N     . ALA A 1 689 ? 9.647   23.221  7.096   1.00 37.14  ? 689  ALA A N     1 
ATOM   5672 C  CA    . ALA A 1 689 ? 10.731  23.716  7.928   1.00 38.01  ? 689  ALA A CA    1 
ATOM   5673 C  C     . ALA A 1 689 ? 11.928  24.158  7.108   1.00 37.05  ? 689  ALA A C     1 
ATOM   5674 O  O     . ALA A 1 689 ? 12.199  23.620  6.035   1.00 37.23  ? 689  ALA A O     1 
ATOM   5675 C  CB    . ALA A 1 689 ? 11.135  22.662  8.961   1.00 36.46  ? 689  ALA A CB    1 
ATOM   5676 N  N     . GLY A 1 690 ? 12.634  25.157  7.624   1.00 38.63  ? 690  GLY A N     1 
ATOM   5677 C  CA    . GLY A 1 690 ? 13.831  25.677  6.977   1.00 37.57  ? 690  GLY A CA    1 
ATOM   5678 C  C     . GLY A 1 690 ? 14.356  26.923  7.661   1.00 38.70  ? 690  GLY A C     1 
ATOM   5679 O  O     . GLY A 1 690 ? 13.710  27.456  8.564   1.00 39.29  ? 690  GLY A O     1 
ATOM   5680 N  N     . PRO A 1 691 ? 15.533  27.406  7.224   1.00 39.45  ? 691  PRO A N     1 
ATOM   5681 C  CA    . PRO A 1 691 ? 16.121  28.605  7.806   1.00 38.23  ? 691  PRO A CA    1 
ATOM   5682 C  C     . PRO A 1 691 ? 15.489  29.881  7.249   1.00 39.41  ? 691  PRO A C     1 
ATOM   5683 O  O     . PRO A 1 691 ? 14.973  29.872  6.121   1.00 42.72  ? 691  PRO A O     1 
ATOM   5684 C  CB    . PRO A 1 691 ? 17.585  28.508  7.378   1.00 38.65  ? 691  PRO A CB    1 
ATOM   5685 C  CG    . PRO A 1 691 ? 17.569  27.738  6.094   1.00 40.31  ? 691  PRO A CG    1 
ATOM   5686 C  CD    . PRO A 1 691 ? 16.302  26.918  6.060   1.00 38.91  ? 691  PRO A CD    1 
ATOM   5687 N  N     . PRO A 1 692 ? 15.519  30.983  8.025   1.00 39.49  ? 692  PRO A N     1 
ATOM   5688 C  CA    . PRO A 1 692 ? 15.089  32.253  7.428   1.00 40.75  ? 692  PRO A CA    1 
ATOM   5689 C  C     . PRO A 1 692 ? 15.901  32.525  6.165   1.00 41.75  ? 692  PRO A C     1 
ATOM   5690 O  O     . PRO A 1 692 ? 17.126  32.361  6.187   1.00 40.95  ? 692  PRO A O     1 
ATOM   5691 C  CB    . PRO A 1 692 ? 15.431  33.288  8.514   1.00 39.44  ? 692  PRO A CB    1 
ATOM   5692 C  CG    . PRO A 1 692 ? 15.405  32.506  9.803   1.00 38.37  ? 692  PRO A CG    1 
ATOM   5693 C  CD    . PRO A 1 692 ? 15.935  31.141  9.432   1.00 38.27  ? 692  PRO A CD    1 
ATOM   5694 N  N     . LEU A 1 693 ? 15.228  32.895  5.074   1.00 42.53  ? 693  LEU A N     1 
ATOM   5695 C  CA    . LEU A 1 693 ? 15.912  33.199  3.809   1.00 44.96  ? 693  LEU A CA    1 
ATOM   5696 C  C     . LEU A 1 693 ? 16.950  34.300  4.020   1.00 44.82  ? 693  LEU A C     1 
ATOM   5697 O  O     . LEU A 1 693 ? 16.658  35.320  4.646   1.00 44.83  ? 693  LEU A O     1 
ATOM   5698 C  CB    . LEU A 1 693 ? 14.920  33.641  2.727   1.00 46.09  ? 693  LEU A CB    1 
ATOM   5699 C  CG    . LEU A 1 693 ? 15.162  33.268  1.250   1.00 47.70  ? 693  LEU A CG    1 
ATOM   5700 C  CD1   . LEU A 1 693 ? 14.837  34.446  0.339   1.00 47.64  ? 693  LEU A CD1   1 
ATOM   5701 C  CD2   . LEU A 1 693 ? 16.567  32.740  0.958   1.00 46.27  ? 693  LEU A CD2   1 
ATOM   5702 N  N     . GLY A 1 694 ? 18.157  34.067  3.512   1.00 45.44  ? 694  GLY A N     1 
ATOM   5703 C  CA    . GLY A 1 694 ? 19.265  35.010  3.637   1.00 47.69  ? 694  GLY A CA    1 
ATOM   5704 C  C     . GLY A 1 694 ? 20.053  34.885  4.925   1.00 49.77  ? 694  GLY A C     1 
ATOM   5705 O  O     . GLY A 1 694 ? 20.938  35.701  5.190   1.00 51.98  ? 694  GLY A O     1 
ATOM   5706 N  N     . SER A 1 695 ? 19.740  33.865  5.727   1.00 48.50  ? 695  SER A N     1 
ATOM   5707 C  CA    . SER A 1 695 ? 20.416  33.661  7.007   1.00 48.23  ? 695  SER A CA    1 
ATOM   5708 C  C     . SER A 1 695 ? 21.430  32.520  6.937   1.00 47.80  ? 695  SER A C     1 
ATOM   5709 O  O     . SER A 1 695 ? 21.555  31.853  5.912   1.00 47.72  ? 695  SER A O     1 
ATOM   5710 C  CB    . SER A 1 695 ? 19.398  33.384  8.116   1.00 47.29  ? 695  SER A CB    1 
ATOM   5711 O  OG    . SER A 1 695 ? 18.899  32.055  8.014   1.00 48.77  ? 695  SER A OG    1 
ATOM   5712 N  N     . LYS A 1 696 ? 22.137  32.299  8.041   1.00 47.42  ? 696  LYS A N     1 
ATOM   5713 C  CA    . LYS A 1 696 ? 23.095  31.200  8.142   1.00 47.04  ? 696  LYS A CA    1 
ATOM   5714 C  C     . LYS A 1 696 ? 22.596  30.077  9.067   1.00 45.39  ? 696  LYS A C     1 
ATOM   5715 O  O     . LYS A 1 696 ? 23.349  29.156  9.402   1.00 44.29  ? 696  LYS A O     1 
ATOM   5716 C  CB    . LYS A 1 696 ? 24.455  31.721  8.621   1.00 47.33  ? 696  LYS A CB    1 
ATOM   5717 C  CG    . LYS A 1 696 ? 25.077  32.779  7.723   1.00 48.19  ? 696  LYS A CG    1 
ATOM   5718 C  CD    . LYS A 1 696 ? 26.216  33.484  8.450   1.00 52.60  ? 696  LYS A CD    1 
ATOM   5719 C  CE    . LYS A 1 696 ? 27.029  34.367  7.519   1.00 53.47  ? 696  LYS A CE    1 
ATOM   5720 N  NZ    . LYS A 1 696 ? 27.960  35.217  8.313   1.00 59.32  ? 696  LYS A NZ    1 
ATOM   5721 N  N     . GLY A 1 697 ? 21.330  30.152  9.472   1.00 43.24  ? 697  GLY A N     1 
ATOM   5722 C  CA    . GLY A 1 697 ? 20.707  29.075  10.255  1.00 41.62  ? 697  GLY A CA    1 
ATOM   5723 C  C     . GLY A 1 697 ? 20.685  27.749  9.503   1.00 40.92  ? 697  GLY A C     1 
ATOM   5724 O  O     . GLY A 1 697 ? 20.626  27.723  8.268   1.00 37.72  ? 697  GLY A O     1 
ATOM   5725 N  N     . ILE A 1 698 ? 20.755  26.645  10.244  1.00 39.46  ? 698  ILE A N     1 
ATOM   5726 C  CA    . ILE A 1 698 ? 20.826  25.323  9.615   1.00 37.81  ? 698  ILE A CA    1 
ATOM   5727 C  C     . ILE A 1 698 ? 19.456  24.703  9.320   1.00 37.64  ? 698  ILE A C     1 
ATOM   5728 O  O     . ILE A 1 698 ? 19.371  23.715  8.589   1.00 37.80  ? 698  ILE A O     1 
ATOM   5729 C  CB    . ILE A 1 698 ? 21.718  24.333  10.412  1.00 38.55  ? 698  ILE A CB    1 
ATOM   5730 C  CG1   . ILE A 1 698 ? 21.125  24.055  11.803  1.00 37.58  ? 698  ILE A CG1   1 
ATOM   5731 C  CG2   . ILE A 1 698 ? 23.147  24.854  10.477  1.00 34.71  ? 698  ILE A CG2   1 
ATOM   5732 C  CD1   . ILE A 1 698 ? 21.853  22.991  12.596  1.00 35.52  ? 698  ILE A CD1   1 
ATOM   5733 N  N     . GLY A 1 699 ? 18.396  25.283  9.888   1.00 36.43  ? 699  GLY A N     1 
ATOM   5734 C  CA    . GLY A 1 699 ? 17.025  24.860  9.605   1.00 33.74  ? 699  GLY A CA    1 
ATOM   5735 C  C     . GLY A 1 699 ? 16.536  23.744  10.511  1.00 33.87  ? 699  GLY A C     1 
ATOM   5736 O  O     . GLY A 1 699 ? 15.454  23.835  11.101  1.00 33.69  ? 699  GLY A O     1 
ATOM   5737 N  N     . GLY A 1 700 ? 17.324  22.679  10.604  1.00 32.68  ? 700  GLY A N     1 
ATOM   5738 C  CA    . GLY A 1 700 ? 17.011  21.574  11.494  1.00 31.75  ? 700  GLY A CA    1 
ATOM   5739 C  C     . GLY A 1 700 ? 18.156  20.596  11.658  1.00 31.47  ? 700  GLY A C     1 
ATOM   5740 O  O     . GLY A 1 700 ? 19.191  20.711  10.987  1.00 31.42  ? 700  GLY A O     1 
ATOM   5741 N  N     . PHE A 1 701 ? 17.966  19.638  12.563  1.00 29.59  ? 701  PHE A N     1 
ATOM   5742 C  CA    . PHE A 1 701 ? 18.900  18.534  12.744  1.00 31.33  ? 701  PHE A CA    1 
ATOM   5743 C  C     . PHE A 1 701 ? 18.254  17.369  13.476  1.00 32.99  ? 701  PHE A C     1 
ATOM   5744 O  O     . PHE A 1 701 ? 17.287  17.544  14.217  1.00 35.32  ? 701  PHE A O     1 
ATOM   5745 C  CB    . PHE A 1 701 ? 20.186  18.974  13.472  1.00 29.89  ? 701  PHE A CB    1 
ATOM   5746 C  CG    . PHE A 1 701 ? 19.973  19.389  14.911  1.00 28.38  ? 701  PHE A CG    1 
ATOM   5747 C  CD1   . PHE A 1 701 ? 19.662  20.713  15.227  1.00 24.68  ? 701  PHE A CD1   1 
ATOM   5748 C  CD2   . PHE A 1 701 ? 20.106  18.464  15.948  1.00 25.80  ? 701  PHE A CD2   1 
ATOM   5749 C  CE1   . PHE A 1 701 ? 19.480  21.110  16.564  1.00 25.86  ? 701  PHE A CE1   1 
ATOM   5750 C  CE2   . PHE A 1 701 ? 19.914  18.849  17.285  1.00 27.61  ? 701  PHE A CE2   1 
ATOM   5751 C  CZ    . PHE A 1 701 ? 19.593  20.175  17.592  1.00 23.19  ? 701  PHE A CZ    1 
ATOM   5752 N  N     . TRP A 1 702 ? 18.804  16.183  13.241  1.00 34.03  ? 702  TRP A N     1 
ATOM   5753 C  CA    . TRP A 1 702 ? 18.475  14.978  13.986  1.00 35.84  ? 702  TRP A CA    1 
ATOM   5754 C  C     . TRP A 1 702 ? 19.753  14.517  14.664  1.00 34.55  ? 702  TRP A C     1 
ATOM   5755 O  O     . TRP A 1 702 ? 20.823  14.637  14.073  1.00 34.98  ? 702  TRP A O     1 
ATOM   5756 C  CB    . TRP A 1 702 ? 18.004  13.882  13.030  1.00 34.48  ? 702  TRP A CB    1 
ATOM   5757 C  CG    . TRP A 1 702 ? 16.539  13.820  12.835  1.00 34.69  ? 702  TRP A CG    1 
ATOM   5758 C  CD1   . TRP A 1 702 ? 15.680  12.891  13.363  1.00 35.73  ? 702  TRP A CD1   1 
ATOM   5759 C  CD2   . TRP A 1 702 ? 15.738  14.708  12.047  1.00 35.35  ? 702  TRP A CD2   1 
ATOM   5760 N  NE1   . TRP A 1 702 ? 14.390  13.151  12.952  1.00 37.57  ? 702  TRP A NE1   1 
ATOM   5761 C  CE2   . TRP A 1 702 ? 14.396  14.260  12.146  1.00 35.41  ? 702  TRP A CE2   1 
ATOM   5762 C  CE3   . TRP A 1 702 ? 16.021  15.839  11.268  1.00 34.85  ? 702  TRP A CE3   1 
ATOM   5763 C  CZ2   . TRP A 1 702 ? 13.339  14.904  11.495  1.00 32.80  ? 702  TRP A CZ2   1 
ATOM   5764 C  CZ3   . TRP A 1 702 ? 14.971  16.480  10.624  1.00 38.77  ? 702  TRP A CZ3   1 
ATOM   5765 C  CH2   . TRP A 1 702 ? 13.640  16.006  10.744  1.00 34.93  ? 702  TRP A CH2   1 
ATOM   5766 N  N     . THR A 1 703 ? 19.652  13.996  15.888  1.00 34.15  ? 703  THR A N     1 
ATOM   5767 C  CA    . THR A 1 703 ? 20.797  13.328  16.527  1.00 33.12  ? 703  THR A CA    1 
ATOM   5768 C  C     . THR A 1 703 ? 20.624  11.805  16.537  1.00 32.80  ? 703  THR A C     1 
ATOM   5769 O  O     . THR A 1 703 ? 21.582  11.056  16.721  1.00 36.74  ? 703  THR A O     1 
ATOM   5770 C  CB    . THR A 1 703 ? 21.078  13.829  17.981  1.00 32.18  ? 703  THR A CB    1 
ATOM   5771 O  OG1   . THR A 1 703 ? 20.282  13.097  18.918  1.00 34.14  ? 703  THR A OG1   1 
ATOM   5772 C  CG2   . THR A 1 703 ? 20.804  15.313  18.136  1.00 34.83  ? 703  THR A CG2   1 
ATOM   5773 N  N     . GLY A 1 704 ? 19.395  11.352  16.344  1.00 33.99  ? 704  GLY A N     1 
ATOM   5774 C  CA    . GLY A 1 704 ? 19.079  9.924   16.400  1.00 33.94  ? 704  GLY A CA    1 
ATOM   5775 C  C     . GLY A 1 704 ? 17.583  9.718   16.394  1.00 32.62  ? 704  GLY A C     1 
ATOM   5776 O  O     . GLY A 1 704 ? 16.821  10.658  16.154  1.00 29.95  ? 704  GLY A O     1 
ATOM   5777 N  N     . LYS A 1 705 ? 17.153  8.487   16.643  1.00 33.15  ? 705  LYS A N     1 
ATOM   5778 C  CA    . LYS A 1 705 ? 15.722  8.205   16.726  1.00 33.16  ? 705  LYS A CA    1 
ATOM   5779 C  C     . LYS A 1 705 ? 15.105  9.072   17.804  1.00 31.42  ? 705  LYS A C     1 
ATOM   5780 O  O     . LYS A 1 705 ? 15.662  9.212   18.892  1.00 34.46  ? 705  LYS A O     1 
ATOM   5781 C  CB    . LYS A 1 705 ? 15.461  6.729   17.031  1.00 32.44  ? 705  LYS A CB    1 
ATOM   5782 C  CG    . LYS A 1 705 ? 15.685  5.806   15.848  1.00 32.18  ? 705  LYS A CG    1 
ATOM   5783 C  CD    . LYS A 1 705 ? 15.416  4.364   16.237  1.00 32.62  ? 705  LYS A CD    1 
ATOM   5784 C  CE    . LYS A 1 705 ? 15.669  3.412   15.075  1.00 34.03  ? 705  LYS A CE    1 
ATOM   5785 N  NZ    . LYS A 1 705 ? 15.472  2.003   15.495  1.00 28.09  ? 705  LYS A NZ    1 
ATOM   5786 N  N     . LYS A 1 706 ? 13.971  9.678   17.481  1.00 32.59  ? 706  LYS A N     1 
ATOM   5787 C  CA    . LYS A 1 706 ? 13.136  10.373  18.467  1.00 32.71  ? 706  LYS A CA    1 
ATOM   5788 C  C     . LYS A 1 706 ? 13.790  11.615  19.079  1.00 31.38  ? 706  LYS A C     1 
ATOM   5789 O  O     . LYS A 1 706 ? 13.373  12.090  20.135  1.00 32.67  ? 706  LYS A O     1 
ATOM   5790 C  CB    . LYS A 1 706 ? 12.660  9.385   19.551  1.00 33.48  ? 706  LYS A CB    1 
ATOM   5791 C  CG    . LYS A 1 706 ? 11.674  8.345   19.022  1.00 38.09  ? 706  LYS A CG    1 
ATOM   5792 C  CD    . LYS A 1 706 ? 11.026  7.541   20.122  1.00 39.04  ? 706  LYS A CD    1 
ATOM   5793 C  CE    . LYS A 1 706 ? 9.947   6.603   19.573  1.00 39.92  ? 706  LYS A CE    1 
ATOM   5794 N  NZ    . LYS A 1 706 ? 8.726   7.332   19.142  1.00 33.80  ? 706  LYS A NZ    1 
ATOM   5795 N  N     . ARG A 1 707 ? 14.801  12.146  18.396  1.00 33.71  ? 707  ARG A N     1 
ATOM   5796 C  CA    . ARG A 1 707 ? 15.565  13.286  18.880  1.00 30.45  ? 707  ARG A CA    1 
ATOM   5797 C  C     . ARG A 1 707 ? 15.866  14.246  17.729  1.00 31.51  ? 707  ARG A C     1 
ATOM   5798 O  O     . ARG A 1 707 ? 16.770  13.996  16.926  1.00 33.49  ? 707  ARG A O     1 
ATOM   5799 C  CB    . ARG A 1 707 ? 16.866  12.805  19.529  1.00 30.05  ? 707  ARG A CB    1 
ATOM   5800 C  CG    . ARG A 1 707 ? 16.666  12.075  20.856  1.00 28.79  ? 707  ARG A CG    1 
ATOM   5801 C  CD    . ARG A 1 707 ? 17.975  11.750  21.562  1.00 23.54  ? 707  ARG A CD    1 
ATOM   5802 N  NE    . ARG A 1 707 ? 18.801  12.930  21.826  1.00 31.56  ? 707  ARG A NE    1 
ATOM   5803 C  CZ    . ARG A 1 707 ? 18.832  13.612  22.972  1.00 31.05  ? 707  ARG A CZ    1 
ATOM   5804 N  NH1   . ARG A 1 707 ? 18.070  13.253  24.003  1.00 30.49  ? 707  ARG A NH1   1 
ATOM   5805 N  NH2   . ARG A 1 707 ? 19.635  14.661  23.090  1.00 29.33  ? 707  ARG A NH2   1 
ATOM   5806 N  N     . TYR A 1 708 ? 15.103  15.335  17.638  1.00 30.97  ? 708  TYR A N     1 
ATOM   5807 C  CA    . TYR A 1 708 ? 15.251  16.284  16.526  1.00 31.14  ? 708  TYR A CA    1 
ATOM   5808 C  C     . TYR A 1 708 ? 14.640  17.654  16.789  1.00 31.53  ? 708  TYR A C     1 
ATOM   5809 O  O     . TYR A 1 708 ? 13.767  17.814  17.648  1.00 32.01  ? 708  TYR A O     1 
ATOM   5810 C  CB    . TYR A 1 708 ? 14.677  15.707  15.219  1.00 30.67  ? 708  TYR A CB    1 
ATOM   5811 C  CG    . TYR A 1 708 ? 13.187  15.441  15.245  1.00 29.29  ? 708  TYR A CG    1 
ATOM   5812 C  CD1   . TYR A 1 708 ? 12.693  14.213  15.668  1.00 28.01  ? 708  TYR A CD1   1 
ATOM   5813 C  CD2   . TYR A 1 708 ? 12.271  16.418  14.847  1.00 25.57  ? 708  TYR A CD2   1 
ATOM   5814 C  CE1   . TYR A 1 708 ? 11.328  13.959  15.701  1.00 29.34  ? 708  TYR A CE1   1 
ATOM   5815 C  CE2   . TYR A 1 708 ? 10.903  16.172  14.867  1.00 27.81  ? 708  TYR A CE2   1 
ATOM   5816 C  CZ    . TYR A 1 708 ? 10.437  14.935  15.297  1.00 32.10  ? 708  TYR A CZ    1 
ATOM   5817 O  OH    . TYR A 1 708 ? 9.080   14.666  15.330  1.00 33.18  ? 708  TYR A OH    1 
ATOM   5818 N  N     . ALA A 1 709 ? 15.114  18.631  16.016  1.00 32.18  ? 709  ALA A N     1 
ATOM   5819 C  CA    . ALA A 1 709 ? 14.688  20.019  16.103  1.00 30.48  ? 709  ALA A CA    1 
ATOM   5820 C  C     . ALA A 1 709 ? 14.482  20.592  14.702  1.00 31.70  ? 709  ALA A C     1 
ATOM   5821 O  O     . ALA A 1 709 ? 15.268  20.323  13.791  1.00 33.00  ? 709  ALA A O     1 
ATOM   5822 C  CB    . ALA A 1 709 ? 15.724  20.836  16.870  1.00 30.24  ? 709  ALA A CB    1 
ATOM   5823 N  N     . LEU A 1 710 ? 13.424  21.379  14.536  1.00 31.83  ? 710  LEU A N     1 
ATOM   5824 C  CA    . LEU A 1 710 ? 13.089  21.974  13.248  1.00 32.18  ? 710  LEU A CA    1 
ATOM   5825 C  C     . LEU A 1 710 ? 12.600  23.402  13.413  1.00 33.04  ? 710  LEU A C     1 
ATOM   5826 O  O     . LEU A 1 710 ? 11.890  23.718  14.370  1.00 32.09  ? 710  LEU A O     1 
ATOM   5827 C  CB    . LEU A 1 710 ? 12.013  21.154  12.535  1.00 31.75  ? 710  LEU A CB    1 
ATOM   5828 C  CG    . LEU A 1 710 ? 12.378  19.797  11.930  1.00 36.24  ? 710  LEU A CG    1 
ATOM   5829 C  CD1   . LEU A 1 710 ? 11.110  19.077  11.490  1.00 38.74  ? 710  LEU A CD1   1 
ATOM   5830 C  CD2   . LEU A 1 710 ? 13.356  19.915  10.759  1.00 35.75  ? 710  LEU A CD2   1 
ATOM   5831 N  N     . ASN A 1 711 ? 12.989  24.263  12.478  1.00 34.46  ? 711  ASN A N     1 
ATOM   5832 C  CA    . ASN A 1 711 ? 12.463  25.618  12.432  1.00 35.24  ? 711  ASN A CA    1 
ATOM   5833 C  C     . ASN A 1 711 ? 11.245  25.672  11.505  1.00 34.67  ? 711  ASN A C     1 
ATOM   5834 O  O     . ASN A 1 711 ? 11.386  25.681  10.289  1.00 35.17  ? 711  ASN A O     1 
ATOM   5835 C  CB    . ASN A 1 711 ? 13.550  26.604  12.003  1.00 37.20  ? 711  ASN A CB    1 
ATOM   5836 C  CG    . ASN A 1 711 ? 13.117  28.046  12.151  1.00 38.29  ? 711  ASN A CG    1 
ATOM   5837 O  OD1   . ASN A 1 711 ? 12.558  28.439  13.175  1.00 39.14  ? 711  ASN A OD1   1 
ATOM   5838 N  ND2   . ASN A 1 711 ? 13.366  28.842  11.125  1.00 37.66  ? 711  ASN A ND2   1 
ATOM   5839 N  N     . VAL A 1 712 ? 10.053  25.700  12.100  1.00 34.45  ? 712  VAL A N     1 
ATOM   5840 C  CA    . VAL A 1 712 ? 8.797   25.524  11.369  1.00 34.36  ? 712  VAL A CA    1 
ATOM   5841 C  C     . VAL A 1 712 ? 8.117   26.853  11.068  1.00 36.28  ? 712  VAL A C     1 
ATOM   5842 O  O     . VAL A 1 712 ? 8.005   27.717  11.941  1.00 38.08  ? 712  VAL A O     1 
ATOM   5843 C  CB    . VAL A 1 712 ? 7.818   24.567  12.119  1.00 33.45  ? 712  VAL A CB    1 
ATOM   5844 C  CG1   . VAL A 1 712 ? 6.496   24.438  11.389  1.00 29.92  ? 712  VAL A CG1   1 
ATOM   5845 C  CG2   . VAL A 1 712 ? 8.438   23.185  12.300  1.00 28.79  ? 712  VAL A CG2   1 
ATOM   5846 N  N     . TRP A 1 713 ? 7.677   26.994  9.817   1.00 36.70  ? 713  TRP A N     1 
ATOM   5847 C  CA    . TRP A 1 713 ? 6.990   28.190  9.323   1.00 35.94  ? 713  TRP A CA    1 
ATOM   5848 C  C     . TRP A 1 713 ? 5.495   27.952  9.170   1.00 35.34  ? 713  TRP A C     1 
ATOM   5849 O  O     . TRP A 1 713 ? 4.682   28.888  9.255   1.00 34.62  ? 713  TRP A O     1 
ATOM   5850 C  CB    . TRP A 1 713 ? 7.585   28.612  7.980   1.00 35.26  ? 713  TRP A CB    1 
ATOM   5851 C  CG    . TRP A 1 713 ? 9.028   28.965  8.108   1.00 37.28  ? 713  TRP A CG    1 
ATOM   5852 C  CD1   . TRP A 1 713 ? 10.095  28.149  7.866   1.00 36.29  ? 713  TRP A CD1   1 
ATOM   5853 C  CD2   . TRP A 1 713 ? 9.566   30.213  8.555   1.00 32.89  ? 713  TRP A CD2   1 
ATOM   5854 N  NE1   . TRP A 1 713 ? 11.268  28.814  8.129   1.00 35.82  ? 713  TRP A NE1   1 
ATOM   5855 C  CE2   . TRP A 1 713 ? 10.975  30.084  8.552   1.00 33.54  ? 713  TRP A CE2   1 
ATOM   5856 C  CE3   . TRP A 1 713 ? 8.996   31.429  8.956   1.00 35.49  ? 713  TRP A CE3   1 
ATOM   5857 C  CZ2   . TRP A 1 713 ? 11.830  31.131  8.927   1.00 33.13  ? 713  TRP A CZ2   1 
ATOM   5858 C  CZ3   . TRP A 1 713 ? 9.847   32.476  9.327   1.00 38.64  ? 713  TRP A CZ3   1 
ATOM   5859 C  CH2   . TRP A 1 713 ? 11.252  32.315  9.307   1.00 38.01  ? 713  TRP A CH2   1 
ATOM   5860 N  N     . ASP A 1 714 ? 5.142   26.693  8.940   1.00 32.95  ? 714  ASP A N     1 
ATOM   5861 C  CA    . ASP A 1 714 ? 3.768   26.320  8.707   1.00 34.78  ? 714  ASP A CA    1 
ATOM   5862 C  C     . ASP A 1 714 ? 3.528   24.906  9.202   1.00 35.89  ? 714  ASP A C     1 
ATOM   5863 O  O     . ASP A 1 714 ? 4.263   23.981  8.849   1.00 33.91  ? 714  ASP A O     1 
ATOM   5864 C  CB    . ASP A 1 714 ? 3.407   26.461  7.220   1.00 35.19  ? 714  ASP A CB    1 
ATOM   5865 C  CG    . ASP A 1 714 ? 1.909   26.408  6.976   1.00 37.03  ? 714  ASP A CG    1 
ATOM   5866 O  OD1   . ASP A 1 714 ? 1.282   25.375  7.299   1.00 38.00  ? 714  ASP A OD1   1 
ATOM   5867 O  OD2   . ASP A 1 714 ? 1.358   27.398  6.456   1.00 40.06  ? 714  ASP A OD2   1 
ATOM   5868 N  N     . MET A 1 715 ? 2.491   24.772  10.029  1.00 37.71  ? 715  MET A N     1 
ATOM   5869 C  CA    . MET A 1 715 ? 2.121   23.522  10.668  1.00 39.78  ? 715  MET A CA    1 
ATOM   5870 C  C     . MET A 1 715 ? 0.631   23.247  10.441  1.00 41.45  ? 715  MET A C     1 
ATOM   5871 O  O     . MET A 1 715 ? -0.232  23.967  10.956  1.00 40.50  ? 715  MET A O     1 
ATOM   5872 C  CB    . MET A 1 715 ? 2.436   23.587  12.170  1.00 41.07  ? 715  MET A CB    1 
ATOM   5873 C  CG    . MET A 1 715 ? 2.187   22.298  12.937  1.00 44.34  ? 715  MET A CG    1 
ATOM   5874 S  SD    . MET A 1 715 ? 3.393   21.025  12.529  1.00 48.91  ? 715  MET A SD    1 
ATOM   5875 C  CE    . MET A 1 715 ? 2.984   19.773  13.751  1.00 57.85  ? 715  MET A CE    1 
ATOM   5876 N  N     . GLU A 1 716 ? 0.356   22.193  9.673   1.00 41.79  ? 716  GLU A N     1 
ATOM   5877 C  CA    . GLU A 1 716 ? -0.997  21.786  9.253   1.00 43.57  ? 716  GLU A CA    1 
ATOM   5878 C  C     . GLU A 1 716 ? -1.985  22.921  8.931   1.00 42.68  ? 716  GLU A C     1 
ATOM   5879 O  O     . GLU A 1 716 ? -3.153  22.891  9.344   1.00 42.10  ? 716  GLU A O     1 
ATOM   5880 C  CB    . GLU A 1 716 ? -1.601  20.724  10.195  1.00 43.74  ? 716  GLU A CB    1 
ATOM   5881 C  CG    . GLU A 1 716 ? -1.820  21.146  11.632  1.00 49.20  ? 716  GLU A CG    1 
ATOM   5882 C  CD    . GLU A 1 716 ? -1.912  19.967  12.606  1.00 49.83  ? 716  GLU A CD    1 
ATOM   5883 O  OE1   . GLU A 1 716 ? -1.479  20.148  13.764  1.00 48.93  ? 716  GLU A OE1   1 
ATOM   5884 O  OE2   . GLU A 1 716 ? -2.406  18.877  12.222  1.00 47.76  ? 716  GLU A OE2   1 
ATOM   5885 N  N     . GLY A 1 717 ? -1.505  23.900  8.169   1.00 39.02  ? 717  GLY A N     1 
ATOM   5886 C  CA    . GLY A 1 717 ? -2.356  24.975  7.676   1.00 39.36  ? 717  GLY A CA    1 
ATOM   5887 C  C     . GLY A 1 717 ? -2.171  26.294  8.393   1.00 38.79  ? 717  GLY A C     1 
ATOM   5888 O  O     . GLY A 1 717 ? -2.642  27.330  7.927   1.00 38.16  ? 717  GLY A O     1 
ATOM   5889 N  N     . THR A 1 718 ? -1.499  26.255  9.538   1.00 39.18  ? 718  THR A N     1 
ATOM   5890 C  CA    . THR A 1 718 ? -1.260  27.461  10.314  1.00 40.70  ? 718  THR A CA    1 
ATOM   5891 C  C     . THR A 1 718 ? 0.045   28.102  9.876   1.00 39.82  ? 718  THR A C     1 
ATOM   5892 O  O     . THR A 1 718 ? 1.109   27.518  10.035  1.00 41.30  ? 718  THR A O     1 
ATOM   5893 C  CB    . THR A 1 718 ? -1.217  27.161  11.819  1.00 40.46  ? 718  THR A CB    1 
ATOM   5894 O  OG1   . THR A 1 718 ? -2.323  26.319  12.162  1.00 42.17  ? 718  THR A OG1   1 
ATOM   5895 C  CG2   . THR A 1 718 ? -1.286  28.455  12.629  1.00 38.88  ? 718  THR A CG2   1 
ATOM   5896 N  N     . ARG A 1 719 ? -0.047  29.293  9.305   1.00 41.12  ? 719  ARG A N     1 
ATOM   5897 C  CA    . ARG A 1 719 ? 1.139   30.051  8.931   1.00 42.48  ? 719  ARG A CA    1 
ATOM   5898 C  C     . ARG A 1 719 ? 1.496   30.966  10.086  1.00 42.70  ? 719  ARG A C     1 
ATOM   5899 O  O     . ARG A 1 719 ? 0.733   31.876  10.414  1.00 45.54  ? 719  ARG A O     1 
ATOM   5900 C  CB    . ARG A 1 719 ? 0.889   30.870  7.655   1.00 42.97  ? 719  ARG A CB    1 
ATOM   5901 C  CG    . ARG A 1 719 ? 2.136   31.578  7.100   1.00 42.02  ? 719  ARG A CG    1 
ATOM   5902 C  CD    . ARG A 1 719 ? 3.186   30.573  6.603   1.00 40.63  ? 719  ARG A CD    1 
ATOM   5903 N  NE    . ARG A 1 719 ? 2.626   29.635  5.637   1.00 39.71  ? 719  ARG A NE    1 
ATOM   5904 C  CZ    . ARG A 1 719 ? 2.531   29.877  4.331   1.00 42.46  ? 719  ARG A CZ    1 
ATOM   5905 N  NH1   . ARG A 1 719 ? 2.967   31.032  3.837   1.00 40.30  ? 719  ARG A NH1   1 
ATOM   5906 N  NH2   . ARG A 1 719 ? 2.002   28.965  3.521   1.00 33.80  ? 719  ARG A NH2   1 
ATOM   5907 N  N     . TYR A 1 720 ? 2.647   30.723  10.706  1.00 42.90  ? 720  TYR A N     1 
ATOM   5908 C  CA    . TYR A 1 720 ? 3.032   31.464  11.905  1.00 43.69  ? 720  TYR A CA    1 
ATOM   5909 C  C     . TYR A 1 720 ? 3.490   32.872  11.563  1.00 45.81  ? 720  TYR A C     1 
ATOM   5910 O  O     . TYR A 1 720 ? 4.097   33.090  10.516  1.00 47.00  ? 720  TYR A O     1 
ATOM   5911 C  CB    . TYR A 1 720 ? 4.144   30.739  12.664  1.00 43.25  ? 720  TYR A CB    1 
ATOM   5912 C  CG    . TYR A 1 720 ? 3.758   29.388  13.202  1.00 43.77  ? 720  TYR A CG    1 
ATOM   5913 C  CD1   . TYR A 1 720 ? 2.792   29.256  14.203  1.00 44.42  ? 720  TYR A CD1   1 
ATOM   5914 C  CD2   . TYR A 1 720 ? 4.364   28.236  12.716  1.00 43.94  ? 720  TYR A CD2   1 
ATOM   5915 C  CE1   . TYR A 1 720 ? 2.434   28.003  14.690  1.00 45.30  ? 720  TYR A CE1   1 
ATOM   5916 C  CE2   . TYR A 1 720 ? 4.018   26.988  13.196  1.00 45.41  ? 720  TYR A CE2   1 
ATOM   5917 C  CZ    . TYR A 1 720 ? 3.056   26.874  14.178  1.00 46.01  ? 720  TYR A CZ    1 
ATOM   5918 O  OH    . TYR A 1 720 ? 2.728   25.621  14.645  1.00 49.68  ? 720  TYR A OH    1 
ATOM   5919 N  N     . ALA A 1 721 ? 3.188   33.826  12.440  1.00 46.32  ? 721  ALA A N     1 
ATOM   5920 C  CA    . ALA A 1 721 ? 3.723   35.180  12.298  1.00 48.82  ? 721  ALA A CA    1 
ATOM   5921 C  C     . ALA A 1 721 ? 5.221   35.143  12.594  1.00 48.86  ? 721  ALA A C     1 
ATOM   5922 O  O     . ALA A 1 721 ? 6.012   35.822  11.943  1.00 50.10  ? 721  ALA A O     1 
ATOM   5923 C  CB    . ALA A 1 721 ? 3.004   36.151  13.236  1.00 48.84  ? 721  ALA A CB    1 
ATOM   5924 N  N     . GLU A 1 722 ? 5.593   34.330  13.580  1.00 48.20  ? 722  GLU A N     1 
ATOM   5925 C  CA    . GLU A 1 722 ? 6.989   34.100  13.928  1.00 49.33  ? 722  GLU A CA    1 
ATOM   5926 C  C     . GLU A 1 722 ? 7.296   32.611  13.820  1.00 46.93  ? 722  GLU A C     1 
ATOM   5927 O  O     . GLU A 1 722 ? 6.484   31.784  14.241  1.00 45.33  ? 722  GLU A O     1 
ATOM   5928 C  CB    . GLU A 1 722 ? 7.281   34.584  15.354  1.00 51.54  ? 722  GLU A CB    1 
ATOM   5929 C  CG    . GLU A 1 722 ? 7.004   36.067  15.608  1.00 58.10  ? 722  GLU A CG    1 
ATOM   5930 C  CD    . GLU A 1 722 ? 7.965   36.994  14.880  1.00 66.45  ? 722  GLU A CD    1 
ATOM   5931 O  OE1   . GLU A 1 722 ? 9.004   36.511  14.374  1.00 70.89  ? 722  GLU A OE1   1 
ATOM   5932 O  OE2   . GLU A 1 722 ? 7.682   38.213  14.816  1.00 70.16  ? 722  GLU A OE2   1 
ATOM   5933 N  N     . PRO A 1 723 ? 8.475   32.259  13.274  1.00 45.18  ? 723  PRO A N     1 
ATOM   5934 C  CA    . PRO A 1 723 ? 8.830   30.841  13.154  1.00 42.97  ? 723  PRO A CA    1 
ATOM   5935 C  C     . PRO A 1 723 ? 8.753   30.139  14.514  1.00 43.21  ? 723  PRO A C     1 
ATOM   5936 O  O     . PRO A 1 723 ? 9.031   30.754  15.549  1.00 40.80  ? 723  PRO A O     1 
ATOM   5937 C  CB    . PRO A 1 723 ? 10.276  30.881  12.654  1.00 41.63  ? 723  PRO A CB    1 
ATOM   5938 C  CG    . PRO A 1 723 ? 10.785  32.230  13.083  1.00 46.89  ? 723  PRO A CG    1 
ATOM   5939 C  CD    . PRO A 1 723 ? 9.604   33.140  12.934  1.00 45.96  ? 723  PRO A CD    1 
ATOM   5940 N  N     . LYS A 1 724 ? 8.361   28.870  14.512  1.00 42.08  ? 724  LYS A N     1 
ATOM   5941 C  CA    . LYS A 1 724 ? 8.180   28.145  15.758  1.00 43.65  ? 724  LYS A CA    1 
ATOM   5942 C  C     . LYS A 1 724 ? 9.108   26.937  15.804  1.00 42.69  ? 724  LYS A C     1 
ATOM   5943 O  O     . LYS A 1 724 ? 9.228   26.195  14.821  1.00 42.27  ? 724  LYS A O     1 
ATOM   5944 C  CB    . LYS A 1 724 ? 6.710   27.742  15.930  1.00 44.32  ? 724  LYS A CB    1 
ATOM   5945 C  CG    . LYS A 1 724 ? 6.344   27.142  17.293  1.00 51.14  ? 724  LYS A CG    1 
ATOM   5946 C  CD    . LYS A 1 724 ? 4.825   27.168  17.526  1.00 56.19  ? 724  LYS A CD    1 
ATOM   5947 C  CE    . LYS A 1 724 ? 4.356   26.076  18.494  1.00 59.24  ? 724  LYS A CE    1 
ATOM   5948 N  NZ    . LYS A 1 724 ? 4.743   26.348  19.907  1.00 59.98  ? 724  LYS A NZ    1 
ATOM   5949 N  N     . LEU A 1 725 ? 9.774   26.750  16.941  1.00 39.87  ? 725  LEU A N     1 
ATOM   5950 C  CA    . LEU A 1 725 ? 10.649  25.597  17.114  1.00 38.53  ? 725  LEU A CA    1 
ATOM   5951 C  C     . LEU A 1 725 ? 9.856   24.332  17.417  1.00 37.32  ? 725  LEU A C     1 
ATOM   5952 O  O     . LEU A 1 725 ? 9.131   24.264  18.407  1.00 38.53  ? 725  LEU A O     1 
ATOM   5953 C  CB    . LEU A 1 725 ? 11.688  25.851  18.210  1.00 38.52  ? 725  LEU A CB    1 
ATOM   5954 C  CG    . LEU A 1 725 ? 12.700  26.985  18.004  1.00 37.36  ? 725  LEU A CG    1 
ATOM   5955 C  CD1   . LEU A 1 725 ? 13.644  27.072  19.183  1.00 36.95  ? 725  LEU A CD1   1 
ATOM   5956 C  CD2   . LEU A 1 725 ? 13.484  26.821  16.715  1.00 38.65  ? 725  LEU A CD2   1 
ATOM   5957 N  N     . LYS A 1 726 ? 9.967   23.343  16.539  1.00 35.50  ? 726  LYS A N     1 
ATOM   5958 C  CA    . LYS A 1 726 ? 9.459   22.022  16.841  1.00 35.02  ? 726  LYS A CA    1 
ATOM   5959 C  C     . LYS A 1 726 ? 10.628  21.171  17.325  1.00 35.17  ? 726  LYS A C     1 
ATOM   5960 O  O     . LYS A 1 726 ? 11.495  20.788  16.536  1.00 36.36  ? 726  LYS A O     1 
ATOM   5961 C  CB    . LYS A 1 726 ? 8.788   21.384  15.626  1.00 34.86  ? 726  LYS A CB    1 
ATOM   5962 C  CG    . LYS A 1 726 ? 8.088   20.053  15.957  1.00 37.57  ? 726  LYS A CG    1 
ATOM   5963 C  CD    . LYS A 1 726 ? 7.495   19.389  14.718  1.00 41.09  ? 726  LYS A CD    1 
ATOM   5964 C  CE    . LYS A 1 726 ? 7.065   17.937  14.981  1.00 45.04  ? 726  LYS A CE    1 
ATOM   5965 N  NZ    . LYS A 1 726 ? 5.999   17.815  16.027  1.00 45.73  ? 726  LYS A NZ    1 
ATOM   5966 N  N     . ILE A 1 727 ? 10.661  20.904  18.627  1.00 33.44  ? 727  ILE A N     1 
ATOM   5967 C  CA    . ILE A 1 727 ? 11.719  20.100  19.219  1.00 32.46  ? 727  ILE A CA    1 
ATOM   5968 C  C     . ILE A 1 727 ? 11.140  18.846  19.845  1.00 34.02  ? 727  ILE A C     1 
ATOM   5969 O  O     . ILE A 1 727 ? 10.271  18.928  20.713  1.00 36.28  ? 727  ILE A O     1 
ATOM   5970 C  CB    . ILE A 1 727 ? 12.498  20.881  20.289  1.00 32.59  ? 727  ILE A CB    1 
ATOM   5971 C  CG1   . ILE A 1 727 ? 13.038  22.194  19.703  1.00 30.08  ? 727  ILE A CG1   1 
ATOM   5972 C  CG2   . ILE A 1 727 ? 13.628  20.011  20.866  1.00 29.25  ? 727  ILE A CG2   1 
ATOM   5973 C  CD1   . ILE A 1 727 ? 13.460  23.200  20.739  1.00 27.76  ? 727  ILE A CD1   1 
ATOM   5974 N  N     . MET A 1 728 ? 11.619  17.686  19.409  1.00 31.60  ? 728  MET A N     1 
ATOM   5975 C  CA    . MET A 1 728 ? 11.157  16.438  19.991  1.00 31.57  ? 728  MET A CA    1 
ATOM   5976 C  C     . MET A 1 728 ? 12.292  15.683  20.665  1.00 31.41  ? 728  MET A C     1 
ATOM   5977 O  O     . MET A 1 728 ? 13.375  15.540  20.095  1.00 31.82  ? 728  MET A O     1 
ATOM   5978 C  CB    . MET A 1 728 ? 10.470  15.552  18.938  1.00 33.18  ? 728  MET A CB    1 
ATOM   5979 C  CG    . MET A 1 728 ? 9.246   16.183  18.222  1.00 38.46  ? 728  MET A CG    1 
ATOM   5980 S  SD    . MET A 1 728 ? 8.023   17.066  19.247  1.00 47.78  ? 728  MET A SD    1 
ATOM   5981 C  CE    . MET A 1 728 ? 7.448   15.782  20.343  1.00 37.15  ? 728  MET A CE    1 
ATOM   5982 N  N     . GLY A 1 729 ? 12.047  15.216  21.886  1.00 29.48  ? 729  GLY A N     1 
ATOM   5983 C  CA    . GLY A 1 729 ? 12.945  14.259  22.530  1.00 28.74  ? 729  GLY A CA    1 
ATOM   5984 C  C     . GLY A 1 729 ? 14.174  14.834  23.200  1.00 28.88  ? 729  GLY A C     1 
ATOM   5985 O  O     . GLY A 1 729 ? 14.675  14.262  24.157  1.00 30.46  ? 729  GLY A O     1 
ATOM   5986 N  N     . LEU A 1 730 ? 14.649  15.970  22.705  1.00 29.33  ? 730  LEU A N     1 
ATOM   5987 C  CA    . LEU A 1 730 ? 15.840  16.613  23.239  1.00 28.60  ? 730  LEU A CA    1 
ATOM   5988 C  C     . LEU A 1 730 ? 15.581  17.187  24.612  1.00 31.26  ? 730  LEU A C     1 
ATOM   5989 O  O     . LEU A 1 730 ? 14.423  17.350  25.039  1.00 30.15  ? 730  LEU A O     1 
ATOM   5990 C  CB    . LEU A 1 730 ? 16.337  17.722  22.304  1.00 29.36  ? 730  LEU A CB    1 
ATOM   5991 C  CG    . LEU A 1 730 ? 16.477  17.402  20.815  1.00 26.09  ? 730  LEU A CG    1 
ATOM   5992 C  CD1   . LEU A 1 730 ? 17.102  18.601  20.110  1.00 23.88  ? 730  LEU A CD1   1 
ATOM   5993 C  CD2   . LEU A 1 730 ? 17.303  16.141  20.599  1.00 25.75  ? 730  LEU A CD2   1 
ATOM   5994 N  N     . GLU A 1 731 ? 16.678  17.518  25.288  1.00 30.04  ? 731  GLU A N     1 
ATOM   5995 C  CA    . GLU A 1 731 ? 16.656  17.827  26.702  1.00 30.36  ? 731  GLU A CA    1 
ATOM   5996 C  C     . GLU A 1 731 ? 15.765  19.018  27.082  1.00 31.20  ? 731  GLU A C     1 
ATOM   5997 O  O     . GLU A 1 731 ? 15.347  19.139  28.232  1.00 31.56  ? 731  GLU A O     1 
ATOM   5998 C  CB    . GLU A 1 731 ? 18.087  17.981  27.212  1.00 31.85  ? 731  GLU A CB    1 
ATOM   5999 C  CG    . GLU A 1 731 ? 18.740  16.631  27.555  1.00 34.72  ? 731  GLU A CG    1 
ATOM   6000 C  CD    . GLU A 1 731 ? 19.274  15.856  26.343  1.00 37.80  ? 731  GLU A CD    1 
ATOM   6001 O  OE1   . GLU A 1 731 ? 19.189  16.345  25.189  1.00 33.45  ? 731  GLU A OE1   1 
ATOM   6002 O  OE2   . GLU A 1 731 ? 19.801  14.741  26.558  1.00 39.60  ? 731  GLU A OE2   1 
ATOM   6003 N  N     . THR A 1 732 ? 15.454  19.869  26.107  1.00 29.32  ? 732  THR A N     1 
ATOM   6004 C  CA    . THR A 1 732 ? 14.569  21.005  26.318  1.00 29.47  ? 732  THR A CA    1 
ATOM   6005 C  C     . THR A 1 732 ? 13.136  20.572  26.569  1.00 30.76  ? 732  THR A C     1 
ATOM   6006 O  O     . THR A 1 732 ? 12.336  21.359  27.061  1.00 33.27  ? 732  THR A O     1 
ATOM   6007 C  CB    . THR A 1 732 ? 14.555  21.950  25.091  1.00 30.22  ? 732  THR A CB    1 
ATOM   6008 O  OG1   . THR A 1 732 ? 14.170  21.214  23.925  1.00 33.22  ? 732  THR A OG1   1 
ATOM   6009 C  CG2   . THR A 1 732 ? 15.912  22.549  24.860  1.00 29.08  ? 732  THR A CG2   1 
ATOM   6010 N  N     . GLN A 1 733 ? 12.807  19.330  26.215  1.00 31.75  ? 733  GLN A N     1 
ATOM   6011 C  CA    . GLN A 1 733 ? 11.432  18.831  26.315  1.00 32.43  ? 733  GLN A CA    1 
ATOM   6012 C  C     . GLN A 1 733 ? 11.201  17.959  27.542  1.00 33.70  ? 733  GLN A C     1 
ATOM   6013 O  O     . GLN A 1 733 ? 10.070  17.562  27.812  1.00 35.70  ? 733  GLN A O     1 
ATOM   6014 C  CB    . GLN A 1 733 ? 11.046  18.045  25.052  1.00 34.15  ? 733  GLN A CB    1 
ATOM   6015 C  CG    . GLN A 1 733 ? 11.364  18.754  23.739  1.00 34.53  ? 733  GLN A CG    1 
ATOM   6016 C  CD    . GLN A 1 733 ? 10.831  20.170  23.707  1.00 37.44  ? 733  GLN A CD    1 
ATOM   6017 O  OE1   . GLN A 1 733 ? 11.587  21.130  23.868  1.00 36.71  ? 733  GLN A OE1   1 
ATOM   6018 N  NE2   . GLN A 1 733 ? 9.519   20.309  23.524  1.00 35.40  ? 733  GLN A NE2   1 
ATOM   6019 N  N     . LYS A 1 734 ? 12.272  17.673  28.278  1.00 35.96  ? 734  LYS A N     1 
ATOM   6020 C  CA    . LYS A 1 734 ? 12.231  16.763  29.422  1.00 36.95  ? 734  LYS A CA    1 
ATOM   6021 C  C     . LYS A 1 734 ? 11.993  17.516  30.722  1.00 36.47  ? 734  LYS A C     1 
ATOM   6022 O  O     . LYS A 1 734 ? 12.641  18.526  30.985  1.00 38.79  ? 734  LYS A O     1 
ATOM   6023 C  CB    . LYS A 1 734 ? 13.542  15.979  29.523  1.00 38.45  ? 734  LYS A CB    1 
ATOM   6024 C  CG    . LYS A 1 734 ? 13.807  15.033  28.360  1.00 41.84  ? 734  LYS A CG    1 
ATOM   6025 C  CD    . LYS A 1 734 ? 15.273  14.582  28.325  1.00 48.17  ? 734  LYS A CD    1 
ATOM   6026 C  CE    . LYS A 1 734 ? 15.516  13.292  29.099  1.00 50.48  ? 734  LYS A CE    1 
ATOM   6027 N  NZ    . LYS A 1 734 ? 15.029  12.104  28.339  1.00 52.26  ? 734  LYS A NZ    1 
ATOM   6028 N  N     . SER A 1 735 ? 11.073  17.013  31.542  1.00 35.44  ? 735  SER A N     1 
ATOM   6029 C  CA    . SER A 1 735 ? 10.768  17.634  32.829  1.00 34.21  ? 735  SER A CA    1 
ATOM   6030 C  C     . SER A 1 735 ? 11.917  17.473  33.828  1.00 35.19  ? 735  SER A C     1 
ATOM   6031 O  O     . SER A 1 735 ? 12.004  18.206  34.810  1.00 33.12  ? 735  SER A O     1 
ATOM   6032 C  CB    . SER A 1 735 ? 9.475   17.060  33.403  1.00 35.41  ? 735  SER A CB    1 
ATOM   6033 O  OG    . SER A 1 735 ? 9.596   15.671  33.634  1.00 33.30  ? 735  SER A OG    1 
ATOM   6034 N  N     . SER A 1 736 ? 12.792  16.509  33.558  1.00 34.38  ? 736  SER A N     1 
ATOM   6035 C  CA    . SER A 1 736 ? 13.981  16.247  34.369  1.00 32.59  ? 736  SER A CA    1 
ATOM   6036 C  C     . SER A 1 736 ? 15.105  17.276  34.187  1.00 31.87  ? 736  SER A C     1 
ATOM   6037 O  O     . SER A 1 736 ? 15.991  17.386  35.027  1.00 28.77  ? 736  SER A O     1 
ATOM   6038 C  CB    . SER A 1 736 ? 14.525  14.871  34.015  1.00 33.76  ? 736  SER A CB    1 
ATOM   6039 O  OG    . SER A 1 736 ? 14.614  14.746  32.609  1.00 34.69  ? 736  SER A OG    1 
ATOM   6040 N  N     . THR A 1 737 ? 15.084  18.004  33.077  1.00 31.12  ? 737  THR A N     1 
ATOM   6041 C  CA    . THR A 1 737 ? 16.107  18.995  32.797  1.00 30.04  ? 737  THR A CA    1 
ATOM   6042 C  C     . THR A 1 737 ? 15.796  20.284  33.548  1.00 32.05  ? 737  THR A C     1 
ATOM   6043 O  O     . THR A 1 737 ? 14.646  20.737  33.532  1.00 32.44  ? 737  THR A O     1 
ATOM   6044 C  CB    . THR A 1 737 ? 16.169  19.272  31.295  1.00 30.31  ? 737  THR A CB    1 
ATOM   6045 O  OG1   . THR A 1 737 ? 16.408  18.040  30.606  1.00 28.58  ? 737  THR A OG1   1 
ATOM   6046 C  CG2   . THR A 1 737 ? 17.285  20.258  30.952  1.00 30.18  ? 737  THR A CG2   1 
ATOM   6047 N  N     . PRO A 1 738 ? 16.813  20.879  34.214  1.00 26.48  ? 738  PRO A N     1 
ATOM   6048 C  CA    . PRO A 1 738 ? 16.624  22.138  34.943  1.00 26.70  ? 738  PRO A CA    1 
ATOM   6049 C  C     . PRO A 1 738 ? 15.937  23.194  34.086  1.00 28.62  ? 738  PRO A C     1 
ATOM   6050 O  O     . PRO A 1 738 ? 16.158  23.254  32.870  1.00 28.37  ? 738  PRO A O     1 
ATOM   6051 C  CB    . PRO A 1 738 ? 18.052  22.576  35.268  1.00 26.37  ? 738  PRO A CB    1 
ATOM   6052 C  CG    . PRO A 1 738 ? 18.825  21.324  35.350  1.00 27.10  ? 738  PRO A CG    1 
ATOM   6053 C  CD    . PRO A 1 738 ? 18.185  20.362  34.367  1.00 25.04  ? 738  PRO A CD    1 
ATOM   6054 N  N     . LYS A 1 739 ? 15.099  24.010  34.713  1.00 31.34  ? 739  LYS A N     1 
ATOM   6055 C  CA    . LYS A 1 739 ? 14.362  25.045  33.985  1.00 35.27  ? 739  LYS A CA    1 
ATOM   6056 C  C     . LYS A 1 739 ? 15.270  25.991  33.206  1.00 34.30  ? 739  LYS A C     1 
ATOM   6057 O  O     . LYS A 1 739 ? 15.035  26.237  32.030  1.00 33.86  ? 739  LYS A O     1 
ATOM   6058 C  CB    . LYS A 1 739 ? 13.423  25.824  34.916  1.00 36.69  ? 739  LYS A CB    1 
ATOM   6059 C  CG    . LYS A 1 739 ? 12.069  25.155  35.100  1.00 46.16  ? 739  LYS A CG    1 
ATOM   6060 C  CD    . LYS A 1 739 ? 11.306  25.058  33.767  1.00 51.54  ? 739  LYS A CD    1 
ATOM   6061 C  CE    . LYS A 1 739 ? 10.302  23.900  33.756  1.00 55.95  ? 739  LYS A CE    1 
ATOM   6062 N  NZ    . LYS A 1 739 ? 9.042   24.219  34.506  1.00 60.89  ? 739  LYS A NZ    1 
ATOM   6063 N  N     . ALA A 1 740 ? 16.308  26.504  33.863  1.00 34.98  ? 740  ALA A N     1 
ATOM   6064 C  CA    . ALA A 1 740 ? 17.235  27.435  33.228  1.00 37.03  ? 740  ALA A CA    1 
ATOM   6065 C  C     . ALA A 1 740 ? 18.000  26.782  32.083  1.00 35.40  ? 740  ALA A C     1 
ATOM   6066 O  O     . ALA A 1 740 ? 18.291  27.427  31.086  1.00 39.33  ? 740  ALA A O     1 
ATOM   6067 C  CB    . ALA A 1 740 ? 18.197  28.031  34.258  1.00 38.98  ? 740  ALA A CB    1 
ATOM   6068 N  N     . VAL A 1 741 ? 18.303  25.499  32.233  1.00 34.70  ? 741  VAL A N     1 
ATOM   6069 C  CA    . VAL A 1 741 ? 18.979  24.720  31.202  1.00 32.60  ? 741  VAL A CA    1 
ATOM   6070 C  C     . VAL A 1 741 ? 18.079  24.474  29.983  1.00 32.74  ? 741  VAL A C     1 
ATOM   6071 O  O     . VAL A 1 741 ? 18.547  24.583  28.855  1.00 32.17  ? 741  VAL A O     1 
ATOM   6072 C  CB    . VAL A 1 741 ? 19.529  23.386  31.767  1.00 33.15  ? 741  VAL A CB    1 
ATOM   6073 C  CG1   . VAL A 1 741 ? 20.161  22.571  30.681  1.00 31.03  ? 741  VAL A CG1   1 
ATOM   6074 C  CG2   . VAL A 1 741 ? 20.551  23.660  32.865  1.00 34.06  ? 741  VAL A CG2   1 
ATOM   6075 N  N     . GLN A 1 742 ? 16.798  24.162  30.208  1.00 31.35  ? 742  GLN A N     1 
ATOM   6076 C  CA    . GLN A 1 742 ? 15.846  23.999  29.107  1.00 32.37  ? 742  GLN A CA    1 
ATOM   6077 C  C     . GLN A 1 742 ? 15.806  25.287  28.301  1.00 33.82  ? 742  GLN A C     1 
ATOM   6078 O  O     . GLN A 1 742 ? 15.816  25.261  27.070  1.00 33.82  ? 742  GLN A O     1 
ATOM   6079 C  CB    . GLN A 1 742 ? 14.420  23.706  29.593  1.00 32.06  ? 742  GLN A CB    1 
ATOM   6080 C  CG    . GLN A 1 742 ? 14.217  22.525  30.535  1.00 32.14  ? 742  GLN A CG    1 
ATOM   6081 C  CD    . GLN A 1 742 ? 12.761  22.404  30.995  1.00 33.88  ? 742  GLN A CD    1 
ATOM   6082 O  OE1   . GLN A 1 742 ? 12.030  23.391  31.055  1.00 32.75  ? 742  GLN A OE1   1 
ATOM   6083 N  NE2   . GLN A 1 742 ? 12.340  21.190  31.313  1.00 34.82  ? 742  GLN A NE2   1 
ATOM   6084 N  N     . LYS A 1 743 ? 15.759  26.411  29.015  1.00 34.76  ? 743  LYS A N     1 
ATOM   6085 C  CA    . LYS A 1 743 ? 15.672  27.736  28.403  1.00 35.85  ? 743  LYS A CA    1 
ATOM   6086 C  C     . LYS A 1 743 ? 16.925  28.028  27.578  1.00 35.73  ? 743  LYS A C     1 
ATOM   6087 O  O     . LYS A 1 743 ? 16.830  28.420  26.407  1.00 35.84  ? 743  LYS A O     1 
ATOM   6088 C  CB    . LYS A 1 743 ? 15.453  28.797  29.488  1.00 37.17  ? 743  LYS A CB    1 
ATOM   6089 C  CG    . LYS A 1 743 ? 15.126  30.206  28.993  1.00 41.94  ? 743  LYS A CG    1 
ATOM   6090 C  CD    . LYS A 1 743 ? 14.424  30.994  30.099  1.00 48.48  ? 743  LYS A CD    1 
ATOM   6091 C  CE    . LYS A 1 743 ? 14.968  32.416  30.245  1.00 52.45  ? 743  LYS A CE    1 
ATOM   6092 N  NZ    . LYS A 1 743 ? 14.629  33.299  29.085  1.00 51.58  ? 743  LYS A NZ    1 
ATOM   6093 N  N     . ALA A 1 744 ? 18.091  27.807  28.183  1.00 33.41  ? 744  ALA A N     1 
ATOM   6094 C  CA    . ALA A 1 744 ? 19.366  28.068  27.513  1.00 34.27  ? 744  ALA A CA    1 
ATOM   6095 C  C     . ALA A 1 744 ? 19.640  27.134  26.326  1.00 32.24  ? 744  ALA A C     1 
ATOM   6096 O  O     . ALA A 1 744 ? 20.082  27.595  25.267  1.00 32.22  ? 744  ALA A O     1 
ATOM   6097 C  CB    . ALA A 1 744 ? 20.510  28.023  28.506  1.00 32.90  ? 744  ALA A CB    1 
ATOM   6098 N  N     . LEU A 1 745 ? 19.389  25.837  26.501  1.00 30.61  ? 745  LEU A N     1 
ATOM   6099 C  CA    . LEU A 1 745 ? 19.504  24.878  25.394  1.00 30.44  ? 745  LEU A CA    1 
ATOM   6100 C  C     . LEU A 1 745 ? 18.578  25.262  24.234  1.00 31.46  ? 745  LEU A C     1 
ATOM   6101 O  O     . LEU A 1 745 ? 18.993  25.246  23.071  1.00 32.73  ? 745  LEU A O     1 
ATOM   6102 C  CB    . LEU A 1 745 ? 19.228  23.439  25.861  1.00 29.40  ? 745  LEU A CB    1 
ATOM   6103 C  CG    . LEU A 1 745 ? 20.277  22.696  26.705  1.00 29.18  ? 745  LEU A CG    1 
ATOM   6104 C  CD1   . LEU A 1 745 ? 19.716  21.372  27.204  1.00 21.39  ? 745  LEU A CD1   1 
ATOM   6105 C  CD2   . LEU A 1 745 ? 21.617  22.478  25.955  1.00 25.63  ? 745  LEU A CD2   1 
ATOM   6106 N  N     . LYS A 1 746 ? 17.337  25.626  24.562  1.00 31.01  ? 746  LYS A N     1 
ATOM   6107 C  CA    . LYS A 1 746 ? 16.383  26.140  23.577  1.00 34.60  ? 746  LYS A CA    1 
ATOM   6108 C  C     . LYS A 1 746 ? 16.895  27.343  22.773  1.00 36.58  ? 746  LYS A C     1 
ATOM   6109 O  O     . LYS A 1 746 ? 16.703  27.409  21.547  1.00 38.65  ? 746  LYS A O     1 
ATOM   6110 C  CB    . LYS A 1 746 ? 15.043  26.493  24.229  1.00 35.71  ? 746  LYS A CB    1 
ATOM   6111 C  CG    . LYS A 1 746 ? 13.962  26.836  23.214  1.00 38.27  ? 746  LYS A CG    1 
ATOM   6112 C  CD    . LYS A 1 746 ? 12.571  26.760  23.798  1.00 41.45  ? 746  LYS A CD    1 
ATOM   6113 C  CE    . LYS A 1 746 ? 11.534  27.058  22.724  1.00 42.12  ? 746  LYS A CE    1 
ATOM   6114 N  NZ    . LYS A 1 746 ? 10.145  26.848  23.217  1.00 48.18  ? 746  LYS A NZ    1 
ATOM   6115 N  N     . GLU A 1 747 ? 17.530  28.293  23.452  1.00 34.57  ? 747  GLU A N     1 
ATOM   6116 C  CA    . GLU A 1 747 ? 18.058  29.465  22.759  1.00 35.85  ? 747  GLU A CA    1 
ATOM   6117 C  C     . GLU A 1 747 ? 19.228  29.069  21.848  1.00 35.92  ? 747  GLU A C     1 
ATOM   6118 O  O     . GLU A 1 747 ? 19.354  29.584  20.742  1.00 33.93  ? 747  GLU A O     1 
ATOM   6119 C  CB    . GLU A 1 747 ? 18.420  30.591  23.742  1.00 33.76  ? 747  GLU A CB    1 
ATOM   6120 C  CG    . GLU A 1 747 ? 18.994  31.872  23.116  1.00 34.27  ? 747  GLU A CG    1 
ATOM   6121 C  CD    . GLU A 1 747 ? 18.106  32.537  22.066  1.00 36.57  ? 747  GLU A CD    1 
ATOM   6122 O  OE1   . GLU A 1 747 ? 18.616  33.436  21.362  1.00 39.63  ? 747  GLU A OE1   1 
ATOM   6123 O  OE2   . GLU A 1 747 ? 16.915  32.184  21.930  1.00 37.55  ? 747  GLU A OE2   1 
ATOM   6124 N  N     . CYS A 1 748 ? 20.056  28.138  22.314  1.00 36.33  ? 748  CYS A N     1 
ATOM   6125 C  CA    . CYS A 1 748 ? 21.132  27.579  21.498  1.00 36.97  ? 748  CYS A CA    1 
ATOM   6126 C  C     . CYS A 1 748 ? 20.590  26.955  20.211  1.00 36.44  ? 748  CYS A C     1 
ATOM   6127 O  O     . CYS A 1 748 ? 21.090  27.226  19.123  1.00 37.93  ? 748  CYS A O     1 
ATOM   6128 C  CB    . CYS A 1 748 ? 21.905  26.525  22.289  1.00 36.89  ? 748  CYS A CB    1 
ATOM   6129 S  SG    . CYS A 1 748 ? 22.919  27.203  23.604  1.00 36.58  ? 748  CYS A SG    1 
ATOM   6130 N  N     . ILE A 1 749 ? 19.561  26.126  20.349  1.00 35.22  ? 749  ILE A N     1 
ATOM   6131 C  CA    . ILE A 1 749 ? 18.883  25.524  19.208  1.00 31.78  ? 749  ILE A CA    1 
ATOM   6132 C  C     . ILE A 1 749 ? 18.253  26.585  18.297  1.00 32.64  ? 749  ILE A C     1 
ATOM   6133 O  O     . ILE A 1 749 ? 18.425  26.533  17.072  1.00 34.20  ? 749  ILE A O     1 
ATOM   6134 C  CB    . ILE A 1 749 ? 17.834  24.492  19.669  1.00 31.40  ? 749  ILE A CB    1 
ATOM   6135 C  CG1   . ILE A 1 749 ? 18.521  23.285  20.313  1.00 28.91  ? 749  ILE A CG1   1 
ATOM   6136 C  CG2   . ILE A 1 749 ? 16.969  24.041  18.507  1.00 33.92  ? 749  ILE A CG2   1 
ATOM   6137 C  CD1   . ILE A 1 749 ? 17.560  22.354  21.067  1.00 28.77  ? 749  ILE A CD1   1 
ATOM   6138 N  N     . ARG A 1 750 ? 17.546  27.549  18.888  1.00 32.48  ? 750  ARG A N     1 
ATOM   6139 C  CA    . ARG A 1 750 ? 17.007  28.680  18.126  1.00 34.57  ? 750  ARG A CA    1 
ATOM   6140 C  C     . ARG A 1 750 ? 18.111  29.321  17.301  1.00 34.93  ? 750  ARG A C     1 
ATOM   6141 O  O     . ARG A 1 750 ? 17.963  29.507  16.088  1.00 36.14  ? 750  ARG A O     1 
ATOM   6142 C  CB    . ARG A 1 750 ? 16.359  29.735  19.037  1.00 35.10  ? 750  ARG A CB    1 
ATOM   6143 C  CG    . ARG A 1 750 ? 15.434  30.694  18.275  1.00 37.18  ? 750  ARG A CG    1 
ATOM   6144 C  CD    . ARG A 1 750 ? 15.088  31.960  19.058  1.00 35.92  ? 750  ARG A CD    1 
ATOM   6145 N  NE    . ARG A 1 750 ? 16.277  32.764  19.346  1.00 39.77  ? 750  ARG A NE    1 
ATOM   6146 C  CZ    . ARG A 1 750 ? 16.929  33.517  18.459  1.00 40.87  ? 750  ARG A CZ    1 
ATOM   6147 N  NH1   . ARG A 1 750 ? 16.527  33.594  17.188  1.00 34.71  ? 750  ARG A NH1   1 
ATOM   6148 N  NH2   . ARG A 1 750 ? 18.002  34.195  18.851  1.00 41.03  ? 750  ARG A NH2   1 
ATOM   6149 N  N     . ARG A 1 751 ? 19.231  29.623  17.950  1.00 34.78  ? 751  ARG A N     1 
ATOM   6150 C  CA    . ARG A 1 751 ? 20.365  30.252  17.272  1.00 36.26  ? 751  ARG A CA    1 
ATOM   6151 C  C     . ARG A 1 751 ? 20.989  29.394  16.170  1.00 37.93  ? 751  ARG A C     1 
ATOM   6152 O  O     . ARG A 1 751 ? 21.352  29.920  15.110  1.00 40.05  ? 751  ARG A O     1 
ATOM   6153 C  CB    . ARG A 1 751 ? 21.409  30.713  18.283  1.00 36.21  ? 751  ARG A CB    1 
ATOM   6154 C  CG    . ARG A 1 751 ? 20.978  31.965  19.020  1.00 35.91  ? 751  ARG A CG    1 
ATOM   6155 C  CD    . ARG A 1 751 ? 21.757  32.173  20.288  1.00 35.54  ? 751  ARG A CD    1 
ATOM   6156 N  NE    . ARG A 1 751 ? 21.425  33.460  20.902  1.00 35.73  ? 751  ARG A NE    1 
ATOM   6157 C  CZ    . ARG A 1 751 ? 22.113  34.584  20.715  1.00 37.29  ? 751  ARG A CZ    1 
ATOM   6158 N  NH1   . ARG A 1 751 ? 23.194  34.596  19.938  1.00 40.02  ? 751  ARG A NH1   1 
ATOM   6159 N  NH2   . ARG A 1 751 ? 21.727  35.700  21.316  1.00 32.93  ? 751  ARG A NH2   1 
ATOM   6160 N  N     . MET A 1 752 ? 21.098  28.085  16.411  1.00 35.36  ? 752  MET A N     1 
ATOM   6161 C  CA    . MET A 1 752 ? 21.610  27.145  15.403  1.00 34.45  ? 752  MET A CA    1 
ATOM   6162 C  C     . MET A 1 752 ? 20.731  27.104  14.160  1.00 33.62  ? 752  MET A C     1 
ATOM   6163 O  O     . MET A 1 752 ? 21.229  27.184  13.045  1.00 34.94  ? 752  MET A O     1 
ATOM   6164 C  CB    . MET A 1 752 ? 21.711  25.728  15.975  1.00 34.54  ? 752  MET A CB    1 
ATOM   6165 C  CG    . MET A 1 752 ? 22.856  25.520  16.945  1.00 37.61  ? 752  MET A CG    1 
ATOM   6166 S  SD    . MET A 1 752 ? 22.609  24.041  17.930  1.00 40.74  ? 752  MET A SD    1 
ATOM   6167 C  CE    . MET A 1 752 ? 23.004  22.762  16.737  1.00 36.09  ? 752  MET A CE    1 
ATOM   6168 N  N     . LEU A 1 753 ? 19.423  26.971  14.366  1.00 32.86  ? 753  LEU A N     1 
ATOM   6169 C  CA    . LEU A 1 753 ? 18.487  26.780  13.274  1.00 32.97  ? 753  LEU A CA    1 
ATOM   6170 C  C     . LEU A 1 753 ? 18.157  28.069  12.520  1.00 35.25  ? 753  LEU A C     1 
ATOM   6171 O  O     . LEU A 1 753 ? 17.864  28.025  11.318  1.00 37.61  ? 753  LEU A O     1 
ATOM   6172 C  CB    . LEU A 1 753 ? 17.194  26.109  13.767  1.00 32.02  ? 753  LEU A CB    1 
ATOM   6173 C  CG    . LEU A 1 753 ? 17.235  24.910  14.733  1.00 31.67  ? 753  LEU A CG    1 
ATOM   6174 C  CD1   . LEU A 1 753 ? 15.853  24.255  14.870  1.00 25.37  ? 753  LEU A CD1   1 
ATOM   6175 C  CD2   . LEU A 1 753 ? 18.292  23.872  14.371  1.00 25.86  ? 753  LEU A CD2   1 
ATOM   6176 N  N     . GLN A 1 754 ? 18.205  29.204  13.213  1.00 34.33  ? 754  GLN A N     1 
ATOM   6177 C  CA    . GLN A 1 754 ? 17.763  30.478  12.637  1.00 37.14  ? 754  GLN A CA    1 
ATOM   6178 C  C     . GLN A 1 754 ? 18.894  31.424  12.264  1.00 40.64  ? 754  GLN A C     1 
ATOM   6179 O  O     . GLN A 1 754 ? 18.739  32.250  11.358  1.00 42.94  ? 754  GLN A O     1 
ATOM   6180 C  CB    . GLN A 1 754 ? 16.791  31.202  13.580  1.00 38.03  ? 754  GLN A CB    1 
ATOM   6181 C  CG    . GLN A 1 754 ? 15.449  30.487  13.756  1.00 39.66  ? 754  GLN A CG    1 
ATOM   6182 C  CD    . GLN A 1 754 ? 14.504  31.180  14.723  1.00 40.01  ? 754  GLN A CD    1 
ATOM   6183 O  OE1   . GLN A 1 754 ? 14.820  32.209  15.322  1.00 40.88  ? 754  GLN A OE1   1 
ATOM   6184 N  NE2   . GLN A 1 754 ? 13.331  30.603  14.884  1.00 43.70  ? 754  GLN A NE2   1 
ATOM   6185 N  N     . GLU A 1 755 ? 20.027  31.312  12.954  1.00 41.09  ? 755  GLU A N     1 
ATOM   6186 C  CA    . GLU A 1 755 ? 21.081  32.320  12.832  1.00 43.23  ? 755  GLU A CA    1 
ATOM   6187 C  C     . GLU A 1 755 ? 22.448  31.754  12.445  1.00 43.40  ? 755  GLU A C     1 
ATOM   6188 O  O     . GLU A 1 755 ? 23.184  32.376  11.686  1.00 46.95  ? 755  GLU A O     1 
ATOM   6189 C  CB    . GLU A 1 755 ? 21.154  33.176  14.105  1.00 41.76  ? 755  GLU A CB    1 
ATOM   6190 C  CG    . GLU A 1 755 ? 19.957  34.120  14.269  1.00 42.08  ? 755  GLU A CG    1 
ATOM   6191 C  CD    . GLU A 1 755 ? 19.855  34.756  15.647  1.00 44.63  ? 755  GLU A CD    1 
ATOM   6192 O  OE1   . GLU A 1 755 ? 18.808  35.377  15.931  1.00 45.36  ? 755  GLU A OE1   1 
ATOM   6193 O  OE2   . GLU A 1 755 ? 20.811  34.642  16.449  1.00 44.77  ? 755  GLU A OE2   1 
ATOM   6194 N  N     . GLY A 1 756 ? 22.790  30.581  12.959  1.00 42.81  ? 756  GLY A N     1 
ATOM   6195 C  CA    . GLY A 1 756 ? 23.992  29.898  12.499  1.00 43.26  ? 756  GLY A CA    1 
ATOM   6196 C  C     . GLY A 1 756 ? 25.008  29.648  13.582  1.00 44.83  ? 756  GLY A C     1 
ATOM   6197 O  O     . GLY A 1 756 ? 24.729  29.868  14.763  1.00 44.96  ? 756  GLY A O     1 
ATOM   6198 N  N     . GLU A 1 757 ? 26.194  29.202  13.166  1.00 45.91  ? 757  GLU A N     1 
ATOM   6199 C  CA    . GLU A 1 757 ? 27.273  28.829  14.078  1.00 45.10  ? 757  GLU A CA    1 
ATOM   6200 C  C     . GLU A 1 757 ? 27.791  29.988  14.938  1.00 46.10  ? 757  GLU A C     1 
ATOM   6201 O  O     . GLU A 1 757 ? 27.980  29.824  16.147  1.00 45.75  ? 757  GLU A O     1 
ATOM   6202 C  CB    . GLU A 1 757 ? 28.425  28.185  13.299  1.00 46.13  ? 757  GLU A CB    1 
ATOM   6203 C  CG    . GLU A 1 757 ? 29.577  27.666  14.168  1.00 47.07  ? 757  GLU A CG    1 
ATOM   6204 C  CD    . GLU A 1 757 ? 30.566  26.808  13.398  1.00 48.39  ? 757  GLU A CD    1 
ATOM   6205 O  OE1   . GLU A 1 757 ? 30.950  27.193  12.274  1.00 52.42  ? 757  GLU A OE1   1 
ATOM   6206 O  OE2   . GLU A 1 757 ? 30.967  25.748  13.926  1.00 48.01  ? 757  GLU A OE2   1 
ATOM   6207 N  N     . GLU A 1 758 ? 28.020  31.147  14.320  1.00 46.12  ? 758  GLU A N     1 
ATOM   6208 C  CA    . GLU A 1 758 ? 28.639  32.272  15.025  1.00 48.27  ? 758  GLU A CA    1 
ATOM   6209 C  C     . GLU A 1 758 ? 27.755  32.817  16.146  1.00 45.85  ? 758  GLU A C     1 
ATOM   6210 O  O     . GLU A 1 758 ? 28.255  33.166  17.218  1.00 45.92  ? 758  GLU A O     1 
ATOM   6211 C  CB    . GLU A 1 758 ? 29.044  33.393  14.060  1.00 51.45  ? 758  GLU A CB    1 
ATOM   6212 C  CG    . GLU A 1 758 ? 30.252  34.199  14.542  1.00 60.67  ? 758  GLU A CG    1 
ATOM   6213 C  CD    . GLU A 1 758 ? 30.589  35.379  13.636  1.00 68.63  ? 758  GLU A CD    1 
ATOM   6214 O  OE1   . GLU A 1 758 ? 29.840  36.379  13.654  1.00 71.08  ? 758  GLU A OE1   1 
ATOM   6215 O  OE2   . GLU A 1 758 ? 31.615  35.313  12.918  1.00 71.18  ? 758  GLU A OE2   1 
ATOM   6216 N  N     . SER A 1 759 ? 26.448  32.875  15.898  1.00 43.39  ? 759  SER A N     1 
ATOM   6217 C  CA    . SER A 1 759 ? 25.499  33.361  16.895  1.00 42.56  ? 759  SER A CA    1 
ATOM   6218 C  C     . SER A 1 759 ? 25.399  32.406  18.079  1.00 39.90  ? 759  SER A C     1 
ATOM   6219 O  O     . SER A 1 759 ? 25.243  32.829  19.230  1.00 37.60  ? 759  SER A O     1 
ATOM   6220 C  CB    . SER A 1 759 ? 24.125  33.554  16.277  1.00 42.26  ? 759  SER A CB    1 
ATOM   6221 O  OG    . SER A 1 759 ? 23.196  33.946  17.272  1.00 46.33  ? 759  SER A OG    1 
ATOM   6222 N  N     . LEU A 1 760 ? 25.495  31.120  17.772  1.00 38.91  ? 760  LEU A N     1 
ATOM   6223 C  CA    . LEU A 1 760 ? 25.482  30.056  18.767  1.00 39.57  ? 760  LEU A CA    1 
ATOM   6224 C  C     . LEU A 1 760 ? 26.662  30.191  19.737  1.00 39.45  ? 760  LEU A C     1 
ATOM   6225 O  O     . LEU A 1 760 ? 26.475  30.134  20.947  1.00 40.84  ? 760  LEU A O     1 
ATOM   6226 C  CB    . LEU A 1 760 ? 25.468  28.695  18.057  1.00 36.88  ? 760  LEU A CB    1 
ATOM   6227 C  CG    . LEU A 1 760 ? 25.364  27.328  18.756  1.00 38.77  ? 760  LEU A CG    1 
ATOM   6228 C  CD1   . LEU A 1 760 ? 26.687  26.610  18.778  1.00 37.52  ? 760  LEU A CD1   1 
ATOM   6229 C  CD2   . LEU A 1 760 ? 24.736  27.352  20.139  1.00 38.64  ? 760  LEU A CD2   1 
ATOM   6230 N  N     . GLN A 1 761 ? 27.862  30.400  19.198  1.00 39.82  ? 761  GLN A N     1 
ATOM   6231 C  CA    . GLN A 1 761 ? 29.073  30.554  20.005  1.00 39.01  ? 761  GLN A CA    1 
ATOM   6232 C  C     . GLN A 1 761 ? 29.055  31.801  20.891  1.00 41.93  ? 761  GLN A C     1 
ATOM   6233 O  O     . GLN A 1 761 ? 29.569  31.765  22.016  1.00 41.70  ? 761  GLN A O     1 
ATOM   6234 C  CB    . GLN A 1 761 ? 30.316  30.551  19.117  1.00 40.71  ? 761  GLN A CB    1 
ATOM   6235 C  CG    . GLN A 1 761 ? 30.414  29.345  18.182  1.00 37.19  ? 761  GLN A CG    1 
ATOM   6236 C  CD    . GLN A 1 761 ? 31.483  29.508  17.114  1.00 39.25  ? 761  GLN A CD    1 
ATOM   6237 O  OE1   . GLN A 1 761 ? 31.907  28.532  16.490  1.00 41.93  ? 761  GLN A OE1   1 
ATOM   6238 N  NE2   . GLN A 1 761 ? 31.927  30.736  16.900  1.00 33.61  ? 761  GLN A NE2   1 
ATOM   6239 N  N     . GLU A 1 762 ? 28.466  32.890  20.390  1.00 41.22  ? 762  GLU A N     1 
ATOM   6240 C  CA    . GLU A 1 762 ? 28.213  34.087  21.204  1.00 45.22  ? 762  GLU A CA    1 
ATOM   6241 C  C     . GLU A 1 762 ? 27.393  33.780  22.455  1.00 43.71  ? 762  GLU A C     1 
ATOM   6242 O  O     . GLU A 1 762 ? 27.733  34.223  23.558  1.00 44.85  ? 762  GLU A O     1 
ATOM   6243 C  CB    . GLU A 1 762 ? 27.459  35.148  20.399  1.00 48.39  ? 762  GLU A CB    1 
ATOM   6244 C  CG    . GLU A 1 762 ? 28.309  36.214  19.734  1.00 56.27  ? 762  GLU A CG    1 
ATOM   6245 C  CD    . GLU A 1 762 ? 27.481  37.444  19.350  1.00 65.42  ? 762  GLU A CD    1 
ATOM   6246 O  OE1   . GLU A 1 762 ? 26.338  37.586  19.856  1.00 65.51  ? 762  GLU A OE1   1 
ATOM   6247 O  OE2   . GLU A 1 762 ? 27.970  38.270  18.543  1.00 68.55  ? 762  GLU A OE2   1 
ATOM   6248 N  N     . TYR A 1 763 ? 26.311  33.027  22.279  1.00 41.72  ? 763  TYR A N     1 
ATOM   6249 C  CA    . TYR A 1 763 ? 25.396  32.763  23.373  1.00 41.00  ? 763  TYR A CA    1 
ATOM   6250 C  C     . TYR A 1 763 ? 25.992  31.830  24.413  1.00 41.13  ? 763  TYR A C     1 
ATOM   6251 O  O     . TYR A 1 763 ? 25.878  32.089  25.611  1.00 40.80  ? 763  TYR A O     1 
ATOM   6252 C  CB    . TYR A 1 763 ? 24.065  32.210  22.870  1.00 40.23  ? 763  TYR A CB    1 
ATOM   6253 C  CG    . TYR A 1 763 ? 22.991  32.250  23.934  1.00 41.86  ? 763  TYR A CG    1 
ATOM   6254 C  CD1   . TYR A 1 763 ? 22.572  31.086  24.587  1.00 41.09  ? 763  TYR A CD1   1 
ATOM   6255 C  CD2   . TYR A 1 763 ? 22.419  33.461  24.313  1.00 41.07  ? 763  TYR A CD2   1 
ATOM   6256 C  CE1   . TYR A 1 763 ? 21.586  31.136  25.584  1.00 41.96  ? 763  TYR A CE1   1 
ATOM   6257 C  CE2   . TYR A 1 763 ? 21.450  33.521  25.300  1.00 42.70  ? 763  TYR A CE2   1 
