data_3SVM
# 
_entry.id   3SVM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3SVM         
RCSB  RCSB066707   
WWPDB D_1000066707 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3QO2 'MPP8-H3K9me2 peptide' unspecified 
PDB 3SWC .                      unspecified 
PDB 3SW9 .                      unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3SVM 
_pdbx_database_status.recvd_initial_deposition_date   2011-07-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chang, Y.'    1 
'Horton, J.R.' 2 
'Zhang, X.'    3 
'Cheng, X.'    4 
# 
_citation.id                        primary 
_citation.title                     
'MPP8 mediates the interactions between DNA methyltransferase Dnmt3a and H3K9 methyltransferase GLP/G9a.' 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_volume            2 
_citation.page_first                533 
_citation.page_last                 533 
_citation.year                      2011 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22086334 
_citation.pdbx_database_id_DOI      10.1038/ncomms1549 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chang, Y.'     1  
primary 'Sun, L.'       2  
primary 'Kokura, K.'    3  
primary 'Horton, J.R.'  4  
primary 'Fukuda, M.'    5  
primary 'Espejo, A.'    6  
primary 'Izumi, V.'     7  
primary 'Koomen, J.M.'  8  
primary 'Bedford, M.T.' 9  
primary 'Zhang, X.'     10 
primary 'Shinkai, Y.'   11 
primary 'Fang, J.'      12 
primary 'Cheng, X.'     13 
# 
_cell.entry_id           3SVM 
_cell.length_a           41.090 
_cell.length_b           43.900 
_cell.length_c           90.280 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3SVM 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'M-phase phosphoprotein 8'              7344.350 1  ?        ? 'unp residues 55-116' ? 
2 polymer syn 'DNA (cytosine-5)-methyltransferase 3A' 1705.937 1  2.1.1.37 ? 'unp residues 40-53'  ? 
3 water   nat water                                   18.015   24 ?        ? ?                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Two hybrid-associated protein 3 with RanBPM, Twa3'                   
2 'Dnmt3a, DNA methyltransferase HsaIIIA, DNA MTase HsaIIIA, M.HsaIIIA' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  GEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAK 
GEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAK A ? 
2 'polypeptide(L)' no yes 'YEPSTTAR(MLY)VGRPGR'                                          YEPSTTARKVGRPGR P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  GLU n 
1 3  ASP n 
1 4  VAL n 
1 5  PHE n 
1 6  GLU n 
1 7  VAL n 
1 8  GLU n 
1 9  LYS n 
1 10 ILE n 
1 11 LEU n 
1 12 ASP n 
1 13 MET n 
1 14 LYS n 
1 15 THR n 
1 16 GLU n 
1 17 GLY n 
1 18 GLY n 
1 19 LYS n 
1 20 VAL n 
1 21 LEU n 
1 22 TYR n 
1 23 LYS n 
1 24 VAL n 
1 25 ARG n 
1 26 TRP n 
1 27 LYS n 
1 28 GLY n 
1 29 TYR n 
1 30 THR n 
1 31 SER n 
1 32 ASP n 
1 33 ASP n 
1 34 ASP n 
1 35 THR n 
1 36 TRP n 
1 37 GLU n 
1 38 PRO n 
1 39 GLU n 
1 40 ILE n 
1 41 HIS n 
1 42 LEU n 
1 43 GLU n 
1 44 ASP n 
1 45 CYS n 
1 46 LYS n 
1 47 GLU n 
1 48 VAL n 
1 49 LEU n 
1 50 LEU n 
1 51 GLU n 
1 52 PHE n 
1 53 ARG n 
1 54 LYS n 
1 55 LYS n 
1 56 ILE n 
1 57 ALA n 
1 58 GLU n 
1 59 ASN n 
1 60 LYS n 
1 61 ALA n 
1 62 LYS n 
2 1  TYR n 
2 2  GLU n 
2 3  PRO n 
2 4  SER n 
2 5  THR n 
2 6  THR n 
2 7  ALA n 
2 8  ARG n 
2 9  MLY n 
2 10 VAL n 
2 11 GLY n 
2 12 ARG n 
2 13 PRO n 
2 14 GLY n 
2 15 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MPHOSPH8, MPP8' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   '6xHis-SUMO tag' 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pXC941 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP MPP8_HUMAN  Q99549 1 GEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAK 55 ? 
2 UNP DNM3A_HUMAN Q9Y6K1 2 EPSTTARKVGRPGR                                                 40 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3SVM A 1 ? 62 ? Q99549 55 ? 116 ? 55 116 
2 2 3SVM P 2 ? 15 ? Q9Y6K1 40 ? 53  ? 40 53  
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             3SVM 
_struct_ref_seq_dif.mon_id                       TYR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           P 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q9Y6K1 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'EXPRESSION TAG' 
_struct_ref_seq_dif.pdbx_auth_seq_num            39 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
MLY 'L-peptide linking' n N-DIMETHYL-LYSINE ? 'C8 H18 N2 O2'   174.241 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3SVM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.24 
_exptl_crystal.density_percent_sol   45.21 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'30% polyethylene glycol 1500, 20% polyethylene glycol 400 and 0.1 M Hepes, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-04-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3SVM 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.29 
_reflns.number_obs                   3624 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.3 
_reflns.pdbx_Rmerge_I_obs            0.056 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        25.6 
_reflns.B_iso_Wilson_estimate        54.5 
_reflns.pdbx_redundancy              5.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.29 
_reflns_shell.d_res_low              2.37 
_reflns_shell.percent_possible_all   82.0 
_reflns_shell.Rmerge_I_obs           0.375 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.3 
_reflns_shell.pdbx_redundancy        4.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3SVM 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     3465 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30 
_refine.ls_d_res_high                            2.31 
_refine.ls_percent_reflns_obs                    90.9 
_refine.ls_R_factor_obs                          0.257 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.257 
_refine.ls_R_factor_R_free                       0.272 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  184 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               58.0 
_refine.aniso_B[1][1]                            -11.75 
_refine.aniso_B[2][2]                            16.67 
_refine.aniso_B[3][3]                            -4.91 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 3QO2' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3SVM 
_refine_analyze.Luzzati_coordinate_error_obs    0.40 
_refine_analyze.Luzzati_sigma_a_obs             0.38 
_refine_analyze.Luzzati_d_res_low_obs           30. 
_refine_analyze.Luzzati_coordinate_error_free   0.42 
_refine_analyze.Luzzati_sigma_a_free            0.43 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        578 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             24 
_refine_hist.number_atoms_total               602 
_refine_hist.d_res_high                       2.31 
_refine_hist.d_res_low                        30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.5  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.75  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.31 
_refine_ls_shell.d_res_low                        2.45 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.316 
_refine_ls_shell.percent_reflns_obs               68.7 
_refine_ls_shell.R_factor_R_free                  0.368 
_refine_ls_shell.R_factor_R_free_error            0.067 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             22 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3SVM 
_struct.title                     'Human MPP8 - human DNMT3AK47me2 peptide' 
_struct.pdbx_descriptor           
'MPP8 (M-phase phosphoprotein 8) chromodomain, DNA (cytosine-5)-methyltransferase 3A (E.C.2.1.1.37)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3SVM 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;epigenetics, methyl-lysine binding, Chromodomain, The dimethylated human DNMT3AK47me2 is recognized by the chromodomain of MPP8, MPP8 chromodomain, dimethylated lysine, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 30 ? ASP A 34 ? THR A 84 ASP A 88  5 ? 5  
HELX_P HELX_P2 2 ILE A 40 ? LEU A 42 ? ILE A 94 LEU A 96  5 ? 3  
HELX_P HELX_P3 3 CYS A 45 ? GLU A 58 ? CYS A 99 GLU A 112 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B ARG 8 C ? ? ? 1_555 B MLY 9  N ? ? P ARG 46 P MLY 47 1_555 ? ? ? ? ? ? ? 1.320 ? 
