data_3SXW
# 
_entry.id   3SXW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3SXW         
RCSB  RCSB066788   
WWPDB D_1000066788 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB      1x82 'Template for engineered protein' unspecified 
TargetDB OR69 .                                 unspecified 
# 
_pdbx_database_status.entry_id                        3SXW 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-07-15 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vorobiev, S.'                                    1  
'Su, M.'                                          2  
'Nivon, L.'                                       3  
'Seetharaman, J.'                                 4  
'Patel, P.'                                       5  
'Xiao, R.'                                        6  
'Maglaqui, M.'                                    7  
'Ciccosanti, C.'                                  8  
'Baker, D.'                                       9  
'Everett, J.K.'                                   10 
'Nair, R.'                                        11 
'Acton, T.B.'                                     12 
'Rost, B.'                                        13 
'Montelione, G.T.'                                14 
'Hunt, J.F.'                                      15 
'Tong, L.'                                        16 
'Northeast Structural Genomics Consortium (NESG)' 17 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR69.' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vorobiev, S.'     1  
primary 'Su, M.'           2  
primary 'Nivon, L.'        3  
primary 'Seetharaman, J.'  4  
primary 'Patel, P.'        5  
primary 'Xiao, R.'         6  
primary 'Maglaqui, M.'     7  
primary 'Ciccosanti, C.'   8  
primary 'Baker, D.'        9  
primary 'Everett, J.K.'    10 
primary 'Nair, R.'         11 
primary 'Acton, T.B.'      12 
primary 'Rost, B.'         13 
primary 'Montelione, G.T.' 14 
primary 'Hunt, J.F.'       15 
primary 'Tong, L.'         16 
# 
_cell.entry_id           3SXW 
_cell.length_a           59.131 
_cell.length_b           59.131 
_cell.length_c           137.630 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3SXW 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.Int_Tables_number                154 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Glucose-6-phosphate isomerase' 22771.857 1   5.3.1.9 ? ? ? 
2 water   nat water                           18.015    164 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GPI, Phosphoglucose isomerase, PGI, Phosphohexose isomerase, PHI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MMMYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFSTHVIYPGKV
GKEFFFAKGHFHAKLDRAQVAVALKGKGGVLMQTPEGDAKWISSEPGTVIYSPPYWAARAVNIGDEPFIMLVIYPADAGH
DYGTIAEKGFSKIVIEENGEVKVVDNPRWKKGSLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MMMYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFSTHVIYPGKV
GKEFFFAKGHFHAKLDRAQVAVALKGKGGVLMQTPEGDAKWISSEPGTVIYSPPYWAARAVNIGDEPFIMLVIYPADAGH
DYGTIAEKGFSKIVIEENGEVKVVDNPRWKKGSLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         OR69 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   MET n 
1 3   MET n 
1 4   TYR n 
1 5   LYS n 
1 6   GLU n 
1 7   PRO n 
1 8   PHE n 
1 9   GLY n 
1 10  VAL n 
1 11  LYS n 
1 12  VAL n 
1 13  ASP n 
1 14  PHE n 
1 15  GLU n 
1 16  THR n 
1 17  GLY n 
1 18  ILE n 
1 19  ILE n 
1 20  GLU n 
1 21  GLY n 
1 22  ALA n 
1 23  LYS n 
1 24  LYS n 
1 25  SER n 
1 26  VAL n 
1 27  ARG n 
1 28  ARG n 
1 29  LEU n 
1 30  SER n 
1 31  ASP n 
1 32  MET n 
1 33  GLU n 
1 34  GLY n 
1 35  TYR n 
1 36  PHE n 
1 37  VAL n 
1 38  ASP n 
1 39  GLU n 
1 40  ARG n 
1 41  ALA n 
1 42  TRP n 
1 43  LYS n 
1 44  GLU n 
1 45  LEU n 
1 46  VAL n 
1 47  GLU n 
1 48  LYS n 
1 49  GLU n 
1 50  ASP n 
1 51  PRO n 
1 52  VAL n 
1 53  VAL n 
1 54  TYR n 
1 55  GLU n 
1 56  VAL n 
1 57  TYR n 
1 58  ALA n 
1 59  VAL n 
1 60  GLU n 
1 61  GLN n 
1 62  GLU n 
1 63  GLU n 
1 64  LYS n 
1 65  GLU n 
1 66  GLY n 
1 67  ASP n 
1 68  LEU n 
1 69  ASN n 
1 70  PHE n 
1 71  SER n 
1 72  THR n 
1 73  HIS n 
1 74  VAL n 
1 75  ILE n 
1 76  TYR n 
1 77  PRO n 
1 78  GLY n 
1 79  LYS n 
1 80  VAL n 
1 81  GLY n 
1 82  LYS n 
1 83  GLU n 
1 84  PHE n 
1 85  PHE n 
1 86  PHE n 
1 87  ALA n 
1 88  LYS n 
1 89  GLY n 
1 90  HIS n 
1 91  PHE n 
1 92  HIS n 
1 93  ALA n 
1 94  LYS n 
1 95  LEU n 
1 96  ASP n 
1 97  ARG n 
1 98  ALA n 
1 99  GLN n 
1 100 VAL n 
1 101 ALA n 
1 102 VAL n 
1 103 ALA n 
1 104 LEU n 
1 105 LYS n 
1 106 GLY n 
1 107 LYS n 
1 108 GLY n 
1 109 GLY n 
1 110 VAL n 
1 111 LEU n 
1 112 MET n 
1 113 GLN n 
1 114 THR n 
1 115 PRO n 
1 116 GLU n 
1 117 GLY n 
1 118 ASP n 
1 119 ALA n 
1 120 LYS n 
1 121 TRP n 
1 122 ILE n 
1 123 SER n 
1 124 SER n 
1 125 GLU n 
1 126 PRO n 
1 127 GLY n 
1 128 THR n 
1 129 VAL n 
1 130 ILE n 
1 131 TYR n 
1 132 SER n 
1 133 PRO n 
1 134 PRO n 
1 135 TYR n 
1 136 TRP n 
1 137 ALA n 
1 138 ALA n 
1 139 ARG n 
1 140 ALA n 
1 141 VAL n 
1 142 ASN n 
1 143 ILE n 
1 144 GLY n 
1 145 ASP n 
1 146 GLU n 
1 147 PRO n 
1 148 PHE n 
1 149 ILE n 
1 150 MET n 
1 151 LEU n 
1 152 VAL n 
1 153 ILE n 
1 154 TYR n 
1 155 PRO n 
1 156 ALA n 
1 157 ASP n 
1 158 ALA n 
1 159 GLY n 
1 160 HIS n 
1 161 ASP n 
1 162 TYR n 
1 163 GLY n 
1 164 THR n 
1 165 ILE n 
1 166 ALA n 
1 167 GLU n 
1 168 LYS n 
1 169 GLY n 
1 170 PHE n 
1 171 SER n 
1 172 LYS n 
1 173 ILE n 
1 174 VAL n 
1 175 ILE n 
1 176 GLU n 
1 177 GLU n 
1 178 ASN n 
1 179 GLY n 
1 180 GLU n 
1 181 VAL n 
1 182 LYS n 
1 183 VAL n 
1 184 VAL n 
1 185 ASP n 
1 186 ASN n 
1 187 PRO n 
1 188 ARG n 
1 189 TRP n 
1 190 LYS n 
1 191 LYS n 
1 192 GLY n 
1 193 SER n 
1 194 LEU n 
1 195 GLU n 
1 196 HIS n 
1 197 HIS n 
1 198 HIS n 
1 199 HIS n 
1 200 HIS n 
1 201 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'pgiA, PF0196' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 43587 / DSM 3638 / JCM 8422 / Vc1' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pyrococcus furiosus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     186497 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_PYRFU 
_struct_ref.pdbx_db_accession          P83194 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MYKEPFGVKVDFETGIIEGAKKSVRRLSDMEGYFVDERAWKELVEKEDPVVYEVYAVEQEEKEGDLNFATTVLYPGKVGK
EFFFTKGHFHAKLDRAEVYVALKGKGGMLLQTPEGDAKWISMEPGTVVYVPPYWAHRTVNIGDEPFIFLAIYPADAGHDY
GTIAEKGFSKIVIEENGEVKVVDNPRWKK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3SXW 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 191 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P83194 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  189 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       3 
_struct_ref_seq.pdbx_auth_seq_align_end       191 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3SXW MET A 1   ? UNP P83194 ?   ?   'EXPRESSION TAG'      1   1  
1 3SXW MET A 2   ? UNP P83194 ?   ?   'EXPRESSION TAG'      2   2  
1 3SXW SER A 71  ? UNP P83194 ALA 69  'engineered mutation' 71  3  
1 3SXW HIS A 73  ? UNP P83194 THR 71  'engineered mutation' 73  4  
1 3SXW ILE A 75  ? UNP P83194 LEU 73  'engineered mutation' 75  5  
1 3SXW ALA A 87  ? UNP P83194 THR 85  'engineered mutation' 87  6  
1 3SXW GLN A 99  ? UNP P83194 GLU 97  'engineered mutation' 99  7  
1 3SXW ALA A 101 ? UNP P83194 TYR 99  'engineered mutation' 101 8  
1 3SXW VAL A 110 ? UNP P83194 MET 108 'engineered mutation' 110 9  
1 3SXW MET A 112 ? UNP P83194 LEU 110 'engineered mutation' 112 10 
1 3SXW SER A 124 ? UNP P83194 MET 122 'engineered mutation' 124 11 
1 3SXW ILE A 130 ? UNP P83194 VAL 128 'engineered mutation' 130 12 
1 3SXW SER A 132 ? UNP P83194 VAL 130 'engineered mutation' 132 13 
1 3SXW ALA A 138 ? UNP P83194 HIS 136 'engineered mutation' 138 14 
1 3SXW ALA A 140 ? UNP P83194 THR 138 'engineered mutation' 140 15 
1 3SXW MET A 150 ? UNP P83194 PHE 148 'engineered mutation' 150 16 
1 3SXW VAL A 152 ? UNP P83194 ALA 150 'engineered mutation' 152 17 
1 3SXW GLY A 192 ? UNP P83194 ?   ?   'EXPRESSION TAG'      192 18 
1 3SXW SER A 193 ? UNP P83194 ?   ?   'EXPRESSION TAG'      193 19 
1 3SXW LEU A 194 ? UNP P83194 ?   ?   'EXPRESSION TAG'      194 20 
1 3SXW GLU A 195 ? UNP P83194 ?   ?   'EXPRESSION TAG'      195 21 
1 3SXW HIS A 196 ? UNP P83194 ?   ?   'EXPRESSION TAG'      196 22 
1 3SXW HIS A 197 ? UNP P83194 ?   ?   'EXPRESSION TAG'      197 23 
1 3SXW HIS A 198 ? UNP P83194 ?   ?   'EXPRESSION TAG'      198 24 
1 3SXW HIS A 199 ? UNP P83194 ?   ?   'EXPRESSION TAG'      199 25 
1 3SXW HIS A 200 ? UNP P83194 ?   ?   'EXPRESSION TAG'      200 26 
1 3SXW HIS A 201 ? UNP P83194 ?   ?   'EXPRESSION TAG'      201 27 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3SXW 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.05 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   59.67 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'Microbatch crystallization under oil' 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
'18-22% PEG 8000, 0.1 M Manganese sulfate, 0.1 M Sodium acetate, pH 5.0 , Microbatch crystallization under oil, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2011-06-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97915 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4C' 
_diffrn_source.pdbx_wavelength_list        0.97915 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4C 
# 
_reflns.entry_id                     3SXW 
_reflns.B_iso_Wilson_estimate        29.730 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            1.80 
_reflns.d_resolution_low             50 
_reflns.number_all                   99736 
_reflns.number_obs                   99636 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.085 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        26.2 
_reflns.pdbx_redundancy              5.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.536 
_reflns_shell.meanI_over_sigI_obs    1.56 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        5.6 
_reflns_shell.number_unique_all      9946 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3SXW 
_refine.ls_d_res_high                            1.801 
_refine.ls_d_res_low                             34.170 
_refine.pdbx_ls_sigma_F                          1.16 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.910 
_refine.ls_number_reflns_obs                     49787 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.178 
_refine.ls_R_factor_R_work                       0.176 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.216 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.050 
_refine.ls_number_reflns_R_free                  2512 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               36.386 
_refine.solvent_model_param_bsol                 60.687 
_refine.solvent_model_param_ksol                 0.400 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            1.748 
_refine.aniso_B[2][2]                            1.748 
_refine.aniso_B[3][3]                            -3.497 
_refine.aniso_B[1][2]                            -0.000 
_refine.aniso_B[1][3]                            -0.000 
_refine.aniso_B[2][3]                            -0.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.230 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.000 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.720 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'pdb entry 1x82' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.883 
_refine.B_iso_max                                91.52 
_refine.B_iso_min                                19.52 
_refine.pdbx_overall_phase_error                 18.750 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1482 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             164 
_refine_hist.number_atoms_total               1646 
_refine_hist.d_res_high                       1.801 
_refine_hist.d_res_low                        34.170 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           1522 0.008  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          2061 1.101  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     214  0.080  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      268  0.004  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 553  15.262 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.801 1.835  18 100.000 2613 . 0.280 0.254 . 124 . 2737 . . 'X-RAY DIFFRACTION' 
1.835 1.873  18 100.000 2643 . 0.290 0.369 . 153 . 2796 . . 'X-RAY DIFFRACTION' 
1.873 1.913  18 100.000 2634 . 0.239 0.288 . 142 . 2776 . . 'X-RAY DIFFRACTION' 
1.913 1.958  18 100.000 2609 . 0.206 0.271 . 123 . 2732 . . 'X-RAY DIFFRACTION' 
1.958 2.007  18 100.000 2645 . 0.184 0.221 . 136 . 2781 . . 'X-RAY DIFFRACTION' 
2.007 2.061  18 100.000 2598 . 0.182 0.197 . 149 . 2747 . . 'X-RAY DIFFRACTION' 
2.061 2.122  18 100.000 2650 . 0.179 0.229 . 147 . 2797 . . 'X-RAY DIFFRACTION' 
2.122 2.190  18 100.000 2651 . 0.172 0.208 . 135 . 2786 . . 'X-RAY DIFFRACTION' 
2.190 2.269  18 100.000 2639 . 0.174 0.199 . 146 . 2785 . . 'X-RAY DIFFRACTION' 
2.269 2.359  18 100.000 2613 . 0.181 0.218 . 137 . 2750 . . 'X-RAY DIFFRACTION' 
2.359 2.467  18 100.000 2614 . 0.180 0.205 . 158 . 2772 . . 'X-RAY DIFFRACTION' 
2.467 2.597  18 100.000 2613 . 0.186 0.266 . 135 . 2748 . . 'X-RAY DIFFRACTION' 
2.597 2.759  18 100.000 2563 . 0.189 0.243 . 188 . 2751 . . 'X-RAY DIFFRACTION' 
2.759 2.972  18 100.000 2655 . 0.189 0.216 . 138 . 2793 . . 'X-RAY DIFFRACTION' 
2.972 3.271  18 100.000 2626 . 0.171 0.211 . 136 . 2762 . . 'X-RAY DIFFRACTION' 
3.271 3.744  18 100.000 2655 . 0.159 0.183 . 117 . 2772 . . 'X-RAY DIFFRACTION' 
3.744 4.715  18 100.000 2631 . 0.141 0.175 . 124 . 2755 . . 'X-RAY DIFFRACTION' 
4.715 34.176 18 99.000  2623 . 0.184 0.231 . 124 . 2747 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3SXW 
_struct.title                     'Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR69.' 
_struct.pdbx_descriptor           'Glucose-6-phosphate isomerase (E.C.5.3.1.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3SXW 
_struct_keywords.text            
;Engineered protein, Structural Genomics, PSI-biology, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, ISOMERASE
;
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'dimer,50.85 kD,94.4%|tetramer,102.5 kD,2.3%' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 30  ? GLU A 33  ? SER A 30  GLU A 33  5 ? 4  
HELX_P HELX_P2 2 ASP A 38  ? GLU A 49  ? ASP A 38  GLU A 49  1 ? 12 
HELX_P HELX_P3 3 TYR A 162 ? GLY A 169 ? TYR A 162 GLY A 169 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 23  ? ARG A 28  ? LYS A 23  ARG A 28  
A 2 VAL A 52  ? VAL A 59  ? VAL A 52  VAL A 59  
A 3 LEU A 68  ? ILE A 75  ? LEU A 68  ILE A 75  
A 4 PHE A 148 ? PRO A 155 ? PHE A 148 PRO A 155 
A 5 GLN A 99  ? LYS A 105 ? GLN A 99  LYS A 105 
A 6 VAL A 129 ? SER A 132 ? VAL A 129 SER A 132 
B 1 LYS A 79  ? VAL A 80  ? LYS A 79  VAL A 80  
B 2 GLU A 83  ? PHE A 84  ? GLU A 83  PHE A 84  
C 1 ALA A 119 ? SER A 123 ? ALA A 119 SER A 123 
C 2 GLY A 108 ? GLN A 113 ? GLY A 108 GLN A 113 
C 3 ALA A 137 ? ASN A 142 ? ALA A 137 ASN A 142 
D 1 LYS A 172 ? GLU A 177 ? LYS A 172 GLU A 177 
D 2 GLU A 180 ? ASP A 185 ? GLU A 180 ASP A 185 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 23  ? N LYS A 23  O ALA A 58  ? O ALA A 58  
A 2 3 N VAL A 59  ? N VAL A 59  O PHE A 70  ? O PHE A 70  
A 3 4 N ASN A 69  ? N ASN A 69  O TYR A 154 ? O TYR A 154 
A 4 5 O ILE A 149 ? O ILE A 149 N LEU A 104 ? N LEU A 104 
A 5 6 N ALA A 101 ? N ALA A 101 O ILE A 130 ? O ILE A 130 
B 1 2 N VAL A 80  ? N VAL A 80  O GLU A 83  ? O GLU A 83  
C 1 2 O ILE A 122 ? O ILE A 122 N VAL A 110 ? N VAL A 110 
C 2 3 N LEU A 111 ? N LEU A 111 O ARG A 139 ? O ARG A 139 
D 1 2 N ILE A 175 ? N ILE A 175 O LYS A 182 ? O LYS A 182 
# 
_atom_sites.entry_id                    3SXW 
_atom_sites.fract_transf_matrix[1][1]   0.016912 
_atom_sites.fract_transf_matrix[1][2]   0.009764 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019528 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007266 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 2   ? 10.320 5.346  87.723 1.00 71.29 ? 2   MET A N   1 
ATOM   2    C CA  . MET A 1 2   ? 9.989  4.235  86.848 1.00 60.89 ? 2   MET A CA  1 
ATOM   3    C C   . MET A 1 2   ? 10.771 4.408  85.589 1.00 69.28 ? 2   MET A C   1 
ATOM   4    O O   . MET A 1 2   ? 10.359 3.947  84.516 1.00 82.75 ? 2   MET A O   1 
ATOM   5    C CB  . MET A 1 2   ? 8.495  4.204  86.532 1.00 68.21 ? 2   MET A CB  1 
ATOM   6    N N   . MET A 1 3   ? 11.896 5.093  85.685 1.00 61.59 ? 3   MET A N   1 
ATOM   7    C CA  . MET A 1 3   ? 12.737 5.124  84.509 1.00 55.88 ? 3   MET A CA  1 
ATOM   8    C C   . MET A 1 3   ? 14.158 5.549  84.672 1.00 59.99 ? 3   MET A C   1 
ATOM   9    O O   . MET A 1 3   ? 14.653 5.839  85.769 1.00 74.48 ? 3   MET A O   1 
ATOM   10   C CB  . MET A 1 3   ? 12.092 5.877  83.372 1.00 64.86 ? 3   MET A CB  1 
ATOM   11   N N   . TYR A 1 4   ? 14.773 5.631  83.504 1.00 51.36 ? 4   TYR A N   1 
ATOM   12   C CA  . TYR A 1 4   ? 16.028 4.959  83.305 1.00 56.20 ? 4   TYR A CA  1 
ATOM   13   C C   . TYR A 1 4   ? 17.033 5.650  82.442 1.00 39.43 ? 4   TYR A C   1 
ATOM   14   O O   . TYR A 1 4   ? 18.193 5.749  82.834 1.00 42.75 ? 4   TYR A O   1 
ATOM   15   C CB  . TYR A 1 4   ? 15.722 3.612  82.670 1.00 69.83 ? 4   TYR A CB  1 
ATOM   16   C CG  . TYR A 1 4   ? 15.390 2.575  83.681 1.00 71.32 ? 4   TYR A CG  1 
ATOM   17   C CD1 . TYR A 1 4   ? 16.381 2.068  84.508 1.00 78.12 ? 4   TYR A CD1 1 
ATOM   18   C CD2 . TYR A 1 4   ? 14.094 2.085  83.822 1.00 80.67 ? 4   TYR A CD2 1 
ATOM   19   C CE1 . TYR A 1 4   ? 16.101 1.112  85.461 1.00 80.42 ? 4   TYR A CE1 1 
ATOM   20   C CE2 . TYR A 1 4   ? 13.795 1.101  84.800 1.00 84.39 ? 4   TYR A CE2 1 
ATOM   21   C CZ  . TYR A 1 4   ? 14.812 0.626  85.603 1.00 85.29 ? 4   TYR A CZ  1 
ATOM   22   O OH  . TYR A 1 4   ? 14.538 -0.339 86.565 1.00 91.14 ? 4   TYR A OH  1 
ATOM   23   N N   . LYS A 1 5   ? 16.619 6.084  81.253 1.00 39.49 ? 5   LYS A N   1 
ATOM   24   C CA  . LYS A 1 5   ? 17.565 6.776  80.403 1.00 32.02 ? 5   LYS A CA  1 
ATOM   25   C C   . LYS A 1 5   ? 17.955 8.052  81.112 1.00 34.67 ? 5   LYS A C   1 
ATOM   26   O O   . LYS A 1 5   ? 17.145 8.648  81.831 1.00 34.02 ? 5   LYS A O   1 
ATOM   27   C CB  . LYS A 1 5   ? 16.999 7.057  79.007 1.00 34.94 ? 5   LYS A CB  1 
ATOM   28   C CG  . LYS A 1 5   ? 16.913 5.826  78.126 1.00 35.00 ? 5   LYS A CG  1 
ATOM   29   C CD  . LYS A 1 5   ? 17.213 6.148  76.664 1.00 41.63 ? 5   LYS A CD  1 
ATOM   30   C CE  . LYS A 1 5   ? 16.073 6.902  76.013 1.00 36.44 ? 5   LYS A CE  1 
ATOM   31   N NZ  . LYS A 1 5   ? 16.260 6.971  74.533 1.00 29.90 ? 5   LYS A NZ  1 
ATOM   32   N N   . GLU A 1 6   ? 19.205 8.453  80.935 1.00 32.09 ? 6   GLU A N   1 
ATOM   33   C CA  . GLU A 1 6   ? 19.714 9.641  81.581 1.00 36.07 ? 6   GLU A CA  1 
ATOM   34   C C   . GLU A 1 6   ? 19.434 10.879 80.736 1.00 31.91 ? 6   GLU A C   1 
ATOM   35   O O   . GLU A 1 6   ? 19.704 10.891 79.527 1.00 31.14 ? 6   GLU A O   1 
ATOM   36   C CB  . GLU A 1 6   ? 21.215 9.505  81.844 1.00 39.50 ? 6   GLU A CB  1 
ATOM   37   C CG  . GLU A 1 6   ? 21.545 8.912  83.198 1.00 58.65 ? 6   GLU A CG  1 
ATOM   38   C CD  . GLU A 1 6   ? 21.284 9.890  84.323 1.00 68.76 ? 6   GLU A CD  1 
ATOM   39   O OE1 . GLU A 1 6   ? 21.807 11.025 84.257 1.00 74.54 ? 6   GLU A OE1 1 
ATOM   40   O OE2 . GLU A 1 6   ? 20.549 9.535  85.267 1.00 76.01 ? 6   GLU A OE2 1 
ATOM   41   N N   . PRO A 1 7   ? 18.877 11.918 81.370 1.00 29.70 ? 7   PRO A N   1 
ATOM   42   C CA  . PRO A 1 7   ? 18.697 13.197 80.690 1.00 30.14 ? 7   PRO A CA  1 
ATOM   43   C C   . PRO A 1 7   ? 20.064 13.755 80.338 1.00 33.11 ? 7   PRO A C   1 
ATOM   44   O O   . PRO A 1 7   ? 21.032 13.460 81.033 1.00 31.15 ? 7   PRO A O   1 
ATOM   45   C CB  . PRO A 1 7   ? 18.052 14.076 81.767 1.00 27.95 ? 7   PRO A CB  1 
ATOM   46   C CG  . PRO A 1 7   ? 17.407 13.099 82.735 1.00 32.01 ? 7   PRO A CG  1 
ATOM   47   C CD  . PRO A 1 7   ? 18.366 11.942 82.756 1.00 33.83 ? 7   PRO A CD  1 
ATOM   48   N N   . PHE A 1 8   ? 20.156 14.537 79.270 1.00 30.17 ? 8   PHE A N   1 
ATOM   49   C CA  . PHE A 1 8   ? 21.406 15.213 78.969 1.00 32.31 ? 8   PHE A CA  1 
ATOM   50   C C   . PHE A 1 8   ? 21.121 16.539 78.290 1.00 32.13 ? 8   PHE A C   1 
ATOM   51   O O   . PHE A 1 8   ? 20.031 16.757 77.756 1.00 29.25 ? 8   PHE A O   1 
ATOM   52   C CB  . PHE A 1 8   ? 22.306 14.338 78.074 1.00 27.77 ? 8   PHE A CB  1 
ATOM   53   C CG  . PHE A 1 8   ? 21.701 14.011 76.730 1.00 30.04 ? 8   PHE A CG  1 
ATOM   54   C CD1 . PHE A 1 8   ? 21.861 14.879 75.645 1.00 31.31 ? 8   PHE A CD1 1 
ATOM   55   C CD2 . PHE A 1 8   ? 20.983 12.839 76.546 1.00 31.19 ? 8   PHE A CD2 1 
ATOM   56   C CE1 . PHE A 1 8   ? 21.298 14.572 74.405 1.00 32.50 ? 8   PHE A CE1 1 
ATOM   57   C CE2 . PHE A 1 8   ? 20.421 12.524 75.311 1.00 31.38 ? 8   PHE A CE2 1 
ATOM   58   C CZ  . PHE A 1 8   ? 20.579 13.393 74.238 1.00 30.21 ? 8   PHE A CZ  1 
ATOM   59   N N   . GLY A 1 9   ? 22.100 17.430 78.335 1.00 26.76 ? 9   GLY A N   1 
ATOM   60   C CA  . GLY A 1 9   ? 22.055 18.648 77.559 1.00 24.39 ? 9   GLY A CA  1 
ATOM   61   C C   . GLY A 1 9   ? 23.246 18.678 76.618 1.00 31.56 ? 9   GLY A C   1 
ATOM   62   O O   . GLY A 1 9   ? 24.302 18.102 76.925 1.00 32.32 ? 9   GLY A O   1 
ATOM   63   N N   . VAL A 1 10  ? 23.078 19.324 75.469 1.00 27.52 ? 10  VAL A N   1 
ATOM   64   C CA  . VAL A 1 10  ? 24.186 19.534 74.552 1.00 28.09 ? 10  VAL A CA  1 
ATOM   65   C C   . VAL A 1 10  ? 24.106 20.956 74.042 1.00 31.46 ? 10  VAL A C   1 
ATOM   66   O O   . VAL A 1 10  ? 23.008 21.509 73.892 1.00 29.84 ? 10  VAL A O   1 
ATOM   67   C CB  . VAL A 1 10  ? 24.152 18.568 73.348 1.00 33.99 ? 10  VAL A CB  1 
ATOM   68   C CG1 . VAL A 1 10  ? 24.436 17.150 73.783 1.00 42.09 ? 10  VAL A CG1 1 
ATOM   69   C CG2 . VAL A 1 10  ? 22.810 18.656 72.623 1.00 33.95 ? 10  VAL A CG2 1 
ATOM   70   N N   . LYS A 1 11  ? 25.263 21.560 73.795 1.00 28.56 ? 11  LYS A N   1 
ATOM   71   C CA  . LYS A 1 11  ? 25.289 22.877 73.185 1.00 31.03 ? 11  LYS A CA  1 
ATOM   72   C C   . LYS A 1 11  ? 25.139 22.777 71.673 1.00 30.80 ? 11  LYS A C   1 
ATOM   73   O O   . LYS A 1 11  ? 25.682 21.869 71.029 1.00 30.50 ? 11  LYS A O   1 
ATOM   74   C CB  . LYS A 1 11  ? 26.582 23.623 73.526 1.00 40.00 ? 11  LYS A CB  1 
ATOM   75   C CG  . LYS A 1 11  ? 26.487 24.431 74.803 1.00 51.27 ? 11  LYS A CG  1 
ATOM   76   C CD  . LYS A 1 11  ? 27.854 24.776 75.366 1.00 60.48 ? 11  LYS A CD  1 
ATOM   77   C CE  . LYS A 1 11  ? 27.724 25.386 76.754 1.00 69.27 ? 11  LYS A CE  1 
ATOM   78   N NZ  . LYS A 1 11  ? 29.041 25.828 77.292 1.00 76.13 ? 11  LYS A NZ  1 
ATOM   79   N N   . VAL A 1 12  ? 24.383 23.716 71.124 1.00 27.59 ? 12  VAL A N   1 
ATOM   80   C CA  . VAL A 1 12  ? 24.286 23.885 69.694 1.00 31.04 ? 12  VAL A CA  1 
ATOM   81   C C   . VAL A 1 12  ? 24.856 25.262 69.402 1.00 37.64 ? 12  VAL A C   1 
ATOM   82   O O   . VAL A 1 12  ? 24.400 26.255 69.957 1.00 37.01 ? 12  VAL A O   1 
ATOM   83   C CB  . VAL A 1 12  ? 22.822 23.799 69.222 1.00 34.05 ? 12  VAL A CB  1 
ATOM   84   C CG1 . VAL A 1 12  ? 22.715 24.084 67.726 1.00 37.20 ? 12  VAL A CG1 1 
ATOM   85   C CG2 . VAL A 1 12  ? 22.237 22.421 69.568 1.00 34.57 ? 12  VAL A CG2 1 
ATOM   86   N N   . ASP A 1 13  ? 25.874 25.321 68.555 1.00 36.05 ? 13  ASP A N   1 
ATOM   87   C CA  . ASP A 1 13  ? 26.428 26.601 68.136 1.00 42.44 ? 13  ASP A CA  1 
ATOM   88   C C   . ASP A 1 13  ? 25.502 27.189 67.068 1.00 40.59 ? 13  ASP A C   1 
ATOM   89   O O   . ASP A 1 13  ? 25.453 26.689 65.946 1.00 37.75 ? 13  ASP A O   1 
ATOM   90   C CB  . ASP A 1 13  ? 27.839 26.392 67.576 1.00 42.94 ? 13  ASP A CB  1 
ATOM   91   C CG  . ASP A 1 13  ? 28.568 27.694 67.313 1.00 52.88 ? 13  ASP A CG  1 
ATOM   92   O OD1 . ASP A 1 13  ? 27.926 28.653 66.836 1.00 53.10 ? 13  ASP A OD1 1 
ATOM   93   O OD2 . ASP A 1 13  ? 29.789 27.754 67.583 1.00 51.64 ? 13  ASP A OD2 1 
ATOM   94   N N   . PHE A 1 14  ? 24.747 28.230 67.415 1.00 42.76 ? 14  PHE A N   1 
ATOM   95   C CA  . PHE A 1 14  ? 23.787 28.800 66.465 1.00 48.07 ? 14  PHE A CA  1 
ATOM   96   C C   . PHE A 1 14  ? 24.459 29.382 65.221 1.00 51.33 ? 14  PHE A C   1 
ATOM   97   O O   . PHE A 1 14  ? 23.798 29.620 64.210 1.00 53.87 ? 14  PHE A O   1 
ATOM   98   C CB  . PHE A 1 14  ? 22.895 29.864 67.123 1.00 42.92 ? 14  PHE A CB  1 
ATOM   99   C CG  . PHE A 1 14  ? 21.799 29.297 67.989 1.00 41.89 ? 14  PHE A CG  1 
ATOM   100  C CD1 . PHE A 1 14  ? 21.836 27.977 68.414 1.00 40.28 ? 14  PHE A CD1 1 
ATOM   101  C CD2 . PHE A 1 14  ? 20.722 30.086 68.369 1.00 48.76 ? 14  PHE A CD2 1 
ATOM   102  C CE1 . PHE A 1 14  ? 20.822 27.453 69.210 1.00 40.84 ? 14  PHE A CE1 1 
ATOM   103  C CE2 . PHE A 1 14  ? 19.706 29.571 69.168 1.00 49.93 ? 14  PHE A CE2 1 
ATOM   104  C CZ  . PHE A 1 14  ? 19.757 28.253 69.592 1.00 45.86 ? 14  PHE A CZ  1 
ATOM   105  N N   . GLU A 1 15  ? 25.770 29.593 65.288 1.00 45.52 ? 15  GLU A N   1 
ATOM   106  C CA  . GLU A 1 15  ? 26.498 30.210 64.181 1.00 51.03 ? 15  GLU A CA  1 
ATOM   107  C C   . GLU A 1 15  ? 27.041 29.198 63.165 1.00 51.37 ? 15  GLU A C   1 
ATOM   108  O O   . GLU A 1 15  ? 27.178 29.509 61.980 1.00 50.66 ? 15  GLU A O   1 
ATOM   109  C CB  . GLU A 1 15  ? 27.643 31.073 64.718 1.00 56.35 ? 15  GLU A CB  1 
ATOM   110  C CG  . GLU A 1 15  ? 27.235 32.013 65.847 1.00 66.71 ? 15  GLU A CG  1 
ATOM   111  C CD  . GLU A 1 15  ? 26.340 33.149 65.378 1.00 74.00 ? 15  GLU A CD  1 
ATOM   112  O OE1 . GLU A 1 15  ? 26.694 33.811 64.379 1.00 76.63 ? 15  GLU A OE1 1 
ATOM   113  O OE2 . GLU A 1 15  ? 25.283 33.379 66.007 1.00 76.32 ? 15  GLU A OE2 1 
ATOM   114  N N   . THR A 1 16  ? 27.348 27.990 63.626 1.00 40.26 ? 16  THR A N   1 
ATOM   115  C CA  . THR A 1 16  ? 27.937 26.972 62.764 1.00 35.63 ? 16  THR A CA  1 
ATOM   116  C C   . THR A 1 16  ? 27.032 25.752 62.629 1.00 39.88 ? 16  THR A C   1 
ATOM   117  O O   . THR A 1 16  ? 27.147 24.977 61.673 1.00 35.32 ? 16  THR A O   1 
ATOM   118  C CB  . THR A 1 16  ? 29.271 26.481 63.331 1.00 45.69 ? 16  THR A CB  1 
ATOM   119  O OG1 . THR A 1 16  ? 29.034 25.790 64.567 1.00 41.43 ? 16  THR A OG1 1 
ATOM   120  C CG2 . THR A 1 16  ? 30.215 27.654 63.574 1.00 53.70 ? 16  THR A CG2 1 
ATOM   121  N N   . GLY A 1 17  ? 26.155 25.568 63.611 1.00 34.60 ? 17  GLY A N   1 
ATOM   122  C CA  . GLY A 1 17  ? 25.249 24.438 63.621 1.00 30.23 ? 17  GLY A CA  1 
ATOM   123  C C   . GLY A 1 17  ? 25.861 23.213 64.264 1.00 32.13 ? 17  GLY A C   1 
ATOM   124  O O   . GLY A 1 17  ? 25.210 22.178 64.374 1.00 28.45 ? 17  GLY A O   1 
ATOM   125  N N   . ILE A 1 18  ? 27.117 23.316 64.697 1.00 28.84 ? 18  ILE A N   1 
ATOM   126  C CA  . ILE A 1 18  ? 27.793 22.140 65.229 1.00 27.75 ? 18  ILE A CA  1 
ATOM   127  C C   . ILE A 1 18  ? 27.246 21.707 66.582 1.00 28.27 ? 18  ILE A C   1 
ATOM   128  O O   . ILE A 1 18  ? 27.001 22.535 67.462 1.00 31.10 ? 18  ILE A O   1 
ATOM   129  C CB  . ILE A 1 18  ? 29.317 22.358 65.364 1.00 31.87 ? 18  ILE A CB  1 
ATOM   130  C CG1 . ILE A 1 18  ? 29.958 22.561 63.987 1.00 34.06 ? 18  ILE A CG1 1 
ATOM   131  C CG2 . ILE A 1 18  ? 29.960 21.183 66.101 1.00 33.40 ? 18  ILE A CG2 1 
ATOM   132  C CD1 . ILE A 1 18  ? 31.417 23.005 64.071 1.00 39.82 ? 18  ILE A CD1 1 
ATOM   133  N N   . ILE A 1 19  ? 27.067 20.400 66.732 1.00 27.93 ? 19  ILE A N   1 
ATOM   134  C CA  . ILE A 1 19  ? 26.747 19.773 68.010 1.00 32.33 ? 19  ILE A CA  1 
ATOM   135  C C   . ILE A 1 19  ? 27.869 18.771 68.306 1.00 29.93 ? 19  ILE A C   1 
ATOM   136  O O   . ILE A 1 19  ? 28.032 17.795 67.574 1.00 32.96 ? 19  ILE A O   1 
ATOM   137  C CB  . ILE A 1 19  ? 25.387 19.021 67.927 1.00 30.58 ? 19  ILE A CB  1 
ATOM   138  C CG1 . ILE A 1 19  ? 24.273 19.985 67.500 1.00 27.58 ? 19  ILE A CG1 1 
ATOM   139  C CG2 . ILE A 1 19  ? 25.056 18.325 69.259 1.00 30.30 ? 19  ILE A CG2 1 
ATOM   140  C CD1 . ILE A 1 19  ? 22.944 19.320 67.237 1.00 27.66 ? 19  ILE A CD1 1 
ATOM   141  N N   . GLU A 1 20  ? 28.664 19.017 69.347 1.00 36.61 ? 20  GLU A N   1 
ATOM   142  C CA  . GLU A 1 20  ? 29.776 18.110 69.661 1.00 40.28 ? 20  GLU A CA  1 
ATOM   143  C C   . GLU A 1 20  ? 29.247 16.753 70.099 1.00 37.20 ? 20  GLU A C   1 
ATOM   144  O O   . GLU A 1 20  ? 28.294 16.676 70.867 1.00 35.57 ? 20  GLU A O   1 
ATOM   145  C CB  . GLU A 1 20  ? 30.693 18.689 70.744 1.00 44.85 ? 20  GLU A CB  1 
ATOM   146  C CG  . GLU A 1 20  ? 31.419 19.957 70.340 1.00 49.60 ? 20  GLU A CG  1 
ATOM   147  C CD  . GLU A 1 20  ? 32.495 20.352 71.336 1.00 61.99 ? 20  GLU A CD  1 
ATOM   148  O OE1 . GLU A 1 20  ? 32.804 19.538 72.236 1.00 63.34 ? 20  GLU A OE1 1 
ATOM   149  O OE2 . GLU A 1 20  ? 33.032 21.474 71.217 1.00 62.14 ? 20  GLU A OE2 1 
ATOM   150  N N   . GLY A 1 21  ? 29.855 15.683 69.596 1.00 39.36 ? 21  GLY A N   1 
ATOM   151  C CA  . GLY A 1 21  ? 29.430 14.336 69.942 1.00 42.55 ? 21  GLY A CA  1 
ATOM   152  C C   . GLY A 1 21  ? 28.250 13.818 69.136 1.00 41.93 ? 21  GLY A C   1 
ATOM   153  O O   . GLY A 1 21  ? 27.838 12.665 69.293 1.00 40.78 ? 21  GLY A O   1 
ATOM   154  N N   . ALA A 1 22  ? 27.695 14.663 68.269 1.00 34.07 ? 22  ALA A N   1 
ATOM   155  C CA  . ALA A 1 22  ? 26.579 14.240 67.430 1.00 31.09 ? 22  ALA A CA  1 
ATOM   156  C C   . ALA A 1 22  ? 27.086 13.431 66.245 1.00 34.10 ? 22  ALA A C   1 
ATOM   157  O O   . ALA A 1 22  ? 28.263 13.523 65.883 1.00 33.66 ? 22  ALA A O   1 
ATOM   158  C CB  . ALA A 1 22  ? 25.785 15.447 66.947 1.00 28.16 ? 22  ALA A CB  1 
ATOM   159  N N   . LYS A 1 23  ? 26.202 12.633 65.652 1.00 25.94 ? 23  LYS A N   1 
ATOM   160  C CA  . LYS A 1 23  ? 26.512 11.936 64.413 1.00 27.34 ? 23  LYS A CA  1 
ATOM   161  C C   . LYS A 1 23  ? 26.554 12.969 63.289 1.00 32.65 ? 23  LYS A C   1 
ATOM   162  O O   . LYS A 1 23  ? 25.551 13.625 63.009 1.00 27.94 ? 23  LYS A O   1 
ATOM   163  C CB  . LYS A 1 23  ? 25.443 10.892 64.119 1.00 31.57 ? 23  LYS A CB  1 
ATOM   164  C CG  . LYS A 1 23  ? 25.643 10.136 62.813 1.00 46.53 ? 23  LYS A CG  1 
ATOM   165  C CD  . LYS A 1 23  ? 24.318 9.551  62.336 1.00 53.15 ? 23  LYS A CD  1 
ATOM   166  C CE  . LYS A 1 23  ? 24.501 8.592  61.177 1.00 62.47 ? 23  LYS A CE  1 
ATOM   167  N NZ  . LYS A 1 23  ? 23.188 8.162  60.616 1.00 64.12 ? 23  LYS A NZ  1 
ATOM   168  N N   . LYS A 1 24  ? 27.716 13.125 62.660 1.00 29.11 ? 24  LYS A N   1 
ATOM   169  C CA  . LYS A 1 24  ? 27.899 14.165 61.651 1.00 32.12 ? 24  LYS A CA  1 
ATOM   170  C C   . LYS A 1 24  ? 27.860 13.565 60.251 1.00 30.55 ? 24  LYS A C   1 
ATOM   171  O O   . LYS A 1 24  ? 28.599 12.632 59.959 1.00 28.82 ? 24  LYS A O   1 
ATOM   172  C CB  . LYS A 1 24  ? 29.212 14.913 61.893 1.00 31.17 ? 24  LYS A CB  1 
ATOM   173  C CG  . LYS A 1 24  ? 29.618 15.864 60.782 1.00 33.19 ? 24  LYS A CG  1 
ATOM   174  C CD  . LYS A 1 24  ? 30.951 16.527 61.111 1.00 39.77 ? 24  LYS A CD  1 
ATOM   175  C CE  . LYS A 1 24  ? 31.411 17.433 59.979 1.00 42.81 ? 24  LYS A CE  1 
ATOM   176  N NZ  . LYS A 1 24  ? 32.694 18.109 60.297 1.00 43.76 ? 24  LYS A NZ  1 
ATOM   177  N N   . SER A 1 25  ? 26.972 14.080 59.400 1.00 27.25 ? 25  SER A N   1 
ATOM   178  C CA  . SER A 1 25  ? 26.857 13.624 58.016 1.00 28.24 ? 25  SER A CA  1 
ATOM   179  C C   . SER A 1 25  ? 27.133 14.781 57.062 1.00 29.02 ? 25  SER A C   1 
ATOM   180  O O   . SER A 1 25  ? 26.500 15.835 57.154 1.00 26.75 ? 25  SER A O   1 
ATOM   181  C CB  . SER A 1 25  ? 25.466 13.056 57.740 1.00 30.72 ? 25  SER A CB  1 
ATOM   182  O OG  . SER A 1 25  ? 25.216 11.917 58.544 1.00 33.19 ? 25  SER A OG  1 
ATOM   183  N N   . VAL A 1 26  ? 28.085 14.586 56.150 1.00 27.85 ? 26  VAL A N   1 
ATOM   184  C CA  . VAL A 1 26  ? 28.465 15.635 55.213 1.00 27.67 ? 26  VAL A CA  1 
ATOM   185  C C   . VAL A 1 26  ? 28.104 15.182 53.813 1.00 29.04 ? 26  VAL A C   1 
ATOM   186  O O   . VAL A 1 26  ? 28.507 14.094 53.394 1.00 26.70 ? 26  VAL A O   1 
ATOM   187  C CB  . VAL A 1 26  ? 29.985 15.900 55.254 1.00 28.89 ? 26  VAL A CB  1 
ATOM   188  C CG1 . VAL A 1 26  ? 30.377 16.927 54.187 1.00 32.03 ? 26  VAL A CG1 1 
ATOM   189  C CG2 . VAL A 1 26  ? 30.429 16.339 56.644 1.00 32.13 ? 26  VAL A CG2 1 
ATOM   190  N N   . ARG A 1 27  ? 27.337 15.992 53.086 1.00 26.76 ? 27  ARG A N   1 
ATOM   191  C CA  . ARG A 1 27  ? 26.992 15.635 51.722 1.00 25.14 ? 27  ARG A CA  1 
ATOM   192  C C   . ARG A 1 27  ? 27.518 16.685 50.762 1.00 25.94 ? 27  ARG A C   1 
ATOM   193  O O   . ARG A 1 27  ? 27.172 17.858 50.861 1.00 24.35 ? 27  ARG A O   1 
ATOM   194  C CB  . ARG A 1 27  ? 25.482 15.407 51.563 1.00 26.13 ? 27  ARG A CB  1 
ATOM   195  C CG  . ARG A 1 27  ? 24.950 14.234 52.417 1.00 29.48 ? 27  ARG A CG  1 
ATOM   196  C CD  . ARG A 1 27  ? 23.466 14.011 52.208 1.00 30.13 ? 27  ARG A CD  1 
ATOM   197  N NE  . ARG A 1 27  ? 22.938 12.797 52.844 1.00 27.51 ? 27  ARG A NE  1 
ATOM   198  C CZ  . ARG A 1 27  ? 22.606 12.693 54.131 1.00 31.22 ? 27  ARG A CZ  1 
ATOM   199  N NH1 . ARG A 1 27  ? 22.798 13.713 54.962 1.00 27.42 ? 27  ARG A NH1 1 
ATOM   200  N NH2 . ARG A 1 27  ? 22.104 11.551 54.593 1.00 30.11 ? 27  ARG A NH2 1 
ATOM   201  N N   . ARG A 1 28  ? 28.400 16.258 49.858 1.00 25.71 ? 28  ARG A N   1 
ATOM   202  C CA  . ARG A 1 28  ? 28.917 17.145 48.819 1.00 26.67 ? 28  ARG A CA  1 
ATOM   203  C C   . ARG A 1 28  ? 28.047 17.102 47.578 1.00 22.84 ? 28  ARG A C   1 
ATOM   204  O O   . ARG A 1 28  ? 27.147 16.266 47.455 1.00 26.54 ? 28  ARG A O   1 
ATOM   205  C CB  . ARG A 1 28  ? 30.385 16.789 48.477 1.00 28.28 ? 28  ARG A CB  1 
ATOM   206  C CG  . ARG A 1 28  ? 31.369 17.126 49.597 1.00 32.58 ? 28  ARG A CG  1 
ATOM   207  C CD  . ARG A 1 28  ? 32.835 16.939 49.173 1.00 42.82 ? 28  ARG A CD  1 
ATOM   208  N NE  . ARG A 1 28  ? 33.750 17.290 50.263 1.00 50.33 ? 28  ARG A NE  1 
ATOM   209  C CZ  . ARG A 1 28  ? 34.428 18.432 50.345 1.00 53.30 ? 28  ARG A CZ  1 
ATOM   210  N NH1 . ARG A 1 28  ? 34.323 19.348 49.388 1.00 45.19 ? 28  ARG A NH1 1 
ATOM   211  N NH2 . ARG A 1 28  ? 35.225 18.654 51.384 1.00 59.02 ? 28  ARG A NH2 1 
ATOM   212  N N   . LEU A 1 29  ? 28.287 18.019 46.647 1.00 25.02 ? 29  LEU A N   1 
ATOM   213  C CA  . LEU A 1 29  ? 27.492 18.040 45.429 1.00 24.73 ? 29  LEU A CA  1 
ATOM   214  C C   . LEU A 1 29  ? 27.546 16.695 44.706 1.00 26.72 ? 29  LEU A C   1 
ATOM   215  O O   . LEU A 1 29  ? 26.557 16.241 44.121 1.00 26.81 ? 29  LEU A O   1 
ATOM   216  C CB  . LEU A 1 29  ? 27.979 19.166 44.520 1.00 27.93 ? 29  LEU A CB  1 
ATOM   217  C CG  . LEU A 1 29  ? 27.071 19.526 43.352 1.00 30.22 ? 29  LEU A CG  1 
ATOM   218  C CD1 . LEU A 1 29  ? 25.654 19.838 43.847 1.00 26.62 ? 29  LEU A CD1 1 
ATOM   219  C CD2 . LEU A 1 29  ? 27.658 20.720 42.601 1.00 34.60 ? 29  LEU A CD2 1 
ATOM   220  N N   . SER A 1 30  ? 28.704 16.044 44.764 1.00 28.95 ? 30  SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 28.864 14.732 44.135 1.00 31.77 ? 30  SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 27.958 13.686 44.774 1.00 33.49 ? 30  SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 27.616 12.681 44.140 1.00 30.15 ? 30  SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 30.329 14.279 44.188 1.00 32.10 ? 30  SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 30.860 14.360 45.501 1.00 31.77 ? 30  SER A OG  1 
ATOM   226  N N   . ASP A 1 31  ? 27.566 13.923 46.030 1.00 26.14 ? 31  ASP A N   1 
ATOM   227  C CA  . ASP A 1 31  ? 26.645 13.017 46.710 1.00 27.01 ? 31  ASP A CA  1 
ATOM   228  C C   . ASP A 1 31  ? 25.194 13.260 46.321 1.00 29.65 ? 31  ASP A C   1 
ATOM   229  O O   . ASP A 1 31  ? 24.297 12.529 46.745 1.00 29.03 ? 31  ASP A O   1 
ATOM   230  C CB  . ASP A 1 31  ? 26.801 13.110 48.229 1.00 27.89 ? 31  ASP A CB  1 
ATOM   231  C CG  . ASP A 1 31  ? 28.195 12.761 48.688 1.00 33.57 ? 31  ASP A CG  1 
ATOM   232  O OD1 . ASP A 1 31  ? 28.688 11.665 48.306 1.00 32.54 ? 31  ASP A OD1 1 
ATOM   233  O OD2 . ASP A 1 31  ? 28.811 13.583 49.400 1.00 30.54 ? 31  ASP A OD2 1 
ATOM   234  N N   . MET A 1 32  ? 24.959 14.262 45.479 1.00 27.23 ? 32  MET A N   1 
ATOM   235  C CA  . MET A 1 32  ? 23.594 14.619 45.120 1.00 28.47 ? 32  MET A CA  1 
ATOM   236  C C   . MET A 1 32  ? 23.346 14.554 43.621 1.00 31.89 ? 32  MET A C   1 
ATOM   237  O O   . MET A 1 32  ? 22.683 15.411 43.030 1.00 29.91 ? 32  MET A O   1 
ATOM   238  C CB  . MET A 1 32  ? 23.244 15.987 45.717 1.00 30.70 ? 32  MET A CB  1 
ATOM   239  C CG  . MET A 1 32  ? 23.362 15.958 47.258 1.00 37.89 ? 32  MET A CG  1 
ATOM   240  S SD  . MET A 1 32  ? 23.050 17.551 48.025 1.00 27.67 ? 32  MET A SD  1 
