data_3T79
# 
_entry.id   3T79 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3T79         
NDB   NA1246       
RCSB  RCSB067125   
WWPDB D_1000067125 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3SQI 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3T79 
_pdbx_database_status.recvd_initial_deposition_date   2011-07-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cho, U.S.'      1 
'Harrison, S.C.' 2 
# 
_citation.id                        primary 
_citation.title                     'Ndc10 is a platform for inner kinetochore assembly in budding yeast.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            19 
_citation.page_first                48 
_citation.page_last                 55 
_citation.year                      2011 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22139014 
_citation.pdbx_database_id_DOI      10.1038/nsmb.2178 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cho, U.S.'      1 
primary 'Harrison, S.C.' 2 
# 
_cell.entry_id           3T79 
_cell.length_a           93.060 
_cell.length_b           99.651 
_cell.length_c           125.915 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3T79 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(P*TP*TP*AP*AP*TP*TP*TP*AP*TP*AP*AP*AP*AP*TP*T)-3')
;
4581.032  1 ? ? ?                                     'Centromeric CDEIII DNA' 
2 polymer syn 
;DNA (5'-D(P*AP*AP*AP*TP*TP*TP*TP*AP*TP*AP*AP*AP*TP*TP*A)-3')
;
4590.046  1 ? ? ?                                     'Centromeric CDEIII DNA' 
3 polymer syn 
;DNA (5'-D(P*TP*AP*AP*TP*TP*TP*AP*TP*AP*AP*AP*AP*TP*T)-3')
;
4276.839  1 ? ? ?                                     'Centromeric CDEIII DNA' 
4 polymer syn 
;DNA (5'-D(P*AP*AP*AP*AP*AP*TP*TP*TP*TP*AP*TP*AP*AP*AP*T)-3')
;
4599.061  1 ? ? ?                                     'Centromeric CDEIII DNA' 
5 polymer man KLLA0E03807p                                                   46610.270 2 ? ? 'DNA binding domain (residues 1-402)' 
?                        
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DT)(DA)(DA)(DT)(DT)(DT)(DA)(DT)(DA)(DA)(DA)(DA)(DT)(DT)' TTAATTTATAAAATT B   ? 
2 polydeoxyribonucleotide no no '(DA)(DA)(DA)(DT)(DT)(DT)(DT)(DA)(DT)(DA)(DA)(DA)(DT)(DT)(DA)' AAATTTTATAAATTA C   ? 
3 polydeoxyribonucleotide no no '(DT)(DA)(DA)(DT)(DT)(DT)(DA)(DT)(DA)(DA)(DA)(DA)(DT)(DT)' TAATTTATAAAATT E   ? 
4 polydeoxyribonucleotide no no '(DA)(DA)(DA)(DA)(DA)(DT)(DT)(DT)(DT)(DA)(DT)(DA)(DA)(DA)(DT)' AAAAATTTTATAAAT F   ? 
5 'polypeptide(L)'        no no 
;MSKLDSLLKELPTRTAHLYRSIWHKYTEWLKTMPDLTGADLKLFLSQKYIVKYIASHDDIAKDPLPTCDAMIWFSRALDI
ENNDVLVLQQRLYGLVKLLEFDYSNVIAILQKISINLWNPSTDSLQSKHFKTCQDKLKLLLDFQWKFNTNVSFEDRTTVS
LKDLQCILDDENGKCGLAHSSKPNFVLVPNFQSPFTCPIFTMAVYYYLRFHGVKKYYKGDGYQILSQLEHIPIIRGKSLD
QYPRELTLGNWYPTIFKYCQLPYTKKHWFQVNQEWPQFPDFSDSSENTSTLAESDSENTIGIPDFYIEKMNRTKLQPCPQ
VHVHLFPTDLPPDIQAVFDLLNSVLVTSLPLLYRVFPTHDIFLDPSLKTPQNIAFLTGTLPLDIESQEHLLAQLIDKTGT
VS
;
;MSKLDSLLKELPTRTAHLYRSIWHKYTEWLKTMPDLTGADLKLFLSQKYIVKYIASHDDIAKDPLPTCDAMIWFSRALDI
ENNDVLVLQQRLYGLVKLLEFDYSNVIAILQKISINLWNPSTDSLQSKHFKTCQDKLKLLLDFQWKFNTNVSFEDRTTVS
LKDLQCILDDENGKCGLAHSSKPNFVLVPNFQSPFTCPIFTMAVYYYLRFHGVKKYYKGDGYQILSQLEHIPIIRGKSLD
QYPRELTLGNWYPTIFKYCQLPYTKKHWFQVNQEWPQFPDFSDSSENTSTLAESDSENTIGIPDFYIEKMNRTKLQPCPQ
VHVHLFPTDLPPDIQAVFDLLNSVLVTSLPLLYRVFPTHDIFLDPSLKTPQNIAFLTGTLPLDIESQEHLLAQLIDKTGT
VS
;
A,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DT  n 
1 3   DA  n 
1 4   DA  n 
1 5   DT  n 
1 6   DT  n 
1 7   DT  n 
1 8   DA  n 
1 9   DT  n 
1 10  DA  n 
1 11  DA  n 
1 12  DA  n 
1 13  DA  n 
1 14  DT  n 
1 15  DT  n 
2 1   DA  n 
2 2   DA  n 
2 3   DA  n 
2 4   DT  n 
2 5   DT  n 
2 6   DT  n 
2 7   DT  n 
2 8   DA  n 
2 9   DT  n 
2 10  DA  n 
2 11  DA  n 
2 12  DA  n 
2 13  DT  n 
2 14  DT  n 
2 15  DA  n 
3 1   DT  n 
3 2   DA  n 
3 3   DA  n 
3 4   DT  n 
3 5   DT  n 
3 6   DT  n 
3 7   DA  n 
3 8   DT  n 
3 9   DA  n 
3 10  DA  n 
3 11  DA  n 
3 12  DA  n 
3 13  DT  n 
3 14  DT  n 
4 1   DA  n 
4 2   DA  n 
4 3   DA  n 
4 4   DA  n 
4 5   DA  n 
4 6   DT  n 
4 7   DT  n 
4 8   DT  n 
4 9   DT  n 
4 10  DA  n 
4 11  DT  n 
4 12  DA  n 
4 13  DA  n 
4 14  DA  n 
4 15  DT  n 
5 1   MET n 
5 2   SER n 
5 3   LYS n 
5 4   LEU n 
5 5   ASP n 
5 6   SER n 
5 7   LEU n 
5 8   LEU n 
5 9   LYS n 
5 10  GLU n 
5 11  LEU n 
5 12  PRO n 
5 13  THR n 
5 14  ARG n 
5 15  THR n 
5 16  ALA n 
5 17  HIS n 
5 18  LEU n 
5 19  TYR n 
5 20  ARG n 
5 21  SER n 
5 22  ILE n 
5 23  TRP n 
5 24  HIS n 
5 25  LYS n 
5 26  TYR n 
5 27  THR n 
5 28  GLU n 
5 29  TRP n 
5 30  LEU n 
5 31  LYS n 
5 32  THR n 
5 33  MET n 
5 34  PRO n 
5 35  ASP n 
5 36  LEU n 
5 37  THR n 
5 38  GLY n 
5 39  ALA n 
5 40  ASP n 
5 41  LEU n 
5 42  LYS n 
5 43  LEU n 
5 44  PHE n 
5 45  LEU n 
5 46  SER n 
5 47  GLN n 
5 48  LYS n 
5 49  TYR n 
5 50  ILE n 
5 51  VAL n 
5 52  LYS n 
5 53  TYR n 
5 54  ILE n 
5 55  ALA n 
5 56  SER n 
5 57  HIS n 
5 58  ASP n 
5 59  ASP n 
5 60  ILE n 
5 61  ALA n 
5 62  LYS n 
5 63  ASP n 
5 64  PRO n 
5 65  LEU n 
5 66  PRO n 
5 67  THR n 
5 68  CYS n 
5 69  ASP n 
5 70  ALA n 
5 71  MET n 
5 72  ILE n 
5 73  TRP n 
5 74  PHE n 
5 75  SER n 
5 76  ARG n 
5 77  ALA n 
5 78  LEU n 
5 79  ASP n 
5 80  ILE n 
5 81  GLU n 
5 82  ASN n 
5 83  ASN n 
5 84  ASP n 
5 85  VAL n 
5 86  LEU n 
5 87  VAL n 
5 88  LEU n 
5 89  GLN n 
5 90  GLN n 
5 91  ARG n 
5 92  LEU n 
5 93  TYR n 
5 94  GLY n 
5 95  LEU n 
5 96  VAL n 
5 97  LYS n 
5 98  LEU n 
5 99  LEU n 
5 100 GLU n 
5 101 PHE n 
5 102 ASP n 
5 103 TYR n 
5 104 SER n 
5 105 ASN n 
5 106 VAL n 
5 107 ILE n 
5 108 ALA n 
5 109 ILE n 
5 110 LEU n 
5 111 GLN n 
5 112 LYS n 
5 113 ILE n 
5 114 SER n 
5 115 ILE n 
5 116 ASN n 
5 117 LEU n 
5 118 TRP n 
5 119 ASN n 
5 120 PRO n 
5 121 SER n 
5 122 THR n 
5 123 ASP n 
5 124 SER n 
5 125 LEU n 
5 126 GLN n 
5 127 SER n 
5 128 LYS n 
5 129 HIS n 
5 130 PHE n 
5 131 LYS n 
5 132 THR n 
5 133 CYS n 
5 134 GLN n 
5 135 ASP n 
5 136 LYS n 
5 137 LEU n 
5 138 LYS n 
5 139 LEU n 
5 140 LEU n 
5 141 LEU n 
5 142 ASP n 
5 143 PHE n 
5 144 GLN n 
5 145 TRP n 
5 146 LYS n 
5 147 PHE n 
5 148 ASN n 
5 149 THR n 
5 150 ASN n 
5 151 VAL n 
5 152 SER n 
5 153 PHE n 
5 154 GLU n 
5 155 ASP n 
5 156 ARG n 
5 157 THR n 
5 158 THR n 
5 159 VAL n 
5 160 SER n 
5 161 LEU n 
5 162 LYS n 
5 163 ASP n 
5 164 LEU n 
5 165 GLN n 
5 166 CYS n 
5 167 ILE n 
5 168 LEU n 
5 169 ASP n 
5 170 ASP n 
5 171 GLU n 
5 172 ASN n 
5 173 GLY n 
5 174 LYS n 
5 175 CYS n 
5 176 GLY n 
5 177 LEU n 
5 178 ALA n 
5 179 HIS n 
5 180 SER n 
5 181 SER n 
5 182 LYS n 
5 183 PRO n 
5 184 ASN n 
5 185 PHE n 
5 186 VAL n 
5 187 LEU n 
5 188 VAL n 
5 189 PRO n 
5 190 ASN n 
5 191 PHE n 
5 192 GLN n 
5 193 SER n 
5 194 PRO n 
5 195 PHE n 
5 196 THR n 
5 197 CYS n 
5 198 PRO n 
5 199 ILE n 
5 200 PHE n 
5 201 THR n 
5 202 MET n 
5 203 ALA n 
5 204 VAL n 
5 205 TYR n 
5 206 TYR n 
5 207 TYR n 
5 208 LEU n 
5 209 ARG n 
5 210 PHE n 
5 211 HIS n 
5 212 GLY n 
5 213 VAL n 
5 214 LYS n 
5 215 LYS n 
5 216 TYR n 
5 217 TYR n 
5 218 LYS n 
5 219 GLY n 
5 220 ASP n 
5 221 GLY n 
5 222 TYR n 
5 223 GLN n 
5 224 ILE n 
5 225 LEU n 
5 226 SER n 
5 227 GLN n 
5 228 LEU n 
5 229 GLU n 
5 230 HIS n 
5 231 ILE n 
5 232 PRO n 
5 233 ILE n 
5 234 ILE n 
5 235 ARG n 
5 236 GLY n 
5 237 LYS n 
5 238 SER n 
5 239 LEU n 
5 240 ASP n 
5 241 GLN n 
5 242 TYR n 
5 243 PRO n 
5 244 ARG n 
5 245 GLU n 
5 246 LEU n 
5 247 THR n 
5 248 LEU n 
5 249 GLY n 
5 250 ASN n 
5 251 TRP n 
5 252 TYR n 
5 253 PRO n 
5 254 THR n 
5 255 ILE n 
5 256 PHE n 
5 257 LYS n 
5 258 TYR n 
5 259 CYS n 
5 260 GLN n 
5 261 LEU n 
5 262 PRO n 
5 263 TYR n 
5 264 THR n 
5 265 LYS n 
5 266 LYS n 
5 267 HIS n 
5 268 TRP n 
5 269 PHE n 
5 270 GLN n 
5 271 VAL n 
5 272 ASN n 
5 273 GLN n 
5 274 GLU n 
5 275 TRP n 
5 276 PRO n 
5 277 GLN n 
5 278 PHE n 
5 279 PRO n 
5 280 ASP n 
5 281 PHE n 
5 282 SER n 
5 283 ASP n 
5 284 SER n 
5 285 SER n 
5 286 GLU n 
5 287 ASN n 
5 288 THR n 
5 289 SER n 
5 290 THR n 
5 291 LEU n 
5 292 ALA n 
5 293 GLU n 
5 294 SER n 
5 295 ASP n 
5 296 SER n 
5 297 GLU n 
5 298 ASN n 
5 299 THR n 
5 300 ILE n 
5 301 GLY n 
5 302 ILE n 
5 303 PRO n 
5 304 ASP n 
5 305 PHE n 
5 306 TYR n 
5 307 ILE n 
5 308 GLU n 
5 309 LYS n 
5 310 MET n 
5 311 ASN n 
5 312 ARG n 
5 313 THR n 
5 314 LYS n 
5 315 LEU n 
5 316 GLN n 
5 317 PRO n 
5 318 CYS n 
5 319 PRO n 
5 320 GLN n 
5 321 VAL n 
5 322 HIS n 
5 323 VAL n 
5 324 HIS n 
5 325 LEU n 
5 326 PHE n 
5 327 PRO n 
5 328 THR n 
5 329 ASP n 
5 330 LEU n 
5 331 PRO n 
5 332 PRO n 
5 333 ASP n 
5 334 ILE n 
5 335 GLN n 
5 336 ALA n 
5 337 VAL n 
5 338 PHE n 
5 339 ASP n 
5 340 LEU n 
5 341 LEU n 
5 342 ASN n 
5 343 SER n 
5 344 VAL n 
5 345 LEU n 
5 346 VAL n 
5 347 THR n 
5 348 SER n 
5 349 LEU n 
5 350 PRO n 
5 351 LEU n 
5 352 LEU n 
5 353 TYR n 
5 354 ARG n 
5 355 VAL n 
5 356 PHE n 
5 357 PRO n 
5 358 THR n 
5 359 HIS n 
5 360 ASP n 
5 361 ILE n 
5 362 PHE n 
5 363 LEU n 
5 364 ASP n 
5 365 PRO n 
5 366 SER n 
5 367 LEU n 
5 368 LYS n 
5 369 THR n 
5 370 PRO n 
5 371 GLN n 
5 372 ASN n 
5 373 ILE n 
5 374 ALA n 
5 375 PHE n 
5 376 LEU n 
5 377 THR n 
5 378 GLY n 
5 379 THR n 
5 380 LEU n 
5 381 PRO n 
5 382 LEU n 
5 383 ASP n 
5 384 ILE n 
5 385 GLU n 
5 386 SER n 
5 387 GLN n 
5 388 GLU n 
5 389 HIS n 
5 390 LEU n 
5 391 LEU n 
5 392 ALA n 
5 393 GLN n 
5 394 LEU n 
5 395 ILE n 
5 396 ASP n 
5 397 LYS n 
5 398 THR n 
5 399 GLY n 
5 400 THR n 
5 401 VAL n 
5 402 SER n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Yeast 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 KLLA0E03807g 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Kluyveromyces lactis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     284590 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET3A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 'synthesized DNA' 
2 1 sample ? ? ? ? ? 'synthesized DNA' 
3 1 sample ? ? ? ? ? 'synthesized DNA' 
4 1 sample ? ? ? ? ? 'synthesized DNA' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q6CPM4_KLULA Q6CPM4 5 
;MSKLDSLLKELPTRTAHLYRSIWHKYTEWLKTMPDLTGADLKLFLSQKYIVKYIASHDDIAKDPLPTCDAMIWFSRALDI
ENNDVLVLQQRLYGLVKLLEFDYSNVIAILQKISINLWNPSTDSLQSKHFKTCQDKLKLLLDFQWKFNTNVSFEDRTTVS
LKDLQCILDDENGKCGLAHSSKPNFVLVPNFQSPFTCPIFTMAVYYYLRFHGVKKYYKGDGYQILSQLEHIPIIRGKSLD
QYPRELTLGNWYPTIFKYCQLPYTKKHWFQVNQEWPQFPDFSDSSENTSTLAESDSENTIGIPDFYIEKMNRTKLQPCPQ
VHVHLFPTDLPPDIQAVFDLLNSVLVTSLPLLYRVFPTHDIFLDPSLKTPQNIAFLTGTLPLDIESQEHLLAQLIDKTGT
VS
;
1 ? 
2 PDB 3T79         3T79   1 ? ? ? 
3 PDB 3T79         3T79   2 ? ? ? 
4 PDB 3T79         3T79   3 ? ? ? 
5 PDB 3T79         3T79   4 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3T79 A 1 ? 402 ? Q6CPM4 1 ? 402 ? 1 402 
2 1 3T79 D 1 ? 402 ? Q6CPM4 1 ? 402 ? 1 402 
3 2 3T79 B 1 ? 15  ? 3T79   1 ? 15  ? 1 15  
4 3 3T79 C 1 ? 15  ? 3T79   1 ? 15  ? 1 15  
5 4 3T79 E 1 ? 14  ? 3T79   1 ? 14  ? 1 14  
6 5 3T79 F 1 ? 15  ? 3T79   0 ? 14  ? 0 14  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3T79 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.62 
_exptl_crystal.density_percent_sol   53.12 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    '25% PEG 10,000, 0.1 M Tris-HCl, pH8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2010-02-10 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'CHOZU HLD8-24' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97914 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97914 
# 
_reflns.entry_id                     3T79 
_reflns.observed_criterion_sigma_I   22.4 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_high            3.6 
_reflns.d_resolution_low             50 
_reflns.number_obs                   13821 
_reflns.number_all                   13976 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.223 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        1.4 
_reflns.B_iso_Wilson_estimate        67.92 
_reflns.pdbx_redundancy              3.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.6 
_reflns_shell.d_res_low              3.73 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.912 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.4 
_reflns_shell.pdbx_redundancy        3.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1374 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3T79 
_refine.ls_number_reflns_obs                     13773 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             43.645 
_refine.ls_d_res_high                            3.6113 
_refine.ls_percent_reflns_obs                    98.65 
_refine.ls_R_factor_obs                          0.2885 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2864 
_refine.ls_R_factor_R_free                       0.3309 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.98 
_refine.ls_number_reflns_R_free                  686 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               89.63 
_refine.aniso_B[1][1]                            29.6388 
_refine.aniso_B[2][2]                            -59.6494 
_refine.aniso_B[3][3]                            23.6294 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.288 
_refine.solvent_model_param_bsol                 66.934 
_refine.pdbx_solvent_vdw_probe_radii             1.10 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.83 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3SQI' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.98 
_refine.pdbx_overall_phase_error                 36.28 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6392 
_refine_hist.pdbx_number_atoms_nucleic_acid   1211 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7603 
_refine_hist.d_res_high                       3.6113 
_refine_hist.d_res_low                        43.645 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.009  ? ? 7930  ? 'X-RAY DIFFRACTION' 
f_angle_d          1.466  ? ? 11029 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 21.759 ? ? 3004  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.084  ? ? 1234  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.007  ? ? 1183  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 3.6113 3.8900  2561 0.3817 99.00 0.3843 . . 138 . . . . 'X-RAY DIFFRACTION' 
. 3.8900 4.2811  2588 0.3006 99.00 0.3550 . . 136 . . . . 'X-RAY DIFFRACTION' 
. 4.2811 4.8999  2620 0.2767 99.00 0.3022 . . 130 . . . . 'X-RAY DIFFRACTION' 
. 4.8999 6.1706  2626 0.3008 99.00 0.3730 . . 130 . . . . 'X-RAY DIFFRACTION' 
. 6.1706 43.6485 2692 0.2473 97.00 0.3006 . . 152 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3T79 
_struct.title                     'Ndc10: a platform for inner kinetochore assembly in budding yeast' 
_struct.pdbx_descriptor           'PROTEIN/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3T79 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
_struct_keywords.text            'DNA recombinase, DNA binding, DNA, DNA BINDING PROTEIN-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU E 4   ? LYS E 9   ? LEU A 4   LYS A 9   5 ? 6  
HELX_P HELX_P2  2  PRO E 12  ? LYS E 31  ? PRO A 12  LYS A 31  1 ? 20 
HELX_P HELX_P3  3  SER E 46  ? HIS E 57  ? SER A 46  HIS A 57  1 ? 12 
HELX_P HELX_P4  4  HIS E 57  ? ASP E 63  ? HIS A 57  ASP A 63  1 ? 7  
HELX_P HELX_P5  5  PRO E 64  ? ALA E 77  ? PRO A 64  ALA A 77  1 ? 14 
HELX_P HELX_P6  6  GLU E 81  ? PHE E 101 ? GLU A 81  PHE A 101 1 ? 21 
HELX_P HELX_P7  7  VAL E 106 ? ASN E 119 ? VAL A 106 ASN A 119 1 ? 14 
HELX_P HELX_P8  8  THR E 132 ? ASN E 150 ? THR A 132 ASN A 150 1 ? 19 
HELX_P HELX_P9  9  SER E 152 ? VAL E 159 ? SER A 152 VAL A 159 1 ? 8  
HELX_P HELX_P10 10 SER E 160 ? LEU E 164 ? SER A 160 LEU A 164 5 ? 5  
HELX_P HELX_P11 11 SER E 193 ? THR E 196 ? SER A 193 THR A 196 5 ? 4  
HELX_P HELX_P12 12 CYS E 197 ? HIS E 211 ? CYS A 197 HIS A 211 1 ? 15 
HELX_P HELX_P13 13 GLN E 223 ? LEU E 228 ? GLN A 223 LEU A 228 1 ? 6  
HELX_P HELX_P14 14 ARG E 244 ? CYS E 259 ? ARG A 244 CYS A 259 1 ? 16 
HELX_P HELX_P15 15 THR E 264 ? GLN E 270 ? THR A 264 GLN A 270 1 ? 7  
HELX_P HELX_P16 16 PRO E 303 ? ASN E 311 ? PRO A 303 ASN A 311 1 ? 9  
HELX_P HELX_P17 17 PRO E 331 ? PHE E 356 ? PRO A 331 PHE A 356 1 ? 26 
HELX_P HELX_P18 18 HIS E 359 ? LYS E 368 ? HIS A 359 LYS A 368 5 ? 10 
HELX_P HELX_P19 19 THR E 369 ? THR E 377 ? THR A 369 THR A 377 1 ? 9  
HELX_P HELX_P20 20 ASP E 383 ? SER E 386 ? ASP A 383 SER A 386 5 ? 4  
HELX_P HELX_P21 21 GLN E 387 ? GLN E 393 ? GLN A 387 GLN A 393 1 ? 7  
HELX_P HELX_P22 22 LEU F 4   ? LYS F 9   ? LEU D 4   LYS D 9   5 ? 6  
HELX_P HELX_P23 23 PRO F 12  ? LYS F 31  ? PRO D 12  LYS D 31  1 ? 20 
HELX_P HELX_P24 24 LEU F 41  ? LEU F 45  ? LEU D 41  LEU D 45  5 ? 5  
HELX_P HELX_P25 25 SER F 46  ? HIS F 57  ? SER D 46  HIS D 57  1 ? 12 
HELX_P HELX_P26 26 HIS F 57  ? ASP F 63  ? HIS D 57  ASP D 63  1 ? 7  
HELX_P HELX_P27 27 PRO F 64  ? ALA F 77  ? PRO D 64  ALA D 77  1 ? 14 
HELX_P HELX_P28 28 GLU F 81  ? PHE F 101 ? GLU D 81  PHE D 101 1 ? 21 
HELX_P HELX_P29 29 ASP F 102 ? ASN F 119 ? ASP D 102 ASN D 119 1 ? 18 
HELX_P HELX_P30 30 THR F 132 ? ASN F 150 ? THR D 132 ASN D 150 1 ? 19 
HELX_P HELX_P31 31 SER F 152 ? VAL F 159 ? SER D 152 VAL D 159 1 ? 8  
HELX_P HELX_P32 32 SER F 160 ? LEU F 164 ? SER D 160 LEU D 164 5 ? 5  
HELX_P HELX_P33 33 SER F 193 ? THR F 196 ? SER D 193 THR D 196 5 ? 4  
HELX_P HELX_P34 34 CYS F 197 ? PHE F 210 ? CYS D 197 PHE D 210 1 ? 14 
HELX_P HELX_P35 35 GLN F 223 ? LEU F 228 ? GLN D 223 LEU D 228 1 ? 6  
HELX_P HELX_P36 36 ARG F 244 ? GLN F 260 ? ARG D 244 GLN D 260 1 ? 17 
HELX_P HELX_P37 37 THR F 264 ? GLN F 270 ? THR D 264 GLN D 270 1 ? 7  
HELX_P HELX_P38 38 PRO F 303 ? ASN F 311 ? PRO D 303 ASN D 311 1 ? 9  
HELX_P HELX_P39 39 PRO F 331 ? PHE F 356 ? PRO D 331 PHE D 356 1 ? 26 
HELX_P HELX_P40 40 HIS F 359 ? LYS F 368 ? HIS D 359 LYS D 368 5 ? 10 
HELX_P HELX_P41 41 THR F 369 ? THR F 377 ? THR D 369 THR D 377 1 ? 9  
HELX_P HELX_P42 42 ASP F 383 ? SER F 386 ? ASP D 383 SER D 386 5 ? 4  
HELX_P HELX_P43 43 GLN F 387 ? GLN F 393 ? GLN D 387 GLN D 393 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DT 2  N3 ? ? ? 1_555 B DA 15 N1 ? ? B DT 2  C DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DT 2  O4 ? ? ? 1_555 B DA 15 N6 ? ? B DT 2  C DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 14 N3 ? ? B DA 4  C DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 14 O4 ? ? B DA 4  C DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DT 5  N3 ? ? ? 1_555 B DA 12 N1 ? ? B DT 5  C DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DT 5  O4 ? ? ? 1_555 B DA 12 N6 ? ? B DT 5  C DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 11 N1 ? ? B DT 6  C DA 11 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? 
hydrog8  hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 10 N1 ? ? B DT 7  C DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 10 N6 ? ? B DT 7  C DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT 9  N3 ? ? B DA 8  C DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT 9  O4 ? ? B DA 8  C DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DT 9  N3 ? ? ? 1_555 B DA 8  N1 ? ? B DT 9  C DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DT 9  O4 ? ? ? 1_555 B DA 8  N6 ? ? B DT 9  C DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT 7  N3 ? ? B DA 10 C DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT 7  O4 ? ? B DA 10 C DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 6  N3 ? ? B DA 11 C DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 6  O4 ? ? B DA 11 C DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DA 13 N1 ? ? ? 1_555 B DT 4  N3 ? ? B DA 13 C DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DA 13 N6 ? ? ? 1_555 B DT 4  O4 ? ? B DA 13 C DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DT 14 N3 ? ? ? 1_555 B DA 3  N1 ? ? B DT 14 C DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DT 14 O4 ? ? ? 1_555 B DA 3  N6 ? ? B DT 14 C DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DT 15 N3 ? ? ? 1_555 B DA 2  N1 ? ? B DT 15 C DA 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DT 15 O4 ? ? ? 1_555 B DA 2  N6 ? ? B DT 15 C DA 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? C DA 3  N1 ? ? ? 1_555 D DT 15 N3 ? ? E DA 3  F DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? C DA 3  N6 ? ? ? 1_555 D DT 15 O4 ? ? E DA 3  F DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? C DT 4  N3 ? ? ? 1_555 D DA 14 N1 ? ? E DT 4  F DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? C DT 4  O4 ? ? ? 1_555 D DA 14 N6 ? ? E DT 4  F DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? C DT 5  N3 ? ? ? 1_555 D DA 13 N1 ? ? E DT 5  F DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? C DT 5  O4 ? ? ? 1_555 D DA 13 N6 ? ? E DT 5  F DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? C DT 6  N3 ? ? ? 1_555 D DA 12 N1 ? ? E DT 6  F DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? C DT 6  O4 ? ? ? 1_555 D DA 12 N6 ? ? E DT 6  F DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? C DA 7  N1 ? ? ? 1_555 D DT 11 N3 ? ? E DA 7  F DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? C DA 7  N6 ? ? ? 1_555 D DT 11 O4 ? ? E DA 7  F DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? C DT 8  N3 ? ? ? 1_555 D DA 10 N1 ? ? E DT 8  F DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? C DT 8  O4 ? ? ? 1_555 D DA 10 N6 ? ? E DT 8  F DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? C DA 9  N1 ? ? ? 1_555 D DT 9  N3 ? ? E DA 9  F DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? C DA 9  N6 ? ? ? 1_555 D DT 9  O4 ? ? E DA 9  F DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? C DA 10 N1 ? ? ? 1_555 D DT 8  N3 ? ? E DA 10 F DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? C DA 10 N6 ? ? ? 1_555 D DT 8  O4 ? ? E DA 10 F DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? C DA 10 N1 ? ? ? 1_555 D DT 9  N3 ? ? E DA 10 F DT 8  1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog41 hydrog ? ? C DA 12 N1 ? ? ? 1_555 D DT 6  N3 ? ? E DA 12 F DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? C DA 12 N6 ? ? ? 1_555 D DT 6  O4 ? ? E DA 12 F DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? C DT 13 N3 ? ? ? 1_555 D DA 5  N1 ? ? E DT 13 F DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? C DT 13 O4 ? ? ? 1_555 D DA 5  N6 ? ? E DT 13 F DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? C DT 14 N3 ? ? ? 1_555 D DA 4  N1 ? ? E DT 14 F DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? C DT 14 O4 ? ? ? 1_555 D DA 4  N6 ? ? E DT 14 F DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN E 165 ? ASP E 169 ? GLN A 165 ASP A 169 
A 2 LYS E 174 ? HIS E 179 ? LYS A 174 HIS A 179 
A 3 PHE E 185 ? LEU E 187 ? PHE A 185 LEU A 187 
B 1 GLY E 212 ? VAL E 213 ? GLY A 212 VAL A 213 
B 2 TYR E 217 ? LYS E 218 ? TYR A 217 LYS A 218 
C 1 GLN F 165 ? ASP F 169 ? GLN D 165 ASP D 169 
C 2 LYS F 174 ? HIS F 179 ? LYS D 174 HIS D 179 
C 3 PHE F 185 ? LEU F 187 ? PHE D 185 LEU D 187 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP E 169 ? N ASP A 169 O LYS E 174 ? O LYS A 174 
A 2 3 N LEU E 177 ? N LEU A 177 O LEU E 187 ? O LEU A 187 
B 1 2 N VAL E 213 ? N VAL A 213 O TYR E 217 ? O TYR A 217 
C 1 2 N ASP F 169 ? N ASP D 169 O LYS F 174 ? O LYS D 174 
C 2 3 N HIS F 179 ? N HIS D 179 O PHE F 185 ? O PHE D 185 
# 
_database_PDB_matrix.entry_id          3T79 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3T79 
_atom_sites.fract_transf_matrix[1][1]   0.010746 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010035 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007942 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    P P     . DT  A 1 1   ? 0.803   -27.856 -13.628 1.00 171.24 ? 1   DT  B P     1 
ATOM 2    O OP1   . DT  A 1 1   ? 1.731   -27.581 -12.512 1.00 170.77 ? 1   DT  B OP1   1 
ATOM 3    O OP2   . DT  A 1 1   ? -0.652  -27.770 -13.393 1.00 170.96 ? 1   DT  B OP2   1 
ATOM 4    O "O5'" . DT  A 1 1   ? 1.208   -26.923 -14.865 1.00 162.03 ? 1   DT  B "O5'" 1 
ATOM 5    C "C5'" . DT  A 1 1   ? 2.492   -26.299 -14.887 1.00 162.27 ? 1   DT  B "C5'" 1 
ATOM 6    C "C4'" . DT  A 1 1   ? 2.795   -25.596 -16.203 1.00 165.64 ? 1   DT  B "C4'" 1 
ATOM 7    O "O4'" . DT  A 1 1   ? 1.769   -25.845 -17.195 1.00 165.82 ? 1   DT  B "O4'" 1 
ATOM 8    C "C3'" . DT  A 1 1   ? 2.776   -24.084 -16.130 1.00 165.69 ? 1   DT  B "C3'" 1 
ATOM 9    O "O3'" . DT  A 1 1   ? 3.316   -23.551 -17.332 1.00 168.30 ? 1   DT  B "O3'" 1 
ATOM 10   C "C2'" . DT  A 1 1   ? 1.271   -23.855 -16.051 1.00 165.71 ? 1   DT  B "C2'" 1 
ATOM 11   C "C1'" . DT  A 1 1   ? 0.838   -24.775 -17.184 1.00 166.36 ? 1   DT  B "C1'" 1 
ATOM 12   N N1    . DT  A 1 1   ? -0.455  -25.460 -17.033 1.00 169.57 ? 1   DT  B N1    1 
ATOM 13   C C2    . DT  A 1 1   ? -1.064  -25.831 -18.202 1.00 172.30 ? 1   DT  B C2    1 
ATOM 14   O O2    . DT  A 1 1   ? -0.600  -25.587 -19.304 1.00 173.34 ? 1   DT  B O2    1 
ATOM 15   N N3    . DT  A 1 1   ? -2.248  -26.492 -18.024 1.00 173.04 ? 1   DT  B N3    1 
ATOM 16   C C4    . DT  A 1 1   ? -2.863  -26.819 -16.834 1.00 170.42 ? 1   DT  B C4    1 
ATOM 17   O O4    . DT  A 1 1   ? -3.935  -27.418 -16.789 1.00 171.37 ? 1   DT  B O4    1 
ATOM 18   C C5    . DT  A 1 1   ? -2.161  -26.410 -15.652 1.00 167.79 ? 1   DT  B C5    1 
ATOM 19   C C7    . DT  A 1 1   ? -2.767  -26.719 -14.320 1.00 165.16 ? 1   DT  B C7    1 
ATOM 20   C C6    . DT  A 1 1   ? -0.999  -25.758 -15.796 1.00 168.04 ? 1   DT  B C6    1 
ATOM 21   P P     . DT  A 1 2   ? 3.675   -21.988 -17.427 1.00 182.15 ? 2   DT  B P     1 
ATOM 22   O OP1   . DT  A 1 2   ? 5.009   -21.792 -16.819 1.00 180.65 ? 2   DT  B OP1   1 
ATOM 23   O OP2   . DT  A 1 2   ? 2.526   -21.230 -16.883 1.00 182.71 ? 2   DT  B OP2   1 
ATOM 24   O "O5'" . DT  A 1 2   ? 3.749   -21.708 -19.012 1.00 148.27 ? 2   DT  B "O5'" 1 
ATOM 25   C "C5'" . DT  A 1 2   ? 2.557   -21.790 -19.818 1.00 148.22 ? 2   DT  B "C5'" 1 
ATOM 26   C "C4'" . DT  A 1 2   ? 2.694   -21.327 -21.268 1.00 148.02 ? 2   DT  B "C4'" 1 
ATOM 27   O "O4'" . DT  A 1 2   ? 1.402   -21.436 -21.920 1.00 146.71 ? 2   DT  B "O4'" 1 
ATOM 28   C "C3'" . DT  A 1 2   ? 2.996   -19.862 -21.545 1.00 148.98 ? 2   DT  B "C3'" 1 
ATOM 29   O "O3'" . DT  A 1 2   ? 3.204   -19.687 -22.944 1.00 150.88 ? 2   DT  B "O3'" 1 
ATOM 30   C "C2'" . DT  A 1 2   ? 1.672   -19.209 -21.190 1.00 147.50 ? 2   DT  B "C2'" 1 
ATOM 31   C "C1'" . DT  A 1 2   ? 0.674   -20.235 -21.704 1.00 144.81 ? 2   DT  B "C1'" 1 
ATOM 32   N N1    . DT  A 1 2   ? -0.319  -20.494 -20.647 1.00 138.98 ? 2   DT  B N1    1 
ATOM 33   C C2    . DT  A 1 2   ? -1.551  -21.008 -20.951 1.00 137.13 ? 2   DT  B C2    1 
ATOM 34   O O2    . DT  A 1 2   ? -1.874  -21.266 -22.094 1.00 137.21 ? 2   DT  B O2    1 
ATOM 35   N N3    . DT  A 1 2   ? -2.381  -21.206 -19.870 1.00 135.03 ? 2   DT  B N3    1 
ATOM 36   C C4    . DT  A 1 2   ? -2.076  -20.944 -18.542 1.00 132.85 ? 2   DT  B C4    1 
ATOM 37   O O4    . DT  A 1 2   ? -2.852  -21.141 -17.618 1.00 132.24 ? 2   DT  B O4    1 
ATOM 38   C C5    . DT  A 1 2   ? -0.767  -20.399 -18.309 1.00 132.06 ? 2   DT  B C5    1 
ATOM 39   C C7    . DT  A 1 2   ? -0.295  -20.055 -16.932 1.00 129.72 ? 2   DT  B C7    1 
ATOM 40   C C6    . DT  A 1 2   ? 0.024   -20.203 -19.355 1.00 135.06 ? 2   DT  B C6    1 
ATOM 41   P P     . DA  A 1 3   ? 3.283   -18.209 -23.577 1.00 144.86 ? 3   DA  B P     1 
ATOM 42   O OP1   . DA  A 1 3   ? 4.212   -18.257 -24.726 1.00 144.11 ? 3   DA  B OP1   1 
ATOM 43   O OP2   . DA  A 1 3   ? 3.538   -17.256 -22.474 1.00 145.06 ? 3   DA  B OP2   1 
ATOM 44   O "O5'" . DA  A 1 3   ? 1.795   -17.943 -24.113 1.00 129.15 ? 3   DA  B "O5'" 1 
ATOM 45   C "C5'" . DA  A 1 3   ? 1.036   -16.867 -23.558 1.00 131.91 ? 3   DA  B "C5'" 1 
ATOM 46   C "C4'" . DA  A 1 3   ? -0.309  -16.699 -24.248 1.00 134.52 ? 3   DA  B "C4'" 1 
ATOM 47   O "O4'" . DA  A 1 3   ? -1.280  -17.578 -23.613 1.00 133.81 ? 3   DA  B "O4'" 1 
ATOM 48   C "C3'" . DA  A 1 3   ? -0.866  -15.276 -24.195 1.00 136.94 ? 3   DA  B "C3'" 1 
ATOM 49   O "O3'" . DA  A 1 3   ? -1.016  -14.723 -25.516 1.00 138.52 ? 3   DA  B "O3'" 1 
ATOM 50   C "C2'" . DA  A 1 3   ? -2.222  -15.409 -23.503 1.00 136.23 ? 3   DA  B "C2'" 1 
ATOM 51   C "C1'" . DA  A 1 3   ? -2.307  -16.840 -22.979 1.00 133.64 ? 3   DA  B "C1'" 1 
ATOM 52   N N9    . DA  A 1 3   ? -2.177  -16.917 -21.520 1.00 131.42 ? 3   DA  B N9    1 
ATOM 53   C C8    . DA  A 1 3   ? -1.032  -17.131 -20.797 1.00 129.99 ? 3   DA  B C8    1 
ATOM 54   N N7    . DA  A 1 3   ? -1.217  -17.143 -19.497 1.00 128.68 ? 3   DA  B N7    1 
ATOM 55   C C5    . DA  A 1 3   ? -2.574  -16.917 -19.353 1.00 128.87 ? 3   DA  B C5    1 
ATOM 56   C C6    . DA  A 1 3   ? -3.390  -16.815 -18.206 1.00 127.41 ? 3   DA  B C6    1 
ATOM 57   N N6    . DA  A 1 3   ? -2.920  -16.940 -16.958 1.00 124.82 ? 3   DA  B N6    1 
ATOM 58   N N1    . DA  A 1 3   ? -4.709  -16.585 -18.395 1.00 129.05 ? 3   DA  B N1    1 
ATOM 59   C C2    . DA  A 1 3   ? -5.168  -16.466 -19.651 1.00 130.76 ? 3   DA  B C2    1 
ATOM 60   N N3    . DA  A 1 3   ? -4.500  -16.545 -20.806 1.00 131.40 ? 3   DA  B N3    1 
ATOM 61   C C4    . DA  A 1 3   ? -3.188  -16.774 -20.587 1.00 130.82 ? 3   DA  B C4    1 
ATOM 62   P P     . DA  A 1 4   ? -1.653  -13.258 -25.713 1.00 202.92 ? 4   DA  B P     1 
ATOM 63   O OP1   . DA  A 1 4   ? -0.834  -12.534 -26.708 1.00 203.69 ? 4   DA  B OP1   1 
ATOM 64   O OP2   . DA  A 1 4   ? -1.843  -12.663 -24.375 1.00 201.88 ? 4   DA  B OP2   1 
ATOM 65   O "O5'" . DA  A 1 4   ? -3.080  -13.548 -26.387 1.00 150.79 ? 4   DA  B "O5'" 1 
ATOM 66   C "C5'" . DA  A 1 4   ? -4.025  -14.460 -25.829 1.00 150.53 ? 4   DA  B "C5'" 1 
ATOM 67   C "C4'" . DA  A 1 4   ? -5.089  -13.744 -25.014 1.00 148.13 ? 4   DA  B "C4'" 1 
ATOM 68   O "O4'" . DA  A 1 4   ? -4.926  -14.078 -23.611 1.00 146.14 ? 4   DA  B "O4'" 1 
ATOM 69   C "C3'" . DA  A 1 4   ? -5.067  -12.220 -25.094 1.00 146.75 ? 4   DA  B "C3'" 1 
ATOM 70   O "O3'" . DA  A 1 4   ? -6.383  -11.684 -25.054 1.00 147.43 ? 4   DA  B "O3'" 1 
ATOM 71   C "C2'" . DA  A 1 4   ? -4.317  -11.835 -23.831 1.00 144.64 ? 4   DA  B "C2'" 1 
ATOM 72   C "C1'" . DA  A 1 4   ? -4.858  -12.882 -22.869 1.00 144.16 ? 4   DA  B "C1'" 1 
ATOM 73   N N9    . DA  A 1 4   ? -4.014  -13.055 -21.701 1.00 144.65 ? 4   DA  B N9    1 
ATOM 74   C C8    . DA  A 1 4   ? -2.656  -13.189 -21.650 1.00 145.93 ? 4   DA  B C8    1 
ATOM 75   N N7    . DA  A 1 4   ? -2.188  -13.321 -20.433 1.00 147.81 ? 4   DA  B N7    1 
ATOM 76   C C5    . DA  A 1 4   ? -3.324  -13.259 -19.633 1.00 148.22 ? 4   DA  B C5    1 
ATOM 77   C C6    . DA  A 1 4   ? -3.522  -13.332 -18.237 1.00 149.48 ? 4   DA  B C6    1 
ATOM 78   N N6    . DA  A 1 4   ? -2.531  -13.489 -17.358 1.00 149.92 ? 4   DA  B N6    1 
ATOM 79   N N1    . DA  A 1 4   ? -4.783  -13.232 -17.776 1.00 148.70 ? 4   DA  B N1    1 
ATOM 80   C C2    . DA  A 1 4   ? -5.775  -13.068 -18.655 1.00 147.33 ? 4   DA  B C2    1 
ATOM 81   N N3    . DA  A 1 4   ? -5.721  -12.991 -19.982 1.00 146.15 ? 4   DA  B N3    1 
ATOM 82   C C4    . DA  A 1 4   ? -4.455  -13.092 -20.407 1.00 146.26 ? 4   DA  B C4    1 
ATOM 83   P P     . DT  A 1 5   ? -6.613  -10.096 -25.169 1.00 180.33 ? 5   DT  B P     1 
ATOM 84   O OP1   . DT  A 1 5   ? -7.700  -9.863  -26.144 1.00 180.36 ? 5   DT  B OP1   1 
ATOM 85   O OP2   . DT  A 1 5   ? -5.294  -9.455  -25.369 1.00 179.85 ? 5   DT  B OP2   1 
ATOM 86   O "O5'" . DT  A 1 5   ? -7.147  -9.686  -23.718 1.00 118.70 ? 5   DT  B "O5'" 1 
ATOM 87   C "C5'" . DT  A 1 5   ? -7.257  -10.671 -22.707 1.00 117.96 ? 5   DT  B "C5'" 1 
ATOM 88   C "C4'" . DT  A 1 5   ? -8.187  -10.209 -21.609 1.00 114.86 ? 5   DT  B "C4'" 1 
ATOM 89   O "O4'" . DT  A 1 5   ? -7.603  -10.492 -20.314 1.00 116.57 ? 5   DT  B "O4'" 1 
ATOM 90   C "C3'" . DT  A 1 5   ? -8.429  -8.718  -21.575 1.00 109.56 ? 5   DT  B "C3'" 1 
ATOM 91   O "O3'" . DT  A 1 5   ? -9.618  -8.529  -20.837 1.00 105.81 ? 5   DT  B "O3'" 1 
ATOM 92   C "C2'" . DT  A 1 5   ? -7.186  -8.252  -20.827 1.00 111.40 ? 5   DT  B "C2'" 1 
ATOM 93   C "C1'" . DT  A 1 5   ? -7.146  -9.294  -19.721 1.00 115.88 ? 5   DT  B "C1'" 1 
ATOM 94   N N1    . DT  A 1 5   ? -5.807  -9.597  -19.147 1.00 121.13 ? 5   DT  B N1    1 
ATOM 95   C C2    . DT  A 1 5   ? -5.746  -10.043 -17.845 1.00 125.56 ? 5   DT  B C2    1 
ATOM 96   O O2    . DT  A 1 5   ? -6.716  -10.194 -17.123 1.00 127.46 ? 5   DT  B O2    1 
ATOM 97   N N3    . DT  A 1 5   ? -4.484  -10.316 -17.404 1.00 126.01 ? 5   DT  B N3    1 
ATOM 98   C C4    . DT  A 1 5   ? -3.297  -10.195 -18.090 1.00 124.46 ? 5   DT  B C4    1 
ATOM 99   O O4    . DT  A 1 5   ? -2.216  -10.475 -17.572 1.00 123.93 ? 5   DT  B O4    1 
ATOM 100  C C5    . DT  A 1 5   ? -3.434  -9.730  -19.446 1.00 123.61 ? 5   DT  B C5    1 
ATOM 101  C C7    . DT  A 1 5   ? -2.214  -9.564  -20.297 1.00 125.44 ? 5   DT  B C7    1 
ATOM 102  C C6    . DT  A 1 5   ? -4.664  -9.458  -19.909 1.00 121.83 ? 5   DT  B C6    1 
ATOM 103  P P     . DT  A 1 6   ? -10.325 -7.091  -20.797 1.00 137.60 ? 6   DT  B P     1 
ATOM 104  O OP1   . DT  A 1 6   ? -11.704 -7.243  -21.311 1.00 136.20 ? 6   DT  B OP1   1 
ATOM 105  O OP2   . DT  A 1 6   ? -9.405  -6.118  -21.418 1.00 139.73 ? 6   DT  B OP2   1 
ATOM 106  O "O5'" . DT  A 1 6   ? -10.380 -6.754  -19.243 1.00 111.76 ? 6   DT  B "O5'" 1 
ATOM 107  C "C5'" . DT  A 1 6   ? -11.604 -6.453  -18.609 1.00 113.66 ? 6   DT  B "C5'" 1 
ATOM 108  C "C4'" . DT  A 1 6   ? -11.294 -6.420  -17.132 1.00 116.70 ? 6   DT  B "C4'" 1 
ATOM 109  O "O4'" . DT  A 1 6   ? -9.948  -6.949  -17.026 1.00 118.89 ? 6   DT  B "O4'" 1 
ATOM 110  C "C3'" . DT  A 1 6   ? -11.276 -5.030  -16.488 1.00 117.49 ? 6   DT  B "C3'" 1 
ATOM 111  O "O3'" . DT  A 1 6   ? -12.054 -5.014  -15.275 1.00 118.51 ? 6   DT  B "O3'" 1 
ATOM 112  C "C2'" . DT  A 1 6   ? -9.791  -4.761  -16.273 1.00 117.61 ? 6   DT  B "C2'" 1 
ATOM 113  C "C1'" . DT  A 1 6   ? -9.237  -6.163  -16.101 1.00 119.02 ? 6   DT  B "C1'" 1 
ATOM 114  N N1    . DT  A 1 6   ? -7.782  -6.215  -16.371 1.00 119.28 ? 6   DT  B N1    1 
ATOM 115  C C2    . DT  A 1 6   ? -6.946  -6.534  -15.322 1.00 122.26 ? 6   DT  B C2    1 
ATOM 116  O O2    . DT  A 1 6   ? -7.344  -6.786  -14.195 1.00 124.45 ? 6   DT  B O2    1 
ATOM 117  N N3    . DT  A 1 6   ? -5.615  -6.555  -15.648 1.00 120.30 ? 6   DT  B N3    1 
ATOM 118  C C4    . DT  A 1 6   ? -5.062  -6.283  -16.885 1.00 116.30 ? 6   DT  B C4    1 
ATOM 119  O O4    . DT  A 1 6   ? -3.852  -6.322  -17.074 1.00 116.00 ? 6   DT  B O4    1 
ATOM 120  C C5    . DT  A 1 6   ? -5.995  -5.948  -17.931 1.00 113.11 ? 6   DT  B C5    1 
ATOM 121  C C7    . DT  A 1 6   ? -5.494  -5.637  -19.308 1.00 110.79 ? 6   DT  B C7    1 
ATOM 122  C C6    . DT  A 1 6   ? -7.298  -5.928  -17.632 1.00 115.13 ? 6   DT  B C6    1 
ATOM 123  P P     . DT  A 1 7   ? -11.702 -3.996  -14.077 1.00 79.85  ? 7   DT  B P     1 
ATOM 124  O OP1   . DT  A 1 7   ? -12.969 -3.423  -13.577 1.00 75.02  ? 7   DT  B OP1   1 
ATOM 125  O OP2   . DT  A 1 7   ? -10.580 -3.136  -14.505 1.00 81.16  ? 7   DT  B OP2   1 
ATOM 126  O "O5'" . DT  A 1 7   ? -11.151 -4.946  -12.930 1.00 138.87 ? 7   DT  B "O5'" 1 
ATOM 127  C "C5'" . DT  A 1 7   ? -11.030 -4.425  -11.626 1.00 137.36 ? 7   DT  B "C5'" 1 
ATOM 128  C "C4'" . DT  A 1 7   ? -9.614  -4.630  -11.133 1.00 135.49 ? 7   DT  B "C4'" 1 
ATOM 129  O "O4'" . DT  A 1 7   ? -8.713  -4.877  -12.246 1.00 133.23 ? 7   DT  B "O4'" 1 
ATOM 130  C "C3'" . DT  A 1 7   ? -9.059  -3.421  -10.388 1.00 135.00 ? 7   DT  B "C3'" 1 
ATOM 131  O "O3'" . DT  A 1 7   ? -8.573  -3.811  -9.122  1.00 135.01 ? 7   DT  B "O3'" 1 
ATOM 132  C "C2'" . DT  A 1 7   ? -7.913  -2.967  -11.278 1.00 134.35 ? 7   DT  B "C2'" 1 
ATOM 133  C "C1'" . DT  A 1 7   ? -7.486  -4.300  -11.872 1.00 133.12 ? 7   DT  B "C1'" 1 
ATOM 134  N N1    . DT  A 1 7   ? -6.598  -4.139  -13.044 1.00 133.00 ? 7   DT  B N1    1 
ATOM 135  C C2    . DT  A 1 7   ? -5.317  -4.636  -12.986 1.00 133.36 ? 7   DT  B C2    1 
ATOM 136  O O2    . DT  A 1 7   ? -4.874  -5.223  -12.013 1.00 133.71 ? 7   DT  B O2    1 
ATOM 137  N N3    . DT  A 1 7   ? -4.574  -4.423  -14.120 1.00 132.84 ? 7   DT  B N3    1 
ATOM 138  C C4    . DT  A 1 7   ? -4.972  -3.772  -15.272 1.00 131.09 ? 7   DT  B C4    1 
ATOM 139  O O4    . DT  A 1 7   ? -4.232  -3.633  -16.241 1.00 128.59 ? 7   DT  B O4    1 
ATOM 140  C C5    . DT  A 1 7   ? -6.324  -3.275  -15.256 1.00 132.25 ? 7   DT  B C5    1 
ATOM 141  C C7    . DT  A 1 7   ? -6.882  -2.551  -16.442 1.00 132.52 ? 7   DT  B C7    1 
ATOM 142  C C6    . DT  A 1 7   ? -7.060  -3.476  -14.158 1.00 132.98 ? 7   DT  B C6    1 
ATOM 143  P P     . DA  A 1 8   ? -9.175  -3.151  -7.790  1.00 149.74 ? 8   DA  B P     1 
ATOM 144  O OP1   . DA  A 1 8   ? -10.221 -4.055  -7.266  1.00 150.11 ? 8   DA  B OP1   1 
ATOM 145  O OP2   . DA  A 1 8   ? -9.514  -1.746  -8.093  1.00 148.99 ? 8   DA  B OP2   1 
ATOM 146  O "O5'" . DA  A 1 8   ? -7.934  -3.146  -6.784  1.00 142.94 ? 8   DA  B "O5'" 1 
ATOM 147  C "C5'" . DA  A 1 8   ? -6.928  -4.144  -6.894  1.00 142.54 ? 8   DA  B "C5'" 1 
ATOM 148  C "C4'" . DA  A 1 8   ? -5.559  -3.526  -7.140  1.00 141.76 ? 8   DA  B "C4'" 1 
ATOM 149  O "O4'" . DA  A 1 8   ? -5.263  -3.464  -8.559  1.00 140.22 ? 8   DA  B "O4'" 1 
ATOM 150  C "C3'" . DA  A 1 8   ? -5.376  -2.098  -6.629  1.00 141.30 ? 8   DA  B "C3'" 1 
ATOM 151  O "O3'" . DA  A 1 8   ? -4.358  -2.058  -5.638  1.00 141.68 ? 8   DA  B "O3'" 1 
ATOM 152  C "C2'" . DA  A 1 8   ? -4.949  -1.312  -7.867  1.00 139.43 ? 8   DA  B "C2'" 1 
ATOM 153  C "C1'" . DA  A 1 8   ? -4.335  -2.417  -8.707  1.00 138.01 ? 8   DA  B "C1'" 1 
ATOM 154  N N9    . DA  A 1 8   ? -4.195  -2.063  -10.112 1.00 135.69 ? 8   DA  B N9    1 
ATOM 155  C C8    . DA  A 1 8   ? -5.200  -1.807  -10.995 1.00 134.83 ? 8   DA  B C8    1 
ATOM 156  N N7    . DA  A 1 8   ? -4.783  -1.508  -12.203 1.00 134.78 ? 8   DA  B N7    1 
ATOM 157  C C5    . DA  A 1 8   ? -3.404  -1.568  -12.105 1.00 134.68 ? 8   DA  B C5    1 
ATOM 158  C C6    . DA  A 1 8   ? -2.373  -1.351  -13.042 1.00 133.77 ? 8   DA  B C6    1 
ATOM 159  N N6    . DA  A 1 8   ? -2.588  -1.017  -14.317 1.00 133.79 ? 8   DA  B N6    1 
ATOM 160  N N1    . DA  A 1 8   ? -1.103  -1.491  -12.616 1.00 134.09 ? 8   DA  B N1    1 
ATOM 161  C C2    . DA  A 1 8   ? -0.888  -1.824  -11.338 1.00 135.98 ? 8   DA  B C2    1 
ATOM 162  N N3    . DA  A 1 8   ? -1.772  -2.054  -10.367 1.00 136.84 ? 8   DA  B N3    1 
ATOM 163  C C4    . DA  A 1 8   ? -3.025  -1.908  -10.820 1.00 135.79 ? 8   DA  B C4    1 
ATOM 164  P P     . DT  A 1 9   ? -3.980  -0.668  -4.925  1.00 204.57 ? 9   DT  B P     1 
ATOM 165  O OP1   . DT  A 1 9   ? -3.845  -0.923  -3.473  1.00 203.72 ? 9   DT  B OP1   1 
ATOM 166  O OP2   . DT  A 1 9   ? -4.940  0.358   -5.393  1.00 204.61 ? 9   DT  B OP2   1 
ATOM 167  O "O5'" . DT  A 1 9   ? -2.539  -0.315  -5.532  1.00 161.08 ? 9   DT  B "O5'" 1 
ATOM 168  C "C5'" . DT  A 1 9   ? -1.479  -1.258  -5.390  1.00 159.35 ? 9   DT  B "C5'" 1 
ATOM 169  C "C4'" . DT  A 1 9   ? -0.142  -0.738  -5.899  1.00 156.64 ? 9   DT  B "C4'" 1 
ATOM 170  O "O4'" . DT  A 1 9   ? -0.145  -0.648  -7.347  1.00 154.16 ? 9   DT  B "O4'" 1 
ATOM 171  C "C3'" . DT  A 1 9   ? 0.288   0.641   -5.404  1.00 156.29 ? 9   DT  B "C3'" 1 
ATOM 172  O "O3'" . DT  A 1 9   ? 1.684   0.635   -5.160  1.00 157.27 ? 9   DT  B "O3'" 1 
ATOM 173  C "C2'" . DT  A 1 9   ? -0.031  1.541   -6.590  1.00 153.74 ? 9   DT  B "C2'" 1 
ATOM 174  C "C1'" . DT  A 1 9   ? 0.381   0.608   -7.715  1.00 151.36 ? 9   DT  B "C1'" 1 
ATOM 175  N N1    . DT  A 1 9   ? -0.207  0.954   -9.014  1.00 146.82 ? 9   DT  B N1    1 
ATOM 176  C C2    . DT  A 1 9   ? 0.594   0.918   -10.125 1.00 146.51 ? 9   DT  B C2    1 
ATOM 177  O O2    . DT  A 1 9   ? 1.775   0.620   -10.110 1.00 147.29 ? 9   DT  B O2    1 
ATOM 178  N N3    . DT  A 1 9   ? -0.057  1.251   -11.274 1.00 144.52 ? 9   DT  B N3    1 
ATOM 179  C C4    . DT  A 1 9   ? -1.379  1.605   -11.446 1.00 141.27 ? 9   DT  B C4    1 
ATOM 180  O O4    . DT  A 1 9   ? -1.844  1.881   -12.548 1.00 139.80 ? 9   DT  B O4    1 
ATOM 181  C C5    . DT  A 1 9   ? -2.158  1.619   -10.238 1.00 140.03 ? 9   DT  B C5    1 
ATOM 182  C C7    . DT  A 1 9   ? -3.610  1.984   -10.281 1.00 137.33 ? 9   DT  B C7    1 
ATOM 183  C C6    . DT  A 1 9   ? -1.541  1.295   -9.094  1.00 143.21 ? 9   DT  B C6    1 
ATOM 184  P P     . DA  A 1 10  ? 2.442   1.999   -4.779  1.00 184.60 ? 10  DA  B P     1 
ATOM 185  O OP1   . DA  A 1 10  ? 3.536   1.663   -3.841  1.00 184.18 ? 10  DA  B OP1   1 
ATOM 186  O OP2   . DA  A 1 10  ? 1.420   2.995   -4.390  1.00 183.94 ? 10  DA  B OP2   1 
ATOM 187  O "O5'" . DA  A 1 10  ? 3.096   2.462   -6.163  1.00 157.15 ? 10  DA  B "O5'" 1 
ATOM 188  C "C5'" . DA  A 1 10  ? 4.111   1.638   -6.727  1.00 156.82 ? 10  DA  B "C5'" 1 
ATOM 189  C "C4'" . DA  A 1 10  ? 5.261   2.434   -7.326  1.00 156.98 ? 10  DA  B "C4'" 1 
ATOM 190  O "O4'" . DA  A 1 10  ? 4.987   2.682   -8.727  1.00 155.93 ? 10  DA  B "O4'" 1 
ATOM 191  C "C3'" . DA  A 1 10  ? 5.548   3.794   -6.693  1.00 158.66 ? 10  DA  B "C3'" 1 
ATOM 192  O "O3'" . DA  A 1 10  ? 6.945   4.090   -6.718  1.00 158.86 ? 10  DA  B "O3'" 1 
ATOM 193  C "C2'" . DA  A 1 10  ? 4.779   4.764   -7.580  1.00 158.71 ? 10  DA  B "C2'" 1 
ATOM 194  C "C1'" . DA  A 1 10  ? 4.654   4.040   -8.917  1.00 157.17 ? 10  DA  B "C1'" 1 
ATOM 195  N N9    . DA  A 1 10  ? 3.290   4.129   -9.411  1.00 156.89 ? 10  DA  B N9    1 
ATOM 196  C C8    . DA  A 1 10  ? 2.149   3.993   -8.669  1.00 156.55 ? 10  DA  B C8    1 
ATOM 197  N N7    . DA  A 1 10  ? 1.050   4.131   -9.366  1.00 155.91 ? 10  DA  B N7    1 
ATOM 198  C C5    . DA  A 1 10  ? 1.508   4.378   -10.647 1.00 155.61 ? 10  DA  B C5    1 
ATOM 199  C C6    . DA  A 1 10  ? 0.833   4.613   -11.853 1.00 155.18 ? 10  DA  B C6    1 
ATOM 200  N N6    . DA  A 1 10  ? -0.498  4.637   -11.951 1.00 154.82 ? 10  DA  B N6    1 
ATOM 201  N N1    . DA  A 1 10  ? 1.584   4.824   -12.951 1.00 155.79 ? 10  DA  B N1    1 
ATOM 202  C C2    . DA  A 1 10  ? 2.917   4.801   -12.849 1.00 155.83 ? 10  DA  B C2    1 
ATOM 203  N N3    . DA  A 1 10  ? 3.665   4.590   -11.770 1.00 155.84 ? 10  DA  B N3    1 
ATOM 204  C C4    . DA  A 1 10  ? 2.887   4.384   -10.697 1.00 155.98 ? 10  DA  B C4    1 
ATOM 205  P P     . DA  A 1 11  ? 7.467   5.575   -6.376  1.00 181.16 ? 11  DA  B P     1 
ATOM 206  O OP1   . DA  A 1 11  ? 8.811   5.455   -5.769  1.00 181.54 ? 11  DA  B OP1   1 
ATOM 207  O OP2   . DA  A 1 11  ? 6.393   6.281   -5.644  1.00 180.48 ? 11  DA  B OP2   1 
ATOM 208  O "O5'" . DA  A 1 11  ? 7.620   6.263   -7.816  1.00 143.76 ? 11  DA  B "O5'" 1 
ATOM 209  C "C5'" . DA  A 1 11  ? 8.770   7.048   -8.134  1.00 141.20 ? 11  DA  B "C5'" 1 
ATOM 210  C "C4'" . DA  A 1 11  ? 9.051   7.025   -9.628  1.00 139.19 ? 11  DA  B "C4'" 1 
ATOM 211  O "O4'" . DA  A 1 11  ? 7.880   6.526   -10.326 1.00 139.80 ? 11  DA  B "O4'" 1 
ATOM 212  C "C3'" . DA  A 1 11  ? 9.338   8.390   -10.235 1.00 137.12 ? 11  DA  B "C3'" 1 
ATOM 213  O "O3'" . DA  A 1 11  ? 10.151  8.310   -11.400 1.00 135.52 ? 11  DA  B "O3'" 1 
ATOM 214  C "C2'" . DA  A 1 11  ? 7.937   8.866   -10.594 1.00 138.33 ? 11  DA  B "C2'" 1 
ATOM 215  C "C1'" . DA  A 1 11  ? 7.246   7.575   -11.028 1.00 139.26 ? 11  DA  B "C1'" 1 
ATOM 216  N N9    . DA  A 1 11  ? 5.822   7.565   -10.703 1.00 139.28 ? 11  DA  B N9    1 
ATOM 217  C C8    . DA  A 1 11  ? 5.265   7.398   -9.465  1.00 138.34 ? 11  DA  B C8    1 
ATOM 218  N N7    . DA  A 1 11  ? 3.955   7.437   -9.462  1.00 137.40 ? 11  DA  B N7    1 
ATOM 219  C C5    . DA  A 1 11  ? 3.632   7.649   -10.791 1.00 138.85 ? 11  DA  B C5    1 
ATOM 220  C C6    . DA  A 1 11  ? 2.397   7.789   -11.451 1.00 140.42 ? 11  DA  B C6    1 
ATOM 221  N N6    . DA  A 1 11  ? 1.222   7.730   -10.818 1.00 140.76 ? 11  DA  B N6    1 
ATOM 222  N N1    . DA  A 1 11  ? 2.420   7.991   -12.786 1.00 141.31 ? 11  DA  B N1    1 
ATOM 223  C C2    . DA  A 1 11  ? 3.603   8.049   -13.414 1.00 140.53 ? 11  DA  B C2    1 
ATOM 224  N N3    . DA  A 1 11  ? 4.827   7.932   -12.902 1.00 139.55 ? 11  DA  B N3    1 
ATOM 225  C C4    . DA  A 1 11  ? 4.769   7.732   -11.573 1.00 138.99 ? 11  DA  B C4    1 
ATOM 226  P P     . DA  A 1 12  ? 10.555  9.652   -12.188 1.00 171.76 ? 12  DA  B P     1 
ATOM 227  O OP1   . DA  A 1 12  ? 11.827  9.398   -12.897 1.00 171.86 ? 12  DA  B OP1   1 
ATOM 228  O OP2   . DA  A 1 12  ? 10.477  10.780  -11.233 1.00 171.35 ? 12  DA  B OP2   1 
ATOM 229  O "O5'" . DA  A 1 12  ? 9.369   9.835   -13.258 1.00 140.62 ? 12  DA  B "O5'" 1 
ATOM 230  C "C5'" . DA  A 1 12  ? 9.597   9.593   -14.651 1.00 139.54 ? 12  DA  B "C5'" 1 
ATOM 231  C "C4'" . DA  A 1 12  ? 8.701   10.436  -15.550 1.00 137.72 ? 12  DA  B "C4'" 1 
ATOM 232  O "O4'" . DA  A 1 12  ? 7.327   10.020  -15.343 1.00 137.55 ? 12  DA  B "O4'" 1 
ATOM 233  C "C3'" . DA  A 1 12  ? 8.753   11.947  -15.310 1.00 136.50 ? 12  DA  B "C3'" 1 
ATOM 234  O "O3'" . DA  A 1 12  ? 9.607   12.649  -16.258 1.00 137.30 ? 12  DA  B "O3'" 1 
ATOM 235  C "C2'" . DA  A 1 12  ? 7.297   12.405  -15.358 1.00 136.31 ? 12  DA  B "C2'" 1 
ATOM 236  C "C1'" . DA  A 1 12  ? 6.492   11.134  -15.113 1.00 136.58 ? 12  DA  B "C1'" 1 
ATOM 237  N N9    . DA  A 1 12  ? 5.988   11.100  -13.750 1.00 135.57 ? 12  DA  B N9    1 
ATOM 238  C C8    . DA  A 1 12  ? 6.714   11.011  -12.597 1.00 135.49 ? 12  DA  B C8    1 
ATOM 239  N N7    . DA  A 1 12  ? 5.978   11.017  -11.511 1.00 134.51 ? 12  DA  B N7    1 
ATOM 240  C C5    . DA  A 1 12  ? 4.685   11.123  -11.993 1.00 133.23 ? 12  DA  B C5    1 
ATOM 241  C C6    . DA  A 1 12  ? 3.436   11.181  -11.352 1.00 131.09 ? 12  DA  B C6    1 
ATOM 242  N N6    . DA  A 1 12  ? 3.284   11.138  -10.024 1.00 129.26 ? 12  DA  B N6    1 
ATOM 243  N N1    . DA  A 1 12  ? 2.345   11.285  -12.138 1.00 132.06 ? 12  DA  B N1    1 
ATOM 244  C C2    . DA  A 1 12  ? 2.499   11.329  -13.467 1.00 131.73 ? 12  DA  B C2    1 
ATOM 245  N N3    . DA  A 1 12  ? 3.617   11.283  -14.184 1.00 131.36 ? 12  DA  B N3    1 
ATOM 246  C C4    . DA  A 1 12  ? 4.677   11.180  -13.372 1.00 133.00 ? 12  DA  B C4    1 
ATOM 247  P P     . DA  A 1 13  ? 9.205   12.755  -17.818 1.00 176.50 ? 13  DA  B P     1 
ATOM 248  O OP1   . DA  A 1 13  ? 9.265   11.399  -18.401 1.00 176.16 ? 13  DA  B OP1   1 
ATOM 249  O OP2   . DA  A 1 13  ? 9.992   13.857  -18.419 1.00 175.73 ? 13  DA  B OP2   1 
ATOM 250  O "O5'" . DA  A 1 13  ? 7.680   13.231  -17.791 1.00 149.85 ? 13  DA  B "O5'" 1 
ATOM 251  C "C5'" . DA  A 1 13  ? 6.714   12.485  -18.517 1.00 148.61 ? 13  DA  B "C5'" 1 
ATOM 252  C "C4'" . DA  A 1 13  ? 5.681   13.409  -19.128 1.00 146.24 ? 13  DA  B "C4'" 1 
ATOM 253  O "O4'" . DA  A 1 13  ? 4.672   13.777  -18.157 1.00 145.12 ? 13  DA  B "O4'" 1 
ATOM 254  C "C3'" . DA  A 1 13  ? 6.222   14.725  -19.644 1.00 145.27 ? 13  DA  B "C3'" 1 
ATOM 255  O "O3'" . DA  A 1 13  ? 5.325   15.115  -20.642 1.00 144.97 ? 13  DA  B "O3'" 1 
ATOM 256  C "C2'" . DA  A 1 13  ? 6.132   15.618  -18.411 1.00 144.72 ? 13  DA  B "C2'" 1 
ATOM 257  C "C1'" . DA  A 1 13  ? 4.837   15.125  -17.776 1.00 144.63 ? 13  DA  B "C1'" 1 
ATOM 258  N N9    . DA  A 1 13  ? 4.835   15.132  -16.321 1.00 144.04 ? 13  DA  B N9    1 
ATOM 259  C C8    . DA  A 1 13  ? 5.875   15.406  -15.481 1.00 143.57 ? 13  DA  B C8    1 
ATOM 260  N N7    . DA  A 1 13  ? 5.555   15.323  -14.211 1.00 143.84 ? 13  DA  B N7    1 
ATOM 261  C C5    . DA  A 1 13  ? 4.217   14.967  -14.225 1.00 144.60 ? 13  DA  B C5    1 
ATOM 262  C C6    . DA  A 1 13  ? 3.283   14.721  -13.200 1.00 145.32 ? 13  DA  B C6    1 
ATOM 263  N N6    . DA  A 1 13  ? 3.560   14.796  -11.892 1.00 145.61 ? 13  DA  B N6    1 
ATOM 264  N N1    . DA  A 1 13  ? 2.033   14.390  -13.578 1.00 144.37 ? 13  DA  B N1    1 
ATOM 265  C C2    . DA  A 1 13  ? 1.729   14.305  -14.876 1.00 143.57 ? 13  DA  B C2    1 
ATOM 266  N N3    . DA  A 1 13  ? 2.520   14.512  -15.923 1.00 143.88 ? 13  DA  B N3    1 
ATOM 267  C C4    . DA  A 1 13  ? 3.758   14.843  -15.522 1.00 144.53 ? 13  DA  B C4    1 
ATOM 268  P P     . DT  A 1 14  ? 5.705   16.297  -21.654 1.00 184.95 ? 14  DT  B P     1 
ATOM 269  O OP1   . DT  A 1 14  ? 5.954   15.696  -22.981 1.00 185.90 ? 14  DT  B OP1   1 
ATOM 270  O OP2   . DT  A 1 14  ? 6.760   17.121  -21.021 1.00 184.69 ? 14  DT  B OP2   1 
ATOM 271  O "O5'" . DT  A 1 14  ? 4.361   17.149  -21.722 1.00 160.45 ? 14  DT  B "O5'" 1 
ATOM 272  C "C5'" . DT  A 1 14  ? 3.482   16.943  -20.628 1.00 159.89 ? 14  DT  B "C5'" 1 
ATOM 273  C "C4'" . DT  A 1 14  ? 2.069   17.393  -20.920 1.00 159.01 ? 14  DT  B "C4'" 1 
ATOM 274  O "O4'" . DT  A 1 14  ? 1.317   17.291  -19.689 1.00 157.79 ? 14  DT  B "O4'" 1 
ATOM 275  C "C3'" . DT  A 1 14  ? 1.943   18.852  -21.321 1.00 158.36 ? 14  DT  B "C3'" 1 
ATOM 276  O "O3'" . DT  A 1 14  ? 0.707   19.069  -21.980 1.00 158.25 ? 14  DT  B "O3'" 1 
ATOM 277  C "C2'" . DT  A 1 14  ? 1.977   19.556  -19.969 1.00 157.11 ? 14  DT  B "C2'" 1 
ATOM 278  C "C1'" . DT  A 1 14  ? 1.383   18.528  -19.004 1.00 156.13 ? 14  DT  B "C1'" 1 
ATOM 279  N N1    . DT  A 1 14  ? 2.202   18.383  -17.760 1.00 153.05 ? 14  DT  B N1    1 
ATOM 280  C C2    . DT  A 1 14  ? 1.601   18.051  -16.563 1.00 151.28 ? 14  DT  B C2    1 
ATOM 281  O O2    . DT  A 1 14  ? 0.409   17.841  -16.428 1.00 151.01 ? 14  DT  B O2    1 
ATOM 282  N N3    . DT  A 1 14  ? 2.465   17.962  -15.505 1.00 149.64 ? 14  DT  B N3    1 
ATOM 283  C C4    . DT  A 1 14  ? 3.827   18.169  -15.507 1.00 149.29 ? 14  DT  B C4    1 
ATOM 284  O O4    . DT  A 1 14  ? 4.510   18.062  -14.495 1.00 148.11 ? 14  DT  B O4    1 
ATOM 285  C C5    . DT  A 1 14  ? 4.388   18.518  -16.783 1.00 150.46 ? 14  DT  B C5    1 
ATOM 286  C C7    . DT  A 1 14  ? 5.859   18.770  -16.918 1.00 150.32 ? 14  DT  B C7    1 
ATOM 287  C C6    . DT  A 1 14  ? 3.560   18.610  -17.830 1.00 151.97 ? 14  DT  B C6    1 
ATOM 288  P P     . DT  A 1 15  ? 0.491   20.380  -22.882 1.00 178.64 ? 15  DT  B P     1 
ATOM 289  O OP1   . DT  A 1 15  ? 0.996   20.088  -24.243 1.00 177.33 ? 15  DT  B OP1   1 
ATOM 290  O OP2   . DT  A 1 15  ? 1.025   21.538  -22.135 1.00 179.48 ? 15  DT  B OP2   1 
ATOM 291  O "O5'" . DT  A 1 15  ? -1.101  20.524  -22.947 1.00 130.87 ? 15  DT  B "O5'" 1 
ATOM 292  C "C5'" . DT  A 1 15  ? -1.921  19.573  -22.267 1.00 127.63 ? 15  DT  B "C5'" 1 
ATOM 293  C "C4'" . DT  A 1 15  ? -2.636  20.212  -21.088 1.00 124.29 ? 15  DT  B "C4'" 1 
ATOM 294  O "O4'" . DT  A 1 15  ? -1.874  20.034  -19.869 1.00 118.61 ? 15  DT  B "O4'" 1 
ATOM 295  C "C3'" . DT  A 1 15  ? -2.820  21.722  -21.218 1.00 127.64 ? 15  DT  B "C3'" 1 
ATOM 296  O "O3'" . DT  A 1 15  ? -4.128  22.061  -21.679 1.00 129.85 ? 15  DT  B "O3'" 1 
ATOM 297  C "C2'" . DT  A 1 15  ? -2.578  22.257  -19.807 1.00 124.97 ? 15  DT  B "C2'" 1 
ATOM 298  C "C1'" . DT  A 1 15  ? -2.302  21.021  -18.958 1.00 118.65 ? 15  DT  B "C1'" 1 
ATOM 299  N N1    . DT  A 1 15  ? -1.243  21.279  -17.941 1.00 115.76 ? 15  DT  B N1    1 
ATOM 300  C C2    . DT  A 1 15  ? -1.520  21.120  -16.600 1.00 112.31 ? 15  DT  B C2    1 
ATOM 301  O O2    . DT  A 1 15  ? -2.603  20.758  -16.182 1.00 107.30 ? 15  DT  B O2    1 
ATOM 302  N N3    . DT  A 1 15  ? -0.468  21.396  -15.761 1.00 115.21 ? 15  DT  B N3    1 
ATOM 303  C C4    . DT  A 1 15  ? 0.802   21.815  -16.122 1.00 117.55 ? 15  DT  B C4    1 
ATOM 304  O O4    . DT  A 1 15  ? 1.683   22.040  -15.297 1.00 118.00 ? 15  DT  B O4    1 
ATOM 305  C C5    . DT  A 1 15  ? 1.021   21.968  -17.539 1.00 118.12 ? 15  DT  B C5    1 
ATOM 306  C C7    . DT  A 1 15  ? 2.359   22.417  -18.052 1.00 117.88 ? 15  DT  B C7    1 
ATOM 307  C C6    . DT  A 1 15  ? 0.001   21.700  -18.366 1.00 117.29 ? 15  DT  B C6    1 
ATOM 308  P P     . DA  B 2 1   ? 5.501   29.940  -8.428  1.00 215.79 ? 1   DA  C P     1 
ATOM 309  O OP1   . DA  B 2 1   ? 5.661   30.630  -7.129  1.00 215.56 ? 1   DA  C OP1   1 
ATOM 310  O OP2   . DA  B 2 1   ? 6.667   29.311  -9.089  1.00 216.40 ? 1   DA  C OP2   1 
ATOM 311  O "O5'" . DA  B 2 1   ? 4.340   28.852  -8.271  1.00 167.48 ? 1   DA  C "O5'" 1 
ATOM 312  C "C5'" . DA  B 2 1   ? 4.222   28.132  -7.043  1.00 169.34 ? 1   DA  C "C5'" 1 
ATOM 313  C "C4'" . DA  B 2 1   ? 3.150   27.052  -7.115  1.00 174.41 ? 1   DA  C "C4'" 1 
ATOM 314  O "O4'" . DA  B 2 1   ? 2.801   26.777  -8.501  1.00 173.29 ? 1   DA  C "O4'" 1 
ATOM 315  C "C3'" . DA  B 2 1   ? 3.575   25.708  -6.529  1.00 173.06 ? 1   DA  C "C3'" 1 
ATOM 316  O "O3'" . DA  B 2 1   ? 2.482   25.047  -5.898  1.00 176.16 ? 1   DA  C "O3'" 1 
ATOM 317  C "C2'" . DA  B 2 1   ? 4.010   24.952  -7.778  1.00 171.98 ? 1   DA  C "C2'" 1 
ATOM 318  C "C1'" . DA  B 2 1   ? 2.896   25.386  -8.715  1.00 172.01 ? 1   DA  C "C1'" 1 
ATOM 319  N N9    . DA  B 2 1   ? 3.164   25.140  -10.125 1.00 174.15 ? 1   DA  C N9    1 
ATOM 320  C C8    . DA  B 2 1   ? 3.892   24.119  -10.668 1.00 175.50 ? 1   DA  C C8    1 
ATOM 321  N N7    . DA  B 2 1   ? 3.956   24.157  -11.979 1.00 176.21 ? 1   DA  C N7    1 
ATOM 322  C C5    . DA  B 2 1   ? 3.218   25.282  -12.318 1.00 176.47 ? 1   DA  C C5    1 
ATOM 323  C C6    . DA  B 2 1   ? 2.893   25.888  -13.552 1.00 174.21 ? 1   DA  C C6    1 
ATOM 324  N N6    . DA  B 2 1   ? 3.292   25.418  -14.739 1.00 173.11 ? 1   DA  C N6    1 
ATOM 325  N N1    . DA  B 2 1   ? 2.134   27.006  -13.525 1.00 174.45 ? 1   DA  C N1    1 
ATOM 326  C C2    . DA  B 2 1   ? 1.729   27.488  -12.344 1.00 174.61 ? 1   DA  C C2    1 
ATOM 327  N N3    . DA  B 2 1   ? 1.968   27.008  -11.125 1.00 175.76 ? 1   DA  C N3    1 
ATOM 328  C C4    . DA  B 2 1   ? 2.724   25.897  -11.183 1.00 175.44 ? 1   DA  C C4    1 
ATOM 329  P P     . DA  B 2 2   ? 2.738   23.722  -5.021  1.00 253.52 ? 2   DA  C P     1 
ATOM 330  O OP1   . DA  B 2 2   ? 3.157   24.143  -3.667  1.00 252.95 ? 2   DA  C OP1   1 
ATOM 331  O OP2   . DA  B 2 2   ? 3.610   22.819  -5.804  1.00 253.70 ? 2   DA  C OP2   1 
ATOM 332  O "O5'" . DA  B 2 2   ? 1.292   23.045  -4.934  1.00 143.44 ? 2   DA  C "O5'" 1 
ATOM 333  C "C5'" . DA  B 2 2   ? 0.190   23.732  -5.521  1.00 143.36 ? 2   DA  C "C5'" 1 
ATOM 334  C "C4'" . DA  B 2 2   ? -0.843  22.768  -6.083  1.00 141.41 ? 2   DA  C "C4'" 1 
ATOM 335  O "O4'" . DA  B 2 2   ? -0.603  22.530  -7.494  1.00 140.89 ? 2   DA  C "O4'" 1 
ATOM 336  C "C3'" . DA  B 2 2   ? -0.888  21.412  -5.388  1.00 139.74 ? 2   DA  C "C3'" 1 
ATOM 337  O "O3'" . DA  B 2 2   ? -2.242  21.212  -4.913  1.00 140.00 ? 2   DA  C "O3'" 1 
ATOM 338  C "C2'" . DA  B 2 2   ? -0.402  20.430  -6.462  1.00 139.42 ? 2   DA  C "C2'" 1 
ATOM 339  C "C1'" . DA  B 2 2   ? -0.663  21.155  -7.781  1.00 140.35 ? 2   DA  C "C1'" 1 
ATOM 340  N N9    . DA  B 2 2   ? 0.328   20.909  -8.821  1.00 142.50 ? 2   DA  C N9    1 
ATOM 341  C C8    . DA  B 2 2   ? 1.632   20.548  -8.628  1.00 143.88 ? 2   DA  C C8    1 
ATOM 342  N N7    . DA  B 2 2   ? 2.311   20.400  -9.739  1.00 145.06 ? 2   DA  C N7    1 
ATOM 343  C C5    . DA  B 2 2   ? 1.387   20.690  -10.729 1.00 145.98 ? 2   DA  C C5    1 
ATOM 344  C C6    . DA  B 2 2   ? 1.486   20.711  -12.133 1.00 147.83 ? 2   DA  C C6    1 
ATOM 345  N N6    . DA  B 2 2   ? 2.615   20.421  -12.788 1.00 149.50 ? 2   DA  C N6    1 
ATOM 346  N N1    . DA  B 2 2   ? 0.382   21.038  -12.836 1.00 147.00 ? 2   DA  C N1    1 
ATOM 347  C C2    . DA  B 2 2   ? -0.742  21.325  -12.168 1.00 145.24 ? 2   DA  C C2    1 
ATOM 348  N N3    . DA  B 2 2   ? -0.959  21.339  -10.854 1.00 143.71 ? 2   DA  C N3    1 
ATOM 349  C C4    . DA  B 2 2   ? 0.158   21.010  -10.184 1.00 143.99 ? 2   DA  C C4    1 
ATOM 350  P P     . DA  B 2 3   ? -2.768  19.743  -4.509  1.00 148.51 ? 3   DA  C P     1 
ATOM 351  O OP1   . DA  B 2 3   ? -4.006  19.890  -3.711  1.00 146.04 ? 3   DA  C OP1   1 
ATOM 352  O OP2   . DA  B 2 3   ? -1.607  18.929  -4.090  1.00 149.37 ? 3   DA  C OP2   1 
ATOM 353  O "O5'" . DA  B 2 3   ? -3.243  19.147  -5.875  1.00 143.15 ? 3   DA  C "O5'" 1 
ATOM 354  C "C5'" . DA  B 2 3   ? -3.454  20.039  -6.924  1.00 142.98 ? 3   DA  C "C5'" 1 
ATOM 355  C "C4'" . DA  B 2 3   ? -3.732  19.079  -8.025  1.00 140.37 ? 3   DA  C "C4'" 1 
ATOM 356  O "O4'" . DA  B 2 3   ? -2.751  18.916  -9.063  1.00 138.33 ? 3   DA  C "O4'" 1 
ATOM 357  C "C3'" . DA  B 2 3   ? -3.792  17.681  -7.444  1.00 139.83 ? 3   DA  C "C3'" 1 
ATOM 358  O "O3'" . DA  B 2 3   ? -4.801  17.192  -8.313  1.00 142.92 ? 3   DA  C "O3'" 1 
ATOM 359  C "C2'" . DA  B 2 3   ? -2.403  17.127  -7.668  1.00 137.06 ? 3   DA  C "C2'" 1 
ATOM 360  C "C1'" . DA  B 2 3   ? -2.308  17.559  -9.105  1.00 135.02 ? 3   DA  C "C1'" 1 
ATOM 361  N N9    . DA  B 2 3   ? -0.948  17.548  -9.600  1.00 128.89 ? 3   DA  C N9    1 
ATOM 362  C C8    . DA  B 2 3   ? 0.167   17.490  -8.815  1.00 124.99 ? 3   DA  C C8    1 
ATOM 363  N N7    . DA  B 2 3   ? 1.266   17.537  -9.515  1.00 122.80 ? 3   DA  C N7    1 
ATOM 364  C C5    . DA  B 2 3   ? 0.831   17.632  -10.831 1.00 122.73 ? 3   DA  C C5    1 
ATOM 365  C C6    . DA  B 2 3   ? 1.528   17.715  -12.047 1.00 119.81 ? 3   DA  C C6    1 
ATOM 366  N N6    . DA  B 2 3   ? 2.861   17.718  -12.130 1.00 118.80 ? 3   DA  C N6    1 
ATOM 367  N N1    . DA  B 2 3   ? 0.804   17.802  -13.179 1.00 119.76 ? 3   DA  C N1    1 
ATOM 368  C C2    . DA  B 2 3   ? -0.530  17.800  -13.107 1.00 120.95 ? 3   DA  C C2    1 
ATOM 369  N N3    . DA  B 2 3   ? -1.302  17.724  -12.024 1.00 123.16 ? 3   DA  C N3    1 
ATOM 370  C C4    . DA  B 2 3   ? -0.543  17.643  -10.913 1.00 125.07 ? 3   DA  C C4    1 
ATOM 371  P P     . DT  B 2 4   ? -5.404  15.724  -8.133  1.00 201.51 ? 4   DT  C P     1 
ATOM 372  O OP1   . DT  B 2 4   ? -6.344  15.763  -6.982  1.00 201.04 ? 4   DT  C OP1   1 
ATOM 373  O OP2   . DT  B 2 4   ? -4.290  14.763  -8.273  1.00 200.91 ? 4   DT  C OP2   1 
ATOM 374  O "O5'" . DT  B 2 4   ? -6.286  15.513  -9.472  1.00 145.14 ? 4   DT  C "O5'" 1 
ATOM 375  C "C5'" . DT  B 2 4   ? -5.777  15.898  -10.862 1.00 146.56 ? 4   DT  C "C5'" 1 
ATOM 376  C "C4'" . DT  B 2 4   ? -5.526  14.913  -12.057 1.00 127.68 ? 4   DT  C "C4'" 1 
ATOM 377  O "O4'" . DT  B 2 4   ? -4.098  14.847  -12.276 1.00 124.84 ? 4   DT  C "O4'" 1 
ATOM 378  C "C3'" . DT  B 2 4   ? -6.012  13.435  -12.157 1.00 105.68 ? 4   DT  C "C3'" 1 
ATOM 379  O "O3'" . DT  B 2 4   ? -6.280  12.912  -13.528 1.00 102.68 ? 4   DT  C "O3'" 1 
ATOM 380  C "C2'" . DT  B 2 4   ? -4.797  12.714  -11.588 1.00 111.09 ? 4   DT  C "C2'" 1 
ATOM 381  C "C1'" . DT  B 2 4   ? -3.698  13.500  -12.252 1.00 117.48 ? 4   DT  C "C1'" 1 
ATOM 382  N N1    . DT  B 2 4   ? -2.441  13.573  -11.557 1.00 115.26 ? 4   DT  C N1    1 
ATOM 383  C C2    . DT  B 2 4   ? -1.455  13.765  -12.461 1.00 114.00 ? 4   DT  C C2    1 
ATOM 384  O O2    . DT  B 2 4   ? -1.692  13.812  -13.651 1.00 113.12 ? 4   DT  C O2    1 
ATOM 385  N N3    . DT  B 2 4   ? -0.225  13.881  -11.931 1.00 114.67 ? 4   DT  C N3    1 
ATOM 386  C C4    . DT  B 2 4   ? 0.088   13.833  -10.600 1.00 117.04 ? 4   DT  C C4    1 
ATOM 387  O O4    . DT  B 2 4   ? 1.258   13.953  -10.255 1.00 119.41 ? 4   DT  C O4    1 
ATOM 388  C C5    . DT  B 2 4   ? -1.014  13.638  -9.682  1.00 116.32 ? 4   DT  C C5    1 
ATOM 389  C C7    . DT  B 2 4   ? -0.718  13.579  -8.214  1.00 116.75 ? 4   DT  C C7    1 
ATOM 390  C C6    . DT  B 2 4   ? -2.255  13.521  -10.187 1.00 114.81 ? 4   DT  C C6    1 
ATOM 391  P P     . DT  B 2 5   ? -7.339  11.716  -13.776 1.00 108.72 ? 5   DT  C P     1 
ATOM 392  O OP1   . DT  B 2 5   ? -8.689  12.242  -13.552 1.00 110.23 ? 5   DT  C OP1   1 
ATOM 393  O OP2   . DT  B 2 5   ? -6.896  10.529  -13.020 1.00 108.57 ? 5   DT  C OP2   1 
ATOM 394  O "O5'" . DT  B 2 5   ? -7.219  11.430  -15.343 1.00 105.87 ? 5   DT  C "O5'" 1 
ATOM 395  C "C5'" . DT  B 2 5   ? -7.430  12.533  -16.197 1.00 105.40 ? 5   DT  C "C5'" 1 
ATOM 396  C "C4'" . DT  B 2 5   ? -6.267  12.726  -17.140 1.00 107.61 ? 5   DT  C "C4'" 1 
ATOM 397  O "O4'" . DT  B 2 5   ? -5.064  12.910  -16.360 1.00 108.38 ? 5   DT  C "O4'" 1 
ATOM 398  C "C3'" . DT  B 2 5   ? -6.034  11.535  -18.060 1.00 110.55 ? 5   DT  C "C3'" 1 
ATOM 399  O "O3'" . DT  B 2 5   ? -6.056  11.948  -19.424 1.00 110.73 ? 5   DT  C "O3'" 1 
ATOM 400  C "C2'" . DT  B 2 5   ? -4.670  11.008  -17.625 1.00 112.37 ? 5   DT  C "C2'" 1 
ATOM 401  C "C1'" . DT  B 2 5   ? -4.015  12.234  -17.002 1.00 112.71 ? 5   DT  C "C1'" 1 
ATOM 402  N N1    . DT  B 2 5   ? -3.023  11.898  -15.958 1.00 116.94 ? 5   DT  C N1    1 
ATOM 403  C C2    . DT  B 2 5   ? -1.711  12.302  -16.098 1.00 117.98 ? 5   DT  C C2    1 
ATOM 404  O O2    . DT  B 2 5   ? -1.294  12.940  -17.049 1.00 118.03 ? 5   DT  C O2    1 
ATOM 405  N N3    . DT  B 2 5   ? -0.894  11.928  -15.064 1.00 118.68 ? 5   DT  C N3    1 
ATOM 406  C C4    . DT  B 2 5   ? -1.256  11.203  -13.943 1.00 120.68 ? 5   DT  C C4    1 
ATOM 407  O O4    . DT  B 2 5   ? -0.455  10.910  -13.065 1.00 122.48 ? 5   DT  C O4    1 
ATOM 408  C C5    . DT  B 2 5   ? -2.640  10.818  -13.861 1.00 120.10 ? 5   DT  C C5    1 
ATOM 409  C C7    . DT  B 2 5   ? -3.128  10.030  -12.679 1.00 120.10 ? 5   DT  C C7    1 
ATOM 410  C C6    . DT  B 2 5   ? -3.450  11.180  -14.861 1.00 118.99 ? 5   DT  C C6    1 
ATOM 411  P P     . DT  B 2 6   ? -5.338  11.059  -20.549 1.00 127.70 ? 6   DT  C P     1 
ATOM 412  O OP1   . DT  B 2 6   ? -5.744  11.580  -21.871 1.00 128.27 ? 6   DT  C OP1   1 
ATOM 413  O OP2   . DT  B 2 6   ? -5.574  9.636   -20.223 1.00 127.55 ? 6   DT  C OP2   1 
ATOM 414  O "O5'" . DT  B 2 6   ? -3.783  11.365  -20.331 1.00 116.99 ? 6   DT  C "O5'" 1 
ATOM 415  C "C5'" . DT  B 2 6   ? -2.844  10.841  -21.261 1.00 116.64 ? 6   DT  C "C5'" 1 
ATOM 416  C "C4'" . DT  B 2 6   ? -1.512  10.461  -20.629 1.00 114.28 ? 6   DT  C "C4'" 1 
ATOM 417  O "O4'" . DT  B 2 6   ? -1.607  10.310  -19.193 1.00 112.88 ? 6   DT  C "O4'" 1 
ATOM 418  C "C3'" . DT  B 2 6   ? -0.941  9.126   -21.108 1.00 112.86 ? 6   DT  C "C3'" 1 
ATOM 419  O "O3'" . DT  B 2 6   ? 0.153   9.339   -21.993 1.00 113.05 ? 6   DT  C "O3'" 1 
ATOM 420  C "C2'" . DT  B 2 6   ? -0.486  8.421   -19.831 1.00 110.96 ? 6   DT  C "C2'" 1 
ATOM 421  C "C1'" . DT  B 2 6   ? -0.462  9.572   -18.845 1.00 111.75 ? 6   DT  C "C1'" 1 
ATOM 422  N N1    . DT  B 2 6   ? -0.518  9.136   -17.429 1.00 115.21 ? 6   DT  C N1    1 
ATOM 423  C C2    . DT  B 2 6   ? 0.621   9.235   -16.661 1.00 118.51 ? 6   DT  C C2    1 
ATOM 424  O O2    . DT  B 2 6   ? 1.675   9.671   -17.085 1.00 119.49 ? 6   DT  C O2    1 
ATOM 425  N N3    . DT  B 2 6   ? 0.484   8.806   -15.366 1.00 121.07 ? 6   DT  C N3    1 
ATOM 426  C C4    . DT  B 2 6   ? -0.655  8.292   -14.775 1.00 123.57 ? 6   DT  C C4    1 
ATOM 427  O O4    . DT  B 2 6   ? -0.677  7.930   -13.599 1.00 125.08 ? 6   DT  C O4    1 
ATOM 428  C C5    . DT  B 2 6   ? -1.811  8.213   -15.639 1.00 122.84 ? 6   DT  C C5    1 
ATOM 429  C C7    . DT  B 2 6   ? -3.110  7.671   -15.114 1.00 124.25 ? 6   DT  C C7    1 
ATOM 430  C C6    . DT  B 2 6   ? -1.689  8.632   -16.907 1.00 118.63 ? 6   DT  C C6    1 
ATOM 431  P P     . DT  B 2 7   ? 0.212   8.571   -23.406 1.00 133.86 ? 7   DT  C P     1 
ATOM 432  O OP1   . DT  B 2 7   ? 0.697   9.527   -24.425 1.00 134.87 ? 7   DT  C OP1   1 
ATOM 433  O OP2   . DT  B 2 7   ? -1.075  7.866   -23.597 1.00 132.73 ? 7   DT  C OP2   1 
ATOM 434  O "O5'" . DT  B 2 7   ? 1.344   7.475   -23.186 1.00 140.82 ? 7   DT  C "O5'" 1 
ATOM 435  C "C5'" . DT  B 2 7   ? 1.309   6.733   -21.995 1.00 141.23 ? 7   DT  C "C5'" 1 
ATOM 436  C "C4'" . DT  B 2 7   ? 2.661   6.814   -21.327 1.00 141.43 ? 7   DT  C "C4'" 1 
ATOM 437  O "O4'" . DT  B 2 7   ? 2.488   7.102   -19.917 1.00 139.79 ? 7   DT  C "O4'" 1 
ATOM 438  C "C3'" . DT  B 2 7   ? 3.445   5.514   -21.405 1.00 143.26 ? 7   DT  C "C3'" 1 
ATOM 439  O "O3'" . DT  B 2 7   ? 4.842   5.780   -21.435 1.00 144.45 ? 7   DT  C "O3'" 1 
ATOM 440  C "C2'" . DT  B 2 7   ? 3.024   4.831   -20.108 1.00 142.23 ? 7   DT  C "C2'" 1 
ATOM 441  C "C1'" . DT  B 2 7   ? 3.014   6.029   -19.163 1.00 138.44 ? 7   DT  C "C1'" 1 
ATOM 442  N N1    . DT  B 2 7   ? 2.169   5.853   -17.953 1.00 132.29 ? 7   DT  C N1    1 
ATOM 443  C C2    . DT  B 2 7   ? 2.761   5.917   -16.712 1.00 129.24 ? 7   DT  C C2    1 
ATOM 444  O O2    . DT  B 2 7   ? 3.949   6.110   -16.539 1.00 128.88 ? 7   DT  C O2    1 
ATOM 445  N N3    . DT  B 2 7   ? 1.898   5.746   -15.664 1.00 127.90 ? 7   DT  C N3    1 
ATOM 446  C C4    . DT  B 2 7   ? 0.536   5.523   -15.735 1.00 128.14 ? 7   DT  C C4    1 
ATOM 447  O O4    . DT  B 2 7   ? -0.164  5.382   -14.739 1.00 127.89 ? 7   DT  C O4    1 
ATOM 448  C C5    . DT  B 2 7   ? -0.019  5.468   -17.061 1.00 129.01 ? 7   DT  C C5    1 
ATOM 449  C C7    . DT  B 2 7   ? -1.490  5.231   -17.243 1.00 128.69 ? 7   DT  C C7    1 
ATOM 450  C C6    . DT  B 2 7   ? 0.814   5.635   -18.097 1.00 130.57 ? 7   DT  C C6    1 
ATOM 451  P P     . DA  B 2 8   ? 5.878   4.607   -21.797 1.00 173.33 ? 8   DA  C P     1 
ATOM 452  O OP1   . DA  B 2 8   ? 7.230   5.203   -21.886 1.00 173.56 ? 8   DA  C OP1   1 
ATOM 453  O OP2   . DA  B 2 8   ? 5.329   3.850   -22.942 1.00 173.91 ? 8   DA  C OP2   1 
ATOM 454  O "O5'" . DA  B 2 8   ? 5.813   3.645   -20.523 1.00 136.68 ? 8   DA  C "O5'" 1 
ATOM 455  C "C5'" . DA  B 2 8   ? 6.842   3.679   -19.552 1.00 138.33 ? 8   DA  C "C5'" 1 
ATOM 456  C "C4'" . DA  B 2 8   ? 6.485   2.762   -18.403 1.00 141.97 ? 8   DA  C "C4'" 1 
ATOM 457  O "O4'" . DA  B 2 8   ? 5.295   3.244   -17.742 1.00 142.38 ? 8   DA  C "O4'" 1 
ATOM 458  C "C3'" . DA  B 2 8   ? 6.069   1.346   -18.782 1.00 144.11 ? 8   DA  C "C3'" 1 
ATOM 459  O "O3'" . DA  B 2 8   ? 7.170   0.505   -19.167 1.00 144.59 ? 8   DA  C "O3'" 1 
ATOM 460  C "C2'" . DA  B 2 8   ? 5.404   0.886   -17.494 1.00 144.58 ? 8   DA  C "C2'" 1 
ATOM 461  C "C1'" . DA  B 2 8   ? 4.840   2.181   -16.929 1.00 143.31 ? 8   DA  C "C1'" 1 
ATOM 462  N N9    . DA  B 2 8   ? 3.395   2.092   -16.908 1.00 142.06 ? 8   DA  C N9    1 
ATOM 463  C C8    . DA  B 2 8   ? 2.511   2.089   -17.950 1.00 142.00 ? 8   DA  C C8    1 
ATOM 464  N N7    . DA  B 2 8   ? 1.261   1.971   -17.562 1.00 142.41 ? 8   DA  C N7    1 
ATOM 465  C C5    . DA  B 2 8   ? 1.345   1.880   -16.179 1.00 142.14 ? 8   DA  C C5    1 
ATOM 466  C C6    . DA  B 2 8   ? 0.388   1.739   -15.154 1.00 142.47 ? 8   DA  C C6    1 
ATOM 467  N N6    . DA  B 2 8   ? -0.936  1.657   -15.334 1.00 142.87 ? 8   DA  C N6    1 
ATOM 468  N N1    . DA  B 2 8   ? 0.853   1.685   -13.897 1.00 142.15 ? 8   DA  C N1    1 
ATOM 469  C C2    . DA  B 2 8   ? 2.161   1.761   -13.651 1.00 141.70 ? 8   DA  C C2    1 
ATOM 470  N N3    . DA  B 2 8   ? 3.149   1.896   -14.524 1.00 141.35 ? 8   DA  C N3    1 
ATOM 471  C C4    . DA  B 2 8   ? 2.660   1.947   -15.770 1.00 141.57 ? 8   DA  C C4    1 
ATOM 472  P P     . DT  B 2 9   ? 8.207   -0.058  -18.068 1.00 133.63 ? 9   DT  C P     1 
ATOM 473  O OP1   . DT  B 2 9   ? 8.800   1.096   -17.359 1.00 133.03 ? 9   DT  C OP1   1 
ATOM 474  O OP2   . DT  B 2 9   ? 9.092   -1.029  -18.743 1.00 133.92 ? 9   DT  C OP2   1 
ATOM 475  O "O5'" . DT  B 2 9   ? 7.285   -0.846  -17.024 1.00 141.45 ? 9   DT  C "O5'" 1 
ATOM 476  C "C5'" . DT  B 2 9   ? 7.560   -0.649  -15.637 1.00 143.49 ? 9   DT  C "C5'" 1 
ATOM 477  C "C4'" . DT  B 2 9   ? 6.631   -1.454  -14.750 1.00 148.06 ? 9   DT  C "C4'" 1 
ATOM 478  O "O4'" . DT  B 2 9   ? 5.271   -0.942  -14.802 1.00 149.87 ? 9   DT  C "O4'" 1 
ATOM 479  C "C3'" . DT  B 2 9   ? 6.542   -2.936  -15.113 1.00 151.98 ? 9   DT  C "C3'" 1 
ATOM 480  O "O3'" . DT  B 2 9   ? 6.650   -3.713  -13.931 1.00 154.27 ? 9   DT  C "O3'" 1 
ATOM 481  C "C2'" . DT  B 2 9   ? 5.144   -3.057  -15.701 1.00 152.75 ? 9   DT  C "C2'" 1 
ATOM 482  C "C1'" . DT  B 2 9   ? 4.435   -2.077  -14.779 1.00 153.61 ? 9   DT  C "C1'" 1 
ATOM 483  N N1    . DT  B 2 9   ? 3.051   -1.783  -15.224 1.00 158.16 ? 9   DT  C N1    1 
ATOM 484  C C2    . DT  B 2 9   ? 2.034   -1.820  -14.292 1.00 160.98 ? 9   DT  C C2    1 
ATOM 485  O O2    . DT  B 2 9   ? 2.209   -2.056  -13.107 1.00 161.57 ? 9   DT  C O2    1 
ATOM 486  N N3    . DT  B 2 9   ? 0.790   -1.555  -14.806 1.00 162.17 ? 9   DT  C N3    1 
ATOM 487  C C4    . DT  B 2 9   ? 0.476   -1.275  -16.125 1.00 162.00 ? 9   DT  C C4    1 
ATOM 488  O O4    . DT  B 2 9   ? -0.671  -1.051  -16.492 1.00 163.58 ? 9   DT  C O4    1 
ATOM 489  C C5    . DT  B 2 9   ? 1.585   -1.262  -17.044 1.00 159.59 ? 9   DT  C C5    1 
ATOM 490  C C7    . DT  B 2 9   ? 1.350   -0.970  -18.495 1.00 158.40 ? 9   DT  C C7    1 
ATOM 491  C C6    . DT  B 2 9   ? 2.806   -1.518  -16.557 1.00 158.78 ? 9   DT  C C6    1 
ATOM 492  P P     . DA  B 2 10  ? 7.181   -5.229  -14.001 1.00 192.45 ? 10  DA  C P     1 
ATOM 493  O OP1   . DA  B 2 10  ? 8.653   -5.202  -13.856 1.00 192.34 ? 10  DA  C OP1   1 
ATOM 494  O OP2   . DA  B 2 10  ? 6.580   -5.868  -15.191 1.00 191.78 ? 10  DA  C OP2   1 
ATOM 495  O "O5'" . DA  B 2 10  ? 6.536   -5.910  -12.703 1.00 148.80 ? 10  DA  C "O5'" 1 
ATOM 496  C "C5'" . DA  B 2 10  ? 6.374   -5.149  -11.506 1.00 146.84 ? 10  DA  C "C5'" 1 
ATOM 497  C "C4'" . DA  B 2 10  ? 5.007   -5.377  -10.880 1.00 143.26 ? 10  DA  C "C4'" 1 
ATOM 498  O "O4'" . DA  B 2 10  ? 3.966   -4.778  -11.701 1.00 140.49 ? 10  DA  C "O4'" 1 
ATOM 499  C "C3'" . DA  B 2 10  ? 4.600   -6.837  -10.707 1.00 140.81 ? 10  DA  C "C3'" 1 
ATOM 500  O "O3'" . DA  B 2 10  ? 3.853   -6.976  -9.507  1.00 139.98 ? 10  DA  C "O3'" 1 
ATOM 501  C "C2'" . DA  B 2 10  ? 3.698   -7.054  -11.917 1.00 139.09 ? 10  DA  C "C2'" 1 
ATOM 502  C "C1'" . DA  B 2 10  ? 2.941   -5.735  -11.843 1.00 137.35 ? 10  DA  C "C1'" 1 
ATOM 503  N N9    . DA  B 2 10  ? 2.114   -5.405  -13.000 1.00 132.80 ? 10  DA  C N9    1 
ATOM 504  C C8    . DA  B 2 10  ? 2.494   -5.226  -14.302 1.00 131.35 ? 10  DA  C C8    1 
ATOM 505  N N7    . DA  B 2 10  ? 1.498   -4.934  -15.107 1.00 130.84 ? 10  DA  C N7    1 
ATOM 506  C C5    . DA  B 2 10  ? 0.392   -4.916  -14.272 1.00 131.15 ? 10  DA  C C5    1 
ATOM 507  C C6    . DA  B 2 10  ? -0.976  -4.666  -14.501 1.00 131.13 ? 10  DA  C C6    1 
ATOM 508  N N6    . DA  B 2 10  ? -1.486  -4.374  -15.703 1.00 129.35 ? 10  DA  C N6    1 
ATOM 509  N N1    . DA  B 2 10  ? -1.801  -4.729  -13.433 1.00 131.95 ? 10  DA  C N1    1 
ATOM 510  C C2    . DA  B 2 10  ? -1.296  -5.021  -12.228 1.00 131.05 ? 10  DA  C C2    1 
ATOM 511  N N3    . DA  B 2 10  ? -0.035  -5.276  -11.892 1.00 130.11 ? 10  DA  C N3    1 
ATOM 512  C C4    . DA  B 2 10  ? 0.760   -5.203  -12.971 1.00 131.34 ? 10  DA  C C4    1 
ATOM 513  P P     . DA  B 2 11  ? 4.044   -8.275  -8.582  1.00 203.44 ? 11  DA  C P     1 
ATOM 514  O OP1   . DA  B 2 11  ? 5.184   -8.022  -7.673  1.00 203.31 ? 11  DA  C OP1   1 
ATOM 515  O OP2   . DA  B 2 11  ? 4.047   -9.464  -9.461  1.00 203.29 ? 11  DA  C OP2   1 
ATOM 516  O "O5'" . DA  B 2 11  ? 2.688   -8.338  -7.736  1.00 155.40 ? 11  DA  C "O5'" 1 
ATOM 517  C "C5'" . DA  B 2 11  ? 1.891   -7.179  -7.575  1.00 154.90 ? 11  DA  C "C5'" 1 
ATOM 518  C "C4'" . DA  B 2 11  ? 0.414   -7.526  -7.652  1.00 154.83 ? 11  DA  C "C4'" 1 
ATOM 519  O "O4'" . DA  B 2 11  ? -0.083  -7.256  -8.987  1.00 155.58 ? 11  DA  C "O4'" 1 
ATOM 520  C "C3'" . DA  B 2 11  ? 0.059   -8.976  -7.334  1.00 153.59 ? 11  DA  C "C3'" 1 
ATOM 521  O "O3'" . DA  B 2 11  ? -1.005  -8.979  -6.385  1.00 152.77 ? 11  DA  C "O3'" 1 
ATOM 522  C "C2'" . DA  B 2 11  ? -0.331  -9.574  -8.688  1.00 153.94 ? 11  DA  C "C2'" 1 
ATOM 523  C "C1'" . DA  B 2 11  ? -0.816  -8.359  -9.472  1.00 155.05 ? 11  DA  C "C1'" 1 
ATOM 524  N N9    . DA  B 2 11  ? -0.581  -8.413  -10.912 1.00 154.67 ? 11  DA  C N9    1 
ATOM 525  C C8    . DA  B 2 11  ? 0.565   -8.781  -11.560 1.00 153.88 ? 11  DA  C C8    1 
ATOM 526  N N7    . DA  B 2 11  ? 0.476   -8.713  -12.869 1.00 152.47 ? 11  DA  C N7    1 
ATOM 527  C C5    . DA  B 2 11  ? -0.813  -8.263  -13.096 1.00 151.32 ? 11  DA  C C5    1 
ATOM 528  C C6    . DA  B 2 11  ? -1.530  -7.981  -14.277 1.00 148.13 ? 11  DA  C C6    1 
ATOM 529  N N6    . DA  B 2 11  ? -1.025  -8.119  -15.504 1.00 146.26 ? 11  DA  C N6    1 
ATOM 530  N N1    . DA  B 2 11  ? -2.798  -7.549  -14.146 1.00 148.38 ? 11  DA  C N1    1 
ATOM 531  C C2    . DA  B 2 11  ? -3.307  -7.409  -12.916 1.00 150.26 ? 11  DA  C C2    1 
ATOM 532  N N3    . DA  B 2 11  ? -2.737  -7.641  -11.735 1.00 152.24 ? 11  DA  C N3    1 
ATOM 533  C C4    . DA  B 2 11  ? -1.476  -8.071  -11.898 1.00 153.21 ? 11  DA  C C4    1 
ATOM 534  P P     . DA  B 2 12  ? -1.889  -10.302 -6.159  1.00 217.93 ? 12  DA  C P     1 
ATOM 535  O OP1   . DA  B 2 12  ? -2.626  -10.147 -4.885  1.00 216.36 ? 12  DA  C OP1   1 
ATOM 536  O OP2   . DA  B 2 12  ? -1.013  -11.478 -6.351  1.00 219.17 ? 12  DA  C OP2   1 
ATOM 537  O "O5'" . DA  B 2 12  ? -2.937  -10.250 -7.357  1.00 161.37 ? 12  DA  C "O5'" 1 
ATOM 538  C "C5'" . DA  B 2 12  ? -3.789  -9.117  -7.460  1.00 160.73 ? 12  DA  C "C5'" 1 
ATOM 539  C "C4'" . DA  B 2 12  ? -5.116  -9.550  -8.043  1.00 158.79 ? 12  DA  C "C4'" 1 
ATOM 540  O "O4'" . DA  B 2 12  ? -4.993  -9.586  -9.486  1.00 157.51 ? 12  DA  C "O4'" 1 
ATOM 541  C "C3'" . DA  B 2 12  ? -5.538  -10.953 -7.629  1.00 158.08 ? 12  DA  C "C3'" 1 
ATOM 542  O "O3'" . DA  B 2 12  ? -6.950  -11.105 -7.752  1.00 157.31 ? 12  DA  C "O3'" 1 
ATOM 543  C "C2'" . DA  B 2 12  ? -4.774  -11.782 -8.653  1.00 158.42 ? 12  DA  C "C2'" 1 
ATOM 544  C "C1'" . DA  B 2 12  ? -4.962  -10.932 -9.906  1.00 158.17 ? 12  DA  C "C1'" 1 
ATOM 545  N N9    . DA  B 2 12  ? -3.919  -11.120 -10.909 1.00 158.97 ? 12  DA  C N9    1 
ATOM 546  C C8    . DA  B 2 12  ? -2.724  -11.764 -10.753 1.00 158.61 ? 12  DA  C C8    1 
ATOM 547  N N7    . DA  B 2 12  ? -1.990  -11.787 -11.840 1.00 159.42 ? 12  DA  C N7    1 
ATOM 548  C C5    . DA  B 2 12  ? -2.759  -11.113 -12.774 1.00 160.90 ? 12  DA  C C5    1 
ATOM 549  C C6    . DA  B 2 12  ? -2.547  -10.795 -14.128 1.00 162.91 ? 12  DA  C C6    1 
ATOM 550  N N6    . DA  B 2 12  ? -1.448  -11.124 -14.818 1.00 163.79 ? 12  DA  C N6    1 
ATOM 551  N N1    . DA  B 2 12  ? -3.519  -10.110 -14.752 1.00 162.76 ? 12  DA  C N1    1 
ATOM 552  C C2    . DA  B 2 12  ? -4.630  -9.778  -14.092 1.00 162.26 ? 12  DA  C C2    1 
ATOM 553  N N3    . DA  B 2 12  ? -4.939  -10.017 -12.822 1.00 161.81 ? 12  DA  C N3    1 
ATOM 554  C C4    . DA  B 2 12  ? -3.953  -10.696 -12.216 1.00 160.84 ? 12  DA  C C4    1 
ATOM 555  P P     . DT  B 2 13  ? -7.640  -12.530 -7.472  1.00 131.45 ? 13  DT  C P     1 
ATOM 556  O OP1   . DT  B 2 13  ? -8.619  -12.356 -6.377  1.00 130.20 ? 13  DT  C OP1   1 
ATOM 557  O OP2   . DT  B 2 13  ? -6.565  -13.540 -7.344  1.00 131.87 ? 13  DT  C OP2   1 
ATOM 558  O "O5'" . DT  B 2 13  ? -8.436  -12.834 -8.830  1.00 138.60 ? 13  DT  C "O5'" 1 
ATOM 559  C "C5'" . DT  B 2 13  ? -9.712  -12.239 -9.066  1.00 137.04 ? 13  DT  C "C5'" 1 
ATOM 560  C "C4'" . DT  B 2 13  ? -9.888  -11.813 -10.516 1.00 134.93 ? 13  DT  C "C4'" 1 
ATOM 561  O "O4'" . DT  B 2 13  ? -8.639  -11.268 -11.010 1.00 134.78 ? 13  DT  C "O4'" 1 
ATOM 562  C "C3'" . DT  B 2 13  ? -10.227 -12.893 -11.530 1.00 133.30 ? 13  DT  C "C3'" 1 
ATOM 563  O "O3'" . DT  B 2 13  ? -11.624 -13.192 -11.505 1.00 133.24 ? 13  DT  C "O3'" 1 
ATOM 564  C "C2'" . DT  B 2 13  ? -9.829  -12.180 -12.819 1.00 133.32 ? 13  DT  C "C2'" 1 
ATOM 565  C "C1'" . DT  B 2 13  ? -8.530  -11.506 -12.403 1.00 134.60 ? 13  DT  C "C1'" 1 
ATOM 566  N N1    . DT  B 2 13  ? -7.283  -12.295 -12.649 1.00 135.67 ? 13  DT  C N1    1 
ATOM 567  C C2    . DT  B 2 13  ? -6.725  -12.349 -13.912 1.00 135.66 ? 13  DT  C C2    1 
ATOM 568  O O2    . DT  B 2 13  ? -7.198  -11.795 -14.889 1.00 135.89 ? 13  DT  C O2    1 
ATOM 569  N N3    . DT  B 2 13  ? -5.576  -13.092 -13.991 1.00 135.69 ? 13  DT  C N3    1 
ATOM 570  C C4    . DT  B 2 13  ? -4.944  -13.766 -12.961 1.00 138.07 ? 13  DT  C C4    1 
ATOM 571  O O4    . DT  B 2 13  ? -3.914  -14.409 -13.126 1.00 140.92 ? 13  DT  C O4    1 
ATOM 572  C C5    . DT  B 2 13  ? -5.573  -13.667 -11.671 1.00 137.27 ? 13  DT  C C5    1 
ATOM 573  C C7    . DT  B 2 13  ? -4.966  -14.367 -10.488 1.00 136.80 ? 13  DT  C C7    1 
ATOM 574  C C6    . DT  B 2 13  ? -6.697  -12.945 -11.582 1.00 136.41 ? 13  DT  C C6    1 
ATOM 575  P P     . DT  B 2 14  ? -12.194 -14.505 -12.245 1.00 218.87 ? 14  DT  C P     1 
ATOM 576  O OP1   . DT  B 2 14  ? -12.922 -14.064 -13.455 1.00 218.71 ? 14  DT  C OP1   1 
ATOM 577  O OP2   . DT  B 2 14  ? -12.917 -15.316 -11.241 1.00 218.22 ? 14  DT  C OP2   1 
ATOM 578  O "O5'" . DT  B 2 14  ? -10.871 -15.322 -12.651 1.00 163.66 ? 14  DT  C "O5'" 1 
ATOM 579  C "C5'" . DT  B 2 14  ? -10.019 -14.933 -13.737 1.00 163.26 ? 14  DT  C "C5'" 1 
ATOM 580  C "C4'" . DT  B 2 14  ? -10.798 -14.846 -15.025 1.00 162.82 ? 14  DT  C "C4'" 1 
ATOM 581  O "O4'" . DT  B 2 14  ? -9.895  -14.664 -16.132 1.00 161.65 ? 14  DT  C "O4'" 1 
ATOM 582  C "C3'" . DT  B 2 14  ? -11.458 -16.164 -15.335 1.00 164.51 ? 14  DT  C "C3'" 1 
ATOM 583  O "O3'" . DT  B 2 14  ? -12.355 -15.946 -16.399 1.00 165.06 ? 14  DT  C "O3'" 1 
ATOM 584  C "C2'" . DT  B 2 14  ? -10.219 -16.974 -15.711 1.00 164.14 ? 14  DT  C "C2'" 1 
ATOM 585  C "C1'" . DT  B 2 14  ? -9.355  -15.937 -16.419 1.00 161.99 ? 14  DT  C "C1'" 1 
ATOM 586  N N1    . DT  B 2 14  ? -7.925  -15.918 -16.026 1.00 159.75 ? 14  DT  C N1    1 
ATOM 587  C C2    . DT  B 2 14  ? -7.132  -15.135 -16.812 1.00 160.83 ? 14  DT  C C2    1 
ATOM 588  O O2    . DT  B 2 14  ? -7.605  -14.522 -17.746 1.00 162.47 ? 14  DT  C O2    1 
ATOM 589  N N3    . DT  B 2 14  ? -5.808  -15.108 -16.464 1.00 159.54 ? 14  DT  C N3    1 
ATOM 590  C C4    . DT  B 2 14  ? -5.217  -15.784 -15.416 1.00 156.86 ? 14  DT  C C4    1 
ATOM 591  O O4    . DT  B 2 14  ? -4.017  -15.697 -15.184 1.00 157.54 ? 14  DT  C O4    1 
ATOM 592  C C5    . DT  B 2 14  ? -6.105  -16.593 -14.621 1.00 154.04 ? 14  DT  C C5    1 
ATOM 593  C C7    . DT  B 2 14  ? -5.535  -17.353 -13.462 1.00 151.24 ? 14  DT  C C7    1 
ATOM 594  C C6    . DT  B 2 14  ? -7.412  -16.629 -14.952 1.00 155.93 ? 14  DT  C C6    1 
ATOM 595  P P     . DA  B 2 15  ? -13.109 -17.182 -17.089 1.00 165.27 ? 15  DA  C P     1 
ATOM 596  O OP1   . DA  B 2 15  ? -14.565 -16.972 -16.939 1.00 163.31 ? 15  DA  C OP1   1 
ATOM 597  O OP2   . DA  B 2 15  ? -12.508 -18.434 -16.574 1.00 165.01 ? 15  DA  C OP2   1 
ATOM 598  O "O5'" . DA  B 2 15  ? -12.726 -17.022 -18.630 1.00 159.06 ? 15  DA  C "O5'" 1 
ATOM 599  C "C5'" . DA  B 2 15  ? -11.438 -16.590 -19.056 1.00 156.80 ? 15  DA  C "C5'" 1 
ATOM 600  C "C4'" . DA  B 2 15  ? -11.221 -17.413 -20.303 1.00 154.03 ? 15  DA  C "C4'" 1 
ATOM 601  O "O4'" . DA  B 2 15  ? -9.819  -17.503 -20.649 1.00 152.67 ? 15  DA  C "O4'" 1 
ATOM 602  C "C3'" . DA  B 2 15  ? -11.755 -18.823 -20.087 1.00 153.35 ? 15  DA  C "C3'" 1 
ATOM 603  O "O3'" . DA  B 2 15  ? -12.690 -19.149 -21.098 1.00 150.65 ? 15  DA  C "O3'" 1 
ATOM 604  C "C2'" . DA  B 2 15  ? -10.534 -19.723 -20.183 1.00 155.06 ? 15  DA  C "C2'" 1 
ATOM 605  C "C1'" . DA  B 2 15  ? -9.355  -18.824 -20.528 1.00 155.09 ? 15  DA  C "C1'" 1 
ATOM 606  N N9    . DA  B 2 15  ? -8.430  -18.872 -19.414 1.00 157.88 ? 15  DA  C N9    1 
ATOM 607  C C8    . DA  B 2 15  ? -8.808  -18.743 -18.112 1.00 157.21 ? 15  DA  C C8    1 
ATOM 608  N N7    . DA  B 2 15  ? -7.806  -18.831 -17.272 1.00 157.83 ? 15  DA  C N7    1 
ATOM 609  C C5    . DA  B 2 15  ? -6.690  -19.046 -18.076 1.00 161.07 ? 15  DA  C C5    1 
ATOM 610  C C6    . DA  B 2 15  ? -5.304  -19.232 -17.814 1.00 164.36 ? 15  DA  C C6    1 
ATOM 611  N N6    . DA  B 2 15  ? -4.755  -19.226 -16.593 1.00 165.25 ? 15  DA  C N6    1 
ATOM 612  N N1    . DA  B 2 15  ? -4.470  -19.426 -18.866 1.00 165.95 ? 15  DA  C N1    1 
ATOM 613  C C2    . DA  B 2 15  ? -4.987  -19.434 -20.099 1.00 165.75 ? 15  DA  C C2    1 
ATOM 614  N N3    . DA  B 2 15  ? -6.257  -19.268 -20.469 1.00 164.43 ? 15  DA  C N3    1 
ATOM 615  C C4    . DA  B 2 15  ? -7.065  -19.080 -19.408 1.00 161.25 ? 15  DA  C C4    1 
ATOM 616  P P     . DT  C 3 1   ? -52.365 27.715  19.591  1.00 100.56 ? 1   DT  E P     1 
ATOM 617  O OP1   . DT  C 3 1   ? -53.637 28.454  19.473  1.00 101.59 ? 1   DT  E OP1   1 
ATOM 618  O OP2   . DT  C 3 1   ? -52.369 26.361  20.178  1.00 97.64  ? 1   DT  E OP2   1 
ATOM 619  O "O5'" . DT  C 3 1   ? -51.666 27.648  18.158  1.00 145.23 ? 1   DT  E "O5'" 1 
ATOM 620  C "C5'" . DT  C 3 1   ? -51.311 26.383  17.643  1.00 143.75 ? 1   DT  E "C5'" 1 
ATOM 621  C "C4'" . DT  C 3 1   ? -52.182 26.050  16.454  1.00 141.53 ? 1   DT  E "C4'" 1 
ATOM 622  O "O4'" . DT  C 3 1   ? -51.369 26.083  15.258  1.00 140.13 ? 1   DT  E "O4'" 1 
ATOM 623  C "C3'" . DT  C 3 1   ? -52.744 24.645  16.501  1.00 141.40 ? 1   DT  E "C3'" 1 
ATOM 624  O "O3'" . DT  C 3 1   ? -53.866 24.571  15.618  1.00 142.41 ? 1   DT  E "O3'" 1 
ATOM 625  C "C2'" . DT  C 3 1   ? -51.523 23.879  16.002  1.00 140.37 ? 1   DT  E "C2'" 1 
ATOM 626  C "C1'" . DT  C 3 1   ? -51.199 24.758  14.801  1.00 139.10 ? 1   DT  E "C1'" 1 
ATOM 627  N N1    . DT  C 3 1   ? -49.845 24.667  14.181  1.00 136.92 ? 1   DT  E N1    1 
ATOM 628  C C2    . DT  C 3 1   ? -48.703 24.380  14.900  1.00 132.89 ? 1   DT  E C2    1 
ATOM 629  O O2    . DT  C 3 1   ? -48.678 24.155  16.097  1.00 130.95 ? 1   DT  E O2    1 
ATOM 630  N N3    . DT  C 3 1   ? -47.563 24.359  14.135  1.00 132.38 ? 1   DT  E N3    1 
ATOM 631  C C4    . DT  C 3 1   ? -47.459 24.592  12.775  1.00 134.12 ? 1   DT  E C4    1 
ATOM 632  O O4    . DT  C 3 1   ? -46.396 24.554  12.176  1.00 134.19 ? 1   DT  E O4    1 
ATOM 633  C C5    . DT  C 3 1   ? -48.685 24.892  12.096  1.00 137.17 ? 1   DT  E C5    1 
ATOM 634  C C7    . DT  C 3 1   ? -48.696 25.169  10.621  1.00 138.76 ? 1   DT  E C7    1 
ATOM 635  C C6    . DT  C 3 1   ? -49.797 24.917  12.828  1.00 137.27 ? 1   DT  E C6    1 
ATOM 636  P P     . DA  C 3 2   ? -55.002 23.451  15.838  1.00 105.73 ? 2   DA  E P     1 
ATOM 637  O OP1   . DA  C 3 2   ? -55.872 23.886  16.950  1.00 105.73 ? 2   DA  E OP1   1 
ATOM 638  O OP2   . DA  C 3 2   ? -54.338 22.133  15.883  1.00 103.99 ? 2   DA  E OP2   1 
ATOM 639  O "O5'" . DA  C 3 2   ? -55.851 23.511  14.492  1.00 137.84 ? 2   DA  E "O5'" 1 
ATOM 640  C "C5'" . DA  C 3 2   ? -55.749 22.398  13.630  1.00 137.47 ? 2   DA  E "C5'" 1 
ATOM 641  C "C4'" . DA  C 3 2   ? -55.599 22.802  12.178  1.00 136.98 ? 2   DA  E "C4'" 1 
ATOM 642  O "O4'" . DA  C 3 2   ? -54.449 23.669  12.052  1.00 138.53 ? 2   DA  E "O4'" 1 
ATOM 643  C "C3'" . DA  C 3 2   ? -55.344 21.623  11.253  1.00 134.87 ? 2   DA  E "C3'" 1 
ATOM 644  O "O3'" . DA  C 3 2   ? -56.530 21.293  10.559  1.00 135.06 ? 2   DA  E "O3'" 1 
ATOM 645  C "C2'" . DA  C 3 2   ? -54.256 22.105  10.304  1.00 134.17 ? 2   DA  E "C2'" 1 
ATOM 646  C "C1'" . DA  C 3 2   ? -53.501 23.088  11.183  1.00 137.78 ? 2   DA  E "C1'" 1 
ATOM 647  N N9    . DA  C 3 2   ? -52.419 22.524  11.987  1.00 141.33 ? 2   DA  E N9    1 
ATOM 648  C C8    . DA  C 3 2   ? -52.447 22.161  13.306  1.00 142.35 ? 2   DA  E C8    1 
ATOM 649  N N7    . DA  C 3 2   ? -51.300 21.701  13.748  1.00 144.22 ? 2   DA  E N7    1 
ATOM 650  C C5    . DA  C 3 2   ? -50.463 21.770  12.645  1.00 146.03 ? 2   DA  E C5    1 
ATOM 651  C C6    . DA  C 3 2   ? -49.107 21.429  12.448  1.00 148.22 ? 2   DA  E C6    1 
ATOM 652  N N6    . DA  C 3 2   ? -48.319 20.927  13.407  1.00 148.96 ? 2   DA  E N6    1 
ATOM 653  N N1    . DA  C 3 2   ? -48.587 21.625  11.217  1.00 148.25 ? 2   DA  E N1    1 
ATOM 654  C C2    . DA  C 3 2   ? -49.371 22.126  10.255  1.00 147.61 ? 2   DA  E C2    1 
ATOM 655  N N3    . DA  C 3 2   ? -50.651 22.486  10.322  1.00 146.74 ? 2   DA  E N3    1 
ATOM 656  C C4    . DA  C 3 2   ? -51.140 22.278  11.554  1.00 144.77 ? 2   DA  E C4    1 
ATOM 657  P P     . DA  C 3 3   ? -57.093 19.791  10.615  1.00 246.95 ? 3   DA  E P     1 
ATOM 658  O OP1   . DA  C 3 3   ? -58.525 19.825  10.244  1.00 246.21 ? 3   DA  E OP1   1 
ATOM 659  O OP2   . DA  C 3 3   ? -56.674 19.199  11.907  1.00 246.51 ? 3   DA  E OP2   1 
ATOM 660  O "O5'" . DA  C 3 3   ? -56.268 19.045  9.468   1.00 187.91 ? 3   DA  E "O5'" 1 
ATOM 661  C "C5'" . DA  C 3 3   ? -55.611 19.812  8.462   1.00 185.86 ? 3   DA  E "C5'" 1 
ATOM 662  C "C4'" . DA  C 3 3   ? -54.231 19.240  8.189   1.00 183.03 ? 3   DA  E "C4'" 1 
ATOM 663  O "O4'" . DA  C 3 3   ? -53.278 19.641  9.215   1.00 181.19 ? 3   DA  E "O4'" 1 
ATOM 664  C "C3'" . DA  C 3 3   ? -54.228 17.717  8.157   1.00 182.00 ? 3   DA  E "C3'" 1 
ATOM 665  O "O3'" . DA  C 3 3   ? -53.630 17.245  6.964   1.00 181.58 ? 3   DA  E "O3'" 1 
ATOM 666  C "C2'" . DA  C 3 3   ? -53.405 17.328  9.379   1.00 180.80 ? 3   DA  E "C2'" 1 
ATOM 667  C "C1'" . DA  C 3 3   ? -52.476 18.524  9.537   1.00 179.00 ? 3   DA  E "C1'" 1 
ATOM 668  N N9    . DA  C 3 3   ? -51.949 18.633  10.896  1.00 175.79 ? 3   DA  E N9    1 
ATOM 669  C C8    . DA  C 3 3   ? -52.647 18.918  12.038  1.00 174.76 ? 3   DA  E C8    1 
ATOM 670  N N7    . DA  C 3 3   ? -51.906 18.937  13.123  1.00 173.46 ? 3   DA  E N7    1 
ATOM 671  C C5    . DA  C 3 3   ? -50.635 18.640  12.660  1.00 172.63 ? 3   DA  E C5    1 
ATOM 672  C C6    . DA  C 3 3   ? -49.396 18.506  13.316  1.00 171.32 ? 3   DA  E C6    1 
ATOM 673  N N6    . DA  C 3 3   ? -49.239 18.670  14.634  1.00 170.94 ? 3   DA  E N6    1 
ATOM 674  N N1    . DA  C 3 3   ? -48.322 18.208  12.558  1.00 171.08 ? 3   DA  E N1    1 
ATOM 675  C C2    . DA  C 3 3   ? -48.486 18.049  11.239  1.00 170.79 ? 3   DA  E C2    1 
ATOM 676  N N3    . DA  C 3 3   ? -49.597 18.147  10.511  1.00 171.24 ? 3   DA  E N3    1 
ATOM 677  C C4    . DA  C 3 3   ? -50.644 18.447  11.291  1.00 172.73 ? 3   DA  E C4    1 
ATOM 678  P P     . DT  C 3 4   ? -54.320 16.054  6.135   1.00 187.90 ? 4   DT  E P     1 
ATOM 679  O OP1   . DT  C 3 4   ? -55.255 16.658  5.162   1.00 186.74 ? 4   DT  E OP1   1 
ATOM 680  O OP2   . DT  C 3 4   ? -54.829 15.058  7.105   1.00 188.82 ? 4   DT  E OP2   1 
ATOM 681  O "O5'" . DT  C 3 4   ? -53.095 15.390  5.356   1.00 175.24 ? 4   DT  E "O5'" 1 
ATOM 682  C "C5'" . DT  C 3 4   ? -51.850 16.086  5.289   1.00 173.66 ? 4   DT  E "C5'" 1 
ATOM 683  C "C4'" . DT  C 3 4   ? -50.713 15.285  5.914   1.00 172.33 ? 4   DT  E "C4'" 1 
ATOM 684  O "O4'" . DT  C 3 4   ? -50.492 15.678  7.294   1.00 169.65 ? 4   DT  E "O4'" 1 
ATOM 685  C "C3'" . DT  C 3 4   ? -50.869 13.761  5.917   1.00 171.17 ? 4   DT  E "C3'" 1 
ATOM 686  O "O3'" . DT  C 3 4   ? -49.757 13.183  5.238   1.00 172.57 ? 4   DT  E "O3'" 1 
ATOM 687  C "C2'" . DT  C 3 4   ? -50.873 13.388  7.400   1.00 170.08 ? 4   DT  E "C2'" 1 
ATOM 688  C "C1'" . DT  C 3 4   ? -50.061 14.532  7.996   1.00 169.10 ? 4   DT  E "C1'" 1 
ATOM 689  N N1    . DT  C 3 4   ? -50.299 14.729  9.446   1.00 168.68 ? 4   DT  E N1    1 
ATOM 690  C C2    . DT  C 3 4   ? -49.230 14.992  10.276  1.00 167.86 ? 4   DT  E C2    1 
ATOM 691  O O2    . DT  C 3 4   ? -48.076 15.080  9.891   1.00 166.10 ? 4   DT  E O2    1 
ATOM 692  N N3    . DT  C 3 4   ? -49.579 15.153  11.593  1.00 168.97 ? 4   DT  E N3    1 
ATOM 693  C C4    . DT  C 3 4   ? -50.849 15.077  12.147  1.00 169.06 ? 4   DT  E C4    1 
ATOM 694  O O4    . DT  C 3 4   ? -51.047 15.239  13.348  1.00 169.98 ? 4   DT  E O4    1 
ATOM 695  C C5    . DT  C 3 4   ? -51.917 14.796  11.220  1.00 167.65 ? 4   DT  E C5    1 
ATOM 696  C C7    . DT  C 3 4   ? -53.338 14.689  11.695  1.00 165.57 ? 4   DT  E C7    1 
ATOM 697  C C6    . DT  C 3 4   ? -51.590 14.636  9.932   1.00 168.18 ? 4   DT  E C6    1 
ATOM 698  P P     . DT  C 3 5   ? -49.727 11.609  4.910   1.00 112.94 ? 5   DT  E P     1 
ATOM 699  O OP1   . DT  C 3 5   ? -49.444 11.450  3.467   1.00 112.58 ? 5   DT  E OP1   1 
ATOM 700  O OP2   . DT  C 3 5   ? -50.950 10.999  5.479   1.00 110.74 ? 5   DT  E OP2   1 
ATOM 701  O "O5'" . DT  C 3 5   ? -48.459 11.084  5.739   1.00 146.36 ? 5   DT  E "O5'" 1 
ATOM 702  C "C5'" . DT  C 3 5   ? -47.179 11.706  5.568   1.00 145.96 ? 5   DT  E "C5'" 1 
ATOM 703  C "C4'" . DT  C 3 5   ? -46.306 11.579  6.810   1.00 147.30 ? 5   DT  E "C4'" 1 
ATOM 704  O "O4'" . DT  C 3 5   ? -47.032 12.024  7.986   1.00 147.07 ? 5   DT  E "O4'" 1 
ATOM 705  C "C3'" . DT  C 3 5   ? -45.803 10.167  7.139   1.00 149.79 ? 5   DT  E "C3'" 1 
ATOM 706  O "O3'" . DT  C 3 5   ? -44.387 10.083  6.869   1.00 152.09 ? 5   DT  E "O3'" 1 
ATOM 707  C "C2'" . DT  C 3 5   ? -46.150 9.956   8.619   1.00 148.58 ? 5   DT  E "C2'" 1 
ATOM 708  C "C1'" . DT  C 3 5   ? -46.468 11.369  9.104   1.00 145.78 ? 5   DT  E "C1'" 1 
ATOM 709  N N1    . DT  C 3 5   ? -47.402 11.439  10.286  1.00 141.04 ? 5   DT  E N1    1 
ATOM 710  C C2    . DT  C 3 5   ? -46.870 11.622  11.549  1.00 135.41 ? 5   DT  E C2    1 
ATOM 711  O O2    . DT  C 3 5   ? -45.677 11.730  11.777  1.00 130.64 ? 5   DT  E O2    1 
ATOM 712  N N3    . DT  C 3 5   ? -47.801 11.676  12.555  1.00 136.22 ? 5   DT  E N3    1 
ATOM 713  C C4    . DT  C 3 5   ? -49.177 11.570  12.451  1.00 137.17 ? 5   DT  E C4    1 
ATOM 714  O O4    . DT  C 3 5   ? -49.905 11.639  13.446  1.00 136.37 ? 5   DT  E O4    1 
ATOM 715  C C5    . DT  C 3 5   ? -49.670 11.378  11.102  1.00 138.77 ? 5   DT  E C5    1 
ATOM 716  C C7    . DT  C 3 5   ? -51.142 11.245  10.835  1.00 138.11 ? 5   DT  E C7    1 
ATOM 717  C C6    . DT  C 3 5   ? -48.770 11.324  10.104  1.00 140.04 ? 5   DT  E C6    1 
ATOM 718  P P     . DT  C 3 6   ? -43.496 8.917   7.532   1.00 136.96 ? 6   DT  E P     1 
ATOM 719  O OP1   . DT  C 3 6   ? -42.297 8.724   6.686   1.00 135.82 ? 6   DT  E OP1   1 
ATOM 720  O OP2   . DT  C 3 6   ? -44.388 7.767   7.810   1.00 134.74 ? 6   DT  E OP2   1 
ATOM 721  O "O5'" . DT  C 3 6   ? -42.999 9.566   8.913   1.00 143.91 ? 6   DT  E "O5'" 1 
ATOM 722  C "C5'" . DT  C 3 6   ? -41.861 9.063   9.602   1.00 141.54 ? 6   DT  E "C5'" 1 
ATOM 723  C "C4'" . DT  C 3 6   ? -42.142 9.007   11.089  1.00 139.35 ? 6   DT  E "C4'" 1 
ATOM 724  O "O4'" . DT  C 3 6   ? -43.533 9.326   11.359  1.00 141.01 ? 6   DT  E "O4'" 1 
ATOM 725  C "C3'" . DT  C 3 6   ? -41.918 7.621   11.675  1.00 136.77 ? 6   DT  E "C3'" 1 
ATOM 726  O "O3'" . DT  C 3 6   ? -40.816 7.633   12.563  1.00 135.50 ? 6   DT  E "O3'" 1 
ATOM 727  C "C2'" . DT  C 3 6   ? -43.225 7.290   12.389  1.00 137.83 ? 6   DT  E "C2'" 1 
ATOM 728  C "C1'" . DT  C 3 6   ? -43.883 8.654   12.550  1.00 140.61 ? 6   DT  E "C1'" 1 
ATOM 729  N N1    . DT  C 3 6   ? -45.377 8.567   12.749  1.00 141.99 ? 6   DT  E N1    1 
ATOM 730  C C2    . DT  C 3 6   ? -45.928 8.977   13.950  1.00 141.95 ? 6   DT  E C2    1 
ATOM 731  O O2    . DT  C 3 6   ? -45.276 9.428   14.875  1.00 141.89 ? 6   DT  E O2    1 
ATOM 732  N N3    . DT  C 3 6   ? -47.292 8.843   14.032  1.00 141.17 ? 6   DT  E N3    1 
ATOM 733  C C4    . DT  C 3 6   ? -48.143 8.350   13.061  1.00 139.70 ? 6   DT  E C4    1 
ATOM 734  O O4    . DT  C 3 6   ? -49.356 8.269   13.222  1.00 139.80 ? 6   DT  E O4    1 
ATOM 735  C C5    . DT  C 3 6   ? -47.505 7.939   11.840  1.00 139.18 ? 6   DT  E C5    1 
ATOM 736  C C7    . DT  C 3 6   ? -48.332 7.392   10.720  1.00 138.83 ? 6   DT  E C7    1 
ATOM 737  C C6    . DT  C 3 6   ? -46.176 8.058   11.743  1.00 140.03 ? 6   DT  E C6    1 
ATOM 738  P P     . DA  C 3 7   ? -39.728 6.457   12.501  1.00 118.62 ? 7   DA  E P     1 
ATOM 739  O OP1   . DA  C 3 7   ? -38.442 7.042   12.058  1.00 114.81 ? 7   DA  E OP1   1 
ATOM 740  O OP2   . DA  C 3 7   ? -40.321 5.340   11.741  1.00 122.55 ? 7   DA  E OP2   1 
ATOM 741  O "O5'" . DA  C 3 7   ? -39.616 5.966   14.019  1.00 101.07 ? 7   DA  E "O5'" 1 
ATOM 742  C "C5'" . DA  C 3 7   ? -39.373 6.873   15.076  1.00 100.31 ? 7   DA  E "C5'" 1 
ATOM 743  C "C4'" . DA  C 3 7   ? -40.526 6.849   16.060  1.00 99.76  ? 7   DA  E "C4'" 1 
ATOM 744  O "O4'" . DA  C 3 7   ? -41.795 6.819   15.375  1.00 98.64  ? 7   DA  E "O4'" 1 
ATOM 745  C "C3'" . DA  C 3 7   ? -40.616 5.618   16.947  1.00 101.99 ? 7   DA  E "C3'" 1 
ATOM 746  O "O3'" . DA  C 3 7   ? -39.746 5.785   18.056  1.00 105.14 ? 7   DA  E "O3'" 1 
ATOM 747  C "C2'" . DA  C 3 7   ? -42.093 5.581   17.355  1.00 100.68 ? 7   DA  E "C2'" 1 
ATOM 748  C "C1'" . DA  C 3 7   ? -42.725 6.606   16.413  1.00 100.41 ? 7   DA  E "C1'" 1 
ATOM 749  N N9    . DA  C 3 7   ? -44.027 6.243   15.861  1.00 102.90 ? 7   DA  E N9    1 
ATOM 750  C C8    . DA  C 3 7   ? -44.350 5.966   14.565  1.00 102.52 ? 7   DA  E C8    1 
ATOM 751  N N7    . DA  C 3 7   ? -45.617 5.687   14.374  1.00 104.63 ? 7   DA  E N7    1 
ATOM 752  C C5    . DA  C 3 7   ? -46.170 5.782   15.641  1.00 109.08 ? 7   DA  E C5    1 
ATOM 753  C C6    . DA  C 3 7   ? -47.483 5.598   16.134  1.00 114.09 ? 7   DA  E C6    1 
ATOM 754  N N6    . DA  C 3 7   ? -48.547 5.265   15.383  1.00 114.08 ? 7   DA  E N6    1 
ATOM 755  N N1    . DA  C 3 7   ? -47.669 5.776   17.460  1.00 116.34 ? 7   DA  E N1    1 
ATOM 756  C C2    . DA  C 3 7   ? -46.625 6.109   18.231  1.00 115.35 ? 7   DA  E C2    1 
ATOM 757  N N3    . DA  C 3 7   ? -45.355 6.310   17.883  1.00 112.09 ? 7   DA  E N3    1 
ATOM 758  C C4    . DA  C 3 7   ? -45.197 6.128   16.564  1.00 108.02 ? 7   DA  E C4    1 
ATOM 759  P P     . DT  C 3 8   ? -39.325 4.519   18.951  1.00 134.81 ? 8   DT  E P     1 
ATOM 760  O OP1   . DT  C 3 8   ? -38.122 4.888   19.728  1.00 133.80 ? 8   DT  E OP1   1 
ATOM 761  O OP2   . DT  C 3 8   ? -39.274 3.334   18.068  1.00 136.09 ? 8   DT  E OP2   1 
ATOM 762  O "O5'" . DT  C 3 8   ? -40.551 4.359   19.959  1.00 119.31 ? 8   DT  E "O5'" 1 
ATOM 763  C "C5'" . DT  C 3 8   ? -40.805 5.434   20.843  1.00 121.82 ? 8   DT  E "C5'" 1 
ATOM 764  C "C4'" . DT  C 3 8   ? -42.122 5.230   21.552  1.00 124.63 ? 8   DT  E "C4'" 1 
ATOM 765  O "O4'" . DT  C 3 8   ? -43.158 5.068   20.557  1.00 124.30 ? 8   DT  E "O4'" 1 
ATOM 766  C "C3'" . DT  C 3 8   ? -42.165 3.973   22.414  1.00 128.16 ? 8   DT  E "C3'" 1 
ATOM 767  O "O3'" . DT  C 3 8   ? -42.584 4.277   23.738  1.00 129.21 ? 8   DT  E "O3'" 1 
ATOM 768  C "C2'" . DT  C 3 8   ? -43.181 3.085   21.705  1.00 128.55 ? 8   DT  E "C2'" 1 
ATOM 769  C "C1'" . DT  C 3 8   ? -44.073 4.160   21.107  1.00 126.79 ? 8   DT  E "C1'" 1 
ATOM 770  N N1    . DT  C 3 8   ? -44.985 3.681   20.050  1.00 127.56 ? 8   DT  E N1    1 
ATOM 771  C C2    . DT  C 3 8   ? -46.329 3.696   20.320  1.00 128.73 ? 8   DT  E C2    1 
ATOM 772  O O2    . DT  C 3 8   ? -46.809 4.082   21.370  1.00 130.88 ? 8   DT  E O2    1 
ATOM 773  N N3    . DT  C 3 8   ? -47.099 3.235   19.298  1.00 127.18 ? 8   DT  E N3    1 
ATOM 774  C C4    . DT  C 3 8   ? -46.698 2.772   18.063  1.00 127.34 ? 8   DT  E C4    1 