ATOM   6258 C  CZ    . TYR A 1 763 ? 21.030  32.364  25.930  1.00 42.92  ? 763  TYR A CZ    1 
ATOM   6259 O  OH    . TYR A 1 763 ? 20.056  32.458  26.901  1.00 45.01  ? 763  TYR A OH    1 
ATOM   6260 N  N     . PHE A 1 764 ? 26.613  30.748  23.946  1.00 40.65  ? 764  PHE A N     1 
ATOM   6261 C  CA    . PHE A 1 764 ? 27.256  29.778  24.820  1.00 40.70  ? 764  PHE A CA    1 
ATOM   6262 C  C     . PHE A 1 764 ? 28.286  30.458  25.712  1.00 41.46  ? 764  PHE A C     1 
ATOM   6263 O  O     . PHE A 1 764 ? 28.284  30.264  26.925  1.00 38.65  ? 764  PHE A O     1 
ATOM   6264 C  CB    . PHE A 1 764 ? 27.920  28.666  23.999  1.00 41.35  ? 764  PHE A CB    1 
ATOM   6265 C  CG    . PHE A 1 764 ? 28.856  27.792  24.797  1.00 40.68  ? 764  PHE A CG    1 
ATOM   6266 C  CD1   . PHE A 1 764 ? 28.381  26.659  25.455  1.00 41.62  ? 764  PHE A CD1   1 
ATOM   6267 C  CD2   . PHE A 1 764 ? 30.214  28.099  24.884  1.00 40.47  ? 764  PHE A CD2   1 
ATOM   6268 C  CE1   . PHE A 1 764 ? 29.244  25.847  26.197  1.00 40.71  ? 764  PHE A CE1   1 
ATOM   6269 C  CE2   . PHE A 1 764 ? 31.085  27.297  25.619  1.00 38.30  ? 764  PHE A CE2   1 
ATOM   6270 C  CZ    . PHE A 1 764 ? 30.596  26.168  26.277  1.00 42.41  ? 764  PHE A CZ    1 
ATOM   6271 N  N     . LYS A 1 765 ? 29.165  31.248  25.099  1.00 43.29  ? 765  LYS A N     1 
ATOM   6272 C  CA    . LYS A 1 765 ? 30.212  31.934  25.831  1.00 45.89  ? 765  LYS A CA    1 
ATOM   6273 C  C     . LYS A 1 765 ? 29.591  32.743  26.974  1.00 46.72  ? 765  LYS A C     1 
ATOM   6274 O  O     . LYS A 1 765 ? 30.020  32.628  28.126  1.00 46.21  ? 765  LYS A O     1 
ATOM   6275 C  CB    . LYS A 1 765 ? 31.035  32.824  24.894  1.00 49.13  ? 765  LYS A CB    1 
ATOM   6276 C  CG    . LYS A 1 765 ? 32.342  33.344  25.493  1.00 54.58  ? 765  LYS A CG    1 
ATOM   6277 C  CD    . LYS A 1 765 ? 32.841  34.580  24.745  1.00 62.73  ? 765  LYS A CD    1 
ATOM   6278 C  CE    . LYS A 1 765 ? 33.388  34.244  23.354  1.00 65.96  ? 765  LYS A CE    1 
ATOM   6279 N  NZ    . LYS A 1 765 ? 33.190  35.368  22.386  1.00 67.18  ? 765  LYS A NZ    1 
ATOM   6280 N  N     . GLU A 1 766 ? 28.557  33.520  26.660  1.00 45.78  ? 766  GLU A N     1 
ATOM   6281 C  CA    . GLU A 1 766 ? 27.901  34.344  27.668  1.00 47.85  ? 766  GLU A CA    1 
ATOM   6282 C  C     . GLU A 1 766 ? 27.192  33.518  28.734  1.00 47.04  ? 766  GLU A C     1 
ATOM   6283 O  O     . GLU A 1 766 ? 27.252  33.861  29.913  1.00 47.11  ? 766  GLU A O     1 
ATOM   6284 C  CB    . GLU A 1 766 ? 26.927  35.337  27.039  1.00 49.36  ? 766  GLU A CB    1 
ATOM   6285 C  CG    . GLU A 1 766 ? 26.707  36.571  27.904  1.00 53.83  ? 766  GLU A CG    1 
ATOM   6286 C  CD    . GLU A 1 766 ? 27.963  37.411  28.048  1.00 57.33  ? 766  GLU A CD    1 
ATOM   6287 O  OE1   . GLU A 1 766 ? 28.457  37.919  27.017  1.00 59.05  ? 766  GLU A OE1   1 
ATOM   6288 O  OE2   . GLU A 1 766 ? 28.453  37.571  29.191  1.00 59.25  ? 766  GLU A OE2   1 
ATOM   6289 N  N     . PHE A 1 767 ? 26.541  32.429  28.322  1.00 45.05  ? 767  PHE A N     1 
ATOM   6290 C  CA    . PHE A 1 767 ? 25.853  31.548  29.266  1.00 44.34  ? 767  PHE A CA    1 
ATOM   6291 C  C     . PHE A 1 767 ? 26.806  30.858  30.242  1.00 44.95  ? 767  PHE A C     1 
ATOM   6292 O  O     . PHE A 1 767 ? 26.497  30.748  31.425  1.00 44.93  ? 767  PHE A O     1 
ATOM   6293 C  CB    . PHE A 1 767 ? 24.958  30.512  28.561  1.00 42.87  ? 767  PHE A CB    1 
ATOM   6294 C  CG    . PHE A 1 767 ? 24.132  29.692  29.518  1.00 40.26  ? 767  PHE A CG    1 
ATOM   6295 C  CD1   . PHE A 1 767 ? 24.577  28.444  29.949  1.00 39.57  ? 767  PHE A CD1   1 
ATOM   6296 C  CD2   . PHE A 1 767 ? 22.936  30.194  30.032  1.00 38.88  ? 767  PHE A CD2   1 
ATOM   6297 C  CE1   . PHE A 1 767 ? 23.835  27.688  30.856  1.00 39.37  ? 767  PHE A CE1   1 
ATOM   6298 C  CE2   . PHE A 1 767 ? 22.186  29.453  30.946  1.00 42.54  ? 767  PHE A CE2   1 
ATOM   6299 C  CZ    . PHE A 1 767 ? 22.639  28.192  31.358  1.00 43.96  ? 767  PHE A CZ    1 
ATOM   6300 N  N     . GLU A 1 768 ? 27.953  30.398  29.741  1.00 46.72  ? 768  GLU A N     1 
ATOM   6301 C  CA    . GLU A 1 768 ? 29.013  29.818  30.576  1.00 46.18  ? 768  GLU A CA    1 
ATOM   6302 C  C     . GLU A 1 768 ? 29.540  30.832  31.600  1.00 46.52  ? 768  GLU A C     1 
ATOM   6303 O  O     . GLU A 1 768 ? 29.900  30.459  32.714  1.00 46.93  ? 768  GLU A O     1 
ATOM   6304 C  CB    . GLU A 1 768 ? 30.159  29.297  29.694  1.00 47.79  ? 768  GLU A CB    1 
ATOM   6305 C  CG    . GLU A 1 768 ? 31.195  28.390  30.389  1.00 49.05  ? 768  GLU A CG    1 
ATOM   6306 C  CD    . GLU A 1 768 ? 32.284  27.876  29.431  1.00 52.08  ? 768  GLU A CD    1 
ATOM   6307 O  OE1   . GLU A 1 768 ? 32.441  26.645  29.304  1.00 53.90  ? 768  GLU A OE1   1 
ATOM   6308 O  OE2   . GLU A 1 768 ? 32.985  28.696  28.801  1.00 50.03  ? 768  GLU A OE2   1 
ATOM   6309 N  N     . LYS A 1 769 ? 29.580  32.106  31.219  1.00 46.35  ? 769  LYS A N     1 
ATOM   6310 C  CA    . LYS A 1 769 ? 30.068  33.168  32.102  1.00 48.49  ? 769  LYS A CA    1 
ATOM   6311 C  C     . LYS A 1 769 ? 29.118  33.443  33.265  1.00 49.01  ? 769  LYS A C     1 
ATOM   6312 O  O     . LYS A 1 769 ? 29.559  33.609  34.402  1.00 49.66  ? 769  LYS A O     1 
ATOM   6313 C  CB    . LYS A 1 769 ? 30.262  34.475  31.327  1.00 49.89  ? 769  LYS A CB    1 
ATOM   6314 C  CG    . LYS A 1 769 ? 31.629  34.700  30.730  1.00 54.53  ? 769  LYS A CG    1 
ATOM   6315 C  CD    . LYS A 1 769 ? 31.773  36.171  30.318  1.00 61.61  ? 769  LYS A CD    1 
ATOM   6316 C  CE    . LYS A 1 769 ? 33.116  36.467  29.649  1.00 62.26  ? 769  LYS A CE    1 
ATOM   6317 N  NZ    . LYS A 1 769 ? 33.180  35.932  28.258  1.00 59.45  ? 769  LYS A NZ    1 
ATOM   6318 N  N     . GLU A 1 770 ? 27.818  33.501  32.972  1.00 47.40  ? 770  GLU A N     1 
ATOM   6319 C  CA    . GLU A 1 770 ? 26.843  34.045  33.922  1.00 47.29  ? 770  GLU A CA    1 
ATOM   6320 C  C     . GLU A 1 770 ? 26.088  32.960  34.690  1.00 45.27  ? 770  GLU A C     1 
ATOM   6321 O  O     . GLU A 1 770 ? 25.398  33.239  35.674  1.00 43.86  ? 770  GLU A O     1 
ATOM   6322 C  CB    . GLU A 1 770 ? 25.868  35.007  33.217  1.00 48.60  ? 770  GLU A CB    1 
ATOM   6323 C  CG    . GLU A 1 770 ? 26.512  35.995  32.209  1.00 49.77  ? 770  GLU A CG    1 
ATOM   6324 C  CD    . GLU A 1 770 ? 27.456  37.030  32.827  1.00 53.35  ? 770  GLU A CD    1 
ATOM   6325 O  OE1   . GLU A 1 770 ? 28.291  37.588  32.075  1.00 54.72  ? 770  GLU A OE1   1 
ATOM   6326 O  OE2   . GLU A 1 770 ? 27.372  37.302  34.044  1.00 53.41  ? 770  GLU A OE2   1 
ATOM   6327 N  N     . PHE A 1 771 ? 26.269  31.723  34.242  1.00 42.89  ? 771  PHE A N     1 
ATOM   6328 C  CA    . PHE A 1 771 ? 25.611  30.533  34.780  1.00 43.26  ? 771  PHE A CA    1 
ATOM   6329 C  C     . PHE A 1 771 ? 25.503  30.456  36.314  1.00 43.00  ? 771  PHE A C     1 
ATOM   6330 O  O     . PHE A 1 771 ? 24.446  30.108  36.837  1.00 44.11  ? 771  PHE A O     1 
ATOM   6331 C  CB    . PHE A 1 771 ? 26.303  29.286  34.197  1.00 44.23  ? 771  PHE A CB    1 
ATOM   6332 C  CG    . PHE A 1 771 ? 25.980  28.009  34.903  1.00 44.46  ? 771  PHE A CG    1 
ATOM   6333 C  CD1   . PHE A 1 771 ? 26.944  27.378  35.678  1.00 47.78  ? 771  PHE A CD1   1 
ATOM   6334 C  CD2   . PHE A 1 771 ? 24.725  27.420  34.773  1.00 48.33  ? 771  PHE A CD2   1 
ATOM   6335 C  CE1   . PHE A 1 771 ? 26.663  26.192  36.335  1.00 48.58  ? 771  PHE A CE1   1 
ATOM   6336 C  CE2   . PHE A 1 771 ? 24.427  26.223  35.422  1.00 51.82  ? 771  PHE A CE2   1 
ATOM   6337 C  CZ    . PHE A 1 771 ? 25.401  25.607  36.208  1.00 52.22  ? 771  PHE A CZ    1 
ATOM   6338 N  N     . ARG A 1 772 ? 26.578  30.799  37.020  1.00 43.75  ? 772  ARG A N     1 
ATOM   6339 C  CA    . ARG A 1 772 ? 26.629  30.674  38.487  1.00 45.20  ? 772  ARG A CA    1 
ATOM   6340 C  C     . ARG A 1 772 ? 25.708  31.620  39.255  1.00 43.71  ? 772  ARG A C     1 
ATOM   6341 O  O     . ARG A 1 772 ? 25.468  31.419  40.440  1.00 45.74  ? 772  ARG A O     1 
ATOM   6342 C  CB    . ARG A 1 772 ? 28.071  30.765  39.001  1.00 45.70  ? 772  ARG A CB    1 
ATOM   6343 C  CG    . ARG A 1 772 ? 28.867  29.520  38.684  1.00 50.25  ? 772  ARG A CG    1 
ATOM   6344 C  CD    . ARG A 1 772 ? 30.365  29.762  38.600  1.00 56.28  ? 772  ARG A CD    1 
ATOM   6345 N  NE    . ARG A 1 772 ? 30.994  28.709  37.801  1.00 62.66  ? 772  ARG A NE    1 
ATOM   6346 C  CZ    . ARG A 1 772 ? 31.485  27.571  38.292  1.00 65.44  ? 772  ARG A CZ    1 
ATOM   6347 N  NH1   . ARG A 1 772 ? 31.449  27.328  39.603  1.00 65.34  ? 772  ARG A NH1   1 
ATOM   6348 N  NH2   . ARG A 1 772 ? 32.021  26.675  37.467  1.00 62.10  ? 772  ARG A NH2   1 
ATOM   6349 N  N     . GLN A 1 773 ? 25.178  32.630  38.573  1.00 43.17  ? 773  GLN A N     1 
ATOM   6350 C  CA    . GLN A 1 773 ? 24.230  33.570  39.179  1.00 43.93  ? 773  GLN A CA    1 
ATOM   6351 C  C     . GLN A 1 773 ? 22.804  33.022  39.241  1.00 41.22  ? 773  GLN A C     1 
ATOM   6352 O  O     . GLN A 1 773 ? 21.949  33.588  39.932  1.00 39.06  ? 773  GLN A O     1 
ATOM   6353 C  CB    . GLN A 1 773 ? 24.207  34.887  38.404  1.00 46.11  ? 773  GLN A CB    1 
ATOM   6354 C  CG    . GLN A 1 773 ? 25.505  35.662  38.419  1.00 51.86  ? 773  GLN A CG    1 
ATOM   6355 C  CD    . GLN A 1 773 ? 25.655  36.573  37.207  1.00 56.40  ? 773  GLN A CD    1 
ATOM   6356 O  OE1   . GLN A 1 773 ? 26.649  36.492  36.482  1.00 57.50  ? 773  GLN A OE1   1 
ATOM   6357 N  NE2   . GLN A 1 773 ? 24.665  37.435  36.978  1.00 55.08  ? 773  GLN A NE2   1 
ATOM   6358 N  N     . LEU A 1 774 ? 22.547  31.944  38.503  1.00 38.20  ? 774  LEU A N     1 
ATOM   6359 C  CA    . LEU A 1 774 ? 21.202  31.370  38.413  1.00 39.63  ? 774  LEU A CA    1 
ATOM   6360 C  C     . LEU A 1 774 ? 20.688  30.853  39.756  1.00 41.23  ? 774  LEU A C     1 
ATOM   6361 O  O     . LEU A 1 774 ? 21.437  30.252  40.538  1.00 43.74  ? 774  LEU A O     1 
ATOM   6362 C  CB    . LEU A 1 774 ? 21.142  30.258  37.354  1.00 37.10  ? 774  LEU A CB    1 
ATOM   6363 C  CG    . LEU A 1 774 ? 21.256  30.712  35.888  1.00 37.49  ? 774  LEU A CG    1 
ATOM   6364 C  CD1   . LEU A 1 774 ? 21.535  29.550  34.951  1.00 36.62  ? 774  LEU A CD1   1 
ATOM   6365 C  CD2   . LEU A 1 774 ? 20.030  31.485  35.439  1.00 35.27  ? 774  LEU A CD2   1 
ATOM   6366 N  N     . ASN A 1 775 ? 19.408  31.109  40.009  1.00 40.31  ? 775  ASN A N     1 
ATOM   6367 C  CA    . ASN A 1 775 ? 18.712  30.597  41.178  1.00 40.08  ? 775  ASN A CA    1 
ATOM   6368 C  C     . ASN A 1 775 ? 18.800  29.068  41.247  1.00 38.21  ? 775  ASN A C     1 
ATOM   6369 O  O     . ASN A 1 775 ? 18.583  28.365  40.241  1.00 35.04  ? 775  ASN A O     1 
ATOM   6370 C  CB    . ASN A 1 775 ? 17.252  31.060  41.150  1.00 41.63  ? 775  ASN A CB    1 
ATOM   6371 C  CG    . ASN A 1 775 ? 16.425  30.475  42.286  1.00 46.43  ? 775  ASN A CG    1 
ATOM   6372 O  OD1   . ASN A 1 775 ? 15.550  29.637  42.061  1.00 49.71  ? 775  ASN A OD1   1 
ATOM   6373 N  ND2   . ASN A 1 775 ? 16.701  30.910  43.509  1.00 45.98  ? 775  ASN A ND2   1 
ATOM   6374 N  N     . TYR A 1 776 ? 19.121  28.564  42.436  1.00 35.45  ? 776  TYR A N     1 
ATOM   6375 C  CA    . TYR A 1 776 ? 19.349  27.126  42.640  1.00 36.15  ? 776  TYR A CA    1 
ATOM   6376 C  C     . TYR A 1 776 ? 18.197  26.213  42.178  1.00 32.74  ? 776  TYR A C     1 
ATOM   6377 O  O     . TYR A 1 776 ? 18.438  25.110  41.707  1.00 33.04  ? 776  TYR A O     1 
ATOM   6378 C  CB    . TYR A 1 776 ? 19.730  26.836  44.098  1.00 37.59  ? 776  TYR A CB    1 
ATOM   6379 C  CG    . TYR A 1 776 ? 18.565  26.824  45.065  1.00 40.34  ? 776  TYR A CG    1 
ATOM   6380 C  CD1   . TYR A 1 776 ? 18.124  25.625  45.636  1.00 39.37  ? 776  TYR A CD1   1 
ATOM   6381 C  CD2   . TYR A 1 776 ? 17.903  28.008  45.413  1.00 42.51  ? 776  TYR A CD2   1 
ATOM   6382 C  CE1   . TYR A 1 776 ? 17.054  25.604  46.528  1.00 42.39  ? 776  TYR A CE1   1 
ATOM   6383 C  CE2   . TYR A 1 776 ? 16.829  27.997  46.306  1.00 43.43  ? 776  TYR A CE2   1 
ATOM   6384 C  CZ    . TYR A 1 776 ? 16.417  26.793  46.857  1.00 43.16  ? 776  TYR A CZ    1 
ATOM   6385 O  OH    . TYR A 1 776 ? 15.366  26.772  47.728  1.00 46.87  ? 776  TYR A OH    1 
ATOM   6386 N  N     . ILE A 1 777 ? 16.956  26.673  42.302  1.00 35.24  ? 777  ILE A N     1 
ATOM   6387 C  CA    . ILE A 1 777 ? 15.805  25.897  41.823  1.00 34.26  ? 777  ILE A CA    1 
ATOM   6388 C  C     . ILE A 1 777 ? 15.795  25.817  40.285  1.00 34.08  ? 777  ILE A C     1 
ATOM   6389 O  O     . ILE A 1 777 ? 15.499  24.769  39.708  1.00 33.67  ? 777  ILE A O     1 
ATOM   6390 C  CB    . ILE A 1 777 ? 14.482  26.446  42.397  1.00 36.59  ? 777  ILE A CB    1 
ATOM   6391 C  CG1   . ILE A 1 777 ? 14.418  26.164  43.898  1.00 37.78  ? 777  ILE A CG1   1 
ATOM   6392 C  CG2   . ILE A 1 777 ? 13.255  25.844  41.692  1.00 37.45  ? 777  ILE A CG2   1 
ATOM   6393 C  CD1   . ILE A 1 777 ? 13.564  27.150  44.673  1.00 45.33  ? 777  ILE A CD1   1 
ATOM   6394 N  N     . SER A 1 778 ? 16.178  26.910  39.634  1.00 34.10  ? 778  SER A N     1 
ATOM   6395 C  CA    . SER A 1 778 ? 16.184  26.977  38.176  1.00 33.20  ? 778  SER A CA    1 
ATOM   6396 C  C     . SER A 1 778 ? 17.246  26.053  37.560  1.00 33.33  ? 778  SER A C     1 
ATOM   6397 O  O     . SER A 1 778 ? 17.221  25.790  36.361  1.00 33.94  ? 778  SER A O     1 
ATOM   6398 C  CB    . SER A 1 778 ? 16.372  28.423  37.707  1.00 32.98  ? 778  SER A CB    1 
ATOM   6399 O  OG    . SER A 1 778 ? 17.742  28.785  37.719  1.00 34.96  ? 778  SER A OG    1 
ATOM   6400 N  N     . ILE A 1 779 ? 18.158  25.546  38.388  1.00 32.66  ? 779  ILE A N     1 
ATOM   6401 C  CA    . ILE A 1 779 ? 19.241  24.681  37.909  1.00 33.33  ? 779  ILE A CA    1 
ATOM   6402 C  C     . ILE A 1 779 ? 19.287  23.281  38.574  1.00 32.82  ? 779  ILE A C     1 
ATOM   6403 O  O     . ILE A 1 779 ? 20.184  22.485  38.295  1.00 30.76  ? 779  ILE A O     1 
ATOM   6404 C  CB    . ILE A 1 779 ? 20.627  25.387  37.999  1.00 34.57  ? 779  ILE A CB    1 
ATOM   6405 C  CG1   . ILE A 1 779 ? 20.900  25.884  39.422  1.00 36.96  ? 779  ILE A CG1   1 
ATOM   6406 C  CG2   . ILE A 1 779 ? 20.699  26.549  37.018  1.00 34.77  ? 779  ILE A CG2   1 
ATOM   6407 C  CD1   . ILE A 1 779 ? 22.196  26.692  39.563  1.00 40.34  ? 779  ILE A CD1   1 
ATOM   6408 N  N     . ALA A 1 780 ? 18.329  22.991  39.451  1.00 31.35  ? 780  ALA A N     1 
ATOM   6409 C  CA    . ALA A 1 780 ? 18.201  21.648  40.011  1.00 32.80  ? 780  ALA A CA    1 
ATOM   6410 C  C     . ALA A 1 780 ? 17.566  20.718  38.993  1.00 32.56  ? 780  ALA A C     1 
ATOM   6411 O  O     . ALA A 1 780 ? 16.629  21.112  38.293  1.00 32.91  ? 780  ALA A O     1 
ATOM   6412 C  CB    . ALA A 1 780 ? 17.367  21.669  41.281  1.00 30.35  ? 780  ALA A CB    1 
ATOM   6413 N  N     . SER A 1 781 ? 18.070  19.487  38.919  1.00 30.20  ? 781  SER A N     1 
ATOM   6414 C  CA    . SER A 1 781 ? 17.446  18.461  38.084  1.00 31.21  ? 781  SER A CA    1 
ATOM   6415 C  C     . SER A 1 781 ? 16.158  18.001  38.753  1.00 31.95  ? 781  SER A C     1 
ATOM   6416 O  O     . SER A 1 781 ? 15.920  18.323  39.925  1.00 29.56  ? 781  SER A O     1 
ATOM   6417 C  CB    . SER A 1 781 ? 18.379  17.266  37.888  1.00 29.69  ? 781  SER A CB    1 
ATOM   6418 O  OG    . SER A 1 781 ? 19.443  17.599  37.022  1.00 38.49  ? 781  SER A OG    1 
ATOM   6419 N  N     . VAL A 1 782 ? 15.328  17.262  38.014  1.00 31.19  ? 782  VAL A N     1 
ATOM   6420 C  CA    . VAL A 1 782 ? 14.119  16.675  38.599  1.00 31.33  ? 782  VAL A CA    1 
ATOM   6421 C  C     . VAL A 1 782 ? 14.053  15.186  38.322  1.00 33.54  ? 782  VAL A C     1 
ATOM   6422 O  O     . VAL A 1 782 ? 14.422  14.734  37.240  1.00 32.95  ? 782  VAL A O     1 
ATOM   6423 C  CB    . VAL A 1 782 ? 12.830  17.351  38.100  1.00 31.71  ? 782  VAL A CB    1 
ATOM   6424 C  CG1   . VAL A 1 782 ? 11.597  16.738  38.779  1.00 33.17  ? 782  VAL A CG1   1 
ATOM   6425 C  CG2   . VAL A 1 782 ? 12.877  18.849  38.361  1.00 24.96  ? 782  VAL A CG2   1 
ATOM   6426 N  N     . SER A 1 783 ? 13.596  14.432  39.319  1.00 35.77  ? 783  SER A N     1 
ATOM   6427 C  CA    . SER A 1 783 ? 13.356  13.006  39.171  1.00 39.07  ? 783  SER A CA    1 
ATOM   6428 C  C     . SER A 1 783 ? 12.173  12.543  40.028  1.00 42.39  ? 783  SER A C     1 
ATOM   6429 O  O     . SER A 1 783 ? 11.686  13.288  40.883  1.00 42.94  ? 783  SER A O     1 
ATOM   6430 C  CB    . SER A 1 783 ? 14.616  12.225  39.530  1.00 38.07  ? 783  SER A CB    1 
ATOM   6431 O  OG    . SER A 1 783 ? 14.498  10.888  39.092  1.00 40.39  ? 783  SER A OG    1 
ATOM   6432 N  N     . SER A 1 784 ? 11.703  11.319  39.782  1.00 44.78  ? 784  SER A N     1 
ATOM   6433 C  CA    . SER A 1 784 ? 10.655  10.710  40.606  1.00 45.86  ? 784  SER A CA    1 
ATOM   6434 C  C     . SER A 1 784 ? 11.263  9.831   41.688  1.00 47.04  ? 784  SER A C     1 
ATOM   6435 O  O     . SER A 1 784 ? 12.199  9.075   41.427  1.00 48.60  ? 784  SER A O     1 
ATOM   6436 C  CB    . SER A 1 784 ? 9.703   9.878   39.751  1.00 45.99  ? 784  SER A CB    1 
ATOM   6437 O  OG    . SER A 1 784 ? 8.922   10.703  38.912  1.00 46.12  ? 784  SER A OG    1 
ATOM   6438 N  N     . ALA A 1 785 ? 10.709  9.916   42.893  1.00 47.98  ? 785  ALA A N     1 
ATOM   6439 C  CA    . ALA A 1 785 ? 11.228  9.180   44.051  1.00 49.70  ? 785  ALA A CA    1 
ATOM   6440 C  C     . ALA A 1 785 ? 10.635  7.775   44.202  1.00 49.63  ? 785  ALA A C     1 
ATOM   6441 O  O     . ALA A 1 785 ? 9.820   7.532   45.093  1.00 49.96  ? 785  ALA A O     1 
ATOM   6442 C  CB    . ALA A 1 785 ? 11.009  9.990   45.328  1.00 49.79  ? 785  ALA A CB    1 
ATOM   6443 N  N     . ASN A 1 786 ? 11.062  6.851   43.345  1.00 50.60  ? 786  ASN A N     1 
ATOM   6444 C  CA    . ASN A 1 786 ? 10.579  5.469   43.413  1.00 52.27  ? 786  ASN A CA    1 
ATOM   6445 C  C     . ASN A 1 786 ? 11.514  4.512   44.138  1.00 53.54  ? 786  ASN A C     1 
ATOM   6446 O  O     . ASN A 1 786 ? 12.737  4.572   43.977  1.00 54.25  ? 786  ASN A O     1 
ATOM   6447 C  CB    . ASN A 1 786 ? 10.249  4.935   42.021  1.00 52.82  ? 786  ASN A CB    1 
ATOM   6448 C  CG    . ASN A 1 786 ? 9.139   5.721   41.346  1.00 51.38  ? 786  ASN A CG    1 
ATOM   6449 O  OD1   . ASN A 1 786 ? 8.150   6.085   41.978  1.00 51.21  ? 786  ASN A OD1   1 
ATOM   6450 N  ND2   . ASN A 1 786 ? 9.304   5.989   40.059  1.00 49.46  ? 786  ASN A ND2   1 
ATOM   6451 N  N     . ASN A 1 787 ? 10.912  3.637   44.941  1.00 54.99  ? 787  ASN A N     1 
ATOM   6452 C  CA    . ASN A 1 787 ? 11.605  2.573   45.675  1.00 55.69  ? 787  ASN A CA    1 
ATOM   6453 C  C     . ASN A 1 787 ? 12.751  3.041   46.565  1.00 54.61  ? 787  ASN A C     1 
ATOM   6454 O  O     . ASN A 1 787 ? 13.859  2.496   46.510  1.00 54.39  ? 787  ASN A O     1 
ATOM   6455 C  CB    . ASN A 1 787 ? 12.075  1.469   44.719  1.00 57.35  ? 787  ASN A CB    1 
ATOM   6456 C  CG    . ASN A 1 787 ? 10.928  0.650   44.171  1.00 62.33  ? 787  ASN A CG    1 
ATOM   6457 O  OD1   . ASN A 1 787 ? 10.050  0.202   44.917  1.00 65.44  ? 787  ASN A OD1   1 
ATOM   6458 N  ND2   . ASN A 1 787 ? 10.931  0.440   42.860  1.00 60.95  ? 787  ASN A ND2   1 
ATOM   6459 N  N     . ILE A 1 788 ? 12.477  4.050   47.387  1.00 52.83  ? 788  ILE A N     1 
ATOM   6460 C  CA    . ILE A 1 788 ? 13.476  4.561   48.319  1.00 52.36  ? 788  ILE A CA    1 
ATOM   6461 C  C     . ILE A 1 788 ? 13.894  3.465   49.295  1.00 54.07  ? 788  ILE A C     1 
ATOM   6462 O  O     . ILE A 1 788 ? 15.083  3.214   49.470  1.00 55.13  ? 788  ILE A O     1 
ATOM   6463 C  CB    . ILE A 1 788 ? 12.974  5.789   49.106  1.00 52.63  ? 788  ILE A CB    1 
ATOM   6464 C  CG1   . ILE A 1 788 ? 12.341  6.816   48.166  1.00 48.68  ? 788  ILE A CG1   1 
ATOM   6465 C  CG2   . ILE A 1 788 ? 14.120  6.411   49.921  1.00 51.88  ? 788  ILE A CG2   1 
ATOM   6466 C  CD1   . ILE A 1 788 ? 11.547  7.889   48.893  1.00 51.85  ? 788  ILE A CD1   1 
ATOM   6467 N  N     . ALA A 1 789 ? 12.913  2.802   49.905  1.00 55.51  ? 789  ALA A N     1 
ATOM   6468 C  CA    . ALA A 1 789 ? 13.182  1.751   50.893  1.00 57.47  ? 789  ALA A CA    1 
ATOM   6469 C  C     . ALA A 1 789 ? 14.053  0.621   50.341  1.00 57.27  ? 789  ALA A C     1 
ATOM   6470 O  O     . ALA A 1 789 ? 14.867  0.056   51.067  1.00 59.02  ? 789  ALA A O     1 
ATOM   6471 C  CB    . ALA A 1 789 ? 11.873  1.198   51.461  1.00 57.61  ? 789  ALA A CB    1 
ATOM   6472 N  N     . LYS A 1 790 ? 13.881  0.307   49.058  1.00 56.39  ? 790  LYS A N     1 
ATOM   6473 C  CA    . LYS A 1 790 ? 14.646  -0.749  48.391  1.00 56.92  ? 790  LYS A CA    1 
ATOM   6474 C  C     . LYS A 1 790 ? 16.157  -0.504  48.446  1.00 55.86  ? 790  LYS A C     1 
ATOM   6475 O  O     . LYS A 1 790 ? 16.945  -1.446  48.567  1.00 55.36  ? 790  LYS A O     1 
ATOM   6476 C  CB    . LYS A 1 790 ? 14.186  -0.890  46.935  1.00 57.12  ? 790  LYS A CB    1 
ATOM   6477 C  CG    . LYS A 1 790 ? 14.999  -1.863  46.089  1.00 58.13  ? 790  LYS A CG    1 
ATOM   6478 C  CD    . LYS A 1 790 ? 14.376  -2.062  44.719  1.00 60.31  ? 790  LYS A CD    1 
ATOM   6479 C  CE    . LYS A 1 790 ? 15.181  -3.037  43.879  1.00 62.12  ? 790  LYS A CE    1 
ATOM   6480 N  NZ    . LYS A 1 790 ? 14.513  -3.308  42.578  1.00 64.56  ? 790  LYS A NZ    1 
ATOM   6481 N  N     . TYR A 1 791 ? 16.546  0.765   48.363  1.00 53.94  ? 791  TYR A N     1 
ATOM   6482 C  CA    . TYR A 1 791 ? 17.954  1.141   48.319  1.00 53.08  ? 791  TYR A CA    1 
ATOM   6483 C  C     . TYR A 1 791 ? 18.432  1.810   49.611  1.00 54.54  ? 791  TYR A C     1 
ATOM   6484 O  O     . TYR A 1 791 ? 19.538  2.356   49.657  1.00 53.34  ? 791  TYR A O     1 
ATOM   6485 C  CB    . TYR A 1 791 ? 18.218  2.051   47.114  1.00 51.16  ? 791  TYR A CB    1 
ATOM   6486 C  CG    . TYR A 1 791 ? 18.014  1.391   45.769  1.00 47.83  ? 791  TYR A CG    1 
ATOM   6487 C  CD1   . TYR A 1 791 ? 16.848  1.607   45.037  1.00 45.66  ? 791  TYR A CD1   1 
ATOM   6488 C  CD2   . TYR A 1 791 ? 18.997  0.562   45.218  1.00 49.35  ? 791  TYR A CD2   1 
ATOM   6489 C  CE1   . TYR A 1 791 ? 16.658  1.014   43.789  1.00 45.94  ? 791  TYR A CE1   1 
ATOM   6490 C  CE2   . TYR A 1 791 ? 18.821  -0.040  43.970  1.00 48.09  ? 791  TYR A CE2   1 
ATOM   6491 C  CZ    . TYR A 1 791 ? 17.648  0.190   43.263  1.00 47.71  ? 791  TYR A CZ    1 
ATOM   6492 O  OH    . TYR A 1 791 ? 17.461  -0.403  42.035  1.00 46.67  ? 791  TYR A OH    1 
ATOM   6493 N  N     . ASP A 1 792 ? 17.596  1.769   50.649  1.00 57.61  ? 792  ASP A N     1 
ATOM   6494 C  CA    . ASP A 1 792 ? 17.955  2.306   51.960  1.00 60.75  ? 792  ASP A CA    1 
ATOM   6495 C  C     . ASP A 1 792 ? 18.577  1.207   52.827  1.00 63.48  ? 792  ASP A C     1 
ATOM   6496 O  O     . ASP A 1 792 ? 17.877  0.317   53.325  1.00 64.95  ? 792  ASP A O     1 
ATOM   6497 C  CB    . ASP A 1 792 ? 16.726  2.916   52.655  1.00 62.04  ? 792  ASP A CB    1 
ATOM   6498 C  CG    . ASP A 1 792 ? 17.083  3.744   53.899  1.00 64.58  ? 792  ASP A CG    1 
ATOM   6499 O  OD1   . ASP A 1 792 ? 18.054  3.413   54.618  1.00 66.54  ? 792  ASP A OD1   1 
ATOM   6500 O  OD2   . ASP A 1 792 ? 16.373  4.739   54.162  1.00 65.04  ? 792  ASP A OD2   1 
ATOM   6501 N  N     . VAL A 1 793 ? 19.896  1.271   52.993  1.00 64.14  ? 793  VAL A N     1 
ATOM   6502 C  CA    . VAL A 1 793 ? 20.606  0.368   53.893  1.00 64.80  ? 793  VAL A CA    1 
ATOM   6503 C  C     . VAL A 1 793 ? 21.087  1.171   55.107  1.00 66.42  ? 793  VAL A C     1 
ATOM   6504 O  O     . VAL A 1 793 ? 22.171  1.761   55.089  1.00 67.32  ? 793  VAL A O     1 
ATOM   6505 C  CB    . VAL A 1 793 ? 21.772  -0.383  53.176  1.00 64.91  ? 793  VAL A CB    1 
ATOM   6506 C  CG1   . VAL A 1 793 ? 22.522  -1.299  54.144  1.00 66.08  ? 793  VAL A CG1   1 
ATOM   6507 C  CG2   . VAL A 1 793 ? 21.244  -1.203  52.008  1.00 64.44  ? 793  VAL A CG2   1 
ATOM   6508 N  N     . GLY A 1 794 ? 20.251  1.206   56.145  1.00 67.00  ? 794  GLY A N     1 
ATOM   6509 C  CA    . GLY A 1 794 ? 20.531  1.944   57.381  1.00 67.29  ? 794  GLY A CA    1 
ATOM   6510 C  C     . GLY A 1 794 ? 20.876  3.415   57.203  1.00 66.05  ? 794  GLY A C     1 
ATOM   6511 O  O     . GLY A 1 794 ? 21.808  3.917   57.833  1.00 67.49  ? 794  GLY A O     1 
ATOM   6512 N  N     . GLY A 1 795 ? 20.130  4.102   56.339  1.00 63.61  ? 795  GLY A N     1 
ATOM   6513 C  CA    . GLY A 1 795 ? 20.342  5.530   56.078  1.00 60.86  ? 795  GLY A CA    1 
ATOM   6514 C  C     . GLY A 1 795 ? 21.361  5.836   54.991  1.00 58.49  ? 795  GLY A C     1 
ATOM   6515 O  O     . GLY A 1 795 ? 21.585  6.999   54.652  1.00 56.74  ? 795  GLY A O     1 
ATOM   6516 N  N     . PHE A 1 796 ? 21.977  4.790   54.443  1.00 57.96  ? 796  PHE A N     1 
ATOM   6517 C  CA    . PHE A 1 796 ? 23.020  4.938   53.431  1.00 56.06  ? 796  PHE A CA    1 
ATOM   6518 C  C     . PHE A 1 796 ? 22.701  4.141   52.161  1.00 53.50  ? 796  PHE A C     1 
ATOM   6519 O  O     . PHE A 1 796 ? 21.964  3.152   52.226  1.00 54.87  ? 796  PHE A O     1 
ATOM   6520 C  CB    . PHE A 1 796 ? 24.383  4.545   54.013  1.00 57.60  ? 796  PHE A CB    1 
ATOM   6521 C  CG    . PHE A 1 796 ? 24.910  5.523   55.035  1.00 59.51  ? 796  PHE A CG    1 
ATOM   6522 C  CD1   . PHE A 1 796 ? 25.564  6.686   54.633  1.00 59.82  ? 796  PHE A CD1   1 
ATOM   6523 C  CD2   . PHE A 1 796 ? 24.754  5.281   56.396  1.00 62.55  ? 796  PHE A CD2   1 
ATOM   6524 C  CE1   . PHE A 1 796 ? 26.054  7.597   55.574  1.00 61.71  ? 796  PHE A CE1   1 
ATOM   6525 C  CE2   . PHE A 1 796 ? 25.240  6.186   57.347  1.00 64.57  ? 796  PHE A CE2   1 
ATOM   6526 C  CZ    . PHE A 1 796 ? 25.891  7.346   56.933  1.00 64.12  ? 796  PHE A CZ    1 
ATOM   6527 N  N     . PRO A 1 797 ? 23.246  4.571   51.001  1.00 50.73  ? 797  PRO A N     1 
ATOM   6528 C  CA    . PRO A 1 797 ? 22.903  3.944   49.717  1.00 48.41  ? 797  PRO A CA    1 
ATOM   6529 C  C     . PRO A 1 797 ? 23.275  2.467   49.640  1.00 48.82  ? 797  PRO A C     1 
ATOM   6530 O  O     . PRO A 1 797 ? 24.420  2.108   49.915  1.00 48.37  ? 797  PRO A O     1 
ATOM   6531 C  CB    . PRO A 1 797 ? 23.736  4.738   48.703  1.00 46.51  ? 797  PRO A CB    1 
ATOM   6532 C  CG    . PRO A 1 797 ? 24.069  6.011   49.376  1.00 47.66  ? 797  PRO A CG    1 
ATOM   6533 C  CD    . PRO A 1 797 ? 24.189  5.693   50.821  1.00 49.00  ? 797  PRO A CD    1 
ATOM   6534 N  N     . GLY A 1 798 ? 22.307  1.630   49.269  1.00 48.24  ? 798  GLY A N     1 
ATOM   6535 C  CA    . GLY A 1 798 ? 22.558  0.214   48.999  1.00 48.86  ? 798  GLY A CA    1 
ATOM   6536 C  C     . GLY A 1 798 ? 23.211  -0.008  47.640  1.00 48.63  ? 798  GLY A C     1 
ATOM   6537 O  O     . GLY A 1 798 ? 23.521  0.957   46.947  1.00 47.12  ? 798  GLY A O     1 
ATOM   6538 N  N     . PRO A 1 799 ? 23.434  -1.284  47.251  1.00 50.19  ? 799  PRO A N     1 
ATOM   6539 C  CA    . PRO A 1 799 ? 24.009  -1.605  45.935  1.00 50.73  ? 799  PRO A CA    1 
ATOM   6540 C  C     . PRO A 1 799 ? 23.118  -1.133  44.772  1.00 50.90  ? 799  PRO A C     1 
ATOM   6541 O  O     . PRO A 1 799 ? 21.889  -1.207  44.863  1.00 51.04  ? 799  PRO A O     1 
ATOM   6542 C  CB    . PRO A 1 799 ? 24.099  -3.139  45.949  1.00 51.05  ? 799  PRO A CB    1 
ATOM   6543 C  CG    . PRO A 1 799 ? 24.080  -3.519  47.396  1.00 52.42  ? 799  PRO A CG    1 
ATOM   6544 C  CD    . PRO A 1 799 ? 23.206  -2.499  48.061  1.00 52.72  ? 799  PRO A CD    1 
ATOM   6545 N  N     . LYS A 1 800 ? 23.744  -0.651  43.699  1.00 49.83  ? 800  LYS A N     1 
ATOM   6546 C  CA    . LYS A 1 800 ? 23.039  -0.138  42.510  1.00 49.68  ? 800  LYS A CA    1 
ATOM   6547 C  C     . LYS A 1 800 ? 22.140  1.080   42.788  1.00 47.58  ? 800  LYS A C     1 
ATOM   6548 O  O     . LYS A 1 800 ? 21.222  1.362   42.013  1.00 46.83  ? 800  LYS A O     1 
ATOM   6549 C  CB    . LYS A 1 800 ? 22.223  -1.247  41.822  1.00 51.18  ? 800  LYS A CB    1 
ATOM   6550 C  CG    . LYS A 1 800 ? 23.026  -2.478  41.434  1.00 57.47  ? 800  LYS A CG    1 
ATOM   6551 C  CD    . LYS A 1 800 ? 22.130  -3.582  40.890  1.00 62.54  ? 800  LYS A CD    1 
ATOM   6552 C  CE    . LYS A 1 800 ? 22.964  -4.755  40.390  1.00 68.18  ? 800  LYS A CE    1 
ATOM   6553 N  NZ    . LYS A 1 800 ? 22.148  -5.988  40.184  1.00 71.48  ? 800  LYS A NZ    1 
ATOM   6554 N  N     . CYS A 1 801 ? 22.409  1.801   43.878  1.00 45.65  ? 801  CYS A N     1 
ATOM   6555 C  CA    . CYS A 1 801 ? 21.559  2.921   44.288  1.00 44.01  ? 801  CYS A CA    1 
ATOM   6556 C  C     . CYS A 1 801 ? 21.532  4.045   43.249  1.00 42.65  ? 801  CYS A C     1 
ATOM   6557 O  O     . CYS A 1 801 ? 22.576  4.623   42.939  1.00 42.02  ? 801  CYS A O     1 
ATOM   6558 C  CB    . CYS A 1 801 ? 21.986  3.478   45.643  1.00 43.00  ? 801  CYS A CB    1 
ATOM   6559 S  SG    . CYS A 1 801 ? 20.895  4.792   46.250  1.00 43.99  ? 801  CYS A SG    1 
ATOM   6560 N  N     . PRO A 1 802 ? 20.332  4.359   42.713  1.00 40.56  ? 802  PRO A N     1 
ATOM   6561 C  CA    . PRO A 1 802 ? 20.243  5.429   41.713  1.00 38.45  ? 802  PRO A CA    1 
ATOM   6562 C  C     . PRO A 1 802 ? 20.650  6.788   42.282  1.00 36.10  ? 802  PRO A C     1 
ATOM   6563 O  O     . PRO A 1 802 ? 20.501  7.044   43.492  1.00 35.60  ? 802  PRO A O     1 
ATOM   6564 C  CB    . PRO A 1 802 ? 18.766  5.412   41.290  1.00 34.42  ? 802  PRO A CB    1 
ATOM   6565 C  CG    . PRO A 1 802 ? 18.298  4.040   41.623  1.00 40.38  ? 802  PRO A CG    1 
ATOM   6566 C  CD    . PRO A 1 802 ? 19.029  3.698   42.910  1.00 39.87  ? 802  PRO A CD    1 
ATOM   6567 N  N     . PHE A 1 803 ? 21.182  7.629   41.405  1.00 33.47  ? 803  PHE A N     1 
ATOM   6568 C  CA    . PHE A 1 803 ? 21.724  8.927   41.779  1.00 34.59  ? 803  PHE A CA    1 
ATOM   6569 C  C     . PHE A 1 803 ? 20.728  9.787   42.545  1.00 35.55  ? 803  PHE A C     1 
ATOM   6570 O  O     . PHE A 1 803 ? 21.086  10.402  43.549  1.00 37.28  ? 803  PHE A O     1 
ATOM   6571 C  CB    . PHE A 1 803 ? 22.206  9.656   40.532  1.00 34.79  ? 803  PHE A CB    1 
ATOM   6572 C  CG    . PHE A 1 803 ? 22.967  10.923  40.813  1.00 35.10  ? 803  PHE A CG    1 
ATOM   6573 C  CD1   . PHE A 1 803 ? 24.320  10.882  41.127  1.00 34.83  ? 803  PHE A CD1   1 
ATOM   6574 C  CD2   . PHE A 1 803 ? 22.338  12.161  40.717  1.00 30.76  ? 803  PHE A CD2   1 
ATOM   6575 C  CE1   . PHE A 1 803 ? 25.038  12.064  41.364  1.00 34.28  ? 803  PHE A CE1   1 
ATOM   6576 C  CE2   . PHE A 1 803 ? 23.039  13.345  40.954  1.00 32.99  ? 803  PHE A CE2   1 
ATOM   6577 C  CZ    . PHE A 1 803 ? 24.394  13.294  41.277  1.00 33.99  ? 803  PHE A CZ    1 
ATOM   6578 N  N     . HIS A 1 804 ? 19.479  9.824   42.088  1.00 34.73  ? 804  HIS A N     1 
ATOM   6579 C  CA    . HIS A 1 804 ? 18.473  10.664  42.745  1.00 34.34  ? 804  HIS A CA    1 
ATOM   6580 C  C     . HIS A 1 804 ? 18.022  10.093  44.093  1.00 36.21  ? 804  HIS A C     1 
ATOM   6581 O  O     . HIS A 1 804 ? 17.665  10.847  45.006  1.00 35.87  ? 804  HIS A O     1 
ATOM   6582 C  CB    . HIS A 1 804 ? 17.290  10.958  41.815  1.00 33.43  ? 804  HIS A CB    1 
ATOM   6583 C  CG    . HIS A 1 804 ? 16.512  9.745   41.414  1.00 33.87  ? 804  HIS A CG    1 
ATOM   6584 N  ND1   . HIS A 1 804 ? 17.021  8.772   40.579  1.00 35.89  ? 804  HIS A ND1   1 
ATOM   6585 C  CD2   . HIS A 1 804 ? 15.260  9.347   41.734  1.00 33.19  ? 804  HIS A CD2   1 
ATOM   6586 C  CE1   . HIS A 1 804 ? 16.117  7.825   40.407  1.00 34.55  ? 804  HIS A CE1   1 
ATOM   6587 N  NE2   . HIS A 1 804 ? 15.040  8.149   41.098  1.00 37.20  ? 804  HIS A NE2   1 
ATOM   6588 N  N     . ILE A 1 805 ? 18.077  8.768   44.218  1.00 36.13  ? 805  ILE A N     1 
ATOM   6589 C  CA    . ILE A 1 805 ? 17.724  8.074   45.460  1.00 37.56  ? 805  ILE A CA    1 
ATOM   6590 C  C     . ILE A 1 805 ? 18.798  8.296   46.531  1.00 38.51  ? 805  ILE A C     1 
ATOM   6591 O  O     . ILE A 1 805 ? 18.494  8.435   47.715  1.00 41.10  ? 805  ILE A O     1 
ATOM   6592 C  CB    . ILE A 1 805 ? 17.470  6.559   45.203  1.00 37.49  ? 805  ILE A CB    1 
ATOM   6593 C  CG1   . ILE A 1 805 ? 16.320  6.368   44.202  1.00 37.18  ? 805  ILE A CG1   1 
ATOM   6594 C  CG2   . ILE A 1 805 ? 17.142  5.837   46.493  1.00 38.40  ? 805  ILE A CG2   1 
ATOM   6595 C  CD1   . ILE A 1 805 ? 14.954  6.930   44.683  1.00 32.94  ? 805  ILE A CD1   1 
ATOM   6596 N  N     . ARG A 1 806 ? 20.052  8.337   46.096  1.00 39.30  ? 806  ARG A N     1 
ATOM   6597 C  CA    . ARG A 1 806 ? 21.177  8.725   46.938  1.00 39.13  ? 806  ARG A CA    1 
ATOM   6598 C  C     . ARG A 1 806 ? 20.946  10.122  47.531  1.00 40.27  ? 806  ARG A C     1 
ATOM   6599 O  O     . ARG A 1 806 ? 21.184  10.356  48.720  1.00 39.80  ? 806  ARG A O     1 
ATOM   6600 C  CB    . ARG A 1 806 ? 22.461  8.715   46.101  1.00 38.94  ? 806  ARG A CB    1 
ATOM   6601 C  CG    . ARG A 1 806 ? 23.727  9.106   46.858  1.00 40.90  ? 806  ARG A CG    1 
ATOM   6602 C  CD    . ARG A 1 806 ? 24.957  9.026   45.961  1.00 41.40  ? 806  ARG A CD    1 
ATOM   6603 N  NE    . ARG A 1 806 ? 25.250  7.652   45.552  1.00 42.62  ? 806  ARG A NE    1 
ATOM   6604 C  CZ    . ARG A 1 806 ? 26.076  6.827   46.194  1.00 43.95  ? 806  ARG A CZ    1 
ATOM   6605 N  NH1   . ARG A 1 806 ? 26.715  7.229   47.293  1.00 43.02  ? 806  ARG A NH1   1 
ATOM   6606 N  NH2   . ARG A 1 806 ? 26.261  5.593   45.738  1.00 36.62  ? 806  ARG A NH2   1 
ATOM   6607 N  N     . GLY A 1 807 ? 20.479  11.041  46.687  1.00 39.22  ? 807  GLY A N     1 
ATOM   6608 C  CA    . GLY A 1 807 ? 20.205  12.412  47.094  1.00 38.47  ? 807  GLY A CA    1 
ATOM   6609 C  C     . GLY A 1 807 ? 19.126  12.494  48.149  1.00 39.71  ? 807  GLY A C     1 
ATOM   6610 O  O     . GLY A 1 807 ? 19.195  13.329  49.054  1.00 41.32  ? 807  GLY A O     1 
ATOM   6611 N  N     . ILE A 1 808 ? 18.133  11.616  48.035  1.00 40.17  ? 808  ILE A N     1 
ATOM   6612 C  CA    . ILE A 1 808 ? 17.043  11.561  49.000  1.00 40.89  ? 808  ILE A CA    1 
ATOM   6613 C  C     . ILE A 1 808 ? 17.556  11.036  50.335  1.00 42.85  ? 808  ILE A C     1 
ATOM   6614 O  O     . ILE A 1 808 ? 17.178  11.545  51.391  1.00 45.33  ? 808  ILE A O     1 
ATOM   6615 C  CB    . ILE A 1 808 ? 15.877  10.683  48.491  1.00 41.39  ? 808  ILE A CB    1 
ATOM   6616 C  CG1   . ILE A 1 808 ? 15.116  11.399  47.374  1.00 38.02  ? 808  ILE A CG1   1 
ATOM   6617 C  CG2   . ILE A 1 808 ? 14.922  10.309  49.639  1.00 39.50  ? 808  ILE A CG2   1 
ATOM   6618 C  CD1   . ILE A 1 808 ? 14.334  10.472  46.497  1.00 33.32  ? 808  ILE A CD1   1 
ATOM   6619 N  N     . LEU A 1 809 ? 18.413  10.019  50.284  1.00 42.91  ? 809  LEU A N     1 
ATOM   6620 C  CA    . LEU A 1 809 ? 18.977  9.445   51.499  1.00 44.13  ? 809  LEU A CA    1 
ATOM   6621 C  C     . LEU A 1 809 ? 19.896  10.442  52.197  1.00 45.27  ? 809  LEU A C     1 
ATOM   6622 O  O     . LEU A 1 809 ? 19.880  10.544  53.428  1.00 49.29  ? 809  LEU A O     1 
ATOM   6623 C  CB    . LEU A 1 809 ? 19.709  8.140   51.197  1.00 44.10  ? 809  LEU A CB    1 
ATOM   6624 C  CG    . LEU A 1 809 ? 18.826  6.979   50.739  1.00 44.36  ? 809  LEU A CG    1 
ATOM   6625 C  CD1   . LEU A 1 809 ? 19.677  5.893   50.117  1.00 45.34  ? 809  LEU A CD1   1 
ATOM   6626 C  CD2   . LEU A 1 809 ? 18.015  6.429   51.898  1.00 44.73  ? 809  LEU A CD2   1 
ATOM   6627 N  N     . THR A 1 810 ? 20.668  11.190  51.406  1.00 43.04  ? 810  THR A N     1 
ATOM   6628 C  CA    . THR A 1 810 ? 21.477  12.290  51.918  1.00 42.86  ? 810  THR A CA    1 
ATOM   6629 C  C     . THR A 1 810 ? 20.553  13.261  52.644  1.00 44.68  ? 810  THR A C     1 
ATOM   6630 O  O     . THR A 1 810 ? 20.793  13.610  53.797  1.00 45.08  ? 810  THR A O     1 
ATOM   6631 C  CB    . THR A 1 810 ? 22.235  13.020  50.785  1.00 43.32  ? 810  THR A CB    1 
ATOM   6632 O  OG1   . THR A 1 810 ? 23.058  12.088  50.068  1.00 40.80  ? 810  THR A OG1   1 
ATOM   6633 C  CG2   . THR A 1 810 ? 23.111  14.145  51.339  1.00 40.11  ? 810  THR A CG2   1 
ATOM   6634 N  N     . TYR A 1 811 ? 19.482  13.664  51.963  1.00 45.41  ? 811  TYR A N     1 
ATOM   6635 C  CA    . TYR A 1 811 ? 18.453  14.512  52.548  1.00 44.82  ? 811  TYR A CA    1 
ATOM   6636 C  C     . TYR A 1 811 ? 17.903  13.939  53.851  1.00 46.14  ? 811  TYR A C     1 
ATOM   6637 O  O     . TYR A 1 811 ? 17.842  14.647  54.854  1.00 46.38  ? 811  TYR A O     1 
ATOM   6638 C  CB    . TYR A 1 811 ? 17.313  14.739  51.551  1.00 41.99  ? 811  TYR A CB    1 
ATOM   6639 C  CG    . TYR A 1 811 ? 16.241  15.677  52.047  1.00 40.21  ? 811  TYR A CG    1 
ATOM   6640 C  CD1   . TYR A 1 811 ? 16.419  17.054  52.001  1.00 39.52  ? 811  TYR A CD1   1 
ATOM   6641 C  CD2   . TYR A 1 811 ? 15.041  15.183  52.564  1.00 41.62  ? 811  TYR A CD2   1 
ATOM   6642 C  CE1   . TYR A 1 811 ? 15.431  17.920  52.466  1.00 43.52  ? 811  TYR A CE1   1 
ATOM   6643 C  CE2   . TYR A 1 811 ? 14.053  16.032  53.023  1.00 41.95  ? 811  TYR A CE2   1 
ATOM   6644 C  CZ    . TYR A 1 811 ? 14.252  17.401  52.978  1.00 45.51  ? 811  TYR A CZ    1 
ATOM   6645 O  OH    . TYR A 1 811 ? 13.265  18.250  53.443  1.00 48.29  ? 811  TYR A OH    1 
ATOM   6646 N  N     . ASN A 1 812 ? 17.501  12.667  53.831  1.00 48.37  ? 812  ASN A N     1 
ATOM   6647 C  CA    . ASN A 1 812 ? 16.902  12.022  55.010  1.00 51.84  ? 812  ASN A CA    1 
ATOM   6648 C  C     . ASN A 1 812 ? 17.817  12.041  56.229  1.00 54.66  ? 812  ASN A C     1 
ATOM   6649 O  O     . ASN A 1 812 ? 17.348  12.217  57.352  1.00 58.61  ? 812  ASN A O     1 
ATOM   6650 C  CB    . ASN A 1 812 ? 16.478  10.579  54.710  1.00 51.87  ? 812  ASN A CB    1 
ATOM   6651 C  CG    . ASN A 1 812 ? 15.240  10.492  53.833  1.00 49.33  ? 812  ASN A CG    1 
ATOM   6652 O  OD1   . ASN A 1 812 ? 14.560  11.483  53.582  1.00 48.64  ? 812  ASN A OD1   1 
ATOM   6653 N  ND2   . ASN A 1 812 ? 14.946  9.291   53.359  1.00 50.51  ? 812  ASN A ND2   1 
ATOM   6654 N  N     . ARG A 1 813 ? 19.118  11.865  56.002  1.00 56.07  ? 813  ARG A N     1 
ATOM   6655 C  CA    . ARG A 1 813 ? 20.105  11.934  57.080  1.00 56.66  ? 813  ARG A CA    1 
ATOM   6656 C  C     . ARG A 1 813 ? 20.274  13.343  57.636  1.00 56.89  ? 813  ARG A C     1 
ATOM   6657 O  O     . ARG A 1 813 ? 20.553  13.517  58.828  1.00 59.62  ? 813  ARG A O     1 
ATOM   6658 C  CB    . ARG A 1 813 ? 21.457  11.416  56.609  1.00 56.12  ? 813  ARG A CB    1 
ATOM   6659 C  CG    . ARG A 1 813 ? 21.546  9.908   56.509  1.00 57.27  ? 813  ARG A CG    1 
ATOM   6660 C  CD    . ARG A 1 813 ? 22.994  9.447   56.425  1.00 54.45  ? 813  ARG A CD    1 
ATOM   6661 N  NE    . ARG A 1 813 ? 23.786  10.243  55.485  1.00 53.28  ? 813  ARG A NE    1 
ATOM   6662 C  CZ    . ARG A 1 813 ? 23.792  10.077  54.163  1.00 50.88  ? 813  ARG A CZ    1 
ATOM   6663 N  NH1   . ARG A 1 813 ? 23.042  9.138   53.594  1.00 49.48  ? 813  ARG A NH1   1 
ATOM   6664 N  NH2   . ARG A 1 813 ? 24.552  10.857  53.406  1.00 48.77  ? 813  ARG A NH2   1 
ATOM   6665 N  N     . ALA A 1 814 ? 20.109  14.341  56.772  1.00 53.87  ? 814  ALA A N     1 
ATOM   6666 C  CA    . ALA A 1 814 ? 20.340  15.731  57.149  1.00 55.03  ? 814  ALA A CA    1 
ATOM   6667 C  C     . ALA A 1 814 ? 19.170  16.318  57.939  1.00 56.00  ? 814  ALA A C     1 
ATOM   6668 O  O     . ALA A 1 814 ? 19.363  17.206  58.773  1.00 55.95  ? 814  ALA A O     1 
ATOM   6669 C  CB    . ALA A 1 814 ? 20.642  16.577  55.909  1.00 52.62  ? 814  ALA A CB    1 
ATOM   6670 N  N     . ILE A 1 815 ? 17.965  15.816  57.675  1.00 55.90  ? 815  ILE A N     1 
ATOM   6671 C  CA    . ILE A 1 815 ? 16.773  16.249  58.405  1.00 59.15  ? 815  ILE A CA    1 
ATOM   6672 C  C     . ILE A 1 815 ? 16.340  15.259  59.491  1.00 62.98  ? 815  ILE A C     1 
ATOM   6673 O  O     . ILE A 1 815 ? 15.299  15.456  60.127  1.00 63.50  ? 815  ILE A O     1 
ATOM   6674 C  CB    . ILE A 1 815 ? 15.561  16.495  57.464  1.00 56.96  ? 815  ILE A CB    1 
ATOM   6675 C  CG1   . ILE A 1 815 ? 15.173  15.200  56.737  1.00 54.32  ? 815  ILE A CG1   1 
ATOM   6676 C  CG2   . ILE A 1 815 ? 15.845  17.656  56.509  1.00 56.24  ? 815  ILE A CG2   1 
ATOM   6677 C  CD1   . ILE A 1 815 ? 13.714  15.101  56.367  1.00 51.30  ? 815  ILE A CD1   1 
ATOM   6678 N  N     . LYS A 1 816 ? 17.133  14.207  59.697  1.00 66.75  ? 816  LYS A N     1 
ATOM   6679 C  CA    . LYS A 1 816 ? 16.762  13.105  60.591  1.00 70.76  ? 816  LYS A CA    1 
ATOM   6680 C  C     . LYS A 1 816 ? 16.377  13.596  61.980  1.00 72.59  ? 816  LYS A C     1 
ATOM   6681 O  O     . LYS A 1 816 ? 17.127  14.343  62.612  1.00 73.35  ? 816  LYS A O     1 
ATOM   6682 C  CB    . LYS A 1 816 ? 17.881  12.059  60.682  1.00 72.20  ? 816  LYS A CB    1 
ATOM   6683 C  CG    . LYS A 1 816 ? 17.548  10.865  61.586  1.00 77.57  ? 816  LYS A CG    1 
ATOM   6684 C  CD    . LYS A 1 816 ? 18.773  9.979   61.838  1.00 81.54  ? 816  LYS A CD    1 
ATOM   6685 C  CE    . LYS A 1 816 ? 18.693  9.251   63.188  1.00 84.71  ? 816  LYS A CE    1 
ATOM   6686 N  NZ    . LYS A 1 816 ? 17.591  8.244   63.266  1.00 84.69  ? 816  LYS A NZ    1 
ATOM   6687 N  N     . GLY A 1 817 ? 15.195  13.182  62.430  1.00 73.88  ? 817  GLY A N     1 
ATOM   6688 C  CA    . GLY A 1 817 ? 14.702  13.524  63.756  1.00 76.88  ? 817  GLY A CA    1 
ATOM   6689 C  C     . GLY A 1 817 ? 14.155  14.933  63.872  1.00 78.34  ? 817  GLY A C     1 
ATOM   6690 O  O     . GLY A 1 817 ? 14.060  15.472  64.977  1.00 80.75  ? 817  GLY A O     1 
ATOM   6691 N  N     . ASN A 1 818 ? 13.808  15.535  62.735  1.00 77.48  ? 818  ASN A N     1 
ATOM   6692 C  CA    . ASN A 1 818 ? 13.106  16.819  62.718  1.00 78.51  ? 818  ASN A CA    1 
ATOM   6693 C  C     . ASN A 1 818 ? 11.698  16.654  62.156  1.00 77.80  ? 818  ASN A C     1 
ATOM   6694 O  O     . ASN A 1 818 ? 11.526  16.415  60.958  1.00 75.70  ? 818  ASN A O     1 
ATOM   6695 C  CB    . ASN A 1 818 ? 13.885  17.882  61.931  1.00 78.44  ? 818  ASN A CB    1 
ATOM   6696 C  CG    . ASN A 1 818 ? 15.130  18.369  62.665  1.00 81.64  ? 818  ASN A CG    1 
ATOM   6697 O  OD1   . ASN A 1 818 ? 15.099  18.636  63.868  1.00 80.98  ? 818  ASN A OD1   1 
ATOM   6698 N  ND2   . ASN A 1 818 ? 16.233  18.497  61.932  1.00 83.77  ? 818  ASN A ND2   1 
ATOM   6699 N  N     . ILE A 1 819 ? 10.702  16.769  63.035  1.00 78.98  ? 819  ILE A N     1 
ATOM   6700 C  CA    . ILE A 1 819 ? 9.288   16.607  62.662  1.00 79.29  ? 819  ILE A CA    1 
ATOM   6701 C  C     . ILE A 1 819 ? 8.787   17.691  61.703  1.00 77.80  ? 819  ILE A C     1 
ATOM   6702 O  O     . ILE A 1 819 ? 7.928   17.434  60.859  1.00 77.35  ? 819  ILE A O     1 
ATOM   6703 C  CB    . ILE A 1 819 ? 8.353   16.518  63.910  1.00 81.94  ? 819  ILE A CB    1 
ATOM   6704 C  CG1   . ILE A 1 819 ? 8.833   17.434  65.048  1.00 83.02  ? 819  ILE A CG1   1 
ATOM   6705 C  CG2   . ILE A 1 819 ? 8.257   15.080  64.408  1.00 83.51  ? 819  ILE A CG2   1 
ATOM   6706 C  CD1   . ILE A 1 819 ? 8.215   18.823  65.058  1.00 83.12  ? 819  ILE A CD1   1 
ATOM   6707 N  N     . ASP A 1 820 ? 9.346   18.891  61.837  1.00 77.26  ? 820  ASP A N     1 
ATOM   6708 C  CA    . ASP A 1 820 ? 8.967   20.055  61.029  1.00 75.16  ? 820  ASP A CA    1 
ATOM   6709 C  C     . ASP A 1 820 ? 9.369   19.968  59.549  1.00 70.77  ? 820  ASP A C     1 
ATOM   6710 O  O     . ASP A 1 820 ? 8.719   20.581  58.697  1.00 70.28  ? 820  ASP A O     1 
ATOM   6711 C  CB    . ASP A 1 820 ? 9.536   21.337  61.654  1.00 78.10  ? 820  ASP A CB    1 
ATOM   6712 C  CG    . ASP A 1 820 ? 10.963  21.157  62.177  1.00 82.82  ? 820  ASP A CG    1 
ATOM   6713 O  OD1   . ASP A 1 820 ? 11.878  20.858  61.371  1.00 83.73  ? 820  ASP A OD1   1 
ATOM   6714 O  OD2   . ASP A 1 820 ? 11.167  21.320  63.402  1.00 85.58  ? 820  ASP A OD2   1 
ATOM   6715 N  N     . ALA A 1 821 ? 10.431  19.216  59.251  1.00 65.16  ? 821  ALA A N     1 
ATOM   6716 C  CA    . ALA A 1 821 ? 10.992  19.147  57.898  1.00 59.89  ? 821  ALA A CA    1 
ATOM   6717 C  C     . ALA A 1 821 ? 10.079  18.424  56.911  1.00 56.74  ? 821  ALA A C     1 
ATOM   6718 O  O     . ALA A 1 821 ? 9.490   17.399  57.257  1.00 56.59  ? 821  ALA A O     1 
ATOM   6719 C  CB    . ALA A 1 821 ? 12.361  18.490  57.926  1.00 58.64  ? 821  ALA A CB    1 
ATOM   6720 N  N     . PRO A 1 822 ? 9.948   18.963  55.683  1.00 53.90  ? 822  PRO A N     1 
ATOM   6721 C  CA    . PRO A 1 822 ? 9.238   18.255  54.618  1.00 52.45  ? 822  PRO A CA    1 
ATOM   6722 C  C     . PRO A 1 822 ? 9.864   16.891  54.359  1.00 52.84  ? 822  PRO A C     1 
ATOM   6723 O  O     . PRO A 1 822 ? 11.071  16.796  54.121  1.00 52.50  ? 822  PRO A O     1 
ATOM   6724 C  CB    . PRO A 1 822 ? 9.440   19.157  53.403  1.00 49.61  ? 822  PRO A CB    1 
ATOM   6725 C  CG    . PRO A 1 822 ? 9.617   20.502  53.964  1.00 51.14  ? 822  PRO A CG    1 
ATOM   6726 C  CD    . PRO A 1 822 ? 10.340  20.322  55.266  1.00 53.24  ? 822  PRO A CD    1 
ATOM   6727 N  N     . GLN A 1 823 ? 9.049   15.846  54.441  1.00 54.12  ? 823  GLN A N     1 
ATOM   6728 C  CA    . GLN A 1 823 ? 9.492   14.499  54.117  1.00 54.34  ? 823  GLN A CA    1 
ATOM   6729 C  C     . GLN A 1 823 ? 9.309   14.256  52.628  1.00 53.30  ? 823  GLN A C     1 
ATOM   6730 O  O     . GLN A 1 823 ? 8.362   14.762  52.024  1.00 53.20  ? 823  GLN A O     1 
ATOM   6731 C  CB    . GLN A 1 823 ? 8.705   13.456  54.913  1.00 55.54  ? 823  GLN A CB    1 
ATOM   6732 C  CG    . GLN A 1 823 ? 8.857   13.559  56.435  1.00 61.54  ? 823  GLN A CG    1 
ATOM   6733 C  CD    . GLN A 1 823 ? 10.180  13.006  56.954  1.00 64.56  ? 823  GLN A CD    1 
ATOM   6734 O  OE1   . GLN A 1 823 ? 10.909  13.688  57.676  1.00 67.25  ? 823  GLN A OE1   1 
ATOM   6735 N  NE2   . GLN A 1 823 ? 10.490  11.765  56.593  1.00 65.44  ? 823  GLN A NE2   1 
ATOM   6736 N  N     . VAL A 1 824 ? 10.231  13.492  52.048  1.00 51.73  ? 824  VAL A N     1 
ATOM   6737 C  CA    . VAL A 1 824 ? 10.125  13.024  50.671  1.00 50.02  ? 824  VAL A CA    1 
ATOM   6738 C  C     . VAL A 1 824 ? 9.094   11.895  50.582  1.00 50.25  ? 824  VAL A C     1 
ATOM   6739 O  O     . VAL A 1 824 ? 9.279   10.833  51.174  1.00 51.54  ? 824  VAL A O     1 
ATOM   6740 C  CB    . VAL A 1 824 ? 11.490  12.499  50.159  1.00 48.74  ? 824  VAL A CB    1 
ATOM   6741 C  CG1   . VAL A 1 824 ? 11.360  11.921  48.737  1.00 46.66  ? 824  VAL A CG1   1 
ATOM   6742 C  CG2   . VAL A 1 824 ? 12.537  13.601  50.204  1.00 47.38  ? 824  VAL A CG2   1 
ATOM   6743 N  N     . VAL A 1 825 ? 8.023   12.120  49.829  1.00 50.13  ? 825  VAL A N     1 
ATOM   6744 C  CA    . VAL A 1 825 ? 6.984   11.101  49.668  1.00 52.08  ? 825  VAL A CA    1 
ATOM   6745 C  C     . VAL A 1 825 ? 7.313   10.125  48.535  1.00 50.16  ? 825  VAL A C     1 
ATOM   6746 O  O     . VAL A 1 825 ? 7.540   10.531  47.396  1.00 49.54  ? 825  VAL A O     1 
ATOM   6747 C  CB    . VAL A 1 825 ? 5.571   11.722  49.458  1.00 53.24  ? 825  VAL A CB    1 
ATOM   6748 C  CG1   . VAL A 1 825 ? 4.505   10.626  49.331  1.00 53.53  ? 825  VAL A CG1   1 
ATOM   6749 C  CG2   . VAL A 1 825 ? 5.220   12.659  50.609  1.00 55.64  ? 825  VAL A CG2   1 
ATOM   6750 N  N     . GLU A 1 826 ? 7.330   8.839   48.875  1.00 50.78  ? 826  GLU A N     1 
ATOM   6751 C  CA    . GLU A 1 826 ? 7.542   7.754   47.924  1.00 50.89  ? 826  GLU A CA    1 
ATOM   6752 C  C     . GLU A 1 826 ? 6.694   7.928   46.662  1.00 51.47  ? 826  GLU A C     1 
ATOM   6753 O  O     . GLU A 1 826 ? 5.467   7.992   46.730  1.00 52.65  ? 826  GLU A O     1 
ATOM   6754 C  CB    . GLU A 1 826 ? 7.241   6.410   48.604  1.00 52.30  ? 826  GLU A CB    1 
ATOM   6755 C  CG    . GLU A 1 826 ? 7.170   5.193   47.680  1.00 53.94  ? 826  GLU A CG    1 
ATOM   6756 C  CD    . GLU A 1 826 ? 8.509   4.835   47.046  1.00 56.93  ? 826  GLU A CD    1 
ATOM   6757 O  OE1   . GLU A 1 826 ? 8.510   4.435   45.863  1.00 56.75  ? 826  GLU A OE1   1 
ATOM   6758 O  OE2   . GLU A 1 826 ? 9.556   4.948   47.723  1.00 57.39  ? 826  GLU A OE2   1 
ATOM   6759 N  N     . GLY A 1 827 ? 7.360   8.015   45.515  1.00 50.37  ? 827  GLY A N     1 
ATOM   6760 C  CA    . GLY A 1 827 ? 6.679   8.140   44.231  1.00 49.68  ? 827  GLY A CA    1 
ATOM   6761 C  C     . GLY A 1 827 ? 6.430   9.568   43.774  1.00 49.15  ? 827  GLY A C     1 
ATOM   6762 O  O     . GLY A 1 827 ? 5.943   9.786   42.667  1.00 48.42  ? 827  GLY A O     1 
ATOM   6763 N  N     . GLU A 1 828 ? 6.748   10.542  44.622  1.00 48.43  ? 828  GLU A N     1 
ATOM   6764 C  CA    . GLU A 1 828 ? 6.580   11.943  44.252  1.00 48.92  ? 828  GLU A CA    1 
ATOM   6765 C  C     . GLU A 1 828 ? 7.891   12.540  43.718  1.00 45.73  ? 828  GLU A C     1 
ATOM   6766 O  O     . GLU A 1 828 ? 8.933   11.881  43.725  1.00 44.39  ? 828  GLU A O     1 
ATOM   6767 C  CB    . GLU A 1 828 ? 5.952   12.750  45.405  1.00 52.88  ? 828  GLU A CB    1 
ATOM   6768 C  CG    . GLU A 1 828 ? 4.456   12.379  45.623  1.00 62.38  ? 828  GLU A CG    1 
ATOM   6769 C  CD    . GLU A 1 828 ? 3.621   13.413  46.402  1.00 69.51  ? 828  GLU A CD    1 
ATOM   6770 O  OE1   . GLU A 1 828 ? 2.604   13.003  47.013  1.00 70.47  ? 828  GLU A OE1   1 
ATOM   6771 O  OE2   . GLU A 1 828 ? 3.958   14.622  46.402  1.00 71.18  ? 828  GLU A OE2   1 
ATOM   6772 N  N     . LYS A 1 829 ? 7.844   13.773  43.231  1.00 42.25  ? 829  LYS A N     1 
ATOM   6773 C  CA    . LYS A 1 829 ? 9.016   14.336  42.568  1.00 38.71  ? 829  LYS A CA    1 
ATOM   6774 C  C     . LYS A 1 829 ? 9.948   15.133  43.468  1.00 37.39  ? 829  LYS A C     1 
ATOM   6775 O  O     . LYS A 1 829 ? 9.515   15.786  44.420  1.00 36.47  ? 829  LYS A O     1 
ATOM   6776 C  CB    . LYS A 1 829 ? 8.613   15.108  41.313  1.00 38.71  ? 829  LYS A CB    1 
ATOM   6777 C  CG    . LYS A 1 829 ? 8.359   14.156  40.149  1.00 38.12  ? 829  LYS A CG    1 
ATOM   6778 C  CD    . LYS A 1 829 ? 7.684   14.814  38.987  1.00 38.03  ? 829  LYS A CD    1 
ATOM   6779 C  CE    . LYS A 1 829 ? 7.633   13.865  37.812  1.00 39.06  ? 829  LYS A CE    1 
ATOM   6780 N  NZ    . LYS A 1 829 ? 7.149   14.570  36.599  1.00 41.58  ? 829  LYS A NZ    1 
ATOM   6781 N  N     . VAL A 1 830 ? 11.239  15.050  43.157  1.00 33.94  ? 830  VAL A N     1 
ATOM   6782 C  CA    . VAL A 1 830 ? 12.271  15.716  43.929  1.00 31.52  ? 830  VAL A CA    1 
ATOM   6783 C  C     . VAL A 1 830 ? 13.183  16.530  43.036  1.00 31.39  ? 830  VAL A C     1 
ATOM   6784 O  O     . VAL A 1 830 ? 13.495  16.113  41.909  1.00 32.99  ? 830  VAL A O     1 
ATOM   6785 C  CB    . VAL A 1 830 ? 13.135  14.710  44.728  1.00 31.62  ? 830  VAL A CB    1 
ATOM   6786 C  CG1   . VAL A 1 830 ? 12.396  14.225  45.971  1.00 25.33  ? 830  VAL A CG1   1 
ATOM   6787 C  CG2   . VAL A 1 830 ? 13.562  13.533  43.854  1.00 32.04  ? 830  VAL A CG2   1 
ATOM   6788 N  N     . TYR A 1 831 ? 13.597  17.691  43.538  1.00 28.97  ? 831  TYR A N     1 
ATOM   6789 C  CA    . TYR A 1 831 ? 14.714  18.432  42.955  1.00 30.15  ? 831  TYR A CA    1 
ATOM   6790 C  C     . TYR A 1 831 ? 16.007  17.781  43.399  1.00 30.56  ? 831  TYR A C     1 
ATOM   6791 O  O     . TYR A 1 831 ? 16.096  17.276  44.524  1.00 30.92  ? 831  TYR A O     1 
ATOM   6792 C  CB    . TYR A 1 831 ? 14.720  19.888  43.410  1.00 31.17  ? 831  TYR A CB    1 
ATOM   6793 C  CG    . TYR A 1 831 ? 13.649  20.751  42.794  1.00 33.46  ? 831  TYR A CG    1 
ATOM   6794 C  CD1   . TYR A 1 831 ? 13.428  20.749  41.417  1.00 31.78  ? 831  TYR A CD1   1 
ATOM   6795 C  CD2   . TYR A 1 831 ? 12.867  21.592  43.594  1.00 35.52  ? 831  TYR A CD2   1 
ATOM   6796 C  CE1   . TYR A 1 831 ? 12.445  21.546  40.850  1.00 33.87  ? 831  TYR A CE1   1 
ATOM   6797 C  CE2   . TYR A 1 831 ? 11.886  22.397  43.040  1.00 38.55  ? 831  TYR A CE2   1 
ATOM   6798 C  CZ    . TYR A 1 831 ? 11.675  22.372  41.667  1.00 38.62  ? 831  TYR A CZ    1 
ATOM   6799 O  OH    . TYR A 1 831 ? 10.699  23.177  41.114  1.00 40.74  ? 831  TYR A OH    1 
ATOM   6800 N  N     . VAL A 1 832 ? 17.004  17.799  42.522  1.00 31.04  ? 832  VAL A N     1 
ATOM   6801 C  CA    . VAL A 1 832 ? 18.287  17.126  42.770  1.00 32.51  ? 832  VAL A CA    1 
ATOM   6802 C  C     . VAL A 1 832 ? 19.441  18.063  42.416  1.00 33.59  ? 832  VAL A C     1 
ATOM   6803 O  O     . VAL A 1 832 ? 19.413  18.723  41.369  1.00 35.06  ? 832  VAL A O     1 
ATOM   6804 C  CB    . VAL A 1 832 ? 18.438  15.831  41.914  1.00 31.83  ? 832  VAL A CB    1 
ATOM   6805 C  CG1   . VAL A 1 832 ? 19.798  15.168  42.164  1.00 31.18  ? 832  VAL A CG1   1 
ATOM   6806 C  CG2   . VAL A 1 832 ? 17.314  14.844  42.198  1.00 31.38  ? 832  VAL A CG2   1 
ATOM   6807 N  N     . LEU A 1 833 ? 20.453  18.111  43.279  1.00 33.18  ? 833  LEU A N     1 
ATOM   6808 C  CA    . LEU A 1 833 ? 21.652  18.918  43.025  1.00 34.47  ? 833  LEU A CA    1 
ATOM   6809 C  C     . LEU A 1 833 ? 22.933  18.162  43.360  1.00 35.18  ? 833  LEU A C     1 
ATOM   6810 O  O     . LEU A 1 833 ? 22.986  17.457  44.374  1.00 36.35  ? 833  LEU A O     1 
ATOM   6811 C  CB    . LEU A 1 833 ? 21.616  20.222  43.837  1.00 32.85  ? 833  LEU A CB    1 
ATOM   6812 C  CG    . LEU A 1 833 ? 20.775  21.375  43.291  1.00 36.06  ? 833  LEU A CG    1 
ATOM   6813 C  CD1   . LEU A 1 833 ? 20.676  22.477  44.327  1.00 30.07  ? 833  LEU A CD1   1 
ATOM   6814 C  CD2   . LEU A 1 833 ? 21.343  21.914  41.960  1.00 32.64  ? 833  LEU A CD2   1 
ATOM   6815 N  N     . PRO A 1 834 ? 23.981  18.327  42.527  1.00 36.75  ? 834  PRO A N     1 
ATOM   6816 C  CA    . PRO A 1 834 ? 25.277  17.759  42.893  1.00 38.26  ? 834  PRO A CA    1 
ATOM   6817 C  C     . PRO A 1 834 ? 25.970  18.597  43.965  1.00 40.20  ? 834  PRO A C     1 
ATOM   6818 O  O     . PRO A 1 834 ? 25.776  19.818  44.037  1.00 40.20  ? 834  PRO A O     1 
ATOM   6819 C  CB    . PRO A 1 834 ? 26.069  17.800  41.586  1.00 36.64  ? 834  PRO A CB    1 
ATOM   6820 C  CG    . PRO A 1 834 ? 25.446  18.913  40.791  1.00 37.13  ? 834  PRO A CG    1 
ATOM   6821 C  CD    . PRO A 1 834 ? 24.035  19.090  41.261  1.00 35.42  ? 834  PRO A CD    1 
ATOM   6822 N  N     . LEU A 1 835 ? 26.776  17.926  44.781  1.00 40.62  ? 835  LEU A N     1 
ATOM   6823 C  CA    . LEU A 1 835 ? 27.508  18.555  45.870  1.00 40.54  ? 835  LEU A CA    1 
ATOM   6824 C  C     . LEU A 1 835 ? 29.008  18.361  45.695  1.00 41.46  ? 835  LEU A C     1 
ATOM   6825 O  O     . LEU A 1 835 ? 29.464  17.255  45.386  1.00 41.09  ? 835  LEU A O     1 
ATOM   6826 C  CB    . LEU A 1 835 ? 27.064  17.937  47.198  1.00 41.30  ? 835  LEU A CB    1 
ATOM   6827 C  CG    . LEU A 1 835 ? 25.960  18.551  48.070  1.00 39.47  ? 835  LEU A CG    1 
ATOM   6828 C  CD1   . LEU A 1 835 ? 25.146  19.653  47.398  1.00 36.57  ? 835  LEU A CD1   1 
ATOM   6829 C  CD2   . LEU A 1 835 ? 25.065  17.445  48.575  1.00 39.94  ? 835  LEU A CD2   1 
ATOM   6830 N  N     . ARG A 1 836 ? 29.764  19.441  45.896  1.00 42.37  ? 836  ARG A N     1 
ATOM   6831 C  CA    . ARG A 1 836 ? 31.228  19.408  45.850  1.00 43.23  ? 836  ARG A CA    1 
ATOM   6832 C  C     . ARG A 1 836 ? 31.812  18.511  46.938  1.00 45.04  ? 836  ARG A C     1 
ATOM   6833 O  O     . ARG A 1 836 ? 31.254  18.396  48.034  1.00 43.35  ? 836  ARG A O     1 
ATOM   6834 C  CB    . ARG A 1 836 ? 31.814  20.813  45.998  1.00 44.00  ? 836  ARG A CB    1 
ATOM   6835 C  CG    . ARG A 1 836 ? 31.543  21.733  44.828  1.00 44.45  ? 836  ARG A CG    1 
ATOM   6836 C  CD    . ARG A 1 836 ? 32.509  22.899  44.795  1.00 45.25  ? 836  ARG A CD    1 
ATOM   6837 N  NE    . ARG A 1 836 ? 32.641  23.581  46.081  1.00 50.35  ? 836  ARG A NE    1 
ATOM   6838 C  CZ    . ARG A 1 836 ? 31.779  24.474  46.550  1.00 49.93  ? 836  ARG A CZ    1 
ATOM   6839 N  NH1   . ARG A 1 836 ? 30.692  24.790  45.852  1.00 48.50  ? 836  ARG A NH1   1 
ATOM   6840 N  NH2   . ARG A 1 836 ? 32.000  25.049  47.723  1.00 47.61  ? 836  ARG A NH2   1 
ATOM   6841 N  N     . GLU A 1 837 ? 32.945  17.892  46.621  1.00 45.79  ? 837  GLU A N     1 
ATOM   6842 C  CA    . GLU A 1 837 ? 33.643  16.989  47.527  1.00 49.67  ? 837  GLU A CA    1 
ATOM   6843 C  C     . GLU A 1 837 ? 34.043  17.669  48.844  1.00 50.95  ? 837  GLU A C     1 
ATOM   6844 O  O     . GLU A 1 837 ? 34.602  18.770  48.842  1.00 51.23  ? 837  GLU A O     1 