ATOM   241  C CE  . MET A 1 32  ? 21.304 17.715 47.615 1.00 28.99 ? 32  MET A CE  1 
ATOM   242  N N   . GLU A 1 33  ? 23.861 13.502 43.002 1.00 31.01 ? 33  GLU A N   1 
ATOM   243  C CA  . GLU A 1 33  ? 23.575 13.287 41.598 1.00 32.42 ? 33  GLU A CA  1 
ATOM   244  C C   . GLU A 1 33  ? 22.084 13.067 41.400 1.00 30.73 ? 33  GLU A C   1 
ATOM   245  O O   . GLU A 1 33  ? 21.437 12.333 42.160 1.00 33.37 ? 33  GLU A O   1 
ATOM   246  C CB  . GLU A 1 33  ? 24.341 12.072 41.079 1.00 37.33 ? 33  GLU A CB  1 
ATOM   247  C CG  . GLU A 1 33  ? 24.011 11.749 39.646 1.00 44.07 ? 33  GLU A CG  1 
ATOM   248  C CD  . GLU A 1 33  ? 25.046 10.846 39.005 1.00 53.68 ? 33  GLU A CD  1 
ATOM   249  O OE1 . GLU A 1 33  ? 25.923 10.321 39.734 1.00 50.14 ? 33  GLU A OE1 1 
ATOM   250  O OE2 . GLU A 1 33  ? 24.977 10.678 37.770 1.00 57.33 ? 33  GLU A OE2 1 
ATOM   251  N N   . GLY A 1 34  ? 21.537 13.710 40.378 1.00 31.63 ? 34  GLY A N   1 
ATOM   252  C CA  . GLY A 1 34  ? 20.140 13.540 40.043 1.00 36.28 ? 34  GLY A CA  1 
ATOM   253  C C   . GLY A 1 34  ? 19.195 14.417 40.856 1.00 37.08 ? 34  GLY A C   1 
ATOM   254  O O   . GLY A 1 34  ? 17.983 14.336 40.670 1.00 41.41 ? 34  GLY A O   1 
ATOM   255  N N   . TYR A 1 35  ? 19.729 15.239 41.753 1.00 27.38 ? 35  TYR A N   1 
ATOM   256  C CA  . TYR A 1 35  ? 18.860 16.048 42.622 1.00 24.83 ? 35  TYR A CA  1 
ATOM   257  C C   . TYR A 1 35  ? 18.509 17.423 42.029 1.00 28.97 ? 35  TYR A C   1 
ATOM   258  O O   . TYR A 1 35  ? 17.436 17.975 42.306 1.00 27.87 ? 35  TYR A O   1 
ATOM   259  C CB  . TYR A 1 35  ? 19.466 16.204 44.020 1.00 23.62 ? 35  TYR A CB  1 
ATOM   260  C CG  . TYR A 1 35  ? 19.137 15.031 44.907 1.00 28.21 ? 35  TYR A CG  1 
ATOM   261  C CD1 . TYR A 1 35  ? 19.786 13.807 44.751 1.00 26.45 ? 35  TYR A CD1 1 
ATOM   262  C CD2 . TYR A 1 35  ? 18.155 15.131 45.876 1.00 25.66 ? 35  TYR A CD2 1 
ATOM   263  C CE1 . TYR A 1 35  ? 19.462 12.712 45.561 1.00 27.82 ? 35  TYR A CE1 1 
ATOM   264  C CE2 . TYR A 1 35  ? 17.830 14.049 46.682 1.00 28.51 ? 35  TYR A CE2 1 
ATOM   265  C CZ  . TYR A 1 35  ? 18.480 12.848 46.520 1.00 27.78 ? 35  TYR A CZ  1 
ATOM   266  O OH  . TYR A 1 35  ? 18.129 11.800 47.327 1.00 26.49 ? 35  TYR A OH  1 
ATOM   267  N N   . PHE A 1 36  ? 19.410 17.969 41.219 1.00 29.18 ? 36  PHE A N   1 
ATOM   268  C CA  . PHE A 1 36  ? 19.210 19.305 40.648 1.00 27.19 ? 36  PHE A CA  1 
ATOM   269  C C   . PHE A 1 36  ? 18.763 19.230 39.184 1.00 31.05 ? 36  PHE A C   1 
ATOM   270  O O   . PHE A 1 36  ? 19.116 18.293 38.464 1.00 32.52 ? 36  PHE A O   1 
ATOM   271  C CB  . PHE A 1 36  ? 20.490 20.138 40.790 1.00 32.12 ? 36  PHE A CB  1 
ATOM   272  C CG  . PHE A 1 36  ? 20.888 20.396 42.220 1.00 28.33 ? 36  PHE A CG  1 
ATOM   273  C CD1 . PHE A 1 36  ? 21.663 19.471 42.922 1.00 29.38 ? 36  PHE A CD1 1 
ATOM   274  C CD2 . PHE A 1 36  ? 20.470 21.550 42.877 1.00 26.74 ? 36  PHE A CD2 1 
ATOM   275  C CE1 . PHE A 1 36  ? 22.022 19.698 44.250 1.00 29.34 ? 36  PHE A CE1 1 
ATOM   276  C CE2 . PHE A 1 36  ? 20.825 21.788 44.203 1.00 28.48 ? 36  PHE A CE2 1 
ATOM   277  C CZ  . PHE A 1 36  ? 21.605 20.863 44.896 1.00 30.31 ? 36  PHE A CZ  1 
ATOM   278  N N   . VAL A 1 37  ? 17.972 20.203 38.741 1.00 29.89 ? 37  VAL A N   1 
ATOM   279  C CA  . VAL A 1 37  ? 17.407 20.146 37.396 1.00 33.44 ? 37  VAL A CA  1 
ATOM   280  C C   . VAL A 1 37  ? 18.461 20.304 36.298 1.00 34.78 ? 37  VAL A C   1 
ATOM   281  O O   . VAL A 1 37  ? 18.337 19.709 35.232 1.00 39.11 ? 37  VAL A O   1 
ATOM   282  C CB  . VAL A 1 37  ? 16.286 21.189 37.188 1.00 44.16 ? 37  VAL A CB  1 
ATOM   283  C CG1 . VAL A 1 37  ? 15.043 20.797 37.977 1.00 43.91 ? 37  VAL A CG1 1 
ATOM   284  C CG2 . VAL A 1 37  ? 16.775 22.578 37.587 1.00 54.85 ? 37  VAL A CG2 1 
ATOM   285  N N   . ASP A 1 38  ? 19.494 21.097 36.554 1.00 35.99 ? 38  ASP A N   1 
ATOM   286  C CA  . ASP A 1 38  ? 20.492 21.396 35.524 1.00 38.17 ? 38  ASP A CA  1 
ATOM   287  C C   . ASP A 1 38  ? 21.673 20.440 35.641 1.00 36.03 ? 38  ASP A C   1 
ATOM   288  O O   . ASP A 1 38  ? 22.663 20.756 36.289 1.00 33.88 ? 38  ASP A O   1 
ATOM   289  C CB  . ASP A 1 38  ? 20.989 22.846 35.639 1.00 37.80 ? 38  ASP A CB  1 
ATOM   290  C CG  . ASP A 1 38  ? 21.828 23.281 34.434 1.00 44.15 ? 38  ASP A CG  1 
ATOM   291  O OD1 . ASP A 1 38  ? 22.282 22.410 33.658 1.00 39.14 ? 38  ASP A OD1 1 
ATOM   292  O OD2 . ASP A 1 38  ? 22.041 24.503 34.268 1.00 43.43 ? 38  ASP A OD2 1 
ATOM   293  N N   . GLU A 1 39  ? 21.572 19.279 35.002 1.00 33.90 ? 39  GLU A N   1 
ATOM   294  C CA  . GLU A 1 39  ? 22.629 18.273 35.116 1.00 35.29 ? 39  GLU A CA  1 
ATOM   295  C C   . GLU A 1 39  ? 23.978 18.751 34.579 1.00 36.15 ? 39  GLU A C   1 
ATOM   296  O O   . GLU A 1 39  ? 25.020 18.429 35.134 1.00 34.88 ? 39  GLU A O   1 
ATOM   297  C CB  . GLU A 1 39  ? 22.203 16.966 34.455 1.00 45.92 ? 39  GLU A CB  1 
ATOM   298  C CG  . GLU A 1 39  ? 20.843 16.487 34.941 1.00 64.59 ? 39  GLU A CG  1 
ATOM   299  C CD  . GLU A 1 39  ? 20.501 15.080 34.490 1.00 78.23 ? 39  GLU A CD  1 
ATOM   300  O OE1 . GLU A 1 39  ? 21.354 14.421 33.853 1.00 84.43 ? 39  GLU A OE1 1 
ATOM   301  O OE2 . GLU A 1 39  ? 19.371 14.632 34.779 1.00 80.94 ? 39  GLU A OE2 1 
ATOM   302  N N   . ARG A 1 40  ? 23.974 19.534 33.506 1.00 32.58 ? 40  ARG A N   1 
ATOM   303  C CA  . ARG A 1 40  ? 25.239 20.051 32.995 1.00 38.28 ? 40  ARG A CA  1 
ATOM   304  C C   . ARG A 1 40  ? 25.922 20.964 34.007 1.00 33.92 ? 40  ARG A C   1 
ATOM   305  O O   . ARG A 1 40  ? 27.135 20.900 34.198 1.00 35.85 ? 40  ARG A O   1 
ATOM   306  C CB  . ARG A 1 40  ? 25.036 20.773 31.656 1.00 41.08 ? 40  ARG A CB  1 
ATOM   307  C CG  . ARG A 1 40  ? 24.455 19.882 30.573 1.00 41.76 ? 40  ARG A CG  1 
ATOM   308  C CD  . ARG A 1 40  ? 24.347 20.612 29.235 1.00 52.46 ? 40  ARG A CD  1 
ATOM   309  N NE  . ARG A 1 40  ? 23.794 19.752 28.190 1.00 57.77 ? 40  ARG A NE  1 
ATOM   310  C CZ  . ARG A 1 40  ? 22.496 19.493 28.047 1.00 64.52 ? 40  ARG A CZ  1 
ATOM   311  N NH1 . ARG A 1 40  ? 21.615 20.022 28.887 1.00 59.54 ? 40  ARG A NH1 1 
ATOM   312  N NH2 . ARG A 1 40  ? 22.076 18.701 27.069 1.00 62.03 ? 40  ARG A NH2 1 
ATOM   313  N N   . ALA A 1 41  ? 25.144 21.817 34.667 1.00 33.26 ? 41  ALA A N   1 
ATOM   314  C CA  . ALA A 1 41  ? 25.707 22.722 35.659 1.00 33.74 ? 41  ALA A CA  1 
ATOM   315  C C   . ALA A 1 41  ? 26.193 21.932 36.876 1.00 29.91 ? 41  ALA A C   1 
ATOM   316  O O   . ALA A 1 41  ? 27.180 22.282 37.526 1.00 33.61 ? 41  ALA A O   1 
ATOM   317  C CB  . ALA A 1 41  ? 24.674 23.769 36.069 1.00 33.70 ? 41  ALA A CB  1 
ATOM   318  N N   . TRP A 1 42  ? 25.479 20.865 37.181 1.00 30.29 ? 42  TRP A N   1 
ATOM   319  C CA  . TRP A 1 42  ? 25.881 19.968 38.265 1.00 31.00 ? 42  TRP A CA  1 
ATOM   320  C C   . TRP A 1 42  ? 27.262 19.361 37.968 1.00 36.02 ? 42  TRP A C   1 
ATOM   321  O O   . TRP A 1 42  ? 28.206 19.472 38.766 1.00 31.81 ? 42  TRP A O   1 
ATOM   322  C CB  . TRP A 1 42  ? 24.837 18.864 38.424 1.00 28.90 ? 42  TRP A CB  1 
ATOM   323  C CG  . TRP A 1 42  ? 25.207 17.858 39.468 1.00 28.24 ? 42  TRP A CG  1 
ATOM   324  C CD1 . TRP A 1 42  ? 25.007 17.961 40.817 1.00 30.37 ? 42  TRP A CD1 1 
ATOM   325  C CD2 . TRP A 1 42  ? 25.861 16.603 39.253 1.00 31.26 ? 42  TRP A CD2 1 
ATOM   326  N NE1 . TRP A 1 42  ? 25.491 16.844 41.453 1.00 32.77 ? 42  TRP A NE1 1 
ATOM   327  C CE2 . TRP A 1 42  ? 26.020 15.991 40.515 1.00 33.30 ? 42  TRP A CE2 1 
ATOM   328  C CE3 . TRP A 1 42  ? 26.322 15.930 38.111 1.00 31.73 ? 42  TRP A CE3 1 
ATOM   329  C CZ2 . TRP A 1 42  ? 26.630 14.740 40.675 1.00 35.63 ? 42  TRP A CZ2 1 
ATOM   330  C CZ3 . TRP A 1 42  ? 26.929 14.686 38.267 1.00 34.47 ? 42  TRP A CZ3 1 
ATOM   331  C CH2 . TRP A 1 42  ? 27.071 14.104 39.541 1.00 36.77 ? 42  TRP A CH2 1 
ATOM   332  N N   . LYS A 1 43  ? 27.378 18.727 36.805 1.00 35.55 ? 43  LYS A N   1 
ATOM   333  C CA  . LYS A 1 43  ? 28.648 18.111 36.427 1.00 34.33 ? 43  LYS A CA  1 
ATOM   334  C C   . LYS A 1 43  ? 29.807 19.096 36.503 1.00 35.97 ? 43  LYS A C   1 
ATOM   335  O O   . LYS A 1 43  ? 30.862 18.778 37.048 1.00 35.83 ? 43  LYS A O   1 
ATOM   336  C CB  . LYS A 1 43  ? 28.575 17.493 35.034 1.00 36.91 ? 43  LYS A CB  1 
ATOM   337  C CG  . LYS A 1 43  ? 29.908 16.905 34.604 1.00 44.62 ? 43  LYS A CG  1 
ATOM   338  C CD  . LYS A 1 43  ? 29.857 16.294 33.214 1.00 59.41 ? 43  LYS A CD  1 
ATOM   339  C CE  . LYS A 1 43  ? 29.067 14.999 33.196 1.00 70.76 ? 43  LYS A CE  1 
ATOM   340  N NZ  . LYS A 1 43  ? 29.505 14.134 32.060 1.00 72.68 ? 43  LYS A NZ  1 
ATOM   341  N N   . GLU A 1 44  ? 29.600 20.299 35.970 1.00 32.19 ? 44  GLU A N   1 
ATOM   342  C CA  . GLU A 1 44  ? 30.650 21.305 35.917 1.00 39.48 ? 44  GLU A CA  1 
ATOM   343  C C   . GLU A 1 44  ? 31.097 21.738 37.304 1.00 39.03 ? 44  GLU A C   1 
ATOM   344  O O   . GLU A 1 44  ? 32.287 21.941 37.546 1.00 37.68 ? 44  GLU A O   1 
ATOM   345  C CB  . GLU A 1 44  ? 30.193 22.519 35.092 1.00 42.70 ? 44  GLU A CB  1 
ATOM   346  C CG  . GLU A 1 44  ? 31.291 23.540 34.805 1.00 64.69 ? 44  GLU A CG  1 
ATOM   347  C CD  . GLU A 1 44  ? 30.787 24.749 34.019 1.00 82.66 ? 44  GLU A CD  1 
ATOM   348  O OE1 . GLU A 1 44  ? 31.053 24.824 32.796 1.00 90.89 ? 44  GLU A OE1 1 
ATOM   349  O OE2 . GLU A 1 44  ? 30.130 25.627 34.623 1.00 82.30 ? 44  GLU A OE2 1 
ATOM   350  N N   . LEU A 1 45  ? 30.142 21.886 38.220 1.00 37.78 ? 45  LEU A N   1 
ATOM   351  C CA  . LEU A 1 45  ? 30.468 22.330 39.568 1.00 32.80 ? 45  LEU A CA  1 
ATOM   352  C C   . LEU A 1 45  ? 31.177 21.219 40.347 1.00 31.59 ? 45  LEU A C   1 
ATOM   353  O O   . LEU A 1 45  ? 32.072 21.487 41.144 1.00 38.44 ? 45  LEU A O   1 
ATOM   354  C CB  . LEU A 1 45  ? 29.203 22.763 40.309 1.00 35.09 ? 45  LEU A CB  1 
ATOM   355  C CG  . LEU A 1 45  ? 29.255 24.095 41.061 1.00 45.79 ? 45  LEU A CG  1 
ATOM   356  C CD1 . LEU A 1 45  ? 28.020 24.248 41.947 1.00 37.81 ? 45  LEU A CD1 1 
ATOM   357  C CD2 . LEU A 1 45  ? 30.519 24.238 41.880 1.00 44.43 ? 45  LEU A CD2 1 
ATOM   358  N N   . VAL A 1 46  ? 30.771 19.976 40.116 1.00 30.76 ? 46  VAL A N   1 
ATOM   359  C CA  . VAL A 1 46  ? 31.438 18.839 40.749 1.00 31.86 ? 46  VAL A CA  1 
ATOM   360  C C   . VAL A 1 46  ? 32.896 18.762 40.306 1.00 41.58 ? 46  VAL A C   1 
ATOM   361  O O   . VAL A 1 46  ? 33.808 18.609 41.126 1.00 39.14 ? 46  VAL A O   1 
ATOM   362  C CB  . VAL A 1 46  ? 30.729 17.520 40.423 1.00 33.73 ? 46  VAL A CB  1 
ATOM   363  C CG1 . VAL A 1 46  ? 31.602 16.327 40.822 1.00 35.13 ? 46  VAL A CG1 1 
ATOM   364  C CG2 . VAL A 1 46  ? 29.366 17.468 41.122 1.00 37.18 ? 46  VAL A CG2 1 
ATOM   365  N N   . GLU A 1 47  ? 33.106 18.895 39.000 1.00 43.45 ? 47  GLU A N   1 
ATOM   366  C CA  . GLU A 1 47  ? 34.442 18.830 38.417 1.00 44.63 ? 47  GLU A CA  1 
ATOM   367  C C   . GLU A 1 47  ? 35.358 19.948 38.912 1.00 41.02 ? 47  GLU A C   1 
ATOM   368  O O   . GLU A 1 47  ? 36.518 19.706 39.228 1.00 51.20 ? 47  GLU A O   1 
ATOM   369  C CB  . GLU A 1 47  ? 34.351 18.850 36.889 1.00 51.55 ? 47  GLU A CB  1 
ATOM   370  C CG  . GLU A 1 47  ? 33.530 17.705 36.319 1.00 63.14 ? 47  GLU A CG  1 
ATOM   371  C CD  . GLU A 1 47  ? 34.194 16.352 36.515 1.00 81.58 ? 47  GLU A CD  1 
ATOM   372  O OE1 . GLU A 1 47  ? 35.163 16.061 35.779 1.00 91.52 ? 47  GLU A OE1 1 
ATOM   373  O OE2 . GLU A 1 47  ? 33.752 15.577 37.399 1.00 78.05 ? 47  GLU A OE2 1 
ATOM   374  N N   . LYS A 1 48  ? 34.834 21.165 38.994 1.00 40.41 ? 48  LYS A N   1 
ATOM   375  C CA  . LYS A 1 48  ? 35.634 22.316 39.403 1.00 48.42 ? 48  LYS A CA  1 
ATOM   376  C C   . LYS A 1 48  ? 35.912 22.377 40.904 1.00 52.85 ? 48  LYS A C   1 
ATOM   377  O O   . LYS A 1 48  ? 36.992 22.795 41.326 1.00 53.01 ? 48  LYS A O   1 
ATOM   378  C CB  . LYS A 1 48  ? 34.938 23.616 38.977 1.00 56.98 ? 48  LYS A CB  1 
ATOM   379  C CG  . LYS A 1 48  ? 35.662 24.888 39.410 1.00 66.68 ? 48  LYS A CG  1 
ATOM   380  C CD  . LYS A 1 48  ? 34.779 26.123 39.259 1.00 76.28 ? 48  LYS A CD  1 
ATOM   381  C CE  . LYS A 1 48  ? 34.076 26.142 37.907 1.00 82.58 ? 48  LYS A CE  1 
ATOM   382  N NZ  . LYS A 1 48  ? 33.594 27.504 37.532 1.00 84.83 ? 48  LYS A NZ  1 
ATOM   383  N N   . GLU A 1 49  ? 34.937 21.971 41.714 1.00 47.50 ? 49  GLU A N   1 
ATOM   384  C CA  . GLU A 1 49  ? 34.982 22.290 43.140 1.00 42.65 ? 49  GLU A CA  1 
ATOM   385  C C   . GLU A 1 49  ? 34.433 21.192 44.057 1.00 44.09 ? 49  GLU A C   1 
ATOM   386  O O   . GLU A 1 49  ? 34.960 20.973 45.144 1.00 45.01 ? 49  GLU A O   1 
ATOM   387  C CB  . GLU A 1 49  ? 34.207 23.590 43.375 1.00 45.79 ? 49  GLU A CB  1 
ATOM   388  C CG  . GLU A 1 49  ? 34.327 24.181 44.770 1.00 57.16 ? 49  GLU A CG  1 
ATOM   389  C CD  . GLU A 1 49  ? 33.335 25.313 44.999 1.00 65.20 ? 49  GLU A CD  1 
ATOM   390  O OE1 . GLU A 1 49  ? 32.654 25.716 44.030 1.00 69.03 ? 49  GLU A OE1 1 
ATOM   391  O OE2 . GLU A 1 49  ? 33.230 25.795 46.147 1.00 65.88 ? 49  GLU A OE2 1 
ATOM   392  N N   . ASP A 1 50  ? 33.380 20.511 43.609 1.00 38.15 ? 50  ASP A N   1 
ATOM   393  C CA  . ASP A 1 50  ? 32.627 19.569 44.445 1.00 36.07 ? 50  ASP A CA  1 
ATOM   394  C C   . ASP A 1 50  ? 32.345 20.103 45.854 1.00 33.59 ? 50  ASP A C   1 
ATOM   395  O O   . ASP A 1 50  ? 32.742 19.498 46.849 1.00 32.09 ? 50  ASP A O   1 
ATOM   396  C CB  . ASP A 1 50  ? 33.309 18.200 44.532 1.00 36.31 ? 50  ASP A CB  1 
ATOM   397  C CG  . ASP A 1 50  ? 32.348 17.117 45.002 1.00 40.03 ? 50  ASP A CG  1 
ATOM   398  O OD1 . ASP A 1 50  ? 31.126 17.369 44.940 1.00 36.01 ? 50  ASP A OD1 1 
ATOM   399  O OD2 . ASP A 1 50  ? 32.796 16.029 45.429 1.00 37.49 ? 50  ASP A OD2 1 
ATOM   400  N N   . PRO A 1 51  ? 31.630 21.230 45.937 1.00 33.70 ? 51  PRO A N   1 
ATOM   401  C CA  . PRO A 1 51  ? 31.379 21.896 47.222 1.00 34.81 ? 51  PRO A CA  1 
ATOM   402  C C   . PRO A 1 51  ? 30.527 21.071 48.204 1.00 31.81 ? 51  PRO A C   1 
ATOM   403  O O   . PRO A 1 51  ? 29.674 20.277 47.800 1.00 26.59 ? 51  PRO A O   1 
ATOM   404  C CB  . PRO A 1 51  ? 30.614 23.160 46.814 1.00 31.58 ? 51  PRO A CB  1 
ATOM   405  C CG  . PRO A 1 51  ? 29.927 22.787 45.523 1.00 31.66 ? 51  PRO A CG  1 
ATOM   406  C CD  . PRO A 1 51  ? 30.908 21.869 44.819 1.00 32.34 ? 51  PRO A CD  1 
ATOM   407  N N   . VAL A 1 52  ? 30.775 21.269 49.495 1.00 30.71 ? 52  VAL A N   1 
ATOM   408  C CA  . VAL A 1 52  ? 29.862 20.769 50.515 1.00 30.41 ? 52  VAL A CA  1 
ATOM   409  C C   . VAL A 1 52  ? 28.516 21.468 50.310 1.00 32.17 ? 52  VAL A C   1 
ATOM   410  O O   . VAL A 1 52  ? 28.454 22.709 50.274 1.00 30.19 ? 52  VAL A O   1 
ATOM   411  C CB  . VAL A 1 52  ? 30.392 21.068 51.928 1.00 31.28 ? 52  VAL A CB  1 
ATOM   412  C CG1 . VAL A 1 52  ? 29.355 20.666 52.993 1.00 29.31 ? 52  VAL A CG1 1 
ATOM   413  C CG2 . VAL A 1 52  ? 31.701 20.328 52.157 1.00 30.26 ? 52  VAL A CG2 1 
ATOM   414  N N   . VAL A 1 53  ? 27.451 20.688 50.142 1.00 25.89 ? 53  VAL A N   1 
ATOM   415  C CA  . VAL A 1 53  ? 26.118 21.269 50.031 1.00 23.68 ? 53  VAL A CA  1 
ATOM   416  C C   . VAL A 1 53  ? 25.471 21.419 51.428 1.00 27.08 ? 53  VAL A C   1 
ATOM   417  O O   . VAL A 1 53  ? 24.958 22.482 51.771 1.00 24.90 ? 53  VAL A O   1 
ATOM   418  C CB  . VAL A 1 53  ? 25.225 20.464 49.071 1.00 24.03 ? 53  VAL A CB  1 
ATOM   419  C CG1 . VAL A 1 53  ? 23.804 21.015 49.042 1.00 23.73 ? 53  VAL A CG1 1 
ATOM   420  C CG2 . VAL A 1 53  ? 25.807 20.490 47.658 1.00 25.17 ? 53  VAL A CG2 1 
ATOM   421  N N   . TYR A 1 54  ? 25.497 20.361 52.235 1.00 22.75 ? 54  TYR A N   1 
ATOM   422  C CA  . TYR A 1 54  ? 24.978 20.497 53.591 1.00 25.27 ? 54  TYR A CA  1 
ATOM   423  C C   . TYR A 1 54  ? 25.511 19.456 54.558 1.00 25.52 ? 54  TYR A C   1 
ATOM   424  O O   . TYR A 1 54  ? 26.008 18.396 54.159 1.00 25.98 ? 54  TYR A O   1 
ATOM   425  C CB  . TYR A 1 54  ? 23.445 20.518 53.605 1.00 24.75 ? 54  TYR A CB  1 
ATOM   426  C CG  . TYR A 1 54  ? 22.748 19.184 53.389 1.00 27.69 ? 54  TYR A CG  1 
ATOM   427  C CD1 . TYR A 1 54  ? 22.755 18.561 52.144 1.00 24.08 ? 54  TYR A CD1 1 
ATOM   428  C CD2 . TYR A 1 54  ? 22.034 18.572 54.427 1.00 26.35 ? 54  TYR A CD2 1 
ATOM   429  C CE1 . TYR A 1 54  ? 22.089 17.361 51.942 1.00 26.86 ? 54  TYR A CE1 1 
ATOM   430  C CE2 . TYR A 1 54  ? 21.358 17.387 54.230 1.00 22.47 ? 54  TYR A CE2 1 
ATOM   431  C CZ  . TYR A 1 54  ? 21.398 16.775 52.994 1.00 23.32 ? 54  TYR A CZ  1 
ATOM   432  O OH  . TYR A 1 54  ? 20.718 15.589 52.806 1.00 24.78 ? 54  TYR A OH  1 
ATOM   433  N N   . GLU A 1 55  ? 25.416 19.796 55.835 1.00 22.55 ? 55  GLU A N   1 
ATOM   434  C CA  . GLU A 1 55  ? 25.856 18.930 56.910 1.00 22.34 ? 55  GLU A CA  1 
ATOM   435  C C   . GLU A 1 55  ? 24.676 18.697 57.832 1.00 23.72 ? 55  GLU A C   1 
ATOM   436  O O   . GLU A 1 55  ? 23.808 19.555 57.962 1.00 23.30 ? 55  GLU A O   1 
ATOM   437  C CB  . GLU A 1 55  ? 26.992 19.592 57.688 1.00 27.34 ? 55  GLU A CB  1 
ATOM   438  C CG  . GLU A 1 55  ? 28.306 19.662 56.917 1.00 29.64 ? 55  GLU A CG  1 
ATOM   439  C CD  . GLU A 1 55  ? 29.360 20.479 57.635 1.00 38.76 ? 55  GLU A CD  1 
ATOM   440  O OE1 . GLU A 1 55  ? 28.995 21.419 58.376 1.00 41.70 ? 55  GLU A OE1 1 
ATOM   441  O OE2 . GLU A 1 55  ? 30.559 20.176 57.463 1.00 47.52 ? 55  GLU A OE2 1 
ATOM   442  N N   . VAL A 1 56  ? 24.643 17.527 58.462 1.00 23.90 ? 56  VAL A N   1 
ATOM   443  C CA  . VAL A 1 56  ? 23.629 17.237 59.467 1.00 23.33 ? 56  VAL A CA  1 
ATOM   444  C C   . VAL A 1 56  ? 24.356 16.773 60.727 1.00 23.29 ? 56  VAL A C   1 
ATOM   445  O O   . VAL A 1 56  ? 25.280 15.958 60.649 1.00 23.32 ? 56  VAL A O   1 
ATOM   446  C CB  . VAL A 1 56  ? 22.653 16.139 58.991 1.00 22.21 ? 56  VAL A CB  1 
ATOM   447  C CG1 . VAL A 1 56  ? 21.691 15.715 60.139 1.00 24.38 ? 56  VAL A CG1 1 
ATOM   448  C CG2 . VAL A 1 56  ? 21.874 16.609 57.771 1.00 23.70 ? 56  VAL A CG2 1 
ATOM   449  N N   . TYR A 1 57  ? 23.984 17.344 61.872 1.00 22.66 ? 57  TYR A N   1 
ATOM   450  C CA  . TYR A 1 57  ? 24.495 16.876 63.155 1.00 24.22 ? 57  TYR A CA  1 
ATOM   451  C C   . TYR A 1 57  ? 23.313 16.304 63.907 1.00 24.92 ? 57  TYR A C   1 
ATOM   452  O O   . TYR A 1 57  ? 22.447 17.062 64.361 1.00 23.89 ? 57  TYR A O   1 
ATOM   453  C CB  . TYR A 1 57  ? 25.109 18.027 63.950 1.00 25.05 ? 57  TYR A CB  1 
ATOM   454  C CG  . TYR A 1 57  ? 26.333 18.620 63.302 1.00 24.82 ? 57  TYR A CG  1 
ATOM   455  C CD1 . TYR A 1 57  ? 26.213 19.561 62.286 1.00 28.72 ? 57  TYR A CD1 1 
ATOM   456  C CD2 . TYR A 1 57  ? 27.612 18.229 63.692 1.00 29.94 ? 57  TYR A CD2 1 
ATOM   457  C CE1 . TYR A 1 57  ? 27.342 20.104 61.672 1.00 34.45 ? 57  TYR A CE1 1 
ATOM   458  C CE2 . TYR A 1 57  ? 28.749 18.770 63.086 1.00 30.27 ? 57  TYR A CE2 1 
ATOM   459  C CZ  . TYR A 1 57  ? 28.603 19.699 62.078 1.00 35.26 ? 57  TYR A CZ  1 
ATOM   460  O OH  . TYR A 1 57  ? 29.719 20.240 61.476 1.00 36.83 ? 57  TYR A OH  1 
ATOM   461  N N   . ALA A 1 58  ? 23.269 14.978 64.036 1.00 24.19 ? 58  ALA A N   1 
ATOM   462  C CA  . ALA A 1 58  ? 22.087 14.309 64.573 1.00 24.71 ? 58  ALA A CA  1 
ATOM   463  C C   . ALA A 1 58  ? 22.313 13.652 65.938 1.00 28.00 ? 58  ALA A C   1 
ATOM   464  O O   . ALA A 1 58  ? 23.341 12.999 66.161 1.00 25.81 ? 58  ALA A O   1 
ATOM   465  C CB  . ALA A 1 58  ? 21.564 13.282 63.569 1.00 26.57 ? 58  ALA A CB  1 
ATOM   466  N N   . VAL A 1 59  ? 21.349 13.836 66.843 1.00 22.37 ? 59  VAL A N   1 
ATOM   467  C CA  . VAL A 1 59  ? 21.356 13.170 68.142 1.00 23.89 ? 59  VAL A CA  1 
ATOM   468  C C   . VAL A 1 59  ? 20.137 12.262 68.153 1.00 29.42 ? 59  VAL A C   1 
ATOM   469  O O   . VAL A 1 59  ? 18.991 12.723 68.292 1.00 26.90 ? 59  VAL A O   1 
ATOM   470  C CB  . VAL A 1 59  ? 21.288 14.173 69.309 1.00 23.34 ? 59  VAL A CB  1 
ATOM   471  C CG1 . VAL A 1 59  ? 21.216 13.433 70.659 1.00 26.31 ? 59  VAL A CG1 1 
ATOM   472  C CG2 . VAL A 1 59  ? 22.479 15.130 69.283 1.00 27.46 ? 59  VAL A CG2 1 
ATOM   473  N N   . GLU A 1 60  ? 20.378 10.966 67.987 1.00 25.82 ? 60  GLU A N   1 
ATOM   474  C CA  . GLU A 1 60  ? 19.296 10.027 67.761 1.00 26.68 ? 60  GLU A CA  1 
ATOM   475  C C   . GLU A 1 60  ? 19.199 8.987  68.881 1.00 31.03 ? 60  GLU A C   1 
ATOM   476  O O   . GLU A 1 60  ? 20.215 8.589  69.468 1.00 30.38 ? 60  GLU A O   1 
ATOM   477  C CB  . GLU A 1 60  ? 19.444 9.364  66.383 1.00 32.39 ? 60  GLU A CB  1 
ATOM   478  C CG  . GLU A 1 60  ? 19.330 10.367 65.217 1.00 33.58 ? 60  GLU A CG  1 
ATOM   479  C CD  . GLU A 1 60  ? 19.210 9.703  63.841 1.00 47.05 ? 60  GLU A CD  1 
ATOM   480  O OE1 . GLU A 1 60  ? 20.005 8.780  63.545 1.00 43.05 ? 60  GLU A OE1 1 
ATOM   481  O OE2 . GLU A 1 60  ? 18.326 10.115 63.048 1.00 44.92 ? 60  GLU A OE2 1 
ATOM   482  N N   . GLN A 1 61  ? 17.971 8.566  69.179 1.00 26.87 ? 61  GLN A N   1 
ATOM   483  C CA  . GLN A 1 61  ? 17.741 7.542  70.195 1.00 24.97 ? 61  GLN A CA  1 
ATOM   484  C C   . GLN A 1 61  ? 17.415 6.221  69.504 1.00 29.69 ? 61  GLN A C   1 
ATOM   485  O O   . GLN A 1 61  ? 17.270 6.177  68.289 1.00 29.89 ? 61  GLN A O   1 
ATOM   486  C CB  . GLN A 1 61  ? 16.568 7.964  71.096 1.00 25.16 ? 61  GLN A CB  1 
ATOM   487  C CG  . GLN A 1 61  ? 16.712 9.355  71.675 1.00 25.86 ? 61  GLN A CG  1 
ATOM   488  C CD  . GLN A 1 61  ? 17.878 9.457  72.611 1.00 27.12 ? 61  GLN A CD  1 
ATOM   489  O OE1 . GLN A 1 61  ? 18.167 8.515  73.356 1.00 33.35 ? 61  GLN A OE1 1 
ATOM   490  N NE2 . GLN A 1 61  ? 18.575 10.587 72.576 1.00 28.24 ? 61  GLN A NE2 1 
ATOM   491  N N   . GLU A 1 62  ? 17.286 5.141  70.269 1.00 32.61 ? 62  GLU A N   1 
ATOM   492  C CA  . GLU A 1 62  ? 16.759 3.902  69.699 1.00 37.67 ? 62  GLU A CA  1 
ATOM   493  C C   . GLU A 1 62  ? 15.378 4.174  69.103 1.00 36.63 ? 62  GLU A C   1 
ATOM   494  O O   . GLU A 1 62  ? 14.657 5.066  69.563 1.00 34.85 ? 62  GLU A O   1 
ATOM   495  C CB  . GLU A 1 62  ? 16.649 2.798  70.756 1.00 43.25 ? 62  GLU A CB  1 
ATOM   496  C CG  . GLU A 1 62  ? 17.973 2.280  71.284 1.00 61.02 ? 62  GLU A CG  1 
ATOM   497  C CD  . GLU A 1 62  ? 17.840 0.904  71.925 1.00 74.09 ? 62  GLU A CD  1 
ATOM   498  O OE1 . GLU A 1 62  ? 16.767 0.277  71.777 1.00 75.39 ? 62  GLU A OE1 1 
ATOM   499  O OE2 . GLU A 1 62  ? 18.808 0.448  72.571 1.00 77.04 ? 62  GLU A OE2 1 
ATOM   500  N N   . GLU A 1 63  ? 15.015 3.412  68.077 1.00 33.47 ? 63  GLU A N   1 
ATOM   501  C CA  . GLU A 1 63  ? 13.751 3.611  67.386 1.00 33.52 ? 63  GLU A CA  1 
ATOM   502  C C   . GLU A 1 63  ? 12.593 3.113  68.229 1.00 42.22 ? 63  GLU A C   1 
ATOM   503  O O   . GLU A 1 63  ? 12.142 1.974  68.081 1.00 46.06 ? 63  GLU A O   1 
ATOM   504  C CB  . GLU A 1 63  ? 13.764 2.904  66.031 1.00 37.60 ? 63  GLU A CB  1 
ATOM   505  C CG  . GLU A 1 63  ? 14.884 3.375  65.126 1.00 46.34 ? 63  GLU A CG  1 
ATOM   506  C CD  . GLU A 1 63  ? 14.740 2.860  63.703 1.00 60.54 ? 63  GLU A CD  1 
ATOM   507  O OE1 . GLU A 1 63  ? 14.670 1.624  63.519 1.00 66.83 ? 63  GLU A OE1 1 
ATOM   508  O OE2 . GLU A 1 63  ? 14.690 3.692  62.772 1.00 59.89 ? 63  GLU A OE2 1 
ATOM   509  N N   . LYS A 1 64  ? 12.105 3.978  69.108 1.00 33.83 ? 64  LYS A N   1 
ATOM   510  C CA  . LYS A 1 64  ? 11.055 3.604  70.039 1.00 36.63 ? 64  LYS A CA  1 
ATOM   511  C C   . LYS A 1 64  ? 9.924  4.612  69.942 1.00 36.81 ? 64  LYS A C   1 
ATOM   512  O O   . LYS A 1 64  ? 10.162 5.814  69.862 1.00 33.92 ? 64  LYS A O   1 
ATOM   513  C CB  . LYS A 1 64  ? 11.612 3.565  71.463 1.00 42.07 ? 64  LYS A CB  1 
ATOM   514  C CG  . LYS A 1 64  ? 11.180 2.355  72.270 1.00 60.74 ? 64  LYS A CG  1 
ATOM   515  C CD  . LYS A 1 64  ? 12.371 1.497  72.708 1.00 72.70 ? 64  LYS A CD  1 
ATOM   516  C CE  . LYS A 1 64  ? 12.788 0.501  71.630 1.00 73.73 ? 64  LYS A CE  1 
ATOM   517  N NZ  . LYS A 1 64  ? 13.471 -0.691 72.215 1.00 72.01 ? 64  LYS A NZ  1 
ATOM   518  N N   . GLU A 1 65  ? 8.695  4.115  69.930 1.00 34.62 ? 65  GLU A N   1 
ATOM   519  C CA  . GLU A 1 65  ? 7.521  4.969  69.928 1.00 36.69 ? 65  GLU A CA  1 
ATOM   520  C C   . GLU A 1 65  ? 7.589  5.962  71.094 1.00 34.77 ? 65  GLU A C   1 
ATOM   521  O O   . GLU A 1 65  ? 7.960  5.588  72.211 1.00 33.11 ? 65  GLU A O   1 
ATOM   522  C CB  . GLU A 1 65  ? 6.265  4.105  70.055 1.00 46.48 ? 65  GLU A CB  1 
ATOM   523  C CG  . GLU A 1 65  ? 6.386  2.721  69.397 1.00 63.92 ? 65  GLU A CG  1 
ATOM   524  C CD  . GLU A 1 65  ? 7.196  1.718  70.231 1.00 66.84 ? 65  GLU A CD  1 
ATOM   525  O OE1 . GLU A 1 65  ? 8.288  1.298  69.781 1.00 47.22 ? 65  GLU A OE1 1 
ATOM   526  O OE2 . GLU A 1 65  ? 6.731  1.344  71.332 1.00 76.04 ? 65  GLU A OE2 1 
ATOM   527  N N   . GLY A 1 66  ? 7.254  7.225  70.826 1.00 31.35 ? 66  GLY A N   1 
ATOM   528  C CA  . GLY A 1 66  ? 7.159  8.233  71.876 1.00 32.13 ? 66  GLY A CA  1 
ATOM   529  C C   . GLY A 1 66  ? 8.436  9.005  72.164 1.00 32.65 ? 66  GLY A C   1 
ATOM   530  O O   . GLY A 1 66  ? 8.412  10.059 72.815 1.00 32.18 ? 66  GLY A O   1 
ATOM   531  N N   . ASP A 1 67  ? 9.563  8.488  71.688 1.00 29.71 ? 67  ASP A N   1 
ATOM   532  C CA  . ASP A 1 67  ? 10.844 9.115  71.973 1.00 30.27 ? 67  ASP A CA  1 
ATOM   533  C C   . ASP A 1 67  ? 11.185 10.104 70.856 1.00 24.71 ? 67  ASP A C   1 
ATOM   534  O O   . ASP A 1 67  ? 10.501 10.157 69.837 1.00 25.46 ? 67  ASP A O   1 
ATOM   535  C CB  . ASP A 1 67  ? 11.925 8.037  72.125 1.00 30.49 ? 67  ASP A CB  1 
ATOM   536  C CG  . ASP A 1 67  ? 13.082 8.481  72.987 1.00 29.24 ? 67  ASP A CG  1 
ATOM   537  O OD1 . ASP A 1 67  ? 13.214 9.692  73.270 1.00 28.73 ? 67  ASP A OD1 1 
ATOM   538  O OD2 . ASP A 1 67  ? 13.886 7.608  73.369 1.00 28.79 ? 67  ASP A OD2 1 
ATOM   539  N N   . LEU A 1 68  ? 12.214 10.917 71.055 1.00 23.44 ? 68  LEU A N   1 
ATOM   540  C CA  . LEU A 1 68  ? 12.456 12.015 70.121 1.00 21.67 ? 68  LEU A CA  1 
ATOM   541  C C   . LEU A 1 68  ? 13.922 12.136 69.762 1.00 23.15 ? 68  LEU A C   1 
ATOM   542  O O   . LEU A 1 68  ? 14.775 12.020 70.636 1.00 26.36 ? 68  LEU A O   1 
ATOM   543  C CB  . LEU A 1 68  ? 12.034 13.344 70.747 1.00 22.85 ? 68  LEU A CB  1 
ATOM   544  C CG  . LEU A 1 68  ? 10.554 13.579 71.069 1.00 24.88 ? 68  LEU A CG  1 
ATOM   545  C CD1 . LEU A 1 68  ? 10.395 14.912 71.807 1.00 22.64 ? 68  LEU A CD1 1 
ATOM   546  C CD2 . LEU A 1 68  ? 9.737  13.576 69.782 1.00 22.54 ? 68  LEU A CD2 1 
ATOM   547  N N   . ASN A 1 69  ? 14.182 12.429 68.485 1.00 22.71 ? 69  ASN A N   1 
ATOM   548  C CA  . ASN A 1 69  ? 15.507 12.788 67.979 1.00 22.14 ? 69  ASN A CA  1 
ATOM   549  C C   . ASN A 1 69  ? 15.578 14.277 67.665 1.00 27.83 ? 69  ASN A C   1 
ATOM   550  O O   . ASN A 1 69  ? 14.547 14.932 67.486 1.00 22.74 ? 69  ASN A O   1 
ATOM   551  C CB  . ASN A 1 69  ? 15.820 12.017 66.687 1.00 22.74 ? 69  ASN A CB  1 
ATOM   552  C CG  . ASN A 1 69  ? 15.927 10.521 66.908 1.00 27.18 ? 69  ASN A CG  1 
ATOM   553  O OD1 . ASN A 1 69  ? 16.011 10.061 68.051 1.00 26.30 ? 69  ASN A OD1 1 
ATOM   554  N ND2 . ASN A 1 69  ? 15.931 9.749  65.815 1.00 28.93 ? 69  ASN A ND2 1 
ATOM   555  N N   . PHE A 1 70  ? 16.791 14.813 67.603 1.00 23.11 ? 70  PHE A N   1 
ATOM   556  C CA  . PHE A 1 70  ? 16.966 16.176 67.117 1.00 23.63 ? 70  PHE A CA  1 
ATOM   557  C C   . PHE A 1 70  ? 18.275 16.314 66.359 1.00 24.48 ? 70  PHE A C   1 
ATOM   558  O O   . PHE A 1 70  ? 19.234 15.566 66.580 1.00 22.97 ? 70  PHE A O   1 
ATOM   559  C CB  . PHE A 1 70  ? 16.834 17.220 68.241 1.00 23.08 ? 70  PHE A CB  1 
ATOM   560  C CG  . PHE A 1 70  ? 17.918 17.138 69.302 1.00 23.53 ? 70  PHE A CG  1 
ATOM   561  C CD1 . PHE A 1 70  ? 17.773 16.293 70.400 1.00 23.23 ? 70  PHE A CD1 1 
ATOM   562  C CD2 . PHE A 1 70  ? 19.063 17.927 69.208 1.00 23.38 ? 70  PHE A CD2 1 
ATOM   563  C CE1 . PHE A 1 70  ? 18.761 16.226 71.378 1.00 24.80 ? 70  PHE A CE1 1 
ATOM   564  C CE2 . PHE A 1 70  ? 20.060 17.862 70.185 1.00 23.71 ? 70  PHE A CE2 1 
ATOM   565  C CZ  . PHE A 1 70  ? 19.907 17.008 71.264 1.00 25.44 ? 70  PHE A CZ  1 
ATOM   566  N N   . SER A 1 71  ? 18.308 17.263 65.435 1.00 23.86 ? 71  SER A N   1 
ATOM   567  C CA  . SER A 1 71  ? 19.518 17.478 64.675 1.00 23.73 ? 71  SER A CA  1 
ATOM   568  C C   . SER A 1 71  ? 19.573 18.912 64.191 1.00 23.00 ? 71  SER A C   1 
ATOM   569  O O   . SER A 1 71  ? 18.582 19.635 64.239 1.00 26.23 ? 71  SER A O   1 
ATOM   570  C CB  . SER A 1 71  ? 19.545 16.522 63.486 1.00 29.44 ? 71  SER A CB  1 
ATOM   571  O OG  . SER A 1 71  ? 18.404 16.721 62.678 1.00 37.96 ? 71  SER A OG  1 
ATOM   572  N N   . THR A 1 72  ? 20.744 19.337 63.753 1.00 20.81 ? 72  THR A N   1 
ATOM   573  C CA  . THR A 1 72  ? 20.815 20.562 62.985 1.00 20.61 ? 72  THR A CA  1 
ATOM   574  C C   . THR A 1 72  ? 21.040 20.220 61.529 1.00 23.73 ? 72  THR A C   1 
ATOM   575  O O   . THR A 1 72  ? 21.712 19.224 61.199 1.00 23.89 ? 72  THR A O   1 
ATOM   576  C CB  . THR A 1 72  ? 21.927 21.497 63.469 1.00 24.17 ? 72  THR A CB  1 
ATOM   577  O OG1 . THR A 1 72  ? 23.163 20.767 63.593 1.00 23.39 ? 72  THR A OG1 1 
ATOM   578  C CG2 . THR A 1 72  ? 21.555 22.104 64.799 1.00 23.62 ? 72  THR A CG2 1 
ATOM   579  N N   . HIS A 1 73  ? 20.439 21.026 60.660 1.00 20.42 ? 73  HIS A N   1 
ATOM   580  C CA  . HIS A 1 73  ? 20.708 20.949 59.236 1.00 22.62 ? 73  HIS A CA  1 
ATOM   581  C C   . HIS A 1 73  ? 21.430 22.237 58.916 1.00 25.70 ? 73  HIS A C   1 
ATOM   582  O O   . HIS A 1 73  ? 20.951 23.323 59.250 1.00 23.84 ? 73  HIS A O   1 
ATOM   583  C CB  . HIS A 1 73  ? 19.424 20.849 58.422 1.00 27.35 ? 73  HIS A CB  1 
ATOM   584  C CG  . HIS A 1 73  ? 18.741 19.520 58.531 1.00 33.77 ? 73  HIS A CG  1 
ATOM   585  N ND1 . HIS A 1 73  ? 17.801 19.092 57.619 1.00 33.61 ? 73  HIS A ND1 1 
ATOM   586  C CD2 . HIS A 1 73  ? 18.856 18.534 59.449 1.00 34.18 ? 73  HIS A CD2 1 
ATOM   587  C CE1 . HIS A 1 73  ? 17.370 17.891 57.969 1.00 40.62 ? 73  HIS A CE1 1 
ATOM   588  N NE2 . HIS A 1 73  ? 17.992 17.529 59.074 1.00 31.82 ? 73  HIS A NE2 1 
ATOM   589  N N   . VAL A 1 74  ? 22.601 22.120 58.306 1.00 21.70 ? 74  VAL A N   1 
ATOM   590  C CA  . VAL A 1 74  ? 23.375 23.295 57.966 1.00 21.47 ? 74  VAL A CA  1 
ATOM   591  C C   . VAL A 1 74  ? 23.454 23.284 56.453 1.00 24.33 ? 74  VAL A C   1 
ATOM   592  O O   . VAL A 1 74  ? 24.185 22.473 55.872 1.00 23.51 ? 74  VAL A O   1 
ATOM   593  C CB  . VAL A 1 74  ? 24.783 23.250 58.586 1.00 25.19 ? 74  VAL A CB  1 
ATOM   594  C CG1 . VAL A 1 74  ? 25.576 24.540 58.273 1.00 27.57 ? 74  VAL A CG1 1 
ATOM   595  C CG2 . VAL A 1 74  ? 24.693 23.057 60.102 1.00 25.61 ? 74  VAL A CG2 1 
ATOM   596  N N   . ILE A 1 75  ? 22.680 24.156 55.809 1.00 23.48 ? 75  ILE A N   1 
ATOM   597  C CA  . ILE A 1 75  ? 22.704 24.229 54.348 1.00 22.77 ? 75  ILE A CA  1 
ATOM   598  C C   . ILE A 1 75  ? 23.679 25.319 53.908 1.00 25.40 ? 75  ILE A C   1 
ATOM   599  O O   . ILE A 1 75  ? 23.494 26.501 54.223 1.00 24.57 ? 75  ILE A O   1 
ATOM   600  C CB  . ILE A 1 75  ? 21.312 24.525 53.734 1.00 25.46 ? 75  ILE A CB  1 
ATOM   601  C CG1 . ILE A 1 75  ? 20.189 23.768 54.462 1.00 25.37 ? 75  ILE A CG1 1 
ATOM   602  C CG2 . ILE A 1 75  ? 21.315 24.216 52.210 1.00 25.44 ? 75  ILE A CG2 1 
ATOM   603  C CD1 . ILE A 1 75  ? 20.411 22.267 54.573 1.00 25.59 ? 75  ILE A CD1 1 
ATOM   604  N N   . TYR A 1 76  ? 24.723 24.946 53.180 1.00 24.85 ? 76  TYR A N   1 
ATOM   605  C CA  . TYR A 1 76  ? 25.683 25.960 52.760 1.00 26.50 ? 76  TYR A CA  1 
ATOM   606  C C   . TYR A 1 76  ? 25.143 26.732 51.565 1.00 28.40 ? 76  TYR A C   1 
ATOM   607  O O   . TYR A 1 76  ? 24.287 26.230 50.837 1.00 26.93 ? 76  TYR A O   1 
ATOM   608  C CB  . TYR A 1 76  ? 27.066 25.346 52.519 1.00 27.28 ? 76  TYR A CB  1 
ATOM   609  C CG  . TYR A 1 76  ? 27.664 24.901 53.823 1.00 32.70 ? 76  TYR A CG  1 
ATOM   610  C CD1 . TYR A 1 76  ? 28.358 25.796 54.628 1.00 45.42 ? 76  TYR A CD1 1 
ATOM   611  C CD2 . TYR A 1 76  ? 27.469 23.609 54.295 1.00 30.97 ? 76  TYR A CD2 1 
ATOM   612  C CE1 . TYR A 1 76  ? 28.889 25.406 55.842 1.00 45.68 ? 76  TYR A CE1 1 
ATOM   613  C CE2 . TYR A 1 76  ? 27.996 23.207 55.508 1.00 34.97 ? 76  TYR A CE2 1 
ATOM   614  C CZ  . TYR A 1 76  ? 28.706 24.107 56.276 1.00 45.53 ? 76  TYR A CZ  1 
ATOM   615  O OH  . TYR A 1 76  ? 29.225 23.711 57.491 1.00 49.87 ? 76  TYR A OH  1 
ATOM   616  N N   . PRO A 1 77  ? 25.590 27.986 51.402 1.00 27.83 ? 77  PRO A N   1 
ATOM   617  C CA  . PRO A 1 77  ? 25.048 28.813 50.326 1.00 28.10 ? 77  PRO A CA  1 
ATOM   618  C C   . PRO A 1 77  ? 25.616 28.420 48.966 1.00 29.11 ? 77  PRO A C   1 
ATOM   619  O O   . PRO A 1 77  ? 26.809 28.105 48.851 1.00 31.66 ? 77  PRO A O   1 
ATOM   620  C CB  . PRO A 1 77  ? 25.514 30.222 50.707 1.00 28.50 ? 77  PRO A CB  1 
ATOM   621  C CG  . PRO A 1 77  ? 26.791 30.007 51.440 1.00 28.96 ? 77  PRO A CG  1 
ATOM   622  C CD  . PRO A 1 77  ? 26.576 28.716 52.222 1.00 28.87 ? 77  PRO A CD  1 
ATOM   623  N N   . GLY A 1 78  ? 24.764 28.435 47.953 1.00 27.20 ? 78  GLY A N   1 
ATOM   624  C CA  . GLY A 1 78  ? 25.202 28.194 46.593 1.00 30.22 ? 78  GLY A CA  1 
ATOM   625  C C   . GLY A 1 78  ? 24.052 27.861 45.669 1.00 30.94 ? 78  GLY A C   1 
ATOM   626  O O   . GLY A 1 78  ? 22.899 27.757 46.096 1.00 30.33 ? 78  GLY A O   1 
ATOM   627  N N   . LYS A 1 79  ? 24.370 27.683 44.390 1.00 26.63 ? 79  LYS A N   1 
ATOM   628  C CA  . LYS A 1 79  ? 23.377 27.335 43.400 1.00 27.73 ? 79  LYS A CA  1 
ATOM   629  C C   . LYS A 1 79  ? 23.950 26.335 42.419 1.00 29.23 ? 79  LYS A C   1 
ATOM   630  O O   . LYS A 1 79  ? 25.146 26.325 42.165 1.00 32.79 ? 79  LYS A O   1 
ATOM   631  C CB  . LYS A 1 79  ? 22.940 28.584 42.606 1.00 30.51 ? 79  LYS A CB  1 
ATOM   632  C CG  . LYS A 1 79  ? 22.165 29.602 43.423 1.00 33.95 ? 79  LYS A CG  1 
ATOM   633  C CD  . LYS A 1 79  ? 21.434 30.584 42.516 1.00 48.58 ? 79  LYS A CD  1 
ATOM   634  C CE  . LYS A 1 79  ? 22.177 31.890 42.404 1.00 59.42 ? 79  LYS A CE  1 
ATOM   635  N NZ  . LYS A 1 79  ? 21.520 32.780 41.397 1.00 68.65 ? 79  LYS A NZ  1 
ATOM   636  N N   . VAL A 1 80  ? 23.078 25.501 41.875 1.00 32.31 ? 80  VAL A N   1 
ATOM   637  C CA  . VAL A 1 80  ? 23.411 24.673 40.734 1.00 33.82 ? 80  VAL A CA  1 
ATOM   638  C C   . VAL A 1 80  ? 22.626 25.238 39.559 1.00 31.10 ? 80  VAL A C   1 
ATOM   639  O O   . VAL A 1 80  ? 21.417 24.996 39.417 1.00 31.73 ? 80  VAL A O   1 
ATOM   640  C CB  . VAL A 1 80  ? 23.045 23.204 40.982 1.00 28.54 ? 80  VAL A CB  1 
ATOM   641  C CG1 . VAL A 1 80  ? 23.390 22.352 39.733 1.00 31.60 ? 80  VAL A CG1 1 
ATOM   642  C CG2 . VAL A 1 80  ? 23.775 22.709 42.232 1.00 27.54 ? 80  VAL A CG2 1 
ATOM   643  N N   . GLY A 1 81  ? 23.319 26.003 38.722 1.00 31.99 ? 81  GLY A N   1 
ATOM   644  C CA  . GLY A 1 81  ? 22.637 26.767 37.691 1.00 33.08 ? 81  GLY A CA  1 
ATOM   645  C C   . GLY A 1 81  ? 21.840 27.854 38.400 1.00 32.36 ? 81  GLY A C   1 
ATOM   646  O O   . GLY A 1 81  ? 22.425 28.706 39.057 1.00 34.10 ? 81  GLY A O   1 
ATOM   647  N N   . LYS A 1 82  ? 20.516 27.798 38.297 1.00 30.63 ? 82  LYS A N   1 
ATOM   648  C CA  . LYS A 1 82  ? 19.645 28.787 38.938 1.00 34.27 ? 82  LYS A CA  1 
ATOM   649  C C   . LYS A 1 82  ? 19.099 28.299 40.275 1.00 31.17 ? 82  LYS A C   1 
ATOM   650  O O   . LYS A 1 82  ? 18.435 29.048 40.998 1.00 28.81 ? 82  LYS A O   1 
ATOM   651  C CB  . LYS A 1 82  ? 18.458 29.104 38.026 1.00 33.74 ? 82  LYS A CB  1 
ATOM   652  C CG  . LYS A 1 82  ? 18.837 29.756 36.702 1.00 44.12 ? 82  LYS A CG  1 
ATOM   653  C CD  . LYS A 1 82  ? 17.618 29.916 35.803 1.00 51.94 ? 82  LYS A CD  1 
ATOM   654  C CE  . LYS A 1 82  ? 17.955 30.772 34.584 1.00 67.40 ? 82  LYS A CE  1 
ATOM   655  N NZ  . LYS A 1 82  ? 16.870 30.754 33.559 1.00 72.66 ? 82  LYS A NZ  1 
ATOM   656  N N   . GLU A 1 83  ? 19.371 27.039 40.596 1.00 27.86 ? 83  GLU A N   1 
ATOM   657  C CA  . GLU A 1 83  ? 18.677 26.359 41.689 1.00 28.95 ? 83  GLU A CA  1 
ATOM   658  C C   . GLU A 1 83  ? 19.489 26.347 42.992 1.00 27.93 ? 83  GLU A C   1 
ATOM   659  O O   . GLU A 1 83  ? 20.644 25.922 43.016 1.00 28.91 ? 83  GLU A O   1 
ATOM   660  C CB  . GLU A 1 83  ? 18.321 24.939 41.240 1.00 29.06 ? 83  GLU A CB  1 
ATOM   661  C CG  . GLU A 1 83  ? 17.372 24.167 42.144 1.00 30.03 ? 83  GLU A CG  1 
ATOM   662  C CD  . GLU A 1 83  ? 17.008 22.806 41.562 1.00 33.28 ? 83  GLU A CD  1 
ATOM   663  O OE1 . GLU A 1 83  ? 17.726 22.334 40.647 1.00 36.33 ? 83  GLU A OE1 1 
ATOM   664  O OE2 . GLU A 1 83  ? 16.008 22.200 42.004 1.00 34.38 ? 83  GLU A OE2 1 
ATOM   665  N N   . PHE A 1 84  ? 18.888 26.830 44.078 1.00 24.24 ? 84  PHE A N   1 
ATOM   666  C CA  . PHE A 1 84  ? 19.601 26.964 45.343 1.00 23.18 ? 84  PHE A CA  1 
ATOM   667  C C   . PHE A 1 84  ? 19.935 25.603 45.950 1.00 23.19 ? 84  PHE A C   1 
ATOM   668  O O   . PHE A 1 84  ? 19.174 24.651 45.766 1.00 25.33 ? 84  PHE A O   1 
ATOM   669  C CB  . PHE A 1 84  ? 18.744 27.726 46.364 1.00 23.93 ? 84  PHE A CB  1 
ATOM   670  C CG  . PHE A 1 84  ? 18.601 29.191 46.058 1.00 26.16 ? 84  PHE A CG  1 