ATOM 775  O O4    . DT  C 3 8   ? -47.500 2.383   17.217  1.00 128.29 ? 8   DT  E O4    1 
ATOM 776  C C5    . DT  C 3 8   ? -45.276 2.781   17.846  1.00 126.79 ? 8   DT  E C5    1 
ATOM 777  C C7    . DT  C 3 8   ? -44.716 2.297   16.539  1.00 126.15 ? 8   DT  E C7    1 
ATOM 778  C C6    . DT  C 3 8   ? -44.494 3.231   18.840  1.00 127.10 ? 8   DT  E C6    1 
ATOM 779  P P     . DA  C 3 9   ? -42.524 3.146   24.879  1.00 154.52 ? 9   DA  E P     1 
ATOM 780  O OP1   . DA  C 3 9   ? -42.270 3.818   26.173  1.00 153.99 ? 9   DA  E OP1   1 
ATOM 781  O OP2   . DA  C 3 9   ? -41.622 2.070   24.407  1.00 153.46 ? 9   DA  E OP2   1 
ATOM 782  O "O5'" . DA  C 3 9   ? -44.006 2.545   24.888  1.00 150.79 ? 9   DA  E "O5'" 1 
ATOM 783  C "C5'" . DA  C 3 9   ? -45.110 3.440   24.878  1.00 148.87 ? 9   DA  E "C5'" 1 
ATOM 784  C "C4'" . DA  C 3 9   ? -46.232 2.963   25.784  1.00 146.05 ? 9   DA  E "C4'" 1 
ATOM 785  O "O4'" . DA  C 3 9   ? -47.391 2.585   25.004  1.00 144.11 ? 9   DA  E "O4'" 1 
ATOM 786  C "C3'" . DA  C 3 9   ? -45.948 1.751   26.659  1.00 143.94 ? 9   DA  E "C3'" 1 
ATOM 787  O "O3'" . DA  C 3 9   ? -46.718 1.938   27.844  1.00 144.37 ? 9   DA  E "O3'" 1 
ATOM 788  C "C2'" . DA  C 3 9   ? -46.405 0.574   25.799  1.00 141.35 ? 9   DA  E "C2'" 1 
ATOM 789  C "C1'" . DA  C 3 9   ? -47.430 1.181   24.843  1.00 140.83 ? 9   DA  E "C1'" 1 
ATOM 790  N N9    . DA  C 3 9   ? -47.185 0.896   23.430  1.00 138.22 ? 9   DA  E N9    1 
ATOM 791  C C8    . DA  C 3 9   ? -45.981 0.834   22.786  1.00 136.27 ? 9   DA  E C8    1 
ATOM 792  N N7    . DA  C 3 9   ? -46.080 0.565   21.503  1.00 135.98 ? 9   DA  E N7    1 
ATOM 793  C C5    . DA  C 3 9   ? -47.444 0.446   21.288  1.00 137.72 ? 9   DA  E C5    1 
ATOM 794  C C6    . DA  C 3 9   ? -48.216 0.167   20.137  1.00 139.17 ? 9   DA  E C6    1 
ATOM 795  N N6    . DA  C 3 9   ? -47.713 -0.055  18.916  1.00 139.41 ? 9   DA  E N6    1 
ATOM 796  N N1    . DA  C 3 9   ? -49.554 0.123   20.285  1.00 139.88 ? 9   DA  E N1    1 
ATOM 797  C C2    . DA  C 3 9   ? -50.084 0.341   21.492  1.00 139.78 ? 9   DA  E C2    1 
ATOM 798  N N3    . DA  C 3 9   ? -49.467 0.609   22.640  1.00 139.26 ? 9   DA  E N3    1 
ATOM 799  C C4    . DA  C 3 9   ? -48.137 0.649   22.468  1.00 138.43 ? 9   DA  E C4    1 
ATOM 800  P P     . DA  C 3 10  ? -47.213 0.678   28.704  1.00 96.67  ? 10  DA  E P     1 
ATOM 801  O OP1   . DA  C 3 10  ? -47.547 1.158   30.064  1.00 94.05  ? 10  DA  E OP1   1 
ATOM 802  O OP2   . DA  C 3 10  ? -46.215 -0.401  28.547  1.00 98.66  ? 10  DA  E OP2   1 
ATOM 803  O "O5'" . DA  C 3 10  ? -48.560 0.237   27.972  1.00 129.83 ? 10  DA  E "O5'" 1 
ATOM 804  C "C5'" . DA  C 3 10  ? -49.002 -1.098  28.146  1.00 130.36 ? 10  DA  E "C5'" 1 
ATOM 805  C "C4'" . DA  C 3 10  ? -50.499 -1.210  27.954  1.00 129.79 ? 10  DA  E "C4'" 1 
ATOM 806  O "O4'" . DA  C 3 10  ? -50.795 -1.144  26.540  1.00 130.10 ? 10  DA  E "O4'" 1 
ATOM 807  C "C3'" . DA  C 3 10  ? -51.107 -2.537  28.365  1.00 127.17 ? 10  DA  E "C3'" 1 
ATOM 808  O "O3'" . DA  C 3 10  ? -52.516 -2.374  28.343  1.00 125.52 ? 10  DA  E "O3'" 1 
ATOM 809  C "C2'" . DA  C 3 10  ? -50.602 -3.398  27.219  1.00 127.88 ? 10  DA  E "C2'" 1 
ATOM 810  C "C1'" . DA  C 3 10  ? -50.876 -2.465  26.043  1.00 129.83 ? 10  DA  E "C1'" 1 
ATOM 811  N N9    . DA  C 3 10  ? -49.923 -2.587  24.947  1.00 129.49 ? 10  DA  E N9    1 
ATOM 812  C C8    . DA  C 3 10  ? -48.560 -2.665  25.021  1.00 128.06 ? 10  DA  E C8    1 
ATOM 813  N N7    . DA  C 3 10  ? -47.978 -2.766  23.848  1.00 125.97 ? 10  DA  E N7    1 
ATOM 814  C C5    . DA  C 3 10  ? -49.034 -2.748  22.952  1.00 125.78 ? 10  DA  E C5    1 
ATOM 815  C C6    . DA  C 3 10  ? -49.097 -2.821  21.549  1.00 124.96 ? 10  DA  E C6    1 
ATOM 816  N N6    . DA  C 3 10  ? -48.018 -2.931  20.769  1.00 125.72 ? 10  DA  E N6    1 
ATOM 817  N N1    . DA  C 3 10  ? -50.317 -2.775  20.976  1.00 124.25 ? 10  DA  E N1    1 
ATOM 818  C C2    . DA  C 3 10  ? -51.402 -2.666  21.749  1.00 124.37 ? 10  DA  E C2    1 
ATOM 819  N N3    . DA  C 3 10  ? -51.469 -2.589  23.074  1.00 125.66 ? 10  DA  E N3    1 
ATOM 820  C C4    . DA  C 3 10  ? -50.240 -2.636  23.614  1.00 127.25 ? 10  DA  E C4    1 
ATOM 821  P P     . DA  C 3 11  ? -53.481 -3.634  28.102  1.00 135.93 ? 11  DA  E P     1 
ATOM 822  O OP1   . DA  C 3 11  ? -54.700 -3.434  28.916  1.00 137.14 ? 11  DA  E OP1   1 
ATOM 823  O OP2   . DA  C 3 11  ? -52.678 -4.861  28.268  1.00 136.15 ? 11  DA  E OP2   1 
ATOM 824  O "O5'" . DA  C 3 11  ? -53.881 -3.520  26.554  1.00 144.05 ? 11  DA  E "O5'" 1 
ATOM 825  C "C5'" . DA  C 3 11  ? -55.248 -3.683  26.150  1.00 143.81 ? 11  DA  E "C5'" 1 
ATOM 826  C "C4'" . DA  C 3 11  ? -55.385 -4.637  24.977  1.00 143.53 ? 11  DA  E "C4'" 1 
ATOM 827  O "O4'" . DA  C 3 11  ? -54.346 -4.345  24.006  1.00 142.67 ? 11  DA  E "O4'" 1 
ATOM 828  C "C3'" . DA  C 3 11  ? -55.205 -6.112  25.322  1.00 143.02 ? 11  DA  E "C3'" 1 
ATOM 829  O "O3'" . DA  C 3 11  ? -56.433 -6.744  25.775  1.00 143.67 ? 11  DA  E "O3'" 1 
ATOM 830  C "C2'" . DA  C 3 11  ? -54.656 -6.707  24.027  1.00 141.88 ? 11  DA  E "C2'" 1 
ATOM 831  C "C1'" . DA  C 3 11  ? -53.927 -5.538  23.369  1.00 140.86 ? 11  DA  E "C1'" 1 
ATOM 832  N N9    . DA  C 3 11  ? -52.479 -5.668  23.472  1.00 137.71 ? 11  DA  E N9    1 
ATOM 833  C C8    . DA  C 3 11  ? -51.707 -5.501  24.585  1.00 136.66 ? 11  DA  E C8    1 
ATOM 834  N N7    . DA  C 3 11  ? -50.426 -5.692  24.371  1.00 136.90 ? 11  DA  E N7    1 
ATOM 835  C C5    . DA  C 3 11  ? -50.356 -6.011  23.024  1.00 137.69 ? 11  DA  E C5    1 
ATOM 836  C C6    . DA  C 3 11  ? -49.276 -6.326  22.173  1.00 138.80 ? 11  DA  E C6    1 
ATOM 837  N N6    . DA  C 3 11  ? -48.000 -6.375  22.575  1.00 138.94 ? 11  DA  E N6    1 
ATOM 838  N N1    . DA  C 3 11  ? -49.564 -6.592  20.882  1.00 138.74 ? 11  DA  E N1    1 
ATOM 839  C C2    . DA  C 3 11  ? -50.840 -6.540  20.477  1.00 137.84 ? 11  DA  E C2    1 
ATOM 840  N N3    . DA  C 3 11  ? -51.936 -6.262  21.179  1.00 136.77 ? 11  DA  E N3    1 
ATOM 841  C C4    . DA  C 3 11  ? -51.617 -6.002  22.457  1.00 137.20 ? 11  DA  E C4    1 
ATOM 842  P P     . DA  C 3 12  ? -57.728 -6.826  24.814  1.00 198.45 ? 12  DA  E P     1 
ATOM 843  O OP1   . DA  C 3 12  ? -58.179 -5.445  24.531  1.00 198.06 ? 12  DA  E OP1   1 
ATOM 844  O OP2   . DA  C 3 12  ? -58.672 -7.802  25.403  1.00 197.98 ? 12  DA  E OP2   1 
ATOM 845  O "O5'" . DA  C 3 12  ? -57.171 -7.482  23.468  1.00 162.79 ? 12  DA  E "O5'" 1 
ATOM 846  C "C5'" . DA  C 3 12  ? -57.481 -6.850  22.232  1.00 163.79 ? 12  DA  E "C5'" 1 
ATOM 847  C "C4'" . DA  C 3 12  ? -57.277 -7.785  21.054  1.00 164.66 ? 12  DA  E "C4'" 1 
ATOM 848  O "O4'" . DA  C 3 12  ? -55.867 -8.056  20.847  1.00 165.80 ? 12  DA  E "O4'" 1 
ATOM 849  C "C3'" . DA  C 3 12  ? -57.926 -9.153  21.181  1.00 163.77 ? 12  DA  E "C3'" 1 
ATOM 850  O "O3'" . DA  C 3 12  ? -58.189 -9.592  19.870  1.00 162.56 ? 12  DA  E "O3'" 1 
ATOM 851  C "C2'" . DA  C 3 12  ? -56.807 -9.966  21.821  1.00 164.11 ? 12  DA  E "C2'" 1 
ATOM 852  C "C1'" . DA  C 3 12  ? -55.623 -9.438  21.021  1.00 165.74 ? 12  DA  E "C1'" 1 
ATOM 853  N N9    . DA  C 3 12  ? -54.317 -9.565  21.654  1.00 167.67 ? 12  DA  E N9    1 
ATOM 854  C C8    . DA  C 3 12  ? -54.017 -9.767  22.972  1.00 167.75 ? 12  DA  E C8    1 
ATOM 855  N N7    . DA  C 3 12  ? -52.728 -9.825  23.215  1.00 167.33 ? 12  DA  E N7    1 
ATOM 856  C C5    . DA  C 3 12  ? -52.150 -9.644  21.970  1.00 167.51 ? 12  DA  E C5    1 
ATOM 857  C C6    . DA  C 3 12  ? -50.815 -9.599  21.535  1.00 166.30 ? 12  DA  E C6    1 
ATOM 858  N N6    . DA  C 3 12  ? -49.756 -9.740  22.341  1.00 164.49 ? 12  DA  E N6    1 
ATOM 859  N N1    . DA  C 3 12  ? -50.608 -9.402  20.220  1.00 167.79 ? 12  DA  E N1    1 
ATOM 860  C C2    . DA  C 3 12  ? -51.648 -9.259  19.394  1.00 168.87 ? 12  DA  E C2    1 
ATOM 861  N N3    . DA  C 3 12  ? -52.941 -9.281  19.687  1.00 169.62 ? 12  DA  E N3    1 
ATOM 862  C C4    . DA  C 3 12  ? -53.117 -9.480  21.001  1.00 168.39 ? 12  DA  E C4    1 
ATOM 863  P P     . DT  C 3 13  ? -59.328 -10.684 19.595  1.00 140.39 ? 13  DT  E P     1 
ATOM 864  O OP1   . DT  C 3 13  ? -60.558 -9.969  19.193  1.00 140.64 ? 13  DT  E OP1   1 
ATOM 865  O OP2   . DT  C 3 13  ? -59.357 -11.610 20.746  1.00 141.31 ? 13  DT  E OP2   1 
ATOM 866  O "O5'" . DT  C 3 13  ? -58.764 -11.481 18.339  1.00 139.85 ? 13  DT  E "O5'" 1 
ATOM 867  C "C5'" . DT  C 3 13  ? -57.356 -11.607 18.253  1.00 138.82 ? 13  DT  E "C5'" 1 
ATOM 868  C "C4'" . DT  C 3 13  ? -56.937 -11.936 16.841  1.00 138.66 ? 13  DT  E "C4'" 1 
ATOM 869  O "O4'" . DT  C 3 13  ? -55.504 -12.105 16.821  1.00 140.30 ? 13  DT  E "O4'" 1 
ATOM 870  C "C3'" . DT  C 3 13  ? -57.452 -13.270 16.346  1.00 138.06 ? 13  DT  E "C3'" 1 
ATOM 871  O "O3'" . DT  C 3 13  ? -57.266 -13.381 14.953  1.00 136.10 ? 13  DT  E "O3'" 1 
ATOM 872  C "C2'" . DT  C 3 13  ? -56.529 -14.224 17.091  1.00 140.82 ? 13  DT  E "C2'" 1 
ATOM 873  C "C1'" . DT  C 3 13  ? -55.211 -13.455 17.115  1.00 142.35 ? 13  DT  E "C1'" 1 
ATOM 874  N N1    . DT  C 3 13  ? -54.511 -13.526 18.431  1.00 145.57 ? 13  DT  E N1    1 
ATOM 875  C C2    . DT  C 3 13  ? -53.329 -12.843 18.592  1.00 145.84 ? 13  DT  E C2    1 
ATOM 876  O O2    . DT  C 3 13  ? -52.822 -12.172 17.713  1.00 146.47 ? 13  DT  E O2    1 
ATOM 877  N N3    . DT  C 3 13  ? -52.757 -12.970 19.827  1.00 145.38 ? 13  DT  E N3    1 
ATOM 878  C C4    . DT  C 3 13  ? -53.232 -13.699 20.896  1.00 145.82 ? 13  DT  E C4    1 
ATOM 879  O O4    . DT  C 3 13  ? -52.630 -13.747 21.964  1.00 147.24 ? 13  DT  E O4    1 
ATOM 880  C C5    . DT  C 3 13  ? -54.473 -14.393 20.665  1.00 145.06 ? 13  DT  E C5    1 
ATOM 881  C C7    . DT  C 3 13  ? -55.083 -15.215 21.761  1.00 143.19 ? 13  DT  E C7    1 
ATOM 882  C C6    . DT  C 3 13  ? -55.048 -14.274 19.459  1.00 145.63 ? 13  DT  E C6    1 
ATOM 883  P P     . DT  C 3 14  ? -58.042 -14.518 14.133  1.00 109.15 ? 14  DT  E P     1 
ATOM 884  O OP1   . DT  C 3 14  ? -59.071 -13.858 13.300  1.00 105.59 ? 14  DT  E OP1   1 
ATOM 885  O OP2   . DT  C 3 14  ? -58.468 -15.553 15.098  1.00 112.10 ? 14  DT  E OP2   1 
ATOM 886  O "O5'" . DT  C 3 14  ? -56.895 -15.185 13.230  1.00 109.66 ? 14  DT  E "O5'" 1 
ATOM 887  C "C5'" . DT  C 3 14  ? -55.836 -14.448 12.647  1.00 111.21 ? 14  DT  E "C5'" 1 
ATOM 888  C "C4'" . DT  C 3 14  ? -54.536 -15.233 12.687  1.00 116.50 ? 14  DT  E "C4'" 1 
ATOM 889  O "O4'" . DT  C 3 14  ? -53.911 -14.957 13.961  1.00 119.98 ? 14  DT  E "O4'" 1 
ATOM 890  C "C3'" . DT  C 3 14  ? -54.639 -16.763 12.601  1.00 118.77 ? 14  DT  E "C3'" 1 
ATOM 891  O "O3'" . DT  C 3 14  ? -54.403 -17.285 11.280  1.00 115.14 ? 14  DT  E "O3'" 1 
ATOM 892  C "C2'" . DT  C 3 14  ? -53.551 -17.268 13.550  1.00 123.51 ? 14  DT  E "C2'" 1 
ATOM 893  C "C1'" . DT  C 3 14  ? -53.034 -16.019 14.266  1.00 126.33 ? 14  DT  E "C1'" 1 
ATOM 894  N N1    . DT  C 3 14  ? -52.982 -16.198 15.741  1.00 133.88 ? 14  DT  E N1    1 
ATOM 895  C C2    . DT  C 3 14  ? -51.800 -15.972 16.414  1.00 137.20 ? 14  DT  E C2    1 
ATOM 896  O O2    . DT  C 3 14  ? -50.776 -15.611 15.860  1.00 137.93 ? 14  DT  E O2    1 
ATOM 897  N N3    . DT  C 3 14  ? -51.869 -16.181 17.769  1.00 138.93 ? 14  DT  E N3    1 
ATOM 898  C C4    . DT  C 3 14  ? -52.983 -16.585 18.489  1.00 139.45 ? 14  DT  E C4    1 
ATOM 899  O O4    . DT  C 3 14  ? -52.959 -16.745 19.704  1.00 139.80 ? 14  DT  E O4    1 
ATOM 900  C C5    . DT  C 3 14  ? -54.180 -16.808 17.718  1.00 139.57 ? 14  DT  E C5    1 
ATOM 901  C C7    . DT  C 3 14  ? -55.448 -17.252 18.390  1.00 141.25 ? 14  DT  E C7    1 
ATOM 902  C C6    . DT  C 3 14  ? -54.121 -16.609 16.399  1.00 136.84 ? 14  DT  E C6    1 
ATOM 903  P P     . DA  D 4 1   ? -56.429 -29.029 23.125  1.00 219.75 ? 0   DA  F P     1 
ATOM 904  O OP1   . DA  D 4 1   ? -57.576 -29.923 23.411  1.00 219.22 ? 0   DA  F OP1   1 
ATOM 905  O OP2   . DA  D 4 1   ? -56.587 -27.555 23.185  1.00 218.52 ? 0   DA  F OP2   1 
ATOM 906  O "O5'" . DA  D 4 1   ? -55.194 -29.469 24.052  1.00 167.74 ? 0   DA  F "O5'" 1 
ATOM 907  C "C5'" . DA  D 4 1   ? -53.931 -29.841 23.475  1.00 165.24 ? 0   DA  F "C5'" 1 
ATOM 908  C "C4'" . DA  D 4 1   ? -52.989 -28.662 23.611  1.00 161.96 ? 0   DA  F "C4'" 1 
ATOM 909  O "O4'" . DA  D 4 1   ? -52.195 -28.490 22.408  1.00 159.26 ? 0   DA  F "O4'" 1 
ATOM 910  C "C3'" . DA  D 4 1   ? -53.795 -27.384 23.803  1.00 162.32 ? 0   DA  F "C3'" 1 
ATOM 911  O "O3'" . DA  D 4 1   ? -54.030 -27.117 25.242  1.00 163.77 ? 0   DA  F "O3'" 1 
ATOM 912  C "C2'" . DA  D 4 1   ? -53.114 -26.339 22.909  1.00 160.54 ? 0   DA  F "C2'" 1 
ATOM 913  C "C1'" . DA  D 4 1   ? -52.238 -27.151 21.943  1.00 158.31 ? 0   DA  F "C1'" 1 
ATOM 914  N N9    . DA  D 4 1   ? -52.636 -27.156 20.525  1.00 156.41 ? 0   DA  F N9    1 
ATOM 915  C C8    . DA  D 4 1   ? -53.842 -27.536 20.005  1.00 154.61 ? 0   DA  F C8    1 
ATOM 916  N N7    . DA  D 4 1   ? -53.919 -27.449 18.697  1.00 155.15 ? 0   DA  F N7    1 
ATOM 917  C C5    . DA  D 4 1   ? -52.675 -26.980 18.315  1.00 157.23 ? 0   DA  F C5    1 
ATOM 918  C C6    . DA  D 4 1   ? -52.123 -26.674 17.049  1.00 158.08 ? 0   DA  F C6    1 
ATOM 919  N N6    . DA  D 4 1   ? -52.789 -26.805 15.893  1.00 157.83 ? 0   DA  F N6    1 
ATOM 920  N N1    . DA  D 4 1   ? -50.849 -26.227 17.020  1.00 158.97 ? 0   DA  F N1    1 
ATOM 921  C C2    . DA  D 4 1   ? -50.191 -26.097 18.179  1.00 159.11 ? 0   DA  F C2    1 
ATOM 922  N N3    . DA  D 4 1   ? -50.602 -26.350 19.422  1.00 159.03 ? 0   DA  F N3    1 
ATOM 923  C C4    . DA  D 4 1   ? -51.870 -26.796 19.428  1.00 157.63 ? 0   DA  F C4    1 
ATOM 924  P P     . DA  D 4 2   ? -53.062 -26.142 26.088  1.00 175.29 ? 1   DA  F P     1 
ATOM 925  O OP1   . DA  D 4 2   ? -53.530 -26.141 27.496  1.00 173.36 ? 1   DA  F OP1   1 
ATOM 926  O OP2   . DA  D 4 2   ? -52.986 -24.847 25.376  1.00 176.15 ? 1   DA  F OP2   1 
ATOM 927  O "O5'" . DA  D 4 2   ? -51.643 -26.903 26.081  1.00 138.57 ? 1   DA  F "O5'" 1 
ATOM 928  C "C5'" . DA  D 4 2   ? -50.673 -26.768 25.032  1.00 138.08 ? 1   DA  F "C5'" 1 
ATOM 929  C "C4'" . DA  D 4 2   ? -49.662 -25.663 25.299  1.00 136.43 ? 1   DA  F "C4'" 1 
ATOM 930  O "O4'" . DA  D 4 2   ? -49.511 -24.898 24.076  1.00 133.17 ? 1   DA  F "O4'" 1 
ATOM 931  C "C3'" . DA  D 4 2   ? -50.049 -24.667 26.394  1.00 137.14 ? 1   DA  F "C3'" 1 
ATOM 932  O "O3'" . DA  D 4 2   ? -48.913 -24.244 27.191  1.00 139.06 ? 1   DA  F "O3'" 1 
ATOM 933  C "C2'" . DA  D 4 2   ? -50.723 -23.525 25.628  1.00 135.63 ? 1   DA  F "C2'" 1 
ATOM 934  C "C1'" . DA  D 4 2   ? -50.140 -23.638 24.224  1.00 132.24 ? 1   DA  F "C1'" 1 
ATOM 935  N N9    . DA  D 4 2   ? -51.069 -23.379 23.135  1.00 129.76 ? 1   DA  F N9    1 
ATOM 936  C C8    . DA  D 4 2   ? -52.435 -23.413 23.069  1.00 129.23 ? 1   DA  F C8    1 
ATOM 937  N N7    . DA  D 4 2   ? -52.904 -23.096 21.880  1.00 129.71 ? 1   DA  F N7    1 
ATOM 938  C C5    . DA  D 4 2   ? -51.758 -22.832 21.141  1.00 131.18 ? 1   DA  F C5    1 
ATOM 939  C C6    . DA  D 4 2   ? -51.518 -22.436 19.814  1.00 133.89 ? 1   DA  F C6    1 
ATOM 940  N N6    . DA  D 4 2   ? -52.484 -22.221 18.921  1.00 134.41 ? 1   DA  F N6    1 
ATOM 941  N N1    . DA  D 4 2   ? -50.236 -22.265 19.435  1.00 135.37 ? 1   DA  F N1    1 
ATOM 942  C C2    . DA  D 4 2   ? -49.257 -22.478 20.321  1.00 134.82 ? 1   DA  F C2    1 
ATOM 943  N N3    . DA  D 4 2   ? -49.351 -22.848 21.582  1.00 132.70 ? 1   DA  F N3    1 
ATOM 944  C C4    . DA  D 4 2   ? -50.634 -23.002 21.912  1.00 130.86 ? 1   DA  F C4    1 
ATOM 945  P P     . DA  D 4 3   ? -48.500 -22.685 27.268  1.00 189.67 ? 2   DA  F P     1 
ATOM 946  O OP1   . DA  D 4 3   ? -47.247 -22.579 28.052  1.00 188.79 ? 2   DA  F OP1   1 
ATOM 947  O OP2   . DA  D 4 3   ? -49.693 -21.902 27.679  1.00 188.57 ? 2   DA  F OP2   1 
ATOM 948  O "O5'" . DA  D 4 3   ? -48.183 -22.324 25.757  1.00 161.16 ? 2   DA  F "O5'" 1 
ATOM 949  C "C5'" . DA  D 4 3   ? -47.331 -23.173 25.003  1.00 161.14 ? 2   DA  F "C5'" 1 
ATOM 950  C "C4'" . DA  D 4 3   ? -46.334 -22.302 24.278  1.00 162.58 ? 2   DA  F "C4'" 1 
ATOM 951  O "O4'" . DA  D 4 3   ? -46.993 -21.457 23.295  1.00 163.02 ? 2   DA  F "O4'" 1 
ATOM 952  C "C3'" . DA  D 4 3   ? -45.704 -21.262 25.175  1.00 164.13 ? 2   DA  F "C3'" 1 
ATOM 953  O "O3'" . DA  D 4 3   ? -44.759 -20.600 24.380  1.00 166.51 ? 2   DA  F "O3'" 1 
ATOM 954  C "C2'" . DA  D 4 3   ? -46.900 -20.346 25.326  1.00 162.84 ? 2   DA  F "C2'" 1 
ATOM 955  C "C1'" . DA  D 4 3   ? -47.118 -20.147 23.836  1.00 160.95 ? 2   DA  F "C1'" 1 
ATOM 956  N N9    . DA  D 4 3   ? -48.453 -19.673 23.539  1.00 155.31 ? 2   DA  F N9    1 
ATOM 957  C C8    . DA  D 4 3   ? -49.388 -19.270 24.446  1.00 153.27 ? 2   DA  F C8    1 
ATOM 958  N N7    . DA  D 4 3   ? -50.523 -18.912 23.900  1.00 151.53 ? 2   DA  F N7    1 
ATOM 959  C C5    . DA  D 4 3   ? -50.311 -19.100 22.544  1.00 151.06 ? 2   DA  F C5    1 
ATOM 960  C C6    . DA  D 4 3   ? -51.134 -18.906 21.420  1.00 151.20 ? 2   DA  F C6    1 
ATOM 961  N N6    . DA  D 4 3   ? -52.388 -18.451 21.497  1.00 151.16 ? 2   DA  F N6    1 
ATOM 962  N N1    . DA  D 4 3   ? -50.612 -19.188 20.208  1.00 151.68 ? 2   DA  F N1    1 
ATOM 963  C C2    . DA  D 4 3   ? -49.353 -19.635 20.138  1.00 151.78 ? 2   DA  F C2    1 
ATOM 964  N N3    . DA  D 4 3   ? -48.484 -19.864 21.120  1.00 151.57 ? 2   DA  F N3    1 
ATOM 965  C C4    . DA  D 4 3   ? -49.037 -19.571 22.305  1.00 152.34 ? 2   DA  F C4    1 
ATOM 966  P P     . DA  D 4 4   ? -44.199 -19.149 24.799  1.00 163.62 ? 3   DA  F P     1 
ATOM 967  O OP1   . DA  D 4 4   ? -42.863 -19.348 25.402  1.00 163.24 ? 3   DA  F OP1   1 
ATOM 968  O OP2   . DA  D 4 4   ? -45.258 -18.440 25.579  1.00 163.82 ? 3   DA  F OP2   1 
ATOM 969  O "O5'" . DA  D 4 4   ? -44.008 -18.391 23.375  1.00 132.22 ? 3   DA  F "O5'" 1 
ATOM 970  C "C5'" . DA  D 4 4   ? -44.119 -19.017 22.037  1.00 134.33 ? 3   DA  F "C5'" 1 
ATOM 971  C "C4'" . DA  D 4 4   ? -43.282 -18.409 20.885  1.00 136.27 ? 3   DA  F "C4'" 1 
ATOM 972  O "O4'" . DA  D 4 4   ? -44.154 -17.828 19.880  1.00 134.73 ? 3   DA  F "O4'" 1 
ATOM 973  C "C3'" . DA  D 4 4   ? -42.409 -17.180 21.167  1.00 136.59 ? 3   DA  F "C3'" 1 
ATOM 974  O "O3'" . DA  D 4 4   ? -41.555 -16.752 20.078  1.00 138.68 ? 3   DA  F "O3'" 1 
ATOM 975  C "C2'" . DA  D 4 4   ? -43.511 -16.171 21.427  1.00 135.54 ? 3   DA  F "C2'" 1 
ATOM 976  C "C1'" . DA  D 4 4   ? -44.414 -16.496 20.259  1.00 134.13 ? 3   DA  F "C1'" 1 
ATOM 977  N N9    . DA  D 4 4   ? -45.787 -16.402 20.689  1.00 133.31 ? 3   DA  F N9    1 
ATOM 978  C C8    . DA  D 4 4   ? -46.236 -16.054 21.931  1.00 133.82 ? 3   DA  F C8    1 
ATOM 979  N N7    . DA  D 4 4   ? -47.542 -16.052 22.033  1.00 134.30 ? 3   DA  F N7    1 
ATOM 980  C C5    . DA  D 4 4   ? -47.960 -16.431 20.766  1.00 134.75 ? 3   DA  F C5    1 
ATOM 981  C C6    . DA  D 4 4   ? -49.228 -16.621 20.195  1.00 136.02 ? 3   DA  F C6    1 
ATOM 982  N N6    . DA  D 4 4   ? -50.352 -16.441 20.890  1.00 136.23 ? 3   DA  F N6    1 
ATOM 983  N N1    . DA  D 4 4   ? -49.295 -17.000 18.897  1.00 136.86 ? 3   DA  F N1    1 
ATOM 984  C C2    . DA  D 4 4   ? -48.153 -17.173 18.219  1.00 136.05 ? 3   DA  F C2    1 
ATOM 985  N N3    . DA  D 4 4   ? -46.903 -17.022 18.644  1.00 134.52 ? 3   DA  F N3    1 
ATOM 986  C C4    . DA  D 4 4   ? -46.889 -16.650 19.929  1.00 133.82 ? 3   DA  F C4    1 
ATOM 987  P P     . DA  D 4 5   ? -41.059 -15.213 19.984  1.00 126.01 ? 4   DA  F P     1 
ATOM 988  O OP1   . DA  D 4 5   ? -39.809 -15.171 19.192  1.00 124.89 ? 4   DA  F OP1   1 
ATOM 989  O OP2   . DA  D 4 5   ? -41.071 -14.636 21.352  1.00 125.97 ? 4   DA  F OP2   1 
ATOM 990  O "O5'" . DA  D 4 5   ? -42.201 -14.507 19.127  1.00 120.63 ? 4   DA  F "O5'" 1 
ATOM 991  C "C5'" . DA  D 4 5   ? -42.622 -15.083 17.898  1.00 121.53 ? 4   DA  F "C5'" 1 
ATOM 992  C "C4'" . DA  D 4 5   ? -43.375 -14.043 17.095  1.00 122.70 ? 4   DA  F "C4'" 1 
ATOM 993  O "O4'" . DA  D 4 5   ? -44.775 -13.966 17.473  1.00 121.84 ? 4   DA  F "O4'" 1 
ATOM 994  C "C3'" . DA  D 4 5   ? -42.842 -12.635 17.275  1.00 124.17 ? 4   DA  F "C3'" 1 
ATOM 995  O "O3'" . DA  D 4 5   ? -43.081 -11.951 16.066  1.00 126.43 ? 4   DA  F "O3'" 1 
ATOM 996  C "C2'" . DA  D 4 5   ? -43.712 -12.104 18.410  1.00 122.83 ? 4   DA  F "C2'" 1 
ATOM 997  C "C1'" . DA  D 4 5   ? -45.060 -12.709 18.052  1.00 121.55 ? 4   DA  F "C1'" 1 
ATOM 998  N N9    . DA  D 4 5   ? -45.937 -12.946 19.191  1.00 121.50 ? 4   DA  F N9    1 
ATOM 999  C C8    . DA  D 4 5   ? -45.598 -13.131 20.502  1.00 121.22 ? 4   DA  F C8    1 
ATOM 1000 N N7    . DA  D 4 5   ? -46.632 -13.333 21.289  1.00 122.01 ? 4   DA  F N7    1 
ATOM 1001 C C5    . DA  D 4 5   ? -47.721 -13.281 20.433  1.00 124.26 ? 4   DA  F C5    1 
ATOM 1002 C C6    . DA  D 4 5   ? -49.112 -13.420 20.631  1.00 126.88 ? 4   DA  F C6    1 
ATOM 1003 N N6    . DA  D 4 5   ? -49.696 -13.653 21.816  1.00 127.67 ? 4   DA  F N6    1 
ATOM 1004 N N1    . DA  D 4 5   ? -49.901 -13.308 19.542  1.00 127.43 ? 4   DA  F N1    1 
ATOM 1005 C C2    . DA  D 4 5   ? -49.344 -13.076 18.348  1.00 126.68 ? 4   DA  F C2    1 
ATOM 1006 N N3    . DA  D 4 5   ? -48.060 -12.930 18.038  1.00 125.42 ? 4   DA  F N3    1 
ATOM 1007 C C4    . DA  D 4 5   ? -47.301 -13.044 19.136  1.00 123.72 ? 4   DA  F C4    1 
ATOM 1008 P P     . DT  D 4 6   ? -42.387 -10.532 15.785  1.00 100.71 ? 5   DT  F P     1 
ATOM 1009 O OP1   . DT  D 4 6   ? -41.011 -10.785 15.304  1.00 100.43 ? 5   DT  F OP1   1 
ATOM 1010 O OP2   . DT  D 4 6   ? -42.583 -9.683  16.983  1.00 98.34  ? 5   DT  F OP2   1 
ATOM 1011 O "O5'" . DT  D 4 6   ? -43.263 -9.933  14.586  1.00 131.46 ? 5   DT  F "O5'" 1 
ATOM 1012 C "C5'" . DT  D 4 6   ? -44.148 -10.786 13.856  1.00 131.25 ? 5   DT  F "C5'" 1 
ATOM 1013 C "C4'" . DT  D 4 6   ? -45.517 -10.146 13.694  1.00 132.31 ? 5   DT  F "C4'" 1 
ATOM 1014 O "O4'" . DT  D 4 6   ? -46.315 -10.387 14.884  1.00 132.79 ? 5   DT  F "O4'" 1 
ATOM 1015 C "C3'" . DT  D 4 6   ? -45.500 -8.631  13.505  1.00 134.08 ? 5   DT  F "C3'" 1 
ATOM 1016 O "O3'" . DT  D 4 6   ? -46.636 -8.200  12.765  1.00 135.73 ? 5   DT  F "O3'" 1 
ATOM 1017 C "C2'" . DT  D 4 6   ? -45.626 -8.165  14.946  1.00 134.40 ? 5   DT  F "C2'" 1 
ATOM 1018 C "C1'" . DT  D 4 6   ? -46.709 -9.134  15.404  1.00 134.57 ? 5   DT  F "C1'" 1 
ATOM 1019 N N1    . DT  D 4 6   ? -46.859 -9.205  16.883  1.00 137.39 ? 5   DT  F N1    1 
ATOM 1020 C C2    . DT  D 4 6   ? -48.124 -9.324  17.414  1.00 136.19 ? 5   DT  F C2    1 
ATOM 1021 O O2    . DT  D 4 6   ? -49.139 -9.387  16.746  1.00 132.58 ? 5   DT  F O2    1 
ATOM 1022 N N3    . DT  D 4 6   ? -48.156 -9.372  18.779  1.00 140.30 ? 5   DT  F N3    1 
ATOM 1023 C C4    . DT  D 4 6   ? -47.090 -9.310  19.656  1.00 144.66 ? 5   DT  F C4    1 
ATOM 1024 O O4    . DT  D 4 6   ? -47.252 -9.362  20.874  1.00 148.43 ? 5   DT  F O4    1 
ATOM 1025 C C5    . DT  D 4 6   ? -45.790 -9.181  19.039  1.00 142.90 ? 5   DT  F C5    1 
ATOM 1026 C C7    . DT  D 4 6   ? -44.557 -9.105  19.897  1.00 141.24 ? 5   DT  F C7    1 
ATOM 1027 C C6    . DT  D 4 6   ? -45.739 -9.133  17.696  1.00 140.89 ? 5   DT  F C6    1 
ATOM 1028 P P     . DT  D 4 7   ? -46.486 -7.070  11.635  1.00 116.60 ? 6   DT  F P     1 
ATOM 1029 O OP1   . DT  D 4 7   ? -45.922 -7.710  10.427  1.00 118.83 ? 6   DT  F OP1   1 
ATOM 1030 O OP2   . DT  D 4 7   ? -45.841 -5.894  12.249  1.00 114.64 ? 6   DT  F OP2   1 
ATOM 1031 O "O5'" . DT  D 4 7   ? -47.989 -6.668  11.303  1.00 97.53  ? 6   DT  F "O5'" 1 
ATOM 1032 C "C5'" . DT  D 4 7   ? -48.787 -7.604  10.612  1.00 98.27  ? 6   DT  F "C5'" 1 
ATOM 1033 C "C4'" . DT  D 4 7   ? -50.114 -7.732  11.321  1.00 99.41  ? 6   DT  F "C4'" 1 
ATOM 1034 O "O4'" . DT  D 4 7   ? -49.847 -7.770  12.736  1.00 101.51 ? 6   DT  F "O4'" 1 
ATOM 1035 C "C3'" . DT  D 4 7   ? -51.073 -6.569  11.120  1.00 99.81  ? 6   DT  F "C3'" 1 
ATOM 1036 O "O3'" . DT  D 4 7   ? -52.259 -7.102  10.524  1.00 101.27 ? 6   DT  F "O3'" 1 
ATOM 1037 C "C2'" . DT  D 4 7   ? -51.251 -5.965  12.521  1.00 98.22  ? 6   DT  F "C2'" 1 
ATOM 1038 C "C1'" . DT  D 4 7   ? -50.888 -7.131  13.431  1.00 100.22 ? 6   DT  F "C1'" 1 
ATOM 1039 N N1    . DT  D 4 7   ? -50.336 -6.859  14.805  1.00 101.66 ? 6   DT  F N1    1 
ATOM 1040 C C2    . DT  D 4 7   ? -51.042 -7.256  15.929  1.00 103.09 ? 6   DT  F C2    1 
ATOM 1041 O O2    . DT  D 4 7   ? -52.134 -7.800  15.893  1.00 104.50 ? 6   DT  F O2    1 
ATOM 1042 N N3    . DT  D 4 7   ? -50.425 -6.981  17.124  1.00 101.81 ? 6   DT  F N3    1 
ATOM 1043 C C4    . DT  D 4 7   ? -49.197 -6.371  17.301  1.00 101.37 ? 6   DT  F C4    1 
ATOM 1044 O O4    . DT  D 4 7   ? -48.717 -6.157  18.409  1.00 100.47 ? 6   DT  F O4    1 
ATOM 1045 C C5    . DT  D 4 7   ? -48.506 -5.997  16.093  1.00 100.46 ? 6   DT  F C5    1 
ATOM 1046 C C7    . DT  D 4 7   ? -47.165 -5.330  16.183  1.00 99.08  ? 6   DT  F C7    1 
ATOM 1047 C C6    . DT  D 4 7   ? -49.095 -6.260  14.918  1.00 100.53 ? 6   DT  F C6    1 
ATOM 1048 P P     . DT  D 4 8   ? -53.635 -6.285  10.590  1.00 95.59  ? 7   DT  F P     1 
ATOM 1049 O OP1   . DT  D 4 8   ? -54.650 -7.032  9.814   1.00 96.12  ? 7   DT  F OP1   1 
ATOM 1050 O OP2   . DT  D 4 8   ? -53.351 -4.889  10.212  1.00 94.50  ? 7   DT  F OP2   1 
ATOM 1051 O "O5'" . DT  D 4 8   ? -53.998 -6.317  12.140  1.00 98.07  ? 7   DT  F "O5'" 1 
ATOM 1052 C "C5'" . DT  D 4 8   ? -54.806 -5.323  12.705  1.00 99.49  ? 7   DT  F "C5'" 1 
ATOM 1053 C "C4'" . DT  D 4 8   ? -54.615 -5.257  14.196  1.00 105.02 ? 7   DT  F "C4'" 1 
ATOM 1054 O "O4'" . DT  D 4 8   ? -53.254 -4.941  14.563  1.00 109.50 ? 7   DT  F "O4'" 1 
ATOM 1055 C "C3'" . DT  D 4 8   ? -55.438 -4.144  14.826  1.00 110.40 ? 7   DT  F "C3'" 1 
ATOM 1056 O "O3'" . DT  D 4 8   ? -56.551 -4.685  15.500  1.00 110.59 ? 7   DT  F "O3'" 1 
ATOM 1057 C "C2'" . DT  D 4 8   ? -54.476 -3.425  15.781  1.00 113.63 ? 7   DT  F "C2'" 1 
ATOM 1058 C "C1'" . DT  D 4 8   ? -53.382 -4.472  15.891  1.00 114.84 ? 7   DT  F "C1'" 1 
ATOM 1059 N N1    . DT  D 4 8   ? -52.106 -3.967  16.442  1.00 120.01 ? 7   DT  F N1    1 
ATOM 1060 C C2    . DT  D 4 8   ? -51.925 -4.037  17.805  1.00 123.28 ? 7   DT  F C2    1 
ATOM 1061 O O2    . DT  D 4 8   ? -52.755 -4.486  18.576  1.00 125.44 ? 7   DT  F O2    1 
ATOM 1062 N N3    . DT  D 4 8   ? -50.721 -3.557  18.238  1.00 123.95 ? 7   DT  F N3    1 
ATOM 1063 C C4    . DT  D 4 8   ? -49.708 -3.028  17.463  1.00 124.65 ? 7   DT  F C4    1 
ATOM 1064 O O4    . DT  D 4 8   ? -48.661 -2.623  17.955  1.00 125.47 ? 7   DT  F O4    1 
ATOM 1065 C C5    . DT  D 4 8   ? -49.963 -2.985  16.044  1.00 123.87 ? 7   DT  F C5    1 
ATOM 1066 C C7    . DT  D 4 8   ? -48.931 -2.428  15.108  1.00 123.59 ? 7   DT  F C7    1 
ATOM 1067 C C6    . DT  D 4 8   ? -51.139 -3.452  15.604  1.00 121.52 ? 7   DT  F C6    1 
ATOM 1068 P P     . DT  D 4 9   ? -57.994 -3.995  15.344  1.00 156.70 ? 8   DT  F P     1 
ATOM 1069 O OP1   . DT  D 4 9   ? -58.956 -5.037  14.910  1.00 156.60 ? 8   DT  F OP1   1 
ATOM 1070 O OP2   . DT  D 4 9   ? -57.818 -2.730  14.596  1.00 155.70 ? 8   DT  F OP2   1 
ATOM 1071 O "O5'" . DT  D 4 9   ? -58.346 -3.514  16.820  1.00 132.98 ? 8   DT  F "O5'" 1 
ATOM 1072 C "C5'" . DT  D 4 9   ? -58.680 -2.147  16.956  1.00 129.78 ? 8   DT  F "C5'" 1 
ATOM 1073 C "C4'" . DT  D 4 9   ? -57.708 -1.480  17.900  1.00 126.16 ? 8   DT  F "C4'" 1 
ATOM 1074 O "O4'" . DT  D 4 9   ? -56.324 -1.620  17.505  1.00 122.92 ? 8   DT  F "O4'" 1 
ATOM 1075 C "C3'" . DT  D 4 9   ? -57.866 0.023   18.027  1.00 127.00 ? 8   DT  F "C3'" 1 
ATOM 1076 O "O3'" . DT  D 4 9   ? -58.969 0.259   18.899  1.00 127.42 ? 8   DT  F "O3'" 1 
ATOM 1077 C "C2'" . DT  D 4 9   ? -56.508 0.420   18.619  1.00 126.61 ? 8   DT  F "C2'" 1 
ATOM 1078 C "C1'" . DT  D 4 9   ? -55.681 -0.866  18.508  1.00 123.04 ? 8   DT  F "C1'" 1 
ATOM 1079 N N1    . DT  D 4 9   ? -54.227 -0.664  18.225  1.00 120.99 ? 8   DT  F N1    1 
ATOM 1080 C C2    . DT  D 4 9   ? -53.354 -0.691  19.291  1.00 121.35 ? 8   DT  F C2    1 
ATOM 1081 O O2    . DT  D 4 9   ? -53.703 -0.874  20.441  1.00 123.61 ? 8   DT  F O2    1 
ATOM 1082 N N3    . DT  D 4 9   ? -52.042 -0.497  18.968  1.00 120.10 ? 8   DT  F N3    1 
ATOM 1083 C C4    . DT  D 4 9   ? -51.517 -0.281  17.713  1.00 121.15 ? 8   DT  F C4    1 
ATOM 1084 O O4    . DT  D 4 9   ? -50.310 -0.117  17.540  1.00 121.81 ? 8   DT  F O4    1 
ATOM 1085 C C5    . DT  D 4 9   ? -52.483 -0.263  16.642  1.00 121.94 ? 8   DT  F C5    1 
ATOM 1086 C C7    . DT  D 4 9   ? -52.030 -0.038  15.231  1.00 122.97 ? 8   DT  F C7    1 
ATOM 1087 C C6    . DT  D 4 9   ? -53.777 -0.452  16.941  1.00 121.01 ? 8   DT  F C6    1 
ATOM 1088 P P     . DA  D 4 10  ? -59.529 1.749   19.123  1.00 113.34 ? 9   DA  F P     1 
ATOM 1089 O OP1   . DA  D 4 10  ? -60.661 1.671   20.074  1.00 112.59 ? 9   DA  F OP1   1 
ATOM 1090 O OP2   . DA  D 4 10  ? -59.738 2.365   17.792  1.00 111.91 ? 9   DA  F OP2   1 
ATOM 1091 O "O5'" . DA  D 4 10  ? -58.312 2.499   19.840  1.00 127.76 ? 9   DA  F "O5'" 1 
ATOM 1092 C "C5'" . DA  D 4 10  ? -58.008 2.225   21.206  1.00 127.20 ? 9   DA  F "C5'" 1 
ATOM 1093 C "C4'" . DA  D 4 10  ? -56.706 2.888   21.633  1.00 129.23 ? 9   DA  F "C4'" 1 
ATOM 1094 O "O4'" . DA  D 4 10  ? -55.610 2.238   20.945  1.00 128.94 ? 9   DA  F "O4'" 1 
ATOM 1095 C "C3'" . DA  D 4 10  ? -56.538 4.378   21.305  1.00 132.05 ? 9   DA  F "C3'" 1 
ATOM 1096 O "O3'" . DA  D 4 10  ? -57.062 5.274   22.318  1.00 130.72 ? 9   DA  F "O3'" 1 
ATOM 1097 C "C2'" . DA  D 4 10  ? -55.028 4.540   21.138  1.00 133.59 ? 9   DA  F "C2'" 1 
ATOM 1098 C "C1'" . DA  D 4 10  ? -54.503 3.119   20.951  1.00 132.72 ? 9   DA  F "C1'" 1 
ATOM 1099 N N9    . DA  D 4 10  ? -53.750 3.022   19.707  1.00 136.12 ? 9   DA  F N9    1 
ATOM 1100 C C8    . DA  D 4 10  ? -54.227 2.829   18.440  1.00 136.71 ? 9   DA  F C8    1 
ATOM 1101 N N7    . DA  D 4 10  ? -53.288 2.803   17.523  1.00 137.69 ? 9   DA  F N7    1 
ATOM 1102 C C5    . DA  D 4 10  ? -52.117 3.003   18.240  1.00 139.51 ? 9   DA  F C5    1 
ATOM 1103 C C6    . DA  D 4 10  ? -50.761 3.086   17.865  1.00 141.03 ? 9   DA  F C6    1 
ATOM 1104 N N6    . DA  D 4 10  ? -50.301 2.973   16.612  1.00 141.52 ? 9   DA  F N6    1 
ATOM 1105 N N1    . DA  D 4 10  ? -49.870 3.295   18.849  1.00 141.27 ? 9   DA  F N1    1 
ATOM 1106 C C2    . DA  D 4 10  ? -50.277 3.410   20.115  1.00 140.80 ? 9   DA  F C2    1 
ATOM 1107 N N3    . DA  D 4 10  ? -51.516 3.351   20.588  1.00 140.19 ? 9   DA  F N3    1 
ATOM 1108 C C4    . DA  D 4 10  ? -52.389 3.145   19.589  1.00 138.60 ? 9   DA  F C4    1 
ATOM 1109 P P     . DT  D 4 11  ? -56.365 5.374   23.766  1.00 172.71 ? 10  DT  F P     1 
ATOM 1110 O OP1   . DT  D 4 11  ? -56.349 4.023   24.362  1.00 174.97 ? 10  DT  F OP1   1 
ATOM 1111 O OP2   . DT  D 4 11  ? -57.009 6.479   24.506  1.00 172.26 ? 10  DT  F OP2   1 
ATOM 1112 O "O5'" . DT  D 4 11  ? -54.866 5.815   23.440  1.00 132.38 ? 10  DT  F "O5'" 1 
ATOM 1113 C "C5'" . DT  D 4 11  ? -53.793 5.343   24.241  1.00 134.99 ? 10  DT  F "C5'" 1 
ATOM 1114 C "C4'" . DT  D 4 11  ? -52.546 6.146   23.931  1.00 139.11 ? 10  DT  F "C4'" 1 
ATOM 1115 O "O4'" . DT  D 4 11  ? -51.998 5.778   22.638  1.00 140.40 ? 10  DT  F "O4'" 1 
ATOM 1116 C "C3'" . DT  D 4 11  ? -52.781 7.649   23.857  1.00 141.15 ? 10  DT  F "C3'" 1 
ATOM 1117 O "O3'" . DT  D 4 11  ? -51.666 8.290   24.434  1.00 142.01 ? 10  DT  F "O3'" 1 
ATOM 1118 C "C2'" . DT  D 4 11  ? -52.839 7.908   22.356  1.00 141.23 ? 10  DT  F "C2'" 1 
ATOM 1119 C "C1'" . DT  D 4 11  ? -51.708 6.977   21.950  1.00 141.04 ? 10  DT  F "C1'" 1 
ATOM 1120 N N1    . DT  D 4 11  ? -51.574 6.743   20.480  1.00 142.10 ? 10  DT  F N1    1 
ATOM 1121 C C2    . DT  D 4 11  ? -50.306 6.605   19.969  1.00 142.95 ? 10  DT  F C2    1 
ATOM 1122 O O2    . DT  D 4 11  ? -49.306 6.654   20.658  1.00 143.18 ? 10  DT  F O2    1 
ATOM 1123 N N3    . DT  D 4 11  ? -50.249 6.399   18.616  1.00 143.74 ? 10  DT  F N3    1 
ATOM 1124 C C4    . DT  D 4 11  ? -51.308 6.323   17.731  1.00 144.86 ? 10  DT  F C4    1 
ATOM 1125 O O4    . DT  D 4 11  ? -51.119 6.133   16.527  1.00 145.99 ? 10  DT  F O4    1 
ATOM 1126 C C5    . DT  D 4 11  ? -52.617 6.480   18.332  1.00 143.75 ? 10  DT  F C5    1 
ATOM 1127 C C7    . DT  D 4 11  ? -53.860 6.420   17.490  1.00 142.87 ? 10  DT  F C7    1 
ATOM 1128 C C6    . DT  D 4 11  ? -52.683 6.682   19.659  1.00 143.00 ? 10  DT  F C6    1 
ATOM 1129 P P     . DA  D 4 12  ? -51.817 9.750   25.084  1.00 115.01 ? 11  DA  F P     1 
ATOM 1130 O OP1   . DA  D 4 12  ? -52.098 9.577   26.528  1.00 114.92 ? 11  DA  F OP1   1 
ATOM 1131 O OP2   . DA  D 4 12  ? -52.754 10.529  24.239  1.00 113.68 ? 11  DA  F OP2   1 
ATOM 1132 O "O5'" . DA  D 4 12  ? -50.354 10.374  24.919  1.00 136.15 ? 11  DA  F "O5'" 1 
ATOM 1133 C "C5'" . DA  D 4 12  ? -49.230 9.569   25.252  1.00 135.89 ? 11  DA  F "C5'" 1 
ATOM 1134 C "C4'" . DA  D 4 12  ? -48.084 9.792   24.283  1.00 136.56 ? 11  DA  F "C4'" 1 
ATOM 1135 O "O4'" . DA  D 4 12  ? -48.421 9.251   22.979  1.00 136.55 ? 11  DA  F "O4'" 1 
ATOM 1136 C "C3'" . DA  D 4 12  ? -47.705 11.250  24.042  1.00 137.54 ? 11  DA  F "C3'" 1 
ATOM 1137 O "O3'" . DA  D 4 12  ? -46.283 11.334  24.032  1.00 138.66 ? 11  DA  F "O3'" 1 
ATOM 1138 C "C2'" . DA  D 4 12  ? -48.308 11.532  22.666  1.00 136.86 ? 11  DA  F "C2'" 1 
ATOM 1139 C "C1'" . DA  D 4 12  ? -48.021 10.189  22.005  1.00 136.04 ? 11  DA  F "C1'" 1 
ATOM 1140 N N9    . DA  D 4 12  ? -48.724 9.921   20.748  1.00 134.61 ? 11  DA  F N9    1 
ATOM 1141 C C8    . DA  D 4 12  ? -50.072 9.974   20.509  1.00 134.72 ? 11  DA  F C8    1 
ATOM 1142 N N7    . DA  D 4 12  ? -50.409 9.672   19.275  1.00 133.49 ? 11  DA  F N7    1 
ATOM 1143 C C5    . DA  D 4 12  ? -49.197 9.399   18.662  1.00 131.15 ? 11  DA  F C5    1 
ATOM 1144 C C6    . DA  D 4 12  ? -48.870 9.018   17.349  1.00 127.75 ? 11  DA  F C6    1 
ATOM 1145 N N6    . DA  D 4 12  ? -49.784 8.843   16.388  1.00 127.30 ? 11  DA  F N6    1 
ATOM 1146 N N1    . DA  D 4 12  ? -47.564 8.827   17.069  1.00 126.08 ? 11  DA  F N1    1 
ATOM 1147 C C2    . DA  D 4 12  ? -46.661 9.011   18.041  1.00 125.85 ? 11  DA  F C2    1 
ATOM 1148 N N3    . DA  D 4 12  ? -46.846 9.362   19.310  1.00 127.54 ? 11  DA  F N3    1 
ATOM 1149 C C4    . DA  D 4 12  ? -48.151 9.545   19.555  1.00 131.10 ? 11  DA  F C4    1 
ATOM 1150 P P     . DA  D 4 13  ? -45.544 12.712  24.410  1.00 158.90 ? 12  DA  F P     1 
ATOM 1151 O OP1   . DA  D 4 13  ? -45.051 12.601  25.801  1.00 157.93 ? 12  DA  F OP1   1 
ATOM 1152 O OP2   . DA  D 4 13  ? -46.435 13.829  24.026  1.00 158.33 ? 12  DA  F OP2   1 
ATOM 1153 O "O5'" . DA  D 4 13  ? -44.286 12.736  23.427  1.00 139.11 ? 12  DA  F "O5'" 1 
ATOM 1154 C "C5'" . DA  D 4 13  ? -43.763 11.502  22.957  1.00 135.81 ? 12  DA  F "C5'" 1 
ATOM 1155 C "C4'" . DA  D 4 13  ? -43.324 11.637  21.512  1.00 132.13 ? 12  DA  F "C4'" 1 
ATOM 1156 O "O4'" . DA  D 4 13  ? -44.442 11.408  20.621  1.00 129.98 ? 12  DA  F "O4'" 1 
ATOM 1157 C "C3'" . DA  D 4 13  ? -42.764 13.008  21.160  1.00 130.65 ? 12  DA  F "C3'" 1 
ATOM 1158 O "O3'" . DA  D 4 13  ? -41.427 12.833  20.718  1.00 128.58 ? 12  DA  F "O3'" 1 
ATOM 1159 C "C2'" . DA  D 4 13  ? -43.693 13.552  20.068  1.00 129.95 ? 12  DA  F "C2'" 1 
ATOM 1160 C "C1'" . DA  D 4 13  ? -44.357 12.292  19.526  1.00 128.20 ? 12  DA  F "C1'" 1 
ATOM 1161 N N9    . DA  D 4 13  ? -45.716 12.449  19.012  1.00 125.05 ? 12  DA  F N9    1 
ATOM 1162 C C8    . DA  D 4 13  ? -46.859 12.710  19.718  1.00 122.92 ? 12  DA  F C8    1 
ATOM 1163 N N7    . DA  D 4 13  ? -47.941 12.776  18.974  1.00 122.14 ? 12  DA  F N7    1 
ATOM 1164 C C5    . DA  D 4 13  ? -47.480 12.534  17.686  1.00 124.69 ? 12  DA  F C5    1 
ATOM 1165 C C6    . DA  D 4 13  ? -48.117 12.462  16.421  1.00 126.86 ? 12  DA  F C6    1 
ATOM 1166 N N6    . DA  D 4 13  ? -49.429 12.630  16.196  1.00 127.48 ? 12  DA  F N6    1 
ATOM 1167 N N1    . DA  D 4 13  ? -47.337 12.198  15.352  1.00 126.87 ? 12  DA  F N1    1 
ATOM 1168 C C2    . DA  D 4 13  ? -46.023 12.020  15.525  1.00 126.04 ? 12  DA  F C2    1 
ATOM 1169 N N3    . DA  D 4 13  ? -45.316 12.063  16.651  1.00 125.62 ? 12  DA  F N3    1 
ATOM 1170 C C4    . DA  D 4 13  ? -46.109 12.327  17.701  1.00 125.17 ? 12  DA  F C4    1 
ATOM 1171 P P     . DA  D 4 14  ? -40.521 14.108  20.358  1.00 171.81 ? 13  DA  F P     1 
ATOM 1172 O OP1   . DA  D 4 14  ? -39.102 13.714  20.497  1.00 171.40 ? 13  DA  F OP1   1 
ATOM 1173 O OP2   . DA  D 4 14  ? -41.052 15.273  21.102  1.00 171.94 ? 13  DA  F OP2   1 
ATOM 1174 O "O5'" . DA  D 4 14  ? -40.823 14.348  18.815  1.00 138.99 ? 13  DA  F "O5'" 1 
ATOM 1175 C "C5'" . DA  D 4 14  ? -40.804 13.225  17.961  1.00 138.23 ? 13  DA  F "C5'" 1 
ATOM 1176 C "C4'" . DA  D 4 14  ? -41.115 13.696  16.565  1.00 137.88 ? 13  DA  F "C4'" 1 
ATOM 1177 O "O4'" . DA  D 4 14  ? -42.548 13.765  16.358  1.00 139.59 ? 13  DA  F "O4'" 1 
ATOM 1178 C "C3'" . DA  D 4 14  ? -40.593 15.097  16.300  1.00 137.28 ? 13  DA  F "C3'" 1 
ATOM 1179 O "O3'" . DA  D 4 14  ? -40.165 15.120  14.977  1.00 135.76 ? 13  DA  F "O3'" 1 
ATOM 1180 C "C2'" . DA  D 4 14  ? -41.848 15.942  16.449  1.00 139.73 ? 13  DA  F "C2'" 1 
ATOM 1181 C "C1'" . DA  D 4 14  ? -42.792 14.998  15.726  1.00 141.87 ? 13  DA  F "C1'" 1 
ATOM 1182 N N9    . DA  D 4 14  ? -44.199 15.358  15.824  1.00 146.06 ? 13  DA  F N9    1 
ATOM 1183 C C8    . DA  D 4 14  ? -44.819 16.044  16.830  1.00 146.92 ? 13  DA  F C8    1 
ATOM 1184 N N7    . DA  D 4 14  ? -46.104 16.223  16.624  1.00 148.18 ? 13  DA  F N7    1 
ATOM 1185 C C5    . DA  D 4 14  ? -46.341 15.614  15.399  1.00 149.64 ? 13  DA  F C5    1 
ATOM 1186 C C6    . DA  D 4 14  ? -47.504 15.453  14.613  1.00 151.03 ? 13  DA  F C6    1 
ATOM 1187 N N6    . DA  D 4 14  ? -48.712 15.914  14.964  1.00 151.41 ? 13  DA  F N6    1 
ATOM 1188 N N1    . DA  D 4 14  ? -47.379 14.793  13.439  1.00 151.25 ? 13  DA  F N1    1 
ATOM 1189 C C2    . DA  D 4 14  ? -46.174 14.330  13.082  1.00 150.83 ? 13  DA  F C2    1 
ATOM 1190 N N3    . DA  D 4 14  ? -45.016 14.418  13.734  1.00 150.21 ? 13  DA  F N3    1 
ATOM 1191 C C4    . DA  D 4 14  ? -45.171 15.078  14.894  1.00 148.91 ? 13  DA  F C4    1 
ATOM 1192 P P     . DT  D 4 15  ? -38.747 15.763  14.599  1.00 136.89 ? 14  DT  F P     1 
ATOM 1193 O OP1   . DT  D 4 15  ? -37.730 14.699  14.687  1.00 137.72 ? 14  DT  F OP1   1 
ATOM 1194 O OP2   . DT  D 4 15  ? -38.565 16.977  15.421  1.00 136.09 ? 14  DT  F OP2   1 
ATOM 1195 O "O5'" . DT  D 4 15  ? -38.941 16.204  13.068  1.00 157.90 ? 14  DT  F "O5'" 1 
ATOM 1196 C "C5'" . DT  D 4 15  ? -39.316 15.230  12.086  1.00 154.73 ? 14  DT  F "C5'" 1 
ATOM 1197 C "C4'" . DT  D 4 15  ? -40.430 15.700  11.160  1.00 149.70 ? 14  DT  F "C4'" 1 
ATOM 1198 O "O4'" . DT  D 4 15  ? -41.681 15.800  11.886  1.00 147.36 ? 14  DT  F "O4'" 1 
ATOM 1199 C "C3'" . DT  D 4 15  ? -40.249 17.072  10.519  1.00 146.53 ? 14  DT  F "C3'" 1 
ATOM 1200 O "O3'" . DT  D 4 15  ? -39.569 16.952  9.270   1.00 143.33 ? 14  DT  F "O3'" 1 
ATOM 1201 C "C2'" . DT  D 4 15  ? -41.687 17.564  10.323  1.00 145.63 ? 14  DT  F "C2'" 1 
ATOM 1202 C "C1'" . DT  D 4 15  ? -42.564 16.603  11.126  1.00 143.50 ? 14  DT  F "C1'" 1 
ATOM 1203 N N1    . DT  D 4 15  ? -43.513 17.301  12.049  1.00 136.30 ? 14  DT  F N1    1 
ATOM 1204 C C2    . DT  D 4 15  ? -44.869 17.345  11.770  1.00 132.88 ? 14  DT  F C2    1 
ATOM 1205 O O2    . DT  D 4 15  ? -45.384 16.834  10.788  1.00 132.11 ? 14  DT  F O2    1 
ATOM 1206 N N3    . DT  D 4 15  ? -45.609 18.023  12.709  1.00 129.22 ? 14  DT  F N3    1 
ATOM 1207 C C4    . DT  D 4 15  ? -45.147 18.639  13.861  1.00 124.23 ? 14  DT  F C4    1 
ATOM 1208 O O4    . DT  D 4 15  ? -45.894 19.219  14.640  1.00 120.12 ? 14  DT  F O4    1 
ATOM 1209 C C5    . DT  D 4 15  ? -43.728 18.550  14.083  1.00 124.77 ? 14  DT  F C5    1 
ATOM 1210 C C7    . DT  D 4 15  ? -43.099 19.170  15.292  1.00 121.66 ? 14  DT  F C7    1 
ATOM 1211 C C6    . DT  D 4 15  ? -42.993 17.898  13.180  1.00 130.19 ? 14  DT  F C6    1 
ATOM 1212 N N     . MET E 5 1   ? -37.971 -18.793 -60.433 1.00 179.77 ? 1   MET A N     1 
ATOM 1213 C CA    . MET E 5 1   ? -37.404 -19.242 -61.699 1.00 181.29 ? 1   MET A CA    1 
ATOM 1214 C C     . MET E 5 1   ? -37.886 -20.644 -62.051 1.00 185.37 ? 1   MET A C     1 
ATOM 1215 O O     . MET E 5 1   ? -38.164 -21.455 -61.166 1.00 186.30 ? 1   MET A O     1 
ATOM 1216 C CB    . MET E 5 1   ? -35.874 -19.220 -61.643 1.00 179.63 ? 1   MET A CB    1 
ATOM 1217 C CG    . MET E 5 1   ? -35.197 -19.539 -62.971 1.00 178.48 ? 1   MET A CG    1 
ATOM 1218 S SD    . MET E 5 1   ? -35.706 -18.407 -64.282 1.00 269.99 ? 1   MET A SD    1 
ATOM 1219 C CE    . MET E 5 1   ? -34.860 -19.106 -65.698 1.00 161.86 ? 1   MET A CE    1 
ATOM 1220 N N     . SER E 5 2   ? -37.986 -20.921 -63.349 1.00 186.01 ? 2   SER A N     1 
ATOM 1221 C CA    . SER E 5 2   ? -38.345 -22.251 -63.829 1.00 183.56 ? 2   SER A CA    1 
ATOM 1222 C C     . SER E 5 2   ? -37.451 -23.310 -63.183 1.00 180.63 ? 2   SER A C     1 
ATOM 1223 O O     . SER E 5 2   ? -37.929 -24.355 -62.735 1.00 178.72 ? 2   SER A O     1 
ATOM 1224 C CB    . SER E 5 2   ? -38.230 -22.320 -65.357 1.00 182.55 ? 2   SER A CB    1 
ATOM 1225 O OG    . SER E 5 2   ? -38.998 -21.306 -65.987 1.00 181.11 ? 2   SER A OG    1 
ATOM 1226 N N     . LYS E 5 3   ? -36.154 -23.022 -63.123 1.00 179.02 ? 3   LYS A N     1 
ATOM 1227 C CA    . LYS E 5 3   ? -35.165 -23.978 -62.631 1.00 176.51 ? 3   LYS A CA    1 
ATOM 1228 C C     . LYS E 5 3   ? -35.160 -24.087 -61.110 1.00 174.22 ? 3   LYS A C     1 
ATOM 1229 O O     . LYS E 5 3   ? -34.558 -25.004 -60.548 1.00 171.51 ? 3   LYS A O     1 
ATOM 1230 C CB    . LYS E 5 3   ? -33.780 -23.591 -63.143 1.00 176.38 ? 3   LYS A CB    1 
ATOM 1231 C CG    . LYS E 5 3   ? -33.784 -23.229 -64.613 1.00 177.91 ? 3   LYS A CG    1 
ATOM 1232 C CD    . LYS E 5 3   ? -32.391 -23.181 -65.200 1.00 183.07 ? 3   LYS A CD    1 
ATOM 1233 C CE    . LYS E 5 3   ? -32.455 -23.313 -66.712 1.00 176.78 ? 3   LYS A CE    1 
ATOM 1234 N NZ    . LYS E 5 3   ? -31.117 -23.542 -67.315 1.00 178.66 ? 3   LYS A NZ    1 
ATOM 1235 N N     . LEU E 5 4   ? -35.843 -23.151 -60.457 1.00 173.42 ? 4   LEU A N     1 
ATOM 1236 C CA    . LEU E 5 4   ? -35.869 -23.071 -59.000 1.00 170.73 ? 4   LEU A CA    1 
ATOM 1237 C C     . LEU E 5 4   ? -36.750 -24.127 -58.345 1.00 174.28 ? 4   LEU A C     1 
ATOM 1238 O O     . LEU E 5 4   ? -36.368 -24.720 -57.335 1.00 173.76 ? 4   LEU A O     1 
ATOM 1239 C CB    . LEU E 5 4   ? -36.365 -21.696 -58.562 1.00 162.25 ? 4   LEU A CB    1 
ATOM 1240 C CG    . LEU E 5 4   ? -36.875 -21.599 -57.125 1.00 152.75 ? 4   LEU A CG    1 
ATOM 1241 C CD1   . LEU E 5 4   ? -35.793 -21.041 -56.212 1.00 147.29 ? 4   LEU A CD1   1 
ATOM 1242 C CD2   . LEU E 5 4   ? -38.128 -20.737 -57.074 1.00 151.69 ? 4   LEU A CD2   1 
ATOM 1243 N N     . ASP E 5 5   ? -37.935 -24.343 -58.910 1.00 175.76 ? 5   ASP A N     1 
ATOM 1244 C CA    . ASP E 5 5   ? -38.933 -25.215 -58.290 1.00 174.28 ? 5   ASP A CA    1 
ATOM 1245 C C     . ASP E 5 5   ? -38.354 -26.549 -57.837 1.00 167.38 ? 5   ASP A C     1 
ATOM 1246 O O     . ASP E 5 5   ? -38.553 -26.968 -56.699 1.00 167.78 ? 5   ASP A O     1 
ATOM 1247 C CB    . ASP E 5 5   ? -40.095 -25.478 -59.248 1.00 176.25 ? 5   ASP A CB    1 
ATOM 1248 C CG    . ASP E 5 5   ? -41.039 -24.305 -59.361 1.00 177.57 ? 5   ASP A CG    1 
ATOM 1249 O OD1   . ASP E 5 5   ? -41.444 -23.746 -58.317 1.00 178.82 ? 5   ASP A OD1   1 
ATOM 1250 O OD2   . ASP E 5 5   ? -41.375 -23.948 -60.509 1.00 176.80 ? 5   ASP A OD2   1 
ATOM 1251 N N     . SER E 5 6   ? -37.627 -27.204 -58.734 1.00 159.62 ? 6   SER A N     1 
ATOM 1252 C CA    . SER E 5 6   ? -37.054 -28.518 -58.460 1.00 150.95 ? 6   SER A CA    1 
ATOM 1253 C C     . SER E 5 6   ? -36.245 -28.582 -57.167 1.00 142.42 ? 6   SER A C     1 
ATOM 1254 O O     . SER E 5 6   ? -36.139 -29.640 -56.555 1.00 138.28 ? 6   SER A O     1 
ATOM 1255 C CB    . SER E 5 6   ? -36.164 -28.950 -59.622 1.00 153.59 ? 6   SER A CB    1 
ATOM 1256 O OG    . SER E 5 6   ? -34.933 -28.247 -59.589 1.00 155.54 ? 6   SER A OG    1 
ATOM 1257 N N     . LEU E 5 7   ? -35.661 -27.465 -56.755 1.00 139.94 ? 7   LEU A N     1 
ATOM 1258 C CA    . LEU E 5 7   ? -34.845 -27.458 -55.540 1.00 136.33 ? 7   LEU A CA    1 
ATOM 1259 C C     . LEU E 5 7   ? -35.643 -27.409 -54.215 1.00 132.96 ? 7   LEU A C     1 
ATOM 1260 O O     . LEU E 5 7   ? -35.049 -27.490 -53.137 1.00 128.30 ? 7   LEU A O     1 
ATOM 1261 C CB    . LEU E 5 7   ? -33.773 -26.358 -55.602 1.00 136.18 ? 7   LEU A CB    1 
ATOM 1262 C CG    . LEU E 5 7   ? -32.572 -26.571 -54.671 1.00 132.95 ? 7   LEU A CG    1 
ATOM 1263 C CD1   . LEU E 5 7   ? -32.499 -28.021 -54.266 1.00 131.31 ? 7   LEU A CD1   1 
ATOM 1264 C CD2   . LEU E 5 7   ? -31.262 -26.131 -55.312 1.00 133.23 ? 7   LEU A CD2   1 
ATOM 1265 N N     . LEU E 5 8   ? -36.968 -27.271 -54.287 1.00 133.82 ? 8   LEU A N     1 
ATOM 1266 C CA    . LEU E 5 8   ? -37.796 -27.332 -53.078 1.00 132.48 ? 8   LEU A CA    1 
ATOM 1267 C C     . LEU E 5 8   ? -38.379 -28.715 -52.793 1.00 134.04 ? 8   LEU A C     1 
ATOM 1268 O O     . LEU E 5 8   ? -38.968 -28.918 -51.733 1.00 132.72 ? 8   LEU A O     1 
ATOM 1269 C CB    . LEU E 5 8   ? -38.914 -26.300 -53.126 1.00 128.17 ? 8   LEU A CB    1 
ATOM 1270 C CG    . LEU E 5 8   ? -38.369 -24.885 -53.152 1.00 122.03 ? 8   LEU A CG    1 
ATOM 1271 C CD1   . LEU E 5 8   ? -38.355 -24.380 -54.583 1.00 122.33 ? 8   LEU A CD1   1 
ATOM 1272 C CD2   . LEU E 5 8   ? -39.215 -24.007 -52.266 1.00 118.84 ? 8   LEU A CD2   1 
ATOM 1273 N N     . LYS E 5 9   ? -38.212 -29.653 -53.734 1.00 136.28 ? 9   LYS A N     1 
ATOM 1274 C CA    . LYS E 5 9   ? -38.464 -31.080 -53.467 1.00 137.54 ? 9   LYS A CA    1 
ATOM 1275 C C     . LYS E 5 9   ? -37.552 -31.524 -52.370 1.00 138.41 ? 9   LYS A C     1 
ATOM 1276 O O     . LYS E 5 9   ? -37.948 -32.302 -51.506 1.00 139.70 ? 9   LYS A O     1 
ATOM 1277 C CB    . LYS E 5 9   ? -38.167 -32.011 -54.672 1.00 174.29 ? 9   LYS A CB    1 
ATOM 1278 C CG    . LYS E 5 9   ? -36.626 -32.249 -54.955 1.00 201.53 ? 9   LYS A CG    1 
ATOM 1279 C CD    . LYS E 5 9   ? -36.188 -33.749 -55.169 1.00 187.80 ? 9   LYS A CD    1 
ATOM 1280 C CE    . LYS E 5 9   ? -34.707 -33.992 -55.130 1.00 187.11 ? 9   LYS A CE    1 
ATOM 1281 N NZ    . LYS E 5 9   ? -34.242 -34.287 -53.737 1.00 186.77 ? 9   LYS A NZ    1 
ATOM 1282 N N     . GLU E 5 10  ? -36.313 -31.042 -52.446 1.00 137.20 ? 10  GLU A N     1 
ATOM 1283 C CA    . GLU E 5 10  ? -35.196 -31.582 -51.669 1.00 135.45 ? 10  GLU A CA    1 
ATOM 1284 C C     . GLU E 5 10  ? -35.330 -31.307 -50.168 1.00 134.91 ? 10  GLU A C     1 
ATOM 1285 O O     . GLU E 5 10  ? -34.472 -31.680 -49.366 1.00 134.77 ? 10  GLU A O     1 
ATOM 1286 C CB    . GLU E 5 10  ? -33.836 -31.095 -52.209 1.00 137.21 ? 10  GLU A CB    1 
ATOM 1287 C CG    . GLU E 5 10  ? -33.501 -31.522 -53.655 1.00 139.27 ? 10  GLU A CG    1 
ATOM 1288 C CD    . GLU E 5 10  ? -32.080 -31.125 -54.107 1.00 143.38 ? 10  GLU A CD    1 
ATOM 1289 O OE1   . GLU E 5 10  ? -31.283 -30.622 -53.280 1.00 143.38 ? 10  GLU A OE1   1 
ATOM 1290 O OE2   . GLU E 5 10  ? -31.754 -31.313 -55.300 1.00 146.25 ? 10  GLU A OE2   1 
ATOM 1291 N N     . LEU E 5 11  ? -36.394 -30.592 -49.829 1.00 132.84 ? 11  LEU A N     1 
ATOM 1292 C CA    . LEU E 5 11  ? -36.630 -30.010 -48.523 1.00 133.52 ? 11  LEU A CA    1 
ATOM 1293 C C     . LEU E 5 11  ? -37.831 -30.702 -47.908 1.00 127.40 ? 11  LEU A C     1 
ATOM 1294 O O     . LEU E 5 11  ? -38.689 -31.202 -48.649 1.00 129.91 ? 11  LEU A O     1 
ATOM 1295 C CB    . LEU E 5 11  ? -36.938 -28.520 -48.761 1.00 141.16 ? 11  LEU A CB    1 
ATOM 1296 C CG    . LEU E 5 11  ? -37.038 -27.330 -47.810 1.00 149.65 ? 11  LEU A CG    1 
ATOM 1297 C CD1   . LEU E 5 11  ? -38.247 -27.515 -47.005 1.00 153.72 ? 11  LEU A CD1   1 
ATOM 1298 C CD2   . LEU E 5 11  ? -35.888 -27.149 -46.859 1.00 149.82 ? 11  LEU A CD2   1 
ATOM 1299 N N     . PRO E 5 12  ? -37.913 -30.700 -46.557 1.00 123.12 ? 12  PRO A N     1 
ATOM 1300 C CA    . PRO E 5 12  ? -39.085 -31.294 -45.901 1.00 120.97 ? 12  PRO A CA    1 
ATOM 1301 C C     . PRO E 5 12  ? -40.346 -30.620 -46.430 1.00 124.97 ? 12  PRO A C     1 
ATOM 1302 O O     . PRO E 5 12  ? -40.338 -29.398 -46.498 1.00 123.64 ? 12  PRO A O     1 
ATOM 1303 C CB    . PRO E 5 12  ? -38.866 -30.971 -44.413 1.00 118.22 ? 12  PRO A CB    1 
ATOM 1304 C CG    . PRO E 5 12  ? -37.390 -30.537 -44.265 1.00 115.79 ? 12  PRO A CG    1 
ATOM 1305 C CD    . PRO E 5 12  ? -36.759 -30.578 -45.640 1.00 117.55 ? 12  PRO A CD    1 
ATOM 1306 N N     . THR E 5 13  ? -41.391 -31.374 -46.779 1.00 126.14 ? 13  THR A N     1 
ATOM 1307 C CA    . THR E 5 13  ? -42.573 -30.795 -47.422 1.00 129.49 ? 13  THR A CA    1 
ATOM 1308 C C     . THR E 5 13  ? -43.085 -29.524 -46.727 1.00 137.06 ? 13  THR A C     1 
ATOM 1309 O O     . THR E 5 13  ? -43.336 -28.506 -47.386 1.00 142.58 ? 13  THR A O     1 
ATOM 1310 C CB    . THR E 5 13  ? -43.719 -31.825 -47.582 1.00 122.63 ? 13  THR A CB    1 
ATOM 1311 O OG1   . THR E 5 13  ? -44.017 -32.421 -46.315 1.00 124.17 ? 13  THR A OG1   1 
ATOM 1312 C CG2   . THR E 5 13  ? -43.339 -32.906 -48.572 1.00 117.07 ? 13  THR A CG2   1 
ATOM 1313 N N     . ARG E 5 14  ? -43.224 -29.580 -45.406 1.00 139.84 ? 14  ARG A N     1 
ATOM 1314 C CA    . ARG E 5 14  ? -43.746 -28.452 -44.634 1.00 141.37 ? 14  ARG A CA    1 
ATOM 1315 C C     . ARG E 5 14  ? -42.991 -27.113 -44.844 1.00 110.35 ? 14  ARG A C     1 
ATOM 1316 O O     . ARG E 5 14  ? -43.583 -26.100 -45.257 1.00 112.55 ? 14  ARG A O     1 
ATOM 1317 C CB    . ARG E 5 14  ? -43.805 -28.839 -43.148 1.00 141.89 ? 14  ARG A CB    1 
ATOM 1318 C CG    . ARG E 5 14  ? -44.429 -27.805 -42.234 1.00 143.45 ? 14  ARG A CG    1 
ATOM 1319 C CD    . ARG E 5 14  ? -45.649 -27.161 -42.876 1.00 142.99 ? 14  ARG A CD    1 
ATOM 1320 N NE    . ARG E 5 14  ? -46.251 -26.117 -42.054 1.00 139.52 ? 14  ARG A NE    1 
ATOM 1321 C CZ    . ARG E 5 14  ? -47.248 -25.340 -42.460 1.00 139.74 ? 14  ARG A CZ    1 
ATOM 1322 N NH1   . ARG E 5 14  ? -47.751 -25.483 -43.679 1.00 145.70 ? 14  ARG A NH1   1 
ATOM 1323 N NH2   . ARG E 5 14  ? -47.739 -24.418 -41.649 1.00 134.46 ? 14  ARG A NH2   1 
ATOM 1324 N N     . THR E 5 15  ? -41.685 -27.111 -44.600 1.00 106.01 ? 15  THR A N     1 
ATOM 1325 C CA    . THR E 5 15  ? -40.873 -25.905 -44.789 1.00 102.58 ? 15  THR A CA    1 
ATOM 1326 C C     . THR E 5 15  ? -40.811 -25.475 -46.262 1.00 102.37 ? 15  THR A C     1 
ATOM 1327 O O     . THR E 5 15  ? -40.890 -24.287 -46.576 1.00 102.35 ? 15  THR A O     1 
ATOM 1328 C CB    . THR E 5 15  ? -39.455 -26.076 -44.177 1.00 74.51  ? 15  THR A CB    1 
ATOM 1329 O OG1   . THR E 5 15  ? -39.462 -25.639 -42.809 1.00 82.83  ? 15  THR A OG1   1 
ATOM 1330 C CG2   . THR E 5 15  ? -38.423 -25.268 -44.940 1.00 71.83  ? 15  THR A CG2   1 
ATOM 1331 N N     . ALA E 5 16  ? -40.692 -26.444 -47.165 1.00 102.31 ? 16  ALA A N     1 
ATOM 1332 C CA    . ALA E 5 16  ? -40.653 -26.147 -48.596 1.00 103.51 ? 16  ALA A CA    1 
ATOM 1333 C C     . ALA E 5 16  ? -41.903 -25.355 -48.913 1.00 106.26 ? 16  ALA A C     1 
ATOM 1334 O O     . ALA E 5 16  ? -41.894 -24.425 -49.718 1.00 110.31 ? 16  ALA A O     1 
ATOM 1335 C CB    . ALA E 5 16  ? -40.607 -27.431 -49.411 1.00 102.35 ? 16  ALA A CB    1 
ATOM 1336 N N     . HIS E 5 17  ? -42.971 -25.718 -48.207 1.00 105.34 ? 17  HIS A N     1 
ATOM 1337 C CA    . HIS E 5 17  ? -44.270 -25.105 -48.383 1.00 107.63 ? 17  HIS A CA    1 
ATOM 1338 C C     . HIS E 5 17  ? -44.284 -23.674 -47.888 1.00 107.18 ? 17  HIS A C     1 
ATOM 1339 O O     . HIS E 5 17  ? -44.599 -22.737 -48.633 1.00 106.92 ? 17  HIS A O     1 
ATOM 1340 C CB    . HIS E 5 17  ? -45.323 -25.890 -47.608 1.00 108.87 ? 17  HIS A CB    1 
ATOM 1341 C CG    . HIS E 5 17  ? -46.709 -25.345 -47.752 1.00 113.72 ? 17  HIS A CG    1 
ATOM 1342 N ND1   . HIS E 5 17  ? -47.087 -24.539 -48.804 1.00 118.87 ? 17  HIS A ND1   1 
ATOM 1343 C CD2   . HIS E 5 17  ? -47.809 -25.495 -46.979 1.00 115.00 ? 17  HIS A CD2   1 
ATOM 1344 C CE1   . HIS E 5 17  ? -48.362 -24.215 -48.672 1.00 120.17 ? 17  HIS A CE1   1 
ATOM 1345 N NE2   . HIS E 5 17  ? -48.822 -24.783 -47.572 1.00 118.74 ? 17  HIS A NE2   1 
ATOM 1346 N N     . LEU E 5 18  ? -43.963 -23.497 -46.608 1.00 102.73 ? 18  LEU A N     1 
ATOM 1347 C CA    . LEU E 5 18  ? -43.894 -22.138 -46.076 1.00 98.62  ? 18  LEU A CA    1 
ATOM 1348 C C     . LEU E 5 18  ? -43.075 -21.251 -47.015 1.00 97.83  ? 18  LEU A C     1 
ATOM 1349 O O     . LEU E 5 18  ? -43.532 -20.192 -47.414 1.00 100.80 ? 18  LEU A O     1 
ATOM 1350 C CB    . LEU E 5 18  ? -43.292 -22.134 -44.669 1.00 93.37  ? 18  LEU A CB    1 
ATOM 1351 C CG    . LEU E 5 18  ? -42.799 -20.829 -44.022 1.00 88.02  ? 18  LEU A CG    1 
ATOM 1352 C CD1   . LEU E 5 18  ? -41.290 -20.596 -44.202 1.00 85.41  ? 18  LEU A CD1   1 
ATOM 1353 C CD2   . LEU E 5 18  ? -43.609 -19.608 -44.463 1.00 88.18  ? 18  LEU A CD2   1 
ATOM 1354 N N     . TYR E 5 19  ? -41.882 -21.703 -47.386 1.00 96.33  ? 19  TYR A N     1 
ATOM 1355 C CA    . TYR E 5 19  ? -41.033 -20.949 -48.297 1.00 95.31  ? 19  TYR A CA    1 
ATOM 1356 C C     . TYR E 5 19  ? -41.796 -20.591 -49.559 1.00 103.98 ? 19  TYR A C     1 
ATOM 1357 O O     . TYR E 5 19  ? -41.733 -19.465 -50.010 1.00 107.81 ? 19  TYR A O     1 
ATOM 1358 C CB    . TYR E 5 19  ? -39.737 -21.708 -48.630 1.00 84.05  ? 19  TYR A CB    1 
ATOM 1359 C CG    . TYR E 5 19  ? -38.711 -21.745 -47.522 1.00 75.65  ? 19  TYR A CG    1 
ATOM 1360 C CD1   . TYR E 5 19  ? -39.088 -21.718 -46.187 1.00 72.77  ? 19  TYR A CD1   1 
ATOM 1361 C CD2   . TYR E 5 19  ? -37.359 -21.802 -47.814 1.00 72.65  ? 19  TYR A CD2   1 
ATOM 1362 C CE1   . TYR E 5 19  ? -38.149 -21.754 -45.177 1.00 69.88  ? 19  TYR A CE1   1 
ATOM 1363 C CE2   . TYR E 5 19  ? -36.405 -21.837 -46.798 1.00 71.28  ? 19  TYR A CE2   1 
ATOM 1364 C CZ    . TYR E 5 19  ? -36.817 -21.812 -45.482 1.00 69.64  ? 19  TYR A CZ    1 
ATOM 1365 O OH    . TYR E 5 19  ? -35.903 -21.848 -44.457 1.00 69.32  ? 19  TYR A OH    1 
ATOM 1366 N N     . ARG E 5 20  ? -42.523 -21.543 -50.131 1.00 109.95 ? 20  ARG A N     1 
ATOM 1367 C CA    . ARG E 5 20  ? -43.371 -21.204 -51.270 1.00 115.14 ? 20  ARG A CA    1 
ATOM 1368 C C     . ARG E 5 20  ? -44.237 -19.986 -50.952 1.00 120.75 ? 20  ARG A C     1 
ATOM 1369 O O     . ARG E 5 20  ? -44.240 -19.002 -51.696 1.00 123.24 ? 20  ARG A O     1 
ATOM 1370 C CB    . ARG E 5 20  ? -44.256 -22.384 -51.689 1.00 118.53 ? 20  ARG A CB    1 
ATOM 1371 C CG    . ARG E 5 20  ? -43.515 -23.434 -52.507 1.00 121.31 ? 20  ARG A CG    1 
ATOM 1372 C CD    . ARG E 5 20  ? -44.468 -24.269 -53.347 1.00 126.30 ? 20  ARG A CD    1 
ATOM 1373 N NE    . ARG E 5 20  ? -44.393 -25.679 -52.990 1.00 131.53 ? 20  ARG A NE    1 
ATOM 1374 C CZ    . ARG E 5 20  ? -45.257 -26.291 -52.187 1.00 141.55 ? 20  ARG A CZ    1 
ATOM 1375 N NH1   . ARG E 5 20  ? -46.274 -25.618 -51.668 1.00 149.42 ? 20  ARG A NH1   1 
ATOM 1376 N NH2   . ARG E 5 20  ? -45.109 -27.578 -51.910 1.00 142.83 ? 20  ARG A NH2   1 
ATOM 1377 N N     . SER E 5 21  ? -44.949 -20.041 -49.828 1.00 121.43 ? 21  SER A N     1 
ATOM 1378 C CA    . SER E 5 21  ? -45.831 -18.928 -49.417 1.00 117.88 ? 21  SER A CA    1 
ATOM 1379 C C     . SER E 5 21  ? -45.116 -17.585 -49.173 1.00 113.17 ? 21  SER A C     1 
ATOM 1380 O O     . SER E 5 21  ? -45.466 -16.577 -49.791 1.00 117.55 ? 21  SER A O     1 
ATOM 1381 C CB    . SER E 5 21  ? -46.656 -19.314 -48.187 1.00 122.45 ? 21  SER A CB    1 
ATOM 1382 O OG    . SER E 5 21  ? -45.822 -19.642 -47.092 1.00 125.22 ? 21  SER A OG    1 
ATOM 1383 N N     . ILE E 5 22  ? -44.120 -17.582 -48.284 1.00 102.59 ? 22  ILE A N     1 
ATOM 1384 C CA    . ILE E 5 22  ? -43.278 -16.422 -48.020 1.00 95.74  ? 22  ILE A CA    1 
ATOM 1385 C C     . ILE E 5 22  ? -42.954 -15.834 -49.367 1.00 98.86  ? 22  ILE A C     1 
ATOM 1386 O O     . ILE E 5 22  ? -43.250 -14.681 -49.651 1.00 97.96  ? 22  ILE A O     1 
ATOM 1387 C CB    . ILE E 5 22  ? -41.914 -16.832 -47.430 1.00 85.57  ? 22  ILE A CB    1 
ATOM 1388 C CG1   . ILE E 5 22  ? -41.923 -16.852 -45.896 1.00 81.74  ? 22  ILE A CG1   1 
ATOM 1389 C CG2   . ILE E 5 22  ? -40.840 -15.880 -47.921 1.00 82.98  ? 22  ILE A CG2   1 
ATOM 1390 C CD1   . ILE E 5 22  ? -40.667 -17.454 -45.313 1.00 79.40  ? 22  ILE A CD1   1 
ATOM 1391 N N     . TRP E 5 23  ? -42.317 -16.653 -50.190 1.00 106.45 ? 23  TRP A N     1 
ATOM 1392 C CA    . TRP E 5 23  ? -41.919 -16.271 -51.526 1.00 116.48 ? 23  TRP A CA    1 
ATOM 1393 C C     . TRP E 5 23  ? -43.029 -15.502 -52.219 1.00 117.78 ? 23  TRP A C     1 
ATOM 1394 O O     . TRP E 5 23  ? -42.853 -14.340 -52.590 1.00 119.29 ? 23  TRP A O     1 
ATOM 1395 C CB    . TRP E 5 23  ? -41.587 -17.525 -52.350 1.00 123.56 ? 23  TRP A CB    1 
ATOM 1396 C CG    . TRP E 5 23  ? -41.111 -17.180 -53.717 1.00 131.20 ? 23  TRP A CG    1 
ATOM 1397 C CD1   . TRP E 5 23  ? -41.759 -17.398 -54.902 1.00 134.58 ? 23  TRP A CD1   1 
ATOM 1398 C CD2   . TRP E 5 23  ? -39.882 -16.527 -54.051 1.00 136.25 ? 23  TRP A CD2   1 
ATOM 1399 N NE1   . TRP E 5 23  ? -40.999 -16.932 -55.949 1.00 137.81 ? 23  TRP A NE1   1 
ATOM 1400 C CE2   . TRP E 5 23  ? -39.837 -16.385 -55.448 1.00 137.93 ? 23  TRP A CE2   1 
ATOM 1401 C CE3   . TRP E 5 23  ? -38.804 -16.047 -53.291 1.00 136.69 ? 23  TRP A CE3   1 
ATOM 1402 C CZ2   . TRP E 5 23  ? -38.759 -15.786 -56.112 1.00 138.22 ? 23  TRP A CZ2   1 
ATOM 1403 C CZ3   . TRP E 5 23  ? -37.736 -15.453 -53.949 1.00 136.75 ? 23  TRP A CZ3   1 
ATOM 1404 C CH2   . TRP E 5 23  ? -37.722 -15.328 -55.340 1.00 136.86 ? 23  TRP A CH2   1 
ATOM 1405 N N     . HIS E 5 24  ? -44.160 -16.172 -52.420 1.00 116.85 ? 24  HIS A N     1 
ATOM 1406 C CA    . HIS E 5 24  ? -45.301 -15.563 -53.094 1.00 115.53 ? 24  HIS A CA    1 
ATOM 1407 C C     . HIS E 5 24  ? -45.617 -14.166 -52.542 1.00 120.80 ? 24  HIS A C     1 
ATOM 1408 O O     . HIS E 5 24  ? -45.796 -13.217 -53.304 1.00 126.13 ? 24  HIS A O     1 
ATOM 1409 C CB    . HIS E 5 24  ? -46.534 -16.459 -52.990 1.00 112.88 ? 24  HIS A CB    1 
ATOM 1410 C CG    . HIS E 5 24  ? -47.695 -15.972 -53.792 1.00 116.26 ? 24  HIS A CG    1 
ATOM 1411 N ND1   . HIS E 5 24  ? -47.836 -16.245 -55.136 1.00 119.73 ? 24  HIS A ND1   1 
ATOM 1412 C CD2   . HIS E 5 24  ? -48.765 -15.220 -53.445 1.00 119.08 ? 24  HIS A CD2   1 
ATOM 1413 C CE1   . HIS E 5 24  ? -48.950 -15.686 -55.579 1.00 126.19 ? 24  HIS A CE1   1 
ATOM 1414 N NE2   . HIS E 5 24  ? -49.529 -15.058 -54.572 1.00 124.78 ? 24  HIS A NE2   1 
ATOM 1415 N N     . LYS E 5 25  ? -45.681 -14.031 -51.224 1.00 118.84 ? 25  LYS A N     1 
ATOM 1416 C CA    . LYS E 5 25  ? -45.878 -12.716 -50.644 1.00 115.63 ? 25  LYS A CA    1 
ATOM 1417 C C     . LYS E 5 25  ? -44.789 -11.750 -51.119 1.00 115.87 ? 25  LYS A C     1 
ATOM 1418 O O     . LYS E 5 25  ? -45.067 -10.821 -51.860 1.00 119.37 ? 25  LYS A O     1 
ATOM 1419 C CB    . LYS E 5 25  ? -45.912 -12.813 -49.121 1.00 112.12 ? 25  LYS A CB    1 
ATOM 1420 C CG    . LYS E 5 25  ? -46.267 -11.516 -48.425 1.00 110.89 ? 25  LYS A CG    1 
ATOM 1421 C CD    . LYS E 5 25  ? -47.713 -11.501 -47.967 1.00 110.04 ? 25  LYS A CD    1 
ATOM 1422 C CE    . LYS E 5 25  ? -47.894 -10.593 -46.754 1.00 109.66 ? 25  LYS A CE    1 
ATOM 1423 N NZ    . LYS E 5 25  ? -47.253 -11.138 -45.521 1.00 107.62 ? 25  LYS A NZ    1 
ATOM 1424 N N     . TYR E 5 26  ? -43.546 -12.005 -50.723 1.00 112.10 ? 26  TYR A N     1 
ATOM 1425 C CA    . TYR E 5 26  ? -42.429 -11.103 -50.998 1.00 110.31 ? 26  TYR A CA    1 
ATOM 1426 C C     . TYR E 5 26  ? -42.374 -10.623 -52.446 1.00 111.70 ? 26  TYR A C     1 
ATOM 1427 O O     . TYR E 5 26  ? -42.115 -9.442  -52.698 1.00 113.53 ? 26  TYR A O     1 
ATOM 1428 C CB    . TYR E 5 26  ? -41.113 -11.774 -50.618 1.00 106.20 ? 26  TYR A CB    1 
ATOM 1429 C CG    . TYR E 5 26  ? -39.891 -10.964 -50.944 1.00 103.25 ? 26  TYR A CG    1 
ATOM 1430 C CD1   . TYR E 5 26  ? -39.735 -9.678  -50.452 1.00 101.40 ? 26  TYR A CD1   1 
ATOM 1431 C CD2   . TYR E 5 26  ? -38.882 -11.492 -51.729 1.00 102.72 ? 26  TYR A CD2   1 
ATOM 1432 C CE1   . TYR E 5 26  ? -38.608 -8.937  -50.744 1.00 100.69 ? 26  TYR A CE1   1 
ATOM 1433 C CE2   . TYR E 5 26  ? -37.753 -10.757 -52.025 1.00 101.73 ? 26  TYR A CE2   1 
ATOM 1434 C CZ    . TYR E 5 26  ? -37.619 -9.483  -51.531 1.00 99.51  ? 26  TYR A CZ    1 
ATOM 1435 O OH    . TYR E 5 26  ? -36.490 -8.762  -51.829 1.00 96.88  ? 26  TYR A OH    1 
ATOM 1436 N N     . THR E 5 27  ? -42.578 -11.534 -53.394 1.00 111.13 ? 27  THR A N     1 
ATOM 1437 C CA    . THR E 5 27  ? -42.752 -11.139 -54.790 1.00 111.86 ? 27  THR A CA    1 
ATOM 1438 C C     . THR E 5 27  ? -43.966 -10.222 -54.970 1.00 120.37 ? 27  THR A C     1 
ATOM 1439 O O     . THR E 5 27  ? -43.829 -9.054  -55.328 1.00 122.40 ? 27  THR A O     1 
ATOM 1440 C CB    . THR E 5 27  ? -42.936 -12.348 -55.708 1.00 106.03 ? 27  THR A CB    1 
ATOM 1441 O OG1   . THR E 5 27  ? -44.237 -12.900 -55.489 1.00 107.58 ? 27  THR A OG1   1 
ATOM 1442 C CG2   . THR E 5 27  ? -41.882 -13.405 -55.435 1.00 102.69 ? 27  THR A CG2   1 
ATOM 1443 N N     . GLU E 5 28  ? -45.155 -10.764 -54.702 1.00 128.46 ? 28  GLU A N     1 
ATOM 1444 C CA    . GLU E 5 28  ? -46.430 -10.064 -54.936 1.00 137.54 ? 28  GLU A CA    1 
ATOM 1445 C C     . GLU E 5 28  ? -46.448 -8.658  -54.346 1.00 140.34 ? 28  GLU A C     1 
ATOM 1446 O O     . GLU E 5 28  ? -47.251 -7.809  -54.742 1.00 142.96 ? 28  GLU A O     1 
ATOM 1447 C CB    . GLU E 5 28  ? -47.597 -10.871 -54.352 1.00 143.86 ? 28  GLU A CB    1 
ATOM 1448 C CG    . GLU E 5 28  ? -48.462 -11.547 -55.396 1.00 150.04 ? 28  GLU A CG    1 
ATOM 1449 C CD    . GLU E 5 28  ? -47.645 -12.188 -56.493 1.00 155.84 ? 28  GLU A CD    1 
ATOM 1450 O OE1   . GLU E 5 28  ? -48.147 -12.271 -57.633 1.00 157.84 ? 28  GLU A OE1   1 
ATOM 1451 O OE2   . GLU E 5 28  ? -46.498 -12.599 -56.220 1.00 158.21 ? 28  GLU A OE2   1 
ATOM 1452 N N     . TRP E 5 29  ? -45.582 -8.465  -53.359 1.00 137.96 ? 29  TRP A N     1 
ATOM 1453 C CA    . TRP E 5 29  ? -45.242 -7.185  -52.758 1.00 133.48 ? 29  TRP A CA    1 
ATOM 1454 C C     . TRP E 5 29  ? -44.320 -6.439  -53.704 1.00 132.70 ? 29  TRP A C     1 
ATOM 1455 O O     . TRP E 5 29  ? -44.623 -5.331  -54.129 1.00 132.94 ? 29  TRP A O     1 
ATOM 1456 C CB    . TRP E 5 29  ? -44.530 -7.414  -51.425 1.00 129.88 ? 29  TRP A CB    1 
ATOM 1457 C CG    . TRP E 5 29  ? -44.083 -6.154  -50.745 1.00 127.34 ? 29  TRP A CG    1 
ATOM 1458 C CD1   . TRP E 5 29  ? -44.868 -5.270  -50.071 1.00 127.21 ? 29  TRP A CD1   1 
ATOM 1459 C CD2   . TRP E 5 29  ? -42.740 -5.652  -50.650 1.00 124.12 ? 29  TRP A CD2   1 
ATOM 1460 N NE1   . TRP E 5 29  ? -44.103 -4.243  -49.571 1.00 126.14 ? 29  TRP A NE1   1 
ATOM 1461 C CE2   . TRP E 5 29  ? -42.794 -4.456  -49.912 1.00 123.89 ? 29  TRP A CE2   1 
ATOM 1462 C CE3   . TRP E 5 29  ? -41.501 -6.096  -51.121 1.00 121.71 ? 29  TRP A CE3   1 
ATOM 1463 C CZ2   . TRP E 5 29  ? -41.655 -3.699  -49.637 1.00 121.67 ? 29  TRP A CZ2   1 
ATOM 1464 C CZ3   . TRP E 5 29  ? -40.370 -5.340  -50.844 1.00 119.31 ? 29  TRP A CZ3   1 
ATOM 1465 C CH2   . TRP E 5 29  ? -40.457 -4.159  -50.111 1.00 119.30 ? 29  TRP A CH2   1 
ATOM 1466 N N     . LEU E 5 30  ? -43.190 -7.073  -54.014 1.00 132.52 ? 30  LEU A N     1 
ATOM 1467 C CA    . LEU E 5 30  ? -42.120 -6.507  -54.836 1.00 135.02 ? 30  LEU A CA    1 
ATOM 1468 C C     . LEU E 5 30  ? -42.655 -5.981  -56.155 1.00 140.82 ? 30  LEU A C     1 
ATOM 1469 O O     . LEU E 5 30  ? -41.978 -5.252  -56.876 1.00 142.04 ? 30  LEU A O     1 
ATOM 1470 C CB    . LEU E 5 30  ? -41.075 -7.582  -55.119 1.00 132.32 ? 30  LEU A CB    1 
ATOM 1471 C CG    . LEU E 5 30  ? -39.613 -7.171  -55.259 1.00 132.16 ? 30  LEU A CG    1 
ATOM 1472 C CD1   . LEU E 5 30  ? -39.152 -6.481  -53.996 1.00 131.89 ? 30  LEU A CD1   1 
ATOM 1473 C CD2   . LEU E 5 30  ? -38.749 -8.392  -55.543 1.00 133.81 ? 30  LEU A CD2   1 
ATOM 1474 N N     . LYS E 5 31  ? -43.879 -6.375  -56.464 1.00 146.05 ? 31  LYS A N     1 
ATOM 1475 C CA    . LYS E 5 31  ? -44.576 -5.895  -57.640 1.00 152.68 ? 31  LYS A CA    1 
ATOM 1476 C C     . LYS E 5 31  ? -45.102 -4.491  -57.341 1.00 160.06 ? 31  LYS A C     1 
ATOM 1477 O O     . LYS E 5 31  ? -45.753 -3.865  -58.180 1.00 162.03 ? 31  LYS A O     1 
ATOM 1478 C CB    . LYS E 5 31  ? -45.729 -6.849  -57.943 1.00 152.07 ? 31  LYS A CB    1 
ATOM 1479 C CG    . LYS E 5 31  ? -46.471 -6.595  -59.234 1.00 151.35 ? 31  LYS A CG    1 
ATOM 1480 C CD    . LYS E 5 31  ? -45.511 -6.497  -60.393 1.00 152.09 ? 31  LYS A CD    1 
ATOM 1481 C CE    . LYS E 5 31  ? -46.253 -6.276  -61.694 1.00 157.65 ? 31  LYS A CE    1 
ATOM 1482 N NZ    . LYS E 5 31  ? -47.707 -6.013  -61.495 1.00 163.06 ? 31  LYS A NZ    1 
ATOM 1483 N N     . THR E 5 32  ? -44.834 -4.006  -56.131 1.00 163.94 ? 32  THR A N     1 
ATOM 1484 C CA    . THR E 5 32  ? -45.247 -2.659  -55.745 1.00 167.09 ? 32  THR A CA    1 
ATOM 1485 C C     . THR E 5 32  ? -44.121 -1.644  -55.982 1.00 172.37 ? 32  THR A C     1 
ATOM 1486 O O     . THR E 5 32  ? -44.316 -0.460  -55.796 1.00 172.04 ? 32  THR A O     1 
ATOM 1487 C CB    . THR E 5 32  ? -45.705 -2.613  -54.265 1.00 166.16 ? 32  THR A CB    1 
ATOM 1488 O OG1   . THR E 5 32  ? -46.959 -3.290  -54.136 1.00 166.02 ? 32  THR A OG1   1 
ATOM 1489 C CG2   . THR E 5 32  ? -45.857 -1.170  -53.763 1.00 166.70 ? 32  THR A CG2   1 
ATOM 1490 N N     . MET E 5 33  ? -42.954 -2.100  -56.428 1.00 179.43 ? 33  MET A N     1 
ATOM 1491 C CA    . MET E 5 33  ? -41.844 -1.175  -56.620 1.00 187.95 ? 33  MET A CA    1 
ATOM 1492 C C     . MET E 5 33  ? -41.432 -1.103  -58.090 1.00 192.01 ? 33  MET A C     1 
ATOM 1493 O O     . MET E 5 33  ? -41.948 -1.868  -58.900 1.00 194.25 ? 33  MET A O     1 
ATOM 1494 C CB    . MET E 5 33  ? -40.664 -1.581  -55.740 1.00 190.85 ? 33  MET A CB    1 
ATOM 1495 C CG    . MET E 5 33  ? -40.970 -1.579  -54.249 1.00 192.54 ? 33  MET A CG    1 
ATOM 1496 S SD    . MET E 5 33  ? -42.105 -0.255  -53.775 1.00 273.74 ? 33  MET A SD    1 
ATOM 1497 C CE    . MET E 5 33  ? -42.680 -0.830  -52.177 1.00 77.36  ? 33  MET A CE    1 
ATOM 1498 N N     . PRO E 5 34  ? -40.507 -0.196  -58.450 1.00 193.75 ? 34  PRO A N     1 
ATOM 1499 C CA    . PRO E 5 34  ? -40.213 -0.000  -59.869 1.00 196.99 ? 34  PRO A CA    1 
ATOM 1500 C C     . PRO E 5 34  ? -39.499 -1.156  -60.558 1.00 202.61 ? 34  PRO A C     1 
ATOM 1501 O O     . PRO E 5 34  ? -39.819 -1.499  -61.705 1.00 201.51 ? 34  PRO A O     1 
ATOM 1502 C CB    . PRO E 5 34  ? -39.321 1.259   -59.910 1.00 195.10 ? 34  PRO A CB    1 
ATOM 1503 C CG    . PRO E 5 34  ? -38.912 1.492   -58.489 1.00 194.29 ? 34  PRO A CG    1 
ATOM 1504 C CD    . PRO E 5 34  ? -39.550 0.506   -57.606 1.00 193.77 ? 34  PRO A CD    1 
ATOM 1505 N N     . ASP E 5 35  ? -38.566 -1.771  -59.845 1.00 210.58 ? 35  ASP A N     1 
ATOM 1506 C CA    . ASP E 5 35  ? -37.631 -2.721  -60.410 1.00 216.02 ? 35  ASP A CA    1 
ATOM 1507 C C     . ASP E 5 35  ? -36.784 -3.292  -59.292 1.00 219.67 ? 35  ASP A C     1 
ATOM 1508 O O     . ASP E 5 35  ? -36.892 -4.465  -58.955 1.00 221.04 ? 35  ASP A O     1 
ATOM 1509 C CB    . ASP E 5 35  ? -36.705 -2.016  -61.385 1.00 215.41 ? 35  ASP A CB    1 
ATOM 1510 C CG    . ASP E 5 35  ? -36.210 -0.675  -60.837 1.00 213.12 ? 35  ASP A CG    1 
ATOM 1511 O OD1   . ASP E 5 35  ? -35.517 0.056   -61.570 1.00 212.98 ? 35  ASP A OD1   1 
ATOM 1512 O OD2   . ASP E 5 35  ? -36.536 -0.342  -59.664 1.00 210.74 ? 35  ASP A OD2   1 
ATOM 1513 N N     . ASP E 5 40  ? -34.039 -9.471  -61.631 1.00 214.51 ? 40  ASP A N     1 
ATOM 1514 C CA    . ASP E 5 40  ? -35.006 -10.549 -61.917 1.00 212.18 ? 40  ASP A CA    1 
ATOM 1515 C C     . ASP E 5 40  ? -34.447 -11.932 -61.601 1.00 211.22 ? 40  ASP A C     1 
ATOM 1516 O O     . ASP E 5 40  ? -35.158 -12.919 -61.733 1.00 213.90 ? 40  ASP A O     1 
ATOM 1517 C CB    . ASP E 5 40  ? -35.427 -10.438 -63.376 1.00 214.55 ? 40  ASP A CB    1 
ATOM 1518 C CG    . ASP E 5 40  ? -36.873 -10.746 -63.629 1.00 217.34 ? 40  ASP A CG    1 
ATOM 1519 O OD1   . ASP E 5 40  ? -37.614 -11.188 -62.739 1.00 218.27 ? 40  ASP A OD1   1 
ATOM 1520 O OD2   . ASP E 5 40  ? -37.225 -10.573 -64.797 1.00 218.57 ? 40  ASP A OD2   1 
ATOM 1521 N N     . LEU E 5 41  ? -33.185 -12.006 -61.177 1.00 210.07 ? 41  LEU A N     1 
ATOM 1522 C CA    . LEU E 5 41  ? -32.727 -13.231 -60.526 1.00 208.07 ? 41  LEU A CA    1 
ATOM 1523 C C     . LEU E 5 41  ? -32.284 -12.879 -59.110 1.00 206.23 ? 41  LEU A C     1 
ATOM 1524 O O     . LEU E 5 41  ? -33.101 -12.895 -58.196 1.00 207.62 ? 41  LEU A O     1 
ATOM 1525 C CB    . LEU E 5 41  ? -31.572 -13.893 -61.308 1.00 205.21 ? 41  LEU A CB    1 
ATOM 1526 C CG    . LEU E 5 41  ? -32.033 -14.998 -62.285 1.00 201.67 ? 41  LEU A CG    1 
ATOM 1527 C CD1   . LEU E 5 41  ? -33.006 -14.436 -63.309 1.00 200.67 ? 41  LEU A CD1   1 
ATOM 1528 C CD2   . LEU E 5 41  ? -30.875 -15.716 -62.975 1.00 199.61 ? 41  LEU A CD2   1 
ATOM 1529 N N     . LYS E 5 42  ? -31.039 -12.440 -58.946 1.00 202.04 ? 42  LYS A N     1 
ATOM 1530 C CA    . LYS E 5 42  ? -30.520 -12.126 -57.616 1.00 196.11 ? 42  LYS A CA    1 
ATOM 1531 C C     . LYS E 5 42  ? -30.788 -10.732 -57.099 1.00 193.10 ? 42  LYS A C     1 
ATOM 1532 O O     . LYS E 5 42  ? -30.962 -10.532 -55.901 1.00 193.53 ? 42  LYS A O     1 
ATOM 1533 C CB    . LYS E 5 42  ? -29.039 -12.392 -57.547 1.00 191.27 ? 42  LYS A CB    1 
ATOM 1534 C CG    . LYS E 5 42  ? -28.550 -13.157 -58.699 1.00 185.74 ? 42  LYS A CG    1 
ATOM 1535 C CD    . LYS E 5 42  ? -27.197 -13.675 -58.384 1.00 180.33 ? 42  LYS A CD    1 
ATOM 1536 C CE    . LYS E 5 42  ? -26.507 -13.908 -59.662 1.00 177.48 ? 42  LYS A CE    1 
ATOM 1537 N NZ    . LYS E 5 42  ? -27.444 -14.591 -60.603 1.00 176.89 ? 42  LYS A NZ    1 
ATOM 1538 N N     . LEU E 5 43  ? -30.739 -9.753  -57.987 1.00 190.74 ? 43  LEU A N     1 
ATOM 1539 C CA    . LEU E 5 43  ? -30.914 -8.380  -57.554 1.00 188.01 ? 43  LEU A CA    1 
ATOM 1540 C C     . LEU E 5 43  ? -32.247 -8.234  -56.834 1.00 185.47 ? 43  LEU A C     1 
ATOM 1541 O O     . LEU E 5 43  ? -32.464 -7.278  -56.094 1.00 183.01 ? 43  LEU A O     1 
ATOM 1542 C CB    . LEU E 5 43  ? -30.845 -7.429  -58.739 1.00 185.79 ? 43  LEU A CB    1 
ATOM 1543 C CG    . LEU E 5 43  ? -31.428 -8.014  -60.018 1.00 181.92 ? 43  LEU A CG    1 
ATOM 1544 C CD1   . LEU E 5 43  ? -32.165 -6.962  -60.830 1.00 181.11 ? 43  LEU A CD1   1 
ATOM 1545 C CD2   . LEU E 5 43  ? -30.314 -8.642  -60.820 1.00 179.57 ? 43  LEU A CD2   1 
ATOM 1546 N N     . PHE E 5 44  ? -33.140 -9.194  -57.038 1.00 185.48 ? 44  PHE A N     1 
ATOM 1547 C CA    . PHE E 5 44  ? -34.412 -9.181  -56.329 1.00 184.34 ? 44  PHE A CA    1 
ATOM 1548 C C     . PHE E 5 44  ? -34.182 -9.372  -54.856 1.00 179.16 ? 44  PHE A C     1 
ATOM 1549 O O     . PHE E 5 44  ? -34.987 -8.953  -54.017 1.00 181.87 ? 44  PHE A O     1 
ATOM 1550 C CB    . PHE E 5 44  ? -35.337 -10.249 -56.872 1.00 187.05 ? 44  PHE A CB    1 
ATOM 1551 C CG    . PHE E 5 44  ? -36.048 -9.795  -58.071 1.00 190.79 ? 44  PHE A CG    1 
ATOM 1552 C CD1   . PHE E 5 44  ? -37.388 -10.068 -58.261 1.00 192.54 ? 44  PHE A CD1   1 
ATOM 1553 C CD2   . PHE E 5 44  ? -35.370 -8.997  -58.984 1.00 195.02 ? 44  PHE A CD2   1 
ATOM 1554 C CE1   . PHE E 5 44  ? -38.029 -9.589  -59.373 1.00 197.03 ? 44  PHE A CE1   1 
ATOM 1555 C CE2   . PHE E 5 44  ? -35.990 -8.514  -60.084 1.00 201.83 ? 44  PHE A CE2   1 
ATOM 1556 C CZ    . PHE E 5 44  ? -37.325 -8.811  -60.294 1.00 204.22 ? 44  PHE A CZ    1 
ATOM 1557 N N     . LEU E 5 45  ? -33.060 -10.004 -54.548 1.00 170.38 ? 45  LEU A N     1 
ATOM 1558 C CA    . LEU E 5 45  ? -32.676 -10.206 -53.174 1.00 161.49 ? 45  LEU A CA    1 
ATOM 1559 C C     . LEU E 5 45  ? -31.446 -9.374  -52.866 1.00 154.82 ? 45  LEU A C     1 
ATOM 1560 O O     . LEU E 5 45  ? -30.335 -9.677  -53.300 1.00 153.79 ? 45  LEU A O     1 
ATOM 1561 C CB    . LEU E 5 45  ? -32.405 -11.687 -52.920 1.00 160.53 ? 45  LEU A CB    1 
ATOM 1562 C CG    . LEU E 5 45  ? -33.602 -12.592 -53.199 1.00 162.53 ? 45  LEU A CG    1 
ATOM 1563 C CD1   . LEU E 5 45  ? -33.359 -13.966 -52.619 1.00 161.60 ? 45  LEU A CD1   1 
ATOM 1564 C CD2   . LEU E 5 45  ? -34.846 -11.968 -52.598 1.00 165.68 ? 45  LEU A CD2   1 
ATOM 1565 N N     . SER E 5 46  ? -31.674 -8.307  -52.117 1.00 152.71 ? 46  SER A N     1 
ATOM 1566 C CA    . SER E 5 46  ? -30.614 -7.459  -51.604 1.00 155.13 ? 46  SER A CA    1 
ATOM 1567 C C     . SER E 5 46  ? -31.126 -6.827  -50.315 1.00 157.76 ? 46  SER A C     1 
ATOM 1568 O O     . SER E 5 46  ? -32.317 -6.532  -50.190 1.00 161.58 ? 46  SER A O     1 
ATOM 1569 C CB    . SER E 5 46  ? -30.232 -6.386  -52.626 1.00 156.67 ? 46  SER A CB    1 
ATOM 1570 O OG    . SER E 5 46  ? -29.750 -5.200  -51.995 1.00 159.12 ? 46  SER A OG    1 
ATOM 1571 N N     . GLN E 5 47  ? -30.222 -6.593  -49.370 1.00 156.02 ? 47  GLN A N     1 
ATOM 1572 C CA    . GLN E 5 47  ? -30.604 -6.232  -48.007 1.00 152.30 ? 47  GLN A CA    1 
ATOM 1573 C C     . GLN E 5 47  ? -31.688 -5.164  -47.984 1.00 151.99 ? 47  GLN A C     1 
ATOM 1574 O O     . GLN E 5 47  ? -32.611 -5.233  -47.175 1.00 153.88 ? 47  GLN A O     1 
ATOM 1575 C CB    . GLN E 5 47  ? -29.371 -5.766  -47.225 1.00 149.60 ? 47  GLN A CB    1 
ATOM 1576 C CG    . GLN E 5 47  ? -28.208 -6.739  -47.346 1.00 149.39 ? 47  GLN A CG    1 
ATOM 1577 C CD    . GLN E 5 47  ? -26.887 -6.139  -46.905 1.00 153.75 ? 47  GLN A CD    1 
ATOM 1578 O OE1   . GLN E 5 47  ? -26.631 -4.953  -47.109 1.00 163.41 ? 47  GLN A OE1   1 
ATOM 1579 N NE2   . GLN E 5 47  ? -26.037 -6.961  -46.308 1.00 149.34 ? 47  GLN A NE2   1 
ATOM 1580 N N     . LYS E 5 48  ? -31.585 -4.194  -48.886 1.00 149.89 ? 48  LYS A N     1 
ATOM 1581 C CA    . LYS E 5 48  ? -32.544 -3.096  -48.940 1.00 146.68 ? 48  LYS A CA    1 
ATOM 1582 C C     . LYS E 5 48  ? -33.996 -3.586  -48.981 1.00 142.36 ? 48  LYS A C     1 
ATOM 1583 O O     . LYS E 5 48  ? -34.811 -3.207  -48.131 1.00 144.54 ? 48  LYS A O     1 
ATOM 1584 C CB    . LYS E 5 48  ? -32.265 -2.215  -50.160 1.00 145.64 ? 48  LYS A CB    1 
ATOM 1585 C CG    . LYS E 5 48  ? -30.924 -1.497  -50.140 1.00 143.29 ? 48  LYS A CG    1 
ATOM 1586 C CD    . LYS E 5 48  ? -30.498 -1.102  -51.550 1.00 140.32 ? 48  LYS A CD    1 
ATOM 1587 C CE    . LYS E 5 48  ? -31.695 -0.701  -52.407 1.00 136.86 ? 48  LYS A CE    1 
ATOM 1588 N NZ    . LYS E 5 48  ? -31.298 -0.345  -53.799 1.00 134.66 ? 48  LYS A NZ    1 
ATOM 1589 N N     . TYR E 5 49  ? -34.312 -4.432  -49.959 1.00 135.89 ? 49  TYR A N     1 
ATOM 1590 C CA    . TYR E 5 49  ? -35.698 -4.818  -50.201 1.00 132.86 ? 49  TYR A CA    1 
ATOM 1591 C C     . TYR E 5 49  ? -36.239 -5.767  -49.143 1.00 124.31 ? 49  TYR A C     1 
ATOM 1592 O O     . TYR E 5 49  ? -37.397 -5.656  -48.738 1.00 123.08 ? 49  TYR A O     1 
ATOM 1593 C CB    . TYR E 5 49  ? -35.852 -5.439  -51.586 1.00 139.01 ? 49  TYR A CB    1 
ATOM 1594 C CG    . TYR E 5 49  ? -35.234 -4.619  -52.691 1.00 146.05 ? 49  TYR A CG    1 
ATOM 1595 C CD1   . TYR E 5 49  ? -35.884 -3.500  -53.203 1.00 149.17 ? 49  TYR A CD1   1 
ATOM 1596 C CD2   . TYR E 5 49  ? -34.000 -4.964  -53.224 1.00 149.89 ? 49  TYR A CD2   1 
ATOM 1597 C CE1   . TYR E 5 49  ? -35.319 -2.747  -54.216 1.00 151.48 ? 49  TYR A CE1   1 
ATOM 1598 C CE2   . TYR E 5 49  ? -33.428 -4.222  -54.236 1.00 152.88 ? 49  TYR A CE2   1 
ATOM 1599 C CZ    . TYR E 5 49  ? -34.091 -3.113  -54.729 1.00 153.51 ? 49  TYR A CZ    1 
ATOM 1600 O OH    . TYR E 5 49  ? -33.523 -2.368  -55.737 1.00 153.78 ? 49  TYR A OH    1 
ATOM 1601 N N     . ILE E 5 50  ? -35.400 -6.703  -48.706 1.00 118.07 ? 50  ILE A N     1 
ATOM 1602 C CA    . ILE E 5 50  ? -35.799 -7.666  -47.685 1.00 114.36 ? 50  ILE A CA    1 
ATOM 1603 C C     . ILE E 5 50  ? -36.056 -6.930  -46.372 1.00 112.36 ? 50  ILE A C     1 
ATOM 1604 O O     . ILE E 5 50  ? -37.081 -7.133  -45.720 1.00 114.31 ? 50  ILE A O     1 
ATOM 1605 C CB    . ILE E 5 50  ? -34.730 -8.782  -47.473 1.00 106.89 ? 50  ILE A CB    1 
ATOM 1606 C CG1   . ILE E 5 50  ? -34.276 -9.387  -48.807 1.00 107.20 ? 50  ILE A CG1   1 
ATOM 1607 C CG2   . ILE E 5 50  ? -35.260 -9.889  -46.555 1.00 104.32 ? 50  ILE A CG2   1 
ATOM 1608 C CD1   . ILE E 5 50  ? -33.145 -10.393 -48.657 1.00 107.25 ? 50  ILE A CD1   1 
ATOM 1609 N N     . VAL E 5 51  ? -35.121 -6.066  -45.996 1.00 109.01 ? 51  VAL A N     1 
ATOM 1610 C CA    . VAL E 5 51  ? -35.277 -5.246  -44.802 1.00 109.88 ? 51  VAL A CA    1 
ATOM 1611 C C     . VAL E 5 51  ? -36.546 -4.389  -44.865 1.00 112.51 ? 51  VAL A C     1 
ATOM 1612 O O     . VAL E 5 51  ? -37.358 -4.402  -43.936 1.00 115.67 ? 51  VAL A O     1 
ATOM 1613 C CB    . VAL E 5 51  ? -34.048 -4.345  -44.569 1.00 108.77 ? 51  VAL A CB    1 
ATOM 1614 C CG1   . VAL E 5 51  ? -34.280 -3.413  -43.391 1.00 111.30 ? 51  VAL A CG1   1 
ATOM 1615 C CG2   . VAL E 5 51  ? -32.810 -5.194  -44.340 1.00 105.05 ? 51  VAL A CG2   1 
ATOM 1616 N N     . LYS E 5 52  ? -36.720 -3.650  -45.959 1.00 110.39 ? 52  LYS A N     1 
ATOM 1617 C CA    . LYS E 5 52  ? -37.926 -2.847  -46.133 1.00 108.85 ? 52  LYS A CA    1 
ATOM 1618 C C     . LYS E 5 52  ? -39.185 -3.690  -45.957 1.00 108.47 ? 52  LYS A C     1 
ATOM 1619 O O     . LYS E 5 52  ? -40.085 -3.333  -45.197 1.00 110.23 ? 52  LYS A O     1 
ATOM 1620 C CB    . LYS E 5 52  ? -37.942 -2.174  -47.503 1.00 108.33 ? 52  LYS A CB    1 
ATOM 1621 C CG    . LYS E 5 52  ? -39.195 -1.354  -47.757 1.00 109.11 ? 52  LYS A CG    1 
ATOM 1622 C CD    . LYS E 5 52  ? -38.995 -0.350  -48.878 1.00 112.48 ? 52  LYS A CD    1 
ATOM 1623 C CE    . LYS E 5 52  ? -40.268 0.430   -49.120 1.00 120.31 ? 52  LYS A CE    1 
ATOM 1624 N NZ    . LYS E 5 52  ? -40.789 0.992   -47.847 1.00 127.05 ? 52  LYS A NZ    1 
ATOM 1625 N N     . TYR E 5 53  ? -39.242 -4.813  -46.661 1.00 107.84 ? 53  TYR A N     1 
ATOM 1626 C CA    . TYR E 5 53  ? -40.381 -5.710  -46.554 1.00 109.37 ? 53  TYR A CA    1 
ATOM 1627 C C     . TYR E 5 53  ? -40.648 -6.051  -45.095 1.00 108.86 ? 53  TYR A C     1 
ATOM 1628 O O     . TYR E 5 53  ? -41.738 -5.809  -44.575 1.00 108.03 ? 53  TYR A O     1 
ATOM 1629 C CB    . TYR E 5 53  ? -40.120 -6.992  -47.353 1.00 112.02 ? 53  TYR A CB    1 
ATOM 1630 C CG    . TYR E 5 53  ? -41.200 -8.045  -47.213 1.00 114.91 ? 53  TYR A CG    1 
ATOM 1631 C CD1   . TYR E 5 53  ? -41.037 -9.132  -46.363 1.00 114.34 ? 53  TYR A CD1   1 
ATOM 1632 C CD2   . TYR E 5 53  ? -42.383 -7.950  -47.932 1.00 117.14 ? 53  TYR A CD2   1 
ATOM 1633 C CE1   . TYR E 5 53  ? -42.023 -10.092 -46.234 1.00 113.56 ? 53  TYR A CE1   1 
ATOM 1634 C CE2   . TYR E 5 53  ? -43.371 -8.906  -47.808 1.00 116.60 ? 53  TYR A CE2   1 
ATOM 1635 C CZ    . TYR E 5 53  ? -43.185 -9.969  -46.959 1.00 112.10 ? 53  TYR A CZ    1 
ATOM 1636 O OH    . TYR E 5 53  ? -44.168 -10.911 -46.834 1.00 107.92 ? 53  TYR A OH    1 
ATOM 1637 N N     . ILE E 5 54  ? -39.637 -6.593  -44.430 1.00 110.73 ? 54  ILE A N     1 
ATOM 1638 C CA    . ILE E 5 54  ? -39.810 -7.086  -43.073 1.00 115.35 ? 54  ILE A CA    1 
ATOM 1639 C C     . ILE E 5 54  ? -40.284 -5.991  -42.119 1.00 119.17 ? 54  ILE A C     1 
ATOM 1640 O O     . ILE E 5 54  ? -41.246 -6.176  -41.376 1.00 120.74 ? 54  ILE A O     1 
ATOM 1641 C CB    . ILE E 5 54  ? -38.526 -7.765  -42.554 1.00 117.84 ? 54  ILE A CB    1 
ATOM 1642 C CG1   . ILE E 5 54  ? -38.245 -9.027  -43.374 1.00 121.20 ? 54  ILE A CG1   1 
ATOM 1643 C CG2   . ILE E 5 54  ? -38.659 -8.120  -41.081 1.00 119.08 ? 54  ILE A CG2   1 
ATOM 1644 C CD1   . ILE E 5 54  ? -36.962 -9.746  -43.002 1.00 124.48 ? 54  ILE A CD1   1 
ATOM 1645 N N     . ALA E 5 55  ? -39.625 -4.841  -42.156 1.00 120.28 ? 55  ALA A N     1 
ATOM 1646 C CA    . ALA E 5 55  ? -39.973 -3.759  -41.243 1.00 123.95 ? 55  ALA A CA    1 
ATOM 1647 C C     . ALA E 5 55  ? -41.324 -3.115  -41.560 1.00 126.01 ? 55  ALA A C     1 
ATOM 1648 O O     . ALA E 5 55  ? -41.980 -2.563  -40.674 1.00 128.32 ? 55  ALA A O     1 
ATOM 1649 C CB    . ALA E 5 55  ? -38.873 -2.703  -41.223 1.00 124.92 ? 55  ALA A CB    1 
ATOM 1650 N N     . SER E 5 56  ? -41.739 -3.172  -42.819 1.00 126.68 ? 56  SER A N     1 
ATOM 1651 C CA    . SER E 5 56  ? -42.946 -2.459  -43.215 1.00 128.08 ? 56  SER A CA    1 
ATOM 1652 C C     . SER E 5 56  ? -44.211 -3.276  -42.978 1.00 126.88 ? 56  SER A C     1 
ATOM 1653 O O     . SER E 5 56  ? -45.319 -2.775  -43.151 1.00 128.39 ? 56  SER A O     1 
ATOM 1654 C CB    . SER E 5 56  ? -42.865 -2.003  -44.673 1.00 128.07 ? 56  SER A CB    1 
ATOM 1655 O OG    . SER E 5 56  ? -42.933 -3.104  -45.554 1.00 128.25 ? 56  SER A OG    1 
ATOM 1656 N N     . HIS E 5 57  ? -44.040 -4.531  -42.575 1.00 123.58 ? 57  HIS A N     1 
ATOM 1657 C CA    . HIS E 5 57  ? -45.175 -5.412  -42.307 1.00 122.89 ? 57  HIS A CA    1 
ATOM 1658 C C     . HIS E 5 57  ? -45.188 -5.866  -40.849 1.00 132.90 ? 57  HIS A C     1 
ATOM 1659 O O     . HIS E 5 57  ? -44.302 -6.602  -40.417 1.00 136.13 ? 57  HIS A O     1 
ATOM 1660 C CB    . HIS E 5 57  ? -45.123 -6.645  -43.212 1.00 115.83 ? 57  HIS A CB    1 
ATOM 1661 C CG    . HIS E 5 57  ? -45.334 -6.353  -44.669 1.00 110.78 ? 57  HIS A CG    1 
ATOM 1662 N ND1   . HIS E 5 57  ? -44.403 -5.688  -45.438 1.00 109.64 ? 57  HIS A ND1   1 
ATOM 1663 C CD2   . HIS E 5 57  ? -46.358 -6.660  -45.496 1.00 107.69 ? 57  HIS A CD2   1 
ATOM 1664 C CE1   . HIS E 5 57  ? -44.853 -5.588  -46.677 1.00 107.85 ? 57  HIS A CE1   1 
ATOM 1665 N NE2   . HIS E 5 57  ? -46.036 -6.169  -46.741 1.00 106.00 ? 57  HIS A NE2   1 
ATOM 1666 N N     . ASP E 5 58  ? -46.196 -5.438  -40.094 1.00 139.34 ? 58  ASP A N     1 
ATOM 1667 C CA    . ASP E 5 58  ? -46.286 -5.793  -38.680 1.00 144.59 ? 58  ASP A CA    1 
ATOM 1668 C C     . ASP E 5 58  ? -46.371 -7.306  -38.519 1.00 143.89 ? 58  ASP A C     1 
ATOM 1669 O O     . ASP E 5 58  ? -45.696 -7.900  -37.673 1.00 143.10 ? 58  ASP A O     1 
ATOM 1670 C CB    . ASP E 5 58  ? -47.500 -5.127  -38.031 1.00 149.89 ? 58  ASP A CB    1 
ATOM 1671 C CG    . ASP E 5 58  ? -47.524 -5.298  -36.522 1.00 158.11 ? 58  ASP A CG    1 
ATOM 1672 O OD1   . ASP E 5 58  ? -48.614 -5.548  -35.967 1.00 162.82 ? 58  ASP A OD1   1 
ATOM 1673 O OD2   . ASP E 5 58  ? -46.454 -5.175  -35.888 1.00 162.27 ? 58  ASP A OD2   1 
ATOM 1674 N N     . ASP E 5 59  ? -47.212 -7.918  -39.343 1.00 142.49 ? 59  ASP A N     1 
ATOM 1675 C CA    . ASP E 5 59  ? -47.359 -9.363  -39.361 1.00 140.92 ? 59  ASP A CA    1 
ATOM 1676 C C     . ASP E 5 59  ? -45.994 -10.036 -39.437 1.00 133.68 ? 59  ASP A C     1 
ATOM 1677 O O     . ASP E 5 59  ? -45.717 -10.973 -38.693 1.00 137.34 ? 59  ASP A O     1 
ATOM 1678 C CB    . ASP E 5 59  ? -48.227 -9.791  -40.546 1.00 144.79 ? 59  ASP A CB    1 
ATOM 1679 C CG    . ASP E 5 59  ? -47.848 -9.081  -41.833 1.00 148.83 ? 59  ASP A CG    1 
ATOM 1680 O OD1   . ASP E 5 59  ? -47.851 -9.738  -42.898 1.00 146.73 ? 59  ASP A OD1   1 
ATOM 1681 O OD2   . ASP E 5 59  ? -47.550 -7.866  -41.777 1.00 152.56 ? 59  ASP A OD2   1 
ATOM 1682 N N     . ILE E 5 60  ? -45.142 -9.550  -40.334 1.00 122.98 ? 60  ILE A N     1 
ATOM 1683 C CA    . ILE E 5 60  ? -43.803 -10.102 -40.484 1.00 112.81 ? 60  ILE A CA    1 
ATOM 1684 C C     . ILE E 5 60  ? -42.874 -9.589  -39.397 1.00 115.06 ? 60  ILE A C     1 
ATOM 1685 O O     . ILE E 5 60  ? -42.040 -10.333 -38.879 1.00 114.92 ? 60  ILE A O     1 
ATOM 1686 C CB    . ILE E 5 60  ? -43.189 -9.742  -41.843 1.00 103.03 ? 60  ILE A CB    1 
ATOM 1687 C CG1   . ILE E 5 60  ? -44.146 -10.125 -42.971 1.00 99.57  ? 60  ILE A CG1   1 
ATOM 1688 C CG2   . ILE E 5 60  ? -41.832 -10.405 -42.008 1.00 101.57 ? 60  ILE A CG2   1 
ATOM 1689 C CD1   . ILE E 5 60  ? -44.929 -11.384 -42.701 1.00 99.46  ? 60  ILE A CD1   1 
ATOM 1690 N N     . ALA E 5 61  ? -43.019 -8.313  -39.054 1.00 118.62 ? 61  ALA A N     1 
ATOM 1691 C CA    . ALA E 5 61  ? -42.115 -7.679  -38.101 1.00 122.88 ? 61  ALA A CA    1 
ATOM 1692 C C     . ALA E 5 61  ? -42.117 -8.390  -36.750 1.00 128.35 ? 61  ALA A C     1 
ATOM 1693 O O     . ALA E 5 61  ? -41.063 -8.582  -36.141 1.00 132.29 ? 61  ALA A O     1 
ATOM 1694 C CB    . ALA E 5 61  ? -42.454 -6.203  -37.937 1.00 120.94 ? 61  ALA A CB    1 
ATOM 1695 N N     . LYS E 5 62  ? -43.296 -8.791  -36.288 1.00 128.68 ? 62  LYS A N     1 
ATOM 1696 C CA    . LYS E 5 62  ? -43.395 -9.480  -35.005 1.00 128.11 ? 62  LYS A CA    1 
ATOM 1697 C C     . LYS E 5 62  ? -42.717 -10.860 -35.004 1.00 129.74 ? 62  LYS A C     1 
ATOM 1698 O O     . LYS E 5 62  ? -42.205 -11.298 -33.973 1.00 130.78 ? 62  LYS A O     1 
ATOM 1699 C CB    . LYS E 5 62  ? -44.853 -9.594  -34.564 1.00 124.26 ? 62  LYS A CB    1 
ATOM 1700 C CG    . LYS E 5 62  ? -45.503 -8.265  -34.234 1.00 122.96 ? 62  LYS A CG    1 
ATOM 1701 C CD    . LYS E 5 62  ? -46.802 -8.479  -33.487 1.00 124.67 ? 62  LYS A CD    1 
ATOM 1702 C CE    . LYS E 5 62  ? -47.693 -9.460  -34.230 1.00 123.57 ? 62  LYS A CE    1 
ATOM 1703 N NZ    . LYS E 5 62  ? -48.850 -9.913  -33.407 1.00 124.19 ? 62  LYS A NZ    1 
ATOM 1704 N N     . ASP E 5 63  ? -42.710 -11.533 -36.155 1.00 131.07 ? 63  ASP A N     1 
ATOM 1705 C CA    . ASP E 5 63  ? -42.113 -12.866 -36.268 1.00 133.04 ? 63  ASP A CA    1 
ATOM 1706 C C     . ASP E 5 63  ? -41.259 -13.024 -37.525 1.00 131.81 ? 63  ASP A C     1 
ATOM 1707 O O     . ASP E 5 63  ? -41.624 -13.758 -38.449 1.00 132.14 ? 63  ASP A O     1 
ATOM 1708 C CB    . ASP E 5 63  ? -43.192 -13.948 -36.237 1.00 138.54 ? 63  ASP A CB    1 
ATOM 1709 C CG    . ASP E 5 63  ? -42.607 -15.348 -36.224 1.00 144.37 ? 63  ASP A CG    1 
ATOM 1710 O OD1   . ASP E 5 63  ? -41.385 -15.482 -35.984 1.00 146.58 ? 63  ASP A OD1   1 
ATOM 1711 O OD2   . ASP E 5 63  ? -43.367 -16.313 -36.446 1.00 146.41 ? 63  ASP A OD2   1 
ATOM 1712 N N     . PRO E 5 64  ? -40.105 -12.344 -37.546 1.00 129.93 ? 64  PRO A N     1 
ATOM 1713 C CA    . PRO E 5 64  ? -39.216 -12.220 -38.708 1.00 129.85 ? 64  PRO A CA    1 
ATOM 1714 C C     . PRO E 5 64  ? -38.474 -13.505 -39.081 1.00 128.16 ? 64  PRO A C     1 
ATOM 1715 O O     . PRO E 5 64  ? -38.149 -13.721 -40.251 1.00 129.02 ? 64  PRO A O     1 
ATOM 1716 C CB    . PRO E 5 64  ? -38.197 -11.156 -38.257 1.00 128.24 ? 64  PRO A CB    1 
ATOM 1717 C CG    . PRO E 5 64  ? -38.764 -10.551 -36.997 1.00 128.02 ? 64  PRO A CG    1 
ATOM 1718 C CD    . PRO E 5 64  ? -39.571 -11.634 -36.373 1.00 128.46 ? 64  PRO A CD    1 
ATOM 1719 N N     . LEU E 5 65  ? -38.206 -14.346 -38.091 1.00 125.36 ? 65  LEU A N     1 
ATOM 1720 C CA    . LEU E 5 65  ? -37.237 -15.421 -38.275 1.00 119.49 ? 65  LEU A CA    1 
ATOM 1721 C C     . LEU E 5 65  ? -37.499 -16.373 -39.441 1.00 124.18 ? 65  LEU A C     1 
ATOM 1722 O O     . LEU E 5 65  ? -36.604 -16.605 -40.255 1.00 126.16 ? 65  LEU A O     1 
ATOM 1723 C CB    . LEU E 5 65  ? -37.001 -16.190 -36.973 1.00 109.58 ? 65  LEU A CB    1 
ATOM 1724 C CG    . LEU E 5 65  ? -35.688 -15.760 -36.316 1.00 103.06 ? 65  LEU A CG    1 
ATOM 1725 C CD1   . LEU E 5 65  ? -35.491 -16.440 -34.972 1.00 103.05 ? 65  LEU A CD1   1 
ATOM 1726 C CD2   . LEU E 5 65  ? -34.513 -16.034 -37.254 1.00 97.46  ? 65  LEU A CD2   1 
ATOM 1727 N N     . PRO E 5 66  ? -38.717 -16.927 -39.535 1.00 127.61 ? 66  PRO A N     1 
ATOM 1728 C CA    . PRO E 5 66  ? -38.886 -17.903 -40.617 1.00 127.70 ? 66  PRO A CA    1 
ATOM 1729 C C     . PRO E 5 66  ? -38.653 -17.219 -41.962 1.00 122.40 ? 66  PRO A C     1 
ATOM 1730 O O     . PRO E 5 66  ? -38.171 -17.837 -42.921 1.00 123.53 ? 66  PRO A O     1 
ATOM 1731 C CB    . PRO E 5 66  ? -40.347 -18.353 -40.465 1.00 130.83 ? 66  PRO A CB    1 
ATOM 1732 C CG    . PRO E 5 66  ? -40.757 -17.914 -39.069 1.00 131.99 ? 66  PRO A CG    1 
ATOM 1733 C CD    . PRO E 5 66  ? -39.980 -16.654 -38.829 1.00 130.38 ? 66  PRO A CD    1 
ATOM 1734 N N     . THR E 5 67  ? -38.968 -15.931 -42.015 1.00 117.37 ? 67  THR A N     1 
ATOM 1735 C CA    . THR E 5 67  ? -38.749 -15.164 -43.225 1.00 116.73 ? 67  THR A CA    1 
ATOM 1736 C C     . THR E 5 67  ? -37.262 -15.065 -43.530 1.00 113.00 ? 67  THR A C     1 
ATOM 1737 O O     . THR E 5 67  ? -36.831 -15.305 -44.658 1.00 112.52 ? 67  THR A O     1 
ATOM 1738 C CB    . THR E 5 67  ? -39.343 -13.762 -43.111 1.00 119.96 ? 67  THR A CB    1 
ATOM 1739 O OG1   . THR E 5 67  ? -40.728 -13.869 -42.756 1.00 123.15 ? 67  THR A OG1   1 
ATOM 1740 C CG2   . THR E 5 67  ? -39.203 -13.018 -44.439 1.00 118.71 ? 67  THR A CG2   1 
ATOM 1741 N N     . CYS E 5 68  ? -36.479 -14.720 -42.517 1.00 111.41 ? 68  CYS A N     1 
ATOM 1742 C CA    . CYS E 5 68  ? -35.037 -14.607 -42.680 1.00 111.76 ? 68  CYS A CA    1 
ATOM 1743 C C     . CYS E 5 68  ? -34.409 -15.924 -43.136 1.00 113.20 ? 68  CYS A C     1 
ATOM 1744 O O     . CYS E 5 68  ? -33.646 -15.955 -44.099 1.00 115.08 ? 68  CYS A O     1 
ATOM 1745 C CB    . CYS E 5 68  ? -34.399 -14.125 -41.381 1.00 111.38 ? 68  CYS A CB    1 
ATOM 1746 S SG    . CYS E 5 68  ? -34.976 -12.491 -40.868 1.00 112.74 ? 68  CYS A SG    1 
ATOM 1747 N N     . ASP E 5 69  ? -34.733 -17.009 -42.444 1.00 111.74 ? 69  ASP A N     1 
ATOM 1748 C CA    . ASP E 5 69  ? -34.216 -18.314 -42.821 1.00 109.32 ? 69  ASP A CA    1 
ATOM 1749 C C     . ASP E 5 69  ? -34.565 -18.590 -44.274 1.00 111.84 ? 69  ASP A C     1 
ATOM 1750 O O     . ASP E 5 69  ? -33.724 -19.055 -45.055 1.00 113.59 ? 69  ASP A O     1 
ATOM 1751 C CB    . ASP E 5 69  ? -34.790 -19.397 -41.915 1.00 110.80 ? 69  ASP A CB    1 
ATOM 1752 C CG    . ASP E 5 69  ? -34.506 -19.136 -40.454 1.00 118.28 ? 69  ASP A CG    1 
ATOM 1753 O OD1   . ASP E 5 69  ? -35.294 -19.589 -39.599 1.00 127.53 ? 69  ASP A OD1   1 
ATOM 1754 O OD2   . ASP E 5 69  ? -33.494 -18.467 -40.164 1.00 109.37 ? 69  ASP A OD2   1 
ATOM 1755 N N     . ALA E 5 70  ? -35.809 -18.293 -44.636 1.00 114.54 ? 70  ALA A N     1 
ATOM 1756 C CA    . ALA E 5 70  ? -36.228 -18.445 -46.019 1.00 116.18 ? 70  ALA A CA    1 
ATOM 1757 C C     . ALA E 5 70  ? -35.271 -17.706 -46.939 1.00 115.13 ? 70  ALA A C     1 
ATOM 1758 O O     . ALA E 5 70  ? -34.732 -18.286 -47.877 1.00 117.91 ? 70  ALA A O     1 
ATOM 1759 C CB    . ALA E 5 70  ? -37.640 -17.935 -46.213 1.00 118.35 ? 70  ALA A CB    1 
ATOM 1760 N N     . MET E 5 71  ? -35.052 -16.427 -46.662 1.00 109.93 ? 71  MET A N     1 
ATOM 1761 C CA    . MET E 5 71  ? -34.282 -15.609 -47.579 1.00 106.19 ? 71  MET A CA    1 
ATOM 1762 C C     . MET E 5 71  ? -32.856 -16.097 -47.690 1.00 103.93 ? 71  MET A C     1 
ATOM 1763 O O     . MET E 5 71  ? -32.300 -16.130 -48.778 1.00 106.58 ? 71  MET A O     1 
ATOM 1764 C CB    . MET E 5 71  ? -34.309 -14.144 -47.172 1.00 110.13 ? 71  MET A CB    1 
ATOM 1765 C CG    . MET E 5 71  ? -35.695 -13.553 -47.170 1.00 112.03 ? 71  MET A CG    1 
ATOM 1766 S SD    . MET E 5 71  ? -36.626 -13.970 -48.650 1.00 100.79 ? 71  MET A SD    1 
ATOM 1767 C CE    . MET E 5 71  ? -38.286 -13.891 -47.990 1.00 78.26  ? 71  MET A CE    1 
ATOM 1768 N N     . ILE E 5 72  ? -32.257 -16.482 -46.573 1.00 101.38 ? 72  ILE A N     1 
ATOM 1769 C CA    . ILE E 5 72  ? -30.894 -16.977 -46.630 1.00 105.76 ? 72  ILE A CA    1 
ATOM 1770 C C     . ILE E 5 72  ? -30.865 -18.225 -47.503 1.00 110.26 ? 72  ILE A C     1 
ATOM 1771 O O     . ILE E 5 72  ? -29.937 -18.427 -48.295 1.00 114.42 ? 72  ILE A O     1 
ATOM 1772 C CB    . ILE E 5 72  ? -30.338 -17.285 -45.239 1.00 108.37 ? 72  ILE A CB    1 
ATOM 1773 C CG1   . ILE E 5 72  ? -30.583 -16.103 -44.302 1.00 111.52 ? 72  ILE A CG1   1 
ATOM 1774 C CG2   . ILE E 5 72  ? -28.855 -17.590 -45.327 1.00 107.81 ? 72  ILE A CG2   1 
ATOM 1775 C CD1   . ILE E 5 72  ? -30.131 -16.343 -42.881 1.00 112.58 ? 72  ILE A CD1   1 
ATOM 1776 N N     . TRP E 5 73  ? -31.892 -19.060 -47.368 1.00 108.37 ? 73  TRP A N     1 
ATOM 1777 C CA    . TRP E 5 73  ? -31.999 -20.224 -48.237 1.00 106.19 ? 73  TRP A CA    1 
ATOM 1778 C C     . TRP E 5 73  ? -32.049 -19.809 -49.705 1.00 103.15 ? 73  TRP A C     1 
ATOM 1779 O O     . TRP E 5 73  ? -31.107 -20.064 -50.449 1.00 106.52 ? 73  TRP A O     1 
ATOM 1780 C CB    . TRP E 5 73  ? -33.198 -21.091 -47.873 1.00 110.22 ? 73  TRP A CB    1 
ATOM 1781 C CG    . TRP E 5 73  ? -33.189 -22.401 -48.595 1.00 117.67 ? 73  TRP A CG    1 
ATOM 1782 C CD1   . TRP E 5 73  ? -32.534 -23.543 -48.224 1.00 118.53 ? 73  TRP A CD1   1 
ATOM 1783 C CD2   . TRP E 5 73  ? -33.858 -22.704 -49.824 1.00 120.75 ? 73  TRP A CD2   1 
ATOM 1784 N NE1   . TRP E 5 73  ? -32.760 -24.539 -49.143 1.00 117.36 ? 73  TRP A NE1   1 
ATOM 1785 C CE2   . TRP E 5 73  ? -33.569 -24.049 -50.135 1.00 119.31 ? 73  TRP A CE2   1 
ATOM 1786 C CE3   . TRP E 5 73  ? -34.676 -21.971 -50.690 1.00 123.31 ? 73  TRP A CE3   1 
ATOM 1787 C CZ2   . TRP E 5 73  ? -34.069 -24.672 -51.275 1.00 121.99 ? 73  TRP A CZ2   1 
ATOM 1788 C CZ3   . TRP E 5 73  ? -35.171 -22.590 -51.820 1.00 123.49 ? 73  TRP A CZ3   1 
ATOM 1789 C CH2   . TRP E 5 73  ? -34.867 -23.928 -52.103 1.00 123.55 ? 73  TRP A CH2   1 
ATOM 1790 N N     . PHE E 5 74  ? -33.128 -19.137 -50.105 1.00 104.35 ? 74  PHE A N     1 
ATOM 1791 C CA    . PHE E 5 74  ? -33.319 -18.726 -51.495 1.00 109.71 ? 74  PHE A CA    1 
ATOM 1792 C C     . PHE E 5 74  ? -32.042 -18.117 -52.053 1.00 118.95 ? 74  PHE A C     1 
ATOM 1793 O O     . PHE E 5 74  ? -31.680 -18.342 -53.206 1.00 122.31 ? 74  PHE A O     1 
ATOM 1794 C CB    . PHE E 5 74  ? -34.431 -17.681 -51.609 1.00 110.02 ? 74  PHE A CB    1 
ATOM 1795 C CG    . PHE E 5 74  ? -35.805 -18.197 -51.290 1.00 112.08 ? 74  PHE A CG    1 
ATOM 1796 C CD1   . PHE E 5 74  ? -36.554 -18.850 -52.251 1.00 113.09 ? 74  PHE A CD1   1 
ATOM 1797 C CD2   . PHE E 5 74  ? -36.363 -17.996 -50.043 1.00 113.58 ? 74  PHE A CD2   1 
ATOM 1798 C CE1   . PHE E 5 74  ? -37.823 -19.312 -51.964 1.00 114.77 ? 74  PHE A CE1   1 
ATOM 1799 C CE2   . PHE E 5 74  ? -37.631 -18.456 -49.750 1.00 114.78 ? 74  PHE A CE2   1 
ATOM 1800 C CZ    . PHE E 5 74  ? -38.362 -19.115 -50.711 1.00 116.12 ? 74  PHE A CZ    1 
ATOM 1801 N N     . SER E 5 75  ? -31.369 -17.324 -51.231 1.00 125.12 ? 75  SER A N     1 
ATOM 1802 C CA    . SER E 5 75  ? -30.089 -16.743 -51.607 1.00 131.72 ? 75  SER A CA    1 
ATOM 1803 C C     . SER E 5 75  ? -29.040 -17.798 -51.937 1.00 136.87 ? 75  SER A C     1 
ATOM 1804 O O     . SER E 5 75  ? -28.615 -17.901 -53.083 1.00 143.62 ? 75  SER A O     1 
ATOM 1805 C CB    . SER E 5 75  ? -29.554 -15.851 -50.498 1.00 134.79 ? 75  SER A CB    1 
ATOM 1806 O OG    . SER E 5 75  ? -28.145 -15.767 -50.593 1.00 136.28 ? 75  SER A OG    1 