ATOM   6845 C  CB    . GLU A 1 837 ? 34.874  16.421  46.821  1.00 51.52  ? 837  GLU A CB    1 
ATOM   6846 C  CG    . GLU A 1 837 ? 35.448  15.165  47.451  1.00 59.86  ? 837  GLU A CG    1 
ATOM   6847 C  CD    . GLU A 1 837 ? 36.113  14.267  46.421  1.00 65.33  ? 837  GLU A CD    1 
ATOM   6848 O  OE1   . GLU A 1 837 ? 37.361  14.288  46.327  1.00 66.14  ? 837  GLU A OE1   1 
ATOM   6849 O  OE2   . GLU A 1 837 ? 35.379  13.559  45.690  1.00 66.72  ? 837  GLU A OE2   1 
ATOM   6850 N  N     . GLY A 1 838 ? 33.743  17.003  49.958  1.00 50.28  ? 838  GLY A N     1 
ATOM   6851 C  CA    . GLY A 1 838 ? 34.126  17.483  51.283  1.00 51.76  ? 838  GLY A CA    1 
ATOM   6852 C  C     . GLY A 1 838 ? 33.036  18.277  51.975  1.00 52.46  ? 838  GLY A C     1 
ATOM   6853 O  O     . GLY A 1 838 ? 33.288  18.940  52.982  1.00 53.81  ? 838  GLY A O     1 
ATOM   6854 N  N     . ASN A 1 839 ? 31.826  18.205  51.426  1.00 49.82  ? 839  ASN A N     1 
ATOM   6855 C  CA    . ASN A 1 839 ? 30.652  18.878  51.973  1.00 48.78  ? 839  ASN A CA    1 
ATOM   6856 C  C     . ASN A 1 839 ? 30.149  18.183  53.246  1.00 48.78  ? 839  ASN A C     1 
ATOM   6857 O  O     . ASN A 1 839 ? 30.416  17.000  53.442  1.00 49.74  ? 839  ASN A O     1 
ATOM   6858 C  CB    . ASN A 1 839 ? 29.549  18.914  50.912  1.00 44.62  ? 839  ASN A CB    1 
ATOM   6859 C  CG    . ASN A 1 839 ? 28.984  17.539  50.618  1.00 41.33  ? 839  ASN A CG    1 
ATOM   6860 O  OD1   . ASN A 1 839 ? 28.098  17.065  51.321  1.00 41.69  ? 839  ASN A OD1   1 
ATOM   6861 N  ND2   . ASN A 1 839 ? 29.499  16.891  49.580  1.00 35.63  ? 839  ASN A ND2   1 
ATOM   6862 N  N     . PRO A 1 840 ? 29.412  18.911  54.105  1.00 50.03  ? 840  PRO A N     1 
ATOM   6863 C  CA    . PRO A 1 840 ? 28.961  18.366  55.395  1.00 51.76  ? 840  PRO A CA    1 
ATOM   6864 C  C     . PRO A 1 840 ? 27.881  17.284  55.290  1.00 50.06  ? 840  PRO A C     1 
ATOM   6865 O  O     . PRO A 1 840 ? 27.664  16.527  56.244  1.00 49.60  ? 840  PRO A O     1 
ATOM   6866 C  CB    . PRO A 1 840 ? 28.409  19.600  56.121  1.00 53.18  ? 840  PRO A CB    1 
ATOM   6867 C  CG    . PRO A 1 840 ? 28.017  20.536  55.025  1.00 52.85  ? 840  PRO A CG    1 
ATOM   6868 C  CD    . PRO A 1 840 ? 29.053  20.334  53.961  1.00 51.28  ? 840  PRO A CD    1 
ATOM   6869 N  N     . PHE A 1 841 ? 27.226  17.202  54.139  1.00 47.88  ? 841  PHE A N     1 
ATOM   6870 C  CA    . PHE A 1 841 ? 26.197  16.195  53.908  1.00 47.22  ? 841  PHE A CA    1 
ATOM   6871 C  C     . PHE A 1 841 ? 26.781  14.796  53.737  1.00 48.07  ? 841  PHE A C     1 
ATOM   6872 O  O     . PHE A 1 841 ? 26.069  13.798  53.868  1.00 48.34  ? 841  PHE A O     1 
ATOM   6873 C  CB    . PHE A 1 841 ? 25.339  16.589  52.707  1.00 46.56  ? 841  PHE A CB    1 
ATOM   6874 C  CG    . PHE A 1 841 ? 24.630  17.902  52.890  1.00 45.84  ? 841  PHE A CG    1 
ATOM   6875 C  CD1   . PHE A 1 841 ? 23.479  17.980  53.663  1.00 46.37  ? 841  PHE A CD1   1 
ATOM   6876 C  CD2   . PHE A 1 841 ? 25.133  19.065  52.316  1.00 43.78  ? 841  PHE A CD2   1 
ATOM   6877 C  CE1   . PHE A 1 841 ? 22.821  19.199  53.849  1.00 48.86  ? 841  PHE A CE1   1 
ATOM   6878 C  CE2   . PHE A 1 841 ? 24.491  20.287  52.494  1.00 46.53  ? 841  PHE A CE2   1 
ATOM   6879 C  CZ    . PHE A 1 841 ? 23.329  20.357  53.261  1.00 46.84  ? 841  PHE A CZ    1 
ATOM   6880 N  N     . GLY A 1 842 ? 28.080  14.735  53.456  1.00 47.96  ? 842  GLY A N     1 
ATOM   6881 C  CA    . GLY A 1 842 ? 28.800  13.471  53.386  1.00 50.24  ? 842  GLY A CA    1 
ATOM   6882 C  C     . GLY A 1 842 ? 28.540  12.637  52.144  1.00 50.91  ? 842  GLY A C     1 
ATOM   6883 O  O     . GLY A 1 842 ? 28.886  11.455  52.122  1.00 52.10  ? 842  GLY A O     1 
ATOM   6884 N  N     . ASP A 1 843 ? 27.935  13.239  51.114  1.00 49.31  ? 843  ASP A N     1 
ATOM   6885 C  CA    . ASP A 1 843 ? 27.709  12.552  49.830  1.00 48.56  ? 843  ASP A CA    1 
ATOM   6886 C  C     . ASP A 1 843 ? 27.749  13.499  48.629  1.00 47.91  ? 843  ASP A C     1 
ATOM   6887 O  O     . ASP A 1 843 ? 27.872  14.715  48.794  1.00 47.52  ? 843  ASP A O     1 
ATOM   6888 C  CB    . ASP A 1 843 ? 26.399  11.758  49.844  1.00 47.72  ? 843  ASP A CB    1 
ATOM   6889 C  CG    . ASP A 1 843 ? 26.514  10.418  49.122  1.00 49.48  ? 843  ASP A CG    1 
ATOM   6890 O  OD1   . ASP A 1 843 ? 27.336  10.280  48.191  1.00 46.21  ? 843  ASP A OD1   1 
ATOM   6891 O  OD2   . ASP A 1 843 ? 25.771  9.489   49.495  1.00 57.34  ? 843  ASP A OD2   1 
ATOM   6892 N  N     . LYS A 1 844 ? 27.641  12.934  47.424  1.00 46.35  ? 844  LYS A N     1 
ATOM   6893 C  CA    . LYS A 1 844 ? 27.850  13.698  46.194  1.00 45.35  ? 844  LYS A CA    1 
ATOM   6894 C  C     . LYS A 1 844 ? 26.625  14.464  45.684  1.00 43.18  ? 844  LYS A C     1 
ATOM   6895 O  O     . LYS A 1 844 ? 26.745  15.304  44.788  1.00 40.09  ? 844  LYS A O     1 
ATOM   6896 C  CB    . LYS A 1 844 ? 28.431  12.809  45.090  1.00 47.52  ? 844  LYS A CB    1 
ATOM   6897 C  CG    . LYS A 1 844 ? 27.490  11.728  44.568  1.00 49.48  ? 844  LYS A CG    1 
ATOM   6898 C  CD    . LYS A 1 844 ? 28.221  10.831  43.583  1.00 51.18  ? 844  LYS A CD    1 
ATOM   6899 C  CE    . LYS A 1 844 ? 27.328  9.714   43.067  1.00 51.96  ? 844  LYS A CE    1 
ATOM   6900 N  NZ    . LYS A 1 844 ? 28.066  8.840   42.108  1.00 50.02  ? 844  LYS A NZ    1 
ATOM   6901 N  N     . CYS A 1 845 ? 25.455  14.171  46.246  1.00 41.93  ? 845  CYS A N     1 
ATOM   6902 C  CA    . CYS A 1 845 ? 24.226  14.831  45.810  1.00 40.84  ? 845  CYS A CA    1 
ATOM   6903 C  C     . CYS A 1 845 ? 23.196  14.863  46.907  1.00 40.02  ? 845  CYS A C     1 
ATOM   6904 O  O     . CYS A 1 845 ? 23.261  14.076  47.847  1.00 41.27  ? 845  CYS A O     1 
ATOM   6905 C  CB    . CYS A 1 845 ? 23.630  14.130  44.588  1.00 40.74  ? 845  CYS A CB    1 
ATOM   6906 S  SG    . CYS A 1 845 ? 23.138  12.416  44.909  1.00 43.15  ? 845  CYS A SG    1 
ATOM   6907 N  N     . ILE A 1 846 ? 22.241  15.778  46.764  1.00 39.80  ? 846  ILE A N     1 
ATOM   6908 C  CA    . ILE A 1 846 ? 21.124  15.910  47.686  1.00 36.22  ? 846  ILE A CA    1 
ATOM   6909 C  C     . ILE A 1 846 ? 19.832  16.212  46.917  1.00 36.81  ? 846  ILE A C     1 
ATOM   6910 O  O     . ILE A 1 846 ? 19.839  16.959  45.943  1.00 37.68  ? 846  ILE A O     1 
ATOM   6911 C  CB    . ILE A 1 846 ? 21.404  16.985  48.775  1.00 36.04  ? 846  ILE A CB    1 
ATOM   6912 C  CG1   . ILE A 1 846 ? 20.490  16.770  49.993  1.00 37.72  ? 846  ILE A CG1   1 
ATOM   6913 C  CG2   . ILE A 1 846 ? 21.319  18.407  48.197  1.00 31.81  ? 846  ILE A CG2   1 
ATOM   6914 C  CD1   . ILE A 1 846 ? 20.739  17.717  51.149  1.00 35.99  ? 846  ILE A CD1   1 
ATOM   6915 N  N     . ALA A 1 847 ? 18.735  15.613  47.367  1.00 37.27  ? 847  ALA A N     1 
ATOM   6916 C  CA    . ALA A 1 847 ? 17.429  15.800  46.766  1.00 37.43  ? 847  ALA A CA    1 
ATOM   6917 C  C     . ALA A 1 847 ? 16.405  16.236  47.819  1.00 39.22  ? 847  ALA A C     1 
ATOM   6918 O  O     . ALA A 1 847 ? 16.436  15.755  48.951  1.00 39.93  ? 847  ALA A O     1 
ATOM   6919 C  CB    . ALA A 1 847 ? 16.978  14.503  46.086  1.00 37.00  ? 847  ALA A CB    1 
ATOM   6920 N  N     . TRP A 1 848 ? 15.506  17.144  47.443  1.00 38.70  ? 848  TRP A N     1 
ATOM   6921 C  CA    . TRP A 1 848 ? 14.411  17.568  48.325  1.00 38.77  ? 848  TRP A CA    1 
ATOM   6922 C  C     . TRP A 1 848 ? 13.080  17.623  47.564  1.00 38.57  ? 848  TRP A C     1 
ATOM   6923 O  O     . TRP A 1 848 ? 13.086  17.622  46.338  1.00 37.97  ? 848  TRP A O     1 
ATOM   6924 C  CB    . TRP A 1 848 ? 14.738  18.903  49.006  1.00 37.98  ? 848  TRP A CB    1 
ATOM   6925 C  CG    . TRP A 1 848 ? 14.688  20.096  48.119  1.00 31.60  ? 848  TRP A CG    1 
ATOM   6926 C  CD1   . TRP A 1 848 ? 13.676  21.011  48.034  1.00 30.77  ? 848  TRP A CD1   1 
ATOM   6927 C  CD2   . TRP A 1 848 ? 15.698  20.525  47.197  1.00 30.75  ? 848  TRP A CD2   1 
ATOM   6928 N  NE1   . TRP A 1 848 ? 13.992  21.986  47.111  1.00 30.25  ? 848  TRP A NE1   1 
ATOM   6929 C  CE2   . TRP A 1 848 ? 15.226  21.708  46.580  1.00 29.55  ? 848  TRP A CE2   1 
ATOM   6930 C  CE3   . TRP A 1 848 ? 16.956  20.023  46.826  1.00 32.43  ? 848  TRP A CE3   1 
ATOM   6931 C  CZ2   . TRP A 1 848 ? 15.968  22.398  45.611  1.00 31.24  ? 848  TRP A CZ2   1 
ATOM   6932 C  CZ3   . TRP A 1 848 ? 17.700  20.714  45.859  1.00 27.99  ? 848  TRP A CZ3   1 
ATOM   6933 C  CH2   . TRP A 1 848 ? 17.199  21.889  45.265  1.00 28.49  ? 848  TRP A CH2   1 
ATOM   6934 N  N     . PRO A 1 849 ? 11.935  17.641  48.282  1.00 39.52  ? 849  PRO A N     1 
ATOM   6935 C  CA    . PRO A 1 849 ? 10.647  17.643  47.573  1.00 39.09  ? 849  PRO A CA    1 
ATOM   6936 C  C     . PRO A 1 849 ? 10.514  18.795  46.582  1.00 39.81  ? 849  PRO A C     1 
ATOM   6937 O  O     . PRO A 1 849 ? 10.913  19.922  46.876  1.00 40.47  ? 849  PRO A O     1 
ATOM   6938 C  CB    . PRO A 1 849 ? 9.628   17.777  48.702  1.00 40.18  ? 849  PRO A CB    1 
ATOM   6939 C  CG    . PRO A 1 849 ? 10.296  17.093  49.858  1.00 41.76  ? 849  PRO A CG    1 
ATOM   6940 C  CD    . PRO A 1 849 ? 11.751  17.486  49.739  1.00 39.94  ? 849  PRO A CD    1 
ATOM   6941 N  N     . SER A 1 850 ? 9.978   18.501  45.402  1.00 39.92  ? 850  SER A N     1 
ATOM   6942 C  CA    . SER A 1 850 ? 9.886   19.501  44.344  1.00 40.35  ? 850  SER A CA    1 
ATOM   6943 C  C     . SER A 1 850 ? 8.754   20.492  44.592  1.00 42.84  ? 850  SER A C     1 
ATOM   6944 O  O     . SER A 1 850 ? 7.832   20.221  45.368  1.00 42.31  ? 850  SER A O     1 
ATOM   6945 C  CB    . SER A 1 850 ? 9.753   18.836  42.972  1.00 39.12  ? 850  SER A CB    1 
ATOM   6946 O  OG    . SER A 1 850 ? 8.494   18.209  42.793  1.00 37.46  ? 850  SER A OG    1 
ATOM   6947 N  N     . GLY A 1 851 ? 8.850   21.647  43.938  1.00 46.92  ? 851  GLY A N     1 
ATOM   6948 C  CA    . GLY A 1 851 ? 7.874   22.731  44.075  1.00 50.25  ? 851  GLY A CA    1 
ATOM   6949 C  C     . GLY A 1 851 ? 8.131   23.602  45.287  1.00 54.17  ? 851  GLY A C     1 
ATOM   6950 O  O     . GLY A 1 851 ? 7.504   24.653  45.451  1.00 56.46  ? 851  GLY A O     1 
ATOM   6951 N  N     . THR A 1 852 ? 9.055   23.164  46.140  1.00 55.17  ? 852  THR A N     1 
ATOM   6952 C  CA    . THR A 1 852 ? 9.322   23.844  47.404  1.00 55.73  ? 852  THR A CA    1 
ATOM   6953 C  C     . THR A 1 852 ? 10.759  24.338  47.478  1.00 56.93  ? 852  THR A C     1 
ATOM   6954 O  O     . THR A 1 852 ? 11.673  23.768  46.858  1.00 54.79  ? 852  THR A O     1 
ATOM   6955 C  CB    . THR A 1 852 ? 9.059   22.936  48.634  1.00 52.19  ? 852  THR A CB    1 
ATOM   6956 O  OG1   . THR A 1 852 ? 10.023  21.883  48.653  1.00 52.66  ? 852  THR A OG1   1 
ATOM   6957 C  CG2   . THR A 1 852 ? 7.653   22.332  48.602  1.00 52.26  ? 852  THR A CG2   1 
ATOM   6958 N  N     . GLU A 1 853 ? 10.929  25.424  48.227  1.00 58.21  ? 853  GLU A N     1 
ATOM   6959 C  CA    . GLU A 1 853 ? 12.219  25.821  48.754  1.00 58.63  ? 853  GLU A CA    1 
ATOM   6960 C  C     . GLU A 1 853 ? 12.636  24.730  49.740  1.00 56.63  ? 853  GLU A C     1 
ATOM   6961 O  O     . GLU A 1 853 ? 11.816  24.220  50.510  1.00 53.35  ? 853  GLU A O     1 
ATOM   6962 C  CB    . GLU A 1 853 ? 12.107  27.170  49.482  1.00 62.27  ? 853  GLU A CB    1 
ATOM   6963 C  CG    . GLU A 1 853 ? 11.761  28.376  48.589  1.00 65.15  ? 853  GLU A CG    1 
ATOM   6964 C  CD    . GLU A 1 853 ? 12.981  28.990  47.896  1.00 68.67  ? 853  GLU A CD    1 
ATOM   6965 O  OE1   . GLU A 1 853 ? 14.120  28.813  48.388  1.00 67.67  ? 853  GLU A OE1   1 
ATOM   6966 O  OE2   . GLU A 1 853 ? 12.798  29.662  46.858  1.00 70.02  ? 853  GLU A OE2   1 
ATOM   6967 N  N     . ILE A 1 854 ? 13.905  24.356  49.690  1.00 55.20  ? 854  ILE A N     1 
ATOM   6968 C  CA    . ILE A 1 854 ? 14.449  23.392  50.627  1.00 55.97  ? 854  ILE A CA    1 
ATOM   6969 C  C     . ILE A 1 854 ? 14.432  24.008  52.040  1.00 56.32  ? 854  ILE A C     1 
ATOM   6970 O  O     . ILE A 1 854 ? 14.751  25.190  52.204  1.00 55.58  ? 854  ILE A O     1 
ATOM   6971 C  CB    . ILE A 1 854 ? 15.864  22.916  50.168  1.00 56.68  ? 854  ILE A CB    1 
ATOM   6972 C  CG1   . ILE A 1 854 ? 16.439  21.862  51.120  1.00 58.39  ? 854  ILE A CG1   1 
ATOM   6973 C  CG2   . ILE A 1 854 ? 16.816  24.103  49.962  1.00 58.26  ? 854  ILE A CG2   1 
ATOM   6974 C  CD1   . ILE A 1 854 ? 17.523  21.013  50.494  1.00 58.01  ? 854  ILE A CD1   1 
ATOM   6975 N  N     . THR A 1 855 ? 14.014  23.220  53.033  1.00 55.66  ? 855  THR A N     1 
ATOM   6976 C  CA    . THR A 1 855 ? 13.958  23.664  54.438  1.00 57.14  ? 855  THR A CA    1 
ATOM   6977 C  C     . THR A 1 855 ? 15.152  24.523  54.867  1.00 58.44  ? 855  THR A C     1 
ATOM   6978 O  O     . THR A 1 855 ? 16.304  24.198  54.566  1.00 57.13  ? 855  THR A O     1 
ATOM   6979 C  CB    . THR A 1 855 ? 13.773  22.474  55.427  1.00 56.99  ? 855  THR A CB    1 
ATOM   6980 O  OG1   . THR A 1 855 ? 13.862  22.948  56.778  1.00 57.83  ? 855  THR A OG1   1 
ATOM   6981 C  CG2   . THR A 1 855 ? 14.816  21.382  55.204  1.00 55.01  ? 855  THR A CG2   1 
ATOM   6982 N  N     . ASP A 1 856 ? 14.857  25.620  55.566  1.00 61.69  ? 856  ASP A N     1 
ATOM   6983 C  CA    . ASP A 1 856 ? 15.866  26.599  56.008  1.00 65.87  ? 856  ASP A CA    1 
ATOM   6984 C  C     . ASP A 1 856 ? 17.036  25.975  56.779  1.00 67.71  ? 856  ASP A C     1 
ATOM   6985 O  O     . ASP A 1 856 ? 18.151  26.518  56.782  1.00 67.17  ? 856  ASP A O     1 
ATOM   6986 C  CB    . ASP A 1 856 ? 15.215  27.716  56.841  1.00 68.96  ? 856  ASP A CB    1 
ATOM   6987 C  CG    . ASP A 1 856 ? 14.544  28.788  55.979  1.00 71.88  ? 856  ASP A CG    1 
ATOM   6988 O  OD1   . ASP A 1 856 ? 13.344  29.067  56.198  1.00 73.96  ? 856  ASP A OD1   1 
ATOM   6989 O  OD2   . ASP A 1 856 ? 15.214  29.356  55.087  1.00 73.93  ? 856  ASP A OD2   1 
ATOM   6990 N  N     . LEU A 1 857 ? 16.770  24.834  57.418  1.00 69.45  ? 857  LEU A N     1 
ATOM   6991 C  CA    . LEU A 1 857 ? 17.796  24.043  58.108  1.00 71.99  ? 857  LEU A CA    1 
ATOM   6992 C  C     . LEU A 1 857 ? 19.075  23.850  57.282  1.00 71.38  ? 857  LEU A C     1 
ATOM   6993 O  O     . LEU A 1 857 ? 20.187  24.034  57.787  1.00 74.15  ? 857  LEU A O     1 
ATOM   6994 C  CB    . LEU A 1 857 ? 17.235  22.665  58.503  1.00 72.75  ? 857  LEU A CB    1 
ATOM   6995 C  CG    . LEU A 1 857 ? 16.256  22.519  59.677  1.00 74.64  ? 857  LEU A CG    1 
ATOM   6996 C  CD1   . LEU A 1 857 ? 15.693  21.103  59.717  1.00 73.40  ? 857  LEU A CD1   1 
ATOM   6997 C  CD2   . LEU A 1 857 ? 16.911  22.872  61.010  1.00 75.91  ? 857  LEU A CD2   1 
ATOM   6998 N  N     . ILE A 1 858 ? 18.909  23.489  56.012  1.00 67.60  ? 858  ILE A N     1 
ATOM   6999 C  CA    . ILE A 1 858 ? 20.036  23.072  55.182  1.00 65.37  ? 858  ILE A CA    1 
ATOM   7000 C  C     . ILE A 1 858 ? 20.250  23.938  53.932  1.00 62.04  ? 858  ILE A C     1 
ATOM   7001 O  O     . ILE A 1 858 ? 21.260  23.792  53.235  1.00 60.33  ? 858  ILE A O     1 
ATOM   7002 C  CB    . ILE A 1 858 ? 19.918  21.572  54.803  1.00 65.26  ? 858  ILE A CB    1 
ATOM   7003 C  CG1   . ILE A 1 858 ? 18.530  21.268  54.227  1.00 63.86  ? 858  ILE A CG1   1 
ATOM   7004 C  CG2   . ILE A 1 858 ? 20.221  20.696  56.030  1.00 68.26  ? 858  ILE A CG2   1 
ATOM   7005 C  CD1   . ILE A 1 858 ? 18.302  19.820  53.866  1.00 65.27  ? 858  ILE A CD1   1 
ATOM   7006 N  N     . LYS A 1 859 ? 19.310  24.844  53.667  1.00 59.65  ? 859  LYS A N     1 
ATOM   7007 C  CA    . LYS A 1 859 ? 19.372  25.707  52.483  1.00 57.70  ? 859  LYS A CA    1 
ATOM   7008 C  C     . LYS A 1 859 ? 20.742  26.366  52.312  1.00 56.26  ? 859  LYS A C     1 
ATOM   7009 O  O     . LYS A 1 859 ? 21.351  26.266  51.244  1.00 54.25  ? 859  LYS A O     1 
ATOM   7010 C  CB    . LYS A 1 859 ? 18.261  26.768  52.509  1.00 57.99  ? 859  LYS A CB    1 
ATOM   7011 C  CG    . LYS A 1 859 ? 18.251  27.667  51.280  1.00 56.48  ? 859  LYS A CG    1 
ATOM   7012 C  CD    . LYS A 1 859 ? 17.132  28.682  51.323  1.00 59.00  ? 859  LYS A CD    1 
ATOM   7013 C  CE    . LYS A 1 859 ? 17.262  29.658  50.165  1.00 62.18  ? 859  LYS A CE    1 
ATOM   7014 N  NZ    . LYS A 1 859 ? 15.976  30.338  49.856  1.00 65.16  ? 859  LYS A NZ    1 
ATOM   7015 N  N     . ASP A 1 860 ? 21.215  27.016  53.373  1.00 55.81  ? 860  ASP A N     1 
ATOM   7016 C  CA    . ASP A 1 860 ? 22.487  27.734  53.365  1.00 56.69  ? 860  ASP A CA    1 
ATOM   7017 C  C     . ASP A 1 860 ? 23.662  26.856  52.957  1.00 54.42  ? 860  ASP A C     1 
ATOM   7018 O  O     . ASP A 1 860 ? 24.513  27.281  52.177  1.00 54.05  ? 860  ASP A O     1 
ATOM   7019 C  CB    . ASP A 1 860 ? 22.750  28.383  54.733  1.00 60.17  ? 860  ASP A CB    1 
ATOM   7020 C  CG    . ASP A 1 860 ? 21.926  29.647  54.948  1.00 66.02  ? 860  ASP A CG    1 
ATOM   7021 O  OD1   . ASP A 1 860 ? 21.496  30.258  53.942  1.00 68.15  ? 860  ASP A OD1   1 
ATOM   7022 O  OD2   . ASP A 1 860 ? 21.707  30.034  56.120  1.00 70.63  ? 860  ASP A OD2   1 
ATOM   7023 N  N     . ASP A 1 861 ? 23.693  25.634  53.476  1.00 54.08  ? 861  ASP A N     1 
ATOM   7024 C  CA    . ASP A 1 861 ? 24.769  24.692  53.182  1.00 55.17  ? 861  ASP A CA    1 
ATOM   7025 C  C     . ASP A 1 861 ? 24.662  24.113  51.776  1.00 53.38  ? 861  ASP A C     1 
ATOM   7026 O  O     . ASP A 1 861 ? 25.672  23.834  51.140  1.00 53.04  ? 861  ASP A O     1 
ATOM   7027 C  CB    . ASP A 1 861 ? 24.793  23.564  54.212  1.00 56.53  ? 861  ASP A CB    1 
ATOM   7028 C  CG    . ASP A 1 861 ? 25.217  24.040  55.588  1.00 61.11  ? 861  ASP A CG    1 
ATOM   7029 O  OD1   . ASP A 1 861 ? 24.436  23.850  56.550  1.00 63.27  ? 861  ASP A OD1   1 
ATOM   7030 O  OD2   . ASP A 1 861 ? 26.328  24.605  55.707  1.00 61.24  ? 861  ASP A OD2   1 
ATOM   7031 N  N     . VAL A 1 862 ? 23.436  23.931  51.298  1.00 52.60  ? 862  VAL A N     1 
ATOM   7032 C  CA    . VAL A 1 862 ? 23.219  23.440  49.943  1.00 50.39  ? 862  VAL A CA    1 
ATOM   7033 C  C     . VAL A 1 862 ? 23.756  24.466  48.947  1.00 51.02  ? 862  VAL A C     1 
ATOM   7034 O  O     . VAL A 1 862 ? 24.550  24.124  48.065  1.00 50.22  ? 862  VAL A O     1 
ATOM   7035 C  CB    . VAL A 1 862 ? 21.724  23.097  49.688  1.00 49.39  ? 862  VAL A CB    1 
ATOM   7036 C  CG1   . VAL A 1 862 ? 21.431  22.961  48.204  1.00 47.84  ? 862  VAL A CG1   1 
ATOM   7037 C  CG2   . VAL A 1 862 ? 21.348  21.811  50.422  1.00 47.52  ? 862  VAL A CG2   1 
ATOM   7038 N  N     . LEU A 1 863 ? 23.363  25.725  49.126  1.00 51.76  ? 863  LEU A N     1 
ATOM   7039 C  CA    . LEU A 1 863 ? 23.737  26.799  48.196  1.00 53.72  ? 863  LEU A CA    1 
ATOM   7040 C  C     . LEU A 1 863 ? 25.235  27.063  48.195  1.00 52.83  ? 863  LEU A C     1 
ATOM   7041 O  O     . LEU A 1 863 ? 25.787  27.554  47.207  1.00 52.69  ? 863  LEU A O     1 
ATOM   7042 C  CB    . LEU A 1 863 ? 22.982  28.108  48.504  1.00 55.27  ? 863  LEU A CB    1 
ATOM   7043 C  CG    . LEU A 1 863 ? 21.445  28.180  48.564  1.00 57.02  ? 863  LEU A CG    1 
ATOM   7044 C  CD1   . LEU A 1 863 ? 20.954  29.569  48.151  1.00 57.77  ? 863  LEU A CD1   1 
ATOM   7045 C  CD2   . LEU A 1 863 ? 20.770  27.118  47.714  1.00 56.34  ? 863  LEU A CD2   1 
ATOM   7046 N  N     . HIS A 1 864 ? 25.878  26.740  49.310  1.00 51.74  ? 864  HIS A N     1 
ATOM   7047 C  CA    . HIS A 1 864 ? 27.302  26.968  49.478  1.00 53.50  ? 864  HIS A CA    1 
ATOM   7048 C  C     . HIS A 1 864 ? 28.113  25.806  48.908  1.00 51.10  ? 864  HIS A C     1 
ATOM   7049 O  O     . HIS A 1 864 ? 29.209  26.012  48.394  1.00 51.08  ? 864  HIS A O     1 
ATOM   7050 C  CB    . HIS A 1 864 ? 27.629  27.184  50.961  1.00 56.11  ? 864  HIS A CB    1 
ATOM   7051 C  CG    . HIS A 1 864 ? 29.053  27.565  51.222  1.00 60.85  ? 864  HIS A CG    1 
ATOM   7052 N  ND1   . HIS A 1 864 ? 30.035  26.636  51.497  1.00 62.46  ? 864  HIS A ND1   1 
ATOM   7053 C  CD2   . HIS A 1 864 ? 29.660  28.775  51.258  1.00 64.48  ? 864  HIS A CD2   1 
ATOM   7054 C  CE1   . HIS A 1 864 ? 31.185  27.257  51.687  1.00 66.37  ? 864  HIS A CE1   1 
ATOM   7055 N  NE2   . HIS A 1 864 ? 30.984  28.556  51.550  1.00 67.73  ? 864  HIS A NE2   1 
ATOM   7056 N  N     . TRP A 1 865 ? 27.565  24.594  48.995  1.00 49.02  ? 865  TRP A N     1 
ATOM   7057 C  CA    . TRP A 1 865 ? 28.260  23.390  48.525  1.00 47.99  ? 865  TRP A CA    1 
ATOM   7058 C  C     . TRP A 1 865 ? 27.763  22.849  47.176  1.00 46.16  ? 865  TRP A C     1 
ATOM   7059 O  O     . TRP A 1 865 ? 28.177  21.771  46.748  1.00 46.68  ? 865  TRP A O     1 
ATOM   7060 C  CB    . TRP A 1 865 ? 28.231  22.305  49.607  1.00 48.08  ? 865  TRP A CB    1 
ATOM   7061 C  CG    . TRP A 1 865 ? 29.134  22.626  50.761  1.00 47.65  ? 865  TRP A CG    1 
ATOM   7062 C  CD1   . TRP A 1 865 ? 28.786  23.235  51.941  1.00 47.23  ? 865  TRP A CD1   1 
ATOM   7063 C  CD2   . TRP A 1 865 ? 30.541  22.380  50.836  1.00 47.38  ? 865  TRP A CD2   1 
ATOM   7064 N  NE1   . TRP A 1 865 ? 29.890  23.372  52.745  1.00 48.48  ? 865  TRP A NE1   1 
ATOM   7065 C  CE2   . TRP A 1 865 ? 30.982  22.859  52.094  1.00 49.04  ? 865  TRP A CE2   1 
ATOM   7066 C  CE3   . TRP A 1 865 ? 31.475  21.801  49.964  1.00 46.78  ? 865  TRP A CE3   1 
ATOM   7067 C  CZ2   . TRP A 1 865 ? 32.319  22.771  52.504  1.00 46.98  ? 865  TRP A CZ2   1 
ATOM   7068 C  CZ3   . TRP A 1 865 ? 32.799  21.710  50.371  1.00 45.85  ? 865  TRP A CZ3   1 
ATOM   7069 C  CH2   . TRP A 1 865 ? 33.209  22.199  51.635  1.00 46.68  ? 865  TRP A CH2   1 
ATOM   7070 N  N     . MET A 1 866 ? 26.880  23.602  46.519  1.00 45.85  ? 866  MET A N     1 
ATOM   7071 C  CA    . MET A 1 866 ? 26.382  23.282  45.179  1.00 43.88  ? 866  MET A CA    1 
ATOM   7072 C  C     . MET A 1 866 ? 27.518  23.192  44.179  1.00 42.24  ? 866  MET A C     1 
ATOM   7073 O  O     . MET A 1 866 ? 28.330  24.116  44.079  1.00 42.46  ? 866  MET A O     1 
ATOM   7074 C  CB    . MET A 1 866 ? 25.483  24.408  44.682  1.00 44.88  ? 866  MET A CB    1 
ATOM   7075 C  CG    . MET A 1 866 ? 24.036  24.331  45.036  1.00 44.86  ? 866  MET A CG    1 
ATOM   7076 S  SD    . MET A 1 866 ? 23.295  25.802  44.328  1.00 43.66  ? 866  MET A SD    1 
ATOM   7077 C  CE    . MET A 1 866 ? 23.180  25.316  42.609  1.00 45.14  ? 866  MET A CE    1 
ATOM   7078 N  N     . ASP A 1 867 ? 27.550  22.102  43.414  1.00 40.47  ? 867  ASP A N     1 
ATOM   7079 C  CA    . ASP A 1 867 ? 28.595  21.908  42.408  1.00 39.15  ? 867  ASP A CA    1 
ATOM   7080 C  C     . ASP A 1 867 ? 28.130  22.390  41.040  1.00 36.44  ? 867  ASP A C     1 
ATOM   7081 O  O     . ASP A 1 867 ? 27.523  21.633  40.284  1.00 33.94  ? 867  ASP A O     1 
ATOM   7082 C  CB    . ASP A 1 867 ? 29.039  20.442  42.343  1.00 36.98  ? 867  ASP A CB    1 
ATOM   7083 C  CG    . ASP A 1 867 ? 30.392  20.270  41.674  1.00 38.53  ? 867  ASP A CG    1 
ATOM   7084 O  OD1   . ASP A 1 867 ? 30.732  21.055  40.762  1.00 39.60  ? 867  ASP A OD1   1 
ATOM   7085 O  OD2   . ASP A 1 867 ? 31.126  19.339  42.058  1.00 38.65  ? 867  ASP A OD2   1 
ATOM   7086 N  N     . TYR A 1 868 ? 28.422  23.656  40.749  1.00 36.36  ? 868  TYR A N     1 
ATOM   7087 C  CA    . TYR A 1 868 ? 28.047  24.301  39.495  1.00 36.23  ? 868  TYR A CA    1 
ATOM   7088 C  C     . TYR A 1 868 ? 28.751  23.698  38.296  1.00 36.54  ? 868  TYR A C     1 
ATOM   7089 O  O     . TYR A 1 868 ? 28.154  23.585  37.233  1.00 36.45  ? 868  TYR A O     1 
ATOM   7090 C  CB    . TYR A 1 868 ? 28.368  25.796  39.536  1.00 37.14  ? 868  TYR A CB    1 
ATOM   7091 C  CG    . TYR A 1 868 ? 27.487  26.628  40.440  1.00 38.98  ? 868  TYR A CG    1 
ATOM   7092 C  CD1   . TYR A 1 868 ? 26.283  27.157  39.979  1.00 39.34  ? 868  TYR A CD1   1 
ATOM   7093 C  CD2   . TYR A 1 868 ? 27.880  26.921  41.745  1.00 43.55  ? 868  TYR A CD2   1 
ATOM   7094 C  CE1   . TYR A 1 868 ? 25.475  27.937  40.807  1.00 41.61  ? 868  TYR A CE1   1 
ATOM   7095 C  CE2   . TYR A 1 868 ? 27.081  27.706  42.581  1.00 44.98  ? 868  TYR A CE2   1 
ATOM   7096 C  CZ    . TYR A 1 868 ? 25.884  28.207  42.105  1.00 42.88  ? 868  TYR A CZ    1 
ATOM   7097 O  OH    . TYR A 1 868 ? 25.100  28.973  42.930  1.00 47.01  ? 868  TYR A OH    1 
ATOM   7098 N  N     . THR A 1 869 ? 30.023  23.331  38.463  1.00 38.10  ? 869  THR A N     1 
ATOM   7099 C  CA    . THR A 1 869 ? 30.816  22.749  37.376  1.00 36.18  ? 869  THR A CA    1 
ATOM   7100 C  C     . THR A 1 869 ? 30.197  21.435  36.898  1.00 35.36  ? 869  THR A C     1 
ATOM   7101 O  O     . THR A 1 869 ? 29.967  21.251  35.702  1.00 34.82  ? 869  THR A O     1 
ATOM   7102 C  CB    . THR A 1 869 ? 32.290  22.527  37.795  1.00 37.66  ? 869  THR A CB    1 
ATOM   7103 O  OG1   . THR A 1 869 ? 32.850  23.758  38.276  1.00 40.14  ? 869  THR A OG1   1 
ATOM   7104 C  CG2   . THR A 1 869 ? 33.123  22.024  36.614  1.00 34.30  ? 869  THR A CG2   1 
ATOM   7105 N  N     . VAL A 1 870 ? 29.918  20.534  37.838  1.00 35.77  ? 870  VAL A N     1 
ATOM   7106 C  CA    . VAL A 1 870 ? 29.254  19.274  37.515  1.00 38.27  ? 870  VAL A CA    1 
ATOM   7107 C  C     . VAL A 1 870 ? 27.904  19.574  36.866  1.00 40.19  ? 870  VAL A C     1 
ATOM   7108 O  O     . VAL A 1 870 ? 27.534  18.982  35.845  1.00 39.70  ? 870  VAL A O     1 
ATOM   7109 C  CB    . VAL A 1 870 ? 29.075  18.391  38.768  1.00 38.65  ? 870  VAL A CB    1 
ATOM   7110 C  CG1   . VAL A 1 870 ? 28.103  17.250  38.493  1.00 38.03  ? 870  VAL A CG1   1 
ATOM   7111 C  CG2   . VAL A 1 870 ? 30.429  17.838  39.224  1.00 39.44  ? 870  VAL A CG2   1 
ATOM   7112 N  N     . LEU A 1 871 ? 27.195  20.529  37.456  1.00 40.36  ? 871  LEU A N     1 
ATOM   7113 C  CA    . LEU A 1 871 ? 25.890  20.932  36.988  1.00 41.20  ? 871  LEU A CA    1 
ATOM   7114 C  C     . LEU A 1 871 ? 25.970  21.411  35.540  1.00 40.77  ? 871  LEU A C     1 
ATOM   7115 O  O     . LEU A 1 871 ? 25.176  21.002  34.699  1.00 42.13  ? 871  LEU A O     1 
ATOM   7116 C  CB    . LEU A 1 871 ? 25.370  22.050  37.886  1.00 44.04  ? 871  LEU A CB    1 
ATOM   7117 C  CG    . LEU A 1 871 ? 23.874  22.185  38.122  1.00 46.98  ? 871  LEU A CG    1 
ATOM   7118 C  CD1   . LEU A 1 871 ? 23.664  23.146  39.279  1.00 49.08  ? 871  LEU A CD1   1 
ATOM   7119 C  CD2   . LEU A 1 871 ? 23.145  22.664  36.854  1.00 50.31  ? 871  LEU A CD2   1 
ATOM   7120 N  N     . LEU A 1 872 ? 26.940  22.269  35.255  1.00 40.81  ? 872  LEU A N     1 
ATOM   7121 C  CA    . LEU A 1 872 ? 27.116  22.798  33.917  1.00 42.88  ? 872  LEU A CA    1 
ATOM   7122 C  C     . LEU A 1 872 ? 27.465  21.696  32.919  1.00 44.02  ? 872  LEU A C     1 
ATOM   7123 O  O     . LEU A 1 872 ? 26.898  21.652  31.826  1.00 45.67  ? 872  LEU A O     1 
ATOM   7124 C  CB    . LEU A 1 872 ? 28.178  23.900  33.894  1.00 40.79  ? 872  LEU A CB    1 
ATOM   7125 C  CG    . LEU A 1 872 ? 28.356  24.588  32.538  1.00 45.57  ? 872  LEU A CG    1 
ATOM   7126 C  CD1   . LEU A 1 872 ? 27.070  25.318  32.133  1.00 45.65  ? 872  LEU A CD1   1 
ATOM   7127 C  CD2   . LEU A 1 872 ? 29.549  25.534  32.543  1.00 47.29  ? 872  LEU A CD2   1 
ATOM   7128 N  N     . GLU A 1 873 ? 28.388  20.814  33.298  1.00 44.47  ? 873  GLU A N     1 
ATOM   7129 C  CA    . GLU A 1 873 ? 28.821  19.726  32.417  1.00 45.46  ? 873  GLU A CA    1 
ATOM   7130 C  C     . GLU A 1 873 ? 27.722  18.724  32.095  1.00 44.16  ? 873  GLU A C     1 
ATOM   7131 O  O     . GLU A 1 873 ? 27.514  18.377  30.933  1.00 44.38  ? 873  GLU A O     1 
ATOM   7132 C  CB    . GLU A 1 873 ? 30.033  18.992  33.000  1.00 46.40  ? 873  GLU A CB    1 
ATOM   7133 C  CG    . GLU A 1 873 ? 31.352  19.708  32.776  1.00 52.08  ? 873  GLU A CG    1 
ATOM   7134 C  CD    . GLU A 1 873 ? 31.652  19.965  31.305  1.00 56.50  ? 873  GLU A CD    1 
ATOM   7135 O  OE1   . GLU A 1 873 ? 32.374  20.952  31.014  1.00 55.40  ? 873  GLU A OE1   1 
ATOM   7136 O  OE2   . GLU A 1 873 ? 31.163  19.181  30.448  1.00 55.91  ? 873  GLU A OE2   1 
ATOM   7137 N  N     . LYS A 1 874 ? 27.021  18.268  33.126  1.00 43.65  ? 874  LYS A N     1 
ATOM   7138 C  CA    . LYS A 1 874 ? 26.056  17.189  32.973  1.00 43.80  ? 874  LYS A CA    1 
ATOM   7139 C  C     . LYS A 1 874 ? 24.791  17.566  32.205  1.00 43.54  ? 874  LYS A C     1 
ATOM   7140 O  O     . LYS A 1 874 ? 24.372  16.832  31.305  1.00 44.97  ? 874  LYS A O     1 
ATOM   7141 C  CB    . LYS A 1 874 ? 25.710  16.575  34.336  1.00 43.83  ? 874  LYS A CB    1 
ATOM   7142 C  CG    . LYS A 1 874 ? 26.431  15.259  34.597  1.00 46.11  ? 874  LYS A CG    1 
ATOM   7143 C  CD    . LYS A 1 874 ? 26.600  14.953  36.076  1.00 48.26  ? 874  LYS A CD    1 
ATOM   7144 C  CE    . LYS A 1 874 ? 25.272  14.903  36.814  1.00 48.22  ? 874  LYS A CE    1 
ATOM   7145 N  NZ    . LYS A 1 874 ? 25.456  14.421  38.210  1.00 48.30  ? 874  LYS A NZ    1 
ATOM   7146 N  N     . THR A 1 875 ? 24.196  18.705  32.548  1.00 41.77  ? 875  THR A N     1 
ATOM   7147 C  CA    . THR A 1 875 ? 22.862  19.045  32.046  1.00 39.70  ? 875  THR A CA    1 
ATOM   7148 C  C     . THR A 1 875 ? 22.875  19.982  30.840  1.00 38.62  ? 875  THR A C     1 
ATOM   7149 O  O     . THR A 1 875 ? 21.892  20.060  30.097  1.00 38.65  ? 875  THR A O     1 
ATOM   7150 C  CB    . THR A 1 875 ? 21.977  19.684  33.153  1.00 39.24  ? 875  THR A CB    1 
ATOM   7151 O  OG1   . THR A 1 875 ? 22.475  20.989  33.465  1.00 36.32  ? 875  THR A OG1   1 
ATOM   7152 C  CG2   . THR A 1 875 ? 21.966  18.831  34.416  1.00 37.91  ? 875  THR A CG2   1 
ATOM   7153 N  N     . PHE A 1 876 ? 23.978  20.696  30.651  1.00 38.26  ? 876  PHE A N     1 
ATOM   7154 C  CA    . PHE A 1 876 ? 24.043  21.702  29.603  1.00 38.21  ? 876  PHE A CA    1 
ATOM   7155 C  C     . PHE A 1 876 ? 25.059  21.357  28.524  1.00 39.82  ? 876  PHE A C     1 
ATOM   7156 O  O     . PHE A 1 876 ? 24.684  21.192  27.363  1.00 41.94  ? 876  PHE A O     1 
ATOM   7157 C  CB    . PHE A 1 876 ? 24.298  23.097  30.186  1.00 36.62  ? 876  PHE A CB    1 
ATOM   7158 C  CG    . PHE A 1 876 ? 24.336  24.184  29.156  1.00 32.91  ? 876  PHE A CG    1 
ATOM   7159 C  CD1   . PHE A 1 876 ? 23.166  24.635  28.560  1.00 31.28  ? 876  PHE A CD1   1 
ATOM   7160 C  CD2   . PHE A 1 876 ? 25.542  24.763  28.786  1.00 32.42  ? 876  PHE A CD2   1 
ATOM   7161 C  CE1   . PHE A 1 876 ? 23.203  25.641  27.590  1.00 34.41  ? 876  PHE A CE1   1 
ATOM   7162 C  CE2   . PHE A 1 876 ? 25.589  25.768  27.823  1.00 33.68  ? 876  PHE A CE2   1 
ATOM   7163 C  CZ    . PHE A 1 876 ? 24.416  26.211  27.227  1.00 33.73  ? 876  PHE A CZ    1 
ATOM   7164 N  N     . ILE A 1 877 ? 26.332  21.236  28.901  1.00 40.94  ? 877  ILE A N     1 
ATOM   7165 C  CA    . ILE A 1 877 ? 27.397  21.067  27.910  1.00 40.78  ? 877  ILE A CA    1 
ATOM   7166 C  C     . ILE A 1 877 ? 27.302  19.758  27.132  1.00 40.95  ? 877  ILE A C     1 
ATOM   7167 O  O     . ILE A 1 877 ? 27.388  19.762  25.897  1.00 42.38  ? 877  ILE A O     1 
ATOM   7168 C  CB    . ILE A 1 877 ? 28.804  21.269  28.507  1.00 42.20  ? 877  ILE A CB    1 
ATOM   7169 C  CG1   . ILE A 1 877 ? 28.930  22.697  29.046  1.00 42.09  ? 877  ILE A CG1   1 
ATOM   7170 C  CG2   . ILE A 1 877 ? 29.891  20.993  27.438  1.00 40.97  ? 877  ILE A CG2   1 
ATOM   7171 C  CD1   . ILE A 1 877 ? 30.343  23.092  29.460  1.00 46.96  ? 877  ILE A CD1   1 
ATOM   7172 N  N     . LYS A 1 878 ? 27.108  18.649  27.839  1.00 39.87  ? 878  LYS A N     1 
ATOM   7173 C  CA    . LYS A 1 878 ? 26.990  17.354  27.174  1.00 41.89  ? 878  LYS A CA    1 
ATOM   7174 C  C     . LYS A 1 878 ? 25.833  17.303  26.160  1.00 40.11  ? 878  LYS A C     1 
ATOM   7175 O  O     . LYS A 1 878 ? 26.063  16.938  25.011  1.00 40.97  ? 878  LYS A O     1 
ATOM   7176 C  CB    . LYS A 1 878 ? 26.939  16.186  28.172  1.00 44.86  ? 878  LYS A CB    1 
ATOM   7177 C  CG    . LYS A 1 878 ? 27.295  14.854  27.526  1.00 51.25  ? 878  LYS A CG    1 
ATOM   7178 C  CD    . LYS A 1 878 ? 27.298  13.682  28.504  1.00 59.54  ? 878  LYS A CD    1 
ATOM   7179 C  CE    . LYS A 1 878 ? 27.438  12.352  27.741  1.00 62.74  ? 878  LYS A CE    1 
ATOM   7180 N  NZ    . LYS A 1 878 ? 27.476  11.164  28.644  1.00 65.73  ? 878  LYS A NZ    1 
ATOM   7181 N  N     . PRO A 1 879 ? 24.602  17.691  26.563  1.00 39.24  ? 879  PRO A N     1 
ATOM   7182 C  CA    . PRO A 1 879 ? 23.546  17.763  25.551  1.00 39.09  ? 879  PRO A CA    1 
ATOM   7183 C  C     . PRO A 1 879 ? 23.878  18.698  24.391  1.00 37.99  ? 879  PRO A C     1 
ATOM   7184 O  O     . PRO A 1 879 ? 23.650  18.329  23.249  1.00 37.31  ? 879  PRO A O     1 
ATOM   7185 C  CB    . PRO A 1 879 ? 22.343  18.299  26.333  1.00 40.31  ? 879  PRO A CB    1 
ATOM   7186 C  CG    . PRO A 1 879 ? 22.600  17.870  27.729  1.00 40.28  ? 879  PRO A CG    1 
ATOM   7187 C  CD    . PRO A 1 879 ? 24.076  18.019  27.903  1.00 38.85  ? 879  PRO A CD    1 
ATOM   7188 N  N     . LEU A 1 880 ? 24.424  19.881  24.674  1.00 38.85  ? 880  LEU A N     1 
ATOM   7189 C  CA    . LEU A 1 880 ? 24.797  20.815  23.603  1.00 38.74  ? 880  LEU A CA    1 
ATOM   7190 C  C     . LEU A 1 880 ? 25.823  20.206  22.629  1.00 39.32  ? 880  LEU A C     1 
ATOM   7191 O  O     . LEU A 1 880 ? 25.681  20.329  21.402  1.00 38.78  ? 880  LEU A O     1 
ATOM   7192 C  CB    . LEU A 1 880 ? 25.292  22.152  24.169  1.00 37.19  ? 880  LEU A CB    1 
ATOM   7193 C  CG    . LEU A 1 880 ? 25.605  23.236  23.127  1.00 38.45  ? 880  LEU A CG    1 
ATOM   7194 C  CD1   . LEU A 1 880 ? 24.395  23.496  22.237  1.00 39.56  ? 880  LEU A CD1   1 
ATOM   7195 C  CD2   . LEU A 1 880 ? 26.064  24.524  23.776  1.00 35.35  ? 880  LEU A CD2   1 
ATOM   7196 N  N     . GLU A 1 881 ? 26.837  19.541  23.181  1.00 40.23  ? 881  GLU A N     1 
ATOM   7197 C  CA    . GLU A 1 881 ? 27.841  18.839  22.374  1.00 41.76  ? 881  GLU A CA    1 
ATOM   7198 C  C     . GLU A 1 881 ? 27.169  17.804  21.479  1.00 39.90  ? 881  GLU A C     1 
ATOM   7199 O  O     . GLU A 1 881 ? 27.543  17.645  20.314  1.00 39.36  ? 881  GLU A O     1 
ATOM   7200 C  CB    . GLU A 1 881 ? 28.891  18.179  23.267  1.00 44.76  ? 881  GLU A CB    1 
ATOM   7201 C  CG    . GLU A 1 881 ? 30.198  17.877  22.560  1.00 54.97  ? 881  GLU A CG    1 
ATOM   7202 C  CD    . GLU A 1 881 ? 31.416  18.182  23.420  1.00 65.56  ? 881  GLU A CD    1 
ATOM   7203 O  OE1   . GLU A 1 881 ? 32.355  18.825  22.895  1.00 70.63  ? 881  GLU A OE1   1 
ATOM   7204 O  OE2   . GLU A 1 881 ? 31.438  17.794  24.616  1.00 65.98  ? 881  GLU A OE2   1 
ATOM   7205 N  N     . GLY A 1 882 ? 26.165  17.120  22.031  1.00 37.52  ? 882  GLY A N     1 
ATOM   7206 C  CA    . GLY A 1 882 ? 25.330  16.199  21.271  1.00 35.14  ? 882  GLY A CA    1 
ATOM   7207 C  C     . GLY A 1 882 ? 24.655  16.871  20.084  1.00 35.30  ? 882  GLY A C     1 
ATOM   7208 O  O     . GLY A 1 882 ? 24.692  16.340  18.968  1.00 36.98  ? 882  GLY A O     1 
ATOM   7209 N  N     . PHE A 1 883 ? 24.047  18.037  20.313  1.00 33.60  ? 883  PHE A N     1 
ATOM   7210 C  CA    . PHE A 1 883 ? 23.346  18.756  19.245  1.00 33.66  ? 883  PHE A CA    1 
ATOM   7211 C  C     . PHE A 1 883 ? 24.321  19.158  18.163  1.00 34.39  ? 883  PHE A C     1 
ATOM   7212 O  O     . PHE A 1 883 ? 24.119  18.851  16.986  1.00 37.32  ? 883  PHE A O     1 
ATOM   7213 C  CB    . PHE A 1 883 ? 22.646  20.035  19.739  1.00 30.28  ? 883  PHE A CB    1 
ATOM   7214 C  CG    . PHE A 1 883 ? 21.727  19.837  20.909  1.00 28.88  ? 883  PHE A CG    1 
ATOM   7215 C  CD1   . PHE A 1 883 ? 21.250  18.570  21.256  1.00 26.36  ? 883  PHE A CD1   1 
ATOM   7216 C  CD2   . PHE A 1 883 ? 21.302  20.937  21.646  1.00 27.21  ? 883  PHE A CD2   1 
ATOM   7217 C  CE1   . PHE A 1 883 ? 20.395  18.397  22.336  1.00 20.40  ? 883  PHE A CE1   1 
ATOM   7218 C  CE2   . PHE A 1 883 ? 20.440  20.774  22.725  1.00 30.46  ? 883  PHE A CE2   1 
ATOM   7219 C  CZ    . PHE A 1 883 ? 19.991  19.493  23.079  1.00 23.18  ? 883  PHE A CZ    1 
ATOM   7220 N  N     . THR A 1 884 ? 25.381  19.841  18.587  1.00 33.11  ? 884  THR A N     1 
ATOM   7221 C  CA    . THR A 1 884 ? 26.306  20.504  17.683  1.00 31.58  ? 884  THR A CA    1 
ATOM   7222 C  C     . THR A 1 884 ? 27.080  19.520  16.821  1.00 34.82  ? 884  THR A C     1 
ATOM   7223 O  O     . THR A 1 884 ? 27.272  19.777  15.632  1.00 38.14  ? 884  THR A O     1 
ATOM   7224 C  CB    . THR A 1 884 ? 27.281  21.437  18.436  1.00 31.20  ? 884  THR A CB    1 
ATOM   7225 O  OG1   . THR A 1 884 ? 27.954  20.702  19.465  1.00 30.74  ? 884  THR A OG1   1 
ATOM   7226 C  CG2   . THR A 1 884 ? 26.527  22.596  19.074  1.00 26.78  ? 884  THR A CG2   1 
ATOM   7227 N  N     . SER A 1 885 ? 27.512  18.401  17.402  1.00 33.73  ? 885  SER A N     1 
ATOM   7228 C  CA    . SER A 1 885 ? 28.224  17.382  16.630  1.00 36.91  ? 885  SER A CA    1 
ATOM   7229 C  C     . SER A 1 885 ? 27.291  16.716  15.614  1.00 37.86  ? 885  SER A C     1 
ATOM   7230 O  O     . SER A 1 885 ? 27.668  16.538  14.463  1.00 37.69  ? 885  SER A O     1 
ATOM   7231 C  CB    . SER A 1 885 ? 28.929  16.349  17.522  1.00 38.62  ? 885  SER A CB    1 
ATOM   7232 O  OG    . SER A 1 885 ? 28.022  15.658  18.359  1.00 41.59  ? 885  SER A OG    1 
ATOM   7233 N  N     . ALA A 1 886 ? 26.067  16.392  16.028  1.00 35.98  ? 886  ALA A N     1 
ATOM   7234 C  CA    . ALA A 1 886 ? 25.059  15.905  15.084  1.00 37.07  ? 886  ALA A CA    1 
ATOM   7235 C  C     . ALA A 1 886 ? 24.868  16.897  13.936  1.00 37.15  ? 886  ALA A C     1 
ATOM   7236 O  O     . ALA A 1 886 ? 24.742  16.497  12.776  1.00 38.50  ? 886  ALA A O     1 
ATOM   7237 C  CB    . ALA A 1 886 ? 23.728  15.638  15.787  1.00 34.54  ? 886  ALA A CB    1 
ATOM   7238 N  N     . ALA A 1 887 ? 24.873  18.188  14.265  1.00 36.47  ? 887  ALA A N     1 
ATOM   7239 C  CA    . ALA A 1 887 ? 24.658  19.242  13.275  1.00 36.24  ? 887  ALA A CA    1 
ATOM   7240 C  C     . ALA A 1 887 ? 25.940  19.703  12.574  1.00 37.81  ? 887  ALA A C     1 
ATOM   7241 O  O     . ALA A 1 887 ? 25.892  20.603  11.726  1.00 37.84  ? 887  ALA A O     1 
ATOM   7242 C  CB    . ALA A 1 887 ? 23.957  20.417  13.924  1.00 36.77  ? 887  ALA A CB    1 
ATOM   7243 N  N     . LYS A 1 888 ? 27.073  19.077  12.914  1.00 38.53  ? 888  LYS A N     1 
ATOM   7244 C  CA    . LYS A 1 888 ? 28.406  19.449  12.394  1.00 39.99  ? 888  LYS A CA    1 
ATOM   7245 C  C     . LYS A 1 888 ? 28.758  20.914  12.663  1.00 40.64  ? 888  LYS A C     1 
ATOM   7246 O  O     . LYS A 1 888 ? 29.253  21.614  11.773  1.00 41.41  ? 888  LYS A O     1 
ATOM   7247 C  CB    . LYS A 1 888 ? 28.567  19.155  10.888  1.00 40.61  ? 888  LYS A CB    1 
ATOM   7248 C  CG    . LYS A 1 888 ? 27.756  17.992  10.327  1.00 46.25  ? 888  LYS A CG    1 
ATOM   7249 C  CD    . LYS A 1 888 ? 28.493  16.673  10.365  1.00 49.81  ? 888  LYS A CD    1 
ATOM   7250 C  CE    . LYS A 1 888 ? 27.913  15.735  9.319   1.00 51.30  ? 888  LYS A CE    1 
ATOM   7251 N  NZ    . LYS A 1 888 ? 28.468  14.356  9.408   1.00 56.28  ? 888  LYS A NZ    1 
ATOM   7252 N  N     . LEU A 1 889 ? 28.485  21.365  13.885  1.00 40.82  ? 889  LEU A N     1 
ATOM   7253 C  CA    . LEU A 1 889 ? 28.856  22.700  14.348  1.00 43.64  ? 889  LEU A CA    1 
ATOM   7254 C  C     . LEU A 1 889 ? 29.801  22.646  15.541  1.00 44.43  ? 889  LEU A C     1 
ATOM   7255 O  O     . LEU A 1 889 ? 29.950  21.609  16.206  1.00 44.40  ? 889  LEU A O     1 
ATOM   7256 C  CB    . LEU A 1 889 ? 27.613  23.502  14.766  1.00 45.62  ? 889  LEU A CB    1 
ATOM   7257 C  CG    . LEU A 1 889 ? 26.819  24.366  13.779  1.00 45.82  ? 889  LEU A CG    1 
ATOM   7258 C  CD1   . LEU A 1 889 ? 27.639  24.714  12.545  1.00 51.28  ? 889  LEU A CD1   1 
ATOM   7259 C  CD2   . LEU A 1 889 ? 25.534  23.697  13.385  1.00 47.64  ? 889  LEU A CD2   1 
ATOM   7260 N  N     . ASP A 1 890 ? 30.423  23.781  15.818  1.00 44.45  ? 890  ASP A N     1 
ATOM   7261 C  CA    . ASP A 1 890 ? 31.176  23.953  17.043  1.00 45.08  ? 890  ASP A CA    1 
ATOM   7262 C  C     . ASP A 1 890 ? 30.541  25.041  17.901  1.00 44.09  ? 890  ASP A C     1 
ATOM   7263 O  O     . ASP A 1 890 ? 30.171  26.108  17.401  1.00 40.87  ? 890  ASP A O     1 
ATOM   7264 C  CB    . ASP A 1 890 ? 32.645  24.256  16.731  1.00 48.71  ? 890  ASP A CB    1 
ATOM   7265 C  CG    . ASP A 1 890 ? 33.406  23.018  16.259  1.00 54.00  ? 890  ASP A CG    1 
ATOM   7266 O  OD1   . ASP A 1 890 ? 33.293  21.957  16.923  1.00 56.31  ? 890  ASP A OD1   1 
ATOM   7267 O  OD2   . ASP A 1 890 ? 34.112  23.100  15.228  1.00 55.34  ? 890  ASP A OD2   1 
ATOM   7268 N  N     . TYR A 1 891 ? 30.385  24.762  19.190  1.00 43.24  ? 891  TYR A N     1 
ATOM   7269 C  CA    . TYR A 1 891 ? 29.848  25.768  20.092  1.00 44.00  ? 891  TYR A CA    1 
ATOM   7270 C  C     . TYR A 1 891 ? 30.957  26.693  20.578  1.00 45.45  ? 891  TYR A C     1 
ATOM   7271 O  O     . TYR A 1 891 ? 30.691  27.798  21.035  1.00 45.69  ? 891  TYR A O     1 
ATOM   7272 C  CB    . TYR A 1 891 ? 29.051  25.141  21.252  1.00 43.99  ? 891  TYR A CB    1 
ATOM   7273 C  CG    . TYR A 1 891 ? 29.809  24.124  22.071  1.00 43.49  ? 891  TYR A CG    1 
ATOM   7274 C  CD1   . TYR A 1 891 ? 29.845  22.785  21.696  1.00 42.72  ? 891  TYR A CD1   1 
ATOM   7275 C  CD2   . TYR A 1 891 ? 30.479  24.500  23.229  1.00 44.75  ? 891  TYR A CD2   1 
ATOM   7276 C  CE1   . TYR A 1 891 ? 30.542  21.849  22.450  1.00 46.40  ? 891  TYR A CE1   1 
ATOM   7277 C  CE2   . TYR A 1 891 ? 31.177  23.572  23.992  1.00 44.89  ? 891  TYR A CE2   1 
ATOM   7278 C  CZ    . TYR A 1 891 ? 31.203  22.251  23.599  1.00 44.11  ? 891  TYR A CZ    1 
ATOM   7279 O  OH    . TYR A 1 891 ? 31.901  21.336  24.347  1.00 40.49  ? 891  TYR A OH    1 
ATOM   7280 N  N     . GLU A 1 892 ? 32.198  26.233  20.466  1.00 47.87  ? 892  GLU A N     1 
ATOM   7281 C  CA    . GLU A 1 892 ? 33.366  27.062  20.752  1.00 51.54  ? 892  GLU A CA    1 
ATOM   7282 C  C     . GLU A 1 892 ? 34.137  27.303  19.465  1.00 52.46  ? 892  GLU A C     1 
ATOM   7283 O  O     . GLU A 1 892 ? 34.369  26.372  18.699  1.00 53.68  ? 892  GLU A O     1 
ATOM   7284 C  CB    . GLU A 1 892 ? 34.261  26.402  21.802  1.00 52.69  ? 892  GLU A CB    1 
ATOM   7285 C  CG    . GLU A 1 892 ? 33.642  26.386  23.193  1.00 56.23  ? 892  GLU A CG    1 
ATOM   7286 C  CD    . GLU A 1 892 ? 34.563  25.830  24.260  1.00 58.04  ? 892  GLU A CD    1 
ATOM   7287 O  OE1   . GLU A 1 892 ? 34.864  26.569  25.225  1.00 60.49  ? 892  GLU A OE1   1 
ATOM   7288 O  OE2   . GLU A 1 892 ? 34.979  24.658  24.145  1.00 59.69  ? 892  GLU A OE2   1 
ATOM   7289 N  N     . LYS A 1 893 ? 34.514  28.554  19.221  1.00 54.15  ? 893  LYS A N     1 
ATOM   7290 C  CA    . LYS A 1 893 ? 35.247  28.906  18.013  1.00 57.87  ? 893  LYS A CA    1 
ATOM   7291 C  C     . LYS A 1 893 ? 36.578  28.158  17.926  1.00 59.69  ? 893  LYS A C     1 
ATOM   7292 O  O     . LYS A 1 893 ? 37.405  28.223  18.837  1.00 59.32  ? 893  LYS A O     1 
ATOM   7293 C  CB    . LYS A 1 893 ? 35.474  30.418  17.930  1.00 59.49  ? 893  LYS A CB    1 
ATOM   7294 C  CG    . LYS A 1 893 ? 35.923  30.892  16.552  1.00 62.29  ? 893  LYS A CG    1 
ATOM   7295 C  CD    . LYS A 1 893 ? 36.320  32.362  16.557  1.00 65.64  ? 893  LYS A CD    1 
ATOM   7296 C  CE    . LYS A 1 893 ? 36.890  32.777  15.205  1.00 68.14  ? 893  LYS A CE    1 
ATOM   7297 N  NZ    . LYS A 1 893 ? 37.423  34.171  15.213  1.00 67.05  ? 893  LYS A NZ    1 
ATOM   7298 N  N     . LYS A 1 894 ? 36.757  27.427  16.831  1.00 63.15  ? 894  LYS A N     1 
ATOM   7299 C  CA    . LYS A 1 894 ? 38.026  26.776  16.520  1.00 66.44  ? 894  LYS A CA    1 
ATOM   7300 C  C     . LYS A 1 894 ? 39.050  27.824  16.081  1.00 68.56  ? 894  LYS A C     1 
ATOM   7301 O  O     . LYS A 1 894 ? 38.688  28.830  15.464  1.00 68.29  ? 894  LYS A O     1 
ATOM   7302 C  CB    . LYS A 1 894 ? 37.837  25.727  15.420  1.00 66.89  ? 894  LYS A CB    1 
ATOM   7303 C  CG    . LYS A 1 894 ? 36.969  26.195  14.254  1.00 69.31  ? 894  LYS A CG    1 
ATOM   7304 C  CD    . LYS A 1 894 ? 37.360  25.522  12.950  1.00 73.87  ? 894  LYS A CD    1 
ATOM   7305 C  CE    . LYS A 1 894 ? 36.615  26.137  11.771  1.00 75.92  ? 894  LYS A CE    1 
ATOM   7306 N  NZ    . LYS A 1 894 ? 37.261  25.808  10.467  1.00 77.93  ? 894  LYS A NZ    1 
ATOM   7307 N  N     . ALA A 1 895 ? 40.319  27.587  16.409  1.00 70.60  ? 895  ALA A N     1 
ATOM   7308 C  CA    . ALA A 1 895 ? 41.404  28.498  16.046  1.00 73.72  ? 895  ALA A CA    1 
ATOM   7309 C  C     . ALA A 1 895 ? 41.656  28.507  14.535  1.00 75.62  ? 895  ALA A C     1 
ATOM   7310 O  O     . ALA A 1 895 ? 41.658  27.451  13.891  1.00 75.92  ? 895  ALA A O     1 
ATOM   7311 C  CB    . ALA A 1 895 ? 42.679  28.137  16.801  1.00 73.76  ? 895  ALA A CB    1 
ATOM   7312 N  N     . SER A 1 896 ? 41.859  29.701  13.979  1.00 77.17  ? 896  SER A N     1 
ATOM   7313 C  CA    . SER A 1 896 ? 42.143  29.855  12.547  1.00 79.68  ? 896  SER A CA    1 
ATOM   7314 C  C     . SER A 1 896 ? 43.440  30.629  12.288  1.00 81.77  ? 896  SER A C     1 
ATOM   7315 O  O     . SER A 1 896 ? 43.987  31.271  13.192  1.00 80.72  ? 896  SER A O     1 
ATOM   7316 C  CB    . SER A 1 896 ? 40.967  30.529  11.823  1.00 79.46  ? 896  SER A CB    1 
ATOM   7317 O  OG    . SER A 1 896 ? 41.002  31.941  11.967  1.00 77.73  ? 896  SER A OG    1 
ATOM   7318 N  N     . LEU A 1 897 ? 43.910  30.573  11.043  1.00 84.25  ? 897  LEU A N     1 
ATOM   7319 C  CA    . LEU A 1 897 ? 45.123  31.273  10.617  1.00 86.99  ? 897  LEU A CA    1 
ATOM   7320 C  C     . LEU A 1 897 ? 45.011  32.792  10.775  1.00 88.86  ? 897  LEU A C     1 
ATOM   7321 O  O     . LEU A 1 897 ? 46.021  33.492  10.839  1.00 89.28  ? 897  LEU A O     1 
ATOM   7322 C  CB    . LEU A 1 897 ? 45.479  30.911  9.167   1.00 88.13  ? 897  LEU A CB    1 
ATOM   7323 C  CG    . LEU A 1 897 ? 46.031  29.520  8.796   1.00 88.18  ? 897  LEU A CG    1 
ATOM   7324 C  CD1   . LEU A 1 897 ? 47.328  29.197  9.539   1.00 87.21  ? 897  LEU A CD1   1 
ATOM   7325 C  CD2   . LEU A 1 897 ? 44.998  28.399  8.985   1.00 88.50  ? 897  LEU A CD2   1 
ATOM   7326 N  N     . PHE A 1 898 ? 43.778  33.287  10.852  1.00 90.96  ? 898  PHE A N     1 
ATOM   7327 C  CA    . PHE A 1 898 ? 43.513  34.709  11.079  1.00 94.93  ? 898  PHE A CA    1 
ATOM   7328 C  C     . PHE A 1 898 ? 43.968  35.231  12.444  1.00 97.47  ? 898  PHE A C     1 
ATOM   7329 O  O     . PHE A 1 898 ? 44.140  36.440  12.620  1.00 98.06  ? 898  PHE A O     1 
ATOM   7330 C  CB    . PHE A 1 898 ? 42.034  35.023  10.843  1.00 94.89  ? 898  PHE A CB    1 
ATOM   7331 C  CG    . PHE A 1 898 ? 41.755  35.597  9.489   1.00 95.77  ? 898  PHE A CG    1 
ATOM   7332 C  CD1   . PHE A 1 898 ? 41.431  36.943  9.347   1.00 96.96  ? 898  PHE A CD1   1 
ATOM   7333 C  CD2   . PHE A 1 898 ? 41.839  34.804  8.351   1.00 96.24  ? 898  PHE A CD2   1 
ATOM   7334 C  CE1   . PHE A 1 898 ? 41.181  37.489  8.094   1.00 97.84  ? 898  PHE A CE1   1 
ATOM   7335 C  CE2   . PHE A 1 898 ? 41.596  35.341  7.094   1.00 98.13  ? 898  PHE A CE2   1 
ATOM   7336 C  CZ    . PHE A 1 898 ? 41.264  36.687  6.967   1.00 98.19  ? 898  PHE A CZ    1 
ATOM   7337 N  N     . ASP A 1 899 ? 44.151  34.322  13.400  1.00 99.84  ? 899  ASP A N     1 
ATOM   7338 C  CA    . ASP A 1 899 ? 44.771  34.653  14.679  1.00 103.60 ? 899  ASP A CA    1 
ATOM   7339 C  C     . ASP A 1 899 ? 46.293  34.673  14.494  1.00 108.46 ? 899  ASP A C     1 
ATOM   7340 O  O     . ASP A 1 899 ? 46.888  33.638  14.186  1.00 109.53 ? 899  ASP A O     1 
ATOM   7341 C  CB    . ASP A 1 899 ? 44.395  33.625  15.756  1.00 101.28 ? 899  ASP A CB    1 
ATOM   7342 C  CG    . ASP A 1 899 ? 42.909  33.295  15.775  1.00 99.00  ? 899  ASP A CG    1 
ATOM   7343 O  OD1   . ASP A 1 899 ? 42.079  34.228  15.833  1.00 97.56  ? 899  ASP A OD1   1 
ATOM   7344 O  OD2   . ASP A 1 899 ? 42.573  32.092  15.746  1.00 97.20  ? 899  ASP A OD2   1 
ATOM   7345 N  N     . MET A 1 900 ? 46.934  35.831  14.649  1.00 113.37 ? 900  MET A N     1 
ATOM   7346 C  CA    . MET A 1 900 ? 46.278  37.110  14.902  1.00 117.52 ? 900  MET A CA    1 
ATOM   7347 C  C     . MET A 1 900 ? 46.927  38.175  14.016  1.00 121.51 ? 900  MET A C     1 
ATOM   7348 O  O     . MET A 1 900 ? 48.101  38.058  13.648  1.00 121.73 ? 900  MET A O     1 
ATOM   7349 C  CB    . MET A 1 900 ? 46.383  37.490  16.388  1.00 117.83 ? 900  MET A CB    1 
ATOM   7350 C  CG    . MET A 1 900 ? 45.536  38.699  16.809  1.00 118.59 ? 900  MET A CG    1 
ATOM   7351 S  SD    . MET A 1 900 ? 45.552  39.079  18.579  1.00 119.04 ? 900  MET A SD    1 
ATOM   7352 C  CE    . MET A 1 900 ? 47.295  39.381  18.883  1.00 119.73 ? 900  MET A CE    1 
ATOM   7353 N  N     . PHE A 1 901 ? 46.153  39.201  13.669  1.00 125.28 ? 901  PHE A N     1 
ATOM   7354 C  CA    . PHE A 1 901 ? 46.651  40.321  12.867  1.00 130.25 ? 901  PHE A CA    1 
ATOM   7355 C  C     . PHE A 1 901 ? 46.553  41.671  13.589  1.00 134.37 ? 901  PHE A C     1 
ATOM   7356 O  O     . PHE A 1 901 ? 47.105  42.671  13.121  1.00 135.86 ? 901  PHE A O     1 
ATOM   7357 C  CB    . PHE A 1 901 ? 45.944  40.366  11.507  1.00 129.55 ? 901  PHE A CB    1 
ATOM   7358 C  CG    . PHE A 1 901 ? 46.507  39.400  10.500  1.00 127.97 ? 901  PHE A CG    1 
ATOM   7359 C  CD1   . PHE A 1 901 ? 47.468  39.816  9.583   1.00 128.29 ? 901  PHE A CD1   1 
ATOM   7360 C  CD2   . PHE A 1 901 ? 46.084  38.074  10.473  1.00 125.64 ? 901  PHE A CD2   1 
ATOM   7361 C  CE1   . PHE A 1 901 ? 47.996  38.929  8.652   1.00 127.18 ? 901  PHE A CE1   1 
ATOM   7362 C  CE2   . PHE A 1 901 ? 46.608  37.181  9.546   1.00 124.66 ? 901  PHE A CE2   1 
ATOM   7363 C  CZ    . PHE A 1 901 ? 47.565  37.610  8.635   1.00 125.69 ? 901  PHE A CZ    1 
ATOM   7364 N  N     . ASP A 1 902 ? 45.853  41.688  14.725  1.00 110.94 ? 902  ASP A N     1 
ATOM   7365 C  CA    . ASP A 1 902 ? 45.803  42.864  15.602  1.00 114.94 ? 902  ASP A CA    1 
ATOM   7366 C  C     . ASP A 1 902 ? 47.152  43.115  16.282  1.00 117.15 ? 902  ASP A C     1 
ATOM   7367 O  O     . ASP A 1 902 ? 47.485  44.260  16.603  1.00 117.52 ? 902  ASP A O     1 
ATOM   7368 C  CB    . ASP A 1 902 ? 44.693  42.724  16.658  1.00 115.23 ? 902  ASP A CB    1 
ATOM   7369 C  CG    . ASP A 1 902 ? 43.385  43.410  16.249  1.00 115.85 ? 902  ASP A CG    1 
ATOM   7370 O  OD1   . ASP A 1 902 ? 43.346  44.101  15.205  1.00 115.99 ? 902  ASP A OD1   1 
ATOM   7371 O  OD2   . ASP A 1 902 ? 42.388  43.264  16.989  1.00 115.61 ? 902  ASP A OD2   1 
ATOM   7372 N  N     . PHE A 1 903 ? 47.911  42.036  16.492  1.00 119.78 ? 903  PHE A N     1 
ATOM   7373 C  CA    . PHE A 1 903 ? 49.266  42.068  17.073  1.00 121.79 ? 903  PHE A CA    1 
ATOM   7374 C  C     . PHE A 1 903 ? 49.333  42.815  18.408  1.00 122.08 ? 903  PHE A C     1 
ATOM   7375 O  O     . PHE A 1 903 ? 48.663  42.443  19.374  1.00 122.38 ? 903  PHE A O     1 
ATOM   7376 C  CB    . PHE A 1 903 ? 50.285  42.639  16.070  1.00 122.79 ? 903  PHE A CB    1 
ATOM   7377 C  CG    . PHE A 1 903 ? 51.712  42.228  16.343  1.00 124.52 ? 903  PHE A CG    1 
ATOM   7378 C  CD1   . PHE A 1 903 ? 52.574  43.073  17.043  1.00 125.10 ? 903  PHE A CD1   1 
ATOM   7379 C  CD2   . PHE A 1 903 ? 52.197  41.000  15.891  1.00 124.90 ? 903  PHE A CD2   1 
ATOM   7380 C  CE1   . PHE A 1 903 ? 53.896  42.698  17.295  1.00 124.99 ? 903  PHE A CE1   1 
ATOM   7381 C  CE2   . PHE A 1 903 ? 53.516  40.616  16.138  1.00 124.92 ? 903  PHE A CE2   1 
ATOM   7382 C  CZ    . PHE A 1 903 ? 54.367  41.468  16.840  1.00 125.17 ? 903  PHE A CZ    1 
ATOM   7383 P  P     . DC  B 2 1   ? -5.549  -0.446  38.582  1.00 87.25  ? 3    DC  T P     1 
ATOM   7384 O  OP1   . DC  B 2 1   ? -6.728  -0.785  39.420  1.00 86.50  ? 3    DC  T OP1   1 
ATOM   7385 O  OP2   . DC  B 2 1   ? -4.569  -1.498  38.214  1.00 84.72  ? 3    DC  T OP2   1 
ATOM   7386 O  "O5'" . DC  B 2 1   ? -6.031  0.306   37.238  1.00 82.85  ? 3    DC  T "O5'" 1 
ATOM   7387 C  "C5'" . DC  B 2 1   ? -7.066  -0.224  36.382  1.00 74.42  ? 3    DC  T "C5'" 1 
ATOM   7388 C  "C4'" . DC  B 2 1   ? -6.560  -0.379  34.947  1.00 66.30  ? 3    DC  T "C4'" 1 
ATOM   7389 O  "O4'" . DC  B 2 1   ? -5.583  -1.440  34.814  1.00 68.78  ? 3    DC  T "O4'" 1 
ATOM   7390 C  "C3'" . DC  B 2 1   ? -7.567  -0.722  33.859  1.00 57.11  ? 3    DC  T "C3'" 1 
ATOM   7391 O  "O3'" . DC  B 2 1   ? -7.045  -0.237  32.620  1.00 41.42  ? 3    DC  T "O3'" 1 
ATOM   7392 C  "C2'" . DC  B 2 1   ? -7.612  -2.251  33.904  1.00 59.53  ? 3    DC  T "C2'" 1 
ATOM   7393 C  "C1'" . DC  B 2 1   ? -6.214  -2.636  34.393  1.00 65.54  ? 3    DC  T "C1'" 1 
ATOM   7394 N  N1    . DC  B 2 1   ? -6.122  -3.539  35.595  1.00 69.15  ? 3    DC  T N1    1 
ATOM   7395 C  C2    . DC  B 2 1   ? -4.845  -3.898  36.091  1.00 69.01  ? 3    DC  T C2    1 
ATOM   7396 O  O2    . DC  B 2 1   ? -3.807  -3.490  35.532  1.00 65.06  ? 3    DC  T O2    1 
ATOM   7397 N  N3    . DC  B 2 1   ? -4.781  -4.703  37.187  1.00 70.04  ? 3    DC  T N3    1 
ATOM   7398 C  C4    . DC  B 2 1   ? -5.903  -5.137  37.779  1.00 70.24  ? 3    DC  T C4    1 
ATOM   7399 N  N4    . DC  B 2 1   ? -5.785  -5.927  38.852  1.00 68.34  ? 3    DC  T N4    1 
ATOM   7400 C  C5    . DC  B 2 1   ? -7.200  -4.776  37.296  1.00 70.94  ? 3    DC  T C5    1 
ATOM   7401 C  C6    . DC  B 2 1   ? -7.261  -3.984  36.215  1.00 69.97  ? 3    DC  T C6    1 
HETATM 7402 P  P     . 2PR B 2 2   ? -7.462  1.182   32.010  1.00 33.13  ? 4    2PR T P     1 
HETATM 7403 O  OP1   . 2PR B 2 2   ? -9.223  0.940   32.360  1.00 39.73  ? 4    2PR T OP1   1 
HETATM 7404 O  OP2   . 2PR B 2 2   ? -6.357  2.186   33.053  1.00 41.06  ? 4    2PR T OP2   1 
HETATM 7405 O  "O5'" . 2PR B 2 2   ? -6.803  0.778   30.487  1.00 37.10  ? 4    2PR T "O5'" 1 
HETATM 7406 C  "C5'" . 2PR B 2 2   ? -5.388  0.785   30.322  1.00 31.83  ? 4    2PR T "C5'" 1 
HETATM 7407 C  "C4'" . 2PR B 2 2   ? -5.200  0.364   28.879  1.00 31.01  ? 4    2PR T "C4'" 1 
HETATM 7408 O  "O4'" . 2PR B 2 2   ? -5.832  1.321   28.034  1.00 30.93  ? 4    2PR T "O4'" 1 
HETATM 7409 C  "C3'" . 2PR B 2 2   ? -3.753  0.314   28.457  1.00 30.66  ? 4    2PR T "C3'" 1 
HETATM 7410 O  "O3'" . 2PR B 2 2   ? -3.234  -0.985  28.706  1.00 30.85  ? 4    2PR T "O3'" 1 
HETATM 7411 C  "C2'" . 2PR B 2 2   ? -3.847  0.600   26.977  1.00 32.79  ? 4    2PR T "C2'" 1 
HETATM 7412 C  "C1'" . 2PR B 2 2   ? -4.999  1.583   26.902  1.00 33.83  ? 4    2PR T "C1'" 1 
HETATM 7413 N  N9    . 2PR B 2 2   ? -4.410  2.945   27.009  1.00 33.89  ? 4    2PR T N9    1 
HETATM 7414 C  C8    . 2PR B 2 2   ? -4.528  3.801   28.043  1.00 30.14  ? 4    2PR T C8    1 
HETATM 7415 N  N7    . 2PR B 2 2   ? -3.820  4.917   27.750  1.00 35.07  ? 4    2PR T N7    1 
HETATM 7416 C  C5    . 2PR B 2 2   ? -3.266  4.749   26.521  1.00 35.34  ? 4    2PR T C5    1 
HETATM 7417 C  C6    . 2PR B 2 2   ? -2.458  5.542   25.707  1.00 34.81  ? 4    2PR T C6    1 
HETATM 7418 N  N1    . 2PR B 2 2   ? -2.058  5.081   24.511  1.00 33.44  ? 4    2PR T N1    1 
HETATM 7419 C  C2    . 2PR B 2 2   ? -2.434  3.846   24.085  1.00 30.87  ? 4    2PR T C2    1 
HETATM 7420 N  N2    . 2PR B 2 2   ? -2.020  3.403   22.874  1.00 26.34  ? 4    2PR T N2    1 
HETATM 7421 N  N3    . 2PR B 2 2   ? -3.217  3.054   24.859  1.00 24.76  ? 4    2PR T N3    1 
HETATM 7422 C  C4    . 2PR B 2 2   ? -3.639  3.495   26.067  1.00 30.89  ? 4    2PR T C4    1 
ATOM   7423 P  P     . DT  B 2 3   ? -1.677  -1.179  28.950  1.00 32.74  ? 5    DT  T P     1 
ATOM   7424 O  OP1   . DT  B 2 3   ? -1.542  -2.492  29.612  1.00 36.18  ? 5    DT  T OP1   1 
ATOM   7425 O  OP2   . DT  B 2 3   ? -1.108  0.031   29.585  1.00 36.61  ? 5    DT  T OP2   1 
ATOM   7426 O  "O5'" . DT  B 2 3   ? -1.046  -1.236  27.483  1.00 31.00  ? 5    DT  T "O5'" 1 
ATOM   7427 C  "C5'" . DT  B 2 3   ? -1.545  -2.126  26.485  1.00 32.43  ? 5    DT  T "C5'" 1 
ATOM   7428 C  "C4'" . DT  B 2 3   ? -0.892  -1.789  25.160  1.00 32.72  ? 5    DT  T "C4'" 1 
ATOM   7429 O  "O4'" . DT  B 2 3   ? -1.274  -0.435  24.820  1.00 34.85  ? 5    DT  T "O4'" 1 
ATOM   7430 C  "C3'" . DT  B 2 3   ? 0.633   -1.745  25.182  1.00 33.87  ? 5    DT  T "C3'" 1 
ATOM   7431 O  "O3'" . DT  B 2 3   ? 1.211   -3.047  25.027  1.00 34.14  ? 5    DT  T "O3'" 1 