ATOM   671  C CD1 . PHE A 1 84  ? 19.676 30.046 46.226 1.00 26.68 ? 84  PHE A CD1 1 
ATOM   672  C CD2 . PHE A 1 84  ? 17.391 29.705 45.622 1.00 27.76 ? 84  PHE A CD2 1 
ATOM   673  C CE1 . PHE A 1 84  ? 19.556 31.408 45.964 1.00 30.14 ? 84  PHE A CE1 1 
ATOM   674  C CE2 . PHE A 1 84  ? 17.262 31.067 45.348 1.00 29.85 ? 84  PHE A CE2 1 
ATOM   675  C CZ  . PHE A 1 84  ? 18.344 31.912 45.521 1.00 31.33 ? 84  PHE A CZ  1 
ATOM   676  N N   . PHE A 1 85  ? 21.037 25.559 46.693 1.00 24.41 ? 85  PHE A N   1 
ATOM   677  C CA  . PHE A 1 85  ? 21.437 24.392 47.490 1.00 24.59 ? 85  PHE A CA  1 
ATOM   678  C C   . PHE A 1 85  ? 20.329 24.029 48.485 1.00 24.88 ? 85  PHE A C   1 
ATOM   679  O O   . PHE A 1 85  ? 19.641 24.909 49.020 1.00 23.63 ? 85  PHE A O   1 
ATOM   680  C CB  . PHE A 1 85  ? 22.701 24.689 48.292 1.00 26.32 ? 85  PHE A CB  1 
ATOM   681  C CG  . PHE A 1 85  ? 23.987 24.596 47.510 1.00 28.50 ? 85  PHE A CG  1 
ATOM   682  C CD1 . PHE A 1 85  ? 23.986 24.417 46.131 1.00 29.15 ? 85  PHE A CD1 1 
ATOM   683  C CD2 . PHE A 1 85  ? 25.212 24.691 48.177 1.00 27.10 ? 85  PHE A CD2 1 
ATOM   684  C CE1 . PHE A 1 85  ? 25.196 24.333 45.418 1.00 29.19 ? 85  PHE A CE1 1 
ATOM   685  C CE2 . PHE A 1 85  ? 26.418 24.606 47.475 1.00 27.32 ? 85  PHE A CE2 1 
ATOM   686  C CZ  . PHE A 1 85  ? 26.402 24.437 46.092 1.00 27.57 ? 85  PHE A CZ  1 
ATOM   687  N N   . PHE A 1 86  ? 20.167 22.732 48.751 1.00 24.45 ? 86  PHE A N   1 
ATOM   688  C CA  . PHE A 1 86  ? 19.106 22.261 49.631 1.00 22.24 ? 86  PHE A CA  1 
ATOM   689  C C   . PHE A 1 86  ? 19.500 20.920 50.234 1.00 25.80 ? 86  PHE A C   1 
ATOM   690  O O   . PHE A 1 86  ? 20.500 20.320 49.800 1.00 24.43 ? 86  PHE A O   1 
ATOM   691  C CB  . PHE A 1 86  ? 17.761 22.138 48.888 1.00 22.71 ? 86  PHE A CB  1 
ATOM   692  C CG  . PHE A 1 86  ? 17.822 21.362 47.584 1.00 25.08 ? 86  PHE A CG  1 
ATOM   693  C CD1 . PHE A 1 86  ? 17.350 21.929 46.406 1.00 28.02 ? 86  PHE A CD1 1 
ATOM   694  C CD2 . PHE A 1 86  ? 18.323 20.064 47.536 1.00 25.58 ? 86  PHE A CD2 1 
ATOM   695  C CE1 . PHE A 1 86  ? 17.402 21.227 45.194 1.00 27.53 ? 86  PHE A CE1 1 
ATOM   696  C CE2 . PHE A 1 86  ? 18.379 19.354 46.330 1.00 28.02 ? 86  PHE A CE2 1 
ATOM   697  C CZ  . PHE A 1 86  ? 17.914 19.932 45.159 1.00 27.48 ? 86  PHE A CZ  1 
ATOM   698  N N   . ALA A 1 87  ? 18.737 20.463 51.232 1.00 24.16 ? 87  ALA A N   1 
ATOM   699  C CA  . ALA A 1 87  ? 18.892 19.097 51.759 1.00 21.27 ? 87  ALA A CA  1 
ATOM   700  C C   . ALA A 1 87  ? 18.227 18.120 50.825 1.00 25.14 ? 87  ALA A C   1 
ATOM   701  O O   . ALA A 1 87  ? 17.321 18.484 50.069 1.00 22.62 ? 87  ALA A O   1 
ATOM   702  C CB  . ALA A 1 87  ? 18.292 18.973 53.165 1.00 21.58 ? 87  ALA A CB  1 
ATOM   703  N N   . LYS A 1 88  ? 18.636 16.851 50.871 1.00 23.59 ? 88  LYS A N   1 
ATOM   704  C CA  . LYS A 1 88  ? 18.041 15.898 49.942 1.00 22.65 ? 88  LYS A CA  1 
ATOM   705  C C   . LYS A 1 88  ? 16.534 15.778 50.070 1.00 23.70 ? 88  LYS A C   1 
ATOM   706  O O   . LYS A 1 88  ? 15.820 15.699 49.063 1.00 26.70 ? 88  LYS A O   1 
ATOM   707  C CB  . LYS A 1 88  ? 18.693 14.510 50.091 1.00 20.73 ? 88  LYS A CB  1 
ATOM   708  C CG  . LYS A 1 88  ? 20.092 14.418 49.482 1.00 22.10 ? 88  LYS A CG  1 
ATOM   709  C CD  . LYS A 1 88  ? 20.641 12.970 49.598 1.00 21.07 ? 88  LYS A CD  1 
ATOM   710  C CE  . LYS A 1 88  ? 21.878 12.779 48.721 1.00 26.93 ? 88  LYS A CE  1 
ATOM   711  N NZ  . LYS A 1 88  ? 22.247 11.320 48.626 1.00 27.56 ? 88  LYS A NZ  1 
ATOM   712  N N   . GLY A 1 89  ? 16.046 15.755 51.310 1.00 23.17 ? 89  GLY A N   1 
ATOM   713  C CA  . GLY A 1 89  ? 14.644 15.498 51.555 1.00 23.83 ? 89  GLY A CA  1 
ATOM   714  C C   . GLY A 1 89  ? 14.359 14.009 51.646 1.00 27.42 ? 89  GLY A C   1 
ATOM   715  O O   . GLY A 1 89  ? 14.984 13.185 50.961 1.00 25.37 ? 89  GLY A O   1 
ATOM   716  N N   . HIS A 1 90  ? 13.414 13.652 52.500 1.00 26.29 ? 90  HIS A N   1 
ATOM   717  C CA  . HIS A 1 90  ? 13.027 12.260 52.652 1.00 26.19 ? 90  HIS A CA  1 
ATOM   718  C C   . HIS A 1 90  ? 11.633 12.207 53.227 1.00 27.24 ? 90  HIS A C   1 
ATOM   719  O O   . HIS A 1 90  ? 11.201 13.135 53.920 1.00 26.04 ? 90  HIS A O   1 
ATOM   720  C CB  . HIS A 1 90  ? 14.015 11.532 53.583 1.00 25.13 ? 90  HIS A CB  1 
ATOM   721  C CG  . HIS A 1 90  ? 14.124 12.140 54.955 1.00 25.03 ? 90  HIS A CG  1 
ATOM   722  N ND1 . HIS A 1 90  ? 15.018 13.135 55.255 1.00 26.72 ? 90  HIS A ND1 1 
ATOM   723  C CD2 . HIS A 1 90  ? 13.445 11.879 56.103 1.00 27.82 ? 90  HIS A CD2 1 
ATOM   724  C CE1 . HIS A 1 90  ? 14.896 13.473 56.534 1.00 29.12 ? 90  HIS A CE1 1 
ATOM   725  N NE2 . HIS A 1 90  ? 13.951 12.709 57.070 1.00 27.03 ? 90  HIS A NE2 1 
ATOM   726  N N   . PHE A 1 91  ? 10.914 11.135 52.933 1.00 25.87 ? 91  PHE A N   1 
ATOM   727  C CA  . PHE A 1 91  ? 9.736  10.816 53.711 1.00 30.43 ? 91  PHE A CA  1 
ATOM   728  C C   . PHE A 1 91  ? 10.162 10.033 54.945 1.00 28.96 ? 91  PHE A C   1 
ATOM   729  O O   . PHE A 1 91  ? 11.261 9.443  54.986 1.00 27.19 ? 91  PHE A O   1 
ATOM   730  C CB  . PHE A 1 91  ? 8.730  10.012 52.886 1.00 30.13 ? 91  PHE A CB  1 
ATOM   731  C CG  . PHE A 1 91  ? 8.007  10.836 51.858 1.00 29.86 ? 91  PHE A CG  1 
ATOM   732  C CD1 . PHE A 1 91  ? 8.480  10.929 50.548 1.00 29.34 ? 91  PHE A CD1 1 
ATOM   733  C CD2 . PHE A 1 91  ? 6.853  11.537 52.206 1.00 29.20 ? 91  PHE A CD2 1 
ATOM   734  C CE1 . PHE A 1 91  ? 7.811  11.701 49.602 1.00 29.58 ? 91  PHE A CE1 1 
ATOM   735  C CE2 . PHE A 1 91  ? 6.185  12.312 51.265 1.00 29.26 ? 91  PHE A CE2 1 
ATOM   736  C CZ  . PHE A 1 91  ? 6.662  12.392 49.963 1.00 30.43 ? 91  PHE A CZ  1 
ATOM   737  N N   . HIS A 1 92  ? 9.315  10.049 55.965 1.00 24.43 ? 92  HIS A N   1 
ATOM   738  C CA  . HIS A 1 92  ? 9.525  9.179  57.109 1.00 27.89 ? 92  HIS A CA  1 
ATOM   739  C C   . HIS A 1 92  ? 9.139  7.746  56.726 1.00 31.36 ? 92  HIS A C   1 
ATOM   740  O O   . HIS A 1 92  ? 8.238  7.537  55.910 1.00 33.84 ? 92  HIS A O   1 
ATOM   741  C CB  . HIS A 1 92  ? 8.705  9.680  58.298 1.00 29.95 ? 92  HIS A CB  1 
ATOM   742  C CG  . HIS A 1 92  ? 9.237  10.947 58.896 1.00 27.49 ? 92  HIS A CG  1 
ATOM   743  N ND1 . HIS A 1 92  ? 8.416  11.920 59.429 1.00 29.65 ? 92  HIS A ND1 1 
ATOM   744  C CD2 . HIS A 1 92  ? 10.505 11.381 59.072 1.00 27.23 ? 92  HIS A CD2 1 
ATOM   745  C CE1 . HIS A 1 92  ? 9.162  12.904 59.905 1.00 30.20 ? 92  HIS A CE1 1 
ATOM   746  N NE2 . HIS A 1 92  ? 10.433 12.603 59.702 1.00 29.74 ? 92  HIS A NE2 1 
ATOM   747  N N   . ALA A 1 93  ? 9.842  6.768  57.285 1.00 28.08 ? 93  ALA A N   1 
ATOM   748  C CA  . ALA A 1 93  ? 9.564  5.359  57.001 1.00 33.06 ? 93  ALA A CA  1 
ATOM   749  C C   . ALA A 1 93  ? 8.228  4.985  57.614 1.00 37.66 ? 93  ALA A C   1 
ATOM   750  O O   . ALA A 1 93  ? 7.449  4.233  57.026 1.00 35.84 ? 93  ALA A O   1 
ATOM   751  C CB  . ALA A 1 93  ? 10.689 4.467  57.538 1.00 35.91 ? 93  ALA A CB  1 
ATOM   752  N N   . LYS A 1 94  ? 7.957  5.517  58.806 1.00 31.70 ? 94  LYS A N   1 
ATOM   753  C CA  . LYS A 1 94  ? 6.590  5.522  59.323 1.00 33.93 ? 94  LYS A CA  1 
ATOM   754  C C   . LYS A 1 94  ? 5.985  6.855  58.912 1.00 33.74 ? 94  LYS A C   1 
ATOM   755  O O   . LYS A 1 94  ? 6.178  7.883  59.573 1.00 33.57 ? 94  LYS A O   1 
ATOM   756  C CB  . LYS A 1 94  ? 6.552  5.340  60.838 1.00 35.48 ? 94  LYS A CB  1 
ATOM   757  C CG  . LYS A 1 94  ? 6.935  3.954  61.317 1.00 39.32 ? 94  LYS A CG  1 
ATOM   758  C CD  . LYS A 1 94  ? 6.701  3.842  62.820 1.00 44.80 ? 94  LYS A CD  1 
ATOM   759  C CE  . LYS A 1 94  ? 6.724  2.401  63.310 1.00 53.22 ? 94  LYS A CE  1 
ATOM   760  N NZ  . LYS A 1 94  ? 8.105  1.890  63.518 1.00 59.39 ? 94  LYS A NZ  1 
ATOM   761  N N   . LEU A 1 95  ? 5.257  6.820  57.805 1.00 29.49 ? 95  LEU A N   1 
ATOM   762  C CA  . LEU A 1 95  ? 4.856  8.020  57.084 1.00 32.96 ? 95  LEU A CA  1 
ATOM   763  C C   . LEU A 1 95  ? 4.155  9.081  57.940 1.00 30.20 ? 95  LEU A C   1 
ATOM   764  O O   . LEU A 1 95  ? 4.370  10.274 57.742 1.00 32.71 ? 95  LEU A O   1 
ATOM   765  C CB  . LEU A 1 95  ? 3.960  7.627  55.906 1.00 36.49 ? 95  LEU A CB  1 
ATOM   766  C CG  . LEU A 1 95  ? 4.074  8.352  54.565 1.00 46.57 ? 95  LEU A CG  1 
ATOM   767  C CD1 . LEU A 1 95  ? 5.517  8.491  54.105 1.00 35.77 ? 95  LEU A CD1 1 
ATOM   768  C CD2 . LEU A 1 95  ? 3.232  7.611  53.514 1.00 43.24 ? 95  LEU A CD2 1 
ATOM   769  N N   . ASP A 1 96  ? 3.312  8.650  58.870 1.00 30.46 ? 96  ASP A N   1 
ATOM   770  C CA  . ASP A 1 96  ? 2.494  9.587  59.648 1.00 33.40 ? 96  ASP A CA  1 
ATOM   771  C C   . ASP A 1 96  ? 3.242  10.272 60.811 1.00 35.03 ? 96  ASP A C   1 
ATOM   772  O O   . ASP A 1 96  ? 2.619  10.800 61.736 1.00 37.82 ? 96  ASP A O   1 
ATOM   773  C CB  . ASP A 1 96  ? 1.227  8.895  60.155 1.00 34.70 ? 96  ASP A CB  1 
ATOM   774  C CG  . ASP A 1 96  ? 1.522  7.809  61.167 1.00 44.07 ? 96  ASP A CG  1 
ATOM   775  O OD1 . ASP A 1 96  ? 2.714  7.510  61.405 1.00 48.21 ? 96  ASP A OD1 1 
ATOM   776  O OD2 . ASP A 1 96  ? 0.558  7.249  61.729 1.00 45.75 ? 96  ASP A OD2 1 
ATOM   777  N N   . ARG A 1 97  ? 4.566  10.282 60.769 1.00 30.18 ? 97  ARG A N   1 
ATOM   778  C CA  . ARG A 1 97  ? 5.326  11.037 61.765 1.00 26.76 ? 97  ARG A CA  1 
ATOM   779  C C   . ARG A 1 97  ? 5.544  12.464 61.279 1.00 26.78 ? 97  ARG A C   1 
ATOM   780  O O   . ARG A 1 97  ? 5.867  12.679 60.116 1.00 28.74 ? 97  ARG A O   1 
ATOM   781  C CB  . ARG A 1 97  ? 6.672  10.364 62.051 1.00 26.77 ? 97  ARG A CB  1 
ATOM   782  C CG  . ARG A 1 97  ? 6.657  9.403  63.243 1.00 32.60 ? 97  ARG A CG  1 
ATOM   783  C CD  . ARG A 1 97  ? 5.539  8.363  63.139 1.00 30.06 ? 97  ARG A CD  1 
ATOM   784  N NE  . ARG A 1 97  ? 5.593  7.407  64.246 1.00 30.71 ? 97  ARG A NE  1 
ATOM   785  C CZ  . ARG A 1 97  ? 4.567  6.658  64.640 1.00 35.98 ? 97  ARG A CZ  1 
ATOM   786  N NH1 . ARG A 1 97  ? 3.399  6.752  64.022 1.00 36.38 ? 97  ARG A NH1 1 
ATOM   787  N NH2 . ARG A 1 97  ? 4.705  5.819  65.656 1.00 34.20 ? 97  ARG A NH2 1 
ATOM   788  N N   . ALA A 1 98  ? 5.376  13.442 62.167 1.00 24.64 ? 98  ALA A N   1 
ATOM   789  C CA  . ALA A 1 98  ? 5.608  14.839 61.803 1.00 23.41 ? 98  ALA A CA  1 
ATOM   790  C C   . ALA A 1 98  ? 7.027  15.262 62.155 1.00 25.02 ? 98  ALA A C   1 
ATOM   791  O O   . ALA A 1 98  ? 7.809  14.490 62.718 1.00 24.68 ? 98  ALA A O   1 
ATOM   792  C CB  . ALA A 1 98  ? 4.627  15.730 62.532 1.00 25.76 ? 98  ALA A CB  1 
ATOM   793  N N   . GLN A 1 99  ? 7.361  16.503 61.838 1.00 23.74 ? 99  GLN A N   1 
ATOM   794  C CA  . GLN A 1 99  ? 8.617  17.064 62.314 1.00 22.93 ? 99  GLN A CA  1 
ATOM   795  C C   . GLN A 1 99  ? 8.449  18.544 62.554 1.00 25.41 ? 99  GLN A C   1 
ATOM   796  O O   . GLN A 1 99  ? 7.584  19.182 61.957 1.00 25.31 ? 99  GLN A O   1 
ATOM   797  C CB  . GLN A 1 99  ? 9.750  16.801 61.311 1.00 27.01 ? 99  GLN A CB  1 
ATOM   798  C CG  . GLN A 1 99  ? 9.457  17.260 59.898 1.00 30.09 ? 99  GLN A CG  1 
ATOM   799  C CD  . GLN A 1 99  ? 10.479 16.731 58.895 1.00 33.98 ? 99  GLN A CD  1 
ATOM   800  O OE1 . GLN A 1 99  ? 11.641 17.154 58.886 1.00 28.33 ? 99  GLN A OE1 1 
ATOM   801  N NE2 . GLN A 1 99  ? 10.045 15.797 58.044 1.00 35.79 ? 99  GLN A NE2 1 
ATOM   802  N N   . VAL A 1 100 ? 9.270  19.084 63.442 1.00 20.35 ? 100 VAL A N   1 
ATOM   803  C CA  . VAL A 1 100 ? 9.254  20.507 63.747 1.00 23.03 ? 100 VAL A CA  1 
ATOM   804  C C   . VAL A 1 100 ? 10.652 21.070 63.514 1.00 27.19 ? 100 VAL A C   1 
ATOM   805  O O   . VAL A 1 100 ? 11.644 20.521 64.008 1.00 27.61 ? 100 VAL A O   1 
ATOM   806  C CB  . VAL A 1 100 ? 8.793  20.730 65.218 1.00 26.86 ? 100 VAL A CB  1 
ATOM   807  C CG1 . VAL A 1 100 ? 8.924  22.197 65.623 1.00 30.45 ? 100 VAL A CG1 1 
ATOM   808  C CG2 . VAL A 1 100 ? 7.355  20.258 65.384 1.00 27.45 ? 100 VAL A CG2 1 
ATOM   809  N N   . ALA A 1 101 ? 10.736 22.167 62.766 1.00 22.67 ? 101 ALA A N   1 
ATOM   810  C CA  . ALA A 1 101 ? 12.019 22.753 62.436 1.00 22.46 ? 101 ALA A CA  1 
ATOM   811  C C   . ALA A 1 101 ? 12.049 24.201 62.898 1.00 31.20 ? 101 ALA A C   1 
ATOM   812  O O   . ALA A 1 101 ? 11.067 24.934 62.709 1.00 28.17 ? 101 ALA A O   1 
ATOM   813  C CB  . ALA A 1 101 ? 12.250 22.671 60.956 1.00 22.17 ? 101 ALA A CB  1 
ATOM   814  N N   . VAL A 1 102 ? 13.161 24.604 63.506 1.00 24.88 ? 102 VAL A N   1 
ATOM   815  C CA  . VAL A 1 102 ? 13.327 25.966 63.988 1.00 27.09 ? 102 VAL A CA  1 
ATOM   816  C C   . VAL A 1 102 ? 14.487 26.622 63.274 1.00 26.97 ? 102 VAL A C   1 
ATOM   817  O O   . VAL A 1 102 ? 15.614 26.130 63.338 1.00 24.34 ? 102 VAL A O   1 
ATOM   818  C CB  . VAL A 1 102 ? 13.640 25.998 65.496 1.00 33.37 ? 102 VAL A CB  1 
ATOM   819  C CG1 . VAL A 1 102 ? 13.411 27.405 66.046 1.00 32.88 ? 102 VAL A CG1 1 
ATOM   820  C CG2 . VAL A 1 102 ? 12.803 24.964 66.226 1.00 40.22 ? 102 VAL A CG2 1 
ATOM   821  N N   . ALA A 1 103 ? 14.245 27.745 62.608 1.00 23.62 ? 103 ALA A N   1 
ATOM   822  C CA  . ALA A 1 103 ? 15.353 28.428 61.949 1.00 26.70 ? 103 ALA A CA  1 
ATOM   823  C C   . ALA A 1 103 ? 16.253 29.126 62.971 1.00 29.45 ? 103 ALA A C   1 
ATOM   824  O O   . ALA A 1 103 ? 15.768 29.854 63.843 1.00 30.27 ? 103 ALA A O   1 
ATOM   825  C CB  . ALA A 1 103 ? 14.847 29.415 60.911 1.00 27.17 ? 103 ALA A CB  1 
ATOM   826  N N   . LEU A 1 104 ? 17.561 28.901 62.864 1.00 25.52 ? 104 LEU A N   1 
ATOM   827  C CA  . LEU A 1 104 ? 18.514 29.482 63.803 1.00 28.75 ? 104 LEU A CA  1 
ATOM   828  C C   . LEU A 1 104 ? 19.362 30.586 63.183 1.00 31.88 ? 104 LEU A C   1 
ATOM   829  O O   . LEU A 1 104 ? 19.742 31.533 63.866 1.00 32.07 ? 104 LEU A O   1 
ATOM   830  C CB  . LEU A 1 104 ? 19.441 28.412 64.383 1.00 29.75 ? 104 LEU A CB  1 
ATOM   831  C CG  . LEU A 1 104 ? 18.743 27.246 65.085 1.00 31.88 ? 104 LEU A CG  1 
ATOM   832  C CD1 . LEU A 1 104 ? 19.773 26.205 65.528 1.00 30.44 ? 104 LEU A CD1 1 
ATOM   833  C CD2 . LEU A 1 104 ? 17.938 27.769 66.265 1.00 31.50 ? 104 LEU A CD2 1 
ATOM   834  N N   . LYS A 1 105 ? 19.678 30.455 61.897 1.00 30.56 ? 105 LYS A N   1 
ATOM   835  C CA  . LYS A 1 105 ? 20.563 31.413 61.253 1.00 29.02 ? 105 LYS A CA  1 
ATOM   836  C C   . LYS A 1 105 ? 20.393 31.414 59.743 1.00 31.94 ? 105 LYS A C   1 
ATOM   837  O O   . LYS A 1 105 ? 20.081 30.383 59.139 1.00 26.77 ? 105 LYS A O   1 
ATOM   838  C CB  . LYS A 1 105 ? 22.024 31.105 61.609 1.00 31.63 ? 105 LYS A CB  1 
ATOM   839  C CG  . LYS A 1 105 ? 23.018 32.080 61.004 1.00 44.95 ? 105 LYS A CG  1 
ATOM   840  C CD  . LYS A 1 105 ? 24.451 31.756 61.416 1.00 58.10 ? 105 LYS A CD  1 
ATOM   841  C CE  . LYS A 1 105 ? 25.442 32.352 60.421 1.00 63.28 ? 105 LYS A CE  1 
ATOM   842  N NZ  . LYS A 1 105 ? 25.173 31.871 59.028 1.00 57.15 ? 105 LYS A NZ  1 
ATOM   843  N N   . GLY A 1 106 ? 20.584 32.580 59.132 1.00 29.16 ? 106 GLY A N   1 
ATOM   844  C CA  . GLY A 1 106 ? 20.603 32.668 57.684 1.00 28.18 ? 106 GLY A CA  1 
ATOM   845  C C   . GLY A 1 106 ? 19.260 32.932 57.032 1.00 32.25 ? 106 GLY A C   1 
ATOM   846  O O   . GLY A 1 106 ? 18.266 33.258 57.692 1.00 32.29 ? 106 GLY A O   1 
ATOM   847  N N   . LYS A 1 107 ? 19.235 32.787 55.715 1.00 29.27 ? 107 LYS A N   1 
ATOM   848  C CA  . LYS A 1 107 ? 18.048 33.085 54.935 1.00 30.96 ? 107 LYS A CA  1 
ATOM   849  C C   . LYS A 1 107 ? 17.658 31.842 54.164 1.00 30.83 ? 107 LYS A C   1 
ATOM   850  O O   . LYS A 1 107 ? 18.420 31.363 53.327 1.00 27.27 ? 107 LYS A O   1 
ATOM   851  C CB  . LYS A 1 107 ? 18.331 34.239 53.966 1.00 39.21 ? 107 LYS A CB  1 
ATOM   852  C CG  . LYS A 1 107 ? 17.079 34.957 53.482 1.00 55.33 ? 107 LYS A CG  1 
ATOM   853  C CD  . LYS A 1 107 ? 17.412 36.143 52.575 1.00 61.04 ? 107 LYS A CD  1 
ATOM   854  C CE  . LYS A 1 107 ? 16.230 37.098 52.477 1.00 63.58 ? 107 LYS A CE  1 
ATOM   855  N NZ  . LYS A 1 107 ? 14.924 36.372 52.450 1.00 65.04 ? 107 LYS A NZ  1 
ATOM   856  N N   . GLY A 1 108 ? 16.478 31.307 54.438 1.00 27.37 ? 108 GLY A N   1 
ATOM   857  C CA  . GLY A 1 108 ? 16.096 30.074 53.790 1.00 28.78 ? 108 GLY A CA  1 
ATOM   858  C C   . GLY A 1 108 ? 14.644 29.764 54.004 1.00 29.85 ? 108 GLY A C   1 
ATOM   859  O O   . GLY A 1 108 ? 13.861 30.649 54.339 1.00 30.41 ? 108 GLY A O   1 
ATOM   860  N N   . GLY A 1 109 ? 14.279 28.503 53.801 1.00 26.63 ? 109 GLY A N   1 
ATOM   861  C CA  . GLY A 1 109 ? 12.904 28.088 53.958 1.00 24.20 ? 109 GLY A CA  1 
ATOM   862  C C   . GLY A 1 109 ? 12.801 26.583 53.868 1.00 30.22 ? 109 GLY A C   1 
ATOM   863  O O   . GLY A 1 109 ? 13.814 25.885 53.664 1.00 25.63 ? 109 GLY A O   1 
ATOM   864  N N   . VAL A 1 110 ? 11.580 26.081 54.002 1.00 23.49 ? 110 VAL A N   1 
ATOM   865  C CA  . VAL A 1 110 ? 11.353 24.656 53.871 1.00 23.59 ? 110 VAL A CA  1 
ATOM   866  C C   . VAL A 1 110 ? 10.348 24.367 52.785 1.00 27.07 ? 110 VAL A C   1 
ATOM   867  O O   . VAL A 1 110 ? 9.240  24.918 52.764 1.00 26.63 ? 110 VAL A O   1 
ATOM   868  C CB  . VAL A 1 110 ? 10.880 24.031 55.184 1.00 26.10 ? 110 VAL A CB  1 
ATOM   869  C CG1 . VAL A 1 110 ? 10.769 22.485 55.046 1.00 26.48 ? 110 VAL A CG1 1 
ATOM   870  C CG2 . VAL A 1 110 ? 11.848 24.420 56.279 1.00 25.04 ? 110 VAL A CG2 1 
ATOM   871  N N   . LEU A 1 111 ? 10.747 23.500 51.862 1.00 25.21 ? 111 LEU A N   1 
ATOM   872  C CA  . LEU A 1 111 ? 9.826  23.018 50.854 1.00 25.06 ? 111 LEU A CA  1 
ATOM   873  C C   . LEU A 1 111 ? 9.311  21.659 51.281 1.00 24.52 ? 111 LEU A C   1 
ATOM   874  O O   . LEU A 1 111 ? 10.099 20.787 51.656 1.00 27.80 ? 111 LEU A O   1 
ATOM   875  C CB  . LEU A 1 111 ? 10.550 22.903 49.514 1.00 25.90 ? 111 LEU A CB  1 
ATOM   876  C CG  . LEU A 1 111 ? 9.699  22.472 48.334 1.00 26.16 ? 111 LEU A CG  1 
ATOM   877  C CD1 . LEU A 1 111 ? 8.700  23.592 48.009 1.00 28.00 ? 111 LEU A CD1 1 
ATOM   878  C CD2 . LEU A 1 111 ? 10.618 22.177 47.135 1.00 26.43 ? 111 LEU A CD2 1 
ATOM   879  N N   . MET A 1 112 ? 7.996  21.465 51.240 1.00 24.29 ? 112 MET A N   1 
ATOM   880  C CA  . MET A 1 112 ? 7.396  20.218 51.718 1.00 24.89 ? 112 MET A CA  1 
ATOM   881  C C   . MET A 1 112 ? 6.487  19.612 50.656 1.00 28.06 ? 112 MET A C   1 
ATOM   882  O O   . MET A 1 112 ? 5.885  20.332 49.848 1.00 30.70 ? 112 MET A O   1 
ATOM   883  C CB  . MET A 1 112 ? 6.603  20.444 53.039 1.00 27.15 ? 112 MET A CB  1 
ATOM   884  C CG  . MET A 1 112 ? 7.495  20.718 54.301 1.00 24.89 ? 112 MET A CG  1 
ATOM   885  S SD  . MET A 1 112 ? 6.720  21.652 55.657 1.00 21.71 ? 112 MET A SD  1 
ATOM   886  C CE  . MET A 1 112 ? 6.542  23.213 54.783 1.00 34.34 ? 112 MET A CE  1 
ATOM   887  N N   . GLN A 1 113 ? 6.374  18.290 50.673 1.00 28.98 ? 113 GLN A N   1 
ATOM   888  C CA  . GLN A 1 113 ? 5.610  17.592 49.658 1.00 32.71 ? 113 GLN A CA  1 
ATOM   889  C C   . GLN A 1 113 ? 4.863  16.403 50.231 1.00 29.72 ? 113 GLN A C   1 
ATOM   890  O O   . GLN A 1 113 ? 5.363  15.721 51.129 1.00 30.38 ? 113 GLN A O   1 
ATOM   891  C CB  . GLN A 1 113 ? 6.594  17.110 48.595 1.00 35.94 ? 113 GLN A CB  1 
ATOM   892  C CG  . GLN A 1 113 ? 6.022  16.305 47.505 1.00 44.70 ? 113 GLN A CG  1 
ATOM   893  C CD  . GLN A 1 113 ? 7.018  16.182 46.383 1.00 41.86 ? 113 GLN A CD  1 
ATOM   894  O OE1 . GLN A 1 113 ? 7.084  17.044 45.518 1.00 36.46 ? 113 GLN A OE1 1 
ATOM   895  N NE2 . GLN A 1 113 ? 7.835  15.135 46.422 1.00 44.23 ? 113 GLN A NE2 1 
ATOM   896  N N   . THR A 1 114 ? 3.668  16.141 49.704 1.00 29.91 ? 114 THR A N   1 
ATOM   897  C CA  . THR A 1 114 ? 2.901  14.970 50.111 1.00 30.86 ? 114 THR A CA  1 
ATOM   898  C C   . THR A 1 114 ? 3.317  13.783 49.237 1.00 33.48 ? 114 THR A C   1 
ATOM   899  O O   . THR A 1 114 ? 4.024  13.960 48.248 1.00 36.18 ? 114 THR A O   1 
ATOM   900  C CB  . THR A 1 114 ? 1.388  15.202 49.950 1.00 36.65 ? 114 THR A CB  1 
ATOM   901  O OG1 . THR A 1 114 ? 1.075  15.282 48.555 1.00 35.95 ? 114 THR A OG1 1 
ATOM   902  C CG2 . THR A 1 114 ? 0.954  16.500 50.648 1.00 36.16 ? 114 THR A CG2 1 
ATOM   903  N N   . PRO A 1 115 ? 2.882  12.571 49.599 1.00 31.55 ? 115 PRO A N   1 
ATOM   904  C CA  . PRO A 1 115 ? 3.237  11.416 48.768 1.00 36.43 ? 115 PRO A CA  1 
ATOM   905  C C   . PRO A 1 115 ? 2.684  11.533 47.339 1.00 40.62 ? 115 PRO A C   1 
ATOM   906  O O   . PRO A 1 115 ? 3.209  10.888 46.422 1.00 39.48 ? 115 PRO A O   1 
ATOM   907  C CB  . PRO A 1 115 ? 2.590  10.241 49.505 1.00 33.63 ? 115 PRO A CB  1 
ATOM   908  C CG  . PRO A 1 115 ? 2.501  10.693 50.938 1.00 34.83 ? 115 PRO A CG  1 
ATOM   909  C CD  . PRO A 1 115 ? 2.203  12.174 50.845 1.00 36.38 ? 115 PRO A CD  1 
ATOM   910  N N   . GLU A 1 116 ? 1.646  12.343 47.149 1.00 35.34 ? 116 GLU A N   1 
ATOM   911  C CA  . GLU A 1 116 ? 1.095  12.546 45.811 1.00 47.37 ? 116 GLU A CA  1 
ATOM   912  C C   . GLU A 1 116 ? 1.745  13.716 45.073 1.00 50.76 ? 116 GLU A C   1 
ATOM   913  O O   . GLU A 1 116 ? 1.429  13.977 43.911 1.00 53.13 ? 116 GLU A O   1 
ATOM   914  C CB  . GLU A 1 116 ? -0.428 12.708 45.847 1.00 49.87 ? 116 GLU A CB  1 
ATOM   915  C CG  . GLU A 1 116 ? -1.189 11.387 45.896 1.00 62.08 ? 116 GLU A CG  1 
ATOM   916  C CD  . GLU A 1 116 ? -1.546 10.955 47.308 1.00 70.15 ? 116 GLU A CD  1 
ATOM   917  O OE1 . GLU A 1 116 ? -2.311 11.687 47.976 1.00 75.01 ? 116 GLU A OE1 1 
ATOM   918  O OE2 . GLU A 1 116 ? -1.071 9.883  47.750 1.00 68.53 ? 116 GLU A OE2 1 
ATOM   919  N N   . GLY A 1 117 ? 2.654  14.419 45.743 1.00 42.27 ? 117 GLY A N   1 
ATOM   920  C CA  . GLY A 1 117 ? 3.409  15.475 45.092 1.00 40.65 ? 117 GLY A CA  1 
ATOM   921  C C   . GLY A 1 117 ? 2.891  16.890 45.283 1.00 41.58 ? 117 GLY A C   1 
ATOM   922  O O   . GLY A 1 117 ? 3.434  17.828 44.704 1.00 51.84 ? 117 GLY A O   1 
ATOM   923  N N   . ASP A 1 118 ? 1.843  17.062 46.079 1.00 38.67 ? 118 ASP A N   1 
ATOM   924  C CA  . ASP A 1 118 ? 1.397  18.409 46.409 1.00 44.32 ? 118 ASP A CA  1 
ATOM   925  C C   . ASP A 1 118 ? 2.502  19.066 47.230 1.00 47.24 ? 118 ASP A C   1 
ATOM   926  O O   . ASP A 1 118 ? 2.951  18.503 48.228 1.00 41.68 ? 118 ASP A O   1 
ATOM   927  C CB  . ASP A 1 118 ? 0.109  18.389 47.234 1.00 52.59 ? 118 ASP A CB  1 
ATOM   928  C CG  . ASP A 1 118 ? -0.892 17.362 46.744 1.00 64.75 ? 118 ASP A CG  1 
ATOM   929  O OD1 . ASP A 1 118 ? -1.461 17.563 45.650 1.00 62.28 ? 118 ASP A OD1 1 
ATOM   930  O OD2 . ASP A 1 118 ? -1.122 16.363 47.465 1.00 66.38 ? 118 ASP A OD2 1 
ATOM   931  N N   . ALA A 1 119 ? 2.945  20.244 46.813 1.00 41.26 ? 119 ALA A N   1 
ATOM   932  C CA  . ALA A 1 119 ? 4.050  20.896 47.492 1.00 42.33 ? 119 ALA A CA  1 
ATOM   933  C C   . ALA A 1 119 ? 3.626  22.208 48.132 1.00 43.20 ? 119 ALA A C   1 
ATOM   934  O O   . ALA A 1 119 ? 2.639  22.816 47.724 1.00 45.59 ? 119 ALA A O   1 
ATOM   935  C CB  . ALA A 1 119 ? 5.214  21.112 46.539 1.00 45.05 ? 119 ALA A CB  1 
ATOM   936  N N   . LYS A 1 120 ? 4.376  22.626 49.148 1.00 31.33 ? 120 LYS A N   1 
ATOM   937  C CA  . LYS A 1 120 ? 4.154  23.902 49.804 1.00 32.60 ? 120 LYS A CA  1 
ATOM   938  C C   . LYS A 1 120 ? 5.491  24.456 50.282 1.00 34.86 ? 120 LYS A C   1 
ATOM   939  O O   . LYS A 1 120 ? 6.299  23.729 50.857 1.00 31.37 ? 120 LYS A O   1 
ATOM   940  C CB  . LYS A 1 120 ? 3.191  23.746 50.983 1.00 34.24 ? 120 LYS A CB  1 
ATOM   941  C CG  . LYS A 1 120 ? 2.966  25.042 51.770 1.00 44.12 ? 120 LYS A CG  1 
ATOM   942  C CD  . LYS A 1 120 ? 1.708  24.957 52.619 1.00 51.52 ? 120 LYS A CD  1 
ATOM   943  C CE  . LYS A 1 120 ? 1.357  26.308 53.244 1.00 60.72 ? 120 LYS A CE  1 
ATOM   944  N NZ  . LYS A 1 120 ? 1.207  27.386 52.226 1.00 63.51 ? 120 LYS A NZ  1 
ATOM   945  N N   . TRP A 1 121 ? 5.729  25.734 50.011 1.00 26.31 ? 121 TRP A N   1 
ATOM   946  C CA  . TRP A 1 121 ? 6.923  26.413 50.467 1.00 28.63 ? 121 TRP A CA  1 
ATOM   947  C C   . TRP A 1 121 ? 6.577  27.331 51.630 1.00 32.53 ? 121 TRP A C   1 
ATOM   948  O O   . TRP A 1 121 ? 5.587  28.065 51.561 1.00 31.83 ? 121 TRP A O   1 
ATOM   949  C CB  . TRP A 1 121 ? 7.491  27.260 49.332 1.00 30.04 ? 121 TRP A CB  1 
ATOM   950  C CG  . TRP A 1 121 ? 8.506  28.274 49.763 1.00 29.36 ? 121 TRP A CG  1 
ATOM   951  C CD1 . TRP A 1 121 ? 8.304  29.619 49.934 1.00 30.05 ? 121 TRP A CD1 1 
ATOM   952  C CD2 . TRP A 1 121 ? 9.891  28.037 50.056 1.00 26.93 ? 121 TRP A CD2 1 
ATOM   953  N NE1 . TRP A 1 121 ? 9.476  30.227 50.304 1.00 32.05 ? 121 TRP A NE1 1 
ATOM   954  C CE2 . TRP A 1 121 ? 10.466 29.278 50.384 1.00 31.62 ? 121 TRP A CE2 1 
ATOM   955  C CE3 . TRP A 1 121 ? 10.698 26.888 50.059 1.00 23.42 ? 121 TRP A CE3 1 
ATOM   956  C CZ2 . TRP A 1 121 ? 11.815 29.411 50.734 1.00 30.85 ? 121 TRP A CZ2 1 
ATOM   957  C CZ3 . TRP A 1 121 ? 12.046 27.025 50.397 1.00 27.15 ? 121 TRP A CZ3 1 
ATOM   958  C CH2 . TRP A 1 121 ? 12.590 28.273 50.724 1.00 29.83 ? 121 TRP A CH2 1 
ATOM   959  N N   . ILE A 1 122 ? 7.377  27.289 52.692 1.00 24.70 ? 122 ILE A N   1 
ATOM   960  C CA  . ILE A 1 122 ? 7.258  28.259 53.771 1.00 26.21 ? 122 ILE A CA  1 
ATOM   961  C C   . ILE A 1 122 ? 8.631  28.791 54.102 1.00 31.82 ? 122 ILE A C   1 
ATOM   962  O O   . ILE A 1 122 ? 9.548  28.022 54.435 1.00 28.14 ? 122 ILE A O   1 
ATOM   963  C CB  . ILE A 1 122 ? 6.640  27.658 55.048 1.00 31.41 ? 122 ILE A CB  1 
ATOM   964  C CG1 . ILE A 1 122 ? 5.253  27.083 54.759 1.00 30.75 ? 122 ILE A CG1 1 
ATOM   965  C CG2 . ILE A 1 122 ? 6.555  28.726 56.147 1.00 31.48 ? 122 ILE A CG2 1 
ATOM   966  C CD1 . ILE A 1 122 ? 4.617  26.374 55.950 1.00 32.92 ? 122 ILE A CD1 1 
ATOM   967  N N   . SER A 1 123 ? 8.787  30.106 54.007 1.00 24.52 ? 123 SER A N   1 
ATOM   968  C CA  . SER A 1 123 ? 10.054 30.735 54.333 1.00 27.37 ? 123 SER A CA  1 
ATOM   969  C C   . SER A 1 123 ? 10.292 30.685 55.842 1.00 30.69 ? 123 SER A C   1 
ATOM   970  O O   . SER A 1 123 ? 9.348  30.538 56.632 1.00 30.32 ? 123 SER A O   1 
ATOM   971  C CB  . SER A 1 123 ? 10.053 32.185 53.856 1.00 36.89 ? 123 SER A CB  1 
ATOM   972  O OG  . SER A 1 123 ? 9.239  32.962 54.718 1.00 42.82 ? 123 SER A OG  1 
ATOM   973  N N   . SER A 1 124 ? 11.542 30.803 56.262 1.00 26.95 ? 124 SER A N   1 
ATOM   974  C CA  . SER A 1 124 ? 11.806 30.825 57.693 1.00 32.32 ? 124 SER A CA  1 
ATOM   975  C C   . SER A 1 124 ? 12.990 31.706 58.076 1.00 37.72 ? 124 SER A C   1 
ATOM   976  O O   . SER A 1 124 ? 14.138 31.292 57.958 1.00 41.28 ? 124 SER A O   1 
ATOM   977  C CB  . SER A 1 124 ? 12.011 29.405 58.222 1.00 37.33 ? 124 SER A CB  1 
ATOM   978  O OG  . SER A 1 124 ? 13.114 28.789 57.581 1.00 27.77 ? 124 SER A OG  1 
ATOM   979  N N   . GLU A 1 125 ? 12.712 32.927 58.520 1.00 35.41 ? 125 GLU A N   1 
ATOM   980  C CA  . GLU A 1 125 ? 13.753 33.755 59.115 1.00 37.75 ? 125 GLU A CA  1 
ATOM   981  C C   . GLU A 1 125 ? 14.086 33.161 60.482 1.00 32.42 ? 125 GLU A C   1 
ATOM   982  O O   . GLU A 1 125 ? 13.285 32.415 61.044 1.00 29.50 ? 125 GLU A O   1 
ATOM   983  C CB  . GLU A 1 125 ? 13.276 35.204 59.274 1.00 46.18 ? 125 GLU A CB  1 
ATOM   984  C CG  . GLU A 1 125 ? 12.935 35.918 57.967 1.00 60.83 ? 125 GLU A CG  1 
ATOM   985  C CD  . GLU A 1 125 ? 14.146 36.154 57.067 1.00 69.47 ? 125 GLU A CD  1 
ATOM   986  O OE1 . GLU A 1 125 ? 15.251 36.424 57.587 1.00 71.71 ? 125 GLU A OE1 1 
ATOM   987  O OE2 . GLU A 1 125 ? 13.988 36.071 55.830 1.00 70.87 ? 125 GLU A OE2 1 
ATOM   988  N N   . PRO A 1 126 ? 15.273 33.474 61.015 1.00 29.81 ? 126 PRO A N   1 
ATOM   989  C CA  . PRO A 1 126 ? 15.594 32.990 62.360 1.00 33.29 ? 126 PRO A CA  1 
ATOM   990  C C   . PRO A 1 126 ? 14.466 33.370 63.318 1.00 39.35 ? 126 PRO A C   1 
ATOM   991  O O   . PRO A 1 126 ? 13.985 34.505 63.270 1.00 30.36 ? 126 PRO A O   1 
ATOM   992  C CB  . PRO A 1 126 ? 16.875 33.748 62.704 1.00 34.82 ? 126 PRO A CB  1 
ATOM   993  C CG  . PRO A 1 126 ? 17.530 33.955 61.353 1.00 36.04 ? 126 PRO A CG  1 
ATOM   994  C CD  . PRO A 1 126 ? 16.393 34.203 60.396 1.00 34.89 ? 126 PRO A CD  1 
ATOM   995  N N   . GLY A 1 127 ? 14.039 32.426 64.154 1.00 33.60 ? 127 GLY A N   1 
ATOM   996  C CA  . GLY A 1 127 ? 12.916 32.655 65.042 1.00 33.69 ? 127 GLY A CA  1 
ATOM   997  C C   . GLY A 1 127 ? 11.651 31.973 64.566 1.00 33.26 ? 127 GLY A C   1 
ATOM   998  O O   . GLY A 1 127 ? 10.719 31.773 65.351 1.00 37.59 ? 127 GLY A O   1 
ATOM   999  N N   . THR A 1 128 ? 11.606 31.615 63.282 1.00 26.37 ? 128 THR A N   1 
ATOM   1000 C CA  . THR A 1 128 ? 10.434 30.963 62.723 1.00 25.11 ? 128 THR A CA  1 
ATOM   1001 C C   . THR A 1 128 ? 10.445 29.456 62.970 1.00 28.99 ? 128 THR A C   1 
ATOM   1002 O O   . THR A 1 128 ? 11.463 28.782 62.758 1.00 28.54 ? 128 THR A O   1 
ATOM   1003 C CB  . THR A 1 128 ? 10.302 31.221 61.201 1.00 33.93 ? 128 THR A CB  1 
ATOM   1004 O OG1 . THR A 1 128 ? 10.134 32.627 60.972 1.00 36.99 ? 128 THR A OG1 1 
ATOM   1005 C CG2 . THR A 1 128 ? 9.102  30.476 60.627 1.00 29.63 ? 128 THR A CG2 1 
ATOM   1006 N N   . VAL A 1 129 ? 9.307  28.931 63.405 1.00 23.56 ? 129 VAL A N   1 
ATOM   1007 C CA  . VAL A 1 129 ? 9.149  27.498 63.583 1.00 24.06 ? 129 VAL A CA  1 
ATOM   1008 C C   . VAL A 1 129 ? 8.248  26.971 62.480 1.00 28.02 ? 129 VAL A C   1 
ATOM   1009 O O   . VAL A 1 129 ? 7.165  27.521 62.234 1.00 25.63 ? 129 VAL A O   1 
ATOM   1010 C CB  . VAL A 1 129 ? 8.538  27.154 64.961 1.00 26.08 ? 129 VAL A CB  1 
ATOM   1011 C CG1 . VAL A 1 129 ? 8.172  25.660 65.033 1.00 24.83 ? 129 VAL A CG1 1 
ATOM   1012 C CG2 . VAL A 1 129 ? 9.499  27.540 66.070 1.00 25.65 ? 129 VAL A CG2 1 
ATOM   1013 N N   . ILE A 1 130 ? 8.697  25.909 61.813 1.00 19.96 ? 130 ILE A N   1 
ATOM   1014 C CA  . ILE A 1 130 ? 7.927  25.307 60.747 1.00 20.51 ? 130 ILE A CA  1 
ATOM   1015 C C   . ILE A 1 130 ? 7.418  23.933 61.148 1.00 27.14 ? 130 ILE A C   1 
ATOM   1016 O O   . ILE A 1 130 ? 8.177  23.068 61.616 1.00 26.91 ? 130 ILE A O   1 
ATOM   1017 C CB  . ILE A 1 130 ? 8.741  25.217 59.440 1.00 26.96 ? 130 ILE A CB  1 
ATOM   1018 C CG1 . ILE A 1 130 ? 8.909  26.625 58.847 1.00 35.67 ? 130 ILE A CG1 1 
ATOM   1019 C CG2 . ILE A 1 130 ? 8.035  24.307 58.450 1.00 25.58 ? 130 ILE A CG2 1 
ATOM   1020 C CD1 . ILE A 1 130 ? 10.063 26.752 57.903 1.00 45.65 ? 130 ILE A CD1 1 
ATOM   1021 N N   . TYR A 1 131 ? 6.118  23.736 60.976 1.00 22.73 ? 131 TYR A N   1 
ATOM   1022 C CA  . TYR A 1 131 ? 5.492  22.471 61.279 1.00 22.72 ? 131 TYR A CA  1 
ATOM   1023 C C   . TYR A 1 131 ? 5.282  21.703 59.976 1.00 27.84 ? 131 TYR A C   1 
ATOM   1024 O O   . TYR A 1 131 ? 4.542  22.156 59.086 1.00 25.23 ? 131 TYR A O   1 
ATOM   1025 C CB  . TYR A 1 131 ? 4.151  22.716 61.970 1.00 22.08 ? 131 TYR A CB  1 
ATOM   1026 C CG  . TYR A 1 131 ? 3.304  21.478 62.151 1.00 23.41 ? 131 TYR A CG  1 
ATOM   1027 C CD1 . TYR A 1 131 ? 3.559  20.576 63.181 1.00 25.95 ? 131 TYR A CD1 1 
ATOM   1028 C CD2 . TYR A 1 131 ? 2.236  21.223 61.305 1.00 26.55 ? 131 TYR A CD2 1 
ATOM   1029 C CE1 . TYR A 1 131 ? 2.770  19.448 63.359 1.00 27.13 ? 131 TYR A CE1 1 
ATOM   1030 C CE2 . TYR A 1 131 ? 1.438  20.104 61.475 1.00 28.07 ? 131 TYR A CE2 1 
ATOM   1031 C CZ  . TYR A 1 131 ? 1.711  19.216 62.494 1.00 25.24 ? 131 TYR A CZ  1 
ATOM   1032 O OH  . TYR A 1 131 ? 0.918  18.103 62.654 1.00 26.07 ? 131 TYR A OH  1 
ATOM   1033 N N   . SER A 1 132 ? 5.951  20.555 59.862 1.00 25.21 ? 132 SER A N   1 
ATOM   1034 C CA  . SER A 1 132 ? 5.787  19.667 58.710 1.00 23.80 ? 132 SER A CA  1 
ATOM   1035 C C   . SER A 1 132 ? 4.912  18.521 59.187 1.00 26.50 ? 132 SER A C   1 
ATOM   1036 O O   . SER A 1 132 ? 5.334  17.715 60.023 1.00 24.77 ? 132 SER A O   1 
ATOM   1037 C CB  . SER A 1 132 ? 7.165  19.164 58.229 1.00 24.52 ? 132 SER A CB  1 
ATOM   1038 O OG  . SER A 1 132 ? 7.039  18.293 57.112 1.00 29.60 ? 132 SER A OG  1 
ATOM   1039 N N   . PRO A 1 133 ? 3.665  18.455 58.693 1.00 27.42 ? 133 PRO A N   1 
ATOM   1040 C CA  . PRO A 1 133 ? 2.719  17.500 59.278 1.00 27.44 ? 133 PRO A CA  1 
ATOM   1041 C C   . PRO A 1 133 ? 3.024  16.047 58.910 1.00 24.86 ? 133 PRO A C   1 
ATOM   1042 O O   . PRO A 1 133 ? 3.878  15.786 58.068 1.00 24.33 ? 133 PRO A O   1 
ATOM   1043 C CB  . PRO A 1 133 ? 1.361  17.917 58.663 1.00 27.85 ? 133 PRO A CB  1 
ATOM   1044 C CG  . PRO A 1 133 ? 1.588  19.279 58.040 1.00 28.16 ? 133 PRO A CG  1 
ATOM   1045 C CD  . PRO A 1 133 ? 3.045  19.256 57.624 1.00 26.40 ? 133 PRO A CD  1 
ATOM   1046 N N   . PRO A 1 134 ? 2.318  15.108 59.546 1.00 29.42 ? 134 PRO A N   1 
ATOM   1047 C CA  . PRO A 1 134 ? 2.357  13.696 59.158 1.00 28.66 ? 134 PRO A CA  1 
ATOM   1048 C C   . PRO A 1 134 ? 2.158  13.551 57.652 1.00 29.16 ? 134 PRO A C   1 
ATOM   1049 O O   . PRO A 1 134 ? 1.355  14.290 57.077 1.00 29.75 ? 134 PRO A O   1 
ATOM   1050 C CB  . PRO A 1 134 ? 1.156  13.110 59.906 1.00 30.76 ? 134 PRO A CB  1 
ATOM   1051 C CG  . PRO A 1 134 ? 1.059  13.951 61.151 1.00 24.83 ? 134 PRO A CG  1 
ATOM   1052 C CD  . PRO A 1 134 ? 1.428  15.349 60.701 1.00 27.62 ? 134 PRO A CD  1 
ATOM   1053 N N   . TYR A 1 135 ? 2.906  12.631 57.044 1.00 29.84 ? 135 TYR A N   1 
ATOM   1054 C CA  . TYR A 1 135 ? 2.816  12.301 55.614 1.00 32.54 ? 135 TYR A CA  1 
ATOM   1055 C C   . TYR A 1 135 ? 3.572  13.225 54.664 1.00 34.40 ? 135 TYR A C   1 
ATOM   1056 O O   . TYR A 1 135 ? 3.648  12.942 53.464 1.00 35.07 ? 135 TYR A O   1 
ATOM   1057 C CB  . TYR A 1 135 ? 1.357  12.144 55.160 1.00 33.13 ? 135 TYR A CB  1 
ATOM   1058 C CG  . TYR A 1 135 ? 0.633  10.997 55.829 1.00 34.57 ? 135 TYR A CG  1 
ATOM   1059 C CD1 . TYR A 1 135 ? 0.838  9.687  55.412 1.00 38.17 ? 135 TYR A CD1 1 
ATOM   1060 C CD2 . TYR A 1 135 ? -0.244 11.220 56.880 1.00 36.63 ? 135 TYR A CD2 1 
ATOM   1061 C CE1 . TYR A 1 135 ? 0.197  8.635  56.021 1.00 39.95 ? 135 TYR A CE1 1 
ATOM   1062 C CE2 . TYR A 1 135 ? -0.897 10.172 57.495 1.00 40.66 ? 135 TYR A CE2 1 
ATOM   1063 C CZ  . TYR A 1 135 ? -0.674 8.880  57.062 1.00 41.78 ? 135 TYR A CZ  1 
ATOM   1064 O OH  . TYR A 1 135 ? -1.326 7.833  57.677 1.00 47.67 ? 135 TYR A OH  1 
ATOM   1065 N N   . TRP A 1 136 ? 4.145  14.312 55.178 1.00 26.55 ? 136 TRP A N   1 
ATOM   1066 C CA  . TRP A 1 136 ? 4.906  15.222 54.326 1.00 25.88 ? 136 TRP A CA  1 
ATOM   1067 C C   . TRP A 1 136 ? 6.416  14.954 54.374 1.00 28.93 ? 136 TRP A C   1 
ATOM   1068 O O   . TRP A 1 136 ? 6.951  14.572 55.413 1.00 28.59 ? 136 TRP A O   1 
ATOM   1069 C CB  . TRP A 1 136 ? 4.647  16.682 54.720 1.00 28.24 ? 136 TRP A CB  1 
ATOM   1070 C CG  . TRP A 1 136 ? 3.230  17.179 54.498 1.00 26.74 ? 136 TRP A CG  1 
ATOM   1071 C CD1 . TRP A 1 136 ? 2.120  16.861 55.231 1.00 27.81 ? 136 TRP A CD1 1 
ATOM   1072 C CD2 . TRP A 1 136 ? 2.787  18.090 53.473 1.00 29.31 ? 136 TRP A CD2 1 
ATOM   1073 N NE1 . TRP A 1 136 ? 1.014  17.525 54.729 1.00 30.54 ? 136 TRP A NE1 1 
ATOM   1074 C CE2 . TRP A 1 136 ? 1.396  18.276 53.657 1.00 32.86 ? 136 TRP A CE2 1 
ATOM   1075 C CE3 . TRP A 1 136 ? 3.430  18.753 52.425 1.00 30.42 ? 136 TRP A CE3 1 
ATOM   1076 C CZ2 . TRP A 1 136 ? 0.644  19.114 52.822 1.00 30.78 ? 136 TRP A CZ2 1 
ATOM   1077 C CZ3 . TRP A 1 136 ? 2.682  19.578 51.600 1.00 30.09 ? 136 TRP A CZ3 1 
ATOM   1078 C CH2 . TRP A 1 136 ? 1.302  19.750 51.802 1.00 34.22 ? 136 TRP A CH2 1 
ATOM   1079 N N   . ALA A 1 137 ? 7.095  15.150 53.246 1.00 26.35 ? 137 ALA A N   1 
ATOM   1080 C CA  . ALA A 1 137 ? 8.556  15.180 53.209 1.00 27.48 ? 137 ALA A CA  1 
ATOM   1081 C C   . ALA A 1 137 ? 9.025  16.630 53.243 1.00 24.38 ? 137 ALA A C   1 
ATOM   1082 O O   . ALA A 1 137 ? 8.385  17.509 52.652 1.00 28.18 ? 137 ALA A O   1 
ATOM   1083 C CB  . ALA A 1 137 ? 9.083  14.490 51.950 1.00 22.12 ? 137 ALA A CB  1 
ATOM   1084 N N   . ALA A 1 138 ? 10.138 16.882 53.924 1.00 22.72 ? 138 ALA A N   1 
ATOM   1085 C CA  . ALA A 1 138 ? 10.661 18.239 54.082 1.00 21.49 ? 138 ALA A CA  1 
ATOM   1086 C C   . ALA A 1 138 ? 12.066 18.414 53.501 1.00 26.11 ? 138 ALA A C   1 
ATOM   1087 O O   . ALA A 1 138 ? 12.917 17.521 53.595 1.00 25.10 ? 138 ALA A O   1 
ATOM   1088 C CB  . ALA A 1 138 ? 10.634 18.661 55.576 1.00 22.57 ? 138 ALA A CB  1 
ATOM   1089 N N   . ARG A 1 139 ? 12.305 19.575 52.905 1.00 22.04 ? 139 ARG A N   1 
ATOM   1090 C CA  . ARG A 1 139 ? 13.588 19.898 52.322 1.00 21.92 ? 139 ARG A CA  1 
ATOM   1091 C C   . ARG A 1 139 ? 13.926 21.339 52.655 1.00 27.32 ? 139 ARG A C   1 
ATOM   1092 O O   . ARG A 1 139 ? 13.275 22.264 52.158 1.00 25.19 ? 139 ARG A O   1 
ATOM   1093 C CB  . ARG A 1 139 ? 13.530 19.698 50.787 1.00 26.67 ? 139 ARG A CB  1 
ATOM   1094 C CG  . ARG A 1 139 ? 14.558 20.495 50.008 1.00 25.31 ? 139 ARG A CG  1 
ATOM   1095 C CD  . ARG A 1 139 ? 14.436 20.223 48.505 1.00 24.49 ? 139 ARG A CD  1 
ATOM   1096 N NE  . ARG A 1 139 ? 14.909 18.880 48.156 1.00 26.94 ? 139 ARG A NE  1 
ATOM   1097 C CZ  . ARG A 1 139 ? 14.904 18.382 46.923 1.00 27.13 ? 139 ARG A CZ  1 
ATOM   1098 N NH1 . ARG A 1 139 ? 14.428 19.111 45.914 1.00 22.70 ? 139 ARG A NH1 1 
ATOM   1099 N NH2 . ARG A 1 139 ? 15.366 17.153 46.702 1.00 26.73 ? 139 ARG A NH2 1 
ATOM   1100 N N   . ALA A 1 140 ? 14.932 21.540 53.502 1.00 24.04 ? 140 ALA A N   1 