ATOM 1807 N N     . ARG E 5 76  ? -28.615 -18.560 -50.925 1.00 134.60 ? 76  ARG A N     1 
ATOM 1808 C CA    . ARG E 5 76  ? -27.553 -19.549 -51.105 1.00 129.74 ? 76  ARG A CA    1 
ATOM 1809 C C     . ARG E 5 76  ? -28.041 -20.700 -51.964 1.00 126.53 ? 76  ARG A C     1 
ATOM 1810 O O     . ARG E 5 76  ? -27.252 -21.442 -52.547 1.00 124.46 ? 76  ARG A O     1 
ATOM 1811 C CB    . ARG E 5 76  ? -27.044 -20.075 -49.766 1.00 127.40 ? 76  ARG A CB    1 
ATOM 1812 C CG    . ARG E 5 76  ? -28.062 -20.892 -49.000 1.00 130.68 ? 76  ARG A CG    1 
ATOM 1813 C CD    . ARG E 5 76  ? -27.376 -21.619 -47.872 1.00 137.61 ? 76  ARG A CD    1 
ATOM 1814 N NE    . ARG E 5 76  ? -26.265 -20.833 -47.345 1.00 138.19 ? 76  ARG A NE    1 
ATOM 1815 C CZ    . ARG E 5 76  ? -25.023 -21.288 -47.205 1.00 140.68 ? 76  ARG A CZ    1 
ATOM 1816 N NH1   . ARG E 5 76  ? -24.725 -22.537 -47.543 1.00 141.85 ? 76  ARG A NH1   1 
ATOM 1817 N NH2   . ARG E 5 76  ? -24.079 -20.494 -46.717 1.00 140.26 ? 76  ARG A NH2   1 
ATOM 1818 N N     . ALA E 5 77  ? -29.356 -20.816 -52.063 1.00 127.81 ? 77  ALA A N     1 
ATOM 1819 C CA    . ALA E 5 77  ? -29.980 -21.822 -52.892 1.00 129.54 ? 77  ALA A CA    1 
ATOM 1820 C C     . ALA E 5 77  ? -29.958 -21.303 -54.324 1.00 131.30 ? 77  ALA A C     1 
ATOM 1821 O O     . ALA E 5 77  ? -30.528 -21.899 -55.226 1.00 134.30 ? 77  ALA A O     1 
ATOM 1822 C CB    . ALA E 5 77  ? -31.396 -22.098 -52.424 1.00 132.76 ? 77  ALA A CB    1 
ATOM 1823 N N     . LEU E 5 78  ? -29.333 -20.147 -54.519 1.00 130.37 ? 78  LEU A N     1 
ATOM 1824 C CA    . LEU E 5 78  ? -29.077 -19.617 -55.861 1.00 134.73 ? 78  LEU A CA    1 
ATOM 1825 C C     . LEU E 5 78  ? -27.582 -19.336 -55.983 1.00 148.50 ? 78  LEU A C     1 
ATOM 1826 O O     . LEU E 5 78  ? -26.821 -19.701 -55.086 1.00 157.21 ? 78  LEU A O     1 
ATOM 1827 C CB    . LEU E 5 78  ? -29.935 -18.371 -56.128 1.00 130.55 ? 78  LEU A CB    1 
ATOM 1828 C CG    . LEU E 5 78  ? -30.812 -18.478 -57.377 1.00 129.01 ? 78  LEU A CG    1 
ATOM 1829 C CD1   . LEU E 5 78  ? -32.026 -17.549 -57.345 1.00 127.59 ? 78  LEU A CD1   1 
ATOM 1830 C CD2   . LEU E 5 78  ? -29.957 -18.209 -58.594 1.00 131.97 ? 78  LEU A CD2   1 
ATOM 1831 N N     . ASP E 5 79  ? -27.126 -18.705 -57.061 1.00 151.65 ? 79  ASP A N     1 
ATOM 1832 C CA    . ASP E 5 79  ? -25.693 -18.424 -57.074 1.00 157.79 ? 79  ASP A CA    1 
ATOM 1833 C C     . ASP E 5 79  ? -25.423 -17.078 -56.404 1.00 158.95 ? 79  ASP A C     1 
ATOM 1834 O O     . ASP E 5 79  ? -25.697 -16.000 -56.933 1.00 159.43 ? 79  ASP A O     1 
ATOM 1835 C CB    . ASP E 5 79  ? -25.046 -18.563 -58.475 1.00 164.50 ? 79  ASP A CB    1 
ATOM 1836 C CG    . ASP E 5 79  ? -25.495 -17.495 -59.468 1.00 172.70 ? 79  ASP A CG    1 
ATOM 1837 O OD1   . ASP E 5 79  ? -26.014 -16.445 -59.049 1.00 177.58 ? 79  ASP A OD1   1 
ATOM 1838 O OD2   . ASP E 5 79  ? -25.310 -17.703 -60.689 1.00 174.00 ? 79  ASP A OD2   1 
ATOM 1839 N N     . ILE E 5 80  ? -24.866 -17.181 -55.205 1.00 160.11 ? 80  ILE A N     1 
ATOM 1840 C CA    . ILE E 5 80  ? -24.519 -16.023 -54.412 1.00 161.71 ? 80  ILE A CA    1 
ATOM 1841 C C     . ILE E 5 80  ? -23.309 -16.407 -53.580 1.00 165.12 ? 80  ILE A C     1 
ATOM 1842 O O     . ILE E 5 80  ? -23.255 -17.501 -53.014 1.00 163.21 ? 80  ILE A O     1 
ATOM 1843 C CB    . ILE E 5 80  ? -25.698 -15.593 -53.512 1.00 160.26 ? 80  ILE A CB    1 
ATOM 1844 C CG1   . ILE E 5 80  ? -26.668 -14.693 -54.288 1.00 160.47 ? 80  ILE A CG1   1 
ATOM 1845 C CG2   . ILE E 5 80  ? -25.201 -14.854 -52.290 1.00 159.56 ? 80  ILE A CG2   1 
ATOM 1846 C CD1   . ILE E 5 80  ? -27.755 -15.438 -55.031 1.00 160.69 ? 80  ILE A CD1   1 
ATOM 1847 N N     . GLU E 5 81  ? -22.354 -15.491 -53.486 1.00 171.06 ? 81  GLU A N     1 
ATOM 1848 C CA    . GLU E 5 81  ? -21.109 -15.750 -52.782 1.00 176.09 ? 81  GLU A CA    1 
ATOM 1849 C C     . GLU E 5 81  ? -21.355 -16.131 -51.324 1.00 178.68 ? 81  GLU A C     1 
ATOM 1850 O O     . GLU E 5 81  ? -22.214 -15.555 -50.655 1.00 179.02 ? 81  GLU A O     1 
ATOM 1851 C CB    . GLU E 5 81  ? -20.182 -14.539 -52.891 1.00 179.76 ? 81  GLU A CB    1 
ATOM 1852 C CG    . GLU E 5 81  ? -19.402 -14.469 -54.200 1.00 182.60 ? 81  GLU A CG    1 
ATOM 1853 C CD    . GLU E 5 81  ? -20.295 -14.392 -55.430 1.00 185.43 ? 81  GLU A CD    1 
ATOM 1854 O OE1   . GLU E 5 81  ? -21.411 -13.837 -55.333 1.00 186.10 ? 81  GLU A OE1   1 
ATOM 1855 O OE2   . GLU E 5 81  ? -19.874 -14.888 -56.498 1.00 186.44 ? 81  GLU A OE2   1 
ATOM 1856 N N     . ASN E 5 82  ? -20.600 -17.115 -50.844 1.00 179.14 ? 82  ASN A N     1 
ATOM 1857 C CA    . ASN E 5 82  ? -20.796 -17.673 -49.508 1.00 177.17 ? 82  ASN A CA    1 
ATOM 1858 C C     . ASN E 5 82  ? -20.627 -16.623 -48.416 1.00 180.43 ? 82  ASN A C     1 
ATOM 1859 O O     . ASN E 5 82  ? -21.485 -16.453 -47.531 1.00 182.78 ? 82  ASN A O     1 
ATOM 1860 C CB    . ASN E 5 82  ? -19.812 -18.814 -49.281 1.00 170.08 ? 82  ASN A CB    1 
ATOM 1861 C CG    . ASN E 5 82  ? -20.081 -19.562 -48.002 1.00 164.29 ? 82  ASN A CG    1 
ATOM 1862 O OD1   . ASN E 5 82  ? -21.229 -19.703 -47.583 1.00 161.65 ? 82  ASN A OD1   1 
ATOM 1863 N ND2   . ASN E 5 82  ? -19.020 -20.045 -47.365 1.00 163.09 ? 82  ASN A ND2   1 
ATOM 1864 N N     . ASN E 5 83  ? -19.497 -15.932 -48.480 1.00 178.39 ? 83  ASN A N     1 
ATOM 1865 C CA    . ASN E 5 83  ? -19.277 -14.757 -47.662 1.00 174.16 ? 83  ASN A CA    1 
ATOM 1866 C C     . ASN E 5 83  ? -20.511 -13.884 -47.746 1.00 174.88 ? 83  ASN A C     1 
ATOM 1867 O O     . ASN E 5 83  ? -21.201 -13.664 -46.763 1.00 175.26 ? 83  ASN A O     1 
ATOM 1868 C CB    . ASN E 5 83  ? -18.086 -13.990 -48.206 1.00 167.04 ? 83  ASN A CB    1 
ATOM 1869 C CG    . ASN E 5 83  ? -18.208 -13.736 -49.688 1.00 161.10 ? 83  ASN A CG    1 
ATOM 1870 O OD1   . ASN E 5 83  ? -19.185 -14.147 -50.316 1.00 162.71 ? 83  ASN A OD1   1 
ATOM 1871 N ND2   . ASN E 5 83  ? -17.234 -13.051 -50.253 1.00 157.19 ? 83  ASN A ND2   1 
ATOM 1872 N N     . ASP E 5 84  ? -20.797 -13.425 -48.956 1.00 174.39 ? 84  ASP A N     1 
ATOM 1873 C CA    . ASP E 5 84  ? -21.904 -12.525 -49.221 1.00 173.23 ? 84  ASP A CA    1 
ATOM 1874 C C     . ASP E 5 84  ? -23.169 -12.953 -48.478 1.00 169.57 ? 84  ASP A C     1 
ATOM 1875 O O     . ASP E 5 84  ? -23.679 -12.222 -47.621 1.00 171.92 ? 84  ASP A O     1 
ATOM 1876 C CB    . ASP E 5 84  ? -22.153 -12.480 -50.728 1.00 173.00 ? 84  ASP A CB    1 
ATOM 1877 C CG    . ASP E 5 84  ? -23.356 -11.657 -51.097 1.00 172.35 ? 84  ASP A CG    1 
ATOM 1878 O OD1   . ASP E 5 84  ? -23.691 -10.717 -50.347 1.00 171.40 ? 84  ASP A OD1   1 
ATOM 1879 O OD2   . ASP E 5 84  ? -23.959 -11.957 -52.147 1.00 172.10 ? 84  ASP A OD2   1 
ATOM 1880 N N     . VAL E 5 85  ? -23.680 -14.133 -48.808 1.00 162.17 ? 85  VAL A N     1 
ATOM 1881 C CA    . VAL E 5 85  ? -24.867 -14.632 -48.132 1.00 156.12 ? 85  VAL A CA    1 
ATOM 1882 C C     . VAL E 5 85  ? -24.710 -14.527 -46.614 1.00 151.21 ? 85  VAL A C     1 
ATOM 1883 O O     . VAL E 5 85  ? -25.649 -14.126 -45.922 1.00 153.93 ? 85  VAL A O     1 
ATOM 1884 C CB    . VAL E 5 85  ? -25.232 -16.071 -48.560 1.00 155.21 ? 85  VAL A CB    1 
ATOM 1885 C CG1   . VAL E 5 85  ? -24.046 -16.990 -48.416 1.00 156.62 ? 85  VAL A CG1   1 
ATOM 1886 C CG2   . VAL E 5 85  ? -26.417 -16.587 -47.758 1.00 153.76 ? 85  VAL A CG2   1 
ATOM 1887 N N     . LEU E 5 86  ? -23.528 -14.850 -46.089 1.00 142.80 ? 86  LEU A N     1 
ATOM 1888 C CA    . LEU E 5 86  ? -23.352 -14.773 -44.636 1.00 133.44 ? 86  LEU A CA    1 
ATOM 1889 C C     . LEU E 5 86  ? -23.378 -13.338 -44.083 1.00 130.05 ? 86  LEU A C     1 
ATOM 1890 O O     . LEU E 5 86  ? -23.881 -13.116 -42.986 1.00 130.98 ? 86  LEU A O     1 
ATOM 1891 C CB    . LEU E 5 86  ? -22.129 -15.568 -44.148 1.00 129.85 ? 86  LEU A CB    1 
ATOM 1892 C CG    . LEU E 5 86  ? -20.698 -15.118 -44.443 1.00 128.61 ? 86  LEU A CG    1 
ATOM 1893 C CD1   . LEU E 5 86  ? -20.330 -13.887 -43.625 1.00 127.74 ? 86  LEU A CD1   1 
ATOM 1894 C CD2   . LEU E 5 86  ? -19.709 -16.250 -44.183 1.00 129.54 ? 86  LEU A CD2   1 
ATOM 1895 N N     . VAL E 5 87  ? -22.854 -12.371 -44.836 1.00 124.57 ? 87  VAL A N     1 
ATOM 1896 C CA    . VAL E 5 87  ? -22.926 -10.965 -44.442 1.00 117.51 ? 87  VAL A CA    1 
ATOM 1897 C C     . VAL E 5 87  ? -24.394 -10.559 -44.396 1.00 109.51 ? 87  VAL A C     1 
ATOM 1898 O O     . VAL E 5 87  ? -24.824 -9.828  -43.494 1.00 105.15 ? 87  VAL A O     1 
ATOM 1899 C CB    . VAL E 5 87  ? -22.156 -10.042 -45.419 1.00 118.48 ? 87  VAL A CB    1 
ATOM 1900 C CG1   . VAL E 5 87  ? -20.946 -10.764 -45.996 1.00 120.34 ? 87  VAL A CG1   1 
ATOM 1901 C CG2   . VAL E 5 87  ? -23.064 -9.537  -46.531 1.00 115.88 ? 87  VAL A CG2   1 
ATOM 1902 N N     . LEU E 5 88  ? -25.164 -11.056 -45.365 1.00 107.72 ? 88  LEU A N     1 
ATOM 1903 C CA    . LEU E 5 88  ? -26.615 -10.892 -45.342 1.00 109.69 ? 88  LEU A CA    1 
ATOM 1904 C C     . LEU E 5 88  ? -27.129 -11.390 -44.005 1.00 120.44 ? 88  LEU A C     1 
ATOM 1905 O O     . LEU E 5 88  ? -27.729 -10.638 -43.244 1.00 124.50 ? 88  LEU A O     1 
ATOM 1906 C CB    . LEU E 5 88  ? -27.300 -11.656 -46.486 1.00 101.01 ? 88  LEU A CB    1 
ATOM 1907 C CG    . LEU E 5 88  ? -28.818 -11.478 -46.644 1.00 95.96  ? 88  LEU A CG    1 
ATOM 1908 C CD1   . LEU E 5 88  ? -29.515 -10.750 -45.502 1.00 96.19  ? 88  LEU A CD1   1 
ATOM 1909 C CD2   . LEU E 5 88  ? -29.101 -10.733 -47.910 1.00 94.50  ? 88  LEU A CD2   1 
ATOM 1910 N N     . GLN E 5 89  ? -26.900 -12.671 -43.731 1.00 122.69 ? 89  GLN A N     1 
ATOM 1911 C CA    . GLN E 5 89  ? -27.344 -13.276 -42.477 1.00 125.74 ? 89  GLN A CA    1 
ATOM 1912 C C     . GLN E 5 89  ? -27.022 -12.396 -41.267 1.00 126.29 ? 89  GLN A C     1 
ATOM 1913 O O     . GLN E 5 89  ? -27.878 -12.147 -40.422 1.00 126.46 ? 89  GLN A O     1 
ATOM 1914 C CB    . GLN E 5 89  ? -26.711 -14.675 -42.306 1.00 125.87 ? 89  GLN A CB    1 
ATOM 1915 C CG    . GLN E 5 89  ? -27.095 -15.389 -40.996 1.00 127.20 ? 89  GLN A CG    1 
ATOM 1916 C CD    . GLN E 5 89  ? -26.787 -16.897 -41.003 1.00 125.59 ? 89  GLN A CD    1 
ATOM 1917 O OE1   . GLN E 5 89  ? -26.219 -17.429 -41.962 1.00 122.50 ? 89  GLN A OE1   1 
ATOM 1918 N NE2   . GLN E 5 89  ? -27.170 -17.584 -39.931 1.00 126.65 ? 89  GLN A NE2   1 
ATOM 1919 N N     . GLN E 5 90  ? -25.788 -11.914 -41.209 1.00 127.52 ? 90  GLN A N     1 
ATOM 1920 C CA    . GLN E 5 90  ? -25.359 -11.004 -40.159 1.00 127.61 ? 90  GLN A CA    1 
ATOM 1921 C C     . GLN E 5 90  ? -26.347 -9.879  -40.065 1.00 131.86 ? 90  GLN A C     1 
ATOM 1922 O O     . GLN E 5 90  ? -26.939 -9.649  -39.007 1.00 134.95 ? 90  GLN A O     1 
ATOM 1923 C CB    . GLN E 5 90  ? -23.974 -10.444 -40.478 1.00 126.33 ? 90  GLN A CB    1 
ATOM 1924 C CG    . GLN E 5 90  ? -22.876 -11.453 -40.261 1.00 127.46 ? 90  GLN A CG    1 
ATOM 1925 C CD    . GLN E 5 90  ? -23.380 -12.883 -40.351 1.00 132.70 ? 90  GLN A CD    1 
ATOM 1926 O OE1   . GLN E 5 90  ? -24.262 -13.297 -39.597 1.00 133.13 ? 90  GLN A OE1   1 
ATOM 1927 N NE2   . GLN E 5 90  ? -22.834 -13.640 -41.292 1.00 138.62 ? 90  GLN A NE2   1 
ATOM 1928 N N     . ARG E 5 91  ? -26.558 -9.200  -41.190 1.00 131.50 ? 91  ARG A N     1 
ATOM 1929 C CA    . ARG E 5 91  ? -27.459 -8.049  -41.203 1.00 129.42 ? 91  ARG A CA    1 
ATOM 1930 C C     . ARG E 5 91  ? -28.878 -8.415  -40.738 1.00 131.69 ? 91  ARG A C     1 
ATOM 1931 O O     . ARG E 5 91  ? -29.496 -7.642  -39.999 1.00 137.96 ? 91  ARG A O     1 
ATOM 1932 C CB    . ARG E 5 91  ? -27.471 -7.335  -42.569 1.00 122.80 ? 91  ARG A CB    1 
ATOM 1933 C CG    . ARG E 5 91  ? -28.438 -6.136  -42.611 1.00 116.93 ? 91  ARG A CG    1 
ATOM 1934 C CD    . ARG E 5 91  ? -28.205 -5.183  -43.783 1.00 115.97 ? 91  ARG A CD    1 
ATOM 1935 N NE    . ARG E 5 91  ? -29.312 -4.243  -44.000 1.00 120.91 ? 91  ARG A NE    1 
ATOM 1936 C CZ    . ARG E 5 91  ? -29.838 -3.438  -43.076 1.00 131.22 ? 91  ARG A CZ    1 
ATOM 1937 N NH1   . ARG E 5 91  ? -29.385 -3.451  -41.831 1.00 136.16 ? 91  ARG A NH1   1 
ATOM 1938 N NH2   . ARG E 5 91  ? -30.834 -2.621  -43.397 1.00 135.46 ? 91  ARG A NH2   1 
ATOM 1939 N N     . LEU E 5 92  ? -29.373 -9.587  -41.157 1.00 121.49 ? 92  LEU A N     1 
ATOM 1940 C CA    . LEU E 5 92  ? -30.736 -10.044 -40.840 1.00 111.59 ? 92  LEU A CA    1 
ATOM 1941 C C     . LEU E 5 92  ? -30.932 -10.308 -39.349 1.00 108.79 ? 92  LEU A C     1 
ATOM 1942 O O     . LEU E 5 92  ? -31.910 -9.860  -38.732 1.00 111.75 ? 92  LEU A O     1 
ATOM 1943 C CB    . LEU E 5 92  ? -31.089 -11.292 -41.645 1.00 105.46 ? 92  LEU A CB    1 
ATOM 1944 C CG    . LEU E 5 92  ? -31.396 -11.049 -43.121 1.00 103.25 ? 92  LEU A CG    1 
ATOM 1945 C CD1   . LEU E 5 92  ? -32.142 -12.227 -43.757 1.00 107.00 ? 92  LEU A CD1   1 
ATOM 1946 C CD2   . LEU E 5 92  ? -32.200 -9.775  -43.285 1.00 97.87  ? 92  LEU A CD2   1 
ATOM 1947 N N     . TYR E 5 93  ? -29.980 -11.020 -38.767 1.00 105.17 ? 93  TYR A N     1 
ATOM 1948 C CA    . TYR E 5 93  ? -29.977 -11.220 -37.332 1.00 107.09 ? 93  TYR A CA    1 
ATOM 1949 C C     . TYR E 5 93  ? -29.864 -9.881  -36.593 1.00 104.90 ? 93  TYR A C     1 
ATOM 1950 O O     . TYR E 5 93  ? -30.546 -9.665  -35.591 1.00 107.80 ? 93  TYR A O     1 
ATOM 1951 C CB    . TYR E 5 93  ? -28.866 -12.199 -36.935 1.00 114.37 ? 93  TYR A CB    1 
ATOM 1952 C CG    . TYR E 5 93  ? -29.123 -13.609 -37.440 1.00 122.29 ? 93  TYR A CG    1 
ATOM 1953 C CD1   . TYR E 5 93  ? -30.371 -13.963 -37.944 1.00 125.31 ? 93  TYR A CD1   1 
ATOM 1954 C CD2   . TYR E 5 93  ? -28.133 -14.585 -37.408 1.00 122.34 ? 93  TYR A CD2   1 
ATOM 1955 C CE1   . TYR E 5 93  ? -30.626 -15.247 -38.408 1.00 123.77 ? 93  TYR A CE1   1 
ATOM 1956 C CE2   . TYR E 5 93  ? -28.383 -15.872 -37.868 1.00 121.23 ? 93  TYR A CE2   1 
ATOM 1957 C CZ    . TYR E 5 93  ? -29.630 -16.193 -38.368 1.00 121.36 ? 93  TYR A CZ    1 
ATOM 1958 O OH    . TYR E 5 93  ? -29.891 -17.461 -38.831 1.00 121.66 ? 93  TYR A OH    1 
ATOM 1959 N N     . GLY E 5 94  ? -29.028 -8.972  -37.092 1.00 99.05  ? 94  GLY A N     1 
ATOM 1960 C CA    . GLY E 5 94  ? -28.978 -7.625  -36.538 1.00 90.19  ? 94  GLY A CA    1 
ATOM 1961 C C     . GLY E 5 94  ? -30.351 -6.979  -36.501 1.00 82.62  ? 94  GLY A C     1 
ATOM 1962 O O     . GLY E 5 94  ? -30.822 -6.544  -35.452 1.00 82.90  ? 94  GLY A O     1 
ATOM 1963 N N     . LEU E 5 95  ? -30.992 -6.948  -37.662 1.00 75.50  ? 95  LEU A N     1 
ATOM 1964 C CA    . LEU E 5 95  ? -32.344 -6.447  -37.825 1.00 74.31  ? 95  LEU A CA    1 
ATOM 1965 C C     . LEU E 5 95  ? -33.327 -7.013  -36.806 1.00 78.39  ? 95  LEU A C     1 
ATOM 1966 O O     . LEU E 5 95  ? -34.093 -6.260  -36.197 1.00 77.12  ? 95  LEU A O     1 
ATOM 1967 C CB    . LEU E 5 95  ? -32.844 -6.762  -39.229 1.00 64.93  ? 95  LEU A CB    1 
ATOM 1968 C CG    . LEU E 5 95  ? -34.362 -6.630  -39.321 1.00 65.14  ? 95  LEU A CG    1 
ATOM 1969 C CD1   . LEU E 5 95  ? -34.750 -5.181  -39.147 1.00 70.48  ? 95  LEU A CD1   1 
ATOM 1970 C CD2   . LEU E 5 95  ? -34.894 -7.165  -40.635 1.00 64.70  ? 95  LEU A CD2   1 
ATOM 1971 N N     . VAL E 5 96  ? -33.342 -8.333  -36.633 1.00 87.52  ? 96  VAL A N     1 
ATOM 1972 C CA    . VAL E 5 96  ? -34.190 -8.897  -35.575 1.00 98.70  ? 96  VAL A CA    1 
ATOM 1973 C C     . VAL E 5 96  ? -33.806 -8.281  -34.239 1.00 108.75 ? 96  VAL A C     1 
ATOM 1974 O O     . VAL E 5 96  ? -34.605 -7.574  -33.614 1.00 111.60 ? 96  VAL A O     1 
ATOM 1975 C CB    . VAL E 5 96  ? -34.196 -10.464 -35.460 1.00 72.95  ? 96  VAL A CB    1 
ATOM 1976 C CG1   . VAL E 5 96  ? -34.474 -11.139 -36.787 1.00 65.53  ? 96  VAL A CG1   1 
ATOM 1977 C CG2   . VAL E 5 96  ? -32.913 -10.975 -34.847 1.00 84.21  ? 96  VAL A CG2   1 
ATOM 1978 N N     . LYS E 5 97  ? -32.568 -8.506  -33.823 1.00 113.73 ? 97  LYS A N     1 
ATOM 1979 C CA    . LYS E 5 97  ? -32.187 -8.119  -32.492 1.00 119.70 ? 97  LYS A CA    1 
ATOM 1980 C C     . LYS E 5 97  ? -32.724 -6.729  -32.223 1.00 124.42 ? 97  LYS A C     1 
ATOM 1981 O O     . LYS E 5 97  ? -33.242 -6.458  -31.145 1.00 130.88 ? 97  LYS A O     1 
ATOM 1982 C CB    . LYS E 5 97  ? -30.672 -8.086  -32.384 1.00 121.57 ? 97  LYS A CB    1 
ATOM 1983 C CG    . LYS E 5 97  ? -30.218 -7.679  -31.004 1.00 122.86 ? 97  LYS A CG    1 
ATOM 1984 C CD    . LYS E 5 97  ? -30.201 -8.886  -30.089 1.00 118.99 ? 97  LYS A CD    1 
ATOM 1985 C CE    . LYS E 5 97  ? -29.118 -9.855  -30.522 1.00 115.09 ? 97  LYS A CE    1 
ATOM 1986 N NZ    . LYS E 5 97  ? -29.397 -11.226 -30.051 1.00 113.42 ? 97  LYS A NZ    1 
ATOM 1987 N N     . LEU E 5 98  ? -32.616 -5.862  -33.225 1.00 118.13 ? 98  LEU A N     1 
ATOM 1988 C CA    . LEU E 5 98  ? -33.239 -4.547  -33.169 1.00 110.04 ? 98  LEU A CA    1 
ATOM 1989 C C     . LEU E 5 98  ? -34.737 -4.671  -32.877 1.00 108.45 ? 98  LEU A C     1 
ATOM 1990 O O     . LEU E 5 98  ? -35.211 -4.263  -31.814 1.00 112.70 ? 98  LEU A O     1 
ATOM 1991 C CB    . LEU E 5 98  ? -33.022 -3.818  -34.500 1.00 102.39 ? 98  LEU A CB    1 
ATOM 1992 C CG    . LEU E 5 98  ? -32.743 -2.323  -34.540 1.00 97.51  ? 98  LEU A CG    1 
ATOM 1993 C CD1   . LEU E 5 98  ? -31.613 -1.961  -33.607 1.00 97.48  ? 98  LEU A CD1   1 
ATOM 1994 C CD2   . LEU E 5 98  ? -32.395 -1.934  -35.963 1.00 95.57  ? 98  LEU A CD2   1 
ATOM 1995 N N     . LEU E 5 99  ? -35.474 -5.256  -33.817 1.00 101.09 ? 99  LEU A N     1 
ATOM 1996 C CA    . LEU E 5 99  ? -36.926 -5.239  -33.744 1.00 97.64  ? 99  LEU A CA    1 
ATOM 1997 C C     . LEU E 5 99  ? -37.433 -5.800  -32.421 1.00 103.05 ? 99  LEU A C     1 
ATOM 1998 O O     . LEU E 5 99  ? -38.166 -5.139  -31.669 1.00 105.59 ? 99  LEU A O     1 
ATOM 1999 C CB    . LEU E 5 99  ? -37.515 -6.029  -34.911 1.00 89.37  ? 99  LEU A CB    1 
ATOM 2000 C CG    . LEU E 5 99  ? -37.218 -5.483  -36.304 1.00 87.17  ? 99  LEU A CG    1 
ATOM 2001 C CD1   . LEU E 5 99  ? -37.660 -6.464  -37.368 1.00 87.88  ? 99  LEU A CD1   1 
ATOM 2002 C CD2   . LEU E 5 99  ? -37.881 -4.125  -36.542 1.00 86.85  ? 99  LEU A CD2   1 
ATOM 2003 N N     . GLU E 5 100 ? -37.005 -7.016  -32.128 1.00 109.27 ? 100 GLU A N     1 
ATOM 2004 C CA    . GLU E 5 100 ? -37.447 -7.709  -30.932 1.00 118.55 ? 100 GLU A CA    1 
ATOM 2005 C C     . GLU E 5 100 ? -36.895 -7.085  -29.657 1.00 122.71 ? 100 GLU A C     1 
ATOM 2006 O O     . GLU E 5 100 ? -37.623 -6.945  -28.685 1.00 129.31 ? 100 GLU A O     1 
ATOM 2007 C CB    . GLU E 5 100 ? -37.040 -9.177  -30.993 1.00 120.90 ? 100 GLU A CB    1 
ATOM 2008 C CG    . GLU E 5 100 ? -37.981 -10.036 -31.757 1.00 123.58 ? 100 GLU A CG    1 
ATOM 2009 C CD    . GLU E 5 100 ? -37.668 -11.477 -31.551 1.00 130.41 ? 100 GLU A CD    1 
ATOM 2010 O OE1   . GLU E 5 100 ? -36.564 -11.777 -31.048 1.00 138.28 ? 100 GLU A OE1   1 
ATOM 2011 O OE2   . GLU E 5 100 ? -38.530 -12.307 -31.879 1.00 127.59 ? 100 GLU A OE2   1 
ATOM 2012 N N     . PHE E 5 101 ? -35.626 -6.685  -29.666 1.00 99.04  ? 101 PHE A N     1 
ATOM 2013 C CA    . PHE E 5 101 ? -34.972 -6.283  -28.430 1.00 94.23  ? 101 PHE A CA    1 
ATOM 2014 C C     . PHE E 5 101 ? -35.865 -5.327  -27.658 1.00 95.90  ? 101 PHE A C     1 
ATOM 2015 O O     . PHE E 5 101 ? -36.322 -4.317  -28.187 1.00 98.98  ? 101 PHE A O     1 
ATOM 2016 C CB    . PHE E 5 101 ? -33.633 -5.570  -28.723 1.00 90.25  ? 101 PHE A CB    1 
ATOM 2017 C CG    . PHE E 5 101 ? -32.803 -5.260  -27.484 1.00 86.43  ? 101 PHE A CG    1 
ATOM 2018 C CD1   . PHE E 5 101 ? -33.271 -4.406  -26.496 1.00 86.52  ? 101 PHE A CD1   1 
ATOM 2019 C CD2   . PHE E 5 101 ? -31.529 -5.782  -27.337 1.00 85.74  ? 101 PHE A CD2   1 
ATOM 2020 C CE1   . PHE E 5 101 ? -32.491 -4.114  -25.372 1.00 85.70  ? 101 PHE A CE1   1 
ATOM 2021 C CE2   . PHE E 5 101 ? -30.746 -5.482  -26.211 1.00 85.26  ? 101 PHE A CE2   1 
ATOM 2022 C CZ    . PHE E 5 101 ? -31.234 -4.648  -25.232 1.00 83.78  ? 101 PHE A CZ    1 
ATOM 2023 N N     . ASP E 5 102 ? -36.125 -5.661  -26.399 1.00 95.43  ? 102 ASP A N     1 
ATOM 2024 C CA    . ASP E 5 102 ? -36.833 -4.737  -25.529 1.00 98.65  ? 102 ASP A CA    1 
ATOM 2025 C C     . ASP E 5 102 ? -35.810 -3.956  -24.723 1.00 95.62  ? 102 ASP A C     1 
ATOM 2026 O O     . ASP E 5 102 ? -35.081 -4.540  -23.916 1.00 96.85  ? 102 ASP A O     1 
ATOM 2027 C CB    . ASP E 5 102 ? -37.774 -5.464  -24.570 1.00 104.38 ? 102 ASP A CB    1 
ATOM 2028 C CG    . ASP E 5 102 ? -38.484 -4.509  -23.618 1.00 110.28 ? 102 ASP A CG    1 
ATOM 2029 O OD1   . ASP E 5 102 ? -38.004 -3.371  -23.488 1.00 112.55 ? 102 ASP A OD1   1 
ATOM 2030 O OD2   . ASP E 5 102 ? -39.513 -4.880  -23.006 1.00 112.02 ? 102 ASP A OD2   1 
ATOM 2031 N N     . TYR E 5 103 ? -35.759 -2.641  -24.940 1.00 90.20  ? 103 TYR A N     1 
ATOM 2032 C CA    . TYR E 5 103 ? -34.946 -1.751  -24.110 1.00 83.58  ? 103 TYR A CA    1 
ATOM 2033 C C     . TYR E 5 103 ? -35.532 -1.613  -22.700 1.00 79.25  ? 103 TYR A C     1 
ATOM 2034 O O     . TYR E 5 103 ? -34.784 -1.500  -21.731 1.00 77.17  ? 103 TYR A O     1 
ATOM 2035 C CB    . TYR E 5 103 ? -34.794 -0.355  -24.746 1.00 81.89  ? 103 TYR A CB    1 
ATOM 2036 C CG    . TYR E 5 103 ? -33.638 -0.225  -25.718 1.00 82.19  ? 103 TYR A CG    1 
ATOM 2037 C CD1   . TYR E 5 103 ? -32.377 0.180   -25.294 1.00 85.68  ? 103 TYR A CD1   1 
ATOM 2038 C CD2   . TYR E 5 103 ? -33.812 -0.498  -27.066 1.00 81.25  ? 103 TYR A CD2   1 
ATOM 2039 C CE1   . TYR E 5 103 ? -31.324 0.294   -26.191 1.00 89.31  ? 103 TYR A CE1   1 
ATOM 2040 C CE2   . TYR E 5 103 ? -32.769 -0.387  -27.961 1.00 84.29  ? 103 TYR A CE2   1 
ATOM 2041 C CZ    . TYR E 5 103 ? -31.530 0.009   -27.521 1.00 89.94  ? 103 TYR A CZ    1 
ATOM 2042 O OH    . TYR E 5 103 ? -30.493 0.120   -28.420 1.00 95.46  ? 103 TYR A OH    1 
ATOM 2043 N N     . SER E 5 104 ? -36.851 -1.729  -22.562 1.00 78.06  ? 104 SER A N     1 
ATOM 2044 C CA    . SER E 5 104 ? -37.555 -1.302  -21.341 1.00 80.94  ? 104 SER A CA    1 
ATOM 2045 C C     . SER E 5 104 ? -36.849 -1.768  -20.080 1.00 87.75  ? 104 SER A C     1 
ATOM 2046 O O     . SER E 5 104 ? -37.069 -1.227  -18.996 1.00 87.74  ? 104 SER A O     1 
ATOM 2047 C CB    . SER E 5 104 ? -38.984 -1.856  -21.317 1.00 78.33  ? 104 SER A CB    1 
ATOM 2048 O OG    . SER E 5 104 ? -39.499 -1.928  -19.994 1.00 76.07  ? 104 SER A OG    1 
ATOM 2049 N N     . ASN E 5 105 ? -36.039 -2.807  -20.221 1.00 96.00  ? 105 ASN A N     1 
ATOM 2050 C CA    . ASN E 5 105 ? -35.166 -3.245  -19.151 1.00 101.49 ? 105 ASN A CA    1 
ATOM 2051 C C     . ASN E 5 105 ? -33.890 -2.405  -19.013 1.00 100.99 ? 105 ASN A C     1 
ATOM 2052 O O     . ASN E 5 105 ? -33.696 -1.729  -18.008 1.00 102.19 ? 105 ASN A O     1 
ATOM 2053 C CB    . ASN E 5 105 ? -34.806 -4.728  -19.323 1.00 109.28 ? 105 ASN A CB    1 
ATOM 2054 C CG    . ASN E 5 105 ? -36.021 -5.643  -19.322 1.00 121.51 ? 105 ASN A CG    1 
ATOM 2055 O OD1   . ASN E 5 105 ? -37.161 -5.203  -19.161 1.00 134.78 ? 105 ASN A OD1   1 
ATOM 2056 N ND2   . ASN E 5 105 ? -35.773 -6.933  -19.523 1.00 120.67 ? 105 ASN A ND2   1 
ATOM 2057 N N     . VAL E 5 106 ? -33.020 -2.434  -20.013 1.00 101.30 ? 106 VAL A N     1 
ATOM 2058 C CA    . VAL E 5 106 ? -31.754 -1.705  -19.915 1.00 102.53 ? 106 VAL A CA    1 
ATOM 2059 C C     . VAL E 5 106 ? -31.930 -0.233  -19.446 1.00 98.04  ? 106 VAL A C     1 
ATOM 2060 O O     . VAL E 5 106 ? -31.070 0.331   -18.750 1.00 99.56  ? 106 VAL A O     1 
ATOM 2061 C CB    . VAL E 5 106 ? -30.949 -1.829  -21.257 1.00 82.35  ? 106 VAL A CB    1 
ATOM 2062 C CG1   . VAL E 5 106 ? -31.814 -1.404  -22.440 1.00 82.69  ? 106 VAL A CG1   1 
ATOM 2063 C CG2   . VAL E 5 106 ? -29.641 -1.055  -21.207 1.00 83.11  ? 106 VAL A CG2   1 
ATOM 2064 N N     . ILE E 5 107 ? -33.062 0.374   -19.789 1.00 93.37  ? 107 ILE A N     1 
ATOM 2065 C CA    . ILE E 5 107 ? -33.222 1.819   -19.597 1.00 88.37  ? 107 ILE A CA    1 
ATOM 2066 C C     . ILE E 5 107 ? -32.849 2.359   -18.212 1.00 87.29  ? 107 ILE A C     1 
ATOM 2067 O O     . ILE E 5 107 ? -32.200 3.398   -18.106 1.00 93.68  ? 107 ILE A O     1 
ATOM 2068 C CB    . ILE E 5 107 ? -34.666 2.309   -19.870 1.00 83.12  ? 107 ILE A CB    1 
ATOM 2069 C CG1   . ILE E 5 107 ? -34.954 2.397   -21.374 1.00 89.22  ? 107 ILE A CG1   1 
ATOM 2070 C CG2   . ILE E 5 107 ? -34.890 3.645   -19.178 1.00 77.28  ? 107 ILE A CG2   1 
ATOM 2071 C CD1   . ILE E 5 107 ? -34.547 1.194   -22.187 1.00 91.25  ? 107 ILE A CD1   1 
ATOM 2072 N N     . ALA E 5 108 ? -33.286 1.692   -17.151 1.00 80.41  ? 108 ALA A N     1 
ATOM 2073 C CA    . ALA E 5 108 ? -33.126 2.253   -15.811 1.00 72.84  ? 108 ALA A CA    1 
ATOM 2074 C C     . ALA E 5 108 ? -31.669 2.365   -15.392 1.00 68.46  ? 108 ALA A C     1 
ATOM 2075 O O     . ALA E 5 108 ? -31.354 3.025   -14.405 1.00 66.14  ? 108 ALA A O     1 
ATOM 2076 C CB    . ALA E 5 108 ? -33.912 1.460   -14.798 1.00 68.09  ? 108 ALA A CB    1 
ATOM 2077 N N     . ILE E 5 109 ? -30.780 1.717   -16.136 1.00 68.22  ? 109 ILE A N     1 
ATOM 2078 C CA    . ILE E 5 109 ? -29.358 1.875   -15.859 1.00 71.60  ? 109 ILE A CA    1 
ATOM 2079 C C     . ILE E 5 109 ? -28.923 3.222   -16.422 1.00 78.71  ? 109 ILE A C     1 
ATOM 2080 O O     . ILE E 5 109 ? -28.227 3.991   -15.764 1.00 84.27  ? 109 ILE A O     1 
ATOM 2081 C CB    . ILE E 5 109 ? -28.504 0.717   -16.439 1.00 99.88  ? 109 ILE A CB    1 
ATOM 2082 C CG1   . ILE E 5 109 ? -28.812 -0.598  -15.723 1.00 103.62 ? 109 ILE A CG1   1 
ATOM 2083 C CG2   . ILE E 5 109 ? -27.026 0.996   -16.274 1.00 97.41  ? 109 ILE A CG2   1 
ATOM 2084 C CD1   . ILE E 5 109 ? -30.049 -1.292  -16.218 1.00 105.96 ? 109 ILE A CD1   1 
ATOM 2085 N N     . LEU E 5 110 ? -29.359 3.500   -17.645 1.00 79.93  ? 110 LEU A N     1 
ATOM 2086 C CA    . LEU E 5 110 ? -29.208 4.817   -18.239 1.00 79.31  ? 110 LEU A CA    1 
ATOM 2087 C C     . LEU E 5 110 ? -29.733 5.864   -17.257 1.00 81.85  ? 110 LEU A C     1 
ATOM 2088 O O     . LEU E 5 110 ? -28.950 6.580   -16.605 1.00 84.14  ? 110 LEU A O     1 
ATOM 2089 C CB    . LEU E 5 110 ? -29.975 4.864   -19.555 1.00 77.76  ? 110 LEU A CB    1 
ATOM 2090 C CG    . LEU E 5 110 ? -29.847 6.099   -20.431 1.00 76.86  ? 110 LEU A CG    1 
ATOM 2091 C CD1   . LEU E 5 110 ? -28.529 6.090   -21.172 1.00 76.81  ? 110 LEU A CD1   1 
ATOM 2092 C CD2   . LEU E 5 110 ? -30.993 6.123   -21.406 1.00 78.89  ? 110 LEU A CD2   1 
ATOM 2093 N N     . GLN E 5 111 ? -31.050 5.876   -17.067 1.00 80.78  ? 111 GLN A N     1 
ATOM 2094 C CA    . GLN E 5 111 ? -31.679 6.831   -16.152 1.00 79.68  ? 111 GLN A CA    1 
ATOM 2095 C C     . GLN E 5 111 ? -30.823 6.926   -14.884 1.00 81.64  ? 111 GLN A C     1 
ATOM 2096 O O     . GLN E 5 111 ? -30.211 7.962   -14.621 1.00 82.95  ? 111 GLN A O     1 
ATOM 2097 C CB    . GLN E 5 111 ? -33.098 6.412   -15.811 1.00 75.69  ? 111 GLN A CB    1 
ATOM 2098 C CG    . GLN E 5 111 ? -34.036 6.361   -17.006 1.00 76.53  ? 111 GLN A CG    1 
ATOM 2099 C CD    . GLN E 5 111 ? -35.409 5.858   -16.644 1.00 80.58  ? 111 GLN A CD    1 
ATOM 2100 O OE1   . GLN E 5 111 ? -35.677 5.528   -15.492 1.00 83.87  ? 111 GLN A OE1   1 
ATOM 2101 N NE2   . GLN E 5 111 ? -36.294 5.795   -17.629 1.00 82.13  ? 111 GLN A NE2   1 
ATOM 2102 N N     . LYS E 5 112 ? -30.653 5.814   -14.182 1.00 80.30  ? 112 LYS A N     1 
ATOM 2103 C CA    . LYS E 5 112 ? -30.038 5.838   -12.860 1.00 79.09  ? 112 LYS A CA    1 
ATOM 2104 C C     . LYS E 5 112 ? -28.803 6.755   -12.775 1.00 79.02  ? 112 LYS A C     1 
ATOM 2105 O O     . LYS E 5 112 ? -28.670 7.503   -11.794 1.00 79.72  ? 112 LYS A O     1 
ATOM 2106 C CB    . LYS E 5 112 ? -29.602 4.431   -12.465 1.00 78.53  ? 112 LYS A CB    1 
ATOM 2107 C CG    . LYS E 5 112 ? -28.842 4.368   -11.155 1.00 76.82  ? 112 LYS A CG    1 
ATOM 2108 C CD    . LYS E 5 112 ? -29.835 4.700   -10.059 1.00 77.25  ? 112 LYS A CD    1 
ATOM 2109 C CE    . LYS E 5 112 ? -29.310 4.570   -8.643  1.00 78.28  ? 112 LYS A CE    1 
ATOM 2110 N NZ    . LYS E 5 112 ? -28.801 3.236   -8.235  1.00 80.54  ? 112 LYS A NZ    1 
ATOM 2111 N N     . ILE E 5 113 ? -27.894 6.662   -13.757 1.00 80.95  ? 113 ILE A N     1 
ATOM 2112 C CA    . ILE E 5 113 ? -26.648 7.438   -13.750 1.00 87.12  ? 113 ILE A CA    1 
ATOM 2113 C C     . ILE E 5 113 ? -26.779 8.829   -14.351 1.00 95.59  ? 113 ILE A C     1 
ATOM 2114 O O     . ILE E 5 113 ? -26.267 9.827   -13.814 1.00 100.05 ? 113 ILE A O     1 
ATOM 2115 C CB    . ILE E 5 113 ? -25.494 6.602   -14.331 1.00 87.23  ? 113 ILE A CB    1 
ATOM 2116 C CG1   . ILE E 5 113 ? -25.835 5.974   -15.708 1.00 85.46  ? 113 ILE A CG1   1 
ATOM 2117 C CG2   . ILE E 5 113 ? -25.156 5.538   -13.330 1.00 88.51  ? 113 ILE A CG2   1 
ATOM 2118 C CD1   . ILE E 5 113 ? -25.537 4.411   -15.797 1.00 51.51  ? 113 ILE A CD1   1 
ATOM 2119 N N     . SER E 5 114 ? -27.512 8.880   -15.453 1.00 98.57  ? 114 SER A N     1 
ATOM 2120 C CA    . SER E 5 114 ? -27.551 10.092  -16.224 1.00 99.54  ? 114 SER A CA    1 
ATOM 2121 C C     . SER E 5 114 ? -27.860 11.178  -15.214 1.00 97.37  ? 114 SER A C     1 
ATOM 2122 O O     . SER E 5 114 ? -27.094 12.134  -15.055 1.00 100.71 ? 114 SER A O     1 
ATOM 2123 C CB    . SER E 5 114 ? -28.622 9.995   -17.306 1.00 102.21 ? 114 SER A CB    1 
ATOM 2124 O OG    . SER E 5 114 ? -28.279 8.999   -18.256 1.00 103.38 ? 114 SER A OG    1 
ATOM 2125 N N     . ILE E 5 115 ? -28.948 10.974  -14.478 1.00 91.71  ? 115 ILE A N     1 
ATOM 2126 C CA    . ILE E 5 115 ? -29.378 11.907  -13.453 1.00 86.13  ? 115 ILE A CA    1 
ATOM 2127 C C     . ILE E 5 115 ? -28.294 12.184  -12.414 1.00 83.80  ? 115 ILE A C     1 
ATOM 2128 O O     . ILE E 5 115 ? -27.904 13.329  -12.199 1.00 87.74  ? 115 ILE A O     1 
ATOM 2129 C CB    . ILE E 5 115 ? -30.637 11.404  -12.752 1.00 85.95  ? 115 ILE A CB    1 
ATOM 2130 C CG1   . ILE E 5 115 ? -31.142 12.453  -11.779 1.00 98.11  ? 115 ILE A CG1   1 
ATOM 2131 C CG2   . ILE E 5 115 ? -30.361 10.124  -12.011 1.00 78.59  ? 115 ILE A CG2   1 
ATOM 2132 C CD1   . ILE E 5 115 ? -32.186 11.929  -10.882 1.00 109.88 ? 115 ILE A CD1   1 
ATOM 2133 N N     . ASN E 5 116 ? -27.814 11.135  -11.764 1.00 81.60  ? 116 ASN A N     1 
ATOM 2134 C CA    . ASN E 5 116 ? -26.731 11.265  -10.797 1.00 82.40  ? 116 ASN A CA    1 
ATOM 2135 C C     . ASN E 5 116 ? -25.463 11.885  -11.386 1.00 79.02  ? 116 ASN A C     1 
ATOM 2136 O O     . ASN E 5 116 ? -24.608 12.349  -10.636 1.00 80.58  ? 116 ASN A O     1 
ATOM 2137 C CB    . ASN E 5 116 ? -26.387 9.905   -10.165 1.00 90.83  ? 116 ASN A CB    1 
ATOM 2138 C CG    . ASN E 5 116 ? -27.399 9.455   -9.107  1.00 95.27  ? 116 ASN A CG    1 
ATOM 2139 O OD1   . ASN E 5 116 ? -27.253 9.770   -7.926  1.00 99.13  ? 116 ASN A OD1   1 
ATOM 2140 N ND2   . ASN E 5 116 ? -28.418 8.701   -9.528  1.00 94.08  ? 116 ASN A ND2   1 
ATOM 2141 N N     . LEU E 5 117 ? -25.306 11.867  -12.708 1.00 73.16  ? 117 LEU A N     1 
ATOM 2142 C CA    . LEU E 5 117 ? -24.129 12.518  -13.277 1.00 73.03  ? 117 LEU A CA    1 
ATOM 2143 C C     . LEU E 5 117 ? -24.380 13.974  -13.680 1.00 85.46  ? 117 LEU A C     1 
ATOM 2144 O O     . LEU E 5 117 ? -23.445 14.751  -13.894 1.00 90.07  ? 117 LEU A O     1 
ATOM 2145 C CB    . LEU E 5 117 ? -23.555 11.723  -14.448 1.00 63.36  ? 117 LEU A CB    1 
ATOM 2146 C CG    . LEU E 5 117 ? -22.476 10.724  -14.065 1.00 56.89  ? 117 LEU A CG    1 
ATOM 2147 C CD1   . LEU E 5 117 ? -21.690 10.314  -15.293 1.00 55.36  ? 117 LEU A CD1   1 
ATOM 2148 C CD2   . LEU E 5 117 ? -21.552 11.327  -13.026 1.00 55.04  ? 117 LEU A CD2   1 
ATOM 2149 N N     . TRP E 5 118 ? -25.650 14.350  -13.748 1.00 91.05  ? 118 TRP A N     1 
ATOM 2150 C CA    . TRP E 5 118 ? -26.016 15.736  -13.995 1.00 96.07  ? 118 TRP A CA    1 
ATOM 2151 C C     . TRP E 5 118 ? -25.973 16.519  -12.702 1.00 102.16 ? 118 TRP A C     1 
ATOM 2152 O O     . TRP E 5 118 ? -25.554 17.666  -12.677 1.00 106.05 ? 118 TRP A O     1 
ATOM 2153 C CB    . TRP E 5 118 ? -27.409 15.829  -14.610 1.00 96.57  ? 118 TRP A CB    1 
ATOM 2154 C CG    . TRP E 5 118 ? -27.468 15.515  -16.076 1.00 100.17 ? 118 TRP A CG    1 
ATOM 2155 C CD1   . TRP E 5 118 ? -27.951 14.376  -16.655 1.00 103.48 ? 118 TRP A CD1   1 
ATOM 2156 C CD2   . TRP E 5 118 ? -27.053 16.361  -17.149 1.00 101.83 ? 118 TRP A CD2   1 
ATOM 2157 N NE1   . TRP E 5 118 ? -27.858 14.463  -18.022 1.00 105.17 ? 118 TRP A NE1   1 
ATOM 2158 C CE2   . TRP E 5 118 ? -27.308 15.674  -18.350 1.00 104.14 ? 118 TRP A CE2   1 
ATOM 2159 C CE3   . TRP E 5 118 ? -26.487 17.632  -17.210 1.00 102.38 ? 118 TRP A CE3   1 
ATOM 2160 C CZ2   . TRP E 5 118 ? -27.019 16.212  -19.594 1.00 105.76 ? 118 TRP A CZ2   1 
ATOM 2161 C CZ3   . TRP E 5 118 ? -26.200 18.165  -18.445 1.00 104.77 ? 118 TRP A CZ3   1 
ATOM 2162 C CH2   . TRP E 5 118 ? -26.466 17.457  -19.622 1.00 105.78 ? 118 TRP A CH2   1 
ATOM 2163 N N     . ASN E 5 119 ? -26.419 15.886  -11.627 1.00 104.89 ? 119 ASN A N     1 
ATOM 2164 C CA    . ASN E 5 119 ? -26.460 16.525  -10.328 1.00 109.19 ? 119 ASN A CA    1 
ATOM 2165 C C     . ASN E 5 119 ? -25.078 17.031  -9.972  1.00 107.30 ? 119 ASN A C     1 
ATOM 2166 O O     . ASN E 5 119 ? -24.149 16.246  -9.780  1.00 110.16 ? 119 ASN A O     1 
ATOM 2167 C CB    . ASN E 5 119 ? -26.928 15.506  -9.293  1.00 111.13 ? 119 ASN A CB    1 
ATOM 2168 C CG    . ASN E 5 119 ? -26.965 16.062  -7.898  1.00 110.81 ? 119 ASN A CG    1 
ATOM 2169 O OD1   . ASN E 5 119 ? -26.973 17.277  -7.695  1.00 108.36 ? 119 ASN A OD1   1 
ATOM 2170 N ND2   . ASN E 5 119 ? -26.996 15.169  -6.916  1.00 109.96 ? 119 ASN A ND2   1 
ATOM 2171 N N     . PRO E 5 120 ? -24.944 18.360  -9.880  1.00 106.51 ? 120 PRO A N     1 
ATOM 2172 C CA    . PRO E 5 120 ? -23.675 19.040  -9.617  1.00 104.61 ? 120 PRO A CA    1 
ATOM 2173 C C     . PRO E 5 120 ? -23.244 18.832  -8.181  1.00 106.51 ? 120 PRO A C     1 
ATOM 2174 O O     . PRO E 5 120 ? -22.061 18.972  -7.860  1.00 105.61 ? 120 PRO A O     1 
ATOM 2175 C CB    . PRO E 5 120 ? -24.025 20.497  -9.862  1.00 104.90 ? 120 PRO A CB    1 
ATOM 2176 C CG    . PRO E 5 120 ? -25.447 20.590  -9.442  1.00 105.64 ? 120 PRO A CG    1 
ATOM 2177 C CD    . PRO E 5 120 ? -26.077 19.300  -9.890  1.00 105.50 ? 120 PRO A CD    1 
ATOM 2178 N N     . SER E 5 121 ? -24.209 18.534  -7.316  1.00 107.76 ? 121 SER A N     1 
ATOM 2179 C CA    . SER E 5 121 ? -23.891 18.263  -5.924  1.00 109.69 ? 121 SER A CA    1 
ATOM 2180 C C     . SER E 5 121 ? -23.900 16.761  -5.721  1.00 113.94 ? 121 SER A C     1 
ATOM 2181 O O     . SER E 5 121 ? -24.951 16.117  -5.692  1.00 115.64 ? 121 SER A O     1 
ATOM 2182 C CB    . SER E 5 121 ? -24.894 18.937  -4.981  1.00 108.50 ? 121 SER A CB    1 
ATOM 2183 O OG    . SER E 5 121 ? -26.087 18.193  -4.889  1.00 107.72 ? 121 SER A OG    1 
ATOM 2184 N N     . THR E 5 122 ? -22.710 16.202  -5.585  1.00 117.96 ? 122 THR A N     1 
ATOM 2185 C CA    . THR E 5 122 ? -22.581 14.811  -5.226  1.00 119.37 ? 122 THR A CA    1 
ATOM 2186 C C     . THR E 5 122 ? -21.618 14.801  -4.083  1.00 122.89 ? 122 THR A C     1 
ATOM 2187 O O     . THR E 5 122 ? -20.423 15.049  -4.239  1.00 118.87 ? 122 THR A O     1 
ATOM 2188 C CB    . THR E 5 122 ? -21.995 14.021  -6.369  1.00 117.57 ? 122 THR A CB    1 
ATOM 2189 O OG1   . THR E 5 122 ? -20.827 14.700  -6.843  1.00 119.47 ? 122 THR A OG1   1 
ATOM 2190 C CG2   . THR E 5 122 ? -23.005 13.935  -7.489  1.00 115.64 ? 122 THR A CG2   1 
ATOM 2191 N N     . ASP E 5 123 ? -22.165 14.520  -2.920  1.00 132.29 ? 123 ASP A N     1 
ATOM 2192 C CA    . ASP E 5 123 ? -21.395 14.518  -1.713  1.00 145.97 ? 123 ASP A CA    1 
ATOM 2193 C C     . ASP E 5 123 ? -20.728 13.174  -1.622  1.00 151.42 ? 123 ASP A C     1 
ATOM 2194 O O     . ASP E 5 123 ? -19.549 13.068  -1.297  1.00 152.26 ? 123 ASP A O     1 
ATOM 2195 C CB    . ASP E 5 123 ? -22.318 14.714  -0.524  1.00 154.81 ? 123 ASP A CB    1 
ATOM 2196 C CG    . ASP E 5 123 ? -21.633 14.429  0.773   1.00 162.92 ? 123 ASP A CG    1 
ATOM 2197 O OD1   . ASP E 5 123 ? -21.112 15.390  1.371   1.00 163.47 ? 123 ASP A OD1   1 
ATOM 2198 O OD2   . ASP E 5 123 ? -21.593 13.247  1.180   1.00 167.20 ? 123 ASP A OD2   1 
ATOM 2199 N N     . SER E 5 124 ? -21.505 12.151  -1.960  1.00 157.69 ? 124 SER A N     1 
ATOM 2200 C CA    . SER E 5 124 ? -21.168 10.757  -1.683  1.00 164.05 ? 124 SER A CA    1 
ATOM 2201 C C     . SER E 5 124 ? -19.874 10.291  -2.333  1.00 163.32 ? 124 SER A C     1 
ATOM 2202 O O     . SER E 5 124 ? -19.343 9.238   -1.967  1.00 162.24 ? 124 SER A O     1 
ATOM 2203 C CB    . SER E 5 124 ? -22.311 9.837   -2.120  1.00 171.47 ? 124 SER A CB    1 
ATOM 2204 O OG    . SER E 5 124 ? -23.508 10.568  -2.318  1.00 175.45 ? 124 SER A OG    1 
ATOM 2205 N N     . LEU E 5 125 ? -19.383 11.063  -3.303  1.00 162.95 ? 125 LEU A N     1 
ATOM 2206 C CA    . LEU E 5 125 ? -18.117 10.745  -3.963  1.00 161.91 ? 125 LEU A CA    1 
ATOM 2207 C C     . LEU E 5 125 ? -16.995 11.728  -3.611  1.00 160.06 ? 125 LEU A C     1 
ATOM 2208 O O     . LEU E 5 125 ? -17.146 12.945  -3.720  1.00 161.21 ? 125 LEU A O     1 
ATOM 2209 C CB    . LEU E 5 125 ? -18.270 10.585  -5.480  1.00 163.63 ? 125 LEU A CB    1 
ATOM 2210 C CG    . LEU E 5 125 ? -19.101 11.608  -6.239  1.00 166.24 ? 125 LEU A CG    1 
ATOM 2211 C CD1   . LEU E 5 125 ? -18.787 13.003  -5.761  1.00 168.67 ? 125 LEU A CD1   1 
ATOM 2212 C CD2   . LEU E 5 125 ? -18.863 11.494  -7.731  1.00 165.72 ? 125 LEU A CD2   1 
ATOM 2213 N N     . GLN E 5 126 ? -15.885 11.163  -3.157  1.00 163.17 ? 126 GLN A N     1 
ATOM 2214 C CA    . GLN E 5 126 ? -14.718 11.892  -2.709  1.00 173.49 ? 126 GLN A CA    1 
ATOM 2215 C C     . GLN E 5 126 ? -13.758 11.874  -3.862  1.00 177.00 ? 126 GLN A C     1 
ATOM 2216 O O     . GLN E 5 126 ? -12.630 12.361  -3.771  1.00 187.12 ? 126 GLN A O     1 
ATOM 2217 C CB    . GLN E 5 126 ? -14.074 11.047  -1.647  1.00 179.09 ? 126 GLN A CB    1 
ATOM 2218 C CG    . GLN E 5 126 ? -14.013 9.568   -2.152  1.00 211.07 ? 126 GLN A CG    1 
ATOM 2219 C CD    . GLN E 5 126 ? -14.299 8.516   -1.103  1.00 210.16 ? 126 GLN A CD    1 
ATOM 2220 O OE1   . GLN E 5 126 ? -15.049 8.747   -0.172  1.00 209.33 ? 126 GLN A OE1   1 
ATOM 2221 N NE2   . GLN E 5 126 ? -13.704 7.345   -1.265  1.00 209.97 ? 126 GLN A NE2   1 
ATOM 2222 N N     . SER E 5 127 ? -14.170 11.217  -4.932  1.00 172.14 ? 127 SER A N     1 
ATOM 2223 C CA    . SER E 5 127 ? -13.215 10.881  -5.950  1.00 170.56 ? 127 SER A CA    1 
ATOM 2224 C C     . SER E 5 127 ? -12.787 12.165  -6.573  1.00 166.70 ? 127 SER A C     1 
ATOM 2225 O O     . SER E 5 127 ? -13.603 13.044  -6.826  1.00 167.33 ? 127 SER A O     1 
ATOM 2226 C CB    . SER E 5 127 ? -13.833 9.948   -6.971  1.00 175.00 ? 127 SER A CB    1 
ATOM 2227 O OG    . SER E 5 127 ? -14.195 8.728   -6.353  1.00 177.04 ? 127 SER A OG    1 
ATOM 2228 N N     . LYS E 5 128 ? -11.487 12.261  -6.769  1.00 163.16 ? 128 LYS A N     1 
ATOM 2229 C CA    . LYS E 5 128 ? -10.856 13.407  -7.352  1.00 162.07 ? 128 LYS A CA    1 
ATOM 2230 C C     . LYS E 5 128 ? -11.438 13.736  -8.730  1.00 158.51 ? 128 LYS A C     1 
ATOM 2231 O O     . LYS E 5 128 ? -11.850 14.879  -8.949  1.00 161.13 ? 128 LYS A O     1 
ATOM 2232 C CB    . LYS E 5 128 ? -9.332  13.184  -7.290  1.00 165.50 ? 128 LYS A CB    1 
ATOM 2233 C CG    . LYS E 5 128 ? -8.515  13.382  -8.471  1.00 168.54 ? 128 LYS A CG    1 
ATOM 2234 C CD    . LYS E 5 128 ? -7.552  12.299  -8.235  1.00 171.75 ? 128 LYS A CD    1 
ATOM 2235 C CE    . LYS E 5 128 ? -6.620  12.221  -9.337  1.00 173.31 ? 128 LYS A CE    1 
ATOM 2236 N NZ    . LYS E 5 128 ? -5.779  13.301  -8.848  1.00 172.53 ? 128 LYS A NZ    1 
ATOM 2237 N N     . HIS E 5 129 ? -11.543 12.761  -9.634  1.00 151.02 ? 129 HIS A N     1 
ATOM 2238 C CA    . HIS E 5 129 ? -12.165 13.063  -10.917 1.00 147.73 ? 129 HIS A CA    1 
ATOM 2239 C C     . HIS E 5 129 ? -13.625 13.321  -10.634 1.00 143.72 ? 129 HIS A C     1 
ATOM 2240 O O     . HIS E 5 129 ? -14.128 12.883  -9.602  1.00 144.09 ? 129 HIS A O     1 
ATOM 2241 C CB    . HIS E 5 129 ? -12.028 11.917  -11.915 1.00 151.17 ? 129 HIS A CB    1 
ATOM 2242 C CG    . HIS E 5 129 ? -11.386 10.693  -11.350 1.00 155.33 ? 129 HIS A CG    1 
ATOM 2243 N ND1   . HIS E 5 129 ? -12.005 9.867   -10.441 1.00 158.18 ? 129 HIS A ND1   1 
ATOM 2244 C CD2   . HIS E 5 129 ? -10.168 10.138  -11.592 1.00 156.57 ? 129 HIS A CD2   1 
ATOM 2245 C CE1   . HIS E 5 129 ? -11.204 8.867   -10.135 1.00 158.51 ? 129 HIS A CE1   1 
ATOM 2246 N NE2   . HIS E 5 129 ? -10.083 9.006   -10.819 1.00 157.58 ? 129 HIS A NE2   1 
ATOM 2247 N N     . PHE E 5 130 ? -14.305 13.994  -11.557 1.00 141.62 ? 130 PHE A N     1 
ATOM 2248 C CA    . PHE E 5 130 ? -15.675 14.463  -11.337 1.00 141.73 ? 130 PHE A CA    1 
ATOM 2249 C C     . PHE E 5 130 ? -15.749 15.552  -10.273 1.00 142.78 ? 130 PHE A C     1 
ATOM 2250 O O     . PHE E 5 130 ? -16.796 15.768  -9.663  1.00 143.96 ? 130 PHE A O     1 
ATOM 2251 C CB    . PHE E 5 130 ? -16.604 13.319  -10.907 1.00 138.39 ? 130 PHE A CB    1 
ATOM 2252 C CG    . PHE E 5 130 ? -16.471 12.087  -11.728 1.00 134.44 ? 130 PHE A CG    1 
ATOM 2253 C CD1   . PHE E 5 130 ? -16.660 10.844  -11.157 1.00 133.33 ? 130 PHE A CD1   1 
ATOM 2254 C CD2   . PHE E 5 130 ? -16.159 12.165  -13.068 1.00 135.36 ? 130 PHE A CD2   1 
ATOM 2255 C CE1   . PHE E 5 130 ? -16.534 9.700   -11.910 1.00 135.24 ? 130 PHE A CE1   1 
ATOM 2256 C CE2   . PHE E 5 130 ? -16.034 11.027  -13.825 1.00 136.65 ? 130 PHE A CE2   1 
ATOM 2257 C CZ    . PHE E 5 130 ? -16.220 9.792   -13.247 1.00 136.80 ? 130 PHE A CZ    1 
ATOM 2258 N N     . LYS E 5 131 ? -14.646 16.252  -10.062 1.00 143.26 ? 131 LYS A N     1 
ATOM 2259 C CA    . LYS E 5 131 ? -14.656 17.370  -9.137  1.00 146.08 ? 131 LYS A CA    1 
ATOM 2260 C C     . LYS E 5 131 ? -15.485 18.492  -9.755  1.00 145.30 ? 131 LYS A C     1 
ATOM 2261 O O     . LYS E 5 131 ? -16.304 19.121  -9.083  1.00 146.44 ? 131 LYS A O     1 
ATOM 2262 C CB    . LYS E 5 131 ? -13.226 17.823  -8.822  1.00 150.59 ? 131 LYS A CB    1 
ATOM 2263 C CG    . LYS E 5 131 ? -12.971 19.318  -8.958  1.00 153.41 ? 131 LYS A CG    1 
ATOM 2264 C CD    . LYS E 5 131 ? -13.602 20.138  -7.833  1.00 154.17 ? 131 LYS A CD    1 
ATOM 2265 C CE    . LYS E 5 131 ? -13.477 21.632  -8.123  1.00 154.87 ? 131 LYS A CE    1 
ATOM 2266 N NZ    . LYS E 5 131 ? -14.165 22.489  -7.115  1.00 155.15 ? 131 LYS A NZ    1 
ATOM 2267 N N     . THR E 5 132 ? -15.285 18.712  -11.050 1.00 140.85 ? 132 THR A N     1 
ATOM 2268 C CA    . THR E 5 132 ? -16.032 19.711  -11.800 1.00 134.87 ? 132 THR A CA    1 
ATOM 2269 C C     . THR E 5 132 ? -17.313 19.088  -12.335 1.00 129.61 ? 132 THR A C     1 
ATOM 2270 O O     . THR E 5 132 ? -17.579 17.912  -12.102 1.00 128.20 ? 132 THR A O     1 
ATOM 2271 C CB    . THR E 5 132 ? -15.213 20.200  -12.996 1.00 136.05 ? 132 THR A CB    1 
ATOM 2272 O OG1   . THR E 5 132 ? -15.538 19.413  -14.150 1.00 139.39 ? 132 THR A OG1   1 
ATOM 2273 C CG2   . THR E 5 132 ? -13.728 20.069  -12.701 1.00 133.32 ? 132 THR A CG2   1 
ATOM 2274 N N     . CYS E 5 133 ? -18.116 19.871  -13.043 1.00 125.89 ? 133 CYS A N     1 
ATOM 2275 C CA    . CYS E 5 133 ? -19.247 19.295  -13.753 1.00 124.52 ? 133 CYS A CA    1 
ATOM 2276 C C     . CYS E 5 133 ? -18.810 18.814  -15.130 1.00 122.82 ? 133 CYS A C     1 
ATOM 2277 O O     . CYS E 5 133 ? -19.495 18.009  -15.760 1.00 125.43 ? 133 CYS A O     1 
ATOM 2278 C CB    . CYS E 5 133 ? -20.408 20.285  -13.855 1.00 124.59 ? 133 CYS A CB    1 
ATOM 2279 S SG    . CYS E 5 133 ? -21.667 20.075  -12.568 1.00 120.15 ? 133 CYS A SG    1 
ATOM 2280 N N     . GLN E 5 134 ? -17.646 19.283  -15.577 1.00 117.24 ? 134 GLN A N     1 
ATOM 2281 C CA    . GLN E 5 134 ? -17.147 18.932  -16.904 1.00 112.19 ? 134 GLN A CA    1 
ATOM 2282 C C     . GLN E 5 134 ? -16.612 17.506  -16.956 1.00 112.09 ? 134 GLN A C     1 
ATOM 2283 O O     . GLN E 5 134 ? -16.702 16.838  -17.985 1.00 113.06 ? 134 GLN A O     1 
ATOM 2284 C CB    . GLN E 5 134 ? -16.073 19.912  -17.388 1.00 106.48 ? 134 GLN A CB    1 
ATOM 2285 C CG    . GLN E 5 134 ? -15.706 19.712  -18.856 1.00 103.40 ? 134 GLN A CG    1 
ATOM 2286 C CD    . GLN E 5 134 ? -14.706 20.728  -19.377 1.00 99.75  ? 134 GLN A CD    1 
ATOM 2287 O OE1   . GLN E 5 134 ? -13.993 21.369  -18.607 1.00 98.49  ? 134 GLN A OE1   1 
ATOM 2288 N NE2   . GLN E 5 134 ? -14.650 20.877  -20.696 1.00 98.05  ? 134 GLN A NE2   1 
ATOM 2289 N N     . ASP E 5 135 ? -16.047 17.039  -15.852 1.00 113.07 ? 135 ASP A N     1 
ATOM 2290 C CA    . ASP E 5 135 ? -15.575 15.671  -15.796 1.00 115.81 ? 135 ASP A CA    1 
ATOM 2291 C C     . ASP E 5 135 ? -16.795 14.765  -15.882 1.00 117.29 ? 135 ASP A C     1 
ATOM 2292 O O     . ASP E 5 135 ? -16.828 13.809  -16.682 1.00 123.09 ? 135 ASP A O     1 
ATOM 2293 C CB    . ASP E 5 135 ? -14.800 15.433  -14.504 1.00 117.98 ? 135 ASP A CB    1 
ATOM 2294 C CG    . ASP E 5 135 ? -13.585 16.330  -14.384 1.00 121.62 ? 135 ASP A CG    1 
ATOM 2295 O OD1   . ASP E 5 135 ? -12.843 16.453  -15.377 1.00 122.52 ? 135 ASP A OD1   1 
ATOM 2296 O OD2   . ASP E 5 135 ? -13.373 16.917  -13.302 1.00 123.51 ? 135 ASP A OD2   1 
ATOM 2297 N N     . LYS E 5 136 ? -17.799 15.092  -15.069 1.00 111.01 ? 136 LYS A N     1 
ATOM 2298 C CA    . LYS E 5 136 ? -19.072 14.389  -15.073 1.00 104.25 ? 136 LYS A CA    1 
ATOM 2299 C C     . LYS E 5 136 ? -19.580 14.279  -16.487 1.00 101.25 ? 136 LYS A C     1 
ATOM 2300 O O     . LYS E 5 136 ? -19.713 13.189  -17.038 1.00 103.91 ? 136 LYS A O     1 
ATOM 2301 C CB    . LYS E 5 136 ? -20.109 15.151  -14.247 1.00 101.49 ? 136 LYS A CB    1 
ATOM 2302 C CG    . LYS E 5 136 ? -19.724 15.428  -12.813 1.00 99.25  ? 136 LYS A CG    1 
ATOM 2303 C CD    . LYS E 5 136 ? -20.966 15.617  -11.957 1.00 99.48  ? 136 LYS A CD    1 
ATOM 2304 C CE    . LYS E 5 136 ? -20.616 15.858  -10.499 1.00 100.53 ? 136 LYS A CE    1 
ATOM 2305 N NZ    . LYS E 5 136 ? -21.809 15.794  -9.608  1.00 103.21 ? 136 LYS A NZ    1 
ATOM 2306 N N     . LEU E 5 137 ? -19.856 15.435  -17.071 1.00 92.66  ? 137 LEU A N     1 
ATOM 2307 C CA    . LEU E 5 137 ? -20.419 15.496  -18.407 1.00 88.47  ? 137 LEU A CA    1 
ATOM 2308 C C     . LEU E 5 137 ? -19.582 14.825  -19.492 1.00 91.45  ? 137 LEU A C     1 
ATOM 2309 O O     . LEU E 5 137 ? -20.129 14.317  -20.467 1.00 94.48  ? 137 LEU A O     1 
ATOM 2310 C CB    . LEU E 5 137 ? -20.715 16.935  -18.788 1.00 81.84  ? 137 LEU A CB    1 
ATOM 2311 C CG    . LEU E 5 137 ? -21.896 17.443  -17.979 1.00 79.04  ? 137 LEU A CG    1 
ATOM 2312 C CD1   . LEU E 5 137 ? -22.447 18.683  -18.630 1.00 79.05  ? 137 LEU A CD1   1 
ATOM 2313 C CD2   . LEU E 5 137 ? -22.958 16.366  -17.911 1.00 80.73  ? 137 LEU A CD2   1 
ATOM 2314 N N     . LYS E 5 138 ? -18.264 14.817  -19.328 1.00 89.51  ? 138 LYS A N     1 
ATOM 2315 C CA    . LYS E 5 138 ? -17.400 14.062  -20.230 1.00 86.40  ? 138 LYS A CA    1 
ATOM 2316 C C     . LYS E 5 138 ? -17.743 12.572  -20.158 1.00 77.23  ? 138 LYS A C     1 
ATOM 2317 O O     . LYS E 5 138 ? -18.137 11.948  -21.161 1.00 80.02  ? 138 LYS A O     1 
ATOM 2318 C CB    . LYS E 5 138 ? -15.933 14.291  -19.854 1.00 89.55  ? 138 LYS A CB    1 
ATOM 2319 C CG    . LYS E 5 138 ? -14.963 14.094  -20.996 1.00 95.86  ? 138 LYS A CG    1 
ATOM 2320 C CD    . LYS E 5 138 ? -13.565 14.581  -20.645 1.00 101.68 ? 138 LYS A CD    1 
ATOM 2321 C CE    . LYS E 5 138 ? -13.585 15.941  -19.966 1.00 104.48 ? 138 LYS A CE    1 
ATOM 2322 N NZ    . LYS E 5 138 ? -13.426 15.800  -18.492 1.00 104.34 ? 138 LYS A NZ    1 
ATOM 2323 N N     . LEU E 5 139 ? -17.629 12.010  -18.958 1.00 69.51  ? 139 LEU A N     1 
ATOM 2324 C CA    . LEU E 5 139 ? -17.923 10.592  -18.795 1.00 69.64  ? 139 LEU A CA    1 
ATOM 2325 C C     . LEU E 5 139 ? -19.316 10.291  -19.331 1.00 68.33  ? 139 LEU A C     1 
ATOM 2326 O O     . LEU E 5 139 ? -19.481 9.470   -20.242 1.00 71.36  ? 139 LEU A O     1 
ATOM 2327 C CB    . LEU E 5 139 ? -17.831 10.172  -17.323 1.00 69.09  ? 139 LEU A CB    1 
ATOM 2328 C CG    . LEU E 5 139 ? -17.967 8.663   -17.101 1.00 71.19  ? 139 LEU A CG    1 
ATOM 2329 C CD1   . LEU E 5 139 ? -16.777 7.957   -17.708 1.00 70.52  ? 139 LEU A CD1   1 
ATOM 2330 C CD2   . LEU E 5 139 ? -18.102 8.306   -15.629 1.00 72.63  ? 139 LEU A CD2   1 
ATOM 2331 N N     . LEU E 5 140 ? -20.314 10.973  -18.776 1.00 63.76  ? 140 LEU A N     1 
ATOM 2332 C CA    . LEU E 5 140 ? -21.700 10.705  -19.132 1.00 66.87  ? 140 LEU A CA    1 
ATOM 2333 C C     . LEU E 5 140 ? -21.913 10.823  -20.620 1.00 71.67  ? 140 LEU A C     1 
ATOM 2334 O O     . LEU E 5 140 ? -22.696 10.079  -21.186 1.00 70.40  ? 140 LEU A O     1 
ATOM 2335 C CB    . LEU E 5 140 ? -22.672 11.636  -18.414 1.00 71.41  ? 140 LEU A CB    1 
ATOM 2336 C CG    . LEU E 5 140 ? -24.091 11.603  -18.991 1.00 76.36  ? 140 LEU A CG    1 
ATOM 2337 C CD1   . LEU E 5 140 ? -24.837 10.428  -18.418 1.00 76.09  ? 140 LEU A CD1   1 
ATOM 2338 C CD2   . LEU E 5 140 ? -24.860 12.892  -18.716 1.00 78.27  ? 140 LEU A CD2   1 
ATOM 2339 N N     . LEU E 5 141 ? -21.232 11.762  -21.268 1.00 76.28  ? 141 LEU A N     1 
ATOM 2340 C CA    . LEU E 5 141 ? -21.361 11.836  -22.715 1.00 79.05  ? 141 LEU A CA    1 
ATOM 2341 C C     . LEU E 5 141 ? -20.869 10.533  -23.319 1.00 88.66  ? 141 LEU A C     1 
ATOM 2342 O O     . LEU E 5 141 ? -21.566 9.927   -24.129 1.00 91.40  ? 141 LEU A O     1 
ATOM 2343 C CB    . LEU E 5 141 ? -20.587 12.990  -23.347 1.00 69.77  ? 141 LEU A CB    1 
ATOM 2344 C CG    . LEU E 5 141 ? -20.820 12.872  -24.862 1.00 61.05  ? 141 LEU A CG    1 
ATOM 2345 C CD1   . LEU E 5 141 ? -22.153 13.493  -25.240 1.00 60.94  ? 141 LEU A CD1   1 
ATOM 2346 C CD2   . LEU E 5 141 ? -19.704 13.439  -25.730 1.00 55.71  ? 141 LEU A CD2   1 
ATOM 2347 N N     . ASP E 5 142 ? -19.664 10.105  -22.944 1.00 90.79  ? 142 ASP A N     1 
ATOM 2348 C CA    . ASP E 5 142 ? -19.145 8.858   -23.490 1.00 90.86  ? 142 ASP A CA    1 
ATOM 2349 C C     . ASP E 5 142 ? -20.229 7.798   -23.402 1.00 89.51  ? 142 ASP A C     1 
ATOM 2350 O O     . ASP E 5 142 ? -20.750 7.333   -24.417 1.00 91.06  ? 142 ASP A O     1 
ATOM 2351 C CB    . ASP E 5 142 ? -17.929 8.372   -22.711 1.00 91.82  ? 142 ASP A CB    1 
ATOM 2352 C CG    . ASP E 5 142 ? -17.421 7.042   -23.224 1.00 93.26  ? 142 ASP A CG    1 
ATOM 2353 O OD1   . ASP E 5 142 ? -17.559 6.018   -22.514 1.00 92.78  ? 142 ASP A OD1   1 
ATOM 2354 O OD2   . ASP E 5 142 ? -16.880 7.030   -24.353 1.00 93.63  ? 142 ASP A OD2   1 
ATOM 2355 N N     . PHE E 5 143 ? -20.562 7.464   -22.152 1.00 85.03  ? 143 PHE A N     1 
ATOM 2356 C CA    . PHE E 5 143 ? -21.477 6.374   -21.802 1.00 80.65  ? 143 PHE A CA    1 
ATOM 2357 C C     . PHE E 5 143 ? -22.814 6.459   -22.521 1.00 76.08  ? 143 PHE A C     1 
ATOM 2358 O O     . PHE E 5 143 ? -23.306 5.454   -23.016 1.00 72.91  ? 143 PHE A O     1 
ATOM 2359 C CB    . PHE E 5 143 ? -21.654 6.252   -20.267 1.00 68.73  ? 143 PHE A CB    1 
ATOM 2360 C CG    . PHE E 5 143 ? -23.006 5.737   -19.834 1.00 68.40  ? 143 PHE A CG    1 
ATOM 2361 C CD1   . PHE E 5 143 ? -23.121 4.860   -18.781 1.00 65.70  ? 143 PHE A CD1   1 
ATOM 2362 C CD2   . PHE E 5 143 ? -24.166 6.168   -20.464 1.00 71.62  ? 143 PHE A CD2   1 
ATOM 2363 C CE1   . PHE E 5 143 ? -24.365 4.414   -18.388 1.00 66.80  ? 143 PHE A CE1   1 
ATOM 2364 C CE2   . PHE E 5 143 ? -25.401 5.722   -20.093 1.00 72.89  ? 143 PHE A CE2   1 
ATOM 2365 C CZ    . PHE E 5 143 ? -25.512 4.844   -19.048 1.00 70.07  ? 143 PHE A CZ    1 
ATOM 2366 N N     . GLN E 5 144 ? -23.408 7.649   -22.554 1.00 74.10  ? 144 GLN A N     1 
ATOM 2367 C CA    . GLN E 5 144 ? -24.721 7.834   -23.167 1.00 74.51  ? 144 GLN A CA    1 
ATOM 2368 C C     . GLN E 5 144 ? -24.529 7.472   -24.622 1.00 76.90  ? 144 GLN A C     1 
ATOM 2369 O O     . GLN E 5 144 ? -25.389 6.870   -25.271 1.00 79.22  ? 144 GLN A O     1 
ATOM 2370 C CB    . GLN E 5 144 ? -25.218 9.293   -23.032 1.00 73.12  ? 144 GLN A CB    1 
ATOM 2371 C CG    . GLN E 5 144 ? -25.524 9.770   -21.595 1.00 70.65  ? 144 GLN A CG    1 
ATOM 2372 C CD    . GLN E 5 144 ? -26.642 10.800  -21.535 1.00 69.94  ? 144 GLN A CD    1 
ATOM 2373 O OE1   . GLN E 5 144 ? -27.049 11.335  -22.558 1.00 71.63  ? 144 GLN A OE1   1 
ATOM 2374 N NE2   . GLN E 5 144 ? -27.154 11.063  -20.337 1.00 68.99  ? 144 GLN A NE2   1 
ATOM 2375 N N     . TRP E 5 145 ? -23.353 7.835   -25.109 1.00 76.96  ? 145 TRP A N     1 
ATOM 2376 C CA    . TRP E 5 145 ? -22.979 7.608   -26.483 1.00 75.88  ? 145 TRP A CA    1 
ATOM 2377 C C     . TRP E 5 145 ? -22.958 6.106   -26.771 1.00 81.58  ? 145 TRP A C     1 
ATOM 2378 O O     . TRP E 5 145 ? -23.703 5.629   -27.614 1.00 82.13  ? 145 TRP A O     1 
ATOM 2379 C CB    . TRP E 5 145 ? -21.612 8.238   -26.726 1.00 68.34  ? 145 TRP A CB    1 
ATOM 2380 C CG    . TRP E 5 145 ? -21.164 8.211   -28.117 1.00 67.48  ? 145 TRP A CG    1 
ATOM 2381 C CD1   . TRP E 5 145 ? -21.924 7.984   -29.226 1.00 65.34  ? 145 TRP A CD1   1 
ATOM 2382 C CD2   . TRP E 5 145 ? -19.830 8.417   -28.578 1.00 70.73  ? 145 TRP A CD2   1 
ATOM 2383 N NE1   . TRP E 5 145 ? -21.141 8.035   -30.353 1.00 65.17  ? 145 TRP A NE1   1 
ATOM 2384 C CE2   . TRP E 5 145 ? -19.850 8.301   -29.980 1.00 67.99  ? 145 TRP A CE2   1 
ATOM 2385 C CE3   . TRP E 5 145 ? -18.619 8.690   -27.936 1.00 71.51  ? 145 TRP A CE3   1 
ATOM 2386 C CZ2   . TRP E 5 145 ? -18.703 8.449   -30.754 1.00 69.43  ? 145 TRP A CZ2   1 
ATOM 2387 C CZ3   . TRP E 5 145 ? -17.484 8.836   -28.706 1.00 72.75  ? 145 TRP A CZ3   1 
ATOM 2388 C CH2   . TRP E 5 145 ? -17.533 8.715   -30.099 1.00 71.59  ? 145 TRP A CH2   1 
ATOM 2389 N N     . LYS E 5 146 ? -22.136 5.360   -26.040 1.00 85.86  ? 146 LYS A N     1 
ATOM 2390 C CA    . LYS E 5 146 ? -22.070 3.909   -26.198 1.00 85.07  ? 146 LYS A CA    1 
ATOM 2391 C C     . LYS E 5 146 ? -23.471 3.311   -26.127 1.00 86.30  ? 146 LYS A C     1 
ATOM 2392 O O     . LYS E 5 146 ? -23.885 2.557   -27.005 1.00 88.28  ? 146 LYS A O     1 
ATOM 2393 C CB    . LYS E 5 146 ? -21.176 3.313   -25.106 1.00 78.35  ? 146 LYS A CB    1 
ATOM 2394 C CG    . LYS E 5 146 ? -21.189 1.797   -25.002 1.00 73.53  ? 146 LYS A CG    1 
ATOM 2395 C CD    . LYS E 5 146 ? -20.551 1.151   -26.210 1.00 74.65  ? 146 LYS A CD    1 
ATOM 2396 C CE    . LYS E 5 146 ? -20.254 -0.328  -25.963 1.00 78.27  ? 146 LYS A CE    1 
ATOM 2397 N NZ    . LYS E 5 146 ? -21.469 -1.173  -25.727 1.00 77.00  ? 146 LYS A NZ    1 
ATOM 2398 N N     . PHE E 5 147 ? -24.197 3.672   -25.077 1.00 85.30  ? 147 PHE A N     1 
ATOM 2399 C CA    . PHE E 5 147 ? -25.551 3.191   -24.836 1.00 86.60  ? 147 PHE A CA    1 
ATOM 2400 C C     . PHE E 5 147 ? -26.470 3.341   -26.051 1.00 93.86  ? 147 PHE A C     1 
ATOM 2401 O O     . PHE E 5 147 ? -27.176 2.395   -26.424 1.00 97.97  ? 147 PHE A O     1 
ATOM 2402 C CB    . PHE E 5 147 ? -26.138 3.940   -23.641 1.00 85.32  ? 147 PHE A CB    1 
ATOM 2403 C CG    . PHE E 5 147 ? -27.347 3.285   -23.029 1.00 87.15  ? 147 PHE A CG    1 
ATOM 2404 C CD1   . PHE E 5 147 ? -27.282 2.739   -21.757 1.00 87.56  ? 147 PHE A CD1   1 
ATOM 2405 C CD2   . PHE E 5 147 ? -28.552 3.236   -23.710 1.00 91.62  ? 147 PHE A CD2   1 
ATOM 2406 C CE1   . PHE E 5 147 ? -28.389 2.149   -21.180 1.00 88.23  ? 147 PHE A CE1   1 
ATOM 2407 C CE2   . PHE E 5 147 ? -29.663 2.640   -23.136 1.00 92.43  ? 147 PHE A CE2   1 
ATOM 2408 C CZ    . PHE E 5 147 ? -29.578 2.097   -21.870 1.00 90.67  ? 147 PHE A CZ    1 
ATOM 2409 N N     . ASN E 5 148 ? -26.460 4.525   -26.665 1.00 92.30  ? 148 ASN A N     1 
ATOM 2410 C CA    . ASN E 5 148 ? -27.300 4.787   -27.842 1.00 92.22  ? 148 ASN A CA    1 
ATOM 2411 C C     . ASN E 5 148 ? -26.785 4.195   -29.155 1.00 91.99  ? 148 ASN A C     1 
ATOM 2412 O O     . ASN E 5 148 ? -27.540 3.591   -29.920 1.00 91.07  ? 148 ASN A O     1 
ATOM 2413 C CB    . ASN E 5 148 ? -27.521 6.289   -28.025 1.00 94.84  ? 148 ASN A CB    1 
ATOM 2414 C CG    . ASN E 5 148 ? -28.718 6.801   -27.245 1.00 95.84  ? 148 ASN A CG    1 
ATOM 2415 O OD1   . ASN E 5 148 ? -29.011 6.320   -26.147 1.00 97.46  ? 148 ASN A OD1   1 
ATOM 2416 N ND2   . ASN E 5 148 ? -29.428 7.768   -27.818 1.00 95.23  ? 148 ASN A ND2   1 
ATOM 2417 N N     . THR E 5 149 ? -25.500 4.390   -29.417 1.00 92.14  ? 149 THR A N     1 
ATOM 2418 C CA    . THR E 5 149 ? -24.888 3.933   -30.655 1.00 96.38  ? 149 THR A CA    1 
ATOM 2419 C C     . THR E 5 149 ? -24.328 2.508   -30.636 1.00 96.76  ? 149 THR A C     1 
ATOM 2420 O O     . THR E 5 149 ? -24.128 1.918   -31.696 1.00 99.95  ? 149 THR A O     1 
ATOM 2421 C CB    . THR E 5 149 ? -23.743 4.856   -31.060 1.00 101.22 ? 149 THR A CB    1 
ATOM 2422 O OG1   . THR E 5 149 ? -23.318 4.532   -32.388 1.00 107.70 ? 149 THR A OG1   1 
ATOM 2423 C CG2   . THR E 5 149 ? -22.563 4.687   -30.095 1.00 96.73  ? 149 THR A CG2   1 
ATOM 2424 N N     . ASN E 5 150 ? -24.105 1.945   -29.449 1.00 93.74  ? 150 ASN A N     1 
ATOM 2425 C CA    . ASN E 5 150 ? -23.457 0.627   -29.322 1.00 91.69  ? 150 ASN A CA    1 
ATOM 2426 C C     . ASN E 5 150 ? -22.169 0.494   -30.155 1.00 86.23  ? 150 ASN A C     1 
ATOM 2427 O O     . ASN E 5 150 ? -22.110 -0.258  -31.127 1.00 82.94  ? 150 ASN A O     1 
ATOM 2428 C CB    . ASN E 5 150 ? -24.464 -0.504  -29.619 1.00 92.81  ? 150 ASN A CB    1 
ATOM 2429 C CG    . ASN E 5 150 ? -23.816 -1.870  -29.717 1.00 91.11  ? 150 ASN A CG    1 
ATOM 2430 O OD1   . ASN E 5 150 ? -23.461 -2.315  -30.801 1.00 93.80  ? 150 ASN A OD1   1 
ATOM 2431 N ND2   . ASN E 5 150 ? -23.670 -2.544  -28.585 1.00 87.85  ? 150 ASN A ND2   1 
ATOM 2432 N N     . VAL E 5 151 ? -21.137 1.235   -29.757 1.00 83.25  ? 151 VAL A N     1 
ATOM 2433 C CA    . VAL E 5 151 ? -19.890 1.280   -30.512 1.00 78.98  ? 151 VAL A CA    1 
ATOM 2434 C C     . VAL E 5 151 ? -18.679 0.883   -29.681 1.00 78.66  ? 151 VAL A C     1 
ATOM 2435 O O     . VAL E 5 151 ? -18.610 1.158   -28.485 1.00 73.00  ? 151 VAL A O     1 
ATOM 2436 C CB    . VAL E 5 151 ? -19.632 2.689   -31.102 1.00 75.49  ? 151 VAL A CB    1 
ATOM 2437 C CG1   . VAL E 5 151 ? -18.244 2.777   -31.720 1.00 77.73  ? 151 VAL A CG1   1 
ATOM 2438 C CG2   . VAL E 5 151 ? -20.687 3.029   -32.135 1.00 71.03  ? 151 VAL A CG2   1 
ATOM 2439 N N     . SER E 5 152 ? -17.714 0.249   -30.332 1.00 86.36  ? 152 SER A N     1 
ATOM 2440 C CA    . SER E 5 152 ? -16.440 -0.054  -29.704 1.00 92.77  ? 152 SER A CA    1 
ATOM 2441 C C     . SER E 5 152 ? -15.776 1.216   -29.175 1.00 96.16  ? 152 SER A C     1 
ATOM 2442 O O     . SER E 5 152 ? -15.987 2.302   -29.706 1.00 93.38  ? 152 SER A O     1 
ATOM 2443 C CB    . SER E 5 152 ? -15.503 -0.713  -30.710 1.00 93.77  ? 152 SER A CB    1 
ATOM 2444 O OG    . SER E 5 152 ? -14.161 -0.483  -30.322 1.00 94.75  ? 152 SER A OG    1 
ATOM 2445 N N     . PHE E 5 153 ? -15.013 1.079   -28.096 1.00 102.54 ? 153 PHE A N     1 
ATOM 2446 C CA    . PHE E 5 153 ? -14.238 2.190   -27.550 1.00 108.01 ? 153 PHE A CA    1 
ATOM 2447 C C     . PHE E 5 153 ? -13.253 2.758   -28.544 1.00 114.15 ? 153 PHE A C     1 
ATOM 2448 O O     . PHE E 5 153 ? -13.286 3.937   -28.883 1.00 120.92 ? 153 PHE A O     1 
ATOM 2449 C CB    . PHE E 5 153 ? -13.425 1.786   -26.326 1.00 103.60 ? 153 PHE A CB    1 
ATOM 2450 C CG    . PHE E 5 153 ? -12.419 2.834   -25.916 1.00 98.87  ? 153 PHE A CG    1 
ATOM 2451 C CD1   . PHE E 5 153 ? -12.718 3.710   -24.898 1.00 92.88  ? 153 PHE A CD1   1 
ATOM 2452 C CD2   . PHE E 5 153 ? -11.183 2.953   -26.554 1.00 98.97  ? 153 PHE A CD2   1 
ATOM 2453 C CE1   . PHE E 5 153 ? -11.819 4.672   -24.513 1.00 89.73  ? 153 PHE A CE1   1 
ATOM 2454 C CE2   . PHE E 5 153 ? -10.279 3.930   -26.164 1.00 96.35  ? 153 PHE A CE2   1 
ATOM 2455 C CZ    . PHE E 5 153 ? -10.602 4.787   -25.142 1.00 91.38  ? 153 PHE A CZ    1 
ATOM 2456 N N     . GLU E 5 154 ? -12.313 1.916   -28.944 1.00 112.35 ? 154 GLU A N     1 
ATOM 2457 C CA    . GLU E 5 154 ? -11.258 2.327   -29.853 1.00 114.48 ? 154 GLU A CA    1 
ATOM 2458 C C     . GLU E 5 154 ? -11.818 3.071   -31.072 1.00 113.79 ? 154 GLU A C     1 
ATOM 2459 O O     . GLU E 5 154 ? -11.275 4.093   -31.510 1.00 117.57 ? 154 GLU A O     1 
ATOM 2460 C CB    . GLU E 5 154 ? -10.455 1.087   -30.268 1.00 121.70 ? 154 GLU A CB    1 
ATOM 2461 C CG    . GLU E 5 154 ? -9.321  1.332   -31.244 1.00 129.23 ? 154 GLU A CG    1 
ATOM 2462 C CD    . GLU E 5 154 ? -9.660  0.836   -32.635 1.00 136.92 ? 154 GLU A CD    1 
ATOM 2463 O OE1   . GLU E 5 154 ? -10.828 0.451   -32.843 1.00 138.15 ? 154 GLU A OE1   1 
ATOM 2464 O OE2   . GLU E 5 154 ? -8.774  0.822   -33.516 1.00 141.68 ? 154 GLU A OE2   1 
ATOM 2465 N N     . ASP E 5 155 ? -12.920 2.555   -31.605 1.00 111.15 ? 155 ASP A N     1 
ATOM 2466 C CA    . ASP E 5 155 ? -13.681 3.250   -32.639 1.00 111.75 ? 155 ASP A CA    1 
ATOM 2467 C C     . ASP E 5 155 ? -14.220 4.588   -32.110 1.00 110.76 ? 155 ASP A C     1 
ATOM 2468 O O     . ASP E 5 155 ? -14.216 5.588   -32.816 1.00 113.07 ? 155 ASP A O     1 
ATOM 2469 C CB    . ASP E 5 155 ? -14.822 2.358   -33.173 1.00 116.80 ? 155 ASP A CB    1 
ATOM 2470 C CG    . ASP E 5 155 ? -14.316 1.197   -34.045 1.00 120.25 ? 155 ASP A CG    1 
ATOM 2471 O OD1   . ASP E 5 155 ? -13.248 1.349   -34.675 1.00 123.24 ? 155 ASP A OD1   1 
ATOM 2472 O OD2   . ASP E 5 155 ? -14.988 0.141   -34.110 1.00 118.04 ? 155 ASP A OD2   1 
ATOM 2473 N N     . ARG E 5 156 ? -14.665 4.612   -30.857 1.00 107.58 ? 156 ARG A N     1 
ATOM 2474 C CA    . ARG E 5 156 ? -15.102 5.863   -30.211 1.00 101.61 ? 156 ARG A CA    1 
ATOM 2475 C C     . ARG E 5 156 ? -14.024 6.967   -30.200 1.00 94.50  ? 156 ARG A C     1 
ATOM 2476 O O     . ARG E 5 156 ? -14.338 8.154   -30.326 1.00 91.80  ? 156 ARG A O     1 
ATOM 2477 C CB    . ARG E 5 156 ? -15.572 5.587   -28.782 1.00 100.78 ? 156 ARG A CB    1 
ATOM 2478 C CG    . ARG E 5 156 ? -17.075 5.615   -28.592 1.00 99.61  ? 156 ARG A CG    1 
ATOM 2479 C CD    . ARG E 5 156 ? -17.428 5.282   -27.153 1.00 96.14  ? 156 ARG A CD    1 
ATOM 2480 N NE    . ARG E 5 156 ? -17.173 3.884   -26.856 1.00 90.81  ? 156 ARG A NE    1 
ATOM 2481 C CZ    . ARG E 5 156 ? -16.983 3.413   -25.636 1.00 88.87  ? 156 ARG A CZ    1 
ATOM 2482 N NH1   . ARG E 5 156 ? -16.760 2.124   -25.456 1.00 99.05  ? 156 ARG A NH1   1 
ATOM 2483 N NH2   . ARG E 5 156 ? -17.009 4.232   -24.599 1.00 80.97  ? 156 ARG A NH2   1 
ATOM 2484 N N     . THR E 5 157 ? -12.762 6.571   -30.035 1.00 90.99  ? 157 THR A N     1 
ATOM 2485 C CA    . THR E 5 157 ? -11.633 7.505   -30.110 1.00 90.85  ? 157 THR A CA    1 
ATOM 2486 C C     . THR E 5 157 ? -11.128 7.732   -31.540 1.00 97.02  ? 157 THR A C     1 
ATOM 2487 O O     . THR E 5 157 ? -10.334 8.646   -31.781 1.00 104.39 ? 157 THR A O     1 
ATOM 2488 C CB    . THR E 5 157 ? -10.449 7.056   -29.210 1.00 69.11  ? 157 THR A CB    1 
ATOM 2489 O OG1   . THR E 5 157 ? -9.343  6.639   -30.019 1.00 70.55  ? 157 THR A OG1   1 
ATOM 2490 C CG2   . THR E 5 157 ? -10.867 5.917   -28.322 1.00 61.96  ? 157 THR A CG2   1 
ATOM 2491 N N     . THR E 5 158 ? -11.579 6.902   -32.480 1.00 98.73  ? 158 THR A N     1 
ATOM 2492 C CA    . THR E 5 158 ? -11.176 7.081   -33.881 1.00 103.58 ? 158 THR A CA    1 
ATOM 2493 C C     . THR E 5 158 ? -11.892 8.252   -34.574 1.00 106.39 ? 158 THR A C     1 
ATOM 2494 O O     . THR E 5 158 ? -11.362 8.846   -35.513 1.00 105.75 ? 158 THR A O     1 
ATOM 2495 C CB    . THR E 5 158 ? -11.335 5.775   -34.733 1.00 125.65 ? 158 THR A CB    1 
ATOM 2496 O OG1   . THR E 5 158 ? -10.421 5.796   -35.839 1.00 126.08 ? 158 THR A OG1   1 
ATOM 2497 C CG2   . THR E 5 158 ? -12.753 5.622   -35.268 1.00 125.38 ? 158 THR A CG2   1 
ATOM 2498 N N     . VAL E 5 159 ? -13.083 8.595   -34.096 1.00 108.88 ? 159 VAL A N     1 
ATOM 2499 C CA    . VAL E 5 159 ? -13.923 9.558   -34.795 1.00 112.57 ? 159 VAL A CA    1 
ATOM 2500 C C     . VAL E 5 159 ? -13.511 11.008  -34.549 1.00 115.80 ? 159 VAL A C     1 
ATOM 2501 O O     . VAL E 5 159 ? -13.502 11.482  -33.416 1.00 114.69 ? 159 VAL A O     1 
ATOM 2502 C CB    . VAL E 5 159 ? -15.405 9.374   -34.425 1.00 113.46 ? 159 VAL A CB    1 
ATOM 2503 C CG1   . VAL E 5 159 ? -15.557 9.194   -32.923 1.00 112.46 ? 159 VAL A CG1   1 
ATOM 2504 C CG2   . VAL E 5 159 ? -16.226 10.546  -34.916 1.00 114.06 ? 159 VAL A CG2   1 
ATOM 2505 N N     . SER E 5 160 ? -13.175 11.706  -35.629 1.00 119.61 ? 160 SER A N     1 
ATOM 2506 C CA    . SER E 5 160 ? -12.841 13.127  -35.574 1.00 118.03 ? 160 SER A CA    1 
ATOM 2507 C C     . SER E 5 160 ? -14.100 13.963  -35.745 1.00 112.46 ? 160 SER A C     1 
ATOM 2508 O O     . SER E 5 160 ? -14.819 13.788  -36.723 1.00 112.42 ? 160 SER A O     1 
ATOM 2509 C CB    . SER E 5 160 ? -11.849 13.476  -36.686 1.00 122.35 ? 160 SER A CB    1 
ATOM 2510 O OG    . SER E 5 160 ? -11.633 14.874  -36.758 1.00 124.43 ? 160 SER A OG    1 
ATOM 2511 N N     . LEU E 5 161 ? -14.367 14.876  -34.814 1.00 106.40 ? 161 LEU A N     1 
ATOM 2512 C CA    . LEU E 5 161 ? -15.595 15.685  -34.867 1.00 102.63 ? 161 LEU A CA    1 
ATOM 2513 C C     . LEU E 5 161 ? -15.853 16.290  -36.249 1.00 107.61 ? 161 LEU A C     1 
ATOM 2514 O O     . LEU E 5 161 ? -16.988 16.324  -36.713 1.00 106.23 ? 161 LEU A O     1 
ATOM 2515 C CB    . LEU E 5 161 ? -15.580 16.784  -33.785 1.00 92.87  ? 161 LEU A CB    1 
ATOM 2516 C CG    . LEU E 5 161 ? -16.882 17.490  -33.373 1.00 80.57  ? 161 LEU A CG    1 
ATOM 2517 C CD1   . LEU E 5 161 ? -16.721 18.161  -32.028 1.00 80.15  ? 161 LEU A CD1   1 
ATOM 2518 C CD2   . LEU E 5 161 ? -17.325 18.496  -34.401 1.00 74.80  ? 161 LEU A CD2   1 
ATOM 2519 N N     . LYS E 5 162 ? -14.801 16.756  -36.910 1.00 114.42 ? 162 LYS A N     1 
ATOM 2520 C CA    . LYS E 5 162 ? -14.952 17.340  -38.240 1.00 122.86 ? 162 LYS A CA    1 
ATOM 2521 C C     . LYS E 5 162 ? -15.593 16.353  -39.218 1.00 125.60 ? 162 LYS A C     1 
ATOM 2522 O O     . LYS E 5 162 ? -16.158 16.758  -40.240 1.00 128.53 ? 162 LYS A O     1 
ATOM 2523 C CB    . LYS E 5 162 ? -13.601 17.826  -38.783 1.00 129.66 ? 162 LYS A CB    1 
ATOM 2524 C CG    . LYS E 5 162 ? -13.257 19.264  -38.386 1.00 137.26 ? 162 LYS A CG    1 
ATOM 2525 C CD    . LYS E 5 162 ? -11.874 19.685  -38.877 1.00 144.16 ? 162 LYS A CD    1 
ATOM 2526 C CE    . LYS E 5 162 ? -10.768 19.116  -38.003 1.00 146.98 ? 162 LYS A CE    1 
ATOM 2527 N NZ    . LYS E 5 162 ? -9.439  19.703  -38.339 1.00 149.01 ? 162 LYS A NZ    1 
ATOM 2528 N N     . ASP E 5 163 ? -15.514 15.061  -38.892 1.00 125.34 ? 163 ASP A N     1 
ATOM 2529 C CA    . ASP E 5 163 ? -16.136 14.000  -39.690 1.00 126.10 ? 163 ASP A CA    1 
ATOM 2530 C C     . ASP E 5 163 ? -17.653 14.057  -39.563 1.00 123.56 ? 163 ASP A C     1 
ATOM 2531 O O     . ASP E 5 163 ? -18.381 13.749  -40.506 1.00 125.41 ? 163 ASP A O     1 
ATOM 2532 C CB    . ASP E 5 163 ? -15.661 12.622  -39.217 1.00 130.21 ? 163 ASP A CB    1 
ATOM 2533 C CG    . ASP E 5 163 ? -14.255 12.294  -39.668 1.00 137.40 ? 163 ASP A CG    1 
ATOM 2534 O OD1   . ASP E 5 163 ? -13.564 13.197  -40.185 1.00 148.53 ? 163 ASP A OD1   1 
ATOM 2535 O OD2   . ASP E 5 163 ? -13.841 11.126  -39.493 1.00 138.37 ? 163 ASP A OD2   1 
ATOM 2536 N N     . LEU E 5 164 ? -18.111 14.440  -38.374 1.00 118.33 ? 164 LEU A N     1 
ATOM 2537 C CA    . LEU E 5 164 ? -19.532 14.483  -38.057 1.00 111.74 ? 164 LEU A CA    1 
ATOM 2538 C C     . LEU E 5 164 ? -20.328 15.317  -39.058 1.00 115.77 ? 164 LEU A C     1 
ATOM 2539 O O     . LEU E 5 164 ? -19.867 16.361  -39.523 1.00 121.39 ? 164 LEU A O     1 
ATOM 2540 C CB    . LEU E 5 164 ? -19.733 15.027  -36.644 1.00 102.84 ? 164 LEU A CB    1 
ATOM 2541 C CG    . LEU E 5 164 ? -21.174 15.149  -36.164 1.00 97.50  ? 164 LEU A CG    1 
ATOM 2542 C CD1   . LEU E 5 164 ? -21.846 13.792  -36.214 1.00 98.14  ? 164 LEU A CD1   1 
ATOM 2543 C CD2   . LEU E 5 164 ? -21.213 15.719  -34.761 1.00 93.50  ? 164 LEU A CD2   1 
ATOM 2544 N N     . GLN E 5 165 ? -21.526 14.847  -39.385 1.00 110.95 ? 165 GLN A N     1 
ATOM 2545 C CA    . GLN E 5 165 ? -22.379 15.524  -40.349 1.00 107.08 ? 165 GLN A CA    1 
ATOM 2546 C C     . GLN E 5 165 ? -23.761 15.764  -39.789 1.00 101.15 ? 165 GLN A C     1 
ATOM 2547 O O     . GLN E 5 165 ? -24.492 14.822  -39.480 1.00 96.33  ? 165 GLN A O     1 
ATOM 2548 C CB    . GLN E 5 165 ? -22.535 14.683  -41.607 1.00 109.87 ? 165 GLN A CB    1 
ATOM 2549 C CG    . GLN E 5 165 ? -21.247 14.373  -42.318 1.00 111.73 ? 165 GLN A CG    1 
ATOM 2550 C CD    . GLN E 5 165 ? -21.467 13.433  -43.472 1.00 117.27 ? 165 GLN A CD    1 
ATOM 2551 O OE1   . GLN E 5 165 ? -22.563 12.901  -43.654 1.00 119.30 ? 165 GLN A OE1   1 
ATOM 2552 N NE2   . GLN E 5 165 ? -20.428 13.221  -44.266 1.00 118.40 ? 165 GLN A NE2   1 
ATOM 2553 N N     . CYS E 5 166 ? -24.130 17.032  -39.687 1.00 99.95  ? 166 CYS A N     1 
ATOM 2554 C CA    . CYS E 5 166 ? -25.443 17.389  -39.188 1.00 98.81  ? 166 CYS A CA    1 
ATOM 2555 C C     . CYS E 5 166 ? -26.527 16.922  -40.149 1.00 102.15 ? 166 CYS A C     1 
ATOM 2556 O O     . CYS E 5 166 ? -26.361 16.972  -41.367 1.00 101.43 ? 166 CYS A O     1 
ATOM 2557 C CB    . CYS E 5 166 ? -25.529 18.895  -38.967 1.00 96.59  ? 166 CYS A CB    1 
ATOM 2558 S SG    . CYS E 5 166 ? -27.160 19.503  -38.496 1.00 155.01 ? 166 CYS A SG    1 
ATOM 2559 N N     . ILE E 5 167 ? -27.615 16.416  -39.582 1.00 105.96 ? 167 ILE A N     1 
ATOM 2560 C CA    . ILE E 5 167 ? -28.802 16.103  -40.350 1.00 110.65 ? 167 ILE A CA    1 
ATOM 2561 C C     . ILE E 5 167 ? -29.878 17.072  -39.921 1.00 116.76 ? 167 ILE A C     1 
ATOM 2562 O O     . ILE E 5 167 ? -30.404 16.983  -38.812 1.00 115.75 ? 167 ILE A O     1 
ATOM 2563 C CB    . ILE E 5 167 ? -29.273 14.659  -40.094 1.00 108.71 ? 167 ILE A CB    1 
ATOM 2564 C CG1   . ILE E 5 167 ? -28.277 13.676  -40.705 1.00 109.79 ? 167 ILE A CG1   1 
ATOM 2565 C CG2   . ILE E 5 167 ? -30.660 14.420  -40.671 1.00 107.94 ? 167 ILE A CG2   1 
ATOM 2566 C CD1   . ILE E 5 167 ? -27.940 13.980  -42.149 1.00 111.78 ? 167 ILE A CD1   1 
ATOM 2567 N N     . LEU E 5 168 ? -30.184 18.020  -40.795 1.00 124.69 ? 168 LEU A N     1 
ATOM 2568 C CA    . LEU E 5 168 ? -31.342 18.862  -40.586 1.00 130.37 ? 168 LEU A CA    1 
ATOM 2569 C C     . LEU E 5 168 ? -32.170 18.737  -41.840 1.00 136.43 ? 168 LEU A C     1 
ATOM 2570 O O     . LEU E 5 168 ? -31.804 19.222  -42.910 1.00 137.78 ? 168 LEU A O     1 
ATOM 2571 C CB    . LEU E 5 168 ? -30.933 20.316  -40.324 1.00 128.76 ? 168 LEU A CB    1 
ATOM 2572 C CG    . LEU E 5 168 ? -30.287 20.595  -38.962 1.00 123.86 ? 168 LEU A CG    1 
ATOM 2573 C CD1   . LEU E 5 168 ? -29.696 21.985  -38.908 1.00 122.81 ? 168 LEU A CD1   1 
ATOM 2574 C CD2   . LEU E 5 168 ? -31.274 20.398  -37.822 1.00 122.65 ? 168 LEU A CD2   1 
ATOM 2575 N N     . ASP E 5 169 ? -33.294 18.061  -41.699 1.00 139.45 ? 169 ASP A N     1 
ATOM 2576 C CA    . ASP E 5 169 ? -34.216 17.915  -42.794 1.00 143.98 ? 169 ASP A CA    1 
ATOM 2577 C C     . ASP E 5 169 ? -35.545 18.306  -42.197 1.00 153.01 ? 169 ASP A C     1 
ATOM 2578 O O     . ASP E 5 169 ? -36.042 17.616  -41.300 1.00 156.97 ? 169 ASP A O     1 
ATOM 2579 C CB    . ASP E 5 169 ? -34.223 16.460  -43.274 1.00 137.71 ? 169 ASP A CB    1 
ATOM 2580 C CG    . ASP E 5 169 ? -33.488 16.275  -44.584 1.00 132.39 ? 169 ASP A CG    1 
ATOM 2581 O OD1   . ASP E 5 169 ? -32.349 16.772  -44.713 1.00 131.14 ? 169 ASP A OD1   1 
ATOM 2582 O OD2   . ASP E 5 169 ? -34.062 15.638  -45.490 1.00 130.15 ? 169 ASP A OD2   1 
ATOM 2583 N N     . ASP E 5 170 ? -36.095 19.436  -42.633 1.00 155.95 ? 170 ASP A N     1 
ATOM 2584 C CA    . ASP E 5 170 ? -37.422 19.828  -42.170 1.00 157.47 ? 170 ASP A CA    1 
ATOM 2585 C C     . ASP E 5 170 ? -38.530 19.368  -43.118 1.00 157.76 ? 170 ASP A C     1 
ATOM 2586 O O     . ASP E 5 170 ? -39.686 19.261  -42.723 1.00 162.82 ? 170 ASP A O     1 
ATOM 2587 C CB    . ASP E 5 170 ? -37.471 21.329  -41.857 1.00 159.40 ? 170 ASP A CB    1 
ATOM 2588 C CG    . ASP E 5 170 ? -36.655 21.682  -40.619 1.00 157.48 ? 170 ASP A CG    1 
ATOM 2589 O OD1   . ASP E 5 170 ? -35.647 20.989  -40.355 1.00 152.19 ? 170 ASP A OD1   1 
ATOM 2590 O OD2   . ASP E 5 170 ? -37.031 22.623  -39.894 1.00 162.77 ? 170 ASP A OD2   1 
ATOM 2591 N N     . GLU E 5 171 ? -38.143 18.988  -44.332 1.00 150.35 ? 171 GLU A N     1 
ATOM 2592 C CA    . GLU E 5 171 ? -39.064 18.342  -45.258 1.00 141.65 ? 171 GLU A CA    1 
ATOM 2593 C C     . GLU E 5 171 ? -39.728 17.216  -44.479 1.00 139.49 ? 171 GLU A C     1 
ATOM 2594 O O     . GLU E 5 171 ? -40.953 17.126  -44.361 1.00 143.56 ? 171 GLU A O     1 
ATOM 2595 C CB    . GLU E 5 171 ? -38.289 17.750  -46.443 1.00 132.38 ? 171 GLU A CB    1 
ATOM 2596 C CG    . GLU E 5 171 ? -37.827 18.743  -47.493 1.00 125.72 ? 171 GLU A CG    1 
ATOM 2597 C CD    . GLU E 5 171 ? -36.433 18.444  -48.021 1.00 123.94 ? 171 GLU A CD    1 
ATOM 2598 O OE1   . GLU E 5 171 ? -35.481 18.432  -47.208 1.00 124.58 ? 171 GLU A OE1   1 
ATOM 2599 O OE2   . GLU E 5 171 ? -36.294 18.246  -49.250 1.00 122.95 ? 171 GLU A OE2   1 
ATOM 2600 N N     . ASN E 5 172 ? -38.862 16.373  -43.938 1.00 130.52 ? 172 ASN A N     1 
ATOM 2601 C CA    . ASN E 5 172 ? -39.214 15.122  -43.309 1.00 121.61 ? 172 ASN A CA    1 
ATOM 2602 C C     . ASN E 5 172 ? -39.266 15.177  -41.777 1.00 118.64 ? 172 ASN A C     1 
ATOM 2603 O O     . ASN E 5 172 ? -39.533 14.184  -41.113 1.00 113.94 ? 172 ASN A O     1 
ATOM 2604 C CB    . ASN E 5 172 ? -38.190 14.127  -43.761 1.00 118.21 ? 172 ASN A CB    1 
ATOM 2605 C CG    . ASN E 5 172 ? -37.118 14.779  -44.628 1.00 114.57 ? 172 ASN A CG    1 
ATOM 2606 O OD1   . ASN E 5 172 ? -36.590 15.823  -44.276 1.00 112.33 ? 172 ASN A OD1   1 
ATOM 2607 N ND2   . ASN E 5 172 ? -36.840 14.193  -45.793 1.00 115.32 ? 172 ASN A ND2   1 
ATOM 2608 N N     . GLY E 5 173 ? -39.001 16.346  -41.210 1.00 118.11 ? 173 GLY A N     1 
ATOM 2609 C CA    . GLY E 5 173 ? -39.018 16.513  -39.765 1.00 110.98 ? 173 GLY A CA    1 
ATOM 2610 C C     . GLY E 5 173 ? -37.934 15.720  -39.066 1.00 103.88 ? 173 GLY A C     1 
ATOM 2611 O O     . GLY E 5 173 ? -38.232 14.898  -38.201 1.00 102.17 ? 173 GLY A O     1 
ATOM 2612 N N     . LYS E 5 174 ? -36.678 15.979  -39.427 1.00 100.81 ? 174 LYS A N     1 
ATOM 2613 C CA    . LYS E 5 174 ? -35.547 15.206  -38.914 1.00 100.32 ? 174 LYS A CA    1 
ATOM 2614 C C     . LYS E 5 174 ? -34.389 16.075  -38.457 1.00 93.78  ? 174 LYS A C     1 
ATOM 2615 O O     . LYS E 5 174 ? -34.075 17.077  -39.096 1.00 95.57  ? 174 LYS A O     1 
ATOM 2616 C CB    . LYS E 5 174 ? -35.049 14.222  -39.983 1.00 107.73 ? 174 LYS A CB    1 
ATOM 2617 C CG    . LYS E 5 174 ? -36.035 13.113  -40.307 1.00 113.02 ? 174 LYS A CG    1 
ATOM 2618 C CD    . LYS E 5 174 ? -35.794 12.520  -41.687 1.00 115.88 ? 174 LYS A CD    1 
ATOM 2619 C CE    . LYS E 5 174 ? -34.391 11.961  -41.831 1.00 116.06 ? 174 LYS A CE    1 
ATOM 2620 N NZ    . LYS E 5 174 ? -34.124 11.463  -43.215 1.00 117.32 ? 174 LYS A NZ    1 
ATOM 2621 N N     . CYS E 5 175 ? -33.762 15.691  -37.348 1.00 87.75  ? 175 CYS A N     1 
ATOM 2622 C CA    . CYS E 5 175 ? -32.492 16.292  -36.954 1.00 88.49  ? 175 CYS A CA    1 
ATOM 2623 C C     . CYS E 5 175 ? -31.636 15.310  -36.185 1.00 89.33  ? 175 CYS A C     1 
ATOM 2624 O O     . CYS E 5 175 ? -32.147 14.467  -35.444 1.00 90.88  ? 175 CYS A O     1 
ATOM 2625 C CB    . CYS E 5 175 ? -32.695 17.546  -36.106 1.00 87.86  ? 175 CYS A CB    1 
ATOM 2626 S SG    . CYS E 5 175 ? -33.481 17.241  -34.510 1.00 182.67 ? 175 CYS A SG    1 
ATOM 2627 N N     . GLY E 5 176 ? -30.326 15.441  -36.348 1.00 89.12  ? 176 GLY A N     1 
ATOM 2628 C CA    . GLY E 5 176 ? -29.397 14.537  -35.703 1.00 89.48  ? 176 GLY A CA    1 
ATOM 2629 C C     . GLY E 5 176 ? -27.950 14.813  -36.045 1.00 91.70  ? 176 GLY A C     1 
ATOM 2630 O O     . GLY E 5 176 ? -27.627 15.787  -36.732 1.00 95.90  ? 176 GLY A O     1 
ATOM 2631 N N     . LEU E 5 177 ? -27.077 13.945  -35.548 1.00 92.36  ? 177 LEU A N     1 
ATOM 2632 C CA    . LEU E 5 177 ? -25.658 14.016  -35.859 1.00 93.73  ? 177 LEU A CA    1 
ATOM 2633 C C     . LEU E 5 177 ? -25.201 12.658  -36.380 1.00 105.71 ? 177 LEU A C     1 
ATOM 2634 O O     . LEU E 5 177 ? -25.218 11.664  -35.644 1.00 107.26 ? 177 LEU A O     1 
ATOM 2635 C CB    . LEU E 5 177 ? -24.875 14.384  -34.610 1.00 84.83  ? 177 LEU A CB    1 
ATOM 2636 C CG    . LEU E 5 177 ? -25.316 15.690  -33.970 1.00 81.11  ? 177 LEU A CG    1 
ATOM 2637 C CD1   . LEU E 5 177 ? -25.280 15.554  -32.477 1.00 79.69  ? 177 LEU A CD1   1 
ATOM 2638 C CD2   . LEU E 5 177 ? -24.419 16.818  -34.436 1.00 80.59  ? 177 LEU A CD2   1 
ATOM 2639 N N     . ALA E 5 178 ? -24.792 12.610  -37.646 1.00 112.29 ? 178 ALA A N     1 
ATOM 2640 C CA    . ALA E 5 178 ? -24.462 11.331  -38.290 1.00 114.24 ? 178 ALA A CA    1 
ATOM 2641 C C     . ALA E 5 178 ? -22.983 11.161  -38.619 1.00 115.83 ? 178 ALA A C     1 
ATOM 2642 O O     . ALA E 5 178 ? -22.256 12.132  -38.789 1.00 121.93 ? 178 ALA A O     1 
ATOM 2643 C CB    . ALA E 5 178 ? -25.309 11.119  -39.537 1.00 116.33 ? 178 ALA A CB    1 
ATOM 2644 N N     . HIS E 5 179 ? -22.537 9.917   -38.682 1.00 108.01 ? 179 HIS A N     1 
ATOM 2645 C CA    . HIS E 5 179 ? -21.177 9.642   -39.090 1.00 106.20 ? 179 HIS A CA    1 
ATOM 2646 C C     . HIS E 5 179 ? -21.223 8.488   -40.096 1.00 118.98 ? 179 HIS A C     1 
ATOM 2647 O O     . HIS E 5 179 ? -21.660 7.383   -39.766 1.00 124.48 ? 179 HIS A O     1 
ATOM 2648 C CB    . HIS E 5 179 ? -20.348 9.325   -37.843 1.00 94.63  ? 179 HIS A CB    1 
ATOM 2649 C CG    . HIS E 5 179 ? -18.872 9.320   -38.071 1.00 89.28  ? 179 HIS A CG    1 
ATOM 2650 N ND1   . HIS E 5 179 ? -18.101 8.196   -37.870 1.00 88.48  ? 179 HIS A ND1   1 
ATOM 2651 C CD2   . HIS E 5 179 ? -18.022 10.294  -38.469 1.00 89.49  ? 179 HIS A CD2   1 
ATOM 2652 C CE1   . HIS E 5 179 ? -16.839 8.478   -38.141 1.00 90.02  ? 179 HIS A CE1   1 
ATOM 2653 N NE2   . HIS E 5 179 ? -16.765 9.744   -38.506 1.00 92.84  ? 179 HIS A NE2   1 
ATOM 2654 N N     . SER E 5 180 ? -20.819 8.766   -41.335 1.00 122.44 ? 180 SER A N     1 
ATOM 2655 C CA    . SER E 5 180 ? -20.836 7.771   -42.410 1.00 125.99 ? 180 SER A CA    1 
ATOM 2656 C C     . SER E 5 180 ? -19.459 7.140   -42.571 1.00 125.64 ? 180 SER A C     1 
ATOM 2657 O O     . SER E 5 180 ? -19.263 6.185   -43.322 1.00 127.15 ? 180 SER A O     1 
ATOM 2658 C CB    . SER E 5 180 ? -21.273 8.436   -43.709 1.00 127.42 ? 180 SER A CB    1 
ATOM 2659 O OG    . SER E 5 180 ? -20.548 9.635   -43.911 1.00 126.07 ? 180 SER A OG    1 
ATOM 2660 N N     . SER E 5 181 ? -18.517 7.663   -41.802 1.00 125.23 ? 181 SER A N     1 
ATOM 2661 C CA    . SER E 5 181 ? -17.135 7.213   -41.817 1.00 126.89 ? 181 SER A CA    1 
ATOM 2662 C C     . SER E 5 181 ? -17.004 5.916   -40.985 1.00 126.24 ? 181 SER A C     1 
ATOM 2663 O O     . SER E 5 181 ? -18.009 5.258   -40.714 1.00 126.29 ? 181 SER A O     1 
ATOM 2664 C CB    . SER E 5 181 ? -16.212 8.341   -41.320 1.00 130.84 ? 181 SER A CB    1 
ATOM 2665 O OG    . SER E 5 181 ? -16.207 9.445   -42.214 1.00 135.17 ? 181 SER A OG    1 
ATOM 2666 N N     . LYS E 5 182 ? -15.780 5.518   -40.635 1.00 127.60 ? 182 LYS A N     1 
ATOM 2667 C CA    . LYS E 5 182 ? -15.514 4.182   -40.060 1.00 127.12 ? 182 LYS A CA    1 
ATOM 2668 C C     . LYS E 5 182 ? -16.500 3.674   -38.985 1.00 124.09 ? 182 LYS A C     1 
ATOM 2669 O O     . LYS E 5 182 ? -17.063 2.575   -39.123 1.00 128.39 ? 182 LYS A O     1 
ATOM 2670 C CB    . LYS E 5 182 ? -14.060 4.081   -39.559 1.00 131.23 ? 182 LYS A CB    1 
ATOM 2671 C CG    . LYS E 5 182 ? -13.240 5.354   -39.729 1.00 134.38 ? 182 LYS A CG    1 
ATOM 2672 C CD    . LYS E 5 182 ? -11.831 5.225   -39.174 1.00 137.14 ? 182 LYS A CD    1 
ATOM 2673 C CE    . LYS E 5 182 ? -10.844 5.977   -40.040 1.00 143.93 ? 182 LYS A CE    1 
ATOM 2674 N NZ    . LYS E 5 182 ? -10.841 5.413   -41.414 1.00 148.21 ? 182 LYS A NZ    1 
ATOM 2675 N N     . PRO E 5 183 ? -16.702 4.447   -37.904 1.00 115.49 ? 183 PRO A N     1 
ATOM 2676 C CA    . PRO E 5 183 ? -17.902 4.056   -37.166 1.00 110.73 ? 183 PRO A CA    1 
ATOM 2677 C C     . PRO E 5 183 ? -19.139 4.522   -37.933 1.00 103.86 ? 183 PRO A C     1 
ATOM 2678 O O     . PRO E 5 183 ? -19.140 5.634   -38.458 1.00 105.70 ? 183 PRO A O     1 
ATOM 2679 C CB    . PRO E 5 183 ? -17.752 4.806   -35.835 1.00 110.65 ? 183 PRO A CB    1 
ATOM 2680 C CG    . PRO E 5 183 ? -16.270 4.955   -35.669 1.00 111.43 ? 183 PRO A CG    1 
ATOM 2681 C CD    . PRO E 5 183 ? -15.793 5.250   -37.073 1.00 113.90 ? 183 PRO A CD    1 
ATOM 2682 N N     . ASN E 5 184 ? -20.169 3.687   -38.007 1.00 96.73  ? 184 ASN A N     1 
ATOM 2683 C CA    . ASN E 5 184 ? -21.384 4.054   -38.717 1.00 91.48  ? 184 ASN A CA    1 
ATOM 2684 C C     . ASN E 5 184 ? -22.511 4.191   -37.714 1.00 86.94  ? 184 ASN A C     1 
ATOM 2685 O O     . ASN E 5 184 ? -22.979 3.205   -37.156 1.00 84.84  ? 184 ASN A O     1 
ATOM 2686 C CB    . ASN E 5 184 ? -21.748 2.987   -39.745 1.00 93.72  ? 184 ASN A CB    1 
ATOM 2687 C CG    . ASN E 5 184 ? -22.760 3.479   -40.764 1.00 98.65  ? 184 ASN A CG    1 
ATOM 2688 O OD1   . ASN E 5 184 ? -23.944 3.623   -40.463 1.00 100.94 ? 184 ASN A OD1   1 
ATOM 2689 N ND2   . ASN E 5 184 ? -22.296 3.733   -41.983 1.00 102.28 ? 184 ASN A ND2   1 
ATOM 2690 N N     . PHE E 5 185 ? -22.947 5.422   -37.482 1.00 87.78  ? 185 PHE A N     1 
ATOM 2691 C CA    . PHE E 5 185 ? -23.976 5.673   -36.478 1.00 91.50  ? 185 PHE A CA    1 
ATOM 2692 C C     . PHE E 5 185 ? -24.725 7.003   -36.652 1.00 95.01  ? 185 PHE A C     1 
ATOM 2693 O O     . PHE E 5 185 ? -24.269 7.898   -37.363 1.00 99.05  ? 185 PHE A O     1 
ATOM 2694 C CB    . PHE E 5 185 ? -23.365 5.568   -35.077 1.00 90.45  ? 185 PHE A CB    1 
ATOM 2695 C CG    . PHE E 5 185 ? -22.472 6.718   -34.708 1.00 90.01  ? 185 PHE A CG    1 
ATOM 2696 C CD1   . PHE E 5 185 ? -22.998 7.812   -34.062 1.00 89.03  ? 185 PHE A CD1   1 
ATOM 2697 C CD2   . PHE E 5 185 ? -21.106 6.692   -34.973 1.00 91.37  ? 185 PHE A CD2   1 
ATOM 2698 C CE1   . PHE E 5 185 ? -22.198 8.867   -33.707 1.00 90.36  ? 185 PHE A CE1   1 
ATOM 2699 C CE2   . PHE E 5 185 ? -20.290 7.758   -34.613 1.00 90.48  ? 185 PHE A CE2   1 
ATOM 2700 C CZ    . PHE E 5 185 ? -20.840 8.845   -33.979 1.00 90.12  ? 185 PHE A CZ    1 
ATOM 2701 N N     . VAL E 5 186 ? -25.903 7.101   -36.037 1.00 94.49  ? 186 VAL A N     1 
ATOM 2702 C CA    . VAL E 5 186 ? -26.713 8.319   -36.101 1.00 94.49  ? 186 VAL A CA    1 
ATOM 2703 C C     . VAL E 5 186 ? -27.298 8.668   -34.721 1.00 91.39  ? 186 VAL A C     1 
ATOM 2704 O O     . VAL E 5 186 ? -28.036 7.867   -34.144 1.00 93.94  ? 186 VAL A O     1 
ATOM 2705 C CB    . VAL E 5 186 ? -27.852 8.158   -37.161 1.00 70.80  ? 186 VAL A CB    1 
ATOM 2706 C CG1   . VAL E 5 186 ? -28.943 9.203   -36.973 1.00 71.04  ? 186 VAL A CG1   1 
ATOM 2707 C CG2   . VAL E 5 186 ? -27.297 8.238   -38.561 1.00 71.43  ? 186 VAL A CG2   1 
ATOM 2708 N N     . LEU E 5 187 ? -26.986 9.846   -34.190 1.00 84.12  ? 187 LEU A N     1 
ATOM 2709 C CA    . LEU E 5 187 ? -27.568 10.233  -32.912 1.00 80.68  ? 187 LEU A CA    1 
ATOM 2710 C C     . LEU E 5 187 ? -28.747 11.174  -33.108 1.00 83.07  ? 187 LEU A C     1 
ATOM 2711 O O     . LEU E 5 187 ? -28.752 12.003  -34.029 1.00 85.78  ? 187 LEU A O     1 
ATOM 2712 C CB    . LEU E 5 187 ? -26.525 10.884  -32.013 1.00 75.18  ? 187 LEU A CB    1 
ATOM 2713 C CG    . LEU E 5 187 ? -25.504 9.941   -31.400 1.00 68.09  ? 187 LEU A CG    1 
ATOM 2714 C CD1   . LEU E 5 187 ? -24.700 10.666  -30.341 1.00 65.37  ? 187 LEU A CD1   1 
ATOM 2715 C CD2   . LEU E 5 187 ? -26.213 8.753   -30.798 1.00 65.52  ? 187 LEU A CD2   1 
ATOM 2716 N N     . VAL E 5 188 ? -29.741 11.042  -32.232 1.00 84.32  ? 188 VAL A N     1 
ATOM 2717 C CA    . VAL E 5 188 ? -30.942 11.875  -32.286 1.00 82.37  ? 188 VAL A CA    1 
ATOM 2718 C C     . VAL E 5 188 ? -31.312 12.498  -30.931 1.00 84.94  ? 188 VAL A C     1 
ATOM 2719 O O     . VAL E 5 188 ? -31.111 11.894  -29.874 1.00 78.71  ? 188 VAL A O     1 
ATOM 2720 C CB    . VAL E 5 188 ? -32.132 11.087  -32.863 1.00 86.31  ? 188 VAL A CB    1 
ATOM 2721 C CG1   . VAL E 5 188 ? -33.447 11.795  -32.573 1.00 87.42  ? 188 VAL A CG1   1 
ATOM 2722 C CG2   . VAL E 5 188 ? -31.943 10.904  -34.352 1.00 83.86  ? 188 VAL A CG2   1 
ATOM 2723 N N     . PRO E 5 189 ? -31.819 13.737  -30.961 1.00 82.74  ? 189 PRO A N     1 
ATOM 2724 C CA    . PRO E 5 189 ? -32.204 14.392  -29.709 1.00 84.24  ? 189 PRO A CA    1 
ATOM 2725 C C     . PRO E 5 189 ? -33.445 13.813  -29.053 1.00 78.96  ? 189 PRO A C     1 
ATOM 2726 O O     . PRO E 5 189 ? -34.487 13.674  -29.696 1.00 73.39  ? 189 PRO A O     1 
ATOM 2727 C CB    . PRO E 5 189 ? -32.461 15.835  -30.142 1.00 82.99  ? 189 PRO A CB    1 
ATOM 2728 C CG    . PRO E 5 189 ? -32.818 15.732  -31.574 1.00 84.89  ? 189 PRO A CG    1 
ATOM 2729 C CD    . PRO E 5 189 ? -32.004 14.615  -32.128 1.00 84.48  ? 189 PRO A CD    1 
ATOM 2730 N N     . ASN E 5 190 ? -33.348 13.527  -27.763 1.00 84.50  ? 190 ASN A N     1 
ATOM 2731 C CA    . ASN E 5 190 ? -34.542 13.209  -27.017 1.00 88.64  ? 190 ASN A CA    1 
ATOM 2732 C C     . ASN E 5 190 ? -35.008 14.456  -26.299 1.00 96.23  ? 190 ASN A C     1 
ATOM 2733 O O     . ASN E 5 190 ? -34.376 14.892  -25.334 1.00 95.46  ? 190 ASN A O     1 
ATOM 2734 C CB    . ASN E 5 190 ? -34.277 12.103  -26.010 1.00 89.15  ? 190 ASN A CB    1 
ATOM 2735 C CG    . ASN E 5 190 ? -35.553 11.469  -25.527 1.00 88.87  ? 190 ASN A CG    1 
ATOM 2736 O OD1   . ASN E 5 190 ? -36.636 11.830  -25.981 1.00 87.61  ? 190 ASN A OD1   1 
ATOM 2737 N ND2   . ASN E 5 190 ? -35.441 10.519  -24.611 1.00 91.33  ? 190 ASN A ND2   1 
ATOM 2738 N N     . PHE E 5 191 ? -36.115 15.026  -26.771 1.00 100.95 ? 191 PHE A N     1 
ATOM 2739 C CA    . PHE E 5 191 ? -36.634 16.276  -26.216 1.00 105.15 ? 191 PHE A CA    1 
ATOM 2740 C C     . PHE E 5 191 ? -37.567 15.993  -25.047 1.00 114.18 ? 191 PHE A C     1 
ATOM 2741 O O     . PHE E 5 191 ? -37.904 16.883  -24.269 1.00 119.80 ? 191 PHE A O     1 
ATOM 2742 C CB    . PHE E 5 191 ? -37.384 17.082  -27.295 1.00 102.59 ? 191 PHE A CB    1 
ATOM 2743 C CG    . PHE E 5 191 ? -36.503 17.619  -28.402 1.00 100.20 ? 191 PHE A CG    1 
ATOM 2744 C CD1   . PHE E 5 191 ? -35.650 18.691  -28.182 1.00 95.32  ? 191 PHE A CD1   1 
ATOM 2745 C CD2   . PHE E 5 191 ? -36.554 17.069  -29.673 1.00 100.67 ? 191 PHE A CD2   1 
ATOM 2746 C CE1   . PHE E 5 191 ? -34.847 19.187  -29.205 1.00 92.08  ? 191 PHE A CE1   1 
ATOM 2747 C CE2   . PHE E 5 191 ? -35.754 17.566  -30.698 1.00 98.22  ? 191 PHE A CE2   1 
ATOM 2748 C CZ    . PHE E 5 191 ? -34.902 18.623  -30.462 1.00 92.58  ? 191 PHE A CZ    1 
ATOM 2749 N N     . GLN E 5 192 ? -37.998 14.745  -24.954 1.00 116.53 ? 192 GLN A N     1 
ATOM 2750 C CA    . GLN E 5 192 ? -38.923 14.332  -23.918 1.00 118.97 ? 192 GLN A CA    1 
ATOM 2751 C C     . GLN E 5 192 ? -38.176 13.846  -22.670 1.00 116.09 ? 192 GLN A C     1 
ATOM 2752 O O     . GLN E 5 192 ? -38.761 13.726  -21.590 1.00 116.09 ? 192 GLN A O     1 
ATOM 2753 C CB    . GLN E 5 192 ? -39.838 13.234  -24.478 1.00 123.34 ? 192 GLN A CB    1 
ATOM 2754 C CG    . GLN E 5 192 ? -40.490 13.574  -25.836 1.00 131.07 ? 192 GLN A CG    1 
ATOM 2755 C CD    . GLN E 5 192 ? -39.495 13.711  -26.995 1.00 141.22 ? 192 GLN A CD    1 
ATOM 2756 O OE1   . GLN E 5 192 ? -38.286 13.566  -26.815 1.00 145.79 ? 192 GLN A OE1   1 
ATOM 2757 N NE2   . GLN E 5 192 ? -40.010 13.997  -28.187 1.00 149.54 ? 192 GLN A NE2   1 
ATOM 2758 N N     . SER E 5 193 ? -36.883 13.563  -22.835 1.00 112.66 ? 193 SER A N     1 
ATOM 2759 C CA    . SER E 5 193 ? -35.991 13.242  -21.716 1.00 108.22 ? 193 SER A CA    1 
ATOM 2760 C C     . SER E 5 193 ? -34.592 13.801  -21.954 1.00 103.82 ? 193 SER A C     1 
ATOM 2761 O O     . SER E 5 193 ? -33.663 13.060  -22.269 1.00 103.85 ? 193 SER A O     1 
ATOM 2762 C CB    . SER E 5 193 ? -35.911 11.737  -21.453 1.00 106.47 ? 193 SER A CB    1 
ATOM 2763 O OG    . SER E 5 193 ? -35.311 11.500  -20.189 1.00 106.54 ? 193 SER A OG    1 
ATOM 2764 N N     . PRO E 5 194 ? -34.446 15.118  -21.820 1.00 101.20 ? 194 PRO A N     1 
ATOM 2765 C CA    . PRO E 5 194 ? -33.170 15.792  -22.068 1.00 97.73  ? 194 PRO A CA    1 
ATOM 2766 C C     . PRO E 5 194 ? -32.000 15.153  -21.324 1.00 92.03  ? 194 PRO A C     1 
ATOM 2767 O O     . PRO E 5 194 ? -30.925 14.992  -21.902 1.00 90.64  ? 194 PRO A O     1 
ATOM 2768 C CB    . PRO E 5 194 ? -33.423 17.205  -21.538 1.00 99.88  ? 194 PRO A CB    1 
ATOM 2769 C CG    . PRO E 5 194 ? -34.896 17.401  -21.722 1.00 101.72 ? 194 PRO A CG    1 
ATOM 2770 C CD    . PRO E 5 194 ? -35.516 16.059  -21.449 1.00 101.68 ? 194 PRO A CD    1 
ATOM 2771 N N     . PHE E 5 195 ? -32.214 14.787  -20.063 1.00 89.50  ? 195 PHE A N     1 
ATOM 2772 C CA    . PHE E 5 195 ? -31.126 14.315  -19.208 1.00 88.05  ? 195 PHE A CA    1 
ATOM 2773 C C     . PHE E 5 195 ? -30.504 13.037  -19.719 1.00 84.78  ? 195 PHE A C     1 
ATOM 2774 O O     . PHE E 5 195 ? -29.284 12.870  -19.685 1.00 80.37  ? 195 PHE A O     1 
ATOM 2775 C CB    . PHE E 5 195 ? -31.604 14.135  -17.771 1.00 88.98  ? 195 PHE A CB    1 
ATOM 2776 C CG    . PHE E 5 195 ? -32.068 15.409  -17.138 1.00 91.31  ? 195 PHE A CG    1 
ATOM 2777 C CD1   . PHE E 5 195 ? -31.155 16.399  -16.777 1.00 89.43  ? 195 PHE A CD1   1 
ATOM 2778 C CD2   . PHE E 5 195 ? -33.414 15.632  -16.921 1.00 93.37  ? 195 PHE A CD2   1 
ATOM 2779 C CE1   . PHE E 5 195 ? -31.574 17.578  -16.201 1.00 88.56  ? 195 PHE A CE1   1 
ATOM 2780 C CE2   . PHE E 5 195 ? -33.843 16.813  -16.346 1.00 94.03  ? 195 PHE A CE2   1 
ATOM 2781 C CZ    . PHE E 5 195 ? -32.919 17.789  -15.984 1.00 92.05  ? 195 PHE A CZ    1 
ATOM 2782 N N     . THR E 5 196 ? -31.349 12.141  -20.208 1.00 87.79  ? 196 THR A N     1 
ATOM 2783 C CA    . THR E 5 196 ? -30.874 10.908  -20.820 1.00 90.63  ? 196 THR A CA    1 
ATOM 2784 C C     . THR E 5 196 ? -30.529 11.103  -22.307 1.00 94.07  ? 196 THR A C     1 
ATOM 2785 O O     . THR E 5 196 ? -30.223 10.136  -23.007 1.00 93.79  ? 196 THR A O     1 
ATOM 2786 C CB    . THR E 5 196 ? -31.871 9.746   -20.644 1.00 91.03  ? 196 THR A CB    1 
ATOM 2787 O OG1   . THR E 5 196 ? -33.139 10.099  -21.210 1.00 93.91  ? 196 THR A OG1   1 
ATOM 2788 C CG2   . THR E 5 196 ? -32.050 9.424   -19.161 1.00 89.46  ? 196 THR A CG2   1 
ATOM 2789 N N     . CYS E 5 197 ? -30.606 12.347  -22.783 1.00 96.31  ? 197 CYS A N     1 
ATOM 2790 C CA    . CYS E 5 197 ? -30.193 12.682  -24.143 1.00 96.70  ? 197 CYS A CA    1 
ATOM 2791 C C     . CYS E 5 197 ? -28.695 12.973  -24.216 1.00 100.14 ? 197 CYS A C     1 
ATOM 2792 O O     . CYS E 5 197 ? -28.190 13.861  -23.522 1.00 98.37  ? 197 CYS A O     1 
ATOM 2793 C CB    . CYS E 5 197 ? -30.989 13.872  -24.682 1.00 94.12  ? 197 CYS A CB    1 
ATOM 2794 S SG    . CYS E 5 197 ? -30.582 14.290  -26.382 1.00 73.15  ? 197 CYS A SG    1 
ATOM 2795 N N     . PRO E 5 198 ? -27.984 12.223  -25.076 1.00 105.04 ? 198 PRO A N     1 
ATOM 2796 C CA    . PRO E 5 198 ? -26.534 12.309  -25.281 1.00 106.28 ? 198 PRO A CA    1 
ATOM 2797 C C     . PRO E 5 198 ? -26.120 13.635  -25.942 1.00 110.41 ? 198 PRO A C     1 
ATOM 2798 O O     . PRO E 5 198 ? -25.025 14.133  -25.619 1.00 113.68 ? 198 PRO A O     1 
ATOM 2799 C CB    . PRO E 5 198 ? -26.248 11.140  -26.234 1.00 102.88 ? 198 PRO A CB    1 
ATOM 2800 C CG    . PRO E 5 198 ? -27.497 11.015  -27.011 1.00 105.09 ? 198 PRO A CG    1 
ATOM 2801 C CD    . PRO E 5 198 ? -28.600 11.266  -26.009 1.00 105.43 ? 198 PRO A CD    1 
ATOM 2802 N N     . ILE E 5 199 ? -26.959 14.208  -26.819 1.00 107.89 ? 199 ILE A N     1 
ATOM 2803 C CA    . ILE E 5 199 ? -26.625 15.510  -27.399 1.00 102.28 ? 199 ILE A CA    1 
ATOM 2804 C C     . ILE E 5 199 ? -26.762 16.568  -26.347 1.00 98.25  ? 199 ILE A C     1 
ATOM 2805 O O     . ILE E 5 199 ? -25.787 17.216  -26.054 1.00 99.21  ? 199 ILE A O     1 
ATOM 2806 C CB    . ILE E 5 199 ? -27.386 15.930  -28.686 1.00 58.41  ? 199 ILE A CB    1 
ATOM 2807 C CG1   . ILE E 5 199 ? -28.828 15.465  -28.694 1.00 56.80  ? 199 ILE A CG1   1 
ATOM 2808 C CG2   . ILE E 5 199 ? -26.727 15.374  -29.913 1.00 55.43  ? 199 ILE A CG2   1 
ATOM 2809 C CD1   . ILE E 5 199 ? -29.180 14.843  -30.020 1.00 56.10  ? 199 ILE A CD1   1 
ATOM 2810 N N     . PHE E 5 200 ? -27.944 16.754  -25.774 1.00 95.32  ? 200 PHE A N     1 
ATOM 2811 C CA    . PHE E 5 200 ? -28.097 17.825  -24.791 1.00 94.70  ? 200 PHE A CA    1 
ATOM 2812 C C     . PHE E 5 200 ? -26.893 17.811  -23.835 1.00 96.96  ? 200 PHE A C     1 
ATOM 2813 O O     . PHE E 5 200 ? -26.323 18.871  -23.489 1.00 99.92  ? 200 PHE A O     1 
ATOM 2814 C CB    . PHE E 5 200 ? -29.419 17.670  -24.029 1.00 91.25  ? 200 PHE A CB    1 
ATOM 2815 C CG    . PHE E 5 200 ? -29.574 18.620  -22.886 1.00 90.40  ? 200 PHE A CG    1 
ATOM 2816 C CD1   . PHE E 5 200 ? -29.736 18.147  -21.600 1.00 92.19  ? 200 PHE A CD1   1 
ATOM 2817 C CD2   . PHE E 5 200 ? -29.539 19.990  -23.096 1.00 93.69  ? 200 PHE A CD2   1 
ATOM 2818 C CE1   . PHE E 5 200 ? -29.875 19.025  -20.540 1.00 96.49  ? 200 PHE A CE1   1 
ATOM 2819 C CE2   . PHE E 5 200 ? -29.675 20.881  -22.039 1.00 95.71  ? 200 PHE A CE2   1 
ATOM 2820 C CZ    . PHE E 5 200 ? -29.844 20.399  -20.759 1.00 97.39  ? 200 PHE A CZ    1 
ATOM 2821 N N     . THR E 5 201 ? -26.483 16.596  -23.469 1.00 93.77  ? 201 THR A N     1 
ATOM 2822 C CA    . THR E 5 201 ? -25.239 16.360  -22.736 1.00 89.58  ? 201 THR A CA    1 
ATOM 2823 C C     . THR E 5 201 ? -24.000 16.948  -23.436 1.00 91.18  ? 201 THR A C     1 
ATOM 2824 O O     . THR E 5 201 ? -23.205 17.667  -22.818 1.00 91.07  ? 201 THR A O     1 
ATOM 2825 C CB    . THR E 5 201 ? -25.027 14.858  -22.512 1.00 82.31  ? 201 THR A CB    1 
ATOM 2826 O OG1   . THR E 5 201 ? -26.100 14.353  -21.709 1.00 79.30  ? 201 THR A OG1   1 
ATOM 2827 C CG2   . THR E 5 201 ? -23.698 14.599  -21.822 1.00 78.10  ? 201 THR A CG2   1 
ATOM 2828 N N     . MET E 5 202 ? -23.844 16.637  -24.721 1.00 91.00  ? 202 MET A N     1 
ATOM 2829 C CA    . MET E 5 202 ? -22.728 17.141  -25.523 1.00 90.63  ? 202 MET A CA    1 
ATOM 2830 C C     . MET E 5 202 ? -22.752 18.666  -25.706 1.00 86.08  ? 202 MET A C     1 
ATOM 2831 O O     . MET E 5 202 ? -21.713 19.292  -25.889 1.00 85.54  ? 202 MET A O     1 
ATOM 2832 C CB    . MET E 5 202 ? -22.723 16.451  -26.892 1.00 95.04  ? 202 MET A CB    1 
ATOM 2833 C CG    . MET E 5 202 ? -21.582 16.865  -27.815 1.00 98.65  ? 202 MET A CG    1 
ATOM 2834 S SD    . MET E 5 202 ? -21.821 16.295  -29.510 1.00 74.59  ? 202 MET A SD    1 
ATOM 2835 C CE    . MET E 5 202 ? -23.599 16.411  -29.656 1.00 155.30 ? 202 MET A CE    1 
ATOM 2836 N N     . ALA E 5 203 ? -23.948 19.241  -25.671 1.00 82.90  ? 203 ALA A N     1 
ATOM 2837 C CA    . ALA E 5 203 ? -24.162 20.664  -25.833 1.00 82.72  ? 203 ALA A CA    1 
ATOM 2838 C C     . ALA E 5 203 ? -23.658 21.373  -24.592 1.00 82.01  ? 203 ALA A C     1 