covale2 covale ? ? B MLY 9 C ? ? ? 1_555 B VAL 10 N ? ? P MLY 47 P VAL 48 1_555 ? ? ? ? ? ? ? 1.327 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 35 ? PRO A 38 ? THR A 89 PRO A 92 
A 2 LYS A 19 ? TRP A 26 ? LYS A 73 TRP A 80 
A 3 PHE A 5  ? GLU A 16 ? PHE A 59 GLU A 70 
A 4 THR B 6  ? ALA B 7  ? THR P 44 ALA P 45 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 37 ? O GLU A 91 N TYR A 22 ? N TYR A 76 
A 2 3 O LYS A 23 ? O LYS A 77 N LEU A 11 ? N LEU A 65 
A 3 4 N PHE A 5  ? N PHE A 59 O ALA B 7  ? O ALA P 45 
# 
_database_PDB_matrix.entry_id          3SVM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3SVM 
_atom_sites.fract_transf_matrix[1][1]   0.024337 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022779 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011077 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . GLU A 1 2  ? -22.878 -11.786 -5.607  1.00 78.89 ? 56  GLU A N   1 
ATOM   2   C CA  . GLU A 1 2  ? -21.570 -11.484 -4.962  1.00 78.23 ? 56  GLU A CA  1 
ATOM   3   C C   . GLU A 1 2  ? -21.105 -10.058 -5.258  1.00 77.39 ? 56  GLU A C   1 
ATOM   4   O O   . GLU A 1 2  ? -19.924 -9.837  -5.536  1.00 77.52 ? 56  GLU A O   1 
ATOM   5   C CB  . GLU A 1 2  ? -20.510 -12.492 -5.427  1.00 77.41 ? 56  GLU A CB  1 
ATOM   6   N N   . ASP A 1 3  ? -22.048 -9.113  -5.198  1.00 75.83 ? 57  ASP A N   1 
ATOM   7   C CA  . ASP A 1 3  ? -21.808 -7.675  -5.414  1.00 73.52 ? 57  ASP A CA  1 
ATOM   8   C C   . ASP A 1 3  ? -21.049 -7.358  -6.705  1.00 71.68 ? 57  ASP A C   1 
ATOM   9   O O   . ASP A 1 3  ? -21.522 -6.575  -7.532  1.00 72.65 ? 57  ASP A O   1 
ATOM   10  C CB  . ASP A 1 3  ? -21.044 -7.092  -4.201  1.00 72.85 ? 57  ASP A CB  1 
ATOM   11  C CG  . ASP A 1 3  ? -20.987 -5.550  -4.193  1.00 72.82 ? 57  ASP A CG  1 
ATOM   12  O OD1 . ASP A 1 3  ? -21.168 -4.901  -5.246  1.00 71.45 ? 57  ASP A OD1 1 
ATOM   13  O OD2 . ASP A 1 3  ? -20.731 -4.957  -3.119  1.00 71.54 ? 57  ASP A OD2 1 
ATOM   14  N N   . VAL A 1 4  ? -19.879 -7.980  -6.850  1.00 68.32 ? 58  VAL A N   1 
ATOM   15  C CA  . VAL A 1 4  ? -18.964 -7.807  -7.978  1.00 63.49 ? 58  VAL A CA  1 
ATOM   16  C C   . VAL A 1 4  ? -18.149 -6.544  -7.752  1.00 61.51 ? 58  VAL A C   1 
ATOM   17  O O   . VAL A 1 4  ? -18.684 -5.499  -7.390  1.00 60.03 ? 58  VAL A O   1 
ATOM   18  C CB  . VAL A 1 4  ? -19.688 -7.741  -9.335  1.00 62.77 ? 58  VAL A CB  1 
ATOM   19  C CG1 . VAL A 1 4  ? -18.750 -7.186  -10.393 1.00 61.58 ? 58  VAL A CG1 1 
ATOM   20  C CG2 . VAL A 1 4  ? -20.151 -9.143  -9.731  1.00 59.58 ? 58  VAL A CG2 1 
ATOM   21  N N   . PHE A 1 5  ? -16.843 -6.663  -7.964  1.00 59.73 ? 59  PHE A N   1 
ATOM   22  C CA  . PHE A 1 5  ? -15.917 -5.572  -7.733  1.00 56.25 ? 59  PHE A CA  1 
ATOM   23  C C   . PHE A 1 5  ? -14.919 -5.372  -8.862  1.00 55.90 ? 59  PHE A C   1 
ATOM   24  O O   . PHE A 1 5  ? -14.656 -6.276  -9.653  1.00 55.84 ? 59  PHE A O   1 
ATOM   25  C CB  . PHE A 1 5  ? -15.157 -5.857  -6.445  1.00 55.20 ? 59  PHE A CB  1 
ATOM   26  C CG  . PHE A 1 5  ? -16.044 -6.140  -5.271  1.00 52.83 ? 59  PHE A CG  1 
ATOM   27  C CD1 . PHE A 1 5  ? -16.310 -5.151  -4.342  1.00 52.41 ? 59  PHE A CD1 1 
ATOM   28  C CD2 . PHE A 1 5  ? -16.613 -7.394  -5.097  1.00 52.18 ? 59  PHE A CD2 1 
ATOM   29  C CE1 . PHE A 1 5  ? -17.129 -5.405  -3.256  1.00 52.40 ? 59  PHE A CE1 1 
ATOM   30  C CE2 . PHE A 1 5  ? -17.434 -7.660  -4.015  1.00 50.09 ? 59  PHE A CE2 1 
ATOM   31  C CZ  . PHE A 1 5  ? -17.693 -6.666  -3.091  1.00 51.86 ? 59  PHE A CZ  1 
ATOM   32  N N   . GLU A 1 6  ? -14.344 -4.180  -8.907  1.00 54.85 ? 60  GLU A N   1 
ATOM   33  C CA  . GLU A 1 6  ? -13.361 -3.833  -9.920  1.00 55.56 ? 60  GLU A CA  1 
ATOM   34  C C   . GLU A 1 6  ? -12.014 -4.505  -9.583  1.00 53.70 ? 60  GLU A C   1 
ATOM   35  O O   . GLU A 1 6  ? -11.489 -4.363  -8.476  1.00 53.60 ? 60  GLU A O   1 
ATOM   36  C CB  . GLU A 1 6  ? -13.218 -2.305  -9.965  1.00 59.59 ? 60  GLU A CB  1 
ATOM   37  C CG  . GLU A 1 6  ? -13.168 -1.681  -11.349 1.00 64.67 ? 60  GLU A CG  1 
ATOM   38  C CD  . GLU A 1 6  ? -11.874 -1.983  -12.082 1.00 70.26 ? 60  GLU A CD  1 
ATOM   39  O OE1 . GLU A 1 6  ? -10.788 -1.708  -11.520 1.00 72.96 ? 60  GLU A OE1 1 
ATOM   40  O OE2 . GLU A 1 6  ? -11.940 -2.489  -13.225 1.00 72.80 ? 60  GLU A OE2 1 
ATOM   41  N N   . VAL A 1 7  ? -11.475 -5.240  -10.548 1.00 50.53 ? 61  VAL A N   1 
ATOM   42  C CA  . VAL A 1 7  ? -10.210 -5.958  -10.416 1.00 49.40 ? 61  VAL A CA  1 
ATOM   43  C C   . VAL A 1 7  ? -9.040  -5.085  -10.897 1.00 49.36 ? 61  VAL A C   1 
ATOM   44  O O   . VAL A 1 7  ? -9.120  -4.484  -11.965 1.00 48.82 ? 61  VAL A O   1 
ATOM   45  C CB  . VAL A 1 7  ? -10.256 -7.267  -11.274 1.00 48.67 ? 61  VAL A CB  1 
ATOM   46  C CG1 . VAL A 1 7  ? -8.984  -8.066  -11.125 1.00 48.48 ? 61  VAL A CG1 1 
ATOM   47  C CG2 . VAL A 1 7  ? -11.440 -8.100  -10.868 1.00 47.53 ? 61  VAL A CG2 1 
ATOM   48  N N   . GLU A 1 8  ? -7.963  -5.010  -10.110 1.00 49.99 ? 62  GLU A N   1 
ATOM   49  C CA  . GLU A 1 8  ? -6.787  -4.222  -10.494 1.00 48.94 ? 62  GLU A CA  1 
ATOM   50  C C   . GLU A 1 8  ? -5.798  -5.105  -11.201 1.00 47.29 ? 62  GLU A C   1 
ATOM   51  O O   . GLU A 1 8  ? -5.285  -4.757  -12.261 1.00 48.08 ? 62  GLU A O   1 
ATOM   52  C CB  . GLU A 1 8  ? -6.066  -3.615  -9.296  1.00 51.68 ? 62  GLU A CB  1 
ATOM   53  C CG  . GLU A 1 8  ? -4.893  -2.735  -9.737  1.00 57.42 ? 62  GLU A CG  1 
ATOM   54  C CD  . GLU A 1 8  ? -3.932  -2.403  -8.612  1.00 61.30 ? 62  GLU A CD  1 
ATOM   55  O OE1 . GLU A 1 8  ? -4.390  -1.907  -7.564  1.00 64.72 ? 62  GLU A OE1 1 
ATOM   56  O OE2 . GLU A 1 8  ? -2.712  -2.628  -8.778  1.00 64.14 ? 62  GLU A OE2 1 
ATOM   57  N N   . LYS A 1 9  ? -5.512  -6.246  -10.588 1.00 46.02 ? 63  LYS A N   1 
ATOM   58  C CA  . LYS A 1 9  ? -4.593  -7.209  -11.170 1.00 43.72 ? 63  LYS A CA  1 
ATOM   59  C C   . LYS A 1 9  ? -4.524  -8.519  -10.403 1.00 41.95 ? 63  LYS A C   1 
ATOM   60  O O   . LYS A 1 9  ? -4.995  -8.625  -9.270  1.00 40.90 ? 63  LYS A O   1 
ATOM   61  C CB  . LYS A 1 9  ? -3.184  -6.606  -11.304 1.00 44.02 ? 63  LYS A CB  1 
ATOM   62  C CG  . LYS A 1 9  ? -2.460  -6.258  -10.014 1.00 43.66 ? 63  LYS A CG  1 
ATOM   63  C CD  . LYS A 1 9  ? -1.046  -5.799  -10.338 1.00 46.78 ? 63  LYS A CD  1 
ATOM   64  C CE  . LYS A 1 9  ? -0.168  -5.633  -9.100  1.00 49.69 ? 63  LYS A CE  1 
ATOM   65  N NZ  . LYS A 1 9  ? -0.576  -4.509  -8.212  1.00 50.51 ? 63  LYS A NZ  1 
ATOM   66  N N   . ILE A 1 10 ? -3.942  -9.516  -11.059 1.00 40.51 ? 64  ILE A N   1 
ATOM   67  C CA  . ILE A 1 10 ? -3.745  -10.841 -10.494 1.00 40.08 ? 64  ILE A CA  1 
ATOM   68  C C   . ILE A 1 10 ? -2.342  -10.826 -9.898  1.00 41.33 ? 64  ILE A C   1 
ATOM   69  O O   . ILE A 1 10 ? -1.391  -10.410 -10.557 1.00 41.76 ? 64  ILE A O   1 
ATOM   70  C CB  . ILE A 1 10 ? -3.852  -11.941 -11.595 1.00 38.52 ? 64  ILE A CB  1 
ATOM   71  C CG1 . ILE A 1 10 ? -5.326  -12.086 -12.030 1.00 37.55 ? 64  ILE A CG1 1 
ATOM   72  C CG2 . ILE A 1 10 ? -3.279  -13.257 -11.073 1.00 34.58 ? 64  ILE A CG2 1 
ATOM   73  C CD1 . ILE A 1 10 ? -5.584  -12.982 -13.237 1.00 37.14 ? 64  ILE A CD1 1 
ATOM   74  N N   . LEU A 1 11 ? -2.211  -11.272 -8.652  1.00 40.81 ? 65  LEU A N   1 
ATOM   75  C CA  . LEU A 1 11 ? -0.911  -11.268 -7.999  1.00 39.18 ? 65  LEU A CA  1 
ATOM   76  C C   . LEU A 1 11 ? -0.147  -12.555 -8.216  1.00 39.42 ? 65  LEU A C   1 
ATOM   77  O O   . LEU A 1 11 ? 1.065   -12.537 -8.378  1.00 40.72 ? 65  LEU A O   1 
ATOM   78  C CB  . LEU A 1 11 ? -1.076  -11.001 -6.500  1.00 40.06 ? 65  LEU A CB  1 
ATOM   79  C CG  . LEU A 1 11 ? -1.733  -9.651  -6.181  1.00 39.09 ? 65  LEU A CG  1 
ATOM   80  C CD1 . LEU A 1 11 ? -2.333  -9.693  -4.796  1.00 40.92 ? 65  LEU A CD1 1 
ATOM   81  C CD2 . LEU A 1 11 ? -0.724  -8.528  -6.322  1.00 37.78 ? 65  LEU A CD2 1 
ATOM   82  N N   . ASP A 1 12 ? -0.854  -13.675 -8.221  1.00 38.23 ? 66  ASP A N   1 
ATOM   83  C CA  . ASP A 1 12 ? -0.220  -14.971 -8.413  1.00 37.20 ? 66  ASP A CA  1 
ATOM   84  C C   . ASP A 1 12 ? -1.282  -16.022 -8.721  1.00 35.38 ? 66  ASP A C   1 
ATOM   85  O O   . ASP A 1 12 ? -2.468  -15.732 -8.727  1.00 31.39 ? 66  ASP A O   1 
ATOM   86  C CB  . ASP A 1 12 ? 0.568   -15.376 -7.147  1.00 39.83 ? 66  ASP A CB  1 
ATOM   87  C CG  . ASP A 1 12 ? 2.018   -14.829 -7.128  1.00 42.57 ? 66  ASP A CG  1 
ATOM   88  O OD1 . ASP A 1 12 ? 2.732   -14.910 -8.166  1.00 37.89 ? 66  ASP A OD1 1 