ATOM   1101 C CA  . ALA A 1 140 ? 15.416 22.889 53.783 1.00 23.53 ? 140 ALA A CA  1 
ATOM   1102 C C   . ALA A 1 140 ? 16.173 23.424 52.575 1.00 25.26 ? 140 ALA A C   1 
ATOM   1103 O O   . ALA A 1 140 ? 16.975 22.712 51.962 1.00 22.82 ? 140 ALA A O   1 
ATOM   1104 C CB  . ALA A 1 140 ? 16.318 22.899 55.010 1.00 22.65 ? 140 ALA A CB  1 
ATOM   1105 N N   . VAL A 1 141 ? 15.932 24.693 52.248 1.00 23.25 ? 141 VAL A N   1 
ATOM   1106 C CA  . VAL A 1 141 ? 16.612 25.350 51.131 1.00 24.59 ? 141 VAL A CA  1 
ATOM   1107 C C   . VAL A 1 141 ? 17.267 26.656 51.574 1.00 26.58 ? 141 VAL A C   1 
ATOM   1108 O O   . VAL A 1 141 ? 16.649 27.464 52.288 1.00 25.77 ? 141 VAL A O   1 
ATOM   1109 C CB  . VAL A 1 141 ? 15.607 25.677 49.993 1.00 27.36 ? 141 VAL A CB  1 
ATOM   1110 C CG1 . VAL A 1 141 ? 16.328 26.314 48.794 1.00 26.31 ? 141 VAL A CG1 1 
ATOM   1111 C CG2 . VAL A 1 141 ? 14.826 24.439 49.573 1.00 23.12 ? 141 VAL A CG2 1 
ATOM   1112 N N   . ASN A 1 142 ? 18.511 26.872 51.148 1.00 23.78 ? 142 ASN A N   1 
ATOM   1113 C CA  . ASN A 1 142 ? 19.246 28.096 51.468 1.00 23.44 ? 142 ASN A CA  1 
ATOM   1114 C C   . ASN A 1 142 ? 19.136 29.099 50.326 1.00 26.88 ? 142 ASN A C   1 
ATOM   1115 O O   . ASN A 1 142 ? 19.714 28.891 49.255 1.00 26.59 ? 142 ASN A O   1 
ATOM   1116 C CB  . ASN A 1 142 ? 20.732 27.796 51.713 1.00 23.97 ? 142 ASN A CB  1 
ATOM   1117 C CG  . ASN A 1 142 ? 21.507 29.012 52.207 1.00 27.30 ? 142 ASN A CG  1 
ATOM   1118 O OD1 . ASN A 1 142 ? 21.064 30.164 52.045 1.00 30.84 ? 142 ASN A OD1 1 
ATOM   1119 N ND2 . ASN A 1 142 ? 22.672 28.771 52.806 1.00 25.39 ? 142 ASN A ND2 1 
ATOM   1120 N N   . ILE A 1 143 ? 18.409 30.192 50.543 1.00 27.38 ? 143 ILE A N   1 
ATOM   1121 C CA  . ILE A 1 143 ? 18.242 31.179 49.467 1.00 26.75 ? 143 ILE A CA  1 
ATOM   1122 C C   . ILE A 1 143 ? 19.127 32.403 49.650 1.00 31.21 ? 143 ILE A C   1 
ATOM   1123 O O   . ILE A 1 143 ? 18.945 33.410 48.962 1.00 32.82 ? 143 ILE A O   1 
ATOM   1124 C CB  . ILE A 1 143 ? 16.777 31.625 49.314 1.00 27.34 ? 143 ILE A CB  1 
ATOM   1125 C CG1 . ILE A 1 143 ? 16.311 32.395 50.556 1.00 29.36 ? 143 ILE A CG1 1 
ATOM   1126 C CG2 . ILE A 1 143 ? 15.872 30.431 49.047 1.00 29.06 ? 143 ILE A CG2 1 
ATOM   1127 C CD1 . ILE A 1 143 ? 14.859 32.875 50.460 1.00 34.78 ? 143 ILE A CD1 1 
ATOM   1128 N N   . GLY A 1 144 ? 20.086 32.324 50.563 1.00 28.42 ? 144 GLY A N   1 
ATOM   1129 C CA  . GLY A 1 144 ? 20.938 33.465 50.862 1.00 31.04 ? 144 GLY A CA  1 
ATOM   1130 C C   . GLY A 1 144 ? 22.414 33.214 50.622 1.00 34.87 ? 144 GLY A C   1 
ATOM   1131 O O   . GLY A 1 144 ? 22.789 32.252 49.955 1.00 37.19 ? 144 GLY A O   1 
ATOM   1132 N N   . ASP A 1 145 ? 23.262 34.070 51.178 1.00 37.26 ? 145 ASP A N   1 
ATOM   1133 C CA  . ASP A 1 145 ? 24.694 33.989 50.910 1.00 41.05 ? 145 ASP A CA  1 
ATOM   1134 C C   . ASP A 1 145 ? 25.496 33.551 52.125 1.00 36.66 ? 145 ASP A C   1 
ATOM   1135 O O   . ASP A 1 145 ? 26.730 33.569 52.107 1.00 38.88 ? 145 ASP A O   1 
ATOM   1136 C CB  . ASP A 1 145 ? 25.220 35.330 50.386 1.00 47.20 ? 145 ASP A CB  1 
ATOM   1137 C CG  . ASP A 1 145 ? 24.578 35.732 49.069 1.00 67.84 ? 145 ASP A CG  1 
ATOM   1138 O OD1 . ASP A 1 145 ? 24.329 34.839 48.227 1.00 73.76 ? 145 ASP A OD1 1 
ATOM   1139 O OD2 . ASP A 1 145 ? 24.318 36.941 48.876 1.00 74.49 ? 145 ASP A OD2 1 
ATOM   1140 N N   . GLU A 1 146 ? 24.794 33.164 53.183 1.00 36.54 ? 146 GLU A N   1 
ATOM   1141 C CA  . GLU A 1 146 ? 25.434 32.619 54.374 1.00 38.07 ? 146 GLU A CA  1 
ATOM   1142 C C   . GLU A 1 146 ? 24.818 31.256 54.677 1.00 32.70 ? 146 GLU A C   1 
ATOM   1143 O O   . GLU A 1 146 ? 23.770 30.903 54.123 1.00 32.22 ? 146 GLU A O   1 
ATOM   1144 C CB  . GLU A 1 146 ? 25.264 33.569 55.580 1.00 40.68 ? 146 GLU A CB  1 
ATOM   1145 C CG  . GLU A 1 146 ? 23.822 33.714 56.078 1.00 53.80 ? 146 GLU A CG  1 
ATOM   1146 C CD  . GLU A 1 146 ? 23.641 34.804 57.145 1.00 68.06 ? 146 GLU A CD  1 
ATOM   1147 O OE1 . GLU A 1 146 ? 24.331 34.756 58.191 1.00 70.50 ? 146 GLU A OE1 1 
ATOM   1148 O OE2 . GLU A 1 146 ? 22.787 35.700 56.939 1.00 62.26 ? 146 GLU A OE2 1 
ATOM   1149 N N   . PRO A 1 147 ? 25.462 30.479 55.554 1.00 31.99 ? 147 PRO A N   1 
ATOM   1150 C CA  . PRO A 1 147 ? 24.854 29.189 55.900 1.00 27.08 ? 147 PRO A CA  1 
ATOM   1151 C C   . PRO A 1 147 ? 23.440 29.389 56.461 1.00 32.86 ? 147 PRO A C   1 
ATOM   1152 O O   . PRO A 1 147 ? 23.205 30.337 57.216 1.00 30.62 ? 147 PRO A O   1 
ATOM   1153 C CB  . PRO A 1 147 ? 25.784 28.649 56.984 1.00 31.67 ? 147 PRO A CB  1 
ATOM   1154 C CG  . PRO A 1 147 ? 27.119 29.339 56.716 1.00 36.17 ? 147 PRO A CG  1 
ATOM   1155 C CD  . PRO A 1 147 ? 26.735 30.713 56.257 1.00 34.94 ? 147 PRO A CD  1 
ATOM   1156 N N   . PHE A 1 148 ? 22.518 28.519 56.068 1.00 27.73 ? 148 PHE A N   1 
ATOM   1157 C CA  . PHE A 1 148 ? 21.160 28.503 56.601 1.00 25.90 ? 148 PHE A CA  1 
ATOM   1158 C C   . PHE A 1 148 ? 21.076 27.310 57.553 1.00 28.65 ? 148 PHE A C   1 
ATOM   1159 O O   . PHE A 1 148 ? 21.312 26.172 57.146 1.00 25.37 ? 148 PHE A O   1 
ATOM   1160 C CB  . PHE A 1 148 ? 20.162 28.362 55.449 1.00 23.93 ? 148 PHE A CB  1 
ATOM   1161 C CG  . PHE A 1 148 ? 18.732 28.146 55.886 1.00 26.46 ? 148 PHE A CG  1 
ATOM   1162 C CD1 . PHE A 1 148 ? 18.107 29.029 56.762 1.00 26.89 ? 148 PHE A CD1 1 
ATOM   1163 C CD2 . PHE A 1 148 ? 18.009 27.075 55.400 1.00 26.98 ? 148 PHE A CD2 1 
ATOM   1164 C CE1 . PHE A 1 148 ? 16.789 28.833 57.154 1.00 27.22 ? 148 PHE A CE1 1 
ATOM   1165 C CE2 . PHE A 1 148 ? 16.683 26.868 55.779 1.00 26.24 ? 148 PHE A CE2 1 
ATOM   1166 C CZ  . PHE A 1 148 ? 16.069 27.756 56.667 1.00 26.67 ? 148 PHE A CZ  1 
ATOM   1167 N N   . ILE A 1 149 ? 20.755 27.573 58.820 1.00 22.41 ? 149 ILE A N   1 
ATOM   1168 C CA  . ILE A 1 149 ? 20.825 26.535 59.847 1.00 23.26 ? 149 ILE A CA  1 
ATOM   1169 C C   . ILE A 1 149 ? 19.469 26.340 60.516 1.00 23.71 ? 149 ILE A C   1 
ATOM   1170 O O   . ILE A 1 149 ? 18.838 27.321 60.933 1.00 24.17 ? 149 ILE A O   1 
ATOM   1171 C CB  . ILE A 1 149 ? 21.859 26.918 60.916 1.00 24.61 ? 149 ILE A CB  1 
ATOM   1172 C CG1 . ILE A 1 149 ? 23.235 27.104 60.249 1.00 29.65 ? 149 ILE A CG1 1 
ATOM   1173 C CG2 . ILE A 1 149 ? 21.903 25.869 62.043 1.00 26.91 ? 149 ILE A CG2 1 
ATOM   1174 C CD1 . ILE A 1 149 ? 24.313 27.626 61.187 1.00 34.07 ? 149 ILE A CD1 1 
ATOM   1175 N N   . MET A 1 150 ? 18.999 25.094 60.581 1.00 21.65 ? 150 MET A N   1 
ATOM   1176 C CA  . MET A 1 150 ? 17.754 24.801 61.281 1.00 22.92 ? 150 MET A CA  1 
ATOM   1177 C C   . MET A 1 150 ? 18.000 23.725 62.324 1.00 25.99 ? 150 MET A C   1 
ATOM   1178 O O   . MET A 1 150 ? 18.848 22.847 62.131 1.00 24.06 ? 150 MET A O   1 
ATOM   1179 C CB  . MET A 1 150 ? 16.648 24.319 60.329 1.00 26.62 ? 150 MET A CB  1 
ATOM   1180 C CG  . MET A 1 150 ? 16.345 25.196 59.107 1.00 30.79 ? 150 MET A CG  1 
ATOM   1181 S SD  . MET A 1 150 ? 14.796 24.698 58.315 1.00 21.62 ? 150 MET A SD  1 
ATOM   1182 C CE  . MET A 1 150 ? 13.654 25.631 59.395 1.00 24.13 ? 150 MET A CE  1 
ATOM   1183 N N   . LEU A 1 151 ? 17.259 23.810 63.426 1.00 21.02 ? 151 LEU A N   1 
ATOM   1184 C CA  . LEU A 1 151 ? 17.184 22.744 64.413 1.00 21.87 ? 151 LEU A CA  1 
ATOM   1185 C C   . LEU A 1 151 ? 15.920 21.948 64.139 1.00 23.65 ? 151 LEU A C   1 
ATOM   1186 O O   . LEU A 1 151 ? 14.822 22.513 64.110 1.00 24.39 ? 151 LEU A O   1 
ATOM   1187 C CB  . LEU A 1 151 ? 17.112 23.325 65.837 1.00 21.45 ? 151 LEU A CB  1 
ATOM   1188 C CG  . LEU A 1 151 ? 16.950 22.264 66.931 1.00 26.35 ? 151 LEU A CG  1 
ATOM   1189 C CD1 . LEU A 1 151 ? 18.192 21.370 66.958 1.00 29.43 ? 151 LEU A CD1 1 
ATOM   1190 C CD2 . LEU A 1 151 ? 16.706 22.914 68.313 1.00 28.98 ? 151 LEU A CD2 1 
ATOM   1191 N N   . VAL A 1 152 ? 16.057 20.643 63.917 1.00 20.02 ? 152 VAL A N   1 
ATOM   1192 C CA  . VAL A 1 152 ? 14.919 19.816 63.525 1.00 19.52 ? 152 VAL A CA  1 
ATOM   1193 C C   . VAL A 1 152 ? 14.685 18.760 64.597 1.00 24.41 ? 152 VAL A C   1 
ATOM   1194 O O   . VAL A 1 152 ? 15.630 18.091 65.023 1.00 22.77 ? 152 VAL A O   1 
ATOM   1195 C CB  . VAL A 1 152 ? 15.168 19.121 62.174 1.00 27.09 ? 152 VAL A CB  1 
ATOM   1196 C CG1 . VAL A 1 152 ? 13.924 18.336 61.734 1.00 27.15 ? 152 VAL A CG1 1 
ATOM   1197 C CG2 . VAL A 1 152 ? 15.560 20.144 61.119 1.00 27.89 ? 152 VAL A CG2 1 
ATOM   1198 N N   . ILE A 1 153 ? 13.433 18.632 65.044 1.00 22.73 ? 153 ILE A N   1 
ATOM   1199 C CA  . ILE A 1 153 ? 13.068 17.652 66.066 1.00 21.59 ? 153 ILE A CA  1 
ATOM   1200 C C   . ILE A 1 153 ? 12.090 16.702 65.413 1.00 22.60 ? 153 ILE A C   1 
ATOM   1201 O O   . ILE A 1 153 ? 11.122 17.122 64.768 1.00 22.03 ? 153 ILE A O   1 
ATOM   1202 C CB  . ILE A 1 153 ? 12.430 18.305 67.346 1.00 21.70 ? 153 ILE A CB  1 
ATOM   1203 C CG1 . ILE A 1 153 ? 13.389 19.305 68.009 1.00 27.33 ? 153 ILE A CG1 1 
ATOM   1204 C CG2 . ILE A 1 153 ? 12.014 17.239 68.359 1.00 23.24 ? 153 ILE A CG2 1 
ATOM   1205 C CD1 . ILE A 1 153 ? 13.451 20.661 67.271 1.00 33.49 ? 153 ILE A CD1 1 
ATOM   1206 N N   . TYR A 1 154 ? 12.336 15.407 65.551 1.00 21.81 ? 154 TYR A N   1 
ATOM   1207 C CA  . TYR A 1 154 ? 11.473 14.432 64.898 1.00 21.78 ? 154 TYR A CA  1 
ATOM   1208 C C   . TYR A 1 154 ? 11.379 13.163 65.735 1.00 24.14 ? 154 TYR A C   1 
ATOM   1209 O O   . TYR A 1 154 ? 12.254 12.896 66.553 1.00 25.34 ? 154 TYR A O   1 
ATOM   1210 C CB  . TYR A 1 154 ? 11.995 14.126 63.486 1.00 24.25 ? 154 TYR A CB  1 
ATOM   1211 C CG  . TYR A 1 154 ? 13.463 13.757 63.433 1.00 23.32 ? 154 TYR A CG  1 
ATOM   1212 C CD1 . TYR A 1 154 ? 14.452 14.719 63.609 1.00 26.75 ? 154 TYR A CD1 1 
ATOM   1213 C CD2 . TYR A 1 154 ? 13.860 12.445 63.185 1.00 27.94 ? 154 TYR A CD2 1 
ATOM   1214 C CE1 . TYR A 1 154 ? 15.806 14.384 63.559 1.00 27.33 ? 154 TYR A CE1 1 
ATOM   1215 C CE2 . TYR A 1 154 ? 15.198 12.103 63.121 1.00 26.50 ? 154 TYR A CE2 1 
ATOM   1216 C CZ  . TYR A 1 154 ? 16.167 13.067 63.308 1.00 31.44 ? 154 TYR A CZ  1 
ATOM   1217 O OH  . TYR A 1 154 ? 17.505 12.699 63.255 1.00 34.13 ? 154 TYR A OH  1 
ATOM   1218 N N   . PRO A 1 155 ? 10.308 12.387 65.551 1.00 23.49 ? 155 PRO A N   1 
ATOM   1219 C CA  . PRO A 1 155 ? 10.133 11.203 66.399 1.00 26.31 ? 155 PRO A CA  1 
ATOM   1220 C C   . PRO A 1 155 ? 11.214 10.153 66.160 1.00 24.39 ? 155 PRO A C   1 
ATOM   1221 O O   . PRO A 1 155 ? 11.655 9.948  65.013 1.00 25.67 ? 155 PRO A O   1 
ATOM   1222 C CB  . PRO A 1 155 ? 8.763  10.664 65.977 1.00 26.35 ? 155 PRO A CB  1 
ATOM   1223 C CG  . PRO A 1 155 ? 8.045  11.859 65.412 1.00 26.71 ? 155 PRO A CG  1 
ATOM   1224 C CD  . PRO A 1 155 ? 9.124  12.647 64.713 1.00 26.19 ? 155 PRO A CD  1 
ATOM   1225 N N   . ALA A 1 156 ? 11.648 9.508  67.239 1.00 23.88 ? 156 ALA A N   1 
ATOM   1226 C CA  . ALA A 1 156 ? 12.759 8.570  67.158 1.00 24.86 ? 156 ALA A CA  1 
ATOM   1227 C C   . ALA A 1 156 ? 12.420 7.362  66.293 1.00 27.58 ? 156 ALA A C   1 
ATOM   1228 O O   . ALA A 1 156 ? 13.323 6.687  65.778 1.00 29.84 ? 156 ALA A O   1 
ATOM   1229 C CB  . ALA A 1 156 ? 13.194 8.138  68.551 1.00 22.99 ? 156 ALA A CB  1 
ATOM   1230 N N   . ASP A 1 157 ? 11.133 7.084  66.118 1.00 26.10 ? 157 ASP A N   1 
ATOM   1231 C CA  . ASP A 1 157 ? 10.740 5.945  65.288 1.00 34.00 ? 157 ASP A CA  1 
ATOM   1232 C C   . ASP A 1 157 ? 10.280 6.311  63.863 1.00 32.19 ? 157 ASP A C   1 
ATOM   1233 O O   . ASP A 1 157 ? 9.731  5.470  63.142 1.00 29.97 ? 157 ASP A O   1 
ATOM   1234 C CB  . ASP A 1 157 ? 9.692  5.086  66.012 1.00 31.74 ? 157 ASP A CB  1 
ATOM   1235 C CG  . ASP A 1 157 ? 8.332  5.751  66.082 1.00 35.74 ? 157 ASP A CG  1 
ATOM   1236 O OD1 . ASP A 1 157 ? 8.230  6.955  65.750 1.00 33.53 ? 157 ASP A OD1 1 
ATOM   1237 O OD2 . ASP A 1 157 ? 7.361  5.061  66.477 1.00 35.52 ? 157 ASP A OD2 1 
ATOM   1238 N N   . ALA A 1 158 ? 10.502 7.558  63.455 1.00 25.88 ? 158 ALA A N   1 
ATOM   1239 C CA  . ALA A 1 158 ? 10.025 8.012  62.151 1.00 25.05 ? 158 ALA A CA  1 
ATOM   1240 C C   . ALA A 1 158 ? 10.738 7.274  61.016 1.00 31.21 ? 158 ALA A C   1 
ATOM   1241 O O   . ALA A 1 158 ? 10.113 6.894  60.023 1.00 30.17 ? 158 ALA A O   1 
ATOM   1242 C CB  . ALA A 1 158 ? 10.218 9.512  62.001 1.00 28.11 ? 158 ALA A CB  1 
ATOM   1243 N N   . GLY A 1 159 ? 12.046 7.092  61.169 1.00 26.49 ? 159 GLY A N   1 
ATOM   1244 C CA  . GLY A 1 159 ? 12.852 6.467  60.130 1.00 27.80 ? 159 GLY A CA  1 
ATOM   1245 C C   . GLY A 1 159 ? 13.057 7.379  58.932 1.00 25.70 ? 159 GLY A C   1 
ATOM   1246 O O   . GLY A 1 159 ? 12.637 8.539  58.932 1.00 25.91 ? 159 GLY A O   1 
ATOM   1247 N N   . HIS A 1 160 ? 13.725 6.862  57.900 1.00 28.03 ? 160 HIS A N   1 
ATOM   1248 C CA  . HIS A 1 160 ? 14.014 7.656  56.705 1.00 25.97 ? 160 HIS A CA  1 
ATOM   1249 C C   . HIS A 1 160 ? 13.679 6.869  55.463 1.00 27.30 ? 160 HIS A C   1 
ATOM   1250 O O   . HIS A 1 160 ? 13.944 5.669  55.402 1.00 32.57 ? 160 HIS A O   1 
ATOM   1251 C CB  . HIS A 1 160 ? 15.497 8.029  56.621 1.00 30.86 ? 160 HIS A CB  1 
ATOM   1252 C CG  . HIS A 1 160 ? 15.941 9.014  57.644 1.00 31.96 ? 160 HIS A CG  1 
ATOM   1253 N ND1 . HIS A 1 160 ? 16.222 8.666  58.946 1.00 32.75 ? 160 HIS A ND1 1 
ATOM   1254 C CD2 . HIS A 1 160 ? 16.189 10.351 57.554 1.00 30.93 ? 160 HIS A CD2 1 
ATOM   1255 C CE1 . HIS A 1 160 ? 16.609 9.737  59.620 1.00 29.83 ? 160 HIS A CE1 1 
ATOM   1256 N NE2 . HIS A 1 160 ? 16.600 10.767 58.792 1.00 32.74 ? 160 HIS A NE2 1 
ATOM   1257 N N   . ASP A 1 161 ? 13.093 7.550  54.483 1.00 30.17 ? 161 ASP A N   1 
ATOM   1258 C CA  . ASP A 1 161 ? 12.870 7.001  53.150 1.00 32.28 ? 161 ASP A CA  1 
ATOM   1259 C C   . ASP A 1 161 ? 13.385 8.016  52.139 1.00 25.84 ? 161 ASP A C   1 
ATOM   1260 O O   . ASP A 1 161 ? 12.664 8.928  51.741 1.00 27.52 ? 161 ASP A O   1 
ATOM   1261 C CB  . ASP A 1 161 ? 11.379 6.713  52.922 1.00 45.36 ? 161 ASP A CB  1 
ATOM   1262 C CG  . ASP A 1 161 ? 11.004 6.647  51.440 1.00 57.66 ? 161 ASP A CG  1 
ATOM   1263 O OD1 . ASP A 1 161 ? 11.874 6.307  50.607 1.00 51.54 ? 161 ASP A OD1 1 
ATOM   1264 O OD2 . ASP A 1 161 ? 9.834  6.944  51.108 1.00 58.26 ? 161 ASP A OD2 1 
ATOM   1265 N N   . TYR A 1 162 ? 14.647 7.875  51.745 1.00 30.03 ? 162 TYR A N   1 
ATOM   1266 C CA  . TYR A 1 162 ? 15.241 8.781  50.753 1.00 27.03 ? 162 TYR A CA  1 
ATOM   1267 C C   . TYR A 1 162 ? 14.914 8.416  49.308 1.00 31.78 ? 162 TYR A C   1 
ATOM   1268 O O   . TYR A 1 162 ? 14.984 9.271  48.418 1.00 29.39 ? 162 TYR A O   1 
ATOM   1269 C CB  . TYR A 1 162 ? 16.761 8.814  50.890 1.00 25.07 ? 162 TYR A CB  1 
ATOM   1270 C CG  . TYR A 1 162 ? 17.292 9.509  52.108 1.00 25.45 ? 162 TYR A CG  1 
ATOM   1271 C CD1 . TYR A 1 162 ? 17.515 8.810  53.287 1.00 29.08 ? 162 TYR A CD1 1 
ATOM   1272 C CD2 . TYR A 1 162 ? 17.601 10.863 52.077 1.00 28.83 ? 162 TYR A CD2 1 
ATOM   1273 C CE1 . TYR A 1 162 ? 18.012 9.439  54.409 1.00 28.85 ? 162 TYR A CE1 1 
ATOM   1274 C CE2 . TYR A 1 162 ? 18.104 11.503 53.193 1.00 30.68 ? 162 TYR A CE2 1 
ATOM   1275 C CZ  . TYR A 1 162 ? 18.306 10.790 54.355 1.00 29.86 ? 162 TYR A CZ  1 
ATOM   1276 O OH  . TYR A 1 162 ? 18.813 11.424 55.462 1.00 36.68 ? 162 TYR A OH  1 
ATOM   1277 N N   . GLY A 1 163 ? 14.560 7.154  49.070 1.00 32.58 ? 163 GLY A N   1 
ATOM   1278 C CA  . GLY A 1 163 ? 14.449 6.631  47.714 1.00 35.61 ? 163 GLY A CA  1 
ATOM   1279 C C   . GLY A 1 163 ? 13.412 7.282  46.810 1.00 38.63 ? 163 GLY A C   1 
ATOM   1280 O O   . GLY A 1 163 ? 13.683 7.565  45.639 1.00 33.35 ? 163 GLY A O   1 
ATOM   1281 N N   . THR A 1 164 ? 12.218 7.506  47.351 1.00 35.73 ? 164 THR A N   1 
ATOM   1282 C CA  . THR A 1 164 ? 11.154 8.162  46.602 1.00 40.54 ? 164 THR A CA  1 
ATOM   1283 C C   . THR A 1 164 ? 11.627 9.509  46.045 1.00 37.96 ? 164 THR A C   1 
ATOM   1284 O O   . THR A 1 164 ? 11.442 9.807  44.867 1.00 39.86 ? 164 THR A O   1 
ATOM   1285 C CB  . THR A 1 164 ? 9.913  8.404  47.498 1.00 49.13 ? 164 THR A CB  1 
ATOM   1286 O OG1 . THR A 1 164 ? 9.524  7.179  48.140 1.00 59.31 ? 164 THR A OG1 1 
ATOM   1287 C CG2 . THR A 1 164 ? 8.763  8.938  46.678 1.00 50.44 ? 164 THR A CG2 1 
ATOM   1288 N N   . ILE A 1 165 ? 12.229 10.325 46.905 1.00 33.92 ? 165 ILE A N   1 
ATOM   1289 C CA  . ILE A 1 165 ? 12.712 11.648 46.509 1.00 31.71 ? 165 ILE A CA  1 
ATOM   1290 C C   . ILE A 1 165 ? 13.906 11.536 45.557 1.00 29.06 ? 165 ILE A C   1 
ATOM   1291 O O   . ILE A 1 165 ? 14.053 12.329 44.625 1.00 32.69 ? 165 ILE A O   1 
ATOM   1292 C CB  . ILE A 1 165 ? 13.134 12.482 47.751 1.00 30.02 ? 165 ILE A CB  1 
ATOM   1293 C CG1 . ILE A 1 165 ? 11.954 12.676 48.715 1.00 42.96 ? 165 ILE A CG1 1 
ATOM   1294 C CG2 . ILE A 1 165 ? 13.743 13.815 47.326 1.00 29.42 ? 165 ILE A CG2 1 
ATOM   1295 C CD1 . ILE A 1 165 ? 10.767 13.376 48.097 1.00 44.23 ? 165 ILE A CD1 1 
ATOM   1296 N N   . ALA A 1 166 ? 14.764 10.548 45.797 1.00 28.58 ? 166 ALA A N   1 
ATOM   1297 C CA  . ALA A 1 166 ? 15.926 10.328 44.934 1.00 29.09 ? 166 ALA A CA  1 
ATOM   1298 C C   . ALA A 1 166 ? 15.500 10.119 43.480 1.00 34.65 ? 166 ALA A C   1 
ATOM   1299 O O   . ALA A 1 166 ? 16.177 10.568 42.553 1.00 34.93 ? 166 ALA A O   1 
ATOM   1300 C CB  . ALA A 1 166 ? 16.749 9.139  45.430 1.00 30.92 ? 166 ALA A CB  1 
ATOM   1301 N N   . GLU A 1 167 ? 14.374 9.448  43.279 1.00 31.39 ? 167 GLU A N   1 
ATOM   1302 C CA  . GLU A 1 167 ? 13.937 9.146  41.924 1.00 35.52 ? 167 GLU A CA  1 
ATOM   1303 C C   . GLU A 1 167 ? 13.032 10.216 41.305 1.00 41.65 ? 167 GLU A C   1 
ATOM   1304 O O   . GLU A 1 167 ? 13.139 10.497 40.115 1.00 42.20 ? 167 GLU A O   1 
ATOM   1305 C CB  . GLU A 1 167 ? 13.269 7.769  41.851 1.00 47.60 ? 167 GLU A CB  1 
ATOM   1306 C CG  . GLU A 1 167 ? 12.004 7.627  42.667 1.00 63.65 ? 167 GLU A CG  1 
ATOM   1307 C CD  . GLU A 1 167 ? 11.346 6.272  42.470 1.00 77.05 ? 167 GLU A CD  1 
ATOM   1308 O OE1 . GLU A 1 167 ? 11.207 5.518  43.460 1.00 71.89 ? 167 GLU A OE1 1 
ATOM   1309 O OE2 . GLU A 1 167 ? 10.967 5.962  41.317 1.00 85.20 ? 167 GLU A OE2 1 
ATOM   1310 N N   . LYS A 1 168 ? 12.163 10.822 42.110 1.00 38.78 ? 168 LYS A N   1 
ATOM   1311 C CA  . LYS A 1 168 ? 11.172 11.767 41.584 1.00 42.87 ? 168 LYS A CA  1 
ATOM   1312 C C   . LYS A 1 168 ? 11.443 13.241 41.904 1.00 40.40 ? 168 LYS A C   1 
ATOM   1313 O O   . LYS A 1 168 ? 10.959 14.125 41.197 1.00 38.49 ? 168 LYS A O   1 
ATOM   1314 C CB  . LYS A 1 168 ? 9.763  11.379 42.048 1.00 51.99 ? 168 LYS A CB  1 
ATOM   1315 C CG  . LYS A 1 168 ? 9.139  10.245 41.236 1.00 65.35 ? 168 LYS A CG  1 
ATOM   1316 C CD  . LYS A 1 168 ? 7.750  9.865  41.743 1.00 73.78 ? 168 LYS A CD  1 
ATOM   1317 C CE  . LYS A 1 168 ? 7.825  9.084  43.043 1.00 74.70 ? 168 LYS A CE  1 
ATOM   1318 N NZ  . LYS A 1 168 ? 6.544  8.383  43.341 1.00 75.59 ? 168 LYS A NZ  1 
ATOM   1319 N N   . GLY A 1 169 ? 12.205 13.508 42.963 1.00 32.71 ? 169 GLY A N   1 
ATOM   1320 C CA  . GLY A 1 169 ? 12.473 14.876 43.377 1.00 31.16 ? 169 GLY A CA  1 
ATOM   1321 C C   . GLY A 1 169 ? 11.216 15.531 43.940 1.00 31.90 ? 169 GLY A C   1 
ATOM   1322 O O   . GLY A 1 169 ? 10.259 14.845 44.290 1.00 32.38 ? 169 GLY A O   1 
ATOM   1323 N N   . PHE A 1 170 ? 11.217 16.857 44.029 1.00 30.10 ? 170 PHE A N   1 
ATOM   1324 C CA  . PHE A 1 170 ? 10.028 17.592 44.458 1.00 27.94 ? 170 PHE A CA  1 
ATOM   1325 C C   . PHE A 1 170 ? 9.345  18.216 43.242 1.00 32.54 ? 170 PHE A C   1 
ATOM   1326 O O   . PHE A 1 170 ? 10.006 18.539 42.253 1.00 33.78 ? 170 PHE A O   1 
ATOM   1327 C CB  . PHE A 1 170 ? 10.410 18.682 45.456 1.00 26.26 ? 170 PHE A CB  1 
ATOM   1328 C CG  . PHE A 1 170 ? 10.605 18.188 46.868 1.00 29.15 ? 170 PHE A CG  1 
ATOM   1329 C CD1 . PHE A 1 170 ? 11.650 17.324 47.189 1.00 26.40 ? 170 PHE A CD1 1 
ATOM   1330 C CD2 . PHE A 1 170 ? 9.751  18.612 47.887 1.00 30.65 ? 170 PHE A CD2 1 
ATOM   1331 C CE1 . PHE A 1 170 ? 11.837 16.877 48.499 1.00 26.38 ? 170 PHE A CE1 1 
ATOM   1332 C CE2 . PHE A 1 170 ? 9.933  18.179 49.207 1.00 29.53 ? 170 PHE A CE2 1 
ATOM   1333 C CZ  . PHE A 1 170 ? 10.975 17.309 49.516 1.00 30.59 ? 170 PHE A CZ  1 
ATOM   1334 N N   . SER A 1 171 ? 8.027  18.399 43.331 1.00 31.87 ? 171 SER A N   1 
ATOM   1335 C CA  . SER A 1 171 ? 7.224  18.868 42.204 1.00 33.83 ? 171 SER A CA  1 
ATOM   1336 C C   . SER A 1 171 ? 7.428  20.353 41.954 1.00 37.60 ? 171 SER A C   1 
ATOM   1337 O O   . SER A 1 171 ? 6.979  20.895 40.938 1.00 35.42 ? 171 SER A O   1 
ATOM   1338 C CB  . SER A 1 171 ? 5.746  18.591 42.460 1.00 32.30 ? 171 SER A CB  1 
ATOM   1339 O OG  . SER A 1 171 ? 5.293  19.300 43.603 1.00 33.86 ? 171 SER A OG  1 
ATOM   1340 N N   . LYS A 1 172 ? 8.090  21.016 42.896 1.00 32.30 ? 172 LYS A N   1 
ATOM   1341 C CA  . LYS A 1 172 ? 8.432  22.418 42.737 1.00 30.78 ? 172 LYS A CA  1 
ATOM   1342 C C   . LYS A 1 172 ? 9.903  22.576 42.999 1.00 32.19 ? 172 LYS A C   1 
ATOM   1343 O O   . LYS A 1 172 ? 10.493 21.780 43.739 1.00 31.06 ? 172 LYS A O   1 
ATOM   1344 C CB  . LYS A 1 172 ? 7.624  23.295 43.709 1.00 33.63 ? 172 LYS A CB  1 
ATOM   1345 C CG  . LYS A 1 172 ? 6.137  23.324 43.391 1.00 43.43 ? 172 LYS A CG  1 
ATOM   1346 C CD  . LYS A 1 172 ? 5.392  24.304 44.272 1.00 61.00 ? 172 LYS A CD  1 
ATOM   1347 C CE  . LYS A 1 172 ? 3.973  24.523 43.762 1.00 65.36 ? 172 LYS A CE  1 
ATOM   1348 N NZ  . LYS A 1 172 ? 3.969  25.084 42.378 1.00 65.91 ? 172 LYS A NZ  1 
ATOM   1349 N N   . ILE A 1 173 ? 10.497 23.603 42.400 1.00 26.93 ? 173 ILE A N   1 
ATOM   1350 C CA  . ILE A 1 173 ? 11.893 23.934 42.633 1.00 27.48 ? 173 ILE A CA  1 
ATOM   1351 C C   . ILE A 1 173 ? 12.017 25.387 43.048 1.00 28.65 ? 173 ILE A C   1 
ATOM   1352 O O   . ILE A 1 173 ? 11.125 26.205 42.769 1.00 28.80 ? 173 ILE A O   1 
ATOM   1353 C CB  . ILE A 1 173 ? 12.774 23.660 41.386 1.00 26.88 ? 173 ILE A CB  1 
ATOM   1354 C CG1 . ILE A 1 173 ? 12.257 24.451 40.176 1.00 30.62 ? 173 ILE A CG1 1 
ATOM   1355 C CG2 . ILE A 1 173 ? 12.781 22.182 41.077 1.00 32.23 ? 173 ILE A CG2 1 
ATOM   1356 C CD1 . ILE A 1 173 ? 13.115 24.281 38.925 1.00 34.73 ? 173 ILE A CD1 1 
ATOM   1357 N N   . VAL A 1 174 ? 13.111 25.700 43.732 1.00 27.49 ? 174 VAL A N   1 
ATOM   1358 C CA  . VAL A 1 174 ? 13.349 27.041 44.251 1.00 24.93 ? 174 VAL A CA  1 
ATOM   1359 C C   . VAL A 1 174 ? 14.573 27.625 43.567 1.00 30.88 ? 174 VAL A C   1 
ATOM   1360 O O   . VAL A 1 174 ? 15.717 27.160 43.755 1.00 26.09 ? 174 VAL A O   1 
ATOM   1361 C CB  . VAL A 1 174 ? 13.543 27.055 45.791 1.00 24.70 ? 174 VAL A CB  1 
ATOM   1362 C CG1 . VAL A 1 174 ? 13.585 28.498 46.307 1.00 25.24 ? 174 VAL A CG1 1 
ATOM   1363 C CG2 . VAL A 1 174 ? 12.426 26.283 46.472 1.00 25.98 ? 174 VAL A CG2 1 
ATOM   1364 N N   . ILE A 1 175 ? 14.330 28.650 42.756 1.00 26.35 ? 175 ILE A N   1 
ATOM   1365 C CA  . ILE A 1 175 ? 15.369 29.177 41.897 1.00 28.06 ? 175 ILE A CA  1 
ATOM   1366 C C   . ILE A 1 175 ? 15.499 30.688 42.050 1.00 27.66 ? 175 ILE A C   1 
ATOM   1367 O O   . ILE A 1 175 ? 14.663 31.331 42.691 1.00 29.61 ? 175 ILE A O   1 
ATOM   1368 C CB  . ILE A 1 175 ? 15.066 28.858 40.411 1.00 29.05 ? 175 ILE A CB  1 
ATOM   1369 C CG1 . ILE A 1 175 ? 13.765 29.528 39.962 1.00 34.44 ? 175 ILE A CG1 1 
ATOM   1370 C CG2 . ILE A 1 175 ? 14.967 27.355 40.177 1.00 32.63 ? 175 ILE A CG2 1 
ATOM   1371 C CD1 . ILE A 1 175 ? 13.429 29.305 38.474 1.00 39.57 ? 175 ILE A CD1 1 
ATOM   1372 N N   . GLU A 1 176 ? 16.548 31.253 41.466 1.00 30.55 ? 176 GLU A N   1 
ATOM   1373 C CA  . GLU A 1 176 ? 16.669 32.699 41.380 1.00 32.23 ? 176 GLU A CA  1 
ATOM   1374 C C   . GLU A 1 176 ? 16.958 33.102 39.943 1.00 32.97 ? 176 GLU A C   1 
ATOM   1375 O O   . GLU A 1 176 ? 17.831 32.527 39.291 1.00 32.82 ? 176 GLU A O   1 
ATOM   1376 C CB  . GLU A 1 176 ? 17.765 33.220 42.308 1.00 36.28 ? 176 GLU A CB  1 
ATOM   1377 C CG  . GLU A 1 176 ? 17.900 34.734 42.315 1.00 45.03 ? 176 GLU A CG  1 
ATOM   1378 C CD  . GLU A 1 176 ? 19.090 35.207 43.129 1.00 62.87 ? 176 GLU A CD  1 
ATOM   1379 O OE1 . GLU A 1 176 ? 18.883 35.728 44.245 1.00 68.36 ? 176 GLU A OE1 1 
ATOM   1380 O OE2 . GLU A 1 176 ? 20.234 35.056 42.652 1.00 72.51 ? 176 GLU A OE2 1 
ATOM   1381 N N   . GLU A 1 177 ? 16.202 34.079 39.445 1.00 30.66 ? 177 GLU A N   1 
ATOM   1382 C CA  . GLU A 1 177 ? 16.407 34.611 38.100 1.00 34.22 ? 177 GLU A CA  1 
ATOM   1383 C C   . GLU A 1 177 ? 16.371 36.133 38.181 1.00 32.55 ? 177 GLU A C   1 
ATOM   1384 O O   . GLU A 1 177 ? 15.371 36.706 38.623 1.00 31.77 ? 177 GLU A O   1 
ATOM   1385 C CB  . GLU A 1 177 ? 15.320 34.109 37.142 1.00 41.99 ? 177 GLU A CB  1 
ATOM   1386 C CG  . GLU A 1 177 ? 15.450 32.650 36.737 1.00 62.99 ? 177 GLU A CG  1 
ATOM   1387 C CD  . GLU A 1 177 ? 14.445 32.249 35.671 1.00 73.17 ? 177 GLU A CD  1 
ATOM   1388 O OE1 . GLU A 1 177 ? 14.592 31.148 35.090 1.00 73.04 ? 177 GLU A OE1 1 
ATOM   1389 O OE2 . GLU A 1 177 ? 13.507 33.034 35.418 1.00 76.40 ? 177 GLU A OE2 1 
ATOM   1390 N N   . ASN A 1 178 ? 17.469 36.775 37.799 1.00 31.83 ? 178 ASN A N   1 
ATOM   1391 C CA  . ASN A 1 178 ? 17.542 38.232 37.802 1.00 34.79 ? 178 ASN A CA  1 
ATOM   1392 C C   . ASN A 1 178 ? 17.197 38.851 39.159 1.00 38.97 ? 178 ASN A C   1 
ATOM   1393 O O   . ASN A 1 178 ? 16.508 39.875 39.242 1.00 33.76 ? 178 ASN A O   1 
ATOM   1394 C CB  . ASN A 1 178 ? 16.644 38.792 36.696 1.00 35.03 ? 178 ASN A CB  1 
ATOM   1395 C CG  . ASN A 1 178 ? 17.161 38.452 35.309 1.00 40.46 ? 178 ASN A CG  1 
ATOM   1396 O OD1 . ASN A 1 178 ? 18.349 38.607 35.031 1.00 42.15 ? 178 ASN A OD1 1 
ATOM   1397 N ND2 . ASN A 1 178 ? 16.274 37.976 34.438 1.00 41.14 ? 178 ASN A ND2 1 
ATOM   1398 N N   . GLY A 1 179 ? 17.673 38.209 40.224 1.00 37.61 ? 179 GLY A N   1 
ATOM   1399 C CA  . GLY A 1 179 ? 17.430 38.679 41.575 1.00 36.00 ? 179 GLY A CA  1 
ATOM   1400 C C   . GLY A 1 179 ? 16.066 38.318 42.129 1.00 31.67 ? 179 GLY A C   1 
ATOM   1401 O O   . GLY A 1 179 ? 15.753 38.668 43.268 1.00 33.99 ? 179 GLY A O   1 
ATOM   1402 N N   . GLU A 1 180 ? 15.245 37.638 41.338 1.00 32.24 ? 180 GLU A N   1 
ATOM   1403 C CA  . GLU A 1 180 ? 13.934 37.193 41.810 1.00 28.11 ? 180 GLU A CA  1 
ATOM   1404 C C   . GLU A 1 180 ? 13.961 35.737 42.298 1.00 27.64 ? 180 GLU A C   1 
ATOM   1405 O O   . GLU A 1 180 ? 14.128 34.810 41.499 1.00 31.48 ? 180 GLU A O   1 
ATOM   1406 C CB  . GLU A 1 180 ? 12.871 37.327 40.708 1.00 33.37 ? 180 GLU A CB  1 
ATOM   1407 C CG  . GLU A 1 180 ? 11.438 37.097 41.223 1.00 34.52 ? 180 GLU A CG  1 
ATOM   1408 C CD  . GLU A 1 180 ? 10.378 37.038 40.120 1.00 32.10 ? 180 GLU A CD  1 
ATOM   1409 O OE1 . GLU A 1 180 ? 10.739 37.046 38.923 1.00 30.49 ? 180 GLU A OE1 1 
ATOM   1410 O OE2 . GLU A 1 180 ? 9.169  36.942 40.446 1.00 32.29 ? 180 GLU A OE2 1 
ATOM   1411 N N   . VAL A 1 181 ? 13.785 35.537 43.601 1.00 27.84 ? 181 VAL A N   1 
ATOM   1412 C CA  . VAL A 1 181 ? 13.605 34.193 44.144 1.00 29.95 ? 181 VAL A CA  1 
ATOM   1413 C C   . VAL A 1 181 ? 12.214 33.672 43.783 1.00 31.18 ? 181 VAL A C   1 
ATOM   1414 O O   . VAL A 1 181 ? 11.209 34.322 44.061 1.00 31.49 ? 181 VAL A O   1 
ATOM   1415 C CB  . VAL A 1 181 ? 13.797 34.179 45.672 1.00 31.59 ? 181 VAL A CB  1 
ATOM   1416 C CG1 . VAL A 1 181 ? 13.509 32.785 46.237 1.00 32.13 ? 181 VAL A CG1 1 
ATOM   1417 C CG2 . VAL A 1 181 ? 15.210 34.622 46.017 1.00 33.71 ? 181 VAL A CG2 1 
ATOM   1418 N N   . LYS A 1 182 ? 12.151 32.509 43.144 1.00 26.84 ? 182 LYS A N   1 
ATOM   1419 C CA  . LYS A 1 182 ? 10.881 31.975 42.677 1.00 33.68 ? 182 LYS A CA  1 
ATOM   1420 C C   . LYS A 1 182 ? 10.713 30.515 43.079 1.00 33.77 ? 182 LYS A C   1 
ATOM   1421 O O   . LYS A 1 182 ? 11.676 29.748 43.065 1.00 31.02 ? 182 LYS A O   1 
ATOM   1422 C CB  . LYS A 1 182 ? 10.781 32.065 41.140 1.00 35.04 ? 182 LYS A CB  1 
ATOM   1423 C CG  . LYS A 1 182 ? 11.111 33.435 40.558 1.00 39.87 ? 182 LYS A CG  1 
ATOM   1424 C CD  . LYS A 1 182 ? 11.214 33.407 39.021 1.00 34.69 ? 182 LYS A CD  1 
ATOM   1425 C CE  . LYS A 1 182 ? 9.866  33.158 38.368 1.00 47.71 ? 182 LYS A CE  1 
ATOM   1426 N NZ  . LYS A 1 182 ? 8.908  34.293 38.571 1.00 49.83 ? 182 LYS A NZ  1 
ATOM   1427 N N   . VAL A 1 183 ? 9.484  30.143 43.412 1.00 28.87 ? 183 VAL A N   1 
ATOM   1428 C CA  . VAL A 1 183 ? 9.130  28.751 43.607 1.00 32.37 ? 183 VAL A CA  1 
ATOM   1429 C C   . VAL A 1 183 ? 8.278  28.357 42.422 1.00 32.05 ? 183 VAL A C   1 
ATOM   1430 O O   . VAL A 1 183 ? 7.139  28.813 42.295 1.00 35.99 ? 183 VAL A O   1 
ATOM   1431 C CB  . VAL A 1 183 ? 8.337  28.552 44.921 1.00 32.36 ? 183 VAL A CB  1 
ATOM   1432 C CG1 . VAL A 1 183 ? 7.870  27.088 45.066 1.00 33.55 ? 183 VAL A CG1 1 
ATOM   1433 C CG2 . VAL A 1 183 ? 9.188  28.972 46.101 1.00 28.66 ? 183 VAL A CG2 1 
ATOM   1434 N N   . VAL A 1 184 ? 8.827  27.527 41.541 1.00 27.97 ? 184 VAL A N   1 
ATOM   1435 C CA  . VAL A 1 184 ? 8.122  27.186 40.312 1.00 32.52 ? 184 VAL A CA  1 
ATOM   1436 C C   . VAL A 1 184 ? 7.972  25.681 40.117 1.00 32.93 ? 184 VAL A C   1 
ATOM   1437 O O   . VAL A 1 184 ? 8.576  24.887 40.840 1.00 31.68 ? 184 VAL A O   1 
ATOM   1438 C CB  . VAL A 1 184 ? 8.815  27.813 39.089 1.00 35.21 ? 184 VAL A CB  1 
ATOM   1439 C CG1 . VAL A 1 184 ? 8.816  29.333 39.208 1.00 38.66 ? 184 VAL A CG1 1 
ATOM   1440 C CG2 . VAL A 1 184 ? 10.252 27.285 38.949 1.00 38.56 ? 184 VAL A CG2 1 
ATOM   1441 N N   . ASP A 1 185 ? 7.151  25.295 39.147 1.00 35.51 ? 185 ASP A N   1 
ATOM   1442 C CA  . ASP A 1 185 ? 6.978  23.887 38.817 1.00 38.76 ? 185 ASP A CA  1 
ATOM   1443 C C   . ASP A 1 185 ? 8.308  23.277 38.398 1.00 36.61 ? 185 ASP A C   1 
ATOM   1444 O O   . ASP A 1 185 ? 9.082  23.898 37.684 1.00 34.83 ? 185 ASP A O   1 
ATOM   1445 C CB  . ASP A 1 185 ? 5.950  23.708 37.698 1.00 40.06 ? 185 ASP A CB  1 
ATOM   1446 C CG  . ASP A 1 185 ? 4.551  24.113 38.124 1.00 49.82 ? 185 ASP A CG  1 
ATOM   1447 O OD1 . ASP A 1 185 ? 4.261  24.062 39.336 1.00 45.65 ? 185 ASP A OD1 1 
ATOM   1448 O OD2 . ASP A 1 185 ? 3.741  24.486 37.248 1.00 62.33 ? 185 ASP A OD2 1 
ATOM   1449 N N   . ASN A 1 186 ? 8.585  22.068 38.877 1.00 32.03 ? 186 ASN A N   1 
ATOM   1450 C CA  . ASN A 1 186 ? 9.764  21.342 38.428 1.00 34.38 ? 186 ASN A CA  1 
ATOM   1451 C C   . ASN A 1 186 ? 9.502  20.844 36.999 1.00 38.03 ? 186 ASN A C   1 
ATOM   1452 O O   . ASN A 1 186 ? 8.560  20.089 36.773 1.00 37.39 ? 186 ASN A O   1 
ATOM   1453 C CB  . ASN A 1 186 ? 10.053 20.173 39.379 1.00 33.03 ? 186 ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 186 ? 11.337 19.431 39.030 1.00 35.30 ? 186 ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 186 ? 11.851 19.544 37.914 1.00 36.71 ? 186 ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 186 ? 11.853 18.658 39.986 1.00 31.98 ? 186 ASN A ND2 1 
ATOM   1457 N N   . PRO A 1 187 ? 10.312 21.299 36.030 1.00 38.25 ? 187 PRO A N   1 
ATOM   1458 C CA  . PRO A 1 187 ? 10.114 20.947 34.615 1.00 47.20 ? 187 PRO A CA  1 
ATOM   1459 C C   . PRO A 1 187 ? 10.028 19.441 34.418 1.00 52.98 ? 187 PRO A C   1 
ATOM   1460 O O   . PRO A 1 187 ? 9.278  18.971 33.560 1.00 54.35 ? 187 PRO A O   1 
ATOM   1461 C CB  . PRO A 1 187 ? 11.385 21.465 33.940 1.00 45.34 ? 187 PRO A CB  1 
ATOM   1462 C CG  . PRO A 1 187 ? 11.864 22.559 34.812 1.00 52.13 ? 187 PRO A CG  1 
ATOM   1463 C CD  . PRO A 1 187 ? 11.465 22.196 36.224 1.00 44.70 ? 187 PRO A CD  1 
ATOM   1464 N N   . ARG A 1 188 ? 10.791 18.701 35.220 1.00 47.34 ? 188 ARG A N   1 
ATOM   1465 C CA  . ARG A 1 188 ? 10.913 17.257 35.067 1.00 56.22 ? 188 ARG A CA  1 
ATOM   1466 C C   . ARG A 1 188 ? 9.727  16.485 35.647 1.00 64.44 ? 188 ARG A C   1 
ATOM   1467 O O   . ARG A 1 188 ? 9.816  15.276 35.858 1.00 64.99 ? 188 ARG A O   1 
ATOM   1468 C CB  . ARG A 1 188 ? 12.220 16.771 35.681 1.00 50.76 ? 188 ARG A CB  1 
ATOM   1469 N N   . TRP A 1 189 ? 8.626  17.187 35.911 1.00 62.68 ? 189 TRP A N   1 
ATOM   1470 C CA  . TRP A 1 189 ? 7.374  16.551 36.326 1.00 61.41 ? 189 TRP A CA  1 
ATOM   1471 C C   . TRP A 1 189 ? 6.326  16.735 35.236 1.00 65.70 ? 189 TRP A C   1 
ATOM   1472 O O   . TRP A 1 189 ? 6.197  17.820 34.662 1.00 65.82 ? 189 TRP A O   1 
ATOM   1473 C CB  . TRP A 1 189 ? 6.850  17.147 37.643 1.00 60.02 ? 189 TRP A CB  1 
ATOM   1474 C CG  . TRP A 1 189 ? 7.428  16.535 38.891 1.00 48.23 ? 189 TRP A CG  1 
ATOM   1475 C CD1 . TRP A 1 189 ? 8.735  16.538 39.266 1.00 47.43 ? 189 TRP A CD1 1 
ATOM   1476 C CD2 . TRP A 1 189 ? 6.711  15.849 39.936 1.00 45.68 ? 189 TRP A CD2 1 
ATOM   1477 N NE1 . TRP A 1 189 ? 8.886  15.884 40.469 1.00 44.95 ? 189 TRP A NE1 1 
ATOM   1478 C CE2 . TRP A 1 189 ? 7.661  15.456 40.903 1.00 42.14 ? 189 TRP A CE2 1 
ATOM   1479 C CE3 . TRP A 1 189 ? 5.366  15.528 40.143 1.00 44.67 ? 189 TRP A CE3 1 
ATOM   1480 C CZ2 . TRP A 1 189 ? 7.309  14.762 42.062 1.00 37.59 ? 189 TRP A CZ2 1 
ATOM   1481 C CZ3 . TRP A 1 189 ? 5.018  14.832 41.293 1.00 45.40 ? 189 TRP A CZ3 1 
ATOM   1482 C CH2 . TRP A 1 189 ? 5.987  14.458 42.239 1.00 46.56 ? 189 TRP A CH2 1 
HETATM 1483 O O   . HOH B 2 .   ? 15.772 19.727 55.526 1.00 27.27 ? 501 HOH A O   1 
HETATM 1484 O O   . HOH B 2 .   ? 24.448 15.970 54.974 1.00 29.49 ? 502 HOH A O   1 
HETATM 1485 O O   . HOH B 2 .   ? 16.149 11.804 48.906 1.00 28.59 ? 503 HOH A O   1 
HETATM 1486 O O   . HOH B 2 .   ? 16.372 24.902 45.361 1.00 26.63 ? 504 HOH A O   1 
HETATM 1487 O O   . HOH B 2 .   ? 13.150 12.897 59.863 1.00 30.42 ? 505 HOH A O   1 
HETATM 1488 O O   . HOH B 2 .   ? 15.564 16.539 43.833 1.00 26.19 ? 506 HOH A O   1 
HETATM 1489 O O   . HOH B 2 .   ? 6.700  11.591 56.119 1.00 31.36 ? 507 HOH A O   1 
HETATM 1490 O O   . HOH B 2 .   ? 15.531 19.709 41.631 1.00 29.08 ? 508 HOH A O   1 
HETATM 1491 O O   . HOH B 2 .   ? 23.917 12.747 60.704 1.00 30.62 ? 509 HOH A O   1 
HETATM 1492 O O   . HOH B 2 .   ? 6.811  15.772 57.943 1.00 30.16 ? 510 HOH A O   1 
HETATM 1493 O O   . HOH B 2 .   ? 16.553 15.201 54.101 1.00 27.03 ? 511 HOH A O   1 
HETATM 1494 O O   . HOH B 2 .   ? 17.621 12.599 70.976 1.00 27.19 ? 512 HOH A O   1 
HETATM 1495 O O   . HOH B 2 .   ? 13.450 18.671 43.090 1.00 32.55 ? 513 HOH A O   1 
HETATM 1496 O O   . HOH B 2 .   ? 12.827 36.656 37.258 1.00 33.64 ? 514 HOH A O   1 
HETATM 1497 O O   . HOH B 2 .   ? 14.849 23.326 44.089 1.00 30.83 ? 515 HOH A O   1 
HETATM 1498 O O   . HOH B 2 .   ? 19.992 9.837  47.593 1.00 31.86 ? 516 HOH A O   1 
HETATM 1499 O O   . HOH B 2 .   ? 16.076 7.010  66.014 1.00 29.59 ? 517 HOH A O   1 
HETATM 1500 O O   . HOH B 2 .   ? 13.842 16.302 57.687 1.00 33.25 ? 518 HOH A O   1 
HETATM 1501 O O   . HOH B 2 .   ? 22.241 29.802 48.673 1.00 29.93 ? 519 HOH A O   1 
HETATM 1502 O O   . HOH B 2 .   ? 11.732 15.044 55.767 1.00 29.27 ? 520 HOH A O   1 
HETATM 1503 O O   . HOH B 2 .   ? 29.680 12.128 56.217 1.00 39.33 ? 521 HOH A O   1 
HETATM 1504 O O   . HOH B 2 .   ? 24.377 16.773 80.105 1.00 31.36 ? 522 HOH A O   1 
HETATM 1505 O O   . HOH B 2 .   ? 7.616  10.481 69.279 1.00 29.00 ? 523 HOH A O   1 
HETATM 1506 O O   . HOH B 2 .   ? 22.808 15.027 38.244 1.00 40.07 ? 524 HOH A O   1 
HETATM 1507 O O   . HOH B 2 .   ? 28.846 27.227 50.244 1.00 35.13 ? 525 HOH A O   1 
HETATM 1508 O O   . HOH B 2 .   ? 19.147 14.623 54.779 1.00 29.48 ? 526 HOH A O   1 
HETATM 1509 O O   . HOH B 2 .   ? -1.172 15.123 57.407 1.00 37.32 ? 527 HOH A O   1 
HETATM 1510 O O   . HOH B 2 .   ? 13.231 37.700 45.369 1.00 32.38 ? 528 HOH A O   1 
HETATM 1511 O O   . HOH B 2 .   ? 13.722 8.789  63.183 1.00 32.27 ? 529 HOH A O   1 
HETATM 1512 O O   . HOH B 2 .   ? 20.811 35.129 60.448 1.00 36.91 ? 530 HOH A O   1 
HETATM 1513 O O   . HOH B 2 .   ? 19.534 23.077 38.728 1.00 30.50 ? 531 HOH A O   1 
HETATM 1514 O O   . HOH B 2 .   ? 13.451 10.278 60.789 1.00 33.05 ? 532 HOH A O   1 
HETATM 1515 O O   . HOH B 2 .   ? 27.357 9.456  47.362 1.00 32.56 ? 533 HOH A O   1 
HETATM 1516 O O   . HOH B 2 .   ? 13.031 21.401 45.062 1.00 32.75 ? 534 HOH A O   1 
HETATM 1517 O O   . HOH B 2 .   ? 13.580 4.563  50.579 1.00 40.85 ? 535 HOH A O   1 
HETATM 1518 O O   . HOH B 2 .   ? 20.294 9.199  77.800 1.00 40.28 ? 536 HOH A O   1 
HETATM 1519 O O   . HOH B 2 .   ? 21.328 31.969 54.218 1.00 34.16 ? 537 HOH A O   1 
HETATM 1520 O O   . HOH B 2 .   ? 32.677 23.429 50.248 1.00 36.91 ? 538 HOH A O   1 
HETATM 1521 O O   . HOH B 2 .   ? 21.614 12.885 57.623 1.00 32.37 ? 539 HOH A O   1 
HETATM 1522 O O   . HOH B 2 .   ? 8.518  34.646 43.545 1.00 36.48 ? 540 HOH A O   1 
HETATM 1523 O O   . HOH B 2 .   ? 26.163 26.594 38.595 1.00 42.12 ? 541 HOH A O   1 
HETATM 1524 O O   . HOH B 2 .   ? 28.011 24.940 37.309 1.00 35.52 ? 542 HOH A O   1 
HETATM 1525 O O   . HOH B 2 .   ? 18.948 13.512 61.245 1.00 33.18 ? 543 HOH A O   1 
HETATM 1526 O O   . HOH B 2 .   ? 6.596  8.215  67.768 1.00 34.96 ? 544 HOH A O   1 
HETATM 1527 O O   . HOH B 2 .   ? 30.756 11.740 46.630 1.00 36.28 ? 545 HOH A O   1 
HETATM 1528 O O   . HOH B 2 .   ? 18.696 40.669 33.381 1.00 35.00 ? 546 HOH A O   1 
HETATM 1529 O O   . HOH B 2 .   ? 15.047 17.178 55.356 1.00 30.92 ? 547 HOH A O   1 
HETATM 1530 O O   . HOH B 2 .   ? 28.177 21.135 71.154 1.00 38.24 ? 548 HOH A O   1 