ATOM   7432 C  "C2'" . DT  B 2 3   ? 0.924   -0.832  24.000  1.00 32.72  ? 5    DT  T "C2'" 1 
ATOM   7433 C  "C1'" . DT  B 2 3   ? -0.226  0.169   24.084  1.00 32.70  ? 5    DT  T "C1'" 1 
ATOM   7434 N  N1    . DT  B 2 3   ? 0.161   1.477   24.714  1.00 34.42  ? 5    DT  T N1    1 
ATOM   7435 C  C2    . DT  B 2 3   ? 0.903   2.342   23.941  1.00 33.28  ? 5    DT  T C2    1 
ATOM   7436 O  O2    . DT  B 2 3   ? 1.246   2.090   22.803  1.00 35.69  ? 5    DT  T O2    1 
ATOM   7437 N  N3    . DT  B 2 3   ? 1.229   3.525   24.544  1.00 34.67  ? 5    DT  T N3    1 
ATOM   7438 C  C4    . DT  B 2 3   ? 0.897   3.920   25.828  1.00 36.28  ? 5    DT  T C4    1 
ATOM   7439 O  O4    . DT  B 2 3   ? 1.253   5.010   26.262  1.00 35.97  ? 5    DT  T O4    1 
ATOM   7440 C  C5    . DT  B 2 3   ? 0.121   2.967   26.606  1.00 35.40  ? 5    DT  T C5    1 
ATOM   7441 C  C7    . DT  B 2 3   ? -0.272  3.301   28.021  1.00 26.82  ? 5    DT  T C7    1 
ATOM   7442 C  C6    . DT  B 2 3   ? -0.208  1.799   26.020  1.00 31.99  ? 5    DT  T C6    1 
ATOM   7443 P  P     . DC  B 2 4   ? 2.743   -3.281  25.421  1.00 33.78  ? 6    DC  T P     1 
ATOM   7444 O  OP1   . DC  B 2 4   ? 2.980   -4.738  25.521  1.00 37.86  ? 6    DC  T OP1   1 
ATOM   7445 O  OP2   . DC  B 2 4   ? 3.071   -2.420  26.575  1.00 37.68  ? 6    DC  T OP2   1 
ATOM   7446 O  "O5'" . DC  B 2 4   ? 3.551   -2.709  24.159  1.00 36.51  ? 6    DC  T "O5'" 1 
ATOM   7447 C  "C5'" . DC  B 2 4   ? 3.364   -3.202  22.829  1.00 30.98  ? 6    DC  T "C5'" 1 
ATOM   7448 C  "C4'" . DC  B 2 4   ? 4.241   -2.425  21.859  1.00 31.56  ? 6    DC  T "C4'" 1 
ATOM   7449 O  "O4'" . DC  B 2 4   ? 4.005   -0.997  21.992  1.00 32.46  ? 6    DC  T "O4'" 1 
ATOM   7450 C  "C3'" . DC  B 2 4   ? 5.745   -2.597  22.052  1.00 33.63  ? 6    DC  T "C3'" 1 
ATOM   7451 O  "O3'" . DC  B 2 4   ? 6.353   -2.480  20.778  1.00 32.25  ? 6    DC  T "O3'" 1 
ATOM   7452 C  "C2'" . DC  B 2 4   ? 6.092   -1.433  22.985  1.00 29.94  ? 6    DC  T "C2'" 1 
ATOM   7453 C  "C1'" . DC  B 2 4   ? 5.197   -0.344  22.406  1.00 30.13  ? 6    DC  T "C1'" 1 
ATOM   7454 N  N1    . DC  B 2 4   ? 4.916   0.767   23.370  1.00 32.02  ? 6    DC  T N1    1 
ATOM   7455 C  C2    . DC  B 2 4   ? 5.246   2.092   23.022  1.00 34.03  ? 6    DC  T C2    1 
ATOM   7456 O  O2    . DC  B 2 4   ? 5.752   2.335   21.915  1.00 38.55  ? 6    DC  T O2    1 
ATOM   7457 N  N3    . DC  B 2 4   ? 4.992   3.088   23.916  1.00 31.33  ? 6    DC  T N3    1 
ATOM   7458 C  C4    . DC  B 2 4   ? 4.437   2.812   25.110  1.00 32.31  ? 6    DC  T C4    1 
ATOM   7459 N  N4    . DC  B 2 4   ? 4.205   3.831   25.957  1.00 29.56  ? 6    DC  T N4    1 
ATOM   7460 C  C5    . DC  B 2 4   ? 4.093   1.472   25.482  1.00 25.88  ? 6    DC  T C5    1 
ATOM   7461 C  C6    . DC  B 2 4   ? 4.342   0.501   24.589  1.00 29.46  ? 6    DC  T C6    1 
ATOM   7462 P  P     . DG  B 2 5   ? 7.905   -2.735  20.471  1.00 32.77  ? 7    DG  T P     1 
ATOM   7463 O  OP1   . DG  B 2 5   ? 7.970   -3.436  19.163  1.00 37.00  ? 7    DG  T OP1   1 
ATOM   7464 O  OP2   . DG  B 2 5   ? 8.539   -3.345  21.657  1.00 38.66  ? 7    DG  T OP2   1 
ATOM   7465 O  "O5'" . DG  B 2 5   ? 8.480   -1.267  20.279  1.00 33.44  ? 7    DG  T "O5'" 1 
ATOM   7466 C  "C5'" . DG  B 2 5   ? 8.054   -0.455  19.193  1.00 33.36  ? 7    DG  T "C5'" 1 
ATOM   7467 C  "C4'" . DG  B 2 5   ? 9.045   0.668   18.966  1.00 32.64  ? 7    DG  T "C4'" 1 
ATOM   7468 O  "O4'" . DG  B 2 5   ? 8.809   1.754   19.904  1.00 33.47  ? 7    DG  T "O4'" 1 
ATOM   7469 C  "C3'" . DG  B 2 5   ? 10.507  0.286   19.149  1.00 34.34  ? 7    DG  T "C3'" 1 
ATOM   7470 O  "O3'" . DG  B 2 5   ? 11.247  1.056   18.207  1.00 35.44  ? 7    DG  T "O3'" 1 
ATOM   7471 C  "C2'" . DG  B 2 5   ? 10.783  0.641   20.619  1.00 32.94  ? 7    DG  T "C2'" 1 
ATOM   7472 C  "C1'" . DG  B 2 5   ? 9.874   1.852   20.843  1.00 34.45  ? 7    DG  T "C1'" 1 
ATOM   7473 N  N9    . DG  B 2 5   ? 9.292   2.008   22.186  1.00 34.94  ? 7    DG  T N9    1 
ATOM   7474 C  C8    . DG  B 2 5   ? 8.685   1.056   22.982  1.00 36.59  ? 7    DG  T C8    1 
ATOM   7475 N  N7    . DG  B 2 5   ? 8.253   1.521   24.129  1.00 32.92  ? 7    DG  T N7    1 
ATOM   7476 C  C5    . DG  B 2 5   ? 8.582   2.871   24.087  1.00 31.09  ? 7    DG  T C5    1 
ATOM   7477 C  C6    . DG  B 2 5   ? 8.384   3.911   25.027  1.00 29.26  ? 7    DG  T C6    1 
ATOM   7478 O  O6    . DG  B 2 5   ? 7.846   3.852   26.127  1.00 29.97  ? 7    DG  T O6    1 
ATOM   7479 N  N1    . DG  B 2 5   ? 8.882   5.138   24.597  1.00 30.53  ? 7    DG  T N1    1 
ATOM   7480 C  C2    . DG  B 2 5   ? 9.503   5.339   23.393  1.00 28.30  ? 7    DG  T C2    1 
ATOM   7481 N  N2    . DG  B 2 5   ? 9.926   6.585   23.101  1.00 33.32  ? 7    DG  T N2    1 
ATOM   7482 N  N3    . DG  B 2 5   ? 9.696   4.375   22.516  1.00 34.09  ? 7    DG  T N3    1 
ATOM   7483 C  C4    . DG  B 2 5   ? 9.219   3.176   22.911  1.00 30.99  ? 7    DG  T C4    1 
ATOM   7484 P  P     . DC  B 2 6   ? 12.840  1.005   18.071  1.00 36.41  ? 8    DC  T P     1 
ATOM   7485 O  OP1   . DC  B 2 6   ? 13.133  1.567   16.739  1.00 32.89  ? 8    DC  T OP1   1 
ATOM   7486 O  OP2   . DC  B 2 6   ? 13.365  -0.333  18.442  1.00 35.50  ? 8    DC  T OP2   1 
ATOM   7487 O  "O5'" . DC  B 2 6   ? 13.312  2.023   19.210  1.00 35.79  ? 8    DC  T "O5'" 1 
ATOM   7488 C  "C5'" . DC  B 2 6   ? 13.202  3.433   19.026  1.00 33.78  ? 8    DC  T "C5'" 1 
ATOM   7489 C  "C4'" . DC  B 2 6   ? 13.827  4.125   20.212  1.00 33.95  ? 8    DC  T "C4'" 1 
ATOM   7490 O  "O4'" . DC  B 2 6   ? 12.965  3.947   21.366  1.00 36.61  ? 8    DC  T "O4'" 1 
ATOM   7491 C  "C3'" . DC  B 2 6   ? 15.185  3.551   20.605  1.00 36.98  ? 8    DC  T "C3'" 1 
ATOM   7492 O  "O3'" . DC  B 2 6   ? 16.091  4.624   20.752  1.00 38.83  ? 8    DC  T "O3'" 1 
ATOM   7493 C  "C2'" . DC  B 2 6   ? 14.925  2.831   21.926  1.00 32.44  ? 8    DC  T "C2'" 1 
ATOM   7494 C  "C1'" . DC  B 2 6   ? 13.806  3.710   22.476  1.00 35.73  ? 8    DC  T "C1'" 1 
ATOM   7495 N  N1    . DC  B 2 6   ? 12.985  3.206   23.655  1.00 34.40  ? 8    DC  T N1    1 
ATOM   7496 C  C2    . DC  B 2 6   ? 12.519  4.159   24.588  1.00 34.56  ? 8    DC  T C2    1 
ATOM   7497 O  O2    . DC  B 2 6   ? 12.788  5.353   24.441  1.00 31.67  ? 8    DC  T O2    1 
ATOM   7498 N  N3    . DC  B 2 6   ? 11.771  3.751   25.640  1.00 35.58  ? 8    DC  T N3    1 
ATOM   7499 C  C4    . DC  B 2 6   ? 11.491  2.453   25.798  1.00 37.00  ? 8    DC  T C4    1 
ATOM   7500 N  N4    . DC  B 2 6   ? 10.756  2.130   26.863  1.00 33.36  ? 8    DC  T N4    1 
ATOM   7501 C  C5    . DC  B 2 6   ? 11.942  1.456   24.865  1.00 35.15  ? 8    DC  T C5    1 
ATOM   7502 C  C6    . DC  B 2 6   ? 12.681  1.882   23.819  1.00 32.86  ? 8    DC  T C6    1 
ATOM   7503 P  P     . DC  B 2 7   ? 17.629  4.531   20.335  1.00 37.34  ? 9    DC  T P     1 
ATOM   7504 O  OP1   . DC  B 2 7   ? 17.719  4.602   18.866  1.00 39.56  ? 9    DC  T OP1   1 
ATOM   7505 O  OP2   . DC  B 2 7   ? 18.313  3.429   21.039  1.00 36.47  ? 9    DC  T OP2   1 
ATOM   7506 O  "O5'" . DC  B 2 7   ? 18.131  5.915   20.966  1.00 32.07  ? 9    DC  T "O5'" 1 
ATOM   7507 C  "C5'" . DC  B 2 7   ? 17.359  7.101   20.777  1.00 34.25  ? 9    DC  T "C5'" 1 
ATOM   7508 C  "C4'" . DC  B 2 7   ? 17.162  7.902   22.056  1.00 32.24  ? 9    DC  T "C4'" 1 
ATOM   7509 O  "O4'" . DC  B 2 7   ? 16.086  7.351   22.843  1.00 33.13  ? 9    DC  T "O4'" 1 
ATOM   7510 C  "C3'" . DC  B 2 7   ? 18.348  7.905   23.000  1.00 35.27  ? 9    DC  T "C3'" 1 
ATOM   7511 O  "O3'" . DC  B 2 7   ? 19.236  8.912   22.568  1.00 36.80  ? 9    DC  T "O3'" 1 
ATOM   7512 C  "C2'" . DC  B 2 7   ? 17.703  8.232   24.342  1.00 37.20  ? 9    DC  T "C2'" 1 
ATOM   7513 C  "C1'" . DC  B 2 7   ? 16.304  7.653   24.212  1.00 33.98  ? 9    DC  T "C1'" 1 
ATOM   7514 N  N1    . DC  B 2 7   ? 16.040  6.433   25.045  1.00 31.90  ? 9    DC  T N1    1 
ATOM   7515 C  C2    . DC  B 2 7   ? 15.504  6.560   26.339  1.00 32.42  ? 9    DC  T C2    1 
ATOM   7516 O  O2    . DC  B 2 7   ? 15.265  7.669   26.828  1.00 34.99  ? 9    DC  T O2    1 
ATOM   7517 N  N3    . DC  B 2 7   ? 15.253  5.441   27.058  1.00 33.41  ? 9    DC  T N3    1 
ATOM   7518 C  C4    . DC  B 2 7   ? 15.501  4.239   26.544  1.00 32.72  ? 9    DC  T C4    1 
ATOM   7519 N  N4    . DC  B 2 7   ? 15.228  3.186   27.321  1.00 35.40  ? 9    DC  T N4    1 
ATOM   7520 C  C5    . DC  B 2 7   ? 16.045  4.075   25.234  1.00 30.78  ? 9    DC  T C5    1 
ATOM   7521 C  C6    . DC  B 2 7   ? 16.294  5.188   24.527  1.00 31.28  ? 9    DC  T C6    1 
ATOM   7522 P  P     . DG  B 2 8   ? 20.738  9.023   23.110  1.00 41.33  ? 10   DG  T P     1 
ATOM   7523 O  OP1   . DG  B 2 8   ? 21.389  10.105  22.334  1.00 36.94  ? 10   DG  T OP1   1 
ATOM   7524 O  OP2   . DG  B 2 8   ? 21.356  7.677   23.164  1.00 38.44  ? 10   DG  T OP2   1 
ATOM   7525 O  "O5'" . DG  B 2 8   ? 20.493  9.484   24.628  1.00 38.25  ? 10   DG  T "O5'" 1 
ATOM   7526 C  "C5'" . DG  B 2 8   ? 20.021  10.777  24.950  1.00 35.11  ? 10   DG  T "C5'" 1 
ATOM   7527 C  "C4'" . DG  B 2 8   ? 20.213  11.003  26.437  1.00 38.05  ? 10   DG  T "C4'" 1 
ATOM   7528 O  "O4'" . DG  B 2 8   ? 19.388  10.084  27.200  1.00 38.77  ? 10   DG  T "O4'" 1 
ATOM   7529 C  "C3'" . DG  B 2 8   ? 21.639  10.816  26.947  1.00 38.34  ? 10   DG  T "C3'" 1 
ATOM   7530 O  "O3'" . DG  B 2 8   ? 21.901  11.865  27.890  1.00 37.87  ? 10   DG  T "O3'" 1 
ATOM   7531 C  "C2'" . DG  B 2 8   ? 21.634  9.419   27.580  1.00 33.23  ? 10   DG  T "C2'" 1 
ATOM   7532 C  "C1'" . DG  B 2 8   ? 20.182  9.249   28.017  1.00 35.69  ? 10   DG  T "C1'" 1 
ATOM   7533 N  N9    . DG  B 2 8   ? 19.680  7.876   27.899  1.00 36.51  ? 10   DG  T N9    1 
ATOM   7534 C  C8    . DG  B 2 8   ? 19.845  7.013   26.845  1.00 31.82  ? 10   DG  T C8    1 
ATOM   7535 N  N7    . DG  B 2 8   ? 19.277  5.850   27.038  1.00 36.74  ? 10   DG  T N7    1 
ATOM   7536 C  C5    . DG  B 2 8   ? 18.696  5.938   28.298  1.00 32.95  ? 10   DG  T C5    1 
ATOM   7537 C  C6    . DG  B 2 8   ? 17.956  4.989   29.054  1.00 32.11  ? 10   DG  T C6    1 
ATOM   7538 O  O6    . DG  B 2 8   ? 17.649  3.832   28.750  1.00 33.27  ? 10   DG  T O6    1 
ATOM   7539 N  N1    . DG  B 2 8   ? 17.550  5.485   30.291  1.00 31.63  ? 10   DG  T N1    1 
ATOM   7540 C  C2    . DG  B 2 8   ? 17.850  6.751   30.748  1.00 33.54  ? 10   DG  T C2    1 
ATOM   7541 N  N2    . DG  B 2 8   ? 17.401  7.077   31.971  1.00 28.31  ? 10   DG  T N2    1 
ATOM   7542 N  N3    . DG  B 2 8   ? 18.545  7.647   30.049  1.00 33.66  ? 10   DG  T N3    1 
ATOM   7543 C  C4    . DG  B 2 8   ? 18.940  7.182   28.840  1.00 35.27  ? 10   DG  T C4    1 
ATOM   7544 P  P     . DC  B 2 9   ? 23.182  11.847  28.837  1.00 38.42  ? 11   DC  T P     1 
ATOM   7545 O  OP1   . DC  B 2 9   ? 23.466  13.273  29.098  1.00 42.23  ? 11   DC  T OP1   1 
ATOM   7546 O  OP2   . DC  B 2 9   ? 24.246  10.998  28.228  1.00 40.55  ? 11   DC  T OP2   1 
ATOM   7547 O  "O5'" . DC  B 2 9   ? 22.675  11.125  30.178  1.00 40.87  ? 11   DC  T "O5'" 1 
ATOM   7548 C  "C5'" . DC  B 2 9   ? 21.863  11.815  31.132  1.00 39.92  ? 11   DC  T "C5'" 1 
ATOM   7549 C  "C4'" . DC  B 2 9   ? 21.911  11.176  32.514  1.00 45.18  ? 11   DC  T "C4'" 1 
ATOM   7550 O  "O4'" . DC  B 2 9   ? 21.218  9.903   32.528  1.00 46.41  ? 11   DC  T "O4'" 1 
ATOM   7551 C  "C3'" . DC  B 2 9   ? 23.300  10.901  33.097  1.00 48.40  ? 11   DC  T "C3'" 1 
ATOM   7552 O  "O3'" . DC  B 2 9   ? 23.270  11.339  34.450  1.00 50.16  ? 11   DC  T "O3'" 1 
ATOM   7553 C  "C2'" . DC  B 2 9   ? 23.486  9.390   32.965  1.00 46.66  ? 11   DC  T "C2'" 1 
ATOM   7554 C  "C1'" . DC  B 2 9   ? 22.057  8.855   32.973  1.00 44.90  ? 11   DC  T "C1'" 1 
ATOM   7555 N  N1    . DC  B 2 9   ? 21.809  7.659   32.080  1.00 46.46  ? 11   DC  T N1    1 
ATOM   7556 C  C2    . DC  B 2 9   ? 21.089  6.545   32.562  1.00 45.93  ? 11   DC  T C2    1 
ATOM   7557 O  O2    . DC  B 2 9   ? 20.659  6.544   33.724  1.00 46.89  ? 11   DC  T O2    1 
ATOM   7558 N  N3    . DC  B 2 9   ? 20.875  5.484   31.736  1.00 45.25  ? 11   DC  T N3    1 
ATOM   7559 C  C4    . DC  B 2 9   ? 21.340  5.495   30.480  1.00 44.08  ? 11   DC  T C4    1 
ATOM   7560 N  N4    . DC  B 2 9   ? 21.104  4.425   29.709  1.00 36.01  ? 11   DC  T N4    1 
ATOM   7561 C  C5    . DC  B 2 9   ? 22.077  6.610   29.970  1.00 43.52  ? 11   DC  T C5    1 
ATOM   7562 C  C6    . DC  B 2 9   ? 22.278  7.654   30.791  1.00 46.57  ? 11   DC  T C6    1 
ATOM   7563 P  P     . DC  B 2 10  ? 24.529  11.303  35.425  1.00 50.37  ? 12   DC  T P     1 
ATOM   7564 O  OP1   . DC  B 2 10  ? 24.212  12.250  36.514  1.00 52.65  ? 12   DC  T OP1   1 
ATOM   7565 O  OP2   . DC  B 2 10  ? 25.772  11.427  34.639  1.00 54.12  ? 12   DC  T OP2   1 
ATOM   7566 O  "O5'" . DC  B 2 10  ? 24.478  9.817   36.017  1.00 50.55  ? 12   DC  T "O5'" 1 
ATOM   7567 C  "C5'" . DC  B 2 10  ? 23.367  9.443   36.810  1.00 44.20  ? 12   DC  T "C5'" 1 
ATOM   7568 C  "C4'" . DC  B 2 10  ? 23.435  7.980   37.167  1.00 43.09  ? 12   DC  T "C4'" 1 
ATOM   7569 O  "O4'" . DC  B 2 10  ? 23.111  7.195   36.004  1.00 41.21  ? 12   DC  T "O4'" 1 
ATOM   7570 C  "C3'" . DC  B 2 10  ? 24.812  7.506   37.621  1.00 45.29  ? 12   DC  T "C3'" 1 
ATOM   7571 O  "O3'" . DC  B 2 10  ? 24.768  7.254   39.025  1.00 41.77  ? 12   DC  T "O3'" 1 
ATOM   7572 C  "C2'" . DC  B 2 10  ? 25.091  6.249   36.792  1.00 41.29  ? 12   DC  T "C2'" 1 
ATOM   7573 C  "C1'" . DC  B 2 10  ? 23.752  5.946   36.137  1.00 40.61  ? 12   DC  T "C1'" 1 
ATOM   7574 N  N1    . DC  B 2 10  ? 23.833  5.333   34.778  1.00 39.13  ? 12   DC  T N1    1 
ATOM   7575 C  C2    . DC  B 2 10  ? 23.212  4.094   34.529  1.00 41.51  ? 12   DC  T C2    1 
ATOM   7576 O  O2    . DC  B 2 10  ? 22.606  3.514   35.453  1.00 38.77  ? 12   DC  T O2    1 
ATOM   7577 N  N3    . DC  B 2 10  ? 23.292  3.566   33.268  1.00 39.44  ? 12   DC  T N3    1 
ATOM   7578 C  C4    . DC  B 2 10  ? 23.945  4.226   32.299  1.00 39.83  ? 12   DC  T C4    1 
ATOM   7579 N  N4    . DC  B 2 10  ? 23.997  3.681   31.078  1.00 40.57  ? 12   DC  T N4    1 
ATOM   7580 C  C5    . DC  B 2 10  ? 24.582  5.484   32.537  1.00 39.96  ? 12   DC  T C5    1 
ATOM   7581 C  C6    . DC  B 2 10  ? 24.496  5.991   33.775  1.00 40.94  ? 12   DC  T C6    1 
ATOM   7582 P  P     . DG  B 2 11  ? 26.084  6.820   39.812  1.00 41.75  ? 13   DG  T P     1 
ATOM   7583 O  OP1   . DG  B 2 11  ? 26.001  7.295   41.210  1.00 39.46  ? 13   DG  T OP1   1 
ATOM   7584 O  OP2   . DG  B 2 11  ? 27.276  7.167   39.003  1.00 41.75  ? 13   DG  T OP2   1 
ATOM   7585 O  "O5'" . DG  B 2 11  ? 25.930  5.231   39.804  1.00 42.55  ? 13   DG  T "O5'" 1 
ATOM   7586 C  "C5'" . DG  B 2 11  ? 24.762  4.602   40.342  1.00 38.95  ? 13   DG  T "C5'" 1 
ATOM   7587 C  "C4'" . DG  B 2 11  ? 24.976  3.101   40.427  1.00 40.79  ? 13   DG  T "C4'" 1 
ATOM   7588 O  "O4'" . DG  B 2 11  ? 24.937  2.529   39.096  1.00 40.90  ? 13   DG  T "O4'" 1 
ATOM   7589 C  "C3'" . DG  B 2 11  ? 26.302  2.631   41.029  1.00 39.24  ? 13   DG  T "C3'" 1 
ATOM   7590 O  "O3'" . DG  B 2 11  ? 26.022  1.471   41.812  1.00 39.33  ? 13   DG  T "O3'" 1 
ATOM   7591 C  "C2'" . DG  B 2 11  ? 27.180  2.346   39.806  1.00 39.53  ? 13   DG  T "C2'" 1 
ATOM   7592 C  "C1'" . DG  B 2 11  ? 26.153  1.875   38.785  1.00 39.97  ? 13   DG  T "C1'" 1 
ATOM   7593 N  N9    . DG  B 2 11  ? 26.354  2.234   37.386  1.00 42.96  ? 13   DG  T N9    1 
ATOM   7594 C  C8    . DG  B 2 11  ? 26.843  3.413   36.860  1.00 40.91  ? 13   DG  T C8    1 
ATOM   7595 N  N7    . DG  B 2 11  ? 26.853  3.429   35.553  1.00 40.73  ? 13   DG  T N7    1 
ATOM   7596 C  C5    . DG  B 2 11  ? 26.327  2.187   35.195  1.00 43.40  ? 13   DG  T C5    1 
ATOM   7597 C  C6    . DG  B 2 11  ? 26.093  1.615   33.916  1.00 42.52  ? 13   DG  T C6    1 
ATOM   7598 O  O6    . DG  B 2 11  ? 26.307  2.117   32.810  1.00 42.57  ? 13   DG  T O6    1 
ATOM   7599 N  N1    . DG  B 2 11  ? 25.561  0.326   33.994  1.00 42.96  ? 13   DG  T N1    1 
ATOM   7600 C  C2    . DG  B 2 11  ? 25.274  -0.334  35.173  1.00 42.81  ? 13   DG  T C2    1 
ATOM   7601 N  N2    . DG  B 2 11  ? 24.757  -1.568  35.069  1.00 36.80  ? 13   DG  T N2    1 
ATOM   7602 N  N3    . DG  B 2 11  ? 25.486  0.189   36.378  1.00 43.61  ? 13   DG  T N3    1 
ATOM   7603 C  C4    . DG  B 2 11  ? 26.015  1.443   36.312  1.00 42.82  ? 13   DG  T C4    1 
ATOM   7604 P  P     . DC  B 2 12  ? 27.156  0.632   42.559  1.00 44.27  ? 14   DC  T P     1 
ATOM   7605 O  OP1   . DC  B 2 12  ? 26.497  -0.069  43.680  1.00 44.52  ? 14   DC  T OP1   1 
ATOM   7606 O  OP2   . DC  B 2 12  ? 28.305  1.531   42.828  1.00 37.68  ? 14   DC  T OP2   1 
ATOM   7607 O  "O5'" . DC  B 2 12  ? 27.611  -0.438  41.453  1.00 43.87  ? 14   DC  T "O5'" 1 
ATOM   7608 C  "C5'" . DC  B 2 12  ? 26.709  -1.375  40.880  1.00 41.65  ? 14   DC  T "C5'" 1 
ATOM   7609 C  "C4'" . DC  B 2 12  ? 27.359  -2.118  39.717  1.00 46.00  ? 14   DC  T "C4'" 1 
ATOM   7610 O  "O4'" . DC  B 2 12  ? 27.503  -1.231  38.581  1.00 44.89  ? 14   DC  T "O4'" 1 
ATOM   7611 C  "C3'" . DC  B 2 12  ? 28.755  -2.693  39.957  1.00 45.72  ? 14   DC  T "C3'" 1 
ATOM   7612 O  "O3'" . DC  B 2 12  ? 28.678  -4.103  39.842  1.00 50.48  ? 14   DC  T "O3'" 1 
ATOM   7613 C  "C2'" . DC  B 2 12  ? 29.632  -2.110  38.845  1.00 45.18  ? 14   DC  T "C2'" 1 
ATOM   7614 C  "C1'" . DC  B 2 12  ? 28.584  -1.712  37.810  1.00 46.87  ? 14   DC  T "C1'" 1 
ATOM   7615 N  N1    . DC  B 2 12  ? 28.944  -0.633  36.819  1.00 45.15  ? 14   DC  T N1    1 
ATOM   7616 C  C2    . DC  B 2 12  ? 28.773  -0.868  35.445  1.00 45.18  ? 14   DC  T C2    1 
ATOM   7617 O  O2    . DC  B 2 12  ? 28.348  -1.963  35.049  1.00 45.45  ? 14   DC  T O2    1 
ATOM   7618 N  N3    . DC  B 2 12  ? 29.079  0.120   34.567  1.00 45.27  ? 14   DC  T N3    1 
ATOM   7619 C  C4    . DC  B 2 12  ? 29.531  1.295   35.008  1.00 48.31  ? 14   DC  T C4    1 
ATOM   7620 N  N4    . DC  B 2 12  ? 29.820  2.226   34.092  1.00 48.04  ? 14   DC  T N4    1 
ATOM   7621 C  C5    . DC  B 2 12  ? 29.711  1.564   36.401  1.00 46.48  ? 14   DC  T C5    1 
ATOM   7622 C  C6    . DC  B 2 12  ? 29.403  0.581   37.257  1.00 46.98  ? 14   DC  T C6    1 
ATOM   7623 P  P     . DG  B 2 13  ? 29.704  -5.097  40.576  1.00 53.50  ? 15   DG  T P     1 
ATOM   7624 O  OP1   . DG  B 2 13  ? 28.859  -6.141  41.207  1.00 49.63  ? 15   DG  T OP1   1 
ATOM   7625 O  OP2   . DG  B 2 13  ? 30.697  -4.326  41.366  1.00 48.67  ? 15   DG  T OP2   1 
ATOM   7626 O  "O5'" . DG  B 2 13  ? 30.532  -5.736  39.373  1.00 51.88  ? 15   DG  T "O5'" 1 
ATOM   7627 C  "C5'" . DG  B 2 13  ? 29.900  -6.338  38.243  1.00 52.51  ? 15   DG  T "C5'" 1 
ATOM   7628 C  "C4'" . DG  B 2 13  ? 30.870  -6.318  37.077  1.00 51.85  ? 15   DG  T "C4'" 1 
ATOM   7629 O  "O4'" . DG  B 2 13  ? 30.835  -4.997  36.474  1.00 49.17  ? 15   DG  T "O4'" 1 
ATOM   7630 C  "C3'" . DG  B 2 13  ? 32.333  -6.580  37.460  1.00 52.89  ? 15   DG  T "C3'" 1 
ATOM   7631 O  "O3'" . DG  B 2 13  ? 32.882  -7.610  36.634  1.00 53.88  ? 15   DG  T "O3'" 1 
ATOM   7632 C  "C2'" . DG  B 2 13  ? 33.023  -5.231  37.247  1.00 49.79  ? 15   DG  T "C2'" 1 
ATOM   7633 C  "C1'" . DG  B 2 13  ? 32.160  -4.660  36.126  1.00 49.51  ? 15   DG  T "C1'" 1 
ATOM   7634 N  N9    . DG  B 2 13  ? 32.287  -3.218  35.907  1.00 47.08  ? 15   DG  T N9    1 
ATOM   7635 C  C8    . DG  B 2 13  ? 32.549  -2.234  36.834  1.00 46.79  ? 15   DG  T C8    1 
ATOM   7636 N  N7    . DG  B 2 13  ? 32.608  -1.034  36.327  1.00 42.68  ? 15   DG  T N7    1 
ATOM   7637 C  C5    . DG  B 2 13  ? 32.377  -1.236  34.978  1.00 42.69  ? 15   DG  T C5    1 
ATOM   7638 C  C6    . DG  B 2 13  ? 32.330  -0.298  33.923  1.00 42.27  ? 15   DG  T C6    1 
ATOM   7639 O  O6    . DG  B 2 13  ? 32.490  0.926   34.023  1.00 44.05  ? 15   DG  T O6    1 
ATOM   7640 N  N1    . DG  B 2 13  ? 32.075  -0.904  32.684  1.00 38.71  ? 15   DG  T N1    1 
ATOM   7641 C  C2    . DG  B 2 13  ? 31.882  -2.263  32.507  1.00 42.15  ? 15   DG  T C2    1 
ATOM   7642 N  N2    . DG  B 2 13  ? 31.636  -2.701  31.260  1.00 40.43  ? 15   DG  T N2    1 
ATOM   7643 N  N3    . DG  B 2 13  ? 31.929  -3.153  33.496  1.00 43.14  ? 15   DG  T N3    1 
ATOM   7644 C  C4    . DG  B 2 13  ? 32.178  -2.570  34.700  1.00 43.77  ? 15   DG  T C4    1 
ATOM   7645 P  P     . DC  B 2 14  ? 34.228  -8.388  37.025  1.00 55.45  ? 16   DC  T P     1 
ATOM   7646 O  OP1   . DC  B 2 14  ? 34.306  -9.585  36.156  1.00 56.49  ? 16   DC  T OP1   1 
ATOM   7647 O  OP2   . DC  B 2 14  ? 34.281  -8.561  38.500  1.00 54.56  ? 16   DC  T OP2   1 
ATOM   7648 O  "O5'" . DC  B 2 14  ? 35.367  -7.331  36.599  1.00 54.37  ? 16   DC  T "O5'" 1 
ATOM   7649 C  "C5'" . DC  B 2 14  ? 36.016  -7.370  35.327  1.00 50.83  ? 16   DC  T "C5'" 1 
ATOM   7650 C  "C4'" . DC  B 2 14  ? 35.181  -6.823  34.173  1.00 50.63  ? 16   DC  T "C4'" 1 
ATOM   7651 O  "O4'" . DC  B 2 14  ? 34.748  -5.465  34.445  1.00 50.53  ? 16   DC  T "O4'" 1 
ATOM   7652 C  "C3'" . DC  B 2 14  ? 35.916  -6.752  32.838  1.00 51.30  ? 16   DC  T "C3'" 1 
ATOM   7653 O  "O3'" . DC  B 2 14  ? 35.064  -7.148  31.775  1.00 52.11  ? 16   DC  T "O3'" 1 
ATOM   7654 C  "C2'" . DC  B 2 14  ? 36.278  -5.278  32.711  1.00 49.53  ? 16   DC  T "C2'" 1 
ATOM   7655 C  "C1'" . DC  B 2 14  ? 35.070  -4.622  33.360  1.00 47.74  ? 16   DC  T "C1'" 1 
ATOM   7656 N  N1    . DC  B 2 14  ? 35.341  -3.226  33.844  1.00 45.23  ? 16   DC  T N1    1 
ATOM   7657 C  C2    . DC  B 2 14  ? 35.327  -2.149  32.935  1.00 45.27  ? 16   DC  T C2    1 
ATOM   7658 O  O2    . DC  B 2 14  ? 35.084  -2.354  31.732  1.00 41.61  ? 16   DC  T O2    1 
ATOM   7659 N  N3    . DC  B 2 14  ? 35.586  -0.894  33.406  1.00 45.57  ? 16   DC  T N3    1 
ATOM   7660 C  C4    . DC  B 2 14  ? 35.840  -0.685  34.708  1.00 45.03  ? 16   DC  T C4    1 
ATOM   7661 N  N4    . DC  B 2 14  ? 36.077  0.573   35.121  1.00 40.91  ? 16   DC  T N4    1 
ATOM   7662 C  C5    . DC  B 2 14  ? 35.860  -1.768  35.643  1.00 45.52  ? 16   DC  T C5    1 
ATOM   7663 C  C6    . DC  B 2 14  ? 35.609  -3.000  35.172  1.00 46.47  ? 16   DC  T C6    1 
ATOM   7664 P  P     . DG  B 2 15  ? 35.601  -8.085  30.589  1.00 50.27  ? 17   DG  T P     1 
ATOM   7665 O  OP1   . DG  B 2 15  ? 34.453  -8.290  29.674  1.00 52.89  ? 17   DG  T OP1   1 
ATOM   7666 O  OP2   . DG  B 2 15  ? 36.278  -9.249  31.200  1.00 50.20  ? 17   DG  T OP2   1 
ATOM   7667 O  "O5'" . DG  B 2 15  ? 36.733  -7.221  29.852  1.00 50.06  ? 17   DG  T "O5'" 1 
ATOM   7668 C  "C5'" . DG  B 2 15  ? 36.491  -6.552  28.619  1.00 47.01  ? 17   DG  T "C5'" 1 
ATOM   7669 C  "C4'" . DG  B 2 15  ? 37.483  -5.418  28.391  1.00 44.70  ? 17   DG  T "C4'" 1 
ATOM   7670 O  "O4'" . DG  B 2 15  ? 37.457  -4.456  29.470  1.00 45.89  ? 17   DG  T "O4'" 1 
ATOM   7671 C  "C3'" . DG  B 2 15  ? 38.933  -5.840  28.288  1.00 44.16  ? 17   DG  T "C3'" 1 
ATOM   7672 O  "O3'" . DG  B 2 15  ? 39.148  -6.141  26.926  1.00 44.33  ? 17   DG  T "O3'" 1 
ATOM   7673 C  "C2'" . DG  B 2 15  ? 39.719  -4.596  28.706  1.00 45.81  ? 17   DG  T "C2'" 1 
ATOM   7674 C  "C1'" . DG  B 2 15  ? 38.728  -3.824  29.571  1.00 46.76  ? 17   DG  T "C1'" 1 
ATOM   7675 N  N9    . DG  B 2 15  ? 39.037  -3.789  30.995  1.00 43.70  ? 17   DG  T N9    1 
ATOM   7676 C  C8    . DG  B 2 15  ? 39.402  -4.842  31.804  1.00 46.79  ? 17   DG  T C8    1 
ATOM   7677 N  N7    . DG  B 2 15  ? 39.589  -4.498  33.053  1.00 45.40  ? 17   DG  T N7    1 
ATOM   7678 C  C5    . DG  B 2 15  ? 39.319  -3.137  33.066  1.00 42.50  ? 17   DG  T C5    1 
ATOM   7679 C  C6    . DG  B 2 15  ? 39.356  -2.214  34.137  1.00 44.05  ? 17   DG  T C6    1 
ATOM   7680 O  O6    . DG  B 2 15  ? 39.635  -2.439  35.327  1.00 45.10  ? 17   DG  T O6    1 
ATOM   7681 N  N1    . DG  B 2 15  ? 39.020  -0.921  33.721  1.00 43.75  ? 17   DG  T N1    1 
ATOM   7682 C  C2    . DG  B 2 15  ? 38.687  -0.573  32.430  1.00 44.26  ? 17   DG  T C2    1 
ATOM   7683 N  N2    . DG  B 2 15  ? 38.389  0.718   32.208  1.00 45.87  ? 17   DG  T N2    1 
ATOM   7684 N  N3    . DG  B 2 15  ? 38.650  -1.436  31.420  1.00 42.40  ? 17   DG  T N3    1 
ATOM   7685 C  C4    . DG  B 2 15  ? 38.976  -2.690  31.810  1.00 41.66  ? 17   DG  T C4    1 
ATOM   7686 P  P     . DG  B 2 16  ? 40.475  -6.840  26.412  1.00 40.57  ? 18   DG  T P     1 
ATOM   7687 O  OP1   . DG  B 2 16  ? 41.483  -5.800  26.133  1.00 41.64  ? 18   DG  T OP1   1 
ATOM   7688 O  OP2   . DG  B 2 16  ? 40.066  -7.789  25.357  1.00 45.72  ? 18   DG  T OP2   1 
ATOM   7689 O  "O5'" . DG  B 2 16  ? 40.945  -7.673  27.697  1.00 44.37  ? 18   DG  T "O5'" 1 
ATOM   7690 C  "C5'" . DG  B 2 16  ? 42.320  -8.023  27.848  1.00 41.22  ? 18   DG  T "C5'" 1 
ATOM   7691 C  "C4'" . DG  B 2 16  ? 42.806  -7.665  29.242  1.00 38.63  ? 18   DG  T "C4'" 1 
ATOM   7692 O  "O4'" . DG  B 2 16  ? 44.145  -8.180  29.406  1.00 36.16  ? 18   DG  T "O4'" 1 
ATOM   7693 C  "C3'" . DG  B 2 16  ? 42.910  -6.180  29.566  1.00 36.45  ? 18   DG  T "C3'" 1 
ATOM   7694 O  "O3'" . DG  B 2 16  ? 42.543  -5.970  30.931  1.00 35.54  ? 18   DG  T "O3'" 1 
ATOM   7695 C  "C2'" . DG  B 2 16  ? 44.380  -5.849  29.291  1.00 35.86  ? 18   DG  T "C2'" 1 
ATOM   7696 C  "C1'" . DG  B 2 16  ? 45.048  -7.140  29.744  1.00 34.21  ? 18   DG  T "C1'" 1 
ATOM   7697 N  N9    . DG  B 2 16  ? 46.352  -7.473  29.163  1.00 31.54  ? 18   DG  T N9    1 
ATOM   7698 C  C8    . DG  B 2 16  ? 47.473  -7.772  29.897  1.00 30.45  ? 18   DG  T C8    1 
ATOM   7699 N  N7    . DG  B 2 16  ? 48.513  -8.061  29.172  1.00 32.73  ? 18   DG  T N7    1 
ATOM   7700 C  C5    . DG  B 2 16  ? 48.056  -7.962  27.858  1.00 35.17  ? 18   DG  T C5    1 
ATOM   7701 C  C6    . DG  B 2 16  ? 48.746  -8.170  26.624  1.00 35.69  ? 18   DG  T C6    1 
ATOM   7702 O  O6    . DG  B 2 16  ? 49.931  -8.493  26.439  1.00 34.63  ? 18   DG  T O6    1 
ATOM   7703 N  N1    . DG  B 2 16  ? 47.926  -7.970  25.515  1.00 35.16  ? 18   DG  T N1    1 
ATOM   7704 C  C2    . DG  B 2 16  ? 46.599  -7.616  25.587  1.00 38.64  ? 18   DG  T C2    1 
ATOM   7705 N  N2    . DG  B 2 16  ? 45.974  -7.467  24.405  1.00 42.18  ? 18   DG  T N2    1 
ATOM   7706 N  N3    . DG  B 2 16  ? 45.938  -7.424  26.732  1.00 37.55  ? 18   DG  T N3    1 
ATOM   7707 C  C4    . DG  B 2 16  ? 46.721  -7.608  27.835  1.00 33.48  ? 18   DG  T C4    1 
ATOM   7708 O  "O5'" . DC  C 3 1   ? 36.036  11.990  28.914  1.00 133.29 ? 103  DC  P "O5'" 1 
ATOM   7709 C  "C5'" . DC  C 3 1   ? 36.745  11.327  29.961  1.00 133.59 ? 103  DC  P "C5'" 1 
ATOM   7710 C  "C4'" . DC  C 3 1   ? 36.655  9.808   29.880  1.00 133.61 ? 103  DC  P "C4'" 1 
ATOM   7711 O  "O4'" . DC  C 3 1   ? 36.714  9.261   31.222  1.00 135.01 ? 103  DC  P "O4'" 1 
ATOM   7712 C  "C3'" . DC  C 3 1   ? 35.386  9.263   29.235  1.00 132.69 ? 103  DC  P "C3'" 1 
ATOM   7713 O  "O3'" . DC  C 3 1   ? 35.709  8.709   27.969  1.00 130.12 ? 103  DC  P "O3'" 1 
ATOM   7714 C  "C2'" . DC  C 3 1   ? 34.848  8.188   30.179  1.00 134.00 ? 103  DC  P "C2'" 1 
ATOM   7715 C  "C1'" . DC  C 3 1   ? 35.730  8.259   31.425  1.00 135.38 ? 103  DC  P "C1'" 1 
ATOM   7716 N  N1    . DC  C 3 1   ? 34.974  8.526   32.717  1.00 136.07 ? 103  DC  P N1    1 
ATOM   7717 C  C2    . DC  C 3 1   ? 34.971  7.568   33.756  1.00 136.38 ? 103  DC  P C2    1 
ATOM   7718 O  O2    . DC  C 3 1   ? 35.587  6.500   33.625  1.00 136.63 ? 103  DC  P O2    1 
ATOM   7719 N  N3    . DC  C 3 1   ? 34.285  7.840   34.901  1.00 136.17 ? 103  DC  P N3    1 
ATOM   7720 C  C4    . DC  C 3 1   ? 33.625  8.996   35.038  1.00 136.04 ? 103  DC  P C4    1 
ATOM   7721 N  N4    . DC  C 3 1   ? 32.968  9.210   36.183  1.00 135.61 ? 103  DC  P N4    1 
ATOM   7722 C  C5    . DC  C 3 1   ? 33.610  9.982   34.001  1.00 136.01 ? 103  DC  P C5    1 
ATOM   7723 C  C6    . DC  C 3 1   ? 34.289  9.707   32.876  1.00 136.08 ? 103  DC  P C6    1 
ATOM   7724 P  P     . DG  C 3 2   ? 34.711  8.897   26.729  1.00 128.28 ? 104  DG  P P     1 
ATOM   7725 O  OP1   . DG  C 3 2   ? 34.739  10.324  26.336  1.00 128.60 ? 104  DG  P OP1   1 
ATOM   7726 O  OP2   . DG  C 3 2   ? 33.424  8.258   27.087  1.00 128.47 ? 104  DG  P OP2   1 
ATOM   7727 O  "O5'" . DG  C 3 2   ? 35.380  8.021   25.563  1.00 125.15 ? 104  DG  P "O5'" 1 
ATOM   7728 C  "C5'" . DG  C 3 2   ? 36.661  7.405   25.729  1.00 119.83 ? 104  DG  P "C5'" 1 
ATOM   7729 C  "C4'" . DG  C 3 2   ? 36.584  5.892   25.878  1.00 115.68 ? 104  DG  P "C4'" 1 
ATOM   7730 O  "O4'" . DG  C 3 2   ? 37.157  5.492   27.148  1.00 114.26 ? 104  DG  P "O4'" 1 
ATOM   7731 C  "C3'" . DG  C 3 2   ? 35.201  5.254   25.915  1.00 113.83 ? 104  DG  P "C3'" 1 
ATOM   7732 O  "O3'" . DG  C 3 2   ? 34.638  5.191   24.588  1.00 111.06 ? 104  DG  P "O3'" 1 
ATOM   7733 C  "C2'" . DG  C 3 2   ? 35.539  3.888   26.512  1.00 113.33 ? 104  DG  P "C2'" 1 
ATOM   7734 C  "C1'" . DG  C 3 2   ? 36.729  4.170   27.428  1.00 111.93 ? 104  DG  P "C1'" 1 
ATOM   7735 N  N9    . DG  C 3 2   ? 36.398  4.031   28.848  1.00 108.83 ? 104  DG  P N9    1 
ATOM   7736 C  C8    . DG  C 3 2   ? 36.329  5.038   29.781  1.00 107.59 ? 104  DG  P C8    1 
ATOM   7737 N  N7    . DG  C 3 2   ? 36.013  4.626   30.976  1.00 106.51 ? 104  DG  P N7    1 
ATOM   7738 C  C5    . DG  C 3 2   ? 35.859  3.253   30.834  1.00 104.86 ? 104  DG  P C5    1 
ATOM   7739 C  C6    . DG  C 3 2   ? 35.517  2.268   31.796  1.00 102.62 ? 104  DG  P C6    1 
ATOM   7740 O  O6    . DG  C 3 2   ? 35.277  2.431   32.999  1.00 101.06 ? 104  DG  P O6    1 
ATOM   7741 N  N1    . DG  C 3 2   ? 35.466  0.985   31.244  1.00 101.44 ? 104  DG  P N1    1 
ATOM   7742 C  C2    . DG  C 3 2   ? 35.718  0.691   29.922  1.00 101.57 ? 104  DG  P C2    1 
ATOM   7743 N  N2    . DG  C 3 2   ? 35.622  -0.599  29.569  1.00 99.10  ? 104  DG  P N2    1 
ATOM   7744 N  N3    . DG  C 3 2   ? 36.039  1.606   29.011  1.00 104.18 ? 104  DG  P N3    1 
ATOM   7745 C  C4    . DG  C 3 2   ? 36.093  2.866   29.530  1.00 106.22 ? 104  DG  P C4    1 
ATOM   7746 P  P     . DC  C 3 3   ? 33.511  4.131   24.145  1.00 109.33 ? 105  DC  P P     1 
ATOM   7747 O  OP1   . DC  C 3 3   ? 33.212  4.370   22.712  1.00 108.60 ? 105  DC  P OP1   1 
ATOM   7748 O  OP2   . DC  C 3 3   ? 32.412  4.155   25.139  1.00 107.84 ? 105  DC  P OP2   1 
ATOM   7749 O  "O5'" . DC  C 3 3   ? 34.288  2.736   24.298  1.00 106.13 ? 105  DC  P "O5'" 1 
ATOM   7750 C  "C5'" . DC  C 3 3   ? 33.890  1.564   23.603  1.00 100.24 ? 105  DC  P "C5'" 1 
ATOM   7751 C  "C4'" . DC  C 3 3   ? 33.225  0.554   24.525  1.00 94.36  ? 105  DC  P "C4'" 1 
ATOM   7752 O  "O4'" . DC  C 3 3   ? 33.753  0.591   25.877  1.00 91.25  ? 105  DC  P "O4'" 1 
ATOM   7753 C  "C3'" . DC  C 3 3   ? 31.737  0.764   24.740  1.00 91.36  ? 105  DC  P "C3'" 1 
ATOM   7754 O  "O3'" . DC  C 3 3   ? 31.033  0.490   23.512  1.00 89.72  ? 105  DC  P "O3'" 1 
ATOM   7755 C  "C2'" . DC  C 3 3   ? 31.531  -0.230  25.881  1.00 90.02  ? 105  DC  P "C2'" 1 
ATOM   7756 C  "C1'" . DC  C 3 3   ? 32.791  -0.023  26.724  1.00 88.91  ? 105  DC  P "C1'" 1 
ATOM   7757 N  N1    . DC  C 3 3   ? 32.546  0.780   27.992  1.00 85.16  ? 105  DC  P N1    1 
ATOM   7758 C  C2    . DC  C 3 3   ? 32.150  0.122   29.177  1.00 81.05  ? 105  DC  P C2    1 
ATOM   7759 O  O2    . DC  C 3 3   ? 32.004  -1.108  29.190  1.00 77.64  ? 105  DC  P O2    1 
ATOM   7760 N  N3    . DC  C 3 3   ? 31.939  0.860   30.300  1.00 79.24  ? 105  DC  P N3    1 
ATOM   7761 C  C4    . DC  C 3 3   ? 32.100  2.189   30.277  1.00 80.33  ? 105  DC  P C4    1 
ATOM   7762 N  N4    . DC  C 3 3   ? 31.880  2.868   31.407  1.00 77.75  ? 105  DC  P N4    1 
ATOM   7763 C  C5    . DC  C 3 3   ? 32.499  2.880   29.090  1.00 81.52  ? 105  DC  P C5    1 
ATOM   7764 C  C6    . DC  C 3 3   ? 32.706  2.143   27.988  1.00 84.08  ? 105  DC  P C6    1 
ATOM   7765 P  P     . DG  C 3 4   ? 29.671  -0.350  23.376  1.00 87.67  ? 106  DG  P P     1 
ATOM   7766 O  OP1   . DG  C 3 4   ? 29.382  -0.475  21.928  1.00 87.97  ? 106  DG  P OP1   1 
ATOM   7767 O  OP2   . DG  C 3 4   ? 28.654  0.245   24.274  1.00 87.38  ? 106  DG  P OP2   1 
ATOM   7768 O  "O5'" . DG  C 3 4   ? 30.074  -1.797  23.932  1.00 85.17  ? 106  DG  P "O5'" 1 
ATOM   7769 C  "C5'" . DG  C 3 4   ? 29.214  -2.911  23.747  1.00 79.20  ? 106  DG  P "C5'" 1 
ATOM   7770 C  "C4'" . DG  C 3 4   ? 28.676  -3.450  25.063  1.00 75.17  ? 106  DG  P "C4'" 1 
ATOM   7771 O  "O4'" . DG  C 3 4   ? 29.151  -2.700  26.213  1.00 70.98  ? 106  DG  P "O4'" 1 
ATOM   7772 C  "C3'" . DG  C 3 4   ? 27.155  -3.426  25.146  1.00 75.29  ? 106  DG  P "C3'" 1 
ATOM   7773 O  "O3'" . DG  C 3 4   ? 26.707  -4.734  25.476  1.00 77.81  ? 106  DG  P "O3'" 1 
ATOM   7774 C  "C2'" . DG  C 3 4   ? 26.845  -2.408  26.243  1.00 71.20  ? 106  DG  P "C2'" 1 
ATOM   7775 C  "C1'" . DG  C 3 4   ? 28.079  -2.536  27.122  1.00 67.93  ? 106  DG  P "C1'" 1 
ATOM   7776 N  N9    . DG  C 3 4   ? 28.345  -1.382  27.986  1.00 63.37  ? 106  DG  P N9    1 
ATOM   7777 C  C8    . DG  C 3 4   ? 28.589  -0.084  27.601  1.00 61.21  ? 106  DG  P C8    1 
ATOM   7778 N  N7    . DG  C 3 4   ? 28.802  0.731   28.596  1.00 60.40  ? 106  DG  P N7    1 
ATOM   7779 C  C5    . DG  C 3 4   ? 28.693  -0.079  29.721  1.00 59.41  ? 106  DG  P C5    1 
ATOM   7780 C  C6    . DG  C 3 4   ? 28.820  0.239   31.099  1.00 57.00  ? 106  DG  P C6    1 
ATOM   7781 O  O6    . DG  C 3 4   ? 29.068  1.341   31.601  1.00 57.18  ? 106  DG  P O6    1 
ATOM   7782 N  N1    . DG  C 3 4   ? 28.635  -0.869  31.927  1.00 53.86  ? 106  DG  P N1    1 
ATOM   7783 C  C2    . DG  C 3 4   ? 28.355  -2.138  31.474  1.00 55.28  ? 106  DG  P C2    1 
ATOM   7784 N  N2    . DG  C 3 4   ? 28.199  -3.089  32.407  1.00 51.38  ? 106  DG  P N2    1 
ATOM   7785 N  N3    . DG  C 3 4   ? 28.227  -2.449  30.184  1.00 57.42  ? 106  DG  P N3    1 
ATOM   7786 C  C4    . DG  C 3 4   ? 28.411  -1.381  29.364  1.00 59.78  ? 106  DG  P C4    1 
ATOM   7787 P  P     . DC  C 3 5   ? 25.197  -5.189  25.210  1.00 80.47  ? 107  DC  P P     1 
ATOM   7788 O  OP1   . DC  C 3 5   ? 25.231  -6.453  24.436  1.00 78.50  ? 107  DC  P OP1   1 
ATOM   7789 O  OP2   . DC  C 3 5   ? 24.435  -4.018  24.708  1.00 79.49  ? 107  DC  P OP2   1 
ATOM   7790 O  "O5'" . DC  C 3 5   ? 24.674  -5.504  26.689  1.00 78.21  ? 107  DC  P "O5'" 1 
ATOM   7791 C  "C5'" . DC  C 3 5   ? 25.284  -6.495  27.512  1.00 72.79  ? 107  DC  P "C5'" 1 
ATOM   7792 C  "C4'" . DC  C 3 5   ? 24.694  -6.412  28.909  1.00 70.14  ? 107  DC  P "C4'" 1 
ATOM   7793 O  "O4'" . DC  C 3 5   ? 25.188  -5.226  29.582  1.00 67.19  ? 107  DC  P "O4'" 1 
ATOM   7794 C  "C3'" . DC  C 3 5   ? 23.174  -6.310  28.960  1.00 69.78  ? 107  DC  P "C3'" 1 
ATOM   7795 O  "O3'" . DC  C 3 5   ? 22.692  -7.190  29.964  1.00 71.81  ? 107  DC  P "O3'" 1 
ATOM   7796 C  "C2'" . DC  C 3 5   ? 22.896  -4.841  29.295  1.00 66.75  ? 107  DC  P "C2'" 1 
ATOM   7797 C  "C1'" . DC  C 3 5   ? 24.113  -4.506  30.151  1.00 62.34  ? 107  DC  P "C1'" 1 
ATOM   7798 N  N1    . DC  C 3 5   ? 24.511  -3.056  30.207  1.00 55.36  ? 107  DC  P N1    1 
ATOM   7799 C  C2    . DC  C 3 5   ? 24.839  -2.482  31.449  1.00 49.03  ? 107  DC  P C2    1 
ATOM   7800 O  O2    . DC  C 3 5   ? 24.781  -3.177  32.470  1.00 44.12  ? 107  DC  P O2    1 
ATOM   7801 N  N3    . DC  C 3 5   ? 25.209  -1.174  31.494  1.00 46.26  ? 107  DC  P N3    1 
ATOM   7802 C  C4    . DC  C 3 5   ? 25.264  -0.454  30.365  1.00 47.56  ? 107  DC  P C4    1 
ATOM   7803 N  N4    . DC  C 3 5   ? 25.630  0.828   30.451  1.00 45.86  ? 107  DC  P N4    1 
ATOM   7804 C  C5    . DC  C 3 5   ? 24.940  -1.016  29.093  1.00 48.03  ? 107  DC  P C5    1 
ATOM   7805 C  C6    . DC  C 3 5   ? 24.576  -2.307  29.062  1.00 52.19  ? 107  DC  P C6    1 
ATOM   7806 P  P     . DG  C 3 6   ? 21.144  -7.594  29.996  1.00 73.86  ? 108  DG  P P     1 
ATOM   7807 O  OP1   . DG  C 3 6   ? 21.089  -9.049  30.277  1.00 74.48  ? 108  DG  P OP1   1 
ATOM   7808 O  OP2   . DG  C 3 6   ? 20.461  -7.028  28.806  1.00 72.28  ? 108  DG  P OP2   1 
ATOM   7809 O  "O5'" . DG  C 3 6   ? 20.613  -6.790  31.263  1.00 68.80  ? 108  DG  P "O5'" 1 
ATOM   7810 C  "C5'" . DG  C 3 6   ? 21.147  -7.062  32.554  1.00 66.97  ? 108  DG  P "C5'" 1 
ATOM   7811 C  "C4'" . DG  C 3 6   ? 20.638  -6.033  33.545  1.00 64.38  ? 108  DG  P "C4'" 1 
ATOM   7812 O  "O4'" . DG  C 3 6   ? 21.283  -4.764  33.270  1.00 61.47  ? 108  DG  P "O4'" 1 
ATOM   7813 C  "C3'" . DG  C 3 6   ? 19.129  -5.784  33.502  1.00 63.18  ? 108  DG  P "C3'" 1 
ATOM   7814 O  "O3'" . DG  C 3 6   ? 18.620  -5.849  34.836  1.00 64.86  ? 108  DG  P "O3'" 1 
ATOM   7815 C  "C2'" . DG  C 3 6   ? 19.001  -4.405  32.851  1.00 60.84  ? 108  DG  P "C2'" 1 
ATOM   7816 C  "C1'" . DG  C 3 6   ? 20.314  -3.742  33.250  1.00 58.83  ? 108  DG  P "C1'" 1 
ATOM   7817 N  N9    . DG  C 3 6   ? 20.770  -2.688  32.343  1.00 56.10  ? 108  DG  P N9    1 
ATOM   7818 C  C8    . DG  C 3 6   ? 20.782  -2.698  30.967  1.00 53.35  ? 108  DG  P C8    1 
ATOM   7819 N  N7    . DG  C 3 6   ? 21.254  -1.599  30.444  1.00 50.53  ? 108  DG  P N7    1 
ATOM   7820 C  C5    . DG  C 3 6   ? 21.571  -0.806  31.544  1.00 50.05  ? 108  DG  P C5    1 
ATOM   7821 C  C6    . DG  C 3 6   ? 22.126  0.499   31.617  1.00 46.73  ? 108  DG  P C6    1 
ATOM   7822 O  O6    . DG  C 3 6   ? 22.444  1.244   30.682  1.00 46.86  ? 108  DG  P O6    1 
ATOM   7823 N  N1    . DG  C 3 6   ? 22.292  0.936   32.931  1.00 45.94  ? 108  DG  P N1    1 
ATOM   7824 C  C2    . DG  C 3 6   ? 21.964  0.197   34.046  1.00 47.37  ? 108  DG  P C2    1 
ATOM   7825 N  N2    . DG  C 3 6   ? 22.183  0.760   35.242  1.00 45.06  ? 108  DG  P N2    1 
ATOM   7826 N  N3    . DG  C 3 6   ? 21.447  -1.026  33.991  1.00 51.35  ? 108  DG  P N3    1 
ATOM   7827 C  C4    . DG  C 3 6   ? 21.280  -1.464  32.717  1.00 51.21  ? 108  DG  P C4    1 
ATOM   7828 P  P     . DG  C 3 7   ? 17.114  -5.476  35.239  1.00 68.18  ? 109  DG  P P     1 
ATOM   7829 O  OP1   . DG  C 3 7   ? 16.758  -6.326  36.401  1.00 68.75  ? 109  DG  P OP1   1 
ATOM   7830 O  OP2   . DG  C 3 7   ? 16.262  -5.482  34.027  1.00 65.57  ? 109  DG  P OP2   1 
ATOM   7831 O  "O5'" . DG  C 3 7   ? 17.247  -3.962  35.749  1.00 65.66  ? 109  DG  P "O5'" 1 
ATOM   7832 C  "C5'" . DG  C 3 7   ? 18.090  -3.649  36.866  1.00 63.80  ? 109  DG  P "C5'" 1 
ATOM   7833 C  "C4'" . DG  C 3 7   ? 17.771  -2.292  37.490  1.00 63.19  ? 109  DG  P "C4'" 1 
ATOM   7834 O  "O4'" . DG  C 3 7   ? 18.435  -1.206  36.778  1.00 60.61  ? 109  DG  P "O4'" 1 
ATOM   7835 C  "C3'" . DG  C 3 7   ? 16.298  -1.912  37.547  1.00 62.50  ? 109  DG  P "C3'" 1 
ATOM   7836 O  "O3'" . DG  C 3 7   ? 16.069  -1.238  38.785  1.00 65.26  ? 109  DG  P "O3'" 1 
ATOM   7837 C  "C2'" . DG  C 3 7   ? 16.119  -1.023  36.312  1.00 59.87  ? 109  DG  P "C2'" 1 
ATOM   7838 C  "C1'" . DG  C 3 7   ? 17.478  -0.327  36.207  1.00 57.92  ? 109  DG  P "C1'" 1 
ATOM   7839 N  N9    . DG  C 3 7   ? 17.894  0.000   34.840  1.00 53.63  ? 109  DG  P N9    1 
ATOM   7840 C  C8    . DG  C 3 7   ? 17.778  -0.807  33.729  1.00 52.19  ? 109  DG  P C8    1 
ATOM   7841 N  N7    . DG  C 3 7   ? 18.237  -0.257  32.636  1.00 52.05  ? 109  DG  P N7    1 
ATOM   7842 C  C5    . DG  C 3 7   ? 18.692  0.991   33.039  1.00 47.77  ? 109  DG  P C5    1 
ATOM   7843 C  C6    . DG  C 3 7   ? 19.292  2.024   32.278  1.00 47.66  ? 109  DG  P C6    1 
ATOM   7844 O  O6    . DG  C 3 7   ? 19.553  2.034   31.062  1.00 49.37  ? 109  DG  P O6    1 
ATOM   7845 N  N1    . DG  C 3 7   ? 19.604  3.132   33.063  1.00 44.91  ? 109  DG  P N1    1 
ATOM   7846 C  C2    . DG  C 3 7   ? 19.366  3.222   34.415  1.00 44.56  ? 109  DG  P C2    1 
ATOM   7847 N  N2    . DG  C 3 7   ? 19.737  4.367   34.996  1.00 39.31  ? 109  DG  P N2    1 
ATOM   7848 N  N3    . DG  C 3 7   ? 18.801  2.260   35.143  1.00 47.53  ? 109  DG  P N3    1 
ATOM   7849 C  C4    . DG  C 3 7   ? 18.487  1.170   34.393  1.00 49.74  ? 109  DG  P C4    1 
ATOM   7850 P  P     . DC  C 3 8   ? 14.642  -0.615  39.189  1.00 70.22  ? 110  DC  P P     1 
ATOM   7851 O  OP1   . DC  C 3 8   ? 14.690  -0.454  40.663  1.00 69.98  ? 110  DC  P OP1   1 
ATOM   7852 O  OP2   . DC  C 3 8   ? 13.555  -1.395  38.540  1.00 66.80  ? 110  DC  P OP2   1 
ATOM   7853 O  "O5'" . DC  C 3 8   ? 14.643  0.836   38.504  1.00 65.80  ? 110  DC  P "O5'" 1 
ATOM   7854 C  "C5'" . DC  C 3 8   ? 15.714  1.753   38.759  1.00 60.92  ? 110  DC  P "C5'" 1 
ATOM   7855 C  "C4'" . DC  C 3 8   ? 15.604  2.981   37.873  1.00 55.41  ? 110  DC  P "C4'" 1 
ATOM   7856 O  "O4'" . DC  C 3 8   ? 15.985  2.686   36.514  1.00 53.50  ? 110  DC  P "O4'" 1 
ATOM   7857 C  "C3'" . DC  C 3 8   ? 14.198  3.548   37.763  1.00 52.91  ? 110  DC  P "C3'" 1 
ATOM   7858 O  "O3'" . DC  C 3 8   ? 14.172  4.638   38.669  1.00 50.03  ? 110  DC  P "O3'" 1 
ATOM   7859 C  "C2'" . DC  C 3 8   ? 14.030  3.927   36.283  1.00 48.92  ? 110  DC  P "C2'" 1 
ATOM   7860 C  "C1'" . DC  C 3 8   ? 15.418  3.683   35.695  1.00 47.11  ? 110  DC  P "C1'" 1 
ATOM   7861 N  N1    . DC  C 3 8   ? 15.523  3.230   34.250  1.00 42.85  ? 110  DC  P N1    1 
ATOM   7862 C  C2    . DC  C 3 8   ? 16.148  4.058   33.297  1.00 41.60  ? 110  DC  P C2    1 
ATOM   7863 O  O2    . DC  C 3 8   ? 16.594  5.157   33.637  1.00 39.64  ? 110  DC  P O2    1 
ATOM   7864 N  N3    . DC  C 3 8   ? 16.251  3.636   32.011  1.00 42.19  ? 110  DC  P N3    1 
ATOM   7865 C  C4    . DC  C 3 8   ? 15.759  2.443   31.656  1.00 42.55  ? 110  DC  P C4    1 
ATOM   7866 N  N4    . DC  C 3 8   ? 15.885  2.065   30.375  1.00 38.53  ? 110  DC  P N4    1 
ATOM   7867 C  C5    . DC  C 3 8   ? 15.118  1.584   32.608  1.00 40.86  ? 110  DC  P C5    1 
ATOM   7868 C  C6    . DC  C 3 8   ? 15.036  2.008   33.874  1.00 39.88  ? 110  DC  P C6    1 
ATOM   7869 P  P     . DG  C 3 9   ? 12.831  5.405   39.038  1.00 49.60  ? 111  DG  P P     1 
ATOM   7870 O  OP1   . DG  C 3 9   ? 13.058  6.071   40.338  1.00 49.24  ? 111  DG  P OP1   1 
ATOM   7871 O  OP2   . DG  C 3 9   ? 11.680  4.487   38.849  1.00 52.30  ? 111  DG  P OP2   1 
ATOM   7872 O  "O5'" . DG  C 3 9   ? 12.726  6.507   37.876  1.00 48.58  ? 111  DG  P "O5'" 1 
ATOM   7873 C  "C5'" . DG  C 3 9   ? 13.839  7.332   37.551  1.00 46.77  ? 111  DG  P "C5'" 1 
ATOM   7874 C  "C4'" . DG  C 3 9   ? 13.553  8.155   36.313  1.00 45.47  ? 111  DG  P "C4'" 1 
ATOM   7875 O  "O4'" . DG  C 3 9   ? 13.814  7.398   35.103  1.00 45.69  ? 111  DG  P "O4'" 1 
ATOM   7876 C  "C3'" . DG  C 3 9   ? 12.116  8.638   36.211  1.00 44.59  ? 111  DG  P "C3'" 1 
ATOM   7877 O  "O3'" . DG  C 3 9   ? 12.228  10.020  36.055  1.00 43.10  ? 111  DG  P "O3'" 1 
ATOM   7878 C  "C2'" . DG  C 3 9   ? 11.549  7.923   34.979  1.00 45.03  ? 111  DG  P "C2'" 1 
ATOM   7879 C  "C1'" . DG  C 3 9   ? 12.805  7.671   34.153  1.00 43.85  ? 111  DG  P "C1'" 1 
ATOM   7880 N  N9    . DG  C 3 9   ? 12.789  6.511   33.270  1.00 42.86  ? 111  DG  P N9    1 
ATOM   7881 C  C8    . DG  C 3 9   ? 12.256  5.272   33.534  1.00 38.67  ? 111  DG  P C8    1 
ATOM   7882 N  N7    . DG  C 3 9   ? 12.428  4.432   32.553  1.00 43.48  ? 111  DG  P N7    1 
ATOM   7883 C  C5    . DG  C 3 9   ? 13.127  5.141   31.576  1.00 41.00  ? 111  DG  P C5    1 
ATOM   7884 C  C6    . DG  C 3 9   ? 13.591  4.756   30.286  1.00 41.95  ? 111  DG  P C6    1 
ATOM   7885 O  O6    . DG  C 3 9   ? 13.485  3.665   29.708  1.00 45.77  ? 111  DG  P O6    1 
ATOM   7886 N  N1    . DG  C 3 9   ? 14.249  5.789   29.625  1.00 40.26  ? 111  DG  P N1    1 
ATOM   7887 C  C2    . DG  C 3 9   ? 14.430  7.049   30.142  1.00 37.73  ? 111  DG  P C2    1 
ATOM   7888 N  N2    . DG  C 3 9   ? 15.087  7.913   29.358  1.00 35.08  ? 111  DG  P N2    1 
ATOM   7889 N  N3    . DG  C 3 9   ? 14.004  7.425   31.345  1.00 36.96  ? 111  DG  P N3    1 
ATOM   7890 C  C4    . DG  C 3 9   ? 13.359  6.429   32.009  1.00 41.85  ? 111  DG  P C4    1 
ATOM   7891 P  P     . DG  C 3 10  ? 10.964  10.979  35.958  1.00 43.89  ? 112  DG  P P     1 
ATOM   7892 O  OP1   . DG  C 3 10  ? 11.426  12.282  36.482  1.00 44.89  ? 112  DG  P OP1   1 
ATOM   7893 O  OP2   . DG  C 3 10  ? 9.731   10.318  36.446  1.00 42.86  ? 112  DG  P OP2   1 
ATOM   7894 O  "O5'" . DG  C 3 10  ? 10.788  11.094  34.375  1.00 42.36  ? 112  DG  P "O5'" 1 
ATOM   7895 C  "C5'" . DG  C 3 10  ? 11.853  11.570  33.570  1.00 41.89  ? 112  DG  P "C5'" 1 
ATOM   7896 C  "C4'" . DG  C 3 10  ? 11.481  11.373  32.115  1.00 43.23  ? 112  DG  P "C4'" 1 
ATOM   7897 O  "O4'" . DG  C 3 10  ? 11.651  9.981   31.743  1.00 39.91  ? 112  DG  P "O4'" 1 
ATOM   7898 C  "C3'" . DG  C 3 10  ? 10.033  11.739  31.783  1.00 41.62  ? 112  DG  P "C3'" 1 
ATOM   7899 O  "O3'" . DG  C 3 10  ? 10.086  12.810  30.867  1.00 40.96  ? 112  DG  P "O3'" 1 
ATOM   7900 C  "C2'" . DG  C 3 10  ? 9.478   10.462  31.164  1.00 39.84  ? 112  DG  P "C2'" 1 
ATOM   7901 C  "C1'" . DG  C 3 10  ? 10.747  9.745   30.706  1.00 38.49  ? 112  DG  P "C1'" 1 
ATOM   7902 N  N9    . DG  C 3 10  ? 10.555  8.312   30.497  1.00 39.49  ? 112  DG  P N9    1 
ATOM   7903 C  C8    . DG  C 3 10  ? 9.935   7.421   31.341  1.00 39.77  ? 112  DG  P C8    1 
ATOM   7904 N  N7    . DG  C 3 10  ? 9.888   6.204   30.884  1.00 40.30  ? 112  DG  P N7    1 
ATOM   7905 C  C5    . DG  C 3 10  ? 10.512  6.292   29.645  1.00 39.41  ? 112  DG  P C5    1 
ATOM   7906 C  C6    . DG  C 3 10  ? 10.755  5.295   28.673  1.00 36.10  ? 112  DG  P C6    1 
ATOM   7907 O  O6    . DG  C 3 10  ? 10.462  4.102   28.723  1.00 36.48  ? 112  DG  P O6    1 
ATOM   7908 N  N1    . DG  C 3 10  ? 11.415  5.789   27.554  1.00 38.18  ? 112  DG  P N1    1 
ATOM   7909 C  C2    . DG  C 3 10  ? 11.791  7.098   27.386  1.00 39.77  ? 112  DG  P C2    1 
ATOM   7910 N  N2    . DG  C 3 10  ? 12.411  7.394   26.239  1.00 40.28  ? 112  DG  P N2    1 
ATOM   7911 N  N3    . DG  C 3 10  ? 11.567  8.050   28.286  1.00 41.36  ? 112  DG  P N3    1 
ATOM   7912 C  C4    . DG  C 3 10  ? 10.925  7.581   29.389  1.00 39.48  ? 112  DG  P C4    1 
ATOM   7913 P  P     . DC  C 3 11  ? 8.843   13.724  30.461  1.00 43.87  ? 113  DC  P P     1 
ATOM   7914 O  OP1   . DC  C 3 11  ? 9.182   15.069  30.964  1.00 41.46  ? 113  DC  P OP1   1 
ATOM   7915 O  OP2   . DC  C 3 11  ? 7.553   13.077  30.782  1.00 45.19  ? 113  DC  P OP2   1 
ATOM   7916 O  "O5'" . DC  C 3 11  ? 8.935   13.719  28.869  1.00 41.31  ? 113  DC  P "O5'" 1 
ATOM   7917 C  "C5'" . DC  C 3 11  ? 10.212  13.775  28.256  1.00 41.60  ? 113  DC  P "C5'" 1 
ATOM   7918 C  "C4'" . DC  C 3 11  ? 10.231  12.998  26.959  1.00 39.11  ? 113  DC  P "C4'" 1 
ATOM   7919 O  "O4'" . DC  C 3 11  ? 10.156  11.577  27.219  1.00 38.45  ? 113  DC  P "O4'" 1 
ATOM   7920 C  "C3'" . DC  C 3 11  ? 9.062   13.351  26.046  1.00 39.73  ? 113  DC  P "C3'" 1 
ATOM   7921 O  "O3'" . DC  C 3 11  ? 9.590   13.827  24.804  1.00 32.57  ? 113  DC  P "O3'" 1 
ATOM   7922 C  "C2'" . DC  C 3 11  ? 8.261   12.045  25.953  1.00 38.88  ? 113  DC  P "C2'" 1 
ATOM   7923 C  "C1'" . DC  C 3 11  ? 9.334   10.994  26.235  1.00 39.83  ? 113  DC  P "C1'" 1 
ATOM   7924 N  N1    . DC  C 3 11  ? 8.810   9.658   26.708  1.00 39.57  ? 113  DC  P N1    1 
ATOM   7925 C  C2    . DC  C 3 11  ? 9.077   8.507   25.940  1.00 40.11  ? 113  DC  P C2    1 
ATOM   7926 O  O2    . DC  C 3 11  ? 9.745   8.604   24.903  1.00 41.91  ? 113  DC  P O2    1 
ATOM   7927 N  N3    . DC  C 3 11  ? 8.599   7.302   26.357  1.00 38.77  ? 113  DC  P N3    1 
ATOM   7928 C  C4    . DC  C 3 11  ? 7.884   7.217   27.485  1.00 37.09  ? 113  DC  P C4    1 
ATOM   7929 N  N4    . DC  C 3 11  ? 7.448   6.005   27.845  1.00 28.31  ? 113  DC  P N4    1 
ATOM   7930 C  C5    . DC  C 3 11  ? 7.587   8.375   28.283  1.00 38.76  ? 113  DC  P C5    1 
ATOM   7931 C  C6    . DC  C 3 11  ? 8.065   9.562   27.861  1.00 39.99  ? 113  DC  P C6    1 
ATOM   7932 P  P     . DG  C 3 12  ? 8.631   14.496  23.726  1.00 39.82  ? 114  DG  P P     1 
ATOM   7933 O  OP1   . DG  C 3 12  ? 9.394   15.549  23.027  1.00 39.89  ? 114  DG  P OP1   1 
ATOM   7934 O  OP2   . DG  C 3 12  ? 7.327   14.793  24.357  1.00 42.21  ? 114  DG  P OP2   1 
ATOM   7935 O  "O5'" . DG  C 3 12  ? 8.394   13.302  22.691  1.00 35.46  ? 114  DG  P "O5'" 1 
ATOM   7936 C  "C5'" . DG  C 3 12  ? 9.543   12.641  22.194  1.00 39.88  ? 114  DG  P "C5'" 1 
ATOM   7937 C  "C4'" . DG  C 3 12  ? 9.187   11.779  21.006  1.00 41.26  ? 114  DG  P "C4'" 1 
ATOM   7938 O  "O4'" . DG  C 3 12  ? 8.818   10.460  21.481  1.00 42.53  ? 114  DG  P "O4'" 1 
ATOM   7939 C  "C3'" . DG  C 3 12  ? 8.017   12.278  20.177  1.00 42.22  ? 114  DG  P "C3'" 1 
ATOM   7940 O  "O3'" . DG  C 3 12  ? 8.366   12.074  18.808  1.00 43.64  ? 114  DG  P "O3'" 1 
ATOM   7941 C  "C2'" . DG  C 3 12  ? 6.824   11.451  20.682  1.00 40.12  ? 114  DG  P "C2'" 1 
ATOM   7942 C  "C1'" . DG  C 3 12  ? 7.484   10.151  21.139  1.00 39.31  ? 114  DG  P "C1'" 1 
ATOM   7943 N  N9    . DG  C 3 12  ? 6.898   9.503   22.314  1.00 37.03  ? 114  DG  P N9    1 
ATOM   7944 C  C8    . DG  C 3 12  ? 6.492   10.078  23.496  1.00 34.26  ? 114  DG  P C8    1 
ATOM   7945 N  N7    . DG  C 3 12  ? 6.014   9.215   24.355  1.00 36.34  ? 114  DG  P N7    1 
ATOM   7946 C  C5    . DG  C 3 12  ? 6.116   7.985   23.703  1.00 36.80  ? 114  DG  P C5    1 
ATOM   7947 C  C6    . DG  C 3 12  ? 5.761   6.669   24.115  1.00 35.49  ? 114  DG  P C6    1 
ATOM   7948 O  O6    . DG  C 3 12  ? 5.257   6.309   25.186  1.00 32.82  ? 114  DG  P O6    1 
ATOM   7949 N  N1    . DG  C 3 12  ? 6.034   5.712   23.134  1.00 32.95  ? 114  DG  P N1    1 
ATOM   7950 C  C2    . DG  C 3 12  ? 6.578   5.989   21.903  1.00 32.92  ? 114  DG  P C2    1 
ATOM   7951 N  N2    . DG  C 3 12  ? 6.785   4.954   21.072  1.00 31.16  ? 114  DG  P N2    1 
ATOM   7952 N  N3    . DG  C 3 12  ? 6.910   7.209   21.510  1.00 34.94  ? 114  DG  P N3    1 
ATOM   7953 C  C4    . DG  C 3 12  ? 6.658   8.153   22.448  1.00 35.23  ? 114  DG  P C4    1 
HETATM 7954 P  P     . 2DA C 3 13  ? 7.401   12.485  17.595  1.00 45.11  ? 115  2DA P P     1 
HETATM 7955 O  OP1   . 2DA C 3 13  ? 8.200   12.286  16.321  1.00 45.80  ? 115  2DA P OP1   1 
HETATM 7956 O  OP2   . 2DA C 3 13  ? 6.786   13.830  17.870  1.00 40.25  ? 115  2DA P OP2   1 
HETATM 7957 O  "O5'" . 2DA C 3 13  ? 6.226   11.381  17.705  1.00 43.04  ? 115  2DA P "O5'" 1 
HETATM 7958 C  "C5'" . 2DA C 3 13  ? 6.001   10.463  16.647  1.00 42.21  ? 115  2DA P "C5'" 1 
HETATM 7959 C  "C4'" . 2DA C 3 13  ? 5.425   9.138   17.138  1.00 40.10  ? 115  2DA P "C4'" 1 
HETATM 7960 O  "O4'" . 2DA C 3 13  ? 5.482   8.931   18.555  1.00 36.59  ? 115  2DA P "O4'" 1 
HETATM 7961 C  "C3'" . 2DA C 3 13  ? 3.956   9.064   16.762  1.00 37.82  ? 115  2DA P "C3'" 1 
HETATM 7962 C  "C2'" . 2DA C 3 13  ? 3.340   8.236   17.871  1.00 40.29  ? 115  2DA P "C2'" 1 
HETATM 7963 C  "C1'" . 2DA C 3 13  ? 4.467   7.975   18.854  1.00 36.72  ? 115  2DA P "C1'" 1 
HETATM 7964 N  N9    . 2DA C 3 13  ? 3.927   8.069   20.232  1.00 36.46  ? 115  2DA P N9    1 
HETATM 7965 C  C8    . 2DA C 3 13  ? 3.778   9.178   20.983  1.00 33.76  ? 115  2DA P C8    1 
HETATM 7966 N  N7    . 2DA C 3 13  ? 3.244   8.835   22.177  1.00 32.11  ? 115  2DA P N7    1 
HETATM 7967 C  C5    . 2DA C 3 13  ? 3.055   7.495   22.159  1.00 34.72  ? 115  2DA P C5    1 
HETATM 7968 C  C6    . 2DA C 3 13  ? 2.554   6.579   23.080  1.00 33.45  ? 115  2DA P C6    1 
HETATM 7969 N  N6    . 2DA C 3 13  ? 2.124   7.011   24.286  1.00 27.06  ? 115  2DA P N6    1 
HETATM 7970 N  N1    . 2DA C 3 13  ? 2.501   5.257   22.754  1.00 33.55  ? 115  2DA P N1    1 
HETATM 7971 C  C2    . 2DA C 3 13  ? 2.927   4.829   21.551  1.00 31.88  ? 115  2DA P C2    1 
HETATM 7972 N  N3    . 2DA C 3 13  ? 3.418   5.696   20.648  1.00 30.00  ? 115  2DA P N3    1 
HETATM 7973 C  C4    . 2DA C 3 13  ? 3.489   7.020   20.929  1.00 33.21  ? 115  2DA P C4    1 
HETATM 7974 N  N1    . DCP D 4 .   ? -0.062  5.974   19.226  1.00 36.59  ? 904  DCP A N1    1 
HETATM 7975 C  C2    . DCP D 4 .   ? -0.445  5.138   20.270  1.00 35.46  ? 904  DCP A C2    1 
HETATM 7976 N  N3    . DCP D 4 .   ? -0.692  5.667   21.520  1.00 35.64  ? 904  DCP A N3    1 
HETATM 7977 C  C4    . DCP D 4 .   ? -0.512  7.017   21.751  1.00 35.12  ? 904  DCP A C4    1 
HETATM 7978 C  C5    . DCP D 4 .   ? -0.200  7.871   20.697  1.00 34.97  ? 904  DCP A C5    1 
HETATM 7979 C  C6    . DCP D 4 .   ? 0.136   7.318   19.463  1.00 33.65  ? 904  DCP A C6    1 
HETATM 7980 O  O2    . DCP D 4 .   ? -0.570  3.925   20.101  1.00 36.25  ? 904  DCP A O2    1 
HETATM 7981 N  N4    . DCP D 4 .   ? -0.636  7.483   22.985  1.00 36.88  ? 904  DCP A N4    1 
HETATM 7982 C  "C1'" . DCP D 4 .   ? -0.138  5.463   17.840  1.00 37.32  ? 904  DCP A "C1'" 1 
HETATM 7983 C  "C2'" . DCP D 4 .   ? -1.577  5.563   17.345  1.00 34.43  ? 904  DCP A "C2'" 1 
HETATM 7984 C  "C3'" . DCP D 4 .   ? -1.561  6.736   16.403  1.00 34.09  ? 904  DCP A "C3'" 1 
HETATM 7985 C  "C4'" . DCP D 4 .   ? -0.126  6.750   15.908  1.00 36.14  ? 904  DCP A "C4'" 1 
HETATM 7986 O  "O4'" . DCP D 4 .   ? 0.658   6.228   16.959  1.00 38.57  ? 904  DCP A "O4'" 1 
HETATM 7987 O  "O3'" . DCP D 4 .   ? -2.514  6.559   15.378  1.00 38.53  ? 904  DCP A "O3'" 1 
HETATM 7988 C  "C5'" . DCP D 4 .   ? 0.388   8.139   15.581  1.00 37.58  ? 904  DCP A "C5'" 1 
HETATM 7989 O  "O5'" . DCP D 4 .   ? 0.122   9.047   16.626  1.00 40.50  ? 904  DCP A "O5'" 1 
HETATM 7990 P  PA    . DCP D 4 .   ? -0.042  10.616  16.287  1.00 39.63  ? 904  DCP A PA    1 
HETATM 7991 O  O1A   . DCP D 4 .   ? 0.575   11.403  17.411  1.00 41.52  ? 904  DCP A O1A   1 
HETATM 7992 O  O2A   . DCP D 4 .   ? 0.577   11.000  14.961  1.00 48.67  ? 904  DCP A O2A   1 
HETATM 7993 O  O3A   . DCP D 4 .   ? -1.626  10.916  16.224  1.00 40.67  ? 904  DCP A O3A   1 
HETATM 7994 P  PB    . DCP D 4 .   ? -2.705  10.172  15.287  1.00 35.96  ? 904  DCP A PB    1 
HETATM 7995 O  O1B   . DCP D 4 .   ? -3.324  9.008   16.013  1.00 36.70  ? 904  DCP A O1B   1 
HETATM 7996 O  O2B   . DCP D 4 .   ? -2.134  9.735   13.955  1.00 35.71  ? 904  DCP A O2B   1 
HETATM 7997 O  O3B   . DCP D 4 .   ? -3.819  11.302  15.132  1.00 37.21  ? 904  DCP A O3B   1 
HETATM 7998 P  PG    . DCP D 4 .   ? -3.507  12.695  14.396  1.00 37.00  ? 904  DCP A PG    1 
HETATM 7999 O  O1G   . DCP D 4 .   ? -2.177  12.618  13.691  1.00 37.87  ? 904  DCP A O1G   1 
HETATM 8000 O  O2G   . DCP D 4 .   ? -4.598  12.932  13.397  1.00 34.84  ? 904  DCP A O2G   1 
HETATM 8001 O  O3G   . DCP D 4 .   ? -3.451  13.806  15.417  1.00 40.83  ? 904  DCP A O3G   1 
HETATM 8002 CA CA    . CA  E 5 .   ? -0.758  11.095  12.700  1.00 38.29  ? 905  CA  A CA    1 
HETATM 8003 CA CA    . CA  F 5 .   ? 2.767   11.712  14.006  1.00 63.47  ? 906  CA  A CA    1 
HETATM 8004 CA CA    . CA  G 5 .   ? -3.496  48.538  12.629  1.00 63.30  ? 907  CA  A CA    1 
HETATM 8005 CA CA    . CA  H 5 .   ? -2.911  15.977  10.160  1.00 72.21  ? 908  CA  A CA    1 
HETATM 8006 CA CA    . CA  I 5 .   ? -3.394  24.437  52.322  1.00 67.85  ? 909  CA  A CA    1 
HETATM 8007 O  O     . HOH J 6 .   ? 13.028  20.680  52.343  1.00 36.71  ? 910  HOH A O     1 
HETATM 8008 O  O     . HOH J 6 .   ? -10.780 -8.458  19.626  1.00 18.52  ? 911  HOH A O     1 
HETATM 8009 O  O     . HOH J 6 .   ? -15.166 21.841  32.638  1.00 19.73  ? 912  HOH A O     1 
HETATM 8010 O  O     . HOH J 6 .   ? 9.886   -1.355  15.574  1.00 17.60  ? 913  HOH A O     1 
HETATM 8011 O  O     . HOH J 6 .   ? -29.306 -6.826  33.136  1.00 25.53  ? 914  HOH A O     1 
HETATM 8012 O  O     . HOH J 6 .   ? -7.968  4.929   56.130  1.00 44.21  ? 915  HOH A O     1 
HETATM 8013 O  O     . HOH J 6 .   ? 28.155  34.508  39.604  1.00 45.27  ? 916  HOH A O     1 
HETATM 8014 O  O     . HOH J 6 .   ? -7.065  -11.668 32.949  1.00 41.12  ? 917  HOH A O     1 
HETATM 8015 O  O     . HOH J 6 .   ? -5.848  33.486  41.826  1.00 33.21  ? 918  HOH A O     1 
HETATM 8016 O  O     . HOH J 6 .   ? -4.893  2.475   1.890   1.00 21.19  ? 919  HOH A O     1 
HETATM 8017 O  O     . HOH J 6 .   ? 4.145   -4.480  14.753  1.00 27.97  ? 920  HOH A O     1 
HETATM 8018 O  O     . HOH J 6 .   ? -10.266 11.010  41.552  1.00 32.08  ? 921  HOH A O     1 