ATOM 2839 O O     . ALA E 5 203 ? -22.867 22.319  -24.680 1.00 84.62  ? 203 ALA A O     1 
ATOM 2840 C CB    . ALA E 5 203 ? -25.645 20.949  -26.048 1.00 82.76  ? 203 ALA A CB    1 
ATOM 2841 N N     . VAL E 5 204 ? -24.105 20.912  -23.428 1.00 73.81  ? 204 VAL A N     1 
ATOM 2842 C CA    . VAL E 5 204 ? -23.597 21.501  -22.200 1.00 66.82  ? 204 VAL A CA    1 
ATOM 2843 C C     . VAL E 5 204 ? -22.077 21.301  -22.152 1.00 67.31  ? 204 VAL A C     1 
ATOM 2844 O O     . VAL E 5 204 ? -21.299 22.268  -22.110 1.00 71.33  ? 204 VAL A O     1 
ATOM 2845 C CB    . VAL E 5 204 ? -24.300 20.918  -20.966 1.00 60.24  ? 204 VAL A CB    1 
ATOM 2846 C CG1   . VAL E 5 204 ? -23.739 21.521  -19.695 1.00 57.51  ? 204 VAL A CG1   1 
ATOM 2847 C CG2   . VAL E 5 204 ? -25.800 21.174  -21.053 1.00 54.91  ? 204 VAL A CG2   1 
ATOM 2848 N N     . TYR E 5 205 ? -21.658 20.046  -22.228 1.00 65.61  ? 205 TYR A N     1 
ATOM 2849 C CA    . TYR E 5 205 ? -20.244 19.708  -22.160 1.00 68.65  ? 205 TYR A CA    1 
ATOM 2850 C C     . TYR E 5 205 ? -19.380 20.534  -23.110 1.00 74.18  ? 205 TYR A C     1 
ATOM 2851 O O     . TYR E 5 205 ? -18.241 20.877  -22.790 1.00 75.45  ? 205 TYR A O     1 
ATOM 2852 C CB    . TYR E 5 205 ? -20.037 18.225  -22.460 1.00 68.28  ? 205 TYR A CB    1 
ATOM 2853 C CG    . TYR E 5 205 ? -18.583 17.879  -22.649 1.00 66.33  ? 205 TYR A CG    1 
ATOM 2854 C CD1   . TYR E 5 205 ? -17.661 18.150  -21.651 1.00 67.49  ? 205 TYR A CD1   1 
ATOM 2855 C CD2   . TYR E 5 205 ? -18.127 17.301  -23.823 1.00 66.56  ? 205 TYR A CD2   1 
ATOM 2856 C CE1   . TYR E 5 205 ? -16.333 17.852  -21.808 1.00 67.67  ? 205 TYR A CE1   1 
ATOM 2857 C CE2   . TYR E 5 205 ? -16.794 16.998  -23.987 1.00 69.07  ? 205 TYR A CE2   1 
ATOM 2858 C CZ    . TYR E 5 205 ? -15.901 17.278  -22.972 1.00 71.34  ? 205 TYR A CZ    1 
ATOM 2859 O OH    . TYR E 5 205 ? -14.564 16.987  -23.108 1.00 75.35  ? 205 TYR A OH    1 
ATOM 2860 N N     . TYR E 5 206 ? -19.923 20.846  -24.280 1.00 76.90  ? 206 TYR A N     1 
ATOM 2861 C CA    . TYR E 5 206 ? -19.189 21.606  -25.285 1.00 77.32  ? 206 TYR A CA    1 
ATOM 2862 C C     . TYR E 5 206 ? -19.168 23.092  -24.978 1.00 79.49  ? 206 TYR A C     1 
ATOM 2863 O O     . TYR E 5 206 ? -18.188 23.771  -25.271 1.00 79.90  ? 206 TYR A O     1 
ATOM 2864 C CB    . TYR E 5 206 ? -19.749 21.354  -26.684 1.00 77.95  ? 206 TYR A CB    1 
ATOM 2865 C CG    . TYR E 5 206 ? -19.161 20.135  -27.338 1.00 78.74  ? 206 TYR A CG    1 
ATOM 2866 C CD1   . TYR E 5 206 ? -19.407 19.850  -28.672 1.00 79.12  ? 206 TYR A CD1   1 
ATOM 2867 C CD2   . TYR E 5 206 ? -18.353 19.270  -26.620 1.00 80.58  ? 206 TYR A CD2   1 
ATOM 2868 C CE1   . TYR E 5 206 ? -18.863 18.733  -29.273 1.00 80.70  ? 206 TYR A CE1   1 
ATOM 2869 C CE2   . TYR E 5 206 ? -17.808 18.153  -27.208 1.00 82.58  ? 206 TYR A CE2   1 
ATOM 2870 C CZ    . TYR E 5 206 ? -18.065 17.889  -28.537 1.00 81.80  ? 206 TYR A CZ    1 
ATOM 2871 O OH    . TYR E 5 206 ? -17.521 16.776  -29.131 1.00 82.53  ? 206 TYR A OH    1 
ATOM 2872 N N     . TYR E 5 207 ? -20.251 23.600  -24.400 1.00 81.39  ? 207 TYR A N     1 
ATOM 2873 C CA    . TYR E 5 207 ? -20.242 24.974  -23.917 1.00 81.68  ? 207 TYR A CA    1 
ATOM 2874 C C     . TYR E 5 207 ? -19.120 25.128  -22.887 1.00 76.54  ? 207 TYR A C     1 
ATOM 2875 O O     . TYR E 5 207 ? -18.262 25.995  -23.040 1.00 76.88  ? 207 TYR A O     1 
ATOM 2876 C CB    . TYR E 5 207 ? -21.604 25.383  -23.343 1.00 87.00  ? 207 TYR A CB    1 
ATOM 2877 C CG    . TYR E 5 207 ? -21.697 26.845  -22.964 1.00 94.44  ? 207 TYR A CG    1 
ATOM 2878 C CD1   . TYR E 5 207 ? -21.917 27.825  -23.928 1.00 100.66 ? 207 TYR A CD1   1 
ATOM 2879 C CD2   . TYR E 5 207 ? -21.567 27.246  -21.641 1.00 99.56  ? 207 TYR A CD2   1 
ATOM 2880 C CE1   . TYR E 5 207 ? -22.001 29.170  -23.581 1.00 104.85 ? 207 TYR A CE1   1 
ATOM 2881 C CE2   . TYR E 5 207 ? -21.646 28.584  -21.284 1.00 102.75 ? 207 TYR A CE2   1 
ATOM 2882 C CZ    . TYR E 5 207 ? -21.864 29.540  -22.254 1.00 106.83 ? 207 TYR A CZ    1 
ATOM 2883 O OH    . TYR E 5 207 ? -21.945 30.863  -21.889 1.00 109.02 ? 207 TYR A OH    1 
ATOM 2884 N N     . LEU E 5 208 ? -19.100 24.279  -21.858 1.00 74.01  ? 208 LEU A N     1 
ATOM 2885 C CA    . LEU E 5 208 ? -18.023 24.361  -20.863 1.00 78.10  ? 208 LEU A CA    1 
ATOM 2886 C C     . LEU E 5 208 ? -16.639 24.089  -21.460 1.00 86.39  ? 208 LEU A C     1 
ATOM 2887 O O     . LEU E 5 208 ? -15.630 24.598  -20.972 1.00 85.52  ? 208 LEU A O     1 
ATOM 2888 C CB    . LEU E 5 208 ? -18.247 23.414  -19.688 1.00 78.97  ? 208 LEU A CB    1 
ATOM 2889 C CG    . LEU E 5 208 ? -19.490 23.483  -18.821 1.00 80.54  ? 208 LEU A CG    1 
ATOM 2890 C CD1   . LEU E 5 208 ? -20.544 22.583  -19.400 1.00 81.60  ? 208 LEU A CD1   1 
ATOM 2891 C CD2   . LEU E 5 208 ? -19.156 23.018  -17.422 1.00 81.53  ? 208 LEU A CD2   1 
ATOM 2892 N N     . ARG E 5 209 ? -16.588 23.264  -22.498 1.00 93.28  ? 209 ARG A N     1 
ATOM 2893 C CA    . ARG E 5 209 ? -15.312 22.870  -23.082 1.00 97.93  ? 209 ARG A CA    1 
ATOM 2894 C C     . ARG E 5 209 ? -14.692 24.001  -23.892 1.00 108.03 ? 209 ARG A C     1 
ATOM 2895 O O     . ARG E 5 209 ? -13.490 24.254  -23.814 1.00 111.71 ? 209 ARG A O     1 
ATOM 2896 C CB    . ARG E 5 209 ? -15.504 21.638  -23.959 1.00 96.33  ? 209 ARG A CB    1 
ATOM 2897 C CG    . ARG E 5 209 ? -14.291 21.217  -24.750 1.00 95.66  ? 209 ARG A CG    1 
ATOM 2898 C CD    . ARG E 5 209 ? -14.615 19.936  -25.493 1.00 94.41  ? 209 ARG A CD    1 
ATOM 2899 N NE    . ARG E 5 209 ? -13.710 19.679  -26.601 1.00 93.42  ? 209 ARG A NE    1 
ATOM 2900 C CZ    . ARG E 5 209 ? -13.849 18.665  -27.443 1.00 93.39  ? 209 ARG A CZ    1 
ATOM 2901 N NH1   . ARG E 5 209 ? -14.861 17.825  -27.292 1.00 93.11  ? 209 ARG A NH1   1 
ATOM 2902 N NH2   . ARG E 5 209 ? -12.983 18.492  -28.434 1.00 94.84  ? 209 ARG A NH2   1 
ATOM 2903 N N     . PHE E 5 210 ? -15.529 24.694  -24.651 1.00 112.16 ? 210 PHE A N     1 
ATOM 2904 C CA    . PHE E 5 210 ? -15.062 25.725  -25.566 1.00 114.56 ? 210 PHE A CA    1 
ATOM 2905 C C     . PHE E 5 210 ? -15.208 27.155  -25.015 1.00 122.58 ? 210 PHE A C     1 
ATOM 2906 O O     . PHE E 5 210 ? -14.212 27.856  -24.811 1.00 125.16 ? 210 PHE A O     1 
ATOM 2907 C CB    . PHE E 5 210 ? -15.776 25.566  -26.906 1.00 107.38 ? 210 PHE A CB    1 
ATOM 2908 C CG    . PHE E 5 210 ? -15.358 24.347  -27.656 1.00 101.13 ? 210 PHE A CG    1 
ATOM 2909 C CD1   . PHE E 5 210 ? -14.088 24.269  -28.191 1.00 97.38  ? 210 PHE A CD1   1 
ATOM 2910 C CD2   . PHE E 5 210 ? -16.215 23.276  -27.815 1.00 100.06 ? 210 PHE A CD2   1 
ATOM 2911 C CE1   . PHE E 5 210 ? -13.680 23.159  -28.878 1.00 94.89  ? 210 PHE A CE1   1 
ATOM 2912 C CE2   . PHE E 5 210 ? -15.810 22.158  -28.506 1.00 98.04  ? 210 PHE A CE2   1 
ATOM 2913 C CZ    . PHE E 5 210 ? -14.540 22.102  -29.038 1.00 95.79  ? 210 PHE A CZ    1 
ATOM 2914 N N     . HIS E 5 211 ? -16.454 27.575  -24.802 1.00 122.31 ? 211 HIS A N     1 
ATOM 2915 C CA    . HIS E 5 211 ? -16.788 28.872  -24.225 1.00 118.43 ? 211 HIS A CA    1 
ATOM 2916 C C     . HIS E 5 211 ? -16.097 28.971  -22.873 1.00 110.78 ? 211 HIS A C     1 
ATOM 2917 O O     . HIS E 5 211 ? -15.454 29.968  -22.557 1.00 112.84 ? 211 HIS A O     1 
ATOM 2918 C CB    . HIS E 5 211 ? -18.320 28.977  -24.107 1.00 122.81 ? 211 HIS A CB    1 
ATOM 2919 C CG    . HIS E 5 211 ? -18.821 30.209  -23.400 1.00 126.03 ? 211 HIS A CG    1 
ATOM 2920 N ND1   . HIS E 5 211 ? -19.511 31.209  -24.057 1.00 129.98 ? 211 HIS A ND1   1 
ATOM 2921 C CD2   . HIS E 5 211 ? -18.786 30.570  -22.103 1.00 125.81 ? 211 HIS A CD2   1 
ATOM 2922 C CE1   . HIS E 5 211 ? -19.853 32.154  -23.185 1.00 130.11 ? 211 HIS A CE1   1 
ATOM 2923 N NE2   . HIS E 5 211 ? -19.427 31.774  -21.989 1.00 128.09 ? 211 HIS A NE2   1 
ATOM 2924 N N     . GLY E 5 212 ? -16.190 27.899  -22.101 1.00 103.56 ? 212 GLY A N     1 
ATOM 2925 C CA    . GLY E 5 212 ? -15.600 27.849  -20.782 1.00 100.68 ? 212 GLY A CA    1 
ATOM 2926 C C     . GLY E 5 212 ? -16.501 28.618  -19.857 1.00 102.16 ? 212 GLY A C     1 
ATOM 2927 O O     . GLY E 5 212 ? -17.534 29.130  -20.274 1.00 98.25  ? 212 GLY A O     1 
ATOM 2928 N N     . VAL E 5 213 ? -16.132 28.694  -18.593 1.00 109.98 ? 213 VAL A N     1 
ATOM 2929 C CA    . VAL E 5 213 ? -16.841 29.606  -17.722 1.00 122.29 ? 213 VAL A CA    1 
ATOM 2930 C C     . VAL E 5 213 ? -15.875 30.691  -17.226 1.00 137.28 ? 213 VAL A C     1 
ATOM 2931 O O     . VAL E 5 213 ? -14.842 30.373  -16.637 1.00 139.26 ? 213 VAL A O     1 
ATOM 2932 C CB    . VAL E 5 213 ? -17.570 28.859  -16.577 1.00 118.27 ? 213 VAL A CB    1 
ATOM 2933 C CG1   . VAL E 5 213 ? -17.967 27.476  -17.023 1.00 117.68 ? 213 VAL A CG1   1 
ATOM 2934 C CG2   . VAL E 5 213 ? -16.710 28.774  -15.358 1.00 116.67 ? 213 VAL A CG2   1 
ATOM 2935 N N     . LYS E 5 214 ? -16.203 31.959  -17.504 1.00 147.22 ? 214 LYS A N     1 
ATOM 2936 C CA    . LYS E 5 214 ? -15.389 33.079  -17.041 1.00 153.50 ? 214 LYS A CA    1 
ATOM 2937 C C     . LYS E 5 214 ? -15.200 32.992  -15.561 1.00 161.76 ? 214 LYS A C     1 
ATOM 2938 O O     . LYS E 5 214 ? -16.119 32.653  -14.821 1.00 162.67 ? 214 LYS A O     1 
ATOM 2939 C CB    . LYS E 5 214 ? -16.024 34.444  -17.333 1.00 149.90 ? 214 LYS A CB    1 
ATOM 2940 C CG    . LYS E 5 214 ? -15.842 34.903  -18.748 1.00 147.04 ? 214 LYS A CG    1 
ATOM 2941 C CD    . LYS E 5 214 ? -16.586 33.945  -19.680 1.00 146.97 ? 214 LYS A CD    1 
ATOM 2942 C CE    . LYS E 5 214 ? -15.980 33.746  -21.107 1.00 150.76 ? 214 LYS A CE    1 
ATOM 2943 N NZ    . LYS E 5 214 ? -16.995 33.500  -22.226 1.00 150.65 ? 214 LYS A NZ    1 
ATOM 2944 N N     . LYS E 5 215 ? -13.987 33.327  -15.151 1.00 167.87 ? 215 LYS A N     1 
ATOM 2945 C CA    . LYS E 5 215 ? -13.629 33.452  -13.758 1.00 170.02 ? 215 LYS A CA    1 
ATOM 2946 C C     . LYS E 5 215 ? -13.757 32.104  -13.050 1.00 169.27 ? 215 LYS A C     1 
ATOM 2947 O O     . LYS E 5 215 ? -13.726 32.033  -11.824 1.00 167.34 ? 215 LYS A O     1 
ATOM 2948 C CB    . LYS E 5 215 ? -14.549 34.490  -13.119 1.00 171.46 ? 215 LYS A CB    1 
ATOM 2949 C CG    . LYS E 5 215 ? -14.433 34.646  -11.619 1.00 169.98 ? 215 LYS A CG    1 
ATOM 2950 C CD    . LYS E 5 215 ? -15.229 35.826  -11.107 1.00 169.14 ? 215 LYS A CD    1 
ATOM 2951 C CE    . LYS E 5 215 ? -14.865 37.071  -11.880 1.00 168.48 ? 215 LYS A CE    1 
ATOM 2952 N NZ    . LYS E 5 215 ? -13.399 37.145  -12.127 1.00 168.83 ? 215 LYS A NZ    1 
ATOM 2953 N N     . TYR E 5 216 ? -13.826 31.024  -13.824 1.00 171.06 ? 216 TYR A N     1 
ATOM 2954 C CA    . TYR E 5 216 ? -13.648 29.682  -13.265 1.00 172.02 ? 216 TYR A CA    1 
ATOM 2955 C C     . TYR E 5 216 ? -12.739 28.773  -14.098 1.00 172.92 ? 216 TYR A C     1 
ATOM 2956 O O     . TYR E 5 216 ? -11.656 28.403  -13.654 1.00 173.64 ? 216 TYR A O     1 
ATOM 2957 C CB    . TYR E 5 216 ? -14.985 29.007  -12.971 1.00 171.46 ? 216 TYR A CB    1 
ATOM 2958 C CG    . TYR E 5 216 ? -15.878 29.803  -12.059 1.00 169.73 ? 216 TYR A CG    1 
ATOM 2959 C CD1   . TYR E 5 216 ? -15.882 29.571  -10.695 1.00 168.60 ? 216 TYR A CD1   1 
ATOM 2960 C CD2   . TYR E 5 216 ? -16.712 30.790  -12.564 1.00 169.03 ? 216 TYR A CD2   1 
ATOM 2961 C CE1   . TYR E 5 216 ? -16.692 30.296  -9.858  1.00 168.27 ? 216 TYR A CE1   1 
ATOM 2962 C CE2   . TYR E 5 216 ? -17.526 31.521  -11.738 1.00 168.39 ? 216 TYR A CE2   1 
ATOM 2963 C CZ    . TYR E 5 216 ? -17.514 31.272  -10.384 1.00 168.46 ? 216 TYR A CZ    1 
ATOM 2964 O OH    . TYR E 5 216 ? -18.329 32.006  -9.558  1.00 168.48 ? 216 TYR A OH    1 
ATOM 2965 N N     . TYR E 5 217 ? -13.201 28.409  -15.292 1.00 170.97 ? 217 TYR A N     1 
ATOM 2966 C CA    . TYR E 5 217 ? -12.545 27.397  -16.112 1.00 166.39 ? 217 TYR A CA    1 
ATOM 2967 C C     . TYR E 5 217 ? -12.332 27.904  -17.526 1.00 156.31 ? 217 TYR A C     1 
ATOM 2968 O O     . TYR E 5 217 ? -13.290 28.241  -18.219 1.00 156.33 ? 217 TYR A O     1 
ATOM 2969 C CB    . TYR E 5 217 ? -13.428 26.157  -16.167 1.00 173.27 ? 217 TYR A CB    1 
ATOM 2970 C CG    . TYR E 5 217 ? -14.096 25.862  -14.850 1.00 177.73 ? 217 TYR A CG    1 
ATOM 2971 C CD1   . TYR E 5 217 ? -13.375 25.318  -13.800 1.00 180.28 ? 217 TYR A CD1   1 
ATOM 2972 C CD2   . TYR E 5 217 ? -15.442 26.137  -14.649 1.00 179.01 ? 217 TYR A CD2   1 
ATOM 2973 C CE1   . TYR E 5 217 ? -13.971 25.051  -12.587 1.00 180.83 ? 217 TYR A CE1   1 
ATOM 2974 C CE2   . TYR E 5 217 ? -16.051 25.875  -13.434 1.00 179.70 ? 217 TYR A CE2   1 
ATOM 2975 C CZ    . TYR E 5 217 ? -15.308 25.330  -12.406 1.00 180.33 ? 217 TYR A CZ    1 
ATOM 2976 O OH    . TYR E 5 217 ? -15.894 25.058  -11.189 1.00 179.84 ? 217 TYR A OH    1 
ATOM 2977 N N     . LYS E 5 218 ? -11.081 27.956  -17.963 1.00 146.00 ? 218 LYS A N     1 
ATOM 2978 C CA    . LYS E 5 218 ? -10.782 28.454  -19.296 1.00 138.61 ? 218 LYS A CA    1 
ATOM 2979 C C     . LYS E 5 218 ? -11.500 27.611  -20.332 1.00 134.51 ? 218 LYS A C     1 
ATOM 2980 O O     . LYS E 5 218 ? -11.418 26.387  -20.306 1.00 132.00 ? 218 LYS A O     1 
ATOM 2981 C CB    . LYS E 5 218 ? -9.280  28.392  -19.565 1.00 137.84 ? 218 LYS A CB    1 
ATOM 2982 C CG    . LYS E 5 218 ? -8.725  26.980  -19.527 1.00 136.96 ? 218 LYS A CG    1 
ATOM 2983 C CD    . LYS E 5 218 ? -7.229  26.940  -19.767 1.00 135.80 ? 218 LYS A CD    1 
ATOM 2984 C CE    . LYS E 5 218 ? -6.472  27.725  -18.716 1.00 133.92 ? 218 LYS A CE    1 
ATOM 2985 N NZ    . LYS E 5 218 ? -5.005  27.535  -18.871 1.00 133.30 ? 218 LYS A NZ    1 
ATOM 2986 N N     . GLY E 5 219 ? -12.210 28.256  -21.246 1.00 134.09 ? 219 GLY A N     1 
ATOM 2987 C CA    . GLY E 5 219 ? -12.682 27.545  -22.416 1.00 134.59 ? 219 GLY A CA    1 
ATOM 2988 C C     . GLY E 5 219 ? -11.437 27.197  -23.206 1.00 133.87 ? 219 GLY A C     1 
ATOM 2989 O O     . GLY E 5 219 ? -10.366 27.720  -22.918 1.00 136.14 ? 219 GLY A O     1 
ATOM 2990 N N     . ASP E 5 220 ? -11.552 26.311  -24.183 1.00 131.44 ? 220 ASP A N     1 
ATOM 2991 C CA    . ASP E 5 220 ? -10.414 26.025  -25.035 1.00 130.97 ? 220 ASP A CA    1 
ATOM 2992 C C     . ASP E 5 220 ? -10.363 27.059  -26.140 1.00 128.47 ? 220 ASP A C     1 
ATOM 2993 O O     . ASP E 5 220 ? -9.354  27.206  -26.836 1.00 130.47 ? 220 ASP A O     1 
ATOM 2994 C CB    . ASP E 5 220 ? -10.533 24.616  -25.620 1.00 134.03 ? 220 ASP A CB    1 
ATOM 2995 C CG    . ASP E 5 220 ? -10.615 23.550  -24.544 1.00 133.38 ? 220 ASP A CG    1 
ATOM 2996 O OD1   . ASP E 5 220 ? -10.777 23.921  -23.363 1.00 134.15 ? 220 ASP A OD1   1 
ATOM 2997 O OD2   . ASP E 5 220 ? -10.523 22.350  -24.877 1.00 132.34 ? 220 ASP A OD2   1 
ATOM 2998 N N     . GLY E 5 221 ? -11.483 27.747  -26.316 1.00 124.83 ? 221 GLY A N     1 
ATOM 2999 C CA    . GLY E 5 221 ? -11.658 28.661  -27.428 1.00 122.69 ? 221 GLY A CA    1 
ATOM 3000 C C     . GLY E 5 221 ? -12.070 27.841  -28.636 1.00 119.51 ? 221 GLY A C     1 
ATOM 3001 O O     . GLY E 5 221 ? -11.644 26.694  -28.775 1.00 118.53 ? 221 GLY A O     1 
ATOM 3002 N N     . TYR E 5 222 ? -12.847 28.448  -29.530 1.00 116.91 ? 222 TYR A N     1 
ATOM 3003 C CA    . TYR E 5 222 ? -13.379 27.762  -30.695 1.00 115.30 ? 222 TYR A CA    1 
ATOM 3004 C C     . TYR E 5 222 ? -12.408 27.904  -31.850 1.00 121.71 ? 222 TYR A C     1 
ATOM 3005 O O     . TYR E 5 222 ? -12.564 27.267  -32.885 1.00 120.70 ? 222 TYR A O     1 
ATOM 3006 C CB    . TYR E 5 222 ? -14.718 28.371  -31.100 1.00 109.18 ? 222 TYR A CB    1 
ATOM 3007 C CG    . TYR E 5 222 ? -15.807 28.313  -30.053 1.00 103.65 ? 222 TYR A CG    1 
ATOM 3008 C CD1   . TYR E 5 222 ? -16.928 27.530  -30.247 1.00 103.95 ? 222 TYR A CD1   1 
ATOM 3009 C CD2   . TYR E 5 222 ? -15.725 29.054  -28.885 1.00 101.08 ? 222 TYR A CD2   1 
ATOM 3010 C CE1   . TYR E 5 222 ? -17.935 27.476  -29.305 1.00 105.06 ? 222 TYR A CE1   1 
ATOM 3011 C CE2   . TYR E 5 222 ? -16.729 29.010  -27.935 1.00 101.78 ? 222 TYR A CE2   1 
ATOM 3012 C CZ    . TYR E 5 222 ? -17.832 28.220  -28.150 1.00 105.07 ? 222 TYR A CZ    1 
ATOM 3013 O OH    . TYR E 5 222 ? -18.827 28.178  -27.202 1.00 107.63 ? 222 TYR A OH    1 
ATOM 3014 N N     . GLN E 5 223 ? -11.406 28.753  -31.668 1.00 130.63 ? 223 GLN A N     1 
ATOM 3015 C CA    . GLN E 5 223 ? -10.433 29.008  -32.721 1.00 141.51 ? 223 GLN A CA    1 
ATOM 3016 C C     . GLN E 5 223 ? -9.790  27.701  -33.173 1.00 146.64 ? 223 GLN A C     1 
ATOM 3017 O O     . GLN E 5 223 ? -9.740  27.393  -34.364 1.00 148.11 ? 223 GLN A O     1 
ATOM 3018 C CB    . GLN E 5 223 ? -9.360  29.986  -32.239 1.00 145.85 ? 223 GLN A CB    1 
ATOM 3019 C CG    . GLN E 5 223 ? -9.891  31.337  -31.794 1.00 149.37 ? 223 GLN A CG    1 
ATOM 3020 C CD    . GLN E 5 223 ? -10.399 31.319  -30.372 1.00 149.96 ? 223 GLN A CD    1 
ATOM 3021 O OE1   . GLN E 5 223 ? -9.747  30.792  -29.472 1.00 149.72 ? 223 GLN A OE1   1 
ATOM 3022 N NE2   . GLN E 5 223 ? -11.573 31.893  -30.162 1.00 150.34 ? 223 GLN A NE2   1 
ATOM 3023 N N     . ILE E 5 224 ? -9.368  26.902  -32.199 1.00 149.79 ? 224 ILE A N     1 
ATOM 3024 C CA    . ILE E 5 224 ? -8.637  25.662  -32.458 1.00 151.89 ? 224 ILE A CA    1 
ATOM 3025 C C     . ILE E 5 224 ? -9.412  24.698  -33.355 1.00 151.74 ? 224 ILE A C     1 
ATOM 3026 O O     . ILE E 5 224 ? -8.862  23.702  -33.822 1.00 155.65 ? 224 ILE A O     1 
ATOM 3027 C CB    . ILE E 5 224 ? -8.211  24.935  -31.145 1.00 129.83 ? 224 ILE A CB    1 
ATOM 3028 C CG1   . ILE E 5 224 ? -9.189  23.814  -30.773 1.00 124.87 ? 224 ILE A CG1   1 
ATOM 3029 C CG2   . ILE E 5 224 ? -8.060  25.937  -30.000 1.00 131.33 ? 224 ILE A CG2   1 
ATOM 3030 C CD1   . ILE E 5 224 ? -10.447 24.290  -30.096 1.00 122.84 ? 224 ILE A CD1   1 
ATOM 3031 N N     . LEU E 5 225 ? -10.686 24.985  -33.596 1.00 146.67 ? 225 LEU A N     1 
ATOM 3032 C CA    . LEU E 5 225 ? -11.459 24.189  -34.548 1.00 142.85 ? 225 LEU A CA    1 
ATOM 3033 C C     . LEU E 5 225 ? -10.908 24.262  -35.979 1.00 150.65 ? 225 LEU A C     1 
ATOM 3034 O O     . LEU E 5 225 ? -11.306 23.470  -36.834 1.00 154.90 ? 225 LEU A O     1 
ATOM 3035 C CB    . LEU E 5 225 ? -12.944 24.564  -34.502 1.00 132.43 ? 225 LEU A CB    1 
ATOM 3036 C CG    . LEU E 5 225 ? -13.736 23.777  -33.451 1.00 122.37 ? 225 LEU A CG    1 
ATOM 3037 C CD1   . LEU E 5 225 ? -13.189 24.036  -32.066 1.00 121.11 ? 225 LEU A CD1   1 
ATOM 3038 C CD2   . LEU E 5 225 ? -15.206 24.119  -33.520 1.00 117.41 ? 225 LEU A CD2   1 
ATOM 3039 N N     . SER E 5 226 ? -10.001 25.205  -36.234 1.00 151.73 ? 226 SER A N     1 
ATOM 3040 C CA    . SER E 5 226 ? -9.312  25.282  -37.522 1.00 153.80 ? 226 SER A CA    1 
ATOM 3041 C C     . SER E 5 226 ? -7.901  24.685  -37.463 1.00 157.95 ? 226 SER A C     1 
ATOM 3042 O O     . SER E 5 226 ? -7.605  23.691  -38.123 1.00 161.90 ? 226 SER A O     1 
ATOM 3043 C CB    . SER E 5 226 ? -9.270  26.721  -38.040 1.00 150.86 ? 226 SER A CB    1 
ATOM 3044 O OG    . SER E 5 226 ? -8.472  26.797  -39.215 1.00 150.31 ? 226 SER A OG    1 
ATOM 3045 N N     . GLN E 5 227 ? -7.048  25.289  -36.645 1.00 159.19 ? 227 GLN A N     1 
ATOM 3046 C CA    . GLN E 5 227 ? -5.634  24.925  -36.568 1.00 162.18 ? 227 GLN A CA    1 
ATOM 3047 C C     . GLN E 5 227 ? -5.408  23.446  -36.237 1.00 163.69 ? 227 GLN A C     1 
ATOM 3048 O O     . GLN E 5 227 ? -4.276  22.961  -36.301 1.00 164.69 ? 227 GLN A O     1 
ATOM 3049 C CB    . GLN E 5 227 ? -4.943  25.802  -35.524 1.00 163.62 ? 227 GLN A CB    1 
ATOM 3050 C CG    . GLN E 5 227 ? -5.763  25.949  -34.254 1.00 166.27 ? 227 GLN A CG    1 
ATOM 3051 C CD    . GLN E 5 227 ? -5.410  27.188  -33.454 1.00 170.58 ? 227 GLN A CD    1 
ATOM 3052 O OE1   . GLN E 5 227 ? -6.076  27.515  -32.472 1.00 170.55 ? 227 GLN A OE1   1 
ATOM 3053 N NE2   . GLN E 5 227 ? -4.360  27.884  -33.871 1.00 174.40 ? 227 GLN A NE2   1 
ATOM 3054 N N     . LEU E 5 228 ? -6.481  22.747  -35.865 1.00 164.13 ? 228 LEU A N     1 
ATOM 3055 C CA    . LEU E 5 228 ? -6.419  21.327  -35.500 1.00 163.13 ? 228 LEU A CA    1 
ATOM 3056 C C     . LEU E 5 228 ? -7.015  20.403  -36.557 1.00 167.92 ? 228 LEU A C     1 
ATOM 3057 O O     . LEU E 5 228 ? -8.034  20.723  -37.174 1.00 171.17 ? 228 LEU A O     1 
ATOM 3058 C CB    . LEU E 5 228 ? -7.096  21.079  -34.146 1.00 158.44 ? 228 LEU A CB    1 
ATOM 3059 C CG    . LEU E 5 228 ? -6.207  21.092  -32.904 1.00 155.34 ? 228 LEU A CG    1 
ATOM 3060 C CD1   . LEU E 5 228 ? -7.013  20.804  -31.646 1.00 153.34 ? 228 LEU A CD1   1 
ATOM 3061 C CD2   . LEU E 5 228 ? -5.096  20.077  -33.069 1.00 155.59 ? 228 LEU A CD2   1 
ATOM 3062 N N     . GLU E 5 229 ? -6.341  19.274  -36.766 1.00 166.68 ? 229 GLU A N     1 
ATOM 3063 C CA    . GLU E 5 229 ? -6.786  18.235  -37.679 1.00 162.15 ? 229 GLU A CA    1 
ATOM 3064 C C     . GLU E 5 229 ? -7.838  17.327  -37.108 1.00 152.05 ? 229 GLU A C     1 
ATOM 3065 O O     . GLU E 5 229 ? -8.881  17.097  -37.721 1.00 149.05 ? 229 GLU A O     1 
ATOM 3066 C CB    . GLU E 5 229 ? -5.593  17.387  -38.072 1.00 167.15 ? 229 GLU A CB    1 
ATOM 3067 C CG    . GLU E 5 229 ? -5.027  17.903  -39.334 1.00 172.14 ? 229 GLU A CG    1 
ATOM 3068 C CD    . GLU E 5 229 ? -5.577  19.286  -39.666 1.00 176.35 ? 229 GLU A CD    1 
ATOM 3069 O OE1   . GLU E 5 229 ? -6.590  19.356  -40.390 1.00 178.58 ? 229 GLU A OE1   1 
ATOM 3070 O OE2   . GLU E 5 229 ? -5.025  20.303  -39.181 1.00 177.70 ? 229 GLU A OE2   1 
ATOM 3071 N N     . HIS E 5 230 ? -7.544  16.804  -35.927 1.00 145.82 ? 230 HIS A N     1 
ATOM 3072 C CA    . HIS E 5 230 ? -8.441  15.875  -35.285 1.00 139.86 ? 230 HIS A CA    1 
ATOM 3073 C C     . HIS E 5 230 ? -8.967  16.408  -33.968 1.00 138.12 ? 230 HIS A C     1 
ATOM 3074 O O     . HIS E 5 230 ? -8.204  16.725  -33.044 1.00 142.22 ? 230 HIS A O     1 
ATOM 3075 C CB    . HIS E 5 230 ? -7.783  14.518  -35.082 1.00 135.03 ? 230 HIS A CB    1 
ATOM 3076 C CG    . HIS E 5 230 ? -8.611  13.583  -34.267 1.00 130.62 ? 230 HIS A CG    1 
ATOM 3077 N ND1   . HIS E 5 230 ? -8.129  12.943  -33.146 1.00 128.77 ? 230 HIS A ND1   1 
ATOM 3078 C CD2   . HIS E 5 230 ? -9.904  13.207  -34.390 1.00 127.49 ? 230 HIS A CD2   1 
ATOM 3079 C CE1   . HIS E 5 230 ? -9.086  12.197  -32.625 1.00 126.46 ? 230 HIS A CE1   1 
ATOM 3080 N NE2   . HIS E 5 230 ? -10.173 12.340  -33.360 1.00 126.02 ? 230 HIS A NE2   1 
ATOM 3081 N N     . ILE E 5 231 ? -10.292 16.459  -33.890 1.00 131.02 ? 231 ILE A N     1 
ATOM 3082 C CA    . ILE E 5 231 ? -11.006 17.097  -32.790 1.00 121.05 ? 231 ILE A CA    1 
ATOM 3083 C C     . ILE E 5 231 ? -11.847 16.083  -32.016 1.00 111.31 ? 231 ILE A C     1 
ATOM 3084 O O     . ILE E 5 231 ? -13.054 15.961  -32.238 1.00 113.05 ? 231 ILE A O     1 
ATOM 3085 C CB    . ILE E 5 231 ? -11.890 18.252  -33.314 1.00 120.20 ? 231 ILE A CB    1 
ATOM 3086 C CG1   . ILE E 5 231 ? -12.447 17.923  -34.705 1.00 121.33 ? 231 ILE A CG1   1 
ATOM 3087 C CG2   . ILE E 5 231 ? -11.057 19.512  -33.403 1.00 118.89 ? 231 ILE A CG2   1 
ATOM 3088 C CD1   . ILE E 5 231 ? -13.499 18.911  -35.216 1.00 121.17 ? 231 ILE A CD1   1 
ATOM 3089 N N     . PRO E 5 232 ? -11.208 15.376  -31.071 1.00 98.12  ? 232 PRO A N     1 
ATOM 3090 C CA    . PRO E 5 232 ? -11.861 14.292  -30.337 1.00 94.18  ? 232 PRO A CA    1 
ATOM 3091 C C     . PRO E 5 232 ? -13.171 14.763  -29.741 1.00 91.24  ? 232 PRO A C     1 
ATOM 3092 O O     . PRO E 5 232 ? -13.251 15.905  -29.308 1.00 91.19  ? 232 PRO A O     1 
ATOM 3093 C CB    . PRO E 5 232 ? -10.870 13.981  -29.215 1.00 92.41  ? 232 PRO A CB    1 
ATOM 3094 C CG    . PRO E 5 232 ? -10.023 15.194  -29.077 1.00 91.39  ? 232 PRO A CG    1 
ATOM 3095 C CD    . PRO E 5 232 ? -9.918  15.751  -30.468 1.00 94.33  ? 232 PRO A CD    1 
ATOM 3096 N N     . ILE E 5 233 ? -14.167 13.883  -29.714 1.00 93.28  ? 233 ILE A N     1 
ATOM 3097 C CA    . ILE E 5 233 ? -15.504 14.186  -29.204 1.00 96.77  ? 233 ILE A CA    1 
ATOM 3098 C C     . ILE E 5 233 ? -15.444 14.522  -27.712 1.00 101.86 ? 233 ILE A C     1 
ATOM 3099 O O     . ILE E 5 233 ? -16.179 15.380  -27.219 1.00 103.30 ? 233 ILE A O     1 
ATOM 3100 C CB    . ILE E 5 233 ? -16.483 13.006  -29.482 1.00 86.16  ? 233 ILE A CB    1 
ATOM 3101 C CG1   . ILE E 5 233 ? -16.805 12.911  -30.973 1.00 86.88  ? 233 ILE A CG1   1 
ATOM 3102 C CG2   . ILE E 5 233 ? -17.792 13.169  -28.727 1.00 87.19  ? 233 ILE A CG2   1 
ATOM 3103 C CD1   . ILE E 5 233 ? -15.600 12.897  -31.881 1.00 89.13  ? 233 ILE A CD1   1 
ATOM 3104 N N     . ILE E 5 234 ? -14.563 13.834  -26.994 1.00 104.52 ? 234 ILE A N     1 
ATOM 3105 C CA    . ILE E 5 234 ? -14.235 14.231  -25.628 1.00 107.28 ? 234 ILE A CA    1 
ATOM 3106 C C     . ILE E 5 234 ? -12.715 14.284  -25.438 1.00 110.25 ? 234 ILE A C     1 
ATOM 3107 O O     . ILE E 5 234 ? -11.982 13.460  -25.987 1.00 114.98 ? 234 ILE A O     1 
ATOM 3108 C CB    . ILE E 5 234 ? -14.938 13.354  -24.560 1.00 73.83  ? 234 ILE A CB    1 
ATOM 3109 C CG1   . ILE E 5 234 ? -14.105 12.131  -24.193 1.00 78.63  ? 234 ILE A CG1   1 
ATOM 3110 C CG2   . ILE E 5 234 ? -16.328 12.946  -25.022 1.00 70.60  ? 234 ILE A CG2   1 
ATOM 3111 C CD1   . ILE E 5 234 ? -14.807 11.196  -23.228 1.00 82.31  ? 234 ILE A CD1   1 
ATOM 3112 N N     . ARG E 5 235 ? -12.245 15.265  -24.675 1.00 109.23 ? 235 ARG A N     1 
ATOM 3113 C CA    . ARG E 5 235 ? -10.818 15.584  -24.653 1.00 113.12 ? 235 ARG A CA    1 
ATOM 3114 C C     . ARG E 5 235 ? -10.126 15.217  -23.347 1.00 115.46 ? 235 ARG A C     1 
ATOM 3115 O O     . ARG E 5 235 ? -10.566 15.611  -22.267 1.00 113.10 ? 235 ARG A O     1 
ATOM 3116 C CB    . ARG E 5 235 ? -10.592 17.069  -24.963 1.00 116.10 ? 235 ARG A CB    1 
ATOM 3117 C CG    . ARG E 5 235 ? -9.194  17.593  -24.628 1.00 120.66 ? 235 ARG A CG    1 
ATOM 3118 C CD    . ARG E 5 235 ? -9.003  19.008  -25.164 1.00 124.83 ? 235 ARG A CD    1 
ATOM 3119 N NE    . ARG E 5 235 ? -9.038  19.060  -26.628 1.00 128.12 ? 235 ARG A NE    1 
ATOM 3120 C CZ    . ARG E 5 235 ? -10.126 19.316  -27.351 1.00 129.53 ? 235 ARG A CZ    1 
ATOM 3121 N NH1   . ARG E 5 235 ? -11.282 19.547  -26.749 1.00 130.37 ? 235 ARG A NH1   1 
ATOM 3122 N NH2   . ARG E 5 235 ? -10.064 19.340  -28.679 1.00 128.64 ? 235 ARG A NH2   1 
ATOM 3123 N N     . GLY E 5 236 ? -9.031  14.471  -23.459 1.00 121.81 ? 236 GLY A N     1 
ATOM 3124 C CA    . GLY E 5 236 ? -8.223  14.109  -22.309 1.00 124.42 ? 236 GLY A CA    1 
ATOM 3125 C C     . GLY E 5 236 ? -7.265  15.237  -21.986 1.00 126.13 ? 236 GLY A C     1 
ATOM 3126 O O     . GLY E 5 236 ? -7.547  16.391  -22.299 1.00 129.75 ? 236 GLY A O     1 
ATOM 3127 N N     . LYS E 5 237 ? -6.138  14.916  -21.359 1.00 124.44 ? 237 LYS A N     1 
ATOM 3128 C CA    . LYS E 5 237 ? -5.159  15.939  -21.017 1.00 124.06 ? 237 LYS A CA    1 
ATOM 3129 C C     . LYS E 5 237 ? -4.865  16.789  -22.242 1.00 128.49 ? 237 LYS A C     1 
ATOM 3130 O O     . LYS E 5 237 ? -4.988  18.012  -22.204 1.00 130.69 ? 237 LYS A O     1 
ATOM 3131 C CB    . LYS E 5 237 ? -3.865  15.311  -20.495 1.00 124.37 ? 237 LYS A CB    1 
ATOM 3132 C CG    . LYS E 5 237 ? -3.714  15.338  -18.981 1.00 121.54 ? 237 LYS A CG    1 
ATOM 3133 C CD    . LYS E 5 237 ? -3.329  16.721  -18.482 1.00 120.99 ? 237 LYS A CD    1 
ATOM 3134 C CE    . LYS E 5 237 ? -3.128  16.734  -16.974 1.00 117.89 ? 237 LYS A CE    1 
ATOM 3135 N NZ    . LYS E 5 237 ? -2.027  15.827  -16.556 1.00 116.39 ? 237 LYS A NZ    1 
ATOM 3136 N N     . SER E 5 238 ? -4.499  16.138  -23.339 1.00 127.44 ? 238 SER A N     1 
ATOM 3137 C CA    . SER E 5 238 ? -4.128  16.858  -24.548 1.00 128.17 ? 238 SER A CA    1 
ATOM 3138 C C     . SER E 5 238 ? -5.329  17.272  -25.385 1.00 127.90 ? 238 SER A C     1 
ATOM 3139 O O     . SER E 5 238 ? -6.304  16.533  -25.507 1.00 124.54 ? 238 SER A O     1 
ATOM 3140 C CB    . SER E 5 238 ? -3.155  16.035  -25.391 1.00 130.61 ? 238 SER A CB    1 
ATOM 3141 O OG    . SER E 5 238 ? -1.868  16.022  -24.800 1.00 130.54 ? 238 SER A OG    1 
ATOM 3142 N N     . LEU E 5 239 ? -5.236  18.462  -25.966 1.00 131.82 ? 239 LEU A N     1 
ATOM 3143 C CA    . LEU E 5 239 ? -6.308  19.018  -26.780 1.00 134.64 ? 239 LEU A CA    1 
ATOM 3144 C C     . LEU E 5 239 ? -6.764  18.139  -27.941 1.00 134.54 ? 239 LEU A C     1 
ATOM 3145 O O     . LEU E 5 239 ? -7.945  18.117  -28.272 1.00 135.25 ? 239 LEU A O     1 
ATOM 3146 C CB    . LEU E 5 239 ? -5.915  20.388  -27.331 1.00 135.35 ? 239 LEU A CB    1 
ATOM 3147 C CG    . LEU E 5 239 ? -6.132  21.631  -26.472 1.00 132.81 ? 239 LEU A CG    1 
ATOM 3148 C CD1   . LEU E 5 239 ? -5.485  22.806  -27.166 1.00 132.38 ? 239 LEU A CD1   1 
ATOM 3149 C CD2   . LEU E 5 239 ? -7.611  21.896  -26.240 1.00 132.06 ? 239 LEU A CD2   1 
ATOM 3150 N N     . ASP E 5 240 ? -5.834  17.438  -28.575 1.00 132.94 ? 240 ASP A N     1 
ATOM 3151 C CA    . ASP E 5 240 ? -6.146  16.757  -29.826 1.00 130.35 ? 240 ASP A CA    1 
ATOM 3152 C C     . ASP E 5 240 ? -6.508  15.284  -29.666 1.00 125.11 ? 240 ASP A C     1 
ATOM 3153 O O     . ASP E 5 240 ? -6.830  14.616  -30.647 1.00 125.89 ? 240 ASP A O     1 
ATOM 3154 C CB    . ASP E 5 240 ? -4.984  16.907  -30.803 1.00 134.08 ? 240 ASP A CB    1 
ATOM 3155 C CG    . ASP E 5 240 ? -3.654  16.581  -30.169 1.00 138.70 ? 240 ASP A CG    1 
ATOM 3156 O OD1   . ASP E 5 240 ? -3.566  16.634  -28.927 1.00 138.29 ? 240 ASP A OD1   1 
ATOM 3157 O OD2   . ASP E 5 240 ? -2.699  16.272  -30.909 1.00 149.48 ? 240 ASP A OD2   1 
ATOM 3158 N N     . GLN E 5 241 ? -6.462  14.779  -28.439 1.00 118.19 ? 241 GLN A N     1 
ATOM 3159 C CA    . GLN E 5 241 ? -6.657  13.352  -28.220 1.00 113.89 ? 241 GLN A CA    1 
ATOM 3160 C C     . GLN E 5 241 ? -7.841  13.017  -27.322 1.00 108.84 ? 241 GLN A C     1 
ATOM 3161 O O     . GLN E 5 241 ? -8.232  13.804  -26.461 1.00 107.31 ? 241 GLN A O     1 
ATOM 3162 C CB    . GLN E 5 241 ? -5.379  12.712  -27.667 1.00 116.76 ? 241 GLN A CB    1 
ATOM 3163 C CG    . GLN E 5 241 ? -4.240  12.593  -28.676 1.00 123.60 ? 241 GLN A CG    1 
ATOM 3164 C CD    . GLN E 5 241 ? -4.416  11.443  -29.659 1.00 134.62 ? 241 GLN A CD    1 
ATOM 3165 O OE1   . GLN E 5 241 ? -5.512  11.193  -30.160 1.00 132.81 ? 241 GLN A OE1   1 
ATOM 3166 N NE2   . GLN E 5 241 ? -3.326  10.738  -29.937 1.00 148.61 ? 241 GLN A NE2   1 
ATOM 3167 N N     . TYR E 5 242 ? -8.406  11.837  -27.557 1.00 107.17 ? 242 TYR A N     1 
ATOM 3168 C CA    . TYR E 5 242 ? -9.429  11.255  -26.705 1.00 102.31 ? 242 TYR A CA    1 
ATOM 3169 C C     . TYR E 5 242 ? -8.725  10.756  -25.450 1.00 103.54 ? 242 TYR A C     1 
ATOM 3170 O O     . TYR E 5 242 ? -7.546  10.409  -25.502 1.00 106.86 ? 242 TYR A O     1 
ATOM 3171 C CB    . TYR E 5 242 ? -10.069 10.083  -27.443 1.00 95.95  ? 242 TYR A CB    1 
ATOM 3172 C CG    . TYR E 5 242 ? -11.524 9.819   -27.129 1.00 89.84  ? 242 TYR A CG    1 
ATOM 3173 C CD1   . TYR E 5 242 ? -12.527 10.534  -27.761 1.00 87.52  ? 242 TYR A CD1   1 
ATOM 3174 C CD2   . TYR E 5 242 ? -11.894 8.822   -26.231 1.00 83.81  ? 242 TYR A CD2   1 
ATOM 3175 C CE1   . TYR E 5 242 ? -13.858 10.281  -27.490 1.00 85.91  ? 242 TYR A CE1   1 
ATOM 3176 C CE2   . TYR E 5 242 ? -13.220 8.564   -25.955 1.00 80.63  ? 242 TYR A CE2   1 
ATOM 3177 C CZ    . TYR E 5 242 ? -14.198 9.291   -26.586 1.00 80.64  ? 242 TYR A CZ    1 
ATOM 3178 O OH    . TYR E 5 242 ? -15.519 9.026   -26.304 1.00 76.74  ? 242 TYR A OH    1 
ATOM 3179 N N     . PRO E 5 243 ? -9.435  10.721  -24.314 1.00 100.46 ? 243 PRO A N     1 
ATOM 3180 C CA    . PRO E 5 243 ? -8.800  10.241  -23.085 1.00 102.26 ? 243 PRO A CA    1 
ATOM 3181 C C     . PRO E 5 243 ? -8.332  8.800   -23.262 1.00 109.09 ? 243 PRO A C     1 
ATOM 3182 O O     . PRO E 5 243 ? -8.951  8.050   -24.014 1.00 111.31 ? 243 PRO A O     1 
ATOM 3183 C CB    . PRO E 5 243 ? -9.934  10.320  -22.056 1.00 96.49  ? 243 PRO A CB    1 
ATOM 3184 C CG    . PRO E 5 243 ? -10.872 11.335  -22.605 1.00 96.04  ? 243 PRO A CG    1 
ATOM 3185 C CD    . PRO E 5 243 ? -10.832 11.119  -24.086 1.00 98.38  ? 243 PRO A CD    1 
ATOM 3186 N N     . ARG E 5 244 ? -7.250  8.426   -22.586 1.00 113.57 ? 244 ARG A N     1 
ATOM 3187 C CA    . ARG E 5 244 ? -6.764  7.050   -22.615 1.00 118.36 ? 244 ARG A CA    1 
ATOM 3188 C C     . ARG E 5 244 ? -7.797  6.094   -22.010 1.00 125.34 ? 244 ARG A C     1 
ATOM 3189 O O     . ARG E 5 244 ? -8.624  6.506   -21.198 1.00 129.55 ? 244 ARG A O     1 
ATOM 3190 C CB    . ARG E 5 244 ? -5.435  6.948   -21.867 1.00 115.16 ? 244 ARG A CB    1 
ATOM 3191 C CG    . ARG E 5 244 ? -4.338  7.744   -22.531 1.00 114.82 ? 244 ARG A CG    1 
ATOM 3192 C CD    . ARG E 5 244 ? -4.452  7.582   -24.027 1.00 118.27 ? 244 ARG A CD    1 
ATOM 3193 N NE    . ARG E 5 244 ? -3.307  8.135   -24.736 1.00 122.04 ? 244 ARG A NE    1 
ATOM 3194 C CZ    . ARG E 5 244 ? -3.383  9.129   -25.614 1.00 124.05 ? 244 ARG A CZ    1 
ATOM 3195 N NH1   . ARG E 5 244 ? -4.555  9.681   -25.893 1.00 121.94 ? 244 ARG A NH1   1 
ATOM 3196 N NH2   . ARG E 5 244 ? -2.288  9.568   -26.216 1.00 128.03 ? 244 ARG A NH2   1 
ATOM 3197 N N     . GLU E 5 245 ? -7.759  4.826   -22.420 1.00 126.73 ? 245 GLU A N     1 
ATOM 3198 C CA    . GLU E 5 245 ? -8.737  3.821   -21.977 1.00 126.76 ? 245 GLU A CA    1 
ATOM 3199 C C     . GLU E 5 245 ? -8.817  3.625   -20.485 1.00 124.74 ? 245 GLU A C     1 
ATOM 3200 O O     . GLU E 5 245 ? -9.847  3.890   -19.868 1.00 124.00 ? 245 GLU A O     1 
ATOM 3201 C CB    . GLU E 5 245 ? -8.436  2.443   -22.574 1.00 130.08 ? 245 GLU A CB    1 
ATOM 3202 C CG    . GLU E 5 245 ? -8.400  2.397   -24.059 1.00 133.30 ? 245 GLU A CG    1 
ATOM 3203 C CD    . GLU E 5 245 ? -7.255  3.191   -24.609 1.00 132.50 ? 245 GLU A CD    1 
ATOM 3204 O OE1   . GLU E 5 245 ? -6.292  3.434   -23.854 1.00 133.08 ? 245 GLU A OE1   1 
ATOM 3205 O OE2   . GLU E 5 245 ? -7.324  3.587   -25.789 1.00 131.56 ? 245 GLU A OE2   1 
ATOM 3206 N N     . LEU E 5 246 ? -7.730  3.119   -19.919 1.00 124.94 ? 246 LEU A N     1 
ATOM 3207 C CA    . LEU E 5 246 ? -7.717  2.761   -18.516 1.00 126.61 ? 246 LEU A CA    1 
ATOM 3208 C C     . LEU E 5 246 ? -8.348  3.888   -17.719 1.00 131.01 ? 246 LEU A C     1 
ATOM 3209 O O     . LEU E 5 246 ? -9.154  3.649   -16.840 1.00 136.58 ? 246 LEU A O     1 
ATOM 3210 C CB    . LEU E 5 246 ? -6.278  2.536   -18.051 1.00 124.93 ? 246 LEU A CB    1 
ATOM 3211 C CG    . LEU E 5 246 ? -5.204  3.500   -18.532 1.00 125.63 ? 246 LEU A CG    1 
ATOM 3212 C CD1   . LEU E 5 246 ? -5.053  4.695   -17.601 1.00 126.07 ? 246 LEU A CD1   1 
ATOM 3213 C CD2   . LEU E 5 246 ? -3.881  2.769   -18.633 1.00 125.33 ? 246 LEU A CD2   1 
ATOM 3214 N N     . THR E 5 247 ? -7.980  5.120   -18.064 1.00 129.64 ? 247 THR A N     1 
ATOM 3215 C CA    . THR E 5 247 ? -8.487  6.298   -17.371 1.00 129.23 ? 247 THR A CA    1 
ATOM 3216 C C     . THR E 5 247 ? -9.984  6.146   -17.180 1.00 129.51 ? 247 THR A C     1 
ATOM 3217 O O     . THR E 5 247 ? -10.489 6.191   -16.062 1.00 131.65 ? 247 THR A O     1 
ATOM 3218 C CB    . THR E 5 247 ? -8.222  7.612   -18.145 1.00 128.14 ? 247 THR A CB    1 
ATOM 3219 O OG1   . THR E 5 247 ? -8.729  7.481   -19.476 1.00 130.85 ? 247 THR A OG1   1 
ATOM 3220 C CG2   . THR E 5 247 ? -6.749  7.928   -18.176 1.00 126.25 ? 247 THR A CG2   1 
ATOM 3221 N N     . LEU E 5 248 ? -10.677 6.040   -18.306 1.00 125.63 ? 248 LEU A N     1 
ATOM 3222 C CA    . LEU E 5 248 ? -12.100 5.803   -18.341 1.00 119.56 ? 248 LEU A CA    1 
ATOM 3223 C C     . LEU E 5 248 ? -12.457 4.573   -17.508 1.00 122.00 ? 248 LEU A C     1 
ATOM 3224 O O     . LEU E 5 248 ? -13.311 4.635   -16.642 1.00 124.10 ? 248 LEU A O     1 
ATOM 3225 C CB    . LEU E 5 248 ? -12.545 5.635   -19.800 1.00 112.15 ? 248 LEU A CB    1 
ATOM 3226 C CG    . LEU E 5 248 ? -12.109 6.693   -20.797 1.00 108.21 ? 248 LEU A CG    1 
ATOM 3227 C CD1   . LEU E 5 248 ? -12.486 6.270   -22.182 1.00 109.14 ? 248 LEU A CD1   1 
ATOM 3228 C CD2   . LEU E 5 248 ? -12.784 7.995   -20.503 1.00 105.70 ? 248 LEU A CD2   1 
ATOM 3229 N N     . GLY E 5 249 ? -11.770 3.467   -17.744 1.00 123.84 ? 249 GLY A N     1 
ATOM 3230 C CA    . GLY E 5 249 ? -12.043 2.246   -17.011 1.00 125.20 ? 249 GLY A CA    1 
ATOM 3231 C C     . GLY E 5 249 ? -12.017 2.437   -15.504 1.00 126.64 ? 249 GLY A C     1 
ATOM 3232 O O     . GLY E 5 249 ? -12.572 1.624   -14.763 1.00 126.80 ? 249 GLY A O     1 
ATOM 3233 N N     . ASN E 5 250 ? -11.307 3.474   -15.055 1.00 125.01 ? 250 ASN A N     1 
ATOM 3234 C CA    . ASN E 5 250 ? -11.338 3.934   -13.666 1.00 122.33 ? 250 ASN A CA    1 
ATOM 3235 C C     . ASN E 5 250 ? -12.558 4.812   -13.404 1.00 116.53 ? 250 ASN A C     1 
ATOM 3236 O O     . ASN E 5 250 ? -13.299 4.588   -12.445 1.00 114.77 ? 250 ASN A O     1 
ATOM 3237 C CB    . ASN E 5 250 ? -10.044 4.687   -13.311 1.00 126.03 ? 250 ASN A CB    1 
ATOM 3238 C CG    . ASN E 5 250 ? -9.950  5.044   -11.832 1.00 131.85 ? 250 ASN A CG    1 
ATOM 3239 O OD1   . ASN E 5 250 ? -10.961 5.106   -11.135 1.00 135.57 ? 250 ASN A OD1   1 
ATOM 3240 N ND2   . ASN E 5 250 ? -8.732  5.287   -11.352 1.00 133.43 ? 250 ASN A ND2   1 
ATOM 3241 N N     . TRP E 5 251 ? -12.792 5.788   -14.275 1.00 115.22 ? 251 TRP A N     1 
ATOM 3242 C CA    . TRP E 5 251 ? -13.932 6.679   -14.065 1.00 119.57 ? 251 TRP A CA    1 
ATOM 3243 C C     . TRP E 5 251 ? -15.240 5.891   -13.926 1.00 118.23 ? 251 TRP A C     1 
ATOM 3244 O O     . TRP E 5 251 ? -16.108 6.235   -13.123 1.00 121.81 ? 251 TRP A O     1 
ATOM 3245 C CB    . TRP E 5 251 ? -14.046 7.724   -15.188 1.00 124.01 ? 251 TRP A CB    1 
ATOM 3246 C CG    . TRP E 5 251 ? -12.901 8.693   -15.233 1.00 131.02 ? 251 TRP A CG    1 
ATOM 3247 C CD1   . TRP E 5 251 ? -11.623 8.451   -14.838 1.00 134.74 ? 251 TRP A CD1   1 
ATOM 3248 C CD2   . TRP E 5 251 ? -12.930 10.058  -15.682 1.00 136.21 ? 251 TRP A CD2   1 
ATOM 3249 N NE1   . TRP E 5 251 ? -10.848 9.569   -15.018 1.00 137.26 ? 251 TRP A NE1   1 
ATOM 3250 C CE2   . TRP E 5 251 ? -11.626 10.571  -15.533 1.00 138.64 ? 251 TRP A CE2   1 
ATOM 3251 C CE3   . TRP E 5 251 ? -13.927 10.894  -16.197 1.00 138.83 ? 251 TRP A CE3   1 
ATOM 3252 C CZ2   . TRP E 5 251 ? -11.291 11.880  -15.878 1.00 142.22 ? 251 TRP A CZ2   1 
ATOM 3253 C CZ3   . TRP E 5 251 ? -13.592 12.199  -16.539 1.00 141.33 ? 251 TRP A CZ3   1 
ATOM 3254 C CH2   . TRP E 5 251 ? -12.285 12.676  -16.377 1.00 142.39 ? 251 TRP A CH2   1 
ATOM 3255 N N     . TYR E 5 252 ? -15.357 4.829   -14.715 1.00 113.43 ? 252 TYR A N     1 
ATOM 3256 C CA    . TYR E 5 252 ? -16.587 4.060   -14.849 1.00 107.19 ? 252 TYR A CA    1 
ATOM 3257 C C     . TYR E 5 252 ? -17.039 3.345   -13.580 1.00 105.22 ? 252 TYR A C     1 
ATOM 3258 O O     . TYR E 5 252 ? -18.151 3.555   -13.114 1.00 105.43 ? 252 TYR A O     1 
ATOM 3259 C CB    . TYR E 5 252 ? -16.473 3.079   -16.021 1.00 103.17 ? 252 TYR A CB    1 
ATOM 3260 C CG    . TYR E 5 252 ? -17.221 3.551   -17.240 1.00 100.45 ? 252 TYR A CG    1 
ATOM 3261 C CD1   . TYR E 5 252 ? -18.600 3.438   -17.305 1.00 102.15 ? 252 TYR A CD1   1 
ATOM 3262 C CD2   . TYR E 5 252 ? -16.558 4.122   -18.316 1.00 97.03  ? 252 TYR A CD2   1 
ATOM 3263 C CE1   . TYR E 5 252 ? -19.298 3.876   -18.403 1.00 102.75 ? 252 TYR A CE1   1 
ATOM 3264 C CE2   . TYR E 5 252 ? -17.249 4.563   -19.422 1.00 98.42  ? 252 TYR A CE2   1 
ATOM 3265 C CZ    . TYR E 5 252 ? -18.618 4.437   -19.459 1.00 100.71 ? 252 TYR A CZ    1 
ATOM 3266 O OH    . TYR E 5 252 ? -19.306 4.877   -20.561 1.00 99.33  ? 252 TYR A OH    1 
ATOM 3267 N N     . PRO E 5 253 ? -16.186 2.487   -13.019 1.00 104.37 ? 253 PRO A N     1 
ATOM 3268 C CA    . PRO E 5 253 ? -16.627 1.769   -11.824 1.00 105.81 ? 253 PRO A CA    1 
ATOM 3269 C C     . PRO E 5 253 ? -16.936 2.729   -10.690 1.00 102.17 ? 253 PRO A C     1 
ATOM 3270 O O     . PRO E 5 253 ? -17.809 2.441   -9.870  1.00 102.68 ? 253 PRO A O     1 
ATOM 3271 C CB    . PRO E 5 253 ? -15.413 0.913   -11.469 1.00 108.67 ? 253 PRO A CB    1 
ATOM 3272 C CG    . PRO E 5 253 ? -14.260 1.599   -12.109 1.00 108.25 ? 253 PRO A CG    1 
ATOM 3273 C CD    . PRO E 5 253 ? -14.802 2.157   -13.379 1.00 106.54 ? 253 PRO A CD    1 
ATOM 3274 N N     . THR E 5 254 ? -16.223 3.855   -10.664 1.00 100.83 ? 254 THR A N     1 
ATOM 3275 C CA    . THR E 5 254 ? -16.375 4.890   -9.638  1.00 96.28  ? 254 THR A CA    1 
ATOM 3276 C C     . THR E 5 254 ? -17.790 5.435   -9.572  1.00 88.90  ? 254 THR A C     1 
ATOM 3277 O O     . THR E 5 254 ? -18.336 5.669   -8.491  1.00 83.76  ? 254 THR A O     1 
ATOM 3278 C CB    . THR E 5 254 ? -15.454 6.080   -9.925  1.00 99.76  ? 254 THR A CB    1 
ATOM 3279 O OG1   . THR E 5 254 ? -14.152 5.608   -10.289 1.00 104.65 ? 254 THR A OG1   1 
ATOM 3280 C CG2   . THR E 5 254 ? -15.353 6.972   -8.705  1.00 96.62  ? 254 THR A CG2   1 
ATOM 3281 N N     . ILE E 5 255 ? -18.371 5.652   -10.744 1.00 89.97  ? 255 ILE A N     1 
ATOM 3282 C CA    . ILE E 5 255 ? -19.753 6.079   -10.825 1.00 93.93  ? 255 ILE A CA    1 
ATOM 3283 C C     . ILE E 5 255 ? -20.757 4.937   -10.584 1.00 104.77 ? 255 ILE A C     1 
ATOM 3284 O O     . ILE E 5 255 ? -21.777 5.146   -9.924  1.00 106.81 ? 255 ILE A O     1 
ATOM 3285 C CB    . ILE E 5 255 ? -20.047 6.782   -12.158 1.00 90.57  ? 255 ILE A CB    1 
ATOM 3286 C CG1   . ILE E 5 255 ? -21.467 7.318   -12.134 1.00 90.38  ? 255 ILE A CG1   1 
ATOM 3287 C CG2   . ILE E 5 255 ? -19.840 5.849   -13.328 1.00 93.01  ? 255 ILE A CG2   1 
ATOM 3288 C CD1   . ILE E 5 255 ? -21.740 8.179   -10.922 1.00 90.18  ? 255 ILE A CD1   1 
ATOM 3289 N N     . PHE E 5 256 ? -20.450 3.740   -11.100 1.00 109.72 ? 256 PHE A N     1 
ATOM 3290 C CA    . PHE E 5 256 ? -21.307 2.549   -10.972 1.00 111.54 ? 256 PHE A CA    1 
ATOM 3291 C C     . PHE E 5 256 ? -21.485 2.075   -9.539  1.00 114.49 ? 256 PHE A C     1 
ATOM 3292 O O     . PHE E 5 256 ? -22.560 1.617   -9.150  1.00 115.81 ? 256 PHE A O     1 
ATOM 3293 C CB    . PHE E 5 256 ? -20.753 1.408   -11.819 1.00 109.97 ? 256 PHE A CB    1 
ATOM 3294 C CG    . PHE E 5 256 ? -21.424 1.272   -13.142 1.00 110.46 ? 256 PHE A CG    1 
ATOM 3295 C CD1   . PHE E 5 256 ? -22.279 0.213   -13.391 1.00 111.56 ? 256 PHE A CD1   1 
ATOM 3296 C CD2   . PHE E 5 256 ? -21.226 2.219   -14.128 1.00 109.30 ? 256 PHE A CD2   1 
ATOM 3297 C CE1   . PHE E 5 256 ? -22.908 0.094   -14.607 1.00 112.47 ? 256 PHE A CE1   1 
ATOM 3298 C CE2   . PHE E 5 256 ? -21.852 2.105   -15.344 1.00 110.76 ? 256 PHE A CE2   1 
ATOM 3299 C CZ    . PHE E 5 256 ? -22.694 1.044   -15.583 1.00 112.79 ? 256 PHE A CZ    1 
ATOM 3300 N N     . LYS E 5 257 ? -20.409 2.159   -8.772  1.00 117.09 ? 257 LYS A N     1 
ATOM 3301 C CA    . LYS E 5 257 ? -20.480 2.051   -7.327  1.00 119.72 ? 257 LYS A CA    1 
ATOM 3302 C C     . LYS E 5 257 ? -21.428 3.099   -6.762  1.00 121.49 ? 257 LYS A C     1 
ATOM 3303 O O     . LYS E 5 257 ? -22.419 2.764   -6.108  1.00 125.08 ? 257 LYS A O     1 
ATOM 3304 C CB    . LYS E 5 257 ? -19.103 2.273   -6.723  1.00 120.14 ? 257 LYS A CB    1 
ATOM 3305 C CG    . LYS E 5 257 ? -18.048 1.299   -7.169  1.00 122.46 ? 257 LYS A CG    1 
ATOM 3306 C CD    . LYS E 5 257 ? -16.724 1.675   -6.532  1.00 123.71 ? 257 LYS A CD    1 
ATOM 3307 C CE    . LYS E 5 257 ? -15.544 1.423   -7.457  1.00 125.03 ? 257 LYS A CE    1 
ATOM 3308 N NZ    . LYS E 5 257 ? -14.254 1.863   -6.848  1.00 128.07 ? 257 LYS A NZ    1 
ATOM 3309 N N     . TYR E 5 258 ? -21.089 4.370   -6.987  1.00 117.21 ? 258 TYR A N     1 
ATOM 3310 C CA    . TYR E 5 258 ? -21.862 5.487   -6.451  1.00 112.70 ? 258 TYR A CA    1 
ATOM 3311 C C     . TYR E 5 258 ? -23.347 5.279   -6.715  1.00 110.60 ? 258 TYR A C     1 
ATOM 3312 O O     . TYR E 5 258 ? -24.179 5.553   -5.853  1.00 107.77 ? 258 TYR A O     1 
ATOM 3313 C CB    . TYR E 5 258 ? -21.379 6.829   -7.040  1.00 116.94 ? 258 TYR A CB    1 
ATOM 3314 C CG    . TYR E 5 258 ? -22.076 8.070   -6.485  1.00 122.23 ? 258 TYR A CG    1 
ATOM 3315 C CD1   . TYR E 5 258 ? -21.373 9.032   -5.768  1.00 123.44 ? 258 TYR A CD1   1 
ATOM 3316 C CD2   . TYR E 5 258 ? -23.433 8.284   -6.697  1.00 125.20 ? 258 TYR A CD2   1 
ATOM 3317 C CE1   . TYR E 5 258 ? -22.010 10.171  -5.271  1.00 125.18 ? 258 TYR A CE1   1 
ATOM 3318 C CE2   . TYR E 5 258 ? -24.074 9.416   -6.207  1.00 125.75 ? 258 TYR A CE2   1 
ATOM 3319 C CZ    . TYR E 5 258 ? -23.366 10.352  -5.492  1.00 127.42 ? 258 TYR A CZ    1 
ATOM 3320 O OH    . TYR E 5 258 ? -24.016 11.471  -5.007  1.00 130.56 ? 258 TYR A OH    1 
ATOM 3321 N N     . CYS E 5 259 ? -23.672 4.789   -7.906  1.00 113.08 ? 259 CYS A N     1 
ATOM 3322 C CA    . CYS E 5 259 ? -25.059 4.504   -8.269  1.00 115.87 ? 259 CYS A CA    1 
ATOM 3323 C C     . CYS E 5 259 ? -25.511 3.105   -7.823  1.00 120.24 ? 259 CYS A C     1 
ATOM 3324 O O     . CYS E 5 259 ? -26.698 2.774   -7.893  1.00 126.40 ? 259 CYS A O     1 
ATOM 3325 C CB    . CYS E 5 259 ? -25.262 4.671   -9.779  1.00 116.31 ? 259 CYS A CB    1 
ATOM 3326 S SG    . CYS E 5 259 ? -24.895 6.333   -10.409 1.00 83.42  ? 259 CYS A SG    1 
ATOM 3327 N N     . GLN E 5 260 ? -24.558 2.299   -7.355  1.00 115.34 ? 260 GLN A N     1 
ATOM 3328 C CA    . GLN E 5 260 ? -24.827 0.943   -6.873  1.00 110.01 ? 260 GLN A CA    1 
ATOM 3329 C C     . GLN E 5 260 ? -25.437 0.058   -7.934  1.00 104.61 ? 260 GLN A C     1 
ATOM 3330 O O     . GLN E 5 260 ? -26.451 -0.603  -7.704  1.00 101.82 ? 260 GLN A O     1 
ATOM 3331 C CB    . GLN E 5 260 ? -25.745 0.961   -5.665  1.00 113.37 ? 260 GLN A CB    1 
ATOM 3332 C CG    . GLN E 5 260 ? -25.110 1.516   -4.430  1.00 119.66 ? 260 GLN A CG    1 
ATOM 3333 C CD    . GLN E 5 260 ? -26.138 1.773   -3.362  1.00 127.44 ? 260 GLN A CD    1 
ATOM 3334 O OE1   . GLN E 5 260 ? -25.947 1.417   -2.203  1.00 132.00 ? 260 GLN A OE1   1 
ATOM 3335 N NE2   . GLN E 5 260 ? -27.247 2.390   -3.750  1.00 129.23 ? 260 GLN A NE2   1 
ATOM 3336 N N     . LEU E 5 261 ? -24.812 0.063   -9.100  1.00 102.71 ? 261 LEU A N     1 
ATOM 3337 C CA    . LEU E 5 261 ? -25.176 -0.836  -10.169 1.00 100.83 ? 261 LEU A CA    1 
ATOM 3338 C C     . LEU E 5 261 ? -23.947 -1.654  -10.492 1.00 104.07 ? 261 LEU A C     1 
ATOM 3339 O O     . LEU E 5 261 ? -22.830 -1.140  -10.458 1.00 106.13 ? 261 LEU A O     1 
ATOM 3340 C CB    . LEU E 5 261 ? -25.602 -0.041  -11.393 1.00 98.64  ? 261 LEU A CB    1 
ATOM 3341 C CG    . LEU E 5 261 ? -26.844 0.820   -11.209 1.00 99.74  ? 261 LEU A CG    1 
ATOM 3342 C CD1   . LEU E 5 261 ? -26.988 1.748   -12.393 1.00 100.90 ? 261 LEU A CD1   1 
ATOM 3343 C CD2   . LEU E 5 261 ? -28.068 -0.063  -11.045 1.00 100.03 ? 261 LEU A CD2   1 
ATOM 3344 N N     . PRO E 5 262 ? -24.150 -2.935  -10.814 1.00 106.20 ? 262 PRO A N     1 
ATOM 3345 C CA    . PRO E 5 262 ? -23.062 -3.860  -11.134 1.00 107.10 ? 262 PRO A CA    1 
ATOM 3346 C C     . PRO E 5 262 ? -22.363 -3.448  -12.420 1.00 107.61 ? 262 PRO A C     1 
ATOM 3347 O O     . PRO E 5 262 ? -23.027 -3.040  -13.370 1.00 109.57 ? 262 PRO A O     1 
ATOM 3348 C CB    . PRO E 5 262 ? -23.790 -5.188  -11.329 1.00 108.05 ? 262 PRO A CB    1 
ATOM 3349 C CG    . PRO E 5 262 ? -25.165 -4.796  -11.753 1.00 107.69 ? 262 PRO A CG    1 
ATOM 3350 C CD    . PRO E 5 262 ? -25.471 -3.567  -10.958 1.00 107.67 ? 262 PRO A CD    1 
ATOM 3351 N N     . TYR E 5 263 ? -21.040 -3.568  -12.444 1.00 105.92 ? 263 TYR A N     1 
ATOM 3352 C CA    . TYR E 5 263 ? -20.236 -3.065  -13.554 1.00 101.64 ? 263 TYR A CA    1 
ATOM 3353 C C     . TYR E 5 263 ? -19.473 -4.155  -14.301 1.00 93.30  ? 263 TYR A C     1 
ATOM 3354 O O     . TYR E 5 263 ? -18.764 -4.954  -13.699 1.00 90.47  ? 263 TYR A O     1 
ATOM 3355 C CB    . TYR E 5 263 ? -19.250 -2.010  -13.044 1.00 102.95 ? 263 TYR A CB    1 
ATOM 3356 C CG    . TYR E 5 263 ? -18.186 -1.600  -14.043 1.00 101.44 ? 263 TYR A CG    1 
ATOM 3357 C CD1   . TYR E 5 263 ? -18.469 -0.704  -15.067 1.00 97.89  ? 263 TYR A CD1   1 
ATOM 3358 C CD2   . TYR E 5 263 ? -16.894 -2.093  -13.947 1.00 101.72 ? 263 TYR A CD2   1 
ATOM 3359 C CE1   . TYR E 5 263 ? -17.496 -0.323  -15.974 1.00 96.13  ? 263 TYR A CE1   1 
ATOM 3360 C CE2   . TYR E 5 263 ? -15.919 -1.718  -14.847 1.00 100.32 ? 263 TYR A CE2   1 
ATOM 3361 C CZ    . TYR E 5 263 ? -16.223 -0.833  -15.858 1.00 96.22  ? 263 TYR A CZ    1 
ATOM 3362 O OH    . TYR E 5 263 ? -15.248 -0.461  -16.752 1.00 93.05  ? 263 TYR A OH    1 
ATOM 3363 N N     . THR E 5 264 ? -19.614 -4.165  -15.620 1.00 89.13  ? 264 THR A N     1 
ATOM 3364 C CA    . THR E 5 264 ? -18.852 -5.064  -16.470 1.00 88.05  ? 264 THR A CA    1 
ATOM 3365 C C     . THR E 5 264 ? -18.168 -4.249  -17.564 1.00 88.64  ? 264 THR A C     1 
ATOM 3366 O O     . THR E 5 264 ? -18.836 -3.665  -18.417 1.00 91.49  ? 264 THR A O     1 
ATOM 3367 C CB    . THR E 5 264 ? -19.763 -6.113  -17.122 1.00 88.41  ? 264 THR A CB    1 
ATOM 3368 O OG1   . THR E 5 264 ? -20.698 -6.605  -16.154 1.00 90.09  ? 264 THR A OG1   1 
ATOM 3369 C CG2   . THR E 5 264 ? -18.937 -7.265  -17.667 1.00 88.45  ? 264 THR A CG2   1 
ATOM 3370 N N     . LYS E 5 265 ? -16.840 -4.214  -17.542 1.00 86.40  ? 265 LYS A N     1 
ATOM 3371 C CA    . LYS E 5 265 ? -16.075 -3.366  -18.460 1.00 87.53  ? 265 LYS A CA    1 
ATOM 3372 C C     . LYS E 5 265 ? -16.341 -3.668  -19.930 1.00 89.89  ? 265 LYS A C     1 
ATOM 3373 O O     . LYS E 5 265 ? -16.442 -2.768  -20.763 1.00 84.40  ? 265 LYS A O     1 
ATOM 3374 C CB    . LYS E 5 265 ? -14.583 -3.503  -18.177 1.00 86.48  ? 265 LYS A CB    1 
ATOM 3375 C CG    . LYS E 5 265 ? -13.703 -2.598  -19.022 1.00 87.16  ? 265 LYS A CG    1 
ATOM 3376 C CD    . LYS E 5 265 ? -12.298 -2.550  -18.443 1.00 86.03  ? 265 LYS A CD    1 
ATOM 3377 C CE    . LYS E 5 265 ? -11.422 -1.492  -19.092 1.00 83.22  ? 265 LYS A CE    1 
ATOM 3378 N NZ    . LYS E 5 265 ? -10.685 -2.002  -20.279 1.00 82.08  ? 265 LYS A NZ    1 
ATOM 3379 N N     . LYS E 5 266 ? -16.443 -4.952  -20.236 1.00 101.39 ? 266 LYS A N     1 
ATOM 3380 C CA    . LYS E 5 266 ? -16.676 -5.411  -21.598 1.00 112.47 ? 266 LYS A CA    1 
ATOM 3381 C C     . LYS E 5 266 ? -17.917 -4.770  -22.221 1.00 117.07 ? 266 LYS A C     1 
ATOM 3382 O O     . LYS E 5 266 ? -17.949 -4.502  -23.421 1.00 120.40 ? 266 LYS A O     1 
ATOM 3383 C CB    . LYS E 5 266 ? -16.769 -6.943  -21.633 1.00 114.58 ? 266 LYS A CB    1 
ATOM 3384 C CG    . LYS E 5 266 ? -17.320 -7.496  -22.928 1.00 115.48 ? 266 LYS A CG    1 
ATOM 3385 C CD    . LYS E 5 266 ? -16.552 -8.716  -23.379 1.00 118.43 ? 266 LYS A CD    1 
ATOM 3386 C CE    . LYS E 5 266 ? -16.956 -9.098  -24.787 1.00 118.68 ? 266 LYS A CE    1 
ATOM 3387 N NZ    . LYS E 5 266 ? -16.065 -10.141 -25.351 1.00 119.60 ? 266 LYS A NZ    1 
ATOM 3388 N N     . HIS E 5 267 ? -18.933 -4.520  -21.404 1.00 119.05 ? 267 HIS A N     1 
ATOM 3389 C CA    . HIS E 5 267 ? -20.161 -3.914  -21.906 1.00 122.68 ? 267 HIS A CA    1 
ATOM 3390 C C     . HIS E 5 267 ? -19.896 -2.561  -22.562 1.00 122.90 ? 267 HIS A C     1 
ATOM 3391 O O     . HIS E 5 267 ? -20.323 -2.314  -23.689 1.00 126.97 ? 267 HIS A O     1 
ATOM 3392 C CB    . HIS E 5 267 ? -21.197 -3.759  -20.789 1.00 125.35 ? 267 HIS A CB    1 
ATOM 3393 C CG    . HIS E 5 267 ? -21.816 -5.051  -20.349 1.00 127.32 ? 267 HIS A CG    1 
ATOM 3394 N ND1   . HIS E 5 267 ? -21.358 -6.277  -20.781 1.00 128.18 ? 267 HIS A ND1   1 
ATOM 3395 C CD2   . HIS E 5 267 ? -22.857 -5.306  -19.525 1.00 127.90 ? 267 HIS A CD2   1 
ATOM 3396 C CE1   . HIS E 5 267 ? -22.092 -7.236  -20.236 1.00 128.35 ? 267 HIS A CE1   1 
ATOM 3397 N NE2   . HIS E 5 267 ? -23.008 -6.670  -19.469 1.00 128.09 ? 267 HIS A NE2   1 
ATOM 3398 N N     . TRP E 5 268 ? -19.214 -1.678  -21.839 1.00 115.57 ? 268 TRP A N     1 
ATOM 3399 C CA    . TRP E 5 268 ? -18.985 -0.325  -22.334 1.00 105.41 ? 268 TRP A CA    1 
ATOM 3400 C C     . TRP E 5 268 ? -17.701 -0.080  -23.110 1.00 105.44 ? 268 TRP A C     1 
ATOM 3401 O O     . TRP E 5 268 ? -17.594 0.946   -23.783 1.00 107.03 ? 268 TRP A O     1 
ATOM 3402 C CB    . TRP E 5 268 ? -19.089 0.678   -21.195 1.00 96.91  ? 268 TRP A CB    1 
ATOM 3403 C CG    . TRP E 5 268 ? -20.445 0.719   -20.677 1.00 94.06  ? 268 TRP A CG    1 
ATOM 3404 C CD1   . TRP E 5 268 ? -21.484 1.433   -21.176 1.00 94.47  ? 268 TRP A CD1   1 
ATOM 3405 C CD2   . TRP E 5 268 ? -20.951 -0.019  -19.570 1.00 94.69  ? 268 TRP A CD2   1 
ATOM 3406 N NE1   . TRP E 5 268 ? -22.613 1.201   -20.438 1.00 93.31  ? 268 TRP A NE1   1 
ATOM 3407 C CE2   . TRP E 5 268 ? -22.312 0.312   -19.442 1.00 94.64  ? 268 TRP A CE2   1 
ATOM 3408 C CE3   . TRP E 5 268 ? -20.387 -0.923  -18.667 1.00 96.41  ? 268 TRP A CE3   1 
ATOM 3409 C CZ2   . TRP E 5 268 ? -23.120 -0.226  -18.451 1.00 95.68  ? 268 TRP A CZ2   1 
ATOM 3410 C CZ3   . TRP E 5 268 ? -21.190 -1.461  -17.680 1.00 96.90  ? 268 TRP A CZ3   1 
ATOM 3411 C CH2   . TRP E 5 268 ? -22.544 -1.112  -17.581 1.00 96.33  ? 268 TRP A CH2   1 
ATOM 3412 N N     . PHE E 5 269 ? -16.725 -0.980  -23.021 1.00 103.70 ? 269 PHE A N     1 
ATOM 3413 C CA    . PHE E 5 269 ? -15.503 -0.775  -23.791 1.00 98.40  ? 269 PHE A CA    1 
ATOM 3414 C C     . PHE E 5 269 ? -15.415 -1.593  -25.063 1.00 93.42  ? 269 PHE A C     1 
ATOM 3415 O O     . PHE E 5 269 ? -14.483 -1.432  -25.843 1.00 90.80  ? 269 PHE A O     1 
ATOM 3416 C CB    . PHE E 5 269 ? -14.265 -0.975  -22.927 1.00 99.73  ? 269 PHE A CB    1 
ATOM 3417 C CG    . PHE E 5 269 ? -14.050 0.126   -21.940 1.00 98.32  ? 269 PHE A CG    1 
ATOM 3418 C CD1   . PHE E 5 269 ? -12.971 0.984   -22.053 1.00 98.34  ? 269 PHE A CD1   1 
ATOM 3419 C CD2   . PHE E 5 269 ? -14.956 0.326   -20.918 1.00 98.80  ? 269 PHE A CD2   1 
ATOM 3420 C CE1   . PHE E 5 269 ? -12.789 2.004   -21.144 1.00 99.56  ? 269 PHE A CE1   1 
ATOM 3421 C CE2   . PHE E 5 269 ? -14.784 1.344   -20.008 1.00 99.96  ? 269 PHE A CE2   1 
ATOM 3422 C CZ    . PHE E 5 269 ? -13.698 2.186   -20.120 1.00 100.11 ? 269 PHE A CZ    1 
ATOM 3423 N N     . GLN E 5 270 ? -16.397 -2.454  -25.280 1.00 91.03  ? 270 GLN A N     1 
ATOM 3424 C CA    . GLN E 5 270 ? -16.426 -3.270  -26.480 1.00 92.82  ? 270 GLN A CA    1 
ATOM 3425 C C     . GLN E 5 270 ? -17.870 -3.520  -26.874 1.00 92.71  ? 270 GLN A C     1 
ATOM 3426 O O     . GLN E 5 270 ? -18.776 -3.393  -26.050 1.00 93.37  ? 270 GLN A O     1 
ATOM 3427 C CB    . GLN E 5 270 ? -15.647 -4.580  -26.293 1.00 93.04  ? 270 GLN A CB    1 
ATOM 3428 C CG    . GLN E 5 270 ? -14.125 -4.440  -26.453 1.00 96.63  ? 270 GLN A CG    1 
ATOM 3429 C CD    . GLN E 5 270 ? -13.712 -3.999  -27.850 1.00 105.18 ? 270 GLN A CD    1 
ATOM 3430 O OE1   . GLN E 5 270 ? -14.528 -3.976  -28.774 1.00 114.61 ? 270 GLN A OE1   1 
ATOM 3431 N NE2   . GLN E 5 270 ? -12.439 -3.646  -28.010 1.00 105.74 ? 270 GLN A NE2   1 
ATOM 3432 N N     . VAL E 5 271 ? -18.080 -3.847  -28.145 1.00 90.18  ? 271 VAL A N     1 
ATOM 3433 C CA    . VAL E 5 271 ? -19.421 -4.028  -28.676 1.00 86.67  ? 271 VAL A CA    1 
ATOM 3434 C C     . VAL E 5 271 ? -20.150 -5.039  -27.819 1.00 94.01  ? 271 VAL A C     1 
ATOM 3435 O O     . VAL E 5 271 ? -19.578 -6.057  -27.443 1.00 100.40 ? 271 VAL A O     1 
ATOM 3436 C CB    . VAL E 5 271 ? -19.374 -4.556  -30.104 1.00 77.10  ? 271 VAL A CB    1 
ATOM 3437 C CG1   . VAL E 5 271 ? -20.715 -4.338  -30.782 1.00 78.01  ? 271 VAL A CG1   1 
ATOM 3438 C CG2   . VAL E 5 271 ? -18.246 -3.885  -30.872 1.00 73.82  ? 271 VAL A CG2   1 
ATOM 3439 N N     . ASN E 5 272 ? -21.404 -4.755  -27.493 1.00 93.55  ? 272 ASN A N     1 
ATOM 3440 C CA    . ASN E 5 272 ? -22.208 -5.675  -26.703 1.00 94.60  ? 272 ASN A CA    1 
ATOM 3441 C C     . ASN E 5 272 ? -23.253 -6.341  -27.591 1.00 95.92  ? 272 ASN A C     1 
ATOM 3442 O O     . ASN E 5 272 ? -24.209 -5.678  -28.002 1.00 97.23  ? 272 ASN A O     1 
ATOM 3443 C CB    . ASN E 5 272 ? -22.882 -4.918  -25.556 1.00 92.50  ? 272 ASN A CB    1 
ATOM 3444 C CG    . ASN E 5 272 ? -23.908 -5.748  -24.842 1.00 90.47  ? 272 ASN A CG    1 
ATOM 3445 O OD1   . ASN E 5 272 ? -23.954 -6.953  -25.019 1.00 90.40  ? 272 ASN A OD1   1 
ATOM 3446 N ND2   . ASN E 5 272 ? -24.743 -5.110  -24.030 1.00 90.46  ? 272 ASN A ND2   1 
ATOM 3447 N N     . GLN E 5 273 ? -23.094 -7.651  -27.831 1.00 96.02  ? 273 GLN A N     1 
ATOM 3448 C CA    . GLN E 5 273 ? -23.886 -8.377  -28.845 1.00 93.89  ? 273 GLN A CA    1 
ATOM 3449 C C     . GLN E 5 273 ? -25.299 -8.818  -28.510 1.00 96.79  ? 273 GLN A C     1 
ATOM 3450 O O     . GLN E 5 273 ? -26.146 -8.871  -29.406 1.00 95.56  ? 273 GLN A O     1 
ATOM 3451 C CB    . GLN E 5 273 ? -23.106 -9.530  -29.485 1.00 89.41  ? 273 GLN A CB    1 
ATOM 3452 C CG    . GLN E 5 273 ? -22.510 -9.168  -30.884 1.00 141.61 ? 273 GLN A CG    1 
ATOM 3453 C CD    . GLN E 5 273 ? -21.535 -7.969  -30.807 1.00 146.19 ? 273 GLN A CD    1 
ATOM 3454 O OE1   . GLN E 5 273 ? -21.428 -7.340  -29.758 1.00 149.44 ? 273 GLN A OE1   1 
ATOM 3455 N NE2   . GLN E 5 273 ? -20.776 -7.701  -31.894 1.00 147.20 ? 273 GLN A NE2   1 
ATOM 3456 N N     . GLU E 5 274 ? -25.566 -9.104  -27.242 1.00 99.36  ? 274 GLU A N     1 
ATOM 3457 C CA    . GLU E 5 274 ? -26.944 -9.250  -26.820 1.00 101.84 ? 274 GLU A CA    1 
ATOM 3458 C C     . GLU E 5 274 ? -27.643 -7.965  -27.266 1.00 102.92 ? 274 GLU A C     1 
ATOM 3459 O O     . GLU E 5 274 ? -28.848 -7.961  -27.511 1.00 104.63 ? 274 GLU A O     1 
ATOM 3460 C CB    . GLU E 5 274 ? -27.041 -9.457  -25.303 1.00 103.40 ? 274 GLU A CB    1 
ATOM 3461 C CG    . GLU E 5 274 ? -28.457 -9.763  -24.781 1.00 110.08 ? 274 GLU A CG    1 
ATOM 3462 C CD    . GLU E 5 274 ? -29.314 -8.522  -24.608 1.00 119.45 ? 274 GLU A CD    1 
ATOM 3463 O OE1   . GLU E 5 274 ? -28.734 -7.451  -24.345 1.00 131.70 ? 274 GLU A OE1   1 
ATOM 3464 O OE2   . GLU E 5 274 ? -30.557 -8.614  -24.740 1.00 117.12 ? 274 GLU A OE2   1 
ATOM 3465 N N     . TRP E 5 275 ? -26.867 -6.890  -27.417 1.00 101.91 ? 275 TRP A N     1 
ATOM 3466 C CA    . TRP E 5 275 ? -27.403 -5.601  -27.849 1.00 100.36 ? 275 TRP A CA    1 
ATOM 3467 C C     . TRP E 5 275 ? -27.443 -5.383  -29.361 1.00 98.56  ? 275 TRP A C     1 
ATOM 3468 O O     . TRP E 5 275 ? -26.655 -5.964  -30.110 1.00 100.23 ? 275 TRP A O     1 
ATOM 3469 C CB    . TRP E 5 275 ? -26.644 -4.455  -27.175 1.00 102.25 ? 275 TRP A CB    1 
ATOM 3470 C CG    . TRP E 5 275 ? -27.092 -4.230  -25.770 1.00 99.84  ? 275 TRP A CG    1 
ATOM 3471 C CD1   . TRP E 5 275 ? -27.833 -5.082  -25.016 1.00 97.38  ? 275 TRP A CD1   1 
ATOM 3472 C CD2   . TRP E 5 275 ? -26.852 -3.075  -24.954 1.00 100.69 ? 275 TRP A CD2   1 
ATOM 3473 N NE1   . TRP E 5 275 ? -28.066 -4.543  -23.780 1.00 96.76  ? 275 TRP A NE1   1 
ATOM 3474 C CE2   . TRP E 5 275 ? -27.473 -3.311  -23.713 1.00 97.60  ? 275 TRP A CE2   1 
ATOM 3475 C CE3   . TRP E 5 275 ? -26.168 -1.869  -25.147 1.00 98.73  ? 275 TRP A CE3   1 
ATOM 3476 C CZ2   . TRP E 5 275 ? -27.431 -2.396  -22.672 1.00 94.80  ? 275 TRP A CZ2   1 
ATOM 3477 C CZ3   . TRP E 5 275 ? -26.132 -0.959  -24.108 1.00 95.84  ? 275 TRP A CZ3   1 
ATOM 3478 C CH2   . TRP E 5 275 ? -26.761 -1.228  -22.887 1.00 92.63  ? 275 TRP A CH2   1 
ATOM 3479 N N     . PRO E 5 276 ? -28.374 -4.529  -29.804 1.00 91.01  ? 276 PRO A N     1 
ATOM 3480 C CA    . PRO E 5 276 ? -28.508 -4.079  -31.190 1.00 92.56  ? 276 PRO A CA    1 
ATOM 3481 C C     . PRO E 5 276 ? -27.318 -3.237  -31.650 1.00 94.66  ? 276 PRO A C     1 
ATOM 3482 O O     . PRO E 5 276 ? -26.584 -2.689  -30.822 1.00 95.23  ? 276 PRO A O     1 
ATOM 3483 C CB    . PRO E 5 276 ? -29.763 -3.213  -31.143 1.00 88.95  ? 276 PRO A CB    1 
ATOM 3484 C CG    . PRO E 5 276 ? -29.877 -2.778  -29.732 1.00 86.47  ? 276 PRO A CG    1 
ATOM 3485 C CD    . PRO E 5 276 ? -29.423 -3.958  -28.944 1.00 88.17  ? 276 PRO A CD    1 
ATOM 3486 N N     . GLN E 5 277 ? -27.146 -3.143  -32.968 1.00 97.08  ? 277 GLN A N     1 
ATOM 3487 C CA    . GLN E 5 277 ? -26.045 -2.397  -33.585 1.00 92.01  ? 277 GLN A CA    1 
ATOM 3488 C C     . GLN E 5 277 ? -26.506 -1.730  -34.878 1.00 93.34  ? 277 GLN A C     1 
ATOM 3489 O O     . GLN E 5 277 ? -27.556 -2.073  -35.427 1.00 95.02  ? 277 GLN A O     1 
ATOM 3490 C CB    . GLN E 5 277 ? -24.884 -3.341  -33.917 1.00 91.57  ? 277 GLN A CB    1 
ATOM 3491 C CG    . GLN E 5 277 ? -24.361 -4.160  -32.742 1.00 87.58  ? 277 GLN A CG    1 
ATOM 3492 C CD    . GLN E 5 277 ? -23.351 -5.214  -33.156 1.00 86.91  ? 277 GLN A CD    1 
ATOM 3493 O OE1   . GLN E 5 277 ? -23.467 -6.369  -32.765 1.00 94.39  ? 277 GLN A OE1   1 
ATOM 3494 N NE2   . GLN E 5 277 ? -22.356 -4.820  -33.942 1.00 80.09  ? 277 GLN A NE2   1 
ATOM 3495 N N     . PHE E 5 278 ? -25.725 -0.785  -35.381 1.00 90.56  ? 278 PHE A N     1 
ATOM 3496 C CA    . PHE E 5 278 ? -25.995 -0.261  -36.711 1.00 94.13  ? 278 PHE A CA    1 
ATOM 3497 C C     . PHE E 5 278 ? -25.312 -1.165  -37.729 1.00 94.06  ? 278 PHE A C     1 
ATOM 3498 O O     . PHE E 5 278 ? -24.249 -1.713  -37.449 1.00 95.09  ? 278 PHE A O     1 
ATOM 3499 C CB    . PHE E 5 278 ? -25.450 1.161   -36.866 1.00 93.79  ? 278 PHE A CB    1 
ATOM 3500 C CG    . PHE E 5 278 ? -26.306 2.233   -36.233 1.00 93.48  ? 278 PHE A CG    1 
ATOM 3501 C CD1   . PHE E 5 278 ? -27.627 2.414   -36.619 1.00 94.18  ? 278 PHE A CD1   1 
ATOM 3502 C CD2   . PHE E 5 278 ? -25.771 3.091   -35.277 1.00 90.24  ? 278 PHE A CD2   1 
ATOM 3503 C CE1   . PHE E 5 278 ? -28.408 3.413   -36.043 1.00 92.62  ? 278 PHE A CE1   1 
ATOM 3504 C CE2   . PHE E 5 278 ? -26.544 4.091   -34.700 1.00 87.81  ? 278 PHE A CE2   1 
ATOM 3505 C CZ    . PHE E 5 278 ? -27.863 4.251   -35.084 1.00 90.00  ? 278 PHE A CZ    1 
ATOM 3506 N N     . PRO E 5 279 ? -25.903 -1.300  -38.926 1.00 93.33  ? 279 PRO A N     1 
ATOM 3507 C CA    . PRO E 5 279 ? -25.242 -2.007  -40.028 1.00 97.52  ? 279 PRO A CA    1 
ATOM 3508 C C     . PRO E 5 279 ? -23.936 -1.304  -40.380 1.00 108.31 ? 279 PRO A C     1 
ATOM 3509 O O     . PRO E 5 279 ? -23.562 -0.358  -39.697 1.00 111.54 ? 279 PRO A O     1 
ATOM 3510 C CB    . PRO E 5 279 ? -26.229 -1.843  -41.186 1.00 91.77  ? 279 PRO A CB    1 
ATOM 3511 C CG    . PRO E 5 279 ? -27.537 -1.550  -40.550 1.00 88.96  ? 279 PRO A CG    1 
ATOM 3512 C CD    . PRO E 5 279 ? -27.228 -0.788  -39.307 1.00 89.68  ? 279 PRO A CD    1 
ATOM 3513 N N     . ASP E 5 280 ? -23.235 -1.773  -41.406 1.00 117.69 ? 280 ASP A N     1 
ATOM 3514 C CA    . ASP E 5 280 ? -22.080 -1.044  -41.933 1.00 126.59 ? 280 ASP A CA    1 
ATOM 3515 C C     . ASP E 5 280 ? -22.234 -0.832  -43.428 1.00 142.22 ? 280 ASP A C     1 
ATOM 3516 O O     . ASP E 5 280 ? -22.835 -1.655  -44.120 1.00 144.66 ? 280 ASP A O     1 
ATOM 3517 C CB    . ASP E 5 280 ? -20.765 -1.776  -41.665 1.00 122.73 ? 280 ASP A CB    1 
ATOM 3518 C CG    . ASP E 5 280 ? -19.565 -1.040  -42.239 1.00 123.04 ? 280 ASP A CG    1 
ATOM 3519 O OD1   . ASP E 5 280 ? -19.266 -1.214  -43.443 1.00 129.32 ? 280 ASP A OD1   1 
ATOM 3520 O OD2   . ASP E 5 280 ? -18.928 -0.279  -41.483 1.00 121.03 ? 280 ASP A OD2   1 
ATOM 3521 N N     . PHE E 5 281 ? -21.686 0.271   -43.923 1.00 155.82 ? 281 PHE A N     1 
ATOM 3522 C CA    . PHE E 5 281 ? -21.856 0.632   -45.319 1.00 169.14 ? 281 PHE A CA    1 
ATOM 3523 C C     . PHE E 5 281 ? -20.558 1.114   -45.954 1.00 175.99 ? 281 PHE A C     1 
ATOM 3524 O O     . PHE E 5 281 ? -19.924 2.062   -45.483 1.00 173.51 ? 281 PHE A O     1 
ATOM 3525 C CB    . PHE E 5 281 ? -22.968 1.674   -45.456 1.00 175.26 ? 281 PHE A CB    1 
ATOM 3526 C CG    . PHE E 5 281 ? -24.328 1.144   -45.097 1.00 178.35 ? 281 PHE A CG    1 
ATOM 3527 C CD1   . PHE E 5 281 ? -25.172 0.656   -46.078 1.00 181.02 ? 281 PHE A CD1   1 
ATOM 3528 C CD2   . PHE E 5 281 ? -24.750 1.103   -43.777 1.00 177.91 ? 281 PHE A CD2   1 
ATOM 3529 C CE1   . PHE E 5 281 ? -26.418 0.152   -45.754 1.00 181.13 ? 281 PHE A CE1   1 
ATOM 3530 C CE2   . PHE E 5 281 ? -25.995 0.598   -43.445 1.00 177.68 ? 281 PHE A CE2   1 
ATOM 3531 C CZ    . PHE E 5 281 ? -26.830 0.122   -44.436 1.00 179.35 ? 281 PHE A CZ    1 
ATOM 3532 N N     . SER E 5 282 ? -20.177 0.440   -47.033 1.00 184.92 ? 282 SER A N     1 
ATOM 3533 C CA    . SER E 5 282 ? -19.004 0.808   -47.805 1.00 192.65 ? 282 SER A CA    1 
ATOM 3534 C C     . SER E 5 282 ? -19.429 1.150   -49.226 1.00 195.87 ? 282 SER A C     1 
ATOM 3535 O O     . SER E 5 282 ? -20.486 0.711   -49.684 1.00 196.89 ? 282 SER A O     1 
ATOM 3536 C CB    . SER E 5 282 ? -17.996 -0.339  -47.822 1.00 196.82 ? 282 SER A CB    1 
ATOM 3537 O OG    . SER E 5 282 ? -16.973 -0.092  -48.768 1.00 200.28 ? 282 SER A OG    1 
ATOM 3538 N N     . GLU E 5 293 ? -27.473 14.662  -45.242 1.00 168.61 ? 293 GLU A N     1 
ATOM 3539 C CA    . GLU E 5 293 ? -27.795 13.941  -46.469 1.00 169.22 ? 293 GLU A CA    1 
ATOM 3540 C C     . GLU E 5 293 ? -28.733 12.779  -46.172 1.00 163.96 ? 293 GLU A C     1 
ATOM 3541 O O     . GLU E 5 293 ? -28.300 11.731  -45.704 1.00 160.80 ? 293 GLU A O     1 
ATOM 3542 C CB    . GLU E 5 293 ? -26.516 13.436  -47.143 1.00 172.98 ? 293 GLU A CB    1 
ATOM 3543 C CG    . GLU E 5 293 ? -26.730 12.780  -48.503 1.00 174.54 ? 293 GLU A CG    1 
ATOM 3544 C CD    . GLU E 5 293 ? -26.708 11.264  -48.436 1.00 172.00 ? 293 GLU A CD    1 
ATOM 3545 O OE1   . GLU E 5 293 ? -26.620 10.718  -47.319 1.00 169.00 ? 293 GLU A OE1   1 
ATOM 3546 O OE2   . GLU E 5 293 ? -26.772 10.614  -49.502 1.00 172.22 ? 293 GLU A OE2   1 
ATOM 3547 N N     . SER E 5 294 ? -30.021 12.969  -46.439 1.00 161.24 ? 294 SER A N     1 
ATOM 3548 C CA    . SER E 5 294 ? -31.012 11.954  -46.109 1.00 157.92 ? 294 SER A CA    1 
ATOM 3549 C C     . SER E 5 294 ? -32.220 11.990  -47.034 1.00 154.70 ? 294 SER A C     1 
ATOM 3550 O O     . SER E 5 294 ? -32.274 12.764  -47.995 1.00 155.44 ? 294 SER A O     1 
ATOM 3551 C CB    . SER E 5 294 ? -31.465 12.087  -44.649 1.00 157.92 ? 294 SER A CB    1 
ATOM 3552 O OG    . SER E 5 294 ? -32.422 13.123  -44.482 1.00 160.27 ? 294 SER A OG    1 
ATOM 3553 N N     . ASP E 5 295 ? -33.186 11.134  -46.713 1.00 150.68 ? 295 ASP A N     1 
ATOM 3554 C CA    . ASP E 5 295 ? -34.388 10.922  -47.515 1.00 150.09 ? 295 ASP A CA    1 
ATOM 3555 C C     . ASP E 5 295 ? -35.538 10.489  -46.609 1.00 148.47 ? 295 ASP A C     1 
ATOM 3556 O O     . ASP E 5 295 ? -35.338 10.258  -45.415 1.00 151.73 ? 295 ASP A O     1 
ATOM 3557 C CB    . ASP E 5 295 ? -34.148 9.937   -48.670 1.00 149.59 ? 295 ASP A CB    1 
ATOM 3558 C CG    . ASP E 5 295 ? -33.906 8.517   -48.203 1.00 152.68 ? 295 ASP A CG    1 
ATOM 3559 O OD1   . ASP E 5 295 ? -34.373 7.588   -48.892 1.00 151.01 ? 295 ASP A OD1   1 
ATOM 3560 O OD2   . ASP E 5 295 ? -33.245 8.319   -47.166 1.00 159.39 ? 295 ASP A OD2   1 
ATOM 3561 N N     . SER E 5 296 ? -36.746 10.448  -47.157 1.00 145.64 ? 296 SER A N     1 
ATOM 3562 C CA    . SER E 5 296 ? -37.927 10.151  -46.359 1.00 141.96 ? 296 SER A CA    1 
ATOM 3563 C C     . SER E 5 296 ? -37.694 8.996   -45.390 1.00 142.42 ? 296 SER A C     1 
ATOM 3564 O O     . SER E 5 296 ? -37.815 9.173   -44.179 1.00 146.60 ? 296 SER A O     1 
ATOM 3565 C CB    . SER E 5 296 ? -39.131 9.876   -47.257 1.00 137.35 ? 296 SER A CB    1 
ATOM 3566 O OG    . SER E 5 296 ? -38.714 9.392   -48.522 1.00 132.26 ? 296 SER A OG    1 
ATOM 3567 N N     . GLU E 5 297 ? -37.387 7.812   -45.903 1.00 136.60 ? 297 GLU A N     1 
ATOM 3568 C CA    . GLU E 5 297 ? -37.271 6.659   -45.017 1.00 130.82 ? 297 GLU A CA    1 
ATOM 3569 C C     . GLU E 5 297 ? -35.874 6.334   -44.447 1.00 121.87 ? 297 GLU A C     1 
ATOM 3570 O O     . GLU E 5 297 ? -35.771 5.565   -43.498 1.00 119.17 ? 297 GLU A O     1 
ATOM 3571 C CB    . GLU E 5 297 ? -37.896 5.433   -45.690 1.00 134.83 ? 297 GLU A CB    1 
ATOM 3572 C CG    . GLU E 5 297 ? -39.390 5.616   -45.974 1.00 140.28 ? 297 GLU A CG    1 
ATOM 3573 C CD    . GLU E 5 297 ? -39.891 4.757   -47.123 1.00 147.24 ? 297 GLU A CD    1 
ATOM 3574 O OE1   . GLU E 5 297 ? -39.128 3.892   -47.606 1.00 144.04 ? 297 GLU A OE1   1 
ATOM 3575 O OE2   . GLU E 5 297 ? -41.051 4.952   -47.547 1.00 157.89 ? 297 GLU A OE2   1 
ATOM 3576 N N     . ASN E 5 298 ? -34.810 6.941   -44.964 1.00 119.90 ? 298 ASN A N     1 
ATOM 3577 C CA    . ASN E 5 298 ? -33.476 6.670   -44.418 1.00 116.70 ? 298 ASN A CA    1 
ATOM 3578 C C     . ASN E 5 298 ? -32.650 7.929   -44.200 1.00 114.25 ? 298 ASN A C     1 
ATOM 3579 O O     . ASN E 5 298 ? -32.922 8.966   -44.795 1.00 116.25 ? 298 ASN A O     1 
ATOM 3580 C CB    . ASN E 5 298 ? -32.696 5.688   -45.298 1.00 117.70 ? 298 ASN A CB    1 
ATOM 3581 C CG    . ASN E 5 298 ? -33.557 5.051   -46.375 1.00 121.34 ? 298 ASN A CG    1 
ATOM 3582 O OD1   . ASN E 5 298 ? -34.162 4.001   -46.163 1.00 121.58 ? 298 ASN A OD1   1 
ATOM 3583 N ND2   . ASN E 5 298 ? -33.607 5.681   -47.544 1.00 123.61 ? 298 ASN A ND2   1 
ATOM 3584 N N     . THR E 5 299 ? -31.636 7.851   -43.350 1.00 113.62 ? 299 THR A N     1 
ATOM 3585 C CA    . THR E 5 299 ? -30.885 9.061   -43.046 1.00 117.05 ? 299 THR A CA    1 
ATOM 3586 C C     . THR E 5 299 ? -29.512 9.101   -43.704 1.00 121.99 ? 299 THR A C     1 
ATOM 3587 O O     . THR E 5 299 ? -29.342 9.793   -44.704 1.00 129.72 ? 299 THR A O     1 
ATOM 3588 C CB    . THR E 5 299 ? -30.779 9.319   -41.533 1.00 114.59 ? 299 THR A CB    1 
ATOM 3589 O OG1   . THR E 5 299 ? -30.149 8.200   -40.902 1.00 116.07 ? 299 THR A OG1   1 
ATOM 3590 C CG2   . THR E 5 299 ? -32.162 9.528   -40.940 1.00 112.67 ? 299 THR A CG2   1 
ATOM 3591 N N     . ILE E 5 300 ? -28.537 8.361   -43.184 1.00 116.46 ? 300 ILE A N     1 
ATOM 3592 C CA    . ILE E 5 300 ? -27.221 8.435   -43.801 1.00 112.57 ? 300 ILE A CA    1 
ATOM 3593 C C     . ILE E 5 300 ? -27.109 7.290   -44.798 1.00 112.37 ? 300 ILE A C     1 
ATOM 3594 O O     . ILE E 5 300 ? -27.199 7.512   -46.005 1.00 118.60 ? 300 ILE A O     1 
ATOM 3595 C CB    . ILE E 5 300 ? -26.051 8.521   -42.758 1.00 208.62 ? 300 ILE A CB    1 
ATOM 3596 C CG1   . ILE E 5 300 ? -24.797 9.152   -43.384 1.00 201.95 ? 300 ILE A CG1   1 
ATOM 3597 C CG2   . ILE E 5 300 ? -25.762 7.169   -42.097 1.00 211.59 ? 300 ILE A CG2   1 
ATOM 3598 C CD1   . ILE E 5 300 ? -24.954 10.622  -43.758 1.00 190.52 ? 300 ILE A CD1   1 
ATOM 3599 N N     . GLY E 5 301 ? -26.916 6.072   -44.313 1.00 109.98 ? 301 GLY A N     1 
ATOM 3600 C CA    . GLY E 5 301 ? -27.177 4.887   -45.115 1.00 114.07 ? 301 GLY A CA    1 
ATOM 3601 C C     . GLY E 5 301 ? -28.341 4.072   -44.577 1.00 117.02 ? 301 GLY A C     1 
ATOM 3602 O O     . GLY E 5 301 ? -28.755 3.068   -45.163 1.00 115.41 ? 301 GLY A O     1 
ATOM 3603 N N     . ILE E 5 302 ? -28.875 4.540   -43.455 1.00 118.29 ? 302 ILE A N     1 
ATOM 3604 C CA    . ILE E 5 302 ? -29.649 3.709   -42.533 1.00 116.84 ? 302 ILE A CA    1 
ATOM 3605 C C     . ILE E 5 302 ? -31.152 3.983   -42.489 1.00 120.83 ? 302 ILE A C     1 
ATOM 3606 O O     . ILE E 5 302 ? -31.576 5.142   -42.408 1.00 124.20 ? 302 ILE A O     1 
ATOM 3607 C CB    . ILE E 5 302 ? -29.078 3.797   -41.108 1.00 109.21 ? 302 ILE A CB    1 
ATOM 3608 C CG1   . ILE E 5 302 ? -27.587 3.465   -41.115 1.00 107.25 ? 302 ILE A CG1   1 
ATOM 3609 C CG2   . ILE E 5 302 ? -29.819 2.869   -40.176 1.00 105.33 ? 302 ILE A CG2   1 
ATOM 3610 C CD1   . ILE E 5 302 ? -26.871 3.903   -39.874 1.00 106.86 ? 302 ILE A CD1   1 
ATOM 3611 N N     . PRO E 5 303 ? -31.963 2.914   -42.585 1.00 116.33 ? 303 PRO A N     1 
ATOM 3612 C CA    . PRO E 5 303 ? -33.407 3.034   -42.364 1.00 113.23 ? 303 PRO A CA    1 
ATOM 3613 C C     . PRO E 5 303 ? -33.664 3.707   -41.027 1.00 111.22 ? 303 PRO A C     1 
ATOM 3614 O O     . PRO E 5 303 ? -32.911 3.487   -40.071 1.00 107.19 ? 303 PRO A O     1 
ATOM 3615 C CB    . PRO E 5 303 ? -33.878 1.585   -42.290 1.00 110.07 ? 303 PRO A CB    1 
ATOM 3616 C CG    . PRO E 5 303 ? -32.852 0.816   -43.012 1.00 111.35 ? 303 PRO A CG    1 
ATOM 3617 C CD    . PRO E 5 303 ? -31.551 1.515   -42.770 1.00 113.85 ? 303 PRO A CD    1 
ATOM 3618 N N     . ASP E 5 304 ? -34.724 4.507   -40.968 1.00 112.43 ? 304 ASP A N     1 
ATOM 3619 C CA    . ASP E 5 304 ? -35.010 5.323   -39.799 1.00 109.23 ? 304 ASP A CA    1 
ATOM 3620 C C     . ASP E 5 304 ? -35.437 4.504   -38.586 1.00 111.17 ? 304 ASP A C     1 
ATOM 3621 O O     . ASP E 5 304 ? -35.113 4.871   -37.465 1.00 111.60 ? 304 ASP A O     1 
ATOM 3622 C CB    . ASP E 5 304 ? -36.045 6.400   -40.129 1.00 106.10 ? 304 ASP A CB    1 
ATOM 3623 C CG    . ASP E 5 304 ? -35.494 7.459   -41.060 1.00 104.36 ? 304 ASP A CG    1 
ATOM 3624 O OD1   . ASP E 5 304 ? -34.255 7.561   -41.183 1.00 105.47 ? 304 ASP A OD1   1 
ATOM 3625 O OD2   . ASP E 5 304 ? -36.298 8.193   -41.664 1.00 104.69 ? 304 ASP A OD2   1 
ATOM 3626 N N     . PHE E 5 305 ? -36.144 3.395   -38.790 1.00 111.02 ? 305 PHE A N     1 
ATOM 3627 C CA    . PHE E 5 305 ? -36.542 2.586   -37.639 1.00 108.19 ? 305 PHE A CA    1 
ATOM 3628 C C     . PHE E 5 305 ? -35.335 2.158   -36.802 1.00 101.00 ? 305 PHE A C     1 
ATOM 3629 O O     . PHE E 5 305 ? -35.429 2.054   -35.580 1.00 95.39  ? 305 PHE A O     1 
ATOM 3630 C CB    . PHE E 5 305 ? -37.453 1.400   -38.020 1.00 112.98 ? 305 PHE A CB    1 
ATOM 3631 C CG    . PHE E 5 305 ? -36.842 0.414   -38.982 1.00 114.66 ? 305 PHE A CG    1 
ATOM 3632 C CD1   . PHE E 5 305 ? -36.263 -0.761  -38.516 1.00 110.97 ? 305 PHE A CD1   1 
ATOM 3633 C CD2   . PHE E 5 305 ? -36.884 0.640   -40.351 1.00 119.28 ? 305 PHE A CD2   1 
ATOM 3634 C CE1   . PHE E 5 305 ? -35.711 -1.683  -39.392 1.00 111.13 ? 305 PHE A CE1   1 
ATOM 3635 C CE2   . PHE E 5 305 ? -36.337 -0.278  -41.235 1.00 120.63 ? 305 PHE A CE2   1 
ATOM 3636 C CZ    . PHE E 5 305 ? -35.748 -1.445  -40.753 1.00 116.54 ? 305 PHE A CZ    1 
ATOM 3637 N N     . TYR E 5 306 ? -34.204 1.936   -37.465 1.00 101.46 ? 306 TYR A N     1 
ATOM 3638 C CA    . TYR E 5 306 ? -32.952 1.625   -36.783 1.00 104.41 ? 306 TYR A CA    1 
ATOM 3639 C C     . TYR E 5 306 ? -32.604 2.739   -35.804 1.00 108.80 ? 306 TYR A C     1 
ATOM 3640 O O     . TYR E 5 306 ? -32.288 2.505   -34.630 1.00 111.29 ? 306 TYR A O     1 
ATOM 3641 C CB    . TYR E 5 306 ? -31.824 1.508   -37.806 1.00 104.85 ? 306 TYR A CB    1 
ATOM 3642 C CG    . TYR E 5 306 ? -31.522 0.104   -38.306 1.00 104.35 ? 306 TYR A CG    1 
ATOM 3643 C CD1   . TYR E 5 306 ? -30.330 -0.531  -37.969 1.00 102.81 ? 306 TYR A CD1   1 
ATOM 3644 C CD2   . TYR E 5 306 ? -32.410 -0.576  -39.130 1.00 103.66 ? 306 TYR A CD2   1 
ATOM 3645 C CE1   . TYR E 5 306 ? -30.039 -1.800  -38.426 1.00 100.70 ? 306 TYR A CE1   1 
ATOM 3646 C CE2   . TYR E 5 306 ? -32.123 -1.848  -39.592 1.00 101.25 ? 306 TYR A CE2   1 
ATOM 3647 C CZ    . TYR E 5 306 ? -30.934 -2.449  -39.237 1.00 101.23 ? 306 TYR A CZ    1 
ATOM 3648 O OH    . TYR E 5 306 ? -30.631 -3.710  -39.688 1.00 103.00 ? 306 TYR A OH    1 
ATOM 3649 N N     . ILE E 5 307 ? -32.664 3.963   -36.310 1.00 108.17 ? 307 ILE A N     1 
ATOM 3650 C CA    . ILE E 5 307 ? -32.323 5.142   -35.534 1.00 103.90 ? 307 ILE A CA    1 
ATOM 3651 C C     . ILE E 5 307 ? -33.318 5.382   -34.394 1.00 97.43  ? 307 ILE A C     1 
ATOM 3652 O O     . ILE E 5 307 ? -32.921 5.532   -33.243 1.00 92.12  ? 307 ILE A O     1 
ATOM 3653 C CB    . ILE E 5 307 ? -32.210 6.361   -36.466 1.00 105.85 ? 307 ILE A CB    1 
ATOM 3654 C CG1   . ILE E 5 307 ? -31.189 6.051   -37.566 1.00 106.98 ? 307 ILE A CG1   1 
ATOM 3655 C CG2   . ILE E 5 307 ? -31.810 7.606   -35.695 1.00 104.48 ? 307 ILE A CG2   1 
ATOM 3656 C CD1   . ILE E 5 307 ? -31.089 7.096   -38.632 1.00 107.41 ? 307 ILE A CD1   1 
ATOM 3657 N N     . GLU E 5 308 ? -34.608 5.390   -34.715 1.00 98.69  ? 308 GLU A N     1 
ATOM 3658 C CA    . GLU E 5 308 ? -35.657 5.601   -33.724 1.00 102.58 ? 308 GLU A CA    1 
ATOM 3659 C C     . GLU E 5 308 ? -35.586 4.573   -32.611 1.00 105.20 ? 308 GLU A C     1 
ATOM 3660 O O     . GLU E 5 308 ? -35.810 4.886   -31.443 1.00 107.25 ? 308 GLU A O     1 
ATOM 3661 C CB    . GLU E 5 308 ? -37.030 5.537   -34.387 1.00 106.78 ? 308 GLU A CB    1 
ATOM 3662 C CG    . GLU E 5 308 ? -37.209 6.565   -35.478 1.00 116.18 ? 308 GLU A CG    1 
ATOM 3663 C CD    . GLU E 5 308 ? -38.576 6.501   -36.118 1.00 126.91 ? 308 GLU A CD    1 
ATOM 3664 O OE1   . GLU E 5 308 ? -38.648 6.510   -37.365 1.00 134.68 ? 308 GLU A OE1   1 
ATOM 3665 O OE2   . GLU E 5 308 ? -39.576 6.446   -35.373 1.00 129.14 ? 308 GLU A OE2   1 
ATOM 3666 N N     . LYS E 5 309 ? -35.274 3.340   -32.985 1.00 104.81 ? 309 LYS A N     1 
ATOM 3667 C CA    . LYS E 5 309 ? -35.212 2.239   -32.036 1.00 99.61  ? 309 LYS A CA    1 
ATOM 3668 C C     . LYS E 5 309 ? -33.989 2.311   -31.136 1.00 94.01  ? 309 LYS A C     1 
ATOM 3669 O O     . LYS E 5 309 ? -34.097 2.111   -29.933 1.00 93.15  ? 309 LYS A O     1 
ATOM 3670 C CB    . LYS E 5 309 ? -35.225 0.904   -32.779 1.00 105.67 ? 309 LYS A CB    1 
ATOM 3671 C CG    . LYS E 5 309 ? -34.972 -0.303  -31.895 1.00 109.60 ? 309 LYS A CG    1 
ATOM 3672 C CD    . LYS E 5 309 ? -36.071 -0.478  -30.867 1.00 112.30 ? 309 LYS A CD    1 
ATOM 3673 C CE    . LYS E 5 309 ? -35.848 -1.750  -30.072 1.00 113.35 ? 309 LYS A CE    1 
ATOM 3674 N NZ    . LYS E 5 309 ? -36.968 -2.034  -29.134 1.00 113.78 ? 309 LYS A NZ    1 
ATOM 3675 N N     . MET E 5 310 ? -32.825 2.580   -31.723 1.00 92.17  ? 310 MET A N     1 
ATOM 3676 C CA    . MET E 5 310 ? -31.575 2.577   -30.959 1.00 91.58  ? 310 MET A CA    1 
ATOM 3677 C C     . MET E 5 310 ? -31.398 3.856   -30.147 1.00 95.08  ? 310 MET A C     1 
ATOM 3678 O O     . MET E 5 310 ? -30.727 3.867   -29.108 1.00 93.14  ? 310 MET A O     1 
ATOM 3679 C CB    . MET E 5 310 ? -30.375 2.351   -31.877 1.00 90.32  ? 310 MET A CB    1 
ATOM 3680 C CG    . MET E 5 310 ? -30.271 0.927   -32.403 1.00 91.41  ? 310 MET A CG    1 
ATOM 3681 S SD    . MET E 5 310 ? -29.105 0.720   -33.758 1.00 81.15  ? 310 MET A SD    1 
ATOM 3682 C CE    . MET E 5 310 ? -27.586 1.285   -33.011 1.00 86.31  ? 310 MET A CE    1 
ATOM 3683 N N     . ASN E 5 311 ? -31.996 4.935   -30.633 1.00 97.89  ? 311 ASN A N     1 
ATOM 3684 C CA    . ASN E 5 311 ? -32.026 6.169   -29.878 1.00 98.86  ? 311 ASN A CA    1 
ATOM 3685 C C     . ASN E 5 311 ? -33.359 6.292   -29.116 1.00 98.95  ? 311 ASN A C     1 
ATOM 3686 O O     . ASN E 5 311 ? -33.589 7.271   -28.402 1.00 100.69 ? 311 ASN A O     1 
ATOM 3687 C CB    . ASN E 5 311 ? -31.782 7.365   -30.797 1.00 100.02 ? 311 ASN A CB    1 
ATOM 3688 C CG    . ASN E 5 311 ? -30.627 7.128   -31.768 1.00 102.25 ? 311 ASN A CG    1 
ATOM 3689 O OD1   . ASN E 5 311 ? -30.806 6.512   -32.825 1.00 105.70 ? 311 ASN A OD1   1 
ATOM 3690 N ND2   . ASN E 5 311 ? -29.431 7.591   -31.397 1.00 100.24 ? 311 ASN A ND2   1 
ATOM 3691 N N     . ARG E 5 312 ? -34.222 5.287   -29.276 1.00 96.58  ? 312 ARG A N     1 
ATOM 3692 C CA    . ARG E 5 312 ? -35.427 5.140   -28.468 1.00 95.25  ? 312 ARG A CA    1 
ATOM 3693 C C     . ARG E 5 312 ? -36.291 6.406   -28.396 1.00 91.46  ? 312 ARG A C     1 
ATOM 3694 O O     . ARG E 5 312 ? -36.919 6.679   -27.371 1.00 88.85  ? 312 ARG A O     1 
ATOM 3695 C CB    . ARG E 5 312 ? -35.031 4.676   -27.066 1.00 99.25  ? 312 ARG A CB    1 
ATOM 3696 C CG    . ARG E 5 312 ? -36.188 4.211   -26.169 1.00 101.55 ? 312 ARG A CG    1 
ATOM 3697 C CD    . ARG E 5 312 ? -35.705 3.803   -24.762 1.00 101.75 ? 312 ARG A CD    1 
ATOM 3698 N NE    . ARG E 5 312 ? -34.929 4.854   -24.095 1.00 100.52 ? 312 ARG A NE    1 
ATOM 3699 C CZ    . ARG E 5 312 ? -33.602 4.951   -24.143 1.00 96.43  ? 312 ARG A CZ    1 
ATOM 3700 N NH1   . ARG E 5 312 ? -32.884 4.069   -24.824 1.00 93.61  ? 312 ARG A NH1   1 
ATOM 3701 N NH2   . ARG E 5 312 ? -32.989 5.940   -23.516 1.00 96.04  ? 312 ARG A NH2   1 
ATOM 3702 N N     . THR E 5 313 ? -36.329 7.176   -29.479 1.00 92.74  ? 313 THR A N     1 
ATOM 3703 C CA    . THR E 5 313 ? -37.196 8.346   -29.530 1.00 95.05  ? 313 THR A CA    1 
ATOM 3704 C C     . THR E 5 313 ? -37.659 8.638   -30.953 1.00 102.61 ? 313 THR A C     1 
ATOM 3705 O O     . THR E 5 313 ? -36.917 8.442   -31.915 1.00 104.60 ? 313 THR A O     1 
ATOM 3706 C CB    . THR E 5 313 ? -36.513 9.576   -28.919 1.00 90.41  ? 313 THR A CB    1 
ATOM 3707 O OG1   . THR E 5 313 ? -37.454 10.656  -28.812 1.00 93.05  ? 313 THR A OG1   1 
ATOM 3708 C CG2   . THR E 5 313 ? -35.326 9.982   -29.765 1.00 84.47  ? 313 THR A CG2   1 
ATOM 3709 N N     . LYS E 5 314 ? -38.902 9.090   -31.073 1.00 108.15 ? 314 LYS A N     1 
ATOM 3710 C CA    . LYS E 5 314 ? -39.473 9.409   -32.368 1.00 116.37 ? 314 LYS A CA    1 
ATOM 3711 C C     . LYS E 5 314 ? -38.599 10.466  -32.997 1.00 114.61 ? 314 LYS A C     1 
ATOM 3712 O O     . LYS E 5 314 ? -38.026 11.289  -32.289 1.00 115.42 ? 314 LYS A O     1 
ATOM 3713 C CB    . LYS E 5 314 ? -40.893 9.945   -32.205 1.00 126.92 ? 314 LYS A CB    1 
ATOM 3714 C CG    . LYS E 5 314 ? -41.777 9.050   -31.368 1.00 136.03 ? 314 LYS A CG    1 
ATOM 3715 C CD    . LYS E 5 314 ? -41.766 7.624   -31.899 1.00 143.71 ? 314 LYS A CD    1 
ATOM 3716 C CE    . LYS E 5 314 ? -42.551 7.507   -33.194 1.00 149.81 ? 314 LYS A CE    1 
ATOM 3717 N NZ    . LYS E 5 314 ? -42.641 6.087   -33.640 1.00 153.18 ? 314 LYS A NZ    1 
ATOM 3718 N N     . LEU E 5 315 ? -38.478 10.436  -34.319 1.00 111.22 ? 315 LEU A N     1 
ATOM 3719 C CA    . LEU E 5 315 ? -37.744 11.474  -35.031 1.00 108.93 ? 315 LEU A CA    1 
ATOM 3720 C C     . LEU E 5 315 ? -38.530 12.790  -35.101 1.00 114.11 ? 315 LEU A C     1 
ATOM 3721 O O     . LEU E 5 315 ? -39.702 12.806  -35.441 1.00 117.73 ? 315 LEU A O     1 
ATOM 3722 C CB    . LEU E 5 315 ? -37.409 11.011  -36.448 1.00 100.57 ? 315 LEU A CB    1 
ATOM 3723 C CG    . LEU E 5 315 ? -36.182 10.124  -36.570 1.00 92.20  ? 315 LEU A CG    1 
ATOM 3724 C CD1   . LEU E 5 315 ? -35.790 10.010  -38.024 1.00 89.98  ? 315 LEU A CD1   1 
ATOM 3725 C CD2   . LEU E 5 315 ? -35.056 10.731  -35.772 1.00 89.42  ? 315 LEU A CD2   1 
ATOM 3726 N N     . GLN E 5 316 ? -37.857 13.899  -34.812 1.00 115.46 ? 316 GLN A N     1 
ATOM 3727 C CA    . GLN E 5 316 ? -38.470 15.228  -34.879 1.00 116.92 ? 316 GLN A CA    1 
ATOM 3728 C C     . GLN E 5 316 ? -37.656 16.196  -35.727 1.00 120.06 ? 316 GLN A C     1 
ATOM 3729 O O     . GLN E 5 316 ? -36.514 15.910  -36.080 1.00 118.30 ? 316 GLN A O     1 
ATOM 3730 C CB    . GLN E 5 316 ? -38.693 15.807  -33.485 1.00 117.59 ? 316 GLN A CB    1 
ATOM 3731 C CG    . GLN E 5 316 ? -37.459 15.734  -32.643 1.00 121.93 ? 316 GLN A CG    1 
ATOM 3732 C CD    . GLN E 5 316 ? -37.589 14.712  -31.541 1.00 131.34 ? 316 GLN A CD    1 
ATOM 3733 O OE1   . GLN E 5 316 ? -38.681 14.484  -31.015 1.00 139.90 ? 316 GLN A OE1   1 
ATOM 3734 N NE2   . GLN E 5 316 ? -36.476 14.092  -31.176 1.00 134.28 ? 316 GLN A NE2   1 
ATOM 3735 N N     . PRO E 5 317 ? -38.294 17.301  -36.152 1.00 119.03 ? 317 PRO A N     1 
ATOM 3736 C CA    . PRO E 5 317 ? -37.621 18.452  -36.773 1.00 114.22 ? 317 PRO A CA    1 
ATOM 3737 C C     . PRO E 5 317 ? -36.900 19.314  -35.731 1.00 102.82 ? 317 PRO A C     1 
ATOM 3738 O O     . PRO E 5 317 ? -37.367 19.406  -34.599 1.00 98.51  ? 317 PRO A O     1 
ATOM 3739 C CB    . PRO E 5 317 ? -38.778 19.255  -37.347 1.00 116.24 ? 317 PRO A CB    1 
ATOM 3740 C CG    . PRO E 5 317 ? -39.941 18.923  -36.465 1.00 118.84 ? 317 PRO A CG    1 
ATOM 3741 C CD    . PRO E 5 317 ? -39.759 17.483  -36.104 1.00 120.99 ? 317 PRO A CD    1 
ATOM 3742 N N     . CYS E 5 318 ? -35.780 19.928  -36.092 1.00 101.87 ? 318 CYS A N     1 
ATOM 3743 C CA    . CYS E 5 318 ? -35.057 20.771  -35.152 1.00 100.25 ? 318 CYS A CA    1 
ATOM 3744 C C     . CYS E 5 318 ? -35.944 21.964  -34.786 1.00 110.43 ? 318 CYS A C     1 
ATOM 3745 O O     . CYS E 5 318 ? -36.484 22.633  -35.671 1.00 113.53 ? 318 CYS A O     1 
ATOM 3746 C CB    . CYS E 5 318 ? -33.722 21.203  -35.776 1.00 97.85  ? 318 CYS A CB    1 
ATOM 3747 S SG    . CYS E 5 318 ? -32.805 22.552  -34.961 1.00 178.69 ? 318 CYS A SG    1 
ATOM 3748 N N     . PRO E 5 319 ? -36.135 22.220  -33.478 1.00 110.69 ? 319 PRO A N     1 
ATOM 3749 C CA    . PRO E 5 319 ? -36.968 23.379  -33.184 1.00 110.12 ? 319 PRO A CA    1 
ATOM 3750 C C     . PRO E 5 319 ? -36.140 24.591  -33.545 1.00 110.84 ? 319 PRO A C     1 
ATOM 3751 O O     . PRO E 5 319 ? -34.918 24.477  -33.632 1.00 110.19 ? 319 PRO A O     1 
ATOM 3752 C CB    . PRO E 5 319 ? -37.155 23.291  -31.664 1.00 106.48 ? 319 PRO A CB    1 
ATOM 3753 C CG    . PRO E 5 319 ? -35.912 22.664  -31.177 1.00 106.28 ? 319 PRO A CG    1 
ATOM 3754 C CD    . PRO E 5 319 ? -35.529 21.662  -32.254 1.00 111.26 ? 319 PRO A CD    1 
ATOM 3755 N N     . GLN E 5 320 ? -36.784 25.728  -33.769 1.00 110.70 ? 320 GLN A N     1 
ATOM 3756 C CA    . GLN E 5 320 ? -36.047 26.968  -33.941 1.00 105.40 ? 320 GLN A CA    1 
ATOM 3757 C C     . GLN E 5 320 ? -36.096 27.795  -32.653 1.00 102.29 ? 320 GLN A C     1 
ATOM 3758 O O     . GLN E 5 320 ? -37.131 28.231  -32.224 1.00 98.40  ? 320 GLN A O     1 
ATOM 3759 C CB    . GLN E 5 320 ? -36.652 27.785  -35.079 1.00 106.58 ? 320 GLN A CB    1 
ATOM 3760 C CG    . GLN E 5 320 ? -35.754 28.908  -35.564 1.00 108.21 ? 320 GLN A CG    1 
ATOM 3761 C CD    . GLN E 5 320 ? -35.865 29.162  -37.059 1.00 112.36 ? 320 GLN A CD    1 
ATOM 3762 O OE1   . GLN E 5 320 ? -36.878 28.850  -37.690 1.00 120.75 ? 320 GLN A OE1   1 
ATOM 3763 N NE2   . GLN E 5 320 ? -34.814 29.737  -37.632 1.00 111.63 ? 320 GLN A NE2   1 
ATOM 3764 N N     . VAL E 5 321 ? -34.967 27.897  -31.960 1.00 106.49 ? 321 VAL A N     1 
ATOM 3765 C CA    . VAL E 5 321 ? -34.714 28.936  -30.933 1.00 114.95 ? 321 VAL A CA    1 
ATOM 3766 C C     . VAL E 5 321 ? -34.333 30.277  -31.550 1.00 121.73 ? 321 VAL A C     1 
ATOM 3767 O O     . VAL E 5 321 ? -33.909 30.296  -32.697 1.00 123.75 ? 321 VAL A O     1 
ATOM 3768 C CB    . VAL E 5 321 ? -33.659 28.541  -29.947 1.00 114.29 ? 321 VAL A CB    1 
ATOM 3769 C CG1   . VAL E 5 321 ? -32.366 28.258  -30.717 1.00 114.23 ? 321 VAL A CG1   1 
ATOM 3770 C CG2   . VAL E 5 321 ? -33.419 29.683  -28.952 1.00 114.29 ? 321 VAL A CG2   1 
ATOM 3771 N N     . HIS E 5 322 ? -34.591 31.394  -30.842 1.00 127.67 ? 322 HIS A N     1 
ATOM 3772 C CA    . HIS E 5 322 ? -33.940 32.687  -31.180 1.00 138.70 ? 322 HIS A CA    1 
ATOM 3773 C C     . HIS E 5 322 ? -32.618 33.031  -30.450 1.00 142.52 ? 322 HIS A C     1 
ATOM 3774 O O     . HIS E 5 322 ? -31.938 34.001  -30.812 1.00 146.93 ? 322 HIS A O     1 
ATOM 3775 C CB    . HIS E 5 322 ? -34.893 33.878  -30.991 1.00 145.84 ? 322 HIS A CB    1 
ATOM 3776 C CG    . HIS E 5 322 ? -35.307 34.127  -29.557 1.00 149.09 ? 322 HIS A CG    1 
ATOM 3777 N ND1   . HIS E 5 322 ? -35.568 33.109  -28.665 1.00 149.32 ? 322 HIS A ND1   1 
ATOM 3778 C CD2   . HIS E 5 322 ? -35.524 35.282  -28.882 1.00 150.39 ? 322 HIS A CD2   1 
ATOM 3779 C CE1   . HIS E 5 322 ? -35.916 33.626  -27.493 1.00 149.16 ? 322 HIS A CE1   1 
ATOM 3780 N NE2   . HIS E 5 322 ? -35.897 34.942  -27.600 1.00 150.02 ? 322 HIS A NE2   1 
ATOM 3781 N N     . VAL E 5 323 ? -32.237 32.244  -29.447 1.00 140.96 ? 323 VAL A N     1 
ATOM 3782 C CA    . VAL E 5 323 ? -31.138 32.648  -28.559 1.00 137.76 ? 323 VAL A CA    1 
ATOM 3783 C C     . VAL E 5 323 ? -29.843 31.906  -28.884 1.00 133.47 ? 323 VAL A C     1 
ATOM 3784 O O     . VAL E 5 323 ? -29.847 30.682  -28.988 1.00 136.73 ? 323 VAL A O     1 
ATOM 3785 C CB    . VAL E 5 323 ? -31.511 32.410  -27.070 1.00 114.57 ? 323 VAL A CB    1 
ATOM 3786 C CG1   . VAL E 5 323 ? -30.275 32.531  -26.184 1.00 113.75 ? 323 VAL A CG1   1 
ATOM 3787 C CG2   . VAL E 5 323 ? -32.603 33.382  -26.627 1.00 115.39 ? 323 VAL A CG2   1 
ATOM 3788 N N     . HIS E 5 324 ? -28.730 32.621  -29.033 1.00 122.64 ? 324 HIS A N     1 
ATOM 3789 C CA    . HIS E 5 324 ? -27.491 31.928  -29.393 1.00 109.90 ? 324 HIS A CA    1 
ATOM 3790 C C     . HIS E 5 324 ? -26.435 31.929  -28.290 1.00 99.76  ? 324 HIS A C     1 
ATOM 3791 O O     . HIS E 5 324 ? -25.814 32.953  -28.007 1.00 99.08  ? 324 HIS A O     1 
ATOM 3792 C CB    . HIS E 5 324 ? -26.916 32.487  -30.699 1.00 110.93 ? 324 HIS A CB    1 
ATOM 3793 C CG    . HIS E 5 324 ? -27.831 32.331  -31.874 1.00 113.44 ? 324 HIS A CG    1 
ATOM 3794 N ND1   . HIS E 5 324 ? -27.378 32.302  -33.174 1.00 115.99 ? 324 HIS A ND1   1 
ATOM 3795 C CD2   . HIS E 5 324 ? -29.178 32.197  -31.944 1.00 115.44 ? 324 HIS A CD2   1 
ATOM 3796 C CE1   . HIS E 5 324 ? -28.404 32.154  -33.996 1.00 118.34 ? 324 HIS A CE1   1 
ATOM 3797 N NE2   . HIS E 5 324 ? -29.508 32.088  -33.269 1.00 118.02 ? 324 HIS A NE2   1 
ATOM 3798 N N     . LEU E 5 325 ? -26.259 30.774  -27.656 1.00 94.80  ? 325 LEU A N     1 
ATOM 3799 C CA    . LEU E 5 325 ? -25.158 30.562  -26.720 1.00 95.39  ? 325 LEU A CA    1 
ATOM 3800 C C     . LEU E 5 325 ? -23.878 30.140  -27.434 1.00 102.78 ? 325 LEU A C     1 
ATOM 3801 O O     . LEU E 5 325 ? -22.772 30.406  -26.961 1.00 106.23 ? 325 LEU A O     1 
ATOM 3802 C CB    . LEU E 5 325 ? -25.532 29.556  -25.634 1.00 89.40  ? 325 LEU A CB    1 
ATOM 3803 C CG    . LEU E 5 325 ? -26.428 30.102  -24.522 1.00 85.47  ? 325 LEU A CG    1 
ATOM 3804 C CD1   . LEU E 5 325 ? -27.703 30.679  -25.101 1.00 85.50  ? 325 LEU A CD1   1 
ATOM 3805 C CD2   . LEU E 5 325 ? -26.751 29.021  -23.521 1.00 85.59  ? 325 LEU A CD2   1 
ATOM 3806 N N     . PHE E 5 326 ? -24.038 29.438  -28.550 1.00 102.32 ? 326 PHE A N     1 
ATOM 3807 C CA    . PHE E 5 326 ? -22.909 29.081  -29.400 1.00 102.63 ? 326 PHE A CA    1 
ATOM 3808 C C     . PHE E 5 326 ? -22.701 30.115  -30.502 1.00 102.95 ? 326 PHE A C     1 
ATOM 3809 O O     . PHE E 5 326 ? -23.657 30.752  -30.939 1.00 101.47 ? 326 PHE A O     1 
ATOM 3810 C CB    . PHE E 5 326 ? -23.083 27.674  -29.989 1.00 101.60 ? 326 PHE A CB    1 
ATOM 3811 C CG    . PHE E 5 326 ? -22.824 26.555  -29.000 1.00 98.20  ? 326 PHE A CG    1 
ATOM 3812 C CD1   . PHE E 5 326 ? -21.531 26.240  -28.607 1.00 95.80  ? 326 PHE A CD1   1 
ATOM 3813 C CD2   . PHE E 5 326 ? -23.873 25.811  -28.477 1.00 94.82  ? 326 PHE A CD2   1 
ATOM 3814 C CE1   . PHE E 5 326 ? -21.292 25.216  -27.702 1.00 92.81  ? 326 PHE A CE1   1 
ATOM 3815 C CE2   . PHE E 5 326 ? -23.639 24.785  -27.568 1.00 90.47  ? 326 PHE A CE2   1 
ATOM 3816 C CZ    . PHE E 5 326 ? -22.348 24.489  -27.181 1.00 89.27  ? 326 PHE A CZ    1 
ATOM 3817 N N     . PRO E 5 327 ? -21.448 30.273  -30.958 1.00 109.02 ? 327 PRO A N     1 
ATOM 3818 C CA    . PRO E 5 327 ? -21.044 31.215  -32.007 1.00 115.33 ? 327 PRO A CA    1 
ATOM 3819 C C     . PRO E 5 327 ? -21.854 31.050  -33.284 1.00 120.72 ? 327 PRO A C     1 
ATOM 3820 O O     . PRO E 5 327 ? -22.154 29.921  -33.668 1.00 122.22 ? 327 PRO A O     1 
ATOM 3821 C CB    . PRO E 5 327 ? -19.596 30.812  -32.292 1.00 112.93 ? 327 PRO A CB    1 
ATOM 3822 C CG    . PRO E 5 327 ? -19.121 30.209  -31.043 1.00 108.17 ? 327 PRO A CG    1 
ATOM 3823 C CD    . PRO E 5 327 ? -20.301 29.498  -30.455 1.00 107.02 ? 327 PRO A CD    1 
ATOM 3824 N N     . THR E 5 328 ? -22.214 32.157  -33.923 1.00 120.45 ? 328 THR A N     1 
ATOM 3825 C CA    . THR E 5 328 ? -22.871 32.089  -35.219 1.00 124.34 ? 328 THR A CA    1 
ATOM 3826 C C     . THR E 5 328 ? -21.866 32.315  -36.346 1.00 124.49 ? 328 THR A C     1 
ATOM 3827 O O     . THR E 5 328 ? -22.200 32.214  -37.527 1.00 122.30 ? 328 THR A O     1 
ATOM 3828 C CB    . THR E 5 328 ? -24.029 33.089  -35.312 1.00 128.32 ? 328 THR A CB    1 
ATOM 3829 O OG1   . THR E 5 328 ? -24.754 33.094  -34.074 1.00 131.68 ? 328 THR A OG1   1 
ATOM 3830 C CG2   . THR E 5 328 ? -24.968 32.704  -36.440 1.00 129.69 ? 328 THR A CG2   1 
ATOM 3831 N N     . ASP E 5 329 ? -20.627 32.606  -35.965 1.00 132.27 ? 329 ASP A N     1 
ATOM 3832 C CA    . ASP E 5 329 ? -19.559 32.833  -36.934 1.00 143.54 ? 329 ASP A CA    1 
ATOM 3833 C C     . ASP E 5 329 ? -18.554 31.694  -36.898 1.00 148.85 ? 329 ASP A C     1 
ATOM 3834 O O     . ASP E 5 329 ? -17.838 31.516  -35.921 1.00 160.54 ? 329 ASP A O     1 
ATOM 3835 C CB    . ASP E 5 329 ? -18.856 34.186  -36.707 1.00 149.99 ? 329 ASP A CB    1 
ATOM 3836 C CG    . ASP E 5 329 ? -18.164 34.293  -35.344 1.00 154.09 ? 329 ASP A CG    1 
ATOM 3837 O OD1   . ASP E 5 329 ? -18.084 33.290  -34.608 1.00 153.13 ? 329 ASP A OD1   1 
ATOM 3838 O OD2   . ASP E 5 329 ? -17.685 35.399  -35.012 1.00 158.56 ? 329 ASP A OD2   1 
ATOM 3839 N N     . LEU E 5 330 ? -18.469 30.941  -37.984 1.00 144.60 ? 330 LEU A N     1 
ATOM 3840 C CA    . LEU E 5 330 ? -17.687 29.715  -37.959 1.00 142.26 ? 330 LEU A CA    1 
ATOM 3841 C C     . LEU E 5 330 ? -17.606 29.063  -39.327 1.00 147.38 ? 330 LEU A C     1 
ATOM 3842 O O     . LEU E 5 330 ? -18.455 29.292  -40.191 1.00 150.02 ? 330 LEU A O     1 
ATOM 3843 C CB    . LEU E 5 330 ? -18.269 28.722  -36.939 1.00 136.94 ? 330 LEU A CB    1 
ATOM 3844 C CG    . LEU E 5 330 ? -18.008 28.934  -35.445 1.00 132.64 ? 330 LEU A CG    1 
ATOM 3845 C CD1   . LEU E 5 330 ? -18.853 28.010  -34.578 1.00 130.88 ? 330 LEU A CD1   1 
ATOM 3846 C CD2   . LEU E 5 330 ? -16.537 28.756  -35.146 1.00 131.81 ? 330 LEU A CD2   1 
ATOM 3847 N N     . PRO E 5 331 ? -16.560 28.256  -39.529 1.00 149.11 ? 331 PRO A N     1 
ATOM 3848 C CA    . PRO E 5 331 ? -16.426 27.514  -40.779 1.00 151.68 ? 331 PRO A CA    1 
ATOM 3849 C C     . PRO E 5 331 ? -17.747 26.814  -41.051 1.00 153.51 ? 331 PRO A C     1 
ATOM 3850 O O     . PRO E 5 331 ? -18.377 26.319  -40.114 1.00 153.65 ? 331 PRO A O     1 
ATOM 3851 C CB    . PRO E 5 331 ? -15.340 26.494  -40.453 1.00 151.87 ? 331 PRO A CB    1 
ATOM 3852 C CG    . PRO E 5 331 ? -14.513 27.159  -39.404 1.00 150.62 ? 331 PRO A CG    1 
ATOM 3853 C CD    . PRO E 5 331 ? -15.475 27.957  -38.578 1.00 148.74 ? 331 PRO A CD    1 
ATOM 3854 N N     . PRO E 5 332 ? -18.176 26.793  -42.318 1.00 155.10 ? 332 PRO A N     1 
ATOM 3855 C CA    . PRO E 5 332 ? -19.472 26.234  -42.721 1.00 156.14 ? 332 PRO A CA    1 
ATOM 3856 C C     . PRO E 5 332 ? -19.634 24.778  -42.288 1.00 155.25 ? 332 PRO A C     1 
ATOM 3857 O O     . PRO E 5 332 ? -20.735 24.346  -41.940 1.00 157.15 ? 332 PRO A O     1 
ATOM 3858 C CB    . PRO E 5 332 ? -19.431 26.334  -44.247 1.00 158.98 ? 332 PRO A CB    1 
ATOM 3859 C CG    . PRO E 5 332 ? -18.469 27.448  -44.525 1.00 162.39 ? 332 PRO A CG    1 
ATOM 3860 C CD    . PRO E 5 332 ? -17.425 27.338  -43.462 1.00 156.95 ? 332 PRO A CD    1 
ATOM 3861 N N     . ASP E 5 333 ? -18.531 24.038  -42.295 1.00 151.12 ? 333 ASP A N     1 
ATOM 3862 C CA    . ASP E 5 333 ? -18.546 22.619  -41.963 1.00 145.56 ? 333 ASP A CA    1 
ATOM 3863 C C     . ASP E 5 333 ? -19.163 22.346  -40.589 1.00 138.80 ? 333 ASP A C     1 
ATOM 3864 O O     . ASP E 5 333 ? -20.135 21.599  -40.474 1.00 138.93 ? 333 ASP A O     1 
ATOM 3865 C CB    . ASP E 5 333 ? -17.121 22.056  -42.003 1.00 145.38 ? 333 ASP A CB    1 
ATOM 3866 C CG    . ASP E 5 333 ? -16.149 22.967  -42.733 1.00 147.90 ? 333 ASP A CG    1 
ATOM 3867 O OD1   . ASP E 5 333 ? -14.994 22.550  -42.962 1.00 147.45 ? 333 ASP A OD1   1 
ATOM 3868 O OD2   . ASP E 5 333 ? -16.536 24.102  -43.078 1.00 150.90 ? 333 ASP A OD2   1 
ATOM 3869 N N     . ILE E 5 334 ? -18.587 22.964  -39.560 1.00 132.31 ? 334 ILE A N     1 
ATOM 3870 C CA    . ILE E 5 334 ? -18.959 22.725  -38.163 1.00 124.46 ? 334 ILE A CA    1 