HETATM 1531 O O   . HOH B 2 .   ? 15.807 13.873 42.988 1.00 34.37 ? 549 HOH A O   1 
HETATM 1532 O O   . HOH B 2 .   ? 17.635 4.937  73.017 1.00 40.01 ? 550 HOH A O   1 
HETATM 1533 O O   . HOH B 2 .   ? 16.656 6.330  60.524 1.00 46.58 ? 551 HOH A O   1 
HETATM 1534 O O   . HOH B 2 .   ? 23.210 10.339 67.144 1.00 42.01 ? 552 HOH A O   1 
HETATM 1535 O O   . HOH B 2 .   ? 29.986 24.854 49.965 1.00 36.25 ? 553 HOH A O   1 
HETATM 1536 O O   . HOH B 2 .   ? 15.006 14.945 59.884 1.00 33.77 ? 554 HOH A O   1 
HETATM 1537 O O   . HOH B 2 .   ? 21.304 12.315 60.242 1.00 34.86 ? 555 HOH A O   1 
HETATM 1538 O O   . HOH B 2 .   ? 30.859 10.101 44.429 1.00 40.19 ? 556 HOH A O   1 
HETATM 1539 O O   . HOH B 2 .   ? 13.546 37.686 34.858 1.00 39.59 ? 557 HOH A O   1 
HETATM 1540 O O   . HOH B 2 .   ? 13.864 21.113 57.381 1.00 36.40 ? 558 HOH A O   1 
HETATM 1541 O O   . HOH B 2 .   ? 19.500 34.974 36.496 1.00 43.75 ? 559 HOH A O   1 
HETATM 1542 O O   . HOH B 2 .   ? 31.000 25.838 66.474 1.00 49.30 ? 560 HOH A O   1 
HETATM 1543 O O   . HOH B 2 .   ? 3.885  27.247 48.318 1.00 45.05 ? 561 HOH A O   1 
HETATM 1544 O O   . HOH B 2 .   ? 0.540  11.221 63.159 1.00 35.80 ? 562 HOH A O   1 
HETATM 1545 O O   . HOH B 2 .   ? 29.906 11.487 63.207 1.00 41.14 ? 563 HOH A O   1 
HETATM 1546 O O   . HOH B 2 .   ? 20.307 8.637  74.930 1.00 36.58 ? 564 HOH A O   1 
HETATM 1547 O O   . HOH B 2 .   ? 19.840 9.772  57.796 1.00 41.06 ? 565 HOH A O   1 
HETATM 1548 O O   . HOH B 2 .   ? 9.418  7.717  68.419 1.00 41.36 ? 566 HOH A O   1 
HETATM 1549 O O   . HOH B 2 .   ? 17.375 15.504 60.645 1.00 41.15 ? 567 HOH A O   1 
HETATM 1550 O O   . HOH B 2 .   ? 19.776 36.247 40.332 1.00 45.88 ? 568 HOH A O   1 
HETATM 1551 O O   . HOH B 2 .   ? 5.354  27.360 37.945 1.00 49.33 ? 569 HOH A O   1 
HETATM 1552 O O   . HOH B 2 .   ? 20.285 26.503 35.129 1.00 55.91 ? 570 HOH A O   1 
HETATM 1553 O O   . HOH B 2 .   ? 23.511 31.272 46.515 1.00 37.87 ? 571 HOH A O   1 
HETATM 1554 O O   . HOH B 2 .   ? 7.447  34.290 41.050 1.00 41.74 ? 572 HOH A O   1 
HETATM 1555 O O   . HOH B 2 .   ? 28.886 23.347 69.543 1.00 46.75 ? 573 HOH A O   1 
HETATM 1556 O O   . HOH B 2 .   ? 28.317 10.306 38.236 1.00 37.71 ? 574 HOH A O   1 
HETATM 1557 O O   . HOH B 2 .   ? 11.916 19.997 58.834 1.00 37.97 ? 575 HOH A O   1 
HETATM 1558 O O   . HOH B 2 .   ? 4.123  4.092  56.960 1.00 47.66 ? 576 HOH A O   1 
HETATM 1559 O O   . HOH B 2 .   ? 32.378 15.636 68.356 1.00 58.85 ? 577 HOH A O   1 
HETATM 1560 O O   . HOH B 2 .   ? 9.219  25.682 35.652 1.00 44.98 ? 578 HOH A O   1 
HETATM 1561 O O   . HOH B 2 .   ? 14.875 37.006 62.253 1.00 52.03 ? 579 HOH A O   1 
HETATM 1562 O O   . HOH B 2 .   ? 28.496 10.089 50.666 1.00 40.99 ? 580 HOH A O   1 
HETATM 1563 O O   . HOH B 2 .   ? 13.453 33.437 54.066 1.00 47.51 ? 581 HOH A O   1 
HETATM 1564 O O   . HOH B 2 .   ? 19.079 13.721 57.140 1.00 43.08 ? 582 HOH A O   1 
HETATM 1565 O O   . HOH B 2 .   ? 16.724 11.673 39.575 1.00 51.93 ? 583 HOH A O   1 
HETATM 1566 O O   . HOH B 2 .   ? 21.458 20.157 31.878 1.00 52.81 ? 584 HOH A O   1 
HETATM 1567 O O   . HOH B 2 .   ? 20.913 6.640  79.033 1.00 44.04 ? 585 HOH A O   1 
HETATM 1568 O O   . HOH B 2 .   ? 13.611 3.311  54.242 1.00 59.27 ? 586 HOH A O   1 
HETATM 1569 O O   . HOH B 2 .   ? 30.140 16.944 65.868 1.00 43.94 ? 587 HOH A O   1 
HETATM 1570 O O   . HOH B 2 .   ? 22.276 8.371  64.442 1.00 56.68 ? 588 HOH A O   1 
HETATM 1571 O O   . HOH B 2 .   ? 17.486 13.162 59.239 1.00 43.97 ? 589 HOH A O   1 
HETATM 1572 O O   . HOH B 2 .   ? 30.684 14.431 65.691 1.00 58.70 ? 590 HOH A O   1 
HETATM 1573 O O   . HOH B 2 .   ? -2.611 13.527 59.461 1.00 51.15 ? 591 HOH A O   1 
HETATM 1574 O O   . HOH B 2 .   ? 7.797  5.998  53.676 1.00 48.16 ? 592 HOH A O   1 
HETATM 1575 O O   . HOH B 2 .   ? 22.441 9.946  57.381 1.00 42.78 ? 593 HOH A O   1 
HETATM 1576 O O   . HOH B 2 .   ? 20.894 41.000 31.630 1.00 53.05 ? 594 HOH A O   1 
HETATM 1577 O O   . HOH B 2 .   ? 28.234 9.751  44.731 1.00 46.68 ? 595 HOH A O   1 
HETATM 1578 O O   . HOH B 2 .   ? 14.336 5.176  72.315 1.00 44.78 ? 596 HOH A O   1 
HETATM 1579 O O   . HOH B 2 .   ? 27.745 20.570 74.908 1.00 47.14 ? 597 HOH A O   1 
HETATM 1580 O O   . HOH B 2 .   ? 28.773 19.808 32.189 1.00 42.71 ? 598 HOH A O   1 
HETATM 1581 O O   . HOH B 2 .   ? 32.589 21.171 59.011 1.00 53.22 ? 599 HOH A O   1 
HETATM 1582 O O   . HOH B 2 .   ? 16.885 1.391  67.213 1.00 52.43 ? 600 HOH A O   1 
HETATM 1583 O O   . HOH B 2 .   ? 18.845 25.642 37.182 1.00 41.82 ? 601 HOH A O   1 
HETATM 1584 O O   . HOH B 2 .   ? 20.452 32.758 39.011 1.00 61.44 ? 602 HOH A O   1 
HETATM 1585 O O   . HOH B 2 .   ? 15.601 32.762 56.638 1.00 47.59 ? 603 HOH A O   1 
HETATM 1586 O O   . HOH B 2 .   ? 33.768 15.755 52.475 1.00 59.24 ? 604 HOH A O   1 
HETATM 1587 O O   . HOH B 2 .   ? 21.922 16.888 40.382 1.00 43.56 ? 605 HOH A O   1 
HETATM 1588 O O   . HOH B 2 .   ? 1.835  28.945 50.029 1.00 51.84 ? 606 HOH A O   1 
HETATM 1589 O O   . HOH B 2 .   ? 14.854 17.624 39.754 1.00 44.71 ? 607 HOH A O   1 
HETATM 1590 O O   . HOH B 2 .   ? 25.656 27.324 72.130 1.00 52.02 ? 608 HOH A O   1 
HETATM 1591 O O   . HOH B 2 .   ? 34.240 14.639 43.133 1.00 54.32 ? 609 HOH A O   1 
HETATM 1592 O O   . HOH B 2 .   ? 25.363 18.244 82.777 1.00 69.32 ? 610 HOH A O   1 
HETATM 1593 O O   . HOH B 2 .   ? 9.400  21.071 59.717 1.00 44.60 ? 611 HOH A O   1 
HETATM 1594 O O   . HOH B 2 .   ? 21.054 43.684 30.500 1.00 47.61 ? 612 HOH A O   1 
HETATM 1595 O O   . HOH B 2 .   ? 11.239 34.947 62.461 1.00 54.10 ? 613 HOH A O   1 
HETATM 1596 O O   . HOH B 2 .   ? 31.324 13.008 50.200 1.00 47.90 ? 614 HOH A O   1 
HETATM 1597 O O   . HOH B 2 .   ? 21.968 10.131 72.728 1.00 60.13 ? 615 HOH A O   1 
HETATM 1598 O O   . HOH B 2 .   ? 6.074  7.852  50.204 1.00 65.99 ? 616 HOH A O   1 
HETATM 1599 O O   . HOH B 2 .   ? 32.219 19.794 62.573 1.00 54.99 ? 617 HOH A O   1 
HETATM 1600 O O   . HOH B 2 .   ? 8.179  24.247 33.749 1.00 60.03 ? 618 HOH A O   1 
HETATM 1601 O O   . HOH B 2 .   ? 6.356  12.087 38.728 1.00 67.47 ? 619 HOH A O   1 
HETATM 1602 O O   . HOH B 2 .   ? 23.592 10.406 78.448 1.00 68.78 ? 620 HOH A O   1 
HETATM 1603 O O   . HOH B 2 .   ? 27.299 11.391 36.112 1.00 50.42 ? 621 HOH A O   1 
HETATM 1604 O O   . HOH B 2 .   ? 25.709 8.357  43.668 1.00 65.60 ? 622 HOH A O   1 
HETATM 1605 O O   . HOH B 2 .   ? 10.313 1.453  83.086 1.00 65.05 ? 623 HOH A O   1 
HETATM 1606 O O   . HOH B 2 .   ? 17.863 23.978 32.931 1.00 63.16 ? 624 HOH A O   1 
HETATM 1607 O O   . HOH B 2 .   ? 35.078 15.568 46.711 1.00 57.65 ? 625 HOH A O   1 
HETATM 1608 O O   . HOH B 2 .   ? 9.630  33.656 58.511 1.00 55.24 ? 626 HOH A O   1 
HETATM 1609 O O   . HOH B 2 .   ? 0.958  17.682 41.639 1.00 69.15 ? 627 HOH A O   1 
HETATM 1610 O O   . HOH B 2 .   ? 31.829 24.693 54.044 1.00 64.95 ? 628 HOH A O   1 
HETATM 1611 O O   . HOH B 2 .   ? 17.736 36.789 31.951 1.00 64.98 ? 629 HOH A O   1 
HETATM 1612 O O   . HOH B 2 .   ? 31.401 13.469 52.891 1.00 59.86 ? 630 HOH A O   1 
HETATM 1613 O O   . HOH B 2 .   ? 1.281  4.988  65.003 1.00 66.99 ? 631 HOH A O   1 
HETATM 1614 O O   . HOH B 2 .   ? 17.734 35.878 48.985 1.00 52.15 ? 632 HOH A O   1 
HETATM 1615 O O   . HOH B 2 .   ? 31.538 23.971 68.357 1.00 57.59 ? 633 HOH A O   1 
HETATM 1616 O O   . HOH B 2 .   ? 27.671 18.037 30.675 1.00 55.33 ? 634 HOH A O   1 
HETATM 1617 O O   . HOH B 2 .   ? 22.077 36.733 51.925 1.00 64.01 ? 635 HOH A O   1 
HETATM 1618 O O   . HOH B 2 .   ? 3.916  10.372 42.901 1.00 70.42 ? 636 HOH A O   1 
HETATM 1619 O O   . HOH B 2 .   ? 29.414 29.651 53.775 1.00 54.64 ? 637 HOH A O   1 
HETATM 1620 O O   . HOH B 2 .   ? 18.044 6.810  86.472 1.00 64.15 ? 638 HOH A O   1 
HETATM 1621 O O   . HOH B 2 .   ? 22.078 34.680 53.777 1.00 65.80 ? 639 HOH A O   1 
HETATM 1622 O O   . HOH B 2 .   ? 25.223 13.350 72.776 1.00 68.98 ? 640 HOH A O   1 
HETATM 1623 O O   . HOH B 2 .   ? 1.469  4.785  68.133 1.00 71.03 ? 641 HOH A O   1 
HETATM 1624 O O   . HOH B 2 .   ? 27.544 28.109 43.962 1.00 53.70 ? 642 HOH A O   1 
HETATM 1625 O O   . HOH B 2 .   ? 7.409  1.969  66.642 1.00 61.18 ? 643 HOH A O   1 
HETATM 1626 O O   . HOH B 2 .   ? 7.038  4.705  42.267 1.00 69.20 ? 644 HOH A O   1 
HETATM 1627 O O   . HOH B 2 .   ? 24.180 11.700 74.396 1.00 45.36 ? 645 HOH A O   1 
HETATM 1628 O O   . HOH B 2 .   ? 3.044  20.932 43.191 1.00 54.94 ? 646 HOH A O   1 
HETATM 1629 O O   . HOH B 2 .   ? 30.963 28.659 56.189 1.00 61.98 ? 647 HOH A O   1 
HETATM 1630 O O   . HOH B 2 .   ? 14.682 14.951 40.431 1.00 66.66 ? 648 HOH A O   1 
HETATM 1631 O O   . HOH B 2 .   ? 18.590 36.369 58.750 1.00 62.21 ? 649 HOH A O   1 
HETATM 1632 O O   . HOH B 2 .   ? 35.529 16.177 41.472 1.00 66.24 ? 650 HOH A O   1 
HETATM 1633 O O   . HOH B 2 .   ? 33.467 13.608 56.070 1.00 67.29 ? 651 HOH A O   1 
HETATM 1634 O O   . HOH B 2 .   ? 10.849 30.415 35.797 1.00 60.22 ? 652 HOH A O   1 
HETATM 1635 O O   . HOH B 2 .   ? 27.961 9.831  34.063 1.00 56.91 ? 653 HOH A O   1 
HETATM 1636 O O   . HOH B 2 .   ? 14.410 6.407  63.240 1.00 55.62 ? 654 HOH A O   1 
HETATM 1637 O O   . HOH B 2 .   ? 20.246 9.940  60.619 1.00 50.34 ? 655 HOH A O   1 
HETATM 1638 O O   . HOH B 2 .   ? -3.144 2.434  55.835 1.00 68.11 ? 656 HOH A O   1 
HETATM 1639 O O   . HOH B 2 .   ? 21.675 33.415 68.094 1.00 62.84 ? 657 HOH A O   1 
HETATM 1640 O O   . HOH B 2 .   ? 21.048 5.244  67.029 1.00 69.66 ? 658 HOH A O   1 
HETATM 1641 O O   . HOH B 2 .   ? 29.050 25.221 59.731 1.00 51.45 ? 659 HOH A O   1 
HETATM 1642 O O   . HOH B 2 .   ? 21.822 31.841 70.901 1.00 63.33 ? 660 HOH A O   1 
HETATM 1643 O O   . HOH B 2 .   ? 22.877 6.176  62.756 1.00 58.62 ? 661 HOH A O   1 
HETATM 1644 O O   . HOH B 2 .   ? 29.706 28.016 59.266 1.00 57.22 ? 662 HOH A O   1 
HETATM 1645 O O   . HOH B 2 .   ? 8.915  1.197  59.715 1.00 69.62 ? 663 HOH A O   1 
HETATM 1646 O O   . HOH B 2 .   ? 33.045 21.734 68.338 1.00 60.24 ? 664 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 2   ? 0.9627 0.9156 0.8303 0.1241 0.1087  0.1105  2   MET A N   
2    C CA  . MET A 2   ? 0.8347 0.7712 0.7075 0.1185 0.1170  0.1129  2   MET A CA  
3    C C   . MET A 2   ? 0.9366 0.8773 0.8185 0.1147 0.1086  0.1079  2   MET A C   
4    O O   . MET A 2   ? 1.1067 1.0389 0.9987 0.1063 0.1113  0.1055  2   MET A O   
5    C CB  . MET A 2   ? 0.9259 0.8558 0.8101 0.1070 0.1238  0.1097  2   MET A CB  
6    N N   . MET A 3   ? 0.8356 0.7900 0.7147 0.1207 0.0983  0.1058  3   MET A N   
7    C CA  . MET A 3   ? 0.7599 0.7168 0.6464 0.1181 0.0918  0.1022  3   MET A CA  
8    C C   . MET A 3   ? 0.8092 0.7787 0.6913 0.1265 0.0827  0.1015  3   MET A C   
9    O O   . MET A 3   ? 0.9931 0.9713 0.8653 0.1358 0.0801  0.1035  3   MET A O   
10   C CB  . MET A 3   ? 0.8671 0.8277 0.7696 0.1057 0.0869  0.0937  3   MET A CB  
11   N N   . TYR A 4   ? 0.6965 0.6677 0.5872 0.1224 0.0776  0.0977  4   TYR A N   
12   C CA  . TYR A 4   ? 0.7601 0.7300 0.6452 0.1304 0.0765  0.1014  4   TYR A CA  
13   C C   . TYR A 4   ? 0.5410 0.5225 0.4347 0.1288 0.0667  0.0955  4   TYR A C   
14   O O   . TYR A 4   ? 0.5815 0.5725 0.4704 0.1375 0.0618  0.0962  4   TYR A O   
15   C CB  . TYR A 4   ? 0.9396 0.8902 0.8235 0.1284 0.0862  0.1065  4   TYR A CB  
16   C CG  . TYR A 4   ? 0.9671 0.9050 0.8376 0.1357 0.0968  0.1154  4   TYR A CG  
17   C CD1 . TYR A 4   ? 1.0577 0.9965 0.9140 0.1493 0.0975  0.1218  4   TYR A CD1 
18   C CD2 . TYR A 4   ? 1.0895 1.0144 0.9612 0.1297 0.1068  0.1173  4   TYR A CD2 
19   C CE1 . TYR A 4   ? 1.0958 1.0218 0.9380 0.1572 0.1080  0.1307  4   TYR A CE1 
20   C CE2 . TYR A 4   ? 1.1454 1.0570 1.0039 0.1369 0.1181  0.1263  4   TYR A CE2 
21   C CZ  . TYR A 4   ? 1.1619 1.0737 1.0050 0.1509 0.1187  0.1332  4   TYR A CZ  
22   O OH  . TYR A 4   ? 1.2446 1.1433 1.0749 0.1584 0.1299  0.1413  4   TYR A OH  
23   N N   . LYS A 5   ? 0.5380 0.5185 0.4442 0.1182 0.0643  0.0897  5   LYS A N   
24   C CA  . LYS A 5   ? 0.4372 0.4279 0.3516 0.1166 0.0559  0.0843  5   LYS A CA  
25   C C   . LYS A 5   ? 0.4643 0.4729 0.3802 0.1187 0.0477  0.0794  5   LYS A C   
26   O O   . LYS A 5   ? 0.4551 0.4674 0.3703 0.1169 0.0477  0.0778  5   LYS A O   
27   C CB  . LYS A 5   ? 0.4718 0.4578 0.3979 0.1056 0.0550  0.0791  5   LYS A CB  
28   C CG  . LYS A 5   ? 0.4779 0.4482 0.4038 0.1039 0.0614  0.0825  5   LYS A CG  
29   C CD  . LYS A 5   ? 0.5586 0.5292 0.4942 0.0978 0.0572  0.0774  5   LYS A CD  
30   C CE  . LYS A 5   ? 0.4897 0.4605 0.4345 0.0877 0.0556  0.0711  5   LYS A CE  
31   N NZ  . LYS A 5   ? 0.4053 0.3731 0.3575 0.0827 0.0532  0.0671  5   LYS A NZ  
32   N N   . GLU A 6   ? 0.4270 0.4467 0.3455 0.1228 0.0411  0.0768  6   GLU A N   
33   C CA  . GLU A 6   ? 0.4706 0.5080 0.3918 0.1250 0.0332  0.0712  6   GLU A CA  
34   C C   . GLU A 6   ? 0.4116 0.4550 0.3460 0.1149 0.0280  0.0632  6   GLU A C   
35   O O   . GLU A 6   ? 0.4004 0.4403 0.3424 0.1099 0.0273  0.0613  6   GLU A O   
36   C CB  . GLU A 6   ? 0.5114 0.5593 0.4303 0.1343 0.0286  0.0713  6   GLU A CB  
37   C CG  . GLU A 6   ? 0.7577 0.8083 0.6626 0.1466 0.0302  0.0766  6   GLU A CG  
38   C CD  . GLU A 6   ? 0.8820 0.9456 0.7850 0.1487 0.0256  0.0725  6   GLU A CD  
39   O OE1 . GLU A 6   ? 0.9471 1.0257 0.8594 0.1462 0.0178  0.0646  6   GLU A OE1 
40   O OE2 . GLU A 6   ? 0.9791 1.0374 0.8715 0.1526 0.0304  0.0771  6   GLU A OE2 
41   N N   . PRO A 7   ? 0.3800 0.4320 0.3166 0.1124 0.0248  0.0588  7   PRO A N   
42   C CA  . PRO A 7   ? 0.3795 0.4380 0.3277 0.1041 0.0197  0.0512  7   PRO A CA  
43   C C   . PRO A 7   ? 0.4111 0.4811 0.3659 0.1061 0.0136  0.0468  7   PRO A C   
44   O O   . PRO A 7   ? 0.3851 0.4631 0.3354 0.1145 0.0115  0.0480  7   PRO A O   
45   C CB  . PRO A 7   ? 0.3495 0.4162 0.2960 0.1042 0.0175  0.0481  7   PRO A CB  
46   C CG  . PRO A 7   ? 0.4076 0.4666 0.3420 0.1096 0.0239  0.0551  7   PRO A CG  
47   C CD  . PRO A 7   ? 0.4343 0.4893 0.3617 0.1177 0.0263  0.0610  7   PRO A CD  
48   N N   . PHE A 8   ? 0.3700 0.4410 0.3353 0.0988 0.0111  0.0417  8   PHE A N   
49   C CA  . PHE A 8   ? 0.3906 0.4731 0.3638 0.0997 0.0059  0.0368  8   PHE A CA  
50   C C   . PHE A 8   ? 0.3837 0.4694 0.3676 0.0913 0.0030  0.0300  8   PHE A C   
51   O O   . PHE A 8   ? 0.3499 0.4268 0.3348 0.0850 0.0052  0.0298  8   PHE A O   
52   C CB  . PHE A 8   ? 0.3346 0.4119 0.3086 0.1019 0.0077  0.0400  8   PHE A CB  
53   C CG  . PHE A 8   ? 0.3672 0.4305 0.3439 0.0951 0.0115  0.0415  8   PHE A CG  
54   C CD1 . PHE A 8   ? 0.3798 0.4438 0.3661 0.0887 0.0096  0.0366  8   PHE A CD1 
55   C CD2 . PHE A 8   ? 0.3888 0.4380 0.3584 0.0955 0.0173  0.0475  8   PHE A CD2 
56   C CE1 . PHE A 8   ? 0.3987 0.4501 0.3862 0.0834 0.0128  0.0378  8   PHE A CE1 
57   C CE2 . PHE A 8   ? 0.3943 0.4315 0.3665 0.0895 0.0203  0.0479  8   PHE A CE2 
58   C CZ  . PHE A 8   ? 0.3761 0.4148 0.3569 0.0838 0.0177  0.0430  8   PHE A CZ  
59   N N   . GLY A 9   ? 0.3089 0.4071 0.3008 0.0916 -0.0017 0.0241  9   GLY A N   
60   C CA  . GLY A 9   ? 0.2748 0.3747 0.2771 0.0841 -0.0035 0.0180  9   GLY A CA  
61   C C   . GLY A 9   ? 0.3625 0.4644 0.3724 0.0837 -0.0039 0.0165  9   GLY A C   
62   O O   . GLY A 9   ? 0.3700 0.4785 0.3794 0.0899 -0.0050 0.0175  9   GLY A O   
63   N N   . VAL A 10  ? 0.3109 0.4070 0.3275 0.0771 -0.0027 0.0141  10  VAL A N   
64   C CA  . VAL A 10  ? 0.3148 0.4129 0.3397 0.0761 -0.0024 0.0121  10  VAL A CA  
65   C C   . VAL A 10  ? 0.3539 0.4537 0.3880 0.0695 -0.0031 0.0060  10  VAL A C   
66   O O   . VAL A 10  ? 0.3359 0.4295 0.3683 0.0652 -0.0025 0.0052  10  VAL A O   
67   C CB  . VAL A 10  ? 0.3951 0.4798 0.4165 0.0757 0.0017  0.0175  10  VAL A CB  
68   C CG1 . VAL A 10  ? 0.5012 0.5837 0.5143 0.0825 0.0031  0.0234  10  VAL A CG1 
69   C CG2 . VAL A 10  ? 0.4002 0.4717 0.4182 0.0703 0.0042  0.0189  10  VAL A CG2 
70   N N   . LYS A 11  ? 0.3109 0.4192 0.3550 0.0690 -0.0041 0.0014  11  LYS A N   
71   C CA  . LYS A 11  ? 0.3393 0.4473 0.3925 0.0627 -0.0034 -0.0040 11  LYS A CA  
72   C C   . LYS A 11  ? 0.3410 0.4353 0.3940 0.0595 0.0011  -0.0010 11  LYS A C   
73   O O   . LYS A 11  ? 0.3392 0.4292 0.3903 0.0620 0.0032  0.0030  11  LYS A O   
74   C CB  . LYS A 11  ? 0.4439 0.5665 0.5095 0.0628 -0.0054 -0.0108 11  LYS A CB  
75   C CG  . LYS A 11  ? 0.5813 0.7165 0.6501 0.0630 -0.0098 -0.0171 11  LYS A CG  
76   C CD  . LYS A 11  ? 0.6885 0.8409 0.7686 0.0652 -0.0128 -0.0238 11  LYS A CD  
77   C CE  . LYS A 11  ? 0.7950 0.9606 0.8761 0.0670 -0.0180 -0.0299 11  LYS A CE  
78   N NZ  . LYS A 11  ? 0.8717 1.0555 0.9654 0.0687 -0.0215 -0.0382 11  LYS A NZ  
79   N N   . VAL A 12  ? 0.3023 0.3897 0.3565 0.0544 0.0025  -0.0029 12  VAL A N   
80   C CA  . VAL A 12  ? 0.3499 0.4253 0.4042 0.0517 0.0066  -0.0012 12  VAL A CA  
81   C C   . VAL A 12  ? 0.4290 0.5076 0.4936 0.0477 0.0081  -0.0069 12  VAL A C   
82   O O   . VAL A 12  ? 0.4188 0.5009 0.4863 0.0450 0.0066  -0.0111 12  VAL A O   
83   C CB  . VAL A 12  ? 0.3950 0.4582 0.4407 0.0499 0.0075  0.0016  12  VAL A CB  
84   C CG1 . VAL A 12  ? 0.4391 0.4903 0.4840 0.0479 0.0113  0.0027  12  VAL A CG1 
85   C CG2 . VAL A 12  ? 0.4057 0.4654 0.4422 0.0532 0.0068  0.0067  12  VAL A CG2 
86   N N   . ASP A 13  ? 0.4071 0.4847 0.4778 0.0473 0.0114  -0.0071 13  ASP A N   
87   C CA  . ASP A 13  ? 0.4844 0.5628 0.5653 0.0432 0.0144  -0.0121 13  ASP A CA  
88   C C   . ASP A 13  ? 0.4678 0.5311 0.5432 0.0406 0.0180  -0.0101 13  ASP A C   
89   O O   . ASP A 13  ? 0.4372 0.4898 0.5072 0.0418 0.0213  -0.0057 13  ASP A O   
90   C CB  . ASP A 13  ? 0.4866 0.5689 0.5761 0.0439 0.0174  -0.0126 13  ASP A CB  
91   C CG  . ASP A 13  ? 0.6071 0.6924 0.7095 0.0394 0.0211  -0.0186 13  ASP A CG  
92   O OD1 . ASP A 13  ? 0.6134 0.6894 0.7148 0.0360 0.0241  -0.0194 13  ASP A OD1 
93   O OD2 . ASP A 13  ? 0.5838 0.6806 0.6978 0.0395 0.0214  -0.0226 13  ASP A OD2 
94   N N   . PHE A 14  ? 0.4954 0.5578 0.5713 0.0377 0.0174  -0.0134 14  PHE A N   
95   C CA  . PHE A 14  ? 0.5696 0.6179 0.6391 0.0363 0.0204  -0.0116 14  PHE A CA  
96   C C   . PHE A 14  ? 0.6125 0.6522 0.6856 0.0351 0.0268  -0.0112 14  PHE A C   
97   O O   . PHE A 14  ? 0.6513 0.6782 0.7171 0.0356 0.0297  -0.0084 14  PHE A O   
98   C CB  . PHE A 14  ? 0.5038 0.5533 0.5736 0.0338 0.0186  -0.0154 14  PHE A CB  
99   C CG  . PHE A 14  ? 0.4923 0.5447 0.5547 0.0353 0.0136  -0.0141 14  PHE A CG  
100  C CD1 . PHE A 14  ? 0.4721 0.5284 0.5300 0.0385 0.0109  -0.0107 14  PHE A CD1 
101  C CD2 . PHE A 14  ? 0.5808 0.6314 0.6406 0.0338 0.0123  -0.0163 14  PHE A CD2 
102  C CE1 . PHE A 14  ? 0.4808 0.5388 0.5320 0.0397 0.0075  -0.0093 14  PHE A CE1 
103  C CE2 . PHE A 14  ? 0.5967 0.6501 0.6503 0.0351 0.0084  -0.0152 14  PHE A CE2 
104  C CZ  . PHE A 14  ? 0.5453 0.6023 0.5947 0.0379 0.0063  -0.0116 14  PHE A CZ  
105  N N   . GLU A 15  ? 0.5328 0.5799 0.6170 0.0339 0.0291  -0.0140 15  GLU A N   
106  C CA  . GLU A 15  ? 0.6035 0.6428 0.6925 0.0324 0.0363  -0.0140 15  GLU A CA  
107  C C   . GLU A 15  ? 0.6113 0.6447 0.6960 0.0356 0.0391  -0.0087 15  GLU A C   
108  O O   . GLU A 15  ? 0.6069 0.6287 0.6891 0.0359 0.0451  -0.0063 15  GLU A O   
109  C CB  . GLU A 15  ? 0.6618 0.7120 0.7671 0.0287 0.0384  -0.0207 15  GLU A CB  
110  C CG  . GLU A 15  ? 0.7888 0.8467 0.8993 0.0257 0.0350  -0.0269 15  GLU A CG  
111  C CD  . GLU A 15  ? 0.8866 0.9320 0.9930 0.0235 0.0387  -0.0271 15  GLU A CD  
112  O OE1 . GLU A 15  ? 0.9226 0.9576 1.0312 0.0220 0.0460  -0.0263 15  GLU A OE1 
113  O OE2 . GLU A 15  ? 0.9179 0.9634 1.0184 0.0236 0.0345  -0.0278 15  GLU A OE2 
114  N N   . THR A 16  ? 0.4685 0.5094 0.5518 0.0385 0.0351  -0.0069 16  THR A N   
115  C CA  . THR A 16  ? 0.4125 0.4489 0.4924 0.0418 0.0375  -0.0023 16  THR A CA  
116  C C   . THR A 16  ? 0.4727 0.5031 0.5395 0.0453 0.0340  0.0028  16  THR A C   
117  O O   . THR A 16  ? 0.4198 0.4419 0.4804 0.0480 0.0363  0.0070  16  THR A O   
118  C CB  . THR A 16  ? 0.5319 0.5821 0.6222 0.0428 0.0366  -0.0044 16  THR A CB  
119  O OG1 . THR A 16  ? 0.4749 0.5357 0.5634 0.0449 0.0299  -0.0050 16  THR A OG1 
120  C CG2 . THR A 16  ? 0.6254 0.6838 0.7313 0.0387 0.0397  -0.0109 16  THR A CG2 
121  N N   . GLY A 17  ? 0.4056 0.4404 0.4687 0.0453 0.0288  0.0021  17  GLY A N   
122  C CA  . GLY A 17  ? 0.3556 0.3854 0.4077 0.0480 0.0259  0.0062  17  GLY A CA  
123  C C   . GLY A 17  ? 0.3770 0.4144 0.4293 0.0513 0.0235  0.0082  17  GLY A C   
124  O O   . GLY A 17  ? 0.3345 0.3680 0.3786 0.0535 0.0217  0.0117  17  GLY A O   
125  N N   . ILE A 18  ? 0.3285 0.3768 0.3903 0.0518 0.0237  0.0059  18  ILE A N   
126  C CA  . ILE A 18  ? 0.3126 0.3679 0.3740 0.0561 0.0217  0.0081  18  ILE A CA  
127  C C   . ILE A 18  ? 0.3179 0.3806 0.3756 0.0579 0.0168  0.0080  18  ILE A C   
128  O O   . ILE A 18  ? 0.3499 0.4203 0.4115 0.0559 0.0141  0.0038  18  ILE A O   
129  C CB  . ILE A 18  ? 0.3569 0.4236 0.4302 0.0568 0.0228  0.0049  18  ILE A CB  
130  C CG1 . ILE A 18  ? 0.3864 0.4451 0.4627 0.0558 0.0288  0.0060  18  ILE A CG1 
131  C CG2 . ILE A 18  ? 0.3738 0.4493 0.4460 0.0623 0.0199  0.0068  18  ILE A CG2 
132  C CD1 . ILE A 18  ? 0.4507 0.5210 0.5412 0.0553 0.0308  0.0017  18  ILE A CD1 
133  N N   . ILE A 19  ? 0.3174 0.3769 0.3671 0.0620 0.0160  0.0128  19  ILE A N   
134  C CA  . ILE A 19  ? 0.3724 0.4384 0.4177 0.0652 0.0124  0.0139  19  ILE A CA  
135  C C   . ILE A 19  ? 0.3397 0.4121 0.3855 0.0710 0.0121  0.0161  19  ILE A C   
136  O O   . ILE A 19  ? 0.3824 0.4465 0.4234 0.0733 0.0147  0.0206  19  ILE A O   
137  C CB  . ILE A 19  ? 0.3577 0.4122 0.3920 0.0651 0.0128  0.0182  19  ILE A CB  
138  C CG1 . ILE A 19  ? 0.3220 0.3701 0.3556 0.0600 0.0130  0.0159  19  ILE A CG1 
139  C CG2 . ILE A 19  ? 0.3542 0.4140 0.3831 0.0688 0.0103  0.0201  19  ILE A CG2 
140  C CD1 . ILE A 19  ? 0.3296 0.3669 0.3544 0.0594 0.0136  0.0189  19  ILE A CD1 
141  N N   . GLU A 20  ? 0.4172 0.5048 0.4690 0.0736 0.0088  0.0127  20  GLU A N   
142  C CA  . GLU A 20  ? 0.4610 0.5561 0.5136 0.0800 0.0081  0.0143  20  GLU A CA  
143  C C   . GLU A 20  ? 0.4283 0.5168 0.4683 0.0853 0.0082  0.0208  20  GLU A C   
144  O O   . GLU A 20  ? 0.4105 0.4972 0.4438 0.0854 0.0068  0.0220  20  GLU A O   
145  C CB  . GLU A 20  ? 0.5093 0.6236 0.5710 0.0824 0.0039  0.0083  20  GLU A CB  
146  C CG  . GLU A 20  ? 0.5621 0.6840 0.6384 0.0773 0.0046  0.0012  20  GLU A CG  
147  C CD  . GLU A 20  ? 0.7087 0.8509 0.7956 0.0802 0.0004  -0.0055 20  GLU A CD  
148  O OE1 . GLU A 20  ? 0.7249 0.8751 0.8067 0.0875 -0.0031 -0.0040 20  GLU A OE1 
149  O OE2 . GLU A 20  ? 0.7037 0.8536 0.8038 0.0755 0.0007  -0.0125 20  GLU A OE2 
150  N N   . GLY A 21  ? 0.4583 0.5423 0.4951 0.0897 0.0105  0.0251  21  GLY A N   
151  C CA  . GLY A 21  ? 0.5052 0.5813 0.5302 0.0948 0.0117  0.0316  21  GLY A CA  
152  C C   . GLY A 21  ? 0.5058 0.5642 0.5230 0.0912 0.0152  0.0355  21  GLY A C   
153  O O   . GLY A 21  ? 0.4972 0.5469 0.5053 0.0946 0.0173  0.0407  21  GLY A O   
154  N N   . ALA A 22  ? 0.4069 0.4598 0.4277 0.0846 0.0161  0.0328  22  ALA A N   
155  C CA  . ALA A 22  ? 0.3765 0.4139 0.3907 0.0814 0.0189  0.0354  22  ALA A CA  
156  C C   . ALA A 22  ? 0.4184 0.4466 0.4307 0.0830 0.0223  0.0382  22  ALA A C   
157  O O   . ALA A 22  ? 0.4092 0.4428 0.4269 0.0851 0.0228  0.0375  22  ALA A O   
158  C CB  . ALA A 22  ? 0.3391 0.3743 0.3567 0.0749 0.0183  0.0314  22  ALA A CB  
159  N N   . LYS A 23  ? 0.3220 0.3366 0.3271 0.0820 0.0247  0.0410  23  LYS A N   
160  C CA  . LYS A 23  ? 0.3438 0.3484 0.3466 0.0830 0.0279  0.0430  23  LYS A CA  
161  C C   . LYS A 23  ? 0.4103 0.4129 0.4174 0.0790 0.0283  0.0396  23  LYS A C   
162  O O   . LYS A 23  ? 0.3521 0.3508 0.3585 0.0748 0.0276  0.0373  23  LYS A O   
163  C CB  . LYS A 23  ? 0.4045 0.3957 0.3992 0.0824 0.0300  0.0456  23  LYS A CB  
164  C CG  . LYS A 23  ? 0.5988 0.5787 0.5904 0.0834 0.0331  0.0470  23  LYS A CG  
165  C CD  . LYS A 23  ? 0.6886 0.6562 0.6748 0.0804 0.0344  0.0468  23  LYS A CD  
166  C CE  . LYS A 23  ? 0.8117 0.7679 0.7939 0.0821 0.0374  0.0480  23  LYS A CE  
167  N NZ  . LYS A 23  ? 0.8373 0.7830 0.8160 0.0787 0.0381  0.0461  23  LYS A NZ  
168  N N   . LYS A 24  ? 0.3629 0.3683 0.3746 0.0808 0.0299  0.0394  24  LYS A N   
169  C CA  . LYS A 24  ? 0.4002 0.4039 0.4162 0.0776 0.0314  0.0366  24  LYS A CA  
170  C C   . LYS A 24  ? 0.3864 0.3774 0.3969 0.0787 0.0347  0.0385  24  LYS A C   
171  O O   . LYS A 24  ? 0.3658 0.3547 0.3746 0.0826 0.0366  0.0412  24  LYS A O   
172  C CB  . LYS A 24  ? 0.3806 0.3967 0.4069 0.0782 0.0316  0.0342  24  LYS A CB  
173  C CG  . LYS A 24  ? 0.4057 0.4188 0.4366 0.0756 0.0348  0.0321  24  LYS A CG  
174  C CD  . LYS A 24  ? 0.4807 0.5068 0.5236 0.0758 0.0356  0.0292  24  LYS A CD  
175  C CE  . LYS A 24  ? 0.5190 0.5410 0.5667 0.0733 0.0403  0.0276  24  LYS A CE  
176  N NZ  . LYS A 24  ? 0.5221 0.5571 0.5835 0.0726 0.0416  0.0240  24  LYS A NZ  
177  N N   . SER A 25  ? 0.3487 0.3312 0.3556 0.0758 0.0352  0.0369  25  SER A N   
178  C CA  . SER A 25  ? 0.3672 0.3378 0.3681 0.0771 0.0379  0.0380  25  SER A CA  
179  C C   . SER A 25  ? 0.3770 0.3457 0.3801 0.0759 0.0402  0.0361  25  SER A C   
180  O O   . SER A 25  ? 0.3475 0.3172 0.3518 0.0727 0.0390  0.0336  25  SER A O   
181  C CB  . SER A 25  ? 0.4043 0.3653 0.3975 0.0759 0.0365  0.0376  25  SER A CB  
182  O OG  . SER A 25  ? 0.4365 0.3973 0.4275 0.0771 0.0358  0.0397  25  SER A OG  
183  N N   . VAL A 26  ? 0.3633 0.3286 0.3664 0.0786 0.0439  0.0376  26  VAL A N   
184  C CA  . VAL A 26  ? 0.3614 0.3239 0.3662 0.0779 0.0475  0.0365  26  VAL A CA  
185  C C   . VAL A 26  ? 0.3865 0.3356 0.3814 0.0807 0.0497  0.0377  26  VAL A C   
186  O O   . VAL A 26  ? 0.3595 0.3044 0.3507 0.0840 0.0510  0.0398  26  VAL A O   
187  C CB  . VAL A 26  ? 0.3711 0.3414 0.3852 0.0790 0.0510  0.0369  26  VAL A CB  
188  C CG1 . VAL A 26  ? 0.4121 0.3773 0.4274 0.0784 0.0562  0.0363  26  VAL A CG1 
189  C CG2 . VAL A 26  ? 0.4038 0.3888 0.4282 0.0768 0.0483  0.0347  26  VAL A CG2 
190  N N   . ARG A 27  ? 0.3614 0.3038 0.3514 0.0799 0.0502  0.0362  27  ARG A N   
191  C CA  . ARG A 27  ? 0.3484 0.2786 0.3281 0.0834 0.0520  0.0367  27  ARG A CA  
192  C C   . ARG A 27  ? 0.3604 0.2861 0.3393 0.0848 0.0571  0.0372  27  ARG A C   
193  O O   . ARG A 27  ? 0.3394 0.2658 0.3200 0.0827 0.0576  0.0358  27  ARG A O   
194  C CB  . ARG A 27  ? 0.3654 0.2901 0.3375 0.0829 0.0477  0.0344  27  ARG A CB  
195  C CG  . ARG A 27  ? 0.4067 0.3339 0.3793 0.0816 0.0439  0.0342  27  ARG A CG  
196  C CD  . ARG A 27  ? 0.4186 0.3409 0.3853 0.0807 0.0402  0.0312  27  ARG A CD  
197  N NE  . ARG A 27  ? 0.3853 0.3076 0.3522 0.0795 0.0381  0.0310  27  ARG A NE  
198  C CZ  . ARG A 27  ? 0.4284 0.3575 0.4003 0.0764 0.0360  0.0311  27  ARG A CZ  
199  N NH1 . ARG A 27  ? 0.3754 0.3131 0.3531 0.0741 0.0352  0.0311  27  ARG A NH1 
200  N NH2 . ARG A 27  ? 0.4153 0.3423 0.3863 0.0757 0.0353  0.0313  27  ARG A NH2 
201  N N   . ARG A 28  ? 0.3599 0.2806 0.3363 0.0885 0.0617  0.0394  28  ARG A N   
202  C CA  . ARG A 28  ? 0.3749 0.2893 0.3491 0.0906 0.0678  0.0405  28  ARG A CA  
203  C C   . ARG A 28  ? 0.3354 0.2372 0.2954 0.0949 0.0679  0.0403  28  ARG A C   
204  O O   . ARG A 28  ? 0.3856 0.2841 0.3387 0.0961 0.0631  0.0389  28  ARG A O   
205  C CB  . ARG A 28  ? 0.3931 0.3092 0.3724 0.0926 0.0735  0.0429  28  ARG A CB  
206  C CG  . ARG A 28  ? 0.4378 0.3676 0.4323 0.0888 0.0741  0.0422  28  ARG A CG  
207  C CD  . ARG A 28  ? 0.5646 0.4969 0.5656 0.0909 0.0803  0.0440  28  ARG A CD  
208  N NE  . ARG A 28  ? 0.6495 0.5966 0.6660 0.0875 0.0803  0.0422  28  ARG A NE  
209  C CZ  . ARG A 28  ? 0.6821 0.6340 0.7091 0.0844 0.0850  0.0405  28  ARG A CZ  
210  N NH1 . ARG A 28  ? 0.5840 0.5259 0.6071 0.0845 0.0911  0.0412  28  ARG A NH1 
211  N NH2 . ARG A 28  ? 0.7447 0.7115 0.7864 0.0815 0.0839  0.0378  28  ARG A NH2 
212  N N   . LEU A 29  ? 0.3669 0.2615 0.3225 0.0974 0.0734  0.0415  29  LEU A N   
213  C CA  . LEU A 29  ? 0.3720 0.2548 0.3129 0.1027 0.0734  0.0412  29  LEU A CA  
214  C C   . LEU A 29  ? 0.4015 0.2790 0.3346 0.1071 0.0723  0.0415  29  LEU A C   
215  O O   . LEU A 29  ? 0.4078 0.2802 0.3308 0.1096 0.0680  0.0391  29  LEU A O   
216  C CB  . LEU A 29  ? 0.4164 0.2914 0.3533 0.1058 0.0811  0.0435  29  LEU A CB  
217  C CG  . LEU A 29  ? 0.4536 0.3196 0.3750 0.1096 0.0801  0.0426  29  LEU A CG  
218  C CD1 . LEU A 29  ? 0.4086 0.2756 0.3273 0.1091 0.0733  0.0393  29  LEU A CD1 
219  C CD2 . LEU A 29  ? 0.5119 0.3723 0.4305 0.1106 0.0882  0.0454  29  LEU A CD2 
220  N N   . SER A 30  ? 0.4271 0.3072 0.3657 0.1074 0.0757  0.0438  30  SER A N   
221  C CA  . SER A 30  ? 0.4661 0.3425 0.3984 0.1103 0.0746  0.0439  30  SER A CA  
222  C C   . SER A 30  ? 0.4876 0.3653 0.4194 0.1094 0.0679  0.0414  30  SER A C   
223  O O   . SER A 30  ? 0.4493 0.3225 0.3737 0.1112 0.0656  0.0398  30  SER A O   
224  C CB  . SER A 30  ? 0.4667 0.3466 0.4062 0.1109 0.0798  0.0469  30  SER A CB  
225  O OG  . SER A 30  ? 0.4543 0.3452 0.4075 0.1071 0.0791  0.0473  30  SER A OG  
226  N N   . ASP A 31  ? 0.3887 0.2753 0.3291 0.1040 0.0641  0.0403  31  ASP A N   
227  C CA  . ASP A 31  ? 0.3991 0.2877 0.3396 0.1017 0.0581  0.0379  31  ASP A CA  
228  C C   . ASP A 31  ? 0.4364 0.3206 0.3695 0.1019 0.0537  0.0340  31  ASP A C   
229  O O   . ASP A 31  ? 0.4283 0.3134 0.3614 0.0999 0.0492  0.0312  31  ASP A O   
230  C CB  . ASP A 31  ? 0.4027 0.3025 0.3546 0.0965 0.0560  0.0384  31  ASP A CB  
231  C CG  . ASP A 31  ? 0.4700 0.3759 0.4297 0.0968 0.0594  0.0415  31  ASP A CG  
232  O OD1 . ASP A 31  ? 0.4592 0.3613 0.4160 0.1000 0.0608  0.0430  31  ASP A OD1 
233  O OD2 . ASP A 31  ? 0.4256 0.3402 0.3944 0.0942 0.0606  0.0420  31  ASP A OD2 
234  N N   . MET A 32  ? 0.4096 0.2889 0.3362 0.1048 0.0554  0.0335  32  MET A N   
235  C CA  . MET A 32  ? 0.4285 0.3049 0.3482 0.1058 0.0509  0.0295  32  MET A CA  
236  C C   . MET A 32  ? 0.4797 0.3461 0.3860 0.1127 0.0518  0.0283  32  MET A C   
237  O O   . MET A 32  ? 0.4577 0.3218 0.3571 0.1148 0.0507  0.0266  32  MET A O   
238  C CB  . MET A 32  ? 0.4539 0.3350 0.3778 0.1028 0.0506  0.0295  32  MET A CB  
239  C CG  . MET A 32  ? 0.5371 0.4289 0.4736 0.0961 0.0486  0.0298  32  MET A CG  
240  S SD  . MET A 32  ? 0.4039 0.3014 0.3460 0.0923 0.0485  0.0294  32  MET A SD  
241  C CE  . MET A 32  ? 0.4246 0.3188 0.3582 0.0940 0.0426  0.0246  32  MET A CE  
242  N N   . GLU A 33  ? 0.4706 0.3341 0.3737 0.1144 0.0528  0.0285  33  GLU A N   
243  C CA  . GLU A 33  ? 0.4945 0.3520 0.3855 0.1188 0.0522  0.0263  33  GLU A CA  
244  C C   . GLU A 33  ? 0.4754 0.3313 0.3611 0.1206 0.0456  0.0202  33  GLU A C   
245  O O   . GLU A 33  ? 0.5065 0.3640 0.3974 0.1186 0.0419  0.0172  33  GLU A O   
246  C CB  . GLU A 33  ? 0.5581 0.4128 0.4473 0.1202 0.0541  0.0271  33  GLU A CB  
247  C CG  . GLU A 33  ? 0.6498 0.4984 0.5263 0.1252 0.0530  0.0243  33  GLU A CG  
248  C CD  . GLU A 33  ? 0.7733 0.6189 0.6473 0.1269 0.0566  0.0264  33  GLU A CD  
249  O OE1 . GLU A 33  ? 0.7246 0.5732 0.6074 0.1241 0.0593  0.0294  33  GLU A OE1 
250  O OE2 . GLU A 33  ? 0.8249 0.6654 0.6879 0.1315 0.0567  0.0250  33  GLU A OE2 
251  N N   . GLY A 34  ? 0.4913 0.3442 0.3665 0.1248 0.0444  0.0182  34  GLY A N   
252  C CA  . GLY A 34  ? 0.5521 0.4044 0.4219 0.1276 0.0378  0.0116  34  GLY A CA  
253  C C   . GLY A 34  ? 0.5594 0.4160 0.4333 0.1258 0.0346  0.0096  34  GLY A C   
254  O O   . GLY A 34  ? 0.6151 0.4725 0.4857 0.1280 0.0288  0.0035  34  GLY A O   
255  N N   . TYR A 35  ? 0.4331 0.2928 0.3146 0.1221 0.0380  0.0142  35  TYR A N   
256  C CA  . TYR A 35  ? 0.3973 0.2623 0.2838 0.1192 0.0348  0.0125  35  TYR A CA  
257  C C   . TYR A 35  ? 0.4532 0.3157 0.3317 0.1232 0.0357  0.0130  35  TYR A C   
258  O O   . TYR A 35  ? 0.4386 0.3036 0.3166 0.1239 0.0315  0.0095  35  TYR A O   
259  C CB  . TYR A 35  ? 0.3750 0.2474 0.2751 0.1113 0.0368  0.0160  35  TYR A CB  
260  C CG  . TYR A 35  ? 0.4284 0.3065 0.3371 0.1057 0.0332  0.0137  35  TYR A CG  
261  C CD1 . TYR A 35  ? 0.4067 0.2822 0.3160 0.1059 0.0348  0.0147  35  TYR A CD1 
262  C CD2 . TYR A 35  ? 0.3915 0.2767 0.3068 0.1006 0.0288  0.0106  35  TYR A CD2 
263  C CE1 . TYR A 35  ? 0.4206 0.2997 0.3369 0.1011 0.0324  0.0129  35  TYR A CE1 
264  C CE2 . TYR A 35  ? 0.4238 0.3130 0.3464 0.0957 0.0265  0.0089  35  TYR A CE2 
265  C CZ  . TYR A 35  ? 0.4157 0.3014 0.3386 0.0961 0.0285  0.0101  35  TYR A CZ  
266  O OH  . TYR A 35  ? 0.3962 0.2846 0.3257 0.0915 0.0271  0.0087  35  TYR A OH  
267  N N   . PHE A 36  ? 0.4592 0.3176 0.3318 0.1250 0.0414  0.0175  36  PHE A N   
268  C CA  . PHE A 36  ? 0.4375 0.2931 0.3025 0.1279 0.0435  0.0191  36  PHE A CA  
269  C C   . PHE A 36  ? 0.4931 0.3439 0.3427 0.1349 0.0418  0.0171  36  PHE A C   
270  O O   . PHE A 36  ? 0.5141 0.3624 0.3591 0.1372 0.0418  0.0165  36  PHE A O   
271  C CB  . PHE A 36  ? 0.4992 0.3529 0.3682 0.1254 0.0520  0.0254  36  PHE A CB  
272  C CG  . PHE A 36  ? 0.4446 0.3036 0.3282 0.1194 0.0534  0.0268  36  PHE A CG  
273  C CD1 . PHE A 36  ? 0.4535 0.3160 0.3468 0.1159 0.0543  0.0280  36  PHE A CD1 
274  C CD2 . PHE A 36  ? 0.4228 0.2834 0.3100 0.1177 0.0537  0.0269  36  PHE A CD2 
275  C CE1 . PHE A 36  ? 0.4467 0.3152 0.3530 0.1108 0.0551  0.0292  36  PHE A CE1 
276  C CE2 . PHE A 36  ? 0.4387 0.3044 0.3389 0.1127 0.0548  0.0279  36  PHE A CE2 
277  C CZ  . PHE A 36  ? 0.4565 0.3283 0.3669 0.1079 0.0549  0.0288  36  PHE A CZ  
278  N N   . VAL A 37  ? 0.4817 0.3311 0.3229 0.1389 0.0402  0.0161  37  VAL A N   
279  C CA  . VAL A 37  ? 0.5331 0.3788 0.3588 0.1465 0.0375  0.0137  37  VAL A CA  
280  C C   . VAL A 37  ? 0.5557 0.3942 0.3715 0.1500 0.0446  0.0190  37  VAL A C   
281  O O   . VAL A 37  ? 0.6152 0.4507 0.4201 0.1556 0.0427  0.0172  37  VAL A O   
282  C CB  . VAL A 37  ? 0.6711 0.5175 0.4894 0.1507 0.0340  0.0116  37  VAL A CB  
283  C CG1 . VAL A 37  ? 0.6629 0.5168 0.4886 0.1492 0.0256  0.0045  37  VAL A CG1 
284  C CG2 . VAL A 37  ? 0.8067 0.6504 0.6268 0.1484 0.0408  0.0173  37  VAL A CG2 
285  N N   . ASP A 38  ? 0.5706 0.4064 0.3904 0.1468 0.0530  0.0251  38  ASP A N   
286  C CA  . ASP A 38  ? 0.6037 0.4323 0.4143 0.1501 0.0609  0.0303  38  ASP A CA  
287  C C   . ASP A 38  ? 0.5739 0.4030 0.3919 0.1467 0.0646  0.0324  38  ASP A C   
288  O O   . ASP A 38  ? 0.5429 0.3729 0.3716 0.1417 0.0707  0.0362  38  ASP A O   
289  C CB  . ASP A 38  ? 0.6003 0.4249 0.4110 0.1490 0.0690  0.0356  38  ASP A CB  
290  C CG  . ASP A 38  ? 0.6877 0.5036 0.4862 0.1537 0.0776  0.0408  38  ASP A CG  
291  O OD1 . ASP A 38  ? 0.6270 0.4408 0.4195 0.1567 0.0782  0.0410  38  ASP A OD1 
292  O OD2 . ASP A 38  ? 0.6815 0.4924 0.4764 0.1546 0.0844  0.0447  38  ASP A OD2 
293  N N   . GLU A 39  ? 0.5491 0.3775 0.3616 0.1498 0.0609  0.0296  39  GLU A N   
294  C CA  . GLU A 39  ? 0.5642 0.3932 0.3834 0.1469 0.0638  0.0312  39  GLU A CA  
295  C C   . GLU A 39  ? 0.5774 0.4016 0.3946 0.1474 0.0740  0.0376  39  GLU A C   
296  O O   . GLU A 39  ? 0.5569 0.3833 0.3851 0.1429 0.0783  0.0402  39  GLU A O   
297  C CB  . GLU A 39  ? 0.7012 0.5295 0.5140 0.1507 0.0581  0.0266  39  GLU A CB  
298  C CG  . GLU A 39  ? 0.9351 0.7681 0.7508 0.1504 0.0486  0.0196  39  GLU A CG  
299  C CD  . GLU A 39  ? 1.1089 0.9416 0.9220 0.1526 0.0434  0.0143  39  GLU A CD  
300  O OE1 . GLU A 39  ? 1.1898 1.0189 0.9993 0.1542 0.0468  0.0163  39  GLU A OE1 
301  O OE2 . GLU A 39  ? 1.1413 0.9775 0.9566 0.1528 0.0360  0.0076  39  GLU A OE2 
302  N N   . ARG A 40  ? 0.5391 0.3565 0.3422 0.1531 0.0781  0.0402  40  ARG A N   
303  C CA  . ARG A 40  ? 0.6137 0.4258 0.4150 0.1536 0.0887  0.0463  40  ARG A CA  
304  C C   . ARG A 40  ? 0.5529 0.3674 0.3687 0.1471 0.0949  0.0496  40  ARG A C   
305  O O   . ARG A 40  ? 0.5744 0.3890 0.3987 0.1441 0.1020  0.0530  40  ARG A O   
306  C CB  . ARG A 40  ? 0.6586 0.4619 0.4405 0.1615 0.0926  0.0489  40  ARG A CB  
307  C CG  . ARG A 40  ? 0.6730 0.4738 0.4398 0.1688 0.0867  0.0457  40  ARG A CG  
308  C CD  . ARG A 40  ? 0.8183 0.6101 0.5647 0.1775 0.0911  0.0489  40  ARG A CD  
309  N NE  . ARG A 40  ? 0.8913 0.6809 0.6229 0.1852 0.0848  0.0455  40  ARG A NE  
310  C CZ  . ARG A 40  ? 0.9778 0.7704 0.7032 0.1892 0.0745  0.0396  40  ARG A CZ  
311  N NH1 . ARG A 40  ? 0.9106 0.7083 0.6432 0.1861 0.0697  0.0366  40  ARG A NH1 
312  N NH2 . ARG A 40  ? 0.9511 0.7418 0.6638 0.1963 0.0690  0.0362  40  ARG A NH2 
313  N N   . ALA A 41  ? 0.5428 0.3592 0.3618 0.1452 0.0923  0.0482  41  ALA A N   
314  C CA  . ALA A 41  ? 0.5435 0.3621 0.3763 0.1393 0.0977  0.0506  41  ALA A CA  
315  C C   . ALA A 41  ? 0.4864 0.3134 0.3368 0.1329 0.0951  0.0491  41  ALA A C   
316  O O   . ALA A 41  ? 0.5283 0.3573 0.3913 0.1285 0.1011  0.0516  41  ALA A O   
317  C CB  . ALA A 41  ? 0.5435 0.3621 0.3748 0.1392 0.0948  0.0491  41  ALA A CB  
318  N N   . TRP A 42  ? 0.4894 0.3210 0.3404 0.1328 0.0862  0.0448  42  TRP A N   