HETATM 8019 O  O     . HOH J 6 .   ? 11.157  22.415  57.811  1.00 43.50  ? 922  HOH A O     1 
HETATM 8020 O  O     . HOH J 6 .   ? 9.251   28.474  19.608  1.00 26.71  ? 923  HOH A O     1 
HETATM 8021 O  O     . HOH J 6 .   ? -9.780  5.722   63.294  1.00 37.81  ? 924  HOH A O     1 
HETATM 8022 O  O     . HOH J 6 .   ? -22.064 6.976   39.685  1.00 19.23  ? 925  HOH A O     1 
HETATM 8023 O  O     . HOH J 6 .   ? -5.507  10.757  43.787  1.00 51.20  ? 926  HOH A O     1 
HETATM 8024 O  O     . HOH J 6 .   ? -22.039 21.153  47.238  1.00 12.46  ? 927  HOH A O     1 
HETATM 8025 O  O     . HOH J 6 .   ? -25.023 20.557  29.597  1.00 32.28  ? 928  HOH A O     1 
HETATM 8026 O  O     . HOH J 6 .   ? 32.434  22.629  19.695  1.00 39.32  ? 929  HOH A O     1 
HETATM 8027 O  O     . HOH J 6 .   ? -19.112 -22.195 27.040  1.00 31.54  ? 930  HOH A O     1 
HETATM 8028 O  O     . HOH J 6 .   ? -26.077 6.658   43.338  1.00 20.16  ? 931  HOH A O     1 
HETATM 8029 O  O     . HOH J 6 .   ? -16.989 1.455   56.173  1.00 56.79  ? 932  HOH A O     1 
HETATM 8030 O  O     . HOH J 6 .   ? -16.213 39.134  57.039  1.00 26.56  ? 933  HOH A O     1 
HETATM 8031 O  O     . HOH J 6 .   ? -14.534 0.790   46.833  1.00 35.70  ? 934  HOH A O     1 
HETATM 8032 O  O     . HOH J 6 .   ? 30.745  15.512  20.583  1.00 53.53  ? 935  HOH A O     1 
HETATM 8033 O  O     . HOH J 6 .   ? 21.307  1.048   -11.398 1.00 31.54  ? 936  HOH A O     1 
HETATM 8034 O  O     . HOH J 6 .   ? 29.246  32.045  36.504  1.00 44.39  ? 937  HOH A O     1 
HETATM 8035 O  O     . HOH J 6 .   ? 7.196   14.977  47.533  1.00 41.74  ? 938  HOH A O     1 
HETATM 8036 O  O     . HOH J 6 .   ? 31.391  29.947  22.304  1.00 30.88  ? 939  HOH A O     1 
HETATM 8037 O  O     . HOH J 6 .   ? -17.612 39.686  43.525  1.00 43.11  ? 940  HOH A O     1 
HETATM 8038 O  O     . HOH J 6 .   ? -10.014 7.158   11.862  1.00 27.28  ? 941  HOH A O     1 
HETATM 8039 O  O     . HOH J 6 .   ? -5.821  8.739   16.524  1.00 27.43  ? 942  HOH A O     1 
HETATM 8040 O  O     . HOH J 6 .   ? 14.501  6.755   2.927   1.00 23.54  ? 943  HOH A O     1 
HETATM 8041 O  O     . HOH J 6 .   ? 5.298   31.351  8.892   1.00 20.63  ? 944  HOH A O     1 
HETATM 8042 O  O     . HOH J 6 .   ? -15.887 3.212   58.041  1.00 39.49  ? 945  HOH A O     1 
HETATM 8043 O  O     . HOH J 6 .   ? -4.960  7.833   7.813   1.00 19.77  ? 946  HOH A O     1 
HETATM 8044 O  O     . HOH J 6 .   ? -24.479 11.415  25.452  1.00 23.80  ? 947  HOH A O     1 
HETATM 8045 O  O     . HOH J 6 .   ? 13.047  1.551   6.240   1.00 36.86  ? 948  HOH A O     1 
HETATM 8046 O  O     . HOH J 6 .   ? -1.430  26.742  61.126  1.00 21.06  ? 949  HOH A O     1 
HETATM 8047 O  O     . HOH J 6 .   ? -18.425 -4.826  26.198  1.00 26.73  ? 950  HOH A O     1 
HETATM 8048 O  O     . HOH J 6 .   ? -0.838  22.032  46.814  1.00 24.00  ? 951  HOH A O     1 
HETATM 8049 O  O     . HOH J 6 .   ? 31.128  22.725  33.519  1.00 49.51  ? 952  HOH A O     1 
HETATM 8050 O  O     . HOH J 6 .   ? -33.311 -15.924 40.798  1.00 27.95  ? 953  HOH A O     1 
HETATM 8051 O  O     . HOH J 6 .   ? -19.981 11.023  15.558  1.00 30.93  ? 954  HOH A O     1 
HETATM 8052 O  O     . HOH J 6 .   ? -28.709 17.012  48.669  1.00 35.59  ? 955  HOH A O     1 
HETATM 8053 O  O     . HOH J 6 .   ? 10.142  10.391  16.635  1.00 28.73  ? 956  HOH A O     1 
HETATM 8054 O  O     . HOH J 6 .   ? 0.718   16.153  34.252  1.00 21.94  ? 957  HOH A O     1 
HETATM 8055 O  O     . HOH J 6 .   ? 20.698  20.615  -5.532  1.00 33.90  ? 958  HOH A O     1 
HETATM 8056 O  O     . HOH J 6 .   ? -29.857 19.403  43.384  1.00 27.30  ? 959  HOH A O     1 
HETATM 8057 O  O     . HOH J 6 .   ? 18.924  6.539   17.406  1.00 29.88  ? 960  HOH A O     1 
HETATM 8058 O  O     . HOH J 6 .   ? -23.162 23.206  37.754  1.00 27.83  ? 961  HOH A O     1 
HETATM 8059 O  O     . HOH J 6 .   ? -37.823 8.192   36.142  1.00 36.95  ? 962  HOH A O     1 
HETATM 8060 O  O     . HOH J 6 .   ? 20.948  7.535   14.185  1.00 26.14  ? 963  HOH A O     1 
HETATM 8061 O  O     . HOH J 6 .   ? -5.933  27.980  73.123  1.00 32.16  ? 964  HOH A O     1 
HETATM 8062 O  O     . HOH J 6 .   ? -2.758  9.352   1.578   1.00 23.77  ? 965  HOH A O     1 
HETATM 8063 O  O     . HOH J 6 .   ? -38.941 16.335  42.937  1.00 45.63  ? 966  HOH A O     1 
HETATM 8064 O  O     . HOH J 6 .   ? -6.472  9.247   -0.865  1.00 37.37  ? 967  HOH A O     1 
HETATM 8065 O  O     . HOH J 6 .   ? -18.861 2.852   35.443  1.00 20.46  ? 968  HOH A O     1 
HETATM 8066 O  O     . HOH J 6 .   ? -22.872 4.169   25.440  1.00 22.56  ? 969  HOH A O     1 
HETATM 8067 O  O     . HOH J 6 .   ? 7.394   -8.556  20.805  1.00 38.92  ? 970  HOH A O     1 
HETATM 8068 O  O     . HOH J 6 .   ? 20.850  6.505   38.683  1.00 32.87  ? 971  HOH A O     1 
HETATM 8069 O  O     . HOH J 6 .   ? -33.615 19.593  42.878  1.00 31.05  ? 972  HOH A O     1 
HETATM 8070 O  O     . HOH J 6 .   ? -21.447 -22.359 25.950  1.00 25.12  ? 973  HOH A O     1 
HETATM 8071 O  O     . HOH J 6 .   ? -19.719 -13.990 40.193  1.00 35.05  ? 974  HOH A O     1 
HETATM 8072 O  O     . HOH J 6 .   ? -3.991  5.603   53.702  1.00 37.08  ? 975  HOH A O     1 
HETATM 8073 O  O     . HOH J 6 .   ? -5.531  21.590  63.694  1.00 24.20  ? 976  HOH A O     1 
HETATM 8074 O  O     . HOH J 6 .   ? 8.878   26.776  49.448  1.00 42.00  ? 977  HOH A O     1 
HETATM 8075 O  O     . HOH J 6 .   ? 15.838  5.414   -3.302  1.00 35.78  ? 978  HOH A O     1 
HETATM 8076 O  O     . HOH J 6 .   ? 27.593  31.889  11.639  1.00 35.96  ? 979  HOH A O     1 
HETATM 8077 O  O     . HOH J 6 .   ? -20.393 -12.545 22.350  1.00 28.86  ? 980  HOH A O     1 
HETATM 8078 O  O     . HOH J 6 .   ? 4.615   -9.702  7.290   1.00 36.66  ? 981  HOH A O     1 
HETATM 8079 O  O     . HOH J 6 .   ? 16.145  2.076   9.946   1.00 20.05  ? 982  HOH A O     1 
HETATM 8080 O  O     . HOH J 6 .   ? -20.036 4.476   12.850  1.00 26.14  ? 983  HOH A O     1 
HETATM 8081 O  O     . HOH J 6 .   ? -18.711 5.183   19.918  1.00 26.26  ? 984  HOH A O     1 
HETATM 8082 O  O     . HOH J 6 .   ? -21.199 -1.674  7.478   1.00 36.66  ? 985  HOH A O     1 
HETATM 8083 O  O     . HOH J 6 .   ? 14.589  21.903  8.404   1.00 33.88  ? 986  HOH A O     1 
HETATM 8084 O  O     . HOH J 6 .   ? -7.578  20.319  51.069  1.00 34.51  ? 987  HOH A O     1 
HETATM 8085 O  O     . HOH J 6 .   ? 2.460   0.715   18.511  1.00 27.36  ? 988  HOH A O     1 
HETATM 8086 O  O     . HOH J 6 .   ? -2.341  12.781  52.173  1.00 32.72  ? 989  HOH A O     1 
HETATM 8087 O  O     . HOH J 6 .   ? -18.373 -17.914 35.220  1.00 33.89  ? 990  HOH A O     1 
HETATM 8088 O  O     . HOH J 6 .   ? -25.489 -21.462 20.799  1.00 29.64  ? 991  HOH A O     1 
HETATM 8089 O  O     . HOH J 6 .   ? -26.965 13.573  51.448  1.00 26.79  ? 992  HOH A O     1 
HETATM 8090 O  O     . HOH J 6 .   ? -4.292  -13.089 22.553  1.00 33.21  ? 993  HOH A O     1 
HETATM 8091 O  O     . HOH J 6 .   ? 14.927  30.752  22.712  1.00 28.36  ? 994  HOH A O     1 
HETATM 8092 O  O     . HOH J 6 .   ? 12.018  26.201  30.743  1.00 24.61  ? 995  HOH A O     1 
HETATM 8093 O  O     . HOH J 6 .   ? -15.079 -13.978 14.023  1.00 30.30  ? 996  HOH A O     1 
HETATM 8094 O  O     . HOH J 6 .   ? -2.822  8.436   56.182  1.00 44.46  ? 997  HOH A O     1 
HETATM 8095 O  O     . HOH J 6 .   ? -5.049  22.550  52.385  1.00 36.18  ? 998  HOH A O     1 
HETATM 8096 O  O     . HOH J 6 .   ? -0.437  42.704  43.027  1.00 63.92  ? 999  HOH A O     1 
HETATM 8097 O  O     . HOH J 6 .   ? -3.133  -6.169  -5.598  1.00 35.14  ? 1000 HOH A O     1 
HETATM 8098 O  O     . HOH J 6 .   ? -31.596 -6.869  24.122  1.00 26.48  ? 1001 HOH A O     1 
HETATM 8099 O  O     . HOH J 6 .   ? -27.851 24.318  29.848  1.00 40.03  ? 1002 HOH A O     1 
HETATM 8100 O  O     . HOH J 6 .   ? 12.037  1.022   -4.926  1.00 18.33  ? 1003 HOH A O     1 
HETATM 8101 O  O     . HOH J 6 .   ? 4.126   34.612  38.219  1.00 45.62  ? 1004 HOH A O     1 
HETATM 8102 O  O     . HOH J 6 .   ? -12.614 8.049   42.252  1.00 32.93  ? 1005 HOH A O     1 
HETATM 8103 O  O     A HOH J 6 .   ? -8.546  -15.963 1.293   0.50 2.57   ? 1006 HOH A O     1 
HETATM 8104 O  O     B HOH J 6 .   ? -6.117  -16.125 1.743   0.50 9.08   ? 1006 HOH A O     1 
HETATM 8105 O  O     . HOH J 6 .   ? -2.123  -6.634  29.902  1.00 21.43  ? 1007 HOH A O     1 
HETATM 8106 O  O     . HOH J 6 .   ? -10.112 27.683  27.570  1.00 23.37  ? 1008 HOH A O     1 
HETATM 8107 O  O     . HOH J 6 .   ? 10.312  22.965  51.868  1.00 35.64  ? 1009 HOH A O     1 
HETATM 8108 O  O     . HOH J 6 .   ? -44.239 16.121  35.538  1.00 29.26  ? 1010 HOH A O     1 
HETATM 8109 O  O     . HOH J 6 .   ? 23.641  16.523  38.906  1.00 34.09  ? 1011 HOH A O     1 
HETATM 8110 O  O     . HOH J 6 .   ? -6.389  36.311  64.853  1.00 22.46  ? 1012 HOH A O     1 
HETATM 8111 O  O     . HOH J 6 .   ? -4.067  -1.934  53.560  1.00 44.16  ? 1013 HOH A O     1 
HETATM 8112 O  O     . HOH J 6 .   ? 8.939   35.967  4.545   1.00 27.66  ? 1014 HOH A O     1 
HETATM 8113 O  O     . HOH J 6 .   ? -22.836 4.789   21.271  1.00 31.37  ? 1015 HOH A O     1 
HETATM 8114 O  O     . HOH J 6 .   ? -42.677 14.874  41.442  1.00 41.21  ? 1016 HOH A O     1 
HETATM 8115 O  O     . HOH J 6 .   ? 20.090  19.607  4.241   1.00 34.63  ? 1017 HOH A O     1 
HETATM 8116 O  O     . HOH J 6 .   ? -12.980 -18.586 4.466   1.00 36.68  ? 1018 HOH A O     1 
HETATM 8117 O  O     . HOH J 6 .   ? -17.878 -19.312 33.044  1.00 27.61  ? 1019 HOH A O     1 
HETATM 8118 O  O     . HOH J 6 .   ? 20.434  30.370  44.433  1.00 20.14  ? 1020 HOH A O     1 
HETATM 8119 O  O     . HOH J 6 .   ? -4.442  10.519  36.192  1.00 30.40  ? 1021 HOH A O     1 
HETATM 8120 O  O     . HOH J 6 .   ? -9.158  28.669  61.505  1.00 25.60  ? 1022 HOH A O     1 
HETATM 8121 O  O     . HOH J 6 .   ? 16.955  31.616  36.958  1.00 43.83  ? 1023 HOH A O     1 
HETATM 8122 O  O     . HOH J 6 .   ? 9.342   25.410  42.298  1.00 28.15  ? 1024 HOH A O     1 
HETATM 8123 O  O     . HOH J 6 .   ? -26.713 -7.853  33.573  1.00 29.88  ? 1025 HOH A O     1 
HETATM 8124 O  O     . HOH J 6 .   ? -27.220 17.791  41.000  1.00 29.97  ? 1026 HOH A O     1 
HETATM 8125 O  O     . HOH J 6 .   ? -13.535 -4.853  29.406  1.00 41.84  ? 1027 HOH A O     1 
HETATM 8126 O  O     . HOH J 6 .   ? -13.296 25.118  20.949  1.00 29.94  ? 1028 HOH A O     1 
HETATM 8127 O  O     . HOH J 6 .   ? 16.833  18.396  4.204   1.00 26.75  ? 1029 HOH A O     1 
HETATM 8128 O  O     . HOH J 6 .   ? 15.970  29.696  3.336   1.00 30.94  ? 1030 HOH A O     1 
HETATM 8129 O  O     . HOH J 6 .   ? -40.610 16.810  38.993  1.00 27.51  ? 1031 HOH A O     1 
HETATM 8130 O  O     . HOH J 6 .   ? 3.510   17.213  45.824  1.00 27.43  ? 1032 HOH A O     1 
HETATM 8131 O  O     . HOH J 6 .   ? 4.322   -14.416 -0.976  1.00 33.23  ? 1033 HOH A O     1 
HETATM 8132 O  O     . HOH J 6 .   ? -23.053 -3.241  39.570  1.00 38.85  ? 1034 HOH A O     1 
HETATM 8133 O  O     . HOH J 6 .   ? -10.024 -9.396  -4.351  1.00 24.49  ? 1035 HOH A O     1 
HETATM 8134 O  O     . HOH J 6 .   ? -1.755  0.415   20.843  1.00 22.23  ? 1036 HOH A O     1 
HETATM 8135 O  O     . HOH J 6 .   ? -1.292  -14.555 11.746  1.00 32.76  ? 1037 HOH A O     1 
HETATM 8136 O  O     . HOH J 6 .   ? -20.587 7.106   42.140  1.00 32.93  ? 1038 HOH A O     1 
HETATM 8137 O  O     . HOH J 6 .   ? 0.773   33.222  67.967  1.00 50.54  ? 1039 HOH A O     1 
HETATM 8138 O  O     . HOH J 6 .   ? 18.437  9.833   7.535   1.00 23.79  ? 1040 HOH A O     1 
HETATM 8139 O  O     . HOH J 6 .   ? -21.715 8.298   64.833  1.00 34.71  ? 1041 HOH A O     1 
HETATM 8140 O  O     . HOH J 6 .   ? 19.373  31.608  2.719   1.00 37.80  ? 1042 HOH A O     1 
HETATM 8141 O  O     . HOH J 6 .   ? 14.501  29.466  33.730  1.00 37.74  ? 1043 HOH A O     1 
HETATM 8142 O  O     . HOH J 6 .   ? 10.968  1.311   3.067   1.00 28.62  ? 1044 HOH A O     1 
HETATM 8143 O  O     . HOH J 6 .   ? -4.217  51.577  51.974  1.00 34.51  ? 1045 HOH A O     1 
HETATM 8144 O  O     . HOH J 6 .   ? 5.979   17.248  11.697  1.00 32.24  ? 1046 HOH A O     1 
HETATM 8145 O  O     . HOH J 6 .   ? 30.281  16.947  42.858  1.00 35.28  ? 1047 HOH A O     1 
HETATM 8146 O  O     . HOH J 6 .   ? 23.471  24.697  58.988  1.00 33.04  ? 1048 HOH A O     1 
HETATM 8147 O  O     . HOH J 6 .   ? -5.066  -9.321  -0.210  1.00 32.50  ? 1049 HOH A O     1 
HETATM 8148 O  O     . HOH J 6 .   ? -13.917 25.847  11.868  1.00 30.63  ? 1050 HOH A O     1 
HETATM 8149 O  O     . HOH J 6 .   ? 4.997   27.024  37.878  1.00 42.43  ? 1051 HOH A O     1 
HETATM 8150 O  O     . HOH J 6 .   ? 4.739   14.972  42.778  1.00 43.02  ? 1052 HOH A O     1 
HETATM 8151 O  O     . HOH J 6 .   ? 4.451   4.230   18.309  1.00 20.03  ? 1053 HOH A O     1 
HETATM 8152 O  O     . HOH J 6 .   ? -3.757  33.048  10.165  1.00 20.75  ? 1054 HOH A O     1 
HETATM 8153 O  O     . HOH J 6 .   ? 18.199  20.209  -7.000  1.00 26.80  ? 1055 HOH A O     1 
HETATM 8154 O  O     . HOH J 6 .   ? -6.816  18.316  49.348  1.00 23.69  ? 1056 HOH A O     1 
HETATM 8155 O  O     . HOH J 6 .   ? 21.611  23.488  7.063   1.00 25.52  ? 1057 HOH A O     1 
HETATM 8156 O  O     . HOH J 6 .   ? 1.367   -13.264 1.220   1.00 25.05  ? 1058 HOH A O     1 
HETATM 8157 O  O     . HOH J 6 .   ? -14.113 38.554  21.712  1.00 25.49  ? 1059 HOH A O     1 
HETATM 8158 O  O     . HOH J 6 .   ? -3.066  46.309  13.120  1.00 33.97  ? 1060 HOH A O     1 
HETATM 8159 O  O     . HOH J 6 .   ? 18.249  16.572  62.794  1.00 51.10  ? 1061 HOH A O     1 
HETATM 8160 O  O     . HOH J 6 .   ? -39.843 12.369  35.820  1.00 47.72  ? 1062 HOH A O     1 
HETATM 8161 O  O     . HOH J 6 .   ? -34.463 -15.962 25.658  1.00 21.21  ? 1063 HOH A O     1 
HETATM 8162 O  O     . HOH J 6 .   ? 5.191   -22.697 3.858   1.00 25.90  ? 1064 HOH A O     1 
HETATM 8163 O  O     . HOH J 6 .   ? 31.747  24.744  41.509  1.00 31.72  ? 1065 HOH A O     1 
HETATM 8164 O  O     . HOH J 6 .   ? -24.706 17.346  61.746  1.00 31.47  ? 1066 HOH A O     1 
HETATM 8165 O  O     . HOH J 6 .   ? 3.587   30.808  59.539  1.00 23.63  ? 1067 HOH A O     1 
HETATM 8166 O  O     . HOH J 6 .   ? -1.878  18.272  8.198   1.00 41.88  ? 1068 HOH A O     1 
HETATM 8167 O  O     . HOH J 6 .   ? 1.818   14.310  42.734  1.00 32.54  ? 1069 HOH A O     1 
HETATM 8168 O  O     . HOH J 6 .   ? -8.847  -17.156 25.369  1.00 42.61  ? 1070 HOH A O     1 
HETATM 8169 O  O     . HOH J 6 .   ? -0.562  -9.150  26.951  1.00 28.98  ? 1071 HOH A O     1 
HETATM 8170 O  O     . HOH J 6 .   ? 9.207   19.364  30.283  1.00 22.27  ? 1072 HOH A O     1 
HETATM 8171 O  O     . HOH J 6 .   ? -3.286  27.582  65.090  1.00 31.41  ? 1073 HOH A O     1 
HETATM 8172 O  O     . HOH J 6 .   ? 5.157   20.181  -11.819 1.00 42.24  ? 1074 HOH A O     1 
HETATM 8173 O  O     . HOH J 6 .   ? -0.795  23.607  13.635  1.00 25.03  ? 1075 HOH A O     1 
HETATM 8174 O  O     . HOH J 6 .   ? 40.368  25.406  18.582  1.00 42.29  ? 1076 HOH A O     1 
HETATM 8175 O  O     . HOH J 6 .   ? 49.114  34.184  12.393  1.00 22.96  ? 1077 HOH A O     1 
HETATM 8176 O  O     . HOH J 6 .   ? -20.557 1.119   54.928  1.00 37.08  ? 1078 HOH A O     1 
HETATM 8177 O  O     . HOH J 6 .   ? -14.624 42.463  40.171  1.00 38.35  ? 1079 HOH A O     1 
HETATM 8178 O  O     . HOH J 6 .   ? 0.780   30.484  41.725  1.00 61.28  ? 1080 HOH A O     1 
HETATM 8179 O  O     . HOH J 6 .   ? -33.045 24.935  33.174  1.00 37.81  ? 1081 HOH A O     1 
HETATM 8180 O  O     . HOH J 6 .   ? 13.656  5.235   -4.850  1.00 32.42  ? 1082 HOH A O     1 
HETATM 8181 O  O     . HOH J 6 .   ? 21.032  9.290   -1.001  1.00 42.80  ? 1083 HOH A O     1 
HETATM 8182 O  O     . HOH J 6 .   ? 21.482  17.292  5.136   1.00 28.31  ? 1084 HOH A O     1 
HETATM 8183 O  O     . HOH J 6 .   ? -21.613 27.849  38.485  1.00 40.44  ? 1085 HOH A O     1 
HETATM 8184 O  O     . HOH J 6 .   ? -4.545  -16.784 32.627  1.00 41.31  ? 1086 HOH A O     1 
HETATM 8185 O  O     . HOH J 6 .   ? -0.618  16.313  9.495   1.00 67.93  ? 1087 HOH A O     1 
HETATM 8186 O  O     . HOH J 6 .   ? 3.999   27.637  29.442  1.00 35.99  ? 1088 HOH A O     1 
HETATM 8187 O  O     . HOH J 6 .   ? -21.710 30.893  61.477  1.00 37.42  ? 1089 HOH A O     1 
HETATM 8188 O  O     . HOH J 6 .   ? 7.025   12.201  13.895  1.00 33.34  ? 1090 HOH A O     1 
HETATM 8189 O  O     . HOH J 6 .   ? 14.841  23.243  37.517  1.00 20.97  ? 1091 HOH A O     1 
HETATM 8190 O  O     . HOH J 6 .   ? 12.423  22.155  37.133  1.00 14.07  ? 1092 HOH A O     1 
HETATM 8191 O  O     . HOH J 6 .   ? 12.301  20.659  34.872  1.00 8.87   ? 1093 HOH A O     1 
HETATM 8192 O  O     . HOH J 6 .   ? -4.967  14.567  1.198   1.00 23.82  ? 1094 HOH A O     1 
HETATM 8193 O  O     . HOH J 6 .   ? -4.267  18.494  -5.697  1.00 36.21  ? 1095 HOH A O     1 
HETATM 8194 O  O     . HOH J 6 .   ? 0.796   21.551  1.981   1.00 29.30  ? 1096 HOH A O     1 
HETATM 8195 O  O     . HOH J 6 .   ? 4.600   1.964   12.433  1.00 21.10  ? 1097 HOH A O     1 
HETATM 8196 O  O     . HOH J 6 .   ? 2.540   0.567   13.660  1.00 25.12  ? 1098 HOH A O     1 
HETATM 8197 O  O     . HOH J 6 .   ? 13.544  -1.503  13.226  1.00 29.25  ? 1099 HOH A O     1 
HETATM 8198 O  O     . HOH J 6 .   ? 14.966  0.824   12.568  1.00 39.63  ? 1100 HOH A O     1 
HETATM 8199 O  O     . HOH J 6 .   ? 22.698  4.162   16.832  1.00 46.57  ? 1101 HOH A O     1 
HETATM 8200 O  O     . HOH J 6 .   ? -16.938 32.645  40.319  1.00 36.80  ? 1102 HOH A O     1 
HETATM 8201 O  O     . HOH J 6 .   ? -15.877 30.756  39.165  1.00 31.30  ? 1103 HOH A O     1 
HETATM 8202 O  O     . HOH J 6 .   ? -13.972 30.812  36.980  1.00 33.60  ? 1104 HOH A O     1 
HETATM 8203 O  O     . HOH J 6 .   ? -9.526  30.754  33.904  1.00 30.70  ? 1105 HOH A O     1 
HETATM 8204 O  O     . HOH J 6 .   ? -20.440 35.465  19.331  1.00 36.35  ? 1106 HOH A O     1 
HETATM 8205 O  O     . HOH J 6 .   ? -19.803 33.144  20.622  1.00 34.92  ? 1107 HOH A O     1 
HETATM 8206 O  O     . HOH J 6 .   ? -11.683 -2.921  -2.065  1.00 29.62  ? 1108 HOH A O     1 
HETATM 8207 O  O     . HOH J 6 .   ? -16.116 -5.131  -0.637  1.00 27.33  ? 1109 HOH A O     1 
HETATM 8208 O  O     . HOH J 6 .   ? -3.407  13.215  61.560  1.00 23.52  ? 1110 HOH A O     1 
HETATM 8209 O  O     . HOH J 6 .   ? -18.924 22.265  33.612  1.00 34.26  ? 1111 HOH A O     1 
HETATM 8210 O  O     . HOH J 6 .   ? 15.777  11.557  24.044  1.00 24.66  ? 1112 HOH A O     1 
HETATM 8211 O  O     . HOH J 6 .   ? 23.632  12.531  -3.051  1.00 27.36  ? 1113 HOH A O     1 
HETATM 8212 O  O     . HOH J 6 .   ? -29.428 19.738  56.708  1.00 44.28  ? 1114 HOH A O     1 
HETATM 8213 O  O     . HOH J 6 .   ? -14.291 22.698  21.084  1.00 19.55  ? 1115 HOH A O     1 
HETATM 8214 O  O     . HOH J 6 .   ? -17.307 23.798  20.869  1.00 27.14  ? 1116 HOH A O     1 
HETATM 8215 O  O     . HOH J 6 .   ? -19.922 19.722  26.038  1.00 38.96  ? 1117 HOH A O     1 
HETATM 8216 O  O     . HOH J 6 .   ? -20.124 18.612  21.413  1.00 31.62  ? 1118 HOH A O     1 
HETATM 8217 O  O     . HOH J 6 .   ? -20.275 15.106  23.682  1.00 43.13  ? 1119 HOH A O     1 
HETATM 8218 O  O     . HOH J 6 .   ? -13.850 19.620  27.323  1.00 21.44  ? 1120 HOH A O     1 
HETATM 8219 O  O     . HOH J 6 .   ? -13.382 21.818  25.843  1.00 25.14  ? 1121 HOH A O     1 
HETATM 8220 O  O     . HOH J 6 .   ? -15.071 22.070  24.041  1.00 28.40  ? 1122 HOH A O     1 
HETATM 8221 O  O     . HOH J 6 .   ? 18.522  12.789  39.252  1.00 28.44  ? 1123 HOH A O     1 
HETATM 8222 O  O     . HOH J 6 .   ? -3.050  2.684   20.101  1.00 30.10  ? 1124 HOH A O     1 
HETATM 8223 O  O     . HOH J 6 .   ? -3.220  9.433   21.762  1.00 21.75  ? 1125 HOH A O     1 
HETATM 8224 O  O     . HOH J 6 .   ? -32.522 11.736  23.048  1.00 36.52  ? 1126 HOH A O     1 
HETATM 8225 O  O     . HOH J 6 .   ? -6.779  6.857   28.097  1.00 27.60  ? 1127 HOH A O     1 
HETATM 8226 O  O     . HOH J 6 .   ? -1.018  27.906  63.452  1.00 23.16  ? 1128 HOH A O     1 
HETATM 8227 O  O     A HOH J 6 .   ? -9.858  -14.604 21.926  0.50 12.79  ? 1129 HOH A O     1 
HETATM 8228 O  O     B HOH J 6 .   ? -11.726 -15.028 21.274  0.50 21.59  ? 1129 HOH A O     1 
HETATM 8229 O  O     . HOH J 6 .   ? -11.227 -11.231 19.575  1.00 28.64  ? 1130 HOH A O     1 
HETATM 8230 O  O     . HOH J 6 .   ? -19.202 -14.976 23.200  1.00 31.24  ? 1131 HOH A O     1 
HETATM 8231 O  O     . HOH J 6 .   ? -15.350 -21.539 29.400  1.00 36.08  ? 1132 HOH A O     1 
HETATM 8232 O  O     . HOH J 6 .   ? -15.826 -5.166  36.779  1.00 42.06  ? 1133 HOH A O     1 
HETATM 8233 O  O     . HOH J 6 .   ? -17.722 -6.330  38.288  1.00 44.16  ? 1134 HOH A O     1 
HETATM 8234 O  O     . HOH J 6 .   ? -11.624 -9.070  43.420  1.00 45.85  ? 1135 HOH A O     1 
HETATM 8235 O  O     . HOH J 6 .   ? -5.057  30.960  19.449  1.00 21.06  ? 1136 HOH A O     1 
HETATM 8236 O  O     . HOH J 6 .   ? -21.700 9.286   38.016  1.00 23.19  ? 1137 HOH A O     1 
HETATM 8237 O  O     . HOH J 6 .   ? -11.236 -12.460 34.562  1.00 41.80  ? 1138 HOH A O     1 
HETATM 8238 O  O     . HOH J 6 .   ? -11.251 0.317   61.648  1.00 48.62  ? 1139 HOH A O     1 
HETATM 8239 O  O     . HOH J 6 .   ? -23.914 1.373   30.307  1.00 23.37  ? 1140 HOH A O     1 
HETATM 8240 O  O     . HOH J 6 .   ? -0.876  9.944   23.748  1.00 30.96  ? 1141 HOH A O     1 
HETATM 8241 O  O     . HOH J 6 .   ? 12.906  3.347   -0.714  1.00 16.37  ? 1142 HOH A O     1 
HETATM 8242 O  O     . HOH J 6 .   ? -24.454 -2.561  52.342  1.00 36.58  ? 1143 HOH A O     1 
HETATM 8243 O  O     . HOH J 6 .   ? -8.298  32.409  10.344  1.00 21.34  ? 1144 HOH A O     1 
HETATM 8244 O  O     . HOH J 6 .   ? -8.187  -15.856 -1.446  1.00 26.72  ? 1145 HOH A O     1 
HETATM 8245 O  O     . HOH J 6 .   ? -26.882 18.225  63.277  1.00 30.57  ? 1146 HOH A O     1 
HETATM 8246 O  O     . HOH J 6 .   ? -27.552 -17.224 45.974  1.00 31.27  ? 1147 HOH A O     1 
HETATM 8247 O  O     . HOH J 6 .   ? -32.288 -15.473 46.596  1.00 41.11  ? 1148 HOH A O     1 
HETATM 8248 O  O     . HOH J 6 .   ? -5.635  -18.057 3.612   1.00 20.02  ? 1149 HOH A O     1 
HETATM 8249 O  O     . HOH J 6 .   ? 30.825  14.177  48.623  1.00 32.70  ? 1150 HOH A O     1 
HETATM 8250 O  O     . HOH J 6 .   ? -43.023 -12.914 40.108  1.00 48.29  ? 1151 HOH A O     1 
HETATM 8251 O  O     . HOH J 6 .   ? -4.794  18.701  26.833  1.00 22.77  ? 1152 HOH A O     1 
HETATM 8252 O  O     . HOH J 6 .   ? -19.029 0.714   36.935  1.00 30.20  ? 1153 HOH A O     1 
HETATM 8253 O  O     . HOH J 6 .   ? 17.944  2.201   17.233  1.00 35.61  ? 1154 HOH A O     1 
HETATM 8254 O  O     . HOH J 6 .   ? -12.918 -12.952 18.574  1.00 26.41  ? 1155 HOH A O     1 
HETATM 8255 O  O     . HOH J 6 .   ? -5.415  4.408   31.396  1.00 21.73  ? 1156 HOH A O     1 
HETATM 8256 O  O     . HOH J 6 .   ? 11.611  0.236   14.742  1.00 22.28  ? 1157 HOH A O     1 
HETATM 8257 O  O     . HOH K 6 .   ? 4.869   1.699   19.351  1.00 22.65  ? 28   HOH T O     1 
HETATM 8258 O  O     . HOH K 6 .   ? 21.078  10.576  19.682  1.00 24.20  ? 108  HOH T O     1 
HETATM 8259 O  O     . HOH K 6 .   ? 13.145  7.322   22.673  1.00 29.99  ? 169  HOH T O     1 
HETATM 8260 O  O     . HOH K 6 .   ? 17.929  10.412  30.557  1.00 26.90  ? 180  HOH T O     1 
HETATM 8261 O  O     . HOH K 6 .   ? 5.184   -5.518  24.715  1.00 29.29  ? 239  HOH T O     1 
HETATM 8262 O  O     . HOH K 6 .   ? -10.019 -1.456  37.552  1.00 36.91  ? 240  HOH T O     1 
HETATM 8263 O  O     . HOH L 6 .   ? 10.322  14.675  36.052  1.00 31.69  ? 49   HOH P O     1 
HETATM 8264 O  O     . HOH L 6 .   ? 10.402  4.774   36.211  1.00 32.59  ? 91   HOH P O     1 
HETATM 8265 O  O     . HOH L 6 .   ? 7.926   17.772  22.838  1.00 31.41  ? 125  HOH P O     1 
HETATM 8266 O  O     . HOH L 6 .   ? 4.695   13.703  19.225  1.00 22.91  ? 131  HOH P O     1 
HETATM 8267 O  O     . HOH L 6 .   ? 7.475   4.720   18.431  1.00 36.17  ? 142  HOH P O     1 
HETATM 8268 O  O     . HOH L 6 .   ? 17.418  -1.619  30.627  1.00 34.22  ? 158  HOH P O     1 
HETATM 8269 O  O     . HOH L 6 .   ? 12.903  -0.439  36.170  1.00 39.51  ? 165  HOH P O     1 
HETATM 8270 O  O     . HOH L 6 .   ? 9.012   2.204   29.973  1.00 23.45  ? 187  HOH P O     1 
HETATM 8271 O  O     . HOH L 6 .   ? 20.417  0.577   27.091  1.00 42.02  ? 203  HOH P O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.7030 0.6991 0.7750 0.0395  -0.0564 -0.0634 1   MET A N     
2    C CA    . MET A 1   ? 0.7219 0.7119 0.7761 0.0370  -0.0536 -0.0565 1   MET A CA    
3    C C     . MET A 1   ? 0.6863 0.6819 0.7418 0.0341  -0.0472 -0.0558 1   MET A C     
4    O O     . MET A 1   ? 0.6726 0.6769 0.7410 0.0333  -0.0428 -0.0598 1   MET A O     
5    C CB    . MET A 1   ? 0.7564 0.7450 0.8018 0.0356  -0.0487 -0.0525 1   MET A CB    
6    C CG    . MET A 1   ? 0.8320 0.8298 0.8835 0.0332  -0.0391 -0.0533 1   MET A CG    
7    S SD    . MET A 1   ? 0.9247 0.9201 0.9660 0.0319  -0.0347 -0.0490 1   MET A SD    
8    C CE    . MET A 1   ? 0.9263 0.9134 0.9503 0.0300  -0.0349 -0.0424 1   MET A CE    
9    N N     . LYS A 2   ? 0.6642 0.6541 0.7062 0.0324  -0.0466 -0.0509 2   LYS A N     
10   C CA    . LYS A 2   ? 0.6523 0.6464 0.6936 0.0296  -0.0405 -0.0496 2   LYS A CA    
11   C C     . LYS A 2   ? 0.6022 0.6014 0.6424 0.0270  -0.0315 -0.0475 2   LYS A C     
12   O O     . LYS A 2   ? 0.5968 0.5928 0.6288 0.0266  -0.0300 -0.0443 2   LYS A O     
13   C CB    . LYS A 2   ? 0.6768 0.6628 0.7040 0.0287  -0.0425 -0.0454 2   LYS A CB    
14   C CG    . LYS A 2   ? 0.7568 0.7401 0.7863 0.0301  -0.0489 -0.0478 2   LYS A CG    
15   C CD    . LYS A 2   ? 0.8044 0.7964 0.8451 0.0286  -0.0446 -0.0505 2   LYS A CD    
16   C CE    . LYS A 2   ? 0.8130 0.8020 0.8553 0.0298  -0.0508 -0.0526 2   LYS A CE    
17   N NZ    . LYS A 2   ? 0.7856 0.7683 0.8136 0.0281  -0.0500 -0.0484 2   LYS A NZ    
18   N N     . GLU A 3   ? 0.5393 0.5457 0.5874 0.0251  -0.0257 -0.0494 3   GLU A N     
19   C CA    . GLU A 3   ? 0.5076 0.5177 0.5538 0.0225  -0.0176 -0.0476 3   GLU A CA    
20   C C     . GLU A 3   ? 0.4753 0.4812 0.5084 0.0207  -0.0151 -0.0421 3   GLU A C     
21   O O     . GLU A 3   ? 0.4885 0.4906 0.5159 0.0205  -0.0175 -0.0402 3   GLU A O     
22   C CB    . GLU A 3   ? 0.4754 0.4923 0.5316 0.0206  -0.0122 -0.0510 3   GLU A CB    
23   C CG    . GLU A 3   ? 0.5453 0.5673 0.6166 0.0221  -0.0137 -0.0573 3   GLU A CG    
24   C CD    . GLU A 3   ? 0.5707 0.5993 0.6515 0.0194  -0.0063 -0.0609 3   GLU A CD    
25   O OE1   . GLU A 3   ? 0.6595 0.6930 0.7540 0.0201  -0.0062 -0.0668 3   GLU A OE1   
26   O OE2   . GLU A 3   ? 0.5482 0.5769 0.6234 0.0164  -0.0005 -0.0582 3   GLU A OE2   
27   N N     . PHE A 4   ? 0.4302 0.4364 0.4589 0.0195  -0.0107 -0.0399 4   PHE A N     
28   C CA    . PHE A 4   ? 0.4233 0.4269 0.4424 0.0176  -0.0077 -0.0356 4   PHE A CA    
29   C C     . PHE A 4   ? 0.3949 0.4010 0.4134 0.0158  -0.0018 -0.0349 4   PHE A C     
30   O O     . PHE A 4   ? 0.4040 0.4123 0.4263 0.0160  -0.0001 -0.0369 4   PHE A O     
31   C CB    . PHE A 4   ? 0.4214 0.4188 0.4313 0.0184  -0.0108 -0.0325 4   PHE A CB    
32   C CG    . PHE A 4   ? 0.4240 0.4203 0.4337 0.0196  -0.0119 -0.0328 4   PHE A CG    
33   C CD1   . PHE A 4   ? 0.4047 0.3999 0.4188 0.0220  -0.0168 -0.0354 4   PHE A CD1   
34   C CD2   . PHE A 4   ? 0.3823 0.3782 0.3878 0.0187  -0.0087 -0.0307 4   PHE A CD2   
35   C CE1   . PHE A 4   ? 0.4101 0.4040 0.4241 0.0232  -0.0181 -0.0357 4   PHE A CE1   
36   C CE2   . PHE A 4   ? 0.3839 0.3785 0.3892 0.0198  -0.0099 -0.0310 4   PHE A CE2   
37   C CZ    . PHE A 4   ? 0.3434 0.3372 0.3530 0.0220  -0.0144 -0.0335 4   PHE A CZ    
38   N N     . TYR A 5   ? 0.4107 0.4158 0.4241 0.0140  0.0010  -0.0323 5   TYR A N     
39   C CA    . TYR A 5   ? 0.4091 0.4146 0.4199 0.0123  0.0055  -0.0312 5   TYR A CA    
40   C C     . TYR A 5   ? 0.3860 0.3887 0.3912 0.0129  0.0051  -0.0292 5   TYR A C     
41   O O     . TYR A 5   ? 0.3691 0.3692 0.3712 0.0139  0.0020  -0.0278 5   TYR A O     
42   C CB    . TYR A 5   ? 0.4346 0.4392 0.4420 0.0105  0.0076  -0.0293 5   TYR A CB    
43   C CG    . TYR A 5   ? 0.4288 0.4302 0.4304 0.0107  0.0058  -0.0264 5   TYR A CG    
44   C CD1   . TYR A 5   ? 0.4246 0.4250 0.4260 0.0112  0.0031  -0.0263 5   TYR A CD1   
45   C CD2   . TYR A 5   ? 0.4236 0.4226 0.4201 0.0102  0.0068  -0.0241 5   TYR A CD2   
46   C CE1   . TYR A 5   ? 0.4581 0.4553 0.4540 0.0109  0.0024  -0.0241 5   TYR A CE1   
47   C CE2   . TYR A 5   ? 0.4147 0.4113 0.4076 0.0102  0.0057  -0.0222 5   TYR A CE2   
48   C CZ    . TYR A 5   ? 0.4274 0.4232 0.4199 0.0103  0.0040  -0.0223 5   TYR A CZ    
49   O OH    . TYR A 5   ? 0.4538 0.4470 0.4426 0.0098  0.0039  -0.0209 5   TYR A OH    
50   N N     . LEU A 6   ? 0.4081 0.4108 0.4116 0.0120  0.0082  -0.0292 6   LEU A N     
51   C CA    . LEU A 6   ? 0.3615 0.3614 0.3597 0.0123  0.0078  -0.0273 6   LEU A CA    
52   C C     . LEU A 6   ? 0.3668 0.3641 0.3597 0.0109  0.0094  -0.0250 6   LEU A C     
53   O O     . LEU A 6   ? 0.3460 0.3413 0.3359 0.0111  0.0078  -0.0230 6   LEU A O     
54   C CB    . LEU A 6   ? 0.4035 0.4040 0.4030 0.0126  0.0093  -0.0293 6   LEU A CB    
55   C CG    . LEU A 6   ? 0.3944 0.3972 0.4002 0.0144  0.0073  -0.0322 6   LEU A CG    
56   C CD1   . LEU A 6   ? 0.4373 0.4414 0.4453 0.0141  0.0102  -0.0350 6   LEU A CD1   
57   C CD2   . LEU A 6   ? 0.4067 0.4069 0.4102 0.0161  0.0030  -0.0306 6   LEU A CD2   
58   N N     . THR A 7   ? 0.3672 0.3643 0.3591 0.0093  0.0126  -0.0255 7   THR A N     
59   C CA    . THR A 7   ? 0.3626 0.3562 0.3490 0.0080  0.0134  -0.0235 7   THR A CA    
60   C C     . THR A 7   ? 0.3742 0.3680 0.3614 0.0061  0.0161  -0.0241 7   THR A C     
61   O O     . THR A 7   ? 0.4201 0.4167 0.4117 0.0054  0.0185  -0.0265 7   THR A O     
62   C CB    . THR A 7   ? 0.3765 0.3660 0.3569 0.0075  0.0144  -0.0231 7   THR A CB    
63   O OG1   . THR A 7   ? 0.4014 0.3910 0.3817 0.0062  0.0182  -0.0253 7   THR A OG1   
64   C CG2   . THR A 7   ? 0.3169 0.3058 0.2967 0.0092  0.0118  -0.0227 7   THR A CG2   
65   N N     . VAL A 8   ? 0.3887 0.3797 0.3723 0.0053  0.0158  -0.0222 8   VAL A N     
66   C CA    . VAL A 8   ? 0.3944 0.3846 0.3778 0.0033  0.0183  -0.0224 8   VAL A CA    
67   C C     . VAL A 8   ? 0.4342 0.4182 0.4102 0.0022  0.0180  -0.0203 8   VAL A C     
68   O O     . VAL A 8   ? 0.4463 0.4283 0.4203 0.0035  0.0149  -0.0187 8   VAL A O     
69   C CB    . VAL A 8   ? 0.4144 0.4085 0.4037 0.0036  0.0171  -0.0229 8   VAL A CB    
70   C CG1   . VAL A 8   ? 0.4089 0.4015 0.3966 0.0045  0.0144  -0.0209 8   VAL A CG1   
71   C CG2   . VAL A 8   ? 0.3616 0.3561 0.3529 0.0015  0.0202  -0.0241 8   VAL A CG2   
72   N N     . GLU A 9   ? 0.4366 0.4169 0.4084 -0.0001 0.0213  -0.0206 9   GLU A N     
73   C CA    . GLU A 9   ? 0.4688 0.4413 0.4320 -0.0013 0.0206  -0.0185 9   GLU A CA    
74   C C     . GLU A 9   ? 0.4887 0.4587 0.4502 -0.0040 0.0239  -0.0187 9   GLU A C     
75   O O     . GLU A 9   ? 0.5452 0.5184 0.5106 -0.0057 0.0282  -0.0209 9   GLU A O     
76   C CB    . GLU A 9   ? 0.4544 0.4205 0.4087 -0.0017 0.0209  -0.0181 9   GLU A CB    
77   C CG    . GLU A 9   ? 0.4661 0.4344 0.4220 0.0008  0.0180  -0.0182 9   GLU A CG    
78   C CD    . GLU A 9   ? 0.4478 0.4143 0.4036 0.0029  0.0128  -0.0165 9   GLU A CD    
79   O OE1   . GLU A 9   ? 0.5043 0.4690 0.4601 0.0028  0.0111  -0.0155 9   GLU A OE1   
80   O OE2   . GLU A 9   ? 0.4699 0.4370 0.4263 0.0046  0.0104  -0.0166 9   GLU A OE2   
81   N N     . GLN A 10  ? 0.4846 0.4489 0.4411 -0.0045 0.0219  -0.0167 10  GLN A N     
82   C CA    . GLN A 10  ? 0.4949 0.4541 0.4470 -0.0075 0.0249  -0.0164 10  GLN A CA    
83   C C     . GLN A 10  ? 0.5308 0.4787 0.4693 -0.0092 0.0253  -0.0149 10  GLN A C     
84   O O     . GLN A 10  ? 0.5510 0.4931 0.4837 -0.0075 0.0204  -0.0131 10  GLN A O     
85   C CB    . GLN A 10  ? 0.4961 0.4555 0.4511 -0.0070 0.0221  -0.0154 10  GLN A CB    
86   C CG    . GLN A 10  ? 0.5167 0.4707 0.4674 -0.0102 0.0252  -0.0151 10  GLN A CG    
87   C CD    . GLN A 10  ? 0.5779 0.5294 0.5290 -0.0096 0.0217  -0.0137 10  GLN A CD    
88   O OE1   . GLN A 10  ? 0.5622 0.5184 0.5196 -0.0069 0.0179  -0.0137 10  GLN A OE1   
89   N NE2   . GLN A 10  ? 0.5536 0.4970 0.4975 -0.0123 0.0232  -0.0126 10  GLN A NE2   
90   N N     . ILE A 11  ? 0.5491 0.4933 0.4826 -0.0126 0.0311  -0.0160 11  ILE A N     
91   C CA    . ILE A 11  ? 0.5753 0.5066 0.4935 -0.0152 0.0325  -0.0146 11  ILE A CA    
92   C C     . ILE A 11  ? 0.5791 0.5055 0.4935 -0.0194 0.0376  -0.0148 11  ILE A C     
93   O O     . ILE A 11  ? 0.5498 0.4802 0.4687 -0.0222 0.0444  -0.0174 11  ILE A O     
94   C CB    . ILE A 11  ? 0.5944 0.5239 0.5074 -0.0161 0.0358  -0.0160 11  ILE A CB    
95   C CG1   . ILE A 11  ? 0.6237 0.5578 0.5407 -0.0120 0.0306  -0.0159 11  ILE A CG1   
96   C CG2   . ILE A 11  ? 0.6162 0.5304 0.5109 -0.0192 0.0375  -0.0145 11  ILE A CG2   
97   C CD1   . ILE A 11  ? 0.6473 0.5825 0.5628 -0.0122 0.0337  -0.0179 11  ILE A CD1   
98   N N     . GLY A 12  ? 0.6032 0.5210 0.5102 -0.0199 0.0342  -0.0122 12  GLY A N     
99   C CA    . GLY A 12  ? 0.6231 0.5358 0.5267 -0.0237 0.0383  -0.0120 12  GLY A CA    
100  C C     . GLY A 12  ? 0.6010 0.5260 0.5204 -0.0238 0.0411  -0.0144 12  GLY A C     
101  O O     . GLY A 12  ? 0.6214 0.5543 0.5508 -0.0206 0.0366  -0.0143 12  GLY A O     
102  N N     . ASP A 13  ? 0.5848 0.5114 0.5066 -0.0277 0.0488  -0.0170 13  ASP A N     
103  C CA    . ASP A 13  ? 0.5550 0.4926 0.4920 -0.0281 0.0513  -0.0198 13  ASP A CA    
104  C C     . ASP A 13  ? 0.5259 0.4752 0.4753 -0.0266 0.0534  -0.0234 13  ASP A C     
105  O O     . ASP A 13  ? 0.4810 0.4389 0.4432 -0.0271 0.0559  -0.0266 13  ASP A O     
106  C CB    . ASP A 13  ? 0.5643 0.4965 0.4984 -0.0334 0.0580  -0.0208 13  ASP A CB    
107  C CG    . ASP A 13  ? 0.5921 0.5148 0.5178 -0.0342 0.0547  -0.0175 13  ASP A CG    
108  O OD1   . ASP A 13  ? 0.6631 0.5739 0.5765 -0.0386 0.0588  -0.0164 13  ASP A OD1   
109  O OD2   . ASP A 13  ? 0.5451 0.4717 0.4760 -0.0304 0.0481  -0.0161 13  ASP A OD2   
110  N N     . SER A 14  ? 0.5265 0.4757 0.4725 -0.0245 0.0517  -0.0231 14  SER A N     
111  C CA    . SER A 14  ? 0.5358 0.4951 0.4928 -0.0226 0.0526  -0.0264 14  SER A CA    
112  C C     . SER A 14  ? 0.5289 0.4941 0.4908 -0.0176 0.0454  -0.0250 14  SER A C     
113  O O     . SER A 14  ? 0.5197 0.4797 0.4739 -0.0158 0.0406  -0.0219 14  SER A O     
114  C CB    . SER A 14  ? 0.5419 0.4970 0.4921 -0.0248 0.0577  -0.0280 14  SER A CB    
115  O OG    . SER A 14  ? 0.5727 0.5260 0.5234 -0.0297 0.0660  -0.0309 14  SER A OG    
116  N N     . ILE A 15  ? 0.5204 0.4959 0.4953 -0.0156 0.0446  -0.0277 15  ILE A N     
117  C CA    . ILE A 15  ? 0.4926 0.4731 0.4716 -0.0114 0.0391  -0.0271 15  ILE A CA    
118  C C     . ILE A 15  ? 0.4917 0.4741 0.4717 -0.0110 0.0411  -0.0292 15  ILE A C     
119  O O     . ILE A 15  ? 0.4861 0.4729 0.4736 -0.0124 0.0453  -0.0330 15  ILE A O     
120  C CB    . ILE A 15  ? 0.4781 0.4670 0.4690 -0.0093 0.0361  -0.0285 15  ILE A CB    
121  C CG1   . ILE A 15  ? 0.4381 0.4253 0.4277 -0.0089 0.0330  -0.0262 15  ILE A CG1   
122  C CG2   . ILE A 15  ? 0.4706 0.4642 0.4656 -0.0057 0.0320  -0.0288 15  ILE A CG2   
123  C CD1   . ILE A 15  ? 0.4627 0.4457 0.4451 -0.0069 0.0285  -0.0228 15  ILE A CD1   
124  N N     . PHE A 16  ? 0.4885 0.4678 0.4620 -0.0091 0.0381  -0.0273 16  PHE A N     
125  C CA    . PHE A 16  ? 0.4626 0.4439 0.4374 -0.0082 0.0391  -0.0292 16  PHE A CA    
126  C C     . PHE A 16  ? 0.4504 0.4381 0.4327 -0.0043 0.0339  -0.0292 16  PHE A C     
127  O O     . PHE A 16  ? 0.4558 0.4421 0.4350 -0.0024 0.0293  -0.0264 16  PHE A O     
128  C CB    . PHE A 16  ? 0.4438 0.4163 0.4055 -0.0089 0.0395  -0.0274 16  PHE A CB    
129  C CG    . PHE A 16  ? 0.4968 0.4619 0.4498 -0.0132 0.0458  -0.0281 16  PHE A CG    
130  C CD1   . PHE A 16  ? 0.5494 0.5147 0.5026 -0.0152 0.0516  -0.0316 16  PHE A CD1   
131  C CD2   . PHE A 16  ? 0.5162 0.4731 0.4600 -0.0154 0.0461  -0.0256 16  PHE A CD2   
132  C CE1   . PHE A 16  ? 0.5667 0.5240 0.5105 -0.0198 0.0584  -0.0325 16  PHE A CE1   
133  C CE2   . PHE A 16  ? 0.5513 0.4994 0.4849 -0.0199 0.0522  -0.0261 16  PHE A CE2   
134  C CZ    . PHE A 16  ? 0.5740 0.5221 0.5071 -0.0223 0.0588  -0.0295 16  PHE A CZ    
135  N N     . GLU A 17  ? 0.4252 0.4195 0.4173 -0.0034 0.0346  -0.0326 17  GLU A N     
136  C CA    . GLU A 17  ? 0.4166 0.4157 0.4150 -0.0001 0.0296  -0.0328 17  GLU A CA    
137  C C     . GLU A 17  ? 0.4243 0.4257 0.4260 0.0012  0.0298  -0.0353 17  GLU A C     
138  O O     . GLU A 17  ? 0.4377 0.4417 0.4451 0.0000  0.0337  -0.0391 17  GLU A O     
139  C CB    . GLU A 17  ? 0.3981 0.4025 0.4061 0.0006  0.0280  -0.0346 17  GLU A CB    
140  C CG    . GLU A 17  ? 0.4204 0.4270 0.4312 0.0038  0.0221  -0.0337 17  GLU A CG    
141  C CD    . GLU A 17  ? 0.4531 0.4644 0.4735 0.0050  0.0197  -0.0364 17  GLU A CD    
142  O OE1   . GLU A 17  ? 0.4357 0.4473 0.4570 0.0074  0.0149  -0.0360 17  GLU A OE1   
143  O OE2   . GLU A 17  ? 0.4481 0.4619 0.4749 0.0034  0.0224  -0.0392 17  GLU A OE2   
144  N N     . ARG A 18  ? 0.4241 0.4245 0.4228 0.0036  0.0259  -0.0334 18  ARG A N     
145  C CA    . ARG A 18  ? 0.4292 0.4322 0.4324 0.0055  0.0245  -0.0356 18  ARG A CA    
146  C C     . ARG A 18  ? 0.4199 0.4264 0.4297 0.0079  0.0196  -0.0358 18  ARG A C     
147  O O     . ARG A 18  ? 0.4383 0.4435 0.4452 0.0085  0.0168  -0.0330 18  ARG A O     
148  C CB    . ARG A 18  ? 0.4180 0.4169 0.4135 0.0064  0.0230  -0.0335 18  ARG A CB    
149  C CG    . ARG A 18  ? 0.4581 0.4514 0.4445 0.0041  0.0269  -0.0330 18  ARG A CG    
150  C CD    . ARG A 18  ? 0.4654 0.4541 0.4442 0.0054  0.0239  -0.0305 18  ARG A CD    
151  N NE    . ARG A 18  ? 0.4091 0.3997 0.3908 0.0071  0.0230  -0.0324 18  ARG A NE    
152  C CZ    . ARG A 18  ? 0.4095 0.3977 0.3875 0.0087  0.0197  -0.0309 18  ARG A CZ    
153  N NH1   . ARG A 18  ? 0.3762 0.3603 0.3483 0.0089  0.0170  -0.0277 18  ARG A NH1   
154  N NH2   . ARG A 18  ? 0.3336 0.3234 0.3147 0.0102  0.0189  -0.0328 18  ARG A NH2   
155  N N     . TYR A 19  ? 0.4223 0.4327 0.4407 0.0094  0.0185  -0.0394 19  TYR A N     
156  C CA    . TYR A 19  ? 0.4049 0.4171 0.4287 0.0116  0.0132  -0.0399 19  TYR A CA    
157  C C     . TYR A 19  ? 0.4267 0.4411 0.4576 0.0139  0.0106  -0.0432 19  TYR A C     
158  O O     . TYR A 19  ? 0.4426 0.4586 0.4765 0.0135  0.0137  -0.0461 19  TYR A O     
159  C CB    . TYR A 19  ? 0.4188 0.4337 0.4486 0.0108  0.0136  -0.0415 19  TYR A CB    
160  C CG    . TYR A 19  ? 0.3947 0.4142 0.4349 0.0096  0.0173  -0.0467 19  TYR A CG    
161  C CD1   . TYR A 19  ? 0.4174 0.4367 0.4560 0.0065  0.0242  -0.0477 19  TYR A CD1   
162  C CD2   . TYR A 19  ? 0.3902 0.4136 0.4418 0.0116  0.0138  -0.0509 19  TYR A CD2   
163  C CE1   . TYR A 19  ? 0.4330 0.4566 0.4819 0.0048  0.0287  -0.0530 19  TYR A CE1   
164  C CE2   . TYR A 19  ? 0.3649 0.3933 0.4284 0.0105  0.0174  -0.0565 19  TYR A CE2   
165  C CZ    . TYR A 19  ? 0.3816 0.4104 0.4440 0.0069  0.0254  -0.0577 19  TYR A CZ    
166  O OH    . TYR A 19  ? 0.3982 0.4319 0.4729 0.0053  0.0299  -0.0637 19  TYR A OH    
167  N N     . ILE A 20  ? 0.4236 0.4372 0.4562 0.0163  0.0046  -0.0430 20  ILE A N     
168  C CA    . ILE A 20  ? 0.4353 0.4501 0.4750 0.0188  0.0006  -0.0462 20  ILE A CA    
169  C C     . ILE A 20  ? 0.4419 0.4601 0.4923 0.0197  -0.0019 -0.0503 20  ILE A C     
170  O O     . ILE A 20  ? 0.4039 0.4203 0.4525 0.0201  -0.0053 -0.0488 20  ILE A O     
171  C CB    . ILE A 20  ? 0.4274 0.4370 0.4604 0.0209  -0.0051 -0.0432 20  ILE A CB    
172  C CG1   . ILE A 20  ? 0.4206 0.4274 0.4451 0.0202  -0.0029 -0.0401 20  ILE A CG1   
173  C CG2   . ILE A 20  ? 0.4182 0.4277 0.4582 0.0238  -0.0107 -0.0466 20  ILE A CG2   
174  C CD1   . ILE A 20  ? 0.4292 0.4380 0.4568 0.0202  0.0001  -0.0426 20  ILE A CD1   
175  N N     . ASP A 21  ? 0.4517 0.4747 0.5136 0.0200  0.0000  -0.0557 21  ASP A N     
176  C CA    . ASP A 21  ? 0.4710 0.4980 0.5457 0.0209  -0.0026 -0.0605 21  ASP A CA    
177  C C     . ASP A 21  ? 0.5016 0.5261 0.5798 0.0248  -0.0119 -0.0619 21  ASP A C     
178  O O     . ASP A 21  ? 0.4909 0.5103 0.5613 0.0264  -0.0158 -0.0590 21  ASP A O     
179  C CB    . ASP A 21  ? 0.4665 0.4998 0.5537 0.0194  0.0035  -0.0666 21  ASP A CB    
180  C CG    . ASP A 21  ? 0.4707 0.5054 0.5637 0.0213  0.0028  -0.0702 21  ASP A CG    
181  O OD1   . ASP A 21  ? 0.4857 0.5167 0.5751 0.0243  -0.0037 -0.0686 21  ASP A OD1   
182  O OD2   . ASP A 21  ? 0.4196 0.4587 0.5204 0.0195  0.0093  -0.0748 21  ASP A OD2   
183  N N     . SER A 22  ? 0.5198 0.5471 0.6097 0.0261  -0.0156 -0.0664 22  SER A N     
184  C CA    . SER A 22  ? 0.5530 0.5765 0.6457 0.0299  -0.0256 -0.0679 22  SER A CA    
185  C C     . SER A 22  ? 0.5558 0.5785 0.6531 0.0327  -0.0295 -0.0706 22  SER A C     
186  O O     . SER A 22  ? 0.5685 0.5865 0.6666 0.0360  -0.0385 -0.0715 22  SER A O     
187  C CB    . SER A 22  ? 0.5460 0.5732 0.6520 0.0308  -0.0291 -0.0730 22  SER A CB    
188  O OG    . SER A 22  ? 0.5719 0.6076 0.6938 0.0296  -0.0234 -0.0794 22  SER A OG    
189  N N     . ASN A 23  ? 0.5531 0.5794 0.6523 0.0314  -0.0229 -0.0717 23  ASN A N     
190  C CA    . ASN A 23  ? 0.5690 0.5951 0.6728 0.0338  -0.0257 -0.0745 23  ASN A CA    
191  C C     . ASN A 23  ? 0.5709 0.5921 0.6606 0.0332  -0.0239 -0.0691 23  ASN A C     
192  O O     . ASN A 23  ? 0.5633 0.5834 0.6546 0.0350  -0.0259 -0.0705 23  ASN A O     
193  C CB    . ASN A 23  ? 0.5656 0.6001 0.6858 0.0332  -0.0202 -0.0819 23  ASN A CB    
194  C CG    . ASN A 23  ? 0.5765 0.6160 0.7139 0.0344  -0.0233 -0.0884 23  ASN A CG    
195  O OD1   . ASN A 23  ? 0.5910 0.6276 0.7333 0.0381  -0.0331 -0.0903 23  ASN A OD1   
196  N ND2   . ASN A 23  ? 0.5944 0.6407 0.7407 0.0313  -0.0152 -0.0921 23  ASN A ND2   
197  N N     . GLY A 24  ? 0.5590 0.5773 0.6355 0.0307  -0.0203 -0.0632 24  GLY A N     
198  C CA    . GLY A 24  ? 0.5528 0.5668 0.6168 0.0298  -0.0185 -0.0582 24  GLY A CA    
199  C C     . GLY A 24  ? 0.5369 0.5546 0.6011 0.0276  -0.0104 -0.0592 24  GLY A C     
200  O O     . GLY A 24  ? 0.5546 0.5694 0.6107 0.0273  -0.0092 -0.0563 24  GLY A O     
201  N N     . ARG A 25  ? 0.5178 0.5414 0.5910 0.0259  -0.0049 -0.0634 25  ARG A N     
202  C CA    . ARG A 25  ? 0.5202 0.5459 0.5913 0.0231  0.0035  -0.0641 25  ARG A CA    
203  C C     . ARG A 25  ? 0.4875 0.5106 0.5469 0.0200  0.0077  -0.0590 25  ARG A C     
204  O O     . ARG A 25  ? 0.4909 0.5146 0.5508 0.0191  0.0076  -0.0579 25  ARG A O     
205  C CB    . ARG A 25  ? 0.5119 0.5439 0.5967 0.0218  0.0087  -0.0710 25  ARG A CB    
206  C CG    . ARG A 25  ? 0.5284 0.5634 0.6236 0.0237  0.0085  -0.0768 25  ARG A CG    
207  C CD    . ARG A 25  ? 0.5035 0.5407 0.6120 0.0275  0.0004  -0.0811 25  ARG A CD    
208  N NE    . ARG A 25  ? 0.5070 0.5483 0.6288 0.0290  0.0009  -0.0881 25  ARG A NE    
209  C CZ    . ARG A 25  ? 0.4728 0.5209 0.6118 0.0287  0.0038  -0.0959 25  ARG A CZ    
210  N NH1   . ARG A 25  ? 0.4419 0.4936 0.5873 0.0268  0.0063  -0.0976 25  ARG A NH1   
211  N NH2   . ARG A 25  ? 0.4763 0.5278 0.6271 0.0303  0.0042  -0.1023 25  ARG A NH2   
212  N N     . GLU A 26  ? 0.4549 0.4748 0.5043 0.0187  0.0110  -0.0560 26  GLU A N     
213  C CA    . GLU A 26  ? 0.4662 0.4835 0.5057 0.0158  0.0154  -0.0523 26  GLU A CA    
214  C C     . GLU A 26  ? 0.4822 0.5021 0.5255 0.0127  0.0227  -0.0557 26  GLU A C     
215  O O     . GLU A 26  ? 0.4574 0.4795 0.5061 0.0119  0.0269  -0.0602 26  GLU A O     
216  C CB    . GLU A 26  ? 0.4557 0.4683 0.4841 0.0155  0.0162  -0.0489 26  GLU A CB    
217  C CG    . GLU A 26  ? 0.4518 0.4606 0.4698 0.0128  0.0197  -0.0452 26  GLU A CG    
218  C CD    . GLU A 26  ? 0.4437 0.4474 0.4513 0.0130  0.0186  -0.0417 26  GLU A CD    
219  O OE1   . GLU A 26  ? 0.4584 0.4614 0.4660 0.0151  0.0146  -0.0409 26  GLU A OE1   
220  O OE2   . GLU A 26  ? 0.4584 0.4584 0.4578 0.0109  0.0215  -0.0397 26  GLU A OE2   
221  N N     . ARG A 27  ? 0.4787 0.4980 0.5193 0.0107  0.0244  -0.0536 27  ARG A N     
222  C CA    . ARG A 27  ? 0.4997 0.5203 0.5423 0.0072  0.0315  -0.0561 27  ARG A CA    
223  C C     . ARG A 27  ? 0.4942 0.5096 0.5246 0.0048  0.0337  -0.0513 27  ARG A C     
224  O O     . ARG A 27  ? 0.5041 0.5165 0.5274 0.0061  0.0292  -0.0466 27  ARG A O     
225  C CB    . ARG A 27  ? 0.5319 0.5582 0.5881 0.0073  0.0310  -0.0602 27  ARG A CB    
226  C CG    . ARG A 27  ? 0.5846 0.6159 0.6547 0.0103  0.0273  -0.0655 27  ARG A CG    
227  C CD    . ARG A 27  ? 0.7092 0.7451 0.7905 0.0083  0.0339  -0.0724 27  ARG A CD    
228  N NE    . ARG A 27  ? 0.8063 0.8482 0.9049 0.0110  0.0297  -0.0782 27  ARG A NE    
229  C CZ    . ARG A 27  ? 0.8572 0.9033 0.9668 0.0105  0.0292  -0.0814 27  ARG A CZ    
230  N NH1   . ARG A 27  ? 0.8789 0.9240 0.9841 0.0073  0.0335  -0.0793 27  ARG A NH1   
231  N NH2   . ARG A 27  ? 0.8894 0.9404 1.0151 0.0134  0.0241  -0.0870 27  ARG A NH2   
232  N N     . THR A 28  ? 0.5049 0.5188 0.5331 0.0011  0.0405  -0.0527 28  THR A N     
233  C CA    . THR A 28  ? 0.5181 0.5263 0.5352 -0.0015 0.0426  -0.0487 28  THR A CA    
234  C C     . THR A 28  ? 0.5243 0.5345 0.5473 -0.0047 0.0479  -0.0515 28  THR A C     
235  O O     . THR A 28  ? 0.5574 0.5717 0.5898 -0.0061 0.0526  -0.0569 28  THR A O     
236  C CB    . THR A 28  ? 0.5434 0.5439 0.5467 -0.0035 0.0461  -0.0468 28  THR A CB    
237  O OG1   . THR A 28  ? 0.5942 0.5945 0.5960 -0.0010 0.0431  -0.0467 28  THR A OG1   
238  C CG2   . THR A 28  ? 0.5385 0.5322 0.5294 -0.0043 0.0443  -0.0414 28  THR A CG2   
239  N N     . ARG A 29  ? 0.4998 0.5073 0.5180 -0.0059 0.0474  -0.0483 29  ARG A N     
240  C CA    . ARG A 29  ? 0.5059 0.5144 0.5285 -0.0093 0.0525  -0.0505 29  ARG A CA    
241  C C     . ARG A 29  ? 0.5403 0.5416 0.5507 -0.0115 0.0531  -0.0458 29  ARG A C     
242  O O     . ARG A 29  ? 0.5438 0.5420 0.5468 -0.0094 0.0478  -0.0413 29  ARG A O     
243  C CB    . ARG A 29  ? 0.4970 0.5133 0.5347 -0.0075 0.0492  -0.0535 29  ARG A CB    
244  C CG    . ARG A 29  ? 0.4525 0.4692 0.4888 -0.0043 0.0413  -0.0496 29  ARG A CG    
245  C CD    . ARG A 29  ? 0.4227 0.4458 0.4728 -0.0026 0.0379  -0.0530 29  ARG A CD    
246  N NE    . ARG A 29  ? 0.4341 0.4568 0.4822 0.0008  0.0302  -0.0499 29  ARG A NE    
247  C CZ    . ARG A 29  ? 0.4740 0.5004 0.5311 0.0037  0.0246  -0.0522 29  ARG A CZ    
248  N NH1   . ARG A 29  ? 0.4756 0.5072 0.5460 0.0040  0.0253  -0.0580 29  ARG A NH1   
249  N NH2   . ARG A 29  ? 0.4784 0.5027 0.5310 0.0061  0.0184  -0.0491 29  ARG A NH2   
250  N N     . GLU A 30  ? 0.5517 0.5501 0.5604 -0.0158 0.0597  -0.0473 30  GLU A N     
251  C CA    . GLU A 30  ? 0.5738 0.5648 0.5715 -0.0181 0.0605  -0.0434 30  GLU A CA    
252  C C     . GLU A 30  ? 0.5857 0.5813 0.5937 -0.0194 0.0615  -0.0454 30  GLU A C     
253  O O     . GLU A 30  ? 0.5994 0.5996 0.6179 -0.0216 0.0668  -0.0504 30  GLU A O     
254  C CB    . GLU A 30  ? 0.6020 0.5834 0.5867 -0.0226 0.0675  -0.0433 30  GLU A CB    
255  C CG    . GLU A 30  ? 0.6476 0.6187 0.6180 -0.0249 0.0674  -0.0387 30  GLU A CG    
256  C CD    . GLU A 30  ? 0.6802 0.6409 0.6380 -0.0303 0.0755  -0.0394 30  GLU A CD    
257  O OE1   . GLU A 30  ? 0.7024 0.6623 0.6586 -0.0318 0.0805  -0.0424 30  GLU A OE1   
258  O OE2   . GLU A 30  ? 0.6462 0.5988 0.5949 -0.0333 0.0770  -0.0369 30  GLU A OE2   
259  N N     . VAL A 31  ? 0.5862 0.5810 0.5923 -0.0179 0.0565  -0.0419 31  VAL A N     
260  C CA    . VAL A 31  ? 0.5701 0.5693 0.5859 -0.0187 0.0565  -0.0436 31  VAL A CA    
261  C C     . VAL A 31  ? 0.5615 0.5532 0.5675 -0.0211 0.0573  -0.0400 31  VAL A C     
262  O O     . VAL A 31  ? 0.5778 0.5644 0.5739 -0.0195 0.0530  -0.0355 31  VAL A O     
263  C CB    . VAL A 31  ? 0.5565 0.5627 0.5818 -0.0142 0.0490  -0.0438 31  VAL A CB    
264  C CG1   . VAL A 31  ? 0.5698 0.5808 0.6062 -0.0150 0.0490  -0.0465 31  VAL A CG1   
265  C CG2   . VAL A 31  ? 0.5799 0.5917 0.6130 -0.0115 0.0471  -0.0468 31  VAL A CG2   
266  N N     . GLU A 32  ? 0.5631 0.5542 0.5726 -0.0251 0.0629  -0.0423 32  GLU A N     
267  C CA    . GLU A 32  ? 0.5977 0.5818 0.5992 -0.0276 0.0636  -0.0393 32  GLU A CA    
268  C C     . GLU A 32  ? 0.5828 0.5723 0.5925 -0.0248 0.0576  -0.0387 32  GLU A C     
269  O O     . GLU A 32  ? 0.5671 0.5602 0.5860 -0.0264 0.0594  -0.0413 32  GLU A O     
270  C CB    . GLU A 32  ? 0.6169 0.5975 0.6185 -0.0333 0.0724  -0.0421 32  GLU A CB    
271  C CG    . GLU A 32  ? 0.7039 0.6768 0.6944 -0.0369 0.0793  -0.0426 32  GLU A CG    
272  C CD    . GLU A 32  ? 0.7625 0.7319 0.7538 -0.0433 0.0892  -0.0460 32  GLU A CD    
273  O OE1   . GLU A 32  ? 0.8043 0.7651 0.7864 -0.0465 0.0910  -0.0434 32  GLU A OE1   
274  O OE2   . GLU A 32  ? 0.7430 0.7180 0.7443 -0.0451 0.0953  -0.0515 32  GLU A OE2   
275  N N     . TYR A 33  ? 0.5638 0.5537 0.5702 -0.0207 0.0507  -0.0355 33  TYR A N     
276  C CA    . TYR A 33  ? 0.5232 0.5178 0.5360 -0.0177 0.0448  -0.0350 33  TYR A CA    
277  C C     . TYR A 33  ? 0.5097 0.5006 0.5205 -0.0197 0.0452  -0.0336 33  TYR A C     
278  O O     . TYR A 33  ? 0.5260 0.5086 0.5260 -0.0217 0.0465  -0.0307 33  TYR A O     
279  C CB    . TYR A 33  ? 0.5027 0.4967 0.5102 -0.0138 0.0388  -0.0318 33  TYR A CB    
280  C CG    . TYR A 33  ? 0.4699 0.4678 0.4823 -0.0108 0.0332  -0.0314 33  TYR A CG    
281  C CD1   . TYR A 33  ? 0.4554 0.4601 0.4786 -0.0093 0.0313  -0.0346 33  TYR A CD1   
282  C CD2   . TYR A 33  ? 0.4102 0.4045 0.4163 -0.0095 0.0297  -0.0281 33  TYR A CD2   
283  C CE1   . TYR A 33  ? 0.4331 0.4397 0.4586 -0.0069 0.0262  -0.0342 33  TYR A CE1   
284  C CE2   . TYR A 33  ? 0.4448 0.4421 0.4545 -0.0072 0.0254  -0.0280 33  TYR A CE2   
285  C CZ    . TYR A 33  ? 0.4292 0.4322 0.4476 -0.0060 0.0238  -0.0308 33  TYR A CZ    
286  O OH    . TYR A 33  ? 0.4052 0.4095 0.4250 -0.0040 0.0196  -0.0307 33  TYR A OH    
287  N N     . LYS A 34  ? 0.4882 0.4849 0.5095 -0.0190 0.0435  -0.0360 34  LYS A N     
288  C CA    . LYS A 34  ? 0.5033 0.4975 0.5245 -0.0206 0.0434  -0.0352 34  LYS A CA    
289  C C     . LYS A 34  ? 0.4805 0.4764 0.5019 -0.0169 0.0366  -0.0333 34  LYS A C     
290  O O     . LYS A 34  ? 0.4901 0.4920 0.5200 -0.0147 0.0333  -0.0356 34  LYS A O     
291  C CB    . LYS A 34  ? 0.5233 0.5225 0.5569 -0.0229 0.0467  -0.0398 34  LYS A CB    
292  C CG    . LYS A 34  ? 0.5825 0.5827 0.6200 -0.0262 0.0538  -0.0433 34  LYS A CG    
293  C CD    . LYS A 34  ? 0.6515 0.6450 0.6840 -0.0317 0.0608  -0.0433 34  LYS A CD    
294  C CE    . LYS A 34  ? 0.6836 0.6811 0.7281 -0.0337 0.0623  -0.0468 34  LYS A CE    
295  N NZ    . LYS A 34  ? 0.7237 0.7204 0.7727 -0.0392 0.0716  -0.0508 34  LYS A NZ    
296  N N     . PRO A 35  ? 0.4537 0.4436 0.4652 -0.0163 0.0344  -0.0295 35  PRO A N     
297  C CA    . PRO A 35  ? 0.4148 0.4059 0.4260 -0.0130 0.0289  -0.0280 35  PRO A CA    
298  C C     . PRO A 35  ? 0.4044 0.3959 0.4195 -0.0135 0.0276  -0.0287 35  PRO A C     
299  O O     . PRO A 35  ? 0.3667 0.3556 0.3824 -0.0165 0.0307  -0.0293 35  PRO A O     
300  C CB    . PRO A 35  ? 0.4109 0.3953 0.4116 -0.0125 0.0276  -0.0244 35  PRO A CB    
301  C CG    . PRO A 35  ? 0.4564 0.4339 0.4505 -0.0161 0.0318  -0.0235 35  PRO A CG    
302  C CD    . PRO A 35  ? 0.4659 0.4468 0.4666 -0.0189 0.0370  -0.0268 35  PRO A CD    
303  N N     . SER A 36  ? 0.3816 0.3759 0.3989 -0.0107 0.0233  -0.0288 36  SER A N     
304  C CA    . SER A 36  ? 0.4174 0.4113 0.4370 -0.0109 0.0216  -0.0293 36  SER A CA    
305  C C     . SER A 36  ? 0.4325 0.4232 0.4465 -0.0091 0.0186  -0.0269 36  SER A C     
306  O O     . SER A 36  ? 0.4570 0.4483 0.4683 -0.0070 0.0167  -0.0260 36  SER A O     
307  C CB    . SER A 36  ? 0.4082 0.4076 0.4358 -0.0095 0.0191  -0.0323 36  SER A CB    
308  O OG    . SER A 36  ? 0.4551 0.4580 0.4904 -0.0111 0.0216  -0.0353 36  SER A OG    
309  N N     . LEU A 37  ? 0.4244 0.4116 0.4374 -0.0103 0.0184  -0.0264 37  LEU A N     
310  C CA    . LEU A 37  ? 0.4045 0.3894 0.4148 -0.0086 0.0155  -0.0252 37  LEU A CA    
311  C C     . LEU A 37  ? 0.3994 0.3854 0.4141 -0.0088 0.0144  -0.0270 37  LEU A C     
312  O O     . LEU A 37  ? 0.4277 0.4161 0.4475 -0.0102 0.0156  -0.0289 37  LEU A O     
313  C CB    . LEU A 37  ? 0.3858 0.3639 0.3897 -0.0092 0.0154  -0.0227 37  LEU A CB    
314  C CG    . LEU A 37  ? 0.4191 0.3956 0.4180 -0.0086 0.0157  -0.0211 37  LEU A CG    
315  C CD1   . LEU A 37  ? 0.4222 0.3904 0.4139 -0.0094 0.0149  -0.0188 37  LEU A CD1   
316  C CD2   . LEU A 37  ? 0.4658 0.4462 0.4660 -0.0057 0.0134  -0.0214 37  LEU A CD2   
317  N N     . PHE A 38  ? 0.4000 0.3846 0.4137 -0.0074 0.0121  -0.0268 38  PHE A N     
318  C CA    . PHE A 38  ? 0.4131 0.3991 0.4306 -0.0072 0.0107  -0.0289 38  PHE A CA    
319  C C     . PHE A 38  ? 0.4232 0.4052 0.4398 -0.0073 0.0096  -0.0285 38  PHE A C     
320  O O     . PHE A 38  ? 0.4234 0.4022 0.4368 -0.0064 0.0087  -0.0271 38  PHE A O     
321  C CB    . PHE A 38  ? 0.4176 0.4070 0.4355 -0.0051 0.0088  -0.0304 38  PHE A CB    
322  C CG    . PHE A 38  ? 0.4709 0.4637 0.4903 -0.0047 0.0089  -0.0311 38  PHE A CG    
323  C CD1   . PHE A 38  ? 0.4634 0.4567 0.4802 -0.0041 0.0097  -0.0297 38  PHE A CD1   
324  C CD2   . PHE A 38  ? 0.4370 0.4323 0.4608 -0.0046 0.0075  -0.0336 38  PHE A CD2   
325  C CE1   . PHE A 38  ? 0.4441 0.4405 0.4628 -0.0036 0.0095  -0.0307 38  PHE A CE1   
326  C CE2   . PHE A 38  ? 0.4277 0.4259 0.4539 -0.0039 0.0067  -0.0347 38  PHE A CE2   
327  C CZ    . PHE A 38  ? 0.4642 0.4629 0.4878 -0.0034 0.0078  -0.0332 38  PHE A CZ    
328  N N     . ALA A 39  ? 0.4058 0.3877 0.4258 -0.0082 0.0092  -0.0301 39  ALA A N     
329  C CA    . ALA A 39  ? 0.4025 0.3811 0.4227 -0.0080 0.0077  -0.0303 39  ALA A CA    
330  C C     . ALA A 39  ? 0.4132 0.3944 0.4367 -0.0072 0.0062  -0.0330 39  ALA A C     
331  O O     . ALA A 39  ? 0.4264 0.4104 0.4529 -0.0077 0.0062  -0.0347 39  ALA A O     
332  C CB    . ALA A 39  ? 0.3982 0.3719 0.4179 -0.0106 0.0088  -0.0292 39  ALA A CB    
333  N N     . HIS A 40  ? 0.4219 0.4017 0.4448 -0.0058 0.0049  -0.0339 40  HIS A N     
334  C CA    . HIS A 40  ? 0.4717 0.4523 0.4966 -0.0053 0.0036  -0.0366 40  HIS A CA    
335  C C     . HIS A 40  ? 0.4721 0.4518 0.5008 -0.0071 0.0034  -0.0373 40  HIS A C     
336  O O     . HIS A 40  ? 0.4412 0.4177 0.4702 -0.0088 0.0042  -0.0357 40  HIS A O     
337  C CB    . HIS A 40  ? 0.4646 0.4432 0.4895 -0.0041 0.0029  -0.0376 40  HIS A CB    
338  C CG    . HIS A 40  ? 0.4843 0.4643 0.5068 -0.0025 0.0036  -0.0381 40  HIS A CG    
339  N ND1   . HIS A 40  ? 0.5072 0.4859 0.5305 -0.0016 0.0036  -0.0379 40  HIS A ND1   
340  C CD2   . HIS A 40  ? 0.5042 0.4862 0.5237 -0.0020 0.0043  -0.0390 40  HIS A CD2   
341  C CE1   . HIS A 40  ? 0.5234 0.5039 0.5450 -0.0007 0.0050  -0.0388 40  HIS A CE1   
342  N NE2   . HIS A 40  ? 0.5003 0.4824 0.5188 -0.0010 0.0055  -0.0392 40  HIS A NE2   
343  N N     . CYS A 41  ? 0.5011 0.4828 0.5321 -0.0070 0.0023  -0.0397 41  CYS A N     
344  C CA    . CYS A 41  ? 0.5761 0.5575 0.6119 -0.0088 0.0019  -0.0410 41  CYS A CA    
345  C C     . CYS A 41  ? 0.6131 0.5942 0.6502 -0.0079 -0.0004 -0.0439 41  CYS A C     
346  O O     . CYS A 41  ? 0.5996 0.5805 0.6328 -0.0061 -0.0014 -0.0450 41  CYS A O     
347  C CB    . CYS A 41  ? 0.5734 0.5583 0.6131 -0.0099 0.0027  -0.0416 41  CYS A CB    
348  S SG    . CYS A 41  ? 0.6168 0.6053 0.6559 -0.0077 0.0000  -0.0437 41  CYS A SG    
349  N N     . PRO A 42  ? 0.6736 0.6537 0.7154 -0.0094 -0.0011 -0.0454 42  PRO A N     
350  C CA    . PRO A 42  ? 0.7008 0.6801 0.7435 -0.0086 -0.0036 -0.0483 42  PRO A CA    
351  C C     . PRO A 42  ? 0.7372 0.7182 0.7779 -0.0070 -0.0060 -0.0506 42  PRO A C     
352  O O     . PRO A 42  ? 0.7166 0.7003 0.7591 -0.0070 -0.0066 -0.0507 42  PRO A O     
353  C CB    . PRO A 42  ? 0.7026 0.6811 0.7517 -0.0108 -0.0037 -0.0493 42  PRO A CB    
354  C CG    . PRO A 42  ? 0.7214 0.6982 0.7708 -0.0130 -0.0006 -0.0463 42  PRO A CG    
355  C CD    . PRO A 42  ? 0.6885 0.6676 0.7345 -0.0122 0.0008  -0.0444 42  PRO A CD    
356  N N     . GLU A 43  ? 0.8061 0.7849 0.8428 -0.0057 -0.0075 -0.0526 43  GLU A N     