ATOM   89  O OD2 . ASP A 1 12 ? 2.442   -14.336 -6.054  1.00 41.59 ? 66  ASP A OD2 1 
ATOM   90  N N   . MET A 1 13 ? -0.844  -17.248 -8.975  1.00 37.33 ? 67  MET A N   1 
ATOM   91  C CA  . MET A 1 13 ? -1.759  -18.349 -9.268  1.00 39.88 ? 67  MET A CA  1 
ATOM   92  C C   . MET A 1 13 ? -1.284  -19.617 -8.582  1.00 37.64 ? 67  MET A C   1 
ATOM   93  O O   . MET A 1 13 ? -0.142  -19.705 -8.135  1.00 36.59 ? 67  MET A O   1 
ATOM   94  C CB  . MET A 1 13 ? -1.802  -18.630 -10.770 1.00 43.22 ? 67  MET A CB  1 
ATOM   95  C CG  . MET A 1 13 ? -0.711  -19.607 -11.228 1.00 48.68 ? 67  MET A CG  1 
ATOM   96  S SD  . MET A 1 13 ? -0.660  -19.864 -13.018 1.00 59.95 ? 67  MET A SD  1 
ATOM   97  C CE  . MET A 1 13 ? -2.193  -20.824 -13.282 1.00 55.36 ? 67  MET A CE  1 
ATOM   98  N N   . LYS A 1 14 ? -2.167  -20.607 -8.536  1.00 38.90 ? 68  LYS A N   1 
ATOM   99  C CA  . LYS A 1 14 ? -1.853  -21.920 -7.960  1.00 40.07 ? 68  LYS A CA  1 
ATOM   100 C C   . LYS A 1 14 ? -2.925  -22.894 -8.382  1.00 40.23 ? 68  LYS A C   1 
ATOM   101 O O   . LYS A 1 14 ? -3.933  -22.503 -8.943  1.00 39.60 ? 68  LYS A O   1 
ATOM   102 C CB  . LYS A 1 14 ? -1.825  -21.881 -6.421  1.00 40.84 ? 68  LYS A CB  1 
ATOM   103 C CG  . LYS A 1 14 ? -3.196  -21.774 -5.730  1.00 36.70 ? 68  LYS A CG  1 
ATOM   104 C CD  . LYS A 1 14 ? -2.990  -21.747 -4.238  1.00 39.27 ? 68  LYS A CD  1 
ATOM   105 C CE  . LYS A 1 14 ? -4.260  -21.448 -3.450  1.00 41.16 ? 68  LYS A CE  1 
ATOM   106 N NZ  . LYS A 1 14 ? -3.942  -21.240 -1.981  1.00 41.92 ? 68  LYS A NZ  1 
ATOM   107 N N   . THR A 1 15 ? -2.695  -24.169 -8.122  1.00 42.72 ? 69  THR A N   1 
ATOM   108 C CA  . THR A 1 15 ? -3.697  -25.175 -8.414  1.00 45.40 ? 69  THR A CA  1 
ATOM   109 C C   . THR A 1 15 ? -3.939  -25.924 -7.110  1.00 48.75 ? 69  THR A C   1 
ATOM   110 O O   . THR A 1 15 ? -3.000  -26.211 -6.372  1.00 47.65 ? 69  THR A O   1 
ATOM   111 C CB  . THR A 1 15 ? -3.247  -26.198 -9.504  1.00 44.07 ? 69  THR A CB  1 
ATOM   112 O OG1 . THR A 1 15 ? -2.016  -26.807 -9.115  1.00 38.77 ? 69  THR A OG1 1 
ATOM   113 C CG2 . THR A 1 15 ? -3.091  -25.521 -10.864 1.00 41.23 ? 69  THR A CG2 1 
ATOM   114 N N   . GLU A 1 16 ? -5.205  -26.191 -6.808  1.00 52.40 ? 70  GLU A N   1 
ATOM   115 C CA  . GLU A 1 16 ? -5.558  -26.948 -5.620  1.00 56.97 ? 70  GLU A CA  1 
ATOM   116 C C   . GLU A 1 16 ? -6.210  -28.190 -6.176  1.00 60.14 ? 70  GLU A C   1 
ATOM   117 O O   . GLU A 1 16 ? -7.414  -28.213 -6.426  1.00 61.68 ? 70  GLU A O   1 
ATOM   118 C CB  . GLU A 1 16 ? -6.542  -26.187 -4.733  1.00 56.83 ? 70  GLU A CB  1 
ATOM   119 C CG  . GLU A 1 16 ? -5.930  -24.998 -4.035  1.00 58.64 ? 70  GLU A CG  1 
ATOM   120 C CD  . GLU A 1 16 ? -6.349  -24.898 -2.580  1.00 59.22 ? 70  GLU A CD  1 
ATOM   121 O OE1 . GLU A 1 16 ? -7.556  -25.034 -2.295  1.00 57.86 ? 70  GLU A OE1 1 
ATOM   122 O OE2 . GLU A 1 16 ? -5.467  -24.674 -1.724  1.00 59.43 ? 70  GLU A OE2 1 
ATOM   123 N N   . GLY A 1 17 ? -5.393  -29.220 -6.383  1.00 63.96 ? 71  GLY A N   1 
ATOM   124 C CA  . GLY A 1 17 ? -5.878  -30.464 -6.954  1.00 65.79 ? 71  GLY A CA  1 
ATOM   125 C C   . GLY A 1 17 ? -5.667  -30.360 -8.452  1.00 66.26 ? 71  GLY A C   1 
ATOM   126 O O   . GLY A 1 17 ? -4.554  -30.571 -8.947  1.00 66.92 ? 71  GLY A O   1 
ATOM   127 N N   . GLY A 1 18 ? -6.732  -30.022 -9.171  1.00 65.00 ? 72  GLY A N   1 
ATOM   128 C CA  . GLY A 1 18 ? -6.629  -29.863 -10.611 1.00 64.77 ? 72  GLY A CA  1 
ATOM   129 C C   . GLY A 1 18 ? -7.284  -28.561 -11.043 1.00 63.65 ? 72  GLY A C   1 
ATOM   130 O O   . GLY A 1 18 ? -7.376  -28.243 -12.230 1.00 63.13 ? 72  GLY A O   1 
ATOM   131 N N   . LYS A 1 19 ? -7.733  -27.798 -10.055 1.00 62.08 ? 73  LYS A N   1 
ATOM   132 C CA  . LYS A 1 19 ? -8.417  -26.540 -10.300 1.00 58.90 ? 73  LYS A CA  1 
ATOM   133 C C   . LYS A 1 19 ? -7.465  -25.354 -10.201 1.00 55.45 ? 73  LYS A C   1 
ATOM   134 O O   . LYS A 1 19 ? -6.570  -25.335 -9.365  1.00 55.61 ? 73  LYS A O   1 
ATOM   135 C CB  . LYS A 1 19 ? -9.556  -26.397 -9.290  1.00 60.27 ? 73  LYS A CB  1 
ATOM   136 C CG  . LYS A 1 19 ? -10.339 -25.100 -9.380  1.00 63.94 ? 73  LYS A CG  1 
ATOM   137 C CD  . LYS A 1 19 ? -10.973 -24.779 -8.027  1.00 65.27 ? 73  LYS A CD  1 
ATOM   138 C CE  . LYS A 1 19 ? -11.810 -23.517 -8.082  1.00 65.52 ? 73  LYS A CE  1 
ATOM   139 N NZ  . LYS A 1 19 ? -12.324 -23.157 -6.735  1.00 67.00 ? 73  LYS A NZ  1 
ATOM   140 N N   . VAL A 1 20 ? -7.675  -24.368 -11.064 1.00 53.09 ? 74  VAL A N   1 
ATOM   141 C CA  . VAL A 1 20 ? -6.853  -23.164 -11.099 1.00 50.07 ? 74  VAL A CA  1 
ATOM   142 C C   . VAL A 1 20 ? -7.442  -22.038 -10.256 1.00 48.43 ? 74  VAL A C   1 
ATOM   143 O O   . VAL A 1 20 ? -8.638  -21.762 -10.328 1.00 49.96 ? 74  VAL A O   1 
ATOM   144 C CB  . VAL A 1 20 ? -6.699  -22.644 -12.545 1.00 49.30 ? 74  VAL A CB  1 
ATOM   145 C CG1 . VAL A 1 20 ? -5.869  -21.365 -12.568 1.00 48.64 ? 74  VAL A CG1 1 
ATOM   146 C CG2 . VAL A 1 20 ? -6.059  -23.710 -13.406 1.00 49.60 ? 74  VAL A CG2 1 
ATOM   147 N N   . LEU A 1 21 ? -6.592  -21.393 -9.464  1.00 45.24 ? 75  LEU A N   1 
ATOM   148 C CA  . LEU A 1 21 ? -7.006  -20.279 -8.625  1.00 43.45 ? 75  LEU A CA  1 
ATOM   149 C C   . LEU A 1 21 ? -6.073  -19.085 -8.819  1.00 42.31 ? 75  LEU A C   1 
ATOM   150 O O   . LEU A 1 21 ? -4.878  -19.257 -9.092  1.00 41.83 ? 75  LEU A O   1 
ATOM   151 C CB  . LEU A 1 21 ? -7.009  -20.694 -7.157  1.00 43.52 ? 75  LEU A CB  1 
ATOM   152 C CG  . LEU A 1 21 ? -7.991  -21.788 -6.758  1.00 43.33 ? 75  LEU A CG  1 
ATOM   153 C CD1 . LEU A 1 21 ? -7.288  -23.116 -6.729  1.00 42.04 ? 75  LEU A CD1 1 
ATOM   154 C CD2 . LEU A 1 21 ? -8.563  -21.470 -5.394  1.00 44.05 ? 75  LEU A CD2 1 
ATOM   155 N N   . TYR A 1 22 ? -6.626  -17.880 -8.680  1.00 40.69 ? 76  TYR A N   1 
ATOM   156 C CA  . TYR A 1 22 ? -5.861  -16.633 -8.834  1.00 39.66 ? 76  TYR A CA  1 
ATOM   157 C C   . TYR A 1 22 ? -5.996  -15.717 -7.619  1.00 37.28 ? 76  TYR A C   1 
ATOM   158 O O   . TYR A 1 22 ? -7.099  -15.504 -7.130  1.00 35.44 ? 76  TYR A O   1 
ATOM   159 C CB  . TYR A 1 22 ? -6.349  -15.833 -10.051 1.00 41.40 ? 76  TYR A CB  1 
ATOM   160 C CG  . TYR A 1 22 ? -6.058  -16.428 -11.406 1.00 41.76 ? 76  TYR A CG  1 
ATOM   161 C CD1 . TYR A 1 22 ? -4.742  -16.672 -11.819 1.00 42.01 ? 76  TYR A CD1 1 
ATOM   162 C CD2 . TYR A 1 22 ? -7.101  -16.717 -12.295 1.00 42.63 ? 76  TYR A CD2 1 
ATOM   163 C CE1 . TYR A 1 22 ? -4.461  -17.192 -13.090 1.00 42.27 ? 76  TYR A CE1 1 
ATOM   164 C CE2 . TYR A 1 22 ? -6.838  -17.233 -13.571 1.00 44.71 ? 76  TYR A CE2 1 
ATOM   165 C CZ  . TYR A 1 22 ? -5.513  -17.469 -13.962 1.00 46.34 ? 76  TYR A CZ  1 
ATOM   166 O OH  . TYR A 1 22 ? -5.245  -17.974 -15.221 1.00 49.50 ? 76  TYR A OH  1 
ATOM   167 N N   . LYS A 1 23 ? -4.883  -15.170 -7.137  1.00 34.98 ? 77  LYS A N   1 
ATOM   168 C CA  . LYS A 1 23 ? -4.942  -14.245 -6.009  1.00 35.20 ? 77  LYS A CA  1 
ATOM   169 C C   . LYS A 1 23 ? -5.209  -12.877 -6.651  1.00 35.88 ? 77  LYS A C   1 
ATOM   170 O O   . LYS A 1 23 ? -4.475  -12.422 -7.542  1.00 36.64 ? 77  LYS A O   1 
ATOM   171 C CB  . LYS A 1 23 ? -3.630  -14.247 -5.214  1.00 35.13 ? 77  LYS A CB  1 
ATOM   172 C CG  . LYS A 1 23 ? -3.770  -13.639 -3.821  1.00 37.24 ? 77  LYS A CG  1 
ATOM   173 C CD  . LYS A 1 23 ? -2.721  -14.159 -2.849  1.00 40.28 ? 77  LYS A CD  1 
ATOM   174 C CE  . LYS A 1 23 ? -1.313  -13.736 -3.252  1.00 45.71 ? 77  LYS A CE  1 
ATOM   175 N NZ  . LYS A 1 23 ? -0.235  -14.296 -2.371  1.00 47.49 ? 77  LYS A NZ  1 
ATOM   176 N N   . VAL A 1 24 ? -6.275  -12.227 -6.201  1.00 35.60 ? 78  VAL A N   1 
ATOM   177 C CA  . VAL A 1 24 ? -6.686  -10.965 -6.782  1.00 35.12 ? 78  VAL A CA  1 
ATOM   178 C C   . VAL A 1 24 ? -6.519  -9.743  -5.894  1.00 34.89 ? 78  VAL A C   1 
ATOM   179 O O   . VAL A 1 24 ? -6.819  -9.765  -4.706  1.00 32.83 ? 78  VAL A O   1 
ATOM   180 C CB  . VAL A 1 24 ? -8.176  -11.066 -7.265  1.00 34.02 ? 78  VAL A CB  1 
ATOM   181 C CG1 . VAL A 1 24 ? -8.614  -9.796  -7.974  1.00 33.08 ? 78  VAL A CG1 1 
ATOM   182 C CG2 . VAL A 1 24 ? -8.325  -12.236 -8.193  1.00 33.05 ? 78  VAL A CG2 1 
ATOM   183 N N   . ARG A 1 25 ? -6.004  -8.685  -6.514  1.00 37.27 ? 79  ARG A N   1 
ATOM   184 C CA  . ARG A 1 25 ? -5.806  -7.385  -5.879  1.00 39.24 ? 79  ARG A CA  1 
ATOM   185 C C   . ARG A 1 25 ? -6.979  -6.585  -6.404  1.00 40.47 ? 79  ARG A C   1 