319  C CA  . TRP A 42  ? 0.4912 0.3301 0.3565 0.1277 0.0836  0.0435  42  TRP A CA  
320  C C   . TRP A 42  ? 0.5538 0.3920 0.4228 0.1274 0.0897  0.0467  42  TRP A C   
321  O O   . TRP A 42  ? 0.4946 0.3370 0.3770 0.1233 0.0939  0.0488  42  TRP A O   
322  C CB  . TRP A 42  ? 0.4645 0.3063 0.3273 0.1286 0.0740  0.0385  42  TRP A CB  
323  C CG  . TRP A 42  ? 0.4498 0.2979 0.3254 0.1242 0.0716  0.0376  42  TRP A CG  
324  C CD1 . TRP A 42  ? 0.4707 0.3249 0.3583 0.1195 0.0691  0.0368  42  TRP A CD1 
325  C CD2 . TRP A 42  ? 0.4876 0.3359 0.3642 0.1246 0.0719  0.0379  42  TRP A CD2 
326  N NE1 . TRP A 42  ? 0.4970 0.3553 0.3927 0.1173 0.0679  0.0367  42  TRP A NE1 
327  C CE2 . TRP A 42  ? 0.5071 0.3617 0.3963 0.1202 0.0695  0.0374  42  TRP A CE2 
328  C CE3 . TRP A 42  ? 0.4983 0.3417 0.3657 0.1286 0.0739  0.0385  42  TRP A CE3 
329  C CZ2 . TRP A 42  ? 0.5349 0.3911 0.4280 0.1197 0.0693  0.0377  42  TRP A CZ2 
330  C CZ3 . TRP A 42  ? 0.5309 0.3760 0.4027 0.1278 0.0736  0.0385  42  TRP A CZ3 
331  C CH2 . TRP A 42  ? 0.5538 0.4051 0.4383 0.1233 0.0714  0.0382  42  TRP A CH2 
332  N N   . LYS A 43  ? 0.5533 0.3867 0.4106 0.1322 0.0902  0.0470  43  LYS A N   
333  C CA  . LYS A 43  ? 0.5373 0.3699 0.3970 0.1325 0.0960  0.0500  43  LYS A CA  
334  C C   . LYS A 43  ? 0.5562 0.3874 0.4230 0.1306 0.1062  0.0547  43  LYS A C   
335  O O   . LYS A 43  ? 0.5490 0.3844 0.4279 0.1277 0.1100  0.0563  43  LYS A O   
336  C CB  . LYS A 43  ? 0.5775 0.4036 0.4214 0.1387 0.0960  0.0499  43  LYS A CB  
337  C CG  . LYS A 43  ? 0.6749 0.4998 0.5209 0.1393 0.1025  0.0532  43  LYS A CG  
338  C CD  . LYS A 43  ? 0.8698 0.6880 0.6996 0.1458 0.1027  0.0531  43  LYS A CD  
339  C CE  . LYS A 43  ? 1.0140 0.8339 0.8406 0.1470 0.0935  0.0479  43  LYS A CE  
340  N NZ  . LYS A 43  ? 1.0435 0.8584 0.8595 0.1520 0.0950  0.0484  43  LYS A NZ  
341  N N   . GLU A 44  ? 0.5128 0.3380 0.3723 0.1325 0.1110  0.0567  44  GLU A N   
342  C CA  . GLU A 44  ? 0.6041 0.4263 0.4696 0.1310 0.1219  0.0612  44  GLU A CA  
343  C C   . GLU A 44  ? 0.5896 0.4188 0.4745 0.1245 0.1231  0.0607  44  GLU A C   
344  O O   . GLU A 44  ? 0.5683 0.3989 0.4647 0.1221 0.1308  0.0630  44  GLU A O   
345  C CB  . GLU A 44  ? 0.6521 0.4656 0.5047 0.1346 0.1266  0.0634  44  GLU A CB  
346  C CG  . GLU A 44  ? 0.9312 0.7390 0.7878 0.1336 0.1396  0.0684  44  GLU A CG  
347  C CD  . GLU A 44  ? 1.1665 0.9649 1.0094 0.1376 0.1447  0.0709  44  GLU A CD  
348  O OE1 . GLU A 44  ? 1.2782 1.0685 1.1068 0.1432 0.1506  0.0744  44  GLU A OE1 
349  O OE2 . GLU A 44  ? 1.1608 0.9597 1.0067 0.1354 0.1431  0.0696  44  GLU A OE2 
350  N N   . LEU A 45  ? 0.5708 0.4048 0.4598 0.1220 0.1157  0.0573  45  LEU A N   
351  C CA  . LEU A 45  ? 0.4996 0.3404 0.4061 0.1165 0.1164  0.0564  45  LEU A CA  
352  C C   . LEU A 45  ? 0.4774 0.3267 0.3963 0.1143 0.1140  0.0555  45  LEU A C   
353  O O   . LEU A 45  ? 0.5570 0.4119 0.4916 0.1110 0.1184  0.0559  45  LEU A O   
354  C CB  . LEU A 45  ? 0.5279 0.3712 0.4342 0.1150 0.1090  0.0531  45  LEU A CB  
355  C CG  . LEU A 45  ? 0.6601 0.5037 0.5760 0.1113 0.1133  0.0533  45  LEU A CG  
356  C CD1 . LEU A 45  ? 0.5573 0.4050 0.4742 0.1098 0.1047  0.0497  45  LEU A CD1 
357  C CD2 . LEU A 45  ? 0.6348 0.4840 0.5694 0.1071 0.1195  0.0539  45  LEU A CD2 
358  N N   . VAL A 46  ? 0.4686 0.3192 0.3809 0.1164 0.1073  0.0539  46  VAL A N   
359  C CA  . VAL A 46  ? 0.4771 0.3347 0.3989 0.1151 0.1053  0.0535  46  VAL A CA  
360  C C   . VAL A 46  ? 0.5984 0.4557 0.5256 0.1158 0.1140  0.0567  46  VAL A C   
361  O O   . VAL A 46  ? 0.5601 0.4248 0.5023 0.1136 0.1165  0.0570  46  VAL A O   
362  C CB  . VAL A 46  ? 0.5041 0.3610 0.4166 0.1174 0.0976  0.0513  46  VAL A CB  
363  C CG1 . VAL A 46  ? 0.5175 0.3796 0.4376 0.1170 0.0975  0.0519  46  VAL A CG1 
364  C CG2 . VAL A 46  ? 0.5473 0.4066 0.4587 0.1159 0.0891  0.0476  46  VAL A CG2 
365  N N   . GLU A 47  ? 0.6289 0.4779 0.5440 0.1194 0.1188  0.0590  47  GLU A N   
366  C CA  . GLU A 47  ? 0.6433 0.4907 0.5618 0.1206 0.1277  0.0624  47  GLU A CA  
367  C C   . GLU A 47  ? 0.5919 0.4415 0.5253 0.1172 0.1367  0.0639  47  GLU A C   
368  O O   . GLU A 47  ? 0.7146 0.5697 0.6611 0.1160 0.1415  0.0647  47  GLU A O   
369  C CB  . GLU A 47  ? 0.7403 0.5775 0.6409 0.1256 0.1313  0.0647  47  GLU A CB  
370  C CG  . GLU A 47  ? 0.8922 0.7276 0.7793 0.1292 0.1231  0.0623  47  GLU A CG  
371  C CD  . GLU A 47  ? 1.1224 0.9625 1.0146 0.1293 0.1211  0.0618  47  GLU A CD  
372  O OE1 . GLU A 47  ? 1.2500 1.0872 1.1402 0.1317 0.1273  0.0646  47  GLU A OE1 
373  O OE2 . GLU A 47  ? 1.0739 0.9200 0.9718 0.1272 0.1136  0.0589  47  GLU A OE2 
374  N N   . LYS A 48  ? 0.5858 0.4314 0.5182 0.1157 0.1389  0.0639  48  LYS A N   
375  C CA  . LYS A 48  ? 0.6822 0.5287 0.6290 0.1121 0.1481  0.0647  48  LYS A CA  
376  C C   . LYS A 48  ? 0.7274 0.5862 0.6945 0.1074 0.1457  0.0611  48  LYS A C   
377  O O   . LYS A 48  ? 0.7218 0.5865 0.7059 0.1044 0.1530  0.0604  48  LYS A O   
378  C CB  . LYS A 48  ? 0.7965 0.6338 0.7345 0.1122 0.1516  0.0659  48  LYS A CB  
379  C CG  . LYS A 48  ? 0.9146 0.7514 0.8675 0.1077 0.1616  0.0662  48  LYS A CG  
380  C CD  . LYS A 48  ? 1.0416 0.8704 0.9865 0.1075 0.1631  0.0667  48  LYS A CD  
381  C CE  . LYS A 48  ? 1.1328 0.9509 1.0539 0.1136 0.1628  0.0700  48  LYS A CE  
382  N NZ  . LYS A 48  ? 1.1670 0.9758 1.0806 0.1141 0.1685  0.0718  48  LYS A NZ  
383  N N   . GLU A 49  ? 0.6583 0.5220 0.6244 0.1068 0.1357  0.0582  49  GLU A N   
384  C CA  . GLU A 49  ? 0.5872 0.4632 0.5703 0.1013 0.1325  0.0546  49  GLU A CA  
385  C C   . GLU A 49  ? 0.6016 0.4876 0.5858 0.0999 0.1209  0.0522  49  GLU A C   
386  O O   . GLU A 49  ? 0.6039 0.5039 0.6026 0.0952 0.1177  0.0497  49  GLU A O   
387  C CB  . GLU A 49  ? 0.6287 0.5005 0.6107 0.0987 0.1332  0.0535  49  GLU A CB  
388  C CG  . GLU A 49  ? 0.7622 0.6480 0.7616 0.0906 0.1299  0.0492  49  GLU A CG  
389  C CD  . GLU A 49  ? 0.8670 0.7477 0.8626 0.0888 0.1289  0.0480  49  GLU A CD  
390  O OE1 . GLU A 49  ? 0.9256 0.7919 0.9055 0.0942 0.1319  0.0507  49  GLU A OE1 
391  O OE2 . GLU A 49  ? 0.8680 0.7594 0.8756 0.0827 0.1251  0.0442  49  GLU A OE2 
392  N N   . ASP A 50  ? 0.5340 0.4128 0.5028 0.1043 0.1149  0.0527  50  ASP A N   
393  C CA  . ASP A 50  ? 0.5054 0.3913 0.4739 0.1027 0.1044  0.0503  50  ASP A CA  
394  C C   . ASP A 50  ? 0.4659 0.3637 0.4465 0.0959 0.0995  0.0472  50  ASP A C   
395  O O   . ASP A 50  ? 0.4396 0.3493 0.4303 0.0930 0.0954  0.0458  50  ASP A O   
396  C CB  . ASP A 50  ? 0.5060 0.3966 0.4768 0.1044 0.1027  0.0511  50  ASP A CB  
397  C CG  . ASP A 50  ? 0.5546 0.4467 0.5197 0.1047 0.0935  0.0495  50  ASP A CG  
398  O OD1 . ASP A 50  ? 0.5080 0.3955 0.4649 0.1048 0.0890  0.0480  50  ASP A OD1 
399  O OD2 . ASP A 50  ? 0.5192 0.4170 0.4882 0.1050 0.0910  0.0498  50  ASP A OD2 
400  N N   . PRO A 51  ? 0.4690 0.3635 0.4478 0.0941 0.0998  0.0461  51  PRO A N   
401  C CA  . PRO A 51  ? 0.4758 0.3810 0.4660 0.0878 0.0959  0.0429  51  PRO A CA  
402  C C   . PRO A 51  ? 0.4353 0.3481 0.4251 0.0860 0.0859  0.0408  51  PRO A C   
403  O O   . PRO A 51  ? 0.3749 0.2820 0.3534 0.0893 0.0814  0.0412  51  PRO A O   
404  C CB  . PRO A 51  ? 0.4401 0.3362 0.4238 0.0881 0.0986  0.0428  51  PRO A CB  
405  C CG  . PRO A 51  ? 0.4517 0.3339 0.4171 0.0953 0.0990  0.0452  51  PRO A CG  
406  C CD  . PRO A 51  ? 0.4615 0.3416 0.4257 0.0988 0.1030  0.0477  51  PRO A CD  
407  N N   . VAL A 52  ? 0.4128 0.3386 0.4154 0.0809 0.0827  0.0382  52  VAL A N   
408  C CA  . VAL A 52  ? 0.4070 0.3393 0.4092 0.0789 0.0742  0.0363  52  VAL A CA  
409  C C   . VAL A 52  ? 0.4346 0.3598 0.4280 0.0789 0.0717  0.0352  52  VAL A C   
410  O O   . VAL A 52  ? 0.4093 0.3326 0.4052 0.0770 0.0750  0.0342  52  VAL A O   
411  C CB  . VAL A 52  ? 0.4080 0.3554 0.4249 0.0740 0.0717  0.0336  52  VAL A CB  
412  C CG1 . VAL A 52  ? 0.3818 0.3347 0.3971 0.0722 0.0637  0.0319  52  VAL A CG1 
413  C CG2 . VAL A 52  ? 0.3895 0.3452 0.4150 0.0750 0.0734  0.0343  52  VAL A CG2 
414  N N   . VAL A 53  ? 0.3597 0.2808 0.3432 0.0810 0.0663  0.0350  53  VAL A N   
415  C CA  . VAL A 53  ? 0.3357 0.2521 0.3118 0.0812 0.0630  0.0333  53  VAL A CA  
416  C C   . VAL A 53  ? 0.3732 0.2997 0.3562 0.0763 0.0571  0.0305  53  VAL A C   
417  O O   . VAL A 53  ? 0.3447 0.2721 0.3293 0.0741 0.0567  0.0288  53  VAL A O   
418  C CB  . VAL A 53  ? 0.3478 0.2550 0.3103 0.0860 0.0603  0.0334  53  VAL A CB  
419  C CG1 . VAL A 53  ? 0.3471 0.2516 0.3031 0.0863 0.0560  0.0308  53  VAL A CG1 
420  C CG2 . VAL A 53  ? 0.3686 0.2651 0.3228 0.0916 0.0664  0.0360  53  VAL A CG2 
421  N N   . TYR A 54  ? 0.3148 0.2485 0.3013 0.0750 0.0529  0.0304  54  TYR A N   
422  C CA  . TYR A 54  ? 0.3414 0.2848 0.3341 0.0709 0.0480  0.0282  54  TYR A CA  
423  C C   . TYR A 54  ? 0.3397 0.2919 0.3381 0.0700 0.0456  0.0290  54  TYR A C   
424  O O   . TYR A 54  ? 0.3472 0.2968 0.3431 0.0728 0.0466  0.0311  54  TYR A O   
425  C CB  . TYR A 54  ? 0.3383 0.2782 0.3238 0.0707 0.0434  0.0262  54  TYR A CB  
426  C CG  . TYR A 54  ? 0.3788 0.3153 0.3580 0.0725 0.0400  0.0263  54  TYR A CG  
427  C CD1 . TYR A 54  ? 0.3390 0.2661 0.3097 0.0767 0.0416  0.0273  54  TYR A CD1 
428  C CD2 . TYR A 54  ? 0.3592 0.3014 0.3407 0.0699 0.0355  0.0252  54  TYR A CD2 
429  C CE1 . TYR A 54  ? 0.3769 0.3009 0.3427 0.0779 0.0386  0.0264  54  TYR A CE1 
430  C CE2 . TYR A 54  ? 0.3129 0.2513 0.2895 0.0709 0.0332  0.0248  54  TYR A CE2 
431  C CZ  . TYR A 54  ? 0.3291 0.2586 0.2984 0.0747 0.0347  0.0252  54  TYR A CZ  
432  O OH  . TYR A 54  ? 0.3501 0.2758 0.3156 0.0753 0.0326  0.0240  54  TYR A OH  
433  N N   . GLU A 55  ? 0.2963 0.2586 0.3019 0.0667 0.0426  0.0272  55  GLU A N   
434  C CA  . GLU A 55  ? 0.2891 0.2604 0.2994 0.0665 0.0401  0.0279  55  GLU A CA  
435  C C   . GLU A 55  ? 0.3064 0.2803 0.3144 0.0647 0.0352  0.0267  55  GLU A C   
436  O O   . GLU A 55  ? 0.3016 0.2749 0.3089 0.0625 0.0337  0.0245  55  GLU A O   
437  C CB  . GLU A 55  ? 0.3446 0.3276 0.3665 0.0649 0.0412  0.0263  55  GLU A CB  
438  C CG  . GLU A 55  ? 0.3725 0.3549 0.3989 0.0665 0.0464  0.0274  55  GLU A CG  
439  C CD  . GLU A 55  ? 0.4794 0.4741 0.5192 0.0641 0.0477  0.0245  55  GLU A CD  
440  O OE1 . GLU A 55  ? 0.5132 0.5134 0.5578 0.0607 0.0458  0.0212  55  GLU A OE1 
441  O OE2 . GLU A 55  ? 0.5868 0.5860 0.6327 0.0657 0.0505  0.0250  55  GLU A OE2 
442  N N   . VAL A 56  ? 0.3083 0.2846 0.3151 0.0659 0.0333  0.0284  56  VAL A N   
443  C CA  . VAL A 56  ? 0.3006 0.2799 0.3060 0.0643 0.0296  0.0277  56  VAL A CA  
444  C C   . VAL A 56  ? 0.2950 0.2846 0.3052 0.0653 0.0284  0.0289  56  VAL A C   
445  O O   . VAL A 56  ? 0.2950 0.2853 0.3056 0.0684 0.0299  0.0314  56  VAL A O   
446  C CB  . VAL A 56  ? 0.2921 0.2621 0.2897 0.0652 0.0290  0.0287  56  VAL A CB  
447  C CG1 . VAL A 56  ? 0.3186 0.2919 0.3157 0.0633 0.0263  0.0284  56  VAL A CG1 
448  C CG2 . VAL A 56  ? 0.3157 0.2769 0.3081 0.0650 0.0294  0.0268  56  VAL A CG2 
449  N N   . TYR A 57  ? 0.2832 0.2810 0.2967 0.0633 0.0256  0.0270  57  TYR A N   
450  C CA  . TYR A 57  ? 0.2988 0.3064 0.3150 0.0651 0.0239  0.0280  57  TYR A CA  
451  C C   . TYR A 57  ? 0.3102 0.3157 0.3211 0.0645 0.0221  0.0290  57  TYR A C   
452  O O   . TYR A 57  ? 0.2962 0.3039 0.3077 0.0616 0.0202  0.0265  57  TYR A O   
453  C CB  . TYR A 57  ? 0.3024 0.3223 0.3271 0.0636 0.0223  0.0245  57  TYR A CB  
454  C CG  . TYR A 57  ? 0.2960 0.3189 0.3280 0.0637 0.0248  0.0230  57  TYR A CG  
455  C CD1 . TYR A 57  ? 0.3472 0.3638 0.3804 0.0610 0.0274  0.0213  57  TYR A CD1 
456  C CD2 . TYR A 57  ? 0.3560 0.3880 0.3936 0.0668 0.0249  0.0232  57  TYR A CD2 
457  C CE1 . TYR A 57  ? 0.4167 0.4352 0.4569 0.0609 0.0309  0.0202  57  TYR A CE1 
458  C CE2 . TYR A 57  ? 0.3563 0.3916 0.4020 0.0664 0.0278  0.0215  57  TYR A CE2 
459  C CZ  . TYR A 57  ? 0.4215 0.4496 0.4685 0.0632 0.0311  0.0201  57  TYR A CZ  
460  O OH  . TYR A 57  ? 0.4379 0.4684 0.4932 0.0627 0.0351  0.0185  57  TYR A OH  
461  N N   . ALA A 58  ? 0.3041 0.3050 0.3099 0.0673 0.0233  0.0326  58  ALA A N   
462  C CA  . ALA A 58  ? 0.3139 0.3103 0.3146 0.0665 0.0231  0.0338  58  ALA A CA  
463  C C   . ALA A 58  ? 0.3542 0.3565 0.3533 0.0697 0.0227  0.0365  58  ALA A C   
464  O O   . ALA A 58  ? 0.3258 0.3306 0.3244 0.0741 0.0236  0.0392  58  ALA A O   
465  C CB  . ALA A 58  ? 0.3434 0.3271 0.3389 0.0666 0.0255  0.0353  58  ALA A CB  
466  N N   . VAL A 59  ? 0.2827 0.2870 0.2804 0.0679 0.0216  0.0359  59  VAL A N   
467  C CA  . VAL A 59  ? 0.3019 0.3099 0.2961 0.0713 0.0220  0.0389  59  VAL A CA  
468  C C   . VAL A 59  ? 0.3771 0.3747 0.3662 0.0697 0.0249  0.0409  59  VAL A C   
469  O O   . VAL A 59  ? 0.3452 0.3419 0.3350 0.0656 0.0243  0.0385  59  VAL A O   
470  C CB  . VAL A 59  ? 0.2899 0.3099 0.2869 0.0710 0.0187  0.0363  59  VAL A CB  
471  C CG1 . VAL A 59  ? 0.3285 0.3514 0.3199 0.0755 0.0194  0.0399  59  VAL A CG1 
472  C CG2 . VAL A 59  ? 0.3362 0.3670 0.3401 0.0718 0.0160  0.0331  59  VAL A CG2 
473  N N   . GLU A 60  ? 0.3356 0.3253 0.3202 0.0728 0.0284  0.0450  60  GLU A N   
474  C CA  . GLU A 60  ? 0.3514 0.3296 0.3326 0.0706 0.0321  0.0463  60  GLU A CA  
475  C C   . GLU A 60  ? 0.4094 0.3847 0.3849 0.0744 0.0359  0.0513  60  GLU A C   
476  O O   . GLU A 60  ? 0.4010 0.3799 0.3733 0.0804 0.0362  0.0550  60  GLU A O   
477  C CB  . GLU A 60  ? 0.4272 0.3953 0.4080 0.0700 0.0340  0.0460  60  GLU A CB  
478  C CG  . GLU A 60  ? 0.4408 0.4097 0.4255 0.0665 0.0311  0.0412  60  GLU A CG  
479  C CD  . GLU A 60  ? 0.6154 0.5736 0.5986 0.0659 0.0328  0.0403  60  GLU A CD  
480  O OE1 . GLU A 60  ? 0.5672 0.5206 0.5477 0.0695 0.0353  0.0434  60  GLU A OE1 
481  O OE2 . GLU A 60  ? 0.5891 0.5442 0.5735 0.0623 0.0315  0.0361  60  GLU A OE2 
482  N N   . GLN A 61  ? 0.3593 0.3282 0.3335 0.0712 0.0389  0.0514  61  GLN A N   
483  C CA  . GLN A 61  ? 0.3389 0.3027 0.3071 0.0745 0.0439  0.0565  61  GLN A CA  
484  C C   . GLN A 61  ? 0.4042 0.3534 0.3705 0.0736 0.0496  0.0584  61  GLN A C   
485  O O   . GLN A 61  ? 0.4072 0.3516 0.3769 0.0703 0.0488  0.0550  61  GLN A O   
486  C CB  . GLN A 61  ? 0.3402 0.3066 0.3090 0.0713 0.0446  0.0553  61  GLN A CB  
487  C CG  . GLN A 61  ? 0.3436 0.3237 0.3151 0.0711 0.0389  0.0522  61  GLN A CG  
488  C CD  . GLN A 61  ? 0.3580 0.3469 0.3256 0.0782 0.0370  0.0552  61  GLN A CD  
489  O OE1 . GLN A 61  ? 0.4403 0.4257 0.4010 0.0838 0.0408  0.0606  61  GLN A OE1 
490  N NE2 . GLN A 61  ? 0.3668 0.3673 0.3388 0.0783 0.0314  0.0516  61  GLN A NE2 
491  N N   . GLU A 62  ? 0.4456 0.3873 0.4061 0.0769 0.0555  0.0637  62  GLU A N   
492  C CA  . GLU A 62  ? 0.5149 0.4417 0.4746 0.0749 0.0618  0.0647  62  GLU A CA  
493  C C   . GLU A 62  ? 0.5004 0.4244 0.4670 0.0665 0.0619  0.0586  62  GLU A C   
494  O O   . GLU A 62  ? 0.4743 0.4058 0.4440 0.0633 0.0593  0.0557  62  GLU A O   
495  C CB  . GLU A 62  ? 0.5908 0.5092 0.5432 0.0792 0.0694  0.0714  62  GLU A CB  
496  C CG  . GLU A 62  ? 0.8183 0.7375 0.7628 0.0887 0.0702  0.0778  62  GLU A CG  
497  C CD  . GLU A 62  ? 0.9910 0.8964 0.9276 0.0930 0.0793  0.0846  62  GLU A CD  
498  O OE1 . GLU A 62  ? 1.0105 0.9047 0.9492 0.0876 0.0855  0.0838  62  GLU A OE1 
499  O OE2 . GLU A 62  ? 1.0309 0.9369 0.9594 0.1019 0.0806  0.0905  62  GLU A OE2 
500  N N   . GLU A 63  ? 0.4630 0.3767 0.4320 0.0633 0.0645  0.0562  63  GLU A N   
501  C CA  . GLU A 63  ? 0.4618 0.3737 0.4380 0.0559 0.0639  0.0493  63  GLU A CA  
502  C C   . GLU A 63  ? 0.5730 0.4802 0.5508 0.0525 0.0700  0.0498  63  GLU A C   
503  O O   . GLU A 63  ? 0.6254 0.5208 0.6040 0.0507 0.0767  0.0502  63  GLU A O   
504  C CB  . GLU A 63  ? 0.5160 0.4187 0.4940 0.0542 0.0647  0.0459  63  GLU A CB  
505  C CG  . GLU A 63  ? 0.6260 0.5325 0.6023 0.0576 0.0595  0.0455  63  GLU A CG  
506  C CD  . GLU A 63  ? 0.8077 0.7064 0.7860 0.0556 0.0594  0.0409  63  GLU A CD  
507  O OE1 . GLU A 63  ? 0.8917 0.7790 0.8687 0.0557 0.0650  0.0421  63  GLU A OE1 
508  O OE2 . GLU A 63  ? 0.7971 0.7007 0.7776 0.0542 0.0540  0.0361  63  GLU A OE2 
509  N N   . LYS A 64  ? 0.4634 0.3796 0.4422 0.0515 0.0681  0.0495  64  LYS A N   
510  C CA  . LYS A 64  ? 0.4996 0.4125 0.4797 0.0488 0.0742  0.0505  64  LYS A CA  
511  C C   . LYS A 64  ? 0.4965 0.4179 0.4842 0.0428 0.0702  0.0437  64  LYS A C   
512  O O   . LYS A 64  ? 0.4561 0.3883 0.4445 0.0434 0.0631  0.0414  64  LYS A O   
513  C CB  . LYS A 64  ? 0.5706 0.4858 0.5422 0.0552 0.0769  0.0580  64  LYS A CB  
514  C CG  . LYS A 64  ? 0.8122 0.7155 0.7800 0.0562 0.0872  0.0634  64  LYS A CG  
515  C CD  . LYS A 64  ? 0.9694 0.8661 0.9267 0.0649 0.0909  0.0716  64  LYS A CD  
516  C CE  . LYS A 64  ? 0.9861 0.8714 0.9441 0.0646 0.0935  0.0713  64  LYS A CE  
517  N NZ  . LYS A 64  ? 0.9712 0.8451 0.9195 0.0718 0.1012  0.0797  64  LYS A NZ  
518  N N   . GLU A 65  ? 0.4684 0.3846 0.4623 0.0372 0.0751  0.0403  65  GLU A N   
519  C CA  . GLU A 65  ? 0.4893 0.4136 0.4910 0.0317 0.0722  0.0339  65  GLU A CA  
520  C C   . GLU A 65  ? 0.4629 0.3973 0.4609 0.0343 0.0698  0.0367  65  GLU A C   
521  O O   . GLU A 65  ? 0.4449 0.3771 0.4361 0.0385 0.0745  0.0435  65  GLU A O   
522  C CB  . GLU A 65  ? 0.6134 0.5304 0.6222 0.0259 0.0799  0.0310  65  GLU A CB  
523  C CG  . GLU A 65  ? 0.8384 0.7418 0.8483 0.0248 0.0859  0.0311  65  GLU A CG  
524  C CD  . GLU A 65  ? 0.8820 0.7749 0.8826 0.0302 0.0938  0.0407  65  GLU A CD  
525  O OE1 . GLU A 65  ? 0.6372 0.5253 0.6317 0.0349 0.0927  0.0441  65  GLU A OE1 
526  O OE2 . GLU A 65  ? 1.0004 0.8895 0.9993 0.0303 0.1012  0.0450  65  GLU A OE2 
527  N N   . GLY A 66  ? 0.4147 0.3598 0.4165 0.0324 0.0626  0.0316  66  GLY A N   
528  C CA  . GLY A 66  ? 0.4220 0.3770 0.4217 0.0340 0.0602  0.0329  66  GLY A CA  
529  C C   . GLY A 66  ? 0.4284 0.3904 0.4217 0.0397 0.0547  0.0361  66  GLY A C   
530  O O   . GLY A 66  ? 0.4195 0.3911 0.4122 0.0407 0.0509  0.0353  66  GLY A O   
531  N N   . ASP A 67  ? 0.3940 0.3517 0.3831 0.0435 0.0544  0.0392  67  ASP A N   
532  C CA  . ASP A 67  ? 0.4004 0.3652 0.3846 0.0489 0.0498  0.0419  67  ASP A CA  
533  C C   . ASP A 67  ? 0.3268 0.2968 0.3151 0.0473 0.0428  0.0369  67  ASP A C   
534  O O   . ASP A 67  ? 0.3358 0.3028 0.3289 0.0431 0.0417  0.0320  67  ASP A O   
535  C CB  . ASP A 67  ? 0.4076 0.3656 0.3851 0.0546 0.0534  0.0482  67  ASP A CB  
536  C CG  . ASP A 67  ? 0.3909 0.3574 0.3628 0.0612 0.0505  0.0520  67  ASP A CG  
537  O OD1 . ASP A 67  ? 0.3800 0.3576 0.3539 0.0610 0.0449  0.0490  67  ASP A OD1 
538  O OD2 . ASP A 67  ? 0.3888 0.3509 0.3542 0.0670 0.0538  0.0576  67  ASP A OD2 
539  N N   . LEU A 68  ? 0.3088 0.2868 0.2952 0.0508 0.0383  0.0376  68  LEU A N   
540  C CA  . LEU A 68  ? 0.2834 0.2663 0.2737 0.0491 0.0325  0.0329  68  LEU A CA  
541  C C   . LEU A 68  ? 0.3020 0.2871 0.2905 0.0532 0.0303  0.0349  68  LEU A C   
542  O O   . LEU A 68  ? 0.3423 0.3319 0.3275 0.0576 0.0305  0.0385  68  LEU A O   
543  C CB  . LEU A 68  ? 0.2943 0.2871 0.2869 0.0477 0.0287  0.0298  68  LEU A CB  
544  C CG  . LEU A 68  ? 0.3188 0.3122 0.3144 0.0435 0.0297  0.0267  68  LEU A CG  
545  C CD1 . LEU A 68  ? 0.2866 0.2902 0.2834 0.0434 0.0259  0.0243  68  LEU A CD1 
546  C CD2 . LEU A 68  ? 0.2892 0.2779 0.2894 0.0394 0.0288  0.0217  68  LEU A CD2 
547  N N   . ASN A 69  ? 0.2965 0.2791 0.2872 0.0519 0.0282  0.0321  69  ASN A N   
548  C CA  . ASN A 69  ? 0.2884 0.2739 0.2791 0.0549 0.0260  0.0328  69  ASN A CA  
549  C C   . ASN A 69  ? 0.3567 0.3492 0.3513 0.0531 0.0218  0.0286  69  ASN A C   
550  O O   . ASN A 69  ? 0.2915 0.2844 0.2881 0.0497 0.0203  0.0249  69  ASN A O   
551  C CB  . ASN A 69  ? 0.2993 0.2756 0.2891 0.0553 0.0276  0.0331  69  ASN A CB  
552  C CG  . ASN A 69  ? 0.3595 0.3277 0.3455 0.0574 0.0324  0.0374  69  ASN A CG  
553  O OD1 . ASN A 69  ? 0.3487 0.3184 0.3319 0.0598 0.0346  0.0411  69  ASN A OD1 
554  N ND2 . ASN A 69  ? 0.3850 0.3440 0.3702 0.0571 0.0342  0.0369  69  ASN A ND2 
555  N N   . PHE A 70  ? 0.2947 0.2926 0.2907 0.0555 0.0201  0.0290  70  PHE A N   
556  C CA  . PHE A 70  ? 0.2986 0.3009 0.2985 0.0537 0.0172  0.0251  70  PHE A CA  
557  C C   . PHE A 70  ? 0.3088 0.3112 0.3102 0.0558 0.0174  0.0258  70  PHE A C   
558  O O   . PHE A 70  ? 0.2896 0.2930 0.2901 0.0592 0.0187  0.0289  70  PHE A O   
559  C CB  . PHE A 70  ? 0.2874 0.2997 0.2899 0.0529 0.0147  0.0230  70  PHE A CB  
560  C CG  . PHE A 70  ? 0.2900 0.3111 0.2929 0.0565 0.0140  0.0248  70  PHE A CG  
561  C CD1 . PHE A 70  ? 0.2871 0.3097 0.2859 0.0593 0.0152  0.0281  70  PHE A CD1 
562  C CD2 . PHE A 70  ? 0.2841 0.3123 0.2919 0.0575 0.0123  0.0229  70  PHE A CD2 
563  C CE1 . PHE A 70  ? 0.3042 0.3356 0.3026 0.0638 0.0141  0.0295  70  PHE A CE1 
564  C CE2 . PHE A 70  ? 0.2847 0.3225 0.2937 0.0612 0.0110  0.0235  70  PHE A CE2 
565  C CZ  . PHE A 70  ? 0.3077 0.3474 0.3114 0.0647 0.0115  0.0268  70  PHE A CZ  
566  N N   . SER A 71  ? 0.3006 0.3016 0.3042 0.0542 0.0166  0.0229  71  SER A N   
567  C CA  . SER A 71  ? 0.2983 0.2991 0.3040 0.0559 0.0177  0.0233  71  SER A CA  
568  C C   . SER A 71  ? 0.2874 0.2898 0.2966 0.0538 0.0169  0.0199  71  SER A C   
569  O O   . SER A 71  ? 0.3287 0.3306 0.3375 0.0515 0.0156  0.0173  71  SER A O   
570  C CB  . SER A 71  ? 0.3756 0.3660 0.3771 0.0573 0.0199  0.0252  71  SER A CB  
571  O OG  . SER A 71  ? 0.4867 0.4703 0.4855 0.0553 0.0194  0.0228  71  SER A OG  
572  N N   . THR A 72  ? 0.2579 0.2622 0.2708 0.0548 0.0183  0.0198  72  THR A N   
573  C CA  . THR A 72  ? 0.2553 0.2574 0.2705 0.0532 0.0194  0.0173  72  THR A CA  
574  C C   . THR A 72  ? 0.2996 0.2915 0.3106 0.0550 0.0222  0.0189  72  THR A C   
575  O O   . THR A 72  ? 0.3028 0.2925 0.3125 0.0574 0.0237  0.0216  72  THR A O   
576  C CB  . THR A 72  ? 0.2947 0.3057 0.3181 0.0524 0.0199  0.0152  72  THR A CB  
577  O OG1 . THR A 72  ? 0.2823 0.2977 0.3088 0.0549 0.0209  0.0172  72  THR A OG1 
578  C CG2 . THR A 72  ? 0.2834 0.3039 0.3103 0.0506 0.0168  0.0125  72  THR A CG2 
579  N N   . HIS A 73  ? 0.2607 0.2462 0.2690 0.0544 0.0228  0.0172  73  HIS A N   
580  C CA  . HIS A 73  ? 0.2932 0.2691 0.2970 0.0567 0.0258  0.0184  73  HIS A CA  
581  C C   . HIS A 73  ? 0.3306 0.3070 0.3387 0.0560 0.0288  0.0173  73  HIS A C   
582  O O   . HIS A 73  ? 0.3059 0.2840 0.3159 0.0540 0.0282  0.0149  73  HIS A O   
583  C CB  . HIS A 73  ? 0.3584 0.3262 0.3545 0.0576 0.0244  0.0172  73  HIS A CB  
584  C CG  . HIS A 73  ? 0.4415 0.4073 0.4341 0.0580 0.0224  0.0178  73  HIS A CG  
585  N ND1 . HIS A 73  ? 0.4441 0.4025 0.4305 0.0594 0.0214  0.0163  73  HIS A ND1 
586  C CD2 . HIS A 73  ? 0.4446 0.4147 0.4393 0.0573 0.0217  0.0193  73  HIS A CD2 
587  C CE1 . HIS A 73  ? 0.5330 0.4912 0.5190 0.0588 0.0204  0.0167  73  HIS A CE1 
588  N NE2 . HIS A 73  ? 0.4181 0.3826 0.4085 0.0577 0.0209  0.0189  73  HIS A NE2 
589  N N   . VAL A 74  ? 0.2798 0.2545 0.2900 0.0576 0.0326  0.0190  74  VAL A N   
590  C CA  . VAL A 74  ? 0.2754 0.2498 0.2907 0.0566 0.0368  0.0180  74  VAL A CA  
591  C C   . VAL A 74  ? 0.3181 0.2804 0.3259 0.0599 0.0409  0.0201  74  VAL A C   
592  O O   . VAL A 74  ? 0.3091 0.2688 0.3156 0.0623 0.0431  0.0225  74  VAL A O   
593  C CB  . VAL A 74  ? 0.3157 0.3000 0.3416 0.0556 0.0384  0.0176  74  VAL A CB  
594  C CG1 . VAL A 74  ? 0.3434 0.3277 0.3767 0.0536 0.0435  0.0157  74  VAL A CG1 
595  C CG2 . VAL A 74  ? 0.3150 0.3116 0.3463 0.0537 0.0337  0.0157  74  VAL A CG2 
596  N N   . ILE A 75  ? 0.3118 0.2664 0.3138 0.0607 0.0420  0.0193  75  ILE A N   
597  C CA  . ILE A 75  ? 0.3099 0.2524 0.3031 0.0650 0.0459  0.0213  75  ILE A CA  
598  C C   . ILE A 75  ? 0.3428 0.2821 0.3404 0.0646 0.0530  0.0219  75  ILE A C   
599  O O   . ILE A 75  ? 0.3310 0.2705 0.3320 0.0624 0.0545  0.0201  75  ILE A O   
600  C CB  . ILE A 75  ? 0.3500 0.2849 0.3327 0.0676 0.0435  0.0203  75  ILE A CB  
601  C CG1 . ILE A 75  ? 0.3474 0.2876 0.3291 0.0662 0.0367  0.0183  75  ILE A CG1 
602  C CG2 . ILE A 75  ? 0.3572 0.2804 0.3289 0.0734 0.0464  0.0223  75  ILE A CG2 
603  C CD1 . ILE A 75  ? 0.3496 0.2918 0.3311 0.0666 0.0348  0.0195  75  ILE A CD1 
604  N N   . TYR A 76  ? 0.3367 0.2727 0.3348 0.0666 0.0578  0.0244  76  TYR A N   
605  C CA  . TYR A 76  ? 0.3570 0.2897 0.3604 0.0659 0.0656  0.0249  76  TYR A CA  
606  C C   . TYR A 76  ? 0.3895 0.3079 0.3816 0.0700 0.0700  0.0266  76  TYR A C   
607  O O   . TYR A 76  ? 0.3774 0.2887 0.3571 0.0746 0.0672  0.0277  76  TYR A O   
608  C CB  . TYR A 76  ? 0.3636 0.2993 0.3735 0.0662 0.0697  0.0265  76  TYR A CB  
609  C CG  . TYR A 76  ? 0.4231 0.3740 0.4453 0.0624 0.0658  0.0243  76  TYR A CG  
610  C CD1 . TYR A 76  ? 0.5767 0.5366 0.6124 0.0579 0.0677  0.0210  76  TYR A CD1 
611  C CD2 . TYR A 76  ? 0.4002 0.3563 0.4203 0.0636 0.0601  0.0250  76  TYR A CD2 
612  C CE1 . TYR A 76  ? 0.5716 0.5463 0.6179 0.0553 0.0635  0.0184  76  TYR A CE1 
613  C CE2 . TYR A 76  ? 0.4431 0.4127 0.4730 0.0613 0.0565  0.0233  76  TYR A CE2 
614  C CZ  . TYR A 76  ? 0.5693 0.5486 0.6119 0.0575 0.0579  0.0199  76  TYR A CZ  
615  O OH  . TYR A 76  ? 0.6165 0.6101 0.6681 0.0561 0.0539  0.0177  76  TYR A OH  
616  N N   . PRO A 77  ? 0.3823 0.2966 0.3786 0.0686 0.0767  0.0264  77  PRO A N   
617  C CA  . PRO A 77  ? 0.3945 0.2944 0.3789 0.0733 0.0815  0.0284  77  PRO A CA  
618  C C   . PRO A 77  ? 0.4138 0.3029 0.3894 0.0790 0.0875  0.0325  77  PRO A C   
619  O O   . PRO A 77  ? 0.4428 0.3343 0.4258 0.0776 0.0923  0.0336  77  PRO A O   
620  C CB  . PRO A 77  ? 0.3966 0.2959 0.3904 0.0692 0.0878  0.0270  77  PRO A CB  
621  C CG  . PRO A 77  ? 0.3930 0.3039 0.4034 0.0637 0.0896  0.0251  77  PRO A CG  
622  C CD  . PRO A 77  ? 0.3873 0.3100 0.3995 0.0628 0.0804  0.0239  77  PRO A CD  
623  N N   . GLY A 78  ? 0.3986 0.2765 0.3582 0.0857 0.0872  0.0343  78  GLY A N   
624  C CA  . GLY A 78  ? 0.4444 0.3106 0.3933 0.0922 0.0933  0.0381  78  GLY A CA  
625  C C   . GLY A 78  ? 0.4623 0.3200 0.3933 0.1000 0.0891  0.0386  78  GLY A C   
626  O O   . GLY A 78  ? 0.4543 0.3160 0.3823 0.0999 0.0812  0.0357  78  GLY A O   
627  N N   . LYS A 79  ? 0.4143 0.2637 0.3340 0.1048 0.0931  0.0416  79  LYS A N   
628  C CA  . LYS A 79  ? 0.4348 0.2807 0.3381 0.1101 0.0878  0.0410  79  LYS A CA  
629  C C   . LYS A 79  ? 0.4567 0.3007 0.3534 0.1130 0.0889  0.0427  79  LYS A C   
630  O O   . LYS A 79  ? 0.5009 0.3429 0.4021 0.1119 0.0962  0.0456  79  LYS A O   
631  C CB  . LYS A 79  ? 0.4766 0.3141 0.3686 0.1134 0.0919  0.0427  79  LYS A CB  
632  C CG  . LYS A 79  ? 0.5186 0.3570 0.4143 0.1116 0.0902  0.0407  79  LYS A CG  
633  C CD  . LYS A 79  ? 0.7114 0.5419 0.5923 0.1166 0.0918  0.0421  79  LYS A CD  
634  C CE  . LYS A 79  ? 0.8504 0.6733 0.7338 0.1149 0.1026  0.0455  79  LYS A CE  
635  N NZ  . LYS A 79  ? 0.9757 0.7900 0.8427 0.1208 0.1050  0.0476  79  LYS A NZ  
636  N N   . VAL A 80  ? 0.4990 0.3434 0.3853 0.1168 0.0816  0.0403  80  VAL A N   
637  C CA  . VAL A 80  ? 0.5225 0.3635 0.3991 0.1208 0.0823  0.0414  80  VAL A CA  
638  C C   . VAL A 80  ? 0.4960 0.3302 0.3555 0.1271 0.0819  0.0416  80  VAL A C   
639  O O   . VAL A 80  ? 0.5057 0.3416 0.3582 0.1301 0.0741  0.0378  80  VAL A O   
640  C CB  . VAL A 80  ? 0.4532 0.2997 0.3315 0.1206 0.0746  0.0381  80  VAL A CB  
641  C CG1 . VAL A 80  ? 0.4970 0.3392 0.3646 0.1251 0.0754  0.0389  80  VAL A CG1 
642  C CG2 . VAL A 80  ? 0.4328 0.2862 0.3273 0.1150 0.0750  0.0384  80  VAL A CG2 
643  N N   . GLY A 81  ? 0.5120 0.3386 0.3649 0.1294 0.0907  0.0459  81  GLY A N   
644  C CA  . GLY A 81  ? 0.5337 0.3532 0.3701 0.1357 0.0917  0.0469  81  GLY A CA  
645  C C   . GLY A 81  ? 0.5234 0.3437 0.3626 0.1342 0.0901  0.0457  81  GLY A C   
646  O O   . GLY A 81  ? 0.5424 0.3617 0.3914 0.1297 0.0963  0.0477  81  GLY A O   
647  N N   . LYS A 82  ? 0.5034 0.3258 0.3347 0.1380 0.0818  0.0419  82  LYS A N   
648  C CA  . LYS A 82  ? 0.5485 0.3720 0.3814 0.1372 0.0795  0.0404  82  LYS A CA  
649  C C   . LYS A 82  ? 0.5017 0.3346 0.3482 0.1320 0.0720  0.0359  82  LYS A C   
650  O O   . LYS A 82  ? 0.4698 0.3047 0.3201 0.1306 0.0699  0.0344  82  LYS A O   
651  C CB  . LYS A 82  ? 0.5485 0.3690 0.3644 0.1452 0.0750  0.0387  82  LYS A CB  
652  C CG  . LYS A 82  ? 0.6889 0.4991 0.4885 0.1516 0.0826  0.0434  82  LYS A CG  
653  C CD  . LYS A 82  ? 0.7943 0.6028 0.5762 0.1606 0.0768  0.0412  82  LYS A CD  
654  C CE  . LYS A 82  ? 0.9996 0.7970 0.7643 0.1675 0.0855  0.0465  82  LYS A CE  
655  N NZ  . LYS A 82  ? 1.0733 0.8690 0.8186 0.1776 0.0796  0.0443  82  LYS A NZ  
656  N N   . GLU A 83  ? 0.4557 0.2940 0.3090 0.1296 0.0682  0.0340  83  GLU A N   
657  C CA  . GLU A 83  ? 0.4634 0.3103 0.3264 0.1263 0.0603  0.0295  83  GLU A CA  
658  C C   . GLU A 83  ? 0.4434 0.2948 0.3231 0.1193 0.0631  0.0306  83  GLU A C   
659  O O   . GLU A 83  ? 0.4540 0.3051 0.3395 0.1169 0.0679  0.0332  83  GLU A O   
660  C CB  . GLU A 83  ? 0.4651 0.3147 0.3243 0.1286 0.0540  0.0262  83  GLU A CB  
661  C CG  . GLU A 83  ? 0.4725 0.3298 0.3388 0.1266 0.0456  0.0209  83  GLU A CG  
662  C CD  . GLU A 83  ? 0.5148 0.3732 0.3766 0.1294 0.0403  0.0172  83  GLU A CD  
663  O OE1 . GLU A 83  ? 0.5568 0.4109 0.4125 0.1316 0.0435  0.0193  83  GLU A OE1 
664  O OE2 . GLU A 83  ? 0.5260 0.3895 0.3907 0.1293 0.0332  0.0118  83  GLU A OE2 
665  N N   . PHE A 84  ? 0.3926 0.2485 0.2799 0.1164 0.0602  0.0284  84  PHE A N   
666  C CA  . PHE A 84  ? 0.3728 0.2330 0.2752 0.1106 0.0629  0.0292  84  PHE A CA  
667  C C   . PHE A 84  ? 0.3668 0.2363 0.2780 0.1058 0.0585  0.0278  84  PHE A C   
668  O O   . PHE A 84  ? 0.3946 0.2664 0.3015 0.1075 0.0521  0.0250  84  PHE A O   
669  C CB  . PHE A 84  ? 0.3781 0.2446 0.2863 0.1066 0.0589  0.0263  84  PHE A CB  
670  C CG  . PHE A 84  ? 0.4111 0.2689 0.3139 0.1098 0.0644  0.0280  84  PHE A CG  
671  C CD1 . PHE A 84  ? 0.4168 0.2707 0.3264 0.1067 0.0733  0.0310  84  PHE A CD1 
672  C CD2 . PHE A 84  ? 0.4354 0.2914 0.3279 0.1142 0.0603  0.0261  84  PHE A CD2 
673  C CE1 . PHE A 84  ? 0.4641 0.3112 0.3698 0.1077 0.0785  0.0324  84  PHE A CE1 
674  C CE2 . PHE A 84  ? 0.4656 0.3153 0.3533 0.1156 0.0650  0.0278  84  PHE A CE2 
675  C CZ  . PHE A 84  ? 0.4839 0.3287 0.3779 0.1122 0.0743  0.0311  84  PHE A CZ  
676  N N   . PHE A 85  ? 0.3763 0.2513 0.3000 0.0997 0.0621  0.0294  85  PHE A N   
677  C CA  . PHE A 85  ? 0.3720 0.2568 0.3053 0.0947 0.0584  0.0285  85  PHE A CA  
678  C C   . PHE A 85  ? 0.3715 0.2651 0.3087 0.0909 0.0502  0.0247  85  PHE A C   
679  O O   . PHE A 85  ? 0.3543 0.2504 0.2933 0.0892 0.0484  0.0229  85  PHE A O   
680  C CB  . PHE A 85  ? 0.3873 0.2783 0.3343 0.0890 0.0630  0.0301  85  PHE A CB  
681  C CG  . PHE A 85  ? 0.4169 0.3023 0.3638 0.0913 0.0707  0.0335  85  PHE A CG  
682  C CD1 . PHE A 85  ? 0.4333 0.3072 0.3671 0.0985 0.0741  0.0358  85  PHE A CD1 
683  C CD2 . PHE A 85  ? 0.3922 0.2848 0.3527 0.0865 0.0746  0.0342  85  PHE A CD2 
684  C CE1 . PHE A 85  ? 0.4355 0.3042 0.3694 0.1006 0.0819  0.0392  85  PHE A CE1 
685  C CE2 . PHE A 85  ? 0.3959 0.2844 0.3578 0.0883 0.0821  0.0371  85  PHE A CE2 
686  C CZ  . PHE A 85  ? 0.4077 0.2837 0.3561 0.0953 0.0860  0.0399  85  PHE A CZ  
687  N N   . PHE A 86  ? 0.3639 0.2622 0.3029 0.0896 0.0457  0.0234  86  PHE A N   
688  C CA  . PHE A 86  ? 0.3322 0.2380 0.2747 0.0862 0.0388  0.0200  86  PHE A CA  
689  C C   . PHE A 86  ? 0.3735 0.2848 0.3219 0.0831 0.0370  0.0203  86  PHE A C   
690  O O   . PHE A 86  ? 0.3572 0.2657 0.3054 0.0846 0.0404  0.0229  86  PHE A O   
691  C CB  . PHE A 86  ? 0.3428 0.2446 0.2754 0.0906 0.0343  0.0165  86  PHE A CB  
692  C CG  . PHE A 86  ? 0.3788 0.2727 0.3012 0.0967 0.0347  0.0164  86  PHE A CG  
693  C CD1 . PHE A 86  ? 0.4229 0.3087 0.3331 0.1039 0.0352  0.0157  86  PHE A CD1 
694  C CD2 . PHE A 86  ? 0.3843 0.2788 0.3087 0.0958 0.0345  0.0169  86  PHE A CD2 
695  C CE1 . PHE A 86  ? 0.4224 0.3011 0.3224 0.1101 0.0354  0.0152  86  PHE A CE1 
696  C CE2 . PHE A 86  ? 0.4209 0.3079 0.3358 0.1015 0.0348  0.0164  86  PHE A CE2 
697  C CZ  . PHE A 86  ? 0.4206 0.3001 0.3233 0.1087 0.0351  0.0154  86  PHE A CZ  
698  N N   . ALA A 87  ? 0.3486 0.2671 0.3021 0.0792 0.0321  0.0179  87  ALA A N   
699  C CA  . ALA A 87  ? 0.3097 0.2317 0.2669 0.0770 0.0304  0.0182  87  ALA A CA  
700  C C   . ALA A 87  ? 0.3632 0.2791 0.3130 0.0803 0.0283  0.0160  87  ALA A C   
701  O O   . ALA A 87  ? 0.3348 0.2470 0.2778 0.0834 0.0261  0.0130  87  ALA A O   
702  C CB  . ALA A 87  ? 0.3081 0.2390 0.2728 0.0720 0.0269  0.0168  87  ALA A CB  
703  N N   . LYS A 88  ? 0.3435 0.2586 0.2944 0.0800 0.0287  0.0170  88  LYS A N   
704  C CA  . LYS A 88  ? 0.3358 0.2448 0.2801 0.0830 0.0269  0.0141  88  LYS A CA  
705  C C   . LYS A 88  ? 0.3484 0.2595 0.2924 0.0815 0.0218  0.0087  88  LYS A C   
706  O O   . LYS A 88  ? 0.3901 0.2970 0.3273 0.0853 0.0196  0.0048  88  LYS A O   
707  C CB  . LYS A 88  ? 0.3113 0.2188 0.2576 0.0824 0.0284  0.0160  88  LYS A CB  
708  C CG  . LYS A 88  ? 0.3307 0.2342 0.2748 0.0858 0.0332  0.0202  88  LYS A CG  
709  C CD  . LYS A 88  ? 0.3179 0.2194 0.2632 0.0859 0.0345  0.0217  88  LYS A CD  
710  C CE  . LYS A 88  ? 0.3951 0.2914 0.3367 0.0903 0.0390  0.0250  88  LYS A CE  
711  N NZ  . LYS A 88  ? 0.4046 0.2971 0.3454 0.0914 0.0400  0.0258  88  LYS A NZ  
712  N N   . GLY A 89  ? 0.3368 0.2551 0.2885 0.0764 0.0201  0.0082  89  GLY A N   
713  C CA  . GLY A 89  ? 0.3437 0.2648 0.2971 0.0742 0.0160  0.0030  89  GLY A CA  
714  C C   . GLY A 89  ? 0.3890 0.3083 0.3447 0.0723 0.0157  0.0012  89  GLY A C   
715  O O   . GLY A 89  ? 0.3661 0.2794 0.3183 0.0748 0.0177  0.0022  89  GLY A O   
716  N N   . HIS A 90  ? 0.3711 0.2950 0.3328 0.0679 0.0139  -0.0015 90  HIS A N   
717  C CA  . HIS A 90  ? 0.3696 0.2911 0.3344 0.0655 0.0145  -0.0036 90  HIS A CA  
718  C C   . HIS A 90  ? 0.3793 0.3059 0.3499 0.0614 0.0120  -0.0087 90  HIS A C   
719  O O   . HIS A 90  ? 0.3610 0.2939 0.3344 0.0597 0.0105  -0.0087 90  HIS A O   
720  C CB  . HIS A 90  ? 0.3553 0.2763 0.3233 0.0636 0.0186  0.0024  90  HIS A CB  
721  C CG  . HIS A 90  ? 0.3498 0.2782 0.3229 0.0605 0.0190  0.0057  90  HIS A CG  
722  N ND1 . HIS A 90  ? 0.3701 0.3022 0.3429 0.0618 0.0197  0.0096  90  HIS A ND1 
723  C CD2 . HIS A 90  ? 0.3819 0.3146 0.3604 0.0564 0.0192  0.0054  90  HIS A CD2 
724  C CE1 . HIS A 90  ? 0.3966 0.3355 0.3743 0.0587 0.0196  0.0111  90  HIS A CE1 
725  N NE2 . HIS A 90  ? 0.3691 0.3082 0.3497 0.0557 0.0194  0.0091  90  HIS A NE2 
726  N N   . PHE A 91  ? 0.3620 0.2859 0.3349 0.0598 0.0116  -0.0136 91  PHE A N   
727  C CA  . PHE A 91  ? 0.4156 0.3441 0.3964 0.0547 0.0110  -0.0176 91  PHE A CA  
728  C C   . PHE A 91  ? 0.3959 0.3234 0.3812 0.0509 0.0157  -0.0123 91  PHE A C   
729  O O   . PHE A 91  ? 0.3761 0.2985 0.3585 0.0525 0.0190  -0.0070 91  PHE A O   
730  C CB  . PHE A 91  ? 0.4118 0.3383 0.3947 0.0541 0.0089  -0.0261 91  PHE A CB  
731  C CG  . PHE A 91  ? 0.4085 0.3383 0.3876 0.0581 0.0035  -0.0325 91  PHE A CG  
732  C CD1 . PHE A 91  ? 0.4066 0.3315 0.3769 0.0643 0.0018  -0.0336 91  PHE A CD1 
733  C CD2 . PHE A 91  ? 0.3958 0.3338 0.3797 0.0564 0.0001  -0.0373 91  PHE A CD2 
734  C CE1 . PHE A 91  ? 0.4104 0.3379 0.3756 0.0692 -0.0032 -0.0392 91  PHE A CE1 
735  C CE2 . PHE A 91  ? 0.3970 0.3381 0.3766 0.0611 -0.0051 -0.0431 91  PHE A CE2 
736  C CZ  . PHE A 91  ? 0.4168 0.3526 0.3867 0.0677 -0.0068 -0.0440 91  PHE A CZ  
737  N N   . HIS A 92  ? 0.3346 0.2671 0.3264 0.0464 0.0162  -0.0135 92  HIS A N   
738  C CA  . HIS A 92  ? 0.3779 0.3086 0.3734 0.0433 0.0211  -0.0090 92  HIS A CA  
739  C C   . HIS A 92  ? 0.4234 0.3466 0.4217 0.0412 0.0241  -0.0124 92  HIS A C   
740  O O   . HIS A 92  ? 0.4539 0.3770 0.4548 0.0402 0.0217  -0.0202 92  HIS A O   
741  C CB  . HIS A 92  ? 0.3997 0.3376 0.4007 0.0395 0.0212  -0.0092 92  HIS A CB  
742  C CG  . HIS A 92  ? 0.3672 0.3115 0.3658 0.0411 0.0193  -0.0051 92  HIS A CG  
743  N ND1 . HIS A 92  ? 0.3909 0.3429 0.3926 0.0394 0.0168  -0.0076 92  HIS A ND1 
744  C CD2 . HIS A 92  ? 0.3652 0.3098 0.3595 0.0442 0.0198  0.0007  92  HIS A CD2 
745  C CE1 . HIS A 92  ? 0.3974 0.3534 0.3965 0.0412 0.0159  -0.0034 92  HIS A CE1 
746  N NE2 . HIS A 92  ? 0.3943 0.3464 0.3894 0.0439 0.0177  0.0014  92  HIS A NE2 
747  N N   . ALA A 93  ? 0.3841 0.3012 0.3816 0.0410 0.0294  -0.0069 93  ALA A N   
748  C CA  . ALA A 93  ? 0.4492 0.3577 0.4493 0.0390 0.0334  -0.0095 93  ALA A CA  
749  C C   . ALA A 93  ? 0.5039 0.4142 0.5128 0.0332 0.0354  -0.0143 93  ALA A C   
750  O O   . ALA A 93  ? 0.4802 0.3871 0.4943 0.0304 0.0361  -0.0214 93  ALA A O   
751  C CB  . ALA A 93  ? 0.4891 0.3901 0.4854 0.0410 0.0390  -0.0015 93  ALA A CB  
752  N N   . LYS A 94  ? 0.4257 0.3418 0.4369 0.0313 0.0365  -0.0109 94  LYS A N   
753  C CA  . LYS A 94  ? 0.4496 0.3701 0.4695 0.0260 0.0374  -0.0162 94  LYS A CA  