ATOM 3871 C C     . ILE E 5 334 ? -20.206 23.501  -37.721 1.00 128.72 ? 334 ILE A C     1 
ATOM 3872 O O     . ILE E 5 334 ? -20.896 23.127  -36.750 1.00 133.86 ? 334 ILE A O     1 
ATOM 3873 C CB    . ILE E 5 334 ? -17.791 23.079  -37.214 1.00 112.35 ? 334 ILE A CB    1 
ATOM 3874 C CG1   . ILE E 5 334 ? -16.634 23.722  -37.990 1.00 108.13 ? 334 ILE A CG1   1 
ATOM 3875 C CG2   . ILE E 5 334 ? -17.309 21.837  -36.481 1.00 109.35 ? 334 ILE A CG2   1 
ATOM 3876 C CD1   . ILE E 5 334 ? -15.763 22.752  -38.778 1.00 106.28 ? 334 ILE A CD1   1 
ATOM 3877 N N     . GLN E 5 335 ? -20.493 24.590  -38.423 1.00 126.21 ? 335 GLN A N     1 
ATOM 3878 C CA    . GLN E 5 335 ? -21.603 25.446  -38.040 1.00 122.42 ? 335 GLN A CA    1 
ATOM 3879 C C     . GLN E 5 335 ? -22.908 24.689  -37.804 1.00 122.36 ? 335 GLN A C     1 
ATOM 3880 O O     . GLN E 5 335 ? -23.466 24.723  -36.725 1.00 122.66 ? 335 GLN A O     1 
ATOM 3881 C CB    . GLN E 5 335 ? -21.821 26.560  -39.054 1.00 120.49 ? 335 GLN A CB    1 
ATOM 3882 C CG    . GLN E 5 335 ? -22.668 27.646  -38.467 1.00 118.54 ? 335 GLN A CG    1 
ATOM 3883 C CD    . GLN E 5 335 ? -21.999 28.301  -37.283 1.00 117.17 ? 335 GLN A CD    1 
ATOM 3884 O OE1   . GLN E 5 335 ? -21.243 29.253  -37.446 1.00 121.22 ? 335 GLN A OE1   1 
ATOM 3885 N NE2   . GLN E 5 335 ? -22.260 27.787  -36.085 1.00 112.62 ? 335 GLN A NE2   1 
ATOM 3886 N N     . ALA E 5 336 ? -23.394 24.019  -38.839 1.00 121.33 ? 336 ALA A N     1 
ATOM 3887 C CA    . ALA E 5 336 ? -24.671 23.306  -38.770 1.00 119.81 ? 336 ALA A CA    1 
ATOM 3888 C C     . ALA E 5 336 ? -24.817 22.447  -37.491 1.00 114.98 ? 336 ALA A C     1 
ATOM 3889 O O     . ALA E 5 336 ? -25.884 22.436  -36.851 1.00 116.10 ? 336 ALA A O     1 
ATOM 3890 C CB    . ALA E 5 336 ? -24.853 22.465  -40.009 1.00 122.26 ? 336 ALA A CB    1 
ATOM 3891 N N     . VAL E 5 337 ? -23.743 21.737  -37.136 1.00 108.36 ? 337 VAL A N     1 
ATOM 3892 C CA    . VAL E 5 337 ? -23.598 21.094  -35.833 1.00 100.71 ? 337 VAL A CA    1 
ATOM 3893 C C     . VAL E 5 337 ? -23.871 22.073  -34.699 1.00 100.65 ? 337 VAL A C     1 
ATOM 3894 O O     . VAL E 5 337 ? -24.822 21.921  -33.928 1.00 101.29 ? 337 VAL A O     1 
ATOM 3895 C CB    . VAL E 5 337 ? -22.162 20.575  -35.611 1.00 92.75  ? 337 VAL A CB    1 
ATOM 3896 C CG1   . VAL E 5 337 ? -22.018 19.988  -34.209 1.00 86.43  ? 337 VAL A CG1   1 
ATOM 3897 C CG2   . VAL E 5 337 ? -21.753 19.563  -36.658 1.00 92.44  ? 337 VAL A CG2   1 
ATOM 3898 N N     . PHE E 5 338 ? -23.006 23.068  -34.572 1.00 99.40  ? 338 PHE A N     1 
ATOM 3899 C CA    . PHE E 5 338 ? -23.142 23.958  -33.431 1.00 98.62  ? 338 PHE A CA    1 
ATOM 3900 C C     . PHE E 5 338 ? -24.491 24.670  -33.355 1.00 105.68 ? 338 PHE A C     1 
ATOM 3901 O O     . PHE E 5 338 ? -24.916 25.081  -32.281 1.00 108.08 ? 338 PHE A O     1 
ATOM 3902 C CB    . PHE E 5 338 ? -21.992 24.957  -33.380 1.00 94.11  ? 338 PHE A CB    1 
ATOM 3903 C CG    . PHE E 5 338 ? -20.658 24.324  -33.161 1.00 88.67  ? 338 PHE A CG    1 
ATOM 3904 C CD1   . PHE E 5 338 ? -20.178 24.129  -31.880 1.00 83.77  ? 338 PHE A CD1   1 
ATOM 3905 C CD2   . PHE E 5 338 ? -19.880 23.926  -34.234 1.00 88.61  ? 338 PHE A CD2   1 
ATOM 3906 C CE1   . PHE E 5 338 ? -18.941 23.547  -31.674 1.00 82.14  ? 338 PHE A CE1   1 
ATOM 3907 C CE2   . PHE E 5 338 ? -18.642 23.343  -34.031 1.00 86.41  ? 338 PHE A CE2   1 
ATOM 3908 C CZ    . PHE E 5 338 ? -18.174 23.154  -32.751 1.00 83.33  ? 338 PHE A CZ    1 
ATOM 3909 N N     . ASP E 5 339 ? -25.160 24.823  -34.489 1.00 109.72 ? 339 ASP A N     1 
ATOM 3910 C CA    . ASP E 5 339 ? -26.487 25.415  -34.498 1.00 115.23 ? 339 ASP A CA    1 
ATOM 3911 C C     . ASP E 5 339 ? -27.436 24.387  -33.899 1.00 116.47 ? 339 ASP A C     1 
ATOM 3912 O O     . ASP E 5 339 ? -28.296 24.737  -33.090 1.00 119.35 ? 339 ASP A O     1 
ATOM 3913 C CB    . ASP E 5 339 ? -26.934 25.786  -35.911 1.00 122.78 ? 339 ASP A CB    1 
ATOM 3914 C CG    . ASP E 5 339 ? -28.357 26.281  -35.944 1.00 132.90 ? 339 ASP A CG    1 
ATOM 3915 O OD1   . ASP E 5 339 ? -28.675 27.161  -35.120 1.00 137.55 ? 339 ASP A OD1   1 
ATOM 3916 O OD2   . ASP E 5 339 ? -29.161 25.778  -36.758 1.00 141.52 ? 339 ASP A OD2   1 
ATOM 3917 N N     . LEU E 5 340 ? -27.267 23.116  -34.283 1.00 114.17 ? 340 LEU A N     1 
ATOM 3918 C CA    . LEU E 5 340 ? -28.036 22.024  -33.657 1.00 111.27 ? 340 LEU A CA    1 
ATOM 3919 C C     . LEU E 5 340 ? -27.869 22.009  -32.121 1.00 106.65 ? 340 LEU A C     1 
ATOM 3920 O O     . LEU E 5 340 ? -28.849 22.130  -31.379 1.00 108.87 ? 340 LEU A O     1 
ATOM 3921 C CB    . LEU E 5 340 ? -27.731 20.639  -34.285 1.00 88.25  ? 340 LEU A CB    1 
ATOM 3922 C CG    . LEU E 5 340 ? -28.515 19.460  -33.671 1.00 88.72  ? 340 LEU A CG    1 
ATOM 3923 C CD1   . LEU E 5 340 ? -30.017 19.663  -33.813 1.00 92.83  ? 340 LEU A CD1   1 
ATOM 3924 C CD2   . LEU E 5 340 ? -28.153 18.092  -34.248 1.00 85.63  ? 340 LEU A CD2   1 
ATOM 3925 N N     . LEU E 5 341 ? -26.628 21.843  -31.660 1.00 101.13 ? 341 LEU A N     1 
ATOM 3926 C CA    . LEU E 5 341 ? -26.276 21.920  -30.228 1.00 94.30  ? 341 LEU A CA    1 
ATOM 3927 C C     . LEU E 5 341 ? -26.834 23.157  -29.521 1.00 97.28  ? 341 LEU A C     1 
ATOM 3928 O O     . LEU E 5 341 ? -27.285 23.102  -28.369 1.00 100.11 ? 341 LEU A O     1 
ATOM 3929 C CB    . LEU E 5 341 ? -24.749 21.894  -30.056 1.00 84.84  ? 341 LEU A CB    1 
ATOM 3930 C CG    . LEU E 5 341 ? -23.996 20.563  -30.089 1.00 72.87  ? 341 LEU A CG    1 
ATOM 3931 C CD1   . LEU E 5 341 ? -24.135 19.917  -31.448 1.00 72.72  ? 341 LEU A CD1   1 
ATOM 3932 C CD2   . LEU E 5 341 ? -22.515 20.684  -29.727 1.00 66.73  ? 341 LEU A CD2   1 
ATOM 3933 N N     . ASN E 5 342 ? -26.771 24.287  -30.208 1.00 94.11  ? 342 ASN A N     1 
ATOM 3934 C CA    . ASN E 5 342 ? -27.445 25.469  -29.706 1.00 86.74  ? 342 ASN A CA    1 
ATOM 3935 C C     . ASN E 5 342 ? -28.925 25.157  -29.513 1.00 83.90  ? 342 ASN A C     1 
ATOM 3936 O O     . ASN E 5 342 ? -29.451 25.358  -28.435 1.00 84.50  ? 342 ASN A O     1 
ATOM 3937 C CB    . ASN E 5 342 ? -27.265 26.655  -30.653 1.00 84.64  ? 342 ASN A CB    1 
ATOM 3938 C CG    . ASN E 5 342 ? -27.846 27.924  -30.102 1.00 84.01  ? 342 ASN A CG    1 
ATOM 3939 O OD1   . ASN E 5 342 ? -27.567 28.302  -28.964 1.00 82.85  ? 342 ASN A OD1   1 
ATOM 3940 N ND2   . ASN E 5 342 ? -28.691 28.579  -30.891 1.00 86.08  ? 342 ASN A ND2   1 
ATOM 3941 N N     . SER E 5 343 ? -29.587 24.634  -30.542 1.00 78.99  ? 343 SER A N     1 
ATOM 3942 C CA    . SER E 5 343 ? -31.024 24.374  -30.470 1.00 76.69  ? 343 SER A CA    1 
ATOM 3943 C C     . SER E 5 343 ? -31.403 23.492  -29.284 1.00 76.90  ? 343 SER A C     1 
ATOM 3944 O O     . SER E 5 343 ? -32.272 23.842  -28.484 1.00 80.20  ? 343 SER A O     1 
ATOM 3945 C CB    . SER E 5 343 ? -31.530 23.752  -31.771 1.00 75.36  ? 343 SER A CB    1 
ATOM 3946 O OG    . SER E 5 343 ? -32.916 23.479  -31.671 1.00 74.13  ? 343 SER A OG    1 
ATOM 3947 N N     . VAL E 5 344 ? -30.751 22.344  -29.172 1.00 77.17  ? 344 VAL A N     1 
ATOM 3948 C CA    . VAL E 5 344 ? -31.055 21.425  -28.083 1.00 78.83  ? 344 VAL A CA    1 
ATOM 3949 C C     . VAL E 5 344 ? -30.801 22.113  -26.746 1.00 85.80  ? 344 VAL A C     1 
ATOM 3950 O O     . VAL E 5 344 ? -31.685 22.179  -25.881 1.00 86.49  ? 344 VAL A O     1 
ATOM 3951 C CB    . VAL E 5 344 ? -30.195 20.166  -28.188 1.00 78.67  ? 344 VAL A CB    1 
ATOM 3952 C CG1   . VAL E 5 344 ? -30.649 19.124  -27.189 1.00 80.53  ? 344 VAL A CG1   1 
ATOM 3953 C CG2   . VAL E 5 344 ? -30.264 19.613  -29.600 1.00 77.64  ? 344 VAL A CG2   1 
ATOM 3954 N N     . LEU E 5 345 ? -29.592 22.649  -26.602 1.00 92.91  ? 345 LEU A N     1 
ATOM 3955 C CA    . LEU E 5 345 ? -29.176 23.315  -25.375 1.00 98.79  ? 345 LEU A CA    1 
ATOM 3956 C C     . LEU E 5 345 ? -30.189 24.352  -24.936 1.00 95.20  ? 345 LEU A C     1 
ATOM 3957 O O     . LEU E 5 345 ? -30.735 24.283  -23.845 1.00 94.41  ? 345 LEU A O     1 
ATOM 3958 C CB    . LEU E 5 345 ? -27.850 24.032  -25.612 1.00 110.45 ? 345 LEU A CB    1 
ATOM 3959 C CG    . LEU E 5 345 ? -27.183 24.563  -24.351 1.00 117.60 ? 345 LEU A CG    1 
ATOM 3960 C CD1   . LEU E 5 345 ? -26.562 23.388  -23.605 1.00 119.27 ? 345 LEU A CD1   1 
ATOM 3961 C CD2   . LEU E 5 345 ? -26.136 25.608  -24.699 1.00 122.60 ? 345 LEU A CD2   1 
ATOM 3962 N N     . VAL E 5 346 ? -30.450 25.307  -25.809 1.00 91.69  ? 346 VAL A N     1 
ATOM 3963 C CA    . VAL E 5 346 ? -31.371 26.375  -25.502 1.00 93.40  ? 346 VAL A CA    1 
ATOM 3964 C C     . VAL E 5 346 ? -32.776 25.849  -25.251 1.00 89.14  ? 346 VAL A C     1 
ATOM 3965 O O     . VAL E 5 346 ? -33.529 26.437  -24.485 1.00 90.89  ? 346 VAL A O     1 
ATOM 3966 C CB    . VAL E 5 346 ? -31.411 27.422  -26.621 1.00 104.22 ? 346 VAL A CB    1 
ATOM 3967 C CG1   . VAL E 5 346 ? -32.570 28.364  -26.402 1.00 106.22 ? 346 VAL A CG1   1 
ATOM 3968 C CG2   . VAL E 5 346 ? -30.096 28.190  -26.672 1.00 107.77 ? 346 VAL A CG2   1 
ATOM 3969 N N     . THR E 5 347 ? -33.132 24.739  -25.884 1.00 85.28  ? 347 THR A N     1 
ATOM 3970 C CA    . THR E 5 347 ? -34.474 24.204  -25.715 1.00 85.71  ? 347 THR A CA    1 
ATOM 3971 C C     . THR E 5 347 ? -34.657 23.670  -24.308 1.00 83.71  ? 347 THR A C     1 
ATOM 3972 O O     . THR E 5 347 ? -35.658 23.952  -23.651 1.00 81.14  ? 347 THR A O     1 
ATOM 3973 C CB    . THR E 5 347 ? -34.793 23.076  -26.712 1.00 85.84  ? 347 THR A CB    1 
ATOM 3974 O OG1   . THR E 5 347 ? -34.631 23.550  -28.052 1.00 89.08  ? 347 THR A OG1   1 
ATOM 3975 C CG2   . THR E 5 347 ? -36.220 22.615  -26.529 1.00 85.98  ? 347 THR A CG2   1 
ATOM 3976 N N     . SER E 5 348 ? -33.683 22.894  -23.849 1.00 88.07  ? 348 SER A N     1 
ATOM 3977 C CA    . SER E 5 348 ? -33.820 22.193  -22.577 1.00 92.25  ? 348 SER A CA    1 
ATOM 3978 C C     . SER E 5 348 ? -33.171 22.911  -21.389 1.00 93.91  ? 348 SER A C     1 
ATOM 3979 O O     . SER E 5 348 ? -33.272 22.443  -20.257 1.00 95.44  ? 348 SER A O     1 
ATOM 3980 C CB    . SER E 5 348 ? -33.259 20.766  -22.691 1.00 93.64  ? 348 SER A CB    1 
ATOM 3981 O OG    . SER E 5 348 ? -33.947 20.004  -23.674 1.00 95.99  ? 348 SER A OG    1 
ATOM 3982 N N     . LEU E 5 349 ? -32.510 24.037  -21.638 1.00 91.31  ? 349 LEU A N     1 
ATOM 3983 C CA    . LEU E 5 349 ? -31.758 24.714  -20.583 1.00 87.86  ? 349 LEU A CA    1 
ATOM 3984 C C     . LEU E 5 349 ? -32.643 25.241  -19.460 1.00 84.36  ? 349 LEU A C     1 
ATOM 3985 O O     . LEU E 5 349 ? -32.257 25.215  -18.289 1.00 81.23  ? 349 LEU A O     1 
ATOM 3986 C CB    . LEU E 5 349 ? -30.843 25.809  -21.147 1.00 87.41  ? 349 LEU A CB    1 
ATOM 3987 C CG    . LEU E 5 349 ? -29.582 26.031  -20.311 1.00 88.01  ? 349 LEU A CG    1 
ATOM 3988 C CD1   . LEU E 5 349 ? -28.898 24.717  -20.017 1.00 88.75  ? 349 LEU A CD1   1 
ATOM 3989 C CD2   . LEU E 5 349 ? -28.632 26.949  -21.031 1.00 90.98  ? 349 LEU A CD2   1 
ATOM 3990 N N     . PRO E 5 350 ? -33.827 25.751  -19.815 1.00 86.68  ? 350 PRO A N     1 
ATOM 3991 C CA    . PRO E 5 350 ? -34.755 26.121  -18.740 1.00 89.94  ? 350 PRO A CA    1 
ATOM 3992 C C     . PRO E 5 350 ? -35.002 24.986  -17.741 1.00 92.70  ? 350 PRO A C     1 
ATOM 3993 O O     . PRO E 5 350 ? -34.987 25.205  -16.535 1.00 94.30  ? 350 PRO A O     1 
ATOM 3994 C CB    . PRO E 5 350 ? -36.049 26.433  -19.494 1.00 90.52  ? 350 PRO A CB    1 
ATOM 3995 C CG    . PRO E 5 350 ? -35.631 26.802  -20.871 1.00 87.84  ? 350 PRO A CG    1 
ATOM 3996 C CD    . PRO E 5 350 ? -34.335 26.105  -21.157 1.00 85.32  ? 350 PRO A CD    1 
ATOM 3997 N N     . LEU E 5 351 ? -35.243 23.788  -18.245 1.00 90.38  ? 351 LEU A N     1 
ATOM 3998 C CA    . LEU E 5 351 ? -35.447 22.664  -17.351 1.00 92.05  ? 351 LEU A CA    1 
ATOM 3999 C C     . LEU E 5 351 ? -34.242 22.488  -16.423 1.00 90.72  ? 351 LEU A C     1 
ATOM 4000 O O     . LEU E 5 351 ? -34.386 22.460  -15.198 1.00 91.21  ? 351 LEU A O     1 
ATOM 4001 C CB    . LEU E 5 351 ? -35.690 21.373  -18.136 1.00 93.22  ? 351 LEU A CB    1 
ATOM 4002 C CG    . LEU E 5 351 ? -36.277 20.189  -17.373 1.00 91.37  ? 351 LEU A CG    1 
ATOM 4003 C CD1   . LEU E 5 351 ? -37.655 20.519  -16.815 1.00 97.99  ? 351 LEU A CD1   1 
ATOM 4004 C CD2   . LEU E 5 351 ? -36.352 19.016  -18.309 1.00 86.34  ? 351 LEU A CD2   1 
ATOM 4005 N N     . LEU E 5 352 ? -33.052 22.390  -17.009 1.00 88.25  ? 352 LEU A N     1 
ATOM 4006 C CA    . LEU E 5 352 ? -31.847 22.125  -16.230 1.00 83.96  ? 352 LEU A CA    1 
ATOM 4007 C C     . LEU E 5 352 ? -31.710 23.114  -15.076 1.00 93.68  ? 352 LEU A C     1 
ATOM 4008 O O     . LEU E 5 352 ? -31.234 22.764  -13.993 1.00 93.43  ? 352 LEU A O     1 
ATOM 4009 C CB    . LEU E 5 352 ? -30.607 22.161  -17.122 1.00 72.48  ? 352 LEU A CB    1 
ATOM 4010 C CG    . LEU E 5 352 ? -29.286 21.954  -16.385 1.00 64.73  ? 352 LEU A CG    1 
ATOM 4011 C CD1   . LEU E 5 352 ? -29.229 20.576  -15.759 1.00 64.03  ? 352 LEU A CD1   1 
ATOM 4012 C CD2   . LEU E 5 352 ? -28.121 22.158  -17.326 1.00 61.94  ? 352 LEU A CD2   1 
ATOM 4013 N N     . TYR E 5 353 ? -32.158 24.342  -15.323 1.00 101.33 ? 353 TYR A N     1 
ATOM 4014 C CA    . TYR E 5 353 ? -32.066 25.442  -14.369 1.00 109.03 ? 353 TYR A CA    1 
ATOM 4015 C C     . TYR E 5 353 ? -33.031 25.289  -13.198 1.00 111.04 ? 353 TYR A C     1 
ATOM 4016 O O     . TYR E 5 353 ? -32.745 25.732  -12.080 1.00 112.47 ? 353 TYR A O     1 
ATOM 4017 C CB    . TYR E 5 353 ? -32.358 26.749  -15.097 1.00 116.82 ? 353 TYR A CB    1 
ATOM 4018 C CG    . TYR E 5 353 ? -32.352 27.968  -14.216 1.00 122.60 ? 353 TYR A CG    1 
ATOM 4019 C CD1   . TYR E 5 353 ? -31.157 28.507  -13.759 1.00 124.15 ? 353 TYR A CD1   1 
ATOM 4020 C CD2   . TYR E 5 353 ? -33.539 28.594  -13.853 1.00 126.00 ? 353 TYR A CD2   1 
ATOM 4021 C CE1   . TYR E 5 353 ? -31.140 29.634  -12.956 1.00 125.98 ? 353 TYR A CE1   1 
ATOM 4022 C CE2   . TYR E 5 353 ? -33.534 29.723  -13.049 1.00 128.30 ? 353 TYR A CE2   1 
ATOM 4023 C CZ    . TYR E 5 353 ? -32.330 30.237  -12.604 1.00 127.09 ? 353 TYR A CZ    1 
ATOM 4024 O OH    . TYR E 5 353 ? -32.311 31.355  -11.804 1.00 125.73 ? 353 TYR A OH    1 
ATOM 4025 N N     . ARG E 5 354 ? -34.181 24.677  -13.472 1.00 108.17 ? 354 ARG A N     1 
ATOM 4026 C CA    . ARG E 5 354 ? -35.223 24.476  -12.468 1.00 105.38 ? 354 ARG A CA    1 
ATOM 4027 C C     . ARG E 5 354 ? -34.895 23.299  -11.558 1.00 99.63  ? 354 ARG A C     1 
ATOM 4028 O O     . ARG E 5 354 ? -35.355 23.235  -10.414 1.00 99.65  ? 354 ARG A O     1 
ATOM 4029 C CB    . ARG E 5 354 ? -36.580 24.261  -13.143 1.00 108.40 ? 354 ARG A CB    1 
ATOM 4030 C CG    . ARG E 5 354 ? -37.125 25.474  -13.895 1.00 114.38 ? 354 ARG A CG    1 
ATOM 4031 C CD    . ARG E 5 354 ? -37.955 26.376  -12.982 1.00 118.30 ? 354 ARG A CD    1 
ATOM 4032 N NE    . ARG E 5 354 ? -38.004 27.766  -13.434 1.00 119.89 ? 354 ARG A NE    1 
ATOM 4033 C CZ    . ARG E 5 354 ? -38.016 28.813  -12.616 1.00 120.30 ? 354 ARG A CZ    1 
ATOM 4034 N NH1   . ARG E 5 354 ? -37.981 28.628  -11.304 1.00 119.53 ? 354 ARG A NH1   1 
ATOM 4035 N NH2   . ARG E 5 354 ? -38.059 30.043  -13.106 1.00 123.37 ? 354 ARG A NH2   1 
ATOM 4036 N N     . VAL E 5 355 ? -34.098 22.371  -12.081 1.00 95.42  ? 355 VAL A N     1 
ATOM 4037 C CA    . VAL E 5 355 ? -33.669 21.191  -11.340 1.00 89.32  ? 355 VAL A CA    1 
ATOM 4038 C C     . VAL E 5 355 ? -32.335 21.439  -10.653 1.00 92.00  ? 355 VAL A C     1 
ATOM 4039 O O     . VAL E 5 355 ? -32.241 21.374  -9.429  1.00 96.46  ? 355 VAL A O     1 
ATOM 4040 C CB    . VAL E 5 355 ? -33.530 19.972  -12.249 1.00 81.44  ? 355 VAL A CB    1 
ATOM 4041 C CG1   . VAL E 5 355 ? -32.978 18.801  -11.460 1.00 80.92  ? 355 VAL A CG1   1 
ATOM 4042 C CG2   . VAL E 5 355 ? -34.873 19.631  -12.880 1.00 78.17  ? 355 VAL A CG2   1 
ATOM 4043 N N     . PHE E 5 356 ? -31.304 21.717  -11.445 1.00 91.91  ? 356 PHE A N     1 
ATOM 4044 C CA    . PHE E 5 356 ? -29.978 21.954  -10.890 1.00 96.32  ? 356 PHE A CA    1 
ATOM 4045 C C     . PHE E 5 356 ? -29.505 23.379  -11.165 1.00 101.31 ? 356 PHE A C     1 
ATOM 4046 O O     . PHE E 5 356 ? -28.579 23.591  -11.952 1.00 103.48 ? 356 PHE A O     1 
ATOM 4047 C CB    . PHE E 5 356 ? -28.957 20.982  -11.487 1.00 99.94  ? 356 PHE A CB    1 
ATOM 4048 C CG    . PHE E 5 356 ? -29.302 19.513  -11.307 1.00 103.57 ? 356 PHE A CG    1 
ATOM 4049 C CD1   . PHE E 5 356 ? -29.150 18.881  -10.077 1.00 102.50 ? 356 PHE A CD1   1 
ATOM 4050 C CD2   . PHE E 5 356 ? -29.731 18.754  -12.386 1.00 103.47 ? 356 PHE A CD2   1 
ATOM 4051 C CE1   . PHE E 5 356 ? -29.447 17.537  -9.923  1.00 98.13  ? 356 PHE A CE1   1 
ATOM 4052 C CE2   . PHE E 5 356 ? -30.026 17.407  -12.234 1.00 100.57 ? 356 PHE A CE2   1 
ATOM 4053 C CZ    . PHE E 5 356 ? -29.883 16.802  -11.002 1.00 97.57  ? 356 PHE A CZ    1 
ATOM 4054 N N     . PRO E 5 357 ? -30.117 24.365  -10.485 1.00 103.82 ? 357 PRO A N     1 
ATOM 4055 C CA    . PRO E 5 357 ? -29.735 25.769  -10.663 1.00 102.80 ? 357 PRO A CA    1 
ATOM 4056 C C     . PRO E 5 357 ? -28.291 25.960  -10.213 1.00 99.03  ? 357 PRO A C     1 
ATOM 4057 O O     . PRO E 5 357 ? -27.643 26.962  -10.543 1.00 97.57  ? 357 PRO A O     1 
ATOM 4058 C CB    . PRO E 5 357 ? -30.694 26.513  -9.733  1.00 105.64 ? 357 PRO A CB    1 
ATOM 4059 C CG    . PRO E 5 357 ? -31.074 25.500  -8.697  1.00 104.82 ? 357 PRO A CG    1 
ATOM 4060 C CD    . PRO E 5 357 ? -31.135 24.204  -9.434  1.00 103.75 ? 357 PRO A CD    1 
ATOM 4061 N N     . THR E 5 358 ? -27.790 24.963  -9.489  1.00 96.09  ? 358 THR A N     1 
ATOM 4062 C CA    . THR E 5 358 ? -26.455 24.982  -8.905  1.00 91.32  ? 358 THR A CA    1 
ATOM 4063 C C     . THR E 5 358 ? -25.400 24.464  -9.879  1.00 90.19  ? 358 THR A C     1 
ATOM 4064 O O     . THR E 5 358 ? -24.236 24.291  -9.514  1.00 89.47  ? 358 THR A O     1 
ATOM 4065 C CB    . THR E 5 358 ? -26.412 24.134  -7.623  1.00 88.25  ? 358 THR A CB    1 
ATOM 4066 O OG1   . THR E 5 358 ? -27.216 22.958  -7.796  1.00 88.32  ? 358 THR A OG1   1 
ATOM 4067 C CG2   . THR E 5 358 ? -26.942 24.918  -6.435  1.00 85.08  ? 358 THR A CG2   1 
ATOM 4068 N N     . HIS E 5 359 ? -25.815 24.204  -11.114 1.00 90.02  ? 359 HIS A N     1 
ATOM 4069 C CA    . HIS E 5 359 ? -24.909 23.664  -12.119 1.00 93.09  ? 359 HIS A CA    1 
ATOM 4070 C C     . HIS E 5 359 ? -23.871 24.670  -12.576 1.00 95.08  ? 359 HIS A C     1 
ATOM 4071 O O     . HIS E 5 359 ? -24.164 25.850  -12.703 1.00 96.33  ? 359 HIS A O     1 
ATOM 4072 C CB    . HIS E 5 359 ? -25.684 23.188  -13.343 1.00 96.50  ? 359 HIS A CB    1 
ATOM 4073 C CG    . HIS E 5 359 ? -24.908 22.254  -14.219 1.00 99.10  ? 359 HIS A CG    1 
ATOM 4074 N ND1   . HIS E 5 359 ? -23.875 22.674  -15.031 1.00 100.44 ? 359 HIS A ND1   1 
ATOM 4075 C CD2   . HIS E 5 359 ? -25.015 20.919  -14.404 1.00 98.45  ? 359 HIS A CD2   1 
ATOM 4076 C CE1   . HIS E 5 359 ? -23.382 21.634  -15.679 1.00 100.33 ? 359 HIS A CE1   1 
ATOM 4077 N NE2   . HIS E 5 359 ? -24.055 20.558  -15.317 1.00 99.15  ? 359 HIS A NE2   1 
ATOM 4078 N N     . ASP E 5 360 ? -22.672 24.182  -12.872 1.00 96.23  ? 360 ASP A N     1 
ATOM 4079 C CA    . ASP E 5 360 ? -21.573 25.028  -13.327 1.00 96.76  ? 360 ASP A CA    1 
ATOM 4080 C C     . ASP E 5 360 ? -21.941 25.987  -14.462 1.00 104.85 ? 360 ASP A C     1 
ATOM 4081 O O     . ASP E 5 360 ? -21.529 27.153  -14.459 1.00 109.04 ? 360 ASP A O     1 
ATOM 4082 C CB    . ASP E 5 360 ? -20.377 24.167  -13.730 1.00 93.31  ? 360 ASP A CB    1 
ATOM 4083 C CG    . ASP E 5 360 ? -19.639 23.613  -12.536 1.00 93.29  ? 360 ASP A CG    1 
ATOM 4084 O OD1   . ASP E 5 360 ? -20.252 23.522  -11.452 1.00 91.27  ? 360 ASP A OD1   1 
ATOM 4085 O OD2   . ASP E 5 360 ? -18.446 23.278  -12.679 1.00 97.96  ? 360 ASP A OD2   1 
ATOM 4086 N N     . ILE E 5 361 ? -22.719 25.501  -15.423 1.00 102.71 ? 361 ILE A N     1 
ATOM 4087 C CA    . ILE E 5 361 ? -23.071 26.294  -16.597 1.00 101.51 ? 361 ILE A CA    1 
ATOM 4088 C C     . ILE E 5 361 ? -23.713 27.651  -16.262 1.00 104.67 ? 361 ILE A C     1 
ATOM 4089 O O     . ILE E 5 361 ? -23.524 28.629  -16.988 1.00 108.22 ? 361 ILE A O     1 
ATOM 4090 C CB    . ILE E 5 361 ? -24.013 25.510  -17.525 1.00 97.97  ? 361 ILE A CB    1 
ATOM 4091 C CG1   . ILE E 5 361 ? -23.891 26.022  -18.962 1.00 96.48  ? 361 ILE A CG1   1 
ATOM 4092 C CG2   . ILE E 5 361 ? -25.450 25.573  -17.011 1.00 96.78  ? 361 ILE A CG2   1 
ATOM 4093 C CD1   . ILE E 5 361 ? -24.856 25.371  -19.919 1.00 96.32  ? 361 ILE A CD1   1 
ATOM 4094 N N     . PHE E 5 362 ? -24.456 27.708  -15.160 1.00 103.49 ? 362 PHE A N     1 
ATOM 4095 C CA    . PHE E 5 362 ? -25.196 28.908  -14.787 1.00 100.58 ? 362 PHE A CA    1 
ATOM 4096 C C     . PHE E 5 362 ? -24.302 29.951  -14.128 1.00 102.33 ? 362 PHE A C     1 
ATOM 4097 O O     . PHE E 5 362 ? -24.732 31.072  -13.871 1.00 101.22 ? 362 PHE A O     1 
ATOM 4098 C CB    . PHE E 5 362 ? -26.369 28.546  -13.872 1.00 100.39 ? 362 PHE A CB    1 
ATOM 4099 C CG    . PHE E 5 362 ? -27.349 27.594  -14.500 1.00 99.83  ? 362 PHE A CG    1 
ATOM 4100 C CD1   . PHE E 5 362 ? -28.110 27.984  -15.586 1.00 101.65 ? 362 PHE A CD1   1 
ATOM 4101 C CD2   . PHE E 5 362 ? -27.499 26.311  -14.016 1.00 101.50 ? 362 PHE A CD2   1 
ATOM 4102 C CE1   . PHE E 5 362 ? -29.008 27.115  -16.177 1.00 101.31 ? 362 PHE A CE1   1 
ATOM 4103 C CE2   . PHE E 5 362 ? -28.395 25.441  -14.603 1.00 102.29 ? 362 PHE A CE2   1 
ATOM 4104 C CZ    . PHE E 5 362 ? -29.149 25.846  -15.686 1.00 102.10 ? 362 PHE A CZ    1 
ATOM 4105 N N     . LEU E 5 363 ? -23.055 29.580  -13.863 1.00 102.44 ? 363 LEU A N     1 
ATOM 4106 C CA    . LEU E 5 363 ? -22.127 30.488  -13.199 1.00 103.83 ? 363 LEU A CA    1 
ATOM 4107 C C     . LEU E 5 363 ? -21.409 31.400  -14.171 1.00 108.52 ? 363 LEU A C     1 
ATOM 4108 O O     . LEU E 5 363 ? -20.687 32.304  -13.760 1.00 108.06 ? 363 LEU A O     1 
ATOM 4109 C CB    . LEU E 5 363 ? -21.108 29.715  -12.365 1.00 100.66 ? 363 LEU A CB    1 
ATOM 4110 C CG    . LEU E 5 363 ? -21.534 29.364  -10.940 1.00 95.41  ? 363 LEU A CG    1 
ATOM 4111 C CD1   . LEU E 5 363 ? -23.004 28.995  -10.888 1.00 94.28  ? 363 LEU A CD1   1 
ATOM 4112 C CD2   . LEU E 5 363 ? -20.673 28.247  -10.394 1.00 92.21  ? 363 LEU A CD2   1 
ATOM 4113 N N     . ASP E 5 364 ? -21.592 31.161  -15.462 1.00 115.21 ? 364 ASP A N     1 
ATOM 4114 C CA    . ASP E 5 364 ? -21.040 32.074  -16.455 1.00 122.85 ? 364 ASP A CA    1 
ATOM 4115 C C     . ASP E 5 364 ? -21.802 33.395  -16.387 1.00 127.89 ? 364 ASP A C     1 
ATOM 4116 O O     . ASP E 5 364 ? -23.027 33.404  -16.252 1.00 131.95 ? 364 ASP A O     1 
ATOM 4117 C CB    . ASP E 5 364 ? -21.132 31.480  -17.861 1.00 125.64 ? 364 ASP A CB    1 
ATOM 4118 C CG    . ASP E 5 364 ? -20.054 32.014  -18.783 1.00 127.03 ? 364 ASP A CG    1 
ATOM 4119 O OD1   . ASP E 5 364 ? -18.924 32.258  -18.299 1.00 126.60 ? 364 ASP A OD1   1 
ATOM 4120 O OD2   . ASP E 5 364 ? -20.323 32.195  -19.986 1.00 129.49 ? 364 ASP A OD2   1 
ATOM 4121 N N     . PRO E 5 365 ? -21.089 34.522  -16.465 1.00 125.16 ? 365 PRO A N     1 
ATOM 4122 C CA    . PRO E 5 365 ? -21.919 35.721  -16.485 1.00 123.10 ? 365 PRO A CA    1 
ATOM 4123 C C     . PRO E 5 365 ? -22.879 35.675  -17.646 1.00 120.28 ? 365 PRO A C     1 
ATOM 4124 O O     . PRO E 5 365 ? -24.013 36.131  -17.542 1.00 122.21 ? 365 PRO A O     1 
ATOM 4125 C CB    . PRO E 5 365 ? -20.914 36.832  -16.735 1.00 127.33 ? 365 PRO A CB    1 
ATOM 4126 C CG    . PRO E 5 365 ? -19.561 36.243  -16.520 1.00 126.68 ? 365 PRO A CG    1 
ATOM 4127 C CD    . PRO E 5 365 ? -19.681 34.793  -16.799 1.00 125.04 ? 365 PRO A CD    1 
ATOM 4128 N N     . SER E 5 366 ? -22.403 35.161  -18.768 1.00 115.26 ? 366 SER A N     1 
ATOM 4129 C CA    . SER E 5 366 ? -23.180 35.245  -19.989 1.00 115.69 ? 366 SER A CA    1 
ATOM 4130 C C     . SER E 5 366 ? -24.604 34.794  -19.746 1.00 118.59 ? 366 SER A C     1 
ATOM 4131 O O     . SER E 5 366 ? -25.538 35.371  -20.274 1.00 119.88 ? 366 SER A O     1 
ATOM 4132 C CB    . SER E 5 366 ? -22.547 34.406  -21.105 1.00 114.50 ? 366 SER A CB    1 
ATOM 4133 O OG    . SER E 5 366 ? -23.348 34.496  -22.273 1.00 119.64 ? 366 SER A OG    1 
ATOM 4134 N N     . LEU E 5 367 ? -24.763 33.752  -18.940 1.00 122.72 ? 367 LEU A N     1 
ATOM 4135 C CA    . LEU E 5 367 ? -26.099 33.327  -18.519 1.00 129.07 ? 367 LEU A CA    1 
ATOM 4136 C C     . LEU E 5 367 ? -26.718 34.247  -17.457 1.00 133.63 ? 367 LEU A C     1 
ATOM 4137 O O     . LEU E 5 367 ? -27.880 34.069  -17.083 1.00 135.61 ? 367 LEU A O     1 
ATOM 4138 C CB    . LEU E 5 367 ? -26.105 31.868  -18.029 1.00 128.03 ? 367 LEU A CB    1 
ATOM 4139 C CG    . LEU E 5 367 ? -26.169 30.722  -19.051 1.00 127.06 ? 367 LEU A CG    1 
ATOM 4140 C CD1   . LEU E 5 367 ? -27.427 30.833  -19.897 1.00 126.86 ? 367 LEU A CD1   1 
ATOM 4141 C CD2   . LEU E 5 367 ? -24.921 30.642  -19.936 1.00 126.51 ? 367 LEU A CD2   1 
ATOM 4142 N N     . LYS E 5 368 ? -25.949 35.224  -16.975 1.00 135.27 ? 368 LYS A N     1 
ATOM 4143 C CA    . LYS E 5 368 ? -26.416 36.135  -15.921 1.00 134.93 ? 368 LYS A CA    1 
ATOM 4144 C C     . LYS E 5 368 ? -27.115 37.396  -16.438 1.00 140.13 ? 368 LYS A C     1 
ATOM 4145 O O     . LYS E 5 368 ? -27.668 38.149  -15.645 1.00 143.01 ? 368 LYS A O     1 
ATOM 4146 C CB    . LYS E 5 368 ? -25.258 36.560  -15.001 1.00 130.20 ? 368 LYS A CB    1 
ATOM 4147 C CG    . LYS E 5 368 ? -24.729 35.495  -14.046 1.00 126.32 ? 368 LYS A CG    1 
ATOM 4148 C CD    . LYS E 5 368 ? -25.693 35.236  -12.894 1.00 124.38 ? 368 LYS A CD    1 
ATOM 4149 C CE    . LYS E 5 368 ? -24.965 34.785  -11.630 1.00 122.98 ? 368 LYS A CE    1 
ATOM 4150 N NZ    . LYS E 5 368 ? -24.072 33.610  -11.847 1.00 123.24 ? 368 LYS A NZ    1 
ATOM 4151 N N     . THR E 5 369 ? -27.091 37.631  -17.749 1.00 143.62 ? 369 THR A N     1 
ATOM 4152 C CA    . THR E 5 369 ? -27.682 38.846  -18.310 1.00 149.19 ? 369 THR A CA    1 
ATOM 4153 C C     . THR E 5 369 ? -29.174 38.933  -17.975 1.00 154.27 ? 369 THR A C     1 
ATOM 4154 O O     . THR E 5 369 ? -29.796 37.925  -17.638 1.00 155.61 ? 369 THR A O     1 
ATOM 4155 C CB    . THR E 5 369 ? -27.434 38.976  -19.843 1.00 112.12 ? 369 THR A CB    1 
ATOM 4156 O OG1   . THR E 5 369 ? -28.682 39.108  -20.526 1.00 124.18 ? 369 THR A OG1   1 
ATOM 4157 C CG2   . THR E 5 369 ? -26.721 37.767  -20.386 1.00 105.42 ? 369 THR A CG2   1 
ATOM 4158 N N     . PRO E 5 370 ? -29.752 40.140  -18.043 1.00 156.41 ? 370 PRO A N     1 
ATOM 4159 C CA    . PRO E 5 370 ? -31.178 40.259  -17.738 1.00 159.16 ? 370 PRO A CA    1 
ATOM 4160 C C     . PRO E 5 370 ? -32.007 39.366  -18.645 1.00 160.82 ? 370 PRO A C     1 
ATOM 4161 O O     . PRO E 5 370 ? -33.021 38.819  -18.221 1.00 161.71 ? 370 PRO A O     1 
ATOM 4162 C CB    . PRO E 5 370 ? -31.486 41.721  -18.078 1.00 162.02 ? 370 PRO A CB    1 
ATOM 4163 C CG    . PRO E 5 370 ? -30.439 42.081  -19.091 1.00 161.31 ? 370 PRO A CG    1 
ATOM 4164 C CD    . PRO E 5 370 ? -29.213 41.394  -18.581 1.00 157.46 ? 370 PRO A CD    1 
ATOM 4165 N N     . GLN E 5 371 ? -31.583 39.219  -19.893 1.00 160.34 ? 371 GLN A N     1 
ATOM 4166 C CA    . GLN E 5 371 ? -32.363 38.441  -20.838 1.00 159.48 ? 371 GLN A CA    1 
ATOM 4167 C C     . GLN E 5 371 ? -32.222 36.952  -20.581 1.00 152.92 ? 371 GLN A C     1 
ATOM 4168 O O     . GLN E 5 371 ? -33.201 36.280  -20.285 1.00 154.63 ? 371 GLN A O     1 
ATOM 4169 C CB    . GLN E 5 371 ? -32.031 38.799  -22.284 1.00 162.86 ? 371 GLN A CB    1 
ATOM 4170 C CG    . GLN E 5 371 ? -30.565 38.770  -22.630 1.00 164.36 ? 371 GLN A CG    1 
ATOM 4171 C CD    . GLN E 5 371 ? -30.273 39.610  -23.846 1.00 170.25 ? 371 GLN A CD    1 
ATOM 4172 O OE1   . GLN E 5 371 ? -31.039 40.514  -24.179 1.00 173.54 ? 371 GLN A OE1   1 
ATOM 4173 N NE2   . GLN E 5 371 ? -29.170 39.318  -24.523 1.00 171.38 ? 371 GLN A NE2   1 
ATOM 4174 N N     . ASN E 5 372 ? -31.012 36.427  -20.697 1.00 144.72 ? 372 ASN A N     1 
ATOM 4175 C CA    . ASN E 5 372 ? -30.818 35.010  -20.446 1.00 136.08 ? 372 ASN A CA    1 
ATOM 4176 C C     . ASN E 5 372 ? -31.500 34.594  -19.141 1.00 134.81 ? 372 ASN A C     1 
ATOM 4177 O O     . ASN E 5 372 ? -32.134 33.533  -19.074 1.00 137.42 ? 372 ASN A O     1 
ATOM 4178 C CB    . ASN E 5 372 ? -29.334 34.646  -20.467 1.00 129.91 ? 372 ASN A CB    1 
ATOM 4179 C CG    . ASN E 5 372 ? -28.721 34.797  -21.851 1.00 126.38 ? 372 ASN A CG    1 
ATOM 4180 O OD1   . ASN E 5 372 ? -29.374 35.264  -22.784 1.00 127.73 ? 372 ASN A OD1   1 
ATOM 4181 N ND2   . ASN E 5 372 ? -27.458 34.409  -21.986 1.00 122.50 ? 372 ASN A ND2   1 
ATOM 4182 N N     . ILE E 5 373 ? -31.413 35.441  -18.117 1.00 129.62 ? 373 ILE A N     1 
ATOM 4183 C CA    . ILE E 5 373 ? -32.170 35.183  -16.897 1.00 124.80 ? 373 ILE A CA    1 
ATOM 4184 C C     . ILE E 5 373 ? -33.667 35.210  -17.212 1.00 128.18 ? 373 ILE A C     1 
ATOM 4185 O O     . ILE E 5 373 ? -34.434 34.402  -16.687 1.00 130.41 ? 373 ILE A O     1 
ATOM 4186 C CB    . ILE E 5 373 ? -31.836 36.168  -15.758 1.00 118.26 ? 373 ILE A CB    1 
ATOM 4187 C CG1   . ILE E 5 373 ? -32.247 35.582  -14.410 1.00 112.53 ? 373 ILE A CG1   1 
ATOM 4188 C CG2   . ILE E 5 373 ? -32.549 37.476  -15.952 1.00 120.61 ? 373 ILE A CG2   1 
ATOM 4189 C CD1   . ILE E 5 373 ? -31.550 34.303  -14.076 1.00 110.84 ? 373 ILE A CD1   1 
ATOM 4190 N N     . ALA E 5 374 ? -34.077 36.120  -18.092 1.00 127.91 ? 374 ALA A N     1 
ATOM 4191 C CA    . ALA E 5 374 ? -35.477 36.201  -18.501 1.00 127.66 ? 374 ALA A CA    1 
ATOM 4192 C C     . ALA E 5 374 ? -36.003 34.875  -19.067 1.00 129.92 ? 374 ALA A C     1 
ATOM 4193 O O     . ALA E 5 374 ? -37.059 34.394  -18.654 1.00 131.05 ? 374 ALA A O     1 
ATOM 4194 C CB    . ALA E 5 374 ? -35.677 37.328  -19.507 1.00 126.27 ? 374 ALA A CB    1 
ATOM 4195 N N     . PHE E 5 375 ? -35.272 34.283  -20.009 1.00 130.51 ? 375 PHE A N     1 
ATOM 4196 C CA    . PHE E 5 375 ? -35.749 33.072  -20.675 1.00 129.78 ? 375 PHE A CA    1 
ATOM 4197 C C     . PHE E 5 375 ? -35.552 31.802  -19.856 1.00 129.12 ? 375 PHE A C     1 
ATOM 4198 O O     . PHE E 5 375 ? -36.339 30.863  -19.976 1.00 131.51 ? 375 PHE A O     1 
ATOM 4199 C CB    . PHE E 5 375 ? -35.167 32.930  -22.092 1.00 130.48 ? 375 PHE A CB    1 
ATOM 4200 C CG    . PHE E 5 375 ? -34.008 31.972  -22.198 1.00 125.93 ? 375 PHE A CG    1 
ATOM 4201 C CD1   . PHE E 5 375 ? -34.198 30.668  -22.633 1.00 121.17 ? 375 PHE A CD1   1 
ATOM 4202 C CD2   . PHE E 5 375 ? -32.723 32.388  -21.890 1.00 126.74 ? 375 PHE A CD2   1 
ATOM 4203 C CE1   . PHE E 5 375 ? -33.130 29.798  -22.740 1.00 117.71 ? 375 PHE A CE1   1 
ATOM 4204 C CE2   . PHE E 5 375 ? -31.652 31.519  -21.997 1.00 123.65 ? 375 PHE A CE2   1 
ATOM 4205 C CZ    . PHE E 5 375 ? -31.856 30.224  -22.423 1.00 119.53 ? 375 PHE A CZ    1 
ATOM 4206 N N     . LEU E 5 376 ? -34.512 31.763  -19.025 1.00 124.11 ? 376 LEU A N     1 
ATOM 4207 C CA    . LEU E 5 376 ? -34.357 30.641  -18.098 1.00 120.54 ? 376 LEU A CA    1 
ATOM 4208 C C     . LEU E 5 376 ? -35.553 30.591  -17.159 1.00 127.91 ? 376 LEU A C     1 
ATOM 4209 O O     . LEU E 5 376 ? -35.946 29.522  -16.684 1.00 125.97 ? 376 LEU A O     1 
ATOM 4210 C CB    . LEU E 5 376 ? -33.065 30.778  -17.293 1.00 114.48 ? 376 LEU A CB    1 
ATOM 4211 C CG    . LEU E 5 376 ? -31.783 30.724  -18.122 1.00 111.39 ? 376 LEU A CG    1 
ATOM 4212 C CD1   . LEU E 5 376 ? -30.579 30.549  -17.221 1.00 109.24 ? 376 LEU A CD1   1 
ATOM 4213 C CD2   . LEU E 5 376 ? -31.868 29.597  -19.121 1.00 111.90 ? 376 LEU A CD2   1 
ATOM 4214 N N     . THR E 5 377 ? -36.118 31.769  -16.900 1.00 135.62 ? 377 THR A N     1 
ATOM 4215 C CA    . THR E 5 377 ? -37.234 31.932  -15.974 1.00 135.51 ? 377 THR A CA    1 
ATOM 4216 C C     . THR E 5 377 ? -38.605 31.864  -16.643 1.00 138.73 ? 377 THR A C     1 
ATOM 4217 O O     . THR E 5 377 ? -39.630 31.807  -15.962 1.00 136.95 ? 377 THR A O     1 
ATOM 4218 C CB    . THR E 5 377 ? -37.130 33.277  -15.243 1.00 139.57 ? 377 THR A CB    1 
ATOM 4219 O OG1   . THR E 5 377 ? -35.781 33.484  -14.807 1.00 144.35 ? 377 THR A OG1   1 
ATOM 4220 C CG2   . THR E 5 377 ? -38.062 33.315  -14.041 1.00 143.34 ? 377 THR A CG2   1 
ATOM 4221 N N     . GLY E 5 378 ? -38.626 31.853  -17.971 1.00 144.17 ? 378 GLY A N     1 
ATOM 4222 C CA    . GLY E 5 378 ? -39.879 31.874  -18.701 1.00 153.15 ? 378 GLY A CA    1 
ATOM 4223 C C     . GLY E 5 378 ? -40.595 30.537  -18.683 1.00 161.13 ? 378 GLY A C     1 
ATOM 4224 O O     . GLY E 5 378 ? -40.382 29.721  -17.790 1.00 163.55 ? 378 GLY A O     1 
ATOM 4225 N N     . THR E 5 379 ? -41.463 30.319  -19.664 1.00 166.10 ? 379 THR A N     1 
ATOM 4226 C CA    . THR E 5 379 ? -42.226 29.075  -19.759 1.00 167.64 ? 379 THR A CA    1 
ATOM 4227 C C     . THR E 5 379 ? -41.291 27.859  -19.744 1.00 168.46 ? 379 THR A C     1 
ATOM 4228 O O     . THR E 5 379 ? -40.169 27.927  -20.242 1.00 167.93 ? 379 THR A O     1 
ATOM 4229 C CB    . THR E 5 379 ? -43.078 29.061  -21.045 1.00 168.31 ? 379 THR A CB    1 
ATOM 4230 O OG1   . THR E 5 379 ? -43.959 30.191  -21.052 1.00 170.86 ? 379 THR A OG1   1 
ATOM 4231 C CG2   . THR E 5 379 ? -43.895 27.803  -21.139 1.00 167.00 ? 379 THR A CG2   1 
ATOM 4232 N N     . LEU E 5 380 ? -41.748 26.759  -19.151 1.00 170.40 ? 380 LEU A N     1 
ATOM 4233 C CA    . LEU E 5 380 ? -40.949 25.536  -19.046 1.00 172.65 ? 380 LEU A CA    1 
ATOM 4234 C C     . LEU E 5 380 ? -41.112 24.664  -20.298 1.00 174.16 ? 380 LEU A C     1 
ATOM 4235 O O     . LEU E 5 380 ? -42.179 24.662  -20.914 1.00 178.32 ? 380 LEU A O     1 
ATOM 4236 C CB    . LEU E 5 380 ? -41.367 24.754  -17.800 1.00 171.02 ? 380 LEU A CB    1 
ATOM 4237 C CG    . LEU E 5 380 ? -40.307 23.949  -17.050 1.00 169.56 ? 380 LEU A CG    1 
ATOM 4238 C CD1   . LEU E 5 380 ? -39.112 24.823  -16.716 1.00 168.32 ? 380 LEU A CD1   1 
ATOM 4239 C CD2   . LEU E 5 380 ? -40.907 23.357  -15.790 1.00 170.59 ? 380 LEU A CD2   1 
ATOM 4240 N N     . PRO E 5 381 ? -40.050 23.933  -20.694 1.00 173.93 ? 381 PRO A N     1 
ATOM 4241 C CA    . PRO E 5 381 ? -40.136 23.101  -21.906 1.00 174.38 ? 381 PRO A CA    1 
ATOM 4242 C C     . PRO E 5 381 ? -41.186 22.000  -21.787 1.00 176.32 ? 381 PRO A C     1 
ATOM 4243 O O     . PRO E 5 381 ? -42.004 21.796  -22.682 1.00 177.46 ? 381 PRO A O     1 
ATOM 4244 C CB    . PRO E 5 381 ? -38.723 22.513  -22.036 1.00 171.80 ? 381 PRO A CB    1 
ATOM 4245 C CG    . PRO E 5 381 ? -38.157 22.568  -20.647 1.00 169.05 ? 381 PRO A CG    1 
ATOM 4246 C CD    . PRO E 5 381 ? -38.756 23.779  -20.002 1.00 169.48 ? 381 PRO A CD    1 
ATOM 4247 N N     . LEU E 5 382 ? -41.163 21.304  -20.661 1.00 176.24 ? 382 LEU A N     1 
ATOM 4248 C CA    . LEU E 5 382 ? -42.214 20.361  -20.304 1.00 177.03 ? 382 LEU A CA    1 
ATOM 4249 C C     . LEU E 5 382 ? -42.357 20.402  -18.788 1.00 175.42 ? 382 LEU A C     1 
ATOM 4250 O O     . LEU E 5 382 ? -41.382 20.606  -18.077 1.00 174.76 ? 382 LEU A O     1 
ATOM 4251 C CB    . LEU E 5 382 ? -41.863 18.954  -20.786 1.00 177.52 ? 382 LEU A CB    1 
ATOM 4252 C CG    . LEU E 5 382 ? -42.285 17.749  -19.918 1.00 176.91 ? 382 LEU A CG    1 
ATOM 4253 C CD1   . LEU E 5 382 ? -43.797 17.567  -19.855 1.00 180.25 ? 382 LEU A CD1   1 
ATOM 4254 C CD2   . LEU E 5 382 ? -41.617 16.469  -20.411 1.00 173.67 ? 382 LEU A CD2   1 
ATOM 4255 N N     . ASP E 5 383 ? -43.580 20.259  -18.295 1.00 174.28 ? 383 ASP A N     1 
ATOM 4256 C CA    . ASP E 5 383 ? -43.855 20.380  -16.861 1.00 171.53 ? 383 ASP A CA    1 
ATOM 4257 C C     . ASP E 5 383 ? -42.949 19.460  -16.069 1.00 166.37 ? 383 ASP A C     1 
ATOM 4258 O O     . ASP E 5 383 ? -42.676 18.346  -16.505 1.00 166.39 ? 383 ASP A O     1 
ATOM 4259 C CB    . ASP E 5 383 ? -45.301 19.982  -16.576 1.00 171.97 ? 383 ASP A CB    1 
ATOM 4260 C CG    . ASP E 5 383 ? -46.279 21.084  -16.873 1.00 174.47 ? 383 ASP A CG    1 
ATOM 4261 O OD1   . ASP E 5 383 ? -46.781 21.686  -15.907 1.00 173.61 ? 383 ASP A OD1   1 
ATOM 4262 O OD2   . ASP E 5 383 ? -46.574 21.331  -18.065 1.00 179.49 ? 383 ASP A OD2   1 
ATOM 4263 N N     . ILE E 5 384 ? -42.514 19.916  -14.896 1.00 162.52 ? 384 ILE A N     1 
ATOM 4264 C CA    . ILE E 5 384 ? -41.729 19.085  -13.974 1.00 159.46 ? 384 ILE A CA    1 
ATOM 4265 C C     . ILE E 5 384 ? -42.362 17.716  -13.712 1.00 159.69 ? 384 ILE A C     1 
ATOM 4266 O O     . ILE E 5 384 ? -41.676 16.697  -13.754 1.00 157.21 ? 384 ILE A O     1 
ATOM 4267 C CB    . ILE E 5 384 ? -41.498 19.775  -12.619 1.00 157.47 ? 384 ILE A CB    1 
ATOM 4268 C CG1   . ILE E 5 384 ? -40.562 18.951  -11.741 1.00 154.40 ? 384 ILE A CG1   1 
ATOM 4269 C CG2   . ILE E 5 384 ? -42.820 19.997  -11.902 1.00 157.80 ? 384 ILE A CG2   1 
ATOM 4270 C CD1   . ILE E 5 384 ? -39.172 18.787  -12.317 1.00 151.96 ? 384 ILE A CD1   1 
ATOM 4271 N N     . GLU E 5 385 ? -43.680 17.687  -13.525 1.00 161.21 ? 385 GLU A N     1 
ATOM 4272 C CA    . GLU E 5 385 ? -44.357 16.518  -12.960 1.00 160.10 ? 385 GLU A CA    1 
ATOM 4273 C C     . GLU E 5 385 ? -44.064 15.338  -13.860 1.00 157.86 ? 385 GLU A C     1 
ATOM 4274 O O     . GLU E 5 385 ? -44.444 14.199  -13.576 1.00 159.66 ? 385 GLU A O     1 
ATOM 4275 C CB    . GLU E 5 385 ? -45.862 16.745  -12.840 1.00 163.59 ? 385 GLU A CB    1 
ATOM 4276 C CG    . GLU E 5 385 ? -46.259 17.698  -11.714 1.00 167.18 ? 385 GLU A CG    1 
ATOM 4277 C CD    . GLU E 5 385 ? -46.461 19.102  -12.225 1.00 175.28 ? 385 GLU A CD    1 
ATOM 4278 O OE1   . GLU E 5 385 ? -46.153 19.314  -13.413 1.00 178.61 ? 385 GLU A OE1   1 
ATOM 4279 O OE2   . GLU E 5 385 ? -46.920 19.983  -11.467 1.00 177.89 ? 385 GLU A OE2   1 
ATOM 4280 N N     . SER E 5 386 ? -43.423 15.647  -14.979 1.00 155.10 ? 386 SER A N     1 
ATOM 4281 C CA    . SER E 5 386 ? -42.902 14.647  -15.882 1.00 153.23 ? 386 SER A CA    1 
ATOM 4282 C C     . SER E 5 386 ? -41.585 14.002  -15.388 1.00 144.23 ? 386 SER A C     1 
ATOM 4283 O O     . SER E 5 386 ? -41.412 12.783  -15.507 1.00 140.62 ? 386 SER A O     1 
ATOM 4284 C CB    . SER E 5 386 ? -42.780 15.254  -17.285 1.00 159.23 ? 386 SER A CB    1 
ATOM 4285 O OG    . SER E 5 386 ? -41.550 14.924  -17.913 1.00 161.78 ? 386 SER A OG    1 
ATOM 4286 N N     . GLN E 5 387 ? -40.680 14.796  -14.813 1.00 138.76 ? 387 GLN A N     1 
ATOM 4287 C CA    . GLN E 5 387 ? -39.363 14.278  -14.423 1.00 131.43 ? 387 GLN A CA    1 
ATOM 4288 C C     . GLN E 5 387 ? -39.275 13.745  -12.981 1.00 131.49 ? 387 GLN A C     1 
ATOM 4289 O O     . GLN E 5 387 ? -38.209 13.298  -12.551 1.00 126.74 ? 387 GLN A O     1 
ATOM 4290 C CB    . GLN E 5 387 ? -38.269 15.310  -14.671 1.00 126.49 ? 387 GLN A CB    1 
ATOM 4291 C CG    . GLN E 5 387 ? -37.469 15.149  -15.997 1.00 103.01 ? 387 GLN A CG    1 
ATOM 4292 C CD    . GLN E 5 387 ? -38.319 14.969  -17.259 1.00 106.72 ? 387 GLN A CD    1 
ATOM 4293 O OE1   . GLN E 5 387 ? -39.544 14.879  -17.201 1.00 110.70 ? 387 GLN A OE1   1 
ATOM 4294 N NE2   . GLN E 5 387 ? -37.653 14.904  -18.410 1.00 106.06 ? 387 GLN A NE2   1 
ATOM 4295 N N     . GLU E 5 388 ? -40.398 13.719  -12.267 1.00 139.23 ? 388 GLU A N     1 
ATOM 4296 C CA    . GLU E 5 388 ? -40.437 13.204  -10.893 1.00 142.88 ? 388 GLU A CA    1 
ATOM 4297 C C     . GLU E 5 388 ? -39.659 11.900  -10.729 1.00 143.46 ? 388 GLU A C     1 
ATOM 4298 O O     . GLU E 5 388 ? -38.713 11.805  -9.942  1.00 142.42 ? 388 GLU A O     1 
ATOM 4299 C CB    . GLU E 5 388 ? -41.893 13.035  -10.407 1.00 144.95 ? 388 GLU A CB    1 
ATOM 4300 C CG    . GLU E 5 388 ? -42.679 11.869  -11.031 1.00 146.91 ? 388 GLU A CG    1 
ATOM 4301 C CD    . GLU E 5 388 ? -42.861 12.016  -12.537 1.00 150.89 ? 388 GLU A CD    1 
ATOM 4302 O OE1   . GLU E 5 388 ? -42.265 12.948  -13.109 1.00 153.80 ? 388 GLU A OE1   1 
ATOM 4303 O OE2   . GLU E 5 388 ? -43.602 11.217  -13.153 1.00 154.34 ? 388 GLU A OE2   1 
ATOM 4304 N N     . HIS E 5 389 ? -40.064 10.870  -11.452 1.00 145.28 ? 389 HIS A N     1 
ATOM 4305 C CA    . HIS E 5 389 ? -39.351 9.615   -11.315 1.00 145.92 ? 389 HIS A CA    1 
ATOM 4306 C C     . HIS E 5 389 ? -37.869 9.899   -11.389 1.00 140.31 ? 389 HIS A C     1 
ATOM 4307 O O     . HIS E 5 389 ? -37.095 9.442   -10.557 1.00 138.16 ? 389 HIS A O     1 
ATOM 4308 C CB    . HIS E 5 389 ? -39.683 8.661   -12.455 1.00 150.28 ? 389 HIS A CB    1 
ATOM 4309 C CG    . HIS E 5 389 ? -38.579 8.522   -13.461 1.00 152.17 ? 389 HIS A CG    1 
ATOM 4310 N ND1   . HIS E 5 389 ? -37.788 7.398   -13.545 1.00 151.87 ? 389 HIS A ND1   1 
ATOM 4311 C CD2   . HIS E 5 389 ? -38.148 9.365   -14.427 1.00 153.38 ? 389 HIS A CD2   1 
ATOM 4312 C CE1   . HIS E 5 389 ? -36.910 7.556   -14.521 1.00 151.90 ? 389 HIS A CE1   1 
ATOM 4313 N NE2   . HIS E 5 389 ? -37.107 8.745   -15.071 1.00 152.62 ? 389 HIS A NE2   1 
ATOM 4314 N N     . LEU E 5 390 ? -37.485 10.667  -12.403 1.00 136.59 ? 390 LEU A N     1 
ATOM 4315 C CA    . LEU E 5 390 ? -36.110 10.662  -12.874 1.00 130.44 ? 390 LEU A CA    1 
ATOM 4316 C C     . LEU E 5 390 ? -35.257 11.079  -11.725 1.00 125.57 ? 390 LEU A C     1 
ATOM 4317 O O     . LEU E 5 390 ? -34.257 10.449  -11.415 1.00 120.77 ? 390 LEU A O     1 
ATOM 4318 C CB    . LEU E 5 390 ? -35.937 11.620  -14.057 1.00 132.91 ? 390 LEU A CB    1 
ATOM 4319 C CG    . LEU E 5 390 ? -34.764 11.277  -14.985 1.00 134.27 ? 390 LEU A CG    1 
ATOM 4320 C CD1   . LEU E 5 390 ? -34.649 12.218  -16.195 1.00 135.91 ? 390 LEU A CD1   1 
ATOM 4321 C CD2   . LEU E 5 390 ? -33.431 11.213  -14.247 1.00 135.01 ? 390 LEU A CD2   1 
ATOM 4322 N N     . LEU E 5 391 ? -35.690 12.159  -11.095 1.00 127.65 ? 391 LEU A N     1 
ATOM 4323 C CA    . LEU E 5 391 ? -35.142 12.602  -9.828  1.00 126.21 ? 391 LEU A CA    1 
ATOM 4324 C C     . LEU E 5 391 ? -35.155 11.510  -8.742  1.00 124.31 ? 391 LEU A C     1 
ATOM 4325 O O     . LEU E 5 391 ? -34.180 11.357  -8.018  1.00 123.03 ? 391 LEU A O     1 
ATOM 4326 C CB    . LEU E 5 391 ? -35.849 13.892  -9.370  1.00 128.86 ? 391 LEU A CB    1 
ATOM 4327 C CG    . LEU E 5 391 ? -37.357 14.044  -9.600  1.00 130.22 ? 391 LEU A CG    1 
ATOM 4328 C CD1   . LEU E 5 391 ? -38.059 13.958  -8.267  1.00 132.65 ? 391 LEU A CD1   1 
ATOM 4329 C CD2   . LEU E 5 391 ? -37.741 15.339  -10.306 1.00 132.62 ? 391 LEU A CD2   1 
ATOM 4330 N N     . ALA E 5 392 ? -36.223 10.716  -8.660  1.00 121.81 ? 392 ALA A N     1 
ATOM 4331 C CA    . ALA E 5 392 ? -36.326 9.726   -7.573  1.00 113.99 ? 392 ALA A CA    1 
ATOM 4332 C C     . ALA E 5 392 ? -35.111 8.801   -7.517  1.00 112.00 ? 392 ALA A C     1 
ATOM 4333 O O     . ALA E 5 392 ? -34.863 8.149   -6.505  1.00 118.97 ? 392 ALA A O     1 
ATOM 4334 C CB    . ALA E 5 392 ? -37.599 8.896   -7.705  1.00 109.41 ? 392 ALA A CB    1 
ATOM 4335 N N     . GLN E 5 393 ? -34.361 8.772   -8.613  1.00 105.06 ? 393 GLN A N     1 
ATOM 4336 C CA    . GLN E 5 393 ? -33.398 7.721   -8.900  1.00 101.26 ? 393 GLN A CA    1 
ATOM 4337 C C     . GLN E 5 393 ? -31.988 8.070   -8.444  1.00 98.16  ? 393 GLN A C     1 
ATOM 4338 O O     . GLN E 5 393 ? -31.061 7.320   -8.731  1.00 99.13  ? 393 GLN A O     1 
ATOM 4339 C CB    . GLN E 5 393 ? -33.380 7.457   -10.400 1.00 100.73 ? 393 GLN A CB    1 
ATOM 4340 C CG    . GLN E 5 393 ? -32.708 6.190   -10.882 1.00 99.24  ? 393 GLN A CG    1 
ATOM 4341 C CD    . GLN E 5 393 ? -33.509 5.520   -11.983 1.00 101.92 ? 393 GLN A CD    1 
ATOM 4342 O OE1   . GLN E 5 393 ? -34.437 6.110   -12.521 1.00 106.88 ? 393 GLN A OE1   1 
ATOM 4343 N NE2   . GLN E 5 393 ? -33.180 4.269   -12.294 1.00 102.48 ? 393 GLN A NE2   1 
ATOM 4344 N N     . LEU E 5 394 ? -31.789 9.194   -7.756  1.00 98.51  ? 394 LEU A N     1 
ATOM 4345 C CA    . LEU E 5 394 ? -30.431 9.508   -7.300  1.00 104.15 ? 394 LEU A CA    1 
ATOM 4346 C C     . LEU E 5 394 ? -30.249 9.297   -5.804  1.00 109.91 ? 394 LEU A C     1 
ATOM 4347 O O     . LEU E 5 394 ? -31.217 9.096   -5.065  1.00 110.09 ? 394 LEU A O     1 
ATOM 4348 C CB    . LEU E 5 394 ? -30.024 10.940  -7.701  1.00 108.95 ? 394 LEU A CB    1 
ATOM 4349 C CG    . LEU E 5 394 ? -31.031 12.111  -7.673  1.00 112.18 ? 394 LEU A CG    1 
ATOM 4350 C CD1   . LEU E 5 394 ? -31.916 12.148  -6.416  1.00 114.82 ? 394 LEU A CD1   1 
ATOM 4351 C CD2   . LEU E 5 394 ? -30.337 13.453  -7.879  1.00 111.10 ? 394 LEU A CD2   1 
ATOM 4352 N N     . ILE E 5 395 ? -28.991 9.340   -5.371  1.00 118.43 ? 395 ILE A N     1 
ATOM 4353 C CA    . ILE E 5 395 ? -28.641 9.125   -3.961  1.00 129.65 ? 395 ILE A CA    1 
ATOM 4354 C C     . ILE E 5 395 ? -28.287 10.373  -3.134  1.00 146.17 ? 395 ILE A C     1 
ATOM 4355 O O     . ILE E 5 395 ? -28.030 10.267  -1.931  1.00 150.34 ? 395 ILE A O     1 
ATOM 4356 C CB    . ILE E 5 395 ? -27.567 8.029   -3.783  1.00 127.19 ? 395 ILE A CB    1 
ATOM 4357 C CG1   . ILE E 5 395 ? -26.436 8.216   -4.794  1.00 125.06 ? 395 ILE A CG1   1 
ATOM 4358 C CG2   . ILE E 5 395 ? -28.177 6.657   -4.044  1.00 129.08 ? 395 ILE A CG2   1 
ATOM 4359 C CD1   . ILE E 5 395 ? -26.769 7.646   -6.142  1.00 126.70 ? 395 ILE A CD1   1 
ATOM 4360 N N     . ASP E 5 396 ? -28.266 11.543  -3.770  1.00 154.03 ? 396 ASP A N     1 
ATOM 4361 C CA    . ASP E 5 396 ? -28.093 12.808  -3.055  1.00 158.00 ? 396 ASP A CA    1 
ATOM 4362 C C     . ASP E 5 396 ? -29.214 13.760  -3.445  1.00 168.44 ? 396 ASP A C     1 
ATOM 4363 O O     . ASP E 5 396 ? -29.263 14.253  -4.572  1.00 171.91 ? 396 ASP A O     1 
ATOM 4364 C CB    . ASP E 5 396 ? -26.738 13.441  -3.389  1.00 152.02 ? 396 ASP A CB    1 
ATOM 4365 C CG    . ASP E 5 396 ? -25.612 12.901  -2.531  1.00 147.29 ? 396 ASP A CG    1 
ATOM 4366 O OD1   . ASP E 5 396 ? -25.813 12.747  -1.308  1.00 146.41 ? 396 ASP A OD1   1 
ATOM 4367 O OD2   . ASP E 5 396 ? -24.523 12.634  -3.079  1.00 145.31 ? 396 ASP A OD2   1 
ATOM 4368 N N     . LYS E 5 397 ? -30.100 14.037  -2.497  1.00 174.44 ? 397 LYS A N     1 
ATOM 4369 C CA    . LYS E 5 397 ? -31.167 15.001  -2.715  1.00 181.25 ? 397 LYS A CA    1 
ATOM 4370 C C     . LYS E 5 397 ? -30.575 16.396  -2.591  1.00 184.26 ? 397 LYS A C     1 
ATOM 4371 O O     . LYS E 5 397 ? -29.814 16.676  -1.664  1.00 182.19 ? 397 LYS A O     1 
ATOM 4372 C CB    . LYS E 5 397 ? -32.283 14.810  -1.687  1.00 182.86 ? 397 LYS A CB    1 
ATOM 4373 C CG    . LYS E 5 397 ? -31.901 15.264  -0.289  1.00 183.52 ? 397 LYS A CG    1 
ATOM 4374 C CD    . LYS E 5 397 ? -32.634 14.482  0.788   1.00 184.31 ? 397 LYS A CD    1 
ATOM 4375 C CE    . LYS E 5 397 ? -34.085 14.903  0.910   1.00 185.56 ? 397 LYS A CE    1 
ATOM 4376 N NZ    . LYS E 5 397 ? -34.713 14.294  2.115   1.00 185.39 ? 397 LYS A NZ    1 
ATOM 4377 N N     . THR E 5 398 ? -30.915 17.271  -3.529  1.00 190.25 ? 398 THR A N     1 
ATOM 4378 C CA    . THR E 5 398 ? -30.350 18.614  -3.538  1.00 195.69 ? 398 THR A CA    1 
ATOM 4379 C C     . THR E 5 398 ? -31.115 19.534  -2.595  1.00 201.33 ? 398 THR A C     1 
ATOM 4380 O O     . THR E 5 398 ? -31.966 19.082  -1.825  1.00 202.85 ? 398 THR A O     1 
ATOM 4381 C CB    . THR E 5 398 ? -30.350 19.221  -4.953  1.00 195.66 ? 398 THR A CB    1 
ATOM 4382 O OG1   . THR E 5 398 ? -31.493 20.070  -5.118  1.00 197.08 ? 398 THR A OG1   1 
ATOM 4383 C CG2   . THR E 5 398 ? -30.375 18.123  -6.004  1.00 195.65 ? 398 THR A CG2   1 
ATOM 4384 N N     . GLY E 5 399 ? -30.801 20.825  -2.653  1.00 205.12 ? 399 GLY A N     1 
ATOM 4385 C CA    . GLY E 5 399 ? -31.493 21.815  -1.847  1.00 207.14 ? 399 GLY A CA    1 
ATOM 4386 C C     . GLY E 5 399 ? -32.956 21.910  -2.233  1.00 208.55 ? 399 GLY A C     1 
ATOM 4387 O O     . GLY E 5 399 ? -33.802 22.297  -1.425  1.00 207.78 ? 399 GLY A O     1 
ATOM 4388 N N     . THR E 5 400 ? -33.248 21.556  -3.482  1.00 209.62 ? 400 THR A N     1 
ATOM 4389 C CA    . THR E 5 400 ? -34.618 21.523  -3.979  1.00 209.90 ? 400 THR A CA    1 
ATOM 4390 C C     . THR E 5 400 ? -35.134 20.088  -4.014  1.00 201.76 ? 400 THR A C     1 
ATOM 4391 O O     . THR E 5 400 ? -34.682 19.273  -4.819  1.00 198.56 ? 400 THR A O     1 
ATOM 4392 C CB    . THR E 5 400 ? -34.733 22.145  -5.389  1.00 215.74 ? 400 THR A CB    1 
ATOM 4393 O OG1   . THR E 5 400 ? -33.735 21.580  -6.249  1.00 216.05 ? 400 THR A OG1   1 
ATOM 4394 C CG2   . THR E 5 400 ? -34.549 23.658  -5.326  1.00 218.82 ? 400 THR A CG2   1 
ATOM 4395 N N     . VAL E 5 401 ? -36.083 19.790  -3.134  1.00 199.27 ? 401 VAL A N     1 
ATOM 4396 C CA    . VAL E 5 401 ? -36.651 18.453  -3.038  1.00 197.52 ? 401 VAL A CA    1 
ATOM 4397 C C     . VAL E 5 401 ? -38.100 18.434  -3.522  1.00 195.45 ? 401 VAL A C     1 
ATOM 4398 O O     . VAL E 5 401 ? -38.973 19.062  -2.924  1.00 193.22 ? 401 VAL A O     1 
ATOM 4399 C CB    . VAL E 5 401 ? -36.576 17.912  -1.594  1.00 199.70 ? 401 VAL A CB    1 
ATOM 4400 C CG1   . VAL E 5 401 ? -37.373 16.623  -1.466  1.00 201.69 ? 401 VAL A CG1   1 
ATOM 4401 C CG2   . VAL E 5 401 ? -35.127 17.696  -1.180  1.00 198.60 ? 401 VAL A CG2   1 
ATOM 4402 N N     . SER E 5 402 ? -38.343 17.717  -4.615  1.00 196.15 ? 402 SER A N     1 
ATOM 4403 C CA    . SER E 5 402 ? -39.688 17.563  -5.165  1.00 197.65 ? 402 SER A CA    1 
ATOM 4404 C C     . SER E 5 402 ? -39.877 16.190  -5.803  1.00 200.17 ? 402 SER A C     1 
ATOM 4405 O O     . SER E 5 402 ? -39.521 15.168  -5.217  1.00 201.23 ? 402 SER A O     1 
ATOM 4406 C CB    . SER E 5 402 ? -39.991 18.657  -6.191  1.00 198.18 ? 402 SER A CB    1 
ATOM 4407 O OG    . SER E 5 402 ? -40.470 19.829  -5.558  1.00 199.19 ? 402 SER A OG    1 
ATOM 4408 N N     . MET F 5 1   ? -76.686 23.932  -34.683 1.00 181.34 ? 1   MET D N     1 
ATOM 4409 C CA    . MET F 5 1   ? -78.074 24.101  -35.095 1.00 183.32 ? 1   MET D CA    1 
ATOM 4410 C C     . MET F 5 1   ? -78.297 25.466  -35.739 1.00 186.49 ? 1   MET D C     1 
ATOM 4411 O O     . MET F 5 1   ? -77.368 26.265  -35.866 1.00 187.44 ? 1   MET D O     1 
ATOM 4412 C CB    . MET F 5 1   ? -79.019 23.927  -33.897 1.00 181.65 ? 1   MET D CB    1 
ATOM 4413 C CG    . MET F 5 1   ? -78.876 25.001  -32.806 1.00 179.23 ? 1   MET D CG    1 
ATOM 4414 S SD    . MET F 5 1   ? -79.634 24.655  -31.200 1.00 234.97 ? 1   MET D SD    1 
ATOM 4415 C CE    . MET F 5 1   ? -81.040 23.664  -31.645 1.00 175.19 ? 1   MET D CE    1 
ATOM 4416 N N     . SER F 5 2   ? -79.539 25.724  -36.142 1.00 186.17 ? 2   SER D N     1 
ATOM 4417 C CA    . SER F 5 2   ? -79.934 27.022  -36.689 1.00 184.26 ? 2   SER D CA    1 
ATOM 4418 C C     . SER F 5 2   ? -79.656 28.155  -35.702 1.00 182.49 ? 2   SER D C     1 
ATOM 4419 O O     . SER F 5 2   ? -79.036 29.164  -36.047 1.00 181.55 ? 2   SER D O     1 
ATOM 4420 C CB    . SER F 5 2   ? -81.422 27.018  -37.050 1.00 180.44 ? 2   SER D CB    1 
ATOM 4421 O OG    . SER F 5 2   ? -81.678 26.190  -38.173 1.00 178.71 ? 2   SER D OG    1 
ATOM 4422 N N     . LYS F 5 3   ? -80.118 27.970  -34.468 1.00 180.83 ? 3   LYS D N     1 
ATOM 4423 C CA    . LYS F 5 3   ? -80.002 28.994  -33.435 1.00 179.06 ? 3   LYS D CA    1 
ATOM 4424 C C     . LYS F 5 3   ? -78.673 28.875  -32.683 1.00 177.66 ? 3   LYS D C     1 
ATOM 4425 O O     . LYS F 5 3   ? -78.412 29.606  -31.723 1.00 174.82 ? 3   LYS D O     1 
ATOM 4426 C CB    . LYS F 5 3   ? -81.215 28.977  -32.488 1.00 178.29 ? 3   LYS D CB    1 
ATOM 4427 C CG    . LYS F 5 3   ? -81.181 27.956  -31.366 1.00 178.35 ? 3   LYS D CG    1 
ATOM 4428 C CD    . LYS F 5 3   ? -82.485 27.945  -30.590 1.00 183.16 ? 3   LYS D CD    1 
ATOM 4429 C CE    . LYS F 5 3   ? -83.550 27.188  -31.360 1.00 180.49 ? 3   LYS D CE    1 
ATOM 4430 N NZ    . LYS F 5 3   ? -84.800 26.956  -30.562 1.00 179.50 ? 3   LYS D NZ    1 
ATOM 4431 N N     . LEU F 5 4   ? -77.818 27.963  -33.140 1.00 178.52 ? 4   LEU D N     1 
ATOM 4432 C CA    . LEU F 5 4   ? -76.449 27.939  -32.640 1.00 176.01 ? 4   LEU D CA    1 
ATOM 4433 C C     . LEU F 5 4   ? -75.682 29.111  -33.199 1.00 179.91 ? 4   LEU D C     1 
ATOM 4434 O O     . LEU F 5 4   ? -75.190 29.915  -32.438 1.00 178.46 ? 4   LEU D O     1 
ATOM 4435 C CB    . LEU F 5 4   ? -75.669 26.643  -32.928 1.00 168.76 ? 4   LEU D CB    1 
ATOM 4436 C CG    . LEU F 5 4   ? -74.162 26.910  -32.730 1.00 159.91 ? 4   LEU D CG    1 
ATOM 4437 C CD1   . LEU F 5 4   ? -73.524 26.090  -31.596 1.00 152.17 ? 4   LEU D CD1   1 
ATOM 4438 C CD2   . LEU F 5 4   ? -73.386 26.746  -34.039 1.00 161.30 ? 4   LEU D CD2   1 
ATOM 4439 N N     . ASP F 5 5   ? -75.569 29.203  -34.521 1.00 182.58 ? 5   ASP D N     1 
ATOM 4440 C CA    . ASP F 5 5   ? -74.501 29.995  -35.137 1.00 182.06 ? 5   ASP D CA    1 
ATOM 4441 C C     . ASP F 5 5   ? -74.267 31.358  -34.458 1.00 175.42 ? 5   ASP D C     1 
ATOM 4442 O O     . ASP F 5 5   ? -73.125 31.769  -34.259 1.00 175.68 ? 5   ASP D O     1 
ATOM 4443 C CB    . ASP F 5 5   ? -74.774 30.213  -36.639 1.00 186.02 ? 5   ASP D CB    1 
ATOM 4444 C CG    . ASP F 5 5   ? -74.599 28.946  -37.481 1.00 189.67 ? 5   ASP D CG    1 
ATOM 4445 O OD1   . ASP F 5 5   ? -73.505 28.333  -37.472 1.00 191.91 ? 5   ASP D OD1   1 
ATOM 4446 O OD2   . ASP F 5 5   ? -75.560 28.591  -38.191 1.00 191.11 ? 5   ASP D OD2   1 
ATOM 4447 N N     . SER F 5 6   ? -75.347 32.039  -34.086 1.00 168.77 ? 6   SER D N     1 
ATOM 4448 C CA    . SER F 5 6   ? -75.282 33.367  -33.457 1.00 162.22 ? 6   SER D CA    1 
ATOM 4449 C C     . SER F 5 6   ? -74.386 33.468  -32.216 1.00 156.71 ? 6   SER D C     1 
ATOM 4450 O O     . SER F 5 6   ? -73.873 34.532  -31.898 1.00 156.66 ? 6   SER D O     1 
ATOM 4451 C CB    . SER F 5 6   ? -76.687 33.840  -33.077 1.00 161.75 ? 6   SER D CB    1 
ATOM 4452 O OG    . SER F 5 6   ? -77.179 33.088  -31.986 1.00 161.42 ? 6   SER D OG    1 
ATOM 4453 N N     . LEU F 5 7   ? -74.228 32.364  -31.500 1.00 152.34 ? 7   LEU D N     1 
ATOM 4454 C CA    . LEU F 5 7   ? -73.412 32.320  -30.292 1.00 145.83 ? 7   LEU D CA    1 
ATOM 4455 C C     . LEU F 5 7   ? -71.910 32.090  -30.556 1.00 145.74 ? 7   LEU D C     1 
ATOM 4456 O O     . LEU F 5 7   ? -71.131 32.049  -29.603 1.00 142.24 ? 7   LEU D O     1 
ATOM 4457 C CB    . LEU F 5 7   ? -73.974 31.279  -29.303 1.00 139.19 ? 7   LEU D CB    1 
ATOM 4458 C CG    . LEU F 5 7   ? -73.635 31.484  -27.825 1.00 130.41 ? 7   LEU D CG    1 
ATOM 4459 C CD1   . LEU F 5 7   ? -73.464 32.952  -27.544 1.00 129.54 ? 7   LEU D CD1   1 
ATOM 4460 C CD2   . LEU F 5 7   ? -74.702 30.888  -26.913 1.00 125.68 ? 7   LEU D CD2   1 
ATOM 4461 N N     . LEU F 5 8   ? -71.505 31.910  -31.819 1.00 148.43 ? 8   LEU D N     1 
ATOM 4462 C CA    . LEU F 5 8   ? -70.072 31.915  -32.161 1.00 150.22 ? 8   LEU D CA    1 
ATOM 4463 C C     . LEU F 5 8   ? -69.677 33.282  -32.650 1.00 152.30 ? 8   LEU D C     1 
ATOM 4464 O O     . LEU F 5 8   ? -68.519 33.573  -32.947 1.00 151.48 ? 8   LEU D O     1 
ATOM 4465 C CB    . LEU F 5 8   ? -69.729 30.901  -33.227 1.00 153.01 ? 8   LEU D CB    1 
ATOM 4466 C CG    . LEU F 5 8   ? -69.955 29.539  -32.637 1.00 153.38 ? 8   LEU D CG    1 
ATOM 4467 C CD1   . LEU F 5 8   ? -71.324 29.070  -33.080 1.00 155.97 ? 8   LEU D CD1   1 
ATOM 4468 C CD2   . LEU F 5 8   ? -68.861 28.598  -33.083 1.00 154.14 ? 8   LEU D CD2   1 
ATOM 4469 N N     . LYS F 5 9   ? -70.699 34.109  -32.745 1.00 154.88 ? 9   LYS D N     1 
ATOM 4470 C CA    . LYS F 5 9   ? -70.521 35.522  -32.783 1.00 157.47 ? 9   LYS D CA    1 
ATOM 4471 C C     . LYS F 5 9   ? -69.678 35.960  -31.611 1.00 149.27 ? 9   LYS D C     1 
ATOM 4472 O O     . LYS F 5 9   ? -68.633 36.589  -31.749 1.00 150.74 ? 9   LYS D O     1 
ATOM 4473 C CB    . LYS F 5 9   ? -71.911 36.150  -32.622 1.00 164.68 ? 9   LYS D CB    1 
ATOM 4474 C CG    . LYS F 5 9   ? -71.942 37.449  -33.320 1.00 172.09 ? 9   LYS D CG    1 
ATOM 4475 C CD    . LYS F 5 9   ? -73.101 37.681  -34.205 1.00 176.05 ? 9   LYS D CD    1 
ATOM 4476 C CE    . LYS F 5 9   ? -73.931 38.801  -33.553 1.00 175.36 ? 9   LYS D CE    1 
ATOM 4477 N NZ    . LYS F 5 9   ? -73.707 39.136  -32.042 1.00 166.93 ? 9   LYS D NZ    1 
ATOM 4478 N N     . GLU F 5 10  ? -70.191 35.580  -30.458 1.00 140.94 ? 10  GLU D N     1 
ATOM 4479 C CA    . GLU F 5 10  ? -69.914 36.151  -29.150 1.00 134.68 ? 10  GLU D CA    1 
ATOM 4480 C C     . GLU F 5 10  ? -68.452 36.175  -28.750 1.00 132.36 ? 10  GLU D C     1 
ATOM 4481 O O     . GLU F 5 10  ? -68.057 36.977  -27.910 1.00 133.07 ? 10  GLU D O     1 
ATOM 4482 C CB    . GLU F 5 10  ? -70.732 35.343  -28.123 1.00 133.97 ? 10  GLU D CB    1 
ATOM 4483 C CG    . GLU F 5 10  ? -70.377 35.553  -26.679 1.00 137.37 ? 10  GLU D CG    1 
ATOM 4484 C CD    . GLU F 5 10  ? -70.987 36.821  -26.114 1.00 143.22 ? 10  GLU D CD    1 
ATOM 4485 O OE1   . GLU F 5 10  ? -72.170 37.089  -26.410 1.00 142.91 ? 10  GLU D OE1   1 
ATOM 4486 O OE2   . GLU F 5 10  ? -70.285 37.560  -25.393 1.00 144.39 ? 10  GLU D OE2   1 
ATOM 4487 N N     . LEU F 5 11  ? -67.670 35.293  -29.363 1.00 129.51 ? 11  LEU D N     1 
ATOM 4488 C CA    . LEU F 5 11  ? -66.275 35.041  -28.999 1.00 130.72 ? 11  LEU D CA    1 
ATOM 4489 C C     . LEU F 5 11  ? -65.290 35.782  -29.916 1.00 131.06 ? 11  LEU D C     1 
ATOM 4490 O O     . LEU F 5 11  ? -65.707 36.617  -30.723 1.00 135.96 ? 11  LEU D O     1 
ATOM 4491 C CB    . LEU F 5 11  ? -65.999 33.527  -29.034 1.00 135.15 ? 11  LEU D CB    1 
ATOM 4492 C CG    . LEU F 5 11  ? -66.363 32.751  -30.310 1.00 142.87 ? 11  LEU D CG    1 
ATOM 4493 C CD1   . LEU F 5 11  ? -67.672 31.944  -30.181 1.00 145.59 ? 11  LEU D CD1   1 
ATOM 4494 C CD2   . LEU F 5 11  ? -66.409 33.700  -31.515 1.00 144.22 ? 11  LEU D CD2   1 
ATOM 4495 N N     . PRO F 5 12  ? -63.979 35.521  -29.743 1.00 129.19 ? 12  PRO D N     1 
ATOM 4496 C CA    . PRO F 5 12  ? -62.884 35.814  -30.685 1.00 130.16 ? 12  PRO D CA    1 
ATOM 4497 C C     . PRO F 5 12  ? -63.124 35.192  -32.065 1.00 133.81 ? 12  PRO D C     1 
ATOM 4498 O O     . PRO F 5 12  ? -63.486 34.014  -32.122 1.00 134.40 ? 12  PRO D O     1 
ATOM 4499 C CB    . PRO F 5 12  ? -61.685 35.110  -30.048 1.00 126.63 ? 12  PRO D CB    1 
ATOM 4500 C CG    . PRO F 5 12  ? -61.988 35.037  -28.593 1.00 123.07 ? 12  PRO D CG    1 
ATOM 4501 C CD    . PRO F 5 12  ? -63.478 35.190  -28.398 1.00 123.62 ? 12  PRO D CD    1 
ATOM 4502 N N     . THR F 5 13  ? -62.896 35.940  -33.146 1.00 135.88 ? 13  THR D N     1 
ATOM 4503 C CA    . THR F 5 13  ? -63.069 35.385  -34.487 1.00 137.86 ? 13  THR D CA    1 
ATOM 4504 C C     . THR F 5 13  ? -62.274 34.099  -34.619 1.00 139.10 ? 13  THR D C     1 
ATOM 4505 O O     . THR F 5 13  ? -62.811 33.062  -35.012 1.00 138.85 ? 13  THR D O     1 
ATOM 4506 C CB    . THR F 5 13  ? -62.604 36.340  -35.616 1.00 144.66 ? 13  THR D CB    1 
ATOM 4507 O OG1   . THR F 5 13  ? -61.240 36.725  -35.397 1.00 147.62 ? 13  THR D OG1   1 
ATOM 4508 C CG2   . THR F 5 13  ? -63.487 37.571  -35.694 1.00 142.05 ? 13  THR D CG2   1 
ATOM 4509 N N     . ARG F 5 14  ? -60.991 34.174  -34.278 1.00 139.93 ? 14  ARG D N     1 
ATOM 4510 C CA    . ARG F 5 14  ? -60.098 33.038  -34.434 1.00 142.11 ? 14  ARG D CA    1 
ATOM 4511 C C     . ARG F 5 14  ? -60.597 31.794  -33.697 1.00 137.96 ? 14  ARG D C     1 
ATOM 4512 O O     . ARG F 5 14  ? -60.696 30.706  -34.276 1.00 140.66 ? 14  ARG D O     1 
ATOM 4513 C CB    . ARG F 5 14  ? -58.688 33.396  -33.977 1.00 145.56 ? 14  ARG D CB    1 
ATOM 4514 C CG    . ARG F 5 14  ? -57.675 32.336  -34.346 1.00 149.89 ? 14  ARG D CG    1 
ATOM 4515 C CD    . ARG F 5 14  ? -56.317 32.618  -33.751 1.00 152.19 ? 14  ARG D CD    1 
ATOM 4516 N NE    . ARG F 5 14  ? -55.652 33.748  -34.392 1.00 154.94 ? 14  ARG D NE    1 
ATOM 4517 C CZ    . ARG F 5 14  ? -54.508 34.270  -33.964 1.00 155.44 ? 14  ARG D CZ    1 
ATOM 4518 N NH1   . ARG F 5 14  ? -53.912 33.766  -32.892 1.00 159.22 ? 14  ARG D NH1   1 
ATOM 4519 N NH2   . ARG F 5 14  ? -53.964 35.296  -34.601 1.00 151.72 ? 14  ARG D NH2   1 
ATOM 4520 N N     . THR F 5 15  ? -60.915 31.957  -32.419 1.00 130.09 ? 15  THR D N     1 
ATOM 4521 C CA    . THR F 5 15  ? -61.366 30.840  -31.591 1.00 123.34 ? 15  THR D CA    1 
ATOM 4522 C C     . THR F 5 15  ? -62.818 30.411  -31.901 1.00 120.84 ? 15  THR D C     1 
ATOM 4523 O O     . THR F 5 15  ? -63.255 29.331  -31.504 1.00 117.46 ? 15  THR D O     1 
ATOM 4524 C CB    . THR F 5 15  ? -61.120 31.147  -30.092 1.00 111.93 ? 15  THR D CB    1 
ATOM 4525 O OG1   . THR F 5 15  ? -59.704 31.212  -29.845 1.00 111.35 ? 15  THR D OG1   1 
ATOM 4526 C CG2   . THR F 5 15  ? -61.731 30.075  -29.211 1.00 108.48 ? 15  THR D CG2   1 
ATOM 4527 N N     . ALA F 5 16  ? -63.545 31.255  -32.635 1.00 124.21 ? 16  ALA D N     1 
ATOM 4528 C CA    . ALA F 5 16  ? -64.851 30.877  -33.178 1.00 127.86 ? 16  ALA D CA    1 
ATOM 4529 C C     . ALA F 5 16  ? -64.600 29.918  -34.310 1.00 131.83 ? 16  ALA D C     1 
ATOM 4530 O O     . ALA F 5 16  ? -65.283 28.901  -34.477 1.00 130.51 ? 16  ALA D O     1 
ATOM 4531 C CB    . ALA F 5 16  ? -65.581 32.085  -33.727 1.00 128.74 ? 16  ALA D CB    1 
ATOM 4532 N N     . HIS F 5 17  ? -63.618 30.295  -35.115 1.00 136.37 ? 17  HIS D N     1 
ATOM 4533 C CA    . HIS F 5 17  ? -63.343 29.614  -36.357 1.00 140.15 ? 17  HIS D CA    1 
ATOM 4534 C C     . HIS F 5 17  ? -62.792 28.218  -36.095 1.00 134.93 ? 17  HIS D C     1 
ATOM 4535 O O     . HIS F 5 17  ? -63.279 27.223  -36.648 1.00 137.80 ? 17  HIS D O     1 
ATOM 4536 C CB    . HIS F 5 17  ? -62.360 30.430  -37.187 1.00 145.62 ? 17  HIS D CB    1 
ATOM 4537 C CG    . HIS F 5 17  ? -61.905 29.715  -38.412 1.00 152.12 ? 17  HIS D CG    1 
ATOM 4538 N ND1   . HIS F 5 17  ? -62.639 28.700  -38.987 1.00 153.93 ? 17  HIS D ND1   1 
ATOM 4539 C CD2   . HIS F 5 17  ? -60.784 29.839  -39.157 1.00 156.03 ? 17  HIS D CD2   1 
ATOM 4540 C CE1   . HIS F 5 17  ? -61.997 28.239  -40.043 1.00 156.74 ? 17  HIS D CE1   1 
ATOM 4541 N NE2   . HIS F 5 17  ? -60.867 28.912  -40.168 1.00 158.38 ? 17  HIS D NE2   1 
ATOM 4542 N N     . LEU F 5 18  ? -61.774 28.160  -35.246 1.00 124.50 ? 18  LEU D N     1 
ATOM 4543 C CA    . LEU F 5 18  ? -61.199 26.898  -34.812 1.00 115.31 ? 18  LEU D CA    1 
ATOM 4544 C C     . LEU F 5 18  ? -62.288 25.919  -34.343 1.00 108.90 ? 18  LEU D C     1 
ATOM 4545 O O     . LEU F 5 18  ? -62.274 24.737  -34.716 1.00 107.99 ? 18  LEU D O     1 
ATOM 4546 C CB    . LEU F 5 18  ? -60.147 27.182  -33.735 1.00 109.80 ? 18  LEU D CB    1 
ATOM 4547 C CG    . LEU F 5 18  ? -59.578 26.133  -32.778 1.00 106.22 ? 18  LEU D CG    1 
ATOM 4548 C CD1   . LEU F 5 18  ? -60.248 26.229  -31.411 1.00 99.96  ? 18  LEU D CD1   1 
ATOM 4549 C CD2   . LEU F 5 18  ? -59.670 24.735  -33.348 1.00 110.08 ? 18  LEU D CD2   1 
ATOM 4550 N N     . TYR F 5 19  ? -63.242 26.409  -33.552 1.00 107.97 ? 19  TYR D N     1 
ATOM 4551 C CA    . TYR F 5 19  ? -64.369 25.579  -33.130 1.00 108.97 ? 19  TYR D CA    1 
ATOM 4552 C C     . TYR F 5 19  ? -65.227 25.172  -34.318 1.00 119.09 ? 19  TYR D C     1 
ATOM 4553 O O     . TYR F 5 19  ? -65.646 24.023  -34.409 1.00 119.85 ? 19  TYR D O     1 
ATOM 4554 C CB    . TYR F 5 19  ? -65.257 26.290  -32.109 1.00 101.91 ? 19  TYR D CB    1 
ATOM 4555 C CG    . TYR F 5 19  ? -64.659 26.452  -30.732 1.00 94.41  ? 19  TYR D CG    1 
ATOM 4556 C CD1   . TYR F 5 19  ? -63.333 26.139  -30.480 1.00 90.65  ? 19  TYR D CD1   1 
ATOM 4557 C CD2   . TYR F 5 19  ? -65.433 26.917  -29.680 1.00 92.35  ? 19  TYR D CD2   1 
ATOM 4558 C CE1   . TYR F 5 19  ? -62.792 26.292  -29.220 1.00 87.84  ? 19  TYR D CE1   1 
ATOM 4559 C CE2   . TYR F 5 19  ? -64.904 27.072  -28.420 1.00 90.80  ? 19  TYR D CE2   1 
ATOM 4560 C CZ    . TYR F 5 19  ? -63.582 26.758  -28.193 1.00 89.34  ? 19  TYR D CZ    1 
ATOM 4561 O OH    . TYR F 5 19  ? -63.053 26.917  -26.932 1.00 89.12  ? 19  TYR D OH    1 
ATOM 4562 N N     . ARG F 5 20  ? -65.505 26.119  -35.214 1.00 128.63 ? 20  ARG D N     1 
ATOM 4563 C CA    . ARG F 5 20  ? -66.289 25.816  -36.411 1.00 133.20 ? 20  ARG D CA    1 
ATOM 4564 C C     . ARG F 5 20  ? -65.715 24.584  -37.116 1.00 133.21 ? 20  ARG D C     1 
ATOM 4565 O O     . ARG F 5 20  ? -66.438 23.627  -37.407 1.00 136.35 ? 20  ARG D O     1 
ATOM 4566 C CB    . ARG F 5 20  ? -66.349 27.019  -37.367 1.00 137.60 ? 20  ARG D CB    1 
ATOM 4567 C CG    . ARG F 5 20  ? -67.438 28.042  -37.047 1.00 137.28 ? 20  ARG D CG    1 
ATOM 4568 C CD    . ARG F 5 20  ? -67.794 28.885  -38.274 1.00 144.90 ? 20  ARG D CD    1 
ATOM 4569 N NE    . ARG F 5 20  ? -67.461 30.300  -38.111 1.00 150.52 ? 20  ARG D NE    1 
ATOM 4570 C CZ    . ARG F 5 20  ? -66.402 30.892  -38.657 1.00 162.02 ? 20  ARG D CZ    1 
ATOM 4571 N NH1   . ARG F 5 20  ? -65.562 30.199  -39.413 1.00 171.18 ? 20  ARG D NH1   1 
ATOM 4572 N NH2   . ARG F 5 20  ? -66.181 32.181  -38.449 1.00 163.58 ? 20  ARG D NH2   1 
ATOM 4573 N N     . SER F 5 21  ? -64.407 24.600  -37.360 1.00 127.38 ? 21  SER D N     1 
ATOM 4574 C CA    . SER F 5 21  ? -63.741 23.463  -37.996 1.00 120.90 ? 21  SER D CA    1 
ATOM 4575 C C     . SER F 5 21  ? -63.807 22.174  -37.163 1.00 119.16 ? 21  SER D C     1 
ATOM 4576 O O     . SER F 5 21  ? -64.194 21.121  -37.687 1.00 122.09 ? 21  SER D O     1 
ATOM 4577 C CB    . SER F 5 21  ? -62.291 23.802  -38.348 1.00 119.90 ? 21  SER D CB    1 
ATOM 4578 O OG    . SER F 5 21  ? -61.589 24.267  -37.212 1.00 117.41 ? 21  SER D OG    1 
ATOM 4579 N N     . ILE F 5 22  ? -63.426 22.245  -35.883 1.00 112.03 ? 22  ILE D N     1 
ATOM 4580 C CA    . ILE F 5 22  ? -63.501 21.057  -35.019 1.00 108.12 ? 22  ILE D CA    1 
ATOM 4581 C C     . ILE F 5 22  ? -64.875 20.435  -35.137 1.00 109.82 ? 22  ILE D C     1 
ATOM 4582 O O     . ILE F 5 22  ? -65.018 19.225  -35.267 1.00 107.38 ? 22  ILE D O     1 
ATOM 4583 C CB    . ILE F 5 22  ? -63.273 21.373  -33.527 1.00 98.76  ? 22  ILE D CB    1 
ATOM 4584 C CG1   . ILE F 5 22  ? -61.796 21.646  -33.251 1.00 95.72  ? 22  ILE D CG1   1 
ATOM 4585 C CG2   . ILE F 5 22  ? -63.768 20.222  -32.659 1.00 93.92  ? 22  ILE D CG2   1 
ATOM 4586 C CD1   . ILE F 5 22  ? -60.864 20.642  -33.881 1.00 96.54  ? 22  ILE D CD1   1 
ATOM 4587 N N     . TRP F 5 23  ? -65.888 21.285  -35.083 1.00 115.35 ? 23  TRP D N     1 
ATOM 4588 C CA    . TRP F 5 23  ? -67.253 20.848  -35.253 1.00 121.27 ? 23  TRP D CA    1 
ATOM 4589 C C     . TRP F 5 23  ? -67.388 20.122  -36.577 1.00 128.07 ? 23  TRP D C     1 
ATOM 4590 O O     . TRP F 5 23  ? -67.756 18.955  -36.600 1.00 130.32 ? 23  TRP D O     1 
ATOM 4591 C CB    . TRP F 5 23  ? -68.207 22.039  -35.213 1.00 121.37 ? 23  TRP D CB    1 
ATOM 4592 C CG    . TRP F 5 23  ? -69.624 21.649  -35.426 1.00 123.26 ? 23  TRP D CG    1 
ATOM 4593 C CD1   . TRP F 5 23  ? -70.374 21.859  -36.544 1.00 127.68 ? 23  TRP D CD1   1 
ATOM 4594 C CD2   . TRP F 5 23  ? -70.465 20.958  -34.500 1.00 124.01 ? 23  TRP D CD2   1 
ATOM 4595 N NE1   . TRP F 5 23  ? -71.638 21.350  -36.367 1.00 129.09 ? 23  TRP D NE1   1 
ATOM 4596 C CE2   . TRP F 5 23  ? -71.719 20.791  -35.119 1.00 127.17 ? 23  TRP D CE2   1 
ATOM 4597 C CE3   . TRP F 5 23  ? -70.282 20.464  -33.205 1.00 122.10 ? 23  TRP D CE3   1 
ATOM 4598 C CZ2   . TRP F 5 23  ? -72.784 20.153  -34.488 1.00 127.87 ? 23  TRP D CZ2   1 
ATOM 4599 C CZ3   . TRP F 5 23  ? -71.339 19.831  -32.579 1.00 122.65 ? 23  TRP D CZ3   1 
ATOM 4600 C CH2   . TRP F 5 23  ? -72.574 19.681  -33.221 1.00 125.04 ? 23  TRP D CH2   1 
ATOM 4601 N N     . HIS F 5 24  ? -67.064 20.794  -37.678 1.00 132.51 ? 24  HIS D N     1 
ATOM 4602 C CA    . HIS F 5 24  ? -67.287 20.197  -38.992 1.00 137.38 ? 24  HIS D CA    1 
ATOM 4603 C C     . HIS F 5 24  ? -66.696 18.796  -39.078 1.00 144.48 ? 24  HIS D C     1 
ATOM 4604 O O     . HIS F 5 24  ? -67.383 17.840  -39.460 1.00 149.97 ? 24  HIS D O     1 
ATOM 4605 C CB    . HIS F 5 24  ? -66.703 21.053  -40.108 1.00 137.84 ? 24  HIS D CB    1 
ATOM 4606 C CG    . HIS F 5 24  ? -67.038 20.546  -41.475 1.00 141.64 ? 24  HIS D CG    1 
ATOM 4607 N ND1   . HIS F 5 24  ? -68.199 20.895  -42.128 1.00 144.87 ? 24  HIS D ND1   1 
ATOM 4608 C CD2   . HIS F 5 24  ? -66.383 19.694  -42.300 1.00 144.13 ? 24  HIS D CD2   1 
ATOM 4609 C CE1   . HIS F 5 24  ? -68.238 20.294  -43.305 1.00 150.55 ? 24  HIS D CE1   1 
ATOM 4610 N NE2   . HIS F 5 24  ? -67.147 19.560  -43.433 1.00 149.53 ? 24  HIS D NE2   1 
ATOM 4611 N N     . LYS F 5 25  ? -65.416 18.681  -38.735 1.00 143.06 ? 25  LYS D N     1 
ATOM 4612 C CA    . LYS F 5 25  ? -64.782 17.374  -38.667 1.00 138.99 ? 25  LYS D CA    1 
ATOM 4613 C C     . LYS F 5 25  ? -65.678 16.474  -37.889 1.00 134.92 ? 25  LYS D C     1 
ATOM 4614 O O     . LYS F 5 25  ? -66.242 15.536  -38.410 1.00 136.56 ? 25  LYS D O     1 
ATOM 4615 C CB    . LYS F 5 25  ? -63.470 17.426  -37.891 1.00 134.22 ? 25  LYS D CB    1 
ATOM 4616 C CG    . LYS F 5 25  ? -62.278 17.865  -38.677 1.00 132.20 ? 25  LYS D CG    1 
ATOM 4617 C CD    . LYS F 5 25  ? -62.642 19.054  -39.520 1.00 131.13 ? 25  LYS D CD    1 
ATOM 4618 C CE    . LYS F 5 25  ? -61.476 19.534  -40.336 1.00 132.17 ? 25  LYS D CE    1 
ATOM 4619 N NZ    . LYS F 5 25  ? -61.991 20.418  -41.412 1.00 133.02 ? 25  LYS D NZ    1 
ATOM 4620 N N     . TYR F 5 26  ? -65.792 16.787  -36.613 1.00 130.27 ? 26  TYR D N     1 
ATOM 4621 C CA    . TYR F 5 26  ? -66.392 15.879  -35.675 1.00 127.59 ? 26  TYR D CA    1 
ATOM 4622 C C     . TYR F 5 26  ? -67.734 15.344  -36.210 1.00 129.74 ? 26  TYR D C     1 
ATOM 4623 O O     . TYR F 5 26  ? -67.920 14.118  -36.283 1.00 133.83 ? 26  TYR D O     1 
ATOM 4624 C CB    . TYR F 5 26  ? -66.456 16.533  -34.293 1.00 123.19 ? 26  TYR D CB    1 
ATOM 4625 C CG    . TYR F 5 26  ? -67.128 15.705  -33.212 1.00 120.04 ? 26  TYR D CG    1 
ATOM 4626 C CD1   . TYR F 5 26  ? -66.554 14.541  -32.696 1.00 118.29 ? 26  TYR D CD1   1 
ATOM 4627 C CD2   . TYR F 5 26  ? -68.342 16.119  -32.702 1.00 119.40 ? 26  TYR D CD2   1 
ATOM 4628 C CE1   . TYR F 5 26  ? -67.201 13.812  -31.685 1.00 115.87 ? 26  TYR D CE1   1 
ATOM 4629 C CE2   . TYR F 5 26  ? -69.008 15.424  -31.730 1.00 115.69 ? 26  TYR D CE2   1 
ATOM 4630 C CZ    . TYR F 5 26  ? -68.440 14.272  -31.206 1.00 112.83 ? 26  TYR D CZ    1 
ATOM 4631 O OH    . TYR F 5 26  ? -69.091 13.580  -30.230 1.00 107.48 ? 26  TYR D OH    1 
ATOM 4632 N N     . THR F 5 27  ? -68.618 16.228  -36.683 1.00 129.14 ? 27  THR D N     1 
ATOM 4633 C CA    . THR F 5 27  ? -69.900 15.786  -37.274 1.00 130.50 ? 27  THR D CA    1 
ATOM 4634 C C     . THR F 5 27  ? -69.830 14.948  -38.565 1.00 134.89 ? 27  THR D C     1 
ATOM 4635 O O     . THR F 5 27  ? -70.556 13.935  -38.729 1.00 134.95 ? 27  THR D O     1 
ATOM 4636 C CB    . THR F 5 27  ? -70.944 16.926  -37.420 1.00 137.36 ? 27  THR D CB    1 
ATOM 4637 O OG1   . THR F 5 27  ? -70.454 17.936  -38.310 1.00 141.30 ? 27  THR D OG1   1 
ATOM 4638 C CG2   . THR F 5 27  ? -71.259 17.533  -36.064 1.00 133.28 ? 27  THR D CG2   1 
ATOM 4639 N N     . GLU F 5 28  ? -68.951 15.379  -39.463 1.00 140.89 ? 28  GLU D N     1 
ATOM 4640 C CA    . GLU F 5 28  ? -68.644 14.652  -40.686 1.00 149.68 ? 28  GLU D CA    1 
ATOM 4641 C C     . GLU F 5 28  ? -68.082 13.258  -40.390 1.00 153.17 ? 28  GLU D C     1 
ATOM 4642 O O     . GLU F 5 28  ? -68.164 12.351  -41.221 1.00 156.54 ? 28  GLU D O     1 
ATOM 4643 C CB    . GLU F 5 28  ? -67.652 15.463  -41.515 1.00 155.36 ? 28  GLU D CB    1 
ATOM 4644 C CG    . GLU F 5 28  ? -68.278 16.200  -42.686 1.00 162.08 ? 28  GLU D CG    1 
ATOM 4645 C CD    . GLU F 5 28  ? -69.579 16.908  -42.339 1.00 166.13 ? 28  GLU D CD    1 
ATOM 4646 O OE1   . GLU F 5 28  ? -70.413 17.064  -43.255 1.00 169.14 ? 28  GLU D OE1   1 
ATOM 4647 O OE2   . GLU F 5 28  ? -69.772 17.315  -41.172 1.00 166.08 ? 28  GLU D OE2   1 
ATOM 4648 N N     . TRP F 5 29  ? -67.502 13.103  -39.203 1.00 150.73 ? 29  TRP D N     1 
ATOM 4649 C CA    . TRP F 5 29  ? -67.067 11.806  -38.712 1.00 148.24 ? 29  TRP D CA    1 
ATOM 4650 C C     . TRP F 5 29  ? -68.255 11.003  -38.210 1.00 150.12 ? 29  TRP D C     1 
ATOM 4651 O O     . TRP F 5 29  ? -68.342 9.812   -38.510 1.00 153.94 ? 29  TRP D O     1 
ATOM 4652 C CB    . TRP F 5 29  ? -66.032 11.950  -37.593 1.00 143.79 ? 29  TRP D CB    1 
ATOM 4653 C CG    . TRP F 5 29  ? -65.607 10.650  -36.951 1.00 140.28 ? 29  TRP D CG    1 
ATOM 4654 C CD1   . TRP F 5 29  ? -64.815 9.686   -37.502 1.00 141.63 ? 29  TRP D CD1   1 
ATOM 4655 C CD2   . TRP F 5 29  ? -65.925 10.194  -35.627 1.00 136.39 ? 29  TRP D CD2   1 
ATOM 4656 N NE1   . TRP F 5 29  ? -64.633 8.654   -36.610 1.00 140.91 ? 29  TRP D NE1   1 
ATOM 4657 C CE2   . TRP F 5 29  ? -65.304 8.944   -35.450 1.00 137.38 ? 29  TRP D CE2   1 
ATOM 4658 C CE3   . TRP F 5 29  ? -66.678 10.722  -34.576 1.00 132.70 ? 29  TRP D CE3   1 
ATOM 4659 C CZ2   . TRP F 5 29  ? -65.415 8.210   -34.268 1.00 133.67 ? 29  TRP D CZ2   1 
ATOM 4660 C CZ3   . TRP F 5 29  ? -66.792 9.992   -33.403 1.00 130.64 ? 29  TRP D CZ3   1 
ATOM 4661 C CH2   . TRP F 5 29  ? -66.162 8.753   -33.258 1.00 131.08 ? 29  TRP D CH2   1 
ATOM 4662 N N     . LEU F 5 30  ? -69.161 11.639  -37.453 1.00 149.42 ? 30  LEU D N     1 
ATOM 4663 C CA    . LEU F 5 30  ? -70.310 10.917  -36.850 1.00 153.01 ? 30  LEU D CA    1 
ATOM 4664 C C     . LEU F 5 30  ? -71.272 10.377  -37.882 1.00 158.88 ? 30  LEU D C     1 
ATOM 4665 O O     . LEU F 5 30  ? -72.083 9.487   -37.590 1.00 158.56 ? 30  LEU D O     1 
ATOM 4666 C CB    . LEU F 5 30  ? -71.161 11.806  -35.938 1.00 154.07 ? 30  LEU D CB    1 
ATOM 4667 C CG    . LEU F 5 30  ? -70.507 12.747  -34.952 1.00 156.72 ? 30  LEU D CG    1 
ATOM 4668 C CD1   . LEU F 5 30  ? -69.158 12.211  -34.704 1.00 158.04 ? 30  LEU D CD1   1 
ATOM 4669 C CD2   . LEU F 5 30  ? -70.480 14.181  -35.377 1.00 159.37 ? 30  LEU D CD2   1 
ATOM 4670 N N     . LYS F 5 31  ? -71.248 10.958  -39.073 1.00 165.29 ? 31  LYS D N     1 
ATOM 4671 C CA    . LYS F 5 31  ? -72.074 10.365  -40.115 1.00 170.91 ? 31  LYS D CA    1 
ATOM 4672 C C     . LYS F 5 31  ? -71.769 8.873   -40.149 1.00 174.06 ? 31  LYS D C     1 
ATOM 4673 O O     . LYS F 5 31  ? -72.657 8.047   -40.344 1.00 174.28 ? 31  LYS D O     1 
ATOM 4674 C CB    . LYS F 5 31  ? -71.842 11.038  -41.467 1.00 174.69 ? 31  LYS D CB    1 
ATOM 4675 C CG    . LYS F 5 31  ? -72.442 12.433  -41.534 1.00 176.83 ? 31  LYS D CG    1 
ATOM 4676 C CD    . LYS F 5 31  ? -73.180 12.759  -40.242 1.00 176.18 ? 31  LYS D CD    1 
ATOM 4677 C CE    . LYS F 5 31  ? -74.175 13.881  -40.425 1.00 177.86 ? 31  LYS D CE    1 
ATOM 4678 N NZ    . LYS F 5 31  ? -75.508 13.469  -39.904 1.00 177.03 ? 31  LYS D NZ    1 
ATOM 4679 N N     . THR F 5 32  ? -70.508 8.557   -39.875 1.00 177.30 ? 32  THR D N     1 
ATOM 4680 C CA    . THR F 5 32  ? -69.972 7.204   -39.921 1.00 181.00 ? 32  THR D CA    1 
ATOM 4681 C C     . THR F 5 32  ? -70.640 6.236   -38.938 1.00 184.93 ? 32  THR D C     1 
ATOM 4682 O O     . THR F 5 32  ? -70.458 5.028   -39.045 1.00 182.49 ? 32  THR D O     1 
ATOM 4683 C CB    . THR F 5 32  ? -68.435 7.227   -39.704 1.00 169.13 ? 32  THR D CB    1 
ATOM 4684 O OG1   . THR F 5 32  ? -67.802 7.753   -40.876 1.00 172.78 ? 32  THR D OG1   1 
ATOM 4685 C CG2   . THR F 5 32  ? -67.890 5.845   -39.424 1.00 168.83 ? 32  THR D CG2   1 
ATOM 4686 N N     . MET F 5 33  ? -71.438 6.753   -38.008 1.00 192.51 ? 33  MET D N     1 
ATOM 4687 C CA    . MET F 5 33  ? -72.084 5.902   -37.003 1.00 200.83 ? 33  MET D CA    1 
ATOM 4688 C C     . MET F 5 33  ? -73.612 5.941   -37.145 1.00 203.21 ? 33  MET D C     1 
ATOM 4689 O O     . MET F 5 33  ? -74.154 6.871   -37.740 1.00 204.15 ? 33  MET D O     1 
ATOM 4690 C CB    . MET F 5 33  ? -71.647 6.315   -35.594 1.00 202.01 ? 33  MET D CB    1 
ATOM 4691 C CG    . MET F 5 33  ? -70.140 6.474   -35.435 1.00 204.66 ? 33  MET D CG    1 
ATOM 4692 S SD    . MET F 5 33  ? -69.218 5.083   -36.112 1.00 302.12 ? 33  MET D SD    1 
ATOM 4693 C CE    . MET F 5 33  ? -67.536 5.660   -35.918 1.00 93.74  ? 33  MET D CE    1 
ATOM 4694 N N     . PRO F 5 34  ? -74.309 4.926   -36.609 1.00 203.79 ? 34  PRO D N     1 
ATOM 4695 C CA    . PRO F 5 34  ? -75.748 4.736   -36.848 1.00 205.70 ? 34  PRO D CA    1 
ATOM 4696 C C     . PRO F 5 34  ? -76.645 5.934   -36.517 1.00 209.34 ? 34  PRO D C     1 
ATOM 4697 O O     . PRO F 5 34  ? -77.526 6.264   -37.314 1.00 208.89 ? 34  PRO D O     1 
ATOM 4698 C CB    . PRO F 5 34  ? -76.099 3.545   -35.947 1.00 201.50 ? 34  PRO D CB    1 
ATOM 4699 C CG    . PRO F 5 34  ? -74.976 3.438   -34.967 1.00 198.61 ? 34  PRO D CG    1 
ATOM 4700 C CD    . PRO F 5 34  ? -73.764 3.910   -35.694 1.00 200.56 ? 34  PRO D CD    1 
ATOM 4701 N N     . ASP F 5 35  ? -76.424 6.571   -35.369 1.00 213.63 ? 35  ASP D N     1 
ATOM 4702 C CA    . ASP F 5 35  ? -77.279 7.672   -34.933 1.00 216.25 ? 35  ASP D CA    1 
ATOM 4703 C C     . ASP F 5 35  ? -76.610 8.510   -33.851 1.00 218.52 ? 35  ASP D C     1 
ATOM 4704 O O     . ASP F 5 35  ? -76.887 9.699   -33.730 1.00 220.21 ? 35  ASP D O     1 
ATOM 4705 C CB    . ASP F 5 35  ? -78.632 7.143   -34.435 1.00 212.11 ? 35  ASP D CB    1 
ATOM 4706 C CG    . ASP F 5 35  ? -79.634 8.254   -34.166 1.00 207.05 ? 35  ASP D CG    1 
ATOM 4707 O OD1   . ASP F 5 35  ? -79.438 9.373   -34.680 1.00 206.53 ? 35  ASP D OD1   1 
ATOM 4708 O OD2   . ASP F 5 35  ? -80.627 8.009   -33.448 1.00 203.55 ? 35  ASP D OD2   1 
ATOM 4709 N N     . ASP F 5 40  ? -82.584 14.934  -31.373 1.00 220.60 ? 40  ASP D N     1 
ATOM 4710 C CA    . ASP F 5 40  ? -81.432 14.935  -32.282 1.00 223.18 ? 40  ASP D CA    1 
ATOM 4711 C C     . ASP F 5 40  ? -80.347 15.977  -31.926 1.00 217.26 ? 40  ASP D C     1 
ATOM 4712 O O     . ASP F 5 40  ? -79.678 16.481  -32.815 1.00 217.41 ? 40  ASP D O     1 
ATOM 4713 C CB    . ASP F 5 40  ? -81.904 15.147  -33.734 1.00 232.87 ? 40  ASP D CB    1 
ATOM 4714 C CG    . ASP F 5 40  ? -80.800 14.907  -34.766 1.00 242.43 ? 40  ASP D CG    1 
ATOM 4715 O OD1   . ASP F 5 40  ? -80.030 15.847  -35.055 1.00 246.56 ? 40  ASP D OD1   1 
ATOM 4716 O OD2   . ASP F 5 40  ? -80.708 13.782  -35.303 1.00 244.50 ? 40  ASP D OD2   1 
ATOM 4717 N N     . LEU F 5 41  ? -80.170 16.328  -30.652 1.00 212.27 ? 41  LEU D N     1 
ATOM 4718 C CA    . LEU F 5 41  ? -79.135 17.318  -30.339 1.00 208.62 ? 41  LEU D CA    1 
ATOM 4719 C C     . LEU F 5 41  ? -78.094 16.951  -29.288 1.00 205.58 ? 41  LEU D C     1 
ATOM 4720 O O     . LEU F 5 41  ? -76.973 16.554  -29.612 1.00 209.41 ? 41  LEU D O     1 
ATOM 4721 C CB    . LEU F 5 41  ? -79.767 18.650  -29.920 1.00 204.04 ? 41  LEU D CB    1 
ATOM 4722 C CG    . LEU F 5 41  ? -80.686 19.467  -30.798 1.00 202.39 ? 41  LEU D CG    1 
ATOM 4723 C CD1   . LEU F 5 41  ? -81.837 18.633  -31.323 1.00 201.85 ? 41  LEU D CD1   1 
ATOM 4724 C CD2   . LEU F 5 41  ? -81.222 20.621  -29.977 1.00 200.51 ? 41  LEU D CD2   1 
ATOM 4725 N N     . LYS F 5 42  ? -78.486 17.061  -28.022 1.00 198.46 ? 42  LYS D N     1 
ATOM 4726 C CA    . LYS F 5 42  ? -77.521 16.957  -26.930 1.00 190.31 ? 42  LYS D CA    1 
ATOM 4727 C C     . LYS F 5 42  ? -77.040 15.533  -26.804 1.00 186.56 ? 42  LYS D C     1 
ATOM 4728 O O     . LYS F 5 42  ? -75.961 15.262  -26.273 1.00 186.59 ? 42  LYS D O     1 
ATOM 4729 C CB    . LYS F 5 42  ? -78.139 17.411  -25.589 1.00 183.98 ? 42  LYS D CB    1 
ATOM 4730 C CG    . LYS F 5 42  ? -78.721 18.793  -25.543 1.00 177.73 ? 42  LYS D CG    1 
ATOM 4731 C CD    . LYS F 5 42  ? -80.098 18.781  -24.884 1.00 172.61 ? 42  LYS D CD    1 
ATOM 4732 C CE    . LYS F 5 42  ? -81.172 18.195  -25.806 1.00 170.59 ? 42  LYS D CE    1 
ATOM 4733 N NZ    . LYS F 5 42  ? -80.946 16.763  -26.169 1.00 170.06 ? 42  LYS D NZ    1 
ATOM 4734 N N     . LEU F 5 43  ? -77.891 14.632  -27.268 1.00 182.84 ? 43  LEU D N     1 
ATOM 4735 C CA    . LEU F 5 43  ? -77.554 13.237  -27.359 1.00 177.20 ? 43  LEU D CA    1 
ATOM 4736 C C     . LEU F 5 43  ? -76.242 13.249  -27.990 1.00 181.32 ? 43  LEU D C     1 
ATOM 4737 O O     . LEU F 5 43  ? -75.271 12.660  -27.531 1.00 181.72 ? 43  LEU D O     1 
ATOM 4738 C CB    . LEU F 5 43  ? -78.448 12.587  -28.383 1.00 167.90 ? 43  LEU D CB    1 
ATOM 4739 C CG    . LEU F 5 43  ? -79.133 13.561  -29.343 1.00 159.12 ? 43  LEU D CG    1 
ATOM 4740 C CD1   . LEU F 5 43  ? -79.180 13.023  -30.767 1.00 160.72 ? 43  LEU D CD1   1 
ATOM 4741 C CD2   . LEU F 5 43  ? -80.532 13.850  -28.827 1.00 157.58 ? 43  LEU D CD2   1 
ATOM 4742 N N     . PHE F 5 44  ? -76.204 13.975  -29.087 1.00 183.67 ? 44  PHE D N     1 
ATOM 4743 C CA    . PHE F 5 44  ? -75.061 13.744  -29.911 1.00 184.49 ? 44  PHE D CA    1 
ATOM 4744 C C     . PHE F 5 44  ? -73.720 14.010  -29.237 1.00 177.16 ? 44  PHE D C     1 
ATOM 4745 O O     . PHE F 5 44  ? -72.727 13.434  -29.662 1.00 181.58 ? 44  PHE D O     1 
ATOM 4746 C CB    . PHE F 5 44  ? -75.039 14.354  -31.289 1.00 190.18 ? 44  PHE D CB    1 
ATOM 4747 C CG    . PHE F 5 44  ? -73.781 14.085  -31.903 1.00 194.48 ? 44  PHE D CG    1 
ATOM 4748 C CD1   . PHE F 5 44  ? -73.439 12.775  -32.138 1.00 196.94 ? 44  PHE D CD1   1 
ATOM 4749 C CD2   . PHE F 5 44  ? -72.843 15.073  -32.033 1.00 197.11 ? 44  PHE D CD2   1 
ATOM 4750 C CE1   . PHE F 5 44  ? -72.248 12.497  -32.615 1.00 200.97 ? 44  PHE D CE1   1 
ATOM 4751 C CE2   . PHE F 5 44  ? -71.661 14.772  -32.507 1.00 203.52 ? 44  PHE D CE2   1 
ATOM 4752 C CZ    . PHE F 5 44  ? -71.363 13.486  -32.780 1.00 206.53 ? 44  PHE D CZ    1 
ATOM 4753 N N     . LEU F 5 45  ? -73.671 14.859  -28.207 1.00 164.94 ? 45  LEU D N     1 
ATOM 4754 C CA    . LEU F 5 45  ? -72.454 14.976  -27.383 1.00 155.59 ? 45  LEU D CA    1 
ATOM 4755 C C     . LEU F 5 45  ? -72.549 14.075  -26.161 1.00 146.54 ? 45  LEU D C     1 
ATOM 4756 O O     . LEU F 5 45  ? -73.332 14.326  -25.243 1.00 144.64 ? 45  LEU D O     1 
ATOM 4757 C CB    . LEU F 5 45  ? -72.191 16.422  -26.946 1.00 154.24 ? 45  LEU D CB    1 
ATOM 4758 C CG    . LEU F 5 45  ? -71.979 17.350  -28.138 1.00 159.05 ? 45  LEU D CG    1 
ATOM 4759 C CD1   . LEU F 5 45  ? -71.546 18.740  -27.711 1.00 157.37 ? 45  LEU D CD1   1 
ATOM 4760 C CD2   . LEU F 5 45  ? -70.962 16.726  -29.086 1.00 164.19 ? 45  LEU D CD2   1 
ATOM 4761 N N     . SER F 5 46  ? -71.740 13.021  -26.174 1.00 141.11 ? 46  SER D N     1 
ATOM 4762 C CA    . SER F 5 46  ? -71.672 12.057  -25.090 1.00 133.46 ? 46  SER D CA    1 
ATOM 4763 C C     . SER F 5 46  ? -70.223 11.645  -24.966 1.00 129.00 ? 46  SER D C     1 
ATOM 4764 O O     . SER F 5 46  ? -69.520 11.533  -25.970 1.00 130.24 ? 46  SER D O     1 
ATOM 4765 C CB    . SER F 5 46  ? -72.535 10.834  -25.396 1.00 132.38 ? 46  SER D CB    1 
ATOM 4766 O OG    . SER F 5 46  ? -72.532 9.929   -24.306 1.00 132.26 ? 46  SER D OG    1 
ATOM 4767 N N     . GLN F 5 47  ? -69.779 11.417  -23.736 1.00 125.81 ? 47  GLN D N     1 
ATOM 4768 C CA    . GLN F 5 47  ? -68.391 11.070  -23.490 1.00 127.81 ? 47  GLN D CA    1 
ATOM 4769 C C     . GLN F 5 47  ? -67.947 9.986   -24.465 1.00 130.28 ? 47  GLN D C     1 
ATOM 4770 O O     . GLN F 5 47  ? -66.850 10.046  -25.021 1.00 131.94 ? 47  GLN D O     1 
ATOM 4771 C CB    . GLN F 5 47  ? -68.226 10.580  -22.053 1.00 128.03 ? 47  GLN D CB    1 
ATOM 4772 C CG    . GLN F 5 47  ? -68.698 11.569  -21.005 1.00 129.37 ? 47  GLN D CG    1 
ATOM 4773 C CD    . GLN F 5 47  ? -68.731 10.957  -19.621 1.00 133.14 ? 47  GLN D CD    1 
ATOM 4774 O OE1   . GLN F 5 47  ? -68.971 9.760   -19.468 1.00 143.02 ? 47  GLN D OE1   1 
ATOM 4775 N NE2   . GLN F 5 47  ? -68.482 11.773  -18.604 1.00 128.97 ? 47  GLN D NE2   1 
ATOM 4776 N N     . LYS F 5 48  ? -68.822 9.014   -24.695 1.00 129.97 ? 48  LYS D N     1 
ATOM 4777 C CA    . LYS F 5 48  ? -68.512 7.895   -25.573 1.00 128.42 ? 48  LYS D CA    1 
ATOM 4778 C C     . LYS F 5 48  ? -67.978 8.373   -26.929 1.00 127.65 ? 48  LYS D C     1 
ATOM 4779 O O     . LYS F 5 48  ? -66.867 8.020   -27.330 1.00 128.34 ? 48  LYS D O     1 
ATOM 4780 C CB    . LYS F 5 48  ? -69.768 7.042   -25.792 1.00 126.46 ? 48  LYS D CB    1 
ATOM 4781 C CG    . LYS F 5 48  ? -70.817 7.154   -24.689 1.00 120.59 ? 48  LYS D CG    1 
ATOM 4782 C CD    . LYS F 5 48  ? -72.207 6.789   -25.208 1.00 117.86 ? 48  LYS D CD    1 
ATOM 4783 C CE    . LYS F 5 48  ? -72.170 5.533   -26.071 1.00 118.50 ? 48  LYS D CE    1 
ATOM 4784 N NZ    . LYS F 5 48  ? -73.529 5.068   -26.474 1.00 119.29 ? 48  LYS D NZ    1 
ATOM 4785 N N     . TYR F 5 49  ? -68.764 9.199   -27.615 1.00 126.54 ? 49  TYR D N     1 
ATOM 4786 C CA    . TYR F 5 49  ? -68.470 9.578   -28.996 1.00 128.87 ? 49  TYR D CA    1 
ATOM 4787 C C     . TYR F 5 49  ? -67.265 10.502  -29.101 1.00 123.64 ? 49  TYR D C     1 
ATOM 4788 O O     . TYR F 5 49  ? -66.448 10.385  -30.020 1.00 124.77 ? 49  TYR D O     1 
ATOM 4789 C CB    . TYR F 5 49  ? -69.694 10.235  -29.638 1.00 135.95 ? 49  TYR D CB    1 
ATOM 4790 C CG    . TYR F 5 49  ? -70.964 9.431   -29.480 1.00 144.82 ? 49  TYR D CG    1 
ATOM 4791 C CD1   . TYR F 5 49  ? -71.192 8.293   -30.249 1.00 151.70 ? 49  TYR D CD1   1 
ATOM 4792 C CD2   . TYR F 5 49  ? -71.933 9.803   -28.558 1.00 147.69 ? 49  TYR D CD2   1 
ATOM 4793 C CE1   . TYR F 5 49  ? -72.353 7.546   -30.106 1.00 154.66 ? 49  TYR D CE1   1 
ATOM 4794 C CE2   . TYR F 5 49  ? -73.099 9.066   -28.407 1.00 151.94 ? 49  TYR D CE2   1 
ATOM 4795 C CZ    . TYR F 5 49  ? -73.303 7.938   -29.183 1.00 155.17 ? 49  TYR D CZ    1 
ATOM 4796 O OH    . TYR F 5 49  ? -74.458 7.202   -29.036 1.00 155.63 ? 49  TYR D OH    1 
ATOM 4797 N N     . ILE F 5 50  ? -67.164 11.425  -28.152 1.00 117.29 ? 50  ILE D N     1 
ATOM 4798 C CA    . ILE F 5 50  ? -66.059 12.371  -28.116 1.00 112.83 ? 50  ILE D CA    1 
ATOM 4799 C C     . ILE F 5 50  ? -64.742 11.640  -27.879 1.00 110.96 ? 50  ILE D C     1 
ATOM 4800 O O     . ILE F 5 50  ? -63.756 11.877  -28.580 1.00 111.32 ? 50  ILE D O     1 
ATOM 4801 C CB    . ILE F 5 50  ? -66.263 13.429  -27.012 1.00 111.12 ? 50  ILE D CB    1 
ATOM 4802 C CG1   . ILE F 5 50  ? -67.636 14.095  -27.140 1.00 112.86 ? 50  ILE D CG1   1 
ATOM 4803 C CG2   . ILE F 5 50  ? -65.168 14.483  -27.064 1.00 109.03 ? 50  ILE D CG2   1 
ATOM 4804 C CD1   . ILE F 5 50  ? -67.869 15.214  -26.132 1.00 111.68 ? 50  ILE D CD1   1 
ATOM 4805 N N     . VAL F 5 51  ? -64.741 10.749  -26.889 1.00 108.46 ? 51  VAL D N     1 
ATOM 4806 C CA    . VAL F 5 51  ? -63.572 9.932   -26.552 1.00 109.19 ? 51  VAL D CA    1 
ATOM 4807 C C     . VAL F 5 51  ? -63.159 9.009   -27.709 1.00 108.09 ? 51  VAL D C     1 
ATOM 4808 O O     . VAL F 5 51  ? -61.972 8.909   -28.057 1.00 109.91 ? 51  VAL D O     1 
ATOM 4809 C CB    . VAL F 5 51  ? -63.839 9.087   -25.281 1.00 109.92 ? 51  VAL D CB    1 
ATOM 4810 C CG1   . VAL F 5 51  ? -62.667 8.156   -24.980 1.00 111.98 ? 51  VAL D CG1   1 
ATOM 4811 C CG2   . VAL F 5 51  ? -64.133 9.992   -24.091 1.00 106.34 ? 51  VAL D CG2   1 
ATOM 4812 N N     . LYS F 5 52  ? -64.139 8.338   -28.304 1.00 102.87 ? 52  LYS D N     1 
ATOM 4813 C CA    . LYS F 5 52  ? -63.871 7.510   -29.468 1.00 101.54 ? 52  LYS D CA    1 
ATOM 4814 C C     . LYS F 5 52  ? -63.190 8.332   -30.555 1.00 102.26 ? 52  LYS D C     1 
ATOM 4815 O O     . LYS F 5 52  ? -62.140 7.954   -31.066 1.00 100.49 ? 52  LYS D O     1 
ATOM 4816 C CB    . LYS F 5 52  ? -65.163 6.880   -30.000 1.00 106.06 ? 52  LYS D CB    1 
ATOM 4817 C CG    . LYS F 5 52  ? -64.954 6.011   -31.239 1.00 112.37 ? 52  LYS D CG    1 
ATOM 4818 C CD    . LYS F 5 52  ? -66.026 4.938   -31.410 1.00 115.40 ? 52  LYS D CD    1 
ATOM 4819 C CE    . LYS F 5 52  ? -65.762 4.120   -32.665 1.00 122.20 ? 52  LYS D CE    1 
ATOM 4820 N NZ    . LYS F 5 52  ? -64.373 3.577   -32.677 1.00 128.70 ? 52  LYS D NZ    1 
ATOM 4821 N N     . TYR F 5 53  ? -63.794 9.468   -30.889 1.00 107.20 ? 53  TYR D N     1 
ATOM 4822 C CA    . TYR F 5 53  ? -63.249 10.386  -31.891 1.00 111.86 ? 53  TYR D CA    1 
ATOM 4823 C C     . TYR F 5 53  ? -61.806 10.813  -31.629 1.00 110.16 ? 53  TYR D C     1 
ATOM 4824 O O     . TYR F 5 53  ? -60.937 10.694  -32.495 1.00 108.73 ? 53  TYR D O     1 
ATOM 4825 C CB    . TYR F 5 53  ? -64.115 11.637  -31.962 1.00 114.84 ? 53  TYR D CB    1 
ATOM 4826 C CG    . TYR F 5 53  ? -63.587 12.675  -32.918 1.00 119.91 ? 53  TYR D CG    1 
ATOM 4827 C CD1   . TYR F 5 53  ? -62.867 13.771  -32.461 1.00 118.82 ? 53  TYR D CD1   1 
ATOM 4828 C CD2   . TYR F 5 53  ? -63.803 12.555  -34.282 1.00 125.36 ? 53  TYR D CD2   1 
ATOM 4829 C CE1   . TYR F 5 53  ? -62.384 14.725  -33.340 1.00 122.56 ? 53  TYR D CE1   1 
ATOM 4830 C CE2   . TYR F 5 53  ? -63.328 13.500  -35.165 1.00 128.83 ? 53  TYR D CE2   1 
ATOM 4831 C CZ    . TYR F 5 53  ? -62.619 14.582  -34.692 1.00 126.94 ? 53  TYR D CZ    1 
ATOM 4832 O OH    . TYR F 5 53  ? -62.147 15.514  -35.585 1.00 128.86 ? 53  TYR D OH    1 
ATOM 4833 N N     . ILE F 5 54  ? -61.571 11.339  -30.433 1.00 110.77 ? 54  ILE D N     1 
ATOM 4834 C CA    . ILE F 5 54  ? -60.251 11.817  -30.051 1.00 114.68 ? 54  ILE D CA    1 
ATOM 4835 C C     . ILE F 5 54  ? -59.185 10.729  -30.110 1.00 113.56 ? 54  ILE D C     1 
ATOM 4836 O O     . ILE F 5 54  ? -58.110 10.942  -30.674 1.00 111.58 ? 54  ILE D O     1 
ATOM 4837 C CB    . ILE F 5 54  ? -60.276 12.427  -28.641 1.00 116.89 ? 54  ILE D CB    1 
ATOM 4838 C CG1   . ILE F 5 54  ? -61.129 13.699  -28.643 1.00 116.90 ? 54  ILE D CG1   1 
ATOM 4839 C CG2   . ILE F 5 54  ? -58.859 12.710  -28.159 1.00 119.17 ? 54  ILE D CG2   1 
ATOM 4840 C CD1   . ILE F 5 54  ? -61.240 14.382  -27.296 1.00 114.42 ? 54  ILE D CD1   1 
ATOM 4841 N N     . ALA F 5 55  ? -59.479 9.568   -29.528 1.00 114.71 ? 55  ALA D N     1 
ATOM 4842 C CA    . ALA F 5 55  ? -58.493 8.489   -29.479 1.00 116.99 ? 55  ALA D CA    1 
ATOM 4843 C C     . ALA F 5 55  ? -58.266 7.845   -30.843 1.00 119.16 ? 55  ALA D C     1 
ATOM 4844 O O     . ALA F 5 55  ? -57.159 7.400   -31.152 1.00 118.02 ? 55  ALA D O     1 
ATOM 4845 C CB    . ALA F 5 55  ? -58.895 7.438   -28.460 1.00 115.36 ? 55  ALA D CB    1 
ATOM 4846 N N     . SER F 5 56  ? -59.316 7.805   -31.657 1.00 122.37 ? 56  SER D N     1 
ATOM 4847 C CA    . SER F 5 56  ? -59.263 7.095   -32.932 1.00 126.49 ? 56  SER D CA    1 
ATOM 4848 C C     . SER F 5 56  ? -58.545 7.889   -34.016 1.00 129.38 ? 56  SER D C     1 
ATOM 4849 O O     . SER F 5 56  ? -58.291 7.380   -35.106 1.00 132.32 ? 56  SER D O     1 
ATOM 4850 C CB    . SER F 5 56  ? -60.670 6.710   -33.403 1.00 125.64 ? 56  SER D CB    1 
ATOM 4851 O OG    . SER F 5 56  ? -61.451 7.853   -33.699 1.00 123.75 ? 56  SER D OG    1 
ATOM 4852 N N     . HIS F 5 57  ? -58.219 9.138   -33.713 1.00 128.11 ? 57  HIS D N     1 
ATOM 4853 C CA    . HIS F 5 57  ? -57.525 9.984   -34.668 1.00 129.64 ? 57  HIS D CA    1 
ATOM 4854 C C     . HIS F 5 57  ? -56.163 10.374  -34.104 1.00 135.10 ? 57  HIS D C     1 
ATOM 4855 O O     . HIS F 5 57  ? -56.090 11.097  -33.115 1.00 133.16 ? 57  HIS D O     1 
ATOM 4856 C CB    . HIS F 5 57  ? -58.358 11.234  -34.964 1.00 126.66 ? 57  HIS D CB    1 
ATOM 4857 C CG    . HIS F 5 57  ? -59.656 10.953  -35.659 1.00 127.62 ? 57  HIS D CG    1 
ATOM 4858 N ND1   . HIS F 5 57  ? -60.517 9.955   -35.255 1.00 129.65 ? 57  HIS D ND1   1 
ATOM 4859 C CD2   . HIS F 5 57  ? -60.241 11.545  -36.725 1.00 128.14 ? 57  HIS D CD2   1 
ATOM 4860 C CE1   . HIS F 5 57  ? -61.575 9.942   -36.047 1.00 130.61 ? 57  HIS D CE1   1 
ATOM 4861 N NE2   . HIS F 5 57  ? -61.432 10.897  -36.949 1.00 129.58 ? 57  HIS D NE2   1 
ATOM 4862 N N     . ASP F 5 58  ? -55.088 9.892   -34.723 1.00 143.84 ? 58  ASP D N     1 
ATOM 4863 C CA    . ASP F 5 58  ? -53.738 10.203  -34.259 1.00 150.97 ? 58  ASP D CA    1 
ATOM 4864 C C     . ASP F 5 58  ? -53.491 11.707  -34.278 1.00 154.13 ? 58  ASP D C     1 
ATOM 4865 O O     . ASP F 5 58  ? -52.886 12.283  -33.356 1.00 154.32 ? 58  ASP D O     1 
ATOM 4866 C CB    . ASP F 5 58  ? -52.695 9.510   -35.134 1.00 158.05 ? 58  ASP D CB    1 
ATOM 4867 C CG    . ASP F 5 58  ? -51.282 9.762   -34.653 1.00 166.11 ? 58  ASP D CG    1 
ATOM 4868 O OD1   . ASP F 5 58  ? -50.398 10.015  -35.500 1.00 172.52 ? 58  ASP D OD1   1 
ATOM 4869 O OD2   . ASP F 5 58  ? -51.056 9.705   -33.423 1.00 167.88 ? 58  ASP D OD2   1 
ATOM 4870 N N     . ASP F 5 59  ? -53.968 12.332  -35.347 1.00 154.14 ? 59  ASP D N     1 
ATOM 4871 C CA    . ASP F 5 59  ? -53.877 13.774  -35.522 1.00 150.24 ? 59  ASP D CA    1 
ATOM 4872 C C     . ASP F 5 59  ? -54.302 14.499  -34.252 1.00 142.13 ? 59  ASP D C     1 
ATOM 4873 O O     . ASP F 5 59  ? -53.497 15.163  -33.607 1.00 142.10 ? 59  ASP D O     1 
ATOM 4874 C CB    . ASP F 5 59  ? -54.744 14.213  -36.712 1.00 153.56 ? 59  ASP D CB    1 
ATOM 4875 C CG    . ASP F 5 59  ? -55.697 13.111  -37.193 1.00 157.23 ? 59  ASP D CG    1 
ATOM 4876 O OD1   . ASP F 5 59  ? -55.957 12.138  -36.441 1.00 157.23 ? 59  ASP D OD1   1 
ATOM 4877 O OD2   . ASP F 5 59  ? -56.202 13.224  -38.330 1.00 160.71 ? 59  ASP D OD2   1 
ATOM 4878 N N     . ILE F 5 60  ? -55.573 14.342  -33.897 1.00 135.76 ? 60  ILE D N     1 
ATOM 4879 C CA    . ILE F 5 60  ? -56.123 14.856  -32.645 1.00 126.97 ? 60  ILE D CA    1 
ATOM 4880 C C     . ILE F 5 60  ? -55.376 14.303  -31.424 1.00 126.83 ? 60  ILE D C     1 
ATOM 4881 O O     . ILE F 5 60  ? -54.877 15.059  -30.590 1.00 126.60 ? 60  ILE D O     1 
ATOM 4882 C CB    . ILE F 5 60  ? -57.600 14.433  -32.449 1.00 117.82 ? 60  ILE D CB    1 
ATOM 4883 C CG1   . ILE F 5 60  ? -58.403 14.429  -33.754 1.00 113.39 ? 60  ILE D CG1   1 
ATOM 4884 C CG2   . ILE F 5 60  ? -58.255 15.256  -31.359 1.00 114.87 ? 60  ILE D CG2   1 
ATOM 4885 C CD1   . ILE F 5 60  ? -58.406 15.729  -34.523 1.00 110.49 ? 60  ILE D CD1   1 
ATOM 4886 N N     . ALA F 5 61  ? -55.276 12.974  -31.349 1.00 126.03 ? 61  ALA D N     1 
ATOM 4887 C CA    . ALA F 5 61  ? -54.781 12.294  -30.152 1.00 122.95 ? 61  ALA D CA    1 
ATOM 4888 C C     . ALA F 5 61  ? -53.485 12.917  -29.649 1.00 124.58 ? 61  ALA D C     1 
ATOM 4889 O O     . ALA F 5 61  ? -53.278 13.060  -28.443 1.00 123.78 ? 61  ALA D O     1 
ATOM 4890 C CB    . ALA F 5 61  ? -54.589 10.814  -30.419 1.00 121.41 ? 61  ALA D CB    1 
ATOM 4891 N N     . LYS F 5 62  ? -52.613 13.290  -30.579 1.00 128.59 ? 62  LYS D N     1 
ATOM 4892 C CA    . LYS F 5 62  ? -51.394 14.008  -30.209 1.00 131.11 ? 62  LYS D CA    1 
ATOM 4893 C C     . LYS F 5 62  ? -51.664 15.410  -29.633 1.00 133.68 ? 62  LYS D C     1 
ATOM 4894 O O     . LYS F 5 62  ? -50.902 15.907  -28.802 1.00 137.08 ? 62  LYS D O     1 
ATOM 4895 C CB    . LYS F 5 62  ? -50.453 14.106  -31.407 1.00 132.21 ? 62  LYS D CB    1 
ATOM 4896 C CG    . LYS F 5 62  ? -49.922 12.774  -31.885 1.00 133.10 ? 62  LYS D CG    1 
ATOM 4897 C CD    . LYS F 5 62  ? -48.743 12.992  -32.805 1.00 136.18 ? 62  LYS D CD    1 
ATOM 4898 C CE    . LYS F 5 62  ? -49.093 14.003  -33.882 1.00 140.67 ? 62  LYS D CE    1 
ATOM 4899 N NZ    . LYS F 5 62  ? -47.889 14.503  -34.604 1.00 144.34 ? 62  LYS D NZ    1 
ATOM 4900 N N     . ASP F 5 63  ? -52.740 16.052  -30.079 1.00 132.15 ? 63  ASP D N     1 
ATOM 4901 C CA    . ASP F 5 63  ? -53.090 17.374  -29.572 1.00 126.72 ? 63  ASP D CA    1 
ATOM 4902 C C     . ASP F 5 63  ? -54.589 17.474  -29.312 1.00 122.35 ? 63  ASP D C     1 