ATOM   186 O O   . ARG A 1 25 ? -7.075  -6.358  -7.612  1.00 41.09 ? 79  ARG A O   1 
ATOM   187 C CB  . ARG A 1 25 ? -4.507  -6.732  -6.357  1.00 37.94 ? 79  ARG A CB  1 
ATOM   188 C CG  . ARG A 1 25 ? -4.341  -5.285  -5.924  1.00 36.10 ? 79  ARG A CG  1 
ATOM   189 C CD  . ARG A 1 25 ? -4.361  -5.141  -4.404  1.00 37.24 ? 79  ARG A CD  1 
ATOM   190 N NE  . ARG A 1 25 ? -3.445  -6.065  -3.735  1.00 38.82 ? 79  ARG A NE  1 
ATOM   191 C CZ  . ARG A 1 25 ? -2.116  -5.954  -3.720  1.00 40.94 ? 79  ARG A CZ  1 
ATOM   192 N NH1 . ARG A 1 25 ? -1.509  -4.953  -4.336  1.00 40.03 ? 79  ARG A NH1 1 
ATOM   193 N NH2 . ARG A 1 25 ? -1.383  -6.851  -3.078  1.00 41.89 ? 79  ARG A NH2 1 
ATOM   194 N N   . TRP A 1 26 ? -7.874  -6.182  -5.504  1.00 40.56 ? 80  TRP A N   1 
ATOM   195 C CA  . TRP A 1 26 ? -9.061  -5.427  -5.878  1.00 39.22 ? 80  TRP A CA  1 
ATOM   196 C C   . TRP A 1 26 ? -8.763  -3.941  -5.945  1.00 40.66 ? 80  TRP A C   1 
ATOM   197 O O   . TRP A 1 26 ? -8.120  -3.380  -5.056  1.00 40.67 ? 80  TRP A O   1 
ATOM   198 C CB  . TRP A 1 26 ? -10.195 -5.715  -4.885  1.00 37.77 ? 80  TRP A CB  1 
ATOM   199 C CG  . TRP A 1 26 ? -10.473 -7.180  -4.763  1.00 36.61 ? 80  TRP A CG  1 
ATOM   200 C CD1 . TRP A 1 26 ? -9.952  -8.036  -3.840  1.00 35.72 ? 80  TRP A CD1 1 
ATOM   201 C CD2 . TRP A 1 26 ? -11.231 -7.988  -5.675  1.00 38.08 ? 80  TRP A CD2 1 
ATOM   202 N NE1 . TRP A 1 26 ? -10.329 -9.328  -4.123  1.00 35.85 ? 80  TRP A NE1 1 
ATOM   203 C CE2 . TRP A 1 26 ? -11.114 -9.325  -5.246  1.00 37.50 ? 80  TRP A CE2 1 
ATOM   204 C CE3 . TRP A 1 26 ? -11.999 -7.708  -6.820  1.00 39.78 ? 80  TRP A CE3 1 
ATOM   205 C CZ2 . TRP A 1 26 ? -11.735 -10.389 -5.923  1.00 39.00 ? 80  TRP A CZ2 1 
ATOM   206 C CZ3 . TRP A 1 26 ? -12.617 -8.764  -7.492  1.00 38.99 ? 80  TRP A CZ3 1 
ATOM   207 C CH2 . TRP A 1 26 ? -12.480 -10.086 -7.041  1.00 40.17 ? 80  TRP A CH2 1 
ATOM   208 N N   . LYS A 1 27 ? -9.217  -3.304  -7.018  1.00 42.43 ? 81  LYS A N   1 
ATOM   209 C CA  . LYS A 1 27 ? -8.973  -1.881  -7.174  1.00 45.44 ? 81  LYS A CA  1 
ATOM   210 C C   . LYS A 1 27 ? -9.582  -1.086  -6.015  1.00 46.11 ? 81  LYS A C   1 
ATOM   211 O O   . LYS A 1 27 ? -10.756 -1.252  -5.671  1.00 45.99 ? 81  LYS A O   1 
ATOM   212 C CB  . LYS A 1 27 ? -9.522  -1.374  -8.510  1.00 45.44 ? 81  LYS A CB  1 
ATOM   213 C CG  . LYS A 1 27 ? -9.034  0.026   -8.809  1.00 51.50 ? 81  LYS A CG  1 
ATOM   214 C CD  . LYS A 1 27 ? -9.594  0.629   -10.082 1.00 54.13 ? 81  LYS A CD  1 
ATOM   215 C CE  . LYS A 1 27 ? -9.126  2.082   -10.202 1.00 56.57 ? 81  LYS A CE  1 
ATOM   216 N NZ  . LYS A 1 27 ? -9.653  2.790   -11.411 1.00 58.82 ? 81  LYS A NZ  1 
ATOM   217 N N   . GLY A 1 28 ? -8.765  -0.231  -5.406  1.00 46.39 ? 82  GLY A N   1 
ATOM   218 C CA  . GLY A 1 28 ? -9.232  0.578   -4.295  1.00 47.42 ? 82  GLY A CA  1 
ATOM   219 C C   . GLY A 1 28 ? -9.080  -0.091  -2.938  1.00 47.62 ? 82  GLY A C   1 
ATOM   220 O O   . GLY A 1 28 ? -9.389  0.508   -1.907  1.00 48.22 ? 82  GLY A O   1 
ATOM   221 N N   . TYR A 1 29 ? -8.612  -1.335  -2.930  1.00 45.74 ? 83  TYR A N   1 
ATOM   222 C CA  . TYR A 1 29 ? -8.424  -2.056  -1.682  1.00 44.02 ? 83  TYR A CA  1 
ATOM   223 C C   . TYR A 1 29 ? -6.940  -2.327  -1.460  1.00 44.45 ? 83  TYR A C   1 
ATOM   224 O O   . TYR A 1 29 ? -6.162  -2.336  -2.412  1.00 46.03 ? 83  TYR A O   1 
ATOM   225 C CB  . TYR A 1 29 ? -9.190  -3.382  -1.719  1.00 41.52 ? 83  TYR A CB  1 
ATOM   226 C CG  . TYR A 1 29 ? -10.701 -3.258  -1.681  1.00 39.14 ? 83  TYR A CG  1 
ATOM   227 C CD1 . TYR A 1 29 ? -11.399 -3.375  -0.481  1.00 39.86 ? 83  TYR A CD1 1 
ATOM   228 C CD2 . TYR A 1 29 ? -11.434 -3.033  -2.848  1.00 38.99 ? 83  TYR A CD2 1 
ATOM   229 C CE1 . TYR A 1 29 ? -12.793 -3.273  -0.444  1.00 38.00 ? 83  TYR A CE1 1 
ATOM   230 C CE2 . TYR A 1 29 ? -12.823 -2.929  -2.822  1.00 36.37 ? 83  TYR A CE2 1 
ATOM   231 C CZ  . TYR A 1 29 ? -13.492 -3.050  -1.617  1.00 38.35 ? 83  TYR A CZ  1 
ATOM   232 O OH  . TYR A 1 29 ? -14.858 -2.949  -1.578  1.00 39.15 ? 83  TYR A OH  1 
ATOM   233 N N   . THR A 1 30 ? -6.557  -2.534  -0.199  1.00 43.91 ? 84  THR A N   1 
ATOM   234 C CA  . THR A 1 30 ? -5.176  -2.830  0.170   1.00 42.41 ? 84  THR A CA  1 
ATOM   235 C C   . THR A 1 30 ? -4.968  -4.337  0.064   1.00 42.12 ? 84  THR A C   1 
ATOM   236 O O   . THR A 1 30 ? -5.920  -5.077  -0.163  1.00 40.42 ? 84  THR A O   1 
ATOM   237 C CB  . THR A 1 30 ? -4.865  -2.416  1.625   1.00 42.28 ? 84  THR A CB  1 
ATOM   238 O OG1 . THR A 1 30 ? -5.580  -3.268  2.523   1.00 45.15 ? 84  THR A OG1 1 
ATOM   239 C CG2 . THR A 1 30 ? -5.269  -0.981  1.880   1.00 42.24 ? 84  THR A CG2 1 
ATOM   240 N N   . SER A 1 31 ? -3.727  -4.784  0.248   1.00 42.19 ? 85  SER A N   1 
ATOM   241 C CA  . SER A 1 31 ? -3.396  -6.207  0.160   1.00 43.27 ? 85  SER A CA  1 
ATOM   242 C C   . SER A 1 31 ? -4.050  -7.064  1.243   1.00 43.71 ? 85  SER A C   1 
ATOM   243 O O   . SER A 1 31 ? -4.062  -8.294  1.150   1.00 42.07 ? 85  SER A O   1 
ATOM   244 C CB  . SER A 1 31 ? -1.875  -6.407  0.187   1.00 42.88 ? 85  SER A CB  1 
ATOM   245 O OG  . SER A 1 31 ? -1.309  -5.924  1.389   1.00 44.60 ? 85  SER A OG  1 
ATOM   246 N N   . ASP A 1 32 ? -4.593  -6.413  2.266   1.00 44.35 ? 86  ASP A N   1 
ATOM   247 C CA  . ASP A 1 32 ? -5.271  -7.117  3.353   1.00 45.89 ? 86  ASP A CA  1 
ATOM   248 C C   . ASP A 1 32 ? -6.601  -7.665  2.857   1.00 45.59 ? 86  ASP A C   1 
ATOM   249 O O   . ASP A 1 32 ? -7.291  -8.381  3.569   1.00 46.14 ? 86  ASP A O   1 
ATOM   250 C CB  . ASP A 1 32 ? -5.533  -6.166  4.524   1.00 46.60 ? 86  ASP A CB  1 
ATOM   251 C CG  . ASP A 1 32 ? -4.262  -5.737  5.219   1.00 47.65 ? 86  ASP A CG  1 
ATOM   252 O OD1 . ASP A 1 32 ? -3.167  -5.953  4.662   1.00 47.71 ? 86  ASP A OD1 1 
ATOM   253 O OD2 . ASP A 1 32 ? -4.358  -5.172  6.324   1.00 52.59 ? 86  ASP A OD2 1 
ATOM   254 N N   . ASP A 1 33 ? -6.953  -7.311  1.629   1.00 45.27 ? 87  ASP A N   1 
ATOM   255 C CA  . ASP A 1 33 ? -8.198  -7.750  1.039   1.00 44.27 ? 87  ASP A CA  1 
ATOM   256 C C   . ASP A 1 33 ? -8.006  -8.637  -0.184  1.00 42.28 ? 87  ASP A C   1 
ATOM   257 O O   . ASP A 1 33 ? -8.957  -8.887  -0.924  1.00 42.27 ? 87  ASP A O   1 
ATOM   258 C CB  . ASP A 1 33 ? -9.050  -6.535  0.677   1.00 46.66 ? 87  ASP A CB  1 
ATOM   259 C CG  . ASP A 1 33 ? -9.977  -6.127  1.799   1.00 50.44 ? 87  ASP A CG  1 
ATOM   260 O OD1 . ASP A 1 33 ? -10.783 -6.989  2.206   1.00 52.27 ? 87  ASP A OD1 1 
ATOM   261 O OD2 . ASP A 1 33 ? -9.911  -4.967  2.277   1.00 50.67 ? 87  ASP A OD2 1 
ATOM   262 N N   . ASP A 1 34 ? -6.783  -9.111  -0.398  1.00 39.24 ? 88  ASP A N   1 
ATOM   263 C CA  . ASP A 1 34 ? -6.512  -9.985  -1.534  1.00 38.09 ? 88  ASP A CA  1 
ATOM   264 C C   . ASP A 1 34 ? -7.175  -11.305 -1.244  1.00 36.83 ? 88  ASP A C   1 
ATOM   265 O O   . ASP A 1 34 ? -7.107  -11.801 -0.121  1.00 38.09 ? 88  ASP A O   1 
ATOM   266 C CB  . ASP A 1 34 ? -5.010  -10.227 -1.735  1.00 38.66 ? 88  ASP A CB  1 
ATOM   267 C CG  . ASP A 1 34 ? -4.237  -8.953  -2.051  1.00 40.70 ? 88  ASP A CG  1 
ATOM   268 O OD1 . ASP A 1 34 ? -4.826  -7.994  -2.610  1.00 41.60 ? 88  ASP A OD1 1 
ATOM   269 O OD2 . ASP A 1 34 ? -3.023  -8.924  -1.753  1.00 40.84 ? 88  ASP A OD2 1 
ATOM   270 N N   . THR A 1 35 ? -7.803  -11.879 -2.260  1.00 36.11 ? 89  THR A N   1 
ATOM   271 C CA  . THR A 1 35 ? -8.494  -13.150 -2.118  1.00 35.97 ? 89  THR A CA  1 
ATOM   272 C C   . THR A 1 35 ? -8.171  -14.129 -3.242  1.00 37.06 ? 89  THR A C   1 
ATOM   273 O O   . THR A 1 35 ? -7.858  -13.723 -4.356  1.00 37.27 ? 89  THR A O   1 
ATOM   274 C CB  . THR A 1 35 ? -10.010 -12.930 -2.120  1.00 36.68 ? 89  THR A CB  1 
ATOM   275 O OG1 . THR A 1 35 ? -10.382 -12.219 -3.310  1.00 36.94 ? 89  THR A OG1 1 
ATOM   276 C CG2 . THR A 1 35 ? -10.440 -12.129 -0.895  1.00 34.85 ? 89  THR A CG2 1 
ATOM   277 N N   . TRP A 1 36 ? -8.235  -15.423 -2.943  1.00 37.30 ? 90  TRP A N   1 
ATOM   278 C CA  . TRP A 1 36 ? -8.004  -16.442 -3.956  1.00 36.04 ? 90  TRP A CA  1 
ATOM   279 C C   . TRP A 1 36 ? -9.360  -16.693 -4.599  1.00 38.72 ? 90  TRP A C   1 
ATOM   280 O O   . TRP A 1 36 ? -10.349 -16.982 -3.919  1.00 37.61 ? 90  TRP A O   1 
ATOM   281 C CB  . TRP A 1 36 ? -7.471  -17.742 -3.350  1.00 33.60 ? 90  TRP A CB  1 
ATOM   282 C CG  . TRP A 1 36 ? -6.018  -17.688 -2.965  1.00 32.42 ? 90  TRP A CG  1 
ATOM   283 C CD1 . TRP A 1 36 ? -5.503  -17.447 -1.720  1.00 30.34 ? 90  TRP A CD1 1 