357  C CA    . GLU A 43  ? 0.8721 0.8500 0.9038 -0.0043 -0.0102 -0.0547 43  GLU A CA    
358  C C     . GLU A 43  ? 0.8911 0.8703 0.9281 -0.0045 -0.0137 -0.0568 43  GLU A C     
359  O O     . GLU A 43  ? 0.8901 0.8688 0.9240 -0.0033 -0.0166 -0.0580 43  GLU A O     
360  C CB    . GLU A 43  ? 0.9065 0.8806 0.9328 -0.0034 -0.0107 -0.0569 43  GLU A CB    
361  C CG    . GLU A 43  ? 0.9511 0.9244 0.9759 -0.0033 -0.0073 -0.0560 43  GLU A CG    
362  C CD    . GLU A 43  ? 1.0031 0.9772 1.0233 -0.0028 -0.0049 -0.0540 43  GLU A CD    
363  O OE1   . GLU A 43  ? 1.0009 0.9733 1.0140 -0.0021 -0.0052 -0.0548 43  GLU A OE1   
364  O OE2   . GLU A 43  ? 1.0129 0.9885 1.0361 -0.0030 -0.0029 -0.0518 43  GLU A OE2   
365  N N     . SER A 44  ? 0.9176 0.8980 0.9627 -0.0061 -0.0135 -0.0575 44  SER A N     
366  C CA    . SER A 44  ? 0.9509 0.9330 1.0036 -0.0067 -0.0165 -0.0603 44  SER A CA    
367  C C     . SER A 44  ? 0.9505 0.9369 1.0113 -0.0084 -0.0143 -0.0594 44  SER A C     
368  O O     . SER A 44  ? 0.9531 0.9408 1.0224 -0.0106 -0.0131 -0.0605 44  SER A O     
369  C CB    . SER A 44  ? 0.9684 0.9487 1.0252 -0.0076 -0.0178 -0.0625 44  SER A CB    
370  O OG    . SER A 44  ? 0.9938 0.9739 1.0545 -0.0098 -0.0141 -0.0606 44  SER A OG    
371  N N     . GLN A 45  ? 0.9378 0.9260 0.9959 -0.0077 -0.0132 -0.0577 45  GLN A N     
372  C CA    . GLN A 45  ? 0.9162 0.9086 0.9820 -0.0090 -0.0117 -0.0579 45  GLN A CA    
373  C C     . GLN A 45  ? 0.9016 0.8954 0.9639 -0.0069 -0.0134 -0.0576 45  GLN A C     
374  O O     . GLN A 45  ? 0.8973 0.8893 0.9507 -0.0057 -0.0123 -0.0550 45  GLN A O     
375  C CB    . GLN A 45  ? 0.9127 0.9054 0.9804 -0.0118 -0.0060 -0.0552 45  GLN A CB    
376  C CG    . GLN A 45  ? 0.9155 0.9062 0.9746 -0.0113 -0.0032 -0.0512 45  GLN A CG    
377  C CD    . GLN A 45  ? 0.9163 0.9082 0.9770 -0.0134 0.0012  -0.0491 45  GLN A CD    
378  O OE1   . GLN A 45  ? 0.8898 0.8850 0.9525 -0.0130 0.0015  -0.0495 45  GLN A OE1   
379  N NE2   . GLN A 45  ? 0.8944 0.8828 0.9535 -0.0157 0.0044  -0.0469 45  GLN A NE2   
380  N N     . ALA A 46  ? 0.8735 0.8703 0.9436 -0.0065 -0.0163 -0.0606 46  ALA A N     
381  C CA    . ALA A 46  ? 0.8343 0.8316 0.9020 -0.0041 -0.0197 -0.0612 46  ALA A CA    
382  C C     . ALA A 46  ? 0.7952 0.7942 0.8598 -0.0044 -0.0156 -0.0580 46  ALA A C     
383  O O     . ALA A 46  ? 0.7886 0.7909 0.8594 -0.0066 -0.0110 -0.0573 46  ALA A O     
384  C CB    . ALA A 46  ? 0.8496 0.8501 0.9291 -0.0036 -0.0240 -0.0658 46  ALA A CB    
385  N N     . THR A 47  ? 0.7379 0.7340 0.7922 -0.0024 -0.0171 -0.0562 47  THR A N     
386  C CA    . THR A 47  ? 0.6959 0.6933 0.7468 -0.0022 -0.0142 -0.0534 47  THR A CA    
387  C C     . THR A 47  ? 0.6545 0.6487 0.6968 0.0003  -0.0181 -0.0531 47  THR A C     
388  O O     . THR A 47  ? 0.6502 0.6397 0.6856 0.0016  -0.0219 -0.0541 47  THR A O     
389  C CB    . THR A 47  ? 0.6959 0.6921 0.7413 -0.0036 -0.0089 -0.0497 47  THR A CB    
390  O OG1   . THR A 47  ? 0.6354 0.6329 0.6782 -0.0034 -0.0064 -0.0472 47  THR A OG1   
391  C CG2   . THR A 47  ? 0.7019 0.6936 0.7380 -0.0026 -0.0098 -0.0488 47  THR A CG2   
392  N N     . LYS A 48  ? 0.5988 0.5948 0.6408 0.0008  -0.0170 -0.0518 48  LYS A N     
393  C CA    . LYS A 48  ? 0.5674 0.5597 0.6003 0.0029  -0.0199 -0.0509 48  LYS A CA    
394  C C     . LYS A 48  ? 0.5309 0.5219 0.5554 0.0024  -0.0155 -0.0471 48  LYS A C     
395  O O     . LYS A 48  ? 0.5202 0.5079 0.5365 0.0036  -0.0167 -0.0459 48  LYS A O     
396  C CB    . LYS A 48  ? 0.5625 0.5571 0.6015 0.0042  -0.0234 -0.0528 48  LYS A CB    
397  C CG    . LYS A 48  ? 0.5314 0.5314 0.5766 0.0032  -0.0187 -0.0516 48  LYS A CG    
398  C CD    . LYS A 48  ? 0.5087 0.5110 0.5609 0.0048  -0.0225 -0.0543 48  LYS A CD    
399  C CE    . LYS A 48  ? 0.5035 0.5109 0.5617 0.0036  -0.0173 -0.0536 48  LYS A CE    
400  N NZ    . LYS A 48  ? 0.4778 0.4889 0.5465 0.0049  -0.0204 -0.0573 48  LYS A NZ    
401  N N     . TYR A 49  ? 0.5162 0.5092 0.5427 0.0007  -0.0106 -0.0454 49  TYR A N     
402  C CA    . TYR A 49  ? 0.5010 0.4932 0.5216 0.0004  -0.0069 -0.0423 49  TYR A CA    
403  C C     . TYR A 49  ? 0.4959 0.4848 0.5111 0.0001  -0.0056 -0.0418 49  TYR A C     
404  O O     . TYR A 49  ? 0.4887 0.4778 0.5075 -0.0009 -0.0050 -0.0426 49  TYR A O     
405  C CB    . TYR A 49  ? 0.4883 0.4838 0.5139 -0.0011 -0.0028 -0.0406 49  TYR A CB    
406  C CG    . TYR A 49  ? 0.4804 0.4796 0.5125 -0.0012 -0.0029 -0.0416 49  TYR A CG    
407  C CD1   . TYR A 49  ? 0.4052 0.4073 0.4466 -0.0028 -0.0020 -0.0437 49  TYR A CD1   
408  C CD2   . TYR A 49  ? 0.4655 0.4651 0.4951 0.0000  -0.0036 -0.0408 49  TYR A CD2   
409  C CE1   . TYR A 49  ? 0.4265 0.4323 0.4751 -0.0031 -0.0014 -0.0453 49  TYR A CE1   
410  C CE2   . TYR A 49  ? 0.4279 0.4311 0.4644 0.0000  -0.0036 -0.0423 49  TYR A CE2   
411  C CZ    . TYR A 49  ? 0.4623 0.4688 0.5087 -0.0016 -0.0023 -0.0448 49  TYR A CZ    
412  O OH    . TYR A 49  ? 0.4595 0.4700 0.5140 -0.0018 -0.0017 -0.0470 49  TYR A OH    
413  N N     . PHE A 50  ? 0.4997 0.4855 0.5066 0.0007  -0.0050 -0.0409 50  PHE A N     
414  C CA    . PHE A 50  ? 0.5148 0.4978 0.5172 0.0004  -0.0032 -0.0411 50  PHE A CA    
415  C C     . PHE A 50  ? 0.5157 0.4987 0.5153 0.0002  0.0003  -0.0392 50  PHE A C     
416  O O     . PHE A 50  ? 0.5049 0.4880 0.5017 0.0007  0.0004  -0.0380 50  PHE A O     
417  C CB    . PHE A 50  ? 0.5235 0.5013 0.5181 0.0009  -0.0056 -0.0431 50  PHE A CB    
418  C CG    . PHE A 50  ? 0.5432 0.5203 0.5409 0.0012  -0.0096 -0.0454 50  PHE A CG    
419  C CD1   . PHE A 50  ? 0.5322 0.5096 0.5321 0.0021  -0.0139 -0.0464 50  PHE A CD1   
420  C CD2   . PHE A 50  ? 0.5617 0.5380 0.5610 0.0006  -0.0093 -0.0470 50  PHE A CD2   
421  C CE1   . PHE A 50  ? 0.5472 0.5243 0.5514 0.0025  -0.0180 -0.0491 50  PHE A CE1   
422  C CE2   . PHE A 50  ? 0.5687 0.5443 0.5714 0.0008  -0.0131 -0.0494 50  PHE A CE2   
423  C CZ    . PHE A 50  ? 0.5386 0.5147 0.5440 0.0017  -0.0175 -0.0505 50  PHE A CZ    
424  N N     . ASP A 51  ? 0.4911 0.4741 0.4923 -0.0003 0.0026  -0.0393 51  ASP A N     
425  C CA    . ASP A 51  ? 0.4702 0.4532 0.4699 -0.0002 0.0054  -0.0384 51  ASP A CA    
426  C C     . ASP A 51  ? 0.4659 0.4452 0.4577 -0.0003 0.0065  -0.0397 51  ASP A C     
427  O O     . ASP A 51  ? 0.4786 0.4545 0.4650 -0.0003 0.0046  -0.0410 51  ASP A O     
428  C CB    . ASP A 51  ? 0.4656 0.4494 0.4704 -0.0005 0.0069  -0.0385 51  ASP A CB    
429  C CG    . ASP A 51  ? 0.4870 0.4688 0.4916 -0.0007 0.0075  -0.0412 51  ASP A CG    
430  O OD1   . ASP A 51  ? 0.4381 0.4172 0.4372 -0.0009 0.0074  -0.0430 51  ASP A OD1   
431  O OD2   . ASP A 51  ? 0.4577 0.4398 0.4672 -0.0006 0.0079  -0.0417 51  ASP A OD2   
432  N N     . ILE A 52  ? 0.4712 0.4503 0.4618 -0.0006 0.0095  -0.0395 52  ILE A N     
433  C CA    . ILE A 52  ? 0.4502 0.4250 0.4324 -0.0013 0.0115  -0.0405 52  ILE A CA    
434  C C     . ILE A 52  ? 0.4875 0.4585 0.4657 -0.0022 0.0130  -0.0435 52  ILE A C     
435  O O     . ILE A 52  ? 0.5055 0.4709 0.4741 -0.0032 0.0142  -0.0445 52  ILE A O     
436  C CB    . ILE A 52  ? 0.4561 0.4319 0.4389 -0.0017 0.0148  -0.0399 52  ILE A CB    
437  C CG1   . ILE A 52  ? 0.4003 0.3792 0.3915 -0.0017 0.0169  -0.0412 52  ILE A CG1   
438  C CG2   . ILE A 52  ? 0.4035 0.3816 0.3873 -0.0009 0.0130  -0.0371 52  ILE A CG2   
439  C CD1   . ILE A 52  ? 0.3741 0.3534 0.3668 -0.0023 0.0206  -0.0421 52  ILE A CD1   
440  N N     . TYR A 53  ? 0.4906 0.4637 0.4753 -0.0021 0.0130  -0.0449 53  TYR A N     
441  C CA    . TYR A 53  ? 0.4939 0.4638 0.4762 -0.0028 0.0143  -0.0480 53  TYR A CA    
442  C C     . TYR A 53  ? 0.5218 0.4893 0.5009 -0.0024 0.0103  -0.0485 53  TYR A C     
443  O O     . TYR A 53  ? 0.5300 0.4945 0.5066 -0.0029 0.0107  -0.0512 53  TYR A O     
444  C CB    . TYR A 53  ? 0.4936 0.4668 0.4855 -0.0026 0.0159  -0.0496 53  TYR A CB    
445  C CG    . TYR A 53  ? 0.5414 0.5175 0.5386 -0.0025 0.0185  -0.0492 53  TYR A CG    
446  C CD1   . TYR A 53  ? 0.5237 0.5035 0.5281 -0.0014 0.0165  -0.0469 53  TYR A CD1   
447  C CD2   . TYR A 53  ? 0.5675 0.5420 0.5620 -0.0036 0.0231  -0.0514 53  TYR A CD2   
448  C CE1   . TYR A 53  ? 0.5558 0.5376 0.5649 -0.0010 0.0180  -0.0468 53  TYR A CE1   
449  C CE2   . TYR A 53  ? 0.5963 0.5737 0.5971 -0.0035 0.0252  -0.0516 53  TYR A CE2   
450  C CZ    . TYR A 53  ? 0.5912 0.5723 0.5993 -0.0020 0.0222  -0.0493 53  TYR A CZ    
451  O OH    . TYR A 53  ? 0.5665 0.5499 0.5806 -0.0017 0.0235  -0.0496 53  TYR A OH    
452  N N     . GLY A 54  ? 0.5195 0.4882 0.4993 -0.0016 0.0064  -0.0465 54  GLY A N     
453  C CA    . GLY A 54  ? 0.5266 0.4934 0.5050 -0.0011 0.0021  -0.0475 54  GLY A CA    
454  C C     . GLY A 54  ? 0.5446 0.5153 0.5326 -0.0009 0.0006  -0.0478 54  GLY A C     
455  O O     . GLY A 54  ? 0.5462 0.5154 0.5344 -0.0007 -0.0026 -0.0494 54  GLY A O     
456  N N     . LYS A 55  ? 0.5387 0.5137 0.5344 -0.0010 0.0026  -0.0465 55  LYS A N     
457  C CA    . LYS A 55  ? 0.5481 0.5256 0.5519 -0.0012 0.0015  -0.0464 55  LYS A CA    
458  C C     . LYS A 55  ? 0.5283 0.5088 0.5366 -0.0013 -0.0003 -0.0446 55  LYS A C     
459  O O     . LYS A 55  ? 0.5307 0.5130 0.5389 -0.0011 0.0006  -0.0425 55  LYS A O     
460  C CB    . LYS A 55  ? 0.5746 0.5532 0.5832 -0.0013 0.0038  -0.0461 55  LYS A CB    
461  C CG    . LYS A 55  ? 0.6467 0.6230 0.6534 -0.0014 0.0059  -0.0490 55  LYS A CG    
462  C CD    . LYS A 55  ? 0.7256 0.7028 0.7393 -0.0011 0.0067  -0.0496 55  LYS A CD    
463  C CE    . LYS A 55  ? 0.7924 0.7687 0.8102 -0.0013 0.0046  -0.0507 55  LYS A CE    
464  N NZ    . LYS A 55  ? 0.7872 0.7610 0.8011 -0.0016 0.0043  -0.0539 55  LYS A NZ    
465  N N     . PRO A 56  ? 0.5111 0.4922 0.5237 -0.0017 -0.0027 -0.0457 56  PRO A N     
466  C CA    . PRO A 56  ? 0.4969 0.4809 0.5150 -0.0021 -0.0039 -0.0450 56  PRO A CA    
467  C C     . PRO A 56  ? 0.4756 0.4618 0.4978 -0.0031 -0.0011 -0.0425 56  PRO A C     
468  O O     . PRO A 56  ? 0.4692 0.4542 0.4924 -0.0036 0.0003  -0.0418 56  PRO A O     
469  C CB    . PRO A 56  ? 0.5119 0.4957 0.5349 -0.0027 -0.0062 -0.0474 56  PRO A CB    
470  C CG    . PRO A 56  ? 0.4871 0.4684 0.5086 -0.0028 -0.0052 -0.0482 56  PRO A CG    
471  C CD    . PRO A 56  ? 0.5134 0.4924 0.5271 -0.0019 -0.0038 -0.0481 56  PRO A CD    
472  N N     . CYS A 57  ? 0.4695 0.4581 0.4935 -0.0033 -0.0008 -0.0415 57  CYS A N     
473  C CA    . CYS A 57  ? 0.4748 0.4644 0.5009 -0.0045 0.0019  -0.0391 57  CYS A CA    
474  C C     . CYS A 57  ? 0.4689 0.4610 0.5011 -0.0059 0.0024  -0.0398 57  CYS A C     
475  O O     . CYS A 57  ? 0.4898 0.4841 0.5248 -0.0052 0.0005  -0.0417 57  CYS A O     
476  C CB    . CYS A 57  ? 0.4765 0.4664 0.4981 -0.0035 0.0031  -0.0371 57  CYS A CB    
477  S SG    . CYS A 57  ? 0.5277 0.5151 0.5445 -0.0025 0.0039  -0.0365 57  CYS A SG    
478  N N     . THR A 58  ? 0.4678 0.4590 0.5022 -0.0080 0.0051  -0.0385 58  THR A N     
479  C CA    . THR A 58  ? 0.4778 0.4711 0.5177 -0.0100 0.0072  -0.0392 58  THR A CA    
480  C C     . THR A 58  ? 0.4549 0.4485 0.4917 -0.0102 0.0096  -0.0370 58  THR A C     
481  O O     . THR A 58  ? 0.4482 0.4387 0.4790 -0.0099 0.0105  -0.0344 58  THR A O     
482  C CB    . THR A 58  ? 0.4877 0.4786 0.5309 -0.0129 0.0093  -0.0393 58  THR A CB    
483  O OG1   . THR A 58  ? 0.5370 0.5291 0.5843 -0.0155 0.0130  -0.0398 58  THR A OG1   
484  C CG2   . THR A 58  ? 0.4864 0.4718 0.5234 -0.0133 0.0101  -0.0365 58  THR A CG2   
485  N N     . ARG A 59  ? 0.4820 0.4792 0.5234 -0.0105 0.0104  -0.0385 59  ARG A N     
486  C CA    . ARG A 59  ? 0.4656 0.4633 0.5048 -0.0109 0.0130  -0.0370 59  ARG A CA    
487  C C     . ARG A 59  ? 0.4912 0.4863 0.5306 -0.0144 0.0177  -0.0362 59  ARG A C     
488  O O     . ARG A 59  ? 0.4887 0.4847 0.5344 -0.0167 0.0195  -0.0384 59  ARG A O     
489  C CB    . ARG A 59  ? 0.4565 0.4590 0.5010 -0.0097 0.0118  -0.0394 59  ARG A CB    
490  C CG    . ARG A 59  ? 0.4780 0.4814 0.5221 -0.0107 0.0153  -0.0387 59  ARG A CG    
491  C CD    . ARG A 59  ? 0.5052 0.5122 0.5516 -0.0084 0.0130  -0.0401 59  ARG A CD    
492  N NE    . ARG A 59  ? 0.5506 0.5622 0.6079 -0.0088 0.0128  -0.0443 59  ARG A NE    
493  C CZ    . ARG A 59  ? 0.5536 0.5682 0.6164 -0.0098 0.0155  -0.0461 59  ARG A CZ    
494  N NH1   . ARG A 59  ? 0.5129 0.5260 0.5698 -0.0104 0.0189  -0.0438 59  ARG A NH1   
495  N NH2   . ARG A 59  ? 0.5565 0.5757 0.6312 -0.0099 0.0148  -0.0507 59  ARG A NH2   
496  N N     . LYS A 60  ? 0.5142 0.5055 0.5463 -0.0149 0.0197  -0.0332 60  LYS A N     
497  C CA    . LYS A 60  ? 0.5290 0.5161 0.5584 -0.0184 0.0243  -0.0322 60  LYS A CA    
498  C C     . LYS A 60  ? 0.5365 0.5248 0.5644 -0.0187 0.0270  -0.0320 60  LYS A C     
499  O O     . LYS A 60  ? 0.5106 0.4973 0.5320 -0.0169 0.0256  -0.0297 60  LYS A O     
500  C CB    . LYS A 60  ? 0.5594 0.5385 0.5802 -0.0192 0.0240  -0.0290 60  LYS A CB    
501  C CG    . LYS A 60  ? 0.6244 0.6013 0.6476 -0.0202 0.0230  -0.0297 60  LYS A CG    
502  C CD    . LYS A 60  ? 0.6541 0.6255 0.6711 -0.0187 0.0197  -0.0273 60  LYS A CD    
503  C CE    . LYS A 60  ? 0.7142 0.6837 0.7343 -0.0194 0.0184  -0.0283 60  LYS A CE    
504  N NZ    . LYS A 60  ? 0.6979 0.6611 0.7160 -0.0235 0.0217  -0.0276 60  LYS A NZ    
505  N N     . LEU A 61  ? 0.5512 0.5426 0.5858 -0.0211 0.0308  -0.0348 61  LEU A N     
506  C CA    . LEU A 61  ? 0.5603 0.5532 0.5950 -0.0219 0.0342  -0.0356 61  LEU A CA    
507  C C     . LEU A 61  ? 0.5597 0.5448 0.5855 -0.0257 0.0395  -0.0335 61  LEU A C     
508  O O     . LEU A 61  ? 0.5502 0.5316 0.5763 -0.0294 0.0432  -0.0341 61  LEU A O     
509  C CB    . LEU A 61  ? 0.5664 0.5666 0.6142 -0.0226 0.0358  -0.0405 61  LEU A CB    
510  C CG    . LEU A 61  ? 0.6105 0.6146 0.6626 -0.0229 0.0389  -0.0429 61  LEU A CG    
511  C CD1   . LEU A 61  ? 0.6718 0.6722 0.7222 -0.0278 0.0468  -0.0437 61  LEU A CD1   
512  C CD2   . LEU A 61  ? 0.5282 0.5320 0.5733 -0.0197 0.0361  -0.0404 61  LEU A CD2   
513  N N     . PHE A 62  ? 0.5178 0.4995 0.5350 -0.0249 0.0397  -0.0311 62  PHE A N     
514  C CA    . PHE A 62  ? 0.5217 0.4940 0.5276 -0.0282 0.0437  -0.0287 62  PHE A CA    
515  C C     . PHE A 62  ? 0.5323 0.5050 0.5386 -0.0311 0.0501  -0.0308 62  PHE A C     
516  O O     . PHE A 62  ? 0.5419 0.5216 0.5546 -0.0292 0.0499  -0.0329 62  PHE A O     
517  C CB    . PHE A 62  ? 0.5173 0.4834 0.5120 -0.0257 0.0394  -0.0246 62  PHE A CB    
518  C CG    . PHE A 62  ? 0.5175 0.4817 0.5114 -0.0238 0.0344  -0.0229 62  PHE A CG    
519  C CD1   . PHE A 62  ? 0.5207 0.4911 0.5198 -0.0198 0.0295  -0.0233 62  PHE A CD1   
520  C CD2   . PHE A 62  ? 0.5119 0.4675 0.4997 -0.0263 0.0349  -0.0213 62  PHE A CD2   
521  C CE1   . PHE A 62  ? 0.5201 0.4889 0.5192 -0.0182 0.0255  -0.0225 62  PHE A CE1   
522  C CE2   . PHE A 62  ? 0.5860 0.5401 0.5743 -0.0244 0.0302  -0.0203 62  PHE A CE2   
523  C CZ    . PHE A 62  ? 0.5271 0.4882 0.5214 -0.0204 0.0257  -0.0210 62  PHE A CZ    
524  N N     . ALA A 63  ? 0.5156 0.4801 0.5149 -0.0360 0.0559  -0.0303 63  ALA A N     
525  C CA    . ALA A 63  ? 0.5323 0.4955 0.5305 -0.0396 0.0633  -0.0325 63  ALA A CA    
526  C C     . ALA A 63  ? 0.5254 0.4872 0.5161 -0.0375 0.0621  -0.0310 63  ALA A C     
527  O O     . ALA A 63  ? 0.5387 0.5047 0.5339 -0.0383 0.0662  -0.0339 63  ALA A O     
528  C CB    . ALA A 63  ? 0.5355 0.4870 0.5232 -0.0455 0.0697  -0.0315 63  ALA A CB    
529  N N     . ASN A 64  ? 0.5428 0.4989 0.5230 -0.0347 0.0565  -0.0267 64  ASN A N     
530  C CA    . ASN A 64  ? 0.5429 0.4966 0.5151 -0.0325 0.0545  -0.0249 64  ASN A CA    
531  C C     . ASN A 64  ? 0.5297 0.4816 0.4975 -0.0282 0.0465  -0.0214 64  ASN A C     
532  O O     . ASN A 64  ? 0.5398 0.4913 0.5095 -0.0274 0.0432  -0.0204 64  ASN A O     
533  C CB    . ASN A 64  ? 0.5350 0.4770 0.4927 -0.0367 0.0599  -0.0236 64  ASN A CB    
534  C CG    . ASN A 64  ? 0.5752 0.5042 0.5205 -0.0398 0.0600  -0.0206 64  ASN A CG    
535  O OD1   . ASN A 64  ? 0.5856 0.5100 0.5255 -0.0371 0.0534  -0.0174 64  ASN A OD1   
536  N ND2   . ASN A 64  ? 0.5651 0.4875 0.5057 -0.0455 0.0677  -0.0218 64  ASN A ND2   
537  N N     . MET A 65  ? 0.5309 0.4820 0.4938 -0.0256 0.0436  -0.0200 65  MET A N     
538  C CA    . MET A 65  ? 0.5243 0.4751 0.4854 -0.0215 0.0365  -0.0175 65  MET A CA    
539  C C     . MET A 65  ? 0.5600 0.4992 0.5098 -0.0220 0.0333  -0.0143 65  MET A C     
540  O O     . MET A 65  ? 0.5522 0.4918 0.5040 -0.0193 0.0279  -0.0132 65  MET A O     
541  C CB    . MET A 65  ? 0.4932 0.4473 0.4541 -0.0186 0.0343  -0.0174 65  MET A CB    
542  C CG    . MET A 65  ? 0.4617 0.4274 0.4349 -0.0166 0.0345  -0.0202 65  MET A CG    
543  S SD    . MET A 65  ? 0.4820 0.4509 0.4547 -0.0132 0.0317  -0.0199 65  MET A SD    
544  C CE    . MET A 65  ? 0.4591 0.4249 0.4269 -0.0162 0.0378  -0.0214 65  MET A CE    
545  N N     . ARG A 66  ? 0.6049 0.5330 0.5424 -0.0256 0.0366  -0.0131 66  ARG A N     
546  C CA    . ARG A 66  ? 0.6468 0.5618 0.5721 -0.0263 0.0330  -0.0100 66  ARG A CA    
547  C C     . ARG A 66  ? 0.6080 0.5226 0.5375 -0.0270 0.0320  -0.0099 66  ARG A C     
548  O O     . ARG A 66  ? 0.5828 0.4939 0.5112 -0.0246 0.0259  -0.0083 66  ARG A O     
549  C CB    . ARG A 66  ? 0.6948 0.5960 0.6038 -0.0304 0.0369  -0.0086 66  ARG A CB    
550  C CG    . ARG A 66  ? 0.8234 0.7213 0.7247 -0.0286 0.0349  -0.0078 66  ARG A CG    
551  C CD    . ARG A 66  ? 0.9210 0.8065 0.8065 -0.0331 0.0404  -0.0072 66  ARG A CD    
552  N NE    . ARG A 66  ? 0.9573 0.8404 0.8363 -0.0312 0.0383  -0.0068 66  ARG A NE    
553  C CZ    . ARG A 66  ? 1.0411 0.9155 0.9075 -0.0345 0.0432  -0.0069 66  ARG A CZ    
554  N NH1   . ARG A 66  ? 1.0495 0.9164 0.9080 -0.0402 0.0511  -0.0075 66  ARG A NH1   
555  N NH2   . ARG A 66  ? 1.0602 0.9329 0.9215 -0.0323 0.0405  -0.0066 66  ARG A NH2   
556  N N     . ASP A 67  ? 0.5907 0.5097 0.5268 -0.0301 0.0377  -0.0121 67  ASP A N     
557  C CA    . ASP A 67  ? 0.5989 0.5189 0.5406 -0.0309 0.0371  -0.0125 67  ASP A CA    
558  C C     . ASP A 67  ? 0.5648 0.4933 0.5166 -0.0262 0.0309  -0.0129 67  ASP A C     
559  O O     . ASP A 67  ? 0.5731 0.4973 0.5234 -0.0251 0.0267  -0.0116 67  ASP A O     
560  C CB    . ASP A 67  ? 0.6036 0.5294 0.5538 -0.0346 0.0442  -0.0156 67  ASP A CB    
561  C CG    . ASP A 67  ? 0.6443 0.5590 0.5837 -0.0405 0.0511  -0.0152 67  ASP A CG    
562  O OD1   . ASP A 67  ? 0.6995 0.6004 0.6230 -0.0418 0.0499  -0.0121 67  ASP A OD1   
563  O OD2   . ASP A 67  ? 0.6962 0.6154 0.6431 -0.0440 0.0577  -0.0183 67  ASP A OD2   
564  N N     . ALA A 68  ? 0.5338 0.4736 0.4951 -0.0234 0.0304  -0.0148 68  ALA A N     
565  C CA    . ALA A 68  ? 0.4968 0.4442 0.4663 -0.0192 0.0254  -0.0154 68  ALA A CA    
566  C C     . ALA A 68  ? 0.5299 0.4715 0.4940 -0.0166 0.0195  -0.0132 68  ALA A C     
567  O O     . ALA A 68  ? 0.5177 0.4606 0.4862 -0.0147 0.0160  -0.0135 68  ALA A O     
568  C CB    . ALA A 68  ? 0.4647 0.4220 0.4413 -0.0171 0.0258  -0.0172 68  ALA A CB    
569  N N     . SER A 69  ? 0.5094 0.4445 0.4645 -0.0163 0.0184  -0.0115 69  SER A N     
570  C CA    . SER A 69  ? 0.5331 0.4619 0.4835 -0.0137 0.0123  -0.0099 69  SER A CA    
571  C C     . SER A 69  ? 0.5618 0.4802 0.5061 -0.0149 0.0096  -0.0084 69  SER A C     
572  O O     . SER A 69  ? 0.5446 0.4620 0.4919 -0.0122 0.0042  -0.0085 69  SER A O     
573  C CB    . SER A 69  ? 0.5375 0.4606 0.4788 -0.0135 0.0116  -0.0085 69  SER A CB    
574  O OG    . SER A 69  ? 0.5437 0.4759 0.4916 -0.0110 0.0113  -0.0097 69  SER A OG    
575  N N     . GLN A 70  ? 0.5921 0.5024 0.5281 -0.0190 0.0135  -0.0073 70  GLN A N     
576  C CA    . GLN A 70  ? 0.6099 0.5087 0.5386 -0.0206 0.0112  -0.0057 70  GLN A CA    
577  C C     . GLN A 70  ? 0.5849 0.4894 0.5238 -0.0200 0.0105  -0.0072 70  GLN A C     
578  O O     . GLN A 70  ? 0.5761 0.4733 0.5125 -0.0194 0.0061  -0.0063 70  GLN A O     
579  C CB    . GLN A 70  ? 0.6342 0.5218 0.5501 -0.0258 0.0166  -0.0042 70  GLN A CB    
580  C CG    . GLN A 70  ? 0.7494 0.6283 0.6521 -0.0267 0.0171  -0.0026 70  GLN A CG    
581  C CD    . GLN A 70  ? 0.8351 0.7090 0.7337 -0.0225 0.0086  -0.0013 70  GLN A CD    
582  O OE1   . GLN A 70  ? 0.8551 0.7363 0.7586 -0.0196 0.0072  -0.0022 70  GLN A OE1   
583  N NE2   . GLN A 70  ? 0.8636 0.7247 0.7539 -0.0220 0.0026  0.0006  70  GLN A NE2   
584  N N     . TRP A 71  ? 0.5488 0.4657 0.4990 -0.0200 0.0143  -0.0096 71  TRP A N     
585  C CA    . TRP A 71  ? 0.5571 0.4803 0.5173 -0.0193 0.0135  -0.0113 71  TRP A CA    
586  C C     . TRP A 71  ? 0.5520 0.4793 0.5182 -0.0148 0.0078  -0.0121 71  TRP A C     
587  O O     . TRP A 71  ? 0.5638 0.4900 0.5334 -0.0139 0.0049  -0.0127 71  TRP A O     
588  C CB    . TRP A 71  ? 0.5289 0.4633 0.4988 -0.0203 0.0183  -0.0139 71  TRP A CB    
589  C CG    . TRP A 71  ? 0.5050 0.4452 0.4844 -0.0195 0.0172  -0.0159 71  TRP A CG    
590  C CD1   . TRP A 71  ? 0.4991 0.4356 0.4791 -0.0220 0.0183  -0.0162 71  TRP A CD1   
591  C CD2   . TRP A 71  ? 0.4504 0.4002 0.4389 -0.0162 0.0149  -0.0180 71  TRP A CD2   
592  N NE1   . TRP A 71  ? 0.4938 0.4374 0.4832 -0.0202 0.0165  -0.0184 71  TRP A NE1   
593  C CE2   . TRP A 71  ? 0.4602 0.4116 0.4542 -0.0167 0.0145  -0.0195 71  TRP A CE2   
594  C CE3   . TRP A 71  ? 0.4534 0.4098 0.4451 -0.0131 0.0133  -0.0187 71  TRP A CE3   
595  C CZ2   . TRP A 71  ? 0.4458 0.4046 0.4475 -0.0143 0.0126  -0.0217 71  TRP A CZ2   
596  C CZ3   . TRP A 71  ? 0.4301 0.3934 0.4290 -0.0109 0.0117  -0.0208 71  TRP A CZ3   
597  C CH2   . TRP A 71  ? 0.4241 0.3884 0.4275 -0.0115 0.0113  -0.0223 71  TRP A CH2   
598  N N     . ILE A 72  ? 0.5635 0.4954 0.5312 -0.0123 0.0064  -0.0124 72  ILE A N     
599  C CA    . ILE A 72  ? 0.5768 0.5123 0.5503 -0.0085 0.0018  -0.0135 72  ILE A CA    
600  C C     . ILE A 72  ? 0.5905 0.5159 0.5596 -0.0074 -0.0038 -0.0125 72  ILE A C     
601  O O     . ILE A 72  ? 0.5688 0.4959 0.5445 -0.0054 -0.0070 -0.0141 72  ILE A O     
602  C CB    . ILE A 72  ? 0.5676 0.5079 0.5421 -0.0065 0.0015  -0.0137 72  ILE A CB    
603  C CG1   . ILE A 72  ? 0.5528 0.5037 0.5336 -0.0066 0.0056  -0.0153 72  ILE A CG1   
604  C CG2   . ILE A 72  ? 0.5963 0.5378 0.5757 -0.0030 -0.0034 -0.0149 72  ILE A CG2   
605  C CD1   . ILE A 72  ? 0.4886 0.4432 0.4688 -0.0054 0.0062  -0.0152 72  ILE A CD1   
606  N N     . LYS A 73  ? 0.6216 0.5360 0.5794 -0.0087 -0.0051 -0.0101 73  LYS A N     
607  C CA    . LYS A 73  ? 0.6597 0.5621 0.6113 -0.0077 -0.0114 -0.0088 73  LYS A CA    
608  C C     . LYS A 73  ? 0.6609 0.5588 0.6131 -0.0091 -0.0121 -0.0089 73  LYS A C     
609  O O     . LYS A 73  ? 0.6673 0.5619 0.6228 -0.0067 -0.0178 -0.0097 73  LYS A O     
610  C CB    . LYS A 73  ? 0.6783 0.5679 0.6150 -0.0095 -0.0123 -0.0060 73  LYS A CB    
611  C CG    . LYS A 73  ? 0.7778 0.6683 0.7135 -0.0069 -0.0152 -0.0061 73  LYS A CG    
612  C CD    . LYS A 73  ? 0.8582 0.7357 0.7774 -0.0091 -0.0152 -0.0033 73  LYS A CD    
613  C CE    . LYS A 73  ? 0.8900 0.7686 0.8085 -0.0065 -0.0182 -0.0036 73  LYS A CE    
614  N NZ    . LYS A 73  ? 0.8853 0.7573 0.8045 -0.0027 -0.0276 -0.0040 73  LYS A NZ    
615  N N     . ARG A 74  ? 0.6597 0.5579 0.6098 -0.0128 -0.0064 -0.0083 74  ARG A N     
616  C CA    . ARG A 74  ? 0.6851 0.5790 0.6357 -0.0145 -0.0066 -0.0084 74  ARG A CA    
617  C C     . ARG A 74  ? 0.6580 0.5620 0.6222 -0.0118 -0.0082 -0.0114 74  ARG A C     
618  O O     . ARG A 74  ? 0.6725 0.5717 0.6382 -0.0111 -0.0119 -0.0118 74  ARG A O     
619  C CB    . ARG A 74  ? 0.6972 0.5899 0.6439 -0.0194 0.0004  -0.0077 74  ARG A CB    
620  C CG    . ARG A 74  ? 0.7593 0.6384 0.6903 -0.0230 0.0023  -0.0048 74  ARG A CG    
621  C CD    . ARG A 74  ? 0.8340 0.7112 0.7625 -0.0283 0.0098  -0.0047 74  ARG A CD    
622  N NE    . ARG A 74  ? 0.8841 0.7575 0.8035 -0.0317 0.0154  -0.0038 74  ARG A NE    
623  C CZ    . ARG A 74  ? 0.8739 0.7577 0.8002 -0.0332 0.0219  -0.0058 74  ARG A CZ    
624  N NH1   . ARG A 74  ? 0.8371 0.7353 0.7786 -0.0317 0.0232  -0.0087 74  ARG A NH1   
625  N NH2   . ARG A 74  ? 0.8996 0.7790 0.8173 -0.0363 0.0270  -0.0052 74  ARG A NH2   
626  N N     . MET A 75  ? 0.6395 0.5563 0.6127 -0.0103 -0.0056 -0.0135 75  MET A N     
627  C CA    . MET A 75  ? 0.6184 0.5443 0.6030 -0.0080 -0.0064 -0.0165 75  MET A CA    
628  C C     . MET A 75  ? 0.6489 0.5734 0.6375 -0.0044 -0.0121 -0.0179 75  MET A C     
629  O O     . MET A 75  ? 0.6561 0.5840 0.6524 -0.0029 -0.0136 -0.0204 75  MET A O     
630  C CB    . MET A 75  ? 0.5699 0.5078 0.5607 -0.0075 -0.0025 -0.0182 75  MET A CB    
631  C CG    . MET A 75  ? 0.5501 0.4912 0.5408 -0.0106 0.0027  -0.0181 75  MET A CG    
632  S SD    . MET A 75  ? 0.5417 0.4818 0.5361 -0.0126 0.0036  -0.0193 75  MET A SD    
633  C CE    . MET A 75  ? 0.3407 0.2916 0.3453 -0.0098 0.0028  -0.0228 75  MET A CE    
634  N N     . GLU A 76  ? 0.6766 0.5963 0.6606 -0.0030 -0.0152 -0.0167 76  GLU A N     
635  C CA    . GLU A 76  ? 0.6952 0.6123 0.6834 0.0004  -0.0214 -0.0183 76  GLU A CA    
636  C C     . GLU A 76  ? 0.6851 0.5905 0.6693 0.0004  -0.0267 -0.0175 76  GLU A C     
637  O O     . GLU A 76  ? 0.6737 0.5801 0.6662 0.0026  -0.0303 -0.0202 76  GLU A O     
638  C CB    . GLU A 76  ? 0.7180 0.6327 0.7021 0.0017  -0.0237 -0.0172 76  GLU A CB    
639  C CG    . GLU A 76  ? 0.8017 0.7176 0.7941 0.0056  -0.0293 -0.0201 76  GLU A CG    
640  C CD    . GLU A 76  ? 0.8617 0.7718 0.8486 0.0069  -0.0333 -0.0188 76  GLU A CD    
641  O OE1   . GLU A 76  ? 0.8769 0.7852 0.8699 0.0100  -0.0393 -0.0211 76  GLU A OE1   
642  O OE2   . GLU A 76  ? 0.8525 0.7598 0.8294 0.0049  -0.0306 -0.0159 76  GLU A OE2   
643  N N     . ASP A 77  ? 0.6742 0.5681 0.6455 -0.0024 -0.0268 -0.0140 77  ASP A N     
644  C CA    . ASP A 77  ? 0.6907 0.5715 0.6555 -0.0032 -0.0312 -0.0127 77  ASP A CA    
645  C C     . ASP A 77  ? 0.6771 0.5621 0.6498 -0.0038 -0.0298 -0.0146 77  ASP A C     
646  O O     . ASP A 77  ? 0.7032 0.5821 0.6781 -0.0021 -0.0352 -0.0156 77  ASP A O     
647  C CB    . ASP A 77  ? 0.7071 0.5754 0.6556 -0.0074 -0.0290 -0.0086 77  ASP A CB    
648  C CG    . ASP A 77  ? 0.7418 0.6027 0.6798 -0.0070 -0.0313 -0.0065 77  ASP A CG    
649  O OD1   . ASP A 77  ? 0.7090 0.5706 0.6514 -0.0031 -0.0373 -0.0079 77  ASP A OD1   
650  O OD2   . ASP A 77  ? 0.7307 0.5848 0.6562 -0.0108 -0.0270 -0.0037 77  ASP A OD2   
651  N N     . ILE A 78  ? 0.6399 0.5346 0.6167 -0.0059 -0.0230 -0.0152 78  ILE A N     
652  C CA    . ILE A 78  ? 0.6175 0.5168 0.6019 -0.0064 -0.0215 -0.0174 78  ILE A CA    
653  C C     . ILE A 78  ? 0.6046 0.5135 0.6020 -0.0027 -0.0234 -0.0215 78  ILE A C     
654  O O     . ILE A 78  ? 0.6182 0.5267 0.6212 -0.0018 -0.0254 -0.0236 78  ILE A O     
655  C CB    . ILE A 78  ? 0.6105 0.5164 0.5953 -0.0098 -0.0142 -0.0171 78  ILE A CB    
656  C CG1   . ILE A 78  ? 0.6166 0.5124 0.5895 -0.0141 -0.0114 -0.0138 78  ILE A CG1   
657  C CG2   . ILE A 78  ? 0.5862 0.4969 0.5791 -0.0100 -0.0134 -0.0196 78  ILE A CG2   
658  C CD1   . ILE A 78  ? 0.5595 0.4624 0.5332 -0.0172 -0.0042 -0.0138 78  ILE A CD1   
659  N N     . GLY A 79  ? 0.5822 0.4992 0.5840 -0.0007 -0.0223 -0.0228 79  GLY A N     
660  C CA    . GLY A 79  ? 0.5867 0.5123 0.6001 0.0023  -0.0230 -0.0270 79  GLY A CA    
661  C C     . GLY A 79  ? 0.5830 0.5197 0.6016 0.0015  -0.0174 -0.0289 79  GLY A C     
662  O O     . GLY A 79  ? 0.5753 0.5172 0.6019 0.0029  -0.0170 -0.0325 79  GLY A O     
663  N N     . LEU A 80  ? 0.5668 0.5065 0.5805 -0.0006 -0.0131 -0.0269 80  LEU A N     
664  C CA    . LEU A 80  ? 0.5561 0.5048 0.5732 -0.0013 -0.0086 -0.0284 80  LEU A CA    
665  C C     . LEU A 80  ? 0.5471 0.5010 0.5626 -0.0011 -0.0061 -0.0276 80  LEU A C     
666  O O     . LEU A 80  ? 0.5472 0.4976 0.5573 -0.0015 -0.0066 -0.0252 80  LEU A O     
667  C CB    . LEU A 80  ? 0.5448 0.4925 0.5592 -0.0042 -0.0061 -0.0272 80  LEU A CB    
668  C CG    . LEU A 80  ? 0.5675 0.5113 0.5841 -0.0049 -0.0077 -0.0283 80  LEU A CG    
669  C CD1   . LEU A 80  ? 0.5176 0.4577 0.5300 -0.0083 -0.0054 -0.0263 80  LEU A CD1   
670  C CD2   . LEU A 80  ? 0.5158 0.4665 0.5396 -0.0036 -0.0069 -0.0319 80  LEU A CD2   
671  N N     . GLU A 81  ? 0.5043 0.4657 0.5236 -0.0005 -0.0036 -0.0298 81  GLU A N     
672  C CA    . GLU A 81  ? 0.4824 0.4485 0.5006 -0.0001 -0.0015 -0.0294 81  GLU A CA    
673  C C     . GLU A 81  ? 0.4737 0.4405 0.4871 -0.0021 0.0009  -0.0271 81  GLU A C     
674  O O     . GLU A 81  ? 0.4715 0.4397 0.4854 -0.0036 0.0025  -0.0274 81  GLU A O     
675  C CB    . GLU A 81  ? 0.4686 0.4408 0.4906 0.0007  0.0005  -0.0323 81  GLU A CB    
676  C CG    . GLU A 81  ? 0.4609 0.4369 0.4817 0.0013  0.0022  -0.0321 81  GLU A CG    
677  C CD    . GLU A 81  ? 0.4610 0.4410 0.4833 0.0016  0.0045  -0.0349 81  GLU A CD    
678  O OE1   . GLU A 81  ? 0.5094 0.4894 0.5341 0.0016  0.0047  -0.0373 81  GLU A OE1   
679  O OE2   . GLU A 81  ? 0.4646 0.4469 0.4850 0.0017  0.0061  -0.0346 81  GLU A OE2   
680  N N     . ALA A 82  ? 0.4366 0.4024 0.4464 -0.0019 0.0010  -0.0252 82  ALA A N     
681  C CA    . ALA A 82  ? 0.4089 0.3762 0.4152 -0.0035 0.0036  -0.0236 82  ALA A CA    
682  C C     . ALA A 82  ? 0.4183 0.3919 0.4263 -0.0022 0.0049  -0.0246 82  ALA A C     
683  O O     . ALA A 82  ? 0.4302 0.4040 0.4378 -0.0009 0.0041  -0.0244 82  ALA A O     
684  C CB    . ALA A 82  ? 0.3886 0.3497 0.3886 -0.0043 0.0031  -0.0210 82  ALA A CB    
685  N N     . LEU A 83  ? 0.4073 0.3852 0.4172 -0.0027 0.0065  -0.0259 83  LEU A N     
686  C CA    . LEU A 83  ? 0.3957 0.3781 0.4060 -0.0016 0.0072  -0.0269 83  LEU A CA    
687  C C     . LEU A 83  ? 0.3975 0.3819 0.4060 -0.0021 0.0084  -0.0258 83  LEU A C     
688  O O     . LEU A 83  ? 0.4059 0.3890 0.4138 -0.0037 0.0095  -0.0249 83  LEU A O     
689  C CB    . LEU A 83  ? 0.3922 0.3769 0.4045 -0.0016 0.0072  -0.0292 83  LEU A CB    
690  C CG    . LEU A 83  ? 0.4179 0.4012 0.4323 -0.0011 0.0064  -0.0310 83  LEU A CG    
691  C CD1   . LEU A 83  ? 0.4240 0.4053 0.4404 -0.0022 0.0057  -0.0312 83  LEU A CD1   
692  C CD2   . LEU A 83  ? 0.3997 0.3848 0.4133 -0.0005 0.0070  -0.0332 83  LEU A CD2   
693  N N     . GLY A 84  ? 0.3805 0.3674 0.3881 -0.0010 0.0086  -0.0261 84  GLY A N     
694  C CA    . GLY A 84  ? 0.3797 0.3686 0.3863 -0.0011 0.0094  -0.0254 84  GLY A CA    
695  C C     . GLY A 84  ? 0.3794 0.3674 0.3834 -0.0005 0.0096  -0.0239 84  GLY A C     
696  O O     . GLY A 84  ? 0.3871 0.3725 0.3905 0.0000  0.0087  -0.0233 84  GLY A O     
697  N N     . MET A 85  ? 0.3981 0.3880 0.4012 -0.0004 0.0102  -0.0236 85  MET A N     
698  C CA    . MET A 85  ? 0.3938 0.3830 0.3945 0.0003  0.0103  -0.0223 85  MET A CA    
699  C C     . MET A 85  ? 0.4103 0.3961 0.4084 -0.0007 0.0108  -0.0208 85  MET A C     
700  O O     . MET A 85  ? 0.4209 0.4067 0.4184 -0.0019 0.0125  -0.0207 85  MET A O     
701  C CB    . MET A 85  ? 0.3943 0.3864 0.3949 0.0009  0.0105  -0.0227 85  MET A CB    
702  C CG    . MET A 85  ? 0.4194 0.4110 0.4177 0.0016  0.0106  -0.0216 85  MET A CG    
703  S SD    . MET A 85  ? 0.4617 0.4515 0.4592 0.0026  0.0096  -0.0210 85  MET A SD    
704  C CE    . MET A 85  ? 0.3820 0.3737 0.3796 0.0032  0.0098  -0.0223 85  MET A CE    
705  N N     . ASP A 86  ? 0.4347 0.4167 0.4311 -0.0001 0.0092  -0.0200 86  ASP A N     
706  C CA    . ASP A 86  ? 0.4536 0.4299 0.4454 -0.0010 0.0088  -0.0183 86  ASP A CA    
707  C C     . ASP A 86  ? 0.4528 0.4280 0.4408 -0.0006 0.0089  -0.0173 86  ASP A C     
708  O O     . ASP A 86  ? 0.4604 0.4299 0.4426 -0.0016 0.0089  -0.0159 86  ASP A O     
709  C CB    . ASP A 86  ? 0.4925 0.4644 0.4844 -0.0001 0.0058  -0.0182 86  ASP A CB    
710  C CG    . ASP A 86  ? 0.5510 0.5253 0.5468 0.0020  0.0039  -0.0194 86  ASP A CG    
711  O OD1   . ASP A 86  ? 0.5790 0.5494 0.5739 0.0030  0.0011  -0.0190 86  ASP A OD1   
712  O OD2   . ASP A 86  ? 0.5508 0.5301 0.5504 0.0025  0.0052  -0.0209 86  ASP A OD2   
713  N N     . ASP A 87  ? 0.4380 0.4176 0.4283 0.0007  0.0090  -0.0180 87  ASP A N     
714  C CA    . ASP A 87  ? 0.4437 0.4229 0.4310 0.0009  0.0094  -0.0173 87  ASP A CA    
715  C C     . ASP A 87  ? 0.4236 0.4062 0.4119 -0.0001 0.0122  -0.0180 87  ASP A C     
716  O O     . ASP A 87  ? 0.4267 0.4140 0.4186 0.0007  0.0123  -0.0191 87  ASP A O     
717  C CB    . ASP A 87  ? 0.4464 0.4278 0.4357 0.0028  0.0079  -0.0176 87  ASP A CB    
718  C CG    . ASP A 87  ? 0.4998 0.4803 0.4859 0.0032  0.0079  -0.0169 87  ASP A CG    
719  O OD1   . ASP A 87  ? 0.5330 0.5121 0.5157 0.0020  0.0097  -0.0165 87  ASP A OD1   
720  O OD2   . ASP A 87  ? 0.4953 0.4765 0.4826 0.0045  0.0065  -0.0172 87  ASP A OD2   
721  N N     . PHE A 88  ? 0.4105 0.3900 0.3953 -0.0020 0.0143  -0.0176 88  PHE A N     
722  C CA    . PHE A 88  ? 0.4194 0.4023 0.4073 -0.0034 0.0174  -0.0191 88  PHE A CA    
723  C C     . PHE A 88  ? 0.4461 0.4332 0.4364 -0.0024 0.0180  -0.0202 88  PHE A C     
724  O O     . PHE A 88  ? 0.4864 0.4781 0.4822 -0.0024 0.0188  -0.0221 88  PHE A O     
725  C CB    . PHE A 88  ? 0.4164 0.3942 0.3998 -0.0063 0.0206  -0.0187 88  PHE A CB    
726  C CG    . PHE A 88  ? 0.4458 0.4188 0.4269 -0.0075 0.0199  -0.0177 88  PHE A CG    
727  C CD1   . PHE A 88  ? 0.4545 0.4310 0.4415 -0.0072 0.0190  -0.0187 88  PHE A CD1   
728  C CD2   . PHE A 88  ? 0.4422 0.4063 0.4145 -0.0089 0.0197  -0.0158 88  PHE A CD2   
729  C CE1   . PHE A 88  ? 0.4868 0.4588 0.4720 -0.0082 0.0183  -0.0179 88  PHE A CE1   
730  C CE2   . PHE A 88  ? 0.4795 0.4384 0.4494 -0.0099 0.0186  -0.0148 88  PHE A CE2   
731  C CZ    . PHE A 88  ? 0.4939 0.4571 0.4708 -0.0095 0.0179  -0.0159 88  PHE A CZ    
732  N N     . LYS A 89  ? 0.4332 0.4186 0.4198 -0.0013 0.0170  -0.0192 89  LYS A N     
733  C CA    . LYS A 89  ? 0.4708 0.4598 0.4596 -0.0002 0.0170  -0.0202 89  LYS A CA    
734  C C     . LYS A 89  ? 0.4440 0.4373 0.4373 0.0017  0.0147  -0.0209 89  LYS A C     
735  O O     . LYS A 89  ? 0.4424 0.4388 0.4387 0.0024  0.0145  -0.0223 89  LYS A O     
736  C CB    . LYS A 89  ? 0.4686 0.4544 0.4521 0.0004  0.0165  -0.0190 89  LYS A CB    
737  C CG    . LYS A 89  ? 0.4811 0.4651 0.4630 0.0021  0.0133  -0.0177 89  LYS A CG    
738  C CD    . LYS A 89  ? 0.5362 0.5154 0.5121 0.0022  0.0126  -0.0167 89  LYS A CD    
739  C CE    . LYS A 89  ? 0.5259 0.5020 0.5006 0.0035  0.0091  -0.0157 89  LYS A CE    
740  N NZ    . LYS A 89  ? 0.5120 0.4833 0.4842 0.0028  0.0079  -0.0149 89  LYS A NZ    
741  N N     . LEU A 90  ? 0.4403 0.4329 0.4335 0.0022  0.0130  -0.0202 90  LEU A N     
742  C CA    . LEU A 90  ? 0.4267 0.4216 0.4221 0.0034  0.0114  -0.0209 90  LEU A CA    
743  C C     . LEU A 90  ? 0.4178 0.4151 0.4169 0.0030  0.0113  -0.0226 90  LEU A C     
744  O O     . LEU A 90  ? 0.4360 0.4348 0.4366 0.0040  0.0098  -0.0237 90  LEU A O     
745  C CB    . LEU A 90  ? 0.4475 0.4409 0.4420 0.0038  0.0104  -0.0203 90  LEU A CB    
746  C CG    . LEU A 90  ? 0.4586 0.4502 0.4514 0.0045  0.0097  -0.0194 90  LEU A CG    
747  C CD1   . LEU A 90  ? 0.4504 0.4415 0.4446 0.0046  0.0092  -0.0199 90  LEU A CD1   
748  C CD2   . LEU A 90  ? 0.4857 0.4782 0.4777 0.0053  0.0094  -0.0194 90  LEU A CD2   
749  N N     . ALA A 91  ? 0.3975 0.3943 0.3980 0.0016  0.0127  -0.0229 91  ALA A N     
750  C CA    . ALA A 91  ? 0.3798 0.3791 0.3851 0.0010  0.0127  -0.0249 91  ALA A CA    
751  C C     . ALA A 91  ? 0.3716 0.3738 0.3813 0.0009  0.0137  -0.0269 91  ALA A C     
752  O O     . ALA A 91  ? 0.3612 0.3659 0.3758 0.0016  0.0119  -0.0291 91  ALA A O     
753  C CB    . ALA A 91  ? 0.3635 0.3611 0.3692 -0.0008 0.0143  -0.0248 91  ALA A CB    
754  N N     . TYR A 92  ? 0.3889 0.3903 0.3968 0.0001  0.0161  -0.0264 92  TYR A N     
755  C CA    . TYR A 92  ? 0.4092 0.4134 0.4216 0.0000  0.0175  -0.0287 92  TYR A CA    
756  C C     . TYR A 92  ? 0.4068 0.4130 0.4210 0.0025  0.0141  -0.0295 92  TYR A C     
757  O O     . TYR A 92  ? 0.4242 0.4335 0.4451 0.0032  0.0128  -0.0323 92  TYR A O     
758  C CB    . TYR A 92  ? 0.4225 0.4242 0.4306 -0.0014 0.0209  -0.0279 92  TYR A CB    
759  C CG    . TYR A 92  ? 0.4474 0.4522 0.4602 -0.0014 0.0227  -0.0306 92  TYR A CG    
760  C CD1   . TYR A 92  ? 0.4268 0.4317 0.4377 0.0004  0.0212  -0.0302 92  TYR A CD1   
761  C CD2   . TYR A 92  ? 0.4700 0.4778 0.4903 -0.0031 0.0258  -0.0340 92  TYR A CD2   
762  C CE1   . TYR A 92  ? 0.4747 0.4825 0.4907 0.0006  0.0227  -0.0331 92  TYR A CE1   
763  C CE2   . TYR A 92  ? 0.4533 0.4644 0.4796 -0.0030 0.0276  -0.0373 92  TYR A CE2   
764  C CZ    . TYR A 92  ? 0.4867 0.4977 0.5106 -0.0011 0.0259  -0.0368 92  TYR A CZ    
765  O OH    . TYR A 92  ? 0.4995 0.5138 0.5299 -0.0009 0.0275  -0.0403 92  TYR A OH    
766  N N     . LEU A 93  ? 0.3992 0.4031 0.4078 0.0037  0.0125  -0.0273 93  LEU A N     
767  C CA    . LEU A 93  ? 0.4069 0.4111 0.4153 0.0057  0.0093  -0.0276 93  LEU A CA    
768  C C     . LEU A 93  ? 0.4163 0.4206 0.4264 0.0068  0.0059  -0.0287 93  LEU A C     
769  O O     . LEU A 93  ? 0.3952 0.3998 0.4074 0.0083  0.0029  -0.0302 93  LEU A O     
770  C CB    . LEU A 93  ? 0.3719 0.3733 0.3741 0.0063  0.0088  -0.0250 93  LEU A CB    
771  C CG    . LEU A 93  ? 0.3694 0.3700 0.3693 0.0063  0.0104  -0.0242 93  LEU A CG    
772  C CD1   . LEU A 93  ? 0.3139 0.3122 0.3095 0.0071  0.0091  -0.0223 93  LEU A CD1   
773  C CD2   . LEU A 93  ? 0.3127 0.3156 0.3164 0.0070  0.0104  -0.0263 93  LEU A CD2   
774  N N     . SER A 94  ? 0.4281 0.4313 0.4369 0.0060  0.0060  -0.0281 94  SER A N     
775  C CA    . SER A 94  ? 0.4482 0.4502 0.4569 0.0067  0.0028  -0.0290 94  SER A CA    
776  C C     . SER A 94  ? 0.4549 0.4599 0.4715 0.0069  0.0013  -0.0323 94  SER A C     
777  O O     . SER A 94  ? 0.4476 0.4516 0.4651 0.0084  -0.0029 -0.0338 94  SER A O     
778  C CB    . SER A 94  ? 0.4452 0.4454 0.4506 0.0057  0.0038  -0.0278 94  SER A CB    
779  O OG    . SER A 94  ? 0.4635 0.4615 0.4670 0.0063  0.0009  -0.0286 94  SER A OG    
780  N N     . ASP A 95  ? 0.4345 0.4426 0.4567 0.0053  0.0047  -0.0335 95  ASP A N     
781  C CA    . ASP A 95  ? 0.4252 0.4370 0.4572 0.0051  0.0043  -0.0372 95  ASP A CA    
782  C C     . ASP A 95  ? 0.4421 0.4563 0.4795 0.0065  0.0029  -0.0397 95  ASP A C     
783  O O     . ASP A 95  ? 0.4238 0.4399 0.4688 0.0079  -0.0007 -0.0431 95  ASP A O     
784  C CB    . ASP A 95  ? 0.4133 0.4269 0.4489 0.0023  0.0095  -0.0378 95  ASP A CB    
785  C CG    . ASP A 95  ? 0.3789 0.3907 0.4124 0.0011  0.0098  -0.0367 95  ASP A CG    
786  O OD1   . ASP A 95  ? 0.3540 0.3643 0.3847 -0.0010 0.0136  -0.0351 95  ASP A OD1   
787  O OD2   . ASP A 95  ? 0.3608 0.3721 0.3949 0.0024  0.0059  -0.0375 95  ASP A OD2   
788  N N     . THR A 96  ? 0.4278 0.4416 0.4619 0.0064  0.0053  -0.0382 96  THR A N     
789  C CA    . THR A 96  ? 0.4053 0.4215 0.4449 0.0076  0.0048  -0.0408 96  THR A CA    
790  C C     . THR A 96  ? 0.4058 0.4197 0.4432 0.0105  -0.0013 -0.0407 96  THR A C     
791  O O     . THR A 96  ? 0.4156 0.4315 0.4602 0.0122  -0.0041 -0.0440 96  THR A O     
792  C CB    . THR A 96  ? 0.3989 0.4151 0.4353 0.0062  0.0097  -0.0395 96  THR A CB    
793  O OG1   . THR A 96  ? 0.3873 0.4033 0.4227 0.0033  0.0149  -0.0390 96  THR A OG1   
794  C CG2   . THR A 96  ? 0.3728 0.3924 0.4170 0.0069  0.0104  -0.0432 96  THR A CG2   
795  N N     . TYR A 97  ? 0.3974 0.4066 0.4250 0.0110  -0.0033 -0.0373 97  TYR A N     
796  C CA    . TYR A 97  ? 0.4279 0.4328 0.4504 0.0132  -0.0085 -0.0366 97  TYR A CA    
797  C C     . TYR A 97  ? 0.4654 0.4658 0.4820 0.0134  -0.0116 -0.0356 97  TYR A C     
798  O O     . TYR A 97  ? 0.4374 0.4334 0.4446 0.0129  -0.0111 -0.0326 97  TYR A O     
799  C CB    . TYR A 97  ? 0.4085 0.4110 0.4238 0.0132  -0.0069 -0.0336 97  TYR A CB    
800  C CG    . TYR A 97  ? 0.4098 0.4159 0.4298 0.0129  -0.0037 -0.0347 97  TYR A CG    
801  C CD1   . TYR A 97  ? 0.4194 0.4273 0.4386 0.0109  0.0016  -0.0335 97  TYR A CD1   
802  C CD2   . TYR A 97  ? 0.4130 0.4203 0.4383 0.0147  -0.0062 -0.0372 97  TYR A CD2   
803  C CE1   . TYR A 97  ? 0.4227 0.4328 0.4448 0.0104  0.0048  -0.0347 97  TYR A CE1   
804  C CE2   . TYR A 97  ? 0.4071 0.4178 0.4368 0.0143  -0.0028 -0.0387 97  TYR A CE2   
805  C CZ    . TYR A 97  ? 0.4367 0.4485 0.4642 0.0120  0.0029  -0.0374 97  TYR A CZ    
806  O OH    . TYR A 97  ? 0.4213 0.4352 0.4514 0.0114  0.0065  -0.0389 97  TYR A OH    
807  N N     . ASN A 98  ? 0.4873 0.4889 0.5100 0.0140  -0.0146 -0.0384 98  ASN A N     
808  C CA    . ASN A 98  ? 0.5551 0.5522 0.5725 0.0141  -0.0178 -0.0381 98  ASN A CA    
809  C C     . ASN A 98  ? 0.5761 0.5661 0.5866 0.0162  -0.0245 -0.0381 98  ASN A C     
810  O O     . ASN A 98  ? 0.6200 0.6072 0.6317 0.0176  -0.0301 -0.0403 98  ASN A O     
811  C CB    . ASN A 98  ? 0.5752 0.5763 0.6021 0.0137  -0.0184 -0.0413 98  ASN A CB    
812  C CG    . ASN A 98  ? 0.6774 0.6746 0.6985 0.0132  -0.0200 -0.0406 98  ASN A CG    
813  O OD1   . ASN A 98  ? 0.7340 0.7255 0.7438 0.0129  -0.0201 -0.0378 98  ASN A OD1   
814  N ND2   . ASN A 98  ? 0.6975 0.6975 0.7267 0.0130  -0.0211 -0.0434 98  ASN A ND2   
815  N N     . TYR A 99  ? 0.5539 0.5401 0.5568 0.0164  -0.0241 -0.0357 99  TYR A N     
816  C CA    . TYR A 99  ? 0.5472 0.5252 0.5417 0.0180  -0.0298 -0.0351 99  TYR A CA    
817  C C     . TYR A 99  ? 0.5531 0.5276 0.5382 0.0169  -0.0265 -0.0317 99  TYR A C     
818  O O     . TYR A 99  ? 0.5467 0.5262 0.5345 0.0156  -0.0209 -0.0304 99  TYR A O     
819  C CB    . TYR A 99  ? 0.5468 0.5261 0.5497 0.0207  -0.0353 -0.0384 99  TYR A CB    
820  C CG    . TYR A 99  ? 0.5342 0.5214 0.5473 0.0207  -0.0315 -0.0396 99  TYR A CG    
821  C CD1   . TYR A 99  ? 0.5224 0.5181 0.5491 0.0203  -0.0288 -0.0430 99  TYR A CD1   
822  C CD2   . TYR A 99  ? 0.5452 0.5307 0.5540 0.0209  -0.0303 -0.0377 99  TYR A CD2   
823  C CE1   . TYR A 99  ? 0.5240 0.5258 0.5586 0.0200  -0.0247 -0.0443 99  TYR A CE1   
824  C CE2   . TYR A 99  ? 0.5132 0.5052 0.5305 0.0210  -0.0268 -0.0390 99  TYR A CE2   
825  C CZ    . TYR A 99  ? 0.5718 0.5717 0.6014 0.0204  -0.0239 -0.0424 99  TYR A CZ    
826  O OH    . TYR A 99  ? 0.5553 0.5606 0.5919 0.0201  -0.0199 -0.0439 99  TYR A OH    
827  N N     . GLU A 100 ? 0.5523 0.5173 0.5260 0.0173  -0.0301 -0.0303 100 GLU A N     
828  C CA    . GLU A 100 ? 0.5809 0.5420 0.5464 0.0161  -0.0272 -0.0274 100 GLU A CA    
829  C C     . GLU A 100 ? 0.5818 0.5473 0.5543 0.0174  -0.0273 -0.0279 100 GLU A C     
830  O O     . GLU A 100 ? 0.6161 0.5807 0.5926 0.0197  -0.0327 -0.0300 100 GLU A O     
831  C CB    . GLU A 100 ? 0.6071 0.5558 0.5582 0.0160  -0.0313 -0.0261 100 GLU A CB    
832  C CG    . GLU A 100 ? 0.7023 0.6460 0.6441 0.0140  -0.0273 -0.0233 100 GLU A CG    
833  C CD    . GLU A 100 ? 0.8094 0.7390 0.7351 0.0133  -0.0309 -0.0219 100 GLU A CD    
834  O OE1   . GLU A 100 ? 0.8301 0.7545 0.7464 0.0106  -0.0262 -0.0199 100 GLU A OE1   
835  O OE2   . GLU A 100 ? 0.8476 0.7708 0.7701 0.0154  -0.0384 -0.0231 100 GLU A OE2   
836  N N     . ILE A 101 ? 0.5377 0.5078 0.5121 0.0161  -0.0216 -0.0264 101 ILE A N     
837  C CA    . ILE A 101 ? 0.5322 0.5067 0.5129 0.0171  -0.0209 -0.0270 101 ILE A CA    
838  C C     . ILE A 101 ? 0.5593 0.5270 0.5333 0.0179  -0.0240 -0.0259 101 ILE A C     
839  O O     . ILE A 101 ? 0.5934 0.5554 0.5580 0.0163  -0.0222 -0.0234 101 ILE A O     
840  C CB    . ILE A 101 ? 0.4970 0.4775 0.4810 0.0155  -0.0146 -0.0259 101 ILE A CB    
841  C CG1   . ILE A 101 ? 0.4767 0.4638 0.4686 0.0149  -0.0121 -0.0274 101 ILE A CG1   
842  C CG2   . ILE A 101 ? 0.4767 0.4594 0.4639 0.0163  -0.0139 -0.0260 101 ILE A CG2   
843  C CD1   . ILE A 101 ? 0.4935 0.4837 0.4853 0.0131  -0.0067 -0.0258 101 ILE A CD1   
844  N N     . LYS A 102 ? 0.5906 0.5586 0.5699 0.0203  -0.0286 -0.0281 102 LYS A N     
845  C CA    . LYS A 102 ? 0.6268 0.5892 0.6016 0.0213  -0.0316 -0.0273 102 LYS A CA    
846  C C     . LYS A 102 ? 0.6132 0.5830 0.5964 0.0217  -0.0283 -0.0282 102 LYS A C     
847  O O     . LYS A 102 ? 0.6108 0.5873 0.6049 0.0230  -0.0285 -0.0313 102 LYS A O     
848  C CB    . LYS A 102 ? 0.6856 0.6425 0.6608 0.0240  -0.0400 -0.0296 102 LYS A CB    
849  C CG    . LYS A 102 ? 0.7826 0.7288 0.7473 0.0247  -0.0443 -0.0279 102 LYS A CG    
850  C CD    . LYS A 102 ? 0.8856 0.8214 0.8341 0.0221  -0.0432 -0.0244 102 LYS A CD    
851  C CE    . LYS A 102 ? 0.9467 0.8706 0.8834 0.0220  -0.0467 -0.0225 102 LYS A CE    
852  N NZ    . LYS A 102 ? 0.9560 0.8705 0.8773 0.0185  -0.0430 -0.0192 102 LYS A NZ    
853  N N     . TYR A 103 ? 0.5944 0.5628 0.5726 0.0203  -0.0248 -0.0257 103 TYR A N     
854  C CA    . TYR A 103 ? 0.5463 0.5207 0.5309 0.0205  -0.0217 -0.0264 103 TYR A CA    
855  C C     . TYR A 103 ? 0.5362 0.5064 0.5187 0.0219  -0.0248 -0.0263 103 TYR A C     
856  O O     . TYR A 103 ? 0.5488 0.5105 0.5226 0.0218  -0.0280 -0.0247 103 TYR A O     
857  C CB    . TYR A 103 ? 0.5098 0.4873 0.4927 0.0182  -0.0156 -0.0243 103 TYR A CB    
858  C CG    . TYR A 103 ? 0.4833 0.4553 0.4579 0.0166  -0.0141 -0.0215 103 TYR A CG    
859  C CD1   . TYR A 103 ? 0.4480 0.4156 0.4157 0.0147  -0.0129 -0.0199 103 TYR A CD1   
860  C CD2   . TYR A 103 ? 0.4184 0.3897 0.3926 0.0167  -0.0134 -0.0209 103 TYR A CD2   
861  C CE1   . TYR A 103 ? 0.4327 0.3954 0.3937 0.0128  -0.0105 -0.0180 103 TYR A CE1   
862  C CE2   . TYR A 103 ? 0.4385 0.4051 0.4063 0.0149  -0.0116 -0.0188 103 TYR A CE2   
863  C CZ    . TYR A 103 ? 0.4515 0.4139 0.4131 0.0128  -0.0099 -0.0175 103 TYR A CZ    
864  O OH    . TYR A 103 ? 0.4392 0.3973 0.3958 0.0107  -0.0073 -0.0161 103 TYR A OH    
865  N N     . ASP A 104 ? 0.4962 0.4717 0.4864 0.0230  -0.0239 -0.0283 104 ASP A N     
866  C CA    . ASP A 104 ? 0.4699 0.4423 0.4594 0.0244  -0.0265 -0.0285 104 ASP A CA    
867  C C     . ASP A 104 ? 0.4490 0.4246 0.4387 0.0232  -0.0217 -0.0274 104 ASP A C     
868  O O     . ASP A 104 ? 0.4716 0.4536 0.4683 0.0235  -0.0189 -0.0294 104 ASP A O     
869  C CB    . ASP A 104 ? 0.4694 0.4447 0.4686 0.0272  -0.0305 -0.0327 104 ASP A CB    
870  C CG    . ASP A 104 ? 0.5287 0.5004 0.5277 0.0289  -0.0338 -0.0333 104 ASP A CG    
871  O OD1   . ASP A 104 ? 0.5306 0.4981 0.5221 0.0277  -0.0325 -0.0303 104 ASP A OD1   
872  O OD2   . ASP A 104 ? 0.5948 0.5681 0.6020 0.0314  -0.0378 -0.0370 104 ASP A OD2   
873  N N     . HIS A 105 ? 0.4514 0.4220 0.4334 0.0217  -0.0206 -0.0245 105 HIS A N     
874  C CA    . HIS A 105 ? 0.4621 0.4352 0.4442 0.0205  -0.0166 -0.0234 105 HIS A CA    
875  C C     . HIS A 105 ? 0.4554 0.4312 0.4427 0.0222  -0.0172 -0.0255 105 HIS A C     
876  O O     . HIS A 105 ? 0.4401 0.4194 0.4291 0.0216  -0.0139 -0.0255 105 HIS A O     
877  C CB    . HIS A 105 ? 0.4717 0.4386 0.4460 0.0187  -0.0158 -0.0207 105 HIS A CB    
878  C CG    . HIS A 105 ? 0.5078 0.4676 0.4778 0.0194  -0.0195 -0.0202 105 HIS A CG    
879  N ND1   . HIS A 105 ? 0.5471 0.5067 0.5184 0.0199  -0.0196 -0.0204 105 HIS A ND1   
880  C CD2   . HIS A 105 ? 0.5399 0.4916 0.5033 0.0196  -0.0236 -0.0195 105 HIS A CD2   
881  C CE1   . HIS A 105 ? 0.5856 0.5376 0.5519 0.0203  -0.0234 -0.0198 105 HIS A CE1   
882  N NE2   . HIS A 105 ? 0.5731 0.5196 0.5339 0.0202  -0.0261 -0.0191 105 HIS A NE2   
883  N N     . THR A 106 ? 0.4615 0.4850 0.4488 0.0240  -0.0384 -0.0099 106 THR A N     
884  C CA    . THR A 106 ? 0.4545 0.4827 0.4513 0.0290  -0.0365 -0.0097 106 THR A CA    
885  C C     . THR A 106 ? 0.4341 0.4744 0.4456 0.0278  -0.0331 -0.0121 106 THR A C     
886  O O     . THR A 106 ? 0.4179 0.4618 0.4369 0.0309  -0.0294 -0.0126 106 THR A O     
887  C CB    . THR A 106 ? 0.4613 0.4902 0.4605 0.0347  -0.0432 -0.0080 106 THR A CB    
888  O OG1   . THR A 106 ? 0.4661 0.5058 0.4753 0.0344  -0.0493 -0.0088 106 THR A OG1   
889  C CG2   . THR A 106 ? 0.4820 0.4976 0.4649 0.0352  -0.0467 -0.0055 106 THR A CG2   
890  N N     . LYS A 107 ? 0.4322 0.4779 0.4468 0.0228  -0.0341 -0.0138 107 LYS A N     
891  C CA    . LYS A 107 ? 0.4316 0.4880 0.4587 0.0203  -0.0305 -0.0161 107 LYS A CA    
892  C C     . LYS A 107 ? 0.4219 0.4733 0.4437 0.0159  -0.0236 -0.0170 107 LYS A C     
893  O O     . LYS A 107 ? 0.4364 0.4940 0.4660 0.0135  -0.0193 -0.0187 107 LYS A O     
894  C CB    . LYS A 107 ? 0.4528 0.5190 0.4877 0.0171  -0.0360 -0.0174 107 LYS A CB    
895  C CG    . LYS A 107 ? 0.4981 0.5711 0.5404 0.0217  -0.0437 -0.0163 107 LYS A CG    
896  C CD    . LYS A 107 ? 0.5642 0.6444 0.6189 0.0280  -0.0414 -0.0164 107 LYS A CD    
897  C CE    . LYS A 107 ? 0.6610 0.7469 0.7228 0.0339  -0.0496 -0.0149 107 LYS A CE    
898  N NZ    . LYS A 107 ? 0.6592 0.7569 0.7302 0.0306  -0.0565 -0.0157 107 LYS A NZ    
899  N N     . ILE A 108 ? 0.4223 0.4625 0.4309 0.0148  -0.0225 -0.0158 108 ILE A N     
900  C CA    . ILE A 108 ? 0.4063 0.4413 0.4097 0.0114  -0.0166 -0.0162 108 ILE A CA    
901  C C     . ILE A 108 ? 0.4184 0.4496 0.4203 0.0142  -0.0119 -0.0152 108 ILE A C     
902  O O     . ILE A 108 ? 0.4458 0.4720 0.4428 0.0177  -0.0130 -0.0135 108 ILE A O     
903  C CB    . ILE A 108 ? 0.4256 0.4513 0.4167 0.0088  -0.0175 -0.0158 108 ILE A CB    
904  C CG1   . ILE A 108 ? 0.4165 0.4447 0.4075 0.0054  -0.0224 -0.0171 108 ILE A CG1   
905  C CG2   . ILE A 108 ? 0.4024 0.4231 0.3894 0.0063  -0.0117 -0.0160 108 ILE A CG2   
906  C CD1   . ILE A 108 ? 0.4340 0.4522 0.4118 0.0031  -0.0235 -0.0170 108 ILE A CD1   
907  N N     . ARG A 109 ? 0.3595 0.3926 0.3650 0.0121  -0.0067 -0.0161 109 ARG A N     
908  C CA    . ARG A 109 ? 0.3443 0.3739 0.3481 0.0138  -0.0023 -0.0153 109 ARG A CA    
909  C C     . ARG A 109 ? 0.3598 0.3807 0.3537 0.0123  -0.0003 -0.0138 109 ARG A C     
910  O O     . ARG A 109 ? 0.3560 0.3753 0.3482 0.0089  0.0020  -0.0143 109 ARG A O     
911  C CB    . ARG A 109 ? 0.3518 0.3869 0.3631 0.0121  0.0022  -0.0169 109 ARG A CB    
912  C CG    . ARG A 109 ? 0.3505 0.3826 0.3606 0.0142  0.0062  -0.0164 109 ARG A CG    
913  C CD    . ARG A 109 ? 0.3102 0.3474 0.3269 0.0122  0.0111  -0.0183 109 ARG A CD    
914  N NE    . ARG A 109 ? 0.3534 0.4012 0.3821 0.0137  0.0100  -0.0202 109 ARG A NE    
915  C CZ    . ARG A 109 ? 0.3591 0.4106 0.3940 0.0185  0.0102  -0.0207 109 ARG A CZ    
916  N NH1   . ARG A 109 ? 0.3152 0.3592 0.3439 0.0218  0.0116  -0.0196 109 ARG A NH1   
917  N NH2   . ARG A 109 ? 0.3377 0.4004 0.3852 0.0200  0.0089  -0.0224 109 ARG A NH2   
918  N N     . VAL A 110 ? 0.3449 0.3601 0.3325 0.0147  -0.0012 -0.0121 110 VAL A N     
919  C CA    . VAL A 110 ? 0.3554 0.3639 0.3352 0.0136  0.0008  -0.0107 110 VAL A CA    
920  C C     . VAL A 110 ? 0.3851 0.3915 0.3642 0.0142  0.0040  -0.0098 110 VAL A C     
921  O O     . VAL A 110 ? 0.3780 0.3835 0.3572 0.0167  0.0037  -0.0094 110 VAL A O     
922  C CB    . VAL A 110 ? 0.3475 0.3507 0.3197 0.0147  -0.0018 -0.0094 110 VAL A CB    
923  C CG1   . VAL A 110 ? 0.3542 0.3522 0.3202 0.0133  0.0009  -0.0081 110 VAL A CG1   
924  C CG2   . VAL A 110 ? 0.3752 0.3793 0.3464 0.0137  -0.0053 -0.0104 110 VAL A CG2   
925  N N     . ALA A 111 ? 0.3802 0.3851 0.3581 0.0117  0.0070  -0.0095 111 ALA A N     
926  C CA    . ALA A 111 ? 0.3865 0.3891 0.3628 0.0113  0.0096  -0.0086 111 ALA A CA    
927  C C     . ALA A 111 ? 0.3727 0.3708 0.3434 0.0106  0.0100  -0.0066 111 ALA A C     
928  O O     . ALA A 111 ? 0.3446 0.3420 0.3141 0.0095  0.0100  -0.0062 111 ALA A O     
929  C CB    . ALA A 111 ? 0.3712 0.3757 0.3506 0.0090  0.0124  -0.0096 111 ALA A CB    
930  N N     . ASN A 112 ? 0.3821 0.3772 0.3495 0.0111  0.0105  -0.0054 112 ASN A N     
931  C CA    . ASN A 112 ? 0.3918 0.3838 0.3548 0.0101  0.0106  -0.0034 112 ASN A CA    
932  C C     . ASN A 112 ? 0.3754 0.3654 0.3366 0.0085  0.0120  -0.0026 112 ASN A C     
933  O O     . ASN A 112 ? 0.3640 0.3516 0.3233 0.0091  0.0125  -0.0030 112 ASN A O     
934  C CB    . ASN A 112 ? 0.4193 0.4086 0.3785 0.0115  0.0091  -0.0027 112 ASN A CB    
935  C CG    . ASN A 112 ? 0.5241 0.5119 0.4799 0.0102  0.0093  -0.0011 112 ASN A CG    
936  O OD1   . ASN A 112 ? 0.5633 0.5505 0.5179 0.0085  0.0103  0.0003  112 ASN A OD1   
937  N ND2   . ASN A 112 ? 0.5364 0.5238 0.4904 0.0109  0.0086  -0.0013 112 ASN A ND2   
938  N N     . PHE A 113 ? 0.4049 0.3949 0.3659 0.0065  0.0127  -0.0015 113 PHE A N     
939  C CA    . PHE A 113 ? 0.4243 0.4116 0.3822 0.0043  0.0134  -0.0006 113 PHE A CA    
940  C C     . PHE A 113 ? 0.4448 0.4317 0.4011 0.0025  0.0124  0.0019  113 PHE A C     
941  O O     . PHE A 113 ? 0.4408 0.4302 0.3998 0.0031  0.0118  0.0028  113 PHE A O     
942  C CB    . PHE A 113 ? 0.4070 0.3941 0.3657 0.0031  0.0153  -0.0019 113 PHE A CB    
943  C CG    . PHE A 113 ? 0.3814 0.3687 0.3407 0.0015  0.0153  -0.0010 113 PHE A CG    
944  C CD1   . PHE A 113 ? 0.4419 0.4314 0.4044 0.0026  0.0146  -0.0011 113 PHE A CD1   
945  C CD2   . PHE A 113 ? 0.4325 0.4164 0.3880 -0.0011 0.0160  -0.0001 113 PHE A CD2   
946  C CE1   . PHE A 113 ? 0.4397 0.4278 0.4020 0.0014  0.0146  -0.0002 113 PHE A CE1   
947  C CE2   . PHE A 113 ? 0.4367 0.4194 0.3918 -0.0025 0.0156  0.0010  113 PHE A CE2   
948  C CZ    . PHE A 113 ? 0.4082 0.3929 0.3669 -0.0010 0.0150  0.0009  113 PHE A CZ    
949  N N     . ASP A 114 ? 0.4631 0.4469 0.4152 0.0002  0.0122  0.0029  114 ASP A N     
950  C CA    . ASP A 114 ? 0.4842 0.4682 0.4351 -0.0021 0.0105  0.0054  114 ASP A CA    
951  C C     . ASP A 114 ? 0.4665 0.4461 0.4121 -0.0050 0.0105  0.0058  114 ASP A C     
952  O O     . ASP A 114 ? 0.4644 0.4400 0.4061 -0.0055 0.0123  0.0041  114 ASP A O     
953  C CB    . ASP A 114 ? 0.5029 0.4872 0.4524 -0.0030 0.0096  0.0065  114 ASP A CB    
954  C CG    . ASP A 114 ? 0.6135 0.6008 0.5646 -0.0052 0.0075  0.0092  114 ASP A CG    
955  O OD1   . ASP A 114 ? 0.6162 0.6084 0.5730 -0.0036 0.0072  0.0101  114 ASP A OD1   
956  O OD2   . ASP A 114 ? 0.7059 0.6908 0.6527 -0.0085 0.0062  0.0104  114 ASP A OD2   
957  N N     . ILE A 115 ? 0.4638 0.4438 0.4091 -0.0069 0.0086  0.0080  115 ILE A N     
958  C CA    . ILE A 115 ? 0.4570 0.4316 0.3954 -0.0103 0.0081  0.0087  115 ILE A CA    
959  C C     . ILE A 115 ? 0.4622 0.4367 0.3981 -0.0133 0.0046  0.0115  115 ILE A C     
960  O O     . ILE A 115 ? 0.4647 0.4449 0.4062 -0.0125 0.0025  0.0132  115 ILE A O     
961  C CB    . ILE A 115 ? 0.4511 0.4240 0.3889 -0.0105 0.0085  0.0089  115 ILE A CB    
962  C CG1   . ILE A 115 ? 0.4501 0.4262 0.3921 -0.0097 0.0053  0.0117  115 ILE A CG1   
963  C CG2   . ILE A 115 ? 0.3983 0.3724 0.3396 -0.0083 0.0119  0.0060  115 ILE A CG2   
964  C CD1   . ILE A 115 ? 0.3868 0.3584 0.3249 -0.0111 0.0045  0.0130  115 ILE A CD1   
965  N N     . GLU A 116 ? 0.4568 0.4250 0.3841 -0.0172 0.0040  0.0118  116 GLU A N     
966  C CA    . GLU A 116 ? 0.4390 0.4069 0.3631 -0.0210 -0.0001 0.0146  116 GLU A CA    
967  C C     . GLU A 116 ? 0.4497 0.4130 0.3678 -0.0236 -0.0023 0.0162  116 GLU A C     
968  O O     . GLU A 116 ? 0.4805 0.4371 0.3919 -0.0247 0.0005  0.0145  116 GLU A O     
969  C CB    . GLU A 116 ? 0.4578 0.4205 0.3745 -0.0242 0.0003  0.0137  116 GLU A CB    
970  C CG    . GLU A 116 ? 0.4891 0.4541 0.4093 -0.0221 0.0022  0.0123  116 GLU A CG    
971  C CD    . GLU A 116 ? 0.5708 0.5448 0.4999 -0.0212 0.0001  0.0143  116 GLU A CD    
972  O OE1   . GLU A 116 ? 0.6288 0.6078 0.5618 -0.0225 -0.0034 0.0169  116 GLU A OE1   
973  O OE2   . GLU A 116 ? 0.5856 0.5615 0.5177 -0.0190 0.0020  0.0132  116 GLU A OE2   
974  N N     . VAL A 117 ? 0.4540 0.4211 0.3750 -0.0246 -0.0073 0.0197  117 VAL A N     
975  C CA    . VAL A 117 ? 0.4570 0.4193 0.3717 -0.0273 -0.0108 0.0221  117 VAL A CA    
976  C C     . VAL A 117 ? 0.4587 0.4233 0.3724 -0.0311 -0.0169 0.0254  117 VAL A C     
977  O O     . VAL A 117 ? 0.4375 0.4113 0.3615 -0.0291 -0.0202 0.0277  117 VAL A O     
978  C CB    . VAL A 117 ? 0.4614 0.4263 0.3820 -0.0236 -0.0118 0.0237  117 VAL A CB    
979  C CG1   . VAL A 117 ? 0.4253 0.3837 0.3379 -0.0265 -0.0161 0.0267  117 VAL A CG1   
980  C CG2   . VAL A 117 ? 0.4870 0.4504 0.4093 -0.0205 -0.0063 0.0205  117 VAL A CG2   
981  N N     . THR A 118 ? 0.4718 0.4283 0.3734 -0.0367 -0.0183 0.0255  118 THR A N     
982  C CA    . THR A 118 ? 0.5197 0.4775 0.4187 -0.0414 -0.0250 0.0288  118 THR A CA    
983  C C     . THR A 118 ? 0.5762 0.5354 0.4768 -0.0409 -0.0309 0.0329  118 THR A C     