ATOM 4903 O O     . ASP F 5 63  ? -55.304 18.184  -30.020 1.00 123.13 ? 63  ASP D O     1 
ATOM 4904 C CB    . ASP F 5 63  ? -52.635 18.458  -30.547 1.00 131.15 ? 63  ASP D CB    1 
ATOM 4905 C CG    . ASP F 5 63  ? -52.860 19.855  -30.007 1.00 135.87 ? 63  ASP D CG    1 
ATOM 4906 O OD1   . ASP F 5 63  ? -53.126 19.985  -28.793 1.00 135.76 ? 63  ASP D OD1   1 
ATOM 4907 O OD2   . ASP F 5 63  ? -52.763 20.824  -30.792 1.00 139.80 ? 63  ASP D OD2   1 
ATOM 4908 N N     . PRO F 5 64  ? -55.062 16.766  -28.275 1.00 116.44 ? 64  PRO D N     1 
ATOM 4909 C CA    . PRO F 5 64  ? -56.476 16.598  -27.922 1.00 113.09 ? 64  PRO D CA    1 
ATOM 4910 C C     . PRO F 5 64  ? -57.109 17.881  -27.362 1.00 110.34 ? 64  PRO D C     1 
ATOM 4911 O O     . PRO F 5 64  ? -58.316 18.065  -27.472 1.00 111.73 ? 64  PRO D O     1 
ATOM 4912 C CB    . PRO F 5 64  ? -56.431 15.546  -26.807 1.00 108.44 ? 64  PRO D CB    1 
ATOM 4913 C CG    . PRO F 5 64  ? -55.023 15.063  -26.743 1.00 109.28 ? 64  PRO D CG    1 
ATOM 4914 C CD    . PRO F 5 64  ? -54.183 16.161  -27.264 1.00 112.36 ? 64  PRO D CD    1 
ATOM 4915 N N     . LEU F 5 65  ? -56.288 18.752  -26.785 1.00 106.42 ? 65  LEU D N     1 
ATOM 4916 C CA    . LEU F 5 65  ? -56.762 19.874  -25.985 1.00 99.55  ? 65  LEU D CA    1 
ATOM 4917 C C     . LEU F 5 65  ? -57.750 20.868  -26.626 1.00 99.81  ? 65  LEU D C     1 
ATOM 4918 O O     . LEU F 5 65  ? -58.821 21.158  -26.061 1.00 95.68  ? 65  LEU D O     1 
ATOM 4919 C CB    . LEU F 5 65  ? -55.568 20.622  -25.383 1.00 95.43  ? 65  LEU D CB    1 
ATOM 4920 C CG    . LEU F 5 65  ? -55.290 20.234  -23.935 1.00 93.13  ? 65  LEU D CG    1 
ATOM 4921 C CD1   . LEU F 5 65  ? -54.100 20.995  -23.362 1.00 93.13  ? 65  LEU D CD1   1 
ATOM 4922 C CD2   . LEU F 5 65  ? -56.522 20.447  -23.059 1.00 89.33  ? 65  LEU D CD2   1 
ATOM 4923 N N     . PRO F 5 66  ? -57.390 21.408  -27.800 1.00 107.12 ? 66  PRO D N     1 
ATOM 4924 C CA    . PRO F 5 66  ? -58.334 22.333  -28.454 1.00 111.66 ? 66  PRO D CA    1 
ATOM 4925 C C     . PRO F 5 66  ? -59.718 21.717  -28.659 1.00 109.63 ? 66  PRO D C     1 
ATOM 4926 O O     . PRO F 5 66  ? -60.740 22.365  -28.479 1.00 109.02 ? 66  PRO D O     1 
ATOM 4927 C CB    . PRO F 5 66  ? -57.637 22.673  -29.788 1.00 116.40 ? 66  PRO D CB    1 
ATOM 4928 C CG    . PRO F 5 66  ? -56.618 21.565  -30.010 1.00 116.35 ? 66  PRO D CG    1 
ATOM 4929 C CD    . PRO F 5 66  ? -56.265 20.999  -28.672 1.00 110.90 ? 66  PRO D CD    1 
ATOM 4930 N N     . THR F 5 67  ? -59.706 20.462  -29.076 1.00 108.05 ? 67  THR D N     1 
ATOM 4931 C CA    . THR F 5 67  ? -60.908 19.663  -29.218 1.00 106.13 ? 67  THR D CA    1 
ATOM 4932 C C     . THR F 5 67  ? -61.710 19.549  -27.923 1.00 108.67 ? 67  THR D C     1 
ATOM 4933 O O     . THR F 5 67  ? -62.911 19.808  -27.892 1.00 110.98 ? 67  THR D O     1 
ATOM 4934 C CB    . THR F 5 67  ? -60.528 18.246  -29.615 1.00 100.11 ? 67  THR D CB    1 
ATOM 4935 O OG1   . THR F 5 67  ? -59.599 18.318  -30.701 1.00 99.39  ? 67  THR D OG1   1 
ATOM 4936 C CG2   . THR F 5 67  ? -61.758 17.447  -29.974 1.00 99.00  ? 67  THR D CG2   1 
ATOM 4937 N N     . CYS F 5 68  ? -61.032 19.151  -26.852 1.00 109.42 ? 68  CYS D N     1 
ATOM 4938 C CA    . CYS F 5 68  ? -61.659 18.972  -25.543 1.00 108.98 ? 68  CYS D CA    1 
ATOM 4939 C C     . CYS F 5 68  ? -62.369 20.248  -25.084 1.00 109.39 ? 68  CYS D C     1 
ATOM 4940 O O     . CYS F 5 68  ? -63.546 20.213  -24.708 1.00 108.84 ? 68  CYS D O     1 
ATOM 4941 C CB    . CYS F 5 68  ? -60.613 18.534  -24.513 1.00 107.94 ? 68  CYS D CB    1 
ATOM 4942 S SG    . CYS F 5 68  ? -60.002 16.836  -24.733 1.00 104.43 ? 68  CYS D SG    1 
ATOM 4943 N N     . ASP F 5 69  ? -61.656 21.373  -25.132 1.00 110.89 ? 69  ASP D N     1 
ATOM 4944 C CA    . ASP F 5 69  ? -62.250 22.670  -24.806 1.00 114.84 ? 69  ASP D CA    1 
ATOM 4945 C C     . ASP F 5 69  ? -63.440 23.022  -25.696 1.00 115.99 ? 69  ASP D C     1 
ATOM 4946 O O     . ASP F 5 69  ? -64.511 23.382  -25.209 1.00 115.86 ? 69  ASP D O     1 
ATOM 4947 C CB    . ASP F 5 69  ? -61.200 23.775  -24.933 1.00 123.32 ? 69  ASP D CB    1 
ATOM 4948 C CG    . ASP F 5 69  ? -60.010 23.583  -24.008 1.00 128.99 ? 69  ASP D CG    1 
ATOM 4949 O OD1   . ASP F 5 69  ? -58.988 24.262  -24.245 1.00 134.72 ? 69  ASP D OD1   1 
ATOM 4950 O OD2   . ASP F 5 69  ? -60.085 22.767  -23.067 1.00 126.72 ? 69  ASP D OD2   1 
ATOM 4951 N N     . ALA F 5 70  ? -63.227 22.932  -27.005 1.00 117.52 ? 70  ALA D N     1 
ATOM 4952 C CA    . ALA F 5 70  ? -64.272 23.218  -27.974 1.00 116.79 ? 70  ALA D CA    1 
ATOM 4953 C C     . ALA F 5 70  ? -65.519 22.446  -27.581 1.00 112.08 ? 70  ALA D C     1 
ATOM 4954 O O     . ALA F 5 70  ? -66.615 22.989  -27.530 1.00 111.76 ? 70  ALA D O     1 
ATOM 4955 C CB    . ALA F 5 70  ? -63.815 22.823  -29.365 1.00 120.59 ? 70  ALA D CB    1 
ATOM 4956 N N     . MET F 5 71  ? -65.333 21.179  -27.249 1.00 108.30 ? 71  MET D N     1 
ATOM 4957 C CA    . MET F 5 71  ? -66.435 20.352  -26.799 1.00 105.58 ? 71  MET D CA    1 
ATOM 4958 C C     . MET F 5 71  ? -67.073 20.865  -25.495 1.00 100.57 ? 71  MET D C     1 
ATOM 4959 O O     . MET F 5 71  ? -68.289 20.989  -25.419 1.00 100.06 ? 71  MET D O     1 
ATOM 4960 C CB    . MET F 5 71  ? -66.006 18.877  -26.718 1.00 109.52 ? 71  MET D CB    1 
ATOM 4961 C CG    . MET F 5 71  ? -65.774 18.207  -28.091 1.00 112.79 ? 71  MET D CG    1 
ATOM 4962 S SD    . MET F 5 71  ? -67.189 18.252  -29.219 1.00 99.82  ? 71  MET D SD    1 
ATOM 4963 C CE    . MET F 5 71  ? -66.340 18.208  -30.793 1.00 70.70  ? 71  MET D CE    1 
ATOM 4964 N N     . ILE F 5 72  ? -66.273 21.191  -24.483 1.00 96.24  ? 72  ILE D N     1 
ATOM 4965 C CA    . ILE F 5 72  ? -66.856 21.678  -23.232 1.00 94.96  ? 72  ILE D CA    1 
ATOM 4966 C C     . ILE F 5 72  ? -67.707 22.919  -23.503 1.00 99.07  ? 72  ILE D C     1 
ATOM 4967 O O     . ILE F 5 72  ? -68.784 23.090  -22.926 1.00 101.84 ? 72  ILE D O     1 
ATOM 4968 C CB    . ILE F 5 72  ? -65.792 21.975  -22.160 1.00 91.48  ? 72  ILE D CB    1 
ATOM 4969 C CG1   . ILE F 5 72  ? -64.846 20.784  -22.017 1.00 90.53  ? 72  ILE D CG1   1 
ATOM 4970 C CG2   . ILE F 5 72  ? -66.455 22.284  -20.821 1.00 88.65  ? 72  ILE D CG2   1 
ATOM 4971 C CD1   . ILE F 5 72  ? -63.735 21.003  -21.027 1.00 90.60  ? 72  ILE D CD1   1 
ATOM 4972 N N     . TRP F 5 73  ? -67.215 23.774  -24.395 1.00 98.48  ? 73  TRP D N     1 
ATOM 4973 C CA    . TRP F 5 73  ? -67.952 24.948  -24.838 1.00 99.89  ? 73  TRP D CA    1 
ATOM 4974 C C     . TRP F 5 73  ? -69.277 24.541  -25.454 1.00 97.50  ? 73  TRP D C     1 
ATOM 4975 O O     . TRP F 5 73  ? -70.329 24.806  -24.882 1.00 99.60  ? 73  TRP D O     1 
ATOM 4976 C CB    . TRP F 5 73  ? -67.139 25.779  -25.833 1.00 109.91 ? 73  TRP D CB    1 
ATOM 4977 C CG    . TRP F 5 73  ? -67.770 27.112  -26.122 1.00 119.58 ? 73  TRP D CG    1 
ATOM 4978 C CD1   . TRP F 5 73  ? -67.653 28.254  -25.380 1.00 120.56 ? 73  TRP D CD1   1 
ATOM 4979 C CD2   . TRP F 5 73  ? -68.629 27.438  -27.222 1.00 127.17 ? 73  TRP D CD2   1 
ATOM 4980 N NE1   . TRP F 5 73  ? -68.382 29.269  -25.951 1.00 122.98 ? 73  TRP D NE1   1 
ATOM 4981 C CE2   . TRP F 5 73  ? -68.991 28.794  -27.083 1.00 128.36 ? 73  TRP D CE2   1 
ATOM 4982 C CE3   . TRP F 5 73  ? -69.126 26.716  -28.312 1.00 132.73 ? 73  TRP D CE3   1 
ATOM 4983 C CZ2   . TRP F 5 73  ? -69.827 29.441  -27.992 1.00 133.87 ? 73  TRP D CZ2   1 
ATOM 4984 C CZ3   . TRP F 5 73  ? -69.955 27.359  -29.214 1.00 136.56 ? 73  TRP D CZ3   1 
ATOM 4985 C CH2   . TRP F 5 73  ? -70.297 28.708  -29.048 1.00 137.47 ? 73  TRP D CH2   1 
ATOM 4986 N N     . PHE F 5 74  ? -69.223 23.857  -26.594 1.00 97.53  ? 74  PHE D N     1 
ATOM 4987 C CA    . PHE F 5 74  ? -70.443 23.526  -27.305 1.00 102.27 ? 74  PHE D CA    1 
ATOM 4988 C C     . PHE F 5 74  ? -71.411 23.020  -26.251 1.00 107.11 ? 74  PHE D C     1 
ATOM 4989 O O     . PHE F 5 74  ? -72.505 23.548  -26.095 1.00 106.14 ? 74  PHE D O     1 
ATOM 4990 C CB    . PHE F 5 74  ? -70.179 22.453  -28.364 1.00 104.84 ? 74  PHE D CB    1 
ATOM 4991 C CG    . PHE F 5 74  ? -69.337 22.930  -29.523 1.00 112.10 ? 74  PHE D CG    1 
ATOM 4992 C CD1   . PHE F 5 74  ? -69.910 23.636  -30.565 1.00 117.23 ? 74  PHE D CD1   1 
ATOM 4993 C CD2   . PHE F 5 74  ? -67.979 22.659  -29.580 1.00 115.21 ? 74  PHE D CD2   1 
ATOM 4994 C CE1   . PHE F 5 74  ? -69.143 24.076  -31.634 1.00 122.15 ? 74  PHE D CE1   1 
ATOM 4995 C CE2   . PHE F 5 74  ? -67.202 23.101  -30.646 1.00 120.27 ? 74  PHE D CE2   1 
ATOM 4996 C CZ    . PHE F 5 74  ? -67.787 23.808  -31.675 1.00 123.35 ? 74  PHE D CZ    1 
ATOM 4997 N N     . SER F 5 75  ? -70.955 22.060  -25.459 1.00 114.34 ? 75  SER D N     1 
ATOM 4998 C CA    . SER F 5 75  ? -71.768 21.481  -24.401 1.00 119.83 ? 75  SER D CA    1 
ATOM 4999 C C     . SER F 5 75  ? -72.450 22.551  -23.557 1.00 117.14 ? 75  SER D C     1 
ATOM 5000 O O     . SER F 5 75  ? -73.649 22.775  -23.692 1.00 117.06 ? 75  SER D O     1 
ATOM 5001 C CB    . SER F 5 75  ? -70.898 20.593  -23.506 1.00 125.32 ? 75  SER D CB    1 
ATOM 5002 O OG    . SER F 5 75  ? -71.512 20.378  -22.249 1.00 128.76 ? 75  SER D OG    1 
ATOM 5003 N N     . ARG F 5 76  ? -71.686 23.239  -22.716 1.00 117.01 ? 76  ARG D N     1 
ATOM 5004 C CA    . ARG F 5 76  ? -72.283 24.236  -21.845 1.00 119.57 ? 76  ARG D CA    1 
ATOM 5005 C C     . ARG F 5 76  ? -72.891 25.365  -22.671 1.00 126.64 ? 76  ARG D C     1 
ATOM 5006 O O     . ARG F 5 76  ? -73.717 26.136  -22.175 1.00 127.72 ? 76  ARG D O     1 
ATOM 5007 C CB    . ARG F 5 76  ? -71.259 24.794  -20.864 1.00 117.67 ? 76  ARG D CB    1 
ATOM 5008 C CG    . ARG F 5 76  ? -70.142 25.575  -21.521 1.00 119.98 ? 76  ARG D CG    1 
ATOM 5009 C CD    . ARG F 5 76  ? -69.597 26.601  -20.558 1.00 125.97 ? 76  ARG D CD    1 
ATOM 5010 N NE    . ARG F 5 76  ? -69.448 26.036  -19.223 1.00 124.21 ? 76  ARG D NE    1 
ATOM 5011 C CZ    . ARG F 5 76  ? -68.334 25.473  -18.775 1.00 117.61 ? 76  ARG D CZ    1 
ATOM 5012 N NH1   . ARG F 5 76  ? -67.266 25.406  -19.557 1.00 115.58 ? 76  ARG D NH1   1 
ATOM 5013 N NH2   . ARG F 5 76  ? -68.286 24.983  -17.545 1.00 113.62 ? 76  ARG D NH2   1 
ATOM 5014 N N     . ALA F 5 77  ? -72.487 25.446  -23.937 1.00 132.70 ? 77  ALA D N     1 
ATOM 5015 C CA    . ALA F 5 77  ? -72.980 26.479  -24.848 1.00 138.30 ? 77  ALA D CA    1 
ATOM 5016 C C     . ALA F 5 77  ? -74.335 26.105  -25.459 1.00 143.02 ? 77  ALA D C     1 
ATOM 5017 O O     . ALA F 5 77  ? -74.904 26.854  -26.257 1.00 144.70 ? 77  ALA D O     1 
ATOM 5018 C CB    . ALA F 5 77  ? -71.951 26.774  -25.939 1.00 141.63 ? 77  ALA D CB    1 
ATOM 5019 N N     . LEU F 5 78  ? -74.828 24.930  -25.077 1.00 141.49 ? 78  LEU D N     1 
ATOM 5020 C CA    . LEU F 5 78  ? -76.202 24.507  -25.329 1.00 139.42 ? 78  LEU D CA    1 
ATOM 5021 C C     . LEU F 5 78  ? -76.718 24.223  -23.933 1.00 144.78 ? 78  LEU D C     1 
ATOM 5022 O O     . LEU F 5 78  ? -76.015 24.508  -22.964 1.00 148.61 ? 78  LEU D O     1 
ATOM 5023 C CB    . LEU F 5 78  ? -76.249 23.248  -26.197 1.00 131.28 ? 78  LEU D CB    1 
ATOM 5024 C CG    . LEU F 5 78  ? -75.886 23.392  -27.679 1.00 129.18 ? 78  LEU D CG    1 
ATOM 5025 C CD1   . LEU F 5 78  ? -74.415 23.059  -27.956 1.00 127.26 ? 78  LEU D CD1   1 
ATOM 5026 C CD2   . LEU F 5 78  ? -76.810 22.548  -28.553 1.00 130.84 ? 78  LEU D CD2   1 
ATOM 5027 N N     . ASP F 5 79  ? -77.921 23.682  -23.786 1.00 148.32 ? 79  ASP D N     1 
ATOM 5028 C CA    . ASP F 5 79  ? -78.353 23.442  -22.423 1.00 152.47 ? 79  ASP D CA    1 
ATOM 5029 C C     . ASP F 5 79  ? -77.945 22.055  -22.013 1.00 153.44 ? 79  ASP D C     1 
ATOM 5030 O O     . ASP F 5 79  ? -78.491 21.045  -22.467 1.00 155.80 ? 79  ASP D O     1 
ATOM 5031 C CB    . ASP F 5 79  ? -79.848 23.656  -22.207 1.00 158.70 ? 79  ASP D CB    1 
ATOM 5032 C CG    . ASP F 5 79  ? -80.139 24.414  -20.917 1.00 163.95 ? 79  ASP D CG    1 
ATOM 5033 O OD1   . ASP F 5 79  ? -80.557 25.587  -21.010 1.00 167.30 ? 79  ASP D OD1   1 
ATOM 5034 O OD2   . ASP F 5 79  ? -79.927 23.857  -19.813 1.00 163.96 ? 79  ASP D OD2   1 
ATOM 5035 N N     . ILE F 5 80  ? -76.951 22.045  -21.144 1.00 151.65 ? 80  ILE D N     1 
ATOM 5036 C CA    . ILE F 5 80  ? -76.467 20.844  -20.524 1.00 149.57 ? 80  ILE D CA    1 
ATOM 5037 C C     . ILE F 5 80  ? -76.222 21.260  -19.116 1.00 150.14 ? 80  ILE D C     1 
ATOM 5038 O O     . ILE F 5 80  ? -75.792 22.382  -18.831 1.00 150.65 ? 80  ILE D O     1 
ATOM 5039 C CB    . ILE F 5 80  ? -75.174 20.310  -21.138 1.00 144.07 ? 80  ILE D CB    1 
ATOM 5040 C CG1   . ILE F 5 80  ? -75.507 19.359  -22.284 1.00 140.81 ? 80  ILE D CG1   1 
ATOM 5041 C CG2   . ILE F 5 80  ? -74.356 19.563  -20.085 1.00 141.67 ? 80  ILE D CG2   1 
ATOM 5042 C CD1   . ILE F 5 80  ? -75.748 20.053  -23.591 1.00 139.53 ? 80  ILE D CD1   1 
ATOM 5043 N N     . GLU F 5 81  ? -76.520 20.341  -18.229 1.00 149.07 ? 81  GLU D N     1 
ATOM 5044 C CA    . GLU F 5 81  ? -76.599 20.650  -16.829 1.00 148.38 ? 81  GLU D CA    1 
ATOM 5045 C C     . GLU F 5 81  ? -75.119 20.786  -16.277 1.00 164.42 ? 81  GLU D C     1 
ATOM 5046 O O     . GLU F 5 81  ? -74.215 20.220  -16.875 1.00 163.29 ? 81  GLU D O     1 
ATOM 5047 C CB    . GLU F 5 81  ? -77.512 19.566  -16.240 1.00 149.19 ? 81  GLU D CB    1 
ATOM 5048 C CG    . GLU F 5 81  ? -77.890 19.767  -14.866 1.00 150.96 ? 81  GLU D CG    1 
ATOM 5049 C CD    . GLU F 5 81  ? -76.690 19.782  -14.067 1.00 151.89 ? 81  GLU D CD    1 
ATOM 5050 O OE1   . GLU F 5 81  ? -75.931 18.799  -14.237 1.00 149.96 ? 81  GLU D OE1   1 
ATOM 5051 O OE2   . GLU F 5 81  ? -76.485 20.744  -13.296 1.00 153.77 ? 81  GLU D OE2   1 
ATOM 5052 N N     . ASN F 5 82  ? -74.868 21.629  -15.255 1.00 164.54 ? 82  ASN D N     1 
ATOM 5053 C CA    . ASN F 5 82  ? -73.505 22.176  -14.897 1.00 164.78 ? 82  ASN D CA    1 
ATOM 5054 C C     . ASN F 5 82  ? -72.402 21.197  -14.419 1.00 165.42 ? 82  ASN D C     1 
ATOM 5055 O O     . ASN F 5 82  ? -71.418 20.940  -15.094 1.00 165.74 ? 82  ASN D O     1 
ATOM 5056 C CB    . ASN F 5 82  ? -73.592 23.369  -13.899 1.00 176.62 ? 82  ASN D CB    1 
ATOM 5057 C CG    . ASN F 5 82  ? -72.465 24.401  -14.100 1.00 177.08 ? 82  ASN D CG    1 
ATOM 5058 O OD1   . ASN F 5 82  ? -71.918 24.540  -15.203 1.00 177.38 ? 82  ASN D OD1   1 
ATOM 5059 N ND2   . ASN F 5 82  ? -72.135 25.135  -13.044 1.00 176.83 ? 82  ASN D ND2   1 
ATOM 5060 N N     . ASN F 5 83  ? -72.598 20.623  -13.249 1.00 164.55 ? 83  ASN D N     1 
ATOM 5061 C CA    . ASN F 5 83  ? -71.808 19.483  -12.877 1.00 161.06 ? 83  ASN D CA    1 
ATOM 5062 C C     . ASN F 5 83  ? -71.668 18.468  -14.027 1.00 160.31 ? 83  ASN D C     1 
ATOM 5063 O O     . ASN F 5 83  ? -70.583 17.998  -14.322 1.00 161.39 ? 83  ASN D O     1 
ATOM 5064 C CB    . ASN F 5 83  ? -72.562 18.807  -11.745 1.00 155.26 ? 83  ASN D CB    1 
ATOM 5065 C CG    . ASN F 5 83  ? -74.035 18.648  -12.043 1.00 149.76 ? 83  ASN D CG    1 
ATOM 5066 O OD1   . ASN F 5 83  ? -74.560 19.250  -12.969 1.00 148.53 ? 83  ASN D OD1   1 
ATOM 5067 N ND2   . ASN F 5 83  ? -74.715 17.888  -11.206 1.00 147.17 ? 83  ASN D ND2   1 
ATOM 5068 N N     . ASP F 5 84  ? -72.779 18.108  -14.658 1.00 157.68 ? 84  ASP D N     1 
ATOM 5069 C CA    . ASP F 5 84  ? -72.690 17.228  -15.816 1.00 155.56 ? 84  ASP D CA    1 
ATOM 5070 C C     . ASP F 5 84  ? -71.571 17.707  -16.748 1.00 153.50 ? 84  ASP D C     1 
ATOM 5071 O O     . ASP F 5 84  ? -70.597 16.980  -16.969 1.00 152.89 ? 84  ASP D O     1 
ATOM 5072 C CB    . ASP F 5 84  ? -74.028 17.149  -16.548 1.00 154.83 ? 84  ASP D CB    1 
ATOM 5073 C CG    . ASP F 5 84  ? -73.946 16.352  -17.843 1.00 153.15 ? 84  ASP D CG    1 
ATOM 5074 O OD1   . ASP F 5 84  ? -73.097 15.443  -17.939 1.00 150.79 ? 84  ASP D OD1   1 
ATOM 5075 O OD2   . ASP F 5 84  ? -74.728 16.646  -18.772 1.00 153.90 ? 84  ASP D OD2   1 
ATOM 5076 N N     . VAL F 5 85  ? -71.688 18.916  -17.293 1.00 151.84 ? 85  VAL D N     1 
ATOM 5077 C CA    . VAL F 5 85  ? -70.630 19.408  -18.180 1.00 150.41 ? 85  VAL D CA    1 
ATOM 5078 C C     . VAL F 5 85  ? -69.244 19.278  -17.532 1.00 147.63 ? 85  VAL D C     1 
ATOM 5079 O O     . VAL F 5 85  ? -68.282 18.833  -18.171 1.00 150.09 ? 85  VAL D O     1 
ATOM 5080 C CB    . VAL F 5 85  ? -70.875 20.855  -18.698 1.00 125.91 ? 85  VAL D CB    1 
ATOM 5081 C CG1   . VAL F 5 85  ? -71.174 21.815  -17.565 1.00 126.74 ? 85  VAL D CG1   1 
ATOM 5082 C CG2   . VAL F 5 85  ? -69.672 21.341  -19.491 1.00 124.80 ? 85  VAL D CG2   1 
ATOM 5083 N N     . LEU F 5 86  ? -69.162 19.634  -16.252 1.00 141.07 ? 86  LEU D N     1 
ATOM 5084 C CA    . LEU F 5 86  ? -67.910 19.574  -15.499 1.00 132.21 ? 86  LEU D CA    1 
ATOM 5085 C C     . LEU F 5 86  ? -67.363 18.140  -15.334 1.00 125.20 ? 86  LEU D C     1 
ATOM 5086 O O     . LEU F 5 86  ? -66.153 17.942  -15.364 1.00 124.50 ? 86  LEU D O     1 
ATOM 5087 C CB    . LEU F 5 86  ? -68.012 20.352  -14.165 1.00 129.16 ? 86  LEU D CB    1 
ATOM 5088 C CG    . LEU F 5 86  ? -68.799 19.918  -12.919 1.00 126.46 ? 86  LEU D CG    1 
ATOM 5089 C CD1   . LEU F 5 86  ? -68.151 18.722  -12.249 1.00 121.88 ? 86  LEU D CD1   1 
ATOM 5090 C CD2   . LEU F 5 86  ? -68.969 21.066  -11.907 1.00 127.29 ? 86  LEU D CD2   1 
ATOM 5091 N N     . VAL F 5 87  ? -68.250 17.152  -15.212 1.00 120.13 ? 87  VAL D N     1 
ATOM 5092 C CA    . VAL F 5 87  ? -67.890 15.750  -15.209 1.00 116.36 ? 87  VAL D CA    1 
ATOM 5093 C C     . VAL F 5 87  ? -67.235 15.544  -16.550 1.00 114.05 ? 87  VAL D C     1 
ATOM 5094 O O     . VAL F 5 87  ? -66.078 15.174  -16.603 1.00 114.38 ? 87  VAL D O     1 
ATOM 5095 C CB    . VAL F 5 87  ? -69.110 14.752  -15.042 1.00 77.78  ? 87  VAL D CB    1 
ATOM 5096 C CG1   . VAL F 5 87  ? -70.140 15.234  -14.033 1.00 82.70  ? 87  VAL D CG1   1 
ATOM 5097 C CG2   . VAL F 5 87  ? -69.783 14.430  -16.382 1.00 74.52  ? 87  VAL D CG2   1 
ATOM 5098 N N     . LEU F 5 88  ? -67.932 15.890  -17.631 1.00 110.41 ? 88  LEU D N     1 
ATOM 5099 C CA    . LEU F 5 88  ? -67.374 15.659  -18.960 1.00 107.91 ? 88  LEU D CA    1 
ATOM 5100 C C     . LEU F 5 88  ? -65.955 16.200  -19.072 1.00 106.61 ? 88  LEU D C     1 
ATOM 5101 O O     . LEU F 5 88  ? -65.064 15.553  -19.628 1.00 108.16 ? 88  LEU D O     1 
ATOM 5102 C CB    . LEU F 5 88  ? -68.256 16.262  -20.048 1.00 104.83 ? 88  LEU D CB    1 
ATOM 5103 C CG    . LEU F 5 88  ? -67.835 15.876  -21.466 1.00 105.07 ? 88  LEU D CG    1 
ATOM 5104 C CD1   . LEU F 5 88  ? -69.017 15.893  -22.419 1.00 108.68 ? 88  LEU D CD1   1 
ATOM 5105 C CD2   . LEU F 5 88  ? -66.731 16.763  -21.989 1.00 103.22 ? 88  LEU D CD2   1 
ATOM 5106 N N     . GLN F 5 89  ? -65.760 17.401  -18.548 1.00 107.98 ? 89  GLN D N     1 
ATOM 5107 C CA    . GLN F 5 89  ? -64.428 17.985  -18.425 1.00 111.96 ? 89  GLN D CA    1 
ATOM 5108 C C     . GLN F 5 89  ? -63.474 17.039  -17.664 1.00 110.17 ? 89  GLN D C     1 
ATOM 5109 O O     . GLN F 5 89  ? -62.357 16.751  -18.120 1.00 107.76 ? 89  GLN D O     1 
ATOM 5110 C CB    . GLN F 5 89  ? -64.533 19.358  -17.742 1.00 112.91 ? 89  GLN D CB    1 
ATOM 5111 C CG    . GLN F 5 89  ? -63.222 20.057  -17.505 1.00 114.71 ? 89  GLN D CG    1 
ATOM 5112 C CD    . GLN F 5 89  ? -63.391 21.550  -17.295 1.00 116.76 ? 89  GLN D CD    1 
ATOM 5113 O OE1   . GLN F 5 89  ? -64.510 22.054  -17.164 1.00 114.88 ? 89  GLN D OE1   1 
ATOM 5114 N NE2   . GLN F 5 89  ? -62.275 22.270  -17.274 1.00 119.37 ? 89  GLN D NE2   1 
ATOM 5115 N N     . GLN F 5 90  ? -63.934 16.541  -16.516 1.00 109.86 ? 90  GLN D N     1 
ATOM 5116 C CA    . GLN F 5 90  ? -63.158 15.617  -15.693 1.00 106.39 ? 90  GLN D CA    1 
ATOM 5117 C C     . GLN F 5 90  ? -62.691 14.448  -16.542 1.00 105.80 ? 90  GLN D C     1 
ATOM 5118 O O     . GLN F 5 90  ? -61.496 14.128  -16.595 1.00 109.16 ? 90  GLN D O     1 
ATOM 5119 C CB    . GLN F 5 90  ? -63.998 15.102  -14.520 1.00 103.92 ? 90  GLN D CB    1 
ATOM 5120 C CG    . GLN F 5 90  ? -63.960 15.978  -13.283 1.00 105.03 ? 90  GLN D CG    1 
ATOM 5121 C CD    . GLN F 5 90  ? -63.739 17.437  -13.608 1.00 110.60 ? 90  GLN D CD    1 
ATOM 5122 O OE1   . GLN F 5 90  ? -62.601 17.892  -13.732 1.00 109.41 ? 90  GLN D OE1   1 
ATOM 5123 N NE2   . GLN F 5 90  ? -64.827 18.183  -13.749 1.00 118.16 ? 90  GLN D NE2   1 
ATOM 5124 N N     . ARG F 5 91  ? -63.643 13.818  -17.218 1.00 102.11 ? 91  ARG D N     1 
ATOM 5125 C CA    . ARG F 5 91  ? -63.355 12.705  -18.104 1.00 99.27  ? 91  ARG D CA    1 
ATOM 5126 C C     . ARG F 5 91  ? -62.285 13.067  -19.133 1.00 97.88  ? 91  ARG D C     1 
ATOM 5127 O O     . ARG F 5 91  ? -61.216 12.474  -19.157 1.00 99.41  ? 91  ARG D O     1 
ATOM 5128 C CB    . ARG F 5 91  ? -64.634 12.216  -18.785 1.00 102.73 ? 91  ARG D CB    1 
ATOM 5129 C CG    . ARG F 5 91  ? -64.392 11.093  -19.778 1.00 109.28 ? 91  ARG D CG    1 
ATOM 5130 C CD    . ARG F 5 91  ? -63.554 10.005  -19.125 1.00 111.70 ? 91  ARG D CD    1 
ATOM 5131 N NE    . ARG F 5 91  ? -63.666 8.682   -19.741 1.00 114.01 ? 91  ARG D NE    1 
ATOM 5132 C CZ    . ARG F 5 91  ? -62.989 8.274   -20.812 1.00 116.07 ? 91  ARG D CZ    1 
ATOM 5133 N NH1   . ARG F 5 91  ? -62.150 9.088   -21.437 1.00 117.84 ? 91  ARG D NH1   1 
ATOM 5134 N NH2   . ARG F 5 91  ? -63.163 7.043   -21.267 1.00 117.56 ? 91  ARG D NH2   1 
ATOM 5135 N N     . LEU F 5 92  ? -62.581 14.047  -19.978 1.00 93.40  ? 92  LEU D N     1 
ATOM 5136 C CA    . LEU F 5 92  ? -61.633 14.514  -20.998 1.00 90.61  ? 92  LEU D CA    1 
ATOM 5137 C C     . LEU F 5 92  ? -60.205 14.748  -20.492 1.00 91.10  ? 92  LEU D C     1 
ATOM 5138 O O     . LEU F 5 92  ? -59.261 14.174  -21.018 1.00 88.58  ? 92  LEU D O     1 
ATOM 5139 C CB    . LEU F 5 92  ? -62.161 15.764  -21.697 1.00 86.39  ? 92  LEU D CB    1 
ATOM 5140 C CG    . LEU F 5 92  ? -63.493 15.564  -22.420 1.00 85.05  ? 92  LEU D CG    1 
ATOM 5141 C CD1   . LEU F 5 92  ? -63.822 16.777  -23.265 1.00 89.55  ? 92  LEU D CD1   1 
ATOM 5142 C CD2   . LEU F 5 92  ? -63.431 14.335  -23.285 1.00 82.69  ? 92  LEU D CD2   1 
ATOM 5143 N N     . TYR F 5 93  ? -60.044 15.642  -19.523 1.00 95.81  ? 93  TYR D N     1 
ATOM 5144 C CA    . TYR F 5 93  ? -58.735 15.868  -18.907 1.00 100.93 ? 93  TYR D CA    1 
ATOM 5145 C C     . TYR F 5 93  ? -58.045 14.555  -18.486 1.00 94.60  ? 93  TYR D C     1 
ATOM 5146 O O     . TYR F 5 93  ? -56.844 14.341  -18.761 1.00 93.23  ? 93  TYR D O     1 
ATOM 5147 C CB    . TYR F 5 93  ? -58.890 16.825  -17.720 1.00 107.60 ? 93  TYR D CB    1 
ATOM 5148 C CG    . TYR F 5 93  ? -59.196 18.250  -18.144 1.00 116.76 ? 93  TYR D CG    1 
ATOM 5149 C CD1   . TYR F 5 93  ? -59.196 18.607  -19.490 1.00 120.56 ? 93  TYR D CD1   1 
ATOM 5150 C CD2   . TYR F 5 93  ? -59.461 19.239  -17.206 1.00 119.32 ? 93  TYR D CD2   1 
ATOM 5151 C CE1   . TYR F 5 93  ? -59.460 19.903  -19.890 1.00 122.66 ? 93  TYR D CE1   1 
ATOM 5152 C CE2   . TYR F 5 93  ? -59.723 20.539  -17.598 1.00 121.07 ? 93  TYR D CE2   1 
ATOM 5153 C CZ    . TYR F 5 93  ? -59.723 20.864  -18.941 1.00 121.53 ? 93  TYR D CZ    1 
ATOM 5154 O OH    . TYR F 5 93  ? -59.987 22.154  -19.340 1.00 120.42 ? 93  TYR D OH    1 
ATOM 5155 N N     . GLY F 5 94  ? -58.817 13.684  -17.826 1.00 90.55  ? 94  GLY D N     1 
ATOM 5156 C CA    . GLY F 5 94  ? -58.354 12.356  -17.445 1.00 86.23  ? 94  GLY D CA    1 
ATOM 5157 C C     . GLY F 5 94  ? -57.820 11.574  -18.639 1.00 88.30  ? 94  GLY D C     1 
ATOM 5158 O O     . GLY F 5 94  ? -56.752 10.926  -18.565 1.00 85.56  ? 94  GLY D O     1 
ATOM 5159 N N     . LEU F 5 95  ? -58.569 11.628  -19.744 1.00 89.51  ? 95  LEU D N     1 
ATOM 5160 C CA    . LEU F 5 95  ? -58.099 11.118  -21.033 1.00 92.75  ? 95  LEU D CA    1 
ATOM 5161 C C     . LEU F 5 95  ? -56.738 11.718  -21.349 1.00 92.40  ? 95  LEU D C     1 
ATOM 5162 O O     . LEU F 5 95  ? -55.751 10.996  -21.428 1.00 95.31  ? 95  LEU D O     1 
ATOM 5163 C CB    . LEU F 5 95  ? -59.116 11.376  -22.177 1.00 55.00  ? 95  LEU D CB    1 
ATOM 5164 C CG    . LEU F 5 95  ? -58.588 11.310  -23.629 1.00 58.04  ? 95  LEU D CG    1 
ATOM 5165 C CD1   . LEU F 5 95  ? -57.364 10.452  -23.731 1.00 59.86  ? 95  LEU D CD1   1 
ATOM 5166 C CD2   . LEU F 5 95  ? -59.612 10.847  -24.675 1.00 54.22  ? 95  LEU D CD2   1 
ATOM 5167 N N     . VAL F 5 96  ? -56.683 13.037  -21.523 1.00 88.94  ? 96  VAL D N     1 
ATOM 5168 C CA    . VAL F 5 96  ? -55.448 13.668  -21.985 1.00 86.06  ? 96  VAL D CA    1 
ATOM 5169 C C     . VAL F 5 96  ? -54.224 13.187  -21.192 1.00 95.15  ? 96  VAL D C     1 
ATOM 5170 O O     . VAL F 5 96  ? -53.234 12.754  -21.793 1.00 100.01 ? 96  VAL D O     1 
ATOM 5171 C CB    . VAL F 5 96  ? -55.513 15.203  -21.998 1.00 73.75  ? 96  VAL D CB    1 
ATOM 5172 C CG1   . VAL F 5 96  ? -54.260 15.760  -22.636 1.00 69.87  ? 96  VAL D CG1   1 
ATOM 5173 C CG2   . VAL F 5 96  ? -56.738 15.660  -22.772 1.00 71.67  ? 96  VAL D CG2   1 
ATOM 5174 N N     . LYS F 5 97  ? -54.289 13.220  -19.859 1.00 96.58  ? 97  LYS D N     1 
ATOM 5175 C CA    . LYS F 5 97  ? -53.201 12.639  -19.066 1.00 95.96  ? 97  LYS D CA    1 
ATOM 5176 C C     . LYS F 5 97  ? -52.917 11.226  -19.537 1.00 94.60  ? 97  LYS D C     1 
ATOM 5177 O O     . LYS F 5 97  ? -51.773 10.861  -19.817 1.00 96.70  ? 97  LYS D O     1 
ATOM 5178 C CB    . LYS F 5 97  ? -53.562 12.619  -17.584 1.00 92.54  ? 97  LYS D CB    1 
ATOM 5179 C CG    . LYS F 5 97  ? -53.828 13.993  -17.018 1.00 89.82  ? 97  LYS D CG    1 
ATOM 5180 C CD    . LYS F 5 97  ? -54.310 13.884  -15.585 1.00 88.25  ? 97  LYS D CD    1 
ATOM 5181 C CE    . LYS F 5 97  ? -54.330 15.239  -14.897 1.00 89.54  ? 97  LYS D CE    1 
ATOM 5182 N NZ    . LYS F 5 97  ? -54.979 15.190  -13.554 1.00 90.69  ? 97  LYS D NZ    1 
ATOM 5183 N N     . LEU F 5 98  ? -53.972 10.432  -19.624 1.00 89.22  ? 98  LEU D N     1 
ATOM 5184 C CA    . LEU F 5 98  ? -53.802 9.070   -20.089 1.00 86.45  ? 98  LEU D CA    1 
ATOM 5185 C C     . LEU F 5 98  ? -52.999 8.959   -21.398 1.00 91.69  ? 98  LEU D C     1 
ATOM 5186 O O     . LEU F 5 98  ? -52.110 8.113   -21.507 1.00 93.14  ? 98  LEU D O     1 
ATOM 5187 C CB    . LEU F 5 98  ? -55.163 8.388   -20.215 1.00 78.06  ? 98  LEU D CB    1 
ATOM 5188 C CG    . LEU F 5 98  ? -55.136 6.950   -20.701 1.00 68.22  ? 98  LEU D CG    1 
ATOM 5189 C CD1   . LEU F 5 98  ? -54.025 6.186   -20.027 1.00 65.01  ? 98  LEU D CD1   1 
ATOM 5190 C CD2   . LEU F 5 98  ? -56.460 6.315   -20.416 1.00 63.77  ? 98  LEU D CD2   1 
ATOM 5191 N N     . LEU F 5 99  ? -53.299 9.807   -22.380 1.00 93.05  ? 99  LEU D N     1 
ATOM 5192 C CA    . LEU F 5 99  ? -52.657 9.727   -23.695 1.00 95.96  ? 99  LEU D CA    1 
ATOM 5193 C C     . LEU F 5 99  ? -51.225 10.202  -23.655 1.00 103.07 ? 99  LEU D C     1 
ATOM 5194 O O     . LEU F 5 99  ? -50.309 9.534   -24.157 1.00 105.92 ? 99  LEU D O     1 
ATOM 5195 C CB    . LEU F 5 99  ? -53.405 10.594  -24.716 1.00 93.34  ? 99  LEU D CB    1 
ATOM 5196 C CG    . LEU F 5 99  ? -54.782 10.174  -25.229 1.00 95.41  ? 99  LEU D CG    1 
ATOM 5197 C CD1   . LEU F 5 99  ? -55.285 11.139  -26.299 1.00 97.29  ? 99  LEU D CD1   1 
ATOM 5198 C CD2   . LEU F 5 99  ? -54.728 8.763   -25.772 1.00 98.37  ? 99  LEU D CD2   1 
ATOM 5199 N N     . GLU F 5 100 ? -51.046 11.369  -23.054 1.00 108.35 ? 100 GLU D N     1 
ATOM 5200 C CA    . GLU F 5 100 ? -49.791 12.088  -23.109 1.00 113.90 ? 100 GLU D CA    1 
ATOM 5201 C C     . GLU F 5 100 ? -48.781 11.494  -22.140 1.00 111.59 ? 100 GLU D C     1 
ATOM 5202 O O     . GLU F 5 100 ? -47.594 11.531  -22.411 1.00 114.91 ? 100 GLU D O     1 
ATOM 5203 C CB    . GLU F 5 100 ? -50.020 13.581  -22.770 1.00 116.35 ? 100 GLU D CB    1 
ATOM 5204 C CG    . GLU F 5 100 ? -50.359 13.715  -21.290 1.00 118.19 ? 100 GLU D CG    1 
ATOM 5205 C CD    . GLU F 5 100 ? -50.639 15.135  -20.879 1.00 121.24 ? 100 GLU D CD    1 
ATOM 5206 O OE1   . GLU F 5 100 ? -50.683 16.017  -21.765 1.00 124.62 ? 100 GLU D OE1   1 
ATOM 5207 O OE2   . GLU F 5 100 ? -50.821 15.392  -19.676 1.00 121.63 ? 100 GLU D OE2   1 
ATOM 5208 N N     . PHE F 5 101 ? -49.266 10.964  -21.014 1.00 100.60 ? 101 PHE D N     1 
ATOM 5209 C CA    . PHE F 5 101 ? -48.409 10.562  -19.905 1.00 96.96  ? 101 PHE D CA    1 
ATOM 5210 C C     . PHE F 5 101 ? -47.235 9.668   -20.289 1.00 96.61  ? 101 PHE D C     1 
ATOM 5211 O O     . PHE F 5 101 ? -47.396 8.639   -20.968 1.00 96.29  ? 101 PHE D O     1 
ATOM 5212 C CB    . PHE F 5 101 ? -49.227 9.888   -18.782 1.00 96.77  ? 101 PHE D CB    1 
ATOM 5213 C CG    . PHE F 5 101 ? -48.444 9.659   -17.493 1.00 93.78  ? 101 PHE D CG    1 
ATOM 5214 C CD1   . PHE F 5 101 ? -47.447 8.685   -17.407 1.00 89.09  ? 101 PHE D CD1   1 
ATOM 5215 C CD2   . PHE F 5 101 ? -48.742 10.392  -16.349 1.00 97.05  ? 101 PHE D CD2   1 
ATOM 5216 C CE1   . PHE F 5 101 ? -46.750 8.473   -16.212 1.00 88.21  ? 101 PHE D CE1   1 
ATOM 5217 C CE2   . PHE F 5 101 ? -48.038 10.173  -15.142 1.00 95.98  ? 101 PHE D CE2   1 
ATOM 5218 C CZ    . PHE F 5 101 ? -47.045 9.210   -15.090 1.00 91.37  ? 101 PHE D CZ    1 
ATOM 5219 N N     . ASP F 5 102 ? -46.052 10.068  -19.835 1.00 96.55  ? 102 ASP D N     1 
ATOM 5220 C CA    . ASP F 5 102 ? -44.879 9.275   -20.114 1.00 97.53  ? 102 ASP D CA    1 
ATOM 5221 C C     . ASP F 5 102 ? -44.513 8.410   -18.904 1.00 96.65  ? 102 ASP D C     1 
ATOM 5222 O O     . ASP F 5 102 ? -43.976 8.895   -17.905 1.00 95.16  ? 102 ASP D O     1 
ATOM 5223 C CB    . ASP F 5 102 ? -43.720 10.187  -20.491 1.00 99.57  ? 102 ASP D CB    1 
ATOM 5224 C CG    . ASP F 5 102 ? -42.657 9.471   -21.282 1.00 102.13 ? 102 ASP D CG    1 
ATOM 5225 O OD1   . ASP F 5 102 ? -42.738 8.234   -21.379 1.00 105.56 ? 102 ASP D OD1   1 
ATOM 5226 O OD2   . ASP F 5 102 ? -41.740 10.139  -21.805 1.00 101.34 ? 102 ASP D OD2   1 
ATOM 5227 N N     . TYR F 5 103 ? -44.767 7.108   -19.031 1.00 97.97  ? 103 TYR D N     1 
ATOM 5228 C CA    . TYR F 5 103 ? -44.465 6.134   -17.978 1.00 94.48  ? 103 TYR D CA    1 
ATOM 5229 C C     . TYR F 5 103 ? -42.972 5.813   -17.992 1.00 90.21  ? 103 TYR D C     1 
ATOM 5230 O O     . TYR F 5 103 ? -42.468 5.174   -17.070 1.00 87.42  ? 103 TYR D O     1 
ATOM 5231 C CB    . TYR F 5 103 ? -45.248 4.819   -18.176 1.00 93.15  ? 103 TYR D CB    1 
ATOM 5232 C CG    . TYR F 5 103 ? -46.614 4.697   -17.509 1.00 93.75  ? 103 TYR D CG    1 
ATOM 5233 C CD1   . TYR F 5 103 ? -46.735 4.365   -16.165 1.00 96.57  ? 103 TYR D CD1   1 
ATOM 5234 C CD2   . TYR F 5 103 ? -47.783 4.857   -18.243 1.00 93.61  ? 103 TYR D CD2   1 
ATOM 5235 C CE1   . TYR F 5 103 ? -47.990 4.232   -15.563 1.00 98.80  ? 103 TYR D CE1   1 
ATOM 5236 C CE2   . TYR F 5 103 ? -49.039 4.726   -17.650 1.00 95.07  ? 103 TYR D CE2   1 
ATOM 5237 C CZ    . TYR F 5 103 ? -49.135 4.413   -16.312 1.00 96.87  ? 103 TYR D CZ    1 
ATOM 5238 O OH    . TYR F 5 103 ? -50.376 4.282   -15.724 1.00 97.01  ? 103 TYR D OH    1 
ATOM 5239 N N     . SER F 5 104 ? -42.275 6.286   -19.029 1.00 87.90  ? 104 SER D N     1 
ATOM 5240 C CA    . SER F 5 104 ? -40.878 5.930   -19.301 1.00 87.26  ? 104 SER D CA    1 
ATOM 5241 C C     . SER F 5 104 ? -40.039 6.296   -18.103 1.00 88.97  ? 104 SER D C     1 
ATOM 5242 O O     . SER F 5 104 ? -38.877 5.902   -17.960 1.00 89.73  ? 104 SER D O     1 
ATOM 5243 C CB    . SER F 5 104 ? -40.356 6.718   -20.507 1.00 85.45  ? 104 SER D CB    1 
ATOM 5244 O OG    . SER F 5 104 ? -41.092 6.448   -21.690 1.00 87.71  ? 104 SER D OG    1 
ATOM 5245 N N     . ASN F 5 105 ? -40.674 7.073   -17.245 1.00 93.12  ? 105 ASN D N     1 
ATOM 5246 C CA    . ASN F 5 105 ? -40.039 7.726   -16.133 1.00 98.92  ? 105 ASN D CA    1 
ATOM 5247 C C     . ASN F 5 105 ? -40.358 6.984   -14.843 1.00 103.70 ? 105 ASN D C     1 
ATOM 5248 O O     . ASN F 5 105 ? -39.490 6.359   -14.237 1.00 106.56 ? 105 ASN D O     1 
ATOM 5249 C CB    . ASN F 5 105 ? -40.540 9.167   -16.067 1.00 105.28 ? 105 ASN D CB    1 
ATOM 5250 C CG    . ASN F 5 105 ? -39.868 10.072  -17.093 1.00 114.60 ? 105 ASN D CG    1 
ATOM 5251 O OD1   . ASN F 5 105 ? -40.528 10.832  -17.807 1.00 128.83 ? 105 ASN D OD1   1 
ATOM 5252 N ND2   . ASN F 5 105 ? -38.548 10.010  -17.151 1.00 109.69 ? 105 ASN D ND2   1 
ATOM 5253 N N     . VAL F 5 106 ? -41.624 7.012   -14.454 1.00 107.51 ? 106 VAL D N     1 
ATOM 5254 C CA    . VAL F 5 106 ? -42.088 6.336   -13.247 1.00 111.26 ? 106 VAL D CA    1 
ATOM 5255 C C     . VAL F 5 106 ? -41.591 4.863   -13.160 1.00 92.56  ? 106 VAL D C     1 
ATOM 5256 O O     . VAL F 5 106 ? -41.347 4.306   -12.063 1.00 91.06  ? 106 VAL D O     1 
ATOM 5257 C CB    . VAL F 5 106 ? -43.641 6.436   -13.219 1.00 64.17  ? 106 VAL D CB    1 
ATOM 5258 C CG1   . VAL F 5 106 ? -44.237 6.045   -14.566 1.00 60.80  ? 106 VAL D CG1   1 
ATOM 5259 C CG2   . VAL F 5 106 ? -44.224 5.633   -12.094 1.00 71.15  ? 106 VAL D CG2   1 
ATOM 5260 N N     . ILE F 5 107 ? -41.358 4.281   -14.331 1.00 89.84  ? 107 ILE D N     1 
ATOM 5261 C CA    . ILE F 5 107 ? -41.071 2.856   -14.501 1.00 86.87  ? 107 ILE D CA    1 
ATOM 5262 C C     . ILE F 5 107 ? -40.052 2.237   -13.549 1.00 89.98  ? 107 ILE D C     1 
ATOM 5263 O O     . ILE F 5 107 ? -40.352 1.252   -12.877 1.00 95.30  ? 107 ILE D O     1 
ATOM 5264 C CB    . ILE F 5 107 ? -40.683 2.536   -15.958 1.00 80.01  ? 107 ILE D CB    1 
ATOM 5265 C CG1   . ILE F 5 107 ? -41.695 1.550   -16.545 1.00 80.82  ? 107 ILE D CG1   1 
ATOM 5266 C CG2   . ILE F 5 107 ? -39.290 1.959   -16.043 1.00 75.15  ? 107 ILE D CG2   1 
ATOM 5267 C CD1   . ILE F 5 107 ? -41.559 1.337   -18.035 1.00 78.96  ? 107 ILE D CD1   1 
ATOM 5268 N N     . ALA F 5 108 ? -38.839 2.776   -13.534 1.00 86.98  ? 108 ALA D N     1 
ATOM 5269 C CA    . ALA F 5 108 ? -37.756 2.170   -12.781 1.00 84.29  ? 108 ALA D CA    1 
ATOM 5270 C C     . ALA F 5 108 ? -38.054 2.060   -11.288 1.00 86.19  ? 108 ALA D C     1 
ATOM 5271 O O     . ALA F 5 108 ? -37.345 1.365   -10.571 1.00 85.01  ? 108 ALA D O     1 
ATOM 5272 C CB    . ALA F 5 108 ? -36.464 2.938   -13.002 1.00 78.01  ? 108 ALA D CB    1 
ATOM 5273 N N     . ILE F 5 109 ? -39.098 2.728   -10.805 1.00 89.19  ? 109 ILE D N     1 
ATOM 5274 C CA    . ILE F 5 109 ? -39.435 2.563   -9.394  1.00 89.71  ? 109 ILE D CA    1 
ATOM 5275 C C     . ILE F 5 109 ? -40.120 1.205   -9.228  1.00 92.86  ? 109 ILE D C     1 
ATOM 5276 O O     . ILE F 5 109 ? -39.750 0.390   -8.375  1.00 92.82  ? 109 ILE D O     1 
ATOM 5277 C CB    . ILE F 5 109 ? -40.309 3.724   -8.859  1.00 90.11  ? 109 ILE D CB    1 
ATOM 5278 C CG1   . ILE F 5 109 ? -39.524 5.034   -8.909  1.00 93.52  ? 109 ILE D CG1   1 
ATOM 5279 C CG2   . ILE F 5 109 ? -40.748 3.472   -7.424  1.00 89.19  ? 109 ILE D CG2   1 
ATOM 5280 C CD1   . ILE F 5 109 ? -39.447 5.665   -10.285 1.00 96.65  ? 109 ILE D CD1   1 
ATOM 5281 N N     . LEU F 5 110 ? -41.106 0.962   -10.081 1.00 90.15  ? 110 LEU D N     1 
ATOM 5282 C CA    . LEU F 5 110 ? -41.747 -0.333  -10.160 1.00 81.95  ? 110 LEU D CA    1 
ATOM 5283 C C     . LEU F 5 110 ? -40.652 -1.368  -10.252 1.00 81.94  ? 110 LEU D C     1 
ATOM 5284 O O     . LEU F 5 110 ? -40.435 -2.144  -9.325  1.00 84.32  ? 110 LEU D O     1 
ATOM 5285 C CB    . LEU F 5 110 ? -42.602 -0.400  -11.420 1.00 75.33  ? 110 LEU D CB    1 
ATOM 5286 C CG    . LEU F 5 110 ? -43.431 -1.647  -11.697 1.00 71.18  ? 110 LEU D CG    1 
ATOM 5287 C CD1   . LEU F 5 110 ? -44.665 -1.625  -10.829 1.00 69.75  ? 110 LEU D CD1   1 
ATOM 5288 C CD2   . LEU F 5 110 ? -43.820 -1.696  -13.167 1.00 71.87  ? 110 LEU D CD2   1 
ATOM 5289 N N     . GLN F 5 111 ? -39.942 -1.349  -11.374 1.00 82.97  ? 111 GLN D N     1 
ATOM 5290 C CA    . GLN F 5 111 ? -38.905 -2.331  -11.628 1.00 87.41  ? 111 GLN D CA    1 
ATOM 5291 C C     . GLN F 5 111 ? -38.082 -2.500  -10.355 1.00 90.14  ? 111 GLN D C     1 
ATOM 5292 O O     . GLN F 5 111 ? -38.197 -3.523  -9.659  1.00 95.63  ? 111 GLN D O     1 
ATOM 5293 C CB    . GLN F 5 111 ? -38.018 -1.883  -12.797 1.00 86.28  ? 111 GLN D CB    1 
ATOM 5294 C CG    . GLN F 5 111 ? -38.701 -1.911  -14.161 1.00 87.63  ? 111 GLN D CG    1 
ATOM 5295 C CD    . GLN F 5 111 ? -37.785 -1.442  -15.269 1.00 86.11  ? 111 GLN D CD    1 
ATOM 5296 O OE1   . GLN F 5 111 ? -36.662 -1.018  -15.010 1.00 87.26  ? 111 GLN D OE1   1 
ATOM 5297 N NE2   . GLN F 5 111 ? -38.256 -1.514  -16.511 1.00 84.03  ? 111 GLN D NE2   1 
ATOM 5298 N N     . LYS F 5 112 ? -37.338 -1.454  -10.005 1.00 83.90  ? 112 LYS D N     1 
ATOM 5299 C CA    . LYS F 5 112 ? -36.358 -1.500  -8.922  1.00 77.76  ? 112 LYS D CA    1 
ATOM 5300 C C     . LYS F 5 112 ? -36.890 -2.099  -7.627  1.00 76.99  ? 112 LYS D C     1 
ATOM 5301 O O     . LYS F 5 112 ? -36.135 -2.659  -6.828  1.00 73.33  ? 112 LYS D O     1 
ATOM 5302 C CB    . LYS F 5 112 ? -35.812 -0.099  -8.667  1.00 74.01  ? 112 LYS D CB    1 
ATOM 5303 C CG    . LYS F 5 112 ? -35.068 0.047   -7.369  1.00 70.87  ? 112 LYS D CG    1 
ATOM 5304 C CD    . LYS F 5 112 ? -33.711 -0.614  -7.416  1.00 71.41  ? 112 LYS D CD    1 
ATOM 5305 C CE    . LYS F 5 112 ? -32.935 -0.334  -6.139  1.00 73.79  ? 112 LYS D CE    1 
ATOM 5306 N NZ    . LYS F 5 112 ? -32.908 1.108   -5.768  1.00 78.62  ? 112 LYS D NZ    1 
ATOM 5307 N N     . ILE F 5 113 ? -38.193 -1.989  -7.427  1.00 81.85  ? 113 ILE D N     1 
ATOM 5308 C CA    . ILE F 5 113 ? -38.825 -2.583  -6.261  1.00 85.19  ? 113 ILE D CA    1 
ATOM 5309 C C     . ILE F 5 113 ? -39.160 -4.067  -6.472  1.00 91.20  ? 113 ILE D C     1 
ATOM 5310 O O     . ILE F 5 113 ? -38.620 -4.946  -5.797  1.00 93.48  ? 113 ILE D O     1 
ATOM 5311 C CB    . ILE F 5 113 ? -40.112 -1.823  -5.905  1.00 81.86  ? 113 ILE D CB    1 
ATOM 5312 C CG1   . ILE F 5 113 ? -39.797 -0.417  -5.413  1.00 76.00  ? 113 ILE D CG1   1 
ATOM 5313 C CG2   . ILE F 5 113 ? -40.887 -2.570  -4.851  1.00 81.50  ? 113 ILE D CG2   1 
ATOM 5314 C CD1   . ILE F 5 113 ? -41.023 0.328   -5.022  1.00 73.07  ? 113 ILE D CD1   1 
ATOM 5315 N N     . SER F 5 114 ? -40.051 -4.330  -7.420  1.00 93.83  ? 114 SER D N     1 
ATOM 5316 C CA    . SER F 5 114 ? -40.678 -5.631  -7.530  1.00 96.63  ? 114 SER D CA    1 
ATOM 5317 C C     . SER F 5 114 ? -39.616 -6.710  -7.498  1.00 94.89  ? 114 SER D C     1 
ATOM 5318 O O     . SER F 5 114 ? -39.763 -7.708  -6.792  1.00 97.41  ? 114 SER D O     1 
ATOM 5319 C CB    . SER F 5 114 ? -41.452 -5.707  -8.839  1.00 102.93 ? 114 SER D CB    1 
ATOM 5320 O OG    . SER F 5 114 ? -42.724 -6.300  -8.672  1.00 107.99 ? 114 SER D OG    1 
ATOM 5321 N N     . ILE F 5 115 ? -38.537 -6.487  -8.251  1.00 93.35  ? 115 ILE D N     1 
ATOM 5322 C CA    . ILE F 5 115 ? -37.414 -7.426  -8.313  1.00 96.70  ? 115 ILE D CA    1 
ATOM 5323 C C     . ILE F 5 115 ? -36.941 -7.826  -6.916  1.00 100.52 ? 115 ILE D C     1 
ATOM 5324 O O     . ILE F 5 115 ? -36.974 -8.996  -6.530  1.00 106.95 ? 115 ILE D O     1 
ATOM 5325 C CB    . ILE F 5 115 ? -36.222 -6.892  -9.171  1.00 107.05 ? 115 ILE D CB    1 
ATOM 5326 C CG1   . ILE F 5 115 ? -35.135 -7.960  -9.256  1.00 111.87 ? 115 ILE D CG1   1 
ATOM 5327 C CG2   . ILE F 5 115 ? -35.667 -5.582  -8.620  1.00 101.29 ? 115 ILE D CG2   1 
ATOM 5328 C CD1   . ILE F 5 115 ? -33.825 -7.447  -9.702  1.00 112.56 ? 115 ILE D CD1   1 
ATOM 5329 N N     . ASN F 5 116 ? -36.488 -6.824  -6.178  1.00 97.89  ? 116 ASN D N     1 
ATOM 5330 C CA    . ASN F 5 116 ? -36.103 -6.971  -4.789  1.00 94.60  ? 116 ASN D CA    1 
ATOM 5331 C C     . ASN F 5 116 ? -37.164 -7.641  -3.934  1.00 89.42  ? 116 ASN D C     1 
ATOM 5332 O O     . ASN F 5 116 ? -36.840 -8.398  -3.026  1.00 90.42  ? 116 ASN D O     1 
ATOM 5333 C CB    . ASN F 5 116 ? -35.767 -5.602  -4.203  1.00 100.08 ? 116 ASN D CB    1 
ATOM 5334 C CG    . ASN F 5 116 ? -34.566 -4.954  -4.880  1.00 105.00 ? 116 ASN D CG    1 
ATOM 5335 O OD1   . ASN F 5 116 ? -33.439 -5.432  -4.745  1.00 110.28 ? 116 ASN D OD1   1 
ATOM 5336 N ND2   . ASN F 5 116 ? -34.801 -3.856  -5.599  1.00 103.01 ? 116 ASN D ND2   1 
ATOM 5337 N N     . LEU F 5 117 ? -38.431 -7.364  -4.203  1.00 84.93  ? 117 LEU D N     1 
ATOM 5338 C CA    . LEU F 5 117 ? -39.471 -7.943  -3.368  1.00 87.73  ? 117 LEU D CA    1 
ATOM 5339 C C     . LEU F 5 117 ? -39.669 -9.409  -3.714  1.00 96.22  ? 117 LEU D C     1 
ATOM 5340 O O     . LEU F 5 117 ? -40.136 -10.203 -2.897  1.00 99.25  ? 117 LEU D O     1 
ATOM 5341 C CB    . LEU F 5 117 ? -40.776 -7.163  -3.490  1.00 86.15  ? 117 LEU D CB    1 
ATOM 5342 C CG    . LEU F 5 117 ? -40.909 -6.132  -2.377  1.00 86.77  ? 117 LEU D CG    1 
ATOM 5343 C CD1   . LEU F 5 117 ? -42.360 -5.735  -2.200  1.00 87.49  ? 117 LEU D CD1   1 
ATOM 5344 C CD2   . LEU F 5 117 ? -40.359 -6.726  -1.104  1.00 87.82  ? 117 LEU D CD2   1 
ATOM 5345 N N     . TRP F 5 118 ? -39.299 -9.758  -4.937  1.00 99.16  ? 118 TRP D N     1 
ATOM 5346 C CA    . TRP F 5 118 ? -39.316 -11.136 -5.366  1.00 102.25 ? 118 TRP D CA    1 
ATOM 5347 C C     . TRP F 5 118 ? -38.210 -11.873 -4.653  1.00 111.26 ? 118 TRP D C     1 
ATOM 5348 O O     . TRP F 5 118 ? -38.436 -12.911 -4.044  1.00 118.09 ? 118 TRP D O     1 
ATOM 5349 C CB    . TRP F 5 118 ? -39.069 -11.224 -6.862  1.00 96.67  ? 118 TRP D CB    1 
ATOM 5350 C CG    . TRP F 5 118 ? -40.264 -11.015 -7.682  1.00 97.39  ? 118 TRP D CG    1 
ATOM 5351 C CD1   . TRP F 5 118 ? -40.424 -10.091 -8.664  1.00 98.19  ? 118 TRP D CD1   1 
ATOM 5352 C CD2   . TRP F 5 118 ? -41.487 -11.749 -7.611  1.00 100.32 ? 118 TRP D CD2   1 
ATOM 5353 N NE1   . TRP F 5 118 ? -41.672 -10.200 -9.216  1.00 101.18 ? 118 TRP D NE1   1 
ATOM 5354 C CE2   . TRP F 5 118 ? -42.348 -11.214 -8.588  1.00 103.51 ? 118 TRP D CE2   1 
ATOM 5355 C CE3   . TRP F 5 118 ? -41.944 -12.809 -6.822  1.00 99.18  ? 118 TRP D CE3   1 
ATOM 5356 C CZ2   . TRP F 5 118 ? -43.635 -11.704 -8.796  1.00 105.99 ? 118 TRP D CZ2   1 
ATOM 5357 C CZ3   . TRP F 5 118 ? -43.222 -13.293 -7.030  1.00 100.40 ? 118 TRP D CZ3   1 
ATOM 5358 C CH2   . TRP F 5 118 ? -44.051 -12.742 -8.005  1.00 103.80 ? 118 TRP D CH2   1 
ATOM 5359 N N     . ASN F 5 119 ? -37.010 -11.311 -4.716  1.00 113.53 ? 119 ASN D N     1 
ATOM 5360 C CA    . ASN F 5 119 ? -35.813 -11.988 -4.246  1.00 118.38 ? 119 ASN D CA    1 
ATOM 5361 C C     . ASN F 5 119 ? -36.061 -12.564 -2.857  1.00 118.14 ? 119 ASN D C     1 
ATOM 5362 O O     . ASN F 5 119 ? -36.441 -11.849 -1.936  1.00 124.23 ? 119 ASN D O     1 
ATOM 5363 C CB    . ASN F 5 119 ? -34.633 -10.990 -4.249  1.00 115.94 ? 119 ASN D CB    1 
ATOM 5364 C CG    . ASN F 5 119 ? -33.327 -11.597 -3.764  1.00 112.38 ? 119 ASN D CG    1 
ATOM 5365 O OD1   . ASN F 5 119 ? -33.171 -12.821 -3.697  1.00 110.28 ? 119 ASN D OD1   1 
ATOM 5366 N ND2   . ASN F 5 119 ? -32.373 -10.732 -3.428  1.00 107.01 ? 119 ASN D ND2   1 
ATOM 5367 N N     . PRO F 5 120 ? -35.881 -13.883 -2.717  1.00 113.48 ? 120 PRO D N     1 
ATOM 5368 C CA    . PRO F 5 120 ? -36.110 -14.640 -1.482  1.00 110.63 ? 120 PRO D CA    1 
ATOM 5369 C C     . PRO F 5 120 ? -35.081 -14.305 -0.422  1.00 108.27 ? 120 PRO D C     1 
ATOM 5370 O O     . PRO F 5 120 ? -35.386 -14.336 0.772   1.00 104.05 ? 120 PRO D O     1 
ATOM 5371 C CB    . PRO F 5 120 ? -35.913 -16.082 -1.927  1.00 114.53 ? 120 PRO D CB    1 
ATOM 5372 C CG    . PRO F 5 120 ? -34.950 -15.967 -3.060  1.00 115.29 ? 120 PRO D CG    1 
ATOM 5373 C CD    . PRO F 5 120 ? -35.361 -14.740 -3.791  1.00 112.64 ? 120 PRO D CD    1 
ATOM 5374 N N     . SER F 5 121 ? -33.872 -13.985 -0.874  1.00 111.14 ? 121 SER D N     1 
ATOM 5375 C CA    . SER F 5 121 ? -32.768 -13.657 0.010   1.00 114.48 ? 121 SER D CA    1 
ATOM 5376 C C     . SER F 5 121 ? -32.606 -12.142 0.134   1.00 117.92 ? 121 SER D C     1 
ATOM 5377 O O     . SER F 5 121 ? -32.242 -11.466 -0.820  1.00 118.21 ? 121 SER D O     1 
ATOM 5378 C CB    . SER F 5 121 ? -31.478 -14.252 -0.555  1.00 113.53 ? 121 SER D CB    1 
ATOM 5379 O OG    . SER F 5 121 ? -30.969 -13.463 -1.620  1.00 114.35 ? 121 SER D OG    1 
ATOM 5380 N N     . THR F 5 122 ? -32.917 -11.586 1.297   1.00 121.67 ? 122 THR D N     1 
ATOM 5381 C CA    . THR F 5 122 ? -32.587 -10.188 1.551   1.00 125.20 ? 122 THR D CA    1 
ATOM 5382 C C     . THR F 5 122 ? -31.602 -10.129 2.704   1.00 135.29 ? 122 THR D C     1 
ATOM 5383 O O     . THR F 5 122 ? -31.990 -10.264 3.867   1.00 137.24 ? 122 THR D O     1 
ATOM 5384 C CB    . THR F 5 122 ? -33.842 -9.372  1.873   1.00 121.60 ? 122 THR D CB    1 
ATOM 5385 O OG1   . THR F 5 122 ? -34.207 -9.579  3.238   1.00 123.23 ? 122 THR D OG1   1 
ATOM 5386 C CG2   . THR F 5 122 ? -34.998 -9.762  0.971   1.00 118.67 ? 122 THR D CG2   1 
ATOM 5387 N N     . ASP F 5 123 ? -30.332 -9.912  2.383   1.00 142.46 ? 123 ASP D N     1 
ATOM 5388 C CA    . ASP F 5 123 ? -29.308 -9.768  3.409   1.00 150.95 ? 123 ASP D CA    1 
ATOM 5389 C C     . ASP F 5 123 ? -29.263 -8.334  3.898   1.00 155.63 ? 123 ASP D C     1 
ATOM 5390 O O     . ASP F 5 123 ? -29.009 -8.066  5.072   1.00 155.95 ? 123 ASP D O     1 
ATOM 5391 C CB    . ASP F 5 123 ? -27.950 -10.190 2.866   1.00 153.66 ? 123 ASP D CB    1 
ATOM 5392 C CG    . ASP F 5 123 ? -28.054 -11.351 1.900   1.00 156.70 ? 123 ASP D CG    1 
ATOM 5393 O OD1   . ASP F 5 123 ? -27.834 -12.509 2.317   1.00 157.54 ? 123 ASP D OD1   1 
ATOM 5394 O OD2   . ASP F 5 123 ? -28.357 -11.102 0.713   1.00 160.62 ? 123 ASP D OD2   1 
ATOM 5395 N N     . SER F 5 124 ? -29.500 -7.412  2.970   1.00 160.08 ? 124 SER D N     1 
ATOM 5396 C CA    . SER F 5 124 ? -29.399 -5.985  3.249   1.00 164.71 ? 124 SER D CA    1 
ATOM 5397 C C     . SER F 5 124 ? -30.514 -5.543  4.201   1.00 164.89 ? 124 SER D C     1 
ATOM 5398 O O     . SER F 5 124 ? -30.293 -4.687  5.059   1.00 167.04 ? 124 SER D O     1 
ATOM 5399 C CB    . SER F 5 124 ? -29.406 -5.186  1.941   1.00 168.79 ? 124 SER D CB    1 
ATOM 5400 O OG    . SER F 5 124 ? -28.808 -5.942  0.897   1.00 171.15 ? 124 SER D OG    1 
ATOM 5401 N N     . LEU F 5 125 ? -31.700 -6.143  4.079   1.00 162.07 ? 125 LEU D N     1 
ATOM 5402 C CA    . LEU F 5 125 ? -32.733 -5.934  5.099   1.00 159.78 ? 125 LEU D CA    1 
ATOM 5403 C C     . LEU F 5 125 ? -32.703 -6.979  6.222   1.00 162.17 ? 125 LEU D C     1 
ATOM 5404 O O     . LEU F 5 125 ? -32.618 -8.184  5.982   1.00 162.00 ? 125 LEU D O     1 
ATOM 5405 C CB    . LEU F 5 125 ? -34.147 -5.743  4.505   1.00 157.43 ? 125 LEU D CB    1 
ATOM 5406 C CG    . LEU F 5 125 ? -35.244 -6.804  4.344   1.00 157.46 ? 125 LEU D CG    1 
ATOM 5407 C CD1   . LEU F 5 125 ? -35.639 -7.502  5.652   1.00 159.83 ? 125 LEU D CD1   1 
ATOM 5408 C CD2   . LEU F 5 125 ? -36.470 -6.154  3.703   1.00 156.00 ? 125 LEU D CD2   1 
ATOM 5409 N N     . GLN F 5 126 ? -32.685 -6.473  7.452   1.00 168.59 ? 126 GLN D N     1 
ATOM 5410 C CA    . GLN F 5 126 ? -32.917 -7.255  8.667   1.00 177.00 ? 126 GLN D CA    1 
ATOM 5411 C C     . GLN F 5 126 ? -34.404 -7.430  9.008   1.00 179.68 ? 126 GLN D C     1 
ATOM 5412 O O     . GLN F 5 126 ? -34.800 -8.475  9.529   1.00 187.35 ? 126 GLN D O     1 
ATOM 5413 C CB    . GLN F 5 126 ? -32.205 -6.610  9.859   1.00 183.19 ? 126 GLN D CB    1 
ATOM 5414 C CG    . GLN F 5 126 ? -32.566 -5.139  10.093  1.00 189.99 ? 126 GLN D CG    1 
ATOM 5415 C CD    . GLN F 5 126 ? -32.119 -4.236  8.954   1.00 195.11 ? 126 GLN D CD    1 
ATOM 5416 O OE1   . GLN F 5 126 ? -31.438 -4.680  8.031   1.00 197.11 ? 126 GLN D OE1   1 
ATOM 5417 N NE2   . GLN F 5 126 ? -32.506 -2.967  9.011   1.00 196.69 ? 126 GLN D NE2   1 
ATOM 5418 N N     . SER F 5 127 ? -35.218 -6.422  8.689   1.00 177.10 ? 127 SER D N     1 
ATOM 5419 C CA    . SER F 5 127 ? -36.513 -6.222  9.337   1.00 175.89 ? 127 SER D CA    1 
ATOM 5420 C C     . SER F 5 127 ? -37.363 -7.481  9.390   1.00 173.46 ? 127 SER D C     1 
ATOM 5421 O O     . SER F 5 127 ? -37.373 -8.272  8.447   1.00 177.25 ? 127 SER D O     1 
ATOM 5422 C CB    . SER F 5 127 ? -37.287 -5.103  8.645   1.00 180.37 ? 127 SER D CB    1 
ATOM 5423 O OG    . SER F 5 127 ? -38.504 -4.878  9.339   1.00 183.12 ? 127 SER D OG    1 
ATOM 5424 N N     . LYS F 5 128 ? -38.039 -7.700  10.512  1.00 165.98 ? 128 LYS D N     1 
ATOM 5425 C CA    . LYS F 5 128 ? -38.749 -8.960  10.691  1.00 160.02 ? 128 LYS D CA    1 
ATOM 5426 C C     . LYS F 5 128 ? -39.683 -9.214  9.540   1.00 160.88 ? 128 LYS D C     1 
ATOM 5427 O O     . LYS F 5 128 ? -39.817 -10.291 9.016   1.00 160.96 ? 128 LYS D O     1 
ATOM 5428 C CB    . LYS F 5 128 ? -39.561 -8.954  12.005  1.00 155.12 ? 128 LYS D CB    1 
ATOM 5429 C CG    . LYS F 5 128 ? -40.920 -8.314  11.879  1.00 150.83 ? 128 LYS D CG    1 
ATOM 5430 C CD    . LYS F 5 128 ? -40.881 -6.920  12.429  1.00 145.83 ? 128 LYS D CD    1 
ATOM 5431 C CE    . LYS F 5 128 ? -40.954 -6.829  13.940  1.00 140.93 ? 128 LYS D CE    1 
ATOM 5432 N NZ    . LYS F 5 128 ? -41.828 -5.707  14.414  1.00 138.64 ? 128 LYS D NZ    1 
ATOM 5433 N N     . HIS F 5 129 ? -40.354 -8.165  9.153   1.00 161.45 ? 129 HIS D N     1 
ATOM 5434 C CA    . HIS F 5 129 ? -41.484 -8.308  8.272   1.00 164.84 ? 129 HIS D CA    1 
ATOM 5435 C C     . HIS F 5 129 ? -41.011 -8.708  6.864   1.00 162.52 ? 129 HIS D C     1 
ATOM 5436 O O     . HIS F 5 129 ? -39.913 -8.327  6.415   1.00 164.51 ? 129 HIS D O     1 
ATOM 5437 C CB    . HIS F 5 129 ? -42.299 -7.010  8.305   1.00 171.53 ? 129 HIS D CB    1 
ATOM 5438 C CG    . HIS F 5 129 ? -42.544 -6.454  9.668   1.00 176.68 ? 129 HIS D CG    1 
ATOM 5439 N ND1   . HIS F 5 129 ? -41.832 -5.398  10.176  1.00 178.07 ? 129 HIS D ND1   1 
ATOM 5440 C CD2   . HIS F 5 129 ? -43.414 -6.835  10.656  1.00 180.54 ? 129 HIS D CD2   1 
ATOM 5441 C CE1   . HIS F 5 129 ? -42.314 -5.054  11.351  1.00 180.17 ? 129 HIS D CE1   1 
ATOM 5442 N NE2   . HIS F 5 129 ? -43.257 -5.943  11.678  1.00 181.64 ? 129 HIS D NE2   1 
ATOM 5443 N N     . PHE F 5 130 ? -41.857 -9.434  6.146   1.00 159.13 ? 130 PHE D N     1 
ATOM 5444 C CA    . PHE F 5 130 ? -41.494 -9.804  4.788   1.00 156.57 ? 130 PHE D CA    1 
ATOM 5445 C C     . PHE F 5 130 ? -40.531 -10.981 4.830   1.00 155.92 ? 130 PHE D C     1 
ATOM 5446 O O     . PHE F 5 130 ? -40.058 -11.453 3.790   1.00 158.81 ? 130 PHE D O     1 
ATOM 5447 C CB    . PHE F 5 130 ? -40.886 -8.607  4.086   1.00 151.07 ? 130 PHE D CB    1 
ATOM 5448 C CG    . PHE F 5 130 ? -41.734 -7.374  4.191   1.00 144.01 ? 130 PHE D CG    1 
ATOM 5449 C CD1   . PHE F 5 130 ? -41.175 -6.115  4.132   1.00 139.39 ? 130 PHE D CD1   1 
ATOM 5450 C CD2   . PHE F 5 130 ? -43.100 -7.488  4.350   1.00 144.42 ? 130 PHE D CD2   1 
ATOM 5451 C CE1   . PHE F 5 130 ? -41.967 -5.000  4.224   1.00 140.26 ? 130 PHE D CE1   1 
ATOM 5452 C CE2   . PHE F 5 130 ? -43.897 -6.383  4.443   1.00 144.40 ? 130 PHE D CE2   1 
ATOM 5453 C CZ    . PHE F 5 130 ? -43.337 -5.134  4.380   1.00 142.35 ? 130 PHE D CZ    1 
ATOM 5454 N N     . LYS F 5 131 ? -40.219 -11.427 6.046   1.00 151.37 ? 131 LYS D N     1 
ATOM 5455 C CA    . LYS F 5 131 ? -39.367 -12.587 6.224   1.00 147.97 ? 131 LYS D CA    1 
ATOM 5456 C C     . LYS F 5 131 ? -39.861 -13.658 5.262   1.00 146.82 ? 131 LYS D C     1 
ATOM 5457 O O     . LYS F 5 131 ? -39.150 -14.037 4.332   1.00 148.08 ? 131 LYS D O     1 
ATOM 5458 C CB    . LYS F 5 131 ? -39.384 -13.059 7.682   1.00 145.75 ? 131 LYS D CB    1 
ATOM 5459 C CG    . LYS F 5 131 ? -40.720 -13.607 8.174   1.00 146.39 ? 131 LYS D CG    1 
ATOM 5460 C CD    . LYS F 5 131 ? -41.255 -12.805 9.353   1.00 148.67 ? 131 LYS D CD    1 
ATOM 5461 C CE    . LYS F 5 131 ? -42.646 -13.272 9.776   1.00 144.93 ? 131 LYS D CE    1 
ATOM 5462 N NZ    . LYS F 5 131 ? -42.645 -14.526 10.581  1.00 144.37 ? 131 LYS D NZ    1 
ATOM 5463 N N     . THR F 5 132 ? -41.087 -14.124 5.470   1.00 141.82 ? 132 THR D N     1 
ATOM 5464 C CA    . THR F 5 132 ? -41.713 -15.038 4.524   1.00 136.06 ? 132 THR D CA    1 
ATOM 5465 C C     . THR F 5 132 ? -41.909 -14.370 3.164   1.00 135.31 ? 132 THR D C     1 
ATOM 5466 O O     . THR F 5 132 ? -42.202 -13.175 3.084   1.00 134.55 ? 132 THR D O     1 
ATOM 5467 C CB    . THR F 5 132 ? -43.071 -15.557 5.031   1.00 131.84 ? 132 THR D CB    1 
ATOM 5468 O OG1   . THR F 5 132 ? -44.062 -15.364 4.016   1.00 130.96 ? 132 THR D OG1   1 
ATOM 5469 C CG2   . THR F 5 132 ? -43.497 -14.817 6.292   1.00 129.21 ? 132 THR D CG2   1 
ATOM 5470 N N     . CYS F 5 133 ? -41.739 -15.144 2.094   1.00 134.01 ? 133 CYS D N     1 
ATOM 5471 C CA    . CYS F 5 133 ? -41.936 -14.626 0.741   1.00 133.41 ? 133 CYS D CA    1 
ATOM 5472 C C     . CYS F 5 133 ? -43.383 -14.167 0.582   1.00 131.26 ? 133 CYS D C     1 
ATOM 5473 O O     . CYS F 5 133 ? -43.686 -13.269 -0.213  1.00 131.11 ? 133 CYS D O     1 
ATOM 5474 C CB    . CYS F 5 133 ? -41.553 -15.672 -0.311  1.00 134.18 ? 133 CYS D CB    1 
ATOM 5475 S SG    . CYS F 5 133 ? -39.761 -15.863 -0.565  1.00 147.06 ? 133 CYS D SG    1 
ATOM 5476 N N     . GLN F 5 134 ? -44.264 -14.769 1.378   1.00 128.17 ? 134 GLN D N     1 
ATOM 5477 C CA    . GLN F 5 134 ? -45.644 -14.311 1.456   1.00 126.34 ? 134 GLN D CA    1 
ATOM 5478 C C     . GLN F 5 134 ? -45.713 -12.804 1.688   1.00 124.97 ? 134 GLN D C     1 
ATOM 5479 O O     . GLN F 5 134 ? -46.153 -12.098 0.808   1.00 127.98 ? 134 GLN D O     1 
ATOM 5480 C CB    . GLN F 5 134 ? -46.444 -15.064 2.524   1.00 124.63 ? 134 GLN D CB    1 
ATOM 5481 C CG    . GLN F 5 134 ? -47.953 -14.835 2.389   1.00 124.61 ? 134 GLN D CG    1 
ATOM 5482 C CD    . GLN F 5 134 ? -48.773 -15.434 3.522   1.00 121.99 ? 134 GLN D CD    1 
ATOM 5483 O OE1   . GLN F 5 134 ? -48.233 -15.970 4.492   1.00 121.50 ? 134 GLN D OE1   1 
ATOM 5484 N NE2   . GLN F 5 134 ? -50.094 -15.336 3.403   1.00 120.53 ? 134 GLN D NE2   1 
ATOM 5485 N N     . ASP F 5 135 ? -45.251 -12.308 2.837   1.00 122.24 ? 135 ASP D N     1 
ATOM 5486 C CA    . ASP F 5 135 ? -45.354 -10.870 3.164   1.00 119.77 ? 135 ASP D CA    1 
ATOM 5487 C C     . ASP F 5 135 ? -44.863 -9.951  2.033   1.00 112.34 ? 135 ASP D C     1 
ATOM 5488 O O     . ASP F 5 135 ? -45.562 -9.010  1.608   1.00 109.23 ? 135 ASP D O     1 
ATOM 5489 C CB    . ASP F 5 135 ? -44.572 -10.539 4.450   1.00 124.59 ? 135 ASP D CB    1 
ATOM 5490 C CG    . ASP F 5 135 ? -44.965 -11.414 5.633   1.00 130.89 ? 135 ASP D CG    1 
ATOM 5491 O OD1   . ASP F 5 135 ? -46.172 -11.696 5.809   1.00 133.01 ? 135 ASP D OD1   1 
ATOM 5492 O OD2   . ASP F 5 135 ? -44.060 -11.809 6.399   1.00 133.28 ? 135 ASP D OD2   1 
ATOM 5493 N N     . LYS F 5 136 ? -43.650 -10.234 1.559   1.00 108.62 ? 136 LYS D N     1 
ATOM 5494 C CA    . LYS F 5 136 ? -43.047 -9.481  0.467   1.00 103.45 ? 136 LYS D CA    1 
ATOM 5495 C C     . LYS F 5 136 ? -44.029 -9.422  -0.681  1.00 111.04 ? 136 LYS D C     1 
ATOM 5496 O O     . LYS F 5 136 ? -44.302 -8.353  -1.206  1.00 113.77 ? 136 LYS D O     1 
ATOM 5497 C CB    . LYS F 5 136 ? -41.757 -10.143 -0.024  1.00 93.73  ? 136 LYS D CB    1 
ATOM 5498 C CG    . LYS F 5 136 ? -40.578 -10.079 0.921   1.00 84.46  ? 136 LYS D CG    1 
ATOM 5499 C CD    . LYS F 5 136 ? -39.376 -10.724 0.265   1.00 83.00  ? 136 LYS D CD    1 
ATOM 5500 C CE    . LYS F 5 136 ? -38.197 -10.840 1.200   1.00 86.52  ? 136 LYS D CE    1 
ATOM 5501 N NZ    . LYS F 5 136 ? -37.154 -11.702 0.582   1.00 91.85  ? 136 LYS D NZ    1 
ATOM 5502 N N     . LEU F 5 137 ? -44.552 -10.587 -1.064  1.00 111.45 ? 137 LEU D N     1 
ATOM 5503 C CA    . LEU F 5 137 ? -45.526 -10.689 -2.151  1.00 108.10 ? 137 LEU D CA    1 
ATOM 5504 C C     . LEU F 5 137 ? -46.842 -9.956  -1.878  1.00 103.17 ? 137 LEU D C     1 
ATOM 5505 O O     . LEU F 5 137 ? -47.428 -9.408  -2.791  1.00 102.42 ? 137 LEU D O     1 
ATOM 5506 C CB    . LEU F 5 137 ? -45.805 -12.154 -2.494  1.00 107.26 ? 137 LEU D CB    1 
ATOM 5507 C CG    . LEU F 5 137 ? -44.694 -12.819 -3.305  1.00 104.91 ? 137 LEU D CG    1 
ATOM 5508 C CD1   . LEU F 5 137 ? -45.248 -13.994 -4.101  1.00 106.60 ? 137 LEU D CD1   1 
ATOM 5509 C CD2   . LEU F 5 137 ? -44.054 -11.796 -4.228  1.00 102.80 ? 137 LEU D CD2   1 
ATOM 5510 N N     . LYS F 5 138 ? -47.309 -9.973  -0.631  1.00 98.05  ? 138 LYS D N     1 
ATOM 5511 C CA    . LYS F 5 138 ? -48.501 -9.240  -0.216  1.00 92.60  ? 138 LYS D CA    1 
ATOM 5512 C C     . LYS F 5 138 ? -48.317 -7.804  -0.629  1.00 85.36  ? 138 LYS D C     1 
ATOM 5513 O O     . LYS F 5 138 ? -49.079 -7.251  -1.444  1.00 87.48  ? 138 LYS D O     1 
ATOM 5514 C CB    . LYS F 5 138 ? -48.643 -9.282  1.308   1.00 91.93  ? 138 LYS D CB    1 
ATOM 5515 C CG    . LYS F 5 138 ? -49.350 -10.502 1.878   1.00 94.08  ? 138 LYS D CG    1 
ATOM 5516 C CD    . LYS F 5 138 ? -49.217 -10.530 3.400   1.00 94.64  ? 138 LYS D CD    1 
ATOM 5517 C CE    . LYS F 5 138 ? -50.421 -11.177 4.052   1.00 98.23  ? 138 LYS D CE    1 
ATOM 5518 N NZ    . LYS F 5 138 ? -51.272 -11.888 3.059   1.00 101.38 ? 138 LYS D NZ    1 
ATOM 5519 N N     . LEU F 5 139 ? -47.296 -7.199  -0.029  1.00 80.51  ? 139 LEU D N     1 
ATOM 5520 C CA    . LEU F 5 139 ? -46.945 -5.823  -0.343  1.00 79.21  ? 139 LEU D CA    1 
ATOM 5521 C C     . LEU F 5 139 ? -46.844 -5.643  -1.838  1.00 78.60  ? 139 LEU D C     1 
ATOM 5522 O O     . LEU F 5 139 ? -47.586 -4.887  -2.439  1.00 80.93  ? 139 LEU D O     1 
ATOM 5523 C CB    . LEU F 5 139 ? -45.602 -5.454  0.270   1.00 76.04  ? 139 LEU D CB    1 
ATOM 5524 C CG    . LEU F 5 139 ? -45.429 -3.951  0.356   1.00 74.63  ? 139 LEU D CG    1 
ATOM 5525 C CD1   . LEU F 5 139 ? -46.003 -3.535  1.682   1.00 72.94  ? 139 LEU D CD1   1 
ATOM 5526 C CD2   . LEU F 5 139 ? -43.972 -3.549  0.243   1.00 74.76  ? 139 LEU D CD2   1 
ATOM 5527 N N     . LEU F 5 140 ? -45.908 -6.364  -2.428  1.00 76.48  ? 140 LEU D N     1 
ATOM 5528 C CA    . LEU F 5 140 ? -45.625 -6.275  -3.841  1.00 76.84  ? 140 LEU D CA    1 
ATOM 5529 C C     . LEU F 5 140 ? -46.884 -6.302  -4.691  1.00 81.40  ? 140 LEU D C     1 
ATOM 5530 O O     . LEU F 5 140 ? -46.982 -5.588  -5.686  1.00 79.41  ? 140 LEU D O     1 
ATOM 5531 C CB    . LEU F 5 140 ? -44.749 -7.444  -4.242  1.00 76.45  ? 140 LEU D CB    1 
ATOM 5532 C CG    . LEU F 5 140 ? -44.468 -7.258  -5.721  1.00 77.81  ? 140 LEU D CG    1 
ATOM 5533 C CD1   . LEU F 5 140 ? -43.719 -5.963  -5.916  1.00 76.03  ? 140 LEU D CD1   1 
ATOM 5534 C CD2   . LEU F 5 140 ? -43.693 -8.405  -6.318  1.00 80.10  ? 140 LEU D CD2   1 
ATOM 5535 N N     . LEU F 5 141 ? -47.837 -7.144  -4.308  1.00 85.72  ? 141 LEU D N     1 
ATOM 5536 C CA    . LEU F 5 141 ? -49.154 -7.151  -4.937  1.00 89.46  ? 141 LEU D CA    1 
ATOM 5537 C C     . LEU F 5 141 ? -49.860 -5.803  -4.737  1.00 97.96  ? 141 LEU D C     1 
ATOM 5538 O O     . LEU F 5 141 ? -50.333 -5.210  -5.701  1.00 100.41 ? 141 LEU D O     1 
ATOM 5539 C CB    . LEU F 5 141 ? -50.062 -8.270  -4.413  1.00 82.93  ? 141 LEU D CB    1 
ATOM 5540 C CG    . LEU F 5 141 ? -51.411 -8.029  -5.098  1.00 78.69  ? 141 LEU D CG    1 
ATOM 5541 C CD1   . LEU F 5 141 ? -51.243 -8.375  -6.563  1.00 79.66  ? 141 LEU D CD1   1 
ATOM 5542 C CD2   . LEU F 5 141 ? -52.615 -8.755  -4.491  1.00 76.36  ? 141 LEU D CD2   1 
ATOM 5543 N N     . ASP F 5 142 ? -49.951 -5.320  -3.497  1.00 98.16  ? 142 ASP D N     1 
ATOM 5544 C CA    . ASP F 5 142 ? -50.557 -4.006  -3.283  1.00 95.17  ? 142 ASP D CA    1 
ATOM 5545 C C     . ASP F 5 142 ? -49.923 -2.987  -4.222  1.00 92.44  ? 142 ASP D C     1 
ATOM 5546 O O     . ASP F 5 142 ? -50.580 -2.446  -5.092  1.00 94.50  ? 142 ASP D O     1 
ATOM 5547 C CB    . ASP F 5 142 ? -50.436 -3.539  -1.829  1.00 95.03  ? 142 ASP D CB    1 
ATOM 5548 C CG    . ASP F 5 142 ? -51.098 -2.188  -1.593  1.00 97.50  ? 142 ASP D CG    1 
ATOM 5549 O OD1   . ASP F 5 142 ? -50.434 -1.286  -1.034  1.00 97.54  ? 142 ASP D OD1   1 
ATOM 5550 O OD2   . ASP F 5 142 ? -52.285 -2.025  -1.953  1.00 98.95  ? 142 ASP D OD2   1 
ATOM 5551 N N     . PHE F 5 143 ? -48.627 -2.774  -4.046  1.00 87.53  ? 143 PHE D N     1 
ATOM 5552 C CA    . PHE F 5 143 ? -47.860 -1.792  -4.786  1.00 84.04  ? 143 PHE D CA    1 
ATOM 5553 C C     . PHE F 5 143 ? -48.123 -1.883  -6.278  1.00 84.21  ? 143 PHE D C     1 
ATOM 5554 O O     . PHE F 5 143 ? -48.537 -0.906  -6.900  1.00 84.76  ? 143 PHE D O     1 
ATOM 5555 C CB    . PHE F 5 143 ? -46.370 -2.043  -4.533  1.00 82.86  ? 143 PHE D CB    1 
ATOM 5556 C CG    . PHE F 5 143 ? -45.467 -1.148  -5.307  1.00 83.77  ? 143 PHE D CG    1 
ATOM 5557 C CD1   . PHE F 5 143 ? -44.757 -0.158  -4.667  1.00 86.16  ? 143 PHE D CD1   1 
ATOM 5558 C CD2   . PHE F 5 143 ? -45.331 -1.288  -6.677  1.00 86.02  ? 143 PHE D CD2   1 
ATOM 5559 C CE1   . PHE F 5 143 ? -43.930 0.681   -5.383  1.00 90.63  ? 143 PHE D CE1   1 
ATOM 5560 C CE2   . PHE F 5 143 ? -44.503 -0.454  -7.396  1.00 88.79  ? 143 PHE D CE2   1 
ATOM 5561 C CZ    . PHE F 5 143 ? -43.800 0.530   -6.749  1.00 91.63  ? 143 PHE D CZ    1 
ATOM 5562 N N     . GLN F 5 144 ? -47.906 -3.062  -6.853  1.00 83.44  ? 144 GLN D N     1 
ATOM 5563 C CA    . GLN F 5 144 ? -48.092 -3.231  -8.291  1.00 82.62  ? 144 GLN D CA    1 
ATOM 5564 C C     . GLN F 5 144 ? -49.523 -2.927  -8.661  1.00 77.52  ? 144 GLN D C     1 
ATOM 5565 O O     . GLN F 5 144 ? -49.819 -2.400  -9.728  1.00 79.78  ? 144 GLN D O     1 
ATOM 5566 C CB    . GLN F 5 144 ? -47.766 -4.657  -8.722  1.00 84.92  ? 144 GLN D CB    1 
ATOM 5567 C CG    . GLN F 5 144 ? -46.364 -5.075  -8.421  1.00 87.15  ? 144 GLN D CG    1 
ATOM 5568 C CD    . GLN F 5 144 ? -45.925 -6.195  -9.310  1.00 93.65  ? 144 GLN D CD    1 
ATOM 5569 O OE1   . GLN F 5 144 ? -46.743 -6.973  -9.799  1.00 96.93  ? 144 GLN D OE1   1 
ATOM 5570 N NE2   . GLN F 5 144 ? -44.627 -6.276  -9.551  1.00 97.11  ? 144 GLN D NE2   1 
ATOM 5571 N N     . TRP F 5 145 ? -50.414 -3.278  -7.758  1.00 72.19  ? 145 TRP D N     1 
ATOM 5572 C CA    . TRP F 5 145 ? -51.822 -3.116  -8.001  1.00 72.34  ? 145 TRP D CA    1 
ATOM 5573 C C     . TRP F 5 145 ? -52.155 -1.622  -8.125  1.00 73.59  ? 145 TRP D C     1 
ATOM 5574 O O     . TRP F 5 145 ? -52.729 -1.202  -9.114  1.00 69.91  ? 145 TRP D O     1 
ATOM 5575 C CB    . TRP F 5 145 ? -52.617 -3.796  -6.894  1.00 68.90  ? 145 TRP D CB    1 
ATOM 5576 C CG    . TRP F 5 145 ? -54.076 -3.685  -7.065  1.00 72.35  ? 145 TRP D CG    1 
ATOM 5577 C CD1   . TRP F 5 145 ? -54.745 -3.418  -8.218  1.00 74.36  ? 145 TRP D CD1   1 
ATOM 5578 C CD2   . TRP F 5 145 ? -55.070 -3.813  -6.042  1.00 75.69  ? 145 TRP D CD2   1 
ATOM 5579 N NE1   . TRP F 5 145 ? -56.098 -3.377  -7.981  1.00 76.71  ? 145 TRP D NE1   1 
ATOM 5580 C CE2   . TRP F 5 145 ? -56.323 -3.618  -6.651  1.00 75.89  ? 145 TRP D CE2   1 
ATOM 5581 C CE3   . TRP F 5 145 ? -55.019 -4.079  -4.670  1.00 75.43  ? 145 TRP D CE3   1 
ATOM 5582 C CZ2   . TRP F 5 145 ? -57.520 -3.682  -5.938  1.00 74.98  ? 145 TRP D CZ2   1 
ATOM 5583 C CZ3   . TRP F 5 145 ? -56.212 -4.142  -3.963  1.00 74.82  ? 145 TRP D CZ3   1 
ATOM 5584 C CH2   . TRP F 5 145 ? -57.443 -3.944  -4.599  1.00 73.69  ? 145 TRP D CH2   1 
ATOM 5585 N N     . LYS F 5 146 ? -51.781 -0.820  -7.137  1.00 79.13  ? 146 LYS D N     1 
ATOM 5586 C CA    . LYS F 5 146 ? -51.932 0.623   -7.229  1.00 81.23  ? 146 LYS D CA    1 
ATOM 5587 C C     . LYS F 5 146 ? -51.320 1.121   -8.531  1.00 84.32  ? 146 LYS D C     1 
ATOM 5588 O O     . LYS F 5 146 ? -51.985 1.714   -9.378  1.00 89.34  ? 146 LYS D O     1 
ATOM 5589 C CB    . LYS F 5 146 ? -51.243 1.296   -6.029  1.00 78.45  ? 146 LYS D CB    1 
ATOM 5590 C CG    . LYS F 5 146 ? -51.148 2.822   -6.116  1.00 78.80  ? 146 LYS D CG    1 
ATOM 5591 C CD    . LYS F 5 146 ? -52.477 3.505   -5.829  1.00 80.09  ? 146 LYS D CD    1 
ATOM 5592 C CE    . LYS F 5 146 ? -52.289 5.003   -5.589  1.00 79.57  ? 146 LYS D CE    1 
ATOM 5593 N NZ    . LYS F 5 146 ? -51.361 5.651   -6.573  1.00 79.10  ? 146 LYS D NZ    1 
ATOM 5594 N N     . PHE F 5 147 ? -50.020 0.885   -8.643  1.00 81.31  ? 147 PHE D N     1 
ATOM 5595 C CA    . PHE F 5 147 ? -49.200 1.369   -9.741  1.00 76.52  ? 147 PHE D CA    1 
ATOM 5596 C C     . PHE F 5 147 ? -49.925 1.119   -11.063 1.00 82.47  ? 147 PHE D C     1 
ATOM 5597 O O     . PHE F 5 147 ? -49.918 1.957   -11.955 1.00 85.04  ? 147 PHE D O     1 
ATOM 5598 C CB    . PHE F 5 147 ? -47.825 0.662   -9.670  1.00 68.03  ? 147 PHE D CB    1 
ATOM 5599 C CG    . PHE F 5 147 ? -46.736 1.292   -10.498 1.00 59.92  ? 147 PHE D CG    1 
ATOM 5600 C CD1   . PHE F 5 147 ? -45.596 1.823   -9.914  1.00 53.13  ? 147 PHE D CD1   1 
ATOM 5601 C CD2   . PHE F 5 147 ? -46.830 1.301   -11.861 1.00 62.00  ? 147 PHE D CD2   1 
ATOM 5602 C CE1   . PHE F 5 147 ? -44.583 2.369   -10.703 1.00 50.65  ? 147 PHE D CE1   1 
ATOM 5603 C CE2   . PHE F 5 147 ? -45.833 1.841   -12.650 1.00 59.72  ? 147 PHE D CE2   1 
ATOM 5604 C CZ    . PHE F 5 147 ? -44.709 2.374   -12.074 1.00 54.57  ? 147 PHE D CZ    1 
ATOM 5605 N N     . ASN F 5 148 ? -50.559 -0.035  -11.196 1.00 82.13  ? 148 ASN D N     1 
ATOM 5606 C CA    . ASN F 5 148 ? -51.275 -0.345  -12.432 1.00 84.40  ? 148 ASN D CA    1 
ATOM 5607 C C     . ASN F 5 148 ? -52.713 0.223   -12.545 1.00 75.11  ? 148 ASN D C     1 
ATOM 5608 O O     . ASN F 5 148 ? -53.181 0.559   -13.640 1.00 70.75  ? 148 ASN D O     1 
ATOM 5609 C CB    . ASN F 5 148 ? -51.237 -1.857  -12.695 1.00 87.03  ? 148 ASN D CB    1 
ATOM 5610 C CG    . ASN F 5 148 ? -50.237 -2.253  -13.788 1.00 85.92  ? 148 ASN D CG    1 
ATOM 5611 O OD1   . ASN F 5 148 ? -49.304 -1.517  -14.107 1.00 87.63  ? 148 ASN D OD1   1 
ATOM 5612 N ND2   . ASN F 5 148 ? -50.438 -3.433  -14.361 1.00 83.45  ? 148 ASN D ND2   1 
ATOM 5613 N N     . THR F 5 149 ? -53.446 0.262   -11.441 1.00 79.70  ? 149 THR D N     1 
ATOM 5614 C CA    . THR F 5 149 ? -54.813 0.798   -11.465 1.00 83.78  ? 149 THR D CA    1 
ATOM 5615 C C     . THR F 5 149 ? -55.013 2.261   -10.987 1.00 110.39 ? 149 THR D C     1 
ATOM 5616 O O     . THR F 5 149 ? -56.067 2.851   -11.227 1.00 112.67 ? 149 THR D O     1 
ATOM 5617 C CB    . THR F 5 149 ? -55.755 -0.101  -10.680 1.00 88.81  ? 149 THR D CB    1 
ATOM 5618 O OG1   . THR F 5 149 ? -57.098 0.372   -10.823 1.00 94.48  ? 149 THR D OG1   1 
ATOM 5619 C CG2   . THR F 5 149 ? -55.368 -0.109  -9.211  1.00 84.41  ? 149 THR D CG2   1 
ATOM 5620 N N     . ASN F 5 150 ? -53.999 2.846   -10.343 1.00 107.17 ? 150 ASN D N     1 
ATOM 5621 C CA    . ASN F 5 150 ? -54.138 4.122   -9.616  1.00 105.04 ? 150 ASN D CA    1 
ATOM 5622 C C     . ASN F 5 150 ? -55.431 4.277   -8.780  1.00 102.89 ? 150 ASN D C     1 
ATOM 5623 O O     . ASN F 5 150 ? -56.270 5.128   -9.086  1.00 102.80 ? 150 ASN D O     1 
ATOM 5624 C CB    . ASN F 5 150 ? -53.920 5.332   -10.529 1.00 105.00 ? 150 ASN D CB    1 
ATOM 5625 C CG    . ASN F 5 150 ? -52.498 5.845   -10.474 1.00 102.71 ? 150 ASN D CG    1 
ATOM 5626 O OD1   . ASN F 5 150 ? -52.030 6.281   -9.424  1.00 99.52  ? 150 ASN D OD1   1 
ATOM 5627 N ND2   . ASN F 5 150 ? -51.801 5.792   -11.607 1.00 103.95 ? 150 ASN D ND2   1 
ATOM 5628 N N     . VAL F 5 151 ? -55.560 3.465   -7.721  1.00 99.13  ? 151 VAL D N     1 
ATOM 5629 C CA    . VAL F 5 151 ? -56.746 3.436   -6.850  1.00 95.09  ? 151 VAL D CA    1 
ATOM 5630 C C     . VAL F 5 151 ? -56.439 3.790   -5.398  1.00 91.12  ? 151 VAL D C     1 
ATOM 5631 O O     . VAL F 5 151 ? -55.371 3.474   -4.875  1.00 84.52  ? 151 VAL D O     1 
ATOM 5632 C CB    . VAL F 5 151 ? -57.438 2.037   -6.823  1.00 87.93  ? 151 VAL D CB    1 
ATOM 5633 C CG1   . VAL F 5 151 ? -58.645 2.043   -5.876  1.00 91.39  ? 151 VAL D CG1   1 
ATOM 5634 C CG2   . VAL F 5 151 ? -57.868 1.606   -8.205  1.00 87.30  ? 151 VAL D CG2   1 
ATOM 5635 N N     . SER F 5 152 ? -57.408 4.429   -4.749  1.00 97.61  ? 152 SER D N     1 
ATOM 5636 C CA    . SER F 5 152 ? -57.320 4.780   -3.338  1.00 103.59 ? 152 SER D CA    1 
ATOM 5637 C C     . SER F 5 152 ? -57.117 3.541   -2.489  1.00 100.88 ? 152 SER D C     1 
ATOM 5638 O O     . SER F 5 152 ? -57.592 2.465   -2.836  1.00 102.44 ? 152 SER D O     1 
ATOM 5639 C CB    . SER F 5 152 ? -58.603 5.484   -2.902  1.00 111.55 ? 152 SER D CB    1 
ATOM 5640 O OG    . SER F 5 152 ? -58.779 5.390   -1.500  1.00 115.57 ? 152 SER D OG    1 
ATOM 5641 N N     . PHE F 5 153 ? -56.410 3.688   -1.376  1.00 99.78  ? 153 PHE D N     1 
ATOM 5642 C CA    . PHE F 5 153 ? -56.214 2.559   -0.483  1.00 103.71 ? 153 PHE D CA    1 
ATOM 5643 C C     . PHE F 5 153 ? -57.542 2.057   0.070   1.00 112.97 ? 153 PHE D C     1 
ATOM 5644 O O     . PHE F 5 153 ? -57.860 0.869   -0.018  1.00 116.55 ? 153 PHE D O     1 
ATOM 5645 C CB    . PHE F 5 153 ? -55.298 2.923   0.675   1.00 97.71  ? 153 PHE D CB    1 
ATOM 5646 C CG    . PHE F 5 153 ? -55.260 1.879   1.742   1.00 95.65  ? 153 PHE D CG    1 
ATOM 5647 C CD1   . PHE F 5 153 ? -54.376 0.829   1.659   1.00 94.39  ? 153 PHE D CD1   1 
ATOM 5648 C CD2   . PHE F 5 153 ? -56.134 1.929   2.810   1.00 96.40  ? 153 PHE D CD2   1 
ATOM 5649 C CE1   . PHE F 5 153 ? -54.349 -0.139  2.630   1.00 93.85  ? 153 PHE D CE1   1 
ATOM 5650 C CE2   . PHE F 5 153 ? -56.109 0.962   3.784   1.00 96.04  ? 153 PHE D CE2   1 
ATOM 5651 C CZ    . PHE F 5 153 ? -55.216 -0.073  3.693   1.00 94.23  ? 153 PHE D CZ    1 
ATOM 5652 N N     . GLU F 5 154 ? -58.310 2.969   0.651   1.00 117.48 ? 154 GLU D N     1 
ATOM 5653 C CA    . GLU F 5 154 ? -59.606 2.626   1.216   1.00 120.15 ? 154 GLU D CA    1 
ATOM 5654 C C     . GLU F 5 154 ? -60.405 1.802   0.192   1.00 118.78 ? 154 GLU D C     1 
ATOM 5655 O O     . GLU F 5 154 ? -60.902 0.697   0.488   1.00 122.21 ? 154 GLU D O     1 
ATOM 5656 C CB    . GLU F 5 154 ? -60.341 3.913   1.611   1.00 124.43 ? 154 GLU D CB    1 
ATOM 5657 C CG    . GLU F 5 154 ? -61.431 3.737   2.645   1.00 130.45 ? 154 GLU D CG    1 
ATOM 5658 C CD    . GLU F 5 154 ? -62.616 2.968   2.103   1.00 141.51 ? 154 GLU D CD    1 
ATOM 5659 O OE1   . GLU F 5 154 ? -62.888 3.072   0.888   1.00 143.45 ? 154 GLU D OE1   1 
ATOM 5660 O OE2   . GLU F 5 154 ? -63.273 2.250   2.887   1.00 148.82 ? 154 GLU D OE2   1 
ATOM 5661 N N     . ASP F 5 155 ? -60.494 2.325   -1.026  1.00 114.60 ? 155 ASP D N     1 
ATOM 5662 C CA    . ASP F 5 155 ? -61.173 1.625   -2.107  1.00 113.20 ? 155 ASP D CA    1 
ATOM 5663 C C     . ASP F 5 155 ? -60.536 0.259   -2.357  1.00 112.16 ? 155 ASP D C     1 
ATOM 5664 O O     . ASP F 5 155 ? -61.230 -0.720  -2.630  1.00 113.28 ? 155 ASP D O     1 
ATOM 5665 C CB    . ASP F 5 155 ? -61.172 2.469   -3.386  1.00 116.59 ? 155 ASP D CB    1 
ATOM 5666 C CG    . ASP F 5 155 ? -62.172 3.617   -3.335  1.00 120.81 ? 155 ASP D CG    1 
ATOM 5667 O OD1   . ASP F 5 155 ? -63.197 3.495   -2.630  1.00 122.96 ? 155 ASP D OD1   1 
ATOM 5668 O OD2   . ASP F 5 155 ? -61.939 4.643   -4.009  1.00 122.51 ? 155 ASP D OD2   1 
ATOM 5669 N N     . ARG F 5 156 ? -59.212 0.197   -2.259  1.00 111.14 ? 156 ARG D N     1 
ATOM 5670 C CA    . ARG F 5 156 ? -58.491 -1.067  -2.386  1.00 110.63 ? 156 ARG D CA    1 
ATOM 5671 C C     . ARG F 5 156 ? -59.025 -2.101  -1.400  1.00 109.52 ? 156 ARG D C     1 
ATOM 5672 O O     . ARG F 5 156 ? -59.122 -3.287  -1.721  1.00 109.03 ? 156 ARG D O     1 
ATOM 5673 C CB    . ARG F 5 156 ? -56.990 -0.853  -2.161  1.00 111.21 ? 156 ARG D CB    1 
ATOM 5674 C CG    . ARG F 5 156 ? -56.136 -0.993  -3.408  1.00 112.67 ? 156 ARG D CG    1 
ATOM 5675 C CD    . ARG F 5 156 ? -54.692 -0.597  -3.150  1.00 112.23 ? 156 ARG D CD    1 
ATOM 5676 N NE    . ARG F 5 156 ? -54.550 0.831   -2.892  1.00 111.15 ? 156 ARG D NE    1 
ATOM 5677 C CZ    . ARG F 5 156 ? -53.525 1.367   -2.241  1.00 109.90 ? 156 ARG D CZ    1 
ATOM 5678 N NH1   . ARG F 5 156 ? -53.468 2.678   -2.044  1.00 112.51 ? 156 ARG D NH1   1 
ATOM 5679 N NH2   . ARG F 5 156 ? -52.559 0.585   -1.780  1.00 106.56 ? 156 ARG D NH2   1 
ATOM 5680 N N     . THR F 5 157 ? -59.370 -1.645  -0.199  1.00 108.17 ? 157 THR D N     1 
ATOM 5681 C CA    . THR F 5 157 ? -59.889 -2.540  0.831   1.00 106.29 ? 157 THR D CA    1 
ATOM 5682 C C     . THR F 5 157 ? -61.382 -2.830  0.652   1.00 107.66 ? 157 THR D C     1 
ATOM 5683 O O     . THR F 5 157 ? -61.901 -3.777  1.244   1.00 110.24 ? 157 THR D O     1 
ATOM 5684 C CB    . THR F 5 157 ? -59.633 -1.989  2.266   1.00 91.48  ? 157 THR D CB    1 
ATOM 5685 O OG1   . THR F 5 157 ? -60.749 -1.200  2.699   1.00 91.69  ? 157 THR D OG1   1 
ATOM 5686 C CG2   . THR F 5 157 ? -58.357 -1.144  2.312   1.00 88.16  ? 157 THR D CG2   1 
ATOM 5687 N N     . THR F 5 158 ? -62.068 -2.019  -0.155  1.00 109.27 ? 158 THR D N     1 
ATOM 5688 C CA    . THR F 5 158 ? -63.499 -2.247  -0.405  1.00 112.63 ? 158 THR D CA    1 
ATOM 5689 C C     . THR F 5 158 ? -63.786 -3.427  -1.343  1.00 115.00 ? 158 THR D C     1 
ATOM 5690 O O     . THR F 5 158 ? -64.825 -4.083  -1.212  1.00 117.87 ? 158 THR D O     1 
ATOM 5691 C CB    . THR F 5 158 ? -64.220 -0.988  -0.964  1.00 123.98 ? 158 THR D CB    1 
ATOM 5692 O OG1   . THR F 5 158 ? -65.626 -1.076  -0.693  1.00 126.84 ? 158 THR D OG1   1 
ATOM 5693 C CG2   . THR F 5 158 ? -64.016 -0.868  -2.462  1.00 122.25 ? 158 THR D CG2   1 
ATOM 5694 N N     . VAL F 5 159 ? -62.863 -3.715  -2.261  1.00 113.15 ? 159 VAL D N     1 
ATOM 5695 C CA    . VAL F 5 159 ? -63.110 -4.732  -3.291  1.00 114.03 ? 159 VAL D CA    1 
ATOM 5696 C C     . VAL F 5 159 ? -63.061 -6.196  -2.817  1.00 113.70 ? 159 VAL D C     1 
ATOM 5697 O O     . VAL F 5 159 ? -62.048 -6.697  -2.314  1.00 109.50 ? 159 VAL D O     1 
ATOM 5698 C CB    . VAL F 5 159 ? -62.199 -4.550  -4.538  1.00 133.08 ? 159 VAL D CB    1 
ATOM 5699 C CG1   . VAL F 5 159 ? -60.906 -3.830  -4.177  1.00 129.45 ? 159 VAL D CG1   1 
ATOM 5700 C CG2   . VAL F 5 159 ? -61.922 -5.902  -5.195  1.00 135.28 ? 159 VAL D CG2   1 
ATOM 5701 N N     . SER F 5 160 ? -64.187 -6.868  -3.013  1.00 118.61 ? 160 SER D N     1 
ATOM 5702 C CA    . SER F 5 160 ? -64.348 -8.267  -2.664  1.00 123.59 ? 160 SER D CA    1 
ATOM 5703 C C     . SER F 5 160 ? -64.066 -9.085  -3.922  1.00 127.03 ? 160 SER D C     1 
ATOM 5704 O O     . SER F 5 160 ? -64.700 -8.861  -4.949  1.00 129.87 ? 160 SER D O     1 
ATOM 5705 C CB    . SER F 5 160 ? -65.783 -8.504  -2.182  1.00 126.14 ? 160 SER D CB    1 
ATOM 5706 O OG    . SER F 5 160 ? -65.853 -9.565  -1.238  1.00 126.60 ? 160 SER D OG    1 
ATOM 5707 N N     . LEU F 5 161 ? -63.125 -10.027 -3.857  1.00 124.72 ? 161 LEU D N     1 
ATOM 5708 C CA    . LEU F 5 161 ? -62.647 -10.687 -5.079  1.00 121.27 ? 161 LEU D CA    1 
ATOM 5709 C C     . LEU F 5 161 ? -63.722 -11.481 -5.846  1.00 122.56 ? 161 LEU D C     1 
ATOM 5710 O O     . LEU F 5 161 ? -63.568 -11.746 -7.040  1.00 120.90 ? 161 LEU D O     1 
ATOM 5711 C CB    . LEU F 5 161 ? -61.348 -11.487 -4.828  1.00 113.48 ? 161 LEU D CB    1 
ATOM 5712 C CG    . LEU F 5 161 ? -61.225 -13.003 -4.647  1.00 106.26 ? 161 LEU D CG    1 
ATOM 5713 C CD1   . LEU F 5 161 ? -61.972 -13.766 -5.712  1.00 108.07 ? 161 LEU D CD1   1 
ATOM 5714 C CD2   . LEU F 5 161 ? -59.750 -13.393 -4.674  1.00 99.88  ? 161 LEU D CD2   1 
ATOM 5715 N N     . LYS F 5 162 ? -64.804 -11.852 -5.164  1.00 125.25 ? 162 LYS D N     1 
ATOM 5716 C CA    . LYS F 5 162 ? -65.946 -12.448 -5.854  1.00 129.88 ? 162 LYS D CA    1 
ATOM 5717 C C     . LYS F 5 162 ? -66.568 -11.405 -6.782  1.00 132.88 ? 162 LYS D C     1 
ATOM 5718 O O     . LYS F 5 162 ? -67.187 -11.744 -7.792  1.00 137.37 ? 162 LYS D O     1 
ATOM 5719 C CB    . LYS F 5 162 ? -66.980 -13.015 -4.873  1.00 130.96 ? 162 LYS D CB    1 
ATOM 5720 C CG    . LYS F 5 162 ? -68.121 -12.070 -4.517  1.00 132.87 ? 162 LYS D CG    1 
ATOM 5721 C CD    . LYS F 5 162 ? -68.256 -12.001 -3.013  1.00 132.78 ? 162 LYS D CD    1 
ATOM 5722 C CE    . LYS F 5 162 ? -66.865 -11.992 -2.397  1.00 131.22 ? 162 LYS D CE    1 
ATOM 5723 N NZ    . LYS F 5 162 ? -66.842 -12.067 -0.919  1.00 129.12 ? 162 LYS D NZ    1 
ATOM 5724 N N     . ASP F 5 163 ? -66.385 -10.135 -6.433  1.00 133.18 ? 163 ASP D N     1 
ATOM 5725 C CA    . ASP F 5 163 ? -66.790 -9.033  -7.294  1.00 136.43 ? 163 ASP D CA    1 
ATOM 5726 C C     . ASP F 5 163 ? -66.012 -9.100  -8.600  1.00 134.51 ? 163 ASP D C     1 
ATOM 5727 O O     . ASP F 5 163 ? -66.478 -8.624  -9.637  1.00 138.25 ? 163 ASP D O     1 
ATOM 5728 C CB    . ASP F 5 163 ? -66.514 -7.685  -6.619  1.00 141.01 ? 163 ASP D CB    1 
ATOM 5729 C CG    . ASP F 5 163 ? -67.464 -7.390  -5.467  1.00 147.68 ? 163 ASP D CG    1 
ATOM 5730 O OD1   . ASP F 5 163 ? -68.690 -7.578  -5.629  1.00 158.07 ? 163 ASP D OD1   1 
ATOM 5731 O OD2   . ASP F 5 163 ? -66.983 -6.952  -4.401  1.00 146.36 ? 163 ASP D OD2   1 
ATOM 5732 N N     . LEU F 5 164 ? -64.818 -9.686  -8.539  1.00 127.87 ? 164 LEU D N     1 
ATOM 5733 C CA    . LEU F 5 164 ? -63.933 -9.749  -9.703  1.00 120.46 ? 164 LEU D CA    1 
ATOM 5734 C C     . LEU F 5 164 ? -64.471 -10.627 -10.826 1.00 120.38 ? 164 LEU D C     1 
ATOM 5735 O O     . LEU F 5 164 ? -65.075 -11.674 -10.593 1.00 121.67 ? 164 LEU D O     1 
ATOM 5736 C CB    . LEU F 5 164 ? -62.520 -10.198 -9.323  1.00 112.63 ? 164 LEU D CB    1 
ATOM 5737 C CG    . LEU F 5 164 ? -61.603 -9.136  -8.717  1.00 105.07 ? 164 LEU D CG    1 
ATOM 5738 C CD1   . LEU F 5 164 ? -60.158 -9.437  -9.095  1.00 99.71  ? 164 LEU D CD1   1 
ATOM 5739 C CD2   . LEU F 5 164 ? -62.009 -7.739  -9.181  1.00 104.66 ? 164 LEU D CD2   1 
ATOM 5740 N N     . GLN F 5 165 ? -64.243 -10.174 -12.051 1.00 118.45 ? 165 GLN D N     1 
ATOM 5741 C CA    . GLN F 5 165 ? -64.786 -10.840 -13.212 1.00 119.21 ? 165 GLN D CA    1 
ATOM 5742 C C     . GLN F 5 165 ? -63.680 -11.091 -14.199 1.00 118.59 ? 165 GLN D C     1 
ATOM 5743 O O     . GLN F 5 165 ? -63.107 -10.153 -14.750 1.00 118.04 ? 165 GLN D O     1 
ATOM 5744 C CB    . GLN F 5 165 ? -65.838 -9.961  -13.870 1.00 124.28 ? 165 GLN D CB    1 
ATOM 5745 C CG    . GLN F 5 165 ? -66.982 -9.584  -12.953 1.00 127.84 ? 165 GLN D CG    1 
ATOM 5746 C CD    . GLN F 5 165 ? -67.806 -8.440  -13.507 1.00 131.73 ? 165 GLN D CD    1 
ATOM 5747 O OE1   . GLN F 5 165 ? -67.394 -7.764  -14.449 1.00 132.44 ? 165 GLN D OE1   1 
ATOM 5748 N NE2   . GLN F 5 165 ? -68.977 -8.215  -12.924 1.00 133.51 ? 165 GLN D NE2   1 
ATOM 5749 N N     . CYS F 5 166 ? -63.388 -12.361 -14.430 1.00 118.77 ? 166 CYS D N     1 
ATOM 5750 C CA    . CYS F 5 166 ? -62.359 -12.740 -15.378 1.00 116.89 ? 166 CYS D CA    1 
ATOM 5751 C C     . CYS F 5 166 ? -62.819 -12.439 -16.798 1.00 118.25 ? 166 CYS D C     1 
ATOM 5752 O O     . CYS F 5 166 ? -63.926 -12.809 -17.202 1.00 114.00 ? 166 CYS D O     1 
ATOM 5753 C CB    . CYS F 5 166 ? -62.044 -14.228 -15.224 1.00 115.53 ? 166 CYS D CB    1 
ATOM 5754 S SG    . CYS F 5 166 ? -60.685 -14.842 -16.247 1.00 131.33 ? 166 CYS D SG    1 
ATOM 5755 N N     . ILE F 5 167 ? -61.975 -11.746 -17.551 1.00 124.31 ? 167 ILE D N     1 
ATOM 5756 C CA    . ILE F 5 167 ? -62.257 -11.545 -18.963 1.00 132.58 ? 167 ILE D CA    1 
ATOM 5757 C C     . ILE F 5 167 ? -61.343 -12.421 -19.799 1.00 139.22 ? 167 ILE D C     1 
ATOM 5758 O O     . ILE F 5 167 ? -60.128 -12.204 -19.850 1.00 140.00 ? 167 ILE D O     1 
ATOM 5759 C CB    . ILE F 5 167 ? -62.116 -10.067 -19.393 1.00 134.09 ? 167 ILE D CB    1 
ATOM 5760 C CG1   . ILE F 5 167 ? -63.417 -9.309  -19.099 1.00 136.94 ? 167 ILE D CG1   1 
ATOM 5761 C CG2   . ILE F 5 167 ? -61.744 -9.967  -20.869 1.00 133.89 ? 167 ILE D CG2   1 
ATOM 5762 C CD1   . ILE F 5 167 ? -64.644 -10.212 -18.958 1.00 137.87 ? 167 ILE D CD1   1 
ATOM 5763 N N     . LEU F 5 168 ? -61.942 -13.437 -20.413 1.00 144.08 ? 168 LEU D N     1 
ATOM 5764 C CA    . LEU F 5 168 ? -61.278 -14.222 -21.439 1.00 145.20 ? 168 LEU D CA    1 
ATOM 5765 C C     . LEU F 5 168 ? -62.087 -14.069 -22.714 1.00 149.10 ? 168 LEU D C     1 
ATOM 5766 O O     . LEU F 5 168 ? -63.191 -14.597 -22.848 1.00 149.05 ? 168 LEU D O     1 
ATOM 5767 C CB    . LEU F 5 168 ? -61.168 -15.690 -21.018 1.00 141.60 ? 168 LEU D CB    1 
ATOM 5768 C CG    . LEU F 5 168 ? -60.350 -15.808 -19.728 1.00 135.62 ? 168 LEU D CG    1 
ATOM 5769 C CD1   . LEU F 5 168 ? -60.465 -17.172 -19.070 1.00 135.99 ? 168 LEU D CD1   1 
ATOM 5770 C CD2   . LEU F 5 168 ? -58.897 -15.447 -19.997 1.00 131.69 ? 168 LEU D CD2   1 
ATOM 5771 N N     . ASP F 5 169 ? -61.516 -13.317 -23.644 1.00 151.22 ? 169 ASP D N     1 
ATOM 5772 C CA    . ASP F 5 169 ? -62.083 -13.156 -24.963 1.00 153.65 ? 169 ASP D CA    1 
ATOM 5773 C C     . ASP F 5 169 ? -60.975 -13.521 -25.915 1.00 159.04 ? 169 ASP D C     1 
ATOM 5774 O O     . ASP F 5 169 ? -59.987 -12.788 -26.043 1.00 163.19 ? 169 ASP D O     1 
ATOM 5775 C CB    . ASP F 5 169 ? -62.491 -11.705 -25.198 1.00 148.41 ? 169 ASP D CB    1 
ATOM 5776 C CG    . ASP F 5 169 ? -62.738 -11.409 -26.658 1.00 145.97 ? 169 ASP D CG    1 
ATOM 5777 O OD1   . ASP F 5 169 ? -62.859 -12.363 -27.445 1.00 149.26 ? 169 ASP D OD1   1 
ATOM 5778 O OD2   . ASP F 5 169 ? -62.816 -10.227 -27.025 1.00 142.60 ? 169 ASP D OD2   1 
ATOM 5779 N N     . ASP F 5 170 ? -61.134 -14.661 -26.575 1.00 158.00 ? 170 ASP D N     1 
ATOM 5780 C CA    . ASP F 5 170 ? -60.121 -15.117 -27.500 1.00 157.74 ? 170 ASP D CA    1 
ATOM 5781 C C     . ASP F 5 170 ? -60.475 -14.793 -28.954 1.00 156.19 ? 170 ASP D C     1 
ATOM 5782 O O     . ASP F 5 170 ? -59.642 -14.945 -29.841 1.00 158.48 ? 170 ASP D O     1 
ATOM 5783 C CB    . ASP F 5 170 ? -59.843 -16.604 -27.263 1.00 161.29 ? 170 ASP D CB    1 
ATOM 5784 C CG    . ASP F 5 170 ? -58.785 -17.153 -28.178 1.00 167.15 ? 170 ASP D CG    1 
ATOM 5785 O OD1   . ASP F 5 170 ? -57.573 -16.885 -27.993 1.00 162.39 ? 170 ASP D OD1   1 
ATOM 5786 O OD2   . ASP F 5 170 ? -59.192 -17.876 -29.089 1.00 176.16 ? 170 ASP D OD2   1 
ATOM 5787 N N     . GLU F 5 171 ? -61.691 -14.291 -29.176 1.00 152.05 ? 171 GLU D N     1 
ATOM 5788 C CA    . GLU F 5 171 ? -62.087 -13.773 -30.489 1.00 148.25 ? 171 GLU D CA    1 
ATOM 5789 C C     . GLU F 5 171 ? -61.348 -12.464 -30.778 1.00 146.87 ? 171 GLU D C     1 
ATOM 5790 O O     . GLU F 5 171 ? -60.941 -12.196 -31.913 1.00 148.95 ? 171 GLU D O     1 
ATOM 5791 C CB    . GLU F 5 171 ? -63.613 -13.575 -30.610 1.00 144.42 ? 171 GLU D CB    1 
ATOM 5792 C CG    . GLU F 5 171 ? -64.386 -13.619 -29.288 1.00 139.35 ? 171 GLU D CG    1 
ATOM 5793 C CD    . GLU F 5 171 ? -65.826 -13.138 -29.408 1.00 137.71 ? 171 GLU D CD    1 
ATOM 5794 O OE1   . GLU F 5 171 ? -66.304 -12.945 -30.547 1.00 138.15 ? 171 GLU D OE1   1 
ATOM 5795 O OE2   . GLU F 5 171 ? -66.477 -12.951 -28.356 1.00 136.88 ? 171 GLU D OE2   1 
ATOM 5796 N N     . ASN F 5 172 ? -61.212 -11.634 -29.750 1.00 142.00 ? 172 ASN D N     1 
ATOM 5797 C CA    . ASN F 5 172 ? -60.375 -10.448 -29.847 1.00 134.94 ? 172 ASN D CA    1 
ATOM 5798 C C     . ASN F 5 172 ? -58.986 -10.601 -29.217 1.00 130.31 ? 172 ASN D C     1 
ATOM 5799 O O     . ASN F 5 172 ? -58.159 -9.690  -29.289 1.00 126.04 ? 172 ASN D O     1 
ATOM 5800 C CB    . ASN F 5 172 ? -61.113 -9.245  -29.288 1.00 133.46 ? 172 ASN D CB    1 
ATOM 5801 C CG    . ASN F 5 172 ? -62.517 -9.125  -29.851 1.00 133.85 ? 172 ASN D CG    1 
ATOM 5802 O OD1   . ASN F 5 172 ? -62.702 -8.807  -31.026 1.00 135.35 ? 172 ASN D OD1   1 
ATOM 5803 N ND2   . ASN F 5 172 ? -63.515 -9.394  -29.018 1.00 133.16 ? 172 ASN D ND2   1 
ATOM 5804 N N     . GLY F 5 173 ? -58.722 -11.760 -28.622 1.00 131.32 ? 173 GLY D N     1 
ATOM 5805 C CA    . GLY F 5 173 ? -57.424 -12.007 -28.020 1.00 129.07 ? 173 GLY D CA    1 
ATOM 5806 C C     . GLY F 5 173 ? -57.189 -11.123 -26.814 1.00 124.03 ? 173 GLY D C     1 
ATOM 5807 O O     . GLY F 5 173 ? -56.254 -10.321 -26.790 1.00 122.78 ? 173 GLY D O     1 
ATOM 5808 N N     . LYS F 5 174 ? -58.066 -11.250 -25.824 1.00 119.22 ? 174 LYS D N     1 
ATOM 5809 C CA    . LYS F 5 174 ? -57.969 -10.448 -24.615 1.00 114.21 ? 174 LYS D CA    1 
ATOM 5810 C C     . LYS F 5 174 ? -58.112 -11.296 -23.359 1.00 109.97 ? 174 LYS D C     1 
ATOM 5811 O O     . LYS F 5 174 ? -58.879 -12.254 -23.340 1.00 110.45 ? 174 LYS D O     1 
ATOM 5812 C CB    . LYS F 5 174 ? -59.036 -9.356  -24.644 1.00 115.66 ? 174 LYS D CB    1 
ATOM 5813 C CG    . LYS F 5 174 ? -58.827 -8.346  -25.765 1.00 114.93 ? 174 LYS D CG    1 
ATOM 5814 C CD    . LYS F 5 174 ? -60.127 -7.667  -26.180 1.00 114.03 ? 174 LYS D CD    1 
ATOM 5815 C CE    . LYS F 5 174 ? -60.813 -6.975  -25.010 1.00 110.62 ? 174 LYS D CE    1 
ATOM 5816 N NZ    . LYS F 5 174 ? -61.927 -6.091  -25.452 1.00 108.21 ? 174 LYS D NZ    1 
ATOM 5817 N N     . CYS F 5 175 ? -57.341 -10.963 -22.326 1.00 106.83 ? 175 CYS D N     1 
ATOM 5818 C CA    . CYS F 5 175 ? -57.544 -11.552 -21.004 1.00 106.64 ? 175 CYS D CA    1 
ATOM 5819 C C     . CYS F 5 175 ? -57.115 -10.618 -19.880 1.00 103.63 ? 175 CYS D C     1 
ATOM 5820 O O     . CYS F 5 175 ? -56.143 -9.863  -20.003 1.00 103.52 ? 175 CYS D O     1 
ATOM 5821 C CB    . CYS F 5 175 ? -56.888 -12.938 -20.863 1.00 106.56 ? 175 CYS D CB    1 
ATOM 5822 S SG    . CYS F 5 175 ? -55.084 -12.968 -20.743 1.00 155.47 ? 175 CYS D SG    1 
ATOM 5823 N N     . GLY F 5 176 ? -57.860 -10.682 -18.782 1.00 102.35 ? 176 GLY D N     1 
ATOM 5824 C CA    . GLY F 5 176 ? -57.586 -9.851  -17.628 1.00 103.57 ? 176 GLY D CA    1 
ATOM 5825 C C     . GLY F 5 176 ? -58.529 -10.097 -16.465 1.00 107.50 ? 176 GLY D C     1 
ATOM 5826 O O     . GLY F 5 176 ? -59.329 -11.042 -16.474 1.00 110.59 ? 176 GLY D O     1 
ATOM 5827 N N     . LEU F 5 177 ? -58.421 -9.233  -15.458 1.00 109.47 ? 177 LEU D N     1 
ATOM 5828 C CA    . LEU F 5 177 ? -59.265 -9.296  -14.271 1.00 110.54 ? 177 LEU D CA    1 
ATOM 5829 C C     . LEU F 5 177 ? -59.956 -7.955  -14.109 1.00 113.42 ? 177 LEU D C     1 
ATOM 5830 O O     . LEU F 5 177 ? -59.306 -6.944  -13.878 1.00 113.61 ? 177 LEU D O     1 
ATOM 5831 C CB    . LEU F 5 177 ? -58.429 -9.611  -13.038 1.00 107.15 ? 177 LEU D CB    1 
ATOM 5832 C CG    . LEU F 5 177 ? -57.757 -10.972 -13.147 1.00 105.57 ? 177 LEU D CG    1 
ATOM 5833 C CD1   . LEU F 5 177 ? -56.364 -10.937 -12.555 1.00 106.35 ? 177 LEU D CD1   1 
ATOM 5834 C CD2   . LEU F 5 177 ? -58.612 -12.052 -12.506 1.00 102.99 ? 177 LEU D CD2   1 
ATOM 5835 N N     . ALA F 5 178 ? -61.279 -7.956  -14.215 1.00 115.65 ? 178 ALA D N     1 
ATOM 5836 C CA    . ALA F 5 178 ? -62.041 -6.714  -14.287 1.00 114.88 ? 178 ALA D CA    1 
ATOM 5837 C C     . ALA F 5 178 ? -62.885 -6.462  -13.031 1.00 116.85 ? 178 ALA D C     1 
ATOM 5838 O O     . ALA F 5 178 ? -63.273 -7.404  -12.326 1.00 118.18 ? 178 ALA D O     1 
ATOM 5839 C CB    . ALA F 5 178 ? -62.911 -6.703  -15.537 1.00 116.03 ? 178 ALA D CB    1 
ATOM 5840 N N     . HIS F 5 179 ? -63.137 -5.183  -12.750 1.00 115.36 ? 179 HIS D N     1 
ATOM 5841 C CA    . HIS F 5 179 ? -64.060 -4.771  -11.692 1.00 116.94 ? 179 HIS D CA    1 
ATOM 5842 C C     . HIS F 5 179 ? -64.955 -3.666  -12.233 1.00 126.34 ? 179 HIS D C     1 
ATOM 5843 O O     . HIS F 5 179 ? -64.461 -2.597  -12.608 1.00 131.17 ? 179 HIS D O     1 
ATOM 5844 C CB    . HIS F 5 179 ? -63.285 -4.250  -10.474 1.00 107.72 ? 179 HIS D CB    1 
ATOM 5845 C CG    . HIS F 5 179 ? -64.065 -4.265  -9.191  1.00 101.55 ? 179 HIS D CG    1 
ATOM 5846 N ND1   . HIS F 5 179 ? -65.343 -4.773  -9.088  1.00 100.96 ? 179 HIS D ND1   1 
ATOM 5847 C CD2   . HIS F 5 179 ? -63.731 -3.840  -7.947  1.00 99.60  ? 179 HIS D CD2   1 
ATOM 5848 C CE1   . HIS F 5 179 ? -65.761 -4.660  -7.843  1.00 101.09 ? 179 HIS D CE1   1 
ATOM 5849 N NE2   . HIS F 5 179 ? -64.806 -4.094  -7.129  1.00 101.66 ? 179 HIS D NE2   1 
ATOM 5850 N N     . SER F 5 180 ? -66.259 -3.929  -12.292 1.00 127.83 ? 180 SER D N     1 
ATOM 5851 C CA    . SER F 5 180 ? -67.228 -2.918  -12.708 1.00 127.91 ? 180 SER D CA    1 
ATOM 5852 C C     . SER F 5 180 ? -67.862 -2.190  -11.511 1.00 124.80 ? 180 SER D C     1 
ATOM 5853 O O     . SER F 5 180 ? -68.606 -1.225  -11.675 1.00 122.28 ? 180 SER D O     1 
ATOM 5854 C CB    . SER F 5 180 ? -68.304 -3.559  -13.595 1.00 127.57 ? 180 SER D CB    1 
ATOM 5855 O OG    . SER F 5 180 ? -68.577 -4.899  -13.202 1.00 124.99 ? 180 SER D OG    1 
ATOM 5856 N N     . SER F 5 181 ? -67.529 -2.647  -10.309 1.00 126.89 ? 181 SER D N     1 
ATOM 5857 C CA    . SER F 5 181 ? -68.097 -2.102  -9.081  1.00 131.66 ? 181 SER D CA    1 
ATOM 5858 C C     . SER F 5 181 ? -67.386 -0.831  -8.636  1.00 130.04 ? 181 SER D C     1 
ATOM 5859 O O     . SER F 5 181 ? -66.654 -0.225  -9.415  1.00 129.24 ? 181 SER D O     1 
ATOM 5860 C CB    . SER F 5 181 ? -68.121 -3.141  -7.960  1.00 140.01 ? 181 SER D CB    1 
ATOM 5861 O OG    . SER F 5 181 ? -68.696 -2.601  -6.782  1.00 143.15 ? 181 SER D OG    1 
ATOM 5862 N N     . LYS F 5 182 ? -67.610 -0.439  -7.383  1.00 133.13 ? 182 LYS D N     1 
ATOM 5863 C CA    . LYS F 5 182 ? -67.302 0.912   -6.914  1.00 135.99 ? 182 LYS D CA    1 
ATOM 5864 C C     . LYS F 5 182 ? -65.945 1.433   -7.396  1.00 135.63 ? 182 LYS D C     1 
ATOM 5865 O O     . LYS F 5 182 ? -65.890 2.453   -8.088  1.00 137.47 ? 182 LYS D O     1 
ATOM 5866 C CB    . LYS F 5 182 ? -67.363 0.965   -5.383  1.00 138.69 ? 182 LYS D CB    1 
ATOM 5867 C CG    . LYS F 5 182 ? -68.382 0.024   -4.759  1.00 141.87 ? 182 LYS D CG    1 
ATOM 5868 C CD    . LYS F 5 182 ? -68.322 0.075   -3.239  1.00 143.72 ? 182 LYS D CD    1 
ATOM 5869 C CE    . LYS F 5 182 ? -69.506 -0.647  -2.615  1.00 150.42 ? 182 LYS D CE    1 
ATOM 5870 N NZ    . LYS F 5 182 ? -70.804 -0.065  -3.060  1.00 154.60 ? 182 LYS D NZ    1 
ATOM 5871 N N     . PRO F 5 183 ? -64.841 0.758   -7.031  1.00 128.84 ? 183 PRO D N     1 
ATOM 5872 C CA    . PRO F 5 183 ? -63.645 1.111   -7.802  1.00 125.22 ? 183 PRO D CA    1 
ATOM 5873 C C     . PRO F 5 183 ? -63.729 0.490   -9.194  1.00 123.75 ? 183 PRO D C     1 
ATOM 5874 O O     . PRO F 5 183 ? -64.070 -0.684  -9.327  1.00 125.59 ? 183 PRO D O     1 
ATOM 5875 C CB    . PRO F 5 183 ? -62.505 0.493   -6.989  1.00 120.91 ? 183 PRO D CB    1 
ATOM 5876 C CG    . PRO F 5 183 ? -63.059 0.339   -5.615  1.00 121.36 ? 183 PRO D CG    1 
ATOM 5877 C CD    . PRO F 5 183 ? -64.503 -0.002  -5.817  1.00 125.12 ? 183 PRO D CD    1 
ATOM 5878 N N     . ASN F 5 184 ? -63.384 1.257   -10.218 1.00 120.20 ? 184 ASN D N     1 
ATOM 5879 C CA    . ASN F 5 184 ? -63.564 0.802   -11.582 1.00 115.80 ? 184 ASN D CA    1 
ATOM 5880 C C     . ASN F 5 184 ? -62.209 0.601   -12.230 1.00 116.13 ? 184 ASN D C     1 
ATOM 5881 O O     . ASN F 5 184 ? -61.484 1.560   -12.488 1.00 115.13 ? 184 ASN D O     1 
ATOM 5882 C CB    . ASN F 5 184 ? -64.374 1.825   -12.368 1.00 110.15 ? 184 ASN D CB    1 
ATOM 5883 C CG    . ASN F 5 184 ? -64.856 1.288   -13.697 1.00 107.73 ? 184 ASN D CG    1 
ATOM 5884 O OD1   . ASN F 5 184 ? -64.069 1.091   -14.620 1.00 104.99 ? 184 ASN D OD1   1 
ATOM 5885 N ND2   . ASN F 5 184 ? -66.159 1.062   -13.808 1.00 111.64 ? 184 ASN D ND2   1 
ATOM 5886 N N     . PHE F 5 185 ? -61.870 -0.655  -12.493 1.00 117.59 ? 185 PHE D N     1 
ATOM 5887 C CA    . PHE F 5 185 ? -60.553 -0.994  -13.025 1.00 117.78 ? 185 PHE D CA    1 
ATOM 5888 C C     . PHE F 5 185 ? -60.456 -2.341  -13.786 1.00 110.61 ? 185 PHE D C     1 
ATOM 5889 O O     . PHE F 5 185 ? -61.302 -3.238  -13.659 1.00 111.69 ? 185 PHE D O     1 
ATOM 5890 C CB    . PHE F 5 185 ? -59.529 -0.970  -11.891 1.00 114.21 ? 185 PHE D CB    1 
ATOM 5891 C CG    . PHE F 5 185 ? -59.605 -2.166  -10.991 1.00 111.85 ? 185 PHE D CG    1 
ATOM 5892 C CD1   . PHE F 5 185 ? -58.715 -3.218  -11.158 1.00 109.14 ? 185 PHE D CD1   1 
ATOM 5893 C CD2   . PHE F 5 185 ? -60.563 -2.241  -9.981  1.00 112.36 ? 185 PHE D CD2   1 
ATOM 5894 C CE1   . PHE F 5 185 ? -58.774 -4.319  -10.356 1.00 108.75 ? 185 PHE D CE1   1 
ATOM 5895 C CE2   . PHE F 5 185 ? -60.627 -3.350  -9.162  1.00 111.46 ? 185 PHE D CE2   1 
ATOM 5896 C CZ    . PHE F 5 185 ? -59.728 -4.395  -9.353  1.00 109.31 ? 185 PHE D CZ    1 
ATOM 5897 N N     . VAL F 5 186 ? -59.407 -2.452  -14.593 1.00 108.92 ? 186 VAL D N     1 
ATOM 5898 C CA    . VAL F 5 186 ? -59.109 -3.667  -15.337 1.00 109.19 ? 186 VAL D CA    1 
ATOM 5899 C C     . VAL F 5 186 ? -57.598 -3.967  -15.252 1.00 109.71 ? 186 VAL D C     1 
ATOM 5900 O O     . VAL F 5 186 ? -56.766 -3.093  -15.504 1.00 111.50 ? 186 VAL D O     1 
ATOM 5901 C CB    . VAL F 5 186 ? -59.600 -3.544  -16.816 1.00 64.73  ? 186 VAL D CB    1 
ATOM 5902 C CG1   . VAL F 5 186 ? -58.864 -4.501  -17.742 1.00 67.53  ? 186 VAL D CG1   1 
ATOM 5903 C CG2   . VAL F 5 186 ? -61.102 -3.778  -16.895 1.00 67.02  ? 186 VAL D CG2   1 
ATOM 5904 N N     . LEU F 5 187 ? -57.231 -5.197  -14.893 1.00 106.50 ? 187 LEU D N     1 
ATOM 5905 C CA    . LEU F 5 187 ? -55.806 -5.584  -14.864 1.00 99.45  ? 187 LEU D CA    1 
ATOM 5906 C C     . LEU F 5 187 ? -55.466 -6.648  -15.931 1.00 94.44  ? 187 LEU D C     1 
ATOM 5907 O O     . LEU F 5 187 ? -56.329 -7.418  -16.363 1.00 94.57  ? 187 LEU D O     1 
ATOM 5908 C CB    . LEU F 5 187 ? -55.323 -5.976  -13.446 1.00 94.56  ? 187 LEU D CB    1 
ATOM 5909 C CG    . LEU F 5 187 ? -55.036 -4.762  -12.568 1.00 89.70  ? 187 LEU D CG    1 
ATOM 5910 C CD1   . LEU F 5 187 ? -54.337 -5.110  -11.259 1.00 86.57  ? 187 LEU D CD1   1 
ATOM 5911 C CD2   . LEU F 5 187 ? -54.168 -3.815  -13.348 1.00 88.76  ? 187 LEU D CD2   1 
ATOM 5912 N N     . VAL F 5 188 ? -54.220 -6.633  -16.393 1.00 92.38  ? 188 VAL D N     1 
ATOM 5913 C CA    . VAL F 5 188 ? -53.804 -7.428  -17.541 1.00 90.55  ? 188 VAL D CA    1 
ATOM 5914 C C     . VAL F 5 188 ? -52.445 -8.038  -17.241 1.00 98.79  ? 188 VAL D C     1 
ATOM 5915 O O     . VAL F 5 188 ? -51.622 -7.417  -16.578 1.00 96.76  ? 188 VAL D O     1 
ATOM 5916 C CB    . VAL F 5 188 ? -53.731 -6.562  -18.812 1.00 88.13  ? 188 VAL D CB    1 
ATOM 5917 C CG1   . VAL F 5 188 ? -52.963 -7.274  -19.927 1.00 89.12  ? 188 VAL D CG1   1 
ATOM 5918 C CG2   . VAL F 5 188 ? -55.130 -6.189  -19.269 1.00 82.19  ? 188 VAL D CG2   1 
ATOM 5919 N N     . PRO F 5 189 ? -52.214 -9.281  -17.690 1.00 99.25  ? 189 PRO D N     1 
ATOM 5920 C CA    . PRO F 5 189 ? -50.905 -9.918  -17.519 1.00 101.38 ? 189 PRO D CA    1 
ATOM 5921 C C     . PRO F 5 189 ? -49.862 -9.212  -18.351 1.00 95.50  ? 189 PRO D C     1 
ATOM 5922 O O     . PRO F 5 189 ? -50.149 -8.812  -19.477 1.00 93.18  ? 189 PRO D O     1 
ATOM 5923 C CB    . PRO F 5 189 ? -51.125 -11.328 -18.096 1.00 104.52 ? 189 PRO D CB    1 
ATOM 5924 C CG    . PRO F 5 189 ? -52.285 -11.161 -19.050 1.00 106.71 ? 189 PRO D CG    1 
ATOM 5925 C CD    . PRO F 5 189 ? -53.175 -10.179 -18.353 1.00 104.78 ? 189 PRO D CD    1 
ATOM 5926 N N     . ASN F 5 190 ? -48.672 -9.035  -17.800 1.00 98.93  ? 190 ASN D N     1 
ATOM 5927 C CA    . ASN F 5 190 ? -47.567 -8.638  -18.634 1.00 103.73 ? 190 ASN D CA    1 
ATOM 5928 C C     . ASN F 5 190 ? -46.673 -9.844  -18.785 1.00 107.66 ? 190 ASN D C     1 
ATOM 5929 O O     . ASN F 5 190 ? -45.976 -10.224 -17.844 1.00 104.35 ? 190 ASN D O     1 
ATOM 5930 C CB    . ASN F 5 190 ? -46.802 -7.479  -18.013 1.00 109.70 ? 190 ASN D CB    1 
ATOM 5931 C CG    . ASN F 5 190 ? -45.789 -6.892  -18.968 1.00 112.80 ? 190 ASN D CG    1 
ATOM 5932 O OD1   . ASN F 5 190 ? -45.663 -7.353  -20.105 1.00 117.83 ? 190 ASN D OD1   1 
ATOM 5933 N ND2   . ASN F 5 190 ? -45.076 -5.859  -18.527 1.00 110.51 ? 190 ASN D ND2   1 
ATOM 5934 N N     . PHE F 5 191 ? -46.697 -10.444 -19.973 1.00 113.99 ? 191 PHE D N     1 