ATOM   284 C CD2 . TRP A 1 36 ? -4.892  -17.856 -3.840  1.00 31.54 ? 90  TRP A CD2 1 
ATOM   285 N NE1 . TRP A 1 36 ? -4.129  -17.457 -1.770  1.00 30.83 ? 90  TRP A NE1 1 
ATOM   286 C CE2 . TRP A 1 36 ? -3.728  -17.703 -3.058  1.00 31.38 ? 90  TRP A CE2 1 
ATOM   287 C CE3 . TRP A 1 36 ? -4.755  -18.119 -5.215  1.00 32.22 ? 90  TRP A CE3 1 
ATOM   288 C CZ2 . TRP A 1 36 ? -2.442  -17.805 -3.602  1.00 30.45 ? 90  TRP A CZ2 1 
ATOM   289 C CZ3 . TRP A 1 36 ? -3.475  -18.220 -5.755  1.00 30.13 ? 90  TRP A CZ3 1 
ATOM   290 C CH2 . TRP A 1 36 ? -2.338  -18.062 -4.950  1.00 30.70 ? 90  TRP A CH2 1 
ATOM   291 N N   . GLU A 1 37 ? -9.402  -16.573 -5.917  1.00 40.85 ? 91  GLU A N   1 
ATOM   292 C CA  . GLU A 1 37 ? -10.636 -16.756 -6.652  1.00 42.85 ? 91  GLU A CA  1 
ATOM   293 C C   . GLU A 1 37 ? -10.547 -17.872 -7.677  1.00 44.32 ? 91  GLU A C   1 
ATOM   294 O O   . GLU A 1 37 ? -9.485  -18.125 -8.248  1.00 45.03 ? 91  GLU A O   1 
ATOM   295 C CB  . GLU A 1 37 ? -11.004 -15.457 -7.376  1.00 43.13 ? 91  GLU A CB  1 
ATOM   296 C CG  . GLU A 1 37 ? -11.241 -14.249 -6.478  1.00 46.27 ? 91  GLU A CG  1 
ATOM   297 C CD  . GLU A 1 37 ? -12.460 -14.393 -5.572  1.00 46.87 ? 91  GLU A CD  1 
ATOM   298 O OE1 . GLU A 1 37 ? -13.408 -15.114 -5.957  1.00 46.55 ? 91  GLU A OE1 1 
ATOM   299 O OE2 . GLU A 1 37 ? -12.473 -13.766 -4.484  1.00 48.74 ? 91  GLU A OE2 1 
ATOM   300 N N   . PRO A 1 38 ? -11.667 -18.576 -7.908  1.00 46.95 ? 92  PRO A N   1 
ATOM   301 C CA  . PRO A 1 38 ? -11.635 -19.650 -8.903  1.00 47.42 ? 92  PRO A CA  1 
ATOM   302 C C   . PRO A 1 38 ? -11.482 -19.016 -10.283 1.00 47.47 ? 92  PRO A C   1 
ATOM   303 O O   . PRO A 1 38 ? -12.007 -17.938 -10.549 1.00 47.27 ? 92  PRO A O   1 
ATOM   304 C CB  . PRO A 1 38 ? -12.984 -20.343 -8.711  1.00 47.70 ? 92  PRO A CB  1 
ATOM   305 C CG  . PRO A 1 38 ? -13.864 -19.249 -8.185  1.00 47.06 ? 92  PRO A CG  1 
ATOM   306 C CD  . PRO A 1 38 ? -12.968 -18.536 -7.212  1.00 46.16 ? 92  PRO A CD  1 
ATOM   307 N N   . GLU A 1 39 ? -10.737 -19.684 -11.146 1.00 48.22 ? 93  GLU A N   1 
ATOM   308 C CA  . GLU A 1 39 ? -10.490 -19.203 -12.495 1.00 50.85 ? 93  GLU A CA  1 
ATOM   309 C C   . GLU A 1 39 ? -11.703 -18.632 -13.255 1.00 50.98 ? 93  GLU A C   1 
ATOM   310 O O   . GLU A 1 39 ? -11.609 -17.564 -13.850 1.00 50.81 ? 93  GLU A O   1 
ATOM   311 C CB  . GLU A 1 39 ? -9.848  -20.332 -13.294 1.00 51.03 ? 93  GLU A CB  1 
ATOM   312 C CG  . GLU A 1 39 ? -9.643  -20.029 -14.754 1.00 58.21 ? 93  GLU A CG  1 
ATOM   313 C CD  . GLU A 1 39 ? -8.974  -21.172 -15.478 1.00 60.30 ? 93  GLU A CD  1 
ATOM   314 O OE1 . GLU A 1 39 ? -9.489  -22.310 -15.403 1.00 61.15 ? 93  GLU A OE1 1 
ATOM   315 O OE2 . GLU A 1 39 ? -7.932  -20.932 -16.120 1.00 63.47 ? 93  GLU A OE2 1 
ATOM   316 N N   . ILE A 1 40 ? -12.831 -19.333 -13.241 1.00 53.35 ? 94  ILE A N   1 
ATOM   317 C CA  . ILE A 1 40 ? -14.034 -18.870 -13.949 1.00 56.69 ? 94  ILE A CA  1 
ATOM   318 C C   . ILE A 1 40 ? -14.457 -17.438 -13.628 1.00 57.94 ? 94  ILE A C   1 
ATOM   319 O O   . ILE A 1 40 ? -15.155 -16.796 -14.421 1.00 58.91 ? 94  ILE A O   1 
ATOM   320 C CB  . ILE A 1 40 ? -15.260 -19.774 -13.665 1.00 57.32 ? 94  ILE A CB  1 
ATOM   321 C CG1 . ILE A 1 40 ? -15.600 -19.741 -12.170 1.00 58.02 ? 94  ILE A CG1 1 
ATOM   322 C CG2 . ILE A 1 40 ? -14.981 -21.192 -14.148 1.00 58.35 ? 94  ILE A CG2 1 
ATOM   323 C CD1 . ILE A 1 40 ? -16.852 -20.515 -11.804 1.00 59.19 ? 94  ILE A CD1 1 
ATOM   324 N N   . HIS A 1 41 ? -14.050 -16.946 -12.463 1.00 58.31 ? 95  HIS A N   1 
ATOM   325 C CA  . HIS A 1 41 ? -14.389 -15.593 -12.051 1.00 58.66 ? 95  HIS A CA  1 
ATOM   326 C C   . HIS A 1 41 ? -13.641 -14.503 -12.788 1.00 59.03 ? 95  HIS A C   1 
ATOM   327 O O   . HIS A 1 41 ? -14.029 -13.337 -12.724 1.00 57.98 ? 95  HIS A O   1 
ATOM   328 C CB  . HIS A 1 41 ? -14.144 -15.424 -10.559 1.00 59.22 ? 95  HIS A CB  1 
ATOM   329 C CG  . HIS A 1 41 ? -15.202 -16.043 -9.710  1.00 60.77 ? 95  HIS A CG  1 
ATOM   330 N ND1 . HIS A 1 41 ? -15.310 -15.794 -8.359  1.00 62.25 ? 95  HIS A ND1 1 
ATOM   331 C CD2 . HIS A 1 41 ? -16.223 -16.872 -10.026 1.00 60.91 ? 95  HIS A CD2 1 
ATOM   332 C CE1 . HIS A 1 41 ? -16.358 -16.439 -7.880  1.00 63.04 ? 95  HIS A CE1 1 
ATOM   333 N NE2 . HIS A 1 41 ? -16.929 -17.101 -8.871  1.00 63.47 ? 95  HIS A NE2 1 
ATOM   334 N N   . LEU A 1 42 ? -12.579 -14.877 -13.495 1.00 60.59 ? 96  LEU A N   1 
ATOM   335 C CA  . LEU A 1 42 ? -11.774 -13.895 -14.203 1.00 63.33 ? 96  LEU A CA  1 
ATOM   336 C C   . LEU A 1 42 ? -11.678 -14.083 -15.711 1.00 65.93 ? 96  LEU A C   1 
ATOM   337 O O   . LEU A 1 42 ? -11.103 -13.247 -16.411 1.00 66.70 ? 96  LEU A O   1 
ATOM   338 C CB  . LEU A 1 42 ? -10.362 -13.867 -13.604 1.00 61.79 ? 96  LEU A CB  1 
ATOM   339 C CG  . LEU A 1 42 ? -10.273 -13.486 -12.123 1.00 61.72 ? 96  LEU A CG  1 
ATOM   340 C CD1 . LEU A 1 42 ? -10.530 -14.707 -11.264 1.00 60.99 ? 96  LEU A CD1 1 
ATOM   341 C CD2 . LEU A 1 42 ? -8.917  -12.914 -11.821 1.00 61.51 ? 96  LEU A CD2 1 
ATOM   342 N N   . GLU A 1 43 ? -12.251 -15.166 -16.217 1.00 68.36 ? 97  GLU A N   1 
ATOM   343 C CA  . GLU A 1 43 ? -12.185 -15.452 -17.646 1.00 70.51 ? 97  GLU A CA  1 
ATOM   344 C C   . GLU A 1 43 ? -12.567 -14.291 -18.583 1.00 69.38 ? 97  GLU A C   1 
ATOM   345 O O   . GLU A 1 43 ? -12.064 -14.210 -19.707 1.00 68.43 ? 97  GLU A O   1 
ATOM   346 C CB  . GLU A 1 43 ? -13.011 -16.712 -17.948 1.00 72.91 ? 97  GLU A CB  1 
ATOM   347 C CG  . GLU A 1 43 ? -12.589 -17.889 -17.064 1.00 78.14 ? 97  GLU A CG  1 
ATOM   348 C CD  . GLU A 1 43 ? -13.139 -19.233 -17.516 1.00 81.49 ? 97  GLU A CD  1 
ATOM   349 O OE1 . GLU A 1 43 ? -14.360 -19.330 -17.759 1.00 83.17 ? 97  GLU A OE1 1 
ATOM   350 O OE2 . GLU A 1 43 ? -12.347 -20.200 -17.615 1.00 82.18 ? 97  GLU A OE2 1 
ATOM   351 N N   . ASP A 1 44 ? -13.434 -13.389 -18.131 1.00 68.17 ? 98  ASP A N   1 
ATOM   352 C CA  . ASP A 1 44 ? -13.828 -12.263 -18.973 1.00 68.28 ? 98  ASP A CA  1 
ATOM   353 C C   . ASP A 1 44 ? -13.010 -11.010 -18.692 1.00 67.83 ? 98  ASP A C   1 
ATOM   354 O O   . ASP A 1 44 ? -13.345 -9.921  -19.161 1.00 68.64 ? 98  ASP A O   1 
ATOM   355 C CB  . ASP A 1 44 ? -15.325 -11.953 -18.822 1.00 68.96 ? 98  ASP A CB  1 
ATOM   356 C CG  . ASP A 1 44 ? -16.213 -12.970 -19.538 1.00 70.15 ? 98  ASP A CG  1 
ATOM   357 O OD1 . ASP A 1 44 ? -15.893 -13.342 -20.693 1.00 67.01 ? 98  ASP A OD1 1 
ATOM   358 O OD2 . ASP A 1 44 ? -17.238 -13.386 -18.950 1.00 70.19 ? 98  ASP A OD2 1 
ATOM   359 N N   . CYS A 1 45 ? -11.940 -11.173 -17.920 1.00 66.79 ? 99  CYS A N   1 
ATOM   360 C CA  . CYS A 1 45 ? -11.035 -10.075 -17.587 1.00 65.22 ? 99  CYS A CA  1 
ATOM   361 C C   . CYS A 1 45 ? -9.729  -10.358 -18.318 1.00 66.18 ? 99  CYS A C   1 
ATOM   362 O O   . CYS A 1 45 ? -8.685  -10.541 -17.696 1.00 65.42 ? 99  CYS A O   1 
ATOM   363 C CB  . CYS A 1 45 ? -10.776 -10.029 -16.079 1.00 63.63 ? 99  CYS A CB  1 
ATOM   364 S SG  . CYS A 1 45 ? -12.204 -9.593  -15.082 1.00 58.98 ? 99  CYS A SG  1 
ATOM   365 N N   . LYS A 1 46 ? -9.798  -10.392 -19.646 1.00 67.69 ? 100 LYS A N   1 
ATOM   366 C CA  . LYS A 1 46 ? -8.636  -10.698 -20.474 1.00 67.22 ? 100 LYS A CA  1 
ATOM   367 C C   . LYS A 1 46 ? -7.474  -9.715  -20.432 1.00 65.93 ? 100 LYS A C   1 
ATOM   368 O O   . LYS A 1 46 ? -6.330  -10.117 -20.639 1.00 65.14 ? 100 LYS A O   1 
ATOM   369 C CB  . LYS A 1 46 ? -9.074  -10.930 -21.921 1.00 69.89 ? 100 LYS A CB  1 
ATOM   370 C CG  . LYS A 1 46 ? -9.818  -12.251 -22.128 1.00 71.85 ? 100 LYS A CG  1 
ATOM   371 C CD  . LYS A 1 46 ? -9.850  -12.638 -23.598 1.00 73.87 ? 100 LYS A CD  1 
ATOM   372 C CE  . LYS A 1 46 ? -10.447 -14.022 -23.804 1.00 75.19 ? 100 LYS A CE  1 
ATOM   373 N NZ  . LYS A 1 46 ? -10.360 -14.447 -25.232 1.00 73.98 ? 100 LYS A NZ  1 
ATOM   374 N N   . GLU A 1 47 ? -7.751  -8.437  -20.178 1.00 64.51 ? 101 GLU A N   1 
ATOM   375 C CA  . GLU A 1 47 ? -6.678  -7.444  -20.090 1.00 63.51 ? 101 GLU A CA  1 
ATOM   376 C C   . GLU A 1 47 ? -5.814  -7.843  -18.900 1.00 60.13 ? 101 GLU A C   1 
ATOM   377 O O   . GLU A 1 47 ? -4.587  -7.796  -18.955 1.00 58.62 ? 101 GLU A O   1 
ATOM   378 C CB  . GLU A 1 47 ? -7.220  -6.043  -19.796 1.00 68.26 ? 101 GLU A CB  1 
ATOM   379 C CG  . GLU A 1 47 ? -8.261  -5.485  -20.743 1.00 74.05 ? 101 GLU A CG  1 
ATOM   380 C CD  . GLU A 1 47 ? -8.825  -4.162  -20.230 1.00 77.38 ? 101 GLU A CD  1 