984  O O     . THR A 118 ? 0.5767 0.5280 0.4697 -0.0410 -0.0302 0.0329  118 THR A O     
985  C CB    . THR A 118 ? 0.5319 0.4780 0.4147 -0.0481 -0.0248 0.0276  118 THR A CB    
986  O OG1   . THR A 118 ? 0.5102 0.4547 0.3920 -0.0480 -0.0198 0.0243  118 THR A OG1   
987  C CG2   . THR A 118 ? 0.4628 0.4095 0.3416 -0.0540 -0.0326 0.0312  118 THR A CG2   
988  N N     . SER A 119 ? 0.6412 0.6107 0.5521 -0.0402 -0.0366 0.0362  119 SER A N     
989  C CA    . SER A 119 ? 0.6909 0.6628 0.6052 -0.0387 -0.0430 0.0404  119 SER A CA    
990  C C     . SER A 119 ? 0.7259 0.7060 0.6455 -0.0418 -0.0512 0.0444  119 SER A C     
991  O O     . SER A 119 ? 0.7242 0.7171 0.6581 -0.0396 -0.0518 0.0450  119 SER A O     
992  C CB    . SER A 119 ? 0.6824 0.6608 0.6094 -0.0310 -0.0408 0.0405  119 SER A CB    
993  O OG    . SER A 119 ? 0.7103 0.6921 0.6424 -0.0287 -0.0474 0.0448  119 SER A OG    
994  N N     . PRO A 120 ? 0.7778 0.7506 0.6856 -0.0473 -0.0575 0.0471  120 PRO A N     
995  C CA    . PRO A 120 ? 0.8025 0.7830 0.7147 -0.0510 -0.0665 0.0512  120 PRO A CA    
996  C C     . PRO A 120 ? 0.8058 0.7974 0.7331 -0.0453 -0.0725 0.0555  120 PRO A C     
997  O O     . PRO A 120 ? 0.8221 0.8270 0.7620 -0.0457 -0.0776 0.0580  120 PRO A O     
998  C CB    . PRO A 120 ? 0.8132 0.7794 0.7053 -0.0584 -0.0710 0.0525  120 PRO A CB    
999  C CG    . PRO A 120 ? 0.8186 0.7718 0.6995 -0.0563 -0.0657 0.0506  120 PRO A CG    
1000 C CD    . PRO A 120 ? 0.8036 0.7601 0.6927 -0.0508 -0.0562 0.0462  120 PRO A CD    
1001 N N     . ASP A 121 ? 0.7963 0.7825 0.7225 -0.0400 -0.0716 0.0563  121 ASP A N     
1002 C CA    . ASP A 121 ? 0.8098 0.8039 0.7484 -0.0340 -0.0774 0.0605  121 ASP A CA    
1003 C C     . ASP A 121 ? 0.7891 0.7941 0.7455 -0.0256 -0.0720 0.0589  121 ASP A C     
1004 O O     . ASP A 121 ? 0.7869 0.7912 0.7483 -0.0191 -0.0725 0.0605  121 ASP A O     
1005 C CB    . ASP A 121 ? 0.8473 0.8276 0.7730 -0.0334 -0.0808 0.0630  121 ASP A CB    
1006 C CG    . ASP A 121 ? 0.8756 0.8427 0.7894 -0.0330 -0.0721 0.0590  121 ASP A CG    
1007 O OD1   . ASP A 121 ? 0.8874 0.8404 0.7854 -0.0358 -0.0735 0.0601  121 ASP A OD1   
1008 O OD2   . ASP A 121 ? 0.9023 0.8733 0.8226 -0.0302 -0.0640 0.0548  121 ASP A OD2   
1009 N N     . GLY A 122 ? 0.7757 0.7893 0.7402 -0.0260 -0.0667 0.0558  122 GLY A N     
1010 C CA    . GLY A 122 ? 0.7496 0.7736 0.7302 -0.0189 -0.0614 0.0541  122 GLY A CA    
1011 C C     . GLY A 122 ? 0.7303 0.7467 0.7061 -0.0161 -0.0524 0.0496  122 GLY A C     
1012 O O     . GLY A 122 ? 0.7307 0.7364 0.6928 -0.0202 -0.0491 0.0471  122 GLY A O     
1013 N N     . PHE A 123 ? 0.6998 0.7219 0.6870 -0.0091 -0.0484 0.0486  123 PHE A N     
1014 C CA    . PHE A 123 ? 0.6850 0.7018 0.6695 -0.0064 -0.0403 0.0443  123 PHE A CA    
1015 C C     . PHE A 123 ? 0.6557 0.6580 0.6266 -0.0068 -0.0390 0.0435  123 PHE A C     
1016 O O     . PHE A 123 ? 0.6721 0.6697 0.6410 -0.0046 -0.0429 0.0464  123 PHE A O     
1017 C CB    . PHE A 123 ? 0.6915 0.7164 0.6899 0.0009  -0.0367 0.0435  123 PHE A CB    
1018 C CG    . PHE A 123 ? 0.7155 0.7367 0.7118 0.0027  -0.0288 0.0390  123 PHE A CG    
1019 C CD1   . PHE A 123 ? 0.7142 0.7404 0.7130 0.0009  -0.0245 0.0363  123 PHE A CD1   
1020 C CD2   . PHE A 123 ? 0.7376 0.7496 0.7286 0.0059  -0.0261 0.0377  123 PHE A CD2   
1021 C CE1   . PHE A 123 ? 0.7498 0.7724 0.7461 0.0025  -0.0181 0.0324  123 PHE A CE1   
1022 C CE2   . PHE A 123 ? 0.7356 0.7447 0.7248 0.0071  -0.0196 0.0337  123 PHE A CE2   
1023 C CZ    . PHE A 123 ? 0.7368 0.7513 0.7287 0.0056  -0.0158 0.0311  123 PHE A CZ    
1024 N N     . PRO A 124 ? 0.6139 0.6094 0.5759 -0.0095 -0.0334 0.0397  124 PRO A N     
1025 C CA    . PRO A 124 ? 0.6259 0.6088 0.5757 -0.0107 -0.0312 0.0384  124 PRO A CA    
1026 C C     . PRO A 124 ? 0.6342 0.6153 0.5880 -0.0053 -0.0273 0.0370  124 PRO A C     
1027 O O     . PRO A 124 ? 0.6607 0.6435 0.6173 -0.0038 -0.0216 0.0334  124 PRO A O     
1028 C CB    . PRO A 124 ? 0.6053 0.5845 0.5475 -0.0150 -0.0265 0.0347  124 PRO A CB    
1029 C CG    . PRO A 124 ? 0.5770 0.5661 0.5289 -0.0137 -0.0242 0.0331  124 PRO A CG    
1030 C CD    . PRO A 124 ? 0.5816 0.5810 0.5449 -0.0116 -0.0290 0.0364  124 PRO A CD    
1031 N N     . GLU A 125 ? 0.6428 0.6197 0.5961 -0.0025 -0.0307 0.0399  125 GLU A N     
1032 C CA    . GLU A 125 ? 0.6339 0.6075 0.5899 0.0025  -0.0274 0.0387  125 GLU A CA    
1033 C C     . GLU A 125 ? 0.6083 0.5725 0.5543 -0.0002 -0.0221 0.0353  125 GLU A C     
1034 O O     . GLU A 125 ? 0.6060 0.5611 0.5403 -0.0046 -0.0230 0.0360  125 GLU A O     
1035 C CB    . GLU A 125 ? 0.6627 0.6325 0.6195 0.0062  -0.0327 0.0429  125 GLU A CB    
1036 C CG    . GLU A 125 ? 0.7030 0.6844 0.6746 0.0116  -0.0364 0.0456  125 GLU A CG    
1037 C CD    . GLU A 125 ? 0.7581 0.7460 0.7409 0.0173  -0.0308 0.0428  125 GLU A CD    
1038 O OE1   . GLU A 125 ? 0.7680 0.7490 0.7465 0.0184  -0.0256 0.0398  125 GLU A OE1   
1039 O OE2   . GLU A 125 ? 0.7635 0.7635 0.7592 0.0203  -0.0314 0.0435  125 GLU A OE2   
1040 N N     . PRO A 126 ? 0.5873 0.5540 0.5379 0.0020  -0.0165 0.0316  126 PRO A N     
1041 C CA    . PRO A 126 ? 0.5715 0.5317 0.5152 -0.0004 -0.0114 0.0282  126 PRO A CA    
1042 C C     . PRO A 126 ? 0.5777 0.5266 0.5127 -0.0013 -0.0117 0.0293  126 PRO A C     
1043 O O     . PRO A 126 ? 0.5973 0.5399 0.5236 -0.0057 -0.0090 0.0276  126 PRO A O     
1044 C CB    . PRO A 126 ? 0.5526 0.5183 0.5046 0.0034  -0.0072 0.0251  126 PRO A CB    
1045 C CG    . PRO A 126 ? 0.5600 0.5358 0.5214 0.0058  -0.0088 0.0260  126 PRO A CG    
1046 C CD    . PRO A 126 ? 0.5776 0.5541 0.5402 0.0065  -0.0146 0.0305  126 PRO A CD    
1047 N N     . SER A 127 ? 0.5783 0.5244 0.5154 0.0027  -0.0147 0.0321  127 SER A N     
1048 C CA    . SER A 127 ? 0.6157 0.5492 0.5433 0.0018  -0.0152 0.0334  127 SER A CA    
1049 C C     . SER A 127 ? 0.6197 0.5452 0.5355 -0.0031 -0.0190 0.0364  127 SER A C     
1050 O O     . SER A 127 ? 0.6567 0.5708 0.5615 -0.0064 -0.0178 0.0366  127 SER A O     
1051 C CB    . SER A 127 ? 0.6191 0.5502 0.5516 0.0081  -0.0174 0.0357  127 SER A CB    
1052 O OG    . SER A 127 ? 0.6383 0.5718 0.5739 0.0107  -0.0240 0.0403  127 SER A OG    
1053 N N     . GLN A 128 ? 0.6237 0.5546 0.5411 -0.0042 -0.0234 0.0386  128 GLN A N     
1054 C CA    . GLN A 128 ? 0.6464 0.5696 0.5514 -0.0095 -0.0272 0.0412  128 GLN A CA    
1055 C C     . GLN A 128 ? 0.6235 0.5456 0.5213 -0.0156 -0.0227 0.0378  128 GLN A C     
1056 O O     . GLN A 128 ? 0.6145 0.5261 0.4991 -0.0207 -0.0212 0.0376  128 GLN A O     
1057 C CB    . GLN A 128 ? 0.6814 0.6102 0.5907 -0.0082 -0.0351 0.0456  128 GLN A CB    
1058 C CG    . GLN A 128 ? 0.7618 0.6915 0.6784 -0.0016 -0.0404 0.0496  128 GLN A CG    
1059 C CD    . GLN A 128 ? 0.8512 0.7658 0.7564 -0.0015 -0.0417 0.0518  128 GLN A CD    
1060 O OE1   . GLN A 128 ? 0.8408 0.7519 0.7488 0.0028  -0.0388 0.0509  128 GLN A OE1   
1061 N NE2   . GLN A 128 ? 0.8643 0.7685 0.7551 -0.0066 -0.0459 0.0548  128 GLN A NE2   
1062 N N     . ALA A 129 ? 0.5921 0.5245 0.4983 -0.0150 -0.0201 0.0350  129 ALA A N     
1063 C CA    . ALA A 129 ? 0.5715 0.5038 0.4727 -0.0195 -0.0158 0.0317  129 ALA A CA    
1064 C C     . ALA A 129 ? 0.5828 0.5063 0.4699 -0.0256 -0.0181 0.0332  129 ALA A C     
1065 O O     . ALA A 129 ? 0.5837 0.5002 0.4612 -0.0299 -0.0133 0.0307  129 ALA A O     
1066 C CB    . ALA A 129 ? 0.5273 0.4583 0.4287 -0.0199 -0.0085 0.0272  129 ALA A CB    
1067 N N     . LYS A 130 ? 0.5947 0.5188 0.4805 -0.0262 -0.0253 0.0373  130 LYS A N     
1068 C CA    . LYS A 130 ? 0.6246 0.5388 0.4952 -0.0323 -0.0286 0.0393  130 LYS A CA    
1069 C C     . LYS A 130 ? 0.6043 0.5202 0.4712 -0.0366 -0.0276 0.0374  130 LYS A C     
1070 O O     . LYS A 130 ? 0.5994 0.5066 0.4526 -0.0422 -0.0300 0.0386  130 LYS A O     
1071 C CB    . LYS A 130 ? 0.6571 0.5688 0.5256 -0.0316 -0.0378 0.0451  130 LYS A CB    
1072 C CG    . LYS A 130 ? 0.7253 0.6501 0.6091 -0.0270 -0.0436 0.0477  130 LYS A CG    
1073 C CD    . LYS A 130 ? 0.7871 0.7093 0.6696 -0.0255 -0.0529 0.0536  130 LYS A CD    
1074 C CE    . LYS A 130 ? 0.8158 0.7524 0.7132 -0.0224 -0.0592 0.0563  130 LYS A CE    
1075 N NZ    . LYS A 130 ? 0.8423 0.7775 0.7398 -0.0206 -0.0690 0.0623  130 LYS A NZ    
1076 N N     . HIS A 131 ? 0.5802 0.5058 0.4578 -0.0341 -0.0241 0.0344  131 HIS A N     
1077 C CA    . HIS A 131 ? 0.5676 0.4939 0.4417 -0.0377 -0.0228 0.0324  131 HIS A CA    
1078 C C     . HIS A 131 ? 0.5543 0.4801 0.4284 -0.0375 -0.0142 0.0272  131 HIS A C     
1079 O O     . HIS A 131 ? 0.5596 0.4904 0.4428 -0.0332 -0.0102 0.0251  131 HIS A O     
1080 C CB    . HIS A 131 ? 0.5709 0.5085 0.4563 -0.0359 -0.0272 0.0340  131 HIS A CB    
1081 C CG    . HIS A 131 ? 0.5869 0.5275 0.4750 -0.0357 -0.0359 0.0391  131 HIS A CG    
1082 N ND1   . HIS A 131 ? 0.5837 0.5344 0.4864 -0.0299 -0.0386 0.0412  131 HIS A ND1   
1083 C CD2   . HIS A 131 ? 0.6311 0.5659 0.5093 -0.0403 -0.0426 0.0426  131 HIS A CD2   
1084 C CE1   . HIS A 131 ? 0.5915 0.5435 0.4947 -0.0304 -0.0467 0.0459  131 HIS A CE1   
1085 N NE2   . HIS A 131 ? 0.6197 0.5621 0.5079 -0.0369 -0.0497 0.0470  131 HIS A NE2   
1086 N N     . PRO A 132 ? 0.5540 0.4730 0.4174 -0.0420 -0.0115 0.0250  132 PRO A N     
1087 C CA    . PRO A 132 ? 0.5386 0.4568 0.4020 -0.0414 -0.0036 0.0202  132 PRO A CA    
1088 C C     . PRO A 132 ? 0.5158 0.4447 0.3931 -0.0365 -0.0019 0.0183  132 PRO A C     
1089 O O     . PRO A 132 ? 0.5224 0.4575 0.4057 -0.0356 -0.0061 0.0201  132 PRO A O     
1090 C CB    . PRO A 132 ? 0.5457 0.4552 0.3957 -0.0468 -0.0029 0.0191  132 PRO A CB    
1091 C CG    . PRO A 132 ? 0.5801 0.4819 0.4185 -0.0516 -0.0089 0.0229  132 PRO A CG    
1092 C CD    . PRO A 132 ? 0.5633 0.4736 0.4126 -0.0481 -0.0158 0.0271  132 PRO A CD    
1093 N N     . ILE A 133 ? 0.5003 0.4314 0.3826 -0.0336 0.0041  0.0149  133 ILE A N     
1094 C CA    . ILE A 133 ? 0.4825 0.4215 0.3751 -0.0296 0.0063  0.0127  133 ILE A CA    
1095 C C     . ILE A 133 ? 0.4865 0.4207 0.3725 -0.0316 0.0092  0.0102  133 ILE A C     
1096 O O     . ILE A 133 ? 0.4845 0.4124 0.3636 -0.0332 0.0141  0.0076  133 ILE A O     
1097 C CB    . ILE A 133 ? 0.4564 0.3997 0.3571 -0.0258 0.0107  0.0101  133 ILE A CB    
1098 C CG1   . ILE A 133 ? 0.4523 0.3987 0.3584 -0.0239 0.0080  0.0123  133 ILE A CG1   
1099 C CG2   . ILE A 133 ? 0.4518 0.4017 0.3610 -0.0220 0.0126  0.0078  133 ILE A CG2   
1100 C CD1   . ILE A 133 ? 0.3784 0.3271 0.2899 -0.0217 0.0121  0.0099  133 ILE A CD1   
1101 N N     . ASP A 134 ? 0.4797 0.4165 0.3675 -0.0315 0.0066  0.0110  134 ASP A N     
1102 C CA    . ASP A 134 ? 0.4964 0.4266 0.3760 -0.0339 0.0088  0.0090  134 ASP A CA    
1103 C C     . ASP A 134 ? 0.4838 0.4173 0.3696 -0.0299 0.0118  0.0064  134 ASP A C     
1104 O O     . ASP A 134 ? 0.5070 0.4343 0.3862 -0.0312 0.0135  0.0049  134 ASP A O     
1105 C CB    . ASP A 134 ? 0.4619 0.3881 0.3335 -0.0390 0.0034  0.0117  134 ASP A CB    
1106 C CG    . ASP A 134 ? 0.4662 0.4022 0.3477 -0.0380 -0.0022 0.0150  134 ASP A CG    
1107 O OD1   . ASP A 134 ? 0.5323 0.4757 0.4239 -0.0339 -0.0011 0.0142  134 ASP A OD1   
1108 O OD2   . ASP A 134 ? 0.4266 0.3628 0.3054 -0.0415 -0.0079 0.0183  134 ASP A OD2   
1109 N N     . ALA A 135 ? 0.4503 0.3925 0.3478 -0.0251 0.0123  0.0062  135 ALA A N     
1110 C CA    . ALA A 135 ? 0.4249 0.3699 0.3280 -0.0211 0.0147  0.0040  135 ALA A CA    
1111 C C     . ALA A 135 ? 0.4175 0.3709 0.3318 -0.0166 0.0153  0.0035  135 ALA A C     
1112 O O     . ALA A 135 ? 0.4101 0.3688 0.3297 -0.0161 0.0124  0.0056  135 ALA A O     
1113 C CB    . ALA A 135 ? 0.4119 0.3570 0.3141 -0.0221 0.0119  0.0053  135 ALA A CB    
1114 N N     . ILE A 136 ? 0.4102 0.3647 0.3281 -0.0132 0.0189  0.0007  136 ILE A N     
1115 C CA    . ILE A 136 ? 0.3939 0.3560 0.3217 -0.0092 0.0190  0.0000  136 ILE A CA    
1116 C C     . ILE A 136 ? 0.4197 0.3820 0.3497 -0.0058 0.0201  -0.0017 136 ILE A C     
1117 O O     . ILE A 136 ? 0.4284 0.3867 0.3557 -0.0049 0.0232  -0.0040 136 ILE A O     
1118 C CB    . ILE A 136 ? 0.3803 0.3446 0.3117 -0.0087 0.0218  -0.0017 136 ILE A CB    
1119 C CG1   . ILE A 136 ? 0.3887 0.3505 0.3160 -0.0123 0.0208  0.0001  136 ILE A CG1   
1120 C CG2   . ILE A 136 ? 0.3310 0.3027 0.2719 -0.0051 0.0213  -0.0025 136 ILE A CG2   
1121 C CD1   . ILE A 136 ? 0.3830 0.3448 0.3112 -0.0132 0.0243  -0.0016 136 ILE A CD1   
1122 N N     . THR A 137 ? 0.4161 0.3824 0.3504 -0.0037 0.0177  -0.0007 137 THR A N     
1123 C CA    . THR A 137 ? 0.3796 0.3465 0.3166 0.0001  0.0181  -0.0021 137 THR A CA    
1124 C C     . THR A 137 ? 0.3785 0.3526 0.3238 0.0027  0.0175  -0.0027 137 THR A C     
1125 O O     . THR A 137 ? 0.3473 0.3249 0.2951 0.0022  0.0157  -0.0012 137 THR A O     
1126 C CB    . THR A 137 ? 0.3751 0.3393 0.3085 -0.0003 0.0160  -0.0005 137 THR A CB    
1127 O OG1   . THR A 137 ? 0.3986 0.3554 0.3235 -0.0035 0.0164  -0.0001 137 THR A OG1   
1128 C CG2   . THR A 137 ? 0.3520 0.3157 0.2870 0.0038  0.0159  -0.0016 137 THR A CG2   
1129 N N     . HIS A 138 ? 0.3648 0.3410 0.3143 0.0055  0.0192  -0.0049 138 HIS A N     
1130 C CA    . HIS A 138 ? 0.3716 0.3545 0.3287 0.0075  0.0186  -0.0059 138 HIS A CA    
1131 C C     . HIS A 138 ? 0.3747 0.3586 0.3346 0.0116  0.0174  -0.0069 138 HIS A C     
1132 O O     . HIS A 138 ? 0.3752 0.3584 0.3365 0.0137  0.0192  -0.0085 138 HIS A O     
1133 C CB    . HIS A 138 ? 0.3932 0.3787 0.3538 0.0063  0.0216  -0.0077 138 HIS A CB    
1134 C CG    . HIS A 138 ? 0.3929 0.3851 0.3610 0.0072  0.0211  -0.0090 138 HIS A CG    
1135 N ND1   . HIS A 138 ? 0.3835 0.3773 0.3527 0.0045  0.0213  -0.0087 138 HIS A ND1   
1136 C CD2   . HIS A 138 ? 0.4064 0.4038 0.3811 0.0101  0.0201  -0.0104 138 HIS A CD2   
1137 C CE1   . HIS A 138 ? 0.3525 0.3519 0.3280 0.0053  0.0207  -0.0101 138 HIS A CE1   
1138 N NE2   . HIS A 138 ? 0.3540 0.3563 0.3334 0.0086  0.0197  -0.0112 138 HIS A NE2   
1139 N N     . TYR A 139 ? 0.3707 0.3556 0.3308 0.0127  0.0145  -0.0058 139 TYR A N     
1140 C CA    . TYR A 139 ? 0.3573 0.3428 0.3193 0.0165  0.0124  -0.0063 139 TYR A CA    
1141 C C     . TYR A 139 ? 0.3855 0.3783 0.3553 0.0178  0.0113  -0.0078 139 TYR A C     
1142 O O     . TYR A 139 ? 0.4219 0.4177 0.3933 0.0158  0.0107  -0.0076 139 TYR A O     
1143 C CB    . TYR A 139 ? 0.3259 0.3074 0.2823 0.0166  0.0099  -0.0044 139 TYR A CB    
1144 C CG    . TYR A 139 ? 0.3473 0.3287 0.3045 0.0202  0.0070  -0.0046 139 TYR A CG    
1145 C CD1   . TYR A 139 ? 0.3985 0.3839 0.3583 0.0205  0.0046  -0.0047 139 TYR A CD1   
1146 C CD2   . TYR A 139 ? 0.3535 0.3297 0.3078 0.0233  0.0063  -0.0046 139 TYR A CD2   
1147 C CE1   . TYR A 139 ? 0.3266 0.3113 0.2860 0.0235  0.0010  -0.0046 139 TYR A CE1   
1148 C CE2   . TYR A 139 ? 0.3691 0.3444 0.3235 0.0269  0.0028  -0.0043 139 TYR A CE2   
1149 C CZ    . TYR A 139 ? 0.4111 0.3910 0.3681 0.0269  -0.0001 -0.0042 139 TYR A CZ    
1150 O OH    . TYR A 139 ? 0.3970 0.3756 0.3532 0.0302  -0.0044 -0.0037 139 TYR A OH    
1151 N N     . ASP A 140 ? 0.3861 0.3817 0.3611 0.0212  0.0109  -0.0092 140 ASP A N     
1152 C CA    . ASP A 140 ? 0.3787 0.3822 0.3621 0.0223  0.0093  -0.0107 140 ASP A CA    
1153 C C     . ASP A 140 ? 0.4054 0.4086 0.3888 0.0258  0.0046  -0.0100 140 ASP A C     
1154 O O     . ASP A 140 ? 0.3980 0.3974 0.3797 0.0294  0.0038  -0.0096 140 ASP A O     
1155 C CB    . ASP A 140 ? 0.3556 0.3643 0.3468 0.0233  0.0125  -0.0129 140 ASP A CB    
1156 C CG    . ASP A 140 ? 0.3968 0.4153 0.3982 0.0237  0.0109  -0.0145 140 ASP A CG    
1157 O OD1   . ASP A 140 ? 0.4054 0.4272 0.4114 0.0276  0.0073  -0.0147 140 ASP A OD1   
1158 O OD2   . ASP A 140 ? 0.4330 0.4554 0.4374 0.0200  0.0130  -0.0156 140 ASP A OD2   
1159 N N     . SER A 141 ? 0.3976 0.4036 0.3816 0.0246  0.0014  -0.0098 141 SER A N     
1160 C CA    . SER A 141 ? 0.4263 0.4304 0.4075 0.0270  -0.0035 -0.0087 141 SER A CA    
1161 C C     . SER A 141 ? 0.4439 0.4538 0.4333 0.0311  -0.0066 -0.0096 141 SER A C     
1162 O O     . SER A 141 ? 0.4403 0.4467 0.4267 0.0345  -0.0108 -0.0084 141 SER A O     
1163 C CB    . SER A 141 ? 0.4279 0.4322 0.4059 0.0240  -0.0056 -0.0085 141 SER A CB    
1164 O OG    . SER A 141 ? 0.4405 0.4526 0.4262 0.0225  -0.0064 -0.0102 141 SER A OG    
1165 N N     . ILE A 142 ? 0.4509 0.4696 0.4508 0.0309  -0.0048 -0.0117 142 ILE A N     
1166 C CA    . ILE A 142 ? 0.4494 0.4761 0.4600 0.0348  -0.0074 -0.0128 142 ILE A CA    
1167 C C     . ILE A 142 ? 0.4688 0.4932 0.4815 0.0401  -0.0052 -0.0130 142 ILE A C     
1168 O O     . ILE A 142 ? 0.4729 0.4981 0.4890 0.0453  -0.0092 -0.0124 142 ILE A O     
1169 C CB    . ILE A 142 ? 0.4495 0.4877 0.4714 0.0319  -0.0060 -0.0151 142 ILE A CB    
1170 C CG1   . ILE A 142 ? 0.3938 0.4337 0.4135 0.0281  -0.0102 -0.0148 142 ILE A CG1   
1171 C CG2   . ILE A 142 ? 0.4231 0.4718 0.4590 0.0362  -0.0069 -0.0166 142 ILE A CG2   
1172 C CD1   . ILE A 142 ? 0.4295 0.4786 0.4577 0.0238  -0.0089 -0.0169 142 ILE A CD1   
1173 N N     . ASP A 143 ? 0.4655 0.4859 0.4754 0.0387  0.0007  -0.0137 143 ASP A N     
1174 C CA    . ASP A 143 ? 0.4815 0.4968 0.4904 0.0431  0.0035  -0.0141 143 ASP A CA    
1175 C C     . ASP A 143 ? 0.4831 0.4858 0.4794 0.0445  0.0013  -0.0117 143 ASP A C     
1176 O O     . ASP A 143 ? 0.4930 0.4900 0.4875 0.0493  0.0014  -0.0115 143 ASP A O     
1177 C CB    . ASP A 143 ? 0.4980 0.5119 0.5059 0.0402  0.0106  -0.0157 143 ASP A CB    
1178 C CG    . ASP A 143 ? 0.5023 0.5276 0.5222 0.0389  0.0140  -0.0183 143 ASP A CG    
1179 O OD1   . ASP A 143 ? 0.5500 0.5854 0.5813 0.0413  0.0112  -0.0192 143 ASP A OD1   
1180 O OD2   . ASP A 143 ? 0.4903 0.5141 0.5078 0.0350  0.0194  -0.0194 143 ASP A OD2   
1181 N N     . ASP A 144 ? 0.4797 0.4778 0.4671 0.0402  -0.0001 -0.0099 144 ASP A N     
1182 C CA    . ASP A 144 ? 0.4685 0.4549 0.4433 0.0399  -0.0013 -0.0077 144 ASP A CA    
1183 C C     . ASP A 144 ? 0.4543 0.4333 0.4234 0.0392  0.0034  -0.0080 144 ASP A C     
1184 O O     . ASP A 144 ? 0.4906 0.4601 0.4526 0.0417  0.0030  -0.0071 144 ASP A O     
1185 C CB    . ASP A 144 ? 0.4993 0.4815 0.4717 0.0448  -0.0066 -0.0062 144 ASP A CB    
1186 C CG    . ASP A 144 ? 0.5290 0.4990 0.4874 0.0434  -0.0080 -0.0037 144 ASP A CG    
1187 O OD1   . ASP A 144 ? 0.5645 0.5320 0.5167 0.0382  -0.0060 -0.0030 144 ASP A OD1   
1188 O OD2   . ASP A 144 ? 0.5634 0.5261 0.5172 0.0475  -0.0111 -0.0024 144 ASP A OD2   
1189 N N     . ARG A 145 ? 0.4219 0.4039 0.3929 0.0355  0.0077  -0.0092 145 ARG A N     
1190 C CA    . ARG A 145 ? 0.4447 0.4198 0.4099 0.0341  0.0122  -0.0098 145 ARG A CA    
1191 C C     . ARG A 145 ? 0.4326 0.4070 0.3932 0.0280  0.0141  -0.0091 145 ARG A C     
1192 O O     . ARG A 145 ? 0.4157 0.3970 0.3808 0.0255  0.0138  -0.0091 145 ARG A O     
1193 C CB    . ARG A 145 ? 0.4350 0.4141 0.4078 0.0368  0.0163  -0.0125 145 ARG A CB    
1194 C CG    . ARG A 145 ? 0.4698 0.4504 0.4491 0.0439  0.0148  -0.0134 145 ARG A CG    
1195 C CD    . ARG A 145 ? 0.4717 0.4392 0.4413 0.0471  0.0151  -0.0127 145 ARG A CD    
1196 N NE    . ARG A 145 ? 0.5009 0.4692 0.4770 0.0548  0.0136  -0.0134 145 ARG A NE    
1197 C CZ    . ARG A 145 ? 0.5376 0.5044 0.5135 0.0587  0.0077  -0.0115 145 ARG A CZ    
1198 N NH1   . ARG A 145 ? 0.5378 0.5021 0.5067 0.0553  0.0033  -0.0090 145 ARG A NH1   
1199 N NH2   . ARG A 145 ? 0.5589 0.5265 0.5413 0.0663  0.0062  -0.0121 145 ARG A NH2   
1200 N N     . PHE A 146 ? 0.4250 0.3906 0.3763 0.0256  0.0157  -0.0083 146 PHE A N     
1201 C CA    . PHE A 146 ? 0.4137 0.3782 0.3605 0.0200  0.0172  -0.0074 146 PHE A CA    
1202 C C     . PHE A 146 ? 0.4129 0.3760 0.3593 0.0188  0.0216  -0.0093 146 PHE A C     
1203 O O     . PHE A 146 ? 0.4182 0.3734 0.3586 0.0196  0.0238  -0.0101 146 PHE A O     
1204 C CB    . PHE A 146 ? 0.4009 0.3570 0.3376 0.0173  0.0160  -0.0053 146 PHE A CB    
1205 C CG    . PHE A 146 ? 0.4192 0.3755 0.3546 0.0176  0.0125  -0.0034 146 PHE A CG    
1206 C CD1   . PHE A 146 ? 0.3910 0.3430 0.3243 0.0215  0.0105  -0.0031 146 PHE A CD1   
1207 C CD2   . PHE A 146 ? 0.4078 0.3682 0.3436 0.0140  0.0115  -0.0019 146 PHE A CD2   
1208 C CE1   . PHE A 146 ? 0.4230 0.3742 0.3535 0.0212  0.0076  -0.0014 146 PHE A CE1   
1209 C CE2   . PHE A 146 ? 0.4309 0.3911 0.3648 0.0140  0.0093  -0.0005 146 PHE A CE2   
1210 C CZ    . PHE A 146 ? 0.4220 0.3773 0.3526 0.0172  0.0073  -0.0002 146 PHE A CZ    
1211 N N     . TYR A 147 ? 0.3987 0.3683 0.3503 0.0167  0.0231  -0.0101 147 TYR A N     
1212 C CA    . TYR A 147 ? 0.3833 0.3510 0.3331 0.0147  0.0276  -0.0118 147 TYR A CA    
1213 C C     . TYR A 147 ? 0.3832 0.3457 0.3243 0.0092  0.0274  -0.0100 147 TYR A C     
1214 O O     . TYR A 147 ? 0.3767 0.3429 0.3191 0.0066  0.0251  -0.0083 147 TYR A O     
1215 C CB    . TYR A 147 ? 0.3904 0.3669 0.3495 0.0148  0.0297  -0.0136 147 TYR A CB    
1216 C CG    . TYR A 147 ? 0.3855 0.3689 0.3549 0.0200  0.0296  -0.0154 147 TYR A CG    
1217 C CD1   . TYR A 147 ? 0.3955 0.3857 0.3715 0.0219  0.0253  -0.0146 147 TYR A CD1   
1218 C CD2   . TYR A 147 ? 0.3905 0.3737 0.3630 0.0231  0.0338  -0.0180 147 TYR A CD2   
1219 C CE1   . TYR A 147 ? 0.3497 0.3468 0.3355 0.0265  0.0243  -0.0161 147 TYR A CE1   
1220 C CE2   . TYR A 147 ? 0.4100 0.4010 0.3938 0.0283  0.0334  -0.0196 147 TYR A CE2   
1221 C CZ    . TYR A 147 ? 0.3965 0.3946 0.3869 0.0299  0.0282  -0.0184 147 TYR A CZ    
1222 O OH    . TYR A 147 ? 0.3838 0.3901 0.3856 0.0350  0.0269  -0.0197 147 TYR A OH    
1223 N N     . VAL A 148 ? 0.4106 0.3641 0.3426 0.0074  0.0295  -0.0104 148 VAL A N     
1224 C CA    . VAL A 148 ? 0.4059 0.3536 0.3286 0.0020  0.0284  -0.0086 148 VAL A CA    
1225 C C     . VAL A 148 ? 0.4509 0.3952 0.3690 -0.0012 0.0322  -0.0100 148 VAL A C     
1226 O O     . VAL A 148 ? 0.4527 0.3921 0.3679 0.0001  0.0367  -0.0126 148 VAL A O     
1227 C CB    . VAL A 148 ? 0.4235 0.3618 0.3369 0.0011  0.0273  -0.0078 148 VAL A CB    
1228 C CG1   . VAL A 148 ? 0.4056 0.3402 0.3112 -0.0050 0.0248  -0.0054 148 VAL A CG1   
1229 C CG2   . VAL A 148 ? 0.4323 0.3724 0.3492 0.0047  0.0244  -0.0068 148 VAL A CG2   
1230 N N     . PHE A 149 ? 0.4344 0.3809 0.3516 -0.0052 0.0308  -0.0083 149 PHE A N     
1231 C CA    . PHE A 149 ? 0.4541 0.3961 0.3650 -0.0091 0.0338  -0.0091 149 PHE A CA    
1232 C C     . PHE A 149 ? 0.4685 0.4035 0.3686 -0.0142 0.0307  -0.0066 149 PHE A C     
1233 O O     . PHE A 149 ? 0.5035 0.4421 0.4054 -0.0159 0.0261  -0.0037 149 PHE A O     
1234 C CB    . PHE A 149 ? 0.4491 0.3979 0.3662 -0.0099 0.0342  -0.0089 149 PHE A CB    
1235 C CG    . PHE A 149 ? 0.4424 0.3995 0.3710 -0.0057 0.0366  -0.0112 149 PHE A CG    
1236 C CD1   . PHE A 149 ? 0.4603 0.4241 0.3975 -0.0017 0.0334  -0.0107 149 PHE A CD1   
1237 C CD2   . PHE A 149 ? 0.4567 0.4151 0.3875 -0.0061 0.0419  -0.0139 149 PHE A CD2   
1238 C CE1   . PHE A 149 ? 0.4442 0.4160 0.3918 0.0017  0.0347  -0.0127 149 PHE A CE1   
1239 C CE2   . PHE A 149 ? 0.3956 0.3631 0.3382 -0.0027 0.0437  -0.0160 149 PHE A CE2   
1240 C CZ    . PHE A 149 ? 0.4395 0.4137 0.3905 0.0012  0.0397  -0.0153 149 PHE A CZ    
1241 N N     . ASP A 150 ? 0.4851 0.4100 0.3742 -0.0167 0.0332  -0.0079 150 ASP A N     
1242 C CA    . ASP A 150 ? 0.4949 0.4124 0.3730 -0.0220 0.0297  -0.0057 150 ASP A CA    
1243 C C     . ASP A 150 ? 0.4917 0.4009 0.3582 -0.0272 0.0317  -0.0061 150 ASP A C     
1244 O O     . ASP A 150 ? 0.4700 0.3731 0.3314 -0.0270 0.0376  -0.0093 150 ASP A O     
1245 C CB    . ASP A 150 ? 0.4972 0.4072 0.3693 -0.0214 0.0302  -0.0067 150 ASP A CB    
1246 C CG    . ASP A 150 ? 0.5633 0.4658 0.4238 -0.0276 0.0264  -0.0045 150 ASP A CG    
1247 O OD1   . ASP A 150 ? 0.5414 0.4465 0.4008 -0.0318 0.0222  -0.0017 150 ASP A OD1   
1248 O OD2   . ASP A 150 ? 0.5769 0.4706 0.4295 -0.0284 0.0272  -0.0056 150 ASP A OD2   
1249 N N     . LEU A 151 ? 0.4735 0.3825 0.3358 -0.0318 0.0268  -0.0028 151 LEU A N     
1250 C CA    . LEU A 151 ? 0.4801 0.3804 0.3298 -0.0374 0.0274  -0.0025 151 LEU A CA    
1251 C C     . LEU A 151 ? 0.5257 0.4150 0.3612 -0.0426 0.0255  -0.0021 151 LEU A C     
1252 O O     . LEU A 151 ? 0.5332 0.4245 0.3690 -0.0445 0.0196  0.0007  151 LEU A O     
1253 C CB    . LEU A 151 ? 0.4553 0.3602 0.3074 -0.0394 0.0225  0.0011  151 LEU A CB    
1254 C CG    . LEU A 151 ? 0.4602 0.3560 0.2988 -0.0453 0.0218  0.0023  151 LEU A CG    
1255 C CD1   . LEU A 151 ? 0.4229 0.3131 0.2565 -0.0457 0.0298  -0.0014 151 LEU A CD1   
1256 C CD2   . LEU A 151 ? 0.4991 0.3998 0.3416 -0.0461 0.0159  0.0064  151 LEU A CD2   
1257 N N     . LEU A 152 ? 0.5771 0.4547 0.3999 -0.0451 0.0308  -0.0050 152 LEU A N     
1258 C CA    . LEU A 152 ? 0.6085 0.4735 0.4156 -0.0504 0.0297  -0.0052 152 LEU A CA    
1259 C C     . LEU A 152 ? 0.5915 0.4492 0.3851 -0.0580 0.0255  -0.0027 152 LEU A C     
1260 O O     . LEU A 152 ? 0.6167 0.4674 0.3998 -0.0634 0.0211  -0.0013 152 LEU A O     
1261 C CB    . LEU A 152 ? 0.5945 0.4487 0.3935 -0.0490 0.0378  -0.0100 152 LEU A CB    
1262 C CG    . LEU A 152 ? 0.6169 0.4756 0.4269 -0.0414 0.0416  -0.0125 152 LEU A CG    
1263 C CD1   . LEU A 152 ? 0.6586 0.5034 0.4569 -0.0410 0.0484  -0.0167 152 LEU A CD1   
1264 C CD2   . LEU A 152 ? 0.5684 0.4336 0.3860 -0.0398 0.0355  -0.0099 152 LEU A CD2   
1265 N N     . ASN A 153 ? 0.5838 0.4425 0.3770 -0.0588 0.0267  -0.0022 153 ASN A N     
1266 C CA    . ASN A 153 ? 0.6442 0.4948 0.4234 -0.0658 0.0226  0.0004  153 ASN A CA    
1267 C C     . ASN A 153 ? 0.6542 0.5140 0.4420 -0.0650 0.0169  0.0045  153 ASN A C     
1268 O O     . ASN A 153 ? 0.6338 0.5000 0.4311 -0.0610 0.0204  0.0037  153 ASN A O     
1269 C CB    . ASN A 153 ? 0.6794 0.5168 0.4432 -0.0692 0.0302  -0.0030 153 ASN A CB    
1270 C CG    . ASN A 153 ? 0.7364 0.5626 0.4899 -0.0699 0.0363  -0.0073 153 ASN A CG    
1271 O OD1   . ASN A 153 ? 0.7837 0.6071 0.5342 -0.0711 0.0328  -0.0068 153 ASN A OD1   
1272 N ND2   . ASN A 153 ? 0.7999 0.6193 0.5478 -0.0691 0.0458  -0.0116 153 ASN A ND2   
1273 N N     . SER A 154 ? 0.6794 0.5395 0.4637 -0.0691 0.0080  0.0089  154 SER A N     
1274 C CA    . SER A 154 ? 0.6601 0.5288 0.4531 -0.0678 0.0014  0.0133  154 SER A CA    
1275 C C     . SER A 154 ? 0.6680 0.5299 0.4484 -0.0745 -0.0068 0.0175  154 SER A C     
1276 O O     . SER A 154 ? 0.7065 0.5611 0.4757 -0.0797 -0.0090 0.0173  154 SER A O     
1277 C CB    . SER A 154 ? 0.6379 0.5213 0.4494 -0.0625 -0.0021 0.0148  154 SER A CB    
1278 O OG    . SER A 154 ? 0.6747 0.5657 0.4933 -0.0621 -0.0098 0.0195  154 SER A OG    
1279 N N     . PRO A 155 ? 0.6702 0.5341 0.4519 -0.0745 -0.0118 0.0213  155 PRO A N     
1280 C CA    . PRO A 155 ? 0.6858 0.5455 0.4582 -0.0799 -0.0215 0.0261  155 PRO A CA    
1281 C C     . PRO A 155 ? 0.6940 0.5634 0.4754 -0.0804 -0.0292 0.0287  155 PRO A C     
1282 O O     . PRO A 155 ? 0.7003 0.5661 0.4732 -0.0860 -0.0373 0.0321  155 PRO A O     
1283 C CB    . PRO A 155 ? 0.6669 0.5296 0.4442 -0.0772 -0.0250 0.0296  155 PRO A CB    
1284 C CG    . PRO A 155 ? 0.6699 0.5420 0.4630 -0.0699 -0.0183 0.0270  155 PRO A CG    
1285 C CD    . PRO A 155 ? 0.6639 0.5320 0.4537 -0.0699 -0.0089 0.0214  155 PRO A CD    
1286 N N     . TYR A 156 ? 0.6857 0.5670 0.4834 -0.0751 -0.0267 0.0272  156 TYR A N     
1287 C CA    . TYR A 156 ? 0.6893 0.5803 0.4963 -0.0758 -0.0328 0.0294  156 TYR A CA    
1288 C C     . TYR A 156 ? 0.6977 0.5838 0.4983 -0.0792 -0.0296 0.0262  156 TYR A C     
1289 O O     . TYR A 156 ? 0.6933 0.5866 0.5005 -0.0807 -0.0337 0.0275  156 TYR A O     
1290 C CB    . TYR A 156 ? 0.6762 0.5838 0.5051 -0.0684 -0.0336 0.0307  156 TYR A CB    
1291 C CG    . TYR A 156 ? 0.7075 0.6190 0.5420 -0.0652 -0.0376 0.0342  156 TYR A CG    
1292 C CD1   . TYR A 156 ? 0.7634 0.6702 0.5894 -0.0694 -0.0456 0.0384  156 TYR A CD1   
1293 C CD2   . TYR A 156 ? 0.6914 0.6099 0.5386 -0.0581 -0.0337 0.0333  156 TYR A CD2   
1294 C CE1   . TYR A 156 ? 0.7689 0.6777 0.5991 -0.0660 -0.0495 0.0419  156 TYR A CE1   
1295 C CE2   . TYR A 156 ? 0.7015 0.6218 0.5527 -0.0551 -0.0371 0.0365  156 TYR A CE2   
1296 C CZ    . TYR A 156 ? 0.7560 0.6712 0.5988 -0.0588 -0.0450 0.0408  156 TYR A CZ    
1297 O OH    . TYR A 156 ? 0.7920 0.7075 0.6378 -0.0554 -0.0486 0.0441  156 TYR A OH    
1298 N N     . GLY A 157 ? 0.6959 0.5692 0.4835 -0.0805 -0.0220 0.0219  157 GLY A N     
1299 C CA    . GLY A 157 ? 0.6960 0.5604 0.4734 -0.0842 -0.0189 0.0188  157 GLY A CA    
1300 C C     . GLY A 157 ? 0.6988 0.5558 0.4725 -0.0806 -0.0082 0.0134  157 GLY A C     
1301 O O     . GLY A 157 ? 0.6865 0.5510 0.4726 -0.0738 -0.0035 0.0120  157 GLY A O     
1302 N N     . ASN A 158 ? 0.6853 0.5274 0.4418 -0.0854 -0.0047 0.0105  158 ASN A N     
1303 C CA    . ASN A 158 ? 0.6970 0.5316 0.4499 -0.0818 0.0054  0.0052  158 ASN A CA    
1304 C C     . ASN A 158 ? 0.7022 0.5368 0.4582 -0.0804 0.0065  0.0036  158 ASN A C     
1305 O O     . ASN A 158 ? 0.7017 0.5310 0.4491 -0.0865 0.0017  0.0048  158 ASN A O     
1306 C CB    . ASN A 158 ? 0.7383 0.5547 0.4694 -0.0872 0.0102  0.0024  158 ASN A CB    
1307 C CG    . ASN A 158 ? 0.7701 0.5844 0.4959 -0.0891 0.0100  0.0038  158 ASN A CG    
1308 O OD1   . ASN A 158 ? 0.7904 0.6156 0.5298 -0.0843 0.0100  0.0052  158 ASN A OD1   
1309 N ND2   . ASN A 158 ? 0.8314 0.6302 0.5360 -0.0966 0.0097  0.0035  158 ASN A ND2   
1310 N N     . VAL A 159 ? 0.6804 0.5206 0.4482 -0.0728 0.0123  0.0010  159 VAL A N     
1311 C CA    . VAL A 159 ? 0.6906 0.5317 0.4628 -0.0705 0.0128  0.0000  159 VAL A CA    
1312 C C     . VAL A 159 ? 0.7074 0.5395 0.4757 -0.0658 0.0217  -0.0049 159 VAL A C     
1313 O O     . VAL A 159 ? 0.7270 0.5561 0.4940 -0.0630 0.0281  -0.0077 159 VAL A O     
1314 C CB    . VAL A 159 ? 0.6749 0.5335 0.4675 -0.0652 0.0095  0.0025  159 VAL A CB    
1315 C CG1   . VAL A 159 ? 0.6543 0.5220 0.4515 -0.0696 0.0006  0.0073  159 VAL A CG1   
1316 C CG2   . VAL A 159 ? 0.6305 0.4979 0.4359 -0.0577 0.0138  0.0013  159 VAL A CG2   
1317 N N     . GLU A 160 ? 0.7215 0.5491 0.4882 -0.0651 0.0222  -0.0059 160 GLU A N     
1318 C CA    . GLU A 160 ? 0.7139 0.5336 0.4788 -0.0594 0.0297  -0.0101 160 GLU A CA    
1319 C C     . GLU A 160 ? 0.6606 0.4939 0.4447 -0.0503 0.0313  -0.0102 160 GLU A C     
1320 O O     . GLU A 160 ? 0.6151 0.4621 0.4120 -0.0492 0.0264  -0.0070 160 GLU A O     
1321 C CB    . GLU A 160 ? 0.7397 0.5461 0.4920 -0.0630 0.0292  -0.0109 160 GLU A CB    
1322 C CG    . GLU A 160 ? 0.8712 0.6609 0.6016 -0.0721 0.0287  -0.0118 160 GLU A CG    
1323 C CD    . GLU A 160 ? 0.9607 0.7386 0.6802 -0.0709 0.0369  -0.0160 160 GLU A CD    
1324 O OE1   . GLU A 160 ? 1.0055 0.7789 0.7271 -0.0638 0.0443  -0.0197 160 GLU A OE1   
1325 O OE2   . GLU A 160 ? 0.9964 0.7695 0.7054 -0.0769 0.0359  -0.0156 160 GLU A OE2   
1326 N N     . GLU A 161 ? 0.6568 0.4861 0.4428 -0.0437 0.0382  -0.0139 161 GLU A N     
1327 C CA    . GLU A 161 ? 0.6540 0.4950 0.4570 -0.0351 0.0394  -0.0142 161 GLU A CA    
1328 C C     . GLU A 161 ? 0.6404 0.4848 0.4481 -0.0343 0.0346  -0.0118 161 GLU A C     
1329 O O     . GLU A 161 ? 0.6485 0.4825 0.4450 -0.0386 0.0329  -0.0113 161 GLU A O     
1330 C CB    . GLU A 161 ? 0.6673 0.5024 0.4707 -0.0283 0.0472  -0.0185 161 GLU A CB    
1331 C CG    . GLU A 161 ? 0.6455 0.4849 0.4533 -0.0263 0.0529  -0.0209 161 GLU A CG    
1332 C CD    . GLU A 161 ? 0.6803 0.5166 0.4917 -0.0188 0.0608  -0.0253 161 GLU A CD    
1333 O OE1   . GLU A 161 ? 0.6679 0.5056 0.4863 -0.0123 0.0606  -0.0257 161 GLU A OE1   
1334 O OE2   . GLU A 161 ? 0.7675 0.5999 0.5747 -0.0193 0.0673  -0.0283 161 GLU A OE2   
1335 N N     . TRP A 162 ? 0.6271 0.4855 0.4505 -0.0293 0.0326  -0.0103 162 TRP A N     
1336 C CA    . TRP A 162 ? 0.6116 0.4740 0.4404 -0.0276 0.0290  -0.0082 162 TRP A CA    
1337 C C     . TRP A 162 ? 0.6116 0.4638 0.4363 -0.0226 0.0325  -0.0106 162 TRP A C     
1338 O O     . TRP A 162 ? 0.5919 0.4413 0.4182 -0.0170 0.0376  -0.0136 162 TRP A O     
1339 C CB    . TRP A 162 ? 0.5902 0.4690 0.4357 -0.0234 0.0269  -0.0066 162 TRP A CB    
1340 C CG    . TRP A 162 ? 0.5582 0.4417 0.4104 -0.0203 0.0243  -0.0050 162 TRP A CG    
1341 C CD1   . TRP A 162 ? 0.5601 0.4472 0.4128 -0.0243 0.0199  -0.0021 162 TRP A CD1   
1342 C CD2   . TRP A 162 ? 0.5199 0.4057 0.3794 -0.0128 0.0260  -0.0062 162 TRP A CD2   
1343 N NE1   . TRP A 162 ? 0.5543 0.4446 0.4129 -0.0201 0.0192  -0.0015 162 TRP A NE1   
1344 C CE2   . TRP A 162 ? 0.5304 0.4195 0.3927 -0.0130 0.0224  -0.0039 162 TRP A CE2   
1345 C CE3   . TRP A 162 ? 0.5064 0.3921 0.3706 -0.0061 0.0300  -0.0091 162 TRP A CE3   
1346 C CZ2   . TRP A 162 ? 0.5144 0.4053 0.3823 -0.0068 0.0223  -0.0041 162 TRP A CZ2   
1347 C CZ3   . TRP A 162 ? 0.5207 0.4096 0.3922 0.0004  0.0294  -0.0091 162 TRP A CZ3   
1348 C CH2   . TRP A 162 ? 0.5347 0.4254 0.4071 -0.0001 0.0253  -0.0066 162 TRP A CH2   
1349 N N     . SER A 163 ? 0.6285 0.4751 0.4480 -0.0245 0.0297  -0.0090 163 SER A N     
1350 C CA    . SER A 163 ? 0.6486 0.4832 0.4621 -0.0201 0.0323  -0.0108 163 SER A CA    
1351 C C     . SER A 163 ? 0.6435 0.4848 0.4661 -0.0155 0.0296  -0.0089 163 SER A C     
1352 O O     . SER A 163 ? 0.6598 0.5038 0.4819 -0.0200 0.0255  -0.0061 163 SER A O     
1353 C CB    . SER A 163 ? 0.6454 0.4631 0.4409 -0.0268 0.0321  -0.0110 163 SER A CB    
1354 O OG    . SER A 163 ? 0.7169 0.5234 0.5069 -0.0230 0.0331  -0.0115 163 SER A OG    
1355 N N     . ILE A 164 ? 0.6400 0.4840 0.4707 -0.0068 0.0319  -0.0104 164 ILE A N     
1356 C CA    . ILE A 164 ? 0.6289 0.4781 0.4674 -0.0017 0.0293  -0.0089 164 ILE A CA    
1357 C C     . ILE A 164 ? 0.6633 0.4982 0.4898 -0.0030 0.0279  -0.0078 164 ILE A C     
1358 O O     . ILE A 164 ? 0.6877 0.5256 0.5163 -0.0031 0.0246  -0.0054 164 ILE A O     
1359 C CB    . ILE A 164 ? 0.6148 0.4698 0.4646 0.0080  0.0316  -0.0109 164 ILE A CB    
1360 C CG1   . ILE A 164 ? 0.6041 0.4660 0.4623 0.0127  0.0279  -0.0090 164 ILE A CG1   
1361 C CG2   . ILE A 164 ? 0.6267 0.4681 0.4694 0.0128  0.0364  -0.0140 164 ILE A CG2   
1362 C CD1   . ILE A 164 ? 0.5410 0.4149 0.4141 0.0203  0.0285  -0.0103 164 ILE A CD1   
1363 N N     . GLU A 165 ? 0.6781 0.4965 0.4907 -0.0046 0.0308  -0.0096 165 GLU A N     
1364 C CA    . GLU A 165 ? 0.6775 0.4798 0.4765 -0.0065 0.0299  -0.0088 165 GLU A CA    
1365 C C     . GLU A 165 ? 0.6347 0.4386 0.4288 -0.0163 0.0260  -0.0058 165 GLU A C     
1366 O O     . GLU A 165 ? 0.6424 0.4425 0.4331 -0.0175 0.0237  -0.0037 165 GLU A O     
1367 C CB    . GLU A 165 ? 0.7453 0.5281 0.5293 -0.0065 0.0342  -0.0117 165 GLU A CB    
1368 C CG    . GLU A 165 ? 0.8307 0.6111 0.6196 0.0037  0.0391  -0.0151 165 GLU A CG    
1369 C CD    . GLU A 165 ? 0.8965 0.6871 0.6932 0.0038  0.0426  -0.0174 165 GLU A CD    
1370 O OE1   . GLU A 165 ? 0.8939 0.6931 0.6919 -0.0034 0.0406  -0.0161 165 GLU A OE1   
1371 O OE2   . GLU A 165 ? 0.9384 0.7285 0.7400 0.0113  0.0473  -0.0204 165 GLU A OE2   
1372 N N     . ILE A 166 ? 0.6242 0.4336 0.4179 -0.0234 0.0253  -0.0056 166 ILE A N     
1373 C CA    . ILE A 166 ? 0.6098 0.4231 0.4010 -0.0329 0.0214  -0.0028 166 ILE A CA    
1374 C C     . ILE A 166 ? 0.5680 0.3989 0.3740 -0.0315 0.0184  -0.0002 166 ILE A C     
1375 O O     . ILE A 166 ? 0.5797 0.4121 0.3845 -0.0362 0.0161  0.0021  166 ILE A O     
1376 C CB    . ILE A 166 ? 0.6108 0.4253 0.3976 -0.0407 0.0206  -0.0030 166 ILE A CB    
1377 C CG1   . ILE A 166 ? 0.6203 0.4150 0.3894 -0.0435 0.0235  -0.0056 166 ILE A CG1   
1378 C CG2   . ILE A 166 ? 0.5947 0.4171 0.3829 -0.0497 0.0159  0.0002  166 ILE A CG2   
1379 C CD1   . ILE A 166 ? 0.6282 0.4220 0.3908 -0.0511 0.0227  -0.0060 166 ILE A CD1   
1380 N N     . ALA A 167 ? 0.5472 0.3906 0.3664 -0.0253 0.0191  -0.0008 167 ALA A N     
1381 C CA    . ALA A 167 ? 0.5462 0.4054 0.3790 -0.0233 0.0168  0.0011  167 ALA A CA    
1382 C C     . ALA A 167 ? 0.5764 0.4325 0.4087 -0.0199 0.0160  0.0022  167 ALA A C     
1383 O O     . ALA A 167 ? 0.5605 0.4251 0.3982 -0.0219 0.0140  0.0043  167 ALA A O     
1384 C CB    . ALA A 167 ? 0.5079 0.3783 0.3529 -0.0175 0.0180  -0.0002 167 ALA A CB    
1385 N N     . ALA A 168 ? 0.6053 0.4488 0.4308 -0.0146 0.0177  0.0008  168 ALA A N     
1386 C CA    . ALA A 168 ? 0.6441 0.4817 0.4667 -0.0112 0.0164  0.0020  168 ALA A CA    
1387 C C     . ALA A 168 ? 0.6789 0.5062 0.4890 -0.0187 0.0153  0.0040  168 ALA A C     
1388 O O     . ALA A 168 ? 0.6943 0.5207 0.5032 -0.0186 0.0139  0.0058  168 ALA A O     
1389 C CB    . ALA A 168 ? 0.6616 0.4887 0.4812 -0.0026 0.0180  0.0002  168 ALA A CB    
1390 N N     . LYS A 169 ? 0.6997 0.5188 0.5000 -0.0257 0.0161  0.0035  169 LYS A N     
1391 C CA    . LYS A 169 ? 0.7178 0.5255 0.5050 -0.0337 0.0153  0.0050  169 LYS A CA    
1392 C C     . LYS A 169 ? 0.7059 0.5264 0.4994 -0.0404 0.0133  0.0076  169 LYS A C     
1393 O O     . LYS A 169 ? 0.6873 0.5249 0.4939 -0.0408 0.0124  0.0081  169 LYS A O     
1394 C CB    . LYS A 169 ? 0.7233 0.5193 0.4982 -0.0403 0.0163  0.0037  169 LYS A CB    
1395 C CG    . LYS A 169 ? 0.7669 0.5456 0.5315 -0.0348 0.0193  0.0009  169 LYS A CG    
1396 C CD    . LYS A 169 ? 0.8526 0.6158 0.6007 -0.0431 0.0202  -0.0002 169 LYS A CD    
1397 C CE    . LYS A 169 ? 0.9233 0.6706 0.6621 -0.0376 0.0242  -0.0037 169 LYS A CE    
1398 N NZ    . LYS A 169 ? 0.9275 0.6619 0.6619 -0.0287 0.0258  -0.0042 169 LYS A NZ    
1399 N N     . LEU A 170 ? 0.7220 0.5337 0.5059 -0.0456 0.0129  0.0093  170 LEU A N     
1400 C CA    . LEU A 170 ? 0.7208 0.5435 0.5096 -0.0529 0.0118  0.0116  170 LEU A CA    
1401 C C     . LEU A 170 ? 0.7119 0.5441 0.5048 -0.0611 0.0106  0.0119  170 LEU A C     
1402 O O     . LEU A 170 ? 0.7292 0.5527 0.5140 -0.0642 0.0105  0.0107  170 LEU A O     
1403 C CB    . LEU A 170 ? 0.7470 0.5556 0.5219 -0.0582 0.0122  0.0131  170 LEU A CB    
1404 C CG    . LEU A 170 ? 0.8021 0.5945 0.5668 -0.0516 0.0127  0.0132  170 LEU A CG    
1405 C CD1   . LEU A 170 ? 0.8610 0.6366 0.6088 -0.0594 0.0132  0.0146  170 LEU A CD1   
1406 C CD2   . LEU A 170 ? 0.7691 0.5718 0.5440 -0.0446 0.0121  0.0140  170 LEU A CD2   
1407 N N     . GLN A 171 ? 0.7015 0.5509 0.5064 -0.0647 0.0097  0.0136  171 GLN A N     
1408 C CA    . GLN A 171 ? 0.7334 0.5932 0.5436 -0.0724 0.0077  0.0144  171 GLN A CA    
1409 C C     . GLN A 171 ? 0.7449 0.5928 0.5412 -0.0828 0.0070  0.0149  171 GLN A C     
1410 O O     . GLN A 171 ? 0.7346 0.5849 0.5302 -0.0891 0.0048  0.0150  171 GLN A O     
1411 C CB    . GLN A 171 ? 0.7482 0.6287 0.5747 -0.0736 0.0072  0.0162  171 GLN A CB    
1412 C CG    . GLN A 171 ? 0.8238 0.7162 0.6637 -0.0643 0.0074  0.0155  171 GLN A CG    
1413 C CD    . GLN A 171 ? 0.9021 0.8147 0.7582 -0.0657 0.0061  0.0169  171 GLN A CD    
1414 O OE1   . GLN A 171 ? 0.9401 0.8605 0.8000 -0.0728 0.0054  0.0185  171 GLN A OE1   
1415 N NE2   . GLN A 171 ? 0.9014 0.8224 0.7673 -0.0588 0.0058  0.0162  171 GLN A NE2   
1416 N N     . GLU A 172 ? 0.7520 0.5858 0.5362 -0.0848 0.0086  0.0152  172 GLU A N     
1417 C CA    . GLU A 172 ? 0.7605 0.5807 0.5298 -0.0951 0.0083  0.0156  172 GLU A CA    
1418 C C     . GLU A 172 ? 0.7896 0.5896 0.5430 -0.0943 0.0086  0.0135  172 GLU A C     
1419 O O     . GLU A 172 ? 0.7909 0.5785 0.5308 -0.1033 0.0080  0.0134  172 GLU A O     
1420 C CB    . GLU A 172 ? 0.7939 0.6056 0.5554 -0.0974 0.0102  0.0169  172 GLU A CB    
1421 C CG    . GLU A 172 ? 0.8176 0.6479 0.5927 -0.1002 0.0109  0.0189  172 GLU A CG    
1422 C CD    . GLU A 172 ? 0.8763 0.7169 0.6632 -0.0896 0.0120  0.0188  172 GLU A CD    
1423 O OE1   . GLU A 172 ? 0.8615 0.7175 0.6600 -0.0909 0.0130  0.0200  172 GLU A OE1   
1424 O OE2   . GLU A 172 ? 0.8962 0.7296 0.6810 -0.0803 0.0120  0.0174  172 GLU A OE2   
1425 N N     . GLN A 173 ? 0.7818 0.5782 0.5367 -0.0838 0.0098  0.0116  173 GLN A N     
1426 C CA    . GLN A 173 ? 0.7819 0.5612 0.5241 -0.0818 0.0110  0.0091  173 GLN A CA    
1427 C C     . GLN A 173 ? 0.7493 0.5386 0.4986 -0.0819 0.0098  0.0080  173 GLN A C     
1428 O O     . GLN A 173 ? 0.7670 0.5443 0.5072 -0.0801 0.0112  0.0057  173 GLN A O     
1429 C CB    . GLN A 173 ? 0.8089 0.5778 0.5486 -0.0699 0.0135  0.0076  173 GLN A CB    
1430 C CG    . GLN A 173 ? 0.8452 0.5966 0.5719 -0.0692 0.0145  0.0083  173 GLN A CG    
1431 C CD    . GLN A 173 ? 0.9019 0.6455 0.6286 -0.0565 0.0161  0.0070  173 GLN A CD    
1432 O OE1   . GLN A 173 ? 0.9097 0.6645 0.6481 -0.0497 0.0154  0.0080  173 GLN A OE1   
1433 N NE2   . GLN A 173 ? 0.9114 0.6357 0.6251 -0.0533 0.0181  0.0048  173 GLN A NE2   
1434 N N     . GLY A 174 ? 0.6971 0.5076 0.4622 -0.0840 0.0074  0.0098  174 GLY A N     
1435 C CA    . GLY A 174 ? 0.6713 0.4923 0.4437 -0.0843 0.0056  0.0094  174 GLY A CA    
1436 C C     . GLY A 174 ? 0.6521 0.4829 0.4371 -0.0735 0.0070  0.0084  174 GLY A C     
1437 O O     . GLY A 174 ? 0.6233 0.4620 0.4141 -0.0728 0.0060  0.0080  174 GLY A O     
1438 N N     . GLY A 175 ? 0.6419 0.4719 0.4304 -0.0657 0.0092  0.0081  175 GLY A N     
1439 C CA    . GLY A 175 ? 0.6249 0.4636 0.4250 -0.0557 0.0105  0.0071  175 GLY A CA    
1440 C C     . GLY A 175 ? 0.6009 0.4601 0.4180 -0.0545 0.0088  0.0089  175 GLY A C     
1441 O O     . GLY A 175 ? 0.5691 0.4373 0.3904 -0.0611 0.0068  0.0110  175 GLY A O     
1442 N N     . ASP A 176 ? 0.6140 0.4806 0.4410 -0.0460 0.0099  0.0081  176 ASP A N     
1443 C CA    . ASP A 176 ? 0.6152 0.5000 0.4578 -0.0440 0.0088  0.0094  176 ASP A CA    
1444 C C     . ASP A 176 ? 0.6375 0.5260 0.4851 -0.0394 0.0095  0.0100  176 ASP A C     
1445 O O     . ASP A 176 ? 0.6347 0.5369 0.4941 -0.0378 0.0090  0.0109  176 ASP A O     
1446 C CB    . ASP A 176 ? 0.5929 0.4840 0.4427 -0.0390 0.0092  0.0080  176 ASP A CB    
1447 C CG    . ASP A 176 ? 0.5988 0.4852 0.4420 -0.0437 0.0086  0.0074  176 ASP A CG    
1448 O OD1   . ASP A 176 ? 0.5679 0.4556 0.4083 -0.0515 0.0060  0.0090  176 ASP A OD1   
1449 O OD2   . ASP A 176 ? 0.5923 0.4737 0.4331 -0.0400 0.0106  0.0052  176 ASP A OD2   
1450 N N     . GLU A 177 ? 0.6704 0.5459 0.5085 -0.0371 0.0106  0.0095  177 GLU A N     
1451 C CA    . GLU A 177 ? 0.7125 0.5885 0.5520 -0.0337 0.0108  0.0104  177 GLU A CA    
1452 C C     . GLU A 177 ? 0.6911 0.5780 0.5428 -0.0260 0.0107  0.0097  177 GLU A C     
1453 O O     . GLU A 177 ? 0.6837 0.5787 0.5414 -0.0253 0.0105  0.0107  177 GLU A O     
1454 C CB    . GLU A 177 ? 0.7424 0.6241 0.5828 -0.0408 0.0105  0.0125  177 GLU A CB    
1455 C CG    . GLU A 177 ? 0.8257 0.6976 0.6569 -0.0417 0.0112  0.0136  177 GLU A CG    
1456 C CD    . GLU A 177 ? 0.8898 0.7656 0.7200 -0.0507 0.0117  0.0154  177 GLU A CD    
1457 O OE1   . GLU A 177 ? 0.8970 0.7833 0.7348 -0.0508 0.0126  0.0163  177 GLU A OE1   
1458 O OE2   . GLU A 177 ? 0.8988 0.7675 0.7207 -0.0580 0.0115  0.0158  177 GLU A OE2   
1459 N N     . VAL A 178 ? 0.6734 0.5603 0.5282 -0.0208 0.0112  0.0078  178 VAL A N     
1460 C CA    . VAL A 178 ? 0.6396 0.5348 0.5045 -0.0136 0.0112  0.0068  178 VAL A CA    
1461 C C     . VAL A 178 ? 0.6464 0.5341 0.5070 -0.0086 0.0106  0.0070  178 VAL A C     
1462 O O     . VAL A 178 ? 0.6604 0.5352 0.5123 -0.0063 0.0109  0.0063  178 VAL A O     
1463 C CB    . VAL A 178 ? 0.6126 0.5086 0.4810 -0.0098 0.0125  0.0046  178 VAL A CB    
1464 C CG1   . VAL A 178 ? 0.5913 0.4953 0.4699 -0.0028 0.0124  0.0035  178 VAL A CG1   
1465 C CG2   . VAL A 178 ? 0.5941 0.4968 0.4657 -0.0148 0.0125  0.0047  178 VAL A CG2   
1466 N N     . PRO A 179 ? 0.6421 0.5369 0.5081 -0.0068 0.0095  0.0079  179 PRO A N     
1467 C CA    . PRO A 179 ? 0.6301 0.5177 0.4909 -0.0030 0.0080  0.0086  179 PRO A CA    
1468 C C     . PRO A 179 ? 0.6355 0.5154 0.4946 0.0041  0.0074  0.0073  179 PRO A C     
1469 O O     . PRO A 179 ? 0.6477 0.5348 0.5159 0.0084  0.0079  0.0055  179 PRO A O     
1470 C CB    . PRO A 179 ? 0.6254 0.5248 0.4954 -0.0009 0.0071  0.0088  179 PRO A CB    
1471 C CG    . PRO A 179 ? 0.6345 0.5447 0.5110 -0.0062 0.0086  0.0092  179 PRO A CG    
1472 C CD    . PRO A 179 ? 0.6227 0.5321 0.4994 -0.0082 0.0095  0.0083  179 PRO A CD    
1473 N N     . SER A 180 ? 0.6174 0.4826 0.4650 0.0053  0.0067  0.0081  180 SER A N     
1474 C CA    . SER A 180 ? 0.6458 0.5024 0.4914 0.0125  0.0063  0.0068  180 SER A CA    
1475 C C     . SER A 180 ? 0.6383 0.5037 0.4949 0.0203  0.0041  0.0061  180 SER A C     
1476 O O     . SER A 180 ? 0.6292 0.4947 0.4909 0.0264  0.0046  0.0043  180 SER A O     
1477 C CB    . SER A 180 ? 0.7090 0.5469 0.5393 0.0127  0.0053  0.0083  180 SER A CB    
1478 O OG    . SER A 180 ? 0.6971 0.5324 0.5221 0.0110  0.0030  0.0107  180 SER A OG    
1479 N N     . GLU A 181 ? 0.6088 0.4820 0.4694 0.0198  0.0019  0.0074  181 GLU A N     
1480 C CA    . GLU A 181 ? 0.6155 0.4963 0.4851 0.0263  -0.0010 0.0070  181 GLU A CA    
1481 C C     . GLU A 181 ? 0.5772 0.4723 0.4614 0.0284  0.0004  0.0046  181 GLU A C     
1482 O O     . GLU A 181 ? 0.6078 0.5099 0.5005 0.0336  -0.0018 0.0039  181 GLU A O     
1483 C CB    . GLU A 181 ? 0.6284 0.5114 0.4957 0.0245  -0.0038 0.0088  181 GLU A CB    
1484 C CG    . GLU A 181 ? 0.6522 0.5469 0.5252 0.0191  -0.0019 0.0086  181 GLU A CG    
1485 C CD    . GLU A 181 ? 0.6922 0.5826 0.5570 0.0115  0.0006  0.0100  181 GLU A CD    
1486 O OE1   . GLU A 181 ? 0.6649 0.5433 0.5194 0.0095  0.0012  0.0108  181 GLU A OE1   
1487 O OE2   . GLU A 181 ? 0.6960 0.5953 0.5652 0.0075  0.0020  0.0101  181 GLU A OE2   
1488 N N     . ILE A 182 ? 0.5210 0.4203 0.4075 0.0240  0.0039  0.0035  182 ILE A N     
1489 C CA    . ILE A 182 ? 0.5061 0.4169 0.4043 0.0253  0.0057  0.0014  182 ILE A CA    
1490 C C     . ILE A 182 ? 0.5043 0.4107 0.4015 0.0260  0.0092  -0.0006 182 ILE A C     
1491 O O     . ILE A 182 ? 0.5310 0.4454 0.4371 0.0276  0.0112  -0.0025 182 ILE A O     
1492 C CB    . ILE A 182 ? 0.4997 0.4211 0.4031 0.0199  0.0066  0.0017  182 ILE A CB    
1493 C CG1   . ILE A 182 ? 0.4943 0.4122 0.3918 0.0136  0.0088  0.0022  182 ILE A CG1   
1494 C CG2   . ILE A 182 ? 0.4950 0.4202 0.3987 0.0190  0.0040  0.0032  182 ILE A CG2   
1495 C CD1   . ILE A 182 ? 0.4805 0.4090 0.3851 0.0100  0.0099  0.0021  182 ILE A CD1   
1496 N N     . ILE A 183 ? 0.5143 0.4074 0.4000 0.0244  0.0103  -0.0002 183 ILE A N     
1497 C CA    . ILE A 183 ? 0.5660 0.4525 0.4481 0.0245  0.0140  -0.0022 183 ILE A CA    
1498 C C     . ILE A 183 ? 0.5919 0.4819 0.4828 0.0319  0.0157  -0.0048 183 ILE A C     
1499 O O     . ILE A 183 ? 0.5959 0.4892 0.4905 0.0314  0.0195  -0.0070 183 ILE A O     
1500 C CB    . ILE A 183 ? 0.5962 0.4650 0.4629 0.0225  0.0144  -0.0015 183 ILE A CB    
1501 C CG1   . ILE A 183 ? 0.6081 0.4750 0.4672 0.0133  0.0141  0.0003  183 ILE A CG1   
1502 C CG2   . ILE A 183 ? 0.5738 0.4331 0.4362 0.0253  0.0183  -0.0041 183 ILE A CG2   
1503 C CD1   . ILE A 183 ? 0.6034 0.4750 0.4636 0.0077  0.0164  -0.0007 183 ILE A CD1   
1504 N N     . ASP A 184 ? 0.6020 0.4919 0.4967 0.0386  0.0129  -0.0043 184 ASP A N     
1505 C CA    . ASP A 184 ? 0.5934 0.4882 0.4984 0.0463  0.0140  -0.0065 184 ASP A CA    
1506 C C     . ASP A 184 ? 0.5512 0.4633 0.4709 0.0464  0.0143  -0.0077 184 ASP A C     
1507 O O     . ASP A 184 ? 0.5420 0.4607 0.4719 0.0514  0.0162  -0.0100 184 ASP A O     
1508 C CB    . ASP A 184 ? 0.6378 0.5276 0.5425 0.0535  0.0097  -0.0051 184 ASP A CB    
1509 C CG    . ASP A 184 ? 0.7279 0.5989 0.6195 0.0560  0.0106  -0.0048 184 ASP A CG    
1510 O OD1   . ASP A 184 ? 0.8013 0.6646 0.6869 0.0542  0.0155  -0.0067 184 ASP A OD1   
1511 O OD2   . ASP A 184 ? 0.7729 0.6357 0.6590 0.0597  0.0064  -0.0027 184 ASP A OD2   
1512 N N     . LYS A 185 ? 0.5249 0.4442 0.4457 0.0407  0.0128  -0.0064 185 LYS A N     
1513 C CA    . LYS A 185 ? 0.4913 0.4255 0.4244 0.0401  0.0126  -0.0073 185 LYS A CA    
1514 C C     . LYS A 185 ? 0.4698 0.4080 0.4040 0.0349  0.0168  -0.0086 185 LYS A C     
1515 O O     . LYS A 185 ? 0.4304 0.3795 0.3732 0.0334  0.0170  -0.0093 185 LYS A O     
1516 C CB    . LYS A 185 ? 0.4668 0.4060 0.4007 0.0381  0.0081  -0.0051 185 LYS A CB    
1517 C CG    . LYS A 185 ? 0.5093 0.4436 0.4404 0.0426  0.0034  -0.0035 185 LYS A CG    
1518 C CD    . LYS A 185 ? 0.4680 0.4070 0.3993 0.0406  -0.0006 -0.0018 185 LYS A CD    
1519 C CE    . LYS A 185 ? 0.5268 0.4605 0.4546 0.0452  -0.0057 -0.0002 185 LYS A CE    
1520 N NZ    . LYS A 185 ? 0.5386 0.4776 0.4673 0.0435  -0.0096 0.0010  185 LYS A NZ    
1521 N N     . ILE A 186 ? 0.4757 0.4043 0.4004 0.0319  0.0197  -0.0089 186 ILE A N     
1522 C CA    . ILE A 186 ? 0.4899 0.4202 0.4131 0.0265  0.0230  -0.0098 186 ILE A CA    
1523 C C     . ILE A 186 ? 0.4858 0.4168 0.4128 0.0288  0.0281  -0.0129 186 ILE A C     
1524 O O     . ILE A 186 ? 0.4874 0.4100 0.4103 0.0323  0.0307  -0.0145 186 ILE A O     
1525 C CB    . ILE A 186 ? 0.4828 0.4033 0.3932 0.0203  0.0229  -0.0082 186 ILE A CB    
1526 C CG1   . ILE A 186 ? 0.4873 0.4104 0.3965 0.0172  0.0188  -0.0053 186 ILE A CG1   
1527 C CG2   . ILE A 186 ? 0.4720 0.3933 0.3801 0.0151  0.0257  -0.0090 186 ILE A CG2   
1528 C CD1   . ILE A 186 ? 0.4790 0.3929 0.3766 0.0116  0.0182  -0.0036 186 ILE A CD1   
1529 N N     . ILE A 187 ? 0.4827 0.4232 0.4169 0.0267  0.0299  -0.0139 187 ILE A N     
1530 C CA    . ILE A 187 ? 0.4660 0.4076 0.4030 0.0273  0.0355  -0.0169 187 ILE A CA    
1531 C C     . ILE A 187 ? 0.4903 0.4285 0.4192 0.0201  0.0374  -0.0165 187 ILE A C     
1532 O O     . ILE A 187 ? 0.4833 0.4282 0.4152 0.0164  0.0356  -0.0152 187 ILE A O     
1533 C CB    . ILE A 187 ? 0.4780 0.4332 0.4301 0.0307  0.0363  -0.0185 187 ILE A CB    
1534 C CG1   . ILE A 187 ? 0.4775 0.4355 0.4371 0.0381  0.0334  -0.0186 187 ILE A CG1   
1535 C CG2   . ILE A 187 ? 0.4795 0.4362 0.4342 0.0302  0.0431  -0.0218 187 ILE A CG2   
1536 C CD1   . ILE A 187 ? 0.4544 0.4268 0.4298 0.0414  0.0329  -0.0199 187 ILE A CD1   
1537 N N     . TYR A 188 ? 0.4728 0.3992 0.3905 0.0183  0.0406  -0.0176 188 TYR A N     
1538 C CA    . TYR A 188 ? 0.4623 0.3827 0.3694 0.0112  0.0411  -0.0167 188 TYR A CA    
1539 C C     . TYR A 188 ? 0.4871 0.4065 0.3926 0.0092  0.0470  -0.0194 188 TYR A C     
1540 O O     . TYR A 188 ? 0.5063 0.4209 0.4107 0.0126  0.0522  -0.0224 188 TYR A O     
1541 C CB    . TYR A 188 ? 0.4802 0.3867 0.3735 0.0090  0.0403  -0.0160 188 TYR A CB    
1542 C CG    . TYR A 188 ? 0.4761 0.3754 0.3573 0.0013  0.0405  -0.0152 188 TYR A CG    
1543 C CD1   . TYR A 188 ? 0.4111 0.3154 0.2923 -0.0039 0.0359  -0.0121 188 TYR A CD1   
1544 C CD2   . TYR A 188 ? 0.5314 0.4186 0.4011 -0.0006 0.0452  -0.0176 188 TYR A CD2   
1545 C CE1   . TYR A 188 ? 0.4323 0.3306 0.3030 -0.0108 0.0351  -0.0111 188 TYR A CE1   
1546 C CE2   . TYR A 188 ? 0.5097 0.3896 0.3671 -0.0082 0.0446  -0.0168 188 TYR A CE2   
1547 C CZ    . TYR A 188 ? 0.4904 0.3764 0.3488 -0.0133 0.0391  -0.0134 188 TYR A CZ    
1548 O OH    . TYR A 188 ? 0.4648 0.3444 0.3117 -0.0207 0.0376  -0.0122 188 TYR A OH    
1549 N N     . MET A 189 ? 0.4770 0.4000 0.3815 0.0040  0.0463  -0.0182 189 MET A N     
1550 C CA    . MET A 189 ? 0.5112 0.4329 0.4130 0.0011  0.0517  -0.0204 189 MET A CA    
1551 C C     . MET A 189 ? 0.5141 0.4287 0.4033 -0.0064 0.0500  -0.0184 189 MET A C     
1552 O O     . MET A 189 ? 0.5478 0.4679 0.4394 -0.0093 0.0456  -0.0156 189 MET A O     
1553 C CB    . MET A 189 ? 0.5174 0.4519 0.4324 0.0025  0.0529  -0.0211 189 MET A CB    
1554 C CG    . MET A 189 ? 0.5264 0.4697 0.4552 0.0097  0.0543  -0.0231 189 MET A CG    
1555 S SD    . MET A 189 ? 0.5680 0.5276 0.5129 0.0107  0.0520  -0.0227 189 MET A SD    
1556 C CE    . MET A 189 ? 0.5250 0.4854 0.4680 0.0093  0.0437  -0.0184 189 MET A CE    
1557 N N     . PRO A 190 ? 0.5158 0.4174 0.3910 -0.0095 0.0530  -0.0197 190 PRO A N     
1558 C CA    . PRO A 190 ? 0.5183 0.4122 0.3803 -0.0171 0.0512  -0.0180 190 PRO A CA    
1559 C C     . PRO A 190 ? 0.5475 0.4411 0.4068 -0.0203 0.0559  -0.0194 190 PRO A C     
1560 O O     . PRO A 190 ? 0.5565 0.4517 0.4203 -0.0172 0.0626  -0.0229 190 PRO A O     
1561 C CB    . PRO A 190 ? 0.5563 0.4355 0.4038 -0.0190 0.0528  -0.0193 190 PRO A CB    
1562 C CG    . PRO A 190 ? 0.5572 0.4348 0.4093 -0.0122 0.0589  -0.0231 190 PRO A CG    
1563 C CD    . PRO A 190 ? 0.5228 0.4155 0.3935 -0.0058 0.0579  -0.0229 190 PRO A CD    
1564 N N     . PHE A 191 ? 0.5457 0.4371 0.3976 -0.0264 0.0523  -0.0167 191 PHE A N     
1565 C CA    . PHE A 191 ? 0.5463 0.4362 0.3941 -0.0301 0.0560  -0.0175 191 PHE A CA    
1566 C C     . PHE A 191 ? 0.5849 0.4620 0.4141 -0.0377 0.0545  -0.0161 191 PHE A C     
1567 O O     . PHE A 191 ? 0.5723 0.4470 0.3963 -0.0409 0.0475  -0.0127 191 PHE A O     
1568 C CB    . PHE A 191 ? 0.5333 0.4350 0.3927 -0.0294 0.0527  -0.0152 191 PHE A CB    
1569 C CG    . PHE A 191 ? 0.5270 0.4408 0.4033 -0.0231 0.0551  -0.0171 191 PHE A CG    
1570 C CD1   . PHE A 191 ? 0.4875 0.4089 0.3742 -0.0184 0.0505  -0.0158 191 PHE A CD1   
1571 C CD2   . PHE A 191 ? 0.5291 0.4465 0.4105 -0.0223 0.0620  -0.0203 191 PHE A CD2   
1572 C CE1   . PHE A 191 ? 0.5103 0.4423 0.4115 -0.0129 0.0519  -0.0174 191 PHE A CE1   
1573 C CE2   . PHE A 191 ? 0.5135 0.4430 0.4112 -0.0168 0.0635  -0.0220 191 PHE A CE2   
1574 C CZ    . PHE A 191 ? 0.4987 0.4352 0.4059 -0.0121 0.0581  -0.0205 191 PHE A CZ    
1575 N N     . ASP A 192 ? 0.6455 0.5145 0.4648 -0.0410 0.0612  -0.0187 192 ASP A N     
1576 C CA    . ASP A 192 ? 0.7018 0.5571 0.5014 -0.0488 0.0601  -0.0175 192 ASP A CA    
1577 C C     . ASP A 192 ? 0.6682 0.5260 0.4662 -0.0530 0.0532  -0.0129 192 ASP A C     
1578 O O     . ASP A 192 ? 0.6807 0.5303 0.4656 -0.0587 0.0476  -0.0101 192 ASP A O     
1579 C CB    . ASP A 192 ? 0.7684 0.6141 0.5574 -0.0513 0.0700  -0.0218 192 ASP A CB    
1580 C CG    . ASP A 192 ? 0.8879 0.7268 0.6738 -0.0479 0.0768  -0.0263 192 ASP A CG    
1581 O OD1   . ASP A 192 ? 0.9329 0.7628 0.7090 -0.0494 0.0735  -0.0257 192 ASP A OD1   
1582 O OD2   . ASP A 192 ? 0.9391 0.7816 0.7325 -0.0438 0.0855  -0.0304 192 ASP A OD2   
1583 N N     . ASN A 193 ? 0.6178 0.4864 0.4287 -0.0503 0.0533  -0.0122 193 ASN A N     
1584 C CA    . ASN A 193 ? 0.6051 0.4753 0.4148 -0.0534 0.0474  -0.0080 193 ASN A CA    
1585 C C     . ASN A 193 ? 0.5647 0.4491 0.3925 -0.0484 0.0448  -0.0066 193 ASN A C     
1586 O O     . ASN A 193 ? 0.5420 0.4350 0.3826 -0.0434 0.0491  -0.0094 193 ASN A O     
1587 C CB    . ASN A 193 ? 0.6261 0.4865 0.4223 -0.0591 0.0522  -0.0088 193 ASN A CB    
1588 C CG    . ASN A 193 ? 0.6690 0.5345 0.4733 -0.0569 0.0616  -0.0130 193 ASN A CG    
1589 O OD1   . ASN A 193 ? 0.6567 0.5298 0.4701 -0.0559 0.0614  -0.0121 193 ASN A OD1   
1590 N ND2   . ASN A 193 ? 0.7193 0.5807 0.5207 -0.0560 0.0699  -0.0176 193 ASN A ND2   
1591 N N     . GLU A 194 ? 0.5803 0.4669 0.4089 -0.0496 0.0375  -0.0022 194 GLU A N     
1592 C CA    . GLU A 194 ? 0.5421 0.4404 0.3859 -0.0453 0.0344  -0.0006 194 GLU A CA    
1593 C C     . GLU A 194 ? 0.5537 0.4562 0.4041 -0.0442 0.0403  -0.0030 194 GLU A C     
1594 O O     . GLU A 194 ? 0.5317 0.4447 0.3965 -0.0395 0.0406  -0.0039 194 GLU A O     
1595 C CB    . GLU A 194 ? 0.5421 0.4399 0.3837 -0.0470 0.0260  0.0045  194 GLU A CB    
1596 C CG    . GLU A 194 ? 0.5111 0.4204 0.3682 -0.0419 0.0224  0.0062  194 GLU A CG    
1597 C CD    . GLU A 194 ? 0.5618 0.4703 0.4174 -0.0428 0.0152  0.0110  194 GLU A CD    
1598 O OE1   . GLU A 194 ? 0.5747 0.4914 0.4419 -0.0386 0.0125  0.0123  194 GLU A OE1   
1599 O OE2   . GLU A 194 ? 0.6134 0.5127 0.4561 -0.0475 0.0121  0.0134  194 GLU A OE2   
1600 N N     . LYS A 195 ? 0.5811 0.4751 0.4205 -0.0490 0.0449  -0.0040 195 LYS A N     
1601 C CA    . LYS A 195 ? 0.5907 0.4885 0.4356 -0.0493 0.0508  -0.0062 195 LYS A CA    
1602 C C     . LYS A 195 ? 0.5717 0.4790 0.4298 -0.0447 0.0570  -0.0107 195 LYS A C     
1603 O O     . LYS A 195 ? 0.5444 0.4620 0.4161 -0.0415 0.0572  -0.0114 195 LYS A O     
1604 C CB    . LYS A 195 ? 0.6299 0.5159 0.4591 -0.0560 0.0556  -0.0068 195 LYS A CB    
1605 C CG    . LYS A 195 ? 0.7135 0.5912 0.5318 -0.0602 0.0494  -0.0020 195 LYS A CG    
1606 C CD    . LYS A 195 ? 0.7579 0.6241 0.5611 -0.0670 0.0550  -0.0028 195 LYS A CD    
1607 C CE    . LYS A 195 ? 0.8250 0.6804 0.6144 -0.0712 0.0479  0.0024  195 LYS A CE    
1608 N NZ    . LYS A 195 ? 0.8709 0.7175 0.6472 -0.0736 0.0422  0.0049  195 LYS A NZ    
1609 N N     . GLU A 196 ? 0.5795 0.4829 0.4334 -0.0442 0.0615  -0.0136 196 GLU A N     