ATOM 5935 C CA    . PHE F 5 191 ? -45.952 -11.675 -20.226 1.00 121.41 ? 191 PHE D CA    1 
ATOM 5936 C C     . PHE F 5 191 ? -44.549 -11.336 -20.671 1.00 127.28 ? 191 PHE D C     1 
ATOM 5937 O O     . PHE F 5 191 ? -43.681 -12.205 -20.761 1.00 134.24 ? 191 PHE D O     1 
ATOM 5938 C CB    . PHE F 5 191 ? -46.616 -12.526 -21.311 1.00 122.21 ? 191 PHE D CB    1 
ATOM 5939 C CG    . PHE F 5 191 ? -47.993 -12.987 -20.964 1.00 122.25 ? 191 PHE D CG    1 
ATOM 5940 C CD1   . PHE F 5 191 ? -48.178 -14.062 -20.115 1.00 122.32 ? 191 PHE D CD1   1 
ATOM 5941 C CD2   . PHE F 5 191 ? -49.102 -12.354 -21.501 1.00 122.37 ? 191 PHE D CD2   1 
ATOM 5942 C CE1   . PHE F 5 191 ? -49.448 -14.495 -19.795 1.00 124.24 ? 191 PHE D CE1   1 
ATOM 5943 C CE2   . PHE F 5 191 ? -50.371 -12.777 -21.190 1.00 124.01 ? 191 PHE D CE2   1 
ATOM 5944 C CZ    . PHE F 5 191 ? -50.548 -13.851 -20.335 1.00 125.03 ? 191 PHE D CZ    1 
ATOM 5945 N N     . GLN F 5 192 ? -44.337 -10.064 -20.968 1.00 122.86 ? 192 GLN D N     1 
ATOM 5946 C CA    . GLN F 5 192 ? -43.024 -9.606  -21.349 1.00 121.09 ? 192 GLN D CA    1 
ATOM 5947 C C     . GLN F 5 192 ? -42.174 -9.491  -20.091 1.00 113.64 ? 192 GLN D C     1 
ATOM 5948 O O     . GLN F 5 192 ? -40.972 -9.755  -20.108 1.00 111.20 ? 192 GLN D O     1 
ATOM 5949 C CB    . GLN F 5 192 ? -43.147 -8.263  -22.060 1.00 128.17 ? 192 GLN D CB    1 
ATOM 5950 C CG    . GLN F 5 192 ? -43.891 -8.356  -23.382 1.00 136.87 ? 192 GLN D CG    1 
ATOM 5951 C CD    . GLN F 5 192 ? -43.003 -8.863  -24.500 1.00 146.00 ? 192 GLN D CD    1 
ATOM 5952 O OE1   . GLN F 5 192 ? -41.812 -8.554  -24.546 1.00 150.54 ? 192 GLN D OE1   1 
ATOM 5953 N NE2   . GLN F 5 192 ? -43.574 -9.647  -25.404 1.00 154.57 ? 192 GLN D NE2   1 
ATOM 5954 N N     . SER F 5 193 ? -42.820 -9.128  -18.989 1.00 110.41 ? 193 SER D N     1 
ATOM 5955 C CA    . SER F 5 193 ? -42.113 -8.829  -17.753 1.00 109.88 ? 193 SER D CA    1 
ATOM 5956 C C     . SER F 5 193 ? -42.897 -9.358  -16.555 1.00 106.74 ? 193 SER D C     1 
ATOM 5957 O O     . SER F 5 193 ? -43.536 -8.601  -15.830 1.00 103.13 ? 193 SER D O     1 
ATOM 5958 C CB    . SER F 5 193 ? -41.894 -7.313  -17.649 1.00 110.56 ? 193 SER D CB    1 
ATOM 5959 O OG    . SER F 5 193 ? -41.002 -6.978  -16.598 1.00 111.67 ? 193 SER D OG    1 
ATOM 5960 N N     . PRO F 5 194 ? -42.854 -10.677 -16.351 1.00 112.57 ? 194 PRO D N     1 
ATOM 5961 C CA    . PRO F 5 194 ? -43.678 -11.348 -15.335 1.00 113.75 ? 194 PRO D CA    1 
ATOM 5962 C C     . PRO F 5 194 ? -43.496 -10.769 -13.926 1.00 113.08 ? 194 PRO D C     1 
ATOM 5963 O O     . PRO F 5 194 ? -44.466 -10.678 -13.165 1.00 116.23 ? 194 PRO D O     1 
ATOM 5964 C CB    . PRO F 5 194 ? -43.181 -12.800 -15.386 1.00 113.24 ? 194 PRO D CB    1 
ATOM 5965 C CG    . PRO F 5 194 ? -42.662 -12.965 -16.780 1.00 112.50 ? 194 PRO D CG    1 
ATOM 5966 C CD    . PRO F 5 194 ? -42.053 -11.631 -17.139 1.00 111.98 ? 194 PRO D CD    1 
ATOM 5967 N N     . PHE F 5 195 ? -42.266 -10.388 -13.593 1.00 105.19 ? 195 PHE D N     1 
ATOM 5968 C CA    . PHE F 5 195 ? -41.955 -9.927  -12.252 1.00 97.25  ? 195 PHE D CA    1 
ATOM 5969 C C     . PHE F 5 195 ? -42.686 -8.641  -12.018 1.00 90.39  ? 195 PHE D C     1 
ATOM 5970 O O     . PHE F 5 195 ? -43.172 -8.372  -10.916 1.00 87.07  ? 195 PHE D O     1 
ATOM 5971 C CB    . PHE F 5 195 ? -40.455 -9.715  -12.086 1.00 95.25  ? 195 PHE D CB    1 
ATOM 5972 C CG    . PHE F 5 195 ? -39.649 -10.970 -12.274 1.00 96.13  ? 195 PHE D CG    1 
ATOM 5973 C CD1   . PHE F 5 195 ? -39.610 -11.938 -11.283 1.00 95.84  ? 195 PHE D CD1   1 
ATOM 5974 C CD2   . PHE F 5 195 ? -38.942 -11.191 -13.442 1.00 95.45  ? 195 PHE D CD2   1 
ATOM 5975 C CE1   . PHE F 5 195 ? -38.882 -13.097 -11.450 1.00 93.83  ? 195 PHE D CE1   1 
ATOM 5976 C CE2   . PHE F 5 195 ? -38.209 -12.348 -13.613 1.00 93.69  ? 195 PHE D CE2   1 
ATOM 5977 C CZ    . PHE F 5 195 ? -38.180 -13.301 -12.616 1.00 93.45  ? 195 PHE D CZ    1 
ATOM 5978 N N     . THR F 5 196 ? -42.775 -7.858  -13.085 1.00 89.45  ? 196 THR D N     1 
ATOM 5979 C CA    . THR F 5 196 ? -43.438 -6.567  -13.035 1.00 88.26  ? 196 THR D CA    1 
ATOM 5980 C C     . THR F 5 196 ? -44.932 -6.715  -13.352 1.00 87.47  ? 196 THR D C     1 
ATOM 5981 O O     . THR F 5 196 ? -45.664 -5.728  -13.425 1.00 84.75  ? 196 THR D O     1 
ATOM 5982 C CB    . THR F 5 196 ? -42.750 -5.523  -13.965 1.00 76.65  ? 196 THR D CB    1 
ATOM 5983 O OG1   . THR F 5 196 ? -42.975 -5.850  -15.344 1.00 80.49  ? 196 THR D OG1   1 
ATOM 5984 C CG2   . THR F 5 196 ? -41.249 -5.474  -13.690 1.00 72.47  ? 196 THR D CG2   1 
ATOM 5985 N N     . CYS F 5 197 ? -45.385 -7.957  -13.521 1.00 87.92  ? 197 CYS D N     1 
ATOM 5986 C CA    . CYS F 5 197 ? -46.816 -8.213  -13.674 1.00 87.51  ? 197 CYS D CA    1 
ATOM 5987 C C     . CYS F 5 197 ? -47.479 -8.503  -12.329 1.00 90.23  ? 197 CYS D C     1 
ATOM 5988 O O     . CYS F 5 197 ? -47.041 -9.390  -11.592 1.00 90.31  ? 197 CYS D O     1 
ATOM 5989 C CB    . CYS F 5 197 ? -47.092 -9.355  -14.658 1.00 85.44  ? 197 CYS D CB    1 
ATOM 5990 S SG    . CYS F 5 197 ? -48.857 -9.712  -14.813 1.00 77.92  ? 197 CYS D SG    1 
ATOM 5991 N N     . PRO F 5 198 ? -48.529 -7.733  -12.003 1.00 95.32  ? 198 PRO D N     1 
ATOM 5992 C CA    . PRO F 5 198 ? -49.302 -7.814  -10.762 1.00 98.28  ? 198 PRO D CA    1 
ATOM 5993 C C     . PRO F 5 198 ? -50.164 -9.069  -10.705 1.00 101.19 ? 198 PRO D C     1 
ATOM 5994 O O     . PRO F 5 198 ? -50.504 -9.552  -9.616  1.00 105.06 ? 198 PRO D O     1 
ATOM 5995 C CB    . PRO F 5 198 ? -50.186 -6.568  -10.822 1.00 99.63  ? 198 PRO D CB    1 
ATOM 5996 C CG    . PRO F 5 198 ? -50.396 -6.349  -12.263 1.00 101.67 ? 198 PRO D CG    1 
ATOM 5997 C CD    . PRO F 5 198 ? -49.091 -6.731  -12.922 1.00 99.54  ? 198 PRO D CD    1 
ATOM 5998 N N     . ILE F 5 199 ? -50.509 -9.601  -11.873 1.00 98.07  ? 199 ILE D N     1 
ATOM 5999 C CA    . ILE F 5 199 ? -51.303 -10.819 -11.926 1.00 93.23  ? 199 ILE D CA    1 
ATOM 6000 C C     . ILE F 5 199 ? -50.440 -12.030 -11.623 1.00 86.62  ? 199 ILE D C     1 
ATOM 6001 O O     . ILE F 5 199 ? -50.888 -12.969 -10.972 1.00 85.70  ? 199 ILE D O     1 
ATOM 6002 C CB    . ILE F 5 199 ? -51.978 -11.002 -13.285 1.00 94.37  ? 199 ILE D CB    1 
ATOM 6003 C CG1   . ILE F 5 199 ? -52.844 -9.782  -13.604 1.00 98.41  ? 199 ILE D CG1   1 
ATOM 6004 C CG2   . ILE F 5 199 ? -52.799 -12.282 -13.296 1.00 92.87  ? 199 ILE D CG2   1 
ATOM 6005 C CD1   . ILE F 5 199 ? -53.596 -9.898  -14.901 1.00 101.63 ? 199 ILE D CD1   1 
ATOM 6006 N N     . PHE F 5 200 ? -49.199 -12.000 -12.095 1.00 83.76  ? 200 PHE D N     1 
ATOM 6007 C CA    . PHE F 5 200 ? -48.254 -13.068 -11.812 1.00 85.88  ? 200 PHE D CA    1 
ATOM 6008 C C     . PHE F 5 200 ? -48.012 -13.142 -10.300 1.00 84.70  ? 200 PHE D C     1 
ATOM 6009 O O     . PHE F 5 200 ? -48.039 -14.226 -9.690  1.00 90.17  ? 200 PHE D O     1 
ATOM 6010 C CB    . PHE F 5 200 ? -46.947 -12.837 -12.575 1.00 89.11  ? 200 PHE D CB    1 
ATOM 6011 C CG    . PHE F 5 200 ? -45.898 -13.861 -12.285 1.00 95.35  ? 200 PHE D CG    1 
ATOM 6012 C CD1   . PHE F 5 200 ? -44.661 -13.482 -11.798 1.00 97.19  ? 200 PHE D CD1   1 
ATOM 6013 C CD2   . PHE F 5 200 ? -46.166 -15.215 -12.468 1.00 99.76  ? 200 PHE D CD2   1 
ATOM 6014 C CE1   . PHE F 5 200 ? -43.698 -14.428 -11.517 1.00 101.44 ? 200 PHE D CE1   1 
ATOM 6015 C CE2   . PHE F 5 200 ? -45.209 -16.177 -12.188 1.00 101.56 ? 200 PHE D CE2   1 
ATOM 6016 C CZ    . PHE F 5 200 ? -43.972 -15.786 -11.712 1.00 103.36 ? 200 PHE D CZ    1 
ATOM 6017 N N     . THR F 5 201 ? -47.802 -11.967 -9.712  1.00 76.88  ? 201 THR D N     1 
ATOM 6018 C CA    . THR F 5 201 ? -47.604 -11.801 -8.277  1.00 72.42  ? 201 THR D CA    1 
ATOM 6019 C C     . THR F 5 201 ? -48.803 -12.233 -7.467  1.00 76.20  ? 201 THR D C     1 
ATOM 6020 O O     . THR F 5 201 ? -48.657 -12.767 -6.368  1.00 80.08  ? 201 THR D O     1 
ATOM 6021 C CB    . THR F 5 201 ? -47.406 -10.353 -7.956  1.00 68.54  ? 201 THR D CB    1 
ATOM 6022 O OG1   . THR F 5 201 ? -47.819 -9.591  -9.087  1.00 77.08  ? 201 THR D OG1   1 
ATOM 6023 C CG2   . THR F 5 201 ? -45.972 -10.052 -7.683  1.00 62.20  ? 201 THR D CG2   1 
ATOM 6024 N N     . MET F 5 202 ? -49.991 -11.963 -7.989  1.00 78.62  ? 202 MET D N     1 
ATOM 6025 C CA    . MET F 5 202 ? -51.206 -12.463 -7.354  1.00 84.03  ? 202 MET D CA    1 
ATOM 6026 C C     . MET F 5 202 ? -51.360 -13.991 -7.480  1.00 82.82  ? 202 MET D C     1 
ATOM 6027 O O     . MET F 5 202 ? -51.961 -14.640 -6.621  1.00 86.93  ? 202 MET D O     1 
ATOM 6028 C CB    . MET F 5 202 ? -52.440 -11.770 -7.930  1.00 89.71  ? 202 MET D CB    1 
ATOM 6029 C CG    . MET F 5 202 ? -53.746 -12.238 -7.319  1.00 92.28  ? 202 MET D CG    1 
ATOM 6030 S SD    . MET F 5 202 ? -55.159 -11.513 -8.157  1.00 108.70 ? 202 MET D SD    1 
ATOM 6031 C CE    . MET F 5 202 ? -54.584 -11.578 -9.851  1.00 192.29 ? 202 MET D CE    1 
ATOM 6032 N N     . ALA F 5 203 ? -50.845 -14.555 -8.568  1.00 76.43  ? 203 ALA D N     1 
ATOM 6033 C CA    . ALA F 5 203 ? -50.906 -15.987 -8.780  1.00 72.68  ? 203 ALA D CA    1 
ATOM 6034 C C     . ALA F 5 203 ? -50.024 -16.678 -7.761  1.00 80.41  ? 203 ALA D C     1 
ATOM 6035 O O     . ALA F 5 203 ? -50.502 -17.475 -6.937  1.00 83.75  ? 203 ALA D O     1 
ATOM 6036 C CB    . ALA F 5 203 ? -50.434 -16.318 -10.179 1.00 66.88  ? 203 ALA D CB    1 
ATOM 6037 N N     . VAL F 5 204 ? -48.739 -16.337 -7.785  1.00 82.95  ? 204 VAL D N     1 
ATOM 6038 C CA    . VAL F 5 204 ? -47.808 -16.932 -6.842  1.00 87.98  ? 204 VAL D CA    1 
ATOM 6039 C C     . VAL F 5 204 ? -48.348 -16.708 -5.445  1.00 90.77  ? 204 VAL D C     1 
ATOM 6040 O O     . VAL F 5 204 ? -48.457 -17.648 -4.631  1.00 89.53  ? 204 VAL D O     1 
ATOM 6041 C CB    . VAL F 5 204 ? -46.431 -16.266 -6.889  1.00 88.31  ? 204 VAL D CB    1 
ATOM 6042 C CG1   . VAL F 5 204 ? -45.544 -16.863 -5.803  1.00 89.75  ? 204 VAL D CG1   1 
ATOM 6043 C CG2   . VAL F 5 204 ? -45.789 -16.413 -8.256  1.00 87.26  ? 204 VAL D CG2   1 
ATOM 6044 N N     . TYR F 5 205 ? -48.669 -15.444 -5.168  1.00 91.10  ? 205 TYR D N     1 
ATOM 6045 C CA    . TYR F 5 205 ? -49.172 -15.069 -3.856  1.00 90.85  ? 205 TYR D CA    1 
ATOM 6046 C C     . TYR F 5 205 ? -50.271 -16.038 -3.454  1.00 99.62  ? 205 TYR D C     1 
ATOM 6047 O O     . TYR F 5 205 ? -50.154 -16.731 -2.446  1.00 104.92 ? 205 TYR D O     1 
ATOM 6048 C CB    . TYR F 5 205 ? -49.675 -13.632 -3.813  1.00 85.69  ? 205 TYR D CB    1 
ATOM 6049 C CG    . TYR F 5 205 ? -50.418 -13.325 -2.540  1.00 85.34  ? 205 TYR D CG    1 
ATOM 6050 C CD1   . TYR F 5 205 ? -49.849 -13.597 -1.307  1.00 86.61  ? 205 TYR D CD1   1 
ATOM 6051 C CD2   . TYR F 5 205 ? -51.687 -12.766 -2.569  1.00 87.96  ? 205 TYR D CD2   1 
ATOM 6052 C CE1   . TYR F 5 205 ? -50.522 -13.325 -0.133  1.00 88.81  ? 205 TYR D CE1   1 
ATOM 6053 C CE2   . TYR F 5 205 ? -52.375 -12.482 -1.391  1.00 90.22  ? 205 TYR D CE2   1 
ATOM 6054 C CZ    . TYR F 5 205 ? -51.781 -12.768 -0.173  1.00 91.20  ? 205 TYR D CZ    1 
ATOM 6055 O OH    . TYR F 5 205 ? -52.427 -12.508 1.017   1.00 90.70  ? 205 TYR D OH    1 
ATOM 6056 N N     . TYR F 5 206 ? -51.336 -16.086 -4.243  1.00 98.65  ? 206 TYR D N     1 
ATOM 6057 C CA    . TYR F 5 206 ? -52.470 -16.943 -3.929  1.00 94.90  ? 206 TYR D CA    1 
ATOM 6058 C C     . TYR F 5 206 ? -52.115 -18.379 -3.668  1.00 96.30  ? 206 TYR D C     1 
ATOM 6059 O O     . TYR F 5 206 ? -52.533 -18.926 -2.674  1.00 97.68  ? 206 TYR D O     1 
ATOM 6060 C CB    . TYR F 5 206 ? -53.560 -16.824 -4.985  1.00 94.38  ? 206 TYR D CB    1 
ATOM 6061 C CG    . TYR F 5 206 ? -54.315 -15.550 -4.790  1.00 95.56  ? 206 TYR D CG    1 
ATOM 6062 C CD1   . TYR F 5 206 ? -55.308 -15.157 -5.662  1.00 94.65  ? 206 TYR D CD1   1 
ATOM 6063 C CD2   . TYR F 5 206 ? -54.017 -14.726 -3.714  1.00 97.81  ? 206 TYR D CD2   1 
ATOM 6064 C CE1   . TYR F 5 206 ? -55.996 -13.973 -5.461  1.00 95.45  ? 206 TYR D CE1   1 
ATOM 6065 C CE2   . TYR F 5 206 ? -54.687 -13.557 -3.507  1.00 98.19  ? 206 TYR D CE2   1 
ATOM 6066 C CZ    . TYR F 5 206 ? -55.675 -13.182 -4.377  1.00 97.63  ? 206 TYR D CZ    1 
ATOM 6067 O OH    . TYR F 5 206 ? -56.331 -12.003 -4.145  1.00 99.95  ? 206 TYR D OH    1 
ATOM 6068 N N     . TYR F 5 207 ? -51.343 -18.991 -4.547  1.00 98.39  ? 207 TYR D N     1 
ATOM 6069 C CA    . TYR F 5 207 ? -50.927 -20.352 -4.279  1.00 100.53 ? 207 TYR D CA    1 
ATOM 6070 C C     . TYR F 5 207 ? -50.402 -20.403 -2.849  1.00 96.42  ? 207 TYR D C     1 
ATOM 6071 O O     . TYR F 5 207 ? -50.792 -21.279 -2.070  1.00 98.07  ? 207 TYR D O     1 
ATOM 6072 C CB    . TYR F 5 207 ? -49.841 -20.776 -5.258  1.00 104.82 ? 207 TYR D CB    1 
ATOM 6073 C CG    . TYR F 5 207 ? -49.464 -22.234 -5.197  1.00 106.36 ? 207 TYR D CG    1 
ATOM 6074 C CD1   . TYR F 5 207 ? -50.229 -23.191 -5.845  1.00 110.57 ? 207 TYR D CD1   1 
ATOM 6075 C CD2   . TYR F 5 207 ? -48.326 -22.650 -4.516  1.00 107.12 ? 207 TYR D CD2   1 
ATOM 6076 C CE1   . TYR F 5 207 ? -49.878 -24.532 -5.808  1.00 114.38 ? 207 TYR D CE1   1 
ATOM 6077 C CE2   . TYR F 5 207 ? -47.965 -23.984 -4.470  1.00 109.30 ? 207 TYR D CE2   1 
ATOM 6078 C CZ    . TYR F 5 207 ? -48.744 -24.923 -5.117  1.00 115.40 ? 207 TYR D CZ    1 
ATOM 6079 O OH    . TYR F 5 207 ? -48.389 -26.256 -5.072  1.00 116.66 ? 207 TYR D OH    1 
ATOM 6080 N N     . LEU F 5 208 ? -49.545 -19.440 -2.503  1.00 88.73  ? 208 LEU D N     1 
ATOM 6081 C CA    . LEU F 5 208 ? -48.936 -19.403 -1.172  1.00 85.62  ? 208 LEU D CA    1 
ATOM 6082 C C     . LEU F 5 208 ? -49.898 -18.991 -0.064  1.00 94.19  ? 208 LEU D C     1 
ATOM 6083 O O     . LEU F 5 208 ? -49.567 -19.049 1.122   1.00 94.33  ? 208 LEU D O     1 
ATOM 6084 C CB    . LEU F 5 208 ? -47.717 -18.493 -1.167  1.00 77.61  ? 208 LEU D CB    1 
ATOM 6085 C CG    . LEU F 5 208 ? -46.410 -19.216 -1.417  1.00 74.59  ? 208 LEU D CG    1 
ATOM 6086 C CD1   . LEU F 5 208 ? -45.733 -18.604 -2.610  1.00 75.04  ? 208 LEU D CD1   1 
ATOM 6087 C CD2   . LEU F 5 208 ? -45.533 -19.120 -0.186  1.00 73.96  ? 208 LEU D CD2   1 
ATOM 6088 N N     . ARG F 5 209 ? -51.092 -18.576 -0.462  1.00 101.06 ? 209 ARG D N     1 
ATOM 6089 C CA    . ARG F 5 209 ? -52.129 -18.188 0.482   1.00 106.91 ? 209 ARG D CA    1 
ATOM 6090 C C     . ARG F 5 209 ? -53.023 -19.402 0.745   1.00 118.65 ? 209 ARG D C     1 
ATOM 6091 O O     . ARG F 5 209 ? -53.102 -19.904 1.873   1.00 123.41 ? 209 ARG D O     1 
ATOM 6092 C CB    . ARG F 5 209 ? -52.929 -17.005 -0.070  1.00 103.84 ? 209 ARG D CB    1 
ATOM 6093 C CG    . ARG F 5 209 ? -53.961 -16.425 0.879   1.00 101.92 ? 209 ARG D CG    1 
ATOM 6094 C CD    . ARG F 5 209 ? -54.358 -15.013 0.457   1.00 101.73 ? 209 ARG D CD    1 
ATOM 6095 N NE    . ARG F 5 209 ? -55.671 -14.618 0.965   1.00 98.60  ? 209 ARG D NE    1 
ATOM 6096 C CZ    . ARG F 5 209 ? -56.547 -13.878 0.293   1.00 92.52  ? 209 ARG D CZ    1 
ATOM 6097 N NH1   . ARG F 5 209 ? -56.258 -13.435 -0.922  1.00 90.12  ? 209 ARG D NH1   1 
ATOM 6098 N NH2   . ARG F 5 209 ? -57.715 -13.588 0.841   1.00 90.71  ? 209 ARG D NH2   1 
ATOM 6099 N N     . PHE F 5 210 ? -53.673 -19.869 -0.318  1.00 120.84 ? 210 PHE D N     1 
ATOM 6100 C CA    . PHE F 5 210 ? -54.641 -20.958 -0.282  1.00 117.89 ? 210 PHE D CA    1 
ATOM 6101 C C     . PHE F 5 210 ? -54.044 -22.344 -0.171  1.00 116.36 ? 210 PHE D C     1 
ATOM 6102 O O     . PHE F 5 210 ? -54.242 -22.997 0.842   1.00 116.40 ? 210 PHE D O     1 
ATOM 6103 C CB    . PHE F 5 210 ? -55.576 -20.839 -1.479  1.00 118.51 ? 210 PHE D CB    1 
ATOM 6104 C CG    . PHE F 5 210 ? -56.371 -19.572 -1.455  1.00 118.11 ? 210 PHE D CG    1 
ATOM 6105 C CD1   . PHE F 5 210 ? -57.387 -19.426 -0.533  1.00 116.55 ? 210 PHE D CD1   1 
ATOM 6106 C CD2   . PHE F 5 210 ? -56.068 -18.510 -2.292  1.00 116.32 ? 210 PHE D CD2   1 
ATOM 6107 C CE1   . PHE F 5 210 ? -58.114 -18.270 -0.459  1.00 115.43 ? 210 PHE D CE1   1 
ATOM 6108 C CE2   . PHE F 5 210 ? -56.798 -17.345 -2.225  1.00 114.67 ? 210 PHE D CE2   1 
ATOM 6109 C CZ    . PHE F 5 210 ? -57.823 -17.224 -1.304  1.00 114.67 ? 210 PHE D CZ    1 
ATOM 6110 N N     . HIS F 5 211 ? -53.321 -22.800 -1.186  1.00 116.19 ? 211 HIS D N     1 
ATOM 6111 C CA    . HIS F 5 211 ? -52.704 -24.125 -1.096  1.00 118.27 ? 211 HIS D CA    1 
ATOM 6112 C C     . HIS F 5 211 ? -51.685 -24.186 0.050   1.00 117.32 ? 211 HIS D C     1 
ATOM 6113 O O     . HIS F 5 211 ? -51.482 -25.241 0.652   1.00 119.14 ? 211 HIS D O     1 
ATOM 6114 C CB    . HIS F 5 211 ? -52.111 -24.555 -2.452  1.00 117.74 ? 211 HIS D CB    1 
ATOM 6115 C CG    . HIS F 5 211 ? -51.050 -25.617 -2.367  1.00 112.35 ? 211 HIS D CG    1 
ATOM 6116 N ND1   . HIS F 5 211 ? -50.864 -26.554 -3.361  1.00 113.50 ? 211 HIS D ND1   1 
ATOM 6117 C CD2   . HIS F 5 211 ? -50.087 -25.855 -1.447  1.00 111.21 ? 211 HIS D CD2   1 
ATOM 6118 C CE1   . HIS F 5 211 ? -49.850 -27.338 -3.043  1.00 117.12 ? 211 HIS D CE1   1 
ATOM 6119 N NE2   . HIS F 5 211 ? -49.360 -26.933 -1.885  1.00 120.17 ? 211 HIS D NE2   1 
ATOM 6120 N N     . GLY F 5 212 ? -51.074 -23.050 0.371   1.00 113.75 ? 212 GLY D N     1 
ATOM 6121 C CA    . GLY F 5 212 ? -50.074 -23.009 1.420   1.00 113.31 ? 212 GLY D CA    1 
ATOM 6122 C C     . GLY F 5 212 ? -48.808 -23.735 1.011   1.00 117.63 ? 212 GLY D C     1 
ATOM 6123 O O     . GLY F 5 212 ? -48.621 -24.069 -0.157  1.00 117.87 ? 212 GLY D O     1 
ATOM 6124 N N     . VAL F 5 213 ? -47.930 -23.978 1.977   1.00 121.23 ? 213 VAL D N     1 
ATOM 6125 C CA    . VAL F 5 213 ? -46.731 -24.771 1.734   1.00 125.83 ? 213 VAL D CA    1 
ATOM 6126 C C     . VAL F 5 213 ? -46.609 -25.919 2.745   1.00 139.24 ? 213 VAL D C     1 
ATOM 6127 O O     . VAL F 5 213 ? -46.610 -25.688 3.952   1.00 140.44 ? 213 VAL D O     1 
ATOM 6128 C CB    . VAL F 5 213 ? -45.473 -23.881 1.711   1.00 117.01 ? 213 VAL D CB    1 
ATOM 6129 C CG1   . VAL F 5 213 ? -44.239 -24.668 2.075   1.00 113.81 ? 213 VAL D CG1   1 
ATOM 6130 C CG2   . VAL F 5 213 ? -45.310 -23.255 0.339   1.00 115.88 ? 213 VAL D CG2   1 
ATOM 6131 N N     . LYS F 5 214 ? -46.519 -27.151 2.239   1.00 150.07 ? 214 LYS D N     1 
ATOM 6132 C CA    . LYS F 5 214 ? -46.472 -28.351 3.077   1.00 158.23 ? 214 LYS D CA    1 
ATOM 6133 C C     . LYS F 5 214 ? -45.236 -28.369 3.981   1.00 161.24 ? 214 LYS D C     1 
ATOM 6134 O O     . LYS F 5 214 ? -44.125 -28.159 3.508   1.00 161.34 ? 214 LYS D O     1 
ATOM 6135 C CB    . LYS F 5 214 ? -46.498 -29.609 2.201   1.00 162.59 ? 214 LYS D CB    1 
ATOM 6136 C CG    . LYS F 5 214 ? -47.540 -30.656 2.601   1.00 164.50 ? 214 LYS D CG    1 
ATOM 6137 C CD    . LYS F 5 214 ? -47.314 -31.995 1.895   1.00 165.59 ? 214 LYS D CD    1 
ATOM 6138 C CE    . LYS F 5 214 ? -48.168 -33.096 2.519   1.00 164.66 ? 214 LYS D CE    1 
ATOM 6139 N NZ    . LYS F 5 214 ? -47.423 -34.383 2.652   1.00 162.64 ? 214 LYS D NZ    1 
ATOM 6140 N N     . LYS F 5 215 ? -45.441 -28.610 5.277   1.00 164.21 ? 215 LYS D N     1 
ATOM 6141 C CA    . LYS F 5 215 ? -44.352 -28.778 6.255   1.00 166.40 ? 215 LYS D CA    1 
ATOM 6142 C C     . LYS F 5 215 ? -43.811 -27.472 6.847   1.00 166.29 ? 215 LYS D C     1 
ATOM 6143 O O     . LYS F 5 215 ? -42.975 -27.491 7.756   1.00 162.37 ? 215 LYS D O     1 
ATOM 6144 C CB    . LYS F 5 215 ? -43.205 -29.611 5.681   1.00 169.55 ? 215 LYS D CB    1 
ATOM 6145 C CG    . LYS F 5 215 ? -43.133 -31.041 6.204   1.00 170.51 ? 215 LYS D CG    1 
ATOM 6146 C CD    . LYS F 5 215 ? -44.237 -31.910 5.619   1.00 172.64 ? 215 LYS D CD    1 
ATOM 6147 C CE    . LYS F 5 215 ? -44.018 -33.381 5.960   1.00 172.96 ? 215 LYS D CE    1 
ATOM 6148 N NZ    . LYS F 5 215 ? -44.993 -34.300 5.300   1.00 174.12 ? 215 LYS D NZ    1 
ATOM 6149 N N     . TYR F 5 216 ? -44.283 -26.347 6.321   1.00 171.25 ? 216 TYR D N     1 
ATOM 6150 C CA    . TYR F 5 216 ? -43.849 -25.042 6.791   1.00 174.27 ? 216 TYR D CA    1 
ATOM 6151 C C     . TYR F 5 216 ? -45.012 -24.363 7.473   1.00 176.64 ? 216 TYR D C     1 
ATOM 6152 O O     . TYR F 5 216 ? -44.964 -24.058 8.666   1.00 178.66 ? 216 TYR D O     1 
ATOM 6153 C CB    . TYR F 5 216 ? -43.343 -24.209 5.623   1.00 175.59 ? 216 TYR D CB    1 
ATOM 6154 C CG    . TYR F 5 216 ? -42.296 -24.967 4.853   1.00 176.67 ? 216 TYR D CG    1 
ATOM 6155 C CD1   . TYR F 5 216 ? -40.964 -24.579 4.866   1.00 176.59 ? 216 TYR D CD1   1 
ATOM 6156 C CD2   . TYR F 5 216 ? -42.631 -26.124 4.174   1.00 177.24 ? 216 TYR D CD2   1 
ATOM 6157 C CE1   . TYR F 5 216 ? -40.008 -25.310 4.186   1.00 176.26 ? 216 TYR D CE1   1 
ATOM 6158 C CE2   . TYR F 5 216 ? -41.692 -26.856 3.494   1.00 176.70 ? 216 TYR D CE2   1 
ATOM 6159 C CZ    . TYR F 5 216 ? -40.382 -26.451 3.500   1.00 176.17 ? 216 TYR D CZ    1 
ATOM 6160 O OH    . TYR F 5 216 ? -39.452 -27.198 2.814   1.00 175.43 ? 216 TYR D OH    1 
ATOM 6161 N N     . TYR F 5 217 ? -46.067 -24.117 6.705   1.00 174.98 ? 217 TYR D N     1 
ATOM 6162 C CA    . TYR F 5 217 ? -47.232 -23.437 7.261   1.00 170.45 ? 217 TYR D CA    1 
ATOM 6163 C C     . TYR F 5 217 ? -48.586 -23.725 6.595   1.00 161.16 ? 217 TYR D C     1 
ATOM 6164 O O     . TYR F 5 217 ? -48.666 -24.094 5.412   1.00 160.69 ? 217 TYR D O     1 
ATOM 6165 C CB    . TYR F 5 217 ? -46.953 -21.932 7.389   1.00 175.13 ? 217 TYR D CB    1 
ATOM 6166 C CG    . TYR F 5 217 ? -48.168 -21.098 7.738   1.00 179.10 ? 217 TYR D CG    1 
ATOM 6167 C CD1   . TYR F 5 217 ? -48.528 -20.862 9.065   1.00 179.72 ? 217 TYR D CD1   1 
ATOM 6168 C CD2   . TYR F 5 217 ? -48.956 -20.539 6.737   1.00 182.47 ? 217 TYR D CD2   1 
ATOM 6169 C CE1   . TYR F 5 217 ? -49.640 -20.099 9.379   1.00 182.15 ? 217 TYR D CE1   1 
ATOM 6170 C CE2   . TYR F 5 217 ? -50.071 -19.772 7.045   1.00 184.52 ? 217 TYR D CE2   1 
ATOM 6171 C CZ    . TYR F 5 217 ? -50.410 -19.558 8.375   1.00 184.57 ? 217 TYR D CZ    1 
ATOM 6172 O OH    . TYR F 5 217 ? -51.511 -18.803 8.741   1.00 185.17 ? 217 TYR D OH    1 
ATOM 6173 N N     . LYS F 5 218 ? -49.639 -23.559 7.395   1.00 151.34 ? 218 LYS D N     1 
ATOM 6174 C CA    . LYS F 5 218 ? -50.981 -23.998 7.040   1.00 144.09 ? 218 LYS D CA    1 
ATOM 6175 C C     . LYS F 5 218 ? -51.507 -23.475 5.708   1.00 138.57 ? 218 LYS D C     1 
ATOM 6176 O O     . LYS F 5 218 ? -51.271 -22.339 5.333   1.00 132.22 ? 218 LYS D O     1 
ATOM 6177 C CB    . LYS F 5 218 ? -51.983 -23.769 8.214   1.00 150.61 ? 218 LYS D CB    1 
ATOM 6178 C CG    . LYS F 5 218 ? -52.137 -22.312 8.686   1.00 150.29 ? 218 LYS D CG    1 
ATOM 6179 C CD    . LYS F 5 218 ? -53.113 -22.186 9.889   1.00 170.20 ? 218 LYS D CD    1 
ATOM 6180 C CE    . LYS F 5 218 ? -53.055 -20.775 10.504  1.00 168.97 ? 218 LYS D CE    1 
ATOM 6181 N NZ    . LYS F 5 218 ? -51.825 -20.655 11.330  1.00 166.29 ? 218 LYS D NZ    1 
ATOM 6182 N N     . GLY F 5 219 ? -52.221 -24.337 4.994   1.00 143.51 ? 219 GLY D N     1 
ATOM 6183 C CA    . GLY F 5 219 ? -52.992 -23.893 3.853   1.00 149.11 ? 219 GLY D CA    1 
ATOM 6184 C C     . GLY F 5 219 ? -54.203 -23.219 4.456   1.00 152.49 ? 219 GLY D C     1 
ATOM 6185 O O     . GLY F 5 219 ? -54.714 -23.676 5.477   1.00 156.71 ? 219 GLY D O     1 
ATOM 6186 N N     . ASP F 5 220 ? -54.648 -22.125 3.853   1.00 149.58 ? 220 ASP D N     1 
ATOM 6187 C CA    . ASP F 5 220 ? -55.856 -21.459 4.307   1.00 144.84 ? 220 ASP D CA    1 
ATOM 6188 C C     . ASP F 5 220 ? -57.033 -22.301 3.856   1.00 144.63 ? 220 ASP D C     1 
ATOM 6189 O O     . ASP F 5 220 ? -58.093 -22.312 4.485   1.00 147.06 ? 220 ASP D O     1 
ATOM 6190 C CB    . ASP F 5 220 ? -55.949 -20.063 3.699   1.00 141.86 ? 220 ASP D CB    1 
ATOM 6191 C CG    . ASP F 5 220 ? -54.802 -19.165 4.120   1.00 137.88 ? 220 ASP D CG    1 
ATOM 6192 O OD1   . ASP F 5 220 ? -53.669 -19.669 4.289   1.00 137.78 ? 220 ASP D OD1   1 
ATOM 6193 O OD2   . ASP F 5 220 ? -55.036 -17.951 4.286   1.00 138.00 ? 220 ASP D OD2   1 
ATOM 6194 N N     . GLY F 5 221 ? -56.823 -23.001 2.745   1.00 141.97 ? 221 GLY D N     1 
ATOM 6195 C CA    . GLY F 5 221 ? -57.811 -23.900 2.177   1.00 140.03 ? 221 GLY D CA    1 
ATOM 6196 C C     . GLY F 5 221 ? -58.662 -23.196 1.138   1.00 138.86 ? 221 GLY D C     1 
ATOM 6197 O O     . GLY F 5 221 ? -58.957 -22.011 1.283   1.00 138.64 ? 221 GLY D O     1 
ATOM 6198 N N     . TYR F 5 222 ? -59.082 -23.932 0.110   1.00 136.94 ? 222 TYR D N     1 
ATOM 6199 C CA    . TYR F 5 222 ? -59.886 -23.366 -0.971  1.00 134.95 ? 222 TYR D CA    1 
ATOM 6200 C C     . TYR F 5 222 ? -61.363 -23.488 -0.651  1.00 134.98 ? 222 TYR D C     1 
ATOM 6201 O O     . TYR F 5 222 ? -62.214 -23.135 -1.465  1.00 132.25 ? 222 TYR D O     1 
ATOM 6202 C CB    . TYR F 5 222 ? -59.624 -24.096 -2.285  1.00 133.05 ? 222 TYR D CB    1 
ATOM 6203 C CG    . TYR F 5 222 ? -58.253 -23.874 -2.864  1.00 132.03 ? 222 TYR D CG    1 
ATOM 6204 C CD1   . TYR F 5 222 ? -57.923 -22.672 -3.460  1.00 132.75 ? 222 TYR D CD1   1 
ATOM 6205 C CD2   . TYR F 5 222 ? -57.297 -24.878 -2.837  1.00 133.61 ? 222 TYR D CD2   1 
ATOM 6206 C CE1   . TYR F 5 222 ? -56.674 -22.463 -4.004  1.00 135.25 ? 222 TYR D CE1   1 
ATOM 6207 C CE2   . TYR F 5 222 ? -56.041 -24.682 -3.379  1.00 136.47 ? 222 TYR D CE2   1 
ATOM 6208 C CZ    . TYR F 5 222 ? -55.733 -23.466 -3.962  1.00 138.75 ? 222 TYR D CZ    1 
ATOM 6209 O OH    . TYR F 5 222 ? -54.487 -23.244 -4.510  1.00 143.01 ? 222 TYR D OH    1 
ATOM 6210 N N     . GLN F 5 223 ? -61.670 -24.005 0.531   1.00 139.94 ? 223 GLN D N     1 
ATOM 6211 C CA    . GLN F 5 223 ? -63.057 -24.147 0.944   1.00 146.72 ? 223 GLN D CA    1 
ATOM 6212 C C     . GLN F 5 223 ? -63.673 -22.783 1.302   1.00 150.84 ? 223 GLN D C     1 
ATOM 6213 O O     . GLN F 5 223 ? -64.789 -22.458 0.877   1.00 155.70 ? 223 GLN D O     1 
ATOM 6214 C CB    . GLN F 5 223 ? -63.170 -25.132 2.116   1.00 146.45 ? 223 GLN D CB    1 
ATOM 6215 C CG    . GLN F 5 223 ? -62.541 -26.496 1.871   1.00 145.24 ? 223 GLN D CG    1 
ATOM 6216 C CD    . GLN F 5 223 ? -61.032 -26.489 2.026   1.00 144.94 ? 223 GLN D CD    1 
ATOM 6217 O OE1   . GLN F 5 223 ? -60.499 -26.018 3.030   1.00 148.71 ? 223 GLN D OE1   1 
ATOM 6218 N NE2   . GLN F 5 223 ? -60.336 -27.012 1.028   1.00 143.23 ? 223 GLN D NE2   1 
ATOM 6219 N N     . ILE F 5 224 ? -62.919 -21.969 2.040   1.00 147.24 ? 224 ILE D N     1 
ATOM 6220 C CA    . ILE F 5 224 ? -63.449 -20.723 2.603   1.00 143.65 ? 224 ILE D CA    1 
ATOM 6221 C C     . ILE F 5 224 ? -63.981 -19.752 1.546   1.00 141.57 ? 224 ILE D C     1 
ATOM 6222 O O     . ILE F 5 224 ? -64.650 -18.777 1.875   1.00 142.81 ? 224 ILE D O     1 
ATOM 6223 C CB    . ILE F 5 224 ? -62.453 -20.018 3.564   1.00 128.28 ? 224 ILE D CB    1 
ATOM 6224 C CG1   . ILE F 5 224 ? -61.639 -18.950 2.835   1.00 127.60 ? 224 ILE D CG1   1 
ATOM 6225 C CG2   . ILE F 5 224 ? -61.532 -21.031 4.231   1.00 127.64 ? 224 ILE D CG2   1 
ATOM 6226 C CD1   . ILE F 5 224 ? -60.609 -19.499 1.881   1.00 128.49 ? 224 ILE D CD1   1 
ATOM 6227 N N     . LEU F 5 225 ? -63.693 -20.032 0.279   1.00 139.31 ? 225 LEU D N     1 
ATOM 6228 C CA    . LEU F 5 225 ? -64.236 -19.234 -0.818  1.00 139.56 ? 225 LEU D CA    1 
ATOM 6229 C C     . LEU F 5 225 ? -65.753 -19.332 -0.946  1.00 145.47 ? 225 LEU D C     1 
ATOM 6230 O O     . LEU F 5 225 ? -66.354 -18.623 -1.751  1.00 148.20 ? 225 LEU D O     1 
ATOM 6231 C CB    . LEU F 5 225 ? -63.561 -19.580 -2.146  1.00 136.88 ? 225 LEU D CB    1 
ATOM 6232 C CG    . LEU F 5 225 ? -62.091 -19.176 -2.227  1.00 134.84 ? 225 LEU D CG    1 
ATOM 6233 C CD1   . LEU F 5 225 ? -61.221 -20.282 -1.666  1.00 136.23 ? 225 LEU D CD1   1 
ATOM 6234 C CD2   . LEU F 5 225 ? -61.688 -18.846 -3.655  1.00 133.02 ? 225 LEU D CD2   1 
ATOM 6235 N N     . SER F 5 226 ? -66.369 -20.218 -0.169  1.00 148.75 ? 226 SER D N     1 
ATOM 6236 C CA    . SER F 5 226 ? -67.830 -20.298 -0.121  1.00 154.01 ? 226 SER D CA    1 
ATOM 6237 C C     . SER F 5 226 ? -68.346 -19.681 1.173   1.00 159.63 ? 226 SER D C     1 
ATOM 6238 O O     . SER F 5 226 ? -69.108 -18.714 1.161   1.00 166.73 ? 226 SER D O     1 
ATOM 6239 C CB    . SER F 5 226 ? -68.302 -21.745 -0.263  1.00 152.90 ? 226 SER D CB    1 
ATOM 6240 O OG    . SER F 5 226 ? -68.042 -22.226 -1.569  1.00 154.19 ? 226 SER D OG    1 
ATOM 6241 N N     . GLN F 5 227 ? -67.931 -20.265 2.289   1.00 161.22 ? 227 GLN D N     1 
ATOM 6242 C CA    . GLN F 5 227 ? -68.341 -19.817 3.617   1.00 166.32 ? 227 GLN D CA    1 
ATOM 6243 C C     . GLN F 5 227 ? -68.265 -18.292 3.832   1.00 168.04 ? 227 GLN D C     1 
ATOM 6244 O O     . GLN F 5 227 ? -69.198 -17.705 4.378   1.00 168.87 ? 227 GLN D O     1 
ATOM 6245 C CB    . GLN F 5 227 ? -67.515 -20.584 4.668   1.00 171.00 ? 227 GLN D CB    1 
ATOM 6246 C CG    . GLN F 5 227 ? -66.183 -21.083 4.099   1.00 177.18 ? 227 GLN D CG    1 
ATOM 6247 C CD    . GLN F 5 227 ? -65.619 -22.346 4.760   1.00 181.78 ? 227 GLN D CD    1 
ATOM 6248 O OE1   . GLN F 5 227 ? -64.493 -22.754 4.465   1.00 182.99 ? 227 GLN D OE1   1 
ATOM 6249 N NE2   . GLN F 5 227 ? -66.395 -22.968 5.640   1.00 183.59 ? 227 GLN D NE2   1 
ATOM 6250 N N     . LEU F 5 228 ? -67.192 -17.649 3.375   1.00 168.94 ? 228 LEU D N     1 
ATOM 6251 C CA    . LEU F 5 228 ? -67.017 -16.206 3.599   1.00 167.68 ? 228 LEU D CA    1 
ATOM 6252 C C     . LEU F 5 228 ? -67.759 -15.296 2.625   1.00 170.11 ? 228 LEU D C     1 
ATOM 6253 O O     . LEU F 5 228 ? -67.837 -15.573 1.428   1.00 171.67 ? 228 LEU D O     1 
ATOM 6254 C CB    . LEU F 5 228 ? -65.537 -15.829 3.607   1.00 164.90 ? 228 LEU D CB    1 
ATOM 6255 C CG    . LEU F 5 228 ? -64.816 -16.347 4.843   1.00 162.61 ? 228 LEU D CG    1 
ATOM 6256 C CD1   . LEU F 5 228 ? -63.329 -16.102 4.718   1.00 161.48 ? 228 LEU D CD1   1 
ATOM 6257 C CD2   . LEU F 5 228 ? -65.378 -15.697 6.100   1.00 162.30 ? 228 LEU D CD2   1 
ATOM 6258 N N     . GLU F 5 229 ? -68.295 -14.203 3.162   1.00 169.63 ? 229 GLU D N     1 
ATOM 6259 C CA    . GLU F 5 229 ? -69.028 -13.226 2.369   1.00 168.92 ? 229 GLU D CA    1 
ATOM 6260 C C     . GLU F 5 229 ? -68.107 -12.261 1.621   1.00 163.54 ? 229 GLU D C     1 
ATOM 6261 O O     . GLU F 5 229 ? -68.410 -11.859 0.499   1.00 165.35 ? 229 GLU D O     1 
ATOM 6262 C CB    . GLU F 5 229 ? -70.026 -12.461 3.249   1.00 171.54 ? 229 GLU D CB    1 
ATOM 6263 C CG    . GLU F 5 229 ? -70.949 -13.362 4.069   1.00 174.60 ? 229 GLU D CG    1 
ATOM 6264 C CD    . GLU F 5 229 ? -71.748 -14.340 3.214   1.00 178.24 ? 229 GLU D CD    1 
ATOM 6265 O OE1   . GLU F 5 229 ? -71.668 -14.254 1.971   1.00 181.80 ? 229 GLU D OE1   1 
ATOM 6266 O OE2   . GLU F 5 229 ? -72.459 -15.197 3.784   1.00 179.02 ? 229 GLU D OE2   1 
ATOM 6267 N N     . HIS F 5 230 ? -66.985 -11.896 2.239   1.00 155.35 ? 230 HIS D N     1 
ATOM 6268 C CA    . HIS F 5 230 ? -66.032 -10.965 1.625   1.00 146.13 ? 230 HIS D CA    1 
ATOM 6269 C C     . HIS F 5 230 ? -64.595 -11.492 1.612   1.00 142.51 ? 230 HIS D C     1 
ATOM 6270 O O     . HIS F 5 230 ? -63.981 -11.681 2.666   1.00 145.17 ? 230 HIS D O     1 
ATOM 6271 C CB    . HIS F 5 230 ? -66.083 -9.598  2.314   1.00 137.09 ? 230 HIS D CB    1 
ATOM 6272 C CG    . HIS F 5 230 ? -65.016 -8.651  1.859   1.00 128.40 ? 230 HIS D CG    1 
ATOM 6273 N ND1   . HIS F 5 230 ? -64.167 -8.008  2.735   1.00 123.50 ? 230 HIS D ND1   1 
ATOM 6274 C CD2   . HIS F 5 230 ? -64.659 -8.235  0.622   1.00 125.03 ? 230 HIS D CD2   1 
ATOM 6275 C CE1   . HIS F 5 230 ? -63.336 -7.239  2.056   1.00 121.23 ? 230 HIS D CE1   1 
ATOM 6276 N NE2   . HIS F 5 230 ? -63.612 -7.360  0.771   1.00 121.84 ? 230 HIS D NE2   1 
ATOM 6277 N N     . ILE F 5 231 ? -64.055 -11.716 0.417   1.00 134.11 ? 231 ILE D N     1 
ATOM 6278 C CA    . ILE F 5 231 ? -62.699 -12.227 0.311   1.00 122.77 ? 231 ILE D CA    1 
ATOM 6279 C C     . ILE F 5 231 ? -61.745 -11.124 -0.163  1.00 117.81 ? 231 ILE D C     1 
ATOM 6280 O O     . ILE F 5 231 ? -61.653 -10.829 -1.356  1.00 118.70 ? 231 ILE D O     1 
ATOM 6281 C CB    . ILE F 5 231 ? -62.664 -13.460 -0.618  1.00 120.74 ? 231 ILE D CB    1 
ATOM 6282 C CG1   . ILE F 5 231 ? -61.283 -14.119 -0.616  1.00 118.78 ? 231 ILE D CG1   1 
ATOM 6283 C CG2   . ILE F 5 231 ? -63.184 -13.117 -2.025  1.00 121.29 ? 231 ILE D CG2   1 
ATOM 6284 C CD1   . ILE F 5 231 ? -61.066 -15.054 0.556   1.00 117.83 ? 231 ILE D CD1   1 
ATOM 6285 N N     . PRO F 5 232 ? -60.982 -10.555 0.792   1.00 109.44 ? 232 PRO D N     1 
ATOM 6286 C CA    . PRO F 5 232 ? -60.086 -9.414  0.568   1.00 102.92 ? 232 PRO D CA    1 
ATOM 6287 C C     . PRO F 5 232 ? -58.952 -9.816  -0.354  1.00 99.15  ? 232 PRO D C     1 
ATOM 6288 O O     . PRO F 5 232 ? -58.383 -10.886 -0.184  1.00 100.26 ? 232 PRO D O     1 
ATOM 6289 C CB    . PRO F 5 232 ? -59.566 -9.083  1.977   1.00 100.06 ? 232 PRO D CB    1 
ATOM 6290 C CG    . PRO F 5 232 ? -59.795 -10.308 2.787   1.00 101.46 ? 232 PRO D CG    1 
ATOM 6291 C CD    . PRO F 5 232 ? -60.994 -10.983 2.203   1.00 106.51 ? 232 PRO D CD    1 
ATOM 6292 N N     . ILE F 5 233 ? -58.643 -8.974  -1.332  1.00 98.44  ? 233 ILE D N     1 
ATOM 6293 C CA    . ILE F 5 233 ? -57.670 -9.323  -2.362  1.00 100.40 ? 233 ILE D CA    1 
ATOM 6294 C C     . ILE F 5 233 ? -56.357 -9.794  -1.758  1.00 101.32 ? 233 ILE D C     1 
ATOM 6295 O O     . ILE F 5 233 ? -55.624 -10.569 -2.367  1.00 102.02 ? 233 ILE D O     1 
ATOM 6296 C CB    . ILE F 5 233 ? -57.384 -8.138  -3.288  1.00 103.88 ? 233 ILE D CB    1 
ATOM 6297 C CG1   . ILE F 5 233 ? -58.643 -7.761  -4.067  1.00 104.83 ? 233 ILE D CG1   1 
ATOM 6298 C CG2   . ILE F 5 233 ? -56.266 -8.490  -4.244  1.00 104.51 ? 233 ILE D CG2   1 
ATOM 6299 C CD1   . ILE F 5 233 ? -59.180 -8.864  -4.941  1.00 105.91 ? 233 ILE D CD1   1 
ATOM 6300 N N     . ILE F 5 234 ? -56.053 -9.289  -0.569  1.00 99.70  ? 234 ILE D N     1 
ATOM 6301 C CA    . ILE F 5 234 ? -54.970 -9.812  0.256   1.00 100.71 ? 234 ILE D CA    1 
ATOM 6302 C C     . ILE F 5 234 ? -55.482 -9.798  1.697   1.00 109.03 ? 234 ILE D C     1 
ATOM 6303 O O     . ILE F 5 234 ? -56.389 -9.030  2.009   1.00 113.08 ? 234 ILE D O     1 
ATOM 6304 C CB    . ILE F 5 234 ? -53.661 -9.001  0.096   1.00 91.41  ? 234 ILE D CB    1 
ATOM 6305 C CG1   . ILE F 5 234 ? -53.641 -7.792  1.022   1.00 90.40  ? 234 ILE D CG1   1 
ATOM 6306 C CG2   . ILE F 5 234 ? -53.422 -8.618  -1.352  1.00 87.79  ? 234 ILE D CG2   1 
ATOM 6307 C CD1   . ILE F 5 234 ? -52.893 -8.080  2.287   1.00 91.00  ? 234 ILE D CD1   1 
ATOM 6308 N N     . ARG F 5 235 ? -54.937 -10.645 2.568   1.00 113.23 ? 235 ARG D N     1 
ATOM 6309 C CA    . ARG F 5 235 ? -55.467 -10.750 3.928   1.00 118.59 ? 235 ARG D CA    1 
ATOM 6310 C C     . ARG F 5 235 ? -54.513 -10.267 5.017   1.00 120.78 ? 235 ARG D C     1 
ATOM 6311 O O     . ARG F 5 235 ? -53.303 -10.477 4.943   1.00 117.08 ? 235 ARG D O     1 
ATOM 6312 C CB    . ARG F 5 235 ? -55.879 -12.188 4.236   1.00 123.23 ? 235 ARG D CB    1 
ATOM 6313 C CG    . ARG F 5 235 ? -54.724 -13.173 4.144   1.00 129.82 ? 235 ARG D CG    1 
ATOM 6314 C CD    . ARG F 5 235 ? -54.978 -14.404 4.999   1.00 137.12 ? 235 ARG D CD    1 
ATOM 6315 N NE    . ARG F 5 235 ? -54.875 -14.114 6.427   1.00 140.32 ? 235 ARG D NE    1 
ATOM 6316 C CZ    . ARG F 5 235 ? -55.130 -14.995 7.391   1.00 142.58 ? 235 ARG D CZ    1 
ATOM 6317 N NH1   . ARG F 5 235 ? -55.511 -16.230 7.085   1.00 143.13 ? 235 ARG D NH1   1 
ATOM 6318 N NH2   . ARG F 5 235 ? -55.005 -14.639 8.663   1.00 141.72 ? 235 ARG D NH2   1 
ATOM 6319 N N     . GLY F 5 236 ? -55.079 -9.632  6.039   1.00 127.09 ? 236 GLY D N     1 
ATOM 6320 C CA    . GLY F 5 236 ? -54.327 -9.248  7.219   1.00 130.36 ? 236 GLY D CA    1 
ATOM 6321 C C     . GLY F 5 236 ? -54.342 -10.383 8.222   1.00 131.92 ? 236 GLY D C     1 
ATOM 6322 O O     . GLY F 5 236 ? -54.390 -11.553 7.840   1.00 133.20 ? 236 GLY D O     1 
ATOM 6323 N N     . LYS F 5 237 ? -54.296 -10.046 9.506   1.00 132.29 ? 237 LYS D N     1 
ATOM 6324 C CA    . LYS F 5 237 ? -54.437 -11.059 10.542  1.00 133.66 ? 237 LYS D CA    1 
ATOM 6325 C C     . LYS F 5 237 ? -55.682 -11.897 10.276  1.00 136.31 ? 237 LYS D C     1 
ATOM 6326 O O     . LYS F 5 237 ? -55.598 -13.116 10.150  1.00 136.81 ? 237 LYS D O     1 
ATOM 6327 C CB    . LYS F 5 237 ? -54.519 -10.418 11.931  1.00 135.97 ? 237 LYS D CB    1 
ATOM 6328 C CG    . LYS F 5 237 ? -53.215 -10.450 12.719  1.00 135.96 ? 237 LYS D CG    1 
ATOM 6329 C CD    . LYS F 5 237 ? -52.919 -11.843 13.257  1.00 136.30 ? 237 LYS D CD    1 
ATOM 6330 C CE    . LYS F 5 237 ? -51.644 -11.854 14.085  1.00 133.49 ? 237 LYS D CE    1 
ATOM 6331 N NZ    . LYS F 5 237 ? -51.670 -10.807 15.143  1.00 131.02 ? 237 LYS D NZ    1 
ATOM 6332 N N     . SER F 5 238 ? -56.832 -11.241 10.163  1.00 134.32 ? 238 SER D N     1 
ATOM 6333 C CA    . SER F 5 238 ? -58.090 -11.955 9.970   1.00 132.77 ? 238 SER D CA    1 
ATOM 6334 C C     . SER F 5 238 ? -58.341 -12.348 8.522   1.00 132.96 ? 238 SER D C     1 
ATOM 6335 O O     . SER F 5 238 ? -58.019 -11.610 7.597   1.00 132.19 ? 238 SER D O     1 
ATOM 6336 C CB    . SER F 5 238 ? -59.266 -11.144 10.506  1.00 133.68 ? 238 SER D CB    1 
ATOM 6337 O OG    . SER F 5 238 ? -59.274 -11.154 11.920  1.00 133.95 ? 238 SER D OG    1 
ATOM 6338 N N     . LEU F 5 239 ? -58.931 -13.521 8.339   1.00 134.96 ? 239 LEU D N     1 
ATOM 6339 C CA    . LEU F 5 239 ? -59.175 -14.064 7.011   1.00 137.55 ? 239 LEU D CA    1 
ATOM 6340 C C     . LEU F 5 239 ? -59.999 -13.150 6.114   1.00 140.19 ? 239 LEU D C     1 
ATOM 6341 O O     . LEU F 5 239 ? -59.737 -13.053 4.916   1.00 140.87 ? 239 LEU D O     1 
ATOM 6342 C CB    . LEU F 5 239 ? -59.886 -15.411 7.118   1.00 134.96 ? 239 LEU D CB    1 
ATOM 6343 C CG    . LEU F 5 239 ? -59.046 -16.662 7.342   1.00 129.57 ? 239 LEU D CG    1 
ATOM 6344 C CD1   . LEU F 5 239 ? -59.971 -17.804 7.687   1.00 128.88 ? 239 LEU D CD1   1 
ATOM 6345 C CD2   . LEU F 5 239 ? -58.227 -16.987 6.106   1.00 128.14 ? 239 LEU D CD2   1 
ATOM 6346 N N     . ASP F 5 240 ? -61.001 -12.492 6.687   1.00 141.95 ? 240 ASP D N     1 
ATOM 6347 C CA    . ASP F 5 240 ? -62.006 -11.810 5.877   1.00 143.76 ? 240 ASP D CA    1 
ATOM 6348 C C     . ASP F 5 240 ? -61.735 -10.331 5.631   1.00 144.33 ? 240 ASP D C     1 
ATOM 6349 O O     . ASP F 5 240 ? -62.509 -9.670  4.942   1.00 145.02 ? 240 ASP D O     1 
ATOM 6350 C CB    . ASP F 5 240 ? -63.400 -11.981 6.486   1.00 144.48 ? 240 ASP D CB    1 
ATOM 6351 C CG    . ASP F 5 240 ? -63.602 -11.143 7.729   1.00 144.26 ? 240 ASP D CG    1 
ATOM 6352 O OD1   . ASP F 5 240 ? -62.642 -10.992 8.514   1.00 140.93 ? 240 ASP D OD1   1 
ATOM 6353 O OD2   . ASP F 5 240 ? -64.726 -10.636 7.919   1.00 151.91 ? 240 ASP D OD2   1 
ATOM 6354 N N     . GLN F 5 241 ? -60.640 -9.815  6.184   1.00 142.90 ? 241 GLN D N     1 
ATOM 6355 C CA    . GLN F 5 241 ? -60.367 -8.380  6.115   1.00 142.07 ? 241 GLN D CA    1 
ATOM 6356 C C     . GLN F 5 241 ? -59.035 -8.051  5.436   1.00 138.78 ? 241 GLN D C     1 
ATOM 6357 O O     . GLN F 5 241 ? -58.090 -8.844  5.453   1.00 140.29 ? 241 GLN D O     1 
ATOM 6358 C CB    . GLN F 5 241 ? -60.430 -7.740  7.515   1.00 141.64 ? 241 GLN D CB    1 
ATOM 6359 C CG    . GLN F 5 241 ? -59.130 -7.834  8.313   1.00 140.64 ? 241 GLN D CG    1 
ATOM 6360 C CD    . GLN F 5 241 ? -59.271 -7.350  9.747   1.00 141.49 ? 241 GLN D CD    1 
ATOM 6361 O OE1   . GLN F 5 241 ? -60.380 -7.139  10.239  1.00 138.87 ? 241 GLN D OE1   1 
ATOM 6362 N NE2   . GLN F 5 241 ? -58.142 -7.177  10.427  1.00 145.27 ? 241 GLN D NE2   1 
ATOM 6363 N N     . TYR F 5 242 ? -58.989 -6.874  4.822   1.00 130.91 ? 242 TYR D N     1 
ATOM 6364 C CA    . TYR F 5 242 ? -57.769 -6.335  4.259   1.00 119.39 ? 242 TYR D CA    1 
ATOM 6365 C C     . TYR F 5 242 ? -56.945 -5.896  5.461   1.00 119.66 ? 242 TYR D C     1 
ATOM 6366 O O     . TYR F 5 242 ? -57.508 -5.621  6.520   1.00 119.97 ? 242 TYR D O     1 
ATOM 6367 C CB    . TYR F 5 242 ? -58.136 -5.142  3.387   1.00 108.96 ? 242 TYR D CB    1 
ATOM 6368 C CG    . TYR F 5 242 ? -57.270 -4.919  2.170   1.00 102.63 ? 242 TYR D CG    1 
ATOM 6369 C CD1   . TYR F 5 242 ? -57.467 -5.644  1.007   1.00 101.30 ? 242 TYR D CD1   1 
ATOM 6370 C CD2   . TYR F 5 242 ? -56.286 -3.945  2.170   1.00 98.67  ? 242 TYR D CD2   1 
ATOM 6371 C CE1   . TYR F 5 242 ? -56.684 -5.420  -0.113  1.00 100.38 ? 242 TYR D CE1   1 
ATOM 6372 C CE2   . TYR F 5 242 ? -55.504 -3.715  1.062   1.00 96.72  ? 242 TYR D CE2   1 
ATOM 6373 C CZ    . TYR F 5 242 ? -55.703 -4.451  -0.077  1.00 96.72  ? 242 TYR D CZ    1 
ATOM 6374 O OH    . TYR F 5 242 ? -54.911 -4.205  -1.178  1.00 95.48  ? 242 TYR D OH    1 
ATOM 6375 N N     . PRO F 5 243 ? -55.610 -5.854  5.320   1.00 119.84 ? 243 PRO D N     1 
ATOM 6376 C CA    . PRO F 5 243 ? -54.759 -5.371  6.415   1.00 122.73 ? 243 PRO D CA    1 
ATOM 6377 C C     . PRO F 5 243 ? -55.006 -3.892  6.673   1.00 128.67 ? 243 PRO D C     1 
ATOM 6378 O O     . PRO F 5 243 ? -55.330 -3.142  5.752   1.00 133.35 ? 243 PRO D O     1 
ATOM 6379 C CB    . PRO F 5 243 ? -53.333 -5.556  5.878   1.00 118.07 ? 243 PRO D CB    1 
ATOM 6380 C CG    . PRO F 5 243 ? -53.454 -6.448  4.731   1.00 117.15 ? 243 PRO D CG    1 
ATOM 6381 C CD    . PRO F 5 243 ? -54.818 -6.251  4.149   1.00 118.61 ? 243 PRO D CD    1 
ATOM 6382 N N     . ARG F 5 244 ? -54.845 -3.471  7.918   1.00 127.79 ? 244 ARG D N     1 
ATOM 6383 C CA    . ARG F 5 244 ? -55.115 -2.088  8.262   1.00 127.51 ? 244 ARG D CA    1 
ATOM 6384 C C     . ARG F 5 244 ? -54.130 -1.113  7.608   1.00 129.07 ? 244 ARG D C     1 
ATOM 6385 O O     . ARG F 5 244 ? -53.001 -1.479  7.264   1.00 125.91 ? 244 ARG D O     1 
ATOM 6386 C CB    . ARG F 5 244 ? -55.155 -1.916  9.778   1.00 123.61 ? 244 ARG D CB    1 
ATOM 6387 C CG    . ARG F 5 244 ? -56.375 -2.561  10.420  1.00 122.35 ? 244 ARG D CG    1 
ATOM 6388 C CD    . ARG F 5 244 ? -56.280 -2.524  11.934  1.00 120.59 ? 244 ARG D CD    1 
ATOM 6389 N NE    . ARG F 5 244 ? -57.519 -2.815  12.665  1.00 118.69 ? 244 ARG D NE    1 
ATOM 6390 C CZ    . ARG F 5 244 ? -58.711 -3.084  12.131  1.00 115.79 ? 244 ARG D CZ    1 
ATOM 6391 N NH1   . ARG F 5 244 ? -58.886 -3.126  10.817  1.00 112.44 ? 244 ARG D NH1   1 
ATOM 6392 N NH2   . ARG F 5 244 ? -59.747 -3.321  12.929  1.00 116.59 ? 244 ARG D NH2   1 
ATOM 6393 N N     . GLU F 5 245 ? -54.586 0.127   7.436   1.00 134.92 ? 245 GLU D N     1 
ATOM 6394 C CA    . GLU F 5 245 ? -53.822 1.183   6.770   1.00 136.63 ? 245 GLU D CA    1 
ATOM 6395 C C     . GLU F 5 245 ? -52.445 1.426   7.384   1.00 136.31 ? 245 GLU D C     1 
ATOM 6396 O O     . GLU F 5 245 ? -51.432 1.428   6.672   1.00 139.12 ? 245 GLU D O     1 
ATOM 6397 C CB    . GLU F 5 245 ? -54.637 2.484   6.748   1.00 134.72 ? 245 GLU D CB    1 
ATOM 6398 C CG    . GLU F 5 245 ? -53.914 3.689   6.148   1.00 133.20 ? 245 GLU D CG    1 
ATOM 6399 C CD    . GLU F 5 245 ? -54.698 4.995   6.290   1.00 130.73 ? 245 GLU D CD    1 
ATOM 6400 O OE1   . GLU F 5 245 ? -55.895 4.946   6.648   1.00 132.66 ? 245 GLU D OE1   1 
ATOM 6401 O OE2   . GLU F 5 245 ? -54.113 6.073   6.045   1.00 126.34 ? 245 GLU D OE2   1 
ATOM 6402 N N     . LEU F 5 246 ? -52.398 1.627   8.698   1.00 133.24 ? 246 LEU D N     1 
ATOM 6403 C CA    . LEU F 5 246 ? -51.128 1.948   9.347   1.00 129.92 ? 246 LEU D CA    1 
ATOM 6404 C C     . LEU F 5 246 ? -50.068 0.895   9.059   1.00 127.42 ? 246 LEU D C     1 
ATOM 6405 O O     . LEU F 5 246 ? -48.932 1.235   8.769   1.00 136.26 ? 246 LEU D O     1 
ATOM 6406 C CB    . LEU F 5 246 ? -51.289 2.156   10.860  1.00 130.10 ? 246 LEU D CB    1 
ATOM 6407 C CG    . LEU F 5 246 ? -50.153 2.946   11.535  1.00 128.51 ? 246 LEU D CG    1 
ATOM 6408 C CD1   . LEU F 5 246 ? -50.574 3.495   12.895  1.00 126.23 ? 246 LEU D CD1   1 
ATOM 6409 C CD2   . LEU F 5 246 ? -48.867 2.122   11.651  1.00 128.96 ? 246 LEU D CD2   1 
ATOM 6410 N N     . THR F 5 247 ? -50.446 -0.376  9.154   1.00 116.42 ? 247 THR D N     1 
ATOM 6411 C CA    . THR F 5 247 ? -49.540 -1.489  8.875   1.00 108.77 ? 247 THR D CA    1 
ATOM 6412 C C     . THR F 5 247 ? -48.806 -1.302  7.544   1.00 102.71 ? 247 THR D C     1 
ATOM 6413 O O     . THR F 5 247 ? -47.576 -1.156  7.493   1.00 97.90  ? 247 THR D O     1 
ATOM 6414 C CB    . THR F 5 247 ? -50.316 -2.827  8.774   1.00 114.12 ? 247 THR D CB    1 
ATOM 6415 O OG1   . THR F 5 247 ? -50.984 -3.106  10.010  1.00 115.69 ? 247 THR D OG1   1 
ATOM 6416 C CG2   . THR F 5 247 ? -49.376 -3.965  8.448   1.00 111.90 ? 247 THR D CG2   1 
ATOM 6417 N N     . LEU F 5 248 ? -49.581 -1.336  6.464   1.00 104.25 ? 248 LEU D N     1 
ATOM 6418 C CA    . LEU F 5 248 ? -49.036 -1.165  5.131   1.00 108.87 ? 248 LEU D CA    1 
ATOM 6419 C C     . LEU F 5 248 ? -48.166 0.066   5.106   1.00 113.27 ? 248 LEU D C     1 
ATOM 6420 O O     . LEU F 5 248 ? -47.033 0.035   4.621   1.00 115.21 ? 248 LEU D O     1 
ATOM 6421 C CB    . LEU F 5 248 ? -50.161 -1.008  4.110   1.00 112.31 ? 248 LEU D CB    1 
ATOM 6422 C CG    . LEU F 5 248 ? -50.649 -2.300  3.466   1.00 117.32 ? 248 LEU D CG    1 
ATOM 6423 C CD1   . LEU F 5 248 ? -51.287 -2.026  2.111   1.00 118.21 ? 248 LEU D CD1   1 
ATOM 6424 C CD2   . LEU F 5 248 ? -49.485 -3.269  3.319   1.00 120.09 ? 248 LEU D CD2   1 
ATOM 6425 N N     . GLY F 5 249 ? -48.706 1.150   5.649   1.00 116.54 ? 249 GLY D N     1 
ATOM 6426 C CA    . GLY F 5 249 ? -47.953 2.380   5.811   1.00 117.47 ? 249 GLY D CA    1 
ATOM 6427 C C     . GLY F 5 249 ? -46.625 2.203   6.535   1.00 118.51 ? 249 GLY D C     1 
ATOM 6428 O O     . GLY F 5 249 ? -45.724 3.015   6.377   1.00 120.43 ? 249 GLY D O     1 
ATOM 6429 N N     . ASN F 5 250 ? -46.494 1.120   7.303   1.00 115.63 ? 250 ASN D N     1 
ATOM 6430 C CA    . ASN F 5 250 ? -45.224 0.759   7.922   1.00 110.93 ? 250 ASN D CA    1 
ATOM 6431 C C     . ASN F 5 250 ? -44.369 -0.009  6.895   1.00 108.22 ? 250 ASN D C     1 
ATOM 6432 O O     . ASN F 5 250 ? -43.161 0.205   6.751   1.00 105.28 ? 250 ASN D O     1 
ATOM 6433 C CB    . ASN F 5 250 ? -45.467 -0.006  9.251   1.00 116.64 ? 250 ASN D CB    1 
ATOM 6434 C CG    . ASN F 5 250 ? -44.465 0.371   10.343  1.00 119.60 ? 250 ASN D CG    1 
ATOM 6435 O OD1   . ASN F 5 250 ? -43.343 0.787   10.052  1.00 127.20 ? 250 ASN D OD1   1 
ATOM 6436 N ND2   . ASN F 5 250 ? -44.859 0.195   11.602  1.00 117.74 ? 250 ASN D ND2   1 
ATOM 6437 N N     . TRP F 5 251 ? -45.009 -0.914  6.174   1.00 109.57 ? 251 TRP D N     1 
ATOM 6438 C CA    . TRP F 5 251 ? -44.272 -1.780  5.283   1.00 114.37 ? 251 TRP D CA    1 
ATOM 6439 C C     . TRP F 5 251 ? -43.507 -0.918  4.315   1.00 113.53 ? 251 TRP D C     1 
ATOM 6440 O O     . TRP F 5 251 ? -42.273 -0.956  4.205   1.00 118.11 ? 251 TRP D O     1 
ATOM 6441 C CB    . TRP F 5 251 ? -45.278 -2.641  4.562   1.00 118.21 ? 251 TRP D CB    1 
ATOM 6442 C CG    . TRP F 5 251 ? -45.881 -3.618  5.448   1.00 123.69 ? 251 TRP D CG    1 
ATOM 6443 C CD1   . TRP F 5 251 ? -46.690 -4.635  5.066   1.00 123.97 ? 251 TRP D CD1   1 
ATOM 6444 C CD2   . TRP F 5 251 ? -45.727 -3.734  6.846   1.00 128.26 ? 251 TRP D CD2   1 
ATOM 6445 N NE1   . TRP F 5 251 ? -47.078 -5.396  6.131   1.00 124.78 ? 251 TRP D NE1   1 
ATOM 6446 C CE2   . TRP F 5 251 ? -46.498 -4.857  7.244   1.00 127.76 ? 251 TRP D CE2   1 
ATOM 6447 C CE3   . TRP F 5 251 ? -45.036 -3.019  7.822   1.00 128.85 ? 251 TRP D CE3   1 
ATOM 6448 C CZ2   . TRP F 5 251 ? -46.570 -5.256  8.538   1.00 129.41 ? 251 TRP D CZ2   1 
ATOM 6449 C CZ3   . TRP F 5 251 ? -45.110 -3.443  9.090   1.00 129.29 ? 251 TRP D CZ3   1 
ATOM 6450 C CH2   . TRP F 5 251 ? -45.866 -4.537  9.443   1.00 129.35 ? 251 TRP D CH2   1 
ATOM 6451 N N     . TYR F 5 252 ? -44.290 -0.119  3.629   1.00 108.59 ? 252 TYR D N     1 
ATOM 6452 C CA    . TYR F 5 252 ? -43.846 0.613   2.487   1.00 105.10 ? 252 TYR D CA    1 
ATOM 6453 C C     . TYR F 5 252 ? -42.513 1.295   2.722   1.00 108.84 ? 252 TYR D C     1 
ATOM 6454 O O     . TYR F 5 252 ? -41.544 0.935   2.074   1.00 110.15 ? 252 TYR D O     1 
ATOM 6455 C CB    . TYR F 5 252 ? -44.947 1.594   2.112   1.00 99.46  ? 252 TYR D CB    1 
ATOM 6456 C CG    . TYR F 5 252 ? -45.748 1.088   0.957   1.00 92.73  ? 252 TYR D CG    1 
ATOM 6457 C CD1   . TYR F 5 252 ? -45.245 1.192   -0.320  1.00 91.26  ? 252 TYR D CD1   1 
ATOM 6458 C CD2   . TYR F 5 252 ? -46.991 0.500   1.129   1.00 88.14  ? 252 TYR D CD2   1 
ATOM 6459 C CE1   . TYR F 5 252 ? -45.945 0.746   -1.401  1.00 90.39  ? 252 TYR D CE1   1 
ATOM 6460 C CE2   . TYR F 5 252 ? -47.711 0.045   0.042   1.00 87.20  ? 252 TYR D CE2   1 
ATOM 6461 C CZ    . TYR F 5 252 ? -47.178 0.172   -1.222  1.00 88.13  ? 252 TYR D CZ    1 
ATOM 6462 O OH    . TYR F 5 252 ? -47.875 -0.275  -2.317  1.00 87.27  ? 252 TYR D OH    1 
ATOM 6463 N N     . PRO F 5 253 ? -42.425 2.206   3.708   1.00 107.35 ? 253 PRO D N     1 
ATOM 6464 C CA    . PRO F 5 253 ? -41.157 2.933   3.813   1.00 103.56 ? 253 PRO D CA    1 
ATOM 6465 C C     . PRO F 5 253 ? -39.992 1.970   4.008   1.00 94.35  ? 253 PRO D C     1 
ATOM 6466 O O     . PRO F 5 253 ? -38.919 2.195   3.447   1.00 89.40  ? 253 PRO D O     1 
ATOM 6467 C CB    . PRO F 5 253 ? -41.358 3.803   5.054   1.00 105.24 ? 253 PRO D CB    1 
ATOM 6468 C CG    . PRO F 5 253 ? -42.404 3.098   5.839   1.00 107.28 ? 253 PRO D CG    1 
ATOM 6469 C CD    . PRO F 5 253 ? -43.333 2.538   4.816   1.00 108.37 ? 253 PRO D CD    1 
ATOM 6470 N N     . THR F 5 254 ? -40.227 0.901   4.774   1.00 94.68  ? 254 THR D N     1 
ATOM 6471 C CA    . THR F 5 254 ? -39.238 -0.160  5.005   1.00 92.83  ? 254 THR D CA    1 
ATOM 6472 C C     . THR F 5 254 ? -38.669 -0.733  3.718   1.00 99.01  ? 254 THR D C     1 
ATOM 6473 O O     . THR F 5 254 ? -37.462 -0.963  3.617   1.00 100.25 ? 254 THR D O     1 
ATOM 6474 C CB    . THR F 5 254 ? -39.811 -1.343  5.806   1.00 88.91  ? 254 THR D CB    1 
ATOM 6475 O OG1   . THR F 5 254 ? -41.138 -1.041  6.245   1.00 97.99  ? 254 THR D OG1   1 
ATOM 6476 C CG2   . THR F 5 254 ? -38.937 -1.649  7.001   1.00 81.85  ? 254 THR D CG2   1 
ATOM 6477 N N     . ILE F 5 255 ? -39.531 -0.986  2.741   1.00 103.27 ? 255 ILE D N     1 
ATOM 6478 C CA    . ILE F 5 255 ? -39.039 -1.495  1.472   1.00 108.39 ? 255 ILE D CA    1 
ATOM 6479 C C     . ILE F 5 255 ? -38.278 -0.449  0.662   1.00 108.78 ? 255 ILE D C     1 
ATOM 6480 O O     . ILE F 5 255 ? -37.295 -0.780  0.005   1.00 109.76 ? 255 ILE D O     1 
ATOM 6481 C CB    . ILE F 5 255 ? -40.148 -2.118  0.604   1.00 113.26 ? 255 ILE D CB    1 
ATOM 6482 C CG1   . ILE F 5 255 ? -39.529 -2.743  -0.642  1.00 116.01 ? 255 ILE D CG1   1 
ATOM 6483 C CG2   . ILE F 5 255 ? -41.176 -1.084  0.207   1.00 114.58 ? 255 ILE D CG2   1 
ATOM 6484 C CD1   . ILE F 5 255 ? -38.401 -3.703  -0.346  1.00 116.43 ? 255 ILE D CD1   1 
ATOM 6485 N N     . PHE F 5 256 ? -38.720 0.805   0.715   1.00 107.83 ? 256 PHE D N     1 
ATOM 6486 C CA    . PHE F 5 256 ? -38.106 1.856   -0.099  1.00 109.10 ? 256 PHE D CA    1 
ATOM 6487 C C     . PHE F 5 256 ? -36.712 2.240   0.392   1.00 113.58 ? 256 PHE D C     1 
ATOM 6488 O O     . PHE F 5 256 ? -35.785 2.383   -0.408  1.00 116.37 ? 256 PHE D O     1 
ATOM 6489 C CB    . PHE F 5 256 ? -38.991 3.097   -0.160  1.00 102.51 ? 256 PHE D CB    1 
ATOM 6490 C CG    . PHE F 5 256 ? -40.294 2.893   -0.888  1.00 98.15  ? 256 PHE D CG    1 
ATOM 6491 C CD1   . PHE F 5 256 ? -40.428 3.279   -2.212  1.00 95.46  ? 256 PHE D CD1   1 
ATOM 6492 C CD2   . PHE F 5 256 ? -41.393 2.353   -0.241  1.00 97.49  ? 256 PHE D CD2   1 
ATOM 6493 C CE1   . PHE F 5 256 ? -41.632 3.114   -2.885  1.00 95.59  ? 256 PHE D CE1   1 
ATOM 6494 C CE2   . PHE F 5 256 ? -42.597 2.186   -0.906  1.00 98.73  ? 256 PHE D CE2   1 
ATOM 6495 C CZ    . PHE F 5 256 ? -42.719 2.568   -2.230  1.00 97.57  ? 256 PHE D CZ    1 
ATOM 6496 N N     . LYS F 5 257 ? -36.565 2.425   1.698   1.00 113.75 ? 257 LYS D N     1 
ATOM 6497 C CA    . LYS F 5 257 ? -35.241 2.591   2.266   1.00 113.57 ? 257 LYS D CA    1 
ATOM 6498 C C     . LYS F 5 257 ? -34.335 1.482   1.714   1.00 115.59 ? 257 LYS D C     1 
ATOM 6499 O O     . LYS F 5 257 ? -33.336 1.752   1.045   1.00 120.79 ? 257 LYS D O     1 
ATOM 6500 C CB    . LYS F 5 257 ? -35.309 2.582   3.801   1.00 111.23 ? 257 LYS D CB    1 
ATOM 6501 C CG    . LYS F 5 257 ? -36.429 1.720   4.346   1.00 114.41 ? 257 LYS D CG    1 
ATOM 6502 C CD    . LYS F 5 257 ? -36.321 1.492   5.860   1.00 116.01 ? 257 LYS D CD    1 
ATOM 6503 C CE    . LYS F 5 257 ? -36.983 2.586   6.708   1.00 119.49 ? 257 LYS D CE    1 
ATOM 6504 N NZ    . LYS F 5 257 ? -36.975 2.249   8.176   1.00 125.39 ? 257 LYS D NZ    1 
ATOM 6505 N N     . TYR F 5 258 ? -34.701 0.235   1.985   1.00 112.56 ? 258 TYR D N     1 
ATOM 6506 C CA    . TYR F 5 258 ? -33.956 -0.904  1.474   1.00 111.43 ? 258 TYR D CA    1 
ATOM 6507 C C     . TYR F 5 258 ? -33.613 -0.699  0.006   1.00 108.69 ? 258 TYR D C     1 
ATOM 6508 O O     . TYR F 5 258 ? -32.487 -0.942  -0.418  1.00 104.10 ? 258 TYR D O     1 
ATOM 6509 C CB    . TYR F 5 258 ? -34.784 -2.202  1.644   1.00 115.23 ? 258 TYR D CB    1 
ATOM 6510 C CG    . TYR F 5 258 ? -34.042 -3.438  1.179   1.00 116.14 ? 258 TYR D CG    1 
ATOM 6511 C CD1   . TYR F 5 258 ? -32.960 -3.915  1.892   1.00 116.39 ? 258 TYR D CD1   1 
ATOM 6512 C CD2   . TYR F 5 258 ? -34.424 -4.129  0.035   1.00 117.02 ? 258 TYR D CD2   1 
ATOM 6513 C CE1   . TYR F 5 258 ? -32.277 -5.033  1.481   1.00 117.92 ? 258 TYR D CE1   1 
ATOM 6514 C CE2   . TYR F 5 258 ? -33.742 -5.264  -0.380  1.00 117.77 ? 258 TYR D CE2   1 
ATOM 6515 C CZ    . TYR F 5 258 ? -32.662 -5.705  0.346   1.00 120.07 ? 258 TYR D CZ    1 
ATOM 6516 O OH    . TYR F 5 258 ? -31.968 -6.824  -0.059  1.00 124.06 ? 258 TYR D OH    1 
ATOM 6517 N N     . CYS F 5 259 ? -34.594 -0.247  -0.763  1.00 111.49 ? 259 CYS D N     1 
ATOM 6518 C CA    . CYS F 5 259 ? -34.401 -0.033  -2.191  1.00 113.75 ? 259 CYS D CA    1 
ATOM 6519 C C     . CYS F 5 259 ? -33.790 1.347   -2.463  1.00 113.12 ? 259 CYS D C     1 
ATOM 6520 O O     . CYS F 5 259 ? -33.393 1.658   -3.589  1.00 112.37 ? 259 CYS D O     1 
ATOM 6521 C CB    . CYS F 5 259 ? -35.728 -0.185  -2.961  1.00 117.22 ? 259 CYS D CB    1 
ATOM 6522 S SG    . CYS F 5 259 ? -36.580 -1.800  -2.824  1.00 80.23  ? 259 CYS D SG    1 
ATOM 6523 N N     . GLN F 5 260 ? -33.712 2.169   -1.421  1.00 114.50 ? 260 GLN D N     1 
ATOM 6524 C CA    . GLN F 5 260 ? -33.142 3.512   -1.524  1.00 117.56 ? 260 GLN D CA    1 
ATOM 6525 C C     . GLN F 5 260 ? -33.838 4.371   -2.551  1.00 113.73 ? 260 GLN D C     1 
ATOM 6526 O O     . GLN F 5 260 ? -33.190 5.027   -3.370  1.00 114.43 ? 260 GLN D O     1 
ATOM 6527 C CB    . GLN F 5 260 ? -31.670 3.451   -1.880  1.00 124.16 ? 260 GLN D CB    1 
ATOM 6528 C CG    . GLN F 5 260 ? -30.788 2.948   -0.781  1.00 131.35 ? 260 GLN D CG    1 
ATOM 6529 C CD    . GLN F 5 260 ? -29.398 2.679   -1.292  1.00 137.89 ? 260 GLN D CD    1 
ATOM 6530 O OE1   . GLN F 5 260 ? -28.410 3.071   -0.675  1.00 142.32 ? 260 GLN D OE1   1 
ATOM 6531 N NE2   . GLN F 5 260 ? -29.313 2.013   -2.438  1.00 138.24 ? 260 GLN D NE2   1 
ATOM 6532 N N     . LEU F 5 261 ? -35.160 4.354   -2.507  1.00 108.26 ? 261 LEU D N     1 
ATOM 6533 C CA    . LEU F 5 261 ? -35.969 5.241   -3.316  1.00 103.40 ? 261 LEU D CA    1 
ATOM 6534 C C     . LEU F 5 261 ? -36.729 6.101   -2.332  1.00 103.24 ? 261 LEU D C     1 
ATOM 6535 O O     . LEU F 5 261 ? -37.019 5.661   -1.217  1.00 102.89 ? 261 LEU D O     1 
ATOM 6536 C CB    . LEU F 5 261 ? -36.929 4.434   -4.180  1.00 100.01 ? 261 LEU D CB    1 
ATOM 6537 C CG    . LEU F 5 261 ? -36.257 3.537   -5.216  1.00 99.99  ? 261 LEU D CG    1 
ATOM 6538 C CD1   . LEU F 5 261 ? -37.313 2.704   -5.896  1.00 103.01 ? 261 LEU D CD1   1 
ATOM 6539 C CD2   . LEU F 5 261 ? -35.479 4.360   -6.229  1.00 98.30  ? 261 LEU D CD2   1 
ATOM 6540 N N     . PRO F 5 262 ? -37.046 7.338   -2.724  1.00 102.82 ? 262 PRO D N     1 
ATOM 6541 C CA    . PRO F 5 262 ? -37.721 8.179   -1.741  1.00 102.43 ? 262 PRO D CA    1 
ATOM 6542 C C     . PRO F 5 262 ? -39.084 7.581   -1.459  1.00 105.98 ? 262 PRO D C     1 
ATOM 6543 O O     . PRO F 5 262 ? -39.484 6.630   -2.130  1.00 108.01 ? 262 PRO D O     1 
ATOM 6544 C CB    . PRO F 5 262 ? -37.868 9.501   -2.480  1.00 100.89 ? 262 PRO D CB    1 
ATOM 6545 C CG    . PRO F 5 262 ? -37.968 9.107   -3.925  1.00 101.61 ? 262 PRO D CG    1 
ATOM 6546 C CD    . PRO F 5 262 ? -37.073 7.910   -4.083  1.00 101.39 ? 262 PRO D CD    1 
ATOM 6547 N N     . TYR F 5 263 ? -39.804 8.141   -0.500  1.00 107.94 ? 263 TYR D N     1 
ATOM 6548 C CA    . TYR F 5 263 ? -41.131 7.633   -0.200  1.00 109.73 ? 263 TYR D CA    1 
ATOM 6549 C C     . TYR F 5 263 ? -42.116 8.730   0.166   1.00 110.09 ? 263 TYR D C     1 
ATOM 6550 O O     . TYR F 5 263 ? -41.869 9.534   1.065   1.00 110.43 ? 263 TYR D O     1 
ATOM 6551 C CB    . TYR F 5 263 ? -41.069 6.586   0.907   1.00 110.41 ? 263 TYR D CB    1 
ATOM 6552 C CG    . TYR F 5 263 ? -42.419 6.211   1.455   1.00 110.51 ? 263 TYR D CG    1 
ATOM 6553 C CD1   . TYR F 5 263 ? -43.256 5.351   0.766   1.00 107.84 ? 263 TYR D CD1   1 
ATOM 6554 C CD2   . TYR F 5 263 ? -42.858 6.719   2.666   1.00 113.35 ? 263 TYR D CD2   1 
ATOM 6555 C CE1   . TYR F 5 263 ? -44.493 5.006   1.270   1.00 107.18 ? 263 TYR D CE1   1 
ATOM 6556 C CE2   . TYR F 5 263 ? -44.094 6.380   3.177   1.00 112.99 ? 263 TYR D CE2   1 
ATOM 6557 C CZ    . TYR F 5 263 ? -44.906 5.523   2.476   1.00 108.41 ? 263 TYR D CZ    1 
ATOM 6558 O OH    . TYR F 5 263 ? -46.137 5.186   2.986   1.00 105.59 ? 263 TYR D OH    1 
ATOM 6559 N N     . THR F 5 264 ? -43.243 8.749   -0.532  1.00 111.83 ? 264 THR D N     1 
ATOM 6560 C CA    . THR F 5 264 ? -44.331 9.653   -0.195  1.00 111.71 ? 264 THR D CA    1 
ATOM 6561 C C     . THR F 5 264 ? -45.613 8.833   -0.071  1.00 113.26 ? 264 THR D C     1 
ATOM 6562 O O     . THR F 5 264 ? -46.079 8.210   -1.031  1.00 114.83 ? 264 THR D O     1 
ATOM 6563 C CB    . THR F 5 264 ? -44.466 10.825  -1.201  1.00 75.73  ? 264 THR D CB    1 
ATOM 6564 O OG1   . THR F 5 264 ? -43.991 10.417  -2.489  1.00 81.51  ? 264 THR D OG1   1 
ATOM 6565 C CG2   . THR F 5 264 ? -43.629 12.002  -0.742  1.00 70.74  ? 264 THR D CG2   1 
ATOM 6566 N N     . LYS F 5 265 ? -46.148 8.814   1.142   1.00 110.30 ? 265 LYS D N     1 
ATOM 6567 C CA    . LYS F 5 265 ? -47.293 7.987   1.493   1.00 110.16 ? 265 LYS D CA    1 
ATOM 6568 C C     . LYS F 5 265 ? -48.516 8.342   0.653   1.00 112.75 ? 265 LYS D C     1 
ATOM 6569 O O     . LYS F 5 265 ? -49.266 7.465   0.206   1.00 114.06 ? 265 LYS D O     1 
ATOM 6570 C CB    . LYS F 5 265 ? -47.593 8.175   2.976   1.00 105.64 ? 265 LYS D CB    1 
ATOM 6571 C CG    . LYS F 5 265 ? -48.742 7.359   3.488   1.00 106.85 ? 265 LYS D CG    1 
ATOM 6572 C CD    . LYS F 5 265 ? -48.789 7.426   5.002   1.00 107.17 ? 265 LYS D CD    1 
ATOM 6573 C CE    . LYS F 5 265 ? -49.730 6.379   5.580   1.00 107.26 ? 265 LYS D CE    1 
ATOM 6574 N NZ    . LYS F 5 265 ? -51.156 6.810   5.558   1.00 107.05 ? 265 LYS D NZ    1 
ATOM 6575 N N     . LYS F 5 266 ? -48.703 9.641   0.443   1.00 112.25 ? 266 LYS D N     1 
ATOM 6576 C CA    . LYS F 5 266 ? -49.821 10.147  -0.343  1.00 111.62 ? 266 LYS D CA    1 
ATOM 6577 C C     . LYS F 5 266 ? -49.884 9.465   -1.704  1.00 110.90 ? 266 LYS D C     1 
ATOM 6578 O O     . LYS F 5 266 ? -50.965 9.225   -2.242  1.00 110.63 ? 266 LYS D O     1 
ATOM 6579 C CB    . LYS F 5 266 ? -49.729 11.674  -0.503  1.00 108.94 ? 266 LYS D CB    1 
ATOM 6580 C CG    . LYS F 5 266 ? -50.682 12.260  -1.551  1.00 110.90 ? 266 LYS D CG    1 
ATOM 6581 C CD    . LYS F 5 266 ? -51.418 13.507  -1.049  1.00 114.67 ? 266 LYS D CD    1 
ATOM 6582 C CE    . LYS F 5 266 ? -52.537 13.916  -2.009  1.00 115.22 ? 266 LYS D CE    1 
ATOM 6583 N NZ    . LYS F 5 266 ? -53.444 14.963  -1.452  1.00 115.33 ? 266 LYS D NZ    1 
ATOM 6584 N N     . HIS F 5 267 ? -48.721 9.144   -2.256  1.00 112.25 ? 267 HIS D N     1 
ATOM 6585 C CA    . HIS F 5 267 ? -48.673 8.561   -3.586  1.00 118.19 ? 267 HIS D CA    1 
ATOM 6586 C C     . HIS F 5 267 ? -49.422 7.228   -3.648  1.00 124.73 ? 267 HIS D C     1 
ATOM 6587 O O     . HIS F 5 267 ? -50.216 7.001   -4.562  1.00 131.22 ? 267 HIS D O     1 
ATOM 6588 C CB    . HIS F 5 267 ? -47.224 8.402   -4.058  1.00 119.55 ? 267 HIS D CB    1 
ATOM 6589 C CG    . HIS F 5 267 ? -46.583 9.686   -4.491  1.00 121.55 ? 267 HIS D CG    1 
ATOM 6590 N ND1   . HIS F 5 267 ? -47.178 10.913  -4.286  1.00 121.67 ? 267 HIS D ND1   1 
ATOM 6591 C CD2   . HIS F 5 267 ? -45.412 9.934   -5.118  1.00 121.82 ? 267 HIS D CD2   1 
ATOM 6592 C CE1   . HIS F 5 267 ? -46.392 11.866  -4.769  1.00 119.79 ? 267 HIS D CE1   1 
ATOM 6593 N NE2   . HIS F 5 267 ? -45.315 11.292  -5.279  1.00 120.52 ? 267 HIS D NE2   1 
ATOM 6594 N N     . TRP F 5 268 ? -49.134 6.343   -2.695  1.00 120.35 ? 268 TRP D N     1 
ATOM 6595 C CA    . TRP F 5 268 ? -49.704 4.995   -2.676  1.00 111.05 ? 268 TRP D CA    1 
ATOM 6596 C C     . TRP F 5 268 ? -50.995 4.785   -1.868  1.00 110.05 ? 268 TRP D C     1 
ATOM 6597 O O     . TRP F 5 268 ? -51.708 3.806   -2.098  1.00 109.48 ? 268 TRP D O     1 
ATOM 6598 C CB    . TRP F 5 268 ? -48.618 4.040   -2.201  1.00 103.99 ? 268 TRP D CB    1 
ATOM 6599 C CG    . TRP F 5 268 ? -47.295 4.395   -2.818  1.00 101.50 ? 268 TRP D CG    1 
ATOM 6600 C CD1   . TRP F 5 268 ? -46.276 5.108   -2.246  1.00 102.31 ? 268 TRP D CD1   1 
ATOM 6601 C CD2   . TRP F 5 268 ? -46.876 4.102   -4.154  1.00 100.88 ? 268 TRP D CD2   1 
ATOM 6602 N NE1   . TRP F 5 268 ? -45.239 5.251   -3.140  1.00 101.86 ? 268 TRP D NE1   1 
ATOM 6603 C CE2   . TRP F 5 268 ? -45.585 4.640   -4.317  1.00 100.51 ? 268 TRP D CE2   1 
ATOM 6604 C CE3   . TRP F 5 268 ? -47.466 3.423   -5.223  1.00 101.21 ? 268 TRP D CE3   1 
ATOM 6605 C CZ2   . TRP F 5 268 ? -44.874 4.519   -5.508  1.00 97.80  ? 268 TRP D CZ2   1 
ATOM 6606 C CZ3   . TRP F 5 268 ? -46.759 3.303   -6.401  1.00 99.79  ? 268 TRP D CZ3   1 
ATOM 6607 C CH2   . TRP F 5 268 ? -45.477 3.850   -6.536  1.00 97.46  ? 268 TRP D CH2   1 
ATOM 6608 N N     . PHE F 5 269 ? -51.305 5.689   -0.938  1.00 110.95 ? 269 PHE D N     1 
ATOM 6609 C CA    . PHE F 5 269 ? -52.529 5.537   -0.145  1.00 110.41 ? 269 PHE D CA    1 
ATOM 6610 C C     . PHE F 5 269 ? -53.701 6.431   -0.578  1.00 115.55 ? 269 PHE D C     1 
ATOM 6611 O O     . PHE F 5 269 ? -54.811 6.312   -0.056  1.00 119.39 ? 269 PHE D O     1 
ATOM 6612 C CB    . PHE F 5 269 ? -52.231 5.661   1.345   1.00 106.14 ? 269 PHE D CB    1 
ATOM 6613 C CG    . PHE F 5 269 ? -51.444 4.506   1.899   1.00 103.75 ? 269 PHE D CG    1 
ATOM 6614 C CD1   . PHE F 5 269 ? -51.953 3.732   2.928   1.00 104.03 ? 269 PHE D CD1   1 
ATOM 6615 C CD2   . PHE F 5 269 ? -50.210 4.176   1.366   1.00 102.46 ? 269 PHE D CD2   1 
ATOM 6616 C CE1   . PHE F 5 269 ? -51.233 2.664   3.433   1.00 102.66 ? 269 PHE D CE1   1 
ATOM 6617 C CE2   . PHE F 5 269 ? -49.480 3.109   1.859   1.00 102.19 ? 269 PHE D CE2   1 
ATOM 6618 C CZ    . PHE F 5 269 ? -49.994 2.349   2.899   1.00 101.66 ? 269 PHE D CZ    1 
ATOM 6619 N N     . GLN F 5 270 ? -53.448 7.289   -1.562  1.00 112.91 ? 270 GLN D N     1 
ATOM 6620 C CA    . GLN F 5 270 ? -54.463 8.184   -2.104  1.00 109.26 ? 270 GLN D CA    1 
ATOM 6621 C C     . GLN F 5 270 ? -54.277 8.317   -3.608  1.00 101.70 ? 270 GLN D C     1 
ATOM 6622 O O     . GLN F 5 270 ? -53.198 8.048   -4.135  1.00 104.14 ? 270 GLN D O     1 
ATOM 6623 C CB    . GLN F 5 270 ? -54.379 9.559   -1.438  1.00 111.96 ? 270 GLN D CB    1 
ATOM 6624 C CG    . GLN F 5 270 ? -54.552 9.535   0.072   1.00 115.49 ? 270 GLN D CG    1 
ATOM 6625 C CD    . GLN F 5 270 ? -53.361 10.121  0.811   1.00 119.12 ? 270 GLN D CD    1 
ATOM 6626 O OE1   . GLN F 5 270 ? -52.733 11.071  0.347   1.00 121.68 ? 270 GLN D OE1   1 
ATOM 6627 N NE2   . GLN F 5 270 ? -53.047 9.556   1.969   1.00 119.59 ? 270 GLN D NE2   1 
ATOM 6628 N N     . VAL F 5 271 ? -55.328 8.731   -4.304  1.00 90.57  ? 271 VAL D N     1 
ATOM 6629 C CA    . VAL F 5 271 ? -55.223 8.887   -5.745  1.00 80.85  ? 271 VAL D CA    1 
ATOM 6630 C C     . VAL F 5 271 ? -54.052 9.821   -6.030  1.00 79.46  ? 271 VAL D C     1 
ATOM 6631 O O     . VAL F 5 271 ? -53.787 10.743  -5.265  1.00 78.53  ? 271 VAL D O     1 
ATOM 6632 C CB    . VAL F 5 271 ? -56.524 9.426   -6.360  1.00 74.94  ? 271 VAL D CB    1 
ATOM 6633 C CG1   . VAL F 5 271 ? -56.536 9.198   -7.874  1.00 80.73  ? 271 VAL D CG1   1 
ATOM 6634 C CG2   . VAL F 5 271 ? -57.720 8.763   -5.701  1.00 67.67  ? 271 VAL D CG2   1 
ATOM 6635 N N     . ASN F 5 272 ? -53.318 9.540   -7.098  1.00 83.39  ? 272 ASN D N     1 
ATOM 6636 C CA    . ASN F 5 272 ? -52.218 10.395  -7.520  1.00 90.92  ? 272 ASN D CA    1 
ATOM 6637 C C     . ASN F 5 272 ? -52.588 10.999  -8.854  1.00 98.60  ? 272 ASN D C     1 
ATOM 6638 O O     . ASN F 5 272 ? -52.733 10.295  -9.852  1.00 104.84 ? 272 ASN D O     1 
ATOM 6639 C CB    . ASN F 5 272 ? -50.898 9.623   -7.599  1.00 91.00  ? 272 ASN D CB    1 
ATOM 6640 C CG    . ASN F 5 272 ? -49.794 10.427  -8.256  1.00 89.96  ? 272 ASN D CG    1 
ATOM 6641 O OD1   . ASN F 5 272 ? -49.916 11.637  -8.432  1.00 90.50  ? 272 ASN D OD1   1 
ATOM 6642 N ND2   . ASN F 5 272 ? -48.712 9.758   -8.625  1.00 89.51  ? 272 ASN D ND2   1 
ATOM 6643 N N     . GLN F 5 273 ? -52.748 12.316  -8.841  1.00 101.03 ? 273 GLN D N     1 
ATOM 6644 C CA    . GLN F 5 273 ? -53.427 13.037  -9.905  1.00 105.00 ? 273 GLN D CA    1 
ATOM 6645 C C     . GLN F 5 273 ? -52.560 13.311  -11.061 1.00 106.30 ? 273 GLN D C     1 
ATOM 6646 O O     . GLN F 5 273 ? -53.006 13.232  -12.196 1.00 107.25 ? 273 GLN D O     1 
ATOM 6647 C CB    . GLN F 5 273 ? -53.968 14.345  -9.390  1.00 110.31 ? 273 GLN D CB    1 
ATOM 6648 C CG    . GLN F 5 273 ? -55.293 14.076  -8.694  1.00 118.57 ? 273 GLN D CG    1 
ATOM 6649 C CD    . GLN F 5 273 ? -55.161 13.043  -7.570  1.00 129.58 ? 273 GLN D CD    1 
ATOM 6650 O OE1   . GLN F 5 273 ? -54.151 13.042  -6.888  1.00 133.38 ? 273 GLN D OE1   1 
ATOM 6651 N NE2   . GLN F 5 273 ? -56.168 12.155  -7.384  1.00 134.81 ? 273 GLN D NE2   1 
ATOM 6652 N N     . GLU F 5 274 ? -51.314 13.630  -10.745 1.00 106.53 ? 274 GLU D N     1 
ATOM 6653 C CA    . GLU F 5 274 ? -50.246 13.756  -11.708 1.00 108.72 ? 274 GLU D CA    1 
ATOM 6654 C C     . GLU F 5 274 ? -50.347 12.545  -12.619 1.00 108.42 ? 274 GLU D C     1 
ATOM 6655 O O     . GLU F 5 274 ? -49.992 12.587  -13.809 1.00 108.43 ? 274 GLU D O     1 
ATOM 6656 C CB    . GLU F 5 274 ? -48.943 13.700  -10.911 1.00 110.94 ? 274 GLU D CB    1 
ATOM 6657 C CG    . GLU F 5 274 ? -47.672 14.010  -11.676 1.00 114.96 ? 274 GLU D CG    1 
ATOM 6658 C CD    . GLU F 5 274 ? -46.522 14.327  -10.735 1.00 119.98 ? 274 GLU D CD    1 
ATOM 6659 O OE1   . GLU F 5 274 ? -46.704 15.194  -9.850  1.00 125.99 ? 274 GLU D OE1   1 
ATOM 6660 O OE2   . GLU F 5 274 ? -45.452 13.694  -10.859 1.00 118.05 ? 274 GLU D OE2   1 
ATOM 6661 N N     . TRP F 5 275 ? -50.786 11.446  -12.019 1.00 106.48 ? 275 TRP D N     1 
ATOM 6662 C CA    . TRP F 5 275 ? -50.981 10.204  -12.736 1.00 103.60 ? 275 TRP D CA    1 
ATOM 6663 C C     . TRP F 5 275 ? -52.334 10.100  -13.414 1.00 103.26 ? 275 TRP D C     1 
ATOM 6664 O O     . TRP F 5 275 ? -53.249 10.877  -13.133 1.00 106.24 ? 275 TRP D O     1 
ATOM 6665 C CB    . TRP F 5 275 ? -50.743 9.029   -11.802 1.00 106.16 ? 275 TRP D CB    1 
ATOM 6666 C CG    . TRP F 5 275 ? -49.307 8.842   -11.567 1.00 107.13 ? 275 TRP D CG    1 
ATOM 6667 C CD1   . TRP F 5 275 ? -48.319 9.729   -11.854 1.00 107.85 ? 275 TRP D CD1   1 
ATOM 6668 C CD2   . TRP F 5 275 ? -48.671 7.687   -11.026 1.00 110.03 ? 275 TRP D CD2   1 
ATOM 6669 N NE1   . TRP F 5 275 ? -47.101 9.204   -11.510 1.00 108.67 ? 275 TRP D NE1   1 
ATOM 6670 C CE2   . TRP F 5 275 ? -47.291 7.947   -11.000 1.00 107.95 ? 275 TRP D CE2   1 
ATOM 6671 C CE3   . TRP F 5 275 ? -49.134 6.461   -10.552 1.00 111.85 ? 275 TRP D CE3   1 
ATOM 6672 C CZ2   . TRP F 5 275 ? -46.375 7.034   -10.520 1.00 107.21 ? 275 TRP D CZ2   1 
ATOM 6673 C CZ3   . TRP F 5 275 ? -48.227 5.559   -10.080 1.00 111.47 ? 275 TRP D CZ3   1 
ATOM 6674 C CH2   . TRP F 5 275 ? -46.859 5.846   -10.066 1.00 108.85 ? 275 TRP D CH2   1 
ATOM 6675 N N     . PRO F 5 276 ? -52.442 9.157   -14.353 1.00 96.87  ? 276 PRO D N     1 
ATOM 6676 C CA    . PRO F 5 276 ? -53.713 8.892   -15.028 1.00 98.19  ? 276 PRO D CA    1 
ATOM 6677 C C     . PRO F 5 276 ? -54.722 8.191   -14.120 1.00 95.38  ? 276 PRO D C     1 
ATOM 6678 O O     . PRO F 5 276 ? -54.393 7.815   -12.989 1.00 93.39  ? 276 PRO D O     1 
ATOM 6679 C CB    . PRO F 5 276 ? -53.305 7.968   -16.178 1.00 97.58  ? 276 PRO D CB    1 
ATOM 6680 C CG    . PRO F 5 276 ? -51.988 7.376   -15.754 1.00 96.38  ? 276 PRO D CG    1 
ATOM 6681 C CD    . PRO F 5 276 ? -51.311 8.461   -14.992 1.00 95.29  ? 276 PRO D CD    1 
ATOM 6682 N N     . GLN F 5 277 ? -55.935 8.012   -14.644 1.00 97.43  ? 277 GLN D N     1 
ATOM 6683 C CA    . GLN F 5 277 ? -57.050 7.408   -13.911 1.00 97.65  ? 277 GLN D CA    1 
ATOM 6684 C C     . GLN F 5 277 ? -58.090 6.760   -14.852 1.00 104.18 ? 277 GLN D C     1 
ATOM 6685 O O     . GLN F 5 277 ? -58.287 7.216   -15.990 1.00 105.41 ? 277 GLN D O     1 
ATOM 6686 C CB    . GLN F 5 277 ? -57.705 8.468   -13.004 1.00 92.42  ? 277 GLN D CB    1 
ATOM 6687 C CG    . GLN F 5 277 ? -58.771 7.926   -12.054 1.00 87.72  ? 277 GLN D CG    1 
ATOM 6688 C CD    . GLN F 5 277 ? -59.263 8.967   -11.067 1.00 81.28  ? 277 GLN D CD    1 
ATOM 6689 O OE1   . GLN F 5 277 ? -58.480 9.754   -10.540 1.00 73.57  ? 277 GLN D OE1   1 
ATOM 6690 N NE2   . GLN F 5 277 ? -60.569 8.971   -10.809 1.00 82.72  ? 277 GLN D NE2   1 
ATOM 6691 N N     . PHE F 5 278 ? -58.747 5.702   -14.372 1.00 102.44 ? 278 PHE D N     1 
ATOM 6692 C CA    . PHE F 5 278 ? -59.823 5.064   -15.120 1.00 104.35 ? 278 PHE D CA    1 
ATOM 6693 C C     . PHE F 5 278 ? -61.120 5.840   -14.878 1.00 109.49 ? 278 PHE D C     1 
ATOM 6694 O O     . PHE F 5 278 ? -61.327 6.389   -13.794 1.00 109.76 ? 278 PHE D O     1 
ATOM 6695 C CB    . PHE F 5 278 ? -59.984 3.602   -14.692 1.00 101.45 ? 278 PHE D CB    1 
ATOM 6696 C CG    . PHE F 5 278 ? -58.951 2.647   -15.296 1.00 98.53  ? 278 PHE D CG    1 
ATOM 6697 C CD1   . PHE F 5 278 ? -58.534 2.775   -16.624 1.00 99.00  ? 278 PHE D CD1   1 
ATOM 6698 C CD2   . PHE F 5 278 ? -58.414 1.603   -14.524 1.00 92.14  ? 278 PHE D CD2   1 
ATOM 6699 C CE1   . PHE F 5 278 ? -57.589 1.885   -17.164 1.00 97.63  ? 278 PHE D CE1   1 
ATOM 6700 C CE2   . PHE F 5 278 ? -57.477 0.722   -15.046 1.00 90.65  ? 278 PHE D CE2   1 
ATOM 6701 C CZ    . PHE F 5 278 ? -57.062 0.856   -16.363 1.00 94.61  ? 278 PHE D CZ    1 
ATOM 6702 N N     . PRO F 5 279 ? -61.985 5.893   -15.902 1.00 118.75 ? 279 PRO D N     1 
ATOM 6703 C CA    . PRO F 5 279 ? -63.306 6.540   -15.911 1.00 125.61 ? 279 PRO D CA    1 
ATOM 6704 C C     . PRO F 5 279 ? -64.238 5.936   -14.880 1.00 131.70 ? 279 PRO D C     1 
ATOM 6705 O O     . PRO F 5 279 ? -64.059 4.772   -14.534 1.00 131.19 ? 279 PRO D O     1 
ATOM 6706 C CB    . PRO F 5 279 ? -63.861 6.187   -17.299 1.00 126.01 ? 279 PRO D CB    1 
ATOM 6707 C CG    . PRO F 5 279 ? -62.681 5.817   -18.121 1.00 124.29 ? 279 PRO D CG    1 
ATOM 6708 C CD    . PRO F 5 279 ? -61.704 5.194   -17.168 1.00 120.78 ? 279 PRO D CD    1 
ATOM 6709 N N     . ASP F 5 280 ? -65.233 6.688   -14.422 1.00 137.99 ? 280 ASP D N     1 
ATOM 6710 C CA    . ASP F 5 280 ? -66.257 6.090   -13.574 1.00 145.07 ? 280 ASP D CA    1 
ATOM 6711 C C     . ASP F 5 280 ? -67.532 5.859   -14.364 1.00 156.99 ? 280 ASP D C     1 
ATOM 6712 O O     . ASP F 5 280 ? -67.966 6.715   -15.131 1.00 158.13 ? 280 ASP D O     1 
ATOM 6713 C CB    . ASP F 5 280 ? -66.557 6.940   -12.342 1.00 140.74 ? 280 ASP D CB    1 
ATOM 6714 C CG    . ASP F 5 280 ? -67.444 6.219   -11.351 1.00 141.24 ? 280 ASP D CG    1 
ATOM 6715 O OD1   . ASP F 5 280 ? -68.620 6.614   -11.199 1.00 142.72 ? 280 ASP D OD1   1 
ATOM 6716 O OD2   . ASP F 5 280 ? -66.970 5.235   -10.749 1.00 140.61 ? 280 ASP D OD2   1 
ATOM 6717 N N     . PHE F 5 281 ? -68.126 4.690   -14.167 1.00 168.08 ? 281 PHE D N     1 
ATOM 6718 C CA    . PHE F 5 281 ? -69.299 4.291   -14.923 1.00 177.77 ? 281 PHE D CA    1 
ATOM 6719 C C     . PHE F 5 281 ? -70.423 3.806   -14.009 1.00 182.98 ? 281 PHE D C     1 
ATOM 6720 O O     . PHE F 5 281 ? -70.256 2.858   -13.239 1.00 180.03 ? 281 PHE D O     1 
ATOM 6721 C CB    . PHE F 5 281 ? -68.922 3.215   -15.945 1.00 181.27 ? 281 PHE D CB    1 
ATOM 6722 C CG    . PHE F 5 281 ? -67.979 3.699   -17.018 1.00 179.95 ? 281 PHE D CG    1 
ATOM 6723 C CD1   . PHE F 5 281 ? -67.912 5.040   -17.348 1.00 177.70 ? 281 PHE D CD1   1 
ATOM 6724 C CD2   . PHE F 5 281 ? -67.162 2.811   -17.697 1.00 179.93 ? 281 PHE D CD2   1 
ATOM 6725 C CE1   . PHE F 5 281 ? -67.052 5.487   -18.330 1.00 176.14 ? 281 PHE D CE1   1 
ATOM 6726 C CE2   . PHE F 5 281 ? -66.298 3.257   -18.684 1.00 177.95 ? 281 PHE D CE2   1 
ATOM 6727 C CZ    . PHE F 5 281 ? -66.246 4.596   -18.999 1.00 176.04 ? 281 PHE D CZ    1 
ATOM 6728 N N     . SER F 5 282 ? -71.564 4.482   -14.100 1.00 190.06 ? 282 SER D N     1 
ATOM 6729 C CA    . SER F 5 282 ? -72.754 4.119   -13.346 1.00 194.79 ? 282 SER D CA    1 
ATOM 6730 C C     . SER F 5 282 ? -73.886 3.782   -14.305 1.00 195.86 ? 282 SER D C     1 
ATOM 6731 O O     . SER F 5 282 ? -73.903 4.256   -15.442 1.00 195.69 ? 282 SER D O     1 
ATOM 6732 C CB    . SER F 5 282 ? -73.176 5.270   -12.436 1.00 197.89 ? 282 SER D CB    1 
ATOM 6733 O OG    . SER F 5 282 ? -74.483 5.063   -11.933 1.00 200.60 ? 282 SER D OG    1 
ATOM 6734 N N     . GLU F 5 293 ? -67.280 -9.261  -20.054 1.00 164.92 ? 293 GLU D N     1 
ATOM 6735 C CA    . GLU F 5 293 ? -68.393 -8.780  -20.856 1.00 166.91 ? 293 GLU D CA    1 
ATOM 6736 C C     . GLU F 5 293 ? -67.979 -7.564  -21.677 1.00 160.67 ? 293 GLU D C     1 
ATOM 6737 O O     . GLU F 5 293 ? -68.542 -6.466  -21.567 1.00 156.96 ? 293 GLU D O     1 
ATOM 6738 C CB    . GLU F 5 293 ? -69.622 -8.522  -19.990 1.00 176.18 ? 293 GLU D CB    1 
ATOM 6739 C CG    . GLU F 5 293 ? -69.324 -7.851  -18.653 1.00 179.71 ? 293 GLU D CG    1 
ATOM 6740 C CD    . GLU F 5 293 ? -68.590 -8.751  -17.660 1.00 179.85 ? 293 GLU D CD    1 
ATOM 6741 O OE1   . GLU F 5 293 ? -67.949 -9.733  -18.087 1.00 180.59 ? 293 GLU D OE1   1 
ATOM 6742 O OE2   . GLU F 5 293 ? -68.650 -8.466  -16.446 1.00 179.34 ? 293 GLU D OE2   1 
ATOM 6743 N N     . SER F 5 294 ? -66.974 -7.830  -22.511 1.00 158.22 ? 294 SER D N     1 
ATOM 6744 C CA    . SER F 5 294 ? -66.279 -6.872  -23.380 1.00 155.98 ? 294 SER D CA    1 
ATOM 6745 C C     . SER F 5 294 ? -66.822 -6.814  -24.812 1.00 156.04 ? 294 SER D C     1 
ATOM 6746 O O     . SER F 5 294 ? -67.875 -7.363  -25.100 1.00 159.51 ? 294 SER D O     1 
ATOM 6747 C CB    . SER F 5 294 ? -64.800 -7.250  -23.457 1.00 154.16 ? 294 SER D CB    1 
ATOM 6748 O OG    . SER F 5 294 ? -64.435 -7.613  -24.785 1.00 154.43 ? 294 SER D OG    1 
ATOM 6749 N N     . ASP F 5 295 ? -66.090 -6.130  -25.692 1.00 152.93 ? 295 ASP D N     1 
ATOM 6750 C CA    . ASP F 5 295 ? -66.235 -6.226  -27.149 1.00 154.33 ? 295 ASP D CA    1 
ATOM 6751 C C     . ASP F 5 295 ? -64.890 -5.907  -27.794 1.00 151.94 ? 295 ASP D C     1 
ATOM 6752 O O     . ASP F 5 295 ? -63.872 -5.818  -27.106 1.00 154.84 ? 295 ASP D O     1 
ATOM 6753 C CB    . ASP F 5 295 ? -67.334 -5.307  -27.701 1.00 158.46 ? 295 ASP D CB    1 
ATOM 6754 C CG    . ASP F 5 295 ? -67.221 -3.884  -27.199 1.00 162.58 ? 295 ASP D CG    1 
ATOM 6755 O OD1   . ASP F 5 295 ? -67.432 -2.949  -28.002 1.00 160.46 ? 295 ASP D OD1   1 
ATOM 6756 O OD2   . ASP F 5 295 ? -66.926 -3.707  -26.000 1.00 170.58 ? 295 ASP D OD2   1 
ATOM 6757 N N     . SER F 5 296 ? -64.889 -5.733  -29.111 1.00 148.46 ? 296 SER D N     1 
ATOM 6758 C CA    . SER F 5 296 ? -63.650 -5.480  -29.840 1.00 143.95 ? 296 SER D CA    1 
ATOM 6759 C C     . SER F 5 296 ? -62.823 -4.336  -29.252 1.00 140.88 ? 296 SER D C     1 
ATOM 6760 O O     . SER F 5 296 ? -61.644 -4.514  -28.943 1.00 140.62 ? 296 SER D O     1 
ATOM 6761 C CB    . SER F 5 296 ? -63.947 -5.202  -31.311 1.00 142.08 ? 296 SER D CB    1 
ATOM 6762 O OG    . SER F 5 296 ? -65.269 -4.708  -31.477 1.00 141.24 ? 296 SER D OG    1 
ATOM 6763 N N     . GLU F 5 297 ? -63.432 -3.163  -29.105 1.00 138.75 ? 297 GLU D N     1 
ATOM 6764 C CA    . GLU F 5 297 ? -62.675 -1.988  -28.683 1.00 135.49 ? 297 GLU D CA    1 
ATOM 6765 C C     . GLU F 5 297 ? -62.749 -1.595  -27.202 1.00 128.09 ? 297 GLU D C     1 
ATOM 6766 O O     . GLU F 5 297 ? -62.032 -0.696  -26.780 1.00 129.66 ? 297 GLU D O     1 
ATOM 6767 C CB    . GLU F 5 297 ? -63.022 -0.790  -29.576 1.00 138.30 ? 297 GLU D CB    1 
ATOM 6768 C CG    . GLU F 5 297 ? -62.568 -0.946  -31.019 1.00 142.77 ? 297 GLU D CG    1 
ATOM 6769 C CD    . GLU F 5 297 ? -63.427 -0.164  -31.992 1.00 151.81 ? 297 GLU D CD    1 
ATOM 6770 O OE1   . GLU F 5 297 ? -64.223 0.682   -31.537 1.00 150.56 ? 297 GLU D OE1   1 
ATOM 6771 O OE2   . GLU F 5 297 ? -63.313 -0.401  -33.212 1.00 164.30 ? 297 GLU D OE2   1 
ATOM 6772 N N     . ASN F 5 298 ? -63.583 -2.258  -26.408 1.00 121.82 ? 298 ASN D N     1 
ATOM 6773 C CA    . ASN F 5 298 ? -63.687 -1.911  -24.989 1.00 116.66 ? 298 ASN D CA    1 
ATOM 6774 C C     . ASN F 5 298 ? -63.880 -3.146  -24.143 1.00 115.70 ? 298 ASN D C     1 
ATOM 6775 O O     . ASN F 5 298 ? -64.329 -4.164  -24.650 1.00 121.70 ? 298 ASN D O     1 
ATOM 6776 C CB    . ASN F 5 298 ? -64.839 -0.942  -24.731 1.00 115.45 ? 298 ASN D CB    1 
ATOM 6777 C CG    . ASN F 5 298 ? -65.420 -0.378  -26.004 1.00 114.02 ? 298 ASN D CG    1 
ATOM 6778 O OD1   . ASN F 5 298 ? -64.920 0.608   -26.546 1.00 111.31 ? 298 ASN D OD1   1 
ATOM 6779 N ND2   . ASN F 5 298 ? -66.485 -1.001  -26.490 1.00 114.38 ? 298 ASN D ND2   1 
ATOM 6780 N N     . THR F 5 299 ? -63.566 -3.067  -22.854 1.00 114.19 ? 299 THR D N     1 
ATOM 6781 C CA    . THR F 5 299 ? -63.604 -4.281  -22.040 1.00 118.81 ? 299 THR D CA    1 
ATOM 6782 C C     . THR F 5 299 ? -64.754 -4.361  -21.026 1.00 123.66 ? 299 THR D C     1 
ATOM 6783 O O     . THR F 5 299 ? -65.700 -5.117  -21.238 1.00 132.54 ? 299 THR D O     1 
ATOM 6784 C CB    . THR F 5 299 ? -62.242 -4.598  -21.387 1.00 115.70 ? 299 THR D CB    1 
ATOM 6785 O OG1   . THR F 5 299 ? -61.191 -4.350  -22.331 1.00 116.15 ? 299 THR D OG1   1 
ATOM 6786 C CG2   . THR F 5 299 ? -62.195 -6.058  -20.970 1.00 114.94 ? 299 THR D CG2   1 
ATOM 6787 N N     . ILE F 5 300 ? -64.696 -3.614  -19.928 1.00 117.72 ? 300 ILE D N     1 
ATOM 6788 C CA    . ILE F 5 300 ? -65.825 -3.663  -18.997 1.00 115.88 ? 300 ILE D CA    1 
ATOM 6789 C C     . ILE F 5 300 ? -66.794 -2.529  -19.327 1.00 119.36 ? 300 ILE D C     1 
ATOM 6790 O O     . ILE F 5 300 ? -67.879 -2.769  -19.852 1.00 129.71 ? 300 ILE D O     1 
ATOM 6791 C CB    . ILE F 5 300 ? -65.396 -3.734  -17.488 1.00 217.63 ? 300 ILE D CB    1 
ATOM 6792 C CG1   . ILE F 5 300 ? -66.525 -4.310  -16.626 1.00 212.06 ? 300 ILE D CG1   1 
ATOM 6793 C CG2   . ILE F 5 300 ? -64.913 -2.391  -16.955 1.00 219.92 ? 300 ILE D CG2   1 
ATOM 6794 C CD1   . ILE F 5 300 ? -66.842 -5.778  -16.913 1.00 202.21 ? 300 ILE D CD1   1 
ATOM 6795 N N     . GLY F 5 301 ? -66.418 -1.300  -19.009 1.00 115.59 ? 301 GLY D N     1 
ATOM 6796 C CA    . GLY F 5 301 ? -67.016 -0.139  -19.645 1.00 115.24 ? 301 GLY D CA    1 
ATOM 6797 C C     . GLY F 5 301 ? -66.026 0.591   -20.543 1.00 115.09 ? 301 GLY D C     1 
ATOM 6798 O O     . GLY F 5 301 ? -66.378 1.551   -21.229 1.00 113.22 ? 301 GLY D O     1 
ATOM 6799 N N     . ILE F 5 302 ? -64.789 0.100   -20.550 1.00 115.46 ? 302 ILE D N     1 
ATOM 6800 C CA    . ILE F 5 302 ? -63.607 0.911   -20.859 1.00 115.17 ? 302 ILE D CA    1 
ATOM 6801 C C     . ILE F 5 302 ? -62.917 0.668   -22.204 1.00 120.44 ? 302 ILE D C     1 
ATOM 6802 O O     . ILE F 5 302 ? -62.596 -0.474  -22.538 1.00 122.80 ? 302 ILE D O     1 
ATOM 6803 C CB    . ILE F 5 302 ? -62.550 0.743   -19.749 1.00 108.70 ? 302 ILE D CB    1 
ATOM 6804 C CG1   . ILE F 5 302 ? -63.186 0.957   -18.373 1.00 103.95 ? 302 ILE D CG1   1 
ATOM 6805 C CG2   . ILE F 5 302 ? -61.388 1.693   -19.965 1.00 107.71 ? 302 ILE D CG2   1 
ATOM 6806 C CD1   . ILE F 5 302 ? -62.304 0.536   -17.222 1.00 100.35 ? 302 ILE D CD1   1 
ATOM 6807 N N     . PRO F 5 303 ? -62.674 1.748   -22.972 1.00 120.59 ? 303 PRO D N     1 
ATOM 6808 C CA    . PRO F 5 303 ? -61.862 1.669   -24.193 1.00 120.41 ? 303 PRO D CA    1 
ATOM 6809 C C     . PRO F 5 303 ? -60.522 1.005   -23.904 1.00 117.50 ? 303 PRO D C     1 
ATOM 6810 O O     . PRO F 5 303 ? -59.918 1.269   -22.867 1.00 114.19 ? 303 PRO D O     1 
ATOM 6811 C CB    . PRO F 5 303 ? -61.639 3.133   -24.562 1.00 120.59 ? 303 PRO D CB    1 
ATOM 6812 C CG    . PRO F 5 303 ? -62.783 3.851   -23.956 1.00 122.05 ? 303 PRO D CG    1 
ATOM 6813 C CD    . PRO F 5 303 ? -63.078 3.132   -22.672 1.00 121.59 ? 303 PRO D CD    1 
ATOM 6814 N N     . ASP F 5 304 ? -60.063 0.159   -24.821 1.00 117.97 ? 304 ASP D N     1 
ATOM 6815 C CA    . ASP F 5 304 ? -58.908 -0.696  -24.570 1.00 114.53 ? 304 ASP D CA    1 
ATOM 6816 C C     . ASP F 5 304 ? -57.602 0.077   -24.400 1.00 111.59 ? 304 ASP D C     1 
ATOM 6817 O O     . ASP F 5 304 ? -56.734 -0.338  -23.638 1.00 108.69 ? 304 ASP D O     1 
ATOM 6818 C CB    . ASP F 5 304 ? -58.776 -1.771  -25.662 1.00 115.54 ? 304 ASP D CB    1 
ATOM 6819 C CG    . ASP F 5 304 ? -58.497 -1.184  -27.041 1.00 114.97 ? 304 ASP D CG    1 
ATOM 6820 O OD1   . ASP F 5 304 ? -57.599 -0.320  -27.165 1.00 112.06 ? 304 ASP D OD1   1 
ATOM 6821 O OD2   . ASP F 5 304 ? -59.178 -1.593  -28.006 1.00 117.14 ? 304 ASP D OD2   1 
ATOM 6822 N N     . PHE F 5 305 ? -57.462 1.197   -25.101 1.00 112.04 ? 305 PHE D N     1 
ATOM 6823 C CA    . PHE F 5 305 ? -56.228 1.970   -25.005 1.00 111.31 ? 305 PHE D CA    1 
ATOM 6824 C C     . PHE F 5 305 ? -55.994 2.442   -23.573 1.00 108.31 ? 305 PHE D C     1 
ATOM 6825 O O     . PHE F 5 305 ? -54.851 2.547   -23.115 1.00 106.62 ? 305 PHE D O     1 
ATOM 6826 C CB    . PHE F 5 305 ? -56.196 3.134   -26.007 1.00 113.89 ? 305 PHE D CB    1 
ATOM 6827 C CG    . PHE F 5 305 ? -57.334 4.108   -25.865 1.00 115.63 ? 305 PHE D CG    1 
ATOM 6828 C CD1   . PHE F 5 305 ? -57.157 5.302   -25.182 1.00 114.17 ? 305 PHE D CD1   1 
ATOM 6829 C CD2   . PHE F 5 305 ? -58.570 3.843   -26.439 1.00 118.16 ? 305 PHE D CD2   1 
ATOM 6830 C CE1   . PHE F 5 305 ? -58.193 6.207   -25.057 1.00 114.02 ? 305 PHE D CE1   1 
ATOM 6831 C CE2   . PHE F 5 305 ? -59.610 4.744   -26.323 1.00 117.87 ? 305 PHE D CE2   1 
ATOM 6832 C CZ    . PHE F 5 305 ? -59.423 5.928   -25.627 1.00 116.14 ? 305 PHE D CZ    1 
ATOM 6833 N N     . TYR F 5 306 ? -57.084 2.707   -22.863 1.00 106.31 ? 306 TYR D N     1 
ATOM 6834 C CA    . TYR F 5 306 ? -57.002 2.993   -21.441 1.00 105.84 ? 306 TYR D CA    1 
ATOM 6835 C C     . TYR F 5 306 ? -56.208 1.901   -20.738 1.00 107.00 ? 306 TYR D C     1 
ATOM 6836 O O     . TYR F 5 306 ? -55.270 2.162   -19.972 1.00 105.72 ? 306 TYR D O     1 
ATOM 6837 C CB    . TYR F 5 306 ? -58.406 3.074   -20.844 1.00 108.08 ? 306 TYR D CB    1 
ATOM 6838 C CG    . TYR F 5 306 ? -58.916 4.481   -20.758 1.00 109.74 ? 306 TYR D CG    1 
ATOM 6839 C CD1   . TYR F 5 306 ? -59.064 5.114   -19.531 1.00 110.40 ? 306 TYR D CD1   1 
ATOM 6840 C CD2   . TYR F 5 306 ? -59.214 5.196   -21.906 1.00 111.39 ? 306 TYR D CD2   1 
ATOM 6841 C CE1   . TYR F 5 306 ? -59.513 6.425   -19.452 1.00 109.45 ? 306 TYR D CE1   1 
ATOM 6842 C CE2   . TYR F 5 306 ? -59.662 6.500   -21.839 1.00 110.23 ? 306 TYR D CE2   1 
ATOM 6843 C CZ    . TYR F 5 306 ? -59.811 7.109   -20.612 1.00 108.50 ? 306 TYR D CZ    1 
ATOM 6844 O OH    . TYR F 5 306 ? -60.259 8.403   -20.549 1.00 106.11 ? 306 TYR D OH    1 
ATOM 6845 N N     . ILE F 5 307 ? -56.593 0.666   -21.028 1.00 107.88 ? 307 ILE D N     1 
ATOM 6846 C CA    . ILE F 5 307 ? -56.112 -0.491  -20.297 1.00 102.96 ? 307 ILE D CA    1 
ATOM 6847 C C     . ILE F 5 307 ? -54.686 -0.833  -20.699 1.00 100.47 ? 307 ILE D C     1 
ATOM 6848 O O     . ILE F 5 307 ? -53.847 -1.132  -19.850 1.00 96.39  ? 307 ILE D O     1 
ATOM 6849 C CB    . ILE F 5 307 ? -57.056 -1.679  -20.520 1.00 99.72  ? 307 ILE D CB    1 
ATOM 6850 C CG1   . ILE F 5 307 ? -58.484 -1.287  -20.116 1.00 98.06  ? 307 ILE D CG1   1 
ATOM 6851 C CG2   . ILE F 5 307 ? -56.585 -2.885  -19.741 1.00 99.08  ? 307 ILE D CG2   1 
ATOM 6852 C CD1   . ILE F 5 307 ? -59.526 -2.340  -20.397 1.00 97.92  ? 307 ILE D CD1   1 
ATOM 6853 N N     . GLU F 5 308 ? -54.420 -0.769  -22.000 1.00 104.72 ? 308 GLU D N     1 
ATOM 6854 C CA    . GLU F 5 308 ? -53.095 -1.048  -22.537 1.00 110.15 ? 308 GLU D CA    1 
ATOM 6855 C C     . GLU F 5 308 ? -52.093 -0.028  -22.031 1.00 109.65 ? 308 GLU D C     1 
ATOM 6856 O O     . GLU F 5 308 ? -50.931 -0.346  -21.782 1.00 109.44 ? 308 GLU D O     1 
ATOM 6857 C CB    . GLU F 5 308 ? -53.119 -1.016  -24.068 1.00 115.67 ? 308 GLU D CB    1 
ATOM 6858 C CG    . GLU F 5 308 ? -54.046 -2.042  -24.696 1.00 124.61 ? 308 GLU D CG    1 
ATOM 6859 C CD    . GLU F 5 308 ? -54.033 -2.008  -26.216 1.00 133.60 ? 308 GLU D CD    1 
ATOM 6860 O OE1   . GLU F 5 308 ? -55.128 -1.997  -26.816 1.00 141.42 ? 308 GLU D OE1   1 
ATOM 6861 O OE2   . GLU F 5 308 ? -52.934 -2.004  -26.811 1.00 134.97 ? 308 GLU D OE2   1 
ATOM 6862 N N     . LYS F 5 309 ? -52.549 1.209   -21.895 1.00 110.25 ? 309 LYS D N     1 
ATOM 6863 C CA    . LYS F 5 309 ? -51.651 2.279   -21.504 1.00 106.50 ? 309 LYS D CA    1 
ATOM 6864 C C     . LYS F 5 309 ? -51.377 2.241   -20.018 1.00 105.39 ? 309 LYS D C     1 
ATOM 6865 O O     . LYS F 5 309 ? -50.232 2.394   -19.591 1.00 106.03 ? 309 LYS D O     1 
ATOM 6866 C CB    . LYS F 5 309 ? -52.220 3.636   -21.893 1.00 106.38 ? 309 LYS D CB    1 
ATOM 6867 C CG    . LYS F 5 309 ? -51.492 4.798   -21.255 1.00 103.66 ? 309 LYS D CG    1 
ATOM 6868 C CD    . LYS F 5 309 ? -50.134 5.042   -21.872 1.00 101.74 ? 309 LYS D CD    1 
ATOM 6869 C CE    . LYS F 5 309 ? -49.520 6.297   -21.273 1.00 99.53  ? 309 LYS D CE    1 
ATOM 6870 N NZ    . LYS F 5 309 ? -48.233 6.702   -21.904 1.00 97.15  ? 309 LYS D NZ    1 
ATOM 6871 N N     . MET F 5 310 ? -52.431 2.041   -19.231 1.00 102.77 ? 310 MET D N     1 
ATOM 6872 C CA    . MET F 5 310 ? -52.275 2.042   -17.782 1.00 99.29  ? 310 MET D CA    1 
ATOM 6873 C C     . MET F 5 310 ? -51.662 0.733   -17.249 1.00 104.59 ? 310 MET D C     1 
ATOM 6874 O O     . MET F 5 310 ? -51.011 0.736   -16.198 1.00 107.07 ? 310 MET D O     1 
ATOM 6875 C CB    . MET F 5 310 ? -53.588 2.393   -17.073 1.00 93.80  ? 310 MET D CB    1 
ATOM 6876 C CG    . MET F 5 310 ? -53.382 2.806   -15.628 1.00 91.50  ? 310 MET D CG    1 
ATOM 6877 S SD    . MET F 5 310 ? -54.844 3.494   -14.836 1.00 139.35 ? 310 MET D SD    1 
ATOM 6878 C CE    . MET F 5 310 ? -55.534 4.475   -16.154 1.00 72.69  ? 310 MET D CE    1 
ATOM 6879 N N     . ASN F 5 311 ? -51.853 -0.370  -17.975 1.00 100.91 ? 311 ASN D N     1 
ATOM 6880 C CA    . ASN F 5 311 ? -51.194 -1.634  -17.646 1.00 94.31  ? 311 ASN D CA    1 
ATOM 6881 C C     . ASN F 5 311 ? -49.877 -1.773  -18.403 1.00 89.62  ? 311 ASN D C     1 
ATOM 6882 O O     . ASN F 5 311 ? -49.134 -2.730  -18.209 1.00 87.41  ? 311 ASN D O     1 
ATOM 6883 C CB    . ASN F 5 311 ? -52.107 -2.816  -17.965 1.00 94.52  ? 311 ASN D CB    1 
ATOM 6884 C CG    . ASN F 5 311 ? -53.272 -2.931  -17.005 1.00 93.74  ? 311 ASN D CG    1 
ATOM 6885 O OD1   . ASN F 5 311 ? -53.226 -3.700  -16.046 1.00 94.06  ? 311 ASN D OD1   1 
ATOM 6886 N ND2   . ASN F 5 311 ? -54.326 -2.167  -17.258 1.00 93.30  ? 311 ASN D ND2   1 
ATOM 6887 N N     . ARG F 5 312 ? -49.616 -0.804  -19.279 1.00 90.77  ? 312 ARG D N     1 
ATOM 6888 C CA    . ARG F 5 312 ? -48.383 -0.722  -20.066 1.00 93.46  ? 312 ARG D CA    1 
ATOM 6889 C C     . ARG F 5 312 ? -47.956 -2.064  -20.644 1.00 95.30  ? 312 ARG D C     1 
ATOM 6890 O O     . ARG F 5 312 ? -46.803 -2.461  -20.518 1.00 93.17  ? 312 ARG D O     1 
ATOM 6891 C CB    . ARG F 5 312 ? -47.242 -0.078  -19.272 1.00 94.98  ? 312 ARG D CB    1 
ATOM 6892 C CG    . ARG F 5 312 ? -47.214 -0.502  -17.827 1.00 97.28  ? 312 ARG D CG    1 
ATOM 6893 C CD    . ARG F 5 312 ? -46.096 0.121   -17.011 1.00 101.32 ? 312 ARG D CD    1 
ATOM 6894 N NE    . ARG F 5 312 ? -46.453 0.330   -15.603 1.00 103.78 ? 312 ARG D NE    1 
ATOM 6895 C CZ    . ARG F 5 312 ? -47.632 0.030   -15.057 1.00 106.19 ? 312 ARG D CZ    1 
ATOM 6896 N NH1   . ARG F 5 312 ? -48.604 -0.522  -15.769 1.00 111.35 ? 312 ARG D NH1   1 
ATOM 6897 N NH2   . ARG F 5 312 ? -47.852 0.263   -13.777 1.00 103.72 ? 312 ARG D NH2   1 
ATOM 6898 N N     . THR F 5 313 ? -48.902 -2.764  -21.256 1.00 99.31  ? 313 THR D N     1 
ATOM 6899 C CA    . THR F 5 313 ? -48.597 -3.954  -22.026 1.00 103.79 ? 313 THR D CA    1 
ATOM 6900 C C     . THR F 5 313 ? -49.661 -4.106  -23.098 1.00 103.65 ? 313 THR D C     1 
ATOM 6901 O O     . THR F 5 313 ? -50.829 -3.802  -22.869 1.00 103.38 ? 313 THR D O     1 
ATOM 6902 C CB    . THR F 5 313 ? -48.591 -5.208  -21.137 1.00 113.19 ? 313 THR D CB    1 
ATOM 6903 O OG1   . THR F 5 313 ? -48.217 -6.355  -21.913 1.00 120.15 ? 313 THR D OG1   1 
ATOM 6904 C CG2   . THR F 5 313 ? -49.964 -5.426  -20.525 1.00 114.32 ? 313 THR D CG2   1 
ATOM 6905 N N     . LYS F 5 314 ? -49.269 -4.609  -24.258 1.00 104.89 ? 314 LYS D N     1 
ATOM 6906 C CA    . LYS F 5 314 ? -50.228 -4.855  -25.317 1.00 112.46 ? 314 LYS D CA    1 
ATOM 6907 C C     . LYS F 5 314 ? -51.244 -5.863  -24.792 1.00 113.87 ? 314 LYS D C     1 
ATOM 6908 O O     . LYS F 5 314 ? -50.955 -6.595  -23.847 1.00 114.02 ? 314 LYS D O     1 
ATOM 6909 C CB    . LYS F 5 314 ? -49.516 -5.400  -26.552 1.00 121.99 ? 314 LYS D CB    1 
ATOM 6910 C CG    . LYS F 5 314 ? -48.370 -4.523  -27.020 1.00 127.78 ? 314 LYS D CG    1 
ATOM 6911 C CD    . LYS F 5 314 ? -48.853 -3.118  -27.334 1.00 132.78 ? 314 LYS D CD    1 
ATOM 6912 C CE    . LYS F 5 314 ? -49.719 -3.099  -28.581 1.00 138.26 ? 314 LYS D CE    1 
ATOM 6913 N NZ    . LYS F 5 314 ? -50.140 -1.716  -28.927 1.00 141.62 ? 314 LYS D NZ    1 
ATOM 6914 N N     . LEU F 5 315 ? -52.450 -5.863  -25.356 1.00 113.35 ? 315 LEU D N     1 
ATOM 6915 C CA    . LEU F 5 315 ? -53.451 -6.880  -25.010 1.00 110.62 ? 315 LEU D CA    1 
ATOM 6916 C C     . LEU F 5 315 ? -53.283 -8.190  -25.822 1.00 152.30 ? 315 LEU D C     1 
ATOM 6917 O O     . LEU F 5 315 ? -53.062 -8.163  -27.030 1.00 154.86 ? 315 LEU D O     1 
ATOM 6918 C CB    . LEU F 5 315 ? -54.877 -6.332  -25.176 1.00 105.68 ? 315 LEU D CB    1 
ATOM 6919 C CG    . LEU F 5 315 ? -55.488 -5.472  -24.072 1.00 99.15  ? 315 LEU D CG    1 
ATOM 6920 C CD1   . LEU F 5 315 ? -56.979 -5.289  -24.308 1.00 98.36  ? 315 LEU D CD1   1 
ATOM 6921 C CD2   . LEU F 5 315 ? -55.259 -6.101  -22.718 1.00 97.07  ? 315 LEU D CD2   1 
ATOM 6922 N N     . GLN F 5 316 ? -53.435 -9.329  -25.141 1.00 148.66 ? 316 GLN D N     1 
ATOM 6923 C CA    . GLN F 5 316 ? -53.208 -10.672 -25.701 1.00 142.24 ? 316 GLN D CA    1 
ATOM 6924 C C     . GLN F 5 316 ? -54.263 -11.695 -25.259 1.00 141.96 ? 316 GLN D C     1 
ATOM 6925 O O     . GLN F 5 316 ? -55.027 -11.446 -24.335 1.00 140.63 ? 316 GLN D O     1 
ATOM 6926 C CB    . GLN F 5 316 ? -51.818 -11.174 -25.317 1.00 137.81 ? 316 GLN D CB    1 
ATOM 6927 C CG    . GLN F 5 316 ? -51.634 -11.194 -23.808 1.00 137.53 ? 316 GLN D CG    1 
ATOM 6928 C CD    . GLN F 5 316 ? -51.586 -9.799  -23.177 1.00 144.51 ? 316 GLN D CD    1 
ATOM 6929 O OE1   . GLN F 5 316 ? -50.727 -8.982  -23.516 1.00 147.65 ? 316 GLN D OE1   1 
ATOM 6930 N NE2   . GLN F 5 316 ? -52.502 -9.533  -22.243 1.00 144.61 ? 316 GLN D NE2   1 
ATOM 6931 N N     . PRO F 5 317 ? -54.363 -12.821 -25.990 1.00 141.74 ? 317 PRO D N     1 
ATOM 6932 C CA    . PRO F 5 317 ? -55.184 -13.981 -25.592 1.00 142.53 ? 317 PRO D CA    1 
ATOM 6933 C C     . PRO F 5 317 ? -54.555 -14.774 -24.439 1.00 136.69 ? 317 PRO D C     1 
ATOM 6934 O O     . PRO F 5 317 ? -53.330 -14.765 -24.313 1.00 139.15 ? 317 PRO D O     1 
ATOM 6935 C CB    . PRO F 5 317 ? -55.176 -14.867 -26.846 1.00 143.90 ? 317 PRO D CB    1 
ATOM 6936 C CG    . PRO F 5 317 ? -53.919 -14.489 -27.569 1.00 143.66 ? 317 PRO D CG    1 
ATOM 6937 C CD    . PRO F 5 317 ? -53.756 -13.013 -27.322 1.00 143.67 ? 317 PRO D CD    1 
ATOM 6938 N N     . CYS F 5 318 ? -55.360 -15.439 -23.610 1.00 131.05 ? 318 CYS D N     1 
ATOM 6939 C CA    . CYS F 5 318 ? -54.806 -16.231 -22.513 1.00 123.58 ? 318 CYS D CA    1 
ATOM 6940 C C     . CYS F 5 318 ? -54.152 -17.469 -23.085 1.00 124.00 ? 318 CYS D C     1 
ATOM 6941 O O     . CYS F 5 318 ? -54.787 -18.217 -23.819 1.00 124.04 ? 318 CYS D O     1 
ATOM 6942 C CB    . CYS F 5 318 ? -55.885 -16.617 -21.494 1.00 123.53 ? 318 CYS D CB    1 
ATOM 6943 S SG    . CYS F 5 318 ? -55.318 -17.744 -20.168 1.00 107.63 ? 318 CYS D SG    1 
ATOM 6944 N N     . PRO F 5 319 ? -52.870 -17.679 -22.760 1.00 124.35 ? 319 PRO D N     1 
ATOM 6945 C CA    . PRO F 5 319 ? -52.131 -18.867 -23.192 1.00 131.54 ? 319 PRO D CA    1 
ATOM 6946 C C     . PRO F 5 319 ? -52.647 -20.109 -22.471 1.00 137.30 ? 319 PRO D C     1 
ATOM 6947 O O     . PRO F 5 319 ? -52.829 -20.093 -21.248 1.00 139.43 ? 319 PRO D O     1 
ATOM 6948 C CB    . PRO F 5 319 ? -50.700 -18.561 -22.751 1.00 128.22 ? 319 PRO D CB    1 
ATOM 6949 C CG    . PRO F 5 319 ? -50.882 -17.714 -21.546 1.00 125.70 ? 319 PRO D CG    1 
ATOM 6950 C CD    . PRO F 5 319 ? -52.072 -16.844 -21.850 1.00 124.93 ? 319 PRO D CD    1 
ATOM 6951 N N     . GLN F 5 320 ? -52.874 -21.175 -23.231 1.00 136.50 ? 320 GLN D N     1 
ATOM 6952 C CA    . GLN F 5 320 ? -53.461 -22.384 -22.689 1.00 132.36 ? 320 GLN D CA    1 
ATOM 6953 C C     . GLN F 5 320 ? -52.356 -23.268 -22.128 1.00 128.80 ? 320 GLN D C     1 
ATOM 6954 O O     . GLN F 5 320 ? -51.385 -23.595 -22.819 1.00 129.92 ? 320 GLN D O     1 
ATOM 6955 C CB    . GLN F 5 320 ? -54.267 -23.104 -23.773 1.00 136.93 ? 320 GLN D CB    1 
ATOM 6956 C CG    . GLN F 5 320 ? -55.091 -24.287 -23.289 1.00 141.01 ? 320 GLN D CG    1 
ATOM 6957 C CD    . GLN F 5 320 ? -56.085 -24.776 -24.337 1.00 143.62 ? 320 GLN D CD    1 
ATOM 6958 O OE1   . GLN F 5 320 ? -56.164 -24.233 -25.439 1.00 146.86 ? 320 GLN D OE1   1 
ATOM 6959 N NE2   . GLN F 5 320 ? -56.853 -25.801 -23.992 1.00 142.54 ? 320 GLN D NE2   1 
ATOM 6960 N N     . VAL F 5 321 ? -52.498 -23.623 -20.856 1.00 124.30 ? 321 VAL D N     1 
ATOM 6961 C CA    . VAL F 5 321 ? -51.521 -24.469 -20.188 1.00 118.90 ? 321 VAL D CA    1 
ATOM 6962 C C     . VAL F 5 321 ? -52.113 -25.831 -19.869 1.00 121.16 ? 321 VAL D C     1 
ATOM 6963 O O     . VAL F 5 321 ? -53.311 -25.966 -19.619 1.00 121.77 ? 321 VAL D O     1 
ATOM 6964 C CB    . VAL F 5 321 ? -50.983 -23.821 -18.903 1.00 110.76 ? 321 VAL D CB    1 
ATOM 6965 C CG1   . VAL F 5 321 ? -50.077 -22.650 -19.247 1.00 109.19 ? 321 VAL D CG1   1 
ATOM 6966 C CG2   . VAL F 5 321 ? -52.135 -23.390 -17.993 1.00 106.67 ? 321 VAL D CG2   1 