754  C C   . LYS A 94  ? 0.4435 0.3742 0.4642 0.0267 0.0303  -0.0212 94  LYS A C   
755  O O   . LYS A 94  ? 0.4399 0.3771 0.4585 0.0279 0.0284  -0.0175 94  LYS A O   
756  C CB  . LYS A 94  ? 0.4686 0.3894 0.4899 0.0239 0.0429  -0.0099 94  LYS A CB  
757  C CG  . LYS A 94  ? 0.5212 0.4309 0.5418 0.0233 0.0510  -0.0052 94  LYS A CG  
758  C CD  . LYS A 94  ? 0.5901 0.5005 0.6117 0.0217 0.0565  0.0004  94  LYS A CD  
759  C CE  . LYS A 94  ? 0.7005 0.5989 0.7228 0.0203 0.0658  0.0039  94  LYS A CE  
760  N NZ  . LYS A 94  ? 0.7840 0.6755 0.7969 0.0260 0.0684  0.0125  94  LYS A NZ  
761  N N   . LEU A 95  ? 0.3882 0.3202 0.4119 0.0264 0.0264  -0.0300 95  LEU A N   
762  C CA  . LEU A 95  ? 0.4303 0.3700 0.4521 0.0292 0.0193  -0.0348 95  LEU A CA  
763  C C   . LEU A 95  ? 0.3910 0.3403 0.4163 0.0275 0.0174  -0.0349 95  LEU A C   
764  O O   . LEU A 95  ? 0.4229 0.3769 0.4432 0.0310 0.0130  -0.0338 95  LEU A O   
765  C CB  . LEU A 95  ? 0.4734 0.4138 0.4993 0.0289 0.0157  -0.0454 95  LEU A CB  
766  C CG  . LEU A 95  ? 0.6029 0.5451 0.6217 0.0349 0.0091  -0.0496 95  LEU A CG  
767  C CD1 . LEU A 95  ? 0.4719 0.4074 0.4799 0.0402 0.0097  -0.0422 95  LEU A CD1 
768  C CD2 . LEU A 95  ? 0.5591 0.5012 0.5826 0.0344 0.0065  -0.0605 95  LEU A CD2 
769  N N   . ASP A 96  ? 0.3908 0.3422 0.4244 0.0223 0.0212  -0.0363 96  ASP A N   
770  C CA  . ASP A 96  ? 0.4235 0.3843 0.4613 0.0204 0.0195  -0.0376 96  ASP A CA  
771  C C   . ASP A 96  ? 0.4453 0.4078 0.4781 0.0217 0.0212  -0.0286 96  ASP A C   
772  O O   . ASP A 96  ? 0.4772 0.4460 0.5138 0.0195 0.0218  -0.0284 96  ASP A O   
773  C CB  . ASP A 96  ? 0.4353 0.3984 0.4847 0.0143 0.0232  -0.0433 96  ASP A CB  
774  C CG  . ASP A 96  ? 0.5559 0.5115 0.6072 0.0109 0.0318  -0.0373 96  ASP A CG  
775  O OD1 . ASP A 96  ? 0.6133 0.5620 0.6567 0.0138 0.0344  -0.0292 96  ASP A OD1 
776  O OD2 . ASP A 96  ? 0.5738 0.5302 0.6345 0.0057 0.0364  -0.0407 96  ASP A OD2 
777  N N   . ARG A 97  ? 0.3881 0.3458 0.4130 0.0253 0.0219  -0.0217 97  ARG A N   
778  C CA  . ARG A 97  ? 0.3451 0.3060 0.3656 0.0270 0.0224  -0.0144 97  ARG A CA  
779  C C   . ARG A 97  ? 0.3450 0.3113 0.3615 0.0304 0.0166  -0.0154 97  ARG A C   
780  O O   . ARG A 97  ? 0.3718 0.3357 0.3844 0.0335 0.0135  -0.0175 97  ARG A O   
781  C CB  . ARG A 97  ? 0.3494 0.3035 0.3642 0.0294 0.0261  -0.0068 97  ARG A CB  
782  C CG  . ARG A 97  ? 0.4238 0.3745 0.4404 0.0273 0.0327  -0.0021 97  ARG A CG  
783  C CD  . ARG A 97  ? 0.3905 0.3371 0.4143 0.0226 0.0366  -0.0071 97  ARG A CD  
784  N NE  . ARG A 97  ? 0.4005 0.3417 0.4247 0.0211 0.0442  -0.0018 97  ARG A NE  
785  C CZ  . ARG A 97  ? 0.4658 0.4043 0.4971 0.0164 0.0494  -0.0046 97  ARG A CZ  
786  N NH1 . ARG A 97  ? 0.4668 0.4090 0.5065 0.0124 0.0473  -0.0135 97  ARG A NH1 
787  N NH2 . ARG A 97  ? 0.4458 0.3781 0.4758 0.0160 0.0571  0.0013  97  ARG A NH2 
788  N N   . ALA A 98  ? 0.3153 0.2884 0.3324 0.0300 0.0155  -0.0139 98  ALA A N   
789  C CA  . ALA A 98  ? 0.2996 0.2770 0.3130 0.0330 0.0110  -0.0144 98  ALA A CA  
790  C C   . ALA A 98  ? 0.3220 0.2985 0.3302 0.0357 0.0118  -0.0078 98  ALA A C   
791  O O   . ALA A 98  ? 0.3191 0.2925 0.3262 0.0357 0.0153  -0.0028 98  ALA A O   
792  C CB  . ALA A 98  ? 0.3253 0.3107 0.3426 0.0312 0.0093  -0.0171 98  ALA A CB  
793  N N   . GLN A 99  ? 0.3059 0.2849 0.3111 0.0381 0.0087  -0.0079 99  GLN A N   
794  C CA  . GLN A 99  ? 0.2962 0.2764 0.2987 0.0398 0.0095  -0.0027 99  GLN A CA  
795  C C   . GLN A 99  ? 0.3258 0.3114 0.3283 0.0404 0.0069  -0.0041 99  GLN A C   
796  O O   . GLN A 99  ? 0.3243 0.3107 0.3266 0.0410 0.0043  -0.0085 99  GLN A O   
797  C CB  . GLN A 99  ? 0.3514 0.3253 0.3495 0.0430 0.0102  -0.0004 99  GLN A CB  
798  C CG  . GLN A 99  ? 0.3929 0.3631 0.3875 0.0457 0.0077  -0.0042 99  GLN A CG  
799  C CD  . GLN A 99  ? 0.4459 0.4091 0.4360 0.0488 0.0092  -0.0019 99  GLN A CD  
800  O OE1 . GLN A 99  ? 0.3752 0.3378 0.3634 0.0505 0.0106  0.0019  99  GLN A OE1 
801  N NE2 . GLN A 99  ? 0.4710 0.4291 0.4598 0.0494 0.0090  -0.0048 99  GLN A NE2 
802  N N   . VAL A 100 ? 0.2603 0.2497 0.2630 0.0405 0.0077  -0.0007 100 VAL A N   
803  C CA  . VAL A 100 ? 0.2926 0.2867 0.2958 0.0407 0.0058  -0.0020 100 VAL A CA  
804  C C   . VAL A 100 ? 0.3461 0.3391 0.3477 0.0427 0.0066  0.0008  100 VAL A C   
805  O O   . VAL A 100 ? 0.3510 0.3450 0.3532 0.0430 0.0083  0.0043  100 VAL A O   
806  C CB  . VAL A 100 ? 0.3376 0.3390 0.3440 0.0384 0.0059  -0.0018 100 VAL A CB  
807  C CG1 . VAL A 100 ? 0.3812 0.3874 0.3883 0.0387 0.0041  -0.0032 100 VAL A CG1 
808  C CG2 . VAL A 100 ? 0.3438 0.3463 0.3527 0.0362 0.0057  -0.0050 100 VAL A CG2 
809  N N   . ALA A 101 ? 0.2901 0.2811 0.2900 0.0443 0.0057  -0.0008 101 ALA A N   
810  C CA  . ALA A 101 ? 0.2882 0.2775 0.2876 0.0458 0.0073  0.0013  101 ALA A CA  
811  C C   . ALA A 101 ? 0.3969 0.3900 0.3984 0.0451 0.0068  -0.0004 101 ALA A C   
812  O O   . ALA A 101 ? 0.3592 0.3519 0.3593 0.0454 0.0053  -0.0032 101 ALA A O   
813  C CB  . ALA A 101 ? 0.2889 0.2699 0.2835 0.0488 0.0082  0.0014  101 ALA A CB  
814  N N   . VAL A 102 ? 0.3144 0.3115 0.3195 0.0444 0.0081  0.0010  102 VAL A N   
815  C CA  . VAL A 102 ? 0.3402 0.3407 0.3483 0.0433 0.0081  -0.0010 102 VAL A CA  
816  C C   . VAL A 102 ? 0.3396 0.3362 0.3488 0.0442 0.0112  -0.0003 102 VAL A C   
817  O O   . VAL A 102 ? 0.3049 0.3032 0.3168 0.0443 0.0127  0.0017  102 VAL A O   
818  C CB  . VAL A 102 ? 0.4148 0.4252 0.4279 0.0412 0.0070  -0.0014 102 VAL A CB  
819  C CG1 . VAL A 102 ? 0.4064 0.4205 0.4224 0.0399 0.0063  -0.0048 102 VAL A CG1 
820  C CG2 . VAL A 102 ? 0.5010 0.5145 0.5128 0.0407 0.0055  -0.0006 102 VAL A CG2 
821  N N   . ALA A 103 ? 0.2996 0.2909 0.3069 0.0452 0.0125  -0.0017 103 ALA A N   
822  C CA  . ALA A 103 ? 0.3397 0.3264 0.3485 0.0458 0.0166  -0.0009 103 ALA A CA  
823  C C   . ALA A 103 ? 0.3689 0.3635 0.3865 0.0427 0.0175  -0.0027 103 ALA A C   
824  O O   . ALA A 103 ? 0.3767 0.3763 0.3970 0.0409 0.0158  -0.0055 103 ALA A O   
825  C CB  . ALA A 103 ? 0.3506 0.3279 0.3538 0.0484 0.0187  -0.0015 103 ALA A CB  
826  N N   . LEU A 104 ? 0.3170 0.3132 0.3393 0.0423 0.0201  -0.0015 104 LEU A N   
827  C CA  . LEU A 104 ? 0.3518 0.3569 0.3836 0.0395 0.0207  -0.0041 104 LEU A CA  
828  C C   . LEU A 104 ? 0.3914 0.3918 0.4279 0.0385 0.0260  -0.0054 104 LEU A C   
829  O O   . LEU A 104 ? 0.3896 0.3953 0.4338 0.0357 0.0267  -0.0092 104 LEU A O   
830  C CB  . LEU A 104 ? 0.3604 0.3737 0.3962 0.0397 0.0193  -0.0028 104 LEU A CB  
831  C CG  . LEU A 104 ? 0.3874 0.4048 0.4189 0.0408 0.0153  -0.0010 104 LEU A CG  
832  C CD1 . LEU A 104 ? 0.3661 0.3901 0.4005 0.0422 0.0148  0.0009  104 LEU A CD1 
833  C CD2 . LEU A 104 ? 0.3800 0.4042 0.4126 0.0392 0.0120  -0.0040 104 LEU A CD2 
834  N N   . LYS A 105 ? 0.3796 0.3699 0.4117 0.0408 0.0301  -0.0024 105 LYS A N   
835  C CA  . LYS A 105 ? 0.3605 0.3452 0.3970 0.0400 0.0365  -0.0029 105 LYS A CA  
836  C C   . LYS A 105 ? 0.4053 0.3759 0.4324 0.0439 0.0408  0.0008  105 LYS A C   
837  O O   . LYS A 105 ? 0.3434 0.3107 0.3630 0.0471 0.0390  0.0038  105 LYS A O   
838  C CB  . LYS A 105 ? 0.3872 0.3803 0.4343 0.0380 0.0383  -0.0039 105 LYS A CB  
839  C CG  . LYS A 105 ? 0.5552 0.5434 0.6092 0.0363 0.0458  -0.0050 105 LYS A CG  
840  C CD  . LYS A 105 ? 0.7143 0.7129 0.7804 0.0343 0.0471  -0.0069 105 LYS A CD  
841  C CE  . LYS A 105 ? 0.7807 0.7718 0.8518 0.0336 0.0557  -0.0063 105 LYS A CE  
842  N NZ  . LYS A 105 ? 0.7119 0.6890 0.7707 0.0382 0.0591  -0.0004 105 LYS A NZ  
843  N N   . GLY A 106 ? 0.3730 0.3349 0.4001 0.0441 0.0467  0.0005  106 GLY A N   
844  C CA  . GLY A 106 ? 0.3683 0.3164 0.3862 0.0485 0.0519  0.0042  106 GLY A CA  
845  C C   . GLY A 106 ? 0.4271 0.3660 0.4321 0.0531 0.0502  0.0054  106 GLY A C   
846  O O   . GLY A 106 ? 0.4268 0.3694 0.4308 0.0524 0.0457  0.0029  106 GLY A O   
847  N N   . LYS A 107 ? 0.3965 0.3239 0.3915 0.0584 0.0537  0.0088  107 LYS A N   
848  C CA  . LYS A 107 ? 0.4254 0.3437 0.4073 0.0641 0.0525  0.0097  107 LYS A CA  
849  C C   . LYS A 107 ? 0.4273 0.3439 0.4003 0.0684 0.0488  0.0115  107 LYS A C   
850  O O   . LYS A 107 ? 0.3849 0.2962 0.3551 0.0708 0.0526  0.0143  107 LYS A O   
851  C CB  . LYS A 107 ? 0.5364 0.4407 0.5125 0.0677 0.0609  0.0119  107 LYS A CB  
852  C CG  . LYS A 107 ? 0.7473 0.6435 0.7116 0.0733 0.0597  0.0118  107 LYS A CG  
853  C CD  . LYS A 107 ? 0.8267 0.7077 0.7846 0.0774 0.0691  0.0146  107 LYS A CD  
854  C CE  . LYS A 107 ? 0.8638 0.7389 0.8130 0.0819 0.0681  0.0137  107 LYS A CE  
855  N NZ  . LYS A 107 ? 0.8829 0.7637 0.8247 0.0857 0.0586  0.0119  107 LYS A NZ  
856  N N   . GLY A 108 ? 0.3832 0.3044 0.3524 0.0694 0.0417  0.0095  108 GLY A N   
857  C CA  . GLY A 108 ? 0.4035 0.3241 0.3660 0.0727 0.0380  0.0102  108 GLY A CA  
858  C C   . GLY A 108 ? 0.4170 0.3416 0.3757 0.0740 0.0311  0.0071  108 GLY A C   
859  O O   . GLY A 108 ? 0.4241 0.3492 0.3820 0.0743 0.0298  0.0051  108 GLY A O   
860  N N   . GLY A 109 ? 0.3759 0.3032 0.3326 0.0747 0.0270  0.0064  109 GLY A N   
861  C CA  . GLY A 109 ? 0.3444 0.2762 0.2989 0.0756 0.0207  0.0028  109 GLY A CA  
862  C C   . GLY A 109 ? 0.4194 0.3542 0.3746 0.0747 0.0176  0.0022  109 GLY A C   
863  O O   . GLY A 109 ? 0.3614 0.2945 0.3179 0.0740 0.0202  0.0049  109 GLY A O   
864  N N   . VAL A 110 ? 0.3329 0.2721 0.2876 0.0748 0.0123  -0.0016 110 VAL A N   
865  C CA  . VAL A 110 ? 0.3332 0.2744 0.2888 0.0739 0.0097  -0.0029 110 VAL A CA  
866  C C   . VAL A 110 ? 0.3809 0.3190 0.3288 0.0793 0.0062  -0.0068 110 VAL A C   
867  O O   . VAL A 110 ? 0.3749 0.3157 0.3212 0.0811 0.0029  -0.0105 110 VAL A O   
868  C CB  . VAL A 110 ? 0.3588 0.3094 0.3234 0.0678 0.0071  -0.0045 110 VAL A CB  
869  C CG1 . VAL A 110 ? 0.3630 0.3141 0.3290 0.0666 0.0058  -0.0054 110 VAL A CG1 
870  C CG2 . VAL A 110 ? 0.3417 0.2964 0.3132 0.0636 0.0099  -0.0013 110 VAL A CG2 
871  N N   . LEU A 111 ? 0.3606 0.2936 0.3037 0.0822 0.0069  -0.0063 111 LEU A N   
872  C CA  . LEU A 111 ? 0.3614 0.2927 0.2980 0.0871 0.0029  -0.0109 111 LEU A CA  
873  C C   . LEU A 111 ? 0.3504 0.2873 0.2940 0.0827 -0.0001 -0.0144 111 LEU A C   
874  O O   . LEU A 111 ? 0.3908 0.3271 0.3385 0.0791 0.0023  -0.0116 111 LEU A O   
875  C CB  . LEU A 111 ? 0.3787 0.3004 0.3051 0.0936 0.0056  -0.0088 111 LEU A CB  
876  C CG  . LEU A 111 ? 0.3855 0.3050 0.3034 0.1002 0.0015  -0.0139 111 LEU A CG  
877  C CD1 . LEU A 111 ? 0.4106 0.3307 0.3225 0.1056 -0.0014 -0.0168 111 LEU A CD1 
878  C CD2 . LEU A 111 ? 0.3954 0.3052 0.3036 0.1060 0.0049  -0.0109 111 LEU A CD2 
879  N N   . MET A 112 ? 0.3453 0.2873 0.2904 0.0830 -0.0049 -0.0206 112 MET A N   
880  C CA  . MET A 112 ? 0.3485 0.2957 0.3015 0.0780 -0.0070 -0.0245 112 MET A CA  
881  C C   . MET A 112 ? 0.3898 0.3370 0.3394 0.0821 -0.0113 -0.0316 112 MET A C   
882  O O   . MET A 112 ? 0.4256 0.3725 0.3683 0.0884 -0.0144 -0.0349 112 MET A O   
883  C CB  . MET A 112 ? 0.3710 0.3271 0.3336 0.0722 -0.0083 -0.0261 112 MET A CB  
884  C CG  . MET A 112 ? 0.3401 0.2977 0.3078 0.0671 -0.0044 -0.0199 112 MET A CG  
885  S SD  . MET A 112 ? 0.2947 0.2611 0.2692 0.0631 -0.0056 -0.0209 112 MET A SD  
886  C CE  . MET A 112 ? 0.4588 0.4217 0.4245 0.0699 -0.0067 -0.0215 112 MET A CE  
887  N N   . GLN A 113 ? 0.3995 0.3472 0.3542 0.0787 -0.0115 -0.0342 113 GLN A N   
888  C CA  . GLN A 113 ? 0.4474 0.3953 0.4000 0.0821 -0.0155 -0.0418 113 GLN A CA  
889  C C   . GLN A 113 ? 0.4041 0.3570 0.3680 0.0755 -0.0163 -0.0470 113 GLN A C   
890  O O   . GLN A 113 ? 0.4107 0.3626 0.3809 0.0695 -0.0124 -0.0430 113 GLN A O   
891  C CB  . GLN A 113 ? 0.4944 0.4332 0.4381 0.0868 -0.0135 -0.0393 113 GLN A CB  
892  C CG  . GLN A 113 ? 0.6066 0.5446 0.5473 0.0907 -0.0172 -0.0468 113 GLN A CG  
893  C CD  . GLN A 113 ? 0.5776 0.5061 0.5067 0.0972 -0.0151 -0.0436 113 GLN A CD  
894  O OE1 . GLN A 113 ? 0.5141 0.4392 0.4322 0.1050 -0.0161 -0.0430 113 GLN A OE1 
895  N NE2 . GLN A 113 ? 0.6087 0.5323 0.5398 0.0943 -0.0117 -0.0409 113 GLN A NE2 
896  N N   . THR A 114 ? 0.4039 0.3622 0.3704 0.0770 -0.0211 -0.0562 114 THR A N   
897  C CA  . THR A 114 ? 0.4107 0.3733 0.3887 0.0706 -0.0214 -0.0624 114 THR A CA  
898  C C   . THR A 114 ? 0.4467 0.4028 0.4224 0.0718 -0.0208 -0.0649 114 THR A C   
899  O O   . THR A 114 ? 0.4868 0.4366 0.4515 0.0783 -0.0212 -0.0629 114 THR A O   
900  C CB  . THR A 114 ? 0.4786 0.4513 0.4625 0.0712 -0.0270 -0.0725 114 THR A CB  
901  O OG1 . THR A 114 ? 0.4725 0.4449 0.4484 0.0792 -0.0321 -0.0790 114 THR A OG1 
902  C CG2 . THR A 114 ? 0.4704 0.4490 0.4547 0.0716 -0.0281 -0.0704 114 THR A CG2 
903  N N   . PRO A 115 ? 0.4185 0.3757 0.4045 0.0656 -0.0193 -0.0693 115 PRO A N   
904  C CA  . PRO A 115 ? 0.4831 0.4338 0.4673 0.0665 -0.0186 -0.0723 115 PRO A CA  
905  C C   . PRO A 115 ? 0.5376 0.4902 0.5154 0.0740 -0.0249 -0.0813 115 PRO A C   
906  O O   . PRO A 115 ? 0.5274 0.4734 0.4991 0.0776 -0.0248 -0.0825 115 PRO A O   
907  C CB  . PRO A 115 ? 0.4424 0.3950 0.4405 0.0580 -0.0158 -0.0768 115 PRO A CB  
908  C CG  . PRO A 115 ? 0.4542 0.4106 0.4586 0.0525 -0.0125 -0.0709 115 PRO A CG  
909  C CD  . PRO A 115 ? 0.4735 0.4361 0.4725 0.0572 -0.0168 -0.0703 115 PRO A CD  
910  N N   . GLU A 116 ? 0.4676 0.4291 0.4462 0.0770 -0.0303 -0.0875 116 GLU A N   
911  C CA  . GLU A 116 ? 0.6215 0.5856 0.5927 0.0855 -0.0368 -0.0960 116 GLU A CA  
912  C C   . GLU A 116 ? 0.6716 0.6309 0.6262 0.0954 -0.0379 -0.0901 116 GLU A C   
913  O O   . GLU A 116 ? 0.7044 0.6645 0.6498 0.1042 -0.0429 -0.0956 116 GLU A O   
914  C CB  . GLU A 116 ? 0.6456 0.6227 0.6264 0.0848 -0.0427 -0.1074 116 GLU A CB  
915  C CG  . GLU A 116 ? 0.7941 0.7755 0.7892 0.0781 -0.0431 -0.1177 116 GLU A CG  
916  C CD  . GLU A 116 ? 0.8901 0.8745 0.9006 0.0670 -0.0380 -0.1159 116 GLU A CD  
917  O OE1 . GLU A 116 ? 0.9468 0.9399 0.9632 0.0653 -0.0394 -0.1171 116 GLU A OE1 
918  O OE2 . GLU A 116 ? 0.8700 0.8476 0.8862 0.0605 -0.0322 -0.1133 116 GLU A OE2 
919  N N   . GLY A 117 ? 0.5669 0.5212 0.5179 0.0941 -0.0331 -0.0790 117 GLY A N   
920  C CA  . GLY A 117 ? 0.5535 0.5013 0.4896 0.1025 -0.0323 -0.0725 117 GLY A CA  
921  C C   . GLY A 117 ? 0.5651 0.5173 0.4975 0.1064 -0.0344 -0.0714 117 GLY A C   
922  O O   . GLY A 117 ? 0.7012 0.6474 0.6210 0.1138 -0.0333 -0.0663 117 GLY A O   
923  N N   . ASP A 118 ? 0.5214 0.4836 0.4645 0.1017 -0.0370 -0.0761 118 ASP A N   
924  C CA  . ASP A 118 ? 0.5926 0.5586 0.5329 0.1047 -0.0384 -0.0744 118 ASP A CA  
925  C C   . ASP A 118 ? 0.6321 0.5919 0.5709 0.1014 -0.0321 -0.0631 118 ASP A C   
926  O O   . ASP A 118 ? 0.5587 0.5185 0.5065 0.0930 -0.0282 -0.0592 118 ASP A O   
927  C CB  . ASP A 118 ? 0.6887 0.6670 0.6424 0.0994 -0.0417 -0.0813 118 ASP A CB  
928  C CG  . ASP A 118 ? 0.8376 0.8234 0.7991 0.0985 -0.0466 -0.0931 118 ASP A CG  
929  O OD1 . ASP A 118 ? 0.8077 0.7964 0.7622 0.1071 -0.0523 -0.1002 118 ASP A OD1 
930  O OD2 . ASP A 118 ? 0.8529 0.8417 0.8277 0.0894 -0.0445 -0.0955 118 ASP A OD2 
931  N N   . ALA A 119 ? 0.5620 0.5163 0.4894 0.1082 -0.0308 -0.0580 119 ALA A N   
932  C CA  . ALA A 119 ? 0.5779 0.5263 0.5042 0.1052 -0.0247 -0.0482 119 ALA A CA  
933  C C   . ALA A 119 ? 0.5877 0.5394 0.5144 0.1056 -0.0248 -0.0465 119 ALA A C   
934  O O   . ALA A 119 ? 0.6178 0.5736 0.5409 0.1113 -0.0292 -0.0515 119 ALA A O   
935  C CB  . ALA A 119 ? 0.6203 0.5573 0.5341 0.1114 -0.0207 -0.0423 119 ALA A CB  
936  N N   . LYS A 120 ? 0.4362 0.3865 0.3676 0.0999 -0.0200 -0.0397 120 LYS A N   
937  C CA  . LYS A 120 ? 0.4516 0.4037 0.3833 0.0998 -0.0192 -0.0375 120 LYS A CA  
938  C C   . LYS A 120 ? 0.4826 0.4282 0.4136 0.0972 -0.0128 -0.0291 120 LYS A C   
939  O O   . LYS A 120 ? 0.4364 0.3818 0.3736 0.0912 -0.0099 -0.0258 120 LYS A O   
940  C CB  . LYS A 120 ? 0.4646 0.4277 0.4086 0.0930 -0.0218 -0.0414 120 LYS A CB  
941  C CG  . LYS A 120 ? 0.5886 0.5539 0.5337 0.0925 -0.0209 -0.0393 120 LYS A CG  
942  C CD  . LYS A 120 ? 0.6753 0.6519 0.6303 0.0884 -0.0246 -0.0449 120 LYS A CD  
943  C CE  . LYS A 120 ? 0.7913 0.7699 0.7458 0.0894 -0.0243 -0.0437 120 LYS A CE  
944  N NZ  . LYS A 120 ? 0.8327 0.8055 0.7748 0.0991 -0.0252 -0.0437 120 LYS A NZ  
945  N N   . TRP A 121 ? 0.3786 0.3187 0.3022 0.1020 -0.0104 -0.0258 121 TRP A N   
946  C CA  . TRP A 121 ? 0.4097 0.3443 0.3339 0.0994 -0.0042 -0.0190 121 TRP A CA  
947  C C   . TRP A 121 ? 0.4550 0.3950 0.3859 0.0951 -0.0040 -0.0188 121 TRP A C   
948  O O   . TRP A 121 ? 0.4463 0.3886 0.3744 0.0988 -0.0069 -0.0220 121 TRP A O   
949  C CB  . TRP A 121 ? 0.4357 0.3589 0.3470 0.1076 -0.0003 -0.0154 121 TRP A CB  
950  C CG  . TRP A 121 ? 0.4285 0.3461 0.3408 0.1055 0.0064  -0.0095 121 TRP A CG  
951  C CD1 . TRP A 121 ? 0.4393 0.3538 0.3488 0.1078 0.0086  -0.0083 121 TRP A CD1 
952  C CD2 . TRP A 121 ? 0.3972 0.3118 0.3143 0.1008 0.0119  -0.0045 121 TRP A CD2 
953  N NE1 . TRP A 121 ? 0.4651 0.3746 0.3779 0.1043 0.0153  -0.0033 121 TRP A NE1 
954  C CE2 . TRP A 121 ? 0.4578 0.3680 0.3755 0.1001 0.0173  -0.0011 121 TRP A CE2 
955  C CE3 . TRP A 121 ? 0.3511 0.2664 0.2722 0.0975 0.0129  -0.0030 121 TRP A CE3 
956  C CZ2 . TRP A 121 ? 0.4471 0.3548 0.3705 0.0957 0.0233  0.0032  121 TRP A CZ2 
957  C CZ3 . TRP A 121 ? 0.3977 0.3105 0.3235 0.0938 0.0188  0.0018  121 TRP A CZ3 
958  C CH2 . TRP A 121 ? 0.4322 0.3417 0.3595 0.0928 0.0237  0.0045  121 TRP A CH2 
959  N N   . ILE A 122 ? 0.3523 0.2947 0.2917 0.0880 -0.0009 -0.0154 122 ILE A N   
960  C CA  . ILE A 122 ? 0.3682 0.3145 0.3131 0.0843 0.0001  -0.0148 122 ILE A CA  
961  C C   . ILE A 122 ? 0.4401 0.3819 0.3871 0.0816 0.0060  -0.0096 122 ILE A C   
962  O O   . ILE A 122 ? 0.3914 0.3344 0.3434 0.0775 0.0079  -0.0072 122 ILE A O   
963  C CB  . ILE A 122 ? 0.4268 0.3841 0.3825 0.0774 -0.0031 -0.0175 122 ILE A CB  
964  C CG1 . ILE A 122 ? 0.4165 0.3794 0.3724 0.0791 -0.0086 -0.0235 122 ILE A CG1 
965  C CG2 . ILE A 122 ? 0.4248 0.3860 0.3853 0.0742 -0.0021 -0.0170 122 ILE A CG2 
966  C CD1 . ILE A 122 ? 0.4371 0.4099 0.4036 0.0723 -0.0106 -0.0260 122 ILE A CD1 
967  N N   . SER A 123 ? 0.3505 0.2870 0.2940 0.0841 0.0092  -0.0081 123 SER A N   
968  C CA  . SER A 123 ? 0.3868 0.3194 0.3338 0.0812 0.0152  -0.0042 123 SER A CA  
969  C C   . SER A 123 ? 0.4216 0.3641 0.3806 0.0733 0.0144  -0.0049 123 SER A C   
970  O O   . SER A 123 ? 0.4129 0.3633 0.3757 0.0710 0.0100  -0.0080 123 SER A O   
971  C CB  . SER A 123 ? 0.5124 0.4362 0.4529 0.0857 0.0194  -0.0029 123 SER A CB  
972  O OG  . SER A 123 ? 0.5846 0.5136 0.5287 0.0840 0.0171  -0.0056 123 SER A OG  
973  N N   . SER A 124 ? 0.3723 0.3146 0.3371 0.0695 0.0186  -0.0023 124 SER A N   
974  C CA  . SER A 124 ? 0.4336 0.3856 0.4087 0.0631 0.0176  -0.0033 124 SER A CA  
975  C C   . SER A 124 ? 0.5005 0.4513 0.4815 0.0602 0.0228  -0.0020 124 SER A C   
976  O O   . SER A 124 ? 0.5446 0.4950 0.5290 0.0588 0.0258  0.0001  124 SER A O   
977  C CB  . SER A 124 ? 0.4931 0.4522 0.4729 0.0598 0.0149  -0.0029 124 SER A CB  
978  O OG  . SER A 124 ? 0.3737 0.3286 0.3527 0.0606 0.0180  0.0001  124 SER A OG  
979  N N   . GLU A 125 ? 0.4708 0.4212 0.4534 0.0595 0.0240  -0.0038 125 GLU A N   
980  C CA  . GLU A 125 ? 0.4975 0.4488 0.4881 0.0556 0.0283  -0.0041 125 GLU A CA  
981  C C   . GLU A 125 ? 0.4223 0.3867 0.4227 0.0501 0.0249  -0.0058 125 GLU A C   
982  O O   . GLU A 125 ? 0.3833 0.3543 0.3832 0.0496 0.0198  -0.0068 125 GLU A O   
983  C CB  . GLU A 125 ? 0.6059 0.5530 0.5956 0.0562 0.0304  -0.0060 125 GLU A CB  
984  C CG  . GLU A 125 ? 0.7998 0.7330 0.7786 0.0627 0.0344  -0.0040 125 GLU A CG  
985  C CD  . GLU A 125 ? 0.9128 0.8362 0.8906 0.0638 0.0420  -0.0007 125 GLU A CD  
986  O OE1 . GLU A 125 ? 0.9368 0.8631 0.9247 0.0588 0.0458  -0.0012 125 GLU A OE1 
987  O OE2 . GLU A 125 ? 0.9374 0.8508 0.9046 0.0701 0.0443  0.0022  125 GLU A OE2 
988  N N   . PRO A 126 ? 0.3852 0.3533 0.3943 0.0465 0.0279  -0.0064 126 PRO A N   
989  C CA  . PRO A 126 ? 0.4222 0.4032 0.4396 0.0424 0.0243  -0.0084 126 PRO A CA  
990  C C   . PRO A 126 ? 0.4970 0.4838 0.5144 0.0413 0.0201  -0.0113 126 PRO A C   
991  O O   . PRO A 126 ? 0.3848 0.3675 0.4010 0.0418 0.0215  -0.0132 126 PRO A O   
992  C CB  . PRO A 126 ? 0.4376 0.4210 0.4646 0.0391 0.0285  -0.0102 126 PRO A CB  
993  C CG  . PRO A 126 ? 0.4579 0.4298 0.4817 0.0415 0.0347  -0.0072 126 PRO A CG  
994  C CD  . PRO A 126 ? 0.4508 0.4120 0.4628 0.0462 0.0347  -0.0055 126 PRO A CD  
995  N N   . GLY A 127 ? 0.4210 0.4163 0.4392 0.0403 0.0155  -0.0115 127 GLY A N   
996  C CA  . GLY A 127 ? 0.4205 0.4214 0.4383 0.0396 0.0118  -0.0139 127 GLY A CA  
997  C C   . GLY A 127 ? 0.4181 0.4164 0.4291 0.0420 0.0091  -0.0130 127 GLY A C   
998  O O   . GLY A 127 ? 0.4709 0.4752 0.4822 0.0412 0.0060  -0.0146 127 GLY A O   
999  N N   . THR A 128 ? 0.3356 0.3255 0.3408 0.0452 0.0104  -0.0109 128 THR A N   
1000 C CA  . THR A 128 ? 0.3222 0.3102 0.3217 0.0477 0.0076  -0.0111 128 THR A CA  
1001 C C   . THR A 128 ? 0.3695 0.3617 0.3702 0.0465 0.0058  -0.0096 128 THR A C   
1002 O O   . THR A 128 ? 0.3639 0.3550 0.3656 0.0461 0.0076  -0.0071 128 THR A O   
1003 C CB  . THR A 128 ? 0.4401 0.4174 0.4318 0.0526 0.0094  -0.0101 128 THR A CB  
1004 O OG1 . THR A 128 ? 0.4813 0.4534 0.4707 0.0544 0.0116  -0.0112 128 THR A OG1 
1005 C CG2 . THR A 128 ? 0.3874 0.3643 0.3741 0.0553 0.0058  -0.0114 128 THR A CG2 
1006 N N   . VAL A 129 ? 0.2993 0.2958 0.3000 0.0458 0.0028  -0.0113 129 VAL A N   
1007 C CA  . VAL A 129 ? 0.3046 0.3035 0.3060 0.0447 0.0018  -0.0101 129 VAL A CA  
1008 C C   . VAL A 129 ? 0.3578 0.3521 0.3549 0.0473 0.0004  -0.0116 129 VAL A C   
1009 O O   . VAL A 129 ? 0.3279 0.3225 0.3233 0.0488 -0.0017 -0.0148 129 VAL A O   
1010 C CB  . VAL A 129 ? 0.3260 0.3334 0.3316 0.0417 0.0003  -0.0111 129 VAL A CB  
1011 C CG1 . VAL A 129 ? 0.3098 0.3178 0.3158 0.0407 0.0002  -0.0099 129 VAL A CG1 
1012 C CG2 . VAL A 129 ? 0.3173 0.3304 0.3268 0.0399 0.0012  -0.0100 129 VAL A CG2 
1013 N N   . ILE A 130 ? 0.2576 0.2479 0.2529 0.0481 0.0012  -0.0098 130 ILE A N   
1014 C CA  . ILE A 130 ? 0.2671 0.2534 0.2586 0.0506 -0.0004 -0.0119 130 ILE A CA  
1015 C C   . ILE A 130 ? 0.3490 0.3384 0.3439 0.0479 -0.0011 -0.0126 130 ILE A C   
1016 O O   . ILE A 130 ? 0.3454 0.3349 0.3423 0.0460 0.0009  -0.0094 130 ILE A O   
1017 C CB  . ILE A 130 ? 0.3536 0.3314 0.3393 0.0544 0.0013  -0.0099 130 ILE A CB  
1018 C CG1 . ILE A 130 ? 0.4671 0.4402 0.4482 0.0578 0.0025  -0.0099 130 ILE A CG1 
1019 C CG2 . ILE A 130 ? 0.3382 0.3130 0.3205 0.0567 -0.0007 -0.0125 130 ILE A CG2 
1020 C CD1 . ILE A 130 ? 0.5975 0.5626 0.5742 0.0607 0.0060  -0.0066 130 ILE A CD1 
1021 N N   . TYR A 131 ? 0.2919 0.2838 0.2879 0.0479 -0.0036 -0.0169 131 TYR A N   
1022 C CA  . TYR A 131 ? 0.2896 0.2837 0.2898 0.0450 -0.0036 -0.0184 131 TYR A CA  
1023 C C   . TYR A 131 ? 0.3572 0.3461 0.3545 0.0475 -0.0046 -0.0209 131 TYR A C   
1024 O O   . TYR A 131 ? 0.3252 0.3138 0.3197 0.0509 -0.0076 -0.0251 131 TYR A O   
1025 C CB  . TYR A 131 ? 0.2775 0.2787 0.2826 0.0429 -0.0053 -0.0225 131 TYR A CB  
1026 C CG  . TYR A 131 ? 0.2919 0.2952 0.3023 0.0398 -0.0048 -0.0253 131 TYR A CG  
1027 C CD1 . TYR A 131 ? 0.3225 0.3268 0.3367 0.0360 -0.0013 -0.0221 131 TYR A CD1 
1028 C CD2 . TYR A 131 ? 0.3307 0.3351 0.3427 0.0409 -0.0075 -0.0314 131 TYR A CD2 
1029 C CE1 . TYR A 131 ? 0.3354 0.3404 0.3549 0.0329 0.0003  -0.0245 131 TYR A CE1 
1030 C CE2 . TYR A 131 ? 0.3472 0.3537 0.3658 0.0374 -0.0065 -0.0348 131 TYR A CE2 
1031 C CZ  . TYR A 131 ? 0.3102 0.3163 0.3327 0.0331 -0.0021 -0.0311 131 TYR A CZ  
1032 O OH  . TYR A 131 ? 0.3180 0.3250 0.3474 0.0294 0.0000  -0.0344 131 TYR A OH  
1033 N N   . SER A 132 ? 0.3251 0.3102 0.3227 0.0464 -0.0024 -0.0184 132 SER A N   
1034 C CA  . SER A 132 ? 0.3097 0.2898 0.3050 0.0483 -0.0031 -0.0210 132 SER A CA  
1035 C C   . SER A 132 ? 0.3406 0.3235 0.3427 0.0441 -0.0025 -0.0241 132 SER A C   
1036 O O   . SER A 132 ? 0.3179 0.3002 0.3231 0.0408 0.0009  -0.0205 132 SER A O   
1037 C CB  . SER A 132 ? 0.3225 0.2957 0.3135 0.0500 -0.0004 -0.0162 132 SER A CB  
1038 O OG  . SER A 132 ? 0.3894 0.3575 0.3777 0.0520 -0.0011 -0.0188 132 SER A OG  
1039 N N   . PRO A 133 ? 0.3502 0.3364 0.3552 0.0442 -0.0055 -0.0310 133 PRO A N   
1040 C CA  . PRO A 133 ? 0.3465 0.3363 0.3600 0.0394 -0.0042 -0.0346 133 PRO A CA  
1041 C C   . PRO A 133 ? 0.3152 0.2990 0.3303 0.0376 -0.0015 -0.0347 133 PRO A C   
1042 O O   . PRO A 133 ? 0.3127 0.2901 0.3218 0.0408 -0.0015 -0.0327 133 PRO A O   
1043 C CB  . PRO A 133 ? 0.3486 0.3444 0.3651 0.0408 -0.0088 -0.0430 133 PRO A CB  
1044 C CG  . PRO A 133 ? 0.3553 0.3508 0.3638 0.0467 -0.0122 -0.0425 133 PRO A CG  
1045 C CD  . PRO A 133 ? 0.3384 0.3255 0.3392 0.0492 -0.0100 -0.0360 133 PRO A CD  
1046 N N   . PRO A 134 ? 0.3698 0.3552 0.3929 0.0327 0.0013  -0.0369 134 PRO A N   
1047 C CA  . PRO A 134 ? 0.3612 0.3407 0.3871 0.0306 0.0042  -0.0385 134 PRO A CA  
1048 C C   . PRO A 134 ? 0.3691 0.3466 0.3923 0.0342 0.0000  -0.0448 134 PRO A C   
1049 O O   . PRO A 134 ? 0.3745 0.3578 0.3979 0.0367 -0.0049 -0.0508 134 PRO A O   
1050 C CB  . PRO A 134 ? 0.3828 0.3668 0.4193 0.0249 0.0068  -0.0429 134 PRO A CB  
1051 C CG  . PRO A 134 ? 0.3056 0.2952 0.3428 0.0237 0.0078  -0.0388 134 PRO A CG  
1052 C CD  . PRO A 134 ? 0.3424 0.3348 0.3724 0.0287 0.0027  -0.0379 134 PRO A CD  
1053 N N   . TYR A 135 ? 0.3814 0.3510 0.4014 0.0352 0.0019  -0.0432 135 TYR A N   
1054 C CA  . TYR A 135 ? 0.4177 0.3843 0.4344 0.0388 -0.0015 -0.0491 135 TYR A CA  
1055 C C   . TYR A 135 ? 0.4458 0.4099 0.4514 0.0459 -0.0048 -0.0467 135 TYR A C   
1056 O O   . TYR A 135 ? 0.4570 0.4176 0.4578 0.0499 -0.0072 -0.0506 135 TYR A O   
1057 C CB  . TYR A 135 ? 0.4202 0.3936 0.4448 0.0374 -0.0052 -0.0601 135 TYR A CB  
1058 C CG  . TYR A 135 ? 0.4343 0.4083 0.4707 0.0303 -0.0008 -0.0636 135 TYR A CG  
1059 C CD1 . TYR A 135 ? 0.4815 0.4484 0.5204 0.0282 0.0023  -0.0657 135 TYR A CD1 
1060 C CD2 . TYR A 135 ? 0.4552 0.4361 0.5003 0.0256 0.0009  -0.0648 135 TYR A CD2 
1061 C CE1 . TYR A 135 ? 0.5007 0.4666 0.5506 0.0215 0.0074  -0.0688 135 TYR A CE1 
1062 C CE2 . TYR A 135 ? 0.5027 0.4833 0.5588 0.0189 0.0060  -0.0678 135 TYR A CE2 
1063 C CZ  . TYR A 135 ? 0.5187 0.4914 0.5773 0.0168 0.0095  -0.0697 135 TYR A CZ  
1064 O OH  . TYR A 135 ? 0.5901 0.5612 0.6599 0.0100 0.0156  -0.0725 135 TYR A OH  
1065 N N   . TRP A 136 ? 0.3474 0.3129 0.3486 0.0475 -0.0046 -0.0406 136 TRP A N   
1066 C CA  . TRP A 136 ? 0.3434 0.3055 0.3345 0.0538 -0.0065 -0.0379 136 TRP A CA  
1067 C C   . TRP A 136 ? 0.3861 0.3409 0.3721 0.0548 -0.0024 -0.0299 136 TRP A C   
1068 O O   . TRP A 136 ? 0.3806 0.3355 0.3703 0.0510 0.0013  -0.0248 136 TRP A O   
1069 C CB  . TRP A 136 ? 0.3721 0.3394 0.3615 0.0555 -0.0084 -0.0367 136 TRP A CB  
1070 C CG  . TRP A 136 ? 0.3497 0.3242 0.3421 0.0564 -0.0131 -0.0445 136 TRP A CG  
1071 C CD1 . TRP A 136 ? 0.3576 0.3394 0.3598 0.0516 -0.0136 -0.0492 136 TRP A CD1 
1072 C CD2 . TRP A 136 ? 0.3843 0.3597 0.3697 0.0632 -0.0176 -0.0484 136 TRP A CD2 
1073 N NE1 . TRP A 136 ? 0.3899 0.3781 0.3925 0.0548 -0.0186 -0.0562 136 TRP A NE1 
1074 C CE2 . TRP A 136 ? 0.4242 0.4085 0.4161 0.0622 -0.0213 -0.0557 136 TRP A CE2 
1075 C CE3 . TRP A 136 ? 0.4042 0.3734 0.3781 0.0704 -0.0184 -0.0461 136 TRP A CE3 
1076 C CZ2 . TRP A 136 ? 0.3983 0.3860 0.3852 0.0688 -0.0263 -0.0610 136 TRP A CZ2 
1077 C CZ3 . TRP A 136 ? 0.4012 0.3727 0.3694 0.0770 -0.0228 -0.0509 136 TRP A CZ3 
1078 C CH2 . TRP A 136 ? 0.4483 0.4291 0.4227 0.0764 -0.0271 -0.0583 136 TRP A CH2 
1079 N N   . ALA A 137 ? 0.3581 0.3073 0.3357 0.0603 -0.0030 -0.0289 137 ALA A N   
1080 C CA  . ALA A 137 ? 0.3759 0.3194 0.3487 0.0620 0.0007  -0.0215 137 ALA A CA  
1081 C C   . ALA A 137 ? 0.3378 0.2823 0.3063 0.0648 0.0006  -0.0179 137 ALA A C   
1082 O O   . ALA A 137 ? 0.3869 0.3326 0.3513 0.0684 -0.0024 -0.0213 137 ALA A O   
1083 C CB  . ALA A 137 ? 0.3128 0.2487 0.2791 0.0663 0.0010  -0.0223 137 ALA A CB  
1084 N N   . ALA A 138 ? 0.3166 0.2607 0.2860 0.0634 0.0041  -0.0115 138 ALA A N   
1085 C CA  . ALA A 138 ? 0.3014 0.2465 0.2685 0.0650 0.0049  -0.0083 138 ALA A CA  
1086 C C   . ALA A 138 ? 0.3636 0.3027 0.3260 0.0681 0.0086  -0.0034 138 ALA A C   
1087 O O   . ALA A 138 ? 0.3511 0.2880 0.3147 0.0673 0.0111  -0.0004 138 ALA A O   
1088 C CB  . ALA A 138 ? 0.3103 0.2626 0.2845 0.0602 0.0055  -0.0063 138 ALA A CB  
1089 N N   . ARG A 139 ? 0.3146 0.2510 0.2718 0.0718 0.0093  -0.0025 139 ARG A N   
1090 C CA  . ARG A 139 ? 0.3163 0.2471 0.2696 0.0747 0.0135  0.0019  139 ARG A CA  
1091 C C   . ARG A 139 ? 0.3841 0.3159 0.3382 0.0746 0.0155  0.0039  139 ARG A C   
1092 O O   . ARG A 139 ? 0.3595 0.2891 0.3086 0.0778 0.0144  0.0020  139 ARG A O   
1093 C CB  . ARG A 139 ? 0.3826 0.3051 0.3258 0.0812 0.0135  0.0006  139 ARG A CB  
1094 C CG  . ARG A 139 ? 0.3696 0.2852 0.3067 0.0855 0.0182  0.0047  139 ARG A CG  
1095 C CD  . ARG A 139 ? 0.3658 0.2731 0.2917 0.0927 0.0181  0.0033  139 ARG A CD  
1096 N NE  . ARG A 139 ? 0.3977 0.3026 0.3233 0.0927 0.0186  0.0035  139 ARG A NE  
1097 C CZ  . ARG A 139 ? 0.4053 0.3036 0.3220 0.0985 0.0184  0.0020  139 ARG A CZ  
1098 N NH1 . ARG A 139 ? 0.3542 0.2477 0.2605 0.1053 0.0175  0.0003  139 ARG A NH1 
1099 N NH2 . ARG A 139 ? 0.4008 0.2969 0.3181 0.0981 0.0191  0.0022  139 ARG A NH2 
1100 N N   . ALA A 140 ? 0.3392 0.2745 0.2998 0.0712 0.0184  0.0073  140 ALA A N   
1101 C CA  . ALA A 140 ? 0.3318 0.2677 0.2944 0.0707 0.0211  0.0088  140 ALA A CA  
1102 C C   . ALA A 140 ? 0.3591 0.2858 0.3149 0.0754 0.0257  0.0112  140 ALA A C   
1103 O O   . ALA A 140 ? 0.3302 0.2530 0.2840 0.0773 0.0282  0.0134  140 ALA A O   
1104 C CB  . ALA A 140 ? 0.3151 0.2584 0.2872 0.0659 0.0226  0.0108  140 ALA A CB  
1105 N N   . VAL A 141 ? 0.3360 0.2590 0.2883 0.0776 0.0274  0.0110  141 VAL A N   
1106 C CA  . VAL A 141 ? 0.3587 0.2718 0.3040 0.0825 0.0330  0.0137  141 VAL A CA  
1107 C C   . VAL A 141 ? 0.3822 0.2949 0.3327 0.0802 0.0380  0.0152  141 VAL A C   
1108 O O   . VAL A 141 ? 0.3697 0.2861 0.3233 0.0779 0.0362  0.0132  141 VAL A O   
1109 C CB  . VAL A 141 ? 0.4005 0.3060 0.3332 0.0896 0.0313  0.0120  141 VAL A CB  
1110 C CG1 . VAL A 141 ? 0.3940 0.2879 0.3177 0.0956 0.0379  0.0155  141 VAL A CG1 
1111 C CG2 . VAL A 141 ? 0.3476 0.2546 0.2763 0.0915 0.0258  0.0089  141 VAL A CG2 
1112 N N   . ASN A 142 ? 0.3478 0.2560 0.2998 0.0806 0.0445  0.0184  142 ASN A N   
1113 C CA  . ASN A 142 ? 0.3418 0.2489 0.2999 0.0781 0.0503  0.0194  142 ASN A CA  
1114 C C   . ASN A 142 ? 0.3931 0.2872 0.3408 0.0840 0.0559  0.0214  142 ASN A C   
1115 O O   . ASN A 142 ? 0.3946 0.2801 0.3355 0.0885 0.0607  0.0243  142 ASN A O   
1116 C CB  . ASN A 142 ? 0.3442 0.2547 0.3118 0.0748 0.0549  0.0213  142 ASN A CB  
1117 C CG  . ASN A 142 ? 0.3828 0.2945 0.3600 0.0709 0.0606  0.0209  142 ASN A CG  
1118 O OD1 . ASN A 142 ? 0.4306 0.3364 0.4048 0.0719 0.0633  0.0205  142 ASN A OD1 
1119 N ND2 . ASN A 142 ? 0.3521 0.2715 0.3411 0.0666 0.0627  0.0208  142 ASN A ND2 
1120 N N   . ILE A 143 ? 0.4009 0.2928 0.3466 0.0845 0.0559  0.0200  143 ILE A N   
1121 C CA  . ILE A 143 ? 0.4012 0.2795 0.3355 0.0911 0.0616  0.0222  143 ILE A CA  
1122 C C   . ILE A 143 ? 0.4572 0.3307 0.3980 0.0883 0.0704  0.0238  143 ILE A C   
1123 O O   . ILE A 143 ? 0.4842 0.3461 0.4166 0.0931 0.0760  0.0257  143 ILE A O   
1124 C CB  . ILE A 143 ? 0.4125 0.2890 0.3374 0.0957 0.0565  0.0199  143 ILE A CB  
1125 C CG1 . ILE A 143 ? 0.4325 0.3165 0.3666 0.0901 0.0541  0.0170  143 ILE A CG1 
1126 C CG2 . ILE A 143 ? 0.4345 0.3158 0.3540 0.0985 0.0482  0.0175  143 ILE A CG2 
1127 C CD1 . ILE A 143 ? 0.5042 0.3872 0.4300 0.0947 0.0492  0.0145  143 ILE A CD1 
1128 N N   . GLY A 144 ? 0.4139 0.2962 0.3696 0.0808 0.0719  0.0228  144 GLY A N   
1129 C CA  . GLY A 144 ? 0.4450 0.3246 0.4097 0.0769 0.0799  0.0229  144 GLY A CA  
1130 C C   . GLY A 144 ? 0.4907 0.3703 0.4637 0.0744 0.0868  0.0247  144 GLY A C   
1131 O O   . GLY A 144 ? 0.5221 0.4003 0.4905 0.0774 0.0867  0.0271  144 GLY A O   
1132 N N   . ASP A 145 ? 0.5160 0.3978 0.5019 0.0688 0.0927  0.0231  145 ASP A N   
1133 C CA  . ASP A 145 ? 0.5608 0.4427 0.5561 0.0663 0.1004  0.0243  145 ASP A CA  
1134 C C   . ASP A 145 ? 0.4937 0.3926 0.5066 0.0589 0.0967  0.0202  145 ASP A C   
1135 O O   . ASP A 145 ? 0.5171 0.4191 0.5411 0.0559 0.1026  0.0198  145 ASP A O   
1136 C CB  . ASP A 145 ? 0.6424 0.5118 0.6392 0.0662 0.1123  0.0256  145 ASP A CB  
1137 C CG  . ASP A 145 ? 0.9162 0.7675 0.8939 0.0750 0.1171  0.0305  145 ASP A CG  
1138 O OD1 . ASP A 145 ? 0.9966 0.8440 0.9620 0.0813 0.1146  0.0336  145 ASP A OD1 
1139 O OD2 . ASP A 145 ? 1.0050 0.8458 0.9796 0.0762 0.1235  0.0311  145 ASP A OD2 
1140 N N   . GLU A 146 ? 0.4875 0.3977 0.5030 0.0565 0.0872  0.0170  146 GLU A N   
1141 C CA  . GLU A 146 ? 0.4966 0.4235 0.5264 0.0510 0.0825  0.0134  146 GLU A CA  
1142 C C   . GLU A 146 ? 0.4283 0.3620 0.4521 0.0530 0.0733  0.0142  146 GLU A C   
1143 O O   . GLU A 146 ? 0.4289 0.3557 0.4396 0.0575 0.0700  0.0163  146 GLU A O   
1144 C CB  . GLU A 146 ? 0.5234 0.4585 0.5638 0.0454 0.0806  0.0081  146 GLU A CB  
1145 C CG  . GLU A 146 ? 0.6921 0.6276 0.7245 0.0466 0.0735  0.0071  146 GLU A CG  
1146 C CD  . GLU A 146 ? 0.8677 0.8090 0.9094 0.0417 0.0728  0.0020  146 GLU A CD  
1147 O OE1 . GLU A 146 ? 0.8896 0.8443 0.9446 0.0368 0.0707  -0.0022 146 GLU A OE1 
1148 O OE2 . GLU A 146 ? 0.7993 0.7319 0.8343 0.0432 0.0742  0.0020  146 GLU A OE2 
1149 N N   . PRO A 147 ? 0.4115 0.3587 0.4451 0.0501 0.0694  0.0125  147 PRO A N   
1150 C CA  . PRO A 147 ? 0.3495 0.3020 0.3774 0.0519 0.0615  0.0135  147 PRO A CA  
1151 C C   . PRO A 147 ? 0.4244 0.3776 0.4465 0.0518 0.0553  0.0118  147 PRO A C   
1152 O O   . PRO A 147 ? 0.3929 0.3500 0.4206 0.0485 0.0548  0.0086  147 PRO A O   
1153 C CB  . PRO A 147 ? 0.3985 0.3659 0.4390 0.0486 0.0588  0.0112  147 PRO A CB  
1154 C CG  . PRO A 147 ? 0.4515 0.4198 0.5031 0.0464 0.0664  0.0099  147 PRO A CG  
1155 C CD  . PRO A 147 ? 0.4398 0.3979 0.4896 0.0455 0.0719  0.0092  147 PRO A CD  
1156 N N   . PHE A 148 ? 0.3642 0.3137 0.3758 0.0552 0.0510  0.0137  148 PHE A N   
1157 C CA  . PHE A 148 ? 0.3419 0.2934 0.3487 0.0551 0.0449  0.0119  148 PHE A CA  
1158 C C   . PHE A 148 ? 0.3722 0.3340 0.3822 0.0535 0.0391  0.0115  148 PHE A C   
1159 O O   . PHE A 148 ? 0.3322 0.2928 0.3390 0.0556 0.0385  0.0138  148 PHE A O   
1160 C CB  . PHE A 148 ? 0.3252 0.2655 0.3185 0.0603 0.0444  0.0135  148 PHE A CB  
1161 C CG  . PHE A 148 ? 0.3578 0.3008 0.3467 0.0605 0.0379  0.0115  148 PHE A CG  
1162 C CD1 . PHE A 148 ? 0.3606 0.3082 0.3531 0.0578 0.0359  0.0086  148 PHE A CD1 
1163 C CD2 . PHE A 148 ? 0.3675 0.3085 0.3491 0.0634 0.0341  0.0119  148 PHE A CD2 
1164 C CE1 . PHE A 148 ? 0.3649 0.3154 0.3539 0.0581 0.0303  0.0066  148 PHE A CE1 
1165 C CE2 . PHE A 148 ? 0.3580 0.3021 0.3369 0.0633 0.0286  0.0094  148 PHE A CE2 
1166 C CZ  . PHE A 148 ? 0.3606 0.3096 0.3432 0.0606 0.0268  0.0069  148 PHE A CZ  
1167 N N   . ILE A 149 ? 0.2880 0.2595 0.3040 0.0502 0.0353  0.0088  149 ILE A N   
1168 C CA  . ILE A 149 ? 0.2944 0.2758 0.3137 0.0490 0.0309  0.0087  149 ILE A CA  
1169 C C   . ILE A 149 ? 0.3006 0.2844 0.3161 0.0484 0.0258  0.0074  149 ILE A C   
1170 O O   . ILE A 149 ? 0.3056 0.2907 0.3222 0.0469 0.0249  0.0048  149 ILE A O   
1171 C CB  . ILE A 149 ? 0.3038 0.2967 0.3347 0.0460 0.0311  0.0064  149 ILE A CB  
1172 C CG1 . ILE A 149 ? 0.3663 0.3576 0.4027 0.0463 0.0366  0.0072  149 ILE A CG1 
1173 C CG2 . ILE A 149 ? 0.3290 0.3319 0.3617 0.0460 0.0265  0.0067  149 ILE A CG2 
1174 C CD1 . ILE A 149 ? 0.4139 0.4172 0.4633 0.0432 0.0371  0.0036  149 ILE A CD1 
1175 N N   . MET A 150 ? 0.2758 0.2598 0.2872 0.0496 0.0231  0.0091  150 MET A N   
1176 C CA  . MET A 150 ? 0.2917 0.2786 0.3008 0.0487 0.0190  0.0078  150 MET A CA  
1177 C C   . MET A 150 ? 0.3271 0.3215 0.3388 0.0480 0.0170  0.0090  150 MET A C   
1178 O O   . MET A 150 ? 0.3027 0.2968 0.3147 0.0495 0.0184  0.0116  150 MET A O   
1179 C CB  . MET A 150 ? 0.3439 0.3227 0.3450 0.0508 0.0179  0.0078  150 MET A CB  
1180 C CG  . MET A 150 ? 0.4014 0.3713 0.3970 0.0534 0.0197  0.0072  150 MET A CG  
1181 S SD  . MET A 150 ? 0.2899 0.2543 0.2772 0.0560 0.0164  0.0054  150 MET A SD  
1182 C CE  . MET A 150 ? 0.3184 0.2896 0.3088 0.0534 0.0133  0.0019  150 MET A CE  
1183 N N   . LEU A 151 ? 0.2617 0.2623 0.2746 0.0463 0.0142  0.0075  151 LEU A N   
1184 C CA  . LEU A 151 ? 0.2706 0.2765 0.2837 0.0464 0.0127  0.0092  151 LEU A CA  
1185 C C   . LEU A 151 ? 0.2967 0.2973 0.3047 0.0464 0.0118  0.0095  151 LEU A C   
1186 O O   . LEU A 151 ? 0.3066 0.3065 0.3136 0.0452 0.0103  0.0069  151 LEU A O   
1187 C CB  . LEU A 151 ? 0.2606 0.2766 0.2779 0.0449 0.0106  0.0072  151 LEU A CB  
1188 C CG  . LEU A 151 ? 0.3214 0.3423 0.3373 0.0458 0.0095  0.0093  151 LEU A CG  