1610 C CA    . GLU A 196 ? 0.5963 0.5083 0.4628 -0.0391 0.0671  -0.0177 196 GLU A CA    
1611 C C     . GLU A 196 ? 0.5493 0.4718 0.4300 -0.0328 0.0616  -0.0167 196 GLU A C     
1612 O O     . GLU A 196 ? 0.5630 0.4961 0.4578 -0.0286 0.0637  -0.0187 196 GLU A O     
1613 C CB    . GLU A 196 ? 0.6253 0.5293 0.4833 -0.0395 0.0738  -0.0213 196 GLU A CB    
1614 C CG    . GLU A 196 ? 0.7479 0.6454 0.5992 -0.0381 0.0700  -0.0205 196 GLU A CG    
1615 C CD    . GLU A 196 ? 0.8283 0.7172 0.6716 -0.0378 0.0777  -0.0247 196 GLU A CD    
1616 O OE1   . GLU A 196 ? 0.7944 0.6819 0.6389 -0.0339 0.0765  -0.0254 196 GLU A OE1   
1617 O OE2   . GLU A 196 ? 0.8624 0.7452 0.6977 -0.0415 0.0852  -0.0273 196 GLU A OE2   
1618 N N     . LEU A 197 ? 0.4891 0.4088 0.3659 -0.0325 0.0544  -0.0134 197 LEU A N     
1619 C CA    . LEU A 197 ? 0.4861 0.4146 0.3744 -0.0275 0.0491  -0.0119 197 LEU A CA    
1620 C C     . LEU A 197 ? 0.4691 0.4072 0.3690 -0.0258 0.0473  -0.0111 197 LEU A C     
1621 O O     . LEU A 197 ? 0.4394 0.3867 0.3516 -0.0212 0.0475  -0.0125 197 LEU A O     
1622 C CB    . LEU A 197 ? 0.4646 0.3888 0.3464 -0.0288 0.0420  -0.0083 197 LEU A CB    
1623 C CG    . LEU A 197 ? 0.4649 0.3966 0.3563 -0.0244 0.0368  -0.0067 197 LEU A CG    
1624 C CD1   . LEU A 197 ? 0.4357 0.3620 0.3194 -0.0264 0.0321  -0.0043 197 LEU A CD1   
1625 C CD2   . LEU A 197 ? 0.4400 0.3795 0.3403 -0.0230 0.0330  -0.0044 197 LEU A CD2   
1626 N N     . LEU A 198 ? 0.4653 0.4004 0.3603 -0.0295 0.0455  -0.0088 198 LEU A N     
1627 C CA    . LEU A 198 ? 0.4773 0.4193 0.3811 -0.0285 0.0436  -0.0079 198 LEU A CA    
1628 C C     . LEU A 198 ? 0.4949 0.4425 0.4060 -0.0286 0.0498  -0.0115 198 LEU A C     
1629 O O     . LEU A 198 ? 0.5054 0.4618 0.4277 -0.0261 0.0489  -0.0121 198 LEU A O     
1630 C CB    . LEU A 198 ? 0.4721 0.4080 0.3680 -0.0320 0.0395  -0.0042 198 LEU A CB    
1631 C CG    . LEU A 198 ? 0.4523 0.3858 0.3447 -0.0313 0.0323  -0.0004 198 LEU A CG    
1632 C CD1   . LEU A 198 ? 0.3849 0.3113 0.2685 -0.0347 0.0285  0.0033  198 LEU A CD1   
1633 C CD2   . LEU A 198 ? 0.4200 0.3628 0.3244 -0.0262 0.0285  0.0004  198 LEU A CD2   
1634 N N     . MET A 199 ? 0.5209 0.4639 0.4258 -0.0318 0.0563  -0.0139 199 MET A N     
1635 C CA    . MET A 199 ? 0.5437 0.4931 0.4565 -0.0324 0.0630  -0.0175 199 MET A CA    
1636 C C     . MET A 199 ? 0.5291 0.4894 0.4563 -0.0264 0.0642  -0.0202 199 MET A C     
1637 O O     . MET A 199 ? 0.5227 0.4932 0.4623 -0.0249 0.0649  -0.0217 199 MET A O     
1638 C CB    . MET A 199 ? 0.5808 0.5223 0.4831 -0.0374 0.0705  -0.0197 199 MET A CB    
1639 C CG    . MET A 199 ? 0.6106 0.5423 0.4999 -0.0441 0.0702  -0.0173 199 MET A CG    
1640 S SD    . MET A 199 ? 0.7137 0.6357 0.5897 -0.0509 0.0800  -0.0201 199 MET A SD    
1641 C CE    . MET A 199 ? 0.6759 0.5860 0.5370 -0.0510 0.0793  -0.0197 199 MET A CE    
1642 N N     . GLU A 200 ? 0.5269 0.4843 0.4517 -0.0231 0.0639  -0.0207 200 GLU A N     
1643 C CA    . GLU A 200 ? 0.5401 0.5058 0.4769 -0.0168 0.0640  -0.0227 200 GLU A CA    
1644 C C     . GLU A 200 ? 0.5103 0.4835 0.4562 -0.0133 0.0570  -0.0206 200 GLU A C     
1645 O O     . GLU A 200 ? 0.5131 0.4961 0.4715 -0.0095 0.0569  -0.0222 200 GLU A O     
1646 C CB    . GLU A 200 ? 0.5598 0.5181 0.4897 -0.0144 0.0652  -0.0235 200 GLU A CB    
1647 C CG    . GLU A 200 ? 0.6339 0.5988 0.5748 -0.0074 0.0654  -0.0255 200 GLU A CG    
1648 C CD    . GLU A 200 ? 0.7420 0.7180 0.6969 -0.0049 0.0707  -0.0290 200 GLU A CD    
1649 O OE1   . GLU A 200 ? 0.7261 0.7009 0.6790 -0.0080 0.0780  -0.0315 200 GLU A OE1   
1650 O OE2   . GLU A 200 ? 0.7483 0.7344 0.7162 -0.0001 0.0676  -0.0291 200 GLU A OE2   
1651 N N     . TYR A 201 ? 0.4668 0.4354 0.4063 -0.0147 0.0513  -0.0171 201 TYR A N     
1652 C CA    . TYR A 201 ? 0.4606 0.4353 0.4073 -0.0119 0.0454  -0.0152 201 TYR A CA    
1653 C C     . TYR A 201 ? 0.4587 0.4408 0.4138 -0.0128 0.0457  -0.0160 201 TYR A C     
1654 O O     . TYR A 201 ? 0.4302 0.4202 0.3950 -0.0095 0.0434  -0.0166 201 TYR A O     
1655 C CB    . TYR A 201 ? 0.4491 0.4180 0.3881 -0.0133 0.0401  -0.0114 201 TYR A CB    
1656 C CG    . TYR A 201 ? 0.4408 0.4150 0.3864 -0.0101 0.0349  -0.0098 201 TYR A CG    
1657 C CD1   . TYR A 201 ? 0.4373 0.4153 0.3881 -0.0058 0.0333  -0.0104 201 TYR A CD1   
1658 C CD2   . TYR A 201 ? 0.4395 0.4141 0.3852 -0.0115 0.0320  -0.0077 201 TYR A CD2   
1659 C CE1   . TYR A 201 ? 0.3933 0.3755 0.3488 -0.0034 0.0291  -0.0090 201 TYR A CE1   
1660 C CE2   . TYR A 201 ? 0.4218 0.4007 0.3729 -0.0086 0.0281  -0.0066 201 TYR A CE2   
1661 C CZ    . TYR A 201 ? 0.3898 0.3725 0.3455 -0.0048 0.0268  -0.0073 201 TYR A CZ    
1662 O OH    . TYR A 201 ? 0.3613 0.3473 0.3209 -0.0025 0.0235  -0.0063 201 TYR A OH    
1663 N N     . LEU A 202 ? 0.4534 0.4320 0.4036 -0.0177 0.0484  -0.0159 202 LEU A N     
1664 C CA    . LEU A 202 ? 0.4502 0.4344 0.4069 -0.0198 0.0493  -0.0169 202 LEU A CA    
1665 C C     . LEU A 202 ? 0.4490 0.4437 0.4180 -0.0181 0.0530  -0.0205 202 LEU A C     
1666 O O     . LEU A 202 ? 0.4346 0.4374 0.4130 -0.0171 0.0509  -0.0211 202 LEU A O     
1667 C CB    . LEU A 202 ? 0.4627 0.4393 0.4101 -0.0259 0.0520  -0.0161 202 LEU A CB    
1668 C CG    . LEU A 202 ? 0.4833 0.4515 0.4214 -0.0276 0.0472  -0.0122 202 LEU A CG    
1669 C CD1   . LEU A 202 ? 0.4326 0.3922 0.3604 -0.0337 0.0504  -0.0117 202 LEU A CD1   
1670 C CD2   . LEU A 202 ? 0.4295 0.4019 0.3740 -0.0256 0.0426  -0.0111 202 LEU A CD2   
1671 N N     . ASN A 203 ? 0.4515 0.4462 0.4205 -0.0177 0.0585  -0.0228 203 ASN A N     
1672 C CA    . ASN A 203 ? 0.4671 0.4726 0.4492 -0.0151 0.0623  -0.0263 203 ASN A CA    
1673 C C     . ASN A 203 ? 0.4497 0.4623 0.4414 -0.0085 0.0574  -0.0262 203 ASN A C     
1674 O O     . ASN A 203 ? 0.4499 0.4737 0.4545 -0.0066 0.0568  -0.0278 203 ASN A O     
1675 C CB    . ASN A 203 ? 0.4764 0.4790 0.4556 -0.0153 0.0697  -0.0289 203 ASN A CB    
1676 C CG    . ASN A 203 ? 0.5070 0.5054 0.4796 -0.0222 0.0761  -0.0301 203 ASN A CG    
1677 O OD1   . ASN A 203 ? 0.5721 0.5619 0.5345 -0.0244 0.0812  -0.0309 203 ASN A OD1   
1678 N ND2   . ASN A 203 ? 0.4469 0.4504 0.4242 -0.0262 0.0761  -0.0301 203 ASN A ND2   
1679 N N     . PHE A 204 ? 0.4451 0.4510 0.4299 -0.0056 0.0535  -0.0240 204 PHE A N     
1680 C CA    . PHE A 204 ? 0.4279 0.4376 0.4184 0.0001  0.0484  -0.0233 204 PHE A CA    
1681 C C     . PHE A 204 ? 0.4040 0.4191 0.3995 -0.0004 0.0433  -0.0220 204 PHE A C     
1682 O O     . PHE A 204 ? 0.3981 0.4217 0.4036 0.0026  0.0409  -0.0230 204 PHE A O     
1683 C CB    . PHE A 204 ? 0.4068 0.4065 0.3867 0.0016  0.0460  -0.0211 204 PHE A CB    
1684 C CG    . PHE A 204 ? 0.4210 0.4218 0.4028 0.0056  0.0400  -0.0193 204 PHE A CG    
1685 C CD1   . PHE A 204 ? 0.4056 0.4083 0.3920 0.0110  0.0393  -0.0203 204 PHE A CD1   
1686 C CD2   . PHE A 204 ? 0.3968 0.3960 0.3751 0.0040  0.0354  -0.0167 204 PHE A CD2   
1687 C CE1   . PHE A 204 ? 0.4136 0.4159 0.3999 0.0142  0.0338  -0.0184 204 PHE A CE1   
1688 C CE2   . PHE A 204 ? 0.3920 0.3917 0.3711 0.0072  0.0306  -0.0152 204 PHE A CE2   
1689 C CZ    . PHE A 204 ? 0.3654 0.3664 0.3480 0.0120  0.0297  -0.0160 204 PHE A CZ    
1690 N N     . TRP A 205 ? 0.4028 0.4123 0.3907 -0.0043 0.0415  -0.0199 205 TRP A N     
1691 C CA    . TRP A 205 ? 0.4108 0.4226 0.4007 -0.0052 0.0373  -0.0187 205 TRP A CA    
1692 C C     . TRP A 205 ? 0.4525 0.4735 0.4524 -0.0070 0.0385  -0.0210 205 TRP A C     
1693 O O     . TRP A 205 ? 0.4653 0.4917 0.4710 -0.0057 0.0346  -0.0211 205 TRP A O     
1694 C CB    . TRP A 205 ? 0.4009 0.4043 0.3810 -0.0091 0.0366  -0.0164 205 TRP A CB    
1695 C CG    . TRP A 205 ? 0.3963 0.3993 0.3762 -0.0096 0.0325  -0.0149 205 TRP A CG    
1696 C CD1   . TRP A 205 ? 0.4096 0.4150 0.3924 -0.0125 0.0326  -0.0158 205 TRP A CD1   
1697 C CD2   . TRP A 205 ? 0.3873 0.3861 0.3627 -0.0075 0.0285  -0.0123 205 TRP A CD2   
1698 N NE1   . TRP A 205 ? 0.3616 0.3637 0.3415 -0.0119 0.0289  -0.0141 205 TRP A NE1   
1699 C CE2   . TRP A 205 ? 0.3819 0.3806 0.3580 -0.0087 0.0265  -0.0120 205 TRP A CE2   
1700 C CE3   . TRP A 205 ? 0.3955 0.3909 0.3668 -0.0051 0.0265  -0.0104 205 TRP A CE3   
1701 C CZ2   . TRP A 205 ? 0.3887 0.3841 0.3617 -0.0068 0.0233  -0.0100 205 TRP A CZ2   
1702 C CZ3   . TRP A 205 ? 0.3967 0.3899 0.3658 -0.0037 0.0231  -0.0083 205 TRP A CZ3   
1703 C CH2   . TRP A 205 ? 0.3652 0.3586 0.3355 -0.0043 0.0217  -0.0082 205 TRP A CH2   
1704 N N     . GLN A 206 ? 0.4785 0.5012 0.4799 -0.0105 0.0441  -0.0230 206 GLN A N     
1705 C CA    . GLN A 206 ? 0.5161 0.5486 0.5279 -0.0130 0.0461  -0.0254 206 GLN A CA    
1706 C C     . GLN A 206 ? 0.5073 0.5514 0.5324 -0.0081 0.0442  -0.0271 206 GLN A C     
1707 O O     . GLN A 206 ? 0.4990 0.5509 0.5321 -0.0087 0.0409  -0.0278 206 GLN A O     
1708 C CB    . GLN A 206 ? 0.5491 0.5812 0.5598 -0.0178 0.0535  -0.0274 206 GLN A CB    
1709 C CG    . GLN A 206 ? 0.6403 0.6821 0.6607 -0.0222 0.0559  -0.0297 206 GLN A CG    
1710 C CD    . GLN A 206 ? 0.7261 0.7663 0.7439 -0.0279 0.0640  -0.0316 206 GLN A CD    
1711 O OE1   . GLN A 206 ? 0.7496 0.7889 0.7654 -0.0343 0.0657  -0.0318 206 GLN A OE1   
1712 N NE2   . GLN A 206 ? 0.7680 0.8069 0.7846 -0.0260 0.0692  -0.0329 206 GLN A NE2   
1713 N N     . GLN A 207 ? 0.5191 0.5634 0.5459 -0.0032 0.0458  -0.0277 207 GLN A N     
1714 C CA    . GLN A 207 ? 0.5514 0.6054 0.5903 0.0026  0.0434  -0.0289 207 GLN A CA    
1715 C C     . GLN A 207 ? 0.5264 0.5795 0.5643 0.0059  0.0355  -0.0268 207 GLN A C     
1716 O O     . GLN A 207 ? 0.5536 0.6158 0.6014 0.0085  0.0317  -0.0273 207 GLN A O     
1717 C CB    . GLN A 207 ? 0.5652 0.6172 0.6045 0.0076  0.0471  -0.0300 207 GLN A CB    
1718 C CG    . GLN A 207 ? 0.7298 0.7905 0.7797 0.0075  0.0542  -0.0335 207 GLN A CG    
1719 C CD    . GLN A 207 ? 0.8144 0.8908 0.8824 0.0111  0.0518  -0.0351 207 GLN A CD    
1720 O OE1   . GLN A 207 ? 0.8419 0.9227 0.9178 0.0177  0.0521  -0.0362 207 GLN A OE1   
1721 N NE2   . GLN A 207 ? 0.8484 0.9330 0.9228 0.0066  0.0491  -0.0353 207 GLN A NE2   
1722 N N     . LYS A 208 ? 0.4888 0.5312 0.5145 0.0056  0.0332  -0.0242 208 LYS A N     
1723 C CA    . LYS A 208 ? 0.4522 0.4923 0.4752 0.0086  0.0269  -0.0222 208 LYS A CA    
1724 C C     . LYS A 208 ? 0.4396 0.4736 0.4543 0.0048  0.0248  -0.0204 208 LYS A C     
1725 O O     . LYS A 208 ? 0.4263 0.4522 0.4320 0.0054  0.0235  -0.0182 208 LYS A O     
1726 C CB    . LYS A 208 ? 0.4540 0.4871 0.4710 0.0131  0.0265  -0.0209 208 LYS A CB    
1727 C CG    . LYS A 208 ? 0.4850 0.5227 0.5097 0.0182  0.0281  -0.0226 208 LYS A CG    
1728 C CD    . LYS A 208 ? 0.5194 0.5474 0.5357 0.0216  0.0286  -0.0215 208 LYS A CD    
1729 C CE    . LYS A 208 ? 0.5315 0.5616 0.5536 0.0260  0.0326  -0.0238 208 LYS A CE    
1730 N NZ    . LYS A 208 ? 0.4918 0.5310 0.5260 0.0315  0.0291  -0.0244 208 LYS A NZ    
1731 N N     . THR A 209 ? 0.4011 0.4393 0.4193 0.0008  0.0246  -0.0213 209 THR A N     
1732 C CA    . THR A 209 ? 0.4159 0.4480 0.4268 -0.0029 0.0235  -0.0201 209 THR A CA    
1733 C C     . THR A 209 ? 0.4012 0.4307 0.4086 -0.0005 0.0182  -0.0186 209 THR A C     
1734 O O     . THR A 209 ? 0.4006 0.4357 0.4133 0.0008  0.0147  -0.0194 209 THR A O     
1735 C CB    . THR A 209 ? 0.4241 0.4602 0.4388 -0.0082 0.0250  -0.0217 209 THR A CB    
1736 O OG1   . THR A 209 ? 0.4753 0.5138 0.4928 -0.0108 0.0306  -0.0232 209 THR A OG1   
1737 C CG2   . THR A 209 ? 0.4091 0.4365 0.4147 -0.0117 0.0243  -0.0204 209 THR A CG2   
1738 N N     . PRO A 210 ? 0.4057 0.4269 0.4043 -0.0001 0.0178  -0.0165 210 PRO A N     
1739 C CA    . PRO A 210 ? 0.3992 0.4175 0.3939 0.0019  0.0139  -0.0152 210 PRO A CA    
1740 C C     . PRO A 210 ? 0.4066 0.4259 0.4019 -0.0007 0.0119  -0.0162 210 PRO A C     
1741 O O     . PRO A 210 ? 0.4125 0.4307 0.4074 -0.0045 0.0139  -0.0169 210 PRO A O     
1742 C CB    . PRO A 210 ? 0.3979 0.4084 0.3848 0.0018  0.0150  -0.0130 210 PRO A CB    
1743 C CG    . PRO A 210 ? 0.4182 0.4275 0.4043 0.0010  0.0184  -0.0128 210 PRO A CG    
1744 C CD    . PRO A 210 ? 0.3830 0.3976 0.3751 -0.0014 0.0208  -0.0151 210 PRO A CD    
1745 N N     . VAL A 211 ? 0.3644 0.3846 0.3594 0.0011  0.0080  -0.0162 211 VAL A N     
1746 C CA    . VAL A 211 ? 0.3726 0.3914 0.3652 -0.0015 0.0058  -0.0171 211 VAL A CA    
1747 C C     . VAL A 211 ? 0.3950 0.4053 0.3788 -0.0005 0.0060  -0.0156 211 VAL A C     
1748 O O     . VAL A 211 ? 0.4026 0.4077 0.3823 -0.0027 0.0076  -0.0157 211 VAL A O     
1749 C CB    . VAL A 211 ? 0.3749 0.3992 0.3714 -0.0006 0.0011  -0.0181 211 VAL A CB    
1750 C CG1   . VAL A 211 ? 0.3467 0.3667 0.3373 -0.0031 -0.0015 -0.0187 211 VAL A CG1   
1751 C CG2   . VAL A 211 ? 0.3505 0.3850 0.3580 -0.0019 0.0011  -0.0198 211 VAL A CG2   
1752 N N     . ILE A 212 ? 0.3833 0.3921 0.3644 0.0029  0.0045  -0.0143 212 ILE A N     
1753 C CA    . ILE A 212 ? 0.3813 0.3836 0.3555 0.0041  0.0055  -0.0128 212 ILE A CA    
1754 C C     . ILE A 212 ? 0.3912 0.3927 0.3656 0.0054  0.0079  -0.0110 212 ILE A C     
1755 O O     . ILE A 212 ? 0.4062 0.4102 0.3829 0.0071  0.0075  -0.0107 212 ILE A O     
1756 C CB    . ILE A 212 ? 0.3642 0.3647 0.3342 0.0061  0.0028  -0.0123 212 ILE A CB    
1757 C CG1   . ILE A 212 ? 0.3615 0.3625 0.3303 0.0044  -0.0005 -0.0140 212 ILE A CG1   
1758 C CG2   . ILE A 212 ? 0.3156 0.3104 0.2795 0.0070  0.0048  -0.0110 212 ILE A CG2   
1759 C CD1   . ILE A 212 ? 0.3612 0.3577 0.3259 0.0015  0.0007  -0.0153 212 ILE A CD1   
1760 N N     . LEU A 213 ? 0.4042 0.4019 0.3760 0.0047  0.0100  -0.0100 213 LEU A N     
1761 C CA    . LEU A 213 ? 0.4061 0.4028 0.3775 0.0053  0.0116  -0.0082 213 LEU A CA    
1762 C C     . LEU A 213 ? 0.4112 0.4051 0.3792 0.0068  0.0117  -0.0065 213 LEU A C     
1763 O O     . LEU A 213 ? 0.4368 0.4280 0.4030 0.0068  0.0124  -0.0064 213 LEU A O     
1764 C CB    . LEU A 213 ? 0.4148 0.4100 0.3865 0.0030  0.0135  -0.0080 213 LEU A CB    
1765 C CG    . LEU A 213 ? 0.4237 0.4175 0.3940 0.0029  0.0146  -0.0062 213 LEU A CG    
1766 C CD1   . LEU A 213 ? 0.3445 0.3409 0.3162 0.0038  0.0147  -0.0065 213 LEU A CD1   
1767 C CD2   . LEU A 213 ? 0.3548 0.3460 0.3239 0.0001  0.0163  -0.0060 213 LEU A CD2   
1768 N N     . THR A 214 ? 0.4035 0.3978 0.3706 0.0080  0.0114  -0.0053 214 THR A N     
1769 C CA    . THR A 214 ? 0.4079 0.4008 0.3726 0.0088  0.0118  -0.0037 214 THR A CA    
1770 C C     . THR A 214 ? 0.4070 0.4001 0.3714 0.0085  0.0120  -0.0018 214 THR A C     
1771 O O     . THR A 214 ? 0.3784 0.3716 0.3433 0.0076  0.0121  -0.0018 214 THR A O     
1772 C CB    . THR A 214 ? 0.4327 0.4246 0.3943 0.0098  0.0109  -0.0044 214 THR A CB    
1773 O OG1   . THR A 214 ? 0.4217 0.4126 0.3814 0.0102  0.0123  -0.0031 214 THR A OG1   
1774 C CG2   . THR A 214 ? 0.3804 0.3726 0.3410 0.0105  0.0090  -0.0044 214 THR A CG2   
1775 N N     . GLY A 215 ? 0.4161 0.4093 0.3795 0.0087  0.0125  -0.0004 215 GLY A N     
1776 C CA    . GLY A 215 ? 0.4278 0.4214 0.3907 0.0076  0.0124  0.0015  215 GLY A CA    
1777 C C     . GLY A 215 ? 0.4456 0.4414 0.4106 0.0078  0.0132  0.0030  215 GLY A C     
1778 O O     . GLY A 215 ? 0.5019 0.4978 0.4676 0.0092  0.0145  0.0022  215 GLY A O     
1779 N N     . TRP A 216 ? 0.4116 0.4090 0.3776 0.0064  0.0127  0.0050  216 TRP A N     
1780 C CA    . TRP A 216 ? 0.4150 0.4164 0.3850 0.0067  0.0134  0.0065  216 TRP A CA    
1781 C C     . TRP A 216 ? 0.4245 0.4274 0.3984 0.0071  0.0122  0.0081  216 TRP A C     
1782 O O     . TRP A 216 ? 0.3989 0.4015 0.3719 0.0052  0.0102  0.0096  216 TRP A O     
1783 C CB    . TRP A 216 ? 0.4121 0.4154 0.3813 0.0044  0.0133  0.0079  216 TRP A CB    
1784 C CG    . TRP A 216 ? 0.4621 0.4706 0.4362 0.0048  0.0150  0.0088  216 TRP A CG    
1785 C CD1   . TRP A 216 ? 0.4479 0.4622 0.4284 0.0043  0.0142  0.0109  216 TRP A CD1   
1786 C CD2   . TRP A 216 ? 0.4419 0.4506 0.4154 0.0058  0.0180  0.0076  216 TRP A CD2   
1787 N NE1   . TRP A 216 ? 0.4731 0.4923 0.4584 0.0053  0.0170  0.0109  216 TRP A NE1   
1788 C CE2   . TRP A 216 ? 0.4487 0.4641 0.4291 0.0060  0.0197  0.0088  216 TRP A CE2   
1789 C CE3   . TRP A 216 ? 0.4797 0.4837 0.4473 0.0063  0.0193  0.0057  216 TRP A CE3   
1790 C CZ2   . TRP A 216 ? 0.4444 0.4614 0.4256 0.0067  0.0237  0.0078  216 TRP A CZ2   
1791 C CZ3   . TRP A 216 ? 0.4921 0.4966 0.4590 0.0067  0.0226  0.0049  216 TRP A CZ3   
1792 C CH2   . TRP A 216 ? 0.4405 0.4514 0.4140 0.0068  0.0252  0.0058  216 TRP A CH2   
1793 N N     . ASN A 217 ? 0.4477 0.4511 0.4248 0.0097  0.0133  0.0078  217 ASN A N     
1794 C CA    . ASN A 217 ? 0.4556 0.4587 0.4355 0.0109  0.0120  0.0094  217 ASN A CA    
1795 C C     . ASN A 217 ? 0.4354 0.4333 0.4111 0.0097  0.0108  0.0089  217 ASN A C     
1796 O O     . ASN A 217 ? 0.4454 0.4418 0.4212 0.0095  0.0090  0.0107  217 ASN A O     
1797 C CB    . ASN A 217 ? 0.4865 0.4945 0.4707 0.0101  0.0098  0.0124  217 ASN A CB    
1798 C CG    . ASN A 217 ? 0.5452 0.5592 0.5369 0.0128  0.0113  0.0132  217 ASN A CG    
1799 O OD1   . ASN A 217 ? 0.5436 0.5564 0.5376 0.0163  0.0131  0.0124  217 ASN A OD1   
1800 N ND2   . ASN A 217 ? 0.5278 0.5481 0.5232 0.0109  0.0108  0.0146  217 ASN A ND2   
1801 N N     . VAL A 218 ? 0.4266 0.4218 0.3986 0.0087  0.0118  0.0066  218 VAL A N     
1802 C CA    . VAL A 218 ? 0.4552 0.4465 0.4240 0.0071  0.0114  0.0059  218 VAL A CA    
1803 C C     . VAL A 218 ? 0.4750 0.4626 0.4435 0.0079  0.0117  0.0060  218 VAL A C     
1804 O O     . VAL A 218 ? 0.4710 0.4551 0.4368 0.0062  0.0110  0.0067  218 VAL A O     
1805 C CB    . VAL A 218 ? 0.4468 0.4376 0.4137 0.0063  0.0124  0.0033  218 VAL A CB    
1806 C CG1   . VAL A 218 ? 0.4417 0.4340 0.4074 0.0055  0.0120  0.0035  218 VAL A CG1   
1807 C CG2   . VAL A 218 ? 0.3847 0.3757 0.3524 0.0079  0.0134  0.0013  218 VAL A CG2   
1808 N N     . GLU A 219 ? 0.5076 0.4948 0.4780 0.0104  0.0129  0.0052  219 GLU A N     
1809 C CA    . GLU A 219 ? 0.5474 0.5294 0.5166 0.0115  0.0133  0.0051  219 GLU A CA    
1810 C C     . GLU A 219 ? 0.5585 0.5393 0.5290 0.0128  0.0115  0.0083  219 GLU A C     
1811 O O     . GLU A 219 ? 0.5830 0.5580 0.5502 0.0122  0.0107  0.0091  219 GLU A O     
1812 C CB    . GLU A 219 ? 0.5685 0.5491 0.5382 0.0139  0.0155  0.0033  219 GLU A CB    
1813 C CG    . GLU A 219 ? 0.6382 0.6113 0.6049 0.0145  0.0162  0.0026  219 GLU A CG    
1814 C CD    . GLU A 219 ? 0.7008 0.6709 0.6665 0.0167  0.0186  0.0006  219 GLU A CD    
1815 O OE1   . GLU A 219 ? 0.6668 0.6313 0.6280 0.0150  0.0194  -0.0016 219 GLU A OE1   
1816 O OE2   . GLU A 219 ? 0.7394 0.7124 0.7085 0.0199  0.0200  0.0010  219 GLU A OE2   
1817 N N     . SER A 220 ? 0.5279 0.5143 0.5033 0.0145  0.0105  0.0102  220 SER A N     
1818 C CA    . SER A 220 ? 0.5177 0.5045 0.4959 0.0163  0.0079  0.0135  220 SER A CA    
1819 C C     . SER A 220 ? 0.4992 0.4863 0.4748 0.0130  0.0045  0.0158  220 SER A C     
1820 O O     . SER A 220 ? 0.5196 0.5043 0.4946 0.0134  0.0015  0.0187  220 SER A O     
1821 C CB    . SER A 220 ? 0.5129 0.5065 0.4992 0.0199  0.0085  0.0145  220 SER A CB    
1822 O OG    . SER A 220 ? 0.5108 0.5109 0.4993 0.0183  0.0094  0.0138  220 SER A OG    
1823 N N     . PHE A 221 ? 0.4316 0.4206 0.4047 0.0097  0.0049  0.0147  221 PHE A N     
1824 C CA    . PHE A 221 ? 0.4274 0.4156 0.3968 0.0063  0.0022  0.0165  221 PHE A CA    
1825 C C     . PHE A 221 ? 0.4436 0.4270 0.4059 0.0027  0.0036  0.0146  221 PHE A C     
1826 O O     . PHE A 221 ? 0.4668 0.4445 0.4236 0.0007  0.0028  0.0155  221 PHE A O     
1827 C CB    . PHE A 221 ? 0.4337 0.4286 0.4067 0.0053  0.0007  0.0179  221 PHE A CB    
1828 C CG    . PHE A 221 ? 0.4332 0.4261 0.4009 0.0012  -0.0022 0.0196  221 PHE A CG    
1829 C CD1   . PHE A 221 ? 0.4162 0.4077 0.3790 -0.0019 -0.0009 0.0179  221 PHE A CD1   
1830 C CD2   . PHE A 221 ? 0.4359 0.4271 0.4023 0.0005  -0.0063 0.0228  221 PHE A CD2   
1831 C CE1   . PHE A 221 ? 0.4131 0.4010 0.3693 -0.0060 -0.0031 0.0191  221 PHE A CE1   
1832 C CE2   . PHE A 221 ? 0.3744 0.3624 0.3340 -0.0039 -0.0092 0.0243  221 PHE A CE2   
1833 C CZ    . PHE A 221 ? 0.4117 0.3977 0.3659 -0.0073 -0.0073 0.0222  221 PHE A CZ    
1834 N N     . ALA A 222 ? 0.4196 0.4052 0.3819 0.0020  0.0058  0.0122  222 ALA A N     
1835 C CA    . ALA A 222 ? 0.4366 0.4190 0.3937 -0.0008 0.0074  0.0103  222 ALA A CA    
1836 C C     . ALA A 222 ? 0.4316 0.4094 0.3859 -0.0018 0.0092  0.0089  222 ALA A C     
1837 O O     . ALA A 222 ? 0.4229 0.3965 0.3719 -0.0047 0.0098  0.0089  222 ALA A O     
1838 C CB    . ALA A 222 ? 0.4061 0.3916 0.3649 -0.0002 0.0092  0.0080  222 ALA A CB    
1839 N N     . ILE A 223 ? 0.4303 0.4086 0.3877 0.0002  0.0104  0.0075  223 ILE A N     
1840 C CA    . ILE A 223 ? 0.4399 0.4143 0.3949 -0.0014 0.0123  0.0059  223 ILE A CA    
1841 C C     . ILE A 223 ? 0.4604 0.4281 0.4101 -0.0031 0.0112  0.0082  223 ILE A C     
1842 O O     . ILE A 223 ? 0.4892 0.4530 0.4338 -0.0066 0.0126  0.0076  223 ILE A O     
1843 C CB    . ILE A 223 ? 0.4231 0.3985 0.3813 0.0004  0.0135  0.0038  223 ILE A CB    
1844 C CG1   . ILE A 223 ? 0.4082 0.3889 0.3695 0.0009  0.0144  0.0014  223 ILE A CG1   
1845 C CG2   . ILE A 223 ? 0.4295 0.3998 0.3846 -0.0020 0.0150  0.0027  223 ILE A CG2   
1846 C CD1   . ILE A 223 ? 0.3599 0.3421 0.3237 0.0031  0.0146  0.0000  223 ILE A CD1   
1847 N N     . PRO A 224 ? 0.4553 0.4214 0.4059 -0.0006 0.0087  0.0108  224 PRO A N     
1848 C CA    . PRO A 224 ? 0.4644 0.4231 0.4092 -0.0020 0.0069  0.0134  224 PRO A CA    
1849 C C     . PRO A 224 ? 0.4763 0.4329 0.4155 -0.0051 0.0049  0.0154  224 PRO A C     
1850 O O     . PRO A 224 ? 0.4690 0.4180 0.4004 -0.0081 0.0046  0.0166  224 PRO A O     
1851 C CB    . PRO A 224 ? 0.4841 0.4430 0.4330 0.0026  0.0043  0.0158  224 PRO A CB    
1852 C CG    . PRO A 224 ? 0.4671 0.4346 0.4239 0.0055  0.0050  0.0147  224 PRO A CG    
1853 C CD    . PRO A 224 ? 0.4420 0.4121 0.3988 0.0036  0.0081  0.0112  224 PRO A CD    
1854 N N     . TYR A 225 ? 0.4458 0.4080 0.3876 -0.0051 0.0036  0.0158  225 TYR A N     
1855 C CA    . TYR A 225 ? 0.4644 0.4235 0.3994 -0.0087 0.0018  0.0174  225 TYR A CA    
1856 C C     . TYR A 225 ? 0.4488 0.4036 0.3772 -0.0126 0.0058  0.0148  225 TYR A C     
1857 O O     . TYR A 225 ? 0.4579 0.4054 0.3774 -0.0163 0.0055  0.0159  225 TYR A O     
1858 C CB    . TYR A 225 ? 0.4452 0.4101 0.3832 -0.0086 -0.0004 0.0184  225 TYR A CB    
1859 C CG    . TYR A 225 ? 0.4427 0.4032 0.3732 -0.0122 -0.0041 0.0211  225 TYR A CG    
1860 C CD1   . TYR A 225 ? 0.4644 0.4190 0.3856 -0.0167 -0.0021 0.0198  225 TYR A CD1   
1861 C CD2   . TYR A 225 ? 0.4439 0.4059 0.3763 -0.0112 -0.0095 0.0251  225 TYR A CD2   
1862 C CE1   . TYR A 225 ? 0.4295 0.3784 0.3415 -0.0206 -0.0055 0.0223  225 TYR A CE1   
1863 C CE2   . TYR A 225 ? 0.4342 0.3916 0.3588 -0.0150 -0.0138 0.0278  225 TYR A CE2   
1864 C CZ    . TYR A 225 ? 0.4671 0.4173 0.3806 -0.0200 -0.0117 0.0264  225 TYR A CZ    
1865 O OH    . TYR A 225 ? 0.5129 0.4573 0.4167 -0.0244 -0.0159 0.0289  225 TYR A OH    
1866 N N     . VAL A 226 ? 0.4227 0.3820 0.3555 -0.0119 0.0094  0.0114  226 VAL A N     
1867 C CA    . VAL A 226 ? 0.4239 0.3812 0.3533 -0.0148 0.0137  0.0085  226 VAL A CA    
1868 C C     . VAL A 226 ? 0.4343 0.3859 0.3594 -0.0173 0.0157  0.0081  226 VAL A C     
1869 O O     . VAL A 226 ? 0.4526 0.3985 0.3700 -0.0213 0.0179  0.0078  226 VAL A O     
1870 C CB    . VAL A 226 ? 0.4013 0.3656 0.3380 -0.0125 0.0163  0.0052  226 VAL A CB    
1871 C CG1   . VAL A 226 ? 0.3963 0.3604 0.3327 -0.0146 0.0209  0.0020  226 VAL A CG1   
1872 C CG2   . VAL A 226 ? 0.3824 0.3493 0.3197 -0.0116 0.0153  0.0053  226 VAL A CG2   
1873 N N     . TYR A 227 ? 0.4323 0.3844 0.3612 -0.0153 0.0152  0.0082  227 TYR A N     
1874 C CA    . TYR A 227 ? 0.4415 0.3873 0.3660 -0.0179 0.0171  0.0079  227 TYR A CA    
1875 C C     . TYR A 227 ? 0.4794 0.4152 0.3935 -0.0207 0.0150  0.0112  227 TYR A C     
1876 O O     . TYR A 227 ? 0.4807 0.4102 0.3874 -0.0252 0.0179  0.0105  227 TYR A O     
1877 C CB    . TYR A 227 ? 0.4315 0.3780 0.3608 -0.0151 0.0163  0.0076  227 TYR A CB    
1878 C CG    . TYR A 227 ? 0.4689 0.4081 0.3931 -0.0182 0.0182  0.0072  227 TYR A CG    
1879 C CD1   . TYR A 227 ? 0.4485 0.3903 0.3750 -0.0211 0.0221  0.0037  227 TYR A CD1   
1880 C CD2   . TYR A 227 ? 0.4886 0.4180 0.4057 -0.0184 0.0158  0.0104  227 TYR A CD2   
1881 C CE1   . TYR A 227 ? 0.5139 0.4486 0.4353 -0.0249 0.0241  0.0032  227 TYR A CE1   
1882 C CE2   . TYR A 227 ? 0.5068 0.4277 0.4177 -0.0216 0.0176  0.0101  227 TYR A CE2   
1883 C CZ    . TYR A 227 ? 0.5187 0.4423 0.4316 -0.0253 0.0219  0.0064  227 TYR A CZ    
1884 O OH    . TYR A 227 ? 0.5388 0.4540 0.4455 -0.0294 0.0239  0.0060  227 TYR A OH    
1885 N N     . ASN A 228 ? 0.5044 0.4390 0.4179 -0.0182 0.0101  0.0147  228 ASN A N     
1886 C CA    . ASN A 228 ? 0.5020 0.4273 0.4059 -0.0201 0.0066  0.0185  228 ASN A CA    
1887 C C     . ASN A 228 ? 0.5235 0.4448 0.4183 -0.0247 0.0067  0.0190  228 ASN A C     
1888 O O     . ASN A 228 ? 0.5196 0.4309 0.4031 -0.0286 0.0062  0.0208  228 ASN A O     
1889 C CB    . ASN A 228 ? 0.4937 0.4207 0.4020 -0.0154 0.0008  0.0222  228 ASN A CB    
1890 C CG    . ASN A 228 ? 0.5110 0.4359 0.4230 -0.0117 0.0006  0.0226  228 ASN A CG    
1891 O OD1   . ASN A 228 ? 0.5882 0.5033 0.4928 -0.0134 0.0009  0.0235  228 ASN A OD1   
1892 N ND2   . ASN A 228 ? 0.5103 0.4432 0.4327 -0.0068 0.0004  0.0217  228 ASN A ND2   
1893 N N     . ARG A 229 ? 0.5158 0.4438 0.4144 -0.0244 0.0075  0.0174  229 ARG A N     
1894 C CA    . ARG A 229 ? 0.5089 0.4325 0.3984 -0.0287 0.0082  0.0172  229 ARG A CA    
1895 C C     . ARG A 229 ? 0.5193 0.4382 0.4026 -0.0330 0.0148  0.0141  229 ARG A C     
1896 O O     . ARG A 229 ? 0.5249 0.4348 0.3960 -0.0378 0.0157  0.0148  229 ARG A O     
1897 C CB    . ARG A 229 ? 0.4922 0.4232 0.3871 -0.0272 0.0080  0.0160  229 ARG A CB    
1898 C CG    . ARG A 229 ? 0.4930 0.4185 0.3777 -0.0315 0.0086  0.0157  229 ARG A CG    
1899 C CD    . ARG A 229 ? 0.5196 0.4390 0.3957 -0.0340 0.0021  0.0201  229 ARG A CD    
1900 N NE    . ARG A 229 ? 0.5103 0.4218 0.3735 -0.0392 0.0030  0.0197  229 ARG A NE    
1901 C CZ    . ARG A 229 ? 0.5731 0.4767 0.4250 -0.0431 -0.0021 0.0232  229 ARG A CZ    
1902 N NH1   . ARG A 229 ? 0.4904 0.3937 0.3435 -0.0416 -0.0088 0.0275  229 ARG A NH1   
1903 N NH2   . ARG A 229 ? 0.5579 0.4534 0.3969 -0.0483 -0.0007 0.0222  229 ARG A NH2   
1904 N N     . ILE A 230 ? 0.5193 0.4447 0.4112 -0.0315 0.0194  0.0105  230 ILE A N     
1905 C CA    . ILE A 230 ? 0.5014 0.4249 0.3905 -0.0353 0.0260  0.0072  230 ILE A CA    
1906 C C     . ILE A 230 ? 0.5075 0.4215 0.3879 -0.0391 0.0264  0.0088  230 ILE A C     
1907 O O     . ILE A 230 ? 0.5370 0.4434 0.4071 -0.0444 0.0303  0.0081  230 ILE A O     
1908 C CB    . ILE A 230 ? 0.4772 0.4113 0.3789 -0.0327 0.0298  0.0032  230 ILE A CB    
1909 C CG1   . ILE A 230 ? 0.4277 0.3685 0.3350 -0.0297 0.0301  0.0016  230 ILE A CG1   
1910 C CG2   . ILE A 230 ? 0.4923 0.4257 0.3929 -0.0368 0.0364  0.0001  230 ILE A CG2   
1911 C CD1   . ILE A 230 ? 0.4379 0.3891 0.3578 -0.0261 0.0319  -0.0014 230 ILE A CD1   
1912 N N     . LYS A 231 ? 0.5034 0.4165 0.3867 -0.0364 0.0226  0.0110  231 LYS A N     
1913 C CA    . LYS A 231 ? 0.5367 0.4389 0.4108 -0.0394 0.0219  0.0132  231 LYS A CA    
1914 C C     . LYS A 231 ? 0.5593 0.4498 0.4185 -0.0430 0.0191  0.0168  231 LYS A C     
1915 O O     . LYS A 231 ? 0.5828 0.4633 0.4305 -0.0484 0.0220  0.0169  231 LYS A O     
1916 C CB    . LYS A 231 ? 0.5413 0.4436 0.4208 -0.0347 0.0178  0.0153  231 LYS A CB    
1917 C CG    . LYS A 231 ? 0.5952 0.4851 0.4651 -0.0375 0.0176  0.0172  231 LYS A CG    
1918 C CD    . LYS A 231 ? 0.6218 0.5107 0.4967 -0.0324 0.0140  0.0188  231 LYS A CD    
1919 C CE    . LYS A 231 ? 0.7209 0.6056 0.5934 -0.0282 0.0069  0.0238  231 LYS A CE    
1920 N NZ    . LYS A 231 ? 0.7364 0.6178 0.6122 -0.0232 0.0043  0.0254  231 LYS A NZ    
1921 N N     . ASN A 232 ? 0.5622 0.4539 0.4213 -0.0404 0.0133  0.0197  232 ASN A N     
1922 C CA    . ASN A 232 ? 0.6131 0.4943 0.4583 -0.0438 0.0092  0.0233  232 ASN A CA    
1923 C C     . ASN A 232 ? 0.6275 0.5031 0.4614 -0.0500 0.0142  0.0211  232 ASN A C     
1924 O O     . ASN A 232 ? 0.6781 0.5413 0.4966 -0.0550 0.0133  0.0234  232 ASN A O     
1925 C CB    . ASN A 232 ? 0.6121 0.4981 0.4618 -0.0399 0.0017  0.0266  232 ASN A CB    
1926 C CG    . ASN A 232 ? 0.6380 0.5258 0.4949 -0.0342 -0.0040 0.0300  232 ASN A CG    
1927 O OD1   . ASN A 232 ? 0.6634 0.5457 0.5188 -0.0336 -0.0032 0.0305  232 ASN A OD1   
1928 N ND2   . ASN A 232 ? 0.6340 0.5295 0.4989 -0.0303 -0.0095 0.0322  232 ASN A ND2   
1929 N N     . ILE A 233 ? 0.6181 0.5021 0.4591 -0.0497 0.0197  0.0168  233 ILE A N     
1930 C CA    . ILE A 233 ? 0.5900 0.4695 0.4218 -0.0547 0.0255  0.0140  233 ILE A CA    
1931 C C     . ILE A 233 ? 0.6064 0.4833 0.4355 -0.0589 0.0339  0.0106  233 ILE A C     
1932 O O     . ILE A 233 ? 0.6344 0.5014 0.4497 -0.0648 0.0380  0.0100  233 ILE A O     
1933 C CB    . ILE A 233 ? 0.5728 0.4615 0.4129 -0.0519 0.0272  0.0111  233 ILE A CB    
1934 C CG1   . ILE A 233 ? 0.5776 0.4669 0.4168 -0.0499 0.0195  0.0144  233 ILE A CG1   
1935 C CG2   . ILE A 233 ? 0.5495 0.4337 0.3813 -0.0562 0.0347  0.0074  233 ILE A CG2   
1936 C CD1   . ILE A 233 ? 0.5555 0.4544 0.4047 -0.0463 0.0201  0.0121  233 ILE A CD1   
1937 N N     . PHE A 234 ? 0.5893 0.4751 0.4313 -0.0563 0.0367  0.0083  234 PHE A N     
1938 C CA    . PHE A 234 ? 0.5805 0.4676 0.4237 -0.0602 0.0450  0.0043  234 PHE A CA    
1939 C C     . PHE A 234 ? 0.5794 0.4618 0.4208 -0.0625 0.0452  0.0055  234 PHE A C     
1940 O O     . PHE A 234 ? 0.5633 0.4423 0.4002 -0.0680 0.0516  0.0033  234 PHE A O     
1941 C CB    . PHE A 234 ? 0.5528 0.4548 0.4128 -0.0563 0.0490  -0.0001 234 PHE A CB    
1942 C CG    . PHE A 234 ? 0.5464 0.4517 0.4074 -0.0544 0.0505  -0.0019 234 PHE A CG    
1943 C CD1   . PHE A 234 ? 0.5188 0.4310 0.3881 -0.0486 0.0454  -0.0010 234 PHE A CD1   
1944 C CD2   . PHE A 234 ? 0.5478 0.4485 0.4009 -0.0585 0.0574  -0.0046 234 PHE A CD2   
1945 C CE1   . PHE A 234 ? 0.5323 0.4461 0.4015 -0.0471 0.0468  -0.0027 234 PHE A CE1   
1946 C CE2   . PHE A 234 ? 0.5361 0.4383 0.3892 -0.0566 0.0591  -0.0065 234 PHE A CE2   
1947 C CZ    . PHE A 234 ? 0.5193 0.4277 0.3802 -0.0509 0.0535  -0.0055 234 PHE A CZ    
1948 N N     . GLY A 235 ? 0.5948 0.4769 0.4396 -0.0584 0.0384  0.0087  235 GLY A N     
1949 C CA    . GLY A 235 ? 0.6108 0.4882 0.4546 -0.0597 0.0382  0.0096  235 GLY A CA    
1950 C C     . GLY A 235 ? 0.6068 0.4959 0.4666 -0.0551 0.0379  0.0074  235 GLY A C     
1951 O O     . GLY A 235 ? 0.6105 0.5118 0.4822 -0.0514 0.0387  0.0049  235 GLY A O     
1952 N N     . GLU A 236 ? 0.6381 0.5223 0.4970 -0.0555 0.0367  0.0084  236 GLU A N     
1953 C CA    . GLU A 236 ? 0.6706 0.5634 0.5422 -0.0515 0.0358  0.0067  236 GLU A CA    
1954 C C     . GLU A 236 ? 0.6714 0.5770 0.5546 -0.0529 0.0413  0.0016  236 GLU A C     
1955 O O     . GLU A 236 ? 0.6750 0.5917 0.5705 -0.0481 0.0398  0.0000  236 GLU A O     
1956 C CB    . GLU A 236 ? 0.7184 0.6007 0.5841 -0.0525 0.0341  0.0085  236 GLU A CB    
1957 C CG    . GLU A 236 ? 0.8176 0.6950 0.6824 -0.0461 0.0270  0.0126  236 GLU A CG    
1958 C CD    . GLU A 236 ? 0.9116 0.7779 0.7709 -0.0461 0.0256  0.0141  236 GLU A CD    
1959 O OE1   . GLU A 236 ? 0.9056 0.7739 0.7687 -0.0484 0.0289  0.0110  236 GLU A OE1   
1960 O OE2   . GLU A 236 ? 0.9627 0.8180 0.8138 -0.0438 0.0209  0.0184  236 GLU A OE2   
1961 N N     . SER A 237 ? 0.6586 0.5629 0.5383 -0.0596 0.0476  -0.0007 237 SER A N     
1962 C CA    . SER A 237 ? 0.6289 0.5460 0.5207 -0.0613 0.0529  -0.0054 237 SER A CA    
1963 C C     . SER A 237 ? 0.5934 0.5234 0.4964 -0.0564 0.0531  -0.0075 237 SER A C     
1964 O O     . SER A 237 ? 0.5625 0.5048 0.4788 -0.0541 0.0537  -0.0103 237 SER A O     
1965 C CB    . SER A 237 ? 0.6435 0.5573 0.5294 -0.0695 0.0603  -0.0075 237 SER A CB    
1966 O OG    . SER A 237 ? 0.6662 0.5804 0.5486 -0.0705 0.0641  -0.0084 237 SER A OG    
1967 N N     . THR A 238 ? 0.5445 0.4707 0.4413 -0.0551 0.0525  -0.0060 238 THR A N     
1968 C CA    . THR A 238 ? 0.4980 0.4336 0.4030 -0.0505 0.0526  -0.0076 238 THR A CA    
1969 C C     . THR A 238 ? 0.4820 0.4229 0.3947 -0.0437 0.0461  -0.0061 238 THR A C     
1970 O O     . THR A 238 ? 0.4946 0.4463 0.4187 -0.0400 0.0462  -0.0083 238 THR A O     
1971 C CB    . THR A 238 ? 0.5086 0.4370 0.4027 -0.0520 0.0540  -0.0066 238 THR A CB    
1972 O OG1   . THR A 238 ? 0.5368 0.4585 0.4218 -0.0589 0.0604  -0.0080 238 THR A OG1   
1973 C CG2   . THR A 238 ? 0.4747 0.4115 0.3764 -0.0480 0.0555  -0.0090 238 THR A CG2   
1974 N N     . ALA A 239 ? 0.4586 0.3919 0.3650 -0.0421 0.0407  -0.0023 239 ALA A N     
1975 C CA    . ALA A 239 ? 0.4944 0.4323 0.4077 -0.0360 0.0353  -0.0010 239 ALA A CA    
1976 C C     . ALA A 239 ? 0.4871 0.4328 0.4107 -0.0344 0.0356  -0.0034 239 ALA A C     
1977 O O     . ALA A 239 ? 0.4717 0.4254 0.4039 -0.0299 0.0336  -0.0042 239 ALA A O     
1978 C CB    . ALA A 239 ? 0.4701 0.3988 0.3761 -0.0346 0.0301  0.0033  239 ALA A CB    
1979 N N     . LYS A 240 ? 0.5068 0.4494 0.4285 -0.0389 0.0382  -0.0045 240 LYS A N     
1980 C CA    . LYS A 240 ? 0.5257 0.4743 0.4555 -0.0387 0.0383  -0.0068 240 LYS A CA    
1981 C C     . LYS A 240 ? 0.5171 0.4790 0.4587 -0.0383 0.0408  -0.0105 240 LYS A C     
1982 O O     . LYS A 240 ? 0.5514 0.5195 0.5003 -0.0381 0.0400  -0.0124 240 LYS A O     
1983 C CB    . LYS A 240 ? 0.5490 0.4893 0.4723 -0.0445 0.0402  -0.0069 240 LYS A CB    
1984 C CG    . LYS A 240 ? 0.5933 0.5201 0.5060 -0.0435 0.0368  -0.0032 240 LYS A CG    
1985 C CD    . LYS A 240 ? 0.6391 0.5558 0.5437 -0.0496 0.0390  -0.0032 240 LYS A CD    
1986 C CE    . LYS A 240 ? 0.6720 0.5759 0.5683 -0.0470 0.0349  0.0001  240 LYS A CE    
1987 N NZ    . LYS A 240 ? 0.6981 0.5916 0.5867 -0.0528 0.0369  -0.0003 240 LYS A NZ    
1988 N N     . ARG A 241 ? 0.4885 0.4543 0.4316 -0.0380 0.0435  -0.0115 241 ARG A N     
1989 C CA    . ARG A 241 ? 0.4694 0.4477 0.4242 -0.0361 0.0455  -0.0147 241 ARG A CA    
1990 C C     . ARG A 241 ? 0.4443 0.4285 0.4058 -0.0297 0.0407  -0.0142 241 ARG A C     
1991 O O     . ARG A 241 ? 0.4518 0.4459 0.4232 -0.0274 0.0408  -0.0165 241 ARG A O     
1992 C CB    . ARG A 241 ? 0.4546 0.4337 0.4081 -0.0372 0.0503  -0.0160 241 ARG A CB    
1993 C CG    . ARG A 241 ? 0.4872 0.4644 0.4376 -0.0441 0.0567  -0.0177 241 ARG A CG    
1994 C CD    . ARG A 241 ? 0.4552 0.4310 0.4019 -0.0451 0.0621  -0.0190 241 ARG A CD    
1995 N NE    . ARG A 241 ? 0.5066 0.4936 0.4650 -0.0403 0.0634  -0.0216 241 ARG A NE    
1996 C CZ    . ARG A 241 ? 0.4956 0.4811 0.4515 -0.0383 0.0663  -0.0224 241 ARG A CZ    
1997 N NH1   . ARG A 241 ? 0.5179 0.4916 0.4597 -0.0412 0.0680  -0.0209 241 ARG A NH1   
1998 N NH2   . ARG A 241 ? 0.4193 0.4144 0.3863 -0.0334 0.0672  -0.0247 241 ARG A NH2   
1999 N N     . LEU A 242 ? 0.4281 0.4061 0.3841 -0.0269 0.0366  -0.0113 242 LEU A N     
2000 C CA    . LEU A 242 ? 0.4323 0.4144 0.3931 -0.0216 0.0324  -0.0107 242 LEU A CA    
2001 C C     . LEU A 242 ? 0.4189 0.4047 0.3848 -0.0216 0.0307  -0.0121 242 LEU A C     
2002 O O     . LEU A 242 ? 0.4166 0.4072 0.3873 -0.0180 0.0280  -0.0125 242 LEU A O     
2003 C CB    . LEU A 242 ? 0.4155 0.3906 0.3697 -0.0191 0.0291  -0.0073 242 LEU A CB    
2004 C CG    . LEU A 242 ? 0.4210 0.3932 0.3703 -0.0190 0.0295  -0.0059 242 LEU A CG    
2005 C CD1   . LEU A 242 ? 0.4425 0.4080 0.3855 -0.0178 0.0259  -0.0022 242 LEU A CD1   
2006 C CD2   . LEU A 242 ? 0.4385 0.4171 0.3931 -0.0156 0.0294  -0.0071 242 LEU A CD2   
2007 N N     . SER A 243 ? 0.4274 0.4099 0.3910 -0.0262 0.0323  -0.0129 243 SER A N     
2008 C CA    . SER A 243 ? 0.4542 0.4399 0.4220 -0.0275 0.0310  -0.0147 243 SER A CA    
2009 C C     . SER A 243 ? 0.4744 0.4694 0.4504 -0.0312 0.0338  -0.0178 243 SER A C     
2010 O O     . SER A 243 ? 0.5151 0.5087 0.4892 -0.0358 0.0380  -0.0184 243 SER A O     
2011 C CB    . SER A 243 ? 0.4399 0.4151 0.3996 -0.0304 0.0307  -0.0136 243 SER A CB    
2012 O OG    . SER A 243 ? 0.4032 0.3809 0.3658 -0.0343 0.0309  -0.0160 243 SER A OG    
2013 N N     . PRO A 244 ? 0.4547 0.4593 0.4396 -0.0293 0.0315  -0.0196 244 PRO A N     
2014 C CA    . PRO A 244 ? 0.4588 0.4746 0.4540 -0.0322 0.0334  -0.0225 244 PRO A CA    
2015 C C     . PRO A 244 ? 0.4692 0.4835 0.4632 -0.0396 0.0358  -0.0239 244 PRO A C     
2016 O O     . PRO A 244 ? 0.4813 0.5048 0.4836 -0.0431 0.0387  -0.0263 244 PRO A O     
2017 C CB    . PRO A 244 ? 0.4362 0.4599 0.4388 -0.0286 0.0286  -0.0234 244 PRO A CB    
2018 C CG    . PRO A 244 ? 0.4644 0.4791 0.4586 -0.0260 0.0249  -0.0214 244 PRO A CG    
2019 C CD    . PRO A 244 ? 0.4557 0.4612 0.4416 -0.0245 0.0268  -0.0190 244 PRO A CD    
2020 N N     . HIS A 245 ? 0.4726 0.4754 0.4566 -0.0418 0.0347  -0.0226 245 HIS A N     
2021 C CA    . HIS A 245 ? 0.4689 0.4673 0.4492 -0.0493 0.0370  -0.0236 245 HIS A CA    
2022 C C     . HIS A 245 ? 0.4995 0.4853 0.4682 -0.0521 0.0405  -0.0216 245 HIS A C     
2023 O O     . HIS A 245 ? 0.5048 0.4832 0.4672 -0.0582 0.0424  -0.0219 245 HIS A O     
2024 C CB    . HIS A 245 ? 0.4472 0.4400 0.4233 -0.0504 0.0332  -0.0238 245 HIS A CB    
2025 C CG    . HIS A 245 ? 0.4058 0.4075 0.3896 -0.0468 0.0287  -0.0250 245 HIS A CG    
2026 N ND1   . HIS A 245 ? 0.4031 0.4194 0.3993 -0.0475 0.0280  -0.0272 245 HIS A ND1   
2027 C CD2   . HIS A 245 ? 0.4010 0.3985 0.3811 -0.0424 0.0247  -0.0242 245 HIS A CD2   
2028 C CE1   . HIS A 245 ? 0.4112 0.4312 0.4103 -0.0439 0.0230  -0.0274 245 HIS A CE1   
2029 N NE2   . HIS A 245 ? 0.4012 0.4098 0.3902 -0.0410 0.0213  -0.0258 245 HIS A NE2   
2030 N N     . ARG A 246 ? 0.5119 0.4946 0.4771 -0.0478 0.0409  -0.0195 246 ARG A N     
2031 C CA    . ARG A 246 ? 0.5483 0.5188 0.5018 -0.0499 0.0432  -0.0172 246 ARG A CA    
2032 C C     . ARG A 246 ? 0.5569 0.5131 0.4992 -0.0506 0.0409  -0.0148 246 ARG A C     
2033 O O     . ARG A 246 ? 0.5299 0.4752 0.4622 -0.0550 0.0430  -0.0135 246 ARG A O     
2034 C CB    . ARG A 246 ? 0.5644 0.5361 0.5173 -0.0568 0.0493  -0.0188 246 ARG A CB    
2035 C CG    . ARG A 246 ? 0.6248 0.6113 0.5900 -0.0562 0.0526  -0.0217 246 ARG A CG    
2036 C CD    . ARG A 246 ? 0.6997 0.6870 0.6647 -0.0502 0.0522  -0.0205 246 ARG A CD    
2037 N NE    . ARG A 246 ? 0.7808 0.7798 0.7560 -0.0498 0.0565  -0.0233 246 ARG A NE    
2038 C CZ    . ARG A 246 ? 0.8055 0.8169 0.7934 -0.0450 0.0546  -0.0250 246 ARG A CZ    
2039 N NH1   . ARG A 246 ? 0.8005 0.8139 0.7914 -0.0408 0.0485  -0.0241 246 ARG A NH1   
2040 N NH2   . ARG A 246 ? 0.8355 0.8566 0.8324 -0.0442 0.0589  -0.0275 246 ARG A NH2   
2041 N N     . LYS A 247 ? 0.5623 0.5177 0.5058 -0.0463 0.0367  -0.0144 247 LYS A N     
2042 C CA    . LYS A 247 ? 0.6056 0.5473 0.5392 -0.0453 0.0346  -0.0122 247 LYS A CA    
2043 C C     . LYS A 247 ? 0.6087 0.5491 0.5423 -0.0375 0.0309  -0.0098 247 LYS A C     
2044 O O     . LYS A 247 ? 0.5888 0.5377 0.5298 -0.0335 0.0290  -0.0109 247 LYS A O     
2045 C CB    . LYS A 247 ? 0.6106 0.5489 0.5429 -0.0490 0.0342  -0.0142 247 LYS A CB    
2046 C CG    . LYS A 247 ? 0.6870 0.6083 0.6070 -0.0496 0.0337  -0.0121 247 LYS A CG    
2047 C CD    . LYS A 247 ? 0.7280 0.6442 0.6456 -0.0512 0.0325  -0.0140 247 LYS A CD    
2048 C CE    . LYS A 247 ? 0.7392 0.6378 0.6450 -0.0489 0.0315  -0.0116 247 LYS A CE    
2049 N NZ    . LYS A 247 ? 0.7513 0.6380 0.6470 -0.0524 0.0333  -0.0091 247 LYS A NZ    
2050 N N     . THR A 248 ? 0.6237 0.5535 0.5490 -0.0356 0.0299  -0.0065 248 THR A N     
2051 C CA    . THR A 248 ? 0.6655 0.5941 0.5913 -0.0286 0.0265  -0.0042 248 THR A CA    
2052 C C     . THR A 248 ? 0.7288 0.6440 0.6465 -0.0270 0.0251  -0.0020 248 THR A C     
2053 O O     . THR A 248 ? 0.7558 0.6605 0.6651 -0.0314 0.0264  -0.0014 248 THR A O     
2054 C CB    . THR A 248 ? 0.6460 0.5775 0.5723 -0.0262 0.0256  -0.0018 248 THR A CB    
2055 O OG1   . THR A 248 ? 0.6138 0.5348 0.5304 -0.0287 0.0257  0.0009  248 THR A OG1   
2056 C CG2   . THR A 248 ? 0.6263 0.5690 0.5592 -0.0277 0.0277  -0.0040 248 THR A CG2   
2057 N N     . ARG A 249 ? 0.7871 0.7021 0.7070 -0.0206 0.0227  -0.0007 249 ARG A N     
2058 C CA    . ARG A 249 ? 0.8592 0.7623 0.7730 -0.0173 0.0213  0.0015  249 ARG A CA    
2059 C C     . ARG A 249 ? 0.8893 0.7950 0.8064 -0.0108 0.0184  0.0047  249 ARG A C     
2060 O O     . ARG A 249 ? 0.8691 0.7849 0.7941 -0.0072 0.0178  0.0040  249 ARG A O     
2061 C CB    . ARG A 249 ? 0.8769 0.7771 0.7908 -0.0162 0.0220  -0.0011 249 ARG A CB    
2062 C CG    . ARG A 249 ? 0.9721 0.8567 0.8773 -0.0147 0.0219  0.0002  249 ARG A CG    
2063 C CD    . ARG A 249 ? 1.0692 0.9427 0.9647 -0.0219 0.0235  0.0000  249 ARG A CD    
2064 N NE    . ARG A 249 ? 1.1075 0.9844 1.0037 -0.0284 0.0257  -0.0040 249 ARG A NE    
2065 C CZ    . ARG A 249 ? 1.1383 1.0068 1.0293 -0.0307 0.0266  -0.0062 249 ARG A CZ    
2066 N NH1   . ARG A 249 ? 1.1542 1.0093 1.0385 -0.0264 0.0262  -0.0051 249 ARG A NH1   
2067 N NH2   . ARG A 249 ? 1.1336 1.0068 1.0263 -0.0373 0.0280  -0.0097 249 ARG A NH2   
2068 N N     . VAL A 250 ? 0.9569 0.8536 0.8680 -0.0096 0.0164  0.0084  250 VAL A N     
2069 C CA    . VAL A 250 ? 1.0156 0.9145 0.9302 -0.0035 0.0130  0.0118  250 VAL A CA    
2070 C C     . VAL A 250 ? 1.0844 0.9764 0.9990 0.0024  0.0123  0.0126  250 VAL A C     
2071 O O     . VAL A 250 ? 1.0952 0.9740 1.0019 0.0025  0.0117  0.0143  250 VAL A O     
2072 C CB    . VAL A 250 ? 1.0154 0.9092 0.9237 -0.0052 0.0104  0.0156  250 VAL A CB    
2073 C CG1   . VAL A 250 ? 1.0083 0.9075 0.9221 0.0004  0.0062  0.0190  250 VAL A CG1   
2074 C CG2   . VAL A 250 ? 1.0007 0.8989 0.9070 -0.0117 0.0124  0.0142  250 VAL A CG2   
2075 N N     . LYS A 251 ? 1.1596 1.0596 1.0825 0.0072  0.0128  0.0112  251 LYS A N     
2076 C CA    . LYS A 251 ? 1.2531 1.1472 1.1765 0.0126  0.0137  0.0108  251 LYS A CA    
2077 C C     . LYS A 251 ? 1.2950 1.1982 1.2284 0.0196  0.0128  0.0119  251 LYS A C     
2078 O O     . LYS A 251 ? 1.2834 1.1986 1.2236 0.0194  0.0132  0.0107  251 LYS A O     
2079 C CB    . LYS A 251 ? 1.2658 1.1574 1.1867 0.0098  0.0171  0.0063  251 LYS A CB    
2080 C CG    . LYS A 251 ? 1.2951 1.1761 1.2125 0.0140  0.0188  0.0053  251 LYS A CG    
2081 C CD    . LYS A 251 ? 1.3031 1.1882 1.2228 0.0141  0.0216  0.0012  251 LYS A CD    
2082 C CE    . LYS A 251 ? 1.3256 1.2017 1.2433 0.0200  0.0237  0.0004  251 LYS A CE    
2083 N NZ    . LYS A 251 ? 1.3331 1.2137 1.2528 0.0206  0.0265  -0.0034 251 LYS A NZ    
2084 N N     . VAL A 252 ? 1.3685 1.2655 1.3025 0.0257  0.0117  0.0142  252 VAL A N     
2085 C CA    . VAL A 252 ? 1.4188 1.3243 1.3632 0.0328  0.0113  0.0154  252 VAL A CA    
2086 C C     . VAL A 252 ? 1.4536 1.3608 1.4010 0.0356  0.0158  0.0115  252 VAL A C     
2087 O O     . VAL A 252 ? 1.4605 1.3580 1.4006 0.0338  0.0186  0.0086  252 VAL A O     
2088 C CB    . VAL A 252 ? 1.4326 1.3318 1.3782 0.0392  0.0082  0.0195  252 VAL A CB    
2089 C CG1   . VAL A 252 ? 1.4268 1.3350 1.3783 0.0399  0.0030  0.0238  252 VAL A CG1   
2090 C CG2   . VAL A 252 ? 1.4605 1.3419 1.3938 0.0378  0.0076  0.0204  252 VAL A CG2   
2091 N N     . ILE A 253 ? 1.4930 1.4119 1.4505 0.0395  0.0165  0.0116  253 ILE A N     
2092 C CA    . ILE A 253 ? 1.5383 1.4586 1.4989 0.0430  0.0210  0.0085  253 ILE A CA    
2093 C C     . ILE A 253 ? 1.5744 1.4905 1.5394 0.0512  0.0219  0.0101  253 ILE A C     
2094 O O     . ILE A 253 ? 1.5754 1.4982 1.5487 0.0553  0.0188  0.0138  253 ILE A O     
2095 C CB    . ILE A 253 ? 1.5282 1.4634 1.4969 0.0424  0.0221  0.0075  253 ILE A CB    
2096 C CG1   . ILE A 253 ? 1.5238 1.4632 1.4889 0.0352  0.0210  0.0062  253 ILE A CG1   
2097 C CG2   . ILE A 253 ? 1.5286 1.4644 1.4993 0.0458  0.0274  0.0043  253 ILE A CG2   
2098 C CD1   . ILE A 253 ? 1.5307 1.4638 1.4878 0.0311  0.0235  0.0021  253 ILE A CD1   
2099 N N     . GLU A 254 ? 1.6168 1.5216 1.5760 0.0536  0.0258  0.0073  254 GLU A N     
2100 C CA    . GLU A 254 ? 1.6552 1.5541 1.6179 0.0622  0.0276  0.0083  254 GLU A CA    
2101 C C     . GLU A 254 ? 1.6672 1.5773 1.6410 0.0675  0.0317  0.0068  254 GLU A C     
2102 O O     . GLU A 254 ? 1.6742 1.5803 1.6444 0.0679  0.0373  0.0027  254 GLU A O     
2103 C CB    . GLU A 254 ? 1.6739 1.5539 1.6242 0.0624  0.0306  0.0057  254 GLU A CB    
2104 C CG    . GLU A 254 ? 1.6817 1.5484 1.6213 0.0586  0.0269  0.0077  254 GLU A CG    
2105 C CD    . GLU A 254 ? 1.6986 1.5457 1.6253 0.0583  0.0301  0.0050  254 GLU A CD    
2106 O OE1   . GLU A 254 ? 1.6971 1.5411 1.6206 0.0582  0.0350  0.0006  254 GLU A OE1   
2107 O OE2   . GLU A 254 ? 1.7084 1.5421 1.6269 0.0578  0.0277  0.0073  254 GLU A OE2   
2108 N N     . ASN A 255 ? 1.6771 1.6008 1.6637 0.0709  0.0291  0.0102  255 ASN A N     
2109 C CA    . ASN A 255 ? 1.6876 1.6234 1.6865 0.0758  0.0331  0.0093  255 ASN A CA    
2110 C C     . ASN A 255 ? 1.6980 1.6336 1.7066 0.0857  0.0336  0.0114  255 ASN A C     
2111 O O     . ASN A 255 ? 1.7127 1.6340 1.7151 0.0894  0.0329  0.0121  255 ASN A O     
2112 C CB    . ASN A 255 ? 1.6816 1.6349 1.6893 0.0719  0.0306  0.0108  255 ASN A CB    
2113 C CG    . ASN A 255 ? 1.6888 1.6489 1.7030 0.0722  0.0234  0.0160  255 ASN A CG    
2114 O OD1   . ASN A 255 ? 1.6846 1.6576 1.7120 0.0757  0.0220  0.0184  255 ASN A OD1   
2115 N ND2   . ASN A 255 ? 1.6921 1.6434 1.6967 0.0680  0.0187  0.0178  255 ASN A ND2   
2116 N N     . MET A 256 ? 1.6927 1.6439 1.7166 0.0899  0.0348  0.0125  256 MET A N     
2117 C CA    . MET A 256 ? 1.7005 1.6545 1.7366 0.1000  0.0356  0.0144  256 MET A CA    
2118 C C     . MET A 256 ? 1.6844 1.6569 1.7372 0.1019  0.0302  0.0191  256 MET A C     
2119 O O     . MET A 256 ? 1.6896 1.6702 1.7569 0.1101  0.0311  0.0206  256 MET A O     
2120 C CB    . MET A 256 ? 1.7101 1.6635 1.7492 0.1049  0.0450  0.0099  256 MET A CB    
2121 C CG    . MET A 256 ? 1.7321 1.6776 1.7759 0.1157  0.0478  0.0101  256 MET A CG    
2122 S SD    . MET A 256 ? 1.7503 1.6855 1.7882 0.1196  0.0599  0.0034  256 MET A SD    
2123 C CE    . MET A 256 ? 1.7341 1.6920 1.7875 0.1189  0.0657  0.0016  256 MET A CE    
2124 N N     . TYR A 257 ? 1.6623 1.6414 1.7132 0.0944  0.0245  0.0212  257 TYR A N     
2125 C CA    . TYR A 257 ? 1.6397 1.6356 1.7042 0.0943  0.0187  0.0255  257 TYR A CA    
2126 C C     . TYR A 257 ? 1.6193 1.6111 1.6772 0.0900  0.0095  0.0299  257 TYR A C     
2127 O O     . TYR A 257 ? 1.6149 1.6185 1.6817 0.0891  0.0035  0.0338  257 TYR A O     
2128 C CB    . TYR A 257 ? 1.6365 1.6473 1.7067 0.0887  0.0217  0.0236  257 TYR A CB    
2129 C CG    . TYR A 257 ? 1.6489 1.6624 1.7225 0.0911  0.0313  0.0189  257 TYR A CG    
2130 C CD1   . TYR A 257 ? 1.6542 1.6633 1.7168 0.0849  0.0361  0.0147  257 TYR A CD1   
2131 C CD2   . TYR A 257 ? 1.6595 1.6797 1.7470 0.0998  0.0356  0.0186  257 TYR A CD2   
2132 C CE1   . TYR A 257 ? 1.6543 1.6646 1.7180 0.0865  0.0448  0.0104  257 TYR A CE1   
2133 C CE2   . TYR A 257 ? 1.6586 1.6804 1.7480 0.1016  0.0452  0.0141  257 TYR A CE2   
2134 C CZ    . TYR A 257 ? 1.6567 1.6729 1.7333 0.0946  0.0497  0.0100  257 TYR A CZ    
2135 O OH    . TYR A 257 ? 1.6540 1.6705 1.7306 0.0960  0.0590  0.0056  257 TYR A OH    
2136 N N     . GLY A 258 ? 1.5993 1.5740 1.6411 0.0869  0.0087  0.0292  258 GLY A N     
2137 C CA    . GLY A 258 ? 1.5654 1.5336 1.5981 0.0822  0.0013  0.0328  258 GLY A CA    
2138 C C     . GLY A 258 ? 1.5393 1.4932 1.5546 0.0753  0.0031  0.0300  258 GLY A C     
2139 O O     . GLY A 258 ? 1.5493 1.4919 1.5575 0.0768  0.0082  0.0267  258 GLY A O     
2140 N N     . SER A 259 ? 1.4978 1.4523 1.5063 0.0677  -0.0008 0.0312  259 SER A N     
2141 C CA    . SER A 259 ? 1.4549 1.3987 1.4489 0.0606  0.0009  0.0286  259 SER A CA    
2142 C C     . SER A 259 ? 1.4099 1.3605 1.4011 0.0527  -0.0016 0.0289  259 SER A C     
2143 O O     . SER A 259 ? 1.4085 1.3641 1.4022 0.0515  -0.0071 0.0327  259 SER A O     
2144 C CB    . SER A 259 ? 1.4713 1.3976 1.4534 0.0608  -0.0014 0.0304  259 SER A CB    
2145 O OG    . SER A 259 ? 1.4682 1.3937 1.4490 0.0602  -0.0085 0.0354  259 SER A OG    
2146 N N     . ARG A 260 ? 1.3568 1.3072 1.3427 0.0475  0.0025  0.0249  260 ARG A N     
2147 C CA    . ARG A 260 ? 1.3003 1.2546 1.2819 0.0402  0.0010  0.0246  260 ARG A CA    
2148 C C     . ARG A 260 ? 1.2504 1.1948 1.2206 0.0349  0.0035  0.0217  260 ARG A C     
2149 O O     . ARG A 260 ? 1.2506 1.1902 1.2182 0.0356  0.0076  0.0184  260 ARG A O     
2150 C CB    . ARG A 260 ? 1.3016 1.2695 1.2911 0.0389  0.0027  0.0231  260 ARG A CB    
2151 C CG    . ARG A 260 ? 1.3073 1.2766 1.2976 0.0394  0.0086  0.0187  260 ARG A CG    
2152 C CD    . ARG A 260 ? 1.3079 1.2890 1.3036 0.0370  0.0097  0.0176  260 ARG A CD    
2153 N NE    . ARG A 260 ? 1.3180 1.2991 1.3122 0.0367  0.0148  0.0136  260 ARG A NE    
2154 C CZ    . ARG A 260 ? 1.3176 1.2974 1.3057 0.0321  0.0160  0.0111  260 ARG A CZ    
2155 N NH1   . ARG A 260 ? 1.3112 1.2899 1.2947 0.0276  0.0132  0.0118  260 ARG A NH1   
2156 N NH2   . ARG A 260 ? 1.3078 1.2872 1.2942 0.0321  0.0199  0.0078  260 ARG A NH2   
2157 N N     . GLU A 261 ? 1.1787 1.1203 1.1419 0.0294  0.0011  0.0228  261 GLU A N     
2158 C CA    . GLU A 261 ? 1.1040 1.0377 1.0576 0.0239  0.0034  0.0202  261 GLU A CA    
2159 C C     . GLU A 261 ? 1.0159 0.9573 0.9702 0.0190  0.0054  0.0174  261 GLU A C     
2160 O O     . GLU A 261 ? 0.9963 0.9437 0.9519 0.0167  0.0035  0.0186  261 GLU A O     
2161 C CB    . GLU A 261 ? 1.1382 1.0611 1.0821 0.0208  0.0006  0.0229  261 GLU A CB    
2162 C CG    . GLU A 261 ? 1.1656 1.0746 1.1015 0.0209  0.0024  0.0221  261 GLU A CG    
2163 C CD    . GLU A 261 ? 1.1937 1.0912 1.1229 0.0226  -0.0015 0.0264  261 GLU A CD    
2164 O OE1   . GLU A 261 ? 1.1998 1.0984 1.1273 0.0211  -0.0057 0.0298  261 GLU A OE1   
2165 O OE2   . GLU A 261 ? 1.1946 1.0807 1.1193 0.0253  -0.0006 0.0264  261 GLU A OE2   
2166 N N     . ILE A 262 ? 0.9195 0.8598 0.8724 0.0177  0.0091  0.0136  262 ILE A N     
2167 C CA    . ILE A 262 ? 0.8115 0.7579 0.7648 0.0135  0.0108  0.0107  262 ILE A CA    
2168 C C     . ILE A 262 ? 0.7456 0.6856 0.6917 0.0082  0.0121  0.0091  262 ILE A C     
2169 O O     . ILE A 262 ? 0.7297 0.6599 0.6700 0.0075  0.0125  0.0094  262 ILE A O     
2170 C CB    . ILE A 262 ? 0.8159 0.7673 0.7734 0.0155  0.0135  0.0077  262 ILE A CB    
2171 C CG1   . ILE A 262 ? 0.8416 0.7847 0.7946 0.0155  0.0159  0.0051  262 ILE A CG1   
2172 C CG2   . ILE A 262 ? 0.8118 0.7695 0.7766 0.0204  0.0132  0.0091  262 ILE A CG2   
2173 C CD1   . ILE A 262 ? 0.8188 0.7654 0.7723 0.0143  0.0180  0.0015  262 ILE A CD1   
2174 N N     . ILE A 263 ? 0.6600 0.6056 0.6067 0.0044  0.0130  0.0074  263 ILE A N     
2175 C CA    . ILE A 263 ? 0.6054 0.5474 0.5472 -0.0009 0.0147  0.0055  263 ILE A CA    
2176 C C     . ILE A 263 ? 0.5795 0.5256 0.5240 -0.0023 0.0168  0.0017  263 ILE A C     
2177 O O     . ILE A 263 ? 0.5805 0.5349 0.5301 -0.0013 0.0168  0.0005  263 ILE A O     
2178 C CB    . ILE A 263 ? 0.5806 0.5254 0.5209 -0.0045 0.0146  0.0063  263 ILE A CB    
2179 C CG1   . ILE A 263 ? 0.5928 0.5342 0.5300 -0.0033 0.0116  0.0102  263 ILE A CG1   
2180 C CG2   . ILE A 263 ? 0.5833 0.5243 0.5189 -0.0101 0.0172  0.0044  263 ILE A CG2   
2181 C CD1   . ILE A 263 ? 0.5568 0.4872 0.4874 -0.0031 0.0101  0.0128  263 ILE A CD1   
2182 N N     . THR A 264 ? 0.5359 0.4755 0.4764 -0.0048 0.0182  0.0001  264 THR A N     
2183 C CA    . THR A 264 ? 0.4923 0.4352 0.4346 -0.0069 0.0194  -0.0034 264 THR A CA    
2184 C C     . THR A 264 ? 0.4958 0.4430 0.4391 -0.0122 0.0207  -0.0051 264 THR A C     
2185 O O     . THR A 264 ? 0.4964 0.4379 0.4350 -0.0163 0.0219  -0.0048 264 THR A O     
2186 C CB    . THR A 264 ? 0.4997 0.4332 0.4369 -0.0073 0.0202  -0.0047 264 THR A CB    
2187 O OG1   . THR A 264 ? 0.4833 0.4141 0.4208 -0.0017 0.0198  -0.0037 264 THR A OG1   
2188 C CG2   . THR A 264 ? 0.4414 0.3783 0.3797 -0.0109 0.0208  -0.0083 264 THR A CG2   
2189 N N     . LEU A 265 ? 0.4506 0.4076 0.4001 -0.0120 0.0205  -0.0068 265 LEU A N     
2190 C CA    . LEU A 265 ? 0.4271 0.3903 0.3799 -0.0159 0.0219  -0.0085 265 LEU A CA    
2191 C C     . LEU A 265 ? 0.4128 0.3792 0.3683 -0.0185 0.0218  -0.0116 265 LEU A C     
2192 O O     . LEU A 265 ? 0.3782 0.3500 0.3376 -0.0163 0.0201  -0.0128 265 LEU A O     
2193 C CB    . LEU A 265 ? 0.3904 0.3618 0.3483 -0.0135 0.0214  -0.0083 265 LEU A CB    
2194 C CG    . LEU A 265 ? 0.4077 0.3770 0.3633 -0.0110 0.0207  -0.0053 265 LEU A CG    
2195 C CD1   . LEU A 265 ? 0.3504 0.3270 0.3105 -0.0084 0.0199  -0.0055 265 LEU A CD1   
2196 C CD2   . LEU A 265 ? 0.3540 0.3186 0.3046 -0.0145 0.0224  -0.0042 265 LEU A CD2   
2197 N N     . PHE A 266 ? 0.4285 0.3908 0.3812 -0.0237 0.0234  -0.0128 266 PHE A N     
2198 C CA    . PHE A 266 ? 0.4606 0.4262 0.4157 -0.0274 0.0231  -0.0157 266 PHE A CA    
2199 C C     . PHE A 266 ? 0.4489 0.4278 0.4138 -0.0276 0.0225  -0.0175 266 PHE A C     
2200 O O     . PHE A 266 ? 0.4019 0.3861 0.3708 -0.0280 0.0244  -0.0173 266 PHE A O     
2201 C CB    . PHE A 266 ? 0.4875 0.4463 0.4377 -0.0339 0.0253  -0.0165 266 PHE A CB    
2202 C CG    . PHE A 266 ? 0.5547 0.4995 0.4951 -0.0337 0.0251  -0.0155 266 PHE A CG    
2203 C CD1   . PHE A 266 ? 0.5105 0.4463 0.4449 -0.0302 0.0252  -0.0124 266 PHE A CD1   
2204 C CD2   . PHE A 266 ? 0.6003 0.5403 0.5372 -0.0370 0.0245  -0.0177 266 PHE A CD2   
2205 C CE1   . PHE A 266 ? 0.5935 0.5162 0.5197 -0.0290 0.0250  -0.0114 266 PHE A CE1   
2206 C CE2   . PHE A 266 ? 0.6323 0.5578 0.5594 -0.0363 0.0247  -0.0170 266 PHE A CE2   
2207 C CZ    . PHE A 266 ? 0.6140 0.5310 0.5362 -0.0319 0.0251  -0.0138 266 PHE A CZ    
2208 N N     . GLY A 267 ? 0.4529 0.4365 0.4211 -0.0268 0.0197  -0.0191 267 GLY A N     
2209 C CA    . GLY A 267 ? 0.4366 0.4325 0.4142 -0.0261 0.0181  -0.0206 267 GLY A CA    
2210 C C     . GLY A 267 ? 0.4406 0.4400 0.4205 -0.0200 0.0166  -0.0192 267 GLY A C     
2211 O O     . GLY A 267 ? 0.4731 0.4816 0.4603 -0.0183 0.0154  -0.0199 267 GLY A O     
2212 N N     . ILE A 268 ? 0.4185 0.4108 0.3924 -0.0165 0.0166  -0.0171 268 ILE A N     
2213 C CA    . ILE A 268 ? 0.3841 0.3786 0.3589 -0.0115 0.0151  -0.0158 268 ILE A CA    
2214 C C     . ILE A 268 ? 0.3987 0.3869 0.3677 -0.0092 0.0139  -0.0152 268 ILE A C     
2215 O O     . ILE A 268 ? 0.4090 0.3895 0.3728 -0.0101 0.0150  -0.0148 268 ILE A O     
2216 C CB    . ILE A 268 ? 0.3847 0.3788 0.3593 -0.0096 0.0170  -0.0138 268 ILE A CB    
2217 C CG1   . ILE A 268 ? 0.3476 0.3481 0.3278 -0.0116 0.0188  -0.0150 268 ILE A CG1   
2218 C CG2   . ILE A 268 ? 0.3203 0.3152 0.2946 -0.0051 0.0155  -0.0123 268 ILE A CG2   
2219 C CD1   . ILE A 268 ? 0.3678 0.3656 0.3455 -0.0116 0.0213  -0.0135 268 ILE A CD1   
2220 N N     . SER A 269 ? 0.3758 0.3667 0.3455 -0.0062 0.0118  -0.0151 269 SER A N     
2221 C CA    . SER A 269 ? 0.3909 0.3764 0.3551 -0.0039 0.0114  -0.0146 269 SER A CA    
2222 C C     . SER A 269 ? 0.3957 0.3817 0.3601 -0.0001 0.0120  -0.0124 269 SER A C     
2223 O O     . SER A 269 ? 0.4080 0.3982 0.3742 0.0016  0.0107  -0.0120 269 SER A O     
2224 C CB    . SER A 269 ? 0.3981 0.3848 0.3609 -0.0044 0.0086  -0.0163 269 SER A CB    
2225 O OG    . SER A 269 ? 0.4229 0.4068 0.3834 -0.0083 0.0081  -0.0183 269 SER A OG    
2226 N N     . VAL A 270 ? 0.3992 0.3807 0.3614 0.0010  0.0139  -0.0108 270 VAL A N     
2227 C CA    . VAL A 270 ? 0.3673 0.3498 0.3302 0.0039  0.0144  -0.0086 270 VAL A CA    
2228 C C     . VAL A 270 ? 0.3777 0.3586 0.3382 0.0062  0.0148  -0.0086 270 VAL A C     
2229 O O     . VAL A 270 ? 0.3794 0.3553 0.3369 0.0068  0.0161  -0.0092 270 VAL A O     
2230 C CB    . VAL A 270 ? 0.3663 0.3455 0.3289 0.0040  0.0156  -0.0066 270 VAL A CB    
2231 C CG1   . VAL A 270 ? 0.3168 0.2979 0.2809 0.0066  0.0156  -0.0042 270 VAL A CG1   
2232 C CG2   . VAL A 270 ? 0.3212 0.3011 0.2847 0.0011  0.0158  -0.0067 270 VAL A CG2   
2233 N N     . LEU A 271 ? 0.4028 0.3870 0.3638 0.0074  0.0139  -0.0081 271 LEU A N     
2234 C CA    . LEU A 271 ? 0.4203 0.4031 0.3786 0.0091  0.0149  -0.0079 271 LEU A CA    
2235 C C     . LEU A 271 ? 0.3979 0.3837 0.3586 0.0105  0.0155  -0.0055 271 LEU A C     
2236 O O     . LEU A 271 ? 0.3899 0.3777 0.3500 0.0104