ATOM   381 O OE1 . GLU A 1 47 ? -8.032  -3.213  -20.037 1.00 77.92 ? 101 GLU A OE1 1 
ATOM   382 O OE2 . GLU A 1 47 ? -10.054 -4.068  -20.008 1.00 80.16 ? 101 GLU A OE2 1 
ATOM   383 N N   . VAL A 1 48 ? -6.492  -8.217  -17.817 1.00 57.12 ? 102 VAL A N   1 
ATOM   384 C CA  . VAL A 1 48 ? -5.850  -8.626  -16.574 1.00 53.95 ? 102 VAL A CA  1 
ATOM   385 C C   . VAL A 1 48 ? -5.110  -9.958  -16.703 1.00 51.52 ? 102 VAL A C   1 
ATOM   386 O O   . VAL A 1 48 ? -3.977  -10.101 -16.229 1.00 50.81 ? 102 VAL A O   1 
ATOM   387 C CB  . VAL A 1 48 ? -6.897  -8.717  -15.443 1.00 52.84 ? 102 VAL A CB  1 
ATOM   388 C CG1 . VAL A 1 48 ? -6.248  -9.192  -14.148 1.00 52.24 ? 102 VAL A CG1 1 
ATOM   389 C CG2 . VAL A 1 48 ? -7.531  -7.358  -15.244 1.00 51.45 ? 102 VAL A CG2 1 
ATOM   390 N N   . LEU A 1 49 ? -5.749  -10.925 -17.350 1.00 49.80 ? 103 LEU A N   1 
ATOM   391 C CA  . LEU A 1 49 ? -5.148  -12.237 -17.545 1.00 49.90 ? 103 LEU A CA  1 
ATOM   392 C C   . LEU A 1 49 ? -3.891  -12.142 -18.404 1.00 51.43 ? 103 LEU A C   1 
ATOM   393 O O   . LEU A 1 49 ? -2.906  -12.845 -18.172 1.00 51.31 ? 103 LEU A O   1 
ATOM   394 C CB  . LEU A 1 49 ? -6.163  -13.175 -18.202 1.00 47.83 ? 103 LEU A CB  1 
ATOM   395 C CG  . LEU A 1 49 ? -7.381  -13.520 -17.338 1.00 48.28 ? 103 LEU A CG  1 
ATOM   396 C CD1 . LEU A 1 49 ? -8.515  -14.077 -18.184 1.00 46.78 ? 103 LEU A CD1 1 
ATOM   397 C CD2 . LEU A 1 49 ? -6.954  -14.504 -16.265 1.00 46.01 ? 103 LEU A CD2 1 
ATOM   398 N N   . LEU A 1 50 ? -3.929  -11.265 -19.401 1.00 54.34 ? 104 LEU A N   1 
ATOM   399 C CA  . LEU A 1 50 ? -2.801  -11.080 -20.304 1.00 55.41 ? 104 LEU A CA  1 
ATOM   400 C C   . LEU A 1 50 ? -1.615  -10.447 -19.589 1.00 54.42 ? 104 LEU A C   1 
ATOM   401 O O   . LEU A 1 50 ? -0.475  -10.870 -19.770 1.00 54.50 ? 104 LEU A O   1 
ATOM   402 C CB  . LEU A 1 50 ? -3.215  -10.199 -21.487 1.00 59.21 ? 104 LEU A CB  1 
ATOM   403 C CG  . LEU A 1 50 ? -2.182  -10.037 -22.610 1.00 61.35 ? 104 LEU A CG  1 
ATOM   404 C CD1 . LEU A 1 50 ? -1.902  -11.402 -23.238 1.00 61.06 ? 104 LEU A CD1 1 
ATOM   405 C CD2 . LEU A 1 50 ? -2.700  -9.056  -23.658 1.00 61.69 ? 104 LEU A CD2 1 
ATOM   406 N N   . GLU A 1 51 ? -1.892  -9.432  -18.778 1.00 52.88 ? 105 GLU A N   1 
ATOM   407 C CA  . GLU A 1 51 ? -0.849  -8.740  -18.043 1.00 53.23 ? 105 GLU A CA  1 
ATOM   408 C C   . GLU A 1 51 ? -0.167  -9.648  -17.031 1.00 52.23 ? 105 GLU A C   1 
ATOM   409 O O   . GLU A 1 51 ? 0.991   -9.422  -16.678 1.00 51.31 ? 105 GLU A O   1 
ATOM   410 C CB  . GLU A 1 51 ? -1.421  -7.517  -17.335 1.00 56.08 ? 105 GLU A CB  1 
ATOM   411 C CG  . GLU A 1 51 ? -0.361  -6.643  -16.710 1.00 62.40 ? 105 GLU A CG  1 
ATOM   412 C CD  . GLU A 1 51 ? 0.744   -6.282  -17.695 1.00 66.52 ? 105 GLU A CD  1 
ATOM   413 O OE1 . GLU A 1 51 ? 0.426   -5.774  -18.795 1.00 66.09 ? 105 GLU A OE1 1 
ATOM   414 O OE2 . GLU A 1 51 ? 1.931   -6.507  -17.363 1.00 69.96 ? 105 GLU A OE2 1 
ATOM   415 N N   . PHE A 1 52 ? -0.886  -10.666 -16.559 1.00 50.55 ? 106 PHE A N   1 
ATOM   416 C CA  . PHE A 1 52 ? -0.318  -11.621 -15.609 1.00 49.36 ? 106 PHE A CA  1 
ATOM   417 C C   . PHE A 1 52 ? 0.543   -12.645 -16.362 1.00 50.45 ? 106 PHE A C   1 
ATOM   418 O O   . PHE A 1 52 ? 1.584   -13.074 -15.869 1.00 48.62 ? 106 PHE A O   1 
ATOM   419 C CB  . PHE A 1 52 ? -1.427  -12.348 -14.830 1.00 46.03 ? 106 PHE A CB  1 
ATOM   420 C CG  . PHE A 1 52 ? -0.907  -13.360 -13.837 1.00 42.86 ? 106 PHE A CG  1 
ATOM   421 C CD1 . PHE A 1 52 ? -0.164  -12.954 -12.727 1.00 41.51 ? 106 PHE A CD1 1 
ATOM   422 C CD2 . PHE A 1 52 ? -1.106  -14.722 -14.043 1.00 40.72 ? 106 PHE A CD2 1 
ATOM   423 C CE1 . PHE A 1 52 ? 0.377   -13.893 -11.843 1.00 40.12 ? 106 PHE A CE1 1 
ATOM   424 C CE2 . PHE A 1 52 ? -0.570  -15.666 -13.170 1.00 38.55 ? 106 PHE A CE2 1 
ATOM   425 C CZ  . PHE A 1 52 ? 0.172   -15.253 -12.069 1.00 39.11 ? 106 PHE A CZ  1 
ATOM   426 N N   . ARG A 1 53 ? 0.107   -13.034 -17.559 1.00 54.06 ? 107 ARG A N   1 
ATOM   427 C CA  . ARG A 1 53 ? 0.859   -13.995 -18.365 1.00 57.94 ? 107 ARG A CA  1 
ATOM   428 C C   . ARG A 1 53 ? 2.226   -13.410 -18.726 1.00 58.21 ? 107 ARG A C   1 
ATOM   429 O O   . ARG A 1 53 ? 3.239   -14.110 -18.731 1.00 56.17 ? 107 ARG A O   1 
ATOM   430 C CB  . ARG A 1 53 ? 0.101   -14.337 -19.650 1.00 60.99 ? 107 ARG A CB  1 
ATOM   431 C CG  . ARG A 1 53 ? 0.835   -15.361 -20.521 1.00 67.79 ? 107 ARG A CG  1 
ATOM   432 C CD  . ARG A 1 53 ? 0.264   -15.456 -21.937 1.00 72.17 ? 107 ARG A CD  1 
ATOM   433 N NE  . ARG A 1 53 ? 0.630   -14.317 -22.782 1.00 76.54 ? 107 ARG A NE  1 
ATOM   434 C CZ  . ARG A 1 53 ? 1.863   -14.062 -23.219 1.00 78.19 ? 107 ARG A CZ  1 
ATOM   435 N NH1 . ARG A 1 53 ? 2.872   -14.861 -22.895 1.00 78.88 ? 107 ARG A NH1 1 
ATOM   436 N NH2 . ARG A 1 53 ? 2.087   -13.007 -23.992 1.00 78.87 ? 107 ARG A NH2 1 
ATOM   437 N N   . LYS A 1 54 ? 2.238   -12.116 -19.030 1.00 60.16 ? 108 LYS A N   1 
ATOM   438 C CA  . LYS A 1 54 ? 3.464   -11.417 -19.384 1.00 61.69 ? 108 LYS A CA  1 
ATOM   439 C C   . LYS A 1 54 ? 4.396   -11.340 -18.178 1.00 62.28 ? 108 LYS A C   1 
ATOM   440 O O   . LYS A 1 54 ? 5.551   -11.757 -18.247 1.00 61.74 ? 108 LYS A O   1 
ATOM   441 C CB  . LYS A 1 54 ? 3.141   -10.002 -19.866 1.00 62.58 ? 108 LYS A CB  1 
ATOM   442 C CG  . LYS A 1 54 ? 2.229   -9.938  -21.081 1.00 64.63 ? 108 LYS A CG  1 
ATOM   443 C CD  . LYS A 1 54 ? 1.905   -8.487  -21.442 1.00 66.47 ? 108 LYS A CD  1 
ATOM   444 C CE  . LYS A 1 54 ? 0.951   -8.390  -22.626 1.00 67.04 ? 108 LYS A CE  1 
ATOM   445 N NZ  . LYS A 1 54 ? 0.691   -6.968  -23.014 1.00 68.26 ? 108 LYS A NZ  1 
ATOM   446 N N   . LYS A 1 55 ? 3.888   -10.799 -17.075 1.00 62.75 ? 109 LYS A N   1 
ATOM   447 C CA  . LYS A 1 55 ? 4.681   -10.665 -15.860 1.00 64.75 ? 109 LYS A CA  1 
ATOM   448 C C   . LYS A 1 55 ? 5.387   -11.960 -15.474 1.00 65.11 ? 109 LYS A C   1 
ATOM   449 O O   . LYS A 1 55 ? 6.482   -11.935 -14.924 1.00 65.19 ? 109 LYS A O   1 
ATOM   450 C CB  . LYS A 1 55 ? 3.803   -10.211 -14.689 1.00 65.35 ? 109 LYS A CB  1 
ATOM   451 C CG  . LYS A 1 55 ? 4.483   -10.366 -13.329 1.00 66.20 ? 109 LYS A CG  1 
ATOM   452 C CD  . LYS A 1 55 ? 3.498   -10.245 -12.175 1.00 66.86 ? 109 LYS A CD  1 
ATOM   453 C CE  . LYS A 1 55 ? 4.161   -10.582 -10.847 1.00 66.38 ? 109 LYS A CE  1 
ATOM   454 N NZ  . LYS A 1 55 ? 3.219   -10.458 -9.701  1.00 67.15 ? 109 LYS A NZ  1 
ATOM   455 N N   . ILE A 1 56 ? 4.762   -13.092 -15.759 1.00 66.42 ? 110 ILE A N   1 
ATOM   456 C CA  . ILE A 1 56 ? 5.367   -14.361 -15.398 1.00 69.34 ? 110 ILE A CA  1 
ATOM   457 C C   . ILE A 1 56 ? 6.337   -14.856 -16.471 1.00 70.68 ? 110 ILE A C   1 
ATOM   458 O O   . ILE A 1 56 ? 7.301   -15.562 -16.169 1.00 70.69 ? 110 ILE A O   1 
ATOM   459 C CB  . ILE A 1 56 ? 4.279   -15.433 -15.119 1.00 70.15 ? 110 ILE A CB  1 
ATOM   460 C CG1 . ILE A 1 56 ? 4.915   -16.678 -14.508 1.00 69.66 ? 110 ILE A CG1 1 
ATOM   461 C CG2 . ILE A 1 56 ? 3.555   -15.793 -16.405 1.00 71.40 ? 110 ILE A CG2 1 
ATOM   462 C CD1 . ILE A 1 56 ? 3.916   -17.745 -14.128 1.00 70.27 ? 110 ILE A CD1 1 
ATOM   463 N N   . ALA A 1 57 ? 6.090   -14.480 -17.722 1.00 71.69 ? 111 ALA A N   1 
ATOM   464 C CA  . ALA A 1 57 ? 6.967   -14.896 -18.813 1.00 73.04 ? 111 ALA A CA  1 
ATOM   465 C C   . ALA A 1 57 ? 8.307   -14.174 -18.718 1.00 73.23 ? 111 ALA A C   1 
ATOM   466 O O   . ALA A 1 57 ? 9.355   -14.777 -18.915 1.00 72.27 ? 111 ALA A O   1 
ATOM   467 C CB  . ALA A 1 57 ? 6.311   -14.612 -20.166 1.00 73.09 ? 111 ALA A CB  1 
ATOM   468 N N   . GLU A 1 58 ? 8.264   -12.883 -18.401 1.00 74.86 ? 112 GLU A N   1 
ATOM   469 C CA  . GLU A 1 58 ? 9.475   -12.081 -18.285 1.00 77.41 ? 112 GLU A CA  1 
ATOM   470 C C   . GLU A 1 58 ? 10.235  -12.328 -16.991 1.00 78.96 ? 112 GLU A C   1 
ATOM   471 O O   . GLU A 1 58 ? 11.258  -11.695 -16.739 1.00 79.20 ? 112 GLU A O   1 
ATOM   472 C CB  . GLU A 1 58 ? 9.142   -10.593 -18.387 1.00 78.26 ? 112 GLU A CB  1 
ATOM   473 C CG  . GLU A 1 58 ? 8.128   -10.108 -17.366 1.00 79.32 ? 112 GLU A CG  1 
ATOM   474 C CD  . GLU A 1 58 ? 8.057   -8.594  -17.297 1.00 80.42 ? 112 GLU A CD  1 
ATOM   475 O OE1 . GLU A 1 58 ? 7.957   -7.960  -18.370 1.00 80.96 ? 112 GLU A OE1 1 
ATOM   476 O OE2 . GLU A 1 58 ? 8.098   -8.038  -16.173 1.00 80.25 ? 112 GLU A OE2 1 
ATOM   477 N N   . ASN A 1 59 ? 9.728   -13.244 -16.172 1.00 80.85 ? 113 ASN A N   1 
ATOM   478 C CA  . ASN A 1 59 ? 10.361  -13.581 -14.902 1.00 82.46 ? 113 ASN A CA  1 