1189 C CD1 . LEU A 151 ? 0.3598 0.3823 0.3763 0.0484 0.0107  0.0123  151 LEU A CD1 
1190 C CD2 . LEU A 151 ? 0.3508 0.3812 0.3692 0.0448 0.0072  0.0070  151 LEU A CD2 
1191 N N   . VAL A 152 ? 0.2528 0.2498 0.2582 0.0477 0.0128  0.0122  152 VAL A N   
1192 C CA  . VAL A 152 ? 0.2494 0.2409 0.2513 0.0473 0.0125  0.0117  152 VAL A CA  
1193 C C   . VAL A 152 ? 0.3104 0.3047 0.3125 0.0468 0.0130  0.0139  152 VAL A C   
1194 O O   . VAL A 152 ? 0.2891 0.2849 0.2912 0.0486 0.0144  0.0171  152 VAL A O   
1195 C CB  . VAL A 152 ? 0.3495 0.3322 0.3476 0.0493 0.0139  0.0126  152 VAL A CB  
1196 C CG1 . VAL A 152 ? 0.3527 0.3305 0.3484 0.0486 0.0133  0.0107  152 VAL A CG1 
1197 C CG2 . VAL A 152 ? 0.3612 0.3404 0.3580 0.0507 0.0144  0.0115  152 VAL A CG2 
1198 N N   . ILE A 153 ? 0.2889 0.2838 0.2911 0.0448 0.0123  0.0121  153 ILE A N   
1199 C CA  . ILE A 153 ? 0.2741 0.2703 0.2760 0.0443 0.0138  0.0143  153 ILE A CA  
1200 C C   . ILE A 153 ? 0.2895 0.2786 0.2905 0.0429 0.0152  0.0130  153 ILE A C   
1201 O O   . ILE A 153 ? 0.2825 0.2703 0.2843 0.0414 0.0135  0.0090  153 ILE A O   
1202 C CB  . ILE A 153 ? 0.2723 0.2762 0.2760 0.0428 0.0127  0.0131  153 ILE A CB  
1203 C CG1 . ILE A 153 ? 0.3404 0.3522 0.3458 0.0440 0.0110  0.0131  153 ILE A CG1 
1204 C CG2 . ILE A 153 ? 0.2923 0.2960 0.2946 0.0428 0.0154  0.0159  153 ILE A CG2 
1205 C CD1 . ILE A 153 ? 0.4176 0.4298 0.4251 0.0431 0.0090  0.0095  153 ILE A CD1 
1206 N N   . TYR A 154 ? 0.2817 0.2661 0.2811 0.0437 0.0182  0.0162  154 TYR A N   
1207 C CA  . TYR A 154 ? 0.2836 0.2608 0.2831 0.0420 0.0199  0.0144  154 TYR A CA  
1208 C C   . TYR A 154 ? 0.3147 0.2887 0.3137 0.0418 0.0243  0.0179  154 TYR A C   
1209 O O   . TYR A 154 ? 0.3301 0.3059 0.3267 0.0445 0.0259  0.0226  154 TYR A O   
1210 C CB  . TYR A 154 ? 0.3178 0.2885 0.3152 0.0438 0.0196  0.0136  154 TYR A CB  
1211 C CG  . TYR A 154 ? 0.3074 0.2765 0.3022 0.0472 0.0211  0.0183  154 TYR A CG  
1212 C CD1 . TYR A 154 ? 0.3489 0.3236 0.3440 0.0490 0.0196  0.0195  154 TYR A CD1 
1213 C CD2 . TYR A 154 ? 0.3689 0.3310 0.3616 0.0486 0.0243  0.0209  154 TYR A CD2 
1214 C CE1 . TYR A 154 ? 0.3566 0.3312 0.3505 0.0521 0.0209  0.0232  154 TYR A CE1 
1215 C CE2 . TYR A 154 ? 0.3517 0.3129 0.3422 0.0521 0.0257  0.0250  154 TYR A CE2 
1216 C CZ  . TYR A 154 ? 0.4117 0.3797 0.4031 0.0539 0.0238  0.0260  154 TYR A CZ  
1217 O OH  . TYR A 154 ? 0.4461 0.4143 0.4364 0.0574 0.0252  0.0296  154 TYR A OH  
1218 N N   . PRO A 155 ? 0.3073 0.2765 0.3085 0.0389 0.0266  0.0155  155 PRO A N   
1219 C CA  . PRO A 155 ? 0.3447 0.3095 0.3453 0.0385 0.0320  0.0191  155 PRO A CA  
1220 C C   . PRO A 155 ? 0.3242 0.2819 0.3207 0.0418 0.0351  0.0238  155 PRO A C   
1221 O O   . PRO A 155 ? 0.3422 0.2954 0.3379 0.0428 0.0339  0.0224  155 PRO A O   
1222 C CB  . PRO A 155 ? 0.3448 0.3058 0.3505 0.0341 0.0337  0.0141  155 PRO A CB  
1223 C CG  . PRO A 155 ? 0.3462 0.3136 0.3550 0.0325 0.0284  0.0081  155 PRO A CG  
1224 C CD  . PRO A 155 ? 0.3404 0.3093 0.3454 0.0360 0.0244  0.0090  155 PRO A CD  
1225 N N   . ALA A 156 ? 0.3192 0.2757 0.3124 0.0442 0.0390  0.0294  156 ALA A N   
1226 C CA  . ALA A 156 ? 0.3352 0.2858 0.3238 0.0484 0.0419  0.0345  156 ALA A CA  
1227 C C   . ALA A 156 ? 0.3731 0.3123 0.3624 0.0468 0.0457  0.0333  156 ALA A C   
1228 O O   . ALA A 156 ? 0.4048 0.3382 0.3908 0.0500 0.0471  0.0360  156 ALA A O   
1229 C CB  . ALA A 156 ? 0.3126 0.2644 0.2966 0.0522 0.0454  0.0407  156 ALA A CB  
1230 N N   . ASP A 157 ? 0.3539 0.2899 0.3480 0.0418 0.0475  0.0289  157 ASP A N   
1231 C CA  . ASP A 157 ? 0.4567 0.3823 0.4527 0.0397 0.0511  0.0265  157 ASP A CA  
1232 C C   . ASP A 157 ? 0.4324 0.3584 0.4322 0.0374 0.0465  0.0190  157 ASP A C   
1233 O O   . ASP A 157 ? 0.4057 0.3245 0.4085 0.0349 0.0486  0.0150  157 ASP A O   
1234 C CB  . ASP A 157 ? 0.4289 0.3489 0.4284 0.0360 0.0578  0.0264  157 ASP A CB  
1235 C CG  . ASP A 157 ? 0.4749 0.4014 0.4818 0.0307 0.0559  0.0200  157 ASP A CG  
1236 O OD1 . ASP A 157 ? 0.4435 0.3790 0.4515 0.0306 0.0493  0.0166  157 ASP A OD1 
1237 O OD2 . ASP A 157 ? 0.4719 0.3941 0.4837 0.0266 0.0614  0.0184  157 ASP A OD2 
1238 N N   . ALA A 158 ? 0.3500 0.2839 0.3493 0.0385 0.0403  0.0169  158 ALA A N   
1239 C CA  . ALA A 158 ? 0.3387 0.2732 0.3399 0.0374 0.0358  0.0101  158 ALA A CA  
1240 C C   . ALA A 158 ? 0.4205 0.3470 0.4184 0.0399 0.0364  0.0100  158 ALA A C   
1241 O O   . ALA A 158 ? 0.4079 0.3306 0.4079 0.0384 0.0354  0.0041  158 ALA A O   
1242 C CB  . ALA A 158 ? 0.3749 0.3181 0.3751 0.0389 0.0302  0.0091  158 ALA A CB  
1243 N N   . GLY A 159 ? 0.3631 0.2877 0.3559 0.0441 0.0377  0.0162  159 GLY A N   
1244 C CA  . GLY A 159 ? 0.3833 0.3008 0.3724 0.0471 0.0383  0.0167  159 GLY A CA  
1245 C C   . GLY A 159 ? 0.3564 0.2764 0.3436 0.0489 0.0333  0.0131  159 GLY A C   
1246 O O   . GLY A 159 ? 0.3563 0.2834 0.3448 0.0481 0.0295  0.0106  159 GLY A O   
1247 N N   . HIS A 160 ? 0.3893 0.3029 0.3728 0.0519 0.0338  0.0131  160 HIS A N   
1248 C CA  . HIS A 160 ? 0.3640 0.2785 0.3442 0.0546 0.0301  0.0104  160 HIS A CA  
1249 C C   . HIS A 160 ? 0.3841 0.2908 0.3624 0.0554 0.0299  0.0055  160 HIS A C   
1250 O O   . HIS A 160 ? 0.4535 0.3528 0.4313 0.0556 0.0336  0.0067  160 HIS A O   
1251 C CB  . HIS A 160 ? 0.4269 0.3423 0.4032 0.0589 0.0308  0.0161  160 HIS A CB  
1252 C CG  . HIS A 160 ? 0.4373 0.3616 0.4156 0.0587 0.0299  0.0196  160 HIS A CG  
1253 N ND1 . HIS A 160 ? 0.4456 0.3730 0.4257 0.0582 0.0321  0.0240  160 HIS A ND1 
1254 C CD2 . HIS A 160 ? 0.4221 0.3526 0.4006 0.0593 0.0272  0.0193  160 HIS A CD2 
1255 C CE1 . HIS A 160 ? 0.4052 0.3412 0.3869 0.0584 0.0302  0.0255  160 HIS A CE1 
1256 N NE2 . HIS A 160 ? 0.4417 0.3795 0.4230 0.0587 0.0275  0.0227  160 HIS A NE2 
1257 N N   . ASP A 161 ? 0.4203 0.3287 0.3972 0.0563 0.0257  -0.0001 161 ASP A N   
1258 C CA  . ASP A 161 ? 0.4502 0.3525 0.4238 0.0584 0.0245  -0.0054 161 ASP A CA  
1259 C C   . ASP A 161 ? 0.3706 0.2737 0.3375 0.0634 0.0217  -0.0054 161 ASP A C   
1260 O O   . ASP A 161 ? 0.3907 0.2981 0.3567 0.0641 0.0177  -0.0096 161 ASP A O   
1261 C CB  . ASP A 161 ? 0.6137 0.5173 0.5924 0.0549 0.0222  -0.0141 161 ASP A CB  
1262 C CG  . ASP A 161 ? 0.7718 0.6726 0.7464 0.0583 0.0185  -0.0213 161 ASP A CG  
1263 O OD1 . ASP A 161 ? 0.6985 0.5931 0.6666 0.0626 0.0195  -0.0195 161 ASP A OD1 
1264 O OD2 . ASP A 161 ? 0.7768 0.6822 0.7545 0.0571 0.0146  -0.0289 161 ASP A OD2 
1265 N N   . TYR A 162 ? 0.4268 0.3257 0.3887 0.0673 0.0241  -0.0004 162 TYR A N   
1266 C CA  . TYR A 162 ? 0.3913 0.2895 0.3464 0.0723 0.0228  0.0003  162 TYR A CA  
1267 C C   . TYR A 162 ? 0.4554 0.3477 0.4043 0.0762 0.0210  -0.0052 162 TYR A C   
1268 O O   . TYR A 162 ? 0.4275 0.3193 0.3700 0.0806 0.0191  -0.0062 162 TYR A O   
1269 C CB  . TYR A 162 ? 0.3675 0.2644 0.3207 0.0749 0.0265  0.0075  162 TYR A CB  
1270 C CG  . TYR A 162 ? 0.3683 0.2724 0.3263 0.0727 0.0276  0.0125  162 TYR A CG  
1271 C CD1 . TYR A 162 ? 0.4121 0.3182 0.3748 0.0701 0.0297  0.0159  162 TYR A CD1 
1272 C CD2 . TYR A 162 ? 0.4097 0.3186 0.3672 0.0737 0.0267  0.0138  162 TYR A CD2 
1273 C CE1 . TYR A 162 ? 0.4053 0.3189 0.3719 0.0688 0.0301  0.0199  162 TYR A CE1 
1274 C CE2 . TYR A 162 ? 0.4291 0.3452 0.3916 0.0717 0.0274  0.0175  162 TYR A CE2 
1275 C CZ  . TYR A 162 ? 0.4162 0.3352 0.3832 0.0694 0.0287  0.0203  162 TYR A CZ  
1276 O OH  . TYR A 162 ? 0.4983 0.4254 0.4699 0.0680 0.0289  0.0233  162 TYR A OH  
1277 N N   . GLY A 163 ? 0.4668 0.3539 0.4171 0.0750 0.0217  -0.0088 163 GLY A N   
1278 C CA  . GLY A 163 ? 0.5093 0.3902 0.4535 0.0791 0.0204  -0.0140 163 GLY A CA  
1279 C C   . GLY A 163 ? 0.5478 0.4315 0.4884 0.0817 0.0149  -0.0216 163 GLY A C   
1280 O O   . GLY A 163 ? 0.4851 0.3653 0.4168 0.0879 0.0137  -0.0230 163 GLY A O   
1281 N N   . THR A 164 ? 0.5068 0.3969 0.4541 0.0776 0.0119  -0.0266 164 THR A N   
1282 C CA  . THR A 164 ? 0.5670 0.4614 0.5118 0.0803 0.0063  -0.0342 164 THR A CA  
1283 C C   . THR A 164 ? 0.5373 0.4322 0.4729 0.0864 0.0052  -0.0305 164 THR A C   
1284 O O   . THR A 164 ? 0.5650 0.4578 0.4919 0.0928 0.0024  -0.0344 164 THR A O   
1285 C CB  . THR A 164 ? 0.6698 0.5725 0.6243 0.0745 0.0038  -0.0386 164 THR A CB  
1286 O OG1 . THR A 164 ? 0.7962 0.6975 0.7600 0.0683 0.0064  -0.0410 164 THR A OG1 
1287 C CG2 . THR A 164 ? 0.6853 0.5932 0.6379 0.0778 -0.0024 -0.0476 164 THR A CG2 
1288 N N   . ILE A 165 ? 0.4846 0.3823 0.4220 0.0846 0.0077  -0.0233 165 ILE A N   
1289 C CA  . ILE A 165 ? 0.4591 0.3566 0.3892 0.0894 0.0079  -0.0194 165 ILE A CA  
1290 C C   . ILE A 165 ? 0.4311 0.3207 0.3522 0.0952 0.0113  -0.0152 165 ILE A C   
1291 O O   . ILE A 165 ? 0.4812 0.3678 0.3930 0.1015 0.0110  -0.0149 165 ILE A O   
1292 C CB  . ILE A 165 ? 0.4341 0.3367 0.3700 0.0853 0.0102  -0.0132 165 ILE A CB  
1293 C CG1 . ILE A 165 ? 0.5925 0.5030 0.5366 0.0800 0.0071  -0.0169 165 ILE A CG1 
1294 C CG2 . ILE A 165 ? 0.4291 0.3303 0.3583 0.0898 0.0116  -0.0091 165 ILE A CG2 
1295 C CD1 . ILE A 165 ? 0.6085 0.5224 0.5495 0.0830 0.0020  -0.0236 165 ILE A CD1 
1296 N N   . ALA A 166 ? 0.4255 0.3113 0.3491 0.0934 0.0150  -0.0117 166 ALA A N   
1297 C CA  . ALA A 166 ? 0.4369 0.3155 0.3530 0.0986 0.0187  -0.0078 166 ALA A CA  
1298 C C   . ALA A 166 ? 0.5124 0.3857 0.4183 0.1052 0.0161  -0.0136 166 ALA A C   
1299 O O   . ALA A 166 ? 0.5209 0.3890 0.4173 0.1116 0.0182  -0.0109 166 ALA A O   
1300 C CB  . ALA A 166 ? 0.4596 0.3352 0.3802 0.0958 0.0225  -0.0043 166 ALA A CB  
1301 N N   . GLU A 167 ? 0.4699 0.3447 0.3779 0.1040 0.0116  -0.0217 167 GLU A N   
1302 C CA  . GLU A 167 ? 0.5266 0.3975 0.4256 0.1106 0.0084  -0.0284 167 GLU A CA  
1303 C C   . GLU A 167 ? 0.6052 0.4797 0.4975 0.1158 0.0036  -0.0330 167 GLU A C   
1304 O O   . GLU A 167 ? 0.6177 0.4877 0.4980 0.1241 0.0026  -0.0345 167 GLU A O   
1305 C CB  . GLU A 167 ? 0.6779 0.5482 0.5824 0.1073 0.0063  -0.0361 167 GLU A CB  
1306 C CG  . GLU A 167 ? 0.8750 0.7530 0.7906 0.1007 0.0027  -0.0422 167 GLU A CG  
1307 C CD  . GLU A 167 ? 1.0431 0.9197 0.9647 0.0976 0.0013  -0.0507 167 GLU A CD  
1308 O OE1 . GLU A 167 ? 0.9741 0.8511 0.9063 0.0901 0.0040  -0.0500 167 GLU A OE1 
1309 O OE2 . GLU A 167 ? 1.1491 1.0238 1.0645 0.1028 -0.0022 -0.0583 167 GLU A OE2 
1310 N N   . LYS A 168 ? 0.5639 0.4462 0.4633 0.1116 0.0007  -0.0348 168 LYS A N   
1311 C CA  . LYS A 168 ? 0.6161 0.5026 0.5100 0.1166 -0.0044 -0.0400 168 LYS A CA  
1312 C C   . LYS A 168 ? 0.5857 0.4731 0.4761 0.1183 -0.0025 -0.0335 168 LYS A C   
1313 O O   . LYS A 168 ? 0.5646 0.4520 0.4460 0.1253 -0.0052 -0.0356 168 LYS A O   
1314 C CB  . LYS A 168 ? 0.7255 0.6206 0.6294 0.1117 -0.0099 -0.0491 168 LYS A CB  
1315 C CG  . LYS A 168 ? 0.8947 0.7895 0.7987 0.1133 -0.0137 -0.0590 168 LYS A CG  
1316 C CD  . LYS A 168 ? 0.9943 0.8984 0.9105 0.1077 -0.0185 -0.0685 168 LYS A CD  
1317 C CE  . LYS A 168 ? 1.0010 0.9061 0.9312 0.0971 -0.0144 -0.0659 168 LYS A CE  
1318 N NZ  . LYS A 168 ? 1.0058 0.9178 0.9483 0.0915 -0.0177 -0.0763 168 LYS A NZ  
1319 N N   . GLY A 169 ? 0.4858 0.3739 0.3832 0.1125 0.0021  -0.0261 169 GLY A N   
1320 C CA  . GLY A 169 ? 0.4661 0.3555 0.3623 0.1130 0.0042  -0.0206 169 GLY A CA  
1321 C C   . GLY A 169 ? 0.4712 0.3687 0.3721 0.1109 -0.0005 -0.0252 169 GLY A C   
1322 O O   . GLY A 169 ? 0.4729 0.3762 0.3812 0.1070 -0.0046 -0.0317 169 GLY A O   
1323 N N   . PHE A 170 ? 0.4497 0.3473 0.3468 0.1134 0.0004  -0.0220 170 PHE A N   
1324 C CA  . PHE A 170 ? 0.4188 0.3237 0.3189 0.1127 -0.0041 -0.0263 170 PHE A CA  
1325 C C   . PHE A 170 ? 0.4821 0.3847 0.3695 0.1227 -0.0077 -0.0306 170 PHE A C   
1326 O O   . PHE A 170 ? 0.5047 0.3989 0.3800 0.1301 -0.0048 -0.0273 170 PHE A O   
1327 C CB  . PHE A 170 ? 0.3954 0.3022 0.3001 0.1089 -0.0007 -0.0204 170 PHE A CB  
1328 C CG  . PHE A 170 ? 0.4256 0.3383 0.3437 0.0993 0.0005  -0.0185 170 PHE A CG  
1329 C CD1 . PHE A 170 ? 0.3904 0.3005 0.3124 0.0957 0.0044  -0.0143 170 PHE A CD1 
1330 C CD2 . PHE A 170 ? 0.4392 0.3600 0.3652 0.0945 -0.0020 -0.0206 170 PHE A CD2 
1331 C CE1 . PHE A 170 ? 0.3846 0.3000 0.3175 0.0880 0.0056  -0.0122 170 PHE A CE1 
1332 C CE2 . PHE A 170 ? 0.4196 0.3455 0.3567 0.0865 -0.0005 -0.0185 170 PHE A CE2 
1333 C CZ  . PHE A 170 ? 0.4330 0.3561 0.3732 0.0835 0.0032  -0.0142 170 PHE A CZ  
1334 N N   . SER A 171 ? 0.4702 0.3805 0.3602 0.1233 -0.0137 -0.0378 171 SER A N   
1335 C CA  . SER A 171 ? 0.4990 0.4091 0.3774 0.1334 -0.0185 -0.0433 171 SER A CA  
1336 C C   . SER A 171 ? 0.5518 0.4568 0.4199 0.1400 -0.0158 -0.0379 171 SER A C   
1337 O O   . SER A 171 ? 0.5295 0.4318 0.3847 0.1503 -0.0182 -0.0404 171 SER A O   
1338 C CB  . SER A 171 ? 0.4731 0.3946 0.3594 0.1316 -0.0259 -0.0533 171 SER A CB  
1339 O OG  . SER A 171 ? 0.4879 0.4157 0.3831 0.1260 -0.0258 -0.0519 171 SER A OG  
1340 N N   . LYS A 172 ? 0.4833 0.3871 0.3570 0.1342 -0.0105 -0.0307 172 LYS A N   
1341 C CA  . LYS A 172 ? 0.4689 0.3665 0.3343 0.1392 -0.0064 -0.0250 172 LYS A CA  
1342 C C   . LYS A 172 ? 0.4887 0.3789 0.3554 0.1357 0.0018  -0.0163 172 LYS A C   
1343 O O   . LYS A 172 ? 0.4699 0.3630 0.3472 0.1276 0.0034  -0.0147 172 LYS A O   
1344 C CB  . LYS A 172 ? 0.5003 0.4050 0.3726 0.1356 -0.0085 -0.0262 172 LYS A CB  
1345 C CG  . LYS A 172 ? 0.6222 0.5348 0.4929 0.1403 -0.0165 -0.0350 172 LYS A CG  
1346 C CD  . LYS A 172 ? 0.8409 0.7596 0.7171 0.1379 -0.0179 -0.0356 172 LYS A CD  
1347 C CE  . LYS A 172 ? 0.8952 0.8209 0.7673 0.1449 -0.0254 -0.0439 172 LYS A CE  
1348 N NZ  . LYS A 172 ? 0.9106 0.8289 0.7649 0.1570 -0.0258 -0.0431 172 LYS A NZ  
1349 N N   . ILE A 173 ? 0.4282 0.3102 0.2850 0.1405 0.0072  -0.0105 173 ILE A N   
1350 C CA  . ILE A 173 ? 0.4362 0.3123 0.2955 0.1366 0.0155  -0.0027 173 ILE A CA  
1351 C C   . ILE A 173 ? 0.4518 0.3257 0.3112 0.1355 0.0198  0.0014  173 ILE A C   
1352 O O   . ILE A 173 ? 0.4556 0.3302 0.3085 0.1396 0.0172  -0.0004 173 ILE A O   
1353 C CB  . ILE A 173 ? 0.4345 0.3033 0.2835 0.1400 0.0197  0.0011  173 ILE A CB  
1354 C CG1 . ILE A 173 ? 0.4883 0.3533 0.3218 0.1478 0.0191  0.0012  173 ILE A CG1 
1355 C CG2 . ILE A 173 ? 0.5013 0.3717 0.3516 0.1402 0.0162  -0.0028 173 ILE A CG2 
1356 C CD1 . ILE A 173 ? 0.5468 0.4041 0.3688 0.1518 0.0238  0.0052  173 ILE A CD1 
1357 N N   . VAL A 174 ? 0.4352 0.3068 0.3023 0.1302 0.0263  0.0066  174 VAL A N   
1358 C CA  . VAL A 174 ? 0.4028 0.2722 0.2724 0.1283 0.0311  0.0100  174 VAL A CA  
1359 C C   . VAL A 174 ? 0.4824 0.3435 0.3475 0.1284 0.0399  0.0163  174 VAL A C   
1360 O O   . VAL A 174 ? 0.4200 0.2800 0.2915 0.1247 0.0445  0.0193  174 VAL A O   
1361 C CB  . VAL A 174 ? 0.3922 0.2690 0.2774 0.1197 0.0308  0.0098  174 VAL A CB  
1362 C CG1 . VAL A 174 ? 0.3991 0.2736 0.2862 0.1185 0.0349  0.0119  174 VAL A CG1 
1363 C CG2 . VAL A 174 ? 0.4023 0.2905 0.2941 0.1159 0.0222  0.0038  174 VAL A CG2 
1364 N N   . ILE A 175 ? 0.4307 0.2859 0.2847 0.1331 0.0426  0.0182  175 ILE A N   
1365 C CA  . ILE A 175 ? 0.4575 0.3039 0.3048 0.1345 0.0513  0.0238  175 ILE A CA  
1366 C C   . ILE A 175 ? 0.4546 0.2955 0.3009 0.1341 0.0576  0.0271  175 ILE A C   
1367 O O   . ILE A 175 ? 0.4776 0.3212 0.3262 0.1338 0.0545  0.0248  175 ILE A O   
1368 C CB  . ILE A 175 ? 0.4771 0.3192 0.3077 0.1423 0.0499  0.0238  175 ILE A CB  
1369 C CG1 . ILE A 175 ? 0.5490 0.3912 0.3684 0.1488 0.0450  0.0211  175 ILE A CG1 
1370 C CG2 . ILE A 175 ? 0.5205 0.3672 0.3520 0.1428 0.0441  0.0202  175 ILE A CG2 
1371 C CD1 . ILE A 175 ? 0.6214 0.4592 0.4228 0.1576 0.0435  0.0209  175 ILE A CD1 
1372 N N   . GLU A 176 ? 0.4950 0.3277 0.3380 0.1342 0.0670  0.0323  176 GLU A N   
1373 C CA  . GLU A 176 ? 0.5198 0.3452 0.3596 0.1348 0.0741  0.0356  176 GLU A CA  
1374 C C   . GLU A 176 ? 0.5379 0.3536 0.3613 0.1413 0.0803  0.0398  176 GLU A C   
1375 O O   . GLU A 176 ? 0.5377 0.3507 0.3587 0.1418 0.0844  0.0423  176 GLU A O   
1376 C CB  . GLU A 176 ? 0.5664 0.3909 0.4214 0.1273 0.0817  0.0378  176 GLU A CB  
1377 C CG  . GLU A 176 ? 0.6803 0.4969 0.5338 0.1271 0.0896  0.0406  176 GLU A CG  
1378 C CD  . GLU A 176 ? 0.9013 0.7168 0.7706 0.1197 0.0978  0.0421  176 GLU A CD  
1379 O OE1 . GLU A 176 ? 0.9662 0.7850 0.8463 0.1153 0.0969  0.0397  176 GLU A OE1 
1380 O OE2 . GLU A 176 ? 1.0241 0.8356 0.8953 0.1184 0.1054  0.0453  176 GLU A OE2 
1381 N N   . GLU A 177 ? 0.5143 0.3249 0.3256 0.1469 0.0810  0.0407  177 GLU A N   
1382 C CA  . GLU A 177 ? 0.5686 0.3691 0.3624 0.1540 0.0876  0.0451  177 GLU A CA  
1383 C C   . GLU A 177 ? 0.5512 0.3436 0.3420 0.1546 0.0952  0.0484  177 GLU A C   
1384 O O   . GLU A 177 ? 0.5409 0.3356 0.3307 0.1560 0.0904  0.0460  177 GLU A O   
1385 C CB  . GLU A 177 ? 0.6721 0.4742 0.4493 0.1631 0.0794  0.0423  177 GLU A CB  
1386 C CG  . GLU A 177 ? 0.9365 0.7437 0.7132 0.1639 0.0737  0.0396  177 GLU A CG  
1387 C CD  . GLU A 177 ? 1.0710 0.8787 0.8302 0.1736 0.0666  0.0367  177 GLU A CD  
1388 O OE1 . GLU A 177 ? 1.0700 0.8797 0.8257 0.1758 0.0631  0.0349  177 GLU A OE1 
1389 O OE2 . GLU A 177 ? 1.1158 0.9221 0.8649 0.1794 0.0643  0.0359  177 GLU A OE2 
1390 N N   . ASN A 178 ? 0.5452 0.3284 0.3356 0.1533 0.1072  0.0537  178 ASN A N   
1391 C CA  . ASN A 178 ? 0.5869 0.3609 0.3743 0.1538 0.1162  0.0572  178 ASN A CA  
1392 C C   . ASN A 178 ? 0.6333 0.4117 0.4355 0.1473 0.1139  0.0544  178 ASN A C   
1393 O O   . ASN A 178 ? 0.5706 0.3450 0.3673 0.1499 0.1148  0.0548  178 ASN A O   
1394 C CB  . ASN A 178 ? 0.5996 0.3670 0.3645 0.1644 0.1159  0.0589  178 ASN A CB  
1395 C CG  . ASN A 178 ? 0.6760 0.4363 0.4250 0.1711 0.1213  0.0628  178 ASN A CG  
1396 O OD1 . ASN A 178 ? 0.6984 0.4524 0.4506 0.1684 0.1321  0.0669  178 ASN A OD1 
1397 N ND2 . ASN A 178 ? 0.6897 0.4514 0.4219 0.1801 0.1140  0.0610  178 ASN A ND2 
1398 N N   . GLY A 179 ? 0.6073 0.3939 0.4278 0.1393 0.1109  0.0514  179 GLY A N   
1399 C CA  . GLY A 179 ? 0.5804 0.3718 0.4156 0.1330 0.1086  0.0482  179 GLY A CA  
1400 C C   . GLY A 179 ? 0.5228 0.3233 0.3573 0.1349 0.0963  0.0432  179 GLY A C   
1401 O O   . GLY A 179 ? 0.5469 0.3519 0.3926 0.1304 0.0937  0.0402  179 GLY A O   
1402 N N   . GLU A 180 ? 0.5334 0.3366 0.3550 0.1418 0.0890  0.0418  180 GLU A N   
1403 C CA  . GLU A 180 ? 0.4780 0.2906 0.2996 0.1437 0.0773  0.0363  180 GLU A CA  
1404 C C   . GLU A 180 ? 0.4655 0.2884 0.2965 0.1402 0.0697  0.0323  180 GLU A C   
1405 O O   . GLU A 180 ? 0.5159 0.3394 0.3406 0.1432 0.0677  0.0324  180 GLU A O   
1406 C CB  . GLU A 180 ? 0.5516 0.3621 0.3541 0.1536 0.0730  0.0359  180 GLU A CB  
1407 C CG  . GLU A 180 ? 0.5627 0.3829 0.3660 0.1558 0.0617  0.0299  180 GLU A CG  
1408 C CD  . GLU A 180 ? 0.5380 0.3583 0.3233 0.1660 0.0560  0.0283  180 GLU A CD  
1409 O OE1 . GLU A 180 ? 0.5249 0.3378 0.2959 0.1718 0.0601  0.0317  180 GLU A OE1 
1410 O OE2 . GLU A 180 ? 0.5378 0.3660 0.3231 0.1685 0.0471  0.0232  180 GLU A OE2 
1411 N N   . VAL A 181 ? 0.4604 0.2911 0.3061 0.1343 0.0657  0.0288  181 VAL A N   
1412 C CA  . VAL A 181 ? 0.4812 0.3218 0.3349 0.1317 0.0581  0.0248  181 VAL A CA  
1413 C C   . VAL A 181 ? 0.4975 0.3440 0.3431 0.1374 0.0481  0.0200  181 VAL A C   
1414 O O   . VAL A 181 ? 0.5015 0.3502 0.3449 0.1397 0.0445  0.0177  181 VAL A O   
1415 C CB  . VAL A 181 ? 0.4943 0.3412 0.3649 0.1244 0.0572  0.0225  181 VAL A CB  
1416 C CG1 . VAL A 181 ? 0.4955 0.3521 0.3731 0.1224 0.0495  0.0185  181 VAL A CG1 
1417 C CG2 . VAL A 181 ? 0.5197 0.3617 0.3995 0.1189 0.0668  0.0262  181 VAL A CG2 
1418 N N   . LYS A 182 ? 0.4429 0.2923 0.2844 0.1398 0.0438  0.0183  182 LYS A N   
1419 C CA  . LYS A 182 ? 0.5302 0.3852 0.3642 0.1456 0.0347  0.0131  182 LYS A CA  
1420 C C   . LYS A 182 ? 0.5258 0.3892 0.3681 0.1429 0.0281  0.0084  182 LYS A C   
1421 O O   . LYS A 182 ? 0.4899 0.3521 0.3367 0.1396 0.0310  0.0104  182 LYS A O   
1422 C CB  . LYS A 182 ? 0.5555 0.4042 0.3717 0.1539 0.0356  0.0149  182 LYS A CB  
1423 C CG  . LYS A 182 ? 0.6236 0.4619 0.4293 0.1572 0.0438  0.0205  182 LYS A CG  
1424 C CD  . LYS A 182 ? 0.5665 0.3977 0.3537 0.1656 0.0459  0.0230  182 LYS A CD  
1425 C CE  . LYS A 182 ? 0.7337 0.5698 0.5093 0.1740 0.0366  0.0179  182 LYS A CE  
1426 N NZ  . LYS A 182 ? 0.7622 0.5981 0.5330 0.1777 0.0351  0.0172  182 LYS A NZ  
1427 N N   . VAL A 183 ? 0.4602 0.3320 0.3045 0.1445 0.0196  0.0021  183 VAL A N   
1428 C CA  . VAL A 183 ? 0.5000 0.3793 0.3504 0.1432 0.0132  -0.0033 183 VAL A CA  
1429 C C   . VAL A 183 ? 0.4995 0.3803 0.3381 0.1509 0.0073  -0.0076 183 VAL A C   
1430 O O   . VAL A 183 ? 0.5493 0.4345 0.3838 0.1553 0.0020  -0.0117 183 VAL A O   
1431 C CB  . VAL A 183 ? 0.4925 0.3813 0.3556 0.1391 0.0081  -0.0084 183 VAL A CB  
1432 C CG1 . VAL A 183 ? 0.5023 0.3999 0.3723 0.1361 0.0016  -0.0144 183 VAL A CG1 
1433 C CG2 . VAL A 183 ? 0.4418 0.3307 0.3164 0.1306 0.0134  -0.0042 183 VAL A CG2 
1434 N N   . VAL A 184 ? 0.4508 0.3283 0.2838 0.1530 0.0080  -0.0069 184 VAL A N   
1435 C CA  . VAL A 184 ? 0.5124 0.3905 0.3328 0.1611 0.0026  -0.0109 184 VAL A CA  
1436 C C   . VAL A 184 ? 0.5145 0.3976 0.3392 0.1606 -0.0027 -0.0168 184 VAL A C   
1437 O O   . VAL A 184 ? 0.4946 0.3787 0.3304 0.1541 -0.0009 -0.0164 184 VAL A O   
1438 C CB  . VAL A 184 ? 0.5553 0.4230 0.3597 0.1668 0.0088  -0.0046 184 VAL A CB  
1439 C CG1 . VAL A 184 ? 0.6024 0.4648 0.4018 0.1680 0.0140  0.0004  184 VAL A CG1 
1440 C CG2 . VAL A 184 ? 0.5989 0.4603 0.4057 0.1626 0.0160  0.0008  184 VAL A CG2 
1441 N N   . ASP A 185 ? 0.5491 0.4353 0.3649 0.1677 -0.0092 -0.0224 185 ASP A N   
1442 C CA  . ASP A 185 ? 0.5878 0.4782 0.4069 0.1677 -0.0142 -0.0288 185 ASP A CA  
1443 C C   . ASP A 185 ? 0.5640 0.4462 0.3807 0.1658 -0.0079 -0.0232 185 ASP A C   
1444 O O   . ASP A 185 ? 0.5480 0.4218 0.3537 0.1689 -0.0019 -0.0163 185 ASP A O   
1445 C CB  . ASP A 185 ? 0.6062 0.5011 0.4149 0.1766 -0.0221 -0.0356 185 ASP A CB  
1446 C CG  . ASP A 185 ? 0.7248 0.6301 0.5382 0.1782 -0.0294 -0.0428 185 ASP A CG  
1447 O OD1 . ASP A 185 ? 0.6653 0.5762 0.4928 0.1714 -0.0298 -0.0451 185 ASP A OD1 
1448 O OD2 . ASP A 185 ? 0.8857 0.7941 0.6885 0.1867 -0.0349 -0.0462 185 ASP A OD2 
1449 N N   . ASN A 186 ? 0.5017 0.3863 0.3289 0.1606 -0.0087 -0.0262 186 ASN A N   
1450 C CA  . ASN A 186 ? 0.5345 0.4124 0.3595 0.1594 -0.0037 -0.0219 186 ASN A CA  
1451 C C   . ASN A 186 ? 0.5855 0.4618 0.3975 0.1673 -0.0075 -0.0254 186 ASN A C   
1452 O O   . ASN A 186 ? 0.5745 0.4575 0.3885 0.1693 -0.0151 -0.0344 186 ASN A O   
1453 C CB  . ASN A 186 ? 0.5116 0.3923 0.3510 0.1521 -0.0038 -0.0244 186 ASN A CB  
1454 C CG  . ASN A 186 ? 0.5430 0.4170 0.3813 0.1504 0.0018  -0.0194 186 ASN A CG  
1455 O OD1 . ASN A 186 ? 0.5667 0.4350 0.3932 0.1553 0.0043  -0.0163 186 ASN A OD1 
1456 N ND2 . ASN A 186 ? 0.4967 0.3715 0.3469 0.1438 0.0039  -0.0186 186 ASN A ND2 
1457 N N   . PRO A 187 ? 0.5956 0.4635 0.3943 0.1718 -0.0021 -0.0188 187 PRO A N   
1458 C CA  . PRO A 187 ? 0.7146 0.5802 0.4987 0.1804 -0.0054 -0.0212 187 PRO A CA  
1459 C C   . PRO A 187 ? 0.7849 0.6538 0.5745 0.1792 -0.0099 -0.0280 187 PRO A C   
1460 O O   . PRO A 187 ? 0.8031 0.6756 0.5864 0.1855 -0.0168 -0.0348 187 PRO A O   
1461 C CB  . PRO A 187 ? 0.6981 0.5531 0.4715 0.1822 0.0039  -0.0116 187 PRO A CB  
1462 C CG  . PRO A 187 ? 0.7830 0.6355 0.5622 0.1769 0.0107  -0.0051 187 PRO A CG  
1463 C CD  . PRO A 187 ? 0.6803 0.5406 0.4775 0.1690 0.0076  -0.0090 187 PRO A CD  
1464 N N   . ARG A 188 ? 0.7097 0.5775 0.5113 0.1714 -0.0059 -0.0263 188 ARG A N   
1465 C CA  . ARG A 188 ? 0.8202 0.6889 0.6268 0.1696 -0.0082 -0.0315 188 ARG A CA  
1466 C C   . ARG A 188 ? 0.9175 0.7954 0.7356 0.1667 -0.0159 -0.0424 188 ARG A C   
1467 O O   . ARG A 188 ? 0.9216 0.8001 0.7475 0.1629 -0.0168 -0.0469 188 ARG A O   
1468 C CB  . ARG A 188 ? 0.7503 0.6138 0.5644 0.1629 -0.0006 -0.0249 188 ARG A CB  
1469 N N   . TRP A 189 ? 0.8924 0.7773 0.7118 0.1683 -0.0211 -0.0467 189 TRP A N   
1470 C CA  . TRP A 189 ? 0.8694 0.7645 0.6995 0.1661 -0.0287 -0.0582 189 TRP A CA  
1471 C C   . TRP A 189 ? 0.9245 0.8259 0.7459 0.1744 -0.0368 -0.0654 189 TRP A C   
1472 O O   . TRP A 189 ? 0.9305 0.8304 0.7398 0.1813 -0.0371 -0.0612 189 TRP A O   
1473 C CB  . TRP A 189 ? 0.8462 0.7467 0.6875 0.1606 -0.0288 -0.0586 189 TRP A CB  
1474 C CG  . TRP A 189 ? 0.6927 0.5919 0.5478 0.1511 -0.0243 -0.0561 189 TRP A CG  
1475 C CD1 . TRP A 189 ? 0.6850 0.5766 0.5407 0.1473 -0.0166 -0.0464 189 TRP A CD1 
1476 C CD2 . TRP A 189 ? 0.6515 0.5603 0.5238 0.1407 -0.0271 -0.0613 189 TRP A CD2 
1477 N NE1 . TRP A 189 ? 0.6469 0.5429 0.5181 0.1359 -0.0150 -0.0451 189 TRP A NE1 
1478 C CE2 . TRP A 189 ? 0.6048 0.5106 0.4859 0.1317 -0.0209 -0.0538 189 TRP A CE2 
1479 C CE3 . TRP A 189 ? 0.6322 0.5518 0.5133 0.1384 -0.0339 -0.0717 189 TRP A CE3 
1480 C CZ2 . TRP A 189 ? 0.5397 0.4519 0.4367 0.1211 -0.0210 -0.0556 189 TRP A CZ2 
1481 C CZ3 . TRP A 189 ? 0.6337 0.5596 0.5318 0.1270 -0.0335 -0.0736 189 TRP A CZ3 
1482 C CH2 . TRP A 189 ? 0.6475 0.5690 0.5525 0.1188 -0.0269 -0.0653 189 TRP A CH2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   MET 2   2   2   MET ALA A . n 
A 1 3   MET 3   3   3   MET ALA A . n 
A 1 4   TYR 4   4   4   TYR TYR A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  PHE 14  14  14  PHE PHE A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  THR 16  16  16  THR THR A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  MET 32  32  32  MET MET A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  VAL 37  37  37  VAL VAL A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  ARG 40  40  40  ARG ARG A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  TRP 42  42  42  TRP TRP A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  TYR 54  54  54  TYR TYR A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  TYR 57  57  57  TYR TYR A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  GLN 61  61  61  GLN GLN A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  ASN 69  69  69  ASN ASN A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  THR 72  72  72  THR THR A . n 
A 1 73  HIS 73  73  73  HIS HIS A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  PRO 77  77  77  PRO PRO A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  PHE 85  85  85  PHE PHE A . n 
A 1 86  PHE 86  86  86  PHE PHE A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  HIS 90  90  90  HIS HIS A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  HIS 92  92  92  HIS HIS A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 GLN 113 113 113 GLN GLN A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 TRP 121 121 121 TRP TRP A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 PRO 126 126 126 PRO PRO A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 ILE 130 130 130 ILE ILE A . n 
A 1 131 TYR 131 131 131 TYR TYR A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 PRO 134 134 134 PRO PRO A . n 
A 1 135 TYR 135 135 135 TYR TYR A . n 
A 1 136 TRP 136 136 136 TRP TRP A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 GLY 144 144 144 GLY GLY A . n 
A 1 145 ASP 145 145 145 ASP ASP A . n 
A 1 146 GLU 146 146 146 GLU GLU A . n 
A 1 147 PRO 147 147 147 PRO PRO A . n 
A 1 148 PHE 148 148 148 PHE PHE A . n 
A 1 149 ILE 149 149 149 ILE ILE A . n 
A 1 150 MET 150 150 150 MET MET A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 TYR 154 154 154 TYR TYR A . n 
A 1 155 PRO 155 155 155 PRO PRO A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 ASP 157 157 157 ASP ASP A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 HIS 160 160 160 HIS HIS A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 TYR 162 162 162 TYR TYR A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 THR 164 164 164 THR THR A . n 
A 1 165 ILE 165 165 165 ILE ILE A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 GLU 167 167 167 GLU GLU A . n 
A 1 168 LYS 168 168 168 LYS LYS A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 PHE 170 170 170 PHE PHE A . n 
A 1 171 SER 171 171 171 SER SER A . n 
A 1 172 LYS 172 172 172 LYS LYS A . n 
A 1 173 ILE 173 173 173 ILE ILE A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 GLU 176 176 176 GLU GLU A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 ASN 178 178 178 ASN ASN A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 ARG 188 188 188 ARG ALA A . n 
A 1 189 TRP 189 189 189 TRP TRP A . n 
A 1 190 LYS 190 190 ?   ?   ?   A . n 
A 1 191 LYS 191 191 ?   ?   ?   A . n 
A 1 192 GLY 192 192 ?   ?   ?   A . n 
A 1 193 SER 193 193 ?   ?   ?   A . n 
A 1 194 LEU 194 194 ?   ?   ?   A . n 
A 1 195 GLU 195 195 ?   ?   ?   A . n 
A 1 196 HIS 196 196 ?   ?   ?   A . n 
A 1 197 HIS 197 197 ?   ?   ?   A . n 
A 1 198 HIS 198 198 ?   ?   ?   A . n 
A 1 199 HIS 199 199 ?   ?   ?   A . n 
A 1 200 HIS 200 200 ?   ?   ?   A . n 
A 1 201 HIS 201 201 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          PSI:Biology 
_pdbx_SG_project.full_name_of_center   'Northeast Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     NESG 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   501 501 HOH HOH A . 
B 2 HOH 2   502 502 HOH HOH A . 
B 2 HOH 3   503 503 HOH HOH A . 
B 2 HOH 4   504 504 HOH HOH A . 
B 2 HOH 5   505 505 HOH HOH A . 
B 2 HOH 6   506 506 HOH HOH A . 
B 2 HOH 7   507 507 HOH HOH A . 
B 2 HOH 8   508 508 HOH HOH A . 
B 2 HOH 9   509 509 HOH HOH A . 
B 2 HOH 10  510 510 HOH HOH A . 
B 2 HOH 11  511 511 HOH HOH A . 
B 2 HOH 12  512 512 HOH HOH A . 
B 2 HOH 13  513 513 HOH HOH A . 
B 2 HOH 14  514 514 HOH HOH A . 
B 2 HOH 15  515 515 HOH HOH A . 
B 2 HOH 16  516 516 HOH HOH A . 
B 2 HOH 17  517 517 HOH HOH A . 
B 2 HOH 18  518 518 HOH HOH A . 
B 2 HOH 19  519 519 HOH HOH A . 
B 2 HOH 20  520 520 HOH HOH A . 
B 2 HOH 21  521 521 HOH HOH A . 
B 2 HOH 22  522 522 HOH HOH A . 
B 2 HOH 23  523 523 HOH HOH A . 
B 2 HOH 24  524 524 HOH HOH A . 
B 2 HOH 25  525 525 HOH HOH A . 
B 2 HOH 26  526 526 HOH HOH A . 
B 2 HOH 27  527 527 HOH HOH A . 
B 2 HOH 28  528 528 HOH HOH A . 
B 2 HOH 29  529 529 HOH HOH A . 
B 2 HOH 30  530 530 HOH HOH A . 
B 2 HOH 31  531 531 HOH HOH A . 
B 2 HOH 32  532 532 HOH HOH A . 
B 2 HOH 33  533 533 HOH HOH A . 
B 2 HOH 34  534 534 HOH HOH A . 
B 2 HOH 35  535 535 HOH HOH A . 
B 2 HOH 36  536 536 HOH HOH A . 
B 2 HOH 37  537 537 HOH HOH A . 
B 2 HOH 38  538 538 HOH HOH A . 
B 2 HOH 39  539 539 HOH HOH A . 
B 2 HOH 40  540 540 HOH HOH A . 
B 2 HOH 41  541 541 HOH HOH A . 
B 2 HOH 42  542 542 HOH HOH A . 
B 2 HOH 43  543 543 HOH HOH A . 
B 2 HOH 44  544 544 HOH HOH A . 
B 2 HOH 45  545 545 HOH HOH A . 
B 2 HOH 46  546 546 HOH HOH A . 
B 2 HOH 47  547 547 HOH HOH A . 
B 2 HOH 48  548 548 HOH HOH A . 
B 2 HOH 49  549 549 HOH HOH A . 
B 2 HOH 50  550 550 HOH HOH A . 
B 2 HOH 51  551 551 HOH HOH A . 
B 2 HOH 52  552 552 HOH HOH A . 
B 2 HOH 53  553 553 HOH HOH A . 
B 2 HOH 54  554 554 HOH HOH A . 
B 2 HOH 55  555 555 HOH HOH A . 
B 2 HOH 56  556 556 HOH HOH A . 
B 2 HOH 57  557 557 HOH HOH A . 
B 2 HOH 58  558 558 HOH HOH A . 
B 2 HOH 59  559 559 HOH HOH A . 
B 2 HOH 60  560 560 HOH HOH A . 
B 2 HOH 61  561 561 HOH HOH A . 
B 2 HOH 62  562 562 HOH HOH A . 
B 2 HOH 63  563 563 HOH HOH A . 
B 2 HOH 64  564 564 HOH HOH A . 
B 2 HOH 65  565 565 HOH HOH A . 
B 2 HOH 66  566 566 HOH HOH A . 
B 2 HOH 67  567 567 HOH HOH A . 
B 2 HOH 68  568 568 HOH HOH A . 
B 2 HOH 69  569 569 HOH HOH A . 
B 2 HOH 70  570 570 HOH HOH A . 
B 2 HOH 71  571 571 HOH HOH A . 
B 2 HOH 72  572 572 HOH HOH A . 
B 2 HOH 73  573 573 HOH HOH A . 
B 2 HOH 74  574 574 HOH HOH A . 
B 2 HOH 75  575 575 HOH HOH A . 
B 2 HOH 76  576 576 HOH HOH A . 
B 2 HOH 77  577 577 HOH HOH A . 
B 2 HOH 78  578 578 HOH HOH A . 
B 2 HOH 79  579 579 HOH HOH A . 
B 2 HOH 80  580 580 HOH HOH A . 
B 2 HOH 81  581 581 HOH HOH A . 
B 2 HOH 82  582 582 HOH HOH A . 
B 2 HOH 83  583 583 HOH HOH A . 
B 2 HOH 84  584 584 HOH HOH A . 
B 2 HOH 85  585 585 HOH HOH A . 
B 2 HOH 86  586 586 HOH HOH A . 
B 2 HOH 87  587 587 HOH HOH A . 
B 2 HOH 88  588 588 HOH HOH A . 
B 2 HOH 89  589 589 HOH HOH A . 
B 2 HOH 90  590 590 HOH HOH A . 
B 2 HOH 91  591 591 HOH HOH A . 
B 2 HOH 92  592 592 HOH HOH A . 
B 2 HOH 93  593 593 HOH HOH A . 
B 2 HOH 94  594 594 HOH HOH A . 
B 2 HOH 95  595 595 HOH HOH A . 
B 2 HOH 96  596 596 HOH HOH A . 
B 2 HOH 97  597 597 HOH HOH A . 
B 2 HOH 98  598 598 HOH HOH A . 
B 2 HOH 99  599 599 HOH HOH A . 
B 2 HOH 100 600 600 HOH HOH A . 
B 2 HOH 101 601 601 HOH HOH A . 
B 2 HOH 102 602 602 HOH HOH A . 
B 2 HOH 103 603 603 HOH HOH A . 
B 2 HOH 104 604 604 HOH HOH A . 
B 2 HOH 105 605 605 HOH HOH A . 
B 2 HOH 106 606 606 HOH HOH A . 
B 2 HOH 107 607 607 HOH HOH A . 
B 2 HOH 108 608 608 HOH HOH A . 
B 2 HOH 109 609 609 HOH HOH A . 
B 2 HOH 110 610 610 HOH HOH A . 
B 2 HOH 111 611 611 HOH HOH A . 
B 2 HOH 112 612 612 HOH HOH A . 
B 2 HOH 113 613 613 HOH HOH A . 
B 2 HOH 114 614 614 HOH HOH A . 
B 2 HOH 115 615 615 HOH HOH A . 
B 2 HOH 116 616 616 HOH HOH A . 
B 2 HOH 117 617 617 HOH HOH A . 
B 2 HOH 118 618 618 HOH HOH A . 
B 2 HOH 119 619 619 HOH HOH A . 
B 2 HOH 120 620 620 HOH HOH A . 
B 2 HOH 121 621 621 HOH HOH A . 
B 2 HOH 122 622 622 HOH HOH A . 
B 2 HOH 123 623 623 HOH HOH A . 
B 2 HOH 124 624 624 HOH HOH A . 
B 2 HOH 125 625 625 HOH HOH A . 
B 2 HOH 126 626 626 HOH HOH A . 
B 2 HOH 127 627 627 HOH HOH A . 
B 2 HOH 128 628 628 HOH HOH A . 
B 2 HOH 129 629 629 HOH HOH A . 
B 2 HOH 130 630 630 HOH HOH A . 
B 2 HOH 131 631 631 HOH HOH A . 
B 2 HOH 132 632 632 HOH HOH A . 
B 2 HOH 133 633 633 HOH HOH A . 
B 2 HOH 134 634 634 HOH HOH A . 
B 2 HOH 135 635 635 HOH HOH A . 
B 2 HOH 136 636 636 HOH HOH A . 
B 2 HOH 137 637 637 HOH HOH A . 
B 2 HOH 138 638 638 HOH HOH A . 
B 2 HOH 139 639 639 HOH HOH A . 
B 2 HOH 140 640 640 HOH HOH A . 
B 2 HOH 141 641 641 HOH HOH A . 
B 2 HOH 142 642 642 HOH HOH A . 
B 2 HOH 143 643 643 HOH HOH A . 
B 2 HOH 144 644 644 HOH HOH A . 
B 2 HOH 145 645 645 HOH HOH A . 
B 2 HOH 146 646 646 HOH HOH A . 
B 2 HOH 147 647 647 HOH HOH A . 
B 2 HOH 148 648 648 HOH HOH A . 
B 2 HOH 149 649 649 HOH HOH A . 
B 2 HOH 150 650 650 HOH HOH A . 
B 2 HOH 151 651 651 HOH HOH A . 
B 2 HOH 152 652 652 HOH HOH A . 
B 2 HOH 153 653 653 HOH HOH A . 
B 2 HOH 154 654 654 HOH HOH A . 
B 2 HOH 155 655 655 HOH HOH A . 
B 2 HOH 156 656 656 HOH HOH A . 
B 2 HOH 157 657 657 HOH HOH A . 
B 2 HOH 158 658 658 HOH HOH A . 
B 2 HOH 159 659 659 HOH HOH A . 
B 2 HOH 160 660 660 HOH HOH A . 
B 2 HOH 161 661 661 HOH HOH A . 
B 2 HOH 162 662 662 HOH HOH A . 
B 2 HOH 163 663 663 HOH HOH A . 
B 2 HOH 164 664 664 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3680  ? 
1 MORE         -31   ? 
1 'SSA (A^2)'  16310 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 137.6300000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2011-08-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 PHENIX      1.7_650 ?               package 'Paul D. Adams' PDAdams@lbl.gov       refinement        
http://www.phenix-online.org/             C++ ? 
2 PDB_EXTRACT 3.100   'Jan. 22, 2010' package PDB             help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 
3 HKL-2000    .       ?               ?       ?               ?                     'data collection' ? ?   ? 
4 HKL-2000    .       ?               ?       ?               ?                     'data reduction'  ? ?   ? 
5 HKL-2000    .       ?               ?       ?               ?                     'data scaling'    ? ?   ? 
6 BALBES      .       ?               ?       ?               ?                     phasing           ? ?   ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 4   ? ? -144.10 -50.35 
2 1 GLU A 49  ? ? -144.01 -36.79 
3 1 TYR A 135 ? ? 81.95   -5.95  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   MET 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    3 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   TYR 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    4 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -128.42 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A MET 2   ? CG  ? A MET 2   CG  
2  1 Y 1 A MET 2   ? SD  ? A MET 2   SD  
3  1 Y 1 A MET 2   ? CE  ? A MET 2   CE  
4  1 Y 1 A MET 3   ? CG  ? A MET 3   CG  
5  1 Y 1 A MET 3   ? SD  ? A MET 3   SD  
6  1 Y 1 A MET 3   ? CE  ? A MET 3   CE  
7  1 Y 1 A ARG 188 ? CG  ? A ARG 188 CG  
8  1 Y 1 A ARG 188 ? CD  ? A ARG 188 CD  
9  1 Y 1 A ARG 188 ? NE  ? A ARG 188 NE  
10 1 Y 1 A ARG 188 ? CZ  ? A ARG 188 CZ  
11 1 Y 1 A ARG 188 ? NH1 ? A ARG 188 NH1 
12 1 Y 1 A ARG 188 ? NH2 ? A ARG 188 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A LYS 190 ? A LYS 190 
3  1 Y 1 A LYS 191 ? A LYS 191 
4  1 Y 1 A GLY 192 ? A GLY 192 
5  1 Y 1 A SER 193 ? A SER 193 
6  1 Y 1 A LEU 194 ? A LEU 194 
7  1 Y 1 A GLU 195 ? A GLU 195 
8  1 Y 1 A HIS 196 ? A HIS 196 
9  1 Y 1 A HIS 197 ? A HIS 197 
10 1 Y 1 A HIS 198 ? A HIS 198 
11 1 Y 1 A HIS 199 ? A HIS 199 
12 1 Y 1 A HIS 200 ? A HIS 200 
13 1 Y 1 A HIS 201 ? A HIS 201 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#