ATOM   479 C C   . ASN A 1 59 ? 10.888  -15.006 -14.914 1.00 83.76 ? 113 ASN A C   1 
ATOM   480 O O   . ASN A 1 59 ? 11.723  -15.371 -14.089 1.00 83.55 ? 113 ASN A O   1 
ATOM   481 C CB  . ASN A 1 59 ? 9.360   -13.430 -13.761 1.00 83.41 ? 113 ASN A CB  1 
ATOM   482 C CG  . ASN A 1 59 ? 9.070   -11.987 -13.431 1.00 85.00 ? 113 ASN A CG  1 
ATOM   483 O OD1 . ASN A 1 59 ? 8.904   -11.156 -14.325 1.00 85.79 ? 113 ASN A OD1 1 
ATOM   484 N ND2 . ASN A 1 59 ? 8.998   -11.678 -12.141 1.00 85.69 ? 113 ASN A ND2 1 
ATOM   485 N N   . LYS A 1 60 ? 10.399  -15.808 -15.856 1.00 85.81 ? 114 LYS A N   1 
ATOM   486 C CA  . LYS A 1 60 ? 10.814  -17.201 -15.959 1.00 88.00 ? 114 LYS A CA  1 
ATOM   487 C C   . LYS A 1 60 ? 12.334  -17.365 -15.990 1.00 88.96 ? 114 LYS A C   1 
ATOM   488 O O   . LYS A 1 60 ? 12.985  -17.111 -17.008 1.00 87.97 ? 114 LYS A O   1 
ATOM   489 C CB  . LYS A 1 60 ? 10.189  -17.859 -17.195 1.00 88.46 ? 114 LYS A CB  1 
ATOM   490 C CG  . LYS A 1 60 ? 10.405  -19.365 -17.237 1.00 90.48 ? 114 LYS A CG  1 
ATOM   491 C CD  . LYS A 1 60 ? 9.625   -20.039 -18.354 1.00 92.26 ? 114 LYS A CD  1 
ATOM   492 C CE  . LYS A 1 60 ? 9.914   -21.540 -18.390 1.00 93.98 ? 114 LYS A CE  1 
ATOM   493 N NZ  . LYS A 1 60 ? 9.210   -22.252 -19.500 1.00 94.92 ? 114 LYS A NZ  1 
ATOM   494 N N   . ALA A 1 61 ? 12.885  -17.793 -14.856 1.00 90.44 ? 115 ALA A N   1 
ATOM   495 C CA  . ALA A 1 61 ? 14.321  -18.008 -14.708 1.00 91.84 ? 115 ALA A CA  1 
ATOM   496 C C   . ALA A 1 61 ? 14.721  -19.372 -15.258 1.00 92.64 ? 115 ALA A C   1 
ATOM   497 O O   . ALA A 1 61 ? 13.825  -20.094 -15.750 1.00 93.06 ? 115 ALA A O   1 
ATOM   498 C CB  . ALA A 1 61 ? 14.718  -17.905 -13.235 1.00 91.27 ? 115 ALA A CB  1 
ATOM   499 N N   . TYR B 2 1  ? -15.111 -1.160  -27.489 1.00 85.66 ? 39  TYR P N   1 
ATOM   500 C CA  . TYR B 2 1  ? -15.575 -2.222  -26.545 1.00 86.20 ? 39  TYR P CA  1 
ATOM   501 C C   . TYR B 2 1  ? -14.400 -2.801  -25.768 1.00 85.86 ? 39  TYR P C   1 
ATOM   502 O O   . TYR B 2 1  ? -13.504 -3.403  -26.357 1.00 86.90 ? 39  TYR P O   1 
ATOM   503 C CB  . TYR B 2 1  ? -16.284 -3.330  -27.315 1.00 85.83 ? 39  TYR P CB  1 
ATOM   504 N N   . GLU B 2 2  ? -14.410 -2.622  -24.448 1.00 85.02 ? 40  GLU P N   1 
ATOM   505 C CA  . GLU B 2 2  ? -13.339 -3.123  -23.587 1.00 83.63 ? 40  GLU P CA  1 
ATOM   506 C C   . GLU B 2 2  ? -13.806 -4.287  -22.706 1.00 82.93 ? 40  GLU P C   1 
ATOM   507 O O   . GLU B 2 2  ? -15.005 -4.443  -22.458 1.00 83.50 ? 40  GLU P O   1 
ATOM   508 C CB  . GLU B 2 2  ? -12.811 -1.987  -22.717 1.00 83.12 ? 40  GLU P CB  1 
ATOM   509 N N   . PRO B 2 3  ? -12.860 -5.123  -22.223 1.00 81.56 ? 41  PRO P N   1 
ATOM   510 C CA  . PRO B 2 3  ? -13.141 -6.283  -21.363 1.00 80.08 ? 41  PRO P CA  1 
ATOM   511 C C   . PRO B 2 3  ? -13.988 -5.947  -20.127 1.00 79.04 ? 41  PRO P C   1 
ATOM   512 O O   . PRO B 2 3  ? -14.185 -4.773  -19.806 1.00 79.15 ? 41  PRO P O   1 
ATOM   513 C CB  . PRO B 2 3  ? -11.747 -6.776  -20.995 1.00 79.56 ? 41  PRO P CB  1 
ATOM   514 C CG  . PRO B 2 3  ? -10.970 -6.471  -22.215 1.00 79.48 ? 41  PRO P CG  1 
ATOM   515 C CD  . PRO B 2 3  ? -11.427 -5.074  -22.562 1.00 80.10 ? 41  PRO P CD  1 
ATOM   516 N N   . SER B 2 4  ? -14.468 -6.979  -19.433 1.00 77.11 ? 42  SER P N   1 
ATOM   517 C CA  . SER B 2 4  ? -15.317 -6.794  -18.255 1.00 75.04 ? 42  SER P CA  1 
ATOM   518 C C   . SER B 2 4  ? -14.712 -5.913  -17.167 1.00 73.39 ? 42  SER P C   1 
ATOM   519 O O   . SER B 2 4  ? -15.391 -5.022  -16.649 1.00 73.25 ? 42  SER P O   1 
ATOM   520 C CB  . SER B 2 4  ? -15.698 -8.145  -17.651 1.00 75.84 ? 42  SER P CB  1 
ATOM   521 O OG  . SER B 2 4  ? -14.642 -8.679  -16.880 1.00 77.73 ? 42  SER P OG  1 
ATOM   522 N N   . THR B 2 5  ? -13.449 -6.172  -16.822 1.00 70.53 ? 43  THR P N   1 
ATOM   523 C CA  . THR B 2 5  ? -12.717 -5.412  -15.799 1.00 67.03 ? 43  THR P CA  1 
ATOM   524 C C   . THR B 2 5  ? -13.188 -5.704  -14.383 1.00 64.41 ? 43  THR P C   1 
ATOM   525 O O   . THR B 2 5  ? -12.544 -5.309  -13.420 1.00 62.24 ? 43  THR P O   1 
ATOM   526 C CB  . THR B 2 5  ? -12.813 -3.866  -16.032 1.00 68.01 ? 43  THR P CB  1 
ATOM   527 O OG1 . THR B 2 5  ? -11.603 -3.243  -15.592 1.00 66.97 ? 43  THR P OG1 1 
ATOM   528 C CG2 . THR B 2 5  ? -13.968 -3.255  -15.238 1.00 66.82 ? 43  THR P CG2 1 
ATOM   529 N N   . THR B 2 6  ? -14.321 -6.382  -14.260 1.00 63.12 ? 44  THR P N   1 
ATOM   530 C CA  . THR B 2 6  ? -14.863 -6.721  -12.952 1.00 61.94 ? 44  THR P CA  1 
ATOM   531 C C   . THR B 2 6  ? -14.998 -8.224  -12.817 1.00 61.07 ? 44  THR P C   1 
ATOM   532 O O   . THR B 2 6  ? -14.992 -8.951  -13.808 1.00 61.25 ? 44  THR P O   1 
ATOM   533 C CB  . THR B 2 6  ? -16.252 -6.116  -12.733 1.00 62.48 ? 44  THR P CB  1 
ATOM   534 O OG1 . THR B 2 6  ? -17.162 -6.668  -13.688 1.00 61.10 ? 44  THR P OG1 1 
ATOM   535 C CG2 . THR B 2 6  ? -16.207 -4.604  -12.875 1.00 62.73 ? 44  THR P CG2 1 
ATOM   536 N N   . ALA B 2 7  ? -15.120 -8.685  -11.583 1.00 60.10 ? 45  ALA P N   1 
ATOM   537 C CA  . ALA B 2 7  ? -15.266 -10.102 -11.321 1.00 60.65 ? 45  ALA P CA  1 
ATOM   538 C C   . ALA B 2 7  ? -15.954 -10.255 -9.982  1.00 62.16 ? 45  ALA P C   1 
ATOM   539 O O   . ALA B 2 7  ? -15.875 -9.363  -9.134  1.00 61.55 ? 45  ALA P O   1 
ATOM   540 C CB  . ALA B 2 7  ? -13.907 -10.770 -11.295 1.00 58.85 ? 45  ALA P CB  1 
ATOM   541 N N   . ARG B 2 8  ? -16.649 -11.373 -9.793  1.00 62.67 ? 46  ARG P N   1 
ATOM   542 C CA  . ARG B 2 8  ? -17.324 -11.598 -8.529  1.00 62.83 ? 46  ARG P CA  1 
ATOM   543 C C   . ARG B 2 8  ? -16.299 -12.096 -7.545  1.00 61.33 ? 46  ARG P C   1 
ATOM   544 O O   . ARG B 2 8  ? -15.282 -12.676 -7.923  1.00 60.55 ? 46  ARG P O   1 
ATOM   545 C CB  . ARG B 2 8  ? -18.480 -12.599 -8.677  1.00 65.48 ? 46  ARG P CB  1 
ATOM   546 C CG  . ARG B 2 8  ? -18.224 -13.717 -9.658  1.00 70.30 ? 46  ARG P CG  1 
ATOM   547 C CD  . ARG B 2 8  ? -19.480 -14.544 -9.943  1.00 72.03 ? 46  ARG P CD  1 
ATOM   548 N NE  . ARG B 2 8  ? -19.311 -15.342 -11.160 1.00 74.69 ? 46  ARG P NE  1 
ATOM   549 C CZ  . ARG B 2 8  ? -20.043 -16.407 -11.477 1.00 75.57 ? 46  ARG P CZ  1 
ATOM   550 N NH1 . ARG B 2 8  ? -21.008 -16.822 -10.667 1.00 76.64 ? 46  ARG P NH1 1 
ATOM   551 N NH2 . ARG B 2 8  ? -19.808 -17.059 -12.608 1.00 74.92 ? 46  ARG P NH2 1 
HETATM 552 N N   . MLY B 2 9  ? -16.565 -11.850 -6.276  1.00 59.78 ? 47  MLY P N   1 
HETATM 553 C CA  . MLY B 2 9  ? -15.657 -12.252 -5.227  1.00 59.45 ? 47  MLY P CA  1 
HETATM 554 C CB  . MLY B 2 9  ? -15.275 -11.024 -4.398  1.00 57.29 ? 47  MLY P CB  1 
HETATM 555 C CG  . MLY B 2 9  ? -14.229 -11.295 -3.358  1.00 55.71 ? 47  MLY P CG  1 
HETATM 556 C CD  . MLY B 2 9  ? -14.185 -10.205 -2.321  1.00 52.42 ? 47  MLY P CD  1 
HETATM 557 C CE  . MLY B 2 9  ? -13.774 -8.869  -2.898  1.00 49.94 ? 47  MLY P CE  1 
HETATM 558 N NZ  . MLY B 2 9  ? -13.631 -7.862  -1.843  1.00 48.71 ? 47  MLY P NZ  1 
HETATM 559 C CH1 A MLY B 2 9  ? -12.648 -8.257  -0.791  0.34 51.00 ? 47  MLY P CH1 1 
HETATM 560 C CH1 B MLY B 2 9  ? -14.914 -7.629  -1.132  0.33 50.97 ? 47  MLY P CH1 1 
HETATM 561 C CH1 C MLY B 2 9  ? -13.166 -6.563  -2.363  0.33 48.36 ? 47  MLY P CH1 1 
HETATM 562 C CH2 C MLY B 2 9  ? -12.648 -8.257  -0.791  0.33 51.00 ? 47  MLY P CH2 1 
HETATM 563 C C   . MLY B 2 9  ? -16.303 -13.296 -4.327  1.00 60.26 ? 47  MLY P C   1 
HETATM 564 O O   . MLY B 2 9  ? -17.167 -12.964 -3.526  1.00 61.78 ? 47  MLY P O   1 
ATOM   565 N N   . VAL B 2 10 ? -15.905 -14.555 -4.457  1.00 61.27 ? 48  VAL P N   1 
ATOM   566 C CA  . VAL B 2 10 ? -16.469 -15.587 -3.598  1.00 64.20 ? 48  VAL P CA  1 
ATOM   567 C C   . VAL B 2 10 ? -15.603 -15.724 -2.357  1.00 67.33 ? 48  VAL P C   1 
ATOM   568 O O   . VAL B 2 10 ? -16.078 -16.155 -1.301  1.00 67.42 ? 48  VAL P O   1 
ATOM   569 C CB  . VAL B 2 10 ? -16.521 -16.961 -4.277  1.00 63.51 ? 48  VAL P CB  1 
ATOM   570 C CG1 . VAL B 2 10 ? -15.121 -17.429 -4.643  1.00 62.88 ? 48  VAL P CG1 1 
ATOM   571 C CG2 . VAL B 2 10 ? -17.159 -17.956 -3.338  1.00 63.36 ? 48  VAL P CG2 1 
ATOM   572 N N   . GLY B 2 11 ? -14.331 -15.349 -2.504  1.00 70.57 ? 49  GLY P N   1 
ATOM   573 C CA  . GLY B 2 11 ? -13.378 -15.432 -1.412  1.00 74.25 ? 49  GLY P CA  1 
ATOM   574 C C   . GLY B 2 11 ? -13.767 -14.550 -0.247  1.00 77.63 ? 49  GLY P C   1 
ATOM   575 O O   . GLY B 2 11 ? -13.475 -14.875 0.907   1.00 78.61 ? 49  GLY P O   1 
ATOM   576 N N   . ARG B 2 12 ? -14.425 -13.434 -0.565  1.00 79.82 ? 50  ARG P N   1 
ATOM   577 C CA  . ARG B 2 12 ? -14.898 -12.452 0.413   1.00 80.90 ? 50  ARG P CA  1 
ATOM   578 C C   . ARG B 2 12 ? -13.894 -12.155 1.525   1.00 81.71 ? 50  ARG P C   1 
ATOM   579 O O   . ARG B 2 12 ? -13.278 -11.067 1.481   1.00 83.09 ? 50  ARG P O   1 
ATOM   580 C CB  . ARG B 2 12 ? -16.228 -12.918 1.015   1.00 80.55 ? 50  ARG P CB  1 
HETATM 581 O O   . HOH C 3 .  ? -12.585 -3.055  -6.206  1.00 52.56 ? 1   HOH A O   1 
HETATM 582 O O   . HOH C 3 .  ? -6.555  -14.421 1.265   1.00 50.92 ? 2   HOH A O   1 
HETATM 583 O O   . HOH C 3 .  ? -12.463 -26.900 -10.816 1.00 62.09 ? 3   HOH A O   1 
HETATM 584 O O   . HOH C 3 .  ? -8.868  -16.119 -0.309  1.00 56.58 ? 4   HOH A O   1 
HETATM 585 O O   . HOH C 3 .  ? -7.235  -6.391  -2.487  1.00 45.06 ? 5   HOH A O   1 
HETATM 586 O O   . HOH C 3 .  ? -15.088 -12.270 -15.500 1.00 56.11 ? 7   HOH A O   1 
HETATM 587 O O   . HOH C 3 .  ? 7.879   -10.198 -10.057 1.00 66.49 ? 9   HOH A O   1 
HETATM 588 O O   . HOH C 3 .  ? -1.048  -25.578 -4.922  1.00 45.08 ? 10  HOH A O   1 
HETATM 589 O O   . HOH C 3 .  ? -8.018  -27.100 -14.256 1.00 51.14 ? 11  HOH A O   1 
HETATM 590 O O   . HOH C 3 .  ? -16.366 -24.988 -1.889  1.00 62.73 ? 14  HOH A O   1 
HETATM 591 O O   . HOH C 3 .  ? -3.299  -1.910  -5.256  1.00 53.58 ? 16  HOH A O   1 
HETATM 592 O O   . HOH C 3 .  ? -11.958 -22.607 -4.114  1.00 58.94 ? 17  HOH A O   1 
HETATM 593 O O   . HOH C 3 .  ? -1.472  -7.430  3.365   1.00 38.81 ? 18  HOH A O   1 
HETATM 594 O O   . HOH C 3 .  ? -7.539  -11.569 3.228   1.00 51.98 ? 19  HOH A O   1 
HETATM 595 O O   . HOH C 3 .  ? -8.449  -3.053  2.128   1.00 54.22 ? 22  HOH A O   1 
HETATM 596 O O   . HOH C 3 .  ? -11.121 -4.023  5.613   1.00 54.45 ? 23  HOH A O   1 
HETATM 597 O O   . HOH C 3 .  ? -19.321 -15.482 -19.052 1.00 62.78 ? 26  HOH A O   1 
HETATM 598 O O   . HOH D 3 .  ? -17.004 -12.909 -11.959 1.00 52.70 ? 6   HOH P O   1 
HETATM 599 O O   . HOH D 3 .  ? -10.502 -7.327  -18.141 1.00 54.25 ? 8   HOH P O   1 
HETATM 600 O O   . HOH D 3 .  ? -17.210 -23.985 0.031   1.00 52.83 ? 13  HOH P O   1 
HETATM 601 O O   . HOH D 3 .  ? -20.448 -14.681 -14.494 1.00 54.66 ? 15  HOH P O   1 
HETATM 602 O O   . HOH D 3 .  ? -11.123 -14.821 2.707   1.00 47.93 ? 20  HOH P O   1 
HETATM 603 O O   . HOH D 3 .  ? -13.659 -16.175 4.884   1.00 67.64 ? 21  HOH P O   1 
HETATM 604 O O   . HOH D 3 .  ? -21.643 -18.800 -13.353 1.00 66.77 ? 25  HOH P O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  55  ?   ?   ?   A . n 
A 1 2  GLU 2  56  56  GLU ALA A . n 
A 1 3  ASP 3  57  57  ASP ASP A . n 
A 1 4  VAL 4  58  58  VAL VAL A . n 
A 1 5  PHE 5  59  59  PHE PHE A . n 
A 1 6  GLU 6  60  60  GLU GLU A . n 
A 1 7  VAL 7  61  61  VAL VAL A . n 
A 1 8  GLU 8  62  62  GLU GLU A . n 
A 1 9  LYS 9  63  63  LYS LYS A . n 
A 1 10 ILE 10 64  64  ILE ILE A . n 
A 1 11 LEU 11 65  65  LEU LEU A . n 
A 1 12 ASP 12 66  66  ASP ASP A . n 
A 1 13 MET 13 67  67  MET MET A . n 
A 1 14 LYS 14 68  68  LYS LYS A . n 
A 1 15 THR 15 69  69  THR THR A . n 
A 1 16 GLU 16 70  70  GLU GLU A . n 
A 1 17 GLY 17 71  71  GLY GLY A . n 
A 1 18 GLY 18 72  72  GLY GLY A . n 
A 1 19 LYS 19 73  73  LYS LYS A . n 
A 1 20 VAL 20 74  74  VAL VAL A . n 
A 1 21 LEU 21 75  75  LEU LEU A . n 
A 1 22 TYR 22 76  76  TYR TYR A . n 
A 1 23 LYS 23 77  77  LYS LYS A . n 
A 1 24 VAL 24 78  78  VAL VAL A . n 
A 1 25 ARG 25 79  79  ARG ARG A . n 
A 1 26 TRP 26 80  80  TRP TRP A . n 
A 1 27 LYS 27 81  81  LYS LYS A . n 
A 1 28 GLY 28 82  82  GLY GLY A . n 
A 1 29 TYR 29 83  83  TYR TYR A . n 
A 1 30 THR 30 84  84  THR THR A . n 
A 1 31 SER 31 85  85  SER SER A . n 
A 1 32 ASP 32 86  86  ASP ASP A . n 
A 1 33 ASP 33 87  87  ASP ASP A . n 
A 1 34 ASP 34 88  88  ASP ASP A . n 
A 1 35 THR 35 89  89  THR THR A . n 
A 1 36 TRP 36 90  90  TRP TRP A . n 
A 1 37 GLU 37 91  91  GLU GLU A . n 
A 1 38 PRO 38 92  92  PRO PRO A . n 
A 1 39 GLU 39 93  93  GLU GLU A . n 
A 1 40 ILE 40 94  94  ILE ILE A . n 
A 1 41 HIS 41 95  95  HIS HIS A . n 
A 1 42 LEU 42 96  96  LEU LEU A . n 
A 1 43 GLU 43 97  97  GLU GLU A . n 
A 1 44 ASP 44 98  98  ASP ASP A . n 
A 1 45 CYS 45 99  99  CYS CYS A . n 
A 1 46 LYS 46 100 100 LYS LYS A . n 
A 1 47 GLU 47 101 101 GLU GLU A . n 
A 1 48 VAL 48 102 102 VAL VAL A . n 
A 1 49 LEU 49 103 103 LEU LEU A . n 
A 1 50 LEU 50 104 104 LEU LEU A . n 
A 1 51 GLU 51 105 105 GLU GLU A . n 
A 1 52 PHE 52 106 106 PHE PHE A . n 
A 1 53 ARG 53 107 107 ARG ARG A . n 
A 1 54 LYS 54 108 108 LYS LYS A . n 
A 1 55 LYS 55 109 109 LYS LYS A . n 
A 1 56 ILE 56 110 110 ILE ILE A . n 
A 1 57 ALA 57 111 111 ALA ALA A . n 
A 1 58 GLU 58 112 112 GLU GLU A . n 
A 1 59 ASN 59 113 113 ASN ASN A . n 
A 1 60 LYS 60 114 114 LYS LYS A . n 
A 1 61 ALA 61 115 115 ALA ALA A . n 
A 1 62 LYS 62 116 ?   ?   ?   A . n 
B 2 1  TYR 1  39  39  TYR TYR P . n 
B 2 2  GLU 2  40  40  GLU GLU P . n 
B 2 3  PRO 3  41  41  PRO PRO P . n 
B 2 4  SER 4  42  42  SER SER P . n 
B 2 5  THR 5  43  43  THR THR P . n 
B 2 6  THR 6  44  44  THR THR P . n 
B 2 7  ALA 7  45  45  ALA ALA P . n 
B 2 8  ARG 8  46  46  ARG ARG P . n 
B 2 9  MLY 9  47  47  MLY MLY P . n 
B 2 10 VAL 10 48  48  VAL VAL P . n 
B 2 11 GLY 11 49  49  GLY GLY P . n 
B 2 12 ARG 12 50  50  ARG ALA P . n 
B 2 13 PRO 13 51  ?   ?   ?   P . n 
B 2 14 GLY 14 52  ?   ?   ?   P . n 
B 2 15 ARG 15 53  ?   ?   ?   P . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    MLY 
_pdbx_struct_mod_residue.label_seq_id     9 
_pdbx_struct_mod_residue.auth_asym_id     P 
_pdbx_struct_mod_residue.auth_comp_id     MLY 
_pdbx_struct_mod_residue.auth_seq_id      47 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   LYS 
_pdbx_struct_mod_residue.details          N-DIMETHYL-LYSINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D 
2 1,2 A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1360 ? 
1 MORE         -9   ? 
1 'SSA (A^2)'  5020 ? 
2 'ABSA (A^2)' 4110 ? 
2 MORE         -24  ? 
2 'SSA (A^2)'  8650 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_545 -x,-y-1,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 -43.9000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2011-11-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .   ? 1 
PHASER   phasing           .   ? 2 
CNS      refinement        1.2 ? 3 
HKL-2000 'data reduction'  .   ? 4 
HKL-2000 'data scaling'    .   ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 57  ? ? 51.07   -55.15 
2 1 VAL A 58  ? ? 81.26   133.62 
3 1 CYS A 99  ? ? -110.44 62.14  
4 1 LYS A 114 ? ? -51.63  103.83 
5 1 THR P 43  ? ? 72.35   -12.11 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 56 ? CG  ? A GLU 2  CG  
2  1 Y 1 A GLU 56 ? CD  ? A GLU 2  CD  
3  1 Y 1 A GLU 56 ? OE1 ? A GLU 2  OE1 
4  1 Y 1 A GLU 56 ? OE2 ? A GLU 2  OE2 
5  1 Y 1 P TYR 39 ? CG  ? B TYR 1  CG  
6  1 Y 1 P TYR 39 ? CD1 ? B TYR 1  CD1 
7  1 Y 1 P TYR 39 ? CD2 ? B TYR 1  CD2 
8  1 Y 1 P TYR 39 ? CE1 ? B TYR 1  CE1 
9  1 Y 1 P TYR 39 ? CE2 ? B TYR 1  CE2 
10 1 Y 1 P TYR 39 ? CZ  ? B TYR 1  CZ  
11 1 Y 1 P TYR 39 ? OH  ? B TYR 1  OH  
12 1 Y 1 P GLU 40 ? CG  ? B GLU 2  CG  
13 1 Y 1 P GLU 40 ? CD  ? B GLU 2  CD  
14 1 Y 1 P GLU 40 ? OE1 ? B GLU 2  OE1 
15 1 Y 1 P GLU 40 ? OE2 ? B GLU 2  OE2 
16 1 Y 1 P ARG 50 ? CG  ? B ARG 12 CG  
17 1 Y 1 P ARG 50 ? CD  ? B ARG 12 CD  
18 1 Y 1 P ARG 50 ? NE  ? B ARG 12 NE  
19 1 Y 1 P ARG 50 ? CZ  ? B ARG 12 CZ  
20 1 Y 1 P ARG 50 ? NH1 ? B ARG 12 NH1 
21 1 Y 1 P ARG 50 ? NH2 ? B ARG 12 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 55  ? A GLY 1  
2 1 Y 1 A LYS 116 ? A LYS 62 
3 1 Y 1 P PRO 51  ? B PRO 13 
4 1 Y 1 P GLY 52  ? B GLY 14 
5 1 Y 1 P ARG 53  ? B ARG 15 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  1  1  HOH TIP A . 
C 3 HOH 2  2  2  HOH TIP A . 
C 3 HOH 3  3  3  HOH TIP A . 
C 3 HOH 4  4  4  HOH TIP A . 
C 3 HOH 5  5  5  HOH TIP A . 
C 3 HOH 6  7  7  HOH TIP A . 
C 3 HOH 7  9  9  HOH TIP A . 
C 3 HOH 8  10 10 HOH TIP A . 
C 3 HOH 9  11 11 HOH TIP A . 
C 3 HOH 10 14 14 HOH TIP A . 
C 3 HOH 11 16 16 HOH TIP A . 
C 3 HOH 12 17 17 HOH TIP A . 
C 3 HOH 13 18 18 HOH TIP A . 
C 3 HOH 14 19 19 HOH TIP A . 
C 3 HOH 15 22 22 HOH TIP A . 
C 3 HOH 16 23 23 HOH TIP A . 
C 3 HOH 17 26 26 HOH TIP A . 
D 3 HOH 1  6  6  HOH TIP P . 
D 3 HOH 2  8  8  HOH TIP P . 
D 3 HOH 3  13 13 HOH TIP P . 
D 3 HOH 4  15 15 HOH TIP P . 
D 3 HOH 5  20 20 HOH TIP P . 
D 3 HOH 6  21 21 HOH TIP P . 
D 3 HOH 7  25 25 HOH TIP P . 
#