ATOM 6967 N N     . HIS F 5 322 ? -51.261 -26.843 -19.903 1.00 122.94 ? 322 HIS D N     1 
ATOM 6968 C CA    . HIS F 5 322 ? -51.695 -28.203 -19.644 1.00 128.29 ? 322 HIS D CA    1 
ATOM 6969 C C     . HIS F 5 322 ? -51.425 -28.624 -18.213 1.00 125.86 ? 322 HIS D C     1 
ATOM 6970 O O     . HIS F 5 322 ? -51.676 -29.766 -17.830 1.00 130.55 ? 322 HIS D O     1 
ATOM 6971 C CB    . HIS F 5 322 ? -51.063 -29.156 -20.659 1.00 136.80 ? 322 HIS D CB    1 
ATOM 6972 C CG    . HIS F 5 322 ? -51.583 -28.957 -22.050 1.00 144.78 ? 322 HIS D CG    1 
ATOM 6973 N ND1   . HIS F 5 322 ? -51.299 -27.828 -22.791 1.00 147.08 ? 322 HIS D ND1   1 
ATOM 6974 C CD2   . HIS F 5 322 ? -52.402 -29.715 -22.814 1.00 148.57 ? 322 HIS D CD2   1 
ATOM 6975 C CE1   . HIS F 5 322 ? -51.905 -27.911 -23.962 1.00 149.41 ? 322 HIS D CE1   1 
ATOM 6976 N NE2   . HIS F 5 322 ? -52.580 -29.045 -24.002 1.00 150.84 ? 322 HIS D NE2   1 
ATOM 6977 N N     . VAL F 5 323 ? -50.916 -27.685 -17.425 1.00 119.73 ? 323 VAL D N     1 
ATOM 6978 C CA    . VAL F 5 323 ? -50.590 -27.955 -16.036 1.00 115.31 ? 323 VAL D CA    1 
ATOM 6979 C C     . VAL F 5 323 ? -51.475 -27.162 -15.080 1.00 114.35 ? 323 VAL D C     1 
ATOM 6980 O O     . VAL F 5 323 ? -51.651 -25.964 -15.248 1.00 115.76 ? 323 VAL D O     1 
ATOM 6981 C CB    . VAL F 5 323 ? -49.118 -27.643 -15.766 1.00 113.42 ? 323 VAL D CB    1 
ATOM 6982 C CG1   . VAL F 5 323 ? -48.852 -27.620 -14.273 1.00 110.70 ? 323 VAL D CG1   1 
ATOM 6983 C CG2   . VAL F 5 323 ? -48.239 -28.670 -16.471 1.00 115.47 ? 323 VAL D CG2   1 
ATOM 6984 N N     . HIS F 5 324 ? -52.059 -27.830 -14.093 1.00 113.26 ? 324 HIS D N     1 
ATOM 6985 C CA    . HIS F 5 324 ? -52.882 -27.116 -13.123 1.00 112.77 ? 324 HIS D CA    1 
ATOM 6986 C C     . HIS F 5 324 ? -52.346 -27.178 -11.690 1.00 108.28 ? 324 HIS D C     1 
ATOM 6987 O O     . HIS F 5 324 ? -52.394 -28.220 -11.030 1.00 108.03 ? 324 HIS D O     1 
ATOM 6988 C CB    . HIS F 5 324 ? -54.334 -27.595 -13.183 1.00 120.62 ? 324 HIS D CB    1 
ATOM 6989 C CG    . HIS F 5 324 ? -54.920 -27.580 -14.564 1.00 128.63 ? 324 HIS D CG    1 
ATOM 6990 N ND1   . HIS F 5 324 ? -54.386 -28.305 -15.608 1.00 133.70 ? 324 HIS D ND1   1 
ATOM 6991 C CD2   . HIS F 5 324 ? -55.999 -26.936 -15.066 1.00 131.64 ? 324 HIS D CD2   1 
ATOM 6992 C CE1   . HIS F 5 324 ? -55.110 -28.108 -16.694 1.00 136.03 ? 324 HIS D CE1   1 
ATOM 6993 N NE2   . HIS F 5 324 ? -56.095 -27.281 -16.394 1.00 135.41 ? 324 HIS D NE2   1 
ATOM 6994 N N     . LEU F 5 325 ? -51.823 -26.042 -11.235 1.00 106.44 ? 325 LEU D N     1 
ATOM 6995 C CA    . LEU F 5 325 ? -51.432 -25.837 -9.843  1.00 105.66 ? 325 LEU D CA    1 
ATOM 6996 C C     . LEU F 5 325 ? -52.609 -25.405 -8.968  1.00 106.15 ? 325 LEU D C     1 
ATOM 6997 O O     . LEU F 5 325 ? -52.620 -25.634 -7.757  1.00 105.79 ? 325 LEU D O     1 
ATOM 6998 C CB    . LEU F 5 325 ? -50.301 -24.818 -9.766  1.00 106.13 ? 325 LEU D CB    1 
ATOM 6999 C CG    . LEU F 5 325 ? -49.168 -25.157 -10.734 1.00 109.65 ? 325 LEU D CG    1 
ATOM 7000 C CD1   . LEU F 5 325 ? -48.043 -24.149 -10.653 1.00 108.64 ? 325 LEU D CD1   1 
ATOM 7001 C CD2   . LEU F 5 325 ? -48.650 -26.549 -10.442 1.00 112.77 ? 325 LEU D CD2   1 
ATOM 7002 N N     . PHE F 5 326 ? -53.563 -24.714 -9.583  1.00 104.70 ? 326 PHE D N     1 
ATOM 7003 C CA    . PHE F 5 326 ? -54.817 -24.364 -8.925  1.00 106.23 ? 326 PHE D CA    1 
ATOM 7004 C C     . PHE F 5 326 ? -55.913 -25.392 -9.205  1.00 114.09 ? 326 PHE D C     1 
ATOM 7005 O O     . PHE F 5 326 ? -55.882 -26.068 -10.233 1.00 117.92 ? 326 PHE D O     1 
ATOM 7006 C CB    . PHE F 5 326 ? -55.256 -22.947 -9.317  1.00 103.06 ? 326 PHE D CB    1 
ATOM 7007 C CG    . PHE F 5 326 ? -54.417 -21.860 -8.691  1.00 97.90  ? 326 PHE D CG    1 
ATOM 7008 C CD1   . PHE F 5 326 ? -54.491 -21.610 -7.326  1.00 93.92  ? 326 PHE D CD1   1 
ATOM 7009 C CD2   . PHE F 5 326 ? -53.554 -21.092 -9.464  1.00 92.12  ? 326 PHE D CD2   1 
ATOM 7010 C CE1   . PHE F 5 326 ? -53.720 -20.621 -6.748  1.00 88.90  ? 326 PHE D CE1   1 
ATOM 7011 C CE2   . PHE F 5 326 ? -52.779 -20.102 -8.889  1.00 86.65  ? 326 PHE D CE2   1 
ATOM 7012 C CZ    . PHE F 5 326 ? -52.864 -19.866 -7.530  1.00 86.01  ? 326 PHE D CZ    1 
ATOM 7013 N N     . PRO F 5 327 ? -56.890 -25.504 -8.289  1.00 120.04 ? 327 PRO D N     1 
ATOM 7014 C CA    . PRO F 5 327 ? -57.990 -26.475 -8.363  1.00 123.97 ? 327 PRO D CA    1 
ATOM 7015 C C     . PRO F 5 327 ? -58.844 -26.320 -9.617  1.00 129.81 ? 327 PRO D C     1 
ATOM 7016 O O     . PRO F 5 327 ? -59.143 -25.200 -10.026 1.00 129.70 ? 327 PRO D O     1 
ATOM 7017 C CB    . PRO F 5 327 ? -58.843 -26.133 -7.138  1.00 122.39 ? 327 PRO D CB    1 
ATOM 7018 C CG    . PRO F 5 327 ? -57.939 -25.399 -6.224  1.00 120.71 ? 327 PRO D CG    1 
ATOM 7019 C CD    . PRO F 5 327 ? -57.000 -24.641 -7.102  1.00 120.37 ? 327 PRO D CD    1 
ATOM 7020 N N     . THR F 5 328 ? -59.232 -27.439 -10.218 1.00 137.16 ? 328 THR D N     1 
ATOM 7021 C CA    . THR F 5 328 ? -60.142 -27.416 -11.357 1.00 147.70 ? 328 THR D CA    1 
ATOM 7022 C C     . THR F 5 328 ? -61.582 -27.650 -10.911 1.00 150.17 ? 328 THR D C     1 
ATOM 7023 O O     . THR F 5 328 ? -62.503 -27.672 -11.729 1.00 151.95 ? 328 THR D O     1 
ATOM 7024 C CB    . THR F 5 328 ? -59.742 -28.447 -12.424 1.00 152.74 ? 328 THR D CB    1 
ATOM 7025 O OG1   . THR F 5 328 ? -59.414 -29.694 -11.794 1.00 156.83 ? 328 THR D OG1   1 
ATOM 7026 C CG2   . THR F 5 328 ? -58.538 -27.945 -13.204 1.00 152.90 ? 328 THR D CG2   1 
ATOM 7027 N N     . ASP F 5 329 ? -61.762 -27.826 -9.604  1.00 152.21 ? 329 ASP D N     1 
ATOM 7028 C CA    . ASP F 5 329 ? -63.088 -27.998 -9.024  1.00 155.10 ? 329 ASP D CA    1 
ATOM 7029 C C     . ASP F 5 329 ? -63.434 -26.834 -8.106  1.00 158.51 ? 329 ASP D C     1 
ATOM 7030 O O     . ASP F 5 329 ? -62.874 -26.703 -7.021  1.00 168.42 ? 329 ASP D O     1 
ATOM 7031 C CB    . ASP F 5 329 ? -63.172 -29.318 -8.252  1.00 153.75 ? 329 ASP D CB    1 
ATOM 7032 C CG    . ASP F 5 329 ? -62.375 -29.300 -6.953  1.00 154.54 ? 329 ASP D CG    1 
ATOM 7033 O OD1   . ASP F 5 329 ? -61.316 -28.641 -6.896  1.00 149.57 ? 329 ASP D OD1   1 
ATOM 7034 O OD2   . ASP F 5 329 ? -62.815 -29.952 -5.984  1.00 164.52 ? 329 ASP D OD2   1 
ATOM 7035 N N     . LEU F 5 330 ? -64.367 -25.990 -8.533  1.00 154.08 ? 330 LEU D N     1 
ATOM 7036 C CA    . LEU F 5 330 ? -64.755 -24.826 -7.733  1.00 150.33 ? 330 LEU D CA    1 
ATOM 7037 C C     . LEU F 5 330 ? -66.137 -24.326 -8.122  1.00 156.03 ? 330 LEU D C     1 
ATOM 7038 O O     . LEU F 5 330 ? -66.752 -24.858 -9.051  1.00 159.26 ? 330 LEU D O     1 
ATOM 7039 C CB    . LEU F 5 330 ? -63.734 -23.695 -7.916  1.00 143.58 ? 330 LEU D CB    1 
ATOM 7040 C CG    . LEU F 5 330 ? -62.426 -23.725 -7.122  1.00 137.87 ? 330 LEU D CG    1 
ATOM 7041 C CD1   . LEU F 5 330 ? -61.383 -22.829 -7.765  1.00 135.96 ? 330 LEU D CD1   1 
ATOM 7042 C CD2   . LEU F 5 330 ? -62.655 -23.330 -5.671  1.00 135.92 ? 330 LEU D CD2   1 
ATOM 7043 N N     . PRO F 5 331 ? -66.633 -23.304 -7.410  1.00 158.25 ? 331 PRO D N     1 
ATOM 7044 C CA    . PRO F 5 331 ? -67.835 -22.607 -7.866  1.00 163.06 ? 331 PRO D CA    1 
ATOM 7045 C C     . PRO F 5 331 ? -67.546 -21.932 -9.187  1.00 167.75 ? 331 PRO D C     1 
ATOM 7046 O O     . PRO F 5 331 ? -66.436 -21.388 -9.350  1.00 170.89 ? 331 PRO D O     1 
ATOM 7047 C CB    . PRO F 5 331 ? -68.067 -21.562 -6.779  1.00 162.91 ? 331 PRO D CB    1 
ATOM 7048 C CG    . PRO F 5 331 ? -67.440 -22.131 -5.574  1.00 159.83 ? 331 PRO D CG    1 
ATOM 7049 C CD    . PRO F 5 331 ? -66.238 -22.887 -6.057  1.00 157.39 ? 331 PRO D CD    1 
ATOM 7050 N N     . PRO F 5 332 ? -68.486 -21.976 -10.118 1.00 167.04 ? 332 PRO D N     1 
ATOM 7051 C CA    . PRO F 5 332 ? -68.286 -21.421 -11.445 1.00 166.06 ? 332 PRO D CA    1 
ATOM 7052 C C     . PRO F 5 332 ? -67.837 -19.950 -11.381 1.00 163.24 ? 332 PRO D C     1 
ATOM 7053 O O     . PRO F 5 332 ? -67.047 -19.520 -12.234 1.00 164.43 ? 332 PRO D O     1 
ATOM 7054 C CB    . PRO F 5 332 ? -69.657 -21.524 -12.113 1.00 168.16 ? 332 PRO D CB    1 
ATOM 7055 C CG    . PRO F 5 332 ? -70.559 -22.244 -11.092 1.00 171.33 ? 332 PRO D CG    1 
ATOM 7056 C CD    . PRO F 5 332 ? -69.697 -22.763 -10.020 1.00 167.03 ? 332 PRO D CD    1 
ATOM 7057 N N     . ASP F 5 333 ? -68.282 -19.211 -10.365 1.00 158.62 ? 333 ASP D N     1 
ATOM 7058 C CA    . ASP F 5 333 ? -67.969 -17.808 -10.233 1.00 156.41 ? 333 ASP D CA    1 
ATOM 7059 C C     . ASP F 5 333 ? -66.458 -17.556 -10.253 1.00 152.00 ? 333 ASP D C     1 
ATOM 7060 O O     . ASP F 5 333 ? -65.957 -16.797 -11.090 1.00 154.80 ? 333 ASP D O     1 
ATOM 7061 C CB    . ASP F 5 333 ? -68.578 -17.237 -8.956  1.00 156.49 ? 333 ASP D CB    1 
ATOM 7062 C CG    . ASP F 5 333 ? -69.728 -18.065 -8.424  1.00 157.23 ? 333 ASP D CG    1 
ATOM 7063 O OD1   . ASP F 5 333 ? -70.458 -17.577 -7.533  1.00 157.21 ? 333 ASP D OD1   1 
ATOM 7064 O OD2   . ASP F 5 333 ? -69.914 -19.204 -8.891  1.00 159.47 ? 333 ASP D OD2   1 
ATOM 7065 N N     . ILE F 5 334 ? -65.740 -18.189 -9.329  1.00 144.63 ? 334 ILE D N     1 
ATOM 7066 C CA    . ILE F 5 334 ? -64.309 -17.943 -9.103  1.00 138.21 ? 334 ILE D CA    1 
ATOM 7067 C C     . ILE F 5 334 ? -63.376 -18.721 -10.037 1.00 141.94 ? 334 ILE D C     1 
ATOM 7068 O O     . ILE F 5 334 ? -62.179 -18.389 -10.199 1.00 145.41 ? 334 ILE D O     1 
ATOM 7069 C CB    . ILE F 5 334 ? -63.919 -18.319 -7.655  1.00 127.44 ? 334 ILE D CB    1 
ATOM 7070 C CG1   . ILE F 5 334 ? -65.131 -18.850 -6.881  1.00 122.61 ? 334 ILE D CG1   1 
ATOM 7071 C CG2   . ILE F 5 334 ? -63.254 -17.147 -6.942  1.00 124.98 ? 334 ILE D CG2   1 
ATOM 7072 C CD1   . ILE F 5 334 ? -66.159 -17.808 -6.496  1.00 120.09 ? 334 ILE D CD1   1 
ATOM 7073 N N     . GLN F 5 335 ? -63.927 -19.771 -10.633 1.00 141.33 ? 335 GLN D N     1 
ATOM 7074 C CA    . GLN F 5 335 ? -63.137 -20.693 -11.435 1.00 138.30 ? 335 GLN D CA    1 
ATOM 7075 C C     . GLN F 5 335 ? -62.399 -19.959 -12.547 1.00 139.07 ? 335 GLN D C     1 
ATOM 7076 O O     . GLN F 5 335 ? -61.169 -19.978 -12.599 1.00 144.06 ? 335 GLN D O     1 
ATOM 7077 C CB    . GLN F 5 335 ? -64.025 -21.791 -12.021 1.00 134.46 ? 335 GLN D CB    1 
ATOM 7078 C CG    . GLN F 5 335 ? -63.251 -22.974 -12.552 1.00 129.33 ? 335 GLN D CG    1 
ATOM 7079 C CD    . GLN F 5 335 ? -62.421 -23.630 -11.476 1.00 125.61 ? 335 GLN D CD    1 
ATOM 7080 O OE1   . GLN F 5 335 ? -62.870 -24.567 -10.817 1.00 129.88 ? 335 GLN D OE1   1 
ATOM 7081 N NE2   . GLN F 5 335 ? -61.204 -23.135 -11.280 1.00 119.07 ? 335 GLN D NE2   1 
ATOM 7082 N N     . ALA F 5 336 ? -63.149 -19.277 -13.406 1.00 131.77 ? 336 ALA D N     1 
ATOM 7083 C CA    . ALA F 5 336 ? -62.562 -18.570 -14.536 1.00 123.52 ? 336 ALA D CA    1 
ATOM 7084 C C     . ALA F 5 336 ? -61.353 -17.743 -14.070 1.00 112.85 ? 336 ALA D C     1 
ATOM 7085 O O     . ALA F 5 336 ? -60.251 -17.825 -14.655 1.00 110.61 ? 336 ALA D O     1 
ATOM 7086 C CB    . ALA F 5 336 ? -63.610 -17.687 -15.181 1.00 125.42 ? 336 ALA D CB    1 
ATOM 7087 N N     . VAL F 5 337 ? -61.557 -16.988 -12.988 1.00 104.23 ? 337 VAL D N     1 
ATOM 7088 C CA    . VAL F 5 337 ? -60.491 -16.225 -12.337 1.00 97.33  ? 337 VAL D CA    1 
ATOM 7089 C C     . VAL F 5 337 ? -59.237 -17.067 -12.138 1.00 100.57 ? 337 VAL D C     1 
ATOM 7090 O O     . VAL F 5 337 ? -58.144 -16.744 -12.633 1.00 101.31 ? 337 VAL D O     1 
ATOM 7091 C CB    . VAL F 5 337 ? -60.894 -15.750 -10.929 1.00 87.05  ? 337 VAL D CB    1 
ATOM 7092 C CG1   . VAL F 5 337 ? -59.737 -15.011 -10.301 1.00 77.74  ? 337 VAL D CG1   1 
ATOM 7093 C CG2   . VAL F 5 337 ? -62.119 -14.877 -10.960 1.00 90.24  ? 337 VAL D CG2   1 
ATOM 7094 N N     . PHE F 5 338 ? -59.379 -18.126 -11.354 1.00 103.55 ? 338 PHE D N     1 
ATOM 7095 C CA    . PHE F 5 338 ? -58.212 -18.943 -11.112 1.00 108.09 ? 338 PHE D CA    1 
ATOM 7096 C C     . PHE F 5 338 ? -57.602 -19.413 -12.427 1.00 122.09 ? 338 PHE D C     1 
ATOM 7097 O O     . PHE F 5 338 ? -56.489 -19.049 -12.712 1.00 127.89 ? 338 PHE D O     1 
ATOM 7098 C CB    . PHE F 5 338 ? -58.508 -20.069 -10.124 1.00 100.14 ? 338 PHE D CB    1 
ATOM 7099 C CG    . PHE F 5 338 ? -58.485 -19.625 -8.689  1.00 89.63  ? 338 PHE D CG    1 
ATOM 7100 C CD1   . PHE F 5 338 ? -57.333 -19.781 -7.934  1.00 84.14  ? 338 PHE D CD1   1 
ATOM 7101 C CD2   . PHE F 5 338 ? -59.606 -19.050 -8.090  1.00 83.99  ? 338 PHE D CD2   1 
ATOM 7102 C CE1   . PHE F 5 338 ? -57.291 -19.382 -6.600  1.00 78.62  ? 338 PHE D CE1   1 
ATOM 7103 C CE2   . PHE F 5 338 ? -59.573 -18.646 -6.749  1.00 77.35  ? 338 PHE D CE2   1 
ATOM 7104 C CZ    . PHE F 5 338 ? -58.410 -18.814 -6.007  1.00 74.65  ? 338 PHE D CZ    1 
ATOM 7105 N N     . ASP F 5 339 ? -58.348 -20.122 -13.271 1.00 125.64 ? 339 ASP D N     1 
ATOM 7106 C CA    . ASP F 5 339 ? -57.789 -20.647 -14.526 1.00 126.82 ? 339 ASP D CA    1 
ATOM 7107 C C     . ASP F 5 339 ? -56.907 -19.605 -15.208 1.00 125.14 ? 339 ASP D C     1 
ATOM 7108 O O     . ASP F 5 339 ? -55.871 -19.954 -15.787 1.00 128.82 ? 339 ASP D O     1 
ATOM 7109 C CB    . ASP F 5 339 ? -58.914 -21.067 -15.482 1.00 133.86 ? 339 ASP D CB    1 
ATOM 7110 C CG    . ASP F 5 339 ? -59.898 -22.014 -14.835 1.00 144.31 ? 339 ASP D CG    1 
ATOM 7111 O OD1   . ASP F 5 339 ? -59.781 -23.231 -15.060 1.00 148.65 ? 339 ASP D OD1   1 
ATOM 7112 O OD2   . ASP F 5 339 ? -60.781 -21.550 -14.094 1.00 150.79 ? 339 ASP D OD2   1 
ATOM 7113 N N     . LEU F 5 340 ? -57.323 -18.335 -15.144 1.00 118.07 ? 340 LEU D N     1 
ATOM 7114 C CA    . LEU F 5 340 ? -56.436 -17.241 -15.552 1.00 108.67 ? 340 LEU D CA    1 
ATOM 7115 C C     . LEU F 5 340 ? -55.151 -17.216 -14.707 1.00 102.35 ? 340 LEU D C     1 
ATOM 7116 O O     . LEU F 5 340 ? -54.038 -17.275 -15.246 1.00 103.93 ? 340 LEU D O     1 
ATOM 7117 C CB    . LEU F 5 340 ? -57.140 -15.893 -15.465 1.00 104.22 ? 340 LEU D CB    1 
ATOM 7118 C CG    . LEU F 5 340 ? -56.239 -14.712 -15.842 1.00 102.31 ? 340 LEU D CG    1 
ATOM 7119 C CD1   . LEU F 5 340 ? -55.977 -14.686 -17.343 1.00 102.39 ? 340 LEU D CD1   1 
ATOM 7120 C CD2   . LEU F 5 340 ? -56.823 -13.377 -15.379 1.00 100.63 ? 340 LEU D CD2   1 
ATOM 7121 N N     . LEU F 5 341 ? -55.309 -17.137 -13.385 1.00 97.52  ? 341 LEU D N     1 
ATOM 7122 C CA    . LEU F 5 341 ? -54.164 -17.183 -12.467 1.00 94.68  ? 341 LEU D CA    1 
ATOM 7123 C C     . LEU F 5 341 ? -53.209 -18.336 -12.768 1.00 103.79 ? 341 LEU D C     1 
ATOM 7124 O O     . LEU F 5 341 ? -51.995 -18.158 -12.846 1.00 105.12 ? 341 LEU D O     1 
ATOM 7125 C CB    . LEU F 5 341 ? -54.653 -17.311 -11.030 1.00 85.62  ? 341 LEU D CB    1 
ATOM 7126 C CG    . LEU F 5 341 ? -55.171 -16.024 -10.432 1.00 78.30  ? 341 LEU D CG    1 
ATOM 7127 C CD1   . LEU F 5 341 ? -55.281 -16.181 -8.939  1.00 75.82  ? 341 LEU D CD1   1 
ATOM 7128 C CD2   . LEU F 5 341 ? -54.184 -14.946 -10.781 1.00 76.61  ? 341 LEU D CD2   1 
ATOM 7129 N N     . ASN F 5 342 ? -53.784 -19.524 -12.893 1.00 107.98 ? 342 ASN D N     1 
ATOM 7130 C CA    . ASN F 5 342 ? -53.079 -20.716 -13.289 1.00 108.31 ? 342 ASN D CA    1 
ATOM 7131 C C     . ASN F 5 342 ? -52.322 -20.475 -14.576 1.00 107.18 ? 342 ASN D C     1 
ATOM 7132 O O     . ASN F 5 342 ? -51.155 -20.803 -14.663 1.00 109.99 ? 342 ASN D O     1 
ATOM 7133 C CB    . ASN F 5 342 ? -54.064 -21.871 -13.470 1.00 113.91 ? 342 ASN D CB    1 
ATOM 7134 C CG    . ASN F 5 342 ? -53.370 -23.197 -13.705 1.00 118.91 ? 342 ASN D CG    1 
ATOM 7135 O OD1   . ASN F 5 342 ? -52.438 -23.291 -14.506 1.00 120.97 ? 342 ASN D OD1   1 
ATOM 7136 N ND2   . ASN F 5 342 ? -53.815 -24.234 -12.994 1.00 119.70 ? 342 ASN D ND2   1 
ATOM 7137 N N     . SER F 5 343 ? -52.978 -19.900 -15.578 1.00 102.81 ? 343 SER D N     1 
ATOM 7138 C CA    . SER F 5 343 ? -52.308 -19.693 -16.859 1.00 102.54 ? 343 SER D CA    1 
ATOM 7139 C C     . SER F 5 343 ? -51.075 -18.817 -16.706 1.00 100.11 ? 343 SER D C     1 
ATOM 7140 O O     . SER F 5 343 ? -49.991 -19.157 -17.187 1.00 99.41  ? 343 SER D O     1 
ATOM 7141 C CB    . SER F 5 343 ? -53.263 -19.112 -17.904 1.00 104.79 ? 343 SER D CB    1 
ATOM 7142 O OG    . SER F 5 343 ? -54.098 -20.127 -18.431 1.00 108.59 ? 343 SER D OG    1 
ATOM 7143 N N     . VAL F 5 344 ? -51.235 -17.691 -16.025 1.00 99.28  ? 344 VAL D N     1 
ATOM 7144 C CA    . VAL F 5 344 ? -50.111 -16.788 -15.846 1.00 95.55  ? 344 VAL D CA    1 
ATOM 7145 C C     . VAL F 5 344 ? -49.001 -17.495 -15.068 1.00 93.16  ? 344 VAL D C     1 
ATOM 7146 O O     . VAL F 5 344 ? -47.856 -17.578 -15.526 1.00 93.80  ? 344 VAL D O     1 
ATOM 7147 C CB    . VAL F 5 344 ? -50.540 -15.491 -15.139 1.00 92.50  ? 344 VAL D CB    1 
ATOM 7148 C CG1   . VAL F 5 344 ? -49.382 -14.520 -15.073 1.00 91.26  ? 344 VAL D CG1   1 
ATOM 7149 C CG2   . VAL F 5 344 ? -51.713 -14.865 -15.872 1.00 90.95  ? 344 VAL D CG2   1 
ATOM 7150 N N     . LEU F 5 345 ? -49.366 -18.030 -13.908 1.00 89.96  ? 345 LEU D N     1 
ATOM 7151 C CA    . LEU F 5 345 ? -48.442 -18.725 -13.021 1.00 85.04  ? 345 LEU D CA    1 
ATOM 7152 C C     . LEU F 5 345 ? -47.644 -19.803 -13.750 1.00 88.36  ? 345 LEU D C     1 
ATOM 7153 O O     . LEU F 5 345 ? -46.420 -19.851 -13.673 1.00 87.78  ? 345 LEU D O     1 
ATOM 7154 C CB    . LEU F 5 345 ? -49.221 -19.340 -11.856 1.00 78.20  ? 345 LEU D CB    1 
ATOM 7155 C CG    . LEU F 5 345 ? -48.470 -20.073 -10.748 1.00 69.46  ? 345 LEU D CG    1 
ATOM 7156 C CD1   . LEU F 5 345 ? -47.295 -19.262 -10.229 1.00 66.78  ? 345 LEU D CD1   1 
ATOM 7157 C CD2   . LEU F 5 345 ? -49.439 -20.400 -9.624  1.00 67.36  ? 345 LEU D CD2   1 
ATOM 7158 N N     . VAL F 5 346 ? -48.348 -20.665 -14.467 1.00 89.93  ? 346 VAL D N     1 
ATOM 7159 C CA    . VAL F 5 346 ? -47.721 -21.796 -15.135 1.00 94.41  ? 346 VAL D CA    1 
ATOM 7160 C C     . VAL F 5 346 ? -46.880 -21.293 -16.306 1.00 96.71  ? 346 VAL D C     1 
ATOM 7161 O O     . VAL F 5 346 ? -45.840 -21.864 -16.633 1.00 97.12  ? 346 VAL D O     1 
ATOM 7162 C CB    . VAL F 5 346 ? -48.770 -22.893 -15.551 1.00 111.58 ? 346 VAL D CB    1 
ATOM 7163 C CG1   . VAL F 5 346 ? -48.133 -23.992 -16.401 1.00 111.52 ? 346 VAL D CG1   1 
ATOM 7164 C CG2   . VAL F 5 346 ? -49.412 -23.513 -14.309 1.00 110.89 ? 346 VAL D CG2   1 
ATOM 7165 N N     . THR F 5 347 ? -47.304 -20.195 -16.913 1.00 100.44 ? 347 THR D N     1 
ATOM 7166 C CA    . THR F 5 347 ? -46.550 -19.656 -18.033 1.00 106.97 ? 347 THR D CA    1 
ATOM 7167 C C     . THR F 5 347 ? -45.199 -19.089 -17.599 1.00 112.40 ? 347 THR D C     1 
ATOM 7168 O O     . THR F 5 347 ? -44.182 -19.327 -18.253 1.00 116.67 ? 347 THR D O     1 
ATOM 7169 C CB    . THR F 5 347 ? -47.333 -18.571 -18.787 1.00 104.25 ? 347 THR D CB    1 
ATOM 7170 O OG1   . THR F 5 347 ? -48.629 -19.068 -19.133 1.00 105.31 ? 347 THR D OG1   1 
ATOM 7171 C CG2   . THR F 5 347 ? -46.596 -18.187 -20.055 1.00 102.85 ? 347 THR D CG2   1 
ATOM 7172 N N     . SER F 5 348 ? -45.194 -18.331 -16.507 1.00 112.04 ? 348 SER D N     1 
ATOM 7173 C CA    . SER F 5 348 ? -43.987 -17.627 -16.074 1.00 110.37 ? 348 SER D CA    1 
ATOM 7174 C C     . SER F 5 348 ? -43.169 -18.326 -14.979 1.00 112.20 ? 348 SER D C     1 
ATOM 7175 O O     . SER F 5 348 ? -42.096 -17.851 -14.602 1.00 114.52 ? 348 SER D O     1 
ATOM 7176 C CB    . SER F 5 348 ? -44.367 -16.226 -15.612 1.00 108.81 ? 348 SER D CB    1 
ATOM 7177 O OG    . SER F 5 348 ? -45.214 -15.609 -16.562 1.00 111.45 ? 348 SER D OG    1 
ATOM 7178 N N     . LEU F 5 349 ? -43.668 -19.452 -14.476 1.00 108.20 ? 349 LEU D N     1 
ATOM 7179 C CA    . LEU F 5 349 ? -43.031 -20.122 -13.345 1.00 101.93 ? 349 LEU D CA    1 
ATOM 7180 C C     . LEU F 5 349 ? -41.621 -20.630 -13.649 1.00 95.33  ? 349 LEU D C     1 
ATOM 7181 O O     . LEU F 5 349 ? -40.735 -20.547 -12.793 1.00 88.92  ? 349 LEU D O     1 
ATOM 7182 C CB    . LEU F 5 349 ? -43.914 -21.243 -12.790 1.00 104.90 ? 349 LEU D CB    1 
ATOM 7183 C CG    . LEU F 5 349 ? -43.700 -21.439 -11.286 1.00 107.25 ? 349 LEU D CG    1 
ATOM 7184 C CD1   . LEU F 5 349 ? -43.824 -20.092 -10.581 1.00 109.74 ? 349 LEU D CD1   1 
ATOM 7185 C CD2   . LEU F 5 349 ? -44.670 -22.454 -10.697 1.00 107.64 ? 349 LEU D CD2   1 
ATOM 7186 N N     . PRO F 5 350 ? -41.408 -21.166 -14.864 1.00 99.60  ? 350 PRO D N     1 
ATOM 7187 C CA    . PRO F 5 350 ? -40.051 -21.621 -15.194 1.00 100.54 ? 350 PRO D CA    1 
ATOM 7188 C C     . PRO F 5 350 ? -39.010 -20.528 -14.990 1.00 98.49  ? 350 PRO D C     1 
ATOM 7189 O O     . PRO F 5 350 ? -37.936 -20.786 -14.458 1.00 97.68  ? 350 PRO D O     1 
ATOM 7190 C CB    . PRO F 5 350 ? -40.158 -22.001 -16.676 1.00 103.98 ? 350 PRO D CB    1 
ATOM 7191 C CG    . PRO F 5 350 ? -41.399 -21.323 -17.182 1.00 103.97 ? 350 PRO D CG    1 
ATOM 7192 C CD    . PRO F 5 350 ? -42.332 -21.279 -16.010 1.00 101.53 ? 350 PRO D CD    1 
ATOM 7193 N N     . LEU F 5 351 ? -39.336 -19.324 -15.435 1.00 95.47  ? 351 LEU D N     1 
ATOM 7194 C CA    . LEU F 5 351 ? -38.441 -18.186 -15.315 1.00 93.43  ? 351 LEU D CA    1 
ATOM 7195 C C     . LEU F 5 351 ? -38.069 -17.868 -13.869 1.00 95.55  ? 351 LEU D C     1 
ATOM 7196 O O     . LEU F 5 351 ? -36.896 -17.679 -13.533 1.00 94.76  ? 351 LEU D O     1 
ATOM 7197 C CB    . LEU F 5 351 ? -39.111 -16.965 -15.914 1.00 89.70  ? 351 LEU D CB    1 
ATOM 7198 C CG    . LEU F 5 351 ? -38.144 -15.831 -16.173 1.00 87.46  ? 351 LEU D CG    1 
ATOM 7199 C CD1   . LEU F 5 351 ? -37.034 -16.325 -17.083 1.00 90.04  ? 351 LEU D CD1   1 
ATOM 7200 C CD2   . LEU F 5 351 ? -38.910 -14.689 -16.797 1.00 87.03  ? 351 LEU D CD2   1 
ATOM 7201 N N     . LEU F 5 352 ? -39.089 -17.786 -13.023 1.00 98.20  ? 352 LEU D N     1 
ATOM 7202 C CA    . LEU F 5 352 ? -38.893 -17.557 -11.601 1.00 98.27  ? 352 LEU D CA    1 
ATOM 7203 C C     . LEU F 5 352 ? -37.972 -18.623 -11.007 1.00 100.89 ? 352 LEU D C     1 
ATOM 7204 O O     . LEU F 5 352 ? -37.176 -18.338 -10.114 1.00 99.46  ? 352 LEU D O     1 
ATOM 7205 C CB    . LEU F 5 352 ? -40.241 -17.564 -10.881 1.00 98.51  ? 352 LEU D CB    1 
ATOM 7206 C CG    . LEU F 5 352 ? -40.172 -17.334 -9.375  1.00 97.84  ? 352 LEU D CG    1 
ATOM 7207 C CD1   . LEU F 5 352 ? -39.755 -15.900 -9.084  1.00 97.43  ? 352 LEU D CD1   1 
ATOM 7208 C CD2   . LEU F 5 352 ? -41.511 -17.655 -8.730  1.00 98.77  ? 352 LEU D CD2   1 
ATOM 7209 N N     . TYR F 5 353 ? -38.086 -19.848 -11.513 1.00 103.76 ? 353 TYR D N     1 
ATOM 7210 C CA    . TYR F 5 353 ? -37.276 -20.962 -11.031 1.00 107.34 ? 353 TYR D CA    1 
ATOM 7211 C C     . TYR F 5 353 ? -35.815 -20.810 -11.437 1.00 108.11 ? 353 TYR D C     1 
ATOM 7212 O O     . TYR F 5 353 ? -34.909 -21.187 -10.694 1.00 106.63 ? 353 TYR D O     1 
ATOM 7213 C CB    . TYR F 5 353 ? -37.831 -22.285 -11.566 1.00 112.97 ? 353 TYR D CB    1 
ATOM 7214 C CG    . TYR F 5 353 ? -37.101 -23.522 -11.086 1.00 115.73 ? 353 TYR D CG    1 
ATOM 7215 C CD1   . TYR F 5 353 ? -37.192 -23.936 -9.764  1.00 117.25 ? 353 TYR D CD1   1 
ATOM 7216 C CD2   . TYR F 5 353 ? -36.341 -24.289 -11.961 1.00 118.04 ? 353 TYR D CD2   1 
ATOM 7217 C CE1   . TYR F 5 353 ? -36.533 -25.072 -9.322  1.00 119.99 ? 353 TYR D CE1   1 
ATOM 7218 C CE2   . TYR F 5 353 ? -35.679 -25.426 -11.527 1.00 121.30 ? 353 TYR D CE2   1 
ATOM 7219 C CZ    . TYR F 5 353 ? -35.778 -25.813 -10.206 1.00 122.60 ? 353 TYR D CZ    1 
ATOM 7220 O OH    . TYR F 5 353 ? -35.121 -26.943 -9.768  1.00 125.22 ? 353 TYR D OH    1 
ATOM 7221 N N     . ARG F 5 354 ? -35.593 -20.257 -12.622 1.00 109.11 ? 354 ARG D N     1 
ATOM 7222 C CA    . ARG F 5 354 ? -34.251 -20.116 -13.161 1.00 110.24 ? 354 ARG D CA    1 
ATOM 7223 C C     . ARG F 5 354 ? -33.538 -18.962 -12.480 1.00 107.99 ? 354 ARG D C     1 
ATOM 7224 O O     . ARG F 5 354 ? -32.309 -18.914 -12.435 1.00 109.78 ? 354 ARG D O     1 
ATOM 7225 C CB    . ARG F 5 354 ? -34.324 -19.859 -14.660 1.00 113.64 ? 354 ARG D CB    1 
ATOM 7226 C CG    . ARG F 5 354 ? -33.005 -19.493 -15.295 1.00 115.90 ? 354 ARG D CG    1 
ATOM 7227 C CD    . ARG F 5 354 ? -32.200 -20.719 -15.654 1.00 118.87 ? 354 ARG D CD    1 
ATOM 7228 N NE    . ARG F 5 354 ? -31.281 -20.435 -16.751 1.00 121.47 ? 354 ARG D NE    1 
ATOM 7229 C CZ    . ARG F 5 354 ? -31.556 -20.662 -18.032 1.00 124.55 ? 354 ARG D CZ    1 
ATOM 7230 N NH1   . ARG F 5 354 ? -32.724 -21.187 -18.382 1.00 125.73 ? 354 ARG D NH1   1 
ATOM 7231 N NH2   . ARG F 5 354 ? -30.659 -20.369 -18.965 1.00 125.17 ? 354 ARG D NH2   1 
ATOM 7232 N N     . VAL F 5 355 ? -34.325 -18.034 -11.948 1.00 105.78 ? 355 VAL D N     1 
ATOM 7233 C CA    . VAL F 5 355 ? -33.796 -16.852 -11.284 1.00 102.39 ? 355 VAL D CA    1 
ATOM 7234 C C     . VAL F 5 355 ? -33.701 -17.036 -9.776  1.00 105.12 ? 355 VAL D C     1 
ATOM 7235 O O     . VAL F 5 355 ? -32.617 -16.978 -9.195  1.00 107.89 ? 355 VAL D O     1 
ATOM 7236 C CB    . VAL F 5 355 ? -34.663 -15.635 -11.568 1.00 97.71  ? 355 VAL D CB    1 
ATOM 7237 C CG1   . VAL F 5 355 ? -34.269 -14.508 -10.629 1.00 96.19  ? 355 VAL D CG1   1 
ATOM 7238 C CG2   . VAL F 5 355 ? -34.518 -15.228 -13.022 1.00 95.07  ? 355 VAL D CG2   1 
ATOM 7239 N N     . PHE F 5 356 ? -34.852 -17.242 -9.148  1.00 105.50 ? 356 PHE D N     1 
ATOM 7240 C CA    . PHE F 5 356 ? -34.915 -17.473 -7.715  1.00 106.30 ? 356 PHE D CA    1 
ATOM 7241 C C     . PHE F 5 356 ? -35.405 -18.882 -7.452  1.00 107.64 ? 356 PHE D C     1 
ATOM 7242 O O     . PHE F 5 356 ? -36.587 -19.084 -7.186  1.00 109.10 ? 356 PHE D O     1 
ATOM 7243 C CB    . PHE F 5 356 ? -35.906 -16.502 -7.053  1.00 105.99 ? 356 PHE D CB    1 
ATOM 7244 C CG    . PHE F 5 356 ? -35.583 -15.063 -7.260  1.00 102.60 ? 356 PHE D CG    1 
ATOM 7245 C CD1   . PHE F 5 356 ? -34.359 -14.559 -6.868  1.00 101.15 ? 356 PHE D CD1   1 
ATOM 7246 C CD2   . PHE F 5 356 ? -36.512 -14.211 -7.830  1.00 102.13 ? 356 PHE D CD2   1 
ATOM 7247 C CE1   . PHE F 5 356 ? -34.059 -13.237 -7.051  1.00 102.10 ? 356 PHE D CE1   1 
ATOM 7248 C CE2   . PHE F 5 356 ? -36.216 -12.880 -8.016  1.00 102.93 ? 356 PHE D CE2   1 
ATOM 7249 C CZ    . PHE F 5 356 ? -34.987 -12.394 -7.626  1.00 103.69 ? 356 PHE D CZ    1 
ATOM 7250 N N     . PRO F 5 357 ? -34.498 -19.861 -7.513  1.00 106.88 ? 357 PRO D N     1 
ATOM 7251 C CA    . PRO F 5 357 ? -34.928 -21.213 -7.144  1.00 103.61 ? 357 PRO D CA    1 
ATOM 7252 C C     . PRO F 5 357 ? -35.378 -21.255 -5.702  1.00 100.66 ? 357 PRO D C     1 
ATOM 7253 O O     . PRO F 5 357 ? -36.325 -21.939 -5.330  1.00 104.06 ? 357 PRO D O     1 
ATOM 7254 C CB    . PRO F 5 357 ? -33.647 -22.020 -7.298  1.00 106.64 ? 357 PRO D CB    1 
ATOM 7255 C CG    . PRO F 5 357 ? -32.529 -21.016 -7.105  1.00 105.94 ? 357 PRO D CG    1 
ATOM 7256 C CD    . PRO F 5 357 ? -33.036 -19.744 -7.697  1.00 105.45 ? 357 PRO D CD    1 
ATOM 7257 N N     . THR F 5 358 ? -34.638 -20.503 -4.900  1.00 93.90  ? 358 THR D N     1 
ATOM 7258 C CA    . THR F 5 358 ? -34.729 -20.540 -3.445  1.00 89.39  ? 358 THR D CA    1 
ATOM 7259 C C     . THR F 5 358 ? -36.100 -20.117 -2.933  1.00 88.29  ? 358 THR D C     1 
ATOM 7260 O O     . THR F 5 358 ? -36.420 -20.296 -1.764  1.00 86.87  ? 358 THR D O     1 
ATOM 7261 C CB    . THR F 5 358 ? -33.572 -19.718 -2.784  1.00 91.19  ? 358 THR D CB    1 
ATOM 7262 O OG1   . THR F 5 358 ? -33.550 -18.405 -3.347  1.00 93.39  ? 358 THR D OG1   1 
ATOM 7263 C CG2   . THR F 5 358 ? -32.235 -20.376 -3.083  1.00 89.96  ? 358 THR D CG2   1 
ATOM 7264 N N     . HIS F 5 359 ? -36.913 -19.575 -3.829  1.00 90.42  ? 359 HIS D N     1 
ATOM 7265 C CA    . HIS F 5 359 ? -38.228 -19.054 -3.472  1.00 94.33  ? 359 HIS D CA    1 
ATOM 7266 C C     . HIS F 5 359 ? -39.062 -20.103 -2.755  1.00 96.19  ? 359 HIS D C     1 
ATOM 7267 O O     . HIS F 5 359 ? -38.999 -21.283 -3.081  1.00 96.42  ? 359 HIS D O     1 
ATOM 7268 C CB    . HIS F 5 359 ? -38.974 -18.582 -4.725  1.00 96.37  ? 359 HIS D CB    1 
ATOM 7269 C CG    . HIS F 5 359 ? -40.075 -17.609 -4.448  1.00 98.00  ? 359 HIS D CG    1 
ATOM 7270 N ND1   . HIS F 5 359 ? -41.272 -17.982 -3.876  1.00 100.56 ? 359 HIS D ND1   1 
ATOM 7271 C CD2   . HIS F 5 359 ? -40.167 -16.280 -4.686  1.00 94.59  ? 359 HIS D CD2   1 
ATOM 7272 C CE1   . HIS F 5 359 ? -42.050 -16.920 -3.765  1.00 98.06  ? 359 HIS D CE1   1 
ATOM 7273 N NE2   . HIS F 5 359 ? -41.403 -15.876 -4.249  1.00 94.34  ? 359 HIS D NE2   1 
ATOM 7274 N N     . ASP F 5 360 ? -39.844 -19.650 -1.782  1.00 98.23  ? 360 ASP D N     1 
ATOM 7275 C CA    . ASP F 5 360 ? -40.704 -20.507 -0.979  1.00 100.88 ? 360 ASP D CA    1 
ATOM 7276 C C     . ASP F 5 360 ? -41.577 -21.463 -1.798  1.00 107.06 ? 360 ASP D C     1 
ATOM 7277 O O     . ASP F 5 360 ? -41.766 -22.618 -1.410  1.00 108.52 ? 360 ASP D O     1 
ATOM 7278 C CB    . ASP F 5 360 ? -41.593 -19.648 -0.067  1.00 101.10 ? 360 ASP D CB    1 
ATOM 7279 C CG    . ASP F 5 360 ? -40.810 -18.920 1.021   1.00 102.19 ? 360 ASP D CG    1 
ATOM 7280 O OD1   . ASP F 5 360 ? -39.600 -19.175 1.174   1.00 101.61 ? 360 ASP D OD1   1 
ATOM 7281 O OD2   . ASP F 5 360 ? -41.417 -18.099 1.740   1.00 105.32 ? 360 ASP D OD2   1 
ATOM 7282 N N     . ILE F 5 361 ? -42.110 -20.984 -2.920  1.00 108.10 ? 361 ILE D N     1 
ATOM 7283 C CA    . ILE F 5 361 ? -43.047 -21.772 -3.724  1.00 111.83 ? 361 ILE D CA    1 
ATOM 7284 C C     . ILE F 5 361 ? -42.473 -23.111 -4.165  1.00 118.24 ? 361 ILE D C     1 
ATOM 7285 O O     . ILE F 5 361 ? -43.210 -24.084 -4.333  1.00 122.50 ? 361 ILE D O     1 
ATOM 7286 C CB    . ILE F 5 361 ? -43.484 -21.031 -5.000  1.00 111.58 ? 361 ILE D CB    1 
ATOM 7287 C CG1   . ILE F 5 361 ? -44.893 -21.476 -5.416  1.00 115.70 ? 361 ILE D CG1   1 
ATOM 7288 C CG2   . ILE F 5 361 ? -42.491 -21.288 -6.130  1.00 109.05 ? 361 ILE D CG2   1 
ATOM 7289 C CD1   . ILE F 5 361 ? -45.367 -20.888 -6.740  1.00 119.76 ? 361 ILE D CD1   1 
ATOM 7290 N N     . PHE F 5 362 ? -41.161 -23.160 -4.362  1.00 117.83 ? 362 PHE D N     1 
ATOM 7291 C CA    . PHE F 5 362 ? -40.540 -24.359 -4.896  1.00 114.13 ? 362 PHE D CA    1 
ATOM 7292 C C     . PHE F 5 362 ? -40.332 -25.413 -3.814  1.00 118.25 ? 362 PHE D C     1 
ATOM 7293 O O     . PHE F 5 362 ? -39.935 -26.540 -4.102  1.00 119.49 ? 362 PHE D O     1 
ATOM 7294 C CB    . PHE F 5 362 ? -39.234 -24.003 -5.597  1.00 110.09 ? 362 PHE D CB    1 
ATOM 7295 C CG    . PHE F 5 362 ? -39.420 -23.090 -6.773  1.00 107.55 ? 362 PHE D CG    1 
ATOM 7296 C CD1   . PHE F 5 362 ? -40.145 -23.500 -7.875  1.00 107.23 ? 362 PHE D CD1   1 
ATOM 7297 C CD2   . PHE F 5 362 ? -38.878 -21.823 -6.778  1.00 109.02 ? 362 PHE D CD2   1 
ATOM 7298 C CE1   . PHE F 5 362 ? -40.324 -22.669 -8.960  1.00 104.63 ? 362 PHE D CE1   1 
ATOM 7299 C CE2   . PHE F 5 362 ? -39.055 -20.989 -7.866  1.00 107.82 ? 362 PHE D CE2   1 
ATOM 7300 C CZ    . PHE F 5 362 ? -39.780 -21.415 -8.955  1.00 105.44 ? 362 PHE D CZ    1 
ATOM 7301 N N     . LEU F 5 363 ? -40.628 -25.042 -2.571  1.00 117.07 ? 363 LEU D N     1 
ATOM 7302 C CA    . LEU F 5 363 ? -40.443 -25.935 -1.430  1.00 116.61 ? 363 LEU D CA    1 
ATOM 7303 C C     . LEU F 5 363 ? -41.622 -26.854 -1.193  1.00 117.55 ? 363 LEU D C     1 
ATOM 7304 O O     . LEU F 5 363 ? -41.554 -27.774 -0.377  1.00 116.26 ? 363 LEU D O     1 
ATOM 7305 C CB    . LEU F 5 363 ? -40.169 -25.132 -0.164  1.00 116.46 ? 363 LEU D CB    1 
ATOM 7306 C CG    . LEU F 5 363 ? -38.714 -24.727 0.042   1.00 117.02 ? 363 LEU D CG    1 
ATOM 7307 C CD1   . LEU F 5 363 ? -38.212 -23.929 -1.146  1.00 119.00 ? 363 LEU D CD1   1 
ATOM 7308 C CD2   . LEU F 5 363 ? -38.578 -23.938 1.328   1.00 116.19 ? 363 LEU D CD2   1 
ATOM 7309 N N     . ASP F 5 364 ? -42.717 -26.597 -1.888  1.00 120.02 ? 364 ASP D N     1 
ATOM 7310 C CA    . ASP F 5 364 ? -43.860 -27.484 -1.776  1.00 123.64 ? 364 ASP D CA    1 
ATOM 7311 C C     . ASP F 5 364 ? -43.526 -28.801 -2.472  1.00 132.18 ? 364 ASP D C     1 
ATOM 7312 O O     . ASP F 5 364 ? -42.899 -28.798 -3.530  1.00 135.36 ? 364 ASP D O     1 
ATOM 7313 C CB    . ASP F 5 364 ? -45.096 -26.848 -2.392  1.00 123.42 ? 364 ASP D CB    1 
ATOM 7314 C CG    . ASP F 5 364 ? -46.364 -27.402 -1.807  1.00 125.29 ? 364 ASP D CG    1 
ATOM 7315 O OD1   . ASP F 5 364 ? -46.406 -27.594 -0.570  1.00 125.11 ? 364 ASP D OD1   1 
ATOM 7316 O OD2   . ASP F 5 364 ? -47.311 -27.661 -2.568  1.00 133.63 ? 364 ASP D OD2   1 
ATOM 7317 N N     . PRO F 5 365 ? -43.937 -29.933 -1.892  1.00 135.01 ? 365 PRO D N     1 
ATOM 7318 C CA    . PRO F 5 365 ? -43.635 -31.155 -2.639  1.00 136.10 ? 365 PRO D CA    1 
ATOM 7319 C C     . PRO F 5 365 ? -44.228 -31.150 -4.028  1.00 139.36 ? 365 PRO D C     1 
ATOM 7320 O O     . PRO F 5 365 ? -43.617 -31.596 -4.986  1.00 142.75 ? 365 PRO D O     1 
ATOM 7321 C CB    . PRO F 5 365 ? -44.343 -32.232 -1.833  1.00 137.51 ? 365 PRO D CB    1 
ATOM 7322 C CG    . PRO F 5 365 ? -44.592 -31.656 -0.495  1.00 136.60 ? 365 PRO D CG    1 
ATOM 7323 C CD    . PRO F 5 365 ? -44.797 -30.187 -0.724  1.00 136.24 ? 365 PRO D CD    1 
ATOM 7324 N N     . SER F 5 366 ? -45.460 -30.678 -4.104  1.00 137.46 ? 366 SER D N     1 
ATOM 7325 C CA    . SER F 5 366 ? -46.237 -30.754 -5.326  1.00 135.10 ? 366 SER D CA    1 
ATOM 7326 C C     . SER F 5 366 ? -45.356 -30.317 -6.495  1.00 135.55 ? 366 SER D C     1 
ATOM 7327 O O     . SER F 5 366 ? -45.406 -30.893 -7.585  1.00 137.75 ? 366 SER D O     1 
ATOM 7328 C CB    . SER F 5 366 ? -47.478 -29.843 -5.207  1.00 131.05 ? 366 SER D CB    1 
ATOM 7329 O OG    . SER F 5 366 ? -48.230 -30.155 -4.054  1.00 127.89 ? 366 SER D OG    1 
ATOM 7330 N N     . LEU F 5 367 ? -44.538 -29.297 -6.250  1.00 132.86 ? 367 LEU D N     1 
ATOM 7331 C CA    . LEU F 5 367 ? -43.561 -28.837 -7.240  1.00 131.28 ? 367 LEU D CA    1 
ATOM 7332 C C     . LEU F 5 367 ? -42.328 -29.758 -7.390  1.00 132.72 ? 367 LEU D C     1 
ATOM 7333 O O     . LEU F 5 367 ? -41.543 -29.612 -8.333  1.00 134.90 ? 367 LEU D O     1 
ATOM 7334 C CB    . LEU F 5 367 ? -43.138 -27.390 -6.952  1.00 125.26 ? 367 LEU D CB    1 
ATOM 7335 C CG    . LEU F 5 367 ? -44.102 -26.335 -7.510  1.00 122.51 ? 367 LEU D CG    1 
ATOM 7336 C CD1   . LEU F 5 367 ? -44.268 -26.550 -9.003  1.00 121.83 ? 367 LEU D CD1   1 
ATOM 7337 C CD2   . LEU F 5 367 ? -45.465 -26.343 -6.813  1.00 122.09 ? 367 LEU D CD2   1 
ATOM 7338 N N     . LYS F 5 368 ? -42.186 -30.714 -6.472  1.00 132.22 ? 368 LYS D N     1 
ATOM 7339 C CA    . LYS F 5 368 ? -41.073 -31.675 -6.465  1.00 132.13 ? 368 LYS D CA    1 
ATOM 7340 C C     . LYS F 5 368 ? -41.388 -32.992 -7.182  1.00 137.30 ? 368 LYS D C     1 
ATOM 7341 O O     . LYS F 5 368 ? -40.621 -33.948 -7.092  1.00 134.49 ? 368 LYS D O     1 
ATOM 7342 C CB    . LYS F 5 368 ? -40.627 -31.981 -5.039  1.00 127.09 ? 368 LYS D CB    1 
ATOM 7343 C CG    . LYS F 5 368 ? -40.891 -30.870 -4.079  1.00 121.96 ? 368 LYS D CG    1 
ATOM 7344 C CD    . LYS F 5 368 ? -39.878 -29.772 -4.238  1.00 120.90 ? 368 LYS D CD    1 
ATOM 7345 C CE    . LYS F 5 368 ? -38.973 -29.683 -3.024  1.00 119.70 ? 368 LYS D CE    1 
ATOM 7346 N NZ    . LYS F 5 368 ? -37.809 -28.807 -3.330  1.00 119.99 ? 368 LYS D NZ    1 
ATOM 7347 N N     . THR F 5 369 ? -42.543 -33.038 -7.842  1.00 144.80 ? 369 THR D N     1 
ATOM 7348 C CA    . THR F 5 369 ? -42.977 -34.182 -8.635  1.00 152.68 ? 369 THR D CA    1 
ATOM 7349 C C     . THR F 5 369 ? -42.045 -34.352 -9.824  1.00 153.39 ? 369 THR D C     1 
ATOM 7350 O O     . THR F 5 369 ? -41.544 -33.369 -10.359 1.00 155.15 ? 369 THR D O     1 
ATOM 7351 C CB    . THR F 5 369 ? -44.431 -34.013 -9.132  1.00 159.52 ? 369 THR D CB    1 
ATOM 7352 O OG1   . THR F 5 369 ? -44.518 -32.864 -9.979  1.00 165.07 ? 369 THR D OG1   1 
ATOM 7353 C CG2   . THR F 5 369 ? -45.408 -33.871 -7.980  1.00 158.12 ? 369 THR D CG2   1 
ATOM 7354 N N     . PRO F 5 370 ? -41.828 -35.602 -10.257 1.00 153.33 ? 370 PRO D N     1 
ATOM 7355 C CA    . PRO F 5 370 ? -40.938 -35.819 -11.401 1.00 155.63 ? 370 PRO D CA    1 
ATOM 7356 C C     . PRO F 5 370 ? -41.285 -34.888 -12.575 1.00 158.61 ? 370 PRO D C     1 
ATOM 7357 O O     . PRO F 5 370 ? -40.379 -34.351 -13.216 1.00 159.51 ? 370 PRO D O     1 
ATOM 7358 C CB    . PRO F 5 370 ? -41.186 -37.295 -11.760 1.00 156.35 ? 370 PRO D CB    1 
ATOM 7359 C CG    . PRO F 5 370 ? -42.490 -37.649 -11.090 1.00 155.10 ? 370 PRO D CG    1 
ATOM 7360 C CD    . PRO F 5 370 ? -42.489 -36.846 -9.831  1.00 152.92 ? 370 PRO D CD    1 
ATOM 7361 N N     . GLN F 5 371 ? -42.579 -34.669 -12.809 1.00 160.15 ? 371 GLN D N     1 
ATOM 7362 C CA    . GLN F 5 371 ? -43.083 -33.842 -13.918 1.00 161.52 ? 371 GLN D CA    1 
ATOM 7363 C C     . GLN F 5 371 ? -42.941 -32.326 -13.715 1.00 157.02 ? 371 GLN D C     1 
ATOM 7364 O O     . GLN F 5 371 ? -42.374 -31.617 -14.552 1.00 158.55 ? 371 GLN D O     1 
ATOM 7365 C CB    . GLN F 5 371 ? -44.530 -34.221 -14.289 1.00 165.53 ? 371 GLN D CB    1 
ATOM 7366 C CG    . GLN F 5 371 ? -45.540 -34.185 -13.143 1.00 168.98 ? 371 GLN D CG    1 
ATOM 7367 C CD    . GLN F 5 371 ? -45.189 -35.137 -12.011 1.00 173.90 ? 371 GLN D CD    1 
ATOM 7368 O OE1   . GLN F 5 371 ? -44.033 -35.243 -11.619 1.00 174.66 ? 371 GLN D OE1   1 
ATOM 7369 N NE2   . GLN F 5 371 ? -46.189 -35.835 -11.483 1.00 175.70 ? 371 GLN D NE2   1 
ATOM 7370 N N     . ASN F 5 372 ? -43.534 -31.819 -12.645 1.00 150.22 ? 372 ASN D N     1 
ATOM 7371 C CA    . ASN F 5 372 ? -43.415 -30.406 -12.342 1.00 142.55 ? 372 ASN D CA    1 
ATOM 7372 C C     . ASN F 5 372 ? -41.955 -29.933 -12.445 1.00 139.88 ? 372 ASN D C     1 
ATOM 7373 O O     . ASN F 5 372 ? -41.673 -28.906 -13.076 1.00 142.47 ? 372 ASN D O     1 
ATOM 7374 C CB    . ASN F 5 372 ? -44.068 -30.100 -10.991 1.00 138.48 ? 372 ASN D CB    1 
ATOM 7375 C CG    . ASN F 5 372 ? -45.572 -30.361 -11.007 1.00 137.85 ? 372 ASN D CG    1 
ATOM 7376 O OD1   . ASN F 5 372 ? -46.108 -30.939 -11.959 1.00 139.28 ? 372 ASN D OD1   1 
ATOM 7377 N ND2   . ASN F 5 372 ? -46.256 -29.938 -9.954  1.00 136.50 ? 372 ASN D ND2   1 
ATOM 7378 N N     . ILE F 5 373 ? -41.023 -30.696 -11.879 1.00 134.20 ? 373 ILE D N     1 
ATOM 7379 C CA    . ILE F 5 373 ? -39.613 -30.457 -12.172 1.00 130.94 ? 373 ILE D CA    1 
ATOM 7380 C C     . ILE F 5 373 ? -39.328 -30.708 -13.661 1.00 138.40 ? 373 ILE D C     1 
ATOM 7381 O O     . ILE F 5 373 ? -38.446 -30.078 -14.254 1.00 142.72 ? 373 ILE D O     1 
ATOM 7382 C CB    . ILE F 5 373 ? -38.650 -31.354 -11.373 1.00 123.25 ? 373 ILE D CB    1 
ATOM 7383 C CG1   . ILE F 5 373 ? -38.579 -30.939 -9.887  1.00 119.57 ? 373 ILE D CG1   1 
ATOM 7384 C CG2   . ILE F 5 373 ? -37.280 -31.325 -12.073 1.00 121.28 ? 373 ILE D CG2   1 
ATOM 7385 C CD1   . ILE F 5 373 ? -39.114 -31.969 -8.880  1.00 121.00 ? 373 ILE D CD1   1 
ATOM 7386 N N     . ALA F 5 374 ? -40.063 -31.634 -14.273 1.00 139.64 ? 374 ALA D N     1 
ATOM 7387 C CA    . ALA F 5 374 ? -39.808 -31.950 -15.683 1.00 139.61 ? 374 ALA D CA    1 
ATOM 7388 C C     . ALA F 5 374 ? -39.833 -30.691 -16.556 1.00 138.86 ? 374 ALA D C     1 
ATOM 7389 O O     . ALA F 5 374 ? -38.866 -30.426 -17.280 1.00 138.61 ? 374 ALA D O     1 
ATOM 7390 C CB    . ALA F 5 374 ? -40.782 -33.005 -16.211 1.00 141.36 ? 374 ALA D CB    1 
ATOM 7391 N N     . PHE F 5 375 ? -40.928 -29.922 -16.472 1.00 138.24 ? 375 PHE D N     1 
ATOM 7392 C CA    . PHE F 5 375 ? -41.058 -28.639 -17.196 1.00 135.09 ? 375 PHE D CA    1 
ATOM 7393 C C     . PHE F 5 375 ? -40.421 -27.389 -16.569 1.00 132.01 ? 375 PHE D C     1 
ATOM 7394 O O     . PHE F 5 375 ? -39.974 -26.497 -17.292 1.00 134.97 ? 375 PHE D O     1 
ATOM 7395 C CB    . PHE F 5 375 ? -42.507 -28.365 -17.641 1.00 136.97 ? 375 PHE D CB    1 
ATOM 7396 C CG    . PHE F 5 375 ? -43.405 -27.745 -16.579 1.00 135.75 ? 375 PHE D CG    1 
ATOM 7397 C CD1   . PHE F 5 375 ? -43.522 -26.350 -16.448 1.00 134.34 ? 375 PHE D CD1   1 
ATOM 7398 C CD2   . PHE F 5 375 ? -44.203 -28.557 -15.777 1.00 137.14 ? 375 PHE D CD2   1 
ATOM 7399 C CE1   . PHE F 5 375 ? -44.379 -25.781 -15.495 1.00 132.73 ? 375 PHE D CE1   1 
ATOM 7400 C CE2   . PHE F 5 375 ? -45.061 -28.003 -14.825 1.00 136.66 ? 375 PHE D CE2   1 
ATOM 7401 C CZ    . PHE F 5 375 ? -45.149 -26.607 -14.684 1.00 135.18 ? 375 PHE D CZ    1 
ATOM 7402 N N     . LEU F 5 376 ? -40.382 -27.308 -15.241 1.00 125.83 ? 376 LEU D N     1 
ATOM 7403 C CA    . LEU F 5 376 ? -39.714 -26.164 -14.625 1.00 123.49 ? 376 LEU D CA    1 
ATOM 7404 C C     . LEU F 5 376 ? -38.303 -26.025 -15.216 1.00 132.14 ? 376 LEU D C     1 
ATOM 7405 O O     . LEU F 5 376 ? -37.738 -24.928 -15.278 1.00 130.49 ? 376 LEU D O     1 
ATOM 7406 C CB    . LEU F 5 376 ? -39.646 -26.310 -13.098 1.00 116.06 ? 376 LEU D CB    1 
ATOM 7407 C CG    . LEU F 5 376 ? -40.900 -26.099 -12.229 1.00 110.92 ? 376 LEU D CG    1 
ATOM 7408 C CD1   . LEU F 5 376 ? -40.574 -25.873 -10.740 1.00 106.98 ? 376 LEU D CD1   1 
ATOM 7409 C CD2   . LEU F 5 376 ? -41.741 -24.954 -12.749 1.00 111.17 ? 376 LEU D CD2   1 
ATOM 7410 N N     . THR F 5 377 ? -37.743 -27.164 -15.621 1.00 141.07 ? 377 THR D N     1 
ATOM 7411 C CA    . THR F 5 377 ? -36.437 -27.256 -16.280 1.00 143.03 ? 377 THR D CA    1 
ATOM 7412 C C     . THR F 5 377 ? -36.533 -27.359 -17.806 1.00 149.16 ? 377 THR D C     1 
ATOM 7413 O O     . THR F 5 377 ? -35.515 -27.468 -18.495 1.00 147.93 ? 377 THR D O     1 
ATOM 7414 C CB    . THR F 5 377 ? -35.641 -28.456 -15.759 1.00 145.24 ? 377 THR D CB    1 
ATOM 7415 O OG1   . THR F 5 377 ? -35.949 -28.657 -14.375 1.00 148.84 ? 377 THR D OG1   1 
ATOM 7416 C CG2   . THR F 5 377 ? -34.145 -28.218 -15.918 1.00 146.28 ? 377 THR D CG2   1 
ATOM 7417 N N     . GLY F 5 378 ? -37.751 -27.286 -18.331 1.00 155.89 ? 378 GLY D N     1 
ATOM 7418 C CA    . GLY F 5 378 ? -37.996 -27.467 -19.753 1.00 162.85 ? 378 GLY D CA    1 
ATOM 7419 C C     . GLY F 5 378 ? -37.720 -26.181 -20.514 1.00 168.79 ? 378 GLY D C     1 
ATOM 7420 O O     . GLY F 5 378 ? -36.754 -25.480 -20.215 1.00 170.30 ? 378 GLY D O     1 
ATOM 7421 N N     . THR F 5 379 ? -38.514 -25.891 -21.540 1.00 172.73 ? 379 THR D N     1 
ATOM 7422 C CA    . THR F 5 379 ? -38.307 -24.672 -22.326 1.00 173.22 ? 379 THR D CA    1 
ATOM 7423 C C     . THR F 5 379 ? -38.392 -23.494 -21.367 1.00 171.37 ? 379 THR D C     1 
ATOM 7424 O O     . THR F 5 379 ? -38.956 -23.614 -20.281 1.00 167.73 ? 379 THR D O     1 
ATOM 7425 C CB    . THR F 5 379 ? -39.422 -24.482 -23.392 1.00 163.58 ? 379 THR D CB    1 
ATOM 7426 O OG1   . THR F 5 379 ? -39.436 -25.595 -24.297 1.00 167.83 ? 379 THR D OG1   1 
ATOM 7427 C CG2   . THR F 5 379 ? -39.214 -23.196 -24.193 1.00 160.36 ? 379 THR D CG2   1 
ATOM 7428 N N     . LEU F 5 380 ? -37.822 -22.360 -21.760 1.00 174.81 ? 380 LEU D N     1 
ATOM 7429 C CA    . LEU F 5 380 ? -37.925 -21.168 -20.938 1.00 177.67 ? 380 LEU D CA    1 
ATOM 7430 C C     . LEU F 5 380 ? -38.892 -20.251 -21.652 1.00 179.83 ? 380 LEU D C     1 
ATOM 7431 O O     . LEU F 5 380 ? -38.997 -20.279 -22.878 1.00 182.75 ? 380 LEU D O     1 
ATOM 7432 C CB    . LEU F 5 380 ? -36.574 -20.466 -20.798 1.00 174.83 ? 380 LEU D CB    1 
ATOM 7433 C CG    . LEU F 5 380 ? -35.847 -19.982 -22.059 1.00 174.14 ? 380 LEU D CG    1 
ATOM 7434 C CD1   . LEU F 5 380 ? -36.593 -18.878 -22.816 1.00 173.05 ? 380 LEU D CD1   1 
ATOM 7435 C CD2   . LEU F 5 380 ? -34.465 -19.511 -21.664 1.00 173.04 ? 380 LEU D CD2   1 
ATOM 7436 N N     . PRO F 5 381 ? -39.651 -19.464 -20.875 1.00 179.62 ? 381 PRO D N     1 
ATOM 7437 C CA    . PRO F 5 381 ? -40.694 -18.631 -21.481 1.00 182.35 ? 381 PRO D CA    1 
ATOM 7438 C C     . PRO F 5 381 ? -40.139 -17.552 -22.410 1.00 186.62 ? 381 PRO D C     1 
ATOM 7439 O O     . PRO F 5 381 ? -40.544 -17.460 -23.569 1.00 189.89 ? 381 PRO D O     1 
ATOM 7440 C CB    . PRO F 5 381 ? -41.428 -18.055 -20.267 1.00 179.37 ? 381 PRO D CB    1 
ATOM 7441 C CG    . PRO F 5 381 ? -40.417 -18.097 -19.151 1.00 175.73 ? 381 PRO D CG    1 
ATOM 7442 C CD    . PRO F 5 381 ? -39.514 -19.253 -19.425 1.00 175.25 ? 381 PRO D CD    1 
ATOM 7443 N N     . LEU F 5 382 ? -39.184 -16.774 -21.917 1.00 186.03 ? 382 LEU D N     1 
ATOM 7444 C CA    . LEU F 5 382 ? -38.418 -15.853 -22.762 1.00 185.18 ? 382 LEU D CA    1 
ATOM 7445 C C     . LEU F 5 382 ? -36.974 -15.786 -22.285 1.00 186.24 ? 382 LEU D C     1 
ATOM 7446 O O     . LEU F 5 382 ? -36.696 -15.744 -21.085 1.00 185.22 ? 382 LEU D O     1 
ATOM 7447 C CB    . LEU F 5 382 ? -39.084 -14.477 -22.866 1.00 180.30 ? 382 LEU D CB    1 
ATOM 7448 C CG    . LEU F 5 382 ? -40.124 -14.451 -23.998 1.00 177.62 ? 382 LEU D CG    1 
ATOM 7449 C CD1   . LEU F 5 382 ? -40.917 -13.154 -24.032 1.00 177.76 ? 382 LEU D CD1   1 
ATOM 7450 C CD2   . LEU F 5 382 ? -39.482 -14.720 -25.353 1.00 174.42 ? 382 LEU D CD2   1 
ATOM 7451 N N     . ASP F 5 383 ? -36.065 -15.795 -23.251 1.00 187.03 ? 383 ASP D N     1 
ATOM 7452 C CA    . ASP F 5 383 ? -34.656 -16.028 -22.988 1.00 183.84 ? 383 ASP D CA    1 
ATOM 7453 C C     . ASP F 5 383 ? -34.185 -15.090 -21.879 1.00 178.13 ? 383 ASP D C     1 
ATOM 7454 O O     . ASP F 5 383 ? -34.569 -13.929 -21.849 1.00 178.00 ? 383 ASP D O     1 
ATOM 7455 C CB    . ASP F 5 383 ? -33.850 -15.800 -24.280 1.00 183.22 ? 383 ASP D CB    1 
ATOM 7456 C CG    . ASP F 5 383 ? -34.001 -14.392 -24.816 1.00 182.50 ? 383 ASP D CG    1 
ATOM 7457 O OD1   . ASP F 5 383 ? -34.666 -14.196 -25.862 1.00 182.35 ? 383 ASP D OD1   1 
ATOM 7458 O OD2   . ASP F 5 383 ? -33.449 -13.467 -24.186 1.00 181.90 ? 383 ASP D OD2   1 
ATOM 7459 N N     . ILE F 5 384 ? -33.380 -15.609 -20.953 1.00 173.19 ? 384 ILE D N     1 
ATOM 7460 C CA    . ILE F 5 384 ? -32.912 -14.826 -19.802 1.00 168.80 ? 384 ILE D CA    1 
ATOM 7461 C C     . ILE F 5 384 ? -32.248 -13.506 -20.171 1.00 166.87 ? 384 ILE D C     1 
ATOM 7462 O O     . ILE F 5 384 ? -32.428 -12.511 -19.476 1.00 166.40 ? 384 ILE D O     1 
ATOM 7463 C CB    . ILE F 5 384 ? -31.925 -15.588 -18.873 1.00 131.18 ? 384 ILE D CB    1 
ATOM 7464 C CG1   . ILE F 5 384 ? -31.088 -16.623 -19.646 1.00 134.70 ? 384 ILE D CG1   1 
ATOM 7465 C CG2   . ILE F 5 384 ? -32.657 -16.180 -17.657 1.00 129.15 ? 384 ILE D CG2   1 
ATOM 7466 C CD1   . ILE F 5 384 ? -29.617 -16.645 -19.223 1.00 134.54 ? 384 ILE D CD1   1 
ATOM 7467 N N     . GLU F 5 385 ? -31.485 -13.493 -21.260 1.00 165.55 ? 385 GLU D N     1 
ATOM 7468 C CA    . GLU F 5 385 ? -30.702 -12.315 -21.608 1.00 162.17 ? 385 GLU D CA    1 
ATOM 7469 C C     . GLU F 5 385 ? -31.644 -11.116 -21.655 1.00 157.49 ? 385 GLU D C     1 
ATOM 7470 O O     . GLU F 5 385 ? -31.214 -9.963  -21.603 1.00 156.51 ? 385 GLU D O     1 
ATOM 7471 C CB    . GLU F 5 385 ? -29.974 -12.514 -22.943 1.00 165.50 ? 385 GLU D CB    1 
ATOM 7472 C CG    . GLU F 5 385 ? -28.799 -13.498 -22.905 1.00 167.62 ? 385 GLU D CG    1 
ATOM 7473 C CD    . GLU F 5 385 ? -27.547 -12.933 -22.240 1.00 169.40 ? 385 GLU D CD    1 
ATOM 7474 O OE1   . GLU F 5 385 ? -27.231 -11.742 -22.450 1.00 171.30 ? 385 GLU D OE1   1 
ATOM 7475 O OE2   . GLU F 5 385 ? -26.877 -13.684 -21.500 1.00 171.00 ? 385 GLU D OE2   1 
ATOM 7476 N N     . SER F 5 386 ? -32.938 -11.416 -21.759 1.00 153.76 ? 386 SER D N     1 
ATOM 7477 C CA    . SER F 5 386 ? -34.008 -10.431 -21.624 1.00 147.22 ? 386 SER D CA    1 
ATOM 7478 C C     . SER F 5 386 ? -34.069 -9.775  -20.239 1.00 135.47 ? 386 SER D C     1 
ATOM 7479 O O     . SER F 5 386 ? -34.341 -8.584  -20.134 1.00 130.80 ? 386 SER D O     1 
ATOM 7480 C CB    . SER F 5 386 ? -35.370 -11.056 -21.978 1.00 153.79 ? 386 SER D CB    1 
ATOM 7481 O OG    . SER F 5 386 ? -35.337 -12.468 -21.848 1.00 157.66 ? 386 SER D OG    1 
ATOM 7482 N N     . GLN F 5 387 ? -33.830 -10.548 -19.182 1.00 132.18 ? 387 GLN D N     1 
ATOM 7483 C CA    . GLN F 5 387 ? -34.044 -10.045 -17.823 1.00 130.23 ? 387 GLN D CA    1 
ATOM 7484 C C     . GLN F 5 387 ? -32.799 -9.516  -17.097 1.00 133.77 ? 387 GLN D C     1 
ATOM 7485 O O     . GLN F 5 387 ? -32.893 -9.153  -15.931 1.00 130.67 ? 387 GLN D O     1 
ATOM 7486 C CB    . GLN F 5 387 ? -34.814 -11.049 -16.938 1.00 126.52 ? 387 GLN D CB    1 
ATOM 7487 C CG    . GLN F 5 387 ? -36.302 -11.334 -17.300 1.00 98.94  ? 387 GLN D CG    1 
ATOM 7488 C CD    . GLN F 5 387 ? -37.107 -10.097 -17.641 1.00 93.19  ? 387 GLN D CD    1 
ATOM 7489 O OE1   . GLN F 5 387 ? -36.548 -9.099  -18.071 1.00 88.25  ? 387 GLN D OE1   1 
ATOM 7490 N NE2   . GLN F 5 387 ? -38.429 -10.164 -17.467 1.00 92.02  ? 387 GLN D NE2   1 
ATOM 7491 N N     . GLU F 5 388 ? -31.657 -9.469  -17.783 1.00 141.67 ? 388 GLU D N     1 
ATOM 7492 C CA    . GLU F 5 388 ? -30.401 -8.941  -17.221 1.00 144.72 ? 388 GLU D CA    1 
ATOM 7493 C C     . GLU F 5 388 ? -30.582 -7.622  -16.464 1.00 146.35 ? 388 GLU D C     1 
ATOM 7494 O O     . GLU F 5 388 ? -30.340 -7.518  -15.249 1.00 148.51 ? 388 GLU D O     1 
ATOM 7495 C CB    . GLU F 5 388 ? -29.338 -8.768  -18.329 1.00 144.65 ? 388 GLU D CB    1 
ATOM 7496 C CG    . GLU F 5 388 ? -29.551 -7.606  -19.327 1.00 142.69 ? 388 GLU D CG    1 
ATOM 7497 C CD    . GLU F 5 388 ? -30.873 -7.672  -20.101 1.00 146.67 ? 388 GLU D CD    1 
ATOM 7498 O OE1   . GLU F 5 388 ? -31.892 -8.094  -19.522 1.00 146.85 ? 388 GLU D OE1   1 
ATOM 7499 O OE2   . GLU F 5 388 ? -30.896 -7.302  -21.298 1.00 151.97 ? 388 GLU D OE2   1 
ATOM 7500 N N     . HIS F 5 389 ? -31.003 -6.596  -17.181 1.00 145.18 ? 389 HIS D N     1 
ATOM 7501 C CA    . HIS F 5 389 ? -31.245 -5.354  -16.501 1.00 143.47 ? 389 HIS D CA    1 
ATOM 7502 C C     . HIS F 5 389 ? -32.044 -5.564  -15.220 1.00 136.92 ? 389 HIS D C     1 
ATOM 7503 O O     . HIS F 5 389 ? -31.582 -5.217  -14.143 1.00 134.85 ? 389 HIS D O     1 
ATOM 7504 C CB    . HIS F 5 389 ? -32.011 -4.368  -17.335 1.00 147.72 ? 389 HIS D CB    1 
ATOM 7505 C CG    . HIS F 5 389 ? -32.888 -3.504  -16.499 1.00 148.16 ? 389 HIS D CG    1 
ATOM 7506 N ND1   . HIS F 5 389 ? -34.260 -3.568  -16.551 1.00 149.29 ? 389 HIS D ND1   1 
ATOM 7507 C CD2   . HIS F 5 389 ? -32.583 -2.606  -15.535 1.00 146.21 ? 389 HIS D CD2   1 
ATOM 7508 C CE1   . HIS F 5 389 ? -34.768 -2.712  -15.681 1.00 147.04 ? 389 HIS D CE1   1 
ATOM 7509 N NE2   . HIS F 5 389 ? -33.771 -2.117  -15.054 1.00 145.28 ? 389 HIS D NE2   1 
ATOM 7510 N N     . LEU F 5 390 ? -33.252 -6.105  -15.340 1.00 133.23 ? 390 LEU D N     1 
ATOM 7511 C CA    . LEU F 5 390 ? -34.187 -6.122  -14.222 1.00 128.23 ? 390 LEU D CA    1 
ATOM 7512 C C     . LEU F 5 390 ? -33.484 -6.529  -12.946 1.00 125.74 ? 390 LEU D C     1 
ATOM 7513 O O     . LEU F 5 390 ? -33.615 -5.871  -11.911 1.00 121.26 ? 390 LEU D O     1 
ATOM 7514 C CB    . LEU F 5 390 ? -35.326 -7.104  -14.496 1.00 128.71 ? 390 LEU D CB    1 
ATOM 7515 C CG    . LEU F 5 390 ? -36.606 -6.443  -15.008 1.00 127.52 ? 390 LEU D CG    1 
ATOM 7516 C CD1   . LEU F 5 390 ? -36.332 -5.624  -16.262 1.00 124.80 ? 390 LEU D CD1   1 
ATOM 7517 C CD2   . LEU F 5 390 ? -37.729 -7.450  -15.249 1.00 131.47 ? 390 LEU D CD2   1 
ATOM 7518 N N     . LEU F 5 391 ? -32.732 -7.619  -13.037 1.00 128.40 ? 391 LEU D N     1 
ATOM 7519 C CA    . LEU F 5 391 ? -31.887 -8.056  -11.939 1.00 126.91 ? 391 LEU D CA    1 
ATOM 7520 C C     . LEU F 5 391 ? -30.899 -6.975  -11.507 1.00 123.67 ? 391 LEU D C     1 
ATOM 7521 O O     . LEU F 5 391 ? -30.710 -6.742  -10.321 1.00 124.26 ? 391 LEU D O     1 
ATOM 7522 C CB    . LEU F 5 391 ? -31.168 -9.372  -12.280 1.00 129.01 ? 391 LEU D CB    1 
ATOM 7523 C CG    . LEU F 5 391 ? -30.481 -9.549  -13.634 1.00 130.93 ? 391 LEU D CG    1 
ATOM 7524 C CD1   . LEU F 5 391 ? -28.974 -9.666  -13.450 1.00 133.29 ? 391 LEU D CD1   1 
ATOM 7525 C CD2   . LEU F 5 391 ? -31.040 -10.747 -14.406 1.00 133.77 ? 391 LEU D CD2   1 
ATOM 7526 N N     . ALA F 5 392 ? -30.306 -6.282  -12.473 1.00 119.06 ? 392 ALA D N     1 
ATOM 7527 C CA    . ALA F 5 392 ? -29.157 -5.419  -12.153 1.00 115.07 ? 392 ALA D CA    1 
ATOM 7528 C C     . ALA F 5 392 ? -29.446 -4.403  -11.038 1.00 115.61 ? 392 ALA D C     1 
ATOM 7529 O O     . ALA F 5 392 ? -28.519 -3.873  -10.404 1.00 116.60 ? 392 ALA D O     1 
ATOM 7530 C CB    . ALA F 5 392 ? -28.642 -4.717  -13.393 1.00 112.86 ? 392 ALA D CB    1 
ATOM 7531 N N     . GLN F 5 393 ? -30.734 -4.177  -10.782 1.00 115.12 ? 393 GLN D N     1 
ATOM 7532 C CA    . GLN F 5 393 ? -31.188 -3.157  -9.842  1.00 111.06 ? 393 GLN D CA    1 
ATOM 7533 C C     . GLN F 5 393 ? -31.348 -3.653  -8.395  1.00 114.84 ? 393 GLN D C     1 
ATOM 7534 O O     . GLN F 5 393 ? -31.773 -2.873  -7.551  1.00 119.11 ? 393 GLN D O     1 
ATOM 7535 C CB    . GLN F 5 393 ? -32.545 -2.599  -10.274 1.00 102.17 ? 393 GLN D CB    1 
ATOM 7536 C CG    . GLN F 5 393 ? -32.533 -1.621  -11.436 1.00 95.79  ? 393 GLN D CG    1 
ATOM 7537 C CD    . GLN F 5 393 ? -33.939 -1.267  -11.884 1.00 99.00  ? 393 GLN D CD    1 
ATOM 7538 O OE1   . GLN F 5 393 ? -34.906 -1.482  -11.161 1.00 106.47 ? 393 GLN D OE1   1 
ATOM 7539 N NE2   . GLN F 5 393 ? -34.058 -0.733  -13.084 1.00 97.70  ? 393 GLN D NE2   1 
ATOM 7540 N N     . LEU F 5 394 ? -31.070 -4.922  -8.080  1.00 113.42 ? 394 LEU D N     1 
ATOM 7541 C CA    . LEU F 5 394 ? -31.281 -5.318  -6.693  1.00 113.78 ? 394 LEU D CA    1 
ATOM 7542 C C     . LEU F 5 394 ? -30.050 -4.983  -5.868  1.00 114.12 ? 394 LEU D C     1 
ATOM 7543 O O     . LEU F 5 394 ? -28.977 -4.715  -6.416  1.00 110.52 ? 394 LEU D O     1 
ATOM 7544 C CB    . LEU F 5 394 ? -31.687 -6.798  -6.552  1.00 117.46 ? 394 LEU D CB    1 
ATOM 7545 C CG    . LEU F 5 394 ? -31.013 -7.932  -7.315  1.00 121.32 ? 394 LEU D CG    1 
ATOM 7546 C CD1   . LEU F 5 394 ? -29.499 -7.768  -7.347  1.00 121.82 ? 394 LEU D CD1   1 
ATOM 7547 C CD2   . LEU F 5 394 ? -31.384 -9.290  -6.734  1.00 123.58 ? 394 LEU D CD2   1 
ATOM 7548 N N     . ILE F 5 395 ? -30.214 -5.022  -4.548  1.00 121.12 ? 395 ILE D N     1 
ATOM 7549 C CA    . ILE F 5 395 ? -29.116 -4.767  -3.610  1.00 130.34 ? 395 ILE D CA    1 
ATOM 7550 C C     . ILE F 5 395 ? -28.502 -6.021  -2.969  1.00 143.67 ? 395 ILE D C     1 
ATOM 7551 O O     . ILE F 5 395 ? -27.506 -5.928  -2.246  1.00 146.54 ? 395 ILE D O     1 
ATOM 7552 C CB    . ILE F 5 395 ? -29.531 -3.779  -2.502  1.00 129.86 ? 395 ILE D CB    1 
ATOM 7553 C CG1   . ILE F 5 395 ? -30.751 -4.316  -1.733  1.00 131.47 ? 395 ILE D CG1   1 
ATOM 7554 C CG2   . ILE F 5 395 ? -29.907 -2.462  -3.115  1.00 129.22 ? 395 ILE D CG2   1 
ATOM 7555 C CD1   . ILE F 5 395 ? -32.063 -4.238  -2.490  1.00 134.60 ? 395 ILE D CD1   1 
ATOM 7556 N N     . ASP F 5 396 ? -29.107 -7.182  -3.221  1.00 151.74 ? 396 ASP D N     1 
ATOM 7557 C CA    . ASP F 5 396 ? -28.563 -8.470  -2.772  1.00 157.65 ? 396 ASP D CA    1 
ATOM 7558 C C     . ASP F 5 396 ? -28.486 -9.446  -3.923  1.00 162.48 ? 396 ASP D C     1 
ATOM 7559 O O     . ASP F 5 396 ? -29.506 -9.916  -4.429  1.00 163.90 ? 396 ASP D O     1 
ATOM 7560 C CB    . ASP F 5 396 ? -29.413 -9.091  -1.668  1.00 160.13 ? 396 ASP D CB    1 
ATOM 7561 C CG    . ASP F 5 396 ? -29.092 -8.534  -0.311  1.00 161.12 ? 396 ASP D CG    1 
ATOM 7562 O OD1   . ASP F 5 396 ? -27.894 -8.389  0.022   1.00 163.44 ? 396 ASP D OD1   1 
ATOM 7563 O OD2   . ASP F 5 396 ? -30.051 -8.231  0.420   1.00 160.64 ? 396 ASP D OD2   1 
ATOM 7564 N N     . LYS F 5 397 ? -27.255 -9.761  -4.295  1.00 167.08 ? 397 LYS D N     1 
ATOM 7565 C CA    . LYS F 5 397 ? -26.943 -10.656 -5.389  1.00 176.75 ? 397 LYS D CA    1 
ATOM 7566 C C     . LYS F 5 397 ? -27.070 -12.057 -4.813  1.00 181.06 ? 397 LYS D C     1 
ATOM 7567 O O     . LYS F 5 397 ? -26.528 -12.350 -3.746  1.00 177.77 ? 397 LYS D O     1 
ATOM 7568 C CB    . LYS F 5 397 ? -25.517 -10.343 -5.852  1.00 180.99 ? 397 LYS D CB    1 
ATOM 7569 C CG    . LYS F 5 397 ? -24.962 -11.009 -7.104  1.00 188.19 ? 397 LYS D CG    1 
ATOM 7570 C CD    . LYS F 5 397 ? -23.562 -10.378 -7.304  1.00 194.75 ? 397 LYS D CD    1 
ATOM 7571 C CE    . LYS F 5 397 ? -22.721 -10.977 -8.355  1.00 200.15 ? 397 LYS D CE    1 
ATOM 7572 N NZ    . LYS F 5 397 ? -21.523 -11.535 -7.706  1.00 202.79 ? 397 LYS D NZ    1 
ATOM 7573 N N     . THR F 5 398 ? -27.827 -12.908 -5.491  1.00 189.72 ? 398 THR D N     1 
ATOM 7574 C CA    . THR F 5 398 ? -28.071 -14.251 -4.990  1.00 197.53 ? 398 THR D CA    1 
ATOM 7575 C C     . THR F 5 398 ? -26.895 -15.177 -5.283  1.00 202.76 ? 398 THR D C     1 
ATOM 7576 O O     . THR F 5 398 ? -25.842 -14.732 -5.745  1.00 203.77 ? 398 THR D O     1 
ATOM 7577 C CB    . THR F 5 398 ? -29.355 -14.838 -5.588  1.00 199.68 ? 398 THR D CB    1 
ATOM 7578 O OG1   . THR F 5 398 ? -29.378 -14.589 -6.999  1.00 200.43 ? 398 THR D OG1   1 
ATOM 7579 C CG2   . THR F 5 398 ? -30.572 -14.187 -4.957  1.00 200.45 ? 398 THR D CG2   1 
ATOM 7580 N N     . GLY F 5 399 ? -27.075 -16.462 -4.995  1.00 206.34 ? 399 GLY D N     1 
ATOM 7581 C CA    . GLY F 5 399 ? -26.061 -17.456 -5.290  1.00 207.51 ? 399 GLY D CA    1 
ATOM 7582 C C     . GLY F 5 399 ? -25.888 -17.636 -6.788  1.00 209.32 ? 399 GLY D C     1 
ATOM 7583 O O     . GLY F 5 399 ? -24.813 -18.035 -7.228  1.00 207.85 ? 399 GLY D O     1 
ATOM 7584 N N     . THR F 5 400 ? -26.938 -17.351 -7.568  1.00 212.20 ? 400 THR D N     1 
ATOM 7585 C CA    . THR F 5 400 ? -26.891 -17.445 -9.039  1.00 213.81 ? 400 THR D CA    1 
ATOM 7586 C C     . THR F 5 400 ? -26.734 -16.042 -9.608  1.00 209.28 ? 400 THR D C     1 
ATOM 7587 O O     . THR F 5 400 ? -27.458 -15.121 -9.235  1.00 208.02 ? 400 THR D O     1 
ATOM 7588 C CB    . THR F 5 400 ? -28.152 -18.032 -9.638  1.00 218.34 ? 400 THR D CB    1 
ATOM 7589 O OG1   . THR F 5 400 ? -29.183 -17.041 -9.570  1.00 219.72 ? 400 THR D OG1   1 
ATOM 7590 C CG2   . THR F 5 400 ? -28.570 -19.279 -8.897  1.00 219.27 ? 400 THR D CG2   1 
ATOM 7591 N N     . VAL F 5 401 ? -25.747 -15.902 -10.484 1.00 205.46 ? 401 VAL D N     1 
ATOM 7592 C CA    . VAL F 5 401 ? -25.201 -14.608 -10.835 1.00 202.08 ? 401 VAL D CA    1 
ATOM 7593 C C     . VAL F 5 401 ? -24.956 -14.417 -12.342 1.00 199.94 ? 401 VAL D C     1 
ATOM 7594 O O     . VAL F 5 401 ? -24.130 -15.099 -12.952 1.00 198.63 ? 401 VAL D O     1 
ATOM 7595 C CB    . VAL F 5 401 ? -23.887 -14.313 -10.026 1.00 178.20 ? 401 VAL D CB    1 
ATOM 7596 C CG1   . VAL F 5 401 ? -23.253 -13.077 -10.591 1.00 178.71 ? 401 VAL D CG1   1 
ATOM 7597 C CG2   . VAL F 5 401 ? -24.135 -14.044 -8.530  1.00 175.63 ? 401 VAL D CG2   1 
ATOM 7598 N N     . SER F 5 402 ? -25.669 -13.461 -12.921 1.00 200.66 ? 402 SER D N     1 
ATOM 7599 C CA    . SER F 5 402 ? -25.630 -13.262 -14.359 1.00 200.86 ? 402 SER D CA    1 
ATOM 7600 C C     . SER F 5 402 ? -26.174 -11.891 -14.695 1.00 202.54 ? 402 SER D C     1 
ATOM 7601 O O     . SER F 5 402 ? -25.810 -10.910 -14.049 1.00 202.61 ? 402 SER D O     1 
ATOM 7602 C CB    . SER F 5 402 ? -26.393 -14.371 -15.104 1.00 202.21 ? 402 SER D CB    1 
ATOM 7603 O OG    . SER F 5 402 ? -25.778 -15.637 -14.906 1.00 201.86 ? 402 SER D OG    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1212 N N   . MET E 1   ? 2.6168 2.1811 2.0326 0.0005  -0.2192 -0.0876 1   MET A N   
1213 C CA  . MET E 1   ? 2.6520 2.1909 2.0453 0.0056  -0.2217 -0.0866 1   MET A CA  
1214 C C   . MET E 1   ? 2.7053 2.2415 2.0962 0.0086  -0.2395 -0.0803 1   MET A C   
1215 O O   . MET E 1   ? 2.7035 2.2629 2.1120 0.0048  -0.2472 -0.0780 1   MET A O   
1216 C CB  . MET E 1   ? 2.6322 2.1728 2.0200 0.0023  -0.2088 -0.0923 1   MET A CB  
1217 C CG  . MET E 1   ? 2.6351 2.1481 1.9981 0.0086  -0.2085 -0.0913 1   MET A CG  
1218 S SD  . MET E 1   ? 3.8117 3.2921 3.1546 0.0167  -0.2053 -0.0903 1   MET A SD  
1219 C CE  . MET E 1   ? 2.4615 1.9129 1.7756 0.0245  -0.2065 -0.0884 1   MET A CE  
1220 N N   . SER E 2   ? 2.7303 2.2378 2.0994 0.0158  -0.2463 -0.0773 2   SER A N   
1221 C CA  . SER E 2   ? 2.7037 2.2039 2.0668 0.0195  -0.2638 -0.0717 2   SER A CA  
1222 C C   . SER E 2   ? 2.6575 2.1770 2.0285 0.0147  -0.2642 -0.0734 2   SER A C   
1223 O O   . SER E 2   ? 2.6246 2.1582 2.0079 0.0133  -0.2779 -0.0691 2   SER A O   
1224 C CB  . SER E 2   ? 2.7129 2.1766 2.0465 0.0281  -0.2677 -0.0701 2   SER A CB  
1225 O OG  . SER E 2   ? 2.7034 2.1486 2.0293 0.0321  -0.2666 -0.0686 2   SER A OG  
1226 N N   . LYS E 3   ? 2.6386 2.1594 2.0040 0.0121  -0.2493 -0.0793 3   LYS A N   
1227 C CA  . LYS E 3   ? 2.5998 2.1361 1.9706 0.0077  -0.2481 -0.0810 3   LYS A CA  
1228 C C   . LYS E 3   ? 2.5495 2.1217 1.9482 -0.0014 -0.2457 -0.0828 3   LYS A C   
1229 O O   . LYS E 3   ? 2.5065 2.0959 1.9143 -0.0060 -0.2476 -0.0832 3   LYS A O   
1230 C CB  . LYS E 3   ? 2.6075 2.1311 1.9629 0.0084  -0.2325 -0.0855 3   LYS A CB  
1231 C CG  . LYS E 3   ? 2.6482 2.1362 1.9756 0.0180  -0.2319 -0.0840 3   LYS A CG  
1232 C CD  . LYS E 3   ? 2.7230 2.1982 2.0344 0.0201  -0.2190 -0.0864 3   LYS A CD  
1233 C CE  . LYS E 3   ? 2.6652 2.1048 1.9467 0.0312  -0.2231 -0.0835 3   LYS A CE  
1234 N NZ  . LYS E 3   ? 2.6987 2.1258 1.9637 0.0346  -0.2124 -0.0843 3   LYS A NZ  
1235 N N   . LEU E 4   ? 2.5313 2.1145 1.9432 -0.0038 -0.2415 -0.0837 4   LEU A N   
1236 C CA  . LEU E 4   ? 2.4782 2.0939 1.9148 -0.0116 -0.2376 -0.0858 4   LEU A CA  
1237 C C   . LEU E 4   ? 2.5104 2.1465 1.9649 -0.0128 -0.2532 -0.0798 4   LEU A C   
1238 O O   . LEU E 4   ? 2.4896 2.1517 1.9607 -0.0190 -0.2530 -0.0809 4   LEU A O   
1239 C CB  . LEU E 4   ? 2.3678 1.9864 1.8107 -0.0125 -0.2282 -0.0884 4   LEU A CB  
1240 C CG  . LEU E 4   ? 2.2290 1.8783 1.6964 -0.0179 -0.2280 -0.0886 4   LEU A CG  
1241 C CD1 . LEU E 4   ? 2.1523 1.8171 1.6268 -0.0251 -0.2130 -0.0962 4   LEU A CD1 
1242 C CD2 . LEU E 4   ? 2.2152 1.8613 1.6870 -0.0144 -0.2295 -0.0858 4   LEU A CD2 
1243 N N   . ASP E 5   ? 2.5338 2.1582 1.9859 -0.0070 -0.2669 -0.0731 5   ASP A N   
1244 C CA  . ASP E 5   ? 2.5023 2.1458 1.9738 -0.0075 -0.2822 -0.0659 5   ASP A CA  
1245 C C   . ASP E 5   ? 2.4059 2.0672 1.8864 -0.0114 -0.2892 -0.0651 5   ASP A C   
1246 O O   . ASP E 5   ? 2.3936 2.0844 1.8968 -0.0163 -0.2915 -0.0635 5   ASP A O   
1247 C CB  . ASP E 5   ? 2.5370 2.1592 2.0005 0.0000  -0.2982 -0.0579 5   ASP A CB  
1248 C CG  . ASP E 5   ? 2.5562 2.1700 2.0204 0.0028  -0.2946 -0.0561 5   ASP A CG  
1249 O OD1 . ASP E 5   ? 2.5586 2.1943 2.0415 -0.0006 -0.2885 -0.0563 5   ASP A OD1 
1250 O OD2 . ASP E 5   ? 2.5625 2.1471 2.0080 0.0087  -0.2979 -0.0543 5   ASP A OD2 
1251 N N   . SER E 6   ? 2.3198 1.9628 1.7822 -0.0089 -0.2922 -0.0660 6   SER A N   
1252 C CA  . SER E 6   ? 2.2035 1.8598 1.6721 -0.0119 -0.2996 -0.0651 6   SER A CA  
1253 C C   . SER E 6   ? 2.0786 1.7665 1.5663 -0.0211 -0.2890 -0.0697 6   SER A C   
1254 O O   . SER E 6   ? 2.0142 1.7230 1.5168 -0.0249 -0.2970 -0.0674 6   SER A O   
1255 C CB  . SER E 6   ? 2.2543 1.8840 1.6973 -0.0076 -0.2991 -0.0671 6   SER A CB  
1256 O OG  . SER E 6   ? 2.2826 1.9098 1.7175 -0.0108 -0.2802 -0.0742 6   SER A OG  
1257 N N   . LEU E 7   ? 2.0463 1.7372 1.5336 -0.0247 -0.2717 -0.0762 7   LEU A N   
1258 C CA  . LEU E 7   ? 1.9859 1.7044 1.4896 -0.0336 -0.2616 -0.0809 7   LEU A CA  
1259 C C   . LEU E 7   ? 1.9245 1.6737 1.4539 -0.0376 -0.2644 -0.0789 7   LEU A C   
1260 O O   . LEU E 7   ? 1.8525 1.6259 1.3964 -0.0449 -0.2576 -0.0824 7   LEU A O   
1261 C CB  . LEU E 7   ? 1.9905 1.6999 1.4839 -0.0362 -0.2428 -0.0885 7   LEU A CB  
1262 C CG  . LEU E 7   ? 1.9388 1.6692 1.4434 -0.0452 -0.2331 -0.0932 7   LEU A CG  
1263 C CD1 . LEU E 7   ? 1.9077 1.6568 1.4247 -0.0484 -0.2445 -0.0896 7   LEU A CD1 
1264 C CD2 . LEU E 7   ? 1.9538 1.6662 1.4420 -0.0457 -0.2199 -0.0975 7   LEU A CD2 
1265 N N   . LEU E 8   ? 1.9340 1.6818 1.4689 -0.0326 -0.2739 -0.0729 8   LEU A N   
1266 C CA  . LEU E 8   ? 1.8991 1.6759 1.4585 -0.0350 -0.2774 -0.0692 8   LEU A CA  
1267 C C   . LEU E 8   ? 1.9076 1.7017 1.4835 -0.0349 -0.2948 -0.0611 8   LEU A C   
1268 O O   . LEU E 8   ? 1.8746 1.6957 1.4726 -0.0370 -0.2978 -0.0573 8   LEU A O   
1269 C CB  . LEU E 8   ? 1.8468 1.6162 1.4067 -0.0302 -0.2761 -0.0666 8   LEU A CB  
1270 C CG  . LEU E 8   ? 1.7768 1.5347 1.3250 -0.0312 -0.2585 -0.0748 8   LEU A CG  
1271 C CD1 . LEU E 8   ? 1.8003 1.5232 1.3246 -0.0253 -0.2580 -0.0753 8   LEU A CD1 
1272 C CD2 . LEU E 8   ? 1.7275 1.4992 1.2888 -0.0308 -0.2536 -0.0741 8   LEU A CD2 
1273 N N   . LYS E 9   ? 1.9448 1.7233 1.5098 -0.0320 -0.3062 -0.0581 9   LYS A N   
1274 C CA  . LYS E 9   ? 1.9501 1.7456 1.5303 -0.0330 -0.3223 -0.0516 9   LYS A CA  
1275 C C   . LYS E 9   ? 1.9465 1.7708 1.5419 -0.0415 -0.3153 -0.0559 9   LYS A C   
1276 O O   . LYS E 9   ? 1.9460 1.7977 1.5642 -0.0443 -0.3237 -0.0510 9   LYS A O   
1277 C CB  . LYS E 9   ? 2.4293 2.2011 1.9919 -0.0289 -0.3339 -0.0497 9   LYS A CB  
1278 C CG  . LYS E 9   ? 2.7814 2.5464 2.3295 -0.0327 -0.3234 -0.0575 9   LYS A CG  
1279 C CD  . LYS E 9   ? 2.6056 2.3747 2.1555 -0.0336 -0.3359 -0.0548 9   LYS A CD  
1280 C CE  . LYS E 9   ? 2.5987 2.3692 2.1414 -0.0388 -0.3243 -0.0615 9   LYS A CE  
1281 N NZ  . LYS E 9   ? 2.5738 2.3810 2.1417 -0.0484 -0.3189 -0.0634 9   LYS A NZ  
1282 N N   . GLU E 10  ? 1.9377 1.7549 1.5205 -0.0456 -0.3002 -0.0646 10  GLU A N   
1283 C CA  . GLU E 10  ? 1.9052 1.7435 1.4978 -0.0539 -0.2939 -0.0690 10  GLU A CA  
1284 C C   . GLU E 10  ? 1.8797 1.7509 1.4954 -0.0602 -0.2879 -0.0702 10  GLU A C   
1285 O O   . GLU E 10  ? 1.8677 1.7591 1.4939 -0.0678 -0.2825 -0.0738 10  GLU A O   
1286 C CB  . GLU E 10  ? 1.9401 1.7601 1.5132 -0.0562 -0.2794 -0.0767 10  GLU A CB  
1287 C CG  . GLU E 10  ? 1.9846 1.7733 1.5338 -0.0500 -0.2843 -0.0756 10  GLU A CG  
1288 C CD  . GLU E 10  ? 2.0472 1.8209 1.5797 -0.0523 -0.2691 -0.0819 10  GLU A CD  
1289 O OE1 . GLU E 10  ? 2.0394 1.8279 1.5805 -0.0596 -0.2559 -0.0870 10  GLU A OE1 
1290 O OE2 . GLU E 10  ? 2.0998 1.8463 1.6106 -0.0463 -0.2705 -0.0814 10  GLU A OE2 
1291 N N   . LEU E 11  ? 1.8501 1.7249 1.4724 -0.0565 -0.2883 -0.0674 11  LEU A N   
1292 C CA  . LEU E 11  ? 1.8449 1.7445 1.4837 -0.0601 -0.2804 -0.0691 11  LEU A CA  
1293 C C   . LEU E 11  ? 1.7525 1.6746 1.4136 -0.0575 -0.2938 -0.0594 11  LEU A C   
1294 O O   . LEU E 11  ? 1.7880 1.6995 1.4484 -0.0515 -0.3078 -0.0515 11  LEU A O   
1295 C CB  . LEU E 11  ? 1.9521 1.8335 1.5780 -0.0564 -0.2692 -0.0730 11  LEU A CB  
1296 C CG  . LEU E 11  ? 2.0547 1.9460 1.6853 -0.0581 -0.2560 -0.0779 11  LEU A CG  
1297 C CD1 . LEU E 11  ? 2.0927 2.0054 1.7426 -0.0551 -0.2631 -0.0705 11  LEU A CD1 
1298 C CD2 . LEU E 11  ? 2.0502 1.9572 1.6852 -0.0666 -0.2443 -0.0858 11  LEU A CD2 
1299 N N   . PRO E 12  ? 1.6815 1.6342 1.3624 -0.0618 -0.2897 -0.0595 12  PRO A N   
1300 C CA  . PRO E 12  ? 1.6388 1.6149 1.3427 -0.0587 -0.3014 -0.0493 12  PRO A CA  
1301 C C   . PRO E 12  ? 1.6960 1.6563 1.3960 -0.0500 -0.3053 -0.0430 12  PRO A C   
1302 O O   . PRO E 12  ? 1.6878 1.6345 1.3756 -0.0485 -0.2932 -0.0485 12  PRO A O   
1303 C CB  . PRO E 12  ? 1.5891 1.5944 1.3082 -0.0636 -0.2912 -0.0528 12  PRO A CB  
1304 C CG  . PRO E 12  ? 1.5643 1.5643 1.2708 -0.0714 -0.2769 -0.0648 12  PRO A CG  
1305 C CD  . PRO E 12  ? 1.6042 1.5732 1.2889 -0.0704 -0.2776 -0.0678 12  PRO A CD  
1306 N N   . THR E 13  ? 1.7066 1.6687 1.4176 -0.0448 -0.3220 -0.0316 13  THR A N   
1307 C CA  . THR E 13  ? 1.7565 1.7005 1.4631 -0.0368 -0.3271 -0.0247 13  THR A CA  
1308 C C   . THR E 13  ? 1.8499 1.7989 1.5588 -0.0346 -0.3139 -0.0263 13  THR A C   
1309 O O   . THR E 13  ? 1.9334 1.8581 1.6261 -0.0308 -0.3079 -0.0288 13  THR A O   
1310 C CB  . THR E 13  ? 1.6607 1.6131 1.3857 -0.0320 -0.3475 -0.0103 13  THR A CB  
1311 O OG1 . THR E 13  ? 1.6587 1.6479 1.4112 -0.0341 -0.3501 -0.0046 13  THR A OG1 
1312 C CG2 . THR E 13  ? 1.5979 1.5355 1.3146 -0.0322 -0.3616 -0.0088 13  THR A CG2 
1313 N N   . ARG E 14  ? 1.8684 1.8481 1.5966 -0.0367 -0.3095 -0.0250 14  ARG A N   
1314 C CA  . ARG E 14  ? 1.8847 1.8711 1.6158 -0.0339 -0.2975 -0.0260 14  ARG A CA  
1315 C C   . ARG E 14  ? 1.5062 1.4720 1.2147 -0.0359 -0.2803 -0.0389 14  ARG A C   
1316 O O   . ARG E 14  ? 1.5431 1.4911 1.2421 -0.0309 -0.2754 -0.0387 14  ARG A O   
1317 C CB  . ARG E 14  ? 1.8715 1.8946 1.6250 -0.0364 -0.2950 -0.0238 14  ARG A CB  
1318 C CG  . ARG E 14  ? 1.8865 1.9193 1.6446 -0.0324 -0.2837 -0.0235 14  ARG A CG  
1319 C CD  . ARG E 14  ? 1.8873 1.9028 1.6430 -0.0239 -0.2868 -0.0154 14  ARG A CD  
1320 N NE  . ARG E 14  ? 1.8401 1.8626 1.5986 -0.0195 -0.2752 -0.0152 14  ARG A NE  
1321 C CZ  . ARG E 14  ? 1.8485 1.8567 1.6043 -0.0125 -0.2743 -0.0095 14  ARG A CZ  
1322 N NH1 . ARG E 14  ? 1.9334 1.9190 1.6834 -0.0095 -0.2847 -0.0036 14  ARG A NH1 
1323 N NH2 . ARG E 14  ? 1.7783 1.7939 1.5364 -0.0084 -0.2631 -0.0097 14  ARG A NH2 
1324 N N   . THR E 15  ? 1.4532 1.4209 1.1538 -0.0432 -0.2717 -0.0495 15  THR A N   
1325 C CA  . THR E 15  ? 1.4226 1.3715 1.1034 -0.0455 -0.2563 -0.0612 15  THR A CA  
1326 C C   . THR E 15  ? 1.4386 1.3527 1.0982 -0.0422 -0.2573 -0.0626 15  THR A C   
1327 O O   . THR E 15  ? 1.4488 1.3449 1.0954 -0.0398 -0.2478 -0.0671 15  THR A O   
1328 C CB  . THR E 15  ? 1.0642 1.0236 0.7434 -0.0545 -0.2478 -0.0709 15  THR A CB  
1329 O OG1 . THR E 15  ? 1.1586 1.1404 0.8482 -0.0566 -0.2393 -0.0739 15  THR A OG1 
1330 C CG2 . THR E 15  ? 1.0465 0.9794 0.7034 -0.0572 -0.2374 -0.0807 15  THR A CG2 
1331 N N   . ALA E 16  ? 1.4424 1.3467 1.0983 -0.0418 -0.2691 -0.0586 16  ALA A N   
1332 C CA  . ALA E 16  ? 1.4758 1.3466 1.1107 -0.0379 -0.2712 -0.0592 16  ALA A CA  
1333 C C   . ALA E 16  ? 1.5147 1.3738 1.1488 -0.0308 -0.2728 -0.0535 16  ALA A C   
1334 O O   . ALA E 16  ? 1.5803 1.4140 1.1970 -0.0280 -0.2668 -0.0570 16  ALA A O   
1335 C CB  . ALA E 16  ? 1.4637 1.3279 1.0972 -0.0370 -0.2865 -0.0537 16  ALA A CB  
1336 N N   . HIS E 17  ? 1.4893 1.3690 1.1440 -0.0279 -0.2804 -0.0441 17  HIS A N   
1337 C CA  . HIS E 17  ? 1.5194 1.3922 1.1778 -0.0211 -0.2832 -0.0364 17  HIS A CA  
1338 C C   . HIS E 17  ? 1.5164 1.3867 1.1692 -0.0205 -0.2668 -0.0431 17  HIS A C   
1339 O O   . HIS E 17  ? 1.5255 1.3722 1.1647 -0.0169 -0.2626 -0.0444 17  HIS A O   
1340 C CB  . HIS E 17  ? 1.5177 1.4168 1.2022 -0.0183 -0.2944 -0.0239 17  HIS A CB  
1341 C CG  . HIS E 17  ? 1.5787 1.4723 1.2699 -0.0111 -0.2980 -0.0139 17  HIS A CG  
1342 N ND1 . HIS E 17  ? 1.6594 1.5231 1.3342 -0.0072 -0.2970 -0.0141 17  HIS A ND1 
1343 C CD2 . HIS E 17  ? 1.5806 1.4950 1.2939 -0.0069 -0.3024 -0.0028 17  HIS A CD2 
1344 C CE1 . HIS E 17  ? 1.6710 1.5370 1.3577 -0.0013 -0.3008 -0.0036 17  HIS A CE1 
1345 N NE2 . HIS E 17  ? 1.6350 1.5315 1.3451 -0.0008 -0.3039 0.0038  17  HIS A NE2 
1346 N N   . LEU E 18  ? 1.4484 1.3430 1.1117 -0.0239 -0.2578 -0.0472 18  LEU A N   
1347 C CA  . LEU E 18  ? 1.3995 1.2913 1.0563 -0.0234 -0.2423 -0.0546 18  LEU A CA  
1348 C C   . LEU E 18  ? 1.4070 1.2697 1.0404 -0.0251 -0.2335 -0.0644 18  LEU A C   
1349 O O   . LEU E 18  ? 1.4532 1.2990 1.0778 -0.0212 -0.2277 -0.0655 18  LEU A O   
1350 C CB  . LEU E 18  ? 1.3212 1.2391 0.9873 -0.0282 -0.2337 -0.0605 18  LEU A CB  
1351 C CG  . LEU E 18  ? 1.2575 1.1726 0.9143 -0.0298 -0.2172 -0.0713 18  LEU A CG  
1352 C CD1 . LEU E 18  ? 1.2325 1.1377 0.8752 -0.0374 -0.2091 -0.0834 18  LEU A CD1 
1353 C CD2 . LEU E 18  ? 1.2687 1.1647 0.9170 -0.0235 -0.2118 -0.0704 18  LEU A CD2 
1354 N N   . TYR E 19  ? 1.3928 1.2500 1.0171 -0.0306 -0.2326 -0.0709 19  TYR A N   
1355 C CA  . TYR E 19  ? 1.3959 1.2265 0.9990 -0.0320 -0.2244 -0.0791 19  TYR A CA  
1356 C C   . TYR E 19  ? 1.5184 1.3224 1.1101 -0.0255 -0.2297 -0.0742 19  TYR A C   
1357 O O   . TYR E 19  ? 1.5773 1.3627 1.1564 -0.0239 -0.2208 -0.0789 19  TYR A O   
1358 C CB  . TYR E 19  ? 1.2563 1.0847 0.8526 -0.0378 -0.2249 -0.0839 19  TYR A CB  
1359 C CG  . TYR E 19  ? 1.1411 0.9893 0.7440 -0.0453 -0.2162 -0.0913 19  TYR A CG  
1360 C CD1 . TYR E 19  ? 1.0906 0.9648 0.7095 -0.0466 -0.2142 -0.0907 19  TYR A CD1 
1361 C CD2 . TYR E 19  ? 1.1090 0.9494 0.7019 -0.0509 -0.2101 -0.0983 19  TYR A CD2 
1362 C CE1 . TYR E 19  ? 1.0465 0.9378 0.6706 -0.0536 -0.2069 -0.0975 19  TYR A CE1 
1363 C CE2 . TYR E 19  ? 1.0837 0.9415 0.6832 -0.0583 -0.2028 -0.1045 19  TYR A CE2 
1364 C CZ  . TYR E 19  ? 1.0495 0.9324 0.6643 -0.0598 -0.2016 -0.1043 19  TYR A CZ  
1365 O OH  . TYR E 19  ? 1.0378 0.9373 0.6586 -0.0672 -0.1951 -0.1104 19  TYR A OH  
1366 N N   . ARG E 20  ? 1.5932 1.3949 1.1896 -0.0220 -0.2447 -0.0645 20  ARG A N   
1367 C CA  . ARG E 20  ? 1.6705 1.4471 1.2572 -0.0157 -0.2509 -0.0588 20  ARG A CA  
1368 C C   . ARG E 20  ? 1.7412 1.5159 1.3309 -0.0120 -0.2433 -0.0578 20  ARG A C   
1369 O O   . ARG E 20  ? 1.7853 1.5371 1.3603 -0.0099 -0.2369 -0.0613 20  ARG A O   
1370 C CB  . ARG E 20  ? 1.7098 1.4880 1.3057 -0.0121 -0.2698 -0.0468 20  ARG A CB  
1371 C CG  . ARG E 20  ? 1.7521 1.5195 1.3377 -0.0136 -0.2787 -0.0475 20  ARG A CG  
1372 C CD  . ARG E 20  ? 1.8187 1.5745 1.4056 -0.0083 -0.2976 -0.0362 20  ARG A CD  
1373 N NE  . ARG E 20  ? 1.8743 1.6484 1.4748 -0.0103 -0.3105 -0.0311 20  ARG A NE  
1374 C CZ  . ARG E 20  ? 1.9851 1.7835 1.6097 -0.0095 -0.3198 -0.0217 20  ARG A CZ  
1375 N NH1 . ARG E 20  ? 2.0779 1.8845 1.7149 -0.0064 -0.3173 -0.0159 20  ARG A NH1 
1376 N NH2 . ARG E 20  ? 1.9918 1.8065 1.6287 -0.0116 -0.3315 -0.0174 20  ARG A NH2 
1377 N N   . SER E 21  ? 1.7353 1.5345 1.3440 -0.0111 -0.2434 -0.0530 21  SER A N   
1378 C CA  . SER E 21  ? 1.6889 1.4883 1.3017 -0.0070 -0.2359 -0.0512 21  SER A CA  
1379 C C   . SER E 21  ? 1.6361 1.4273 1.2364 -0.0092 -0.2188 -0.0634 21  SER A C   
1380 O O   . SER E 21  ? 1.7015 1.4729 1.2919 -0.0061 -0.2138 -0.0646 21  SER A O   
1381 C CB  . SER E 21  ? 1.7294 1.5582 1.3649 -0.0050 -0.2387 -0.0434 21  SER A CB  
1382 O OG  . SER E 21  ? 1.7548 1.6065 1.3967 -0.0101 -0.2328 -0.0498 21  SER A OG  
1383 N N   . ILE E 22  ? 1.4967 1.3030 1.0982 -0.0147 -0.2105 -0.0721 22  ILE A N   
1384 C CA  . ILE E 22  ? 1.4162 1.2151 1.0065 -0.0178 -0.1956 -0.0839 22  ILE A CA  
1385 C C   . ILE E 22  ? 1.4719 1.2405 1.0439 -0.0168 -0.1936 -0.0870 22  ILE A C   
1386 O O   . ILE E 22  ? 1.4677 1.2218 1.0323 -0.0141 -0.1863 -0.0896 22  ILE A O   
1387 C CB  . ILE E 22  ? 1.2837 1.0943 0.8731 -0.0253 -0.1910 -0.0923 22  ILE A CB  
1388 C CG1 . ILE E 22  ? 1.2217 1.0595 0.8245 -0.0273 -0.1864 -0.0943 22  ILE A CG1 
1389 C CG2 . ILE E 22  ? 1.2631 1.0539 0.8358 -0.0285 -0.1800 -0.1027 22  ILE A CG2 
1390 C CD1 . ILE E 22  ? 1.1871 1.0381 0.7915 -0.0351 -0.1843 -0.1008 22  ILE A CD1 
1391 N N   . TRP E 23  ? 1.5736 1.3329 1.1381 -0.0188 -0.2001 -0.0866 23  TRP A N   
1392 C CA  . TRP E 23  ? 1.7162 1.4470 1.2625 -0.0174 -0.1989 -0.0889 23  TRP A CA  
1393 C C   . TRP E 23  ? 1.7399 1.4531 1.2820 -0.0112 -0.2004 -0.0839 23  TRP A C   
1394 O O   . TRP E 23  ? 1.7677 1.4652 1.2996 -0.0104 -0.1908 -0.0893 23  TRP A O   
1395 C CB  . TRP E 23  ? 1.8098 1.5339 1.3509 -0.0176 -0.2104 -0.0848 23  TRP A CB  
1396 C CG  . TRP E 23  ? 1.9233 1.6177 1.4440 -0.0155 -0.2087 -0.0872 23  TRP A CG  
1397 C CD1 . TRP E 23  ? 1.9765 1.6495 1.4876 -0.0101 -0.2182 -0.0808 23  TRP A CD1 
1398 C CD2 . TRP E 23  ? 1.9957 1.6780 1.5032 -0.0185 -0.1968 -0.0960 23  TRP A CD2 
1399 N NE1 . TRP E 23  ? 2.0320 1.6805 1.5235 -0.0092 -0.2124 -0.0855 23  TRP A NE1 
1400 C CE2 . TRP E 23  ? 2.0321 1.6864 1.5220 -0.0142 -0.1990 -0.0945 23  TRP A CE2 
1401 C CE3 . TRP E 23  ? 1.9973 1.6896 1.5065 -0.0243 -0.1848 -0.1046 23  TRP A CE3 
1402 C CZ2 . TRP E 23  ? 2.0467 1.6837 1.5213 -0.0150 -0.1889 -0.1008 23  TRP A CZ2 
1403 C CZ3 . TRP E 23  ? 2.0087 1.6835 1.5038 -0.0256 -0.1755 -0.1105 23  TRP A CZ3 
1404 C CH2 . TRP E 23  ? 2.0245 1.6726 1.5029 -0.0208 -0.1772 -0.1083 23  TRP A CH2 
1405 N N   . HIS E 24  ? 1.7244 1.4402 1.2753 -0.0070 -0.2131 -0.0731 24  HIS A N   
1406 C CA  . HIS E 24  ? 1.7137 1.4132 1.2626 -0.0013 -0.2163 -0.0666 24  HIS A CA  
1407 C C   . HIS E 24  ? 1.7796 1.4800 1.3301 -0.0002 -0.2033 -0.0709 24  HIS A C   
1408 O O   . HIS E 24  ? 1.8578 1.5371 1.3974 0.0020  -0.1986 -0.0726 24  HIS A O   
1409 C CB  . HIS E 24  ? 1.6717 1.3811 1.2360 0.0025  -0.2312 -0.0533 24  HIS A CB  
1410 C CG  . HIS E 24  ? 1.7213 1.4122 1.2837 0.0080  -0.2365 -0.0452 24  HIS A CG  
1411 N ND1 . HIS E 24  ? 1.7783 1.4436 1.3274 0.0104  -0.2459 -0.0416 24  HIS A ND1 
1412 C CD2 . HIS E 24  ? 1.7529 1.4467 1.3249 0.0117  -0.2337 -0.0398 24  HIS A CD2 
1413 C CE1 . HIS E 24  ? 1.8634 1.5167 1.4145 0.0148  -0.2491 -0.0342 24  HIS A CE1 
1414 N NE2 . HIS E 24  ? 1.8351 1.5055 1.4006 0.0156  -0.2416 -0.0328 24  HIS A NE2 
1415 N N   . LYS E 25  ? 1.7428 1.4668 1.3060 -0.0016 -0.1976 -0.0727 25  LYS A N   
1416 C CA  . LYS E 25  ? 1.7020 1.4264 1.2651 -0.0005 -0.1850 -0.0779 25  LYS A CA  
1417 C C   . LYS E 25  ? 1.7165 1.4231 1.2630 -0.0037 -0.1738 -0.0895 25  LYS A C   
1418 O O   . LYS E 25  ? 1.7702 1.4572 1.3080 -0.0011 -0.1698 -0.0904 25  LYS A O   
1419 C CB  . LYS E 25  ? 1.6438 1.3958 1.2206 -0.0016 -0.1804 -0.0793 25  LYS A CB  
1420 C CG  . LYS E 25  ? 1.6277 1.3809 1.2048 0.0008  -0.1685 -0.0836 25  LYS A CG  
1421 C CD  . LYS E 25  ? 1.6088 1.3724 1.2000 0.0073  -0.1718 -0.0725 25  LYS A CD  
1422 C CE  . LYS E 25  ? 1.5987 1.3744 1.1934 0.0093  -0.1601 -0.0772 25  LYS A CE  
1423 N NZ  . LYS E 25  ? 1.5629 1.3624 1.1639 0.0060  -0.1578 -0.0816 25  LYS A NZ  
1424 N N   . TYR E 26  ? 1.6674 1.3811 1.2107 -0.0093 -0.1692 -0.0975 26  TYR A N   
1425 C CA  . TYR E 26  ? 1.6535 1.3537 1.1840 -0.0127 -0.1583 -0.1080 26  TYR A CA  
1426 C C   . TYR E 26  ? 1.6854 1.3574 1.2013 -0.0102 -0.1582 -0.1076 26  TYR A C   
1427 O O   . TYR E 26  ? 1.7155 1.3744 1.2239 -0.0101 -0.1489 -0.1134 26  TYR A O   
1428 C CB  . TYR E 26  ? 1.5984 1.3083 1.1282 -0.0191 -0.1568 -0.1137 26  TYR A CB  
1429 C CG  . TYR E 26  ? 1.5695 1.2657 1.0877 -0.0228 -0.1466 -0.1230 26  TYR A CG  
1430 C CD1 . TYR E 26  ? 1.5475 1.2409 1.0642 -0.0233 -0.1360 -0.1299 26  TYR A CD1 
1431 C CD2 . TYR E 26  ? 1.5692 1.2553 1.0785 -0.0254 -0.1476 -0.1242 26  TYR A CD2 
1432 C CE1 . TYR E 26  ? 1.5456 1.2268 1.0535 -0.0268 -0.1274 -0.1375 26  TYR A CE1 
1433 C CE2 . TYR E 26  ? 1.5635 1.2377 1.0639 -0.0285 -0.1381 -0.1313 26  TYR A CE2 
1434 C CZ  . TYR E 26  ? 1.5362 1.2082 1.0366 -0.0293 -0.1284 -0.1377 26  TYR A CZ  
1435 O OH  . TYR E 26  ? 1.5092 1.1695 1.0024 -0.0324 -0.1198 -0.1439 26  TYR A OH  
1436 N N   . THR E 27  ? 1.6828 1.3453 1.1942 -0.0083 -0.1689 -0.1010 27  THR A N   
1437 C CA  . THR E 27  ? 1.7058 1.3412 1.2033 -0.0047 -0.1704 -0.0989 27  THR A CA  
1438 C C   . THR E 27  ? 1.8155 1.4426 1.3155 -0.0001 -0.1696 -0.0948 27  THR A C   
1439 O O   . THR E 27  ? 1.8482 1.4616 1.3410 0.0006  -0.1606 -0.0996 27  THR A O   
1440 C CB  . THR E 27  ? 1.6367 1.2631 1.1289 -0.0025 -0.1839 -0.0916 27  THR A CB  
1441 O OG1 . THR E 27  ? 1.6495 1.2842 1.1538 0.0009  -0.1951 -0.0817 27  THR A OG1 
1442 C CG2 . THR E 27  ? 1.5908 1.2281 1.0829 -0.0068 -0.1861 -0.0943 27  THR A CG2 
1443 N N   . GLU E 28  ? 1.9109 1.5473 1.4227 0.0031  -0.1791 -0.0853 28  GLU A N   
1444 C CA  . GLU E 28  ? 2.0271 1.6557 1.5430 0.0078  -0.1802 -0.0789 28  GLU A CA  
1445 C C   . GLU E 28  ? 2.0618 1.6917 1.5788 0.0077  -0.1664 -0.0856 28  GLU A C   
1446 O O   . GLU E 28  ? 2.0991 1.7172 1.6155 0.0111  -0.1643 -0.0827 28  GLU A O   
1447 C CB  . GLU E 28  ? 2.0959 1.7413 1.6289 0.0106  -0.1908 -0.0676 28  GLU A CB  
1448 C CG  . GLU E 28  ? 2.1793 1.8102 1.7113 0.0143  -0.2055 -0.0564 28  GLU A CG  
1449 C CD  . GLU E 28  ? 2.2642 1.8772 1.7797 0.0132  -0.2114 -0.0587 28  GLU A CD  
1450 O OE1 . GLU E 28  ? 2.2998 1.8910 1.8065 0.0165  -0.2197 -0.0531 28  GLU A OE1 
1451 O OE2 . GLU E 28  ? 2.2933 1.9135 1.8044 0.0093  -0.2077 -0.0661 28  GLU A OE2 
1452 N N   . TRP E 29  ? 2.0260 1.6707 1.5453 0.0038  -0.1579 -0.0943 29  TRP A N   
1453 C CA  . TRP E 29  ? 1.9695 1.6147 1.4872 0.0027  -0.1446 -0.1032 29  TRP A CA  
1454 C C   . TRP E 29  ? 1.9718 1.5955 1.4747 0.0008  -0.1382 -0.1103 29  TRP A C   
1455 O O   . TRP E 29  ? 1.9809 1.5907 1.4795 0.0029  -0.1323 -0.1121 29  TRP A O   
1456 C CB  . TRP E 29  ? 1.9145 1.5817 1.4387 -0.0013 -0.1399 -0.1096 29  TRP A CB  
1457 C CG  . TRP E 29  ? 1.8832 1.5504 1.4048 -0.0027 -0.1274 -0.1193 29  TRP A CG  
1458 C CD1 . TRP E 29  ? 1.8786 1.5498 1.4051 0.0008  -0.1217 -0.1196 29  TRP A CD1 
1459 C CD2 . TRP E 29  ? 1.8466 1.5091 1.3605 -0.0078 -0.1195 -0.1298 29  TRP A CD2 
1460 N NE1 . TRP E 29  ? 1.8676 1.5361 1.3889 -0.0017 -0.1114 -0.1303 29  TRP A NE1 
1461 C CE2 . TRP E 29  ? 1.8432 1.5065 1.3574 -0.0072 -0.1102 -0.1364 29  TRP A CE2 
1462 C CE3 . TRP E 29  ? 1.8200 1.4774 1.3270 -0.0125 -0.1196 -0.1338 29  TRP A CE3 
1463 C CZ2 . TRP E 29  ? 1.8185 1.4774 1.3270 -0.0115 -0.1020 -0.1466 29  TRP A CZ2 
1464 C CZ3 . TRP E 29  ? 1.7925 1.4461 1.2947 -0.0168 -0.1107 -0.1432 29  TRP A CZ3 
1465 C CH2 . TRP E 29  ? 1.7917 1.4460 1.2950 -0.0164 -0.1026 -0.1495 29  TRP A CH2 
1466 N N   . LEU E 30  ? 1.9723 1.5943 1.4684 -0.0029 -0.1392 -0.1139 30  LEU A N   
1467 C CA  . LEU E 30  ? 2.0143 1.6185 1.4975 -0.0048 -0.1326 -0.1201 30  LEU A CA  
1468 C C   . LEU E 30  ? 2.0989 1.6790 1.5724 -0.0004 -0.1341 -0.1162 30  LEU A C   
1469 O O   . LEU E 30  ? 2.1231 1.6871 1.5866 -0.0007 -0.1275 -0.1206 30  LEU A O   
1470 C CB  . LEU E 30  ? 1.9812 1.5869 1.4594 -0.0079 -0.1364 -0.1208 30  LEU A CB  
1471 C CG  . LEU E 30  ? 1.9837 1.5834 1.4544 -0.0121 -0.1273 -0.1286 30  LEU A CG  
1472 C CD1 . LEU E 30  ? 1.9726 1.5870 1.4514 -0.0163 -0.1188 -0.1363 30  LEU A CD1 
1473 C CD2 . LEU E 30  ? 2.0051 1.6072 1.4719 -0.0144 -0.1322 -0.1273 30  LEU A CD2 
1474 N N   . LYS E 31  ? 2.1647 1.7427 1.6420 0.0036  -0.1432 -0.1073 31  LYS A N   
1475 C CA  . LYS E 31  ? 2.2585 1.8145 1.7282 0.0078  -0.1459 -0.1025 31  LYS A CA  
1476 C C   . LYS E 31  ? 2.3514 1.9049 1.8252 0.0089  -0.1367 -0.1054 31  LYS A C   
1477 O O   . LYS E 31  ? 2.3834 1.9200 1.8529 0.0120  -0.1371 -0.1020 31  LYS A O   
1478 C CB  . LYS E 31  ? 2.2491 1.8052 1.7237 0.0112  -0.1598 -0.0912 31  LYS A CB  
1479 C CG  . LYS E 31  ? 2.2510 1.7829 1.7168 0.0154  -0.1656 -0.0849 31  LYS A CG  
1480 C CD  . LYS E 31  ? 2.2734 1.7842 1.7210 0.0155  -0.1633 -0.0890 31  LYS A CD  
1481 C CE  . LYS E 31  ? 2.3555 1.8415 1.7931 0.0199  -0.1695 -0.0827 31  LYS A CE  
1482 N NZ  . LYS E 31  ? 2.4194 1.9074 1.8688 0.0222  -0.1748 -0.0746 31  LYS A NZ  
1483 N N   . THR E 32  ? 2.3923 1.9624 1.8741 0.0065  -0.1287 -0.1116 32  THR A N   
1484 C CA  . THR E 32  ? 2.4317 2.0000 1.9169 0.0076  -0.1196 -0.1153 32  THR A CA  
1485 C C   . THR E 32  ? 2.5048 2.0628 1.9818 0.0049  -0.1091 -0.1252 32  THR A C   
1486 O O   . THR E 32  ? 2.5016 2.0553 1.9799 0.0056  -0.1015 -0.1293 32  THR A O   
1487 C CB  . THR E 32  ? 2.4084 1.9990 1.9061 0.0078  -0.1170 -0.1162 32  THR A CB  
1488 O OG1 . THR E 32  ? 2.4009 1.9990 1.9081 0.0116  -0.1257 -0.1053 32  THR A OG1 
1489 C CG2 . THR E 32  ? 2.4155 2.0039 1.9144 0.0086  -0.1061 -0.1225 32  THR A CG2 
1490 N N   . MET E 33  ? 2.5983 2.1518 2.0675 0.0020  -0.1090 -0.1285 33  MET A N   
1491 C CA  . MET E 33  ? 2.7110 2.2558 2.1744 -0.0007 -0.0993 -0.1367 33  MET A CA  
1492 C C   . MET E 33  ? 2.7738 2.2968 2.2251 0.0011  -0.0998 -0.1345 33  MET A C   
1493 O O   . MET E 33  ? 2.8065 2.3214 2.2525 0.0040  -0.1081 -0.1274 33  MET A O   
1494 C CB  . MET E 33  ? 2.7422 2.3012 2.2082 -0.0058 -0.0964 -0.1428 33  MET A CB  
1495 C CG  . MET E 33  ? 2.7531 2.3330 2.2297 -0.0074 -0.0952 -0.1458 33  MET A CG  
1496 S SD  . MET E 33  ? 3.7802 3.3586 3.2618 -0.0036 -0.0898 -0.1470 33  MET A SD  
1497 C CE  . MET E 33  ? 1.2808 0.8850 0.7735 -0.0034 -0.0920 -0.1464 33  MET A CE  
1498 N N   . PRO E 34  ? 2.8005 2.3137 2.2473 -0.0004 -0.0912 -0.1402 34  PRO A N   
1499 C CA  . PRO E 34  ? 2.8525 2.3444 2.2877 0.0024  -0.0906 -0.1376 34  PRO A CA  
1500 C C   . PRO E 34  ? 2.9287 2.4154 2.3543 0.0028  -0.0954 -0.1343 34  PRO A C   
1501 O O   . PRO E 34  ? 2.9236 2.3942 2.3387 0.0070  -0.1004 -0.1288 34  PRO A O   
1502 C CB  . PRO E 34  ? 2.8305 2.3163 2.2660 0.0005  -0.0797 -0.1443 34  PRO A CB  
1503 C CG  . PRO E 34  ? 2.8109 2.3148 2.2564 -0.0041 -0.0758 -0.1510 34  PRO A CG  
1504 C CD  . PRO E 34  ? 2.7966 2.3176 2.2480 -0.0046 -0.0827 -0.1486 34  PRO A CD  
1505 N N   . ASP E 35  ? 3.0241 2.5242 2.4528 -0.0013 -0.0943 -0.1375 35  ASP A N   
1506 C CA  . ASP E 35  ? 3.0973 2.5931 2.5175 -0.0014 -0.0963 -0.1356 35  ASP A CA  
1507 C C   . ASP E 35  ? 3.1343 2.6495 2.5626 -0.0071 -0.0950 -0.1396 35  ASP A C   
1508 O O   . ASP E 35  ? 3.1475 2.6734 2.5775 -0.0081 -0.1023 -0.1369 35  ASP A O   
1509 C CB  . ASP E 35  ? 3.0983 2.5767 2.5095 0.0001  -0.0884 -0.1368 35  ASP A CB  
1510 C CG  . ASP E 35  ? 3.0656 2.5469 2.4850 -0.0031 -0.0783 -0.1433 35  ASP A CG  
1511 O OD1 . ASP E 35  ? 3.0698 2.5381 2.4846 -0.0018 -0.0715 -0.1439 35  ASP A OD1 
1512 O OD2 . ASP E 35  ? 3.0268 2.5231 2.4571 -0.0064 -0.0774 -0.1475 35  ASP A OD2 
1513 N N   . ASP E 40  ? 3.0858 2.5896 2.4751 -0.0028 -0.1205 -0.1219 40  ASP A N   
1514 C CA  . ASP E 40  ? 3.0581 2.5605 2.4434 0.0006  -0.1344 -0.1165 40  ASP A CA  
1515 C C   . ASP E 40  ? 3.0417 2.5553 2.4284 -0.0018 -0.1402 -0.1150 40  ASP A C   
1516 O O   . ASP E 40  ? 3.0757 2.5904 2.4611 0.0004  -0.1525 -0.1106 40  ASP A O   
1517 C CB  . ASP E 40  ? 3.1034 2.5784 2.4702 0.0085  -0.1379 -0.1121 40  ASP A CB  
1518 C CG  . ASP E 40  ? 3.1404 2.6106 2.5067 0.0121  -0.1505 -0.1071 40  ASP A CG  
1519 O OD1 . ASP E 40  ? 3.1416 2.6298 2.5218 0.0092  -0.1577 -0.1058 40  ASP A OD1 
1520 O OD2 . ASP E 40  ? 3.1689 2.6159 2.5199 0.0182  -0.1533 -0.1038 40  ASP A OD2 
1521 N N   . LEU E 41  ? 3.0232 2.5452 2.4134 -0.0065 -0.1319 -0.1184 41  LEU A N   
1522 C CA  . LEU E 41  ? 2.9898 2.5289 2.3869 -0.0107 -0.1369 -0.1178 41  LEU A CA  
1523 C C   . LEU E 41  ? 2.9524 2.5156 2.3678 -0.0191 -0.1307 -0.1231 41  LEU A C   
1524 O O   . LEU E 41  ? 2.9603 2.5400 2.3882 -0.0215 -0.1353 -0.1239 41  LEU A O   
1525 C CB  . LEU E 41  ? 2.9617 2.4892 2.3460 -0.0088 -0.1340 -0.1159 41  LEU A CB  
1526 C CG  . LEU E 41  ? 2.9268 2.4397 2.2960 -0.0020 -0.1457 -0.1104 41  LEU A CG  
1527 C CD1 . LEU E 41  ? 2.9260 2.4165 2.2821 0.0055  -0.1497 -0.1076 41  LEU A CD1 
1528 C CD2 . LEU E 41  ? 2.9085 2.4109 2.2649 0.0003  -0.1425 -0.1085 41  LEU A CD2 
1529 N N   . LYS E 42  ? 2.8987 2.4624 2.3154 -0.0229 -0.1199 -0.1263 42  LYS A N   
1530 C CA  . LYS E 42  ? 2.8113 2.3960 2.2441 -0.0311 -0.1146 -0.1314 42  LYS A CA  
1531 C C   . LYS E 42  ? 2.7707 2.3564 2.2098 -0.0326 -0.1078 -0.1362 42  LYS A C   
1532 O O   . LYS E 42  ? 2.7658 2.3697 2.2178 -0.0376 -0.1075 -0.1400 42  LYS A O   
1533 C CB  . LYS E 42  ? 2.7490 2.3357 2.1828 -0.0355 -0.1075 -0.1320 42  LYS A CB  
1534 C CG  . LYS E 42  ? 2.6889 2.2600 2.1084 -0.0305 -0.1087 -0.1270 42  LYS A CG  
1535 C CD  . LYS E 42  ? 2.6163 2.1950 2.0404 -0.0358 -0.1033 -0.1267 42  LYS A CD  
1536 C CE  . LYS E 42  ? 2.5927 2.1503 2.0006 -0.0296 -0.0994 -0.1221 42  LYS A CE  
1537 N NZ  . LYS E 42  ? 2.5947 2.1387 1.9877 -0.0215 -0.1094 -0.1184 42  LYS A NZ  
1538 N N   . LEU E 43  ? 2.7504 2.3165 2.1804 -0.0282 -0.1018 -0.1361 43  LEU A N   
1539 C CA  . LEU E 43  ? 2.7140 2.2797 2.1498 -0.0295 -0.0951 -0.1408 43  LEU A CA  
1540 C C   . LEU E 43  ? 2.6758 2.2525 2.1188 -0.0290 -0.1010 -0.1419 43  LEU A C   
1541 O O   . LEU E 43  ? 2.6402 2.2226 2.0907 -0.0312 -0.0966 -0.1465 43  LEU A O   
1542 C CB  . LEU E 43  ? 2.6972 2.2398 2.1219 -0.0239 -0.0893 -0.1394 43  LEU A CB  
1543 C CG  . LEU E 43  ? 2.6590 2.1843 2.0686 -0.0163 -0.0955 -0.1335 43  LEU A CG  
1544 C CD1 . LEU E 43  ? 2.6571 2.1648 2.0596 -0.0108 -0.0935 -0.1329 43  LEU A CD1 
1545 C CD2 . LEU E 43  ? 2.6361 2.1511 2.0355 -0.0145 -0.0925 -0.1301 43  LEU A CD2 
1546 N N   . PHE E 44  ? 2.6756 2.2549 2.1168 -0.0259 -0.1112 -0.1372 44  PHE A N   
1547 C CA  . PHE E 44  ? 2.6544 2.2457 2.1042 -0.0251 -0.1172 -0.1366 44  PHE A CA  
1548 C C   . PHE E 44  ? 2.5758 2.1915 2.0398 -0.0314 -0.1163 -0.1406 44  PHE A C   
1549 O O   . PHE E 44  ? 2.6038 2.2305 2.0762 -0.0315 -0.1168 -0.1422 44  PHE A O   
1550 C CB  . PHE E 44  ? 2.6906 2.2797 2.1368 -0.0207 -0.1293 -0.1295 44  PHE A CB  
1551 C CG  . PHE E 44  ? 2.7493 2.3159 2.1838 -0.0140 -0.1314 -0.1258 44  PHE A CG  
1552 C CD1 . PHE E 44  ? 2.7715 2.3366 2.2074 -0.0098 -0.1411 -0.1203 44  PHE A CD1 
1553 C CD2 . PHE E 44  ? 2.8132 2.3602 2.2364 -0.0119 -0.1232 -0.1276 44  PHE A CD2 
1554 C CE1 . PHE E 44  ? 2.8393 2.3827 2.2644 -0.0041 -0.1430 -0.1169 44  PHE A CE1 
1555 C CE2 . PHE E 44  ? 2.9101 2.4363 2.3224 -0.0059 -0.1246 -0.1244 44  PHE A CE2 
1556 C CZ  . PHE E 44  ? 2.9410 2.4648 2.3537 -0.0022 -0.1346 -0.1192 44  PHE A CZ  
1557 N N   . LEU E 45  ? 2.4613 2.0849 1.9275 -0.0365 -0.1146 -0.1421 45  LEU A N   
1558 C CA  . LEU E 45  ? 2.3371 1.9828 1.8159 -0.0431 -0.1134 -0.1461 45  LEU A CA  
1559 C C   . LEU E 45  ? 2.2531 1.8961 1.7331 -0.0482 -0.1033 -0.1518 45  LEU A C   
1560 O O   . LEU E 45  ? 2.2431 1.8805 1.7197 -0.0506 -0.1000 -0.1510 45  LEU A O   
1561 C CB  . LEU E 45  ? 2.3187 1.9787 1.8021 -0.0459 -0.1207 -0.1427 45  LEU A CB  
1562 C CG  . LEU E 45  ? 2.3427 2.0061 1.8266 -0.0411 -0.1322 -0.1363 45  LEU A CG  
1563 C CD1 . LEU E 45  ? 2.3216 2.0042 1.8141 -0.0450 -0.1394 -0.1339 45  LEU A CD1 
1564 C CD2 . LEU E 45  ? 2.3780 2.0482 1.8687 -0.0384 -0.1337 -0.1363 45  LEU A CD2 
1565 N N   . SER E 46  ? 2.2238 1.8699 1.7085 -0.0494 -0.0986 -0.1570 46  SER A N   
1566 C CA  . SER E 46  ? 2.2537 1.8989 1.7416 -0.0546 -0.0905 -0.1628 46  SER A CA  
1567 C C   . SER E 46  ? 2.2802 1.9382 1.7756 -0.0565 -0.0897 -0.1683 46  SER A C   
1568 O O   . SER E 46  ? 2.3282 1.9874 1.8236 -0.0517 -0.0921 -0.1677 46  SER A O   
1569 C CB  . SER E 46  ? 2.2832 1.9063 1.7631 -0.0516 -0.0837 -0.1630 46  SER A CB  
1570 O OG  . SER E 46  ? 2.3132 1.9350 1.7975 -0.0549 -0.0772 -0.1691 46  SER A OG  
1571 N N   . GLN E 47  ? 2.2534 1.9198 1.7549 -0.0630 -0.0862 -0.1734 47  GLN A N   
1572 C CA  . GLN E 47  ? 2.1995 1.8800 1.7073 -0.0651 -0.0864 -0.1787 47  GLN A CA  
1573 C C   . GLN E 47  ? 2.1989 1.8724 1.7037 -0.0591 -0.0845 -0.1808 47  GLN A C   
1574 O O   . GLN E 47  ? 2.2177 1.9032 1.7259 -0.0568 -0.0870 -0.1815 47  GLN A O   
1575 C CB  . GLN E 47  ? 2.1631 1.8458 1.6752 -0.0725 -0.0820 -0.1844 47  GLN A CB  
1576 C CG  . GLN E 47  ? 2.1575 1.8453 1.6732 -0.0786 -0.0828 -0.1816 47  GLN A CG  
1577 C CD  . GLN E 47  ? 2.2128 1.8968 1.7322 -0.0856 -0.0780 -0.1856 47  GLN A CD  
1578 O OE1 . GLN E 47  ? 2.3406 2.0107 1.8576 -0.0848 -0.0733 -0.1885 47  GLN A OE1 
1579 N NE2 . GLN E 47  ? 2.1505 1.8469 1.6767 -0.0927 -0.0796 -0.1851 47  GLN A NE2 
1580 N N   . LYS E 48  ? 2.1808 1.8349 1.6794 -0.0563 -0.0799 -0.1813 48  LYS A N   
1581 C CA  . LYS E 48  ? 2.1439 1.7897 1.6398 -0.0509 -0.0775 -0.1833 48  LYS A CA  
1582 C C   . LYS E 48  ? 2.0868 1.7392 1.5832 -0.0450 -0.0828 -0.1784 48  LYS A C   
1583 O O   . LYS E 48  ? 2.1106 1.7711 1.6100 -0.0427 -0.0827 -0.1805 48  LYS A O   
1584 C CB  . LYS E 48  ? 2.1400 1.7641 1.6295 -0.0483 -0.0729 -0.1825 48  LYS A CB  
1585 C CG  . LYS E 48  ? 2.1126 1.7287 1.6032 -0.0533 -0.0672 -0.1865 48  LYS A CG  
1586 C CD  . LYS E 48  ? 2.0832 1.6802 1.5681 -0.0506 -0.0636 -0.1827 48  LYS A CD  
1587 C CE  . LYS E 48  ? 2.0450 1.6312 1.5239 -0.0433 -0.0644 -0.1798 48  LYS A CE  
1588 N NZ  . LYS E 48  ? 2.0255 1.5931 1.4979 -0.0402 -0.0609 -0.1759 48  LYS A NZ  
1589 N N   . TYR E 49  ? 2.0073 1.6555 1.5006 -0.0423 -0.0877 -0.1714 49  TYR A N   
1590 C CA  . TYR E 49  ? 1.9679 1.6185 1.4618 -0.0364 -0.0935 -0.1654 49  TYR A CA  
1591 C C   . TYR E 49  ? 1.8490 1.5224 1.3518 -0.0371 -0.0992 -0.1633 49  TYR A C   
1592 O O   . TYR E 49  ? 1.8299 1.5098 1.3367 -0.0326 -0.1013 -0.1606 49  TYR A O   
1593 C CB  . TYR E 49  ? 2.0524 1.6900 1.5394 -0.0331 -0.0981 -0.1586 49  TYR A CB  
1594 C CG  . TYR E 49  ? 2.1519 1.7676 1.6298 -0.0321 -0.0924 -0.1598 49  TYR A CG  
1595 C CD1 . TYR E 49  ? 2.1973 1.7990 1.6716 -0.0278 -0.0889 -0.1603 49  TYR A CD1 
1596 C CD2 . TYR E 49  ? 2.2039 1.8135 1.6777 -0.0352 -0.0902 -0.1599 49  TYR A CD2 
1597 C CE1 . TYR E 49  ? 2.2354 1.8180 1.7023 -0.0267 -0.0836 -0.1610 49  TYR A CE1 
1598 C CE2 . TYR E 49  ? 2.2508 1.8411 1.7170 -0.0336 -0.0845 -0.1601 49  TYR A CE2 
1599 C CZ  . TYR E 49  ? 2.2642 1.8414 1.7272 -0.0294 -0.0814 -0.1607 49  TYR A CZ  
1600 O OH  . TYR E 49  ? 2.2759 1.8347 1.7322 -0.0276 -0.0757 -0.1604 49  TYR A OH  
1601 N N   . ILE E 50  ? 1.7647 1.4503 1.2713 -0.0425 -0.1015 -0.1638 50  ILE A N   
1602 C CA  . ILE E 50  ? 1.7067 1.4153 1.2229 -0.0436 -0.1070 -0.1616 50  ILE A CA  
1603 C C   . ILE E 50  ? 1.6765 1.3958 1.1969 -0.0439 -0.1025 -0.1673 50  ILE A C   
1604 O O   . ILE E 50  ? 1.6950 1.4271 1.2212 -0.0400 -0.1053 -0.1642 50  ILE A O   
1605 C CB  . ILE E 50  ? 1.6074 1.3269 1.1271 -0.0502 -0.1098 -0.1615 50  ILE A CB  
1606 C CG1 . ILE E 50  ? 1.6182 1.3239 1.1311 -0.0497 -0.1126 -0.1570 50  ILE A CG1 
1607 C CG2 . ILE E 50  ? 1.5631 1.3068 1.0937 -0.0508 -0.1167 -0.1579 50  ILE A CG2 
1608 C CD1 . ILE E 50  ? 1.6149 1.3293 1.1307 -0.0561 -0.1142 -0.1570 50  ILE A CD1 
1609 N N   . VAL E 51  ? 1.6371 1.3504 1.1544 -0.0480 -0.0959 -0.1751 51  VAL A N   
1610 C CA  . VAL E 51  ? 1.6456 1.3651 1.1641 -0.0479 -0.0916 -0.1816 51  VAL A CA  
1611 C C   . VAL E 51  ? 1.6817 1.3951 1.1981 -0.0402 -0.0896 -0.1804 51  VAL A C   
1612 O O   . VAL E 51  ? 1.7161 1.4423 1.2364 -0.0367 -0.0899 -0.1798 51  VAL A O   
1613 C CB  . VAL E 51  ? 1.6361 1.3458 1.1508 -0.0533 -0.0856 -0.1898 51  VAL A CB  
1614 C CG1 . VAL E 51  ? 1.6674 1.3802 1.1811 -0.0522 -0.0819 -0.1968 51  VAL A CG1 
1615 C CG2 . VAL E 51  ? 1.5850 1.3027 1.1035 -0.0613 -0.0874 -0.1905 51  VAL A CG2 
1616 N N   . LYS E 52  ? 1.6633 1.3572 1.1737 -0.0373 -0.0871 -0.1795 52  LYS A N   
1617 C CA  . LYS E 52  ? 1.6467 1.3336 1.1555 -0.0303 -0.0852 -0.1776 52  LYS A CA  
1618 C C   . LYS E 52  ? 1.6352 1.3354 1.1507 -0.0252 -0.0912 -0.1690 52  LYS A C   
1619 O O   . LYS E 52  ? 1.6539 1.3616 1.1725 -0.0206 -0.0896 -0.1683 52  LYS A O   
1620 C CB  . LYS E 52  ? 1.6496 1.3144 1.1519 -0.0282 -0.0832 -0.1762 52  LYS A CB  
1621 C CG  . LYS E 52  ? 1.6624 1.3194 1.1639 -0.0214 -0.0814 -0.1737 52  LYS A CG  
1622 C CD  . LYS E 52  ? 1.7146 1.3495 1.2095 -0.0205 -0.0773 -0.1752 52  LYS A CD  
1623 C CE  . LYS E 52  ? 1.8161 1.4439 1.3111 -0.0141 -0.0757 -0.1722 52  LYS A CE  
1624 N NZ  . LYS E 52  ? 1.8970 1.5350 1.3951 -0.0118 -0.0720 -0.1762 52  LYS A NZ  
1625 N N   . TYR E 53  ? 1.6257 1.3283 1.1435 -0.0258 -0.0983 -0.1619 53  TYR A N   
1626 C CA  . TYR E 53  ? 1.6382 1.3533 1.1639 -0.0214 -0.1056 -0.1526 53  TYR A CA  
1627 C C   . TYR E 53  ? 1.6214 1.3594 1.1555 -0.0212 -0.1055 -0.1533 53  TYR A C   
1628 O O   . TYR E 53  ? 1.6070 1.3519 1.1458 -0.0153 -0.1050 -0.1494 53  TYR A O   
1629 C CB  . TYR E 53  ? 1.6712 1.3871 1.1979 -0.0234 -0.1141 -0.1464 53  TYR A CB  
1630 C CG  . TYR E 53  ? 1.6998 1.4299 1.2365 -0.0196 -0.1233 -0.1362 53  TYR A CG  
1631 C CD1 . TYR E 53  ? 1.6820 1.4343 1.2282 -0.0222 -0.1281 -0.1342 53  TYR A CD1 
1632 C CD2 . TYR E 53  ? 1.7307 1.4519 1.2683 -0.0135 -0.1276 -0.1281 53  TYR A CD2 
1633 C CE1 . TYR E 53  ? 1.6641 1.4299 1.2210 -0.0186 -0.1370 -0.1241 53  TYR A CE1 
1634 C CE2 . TYR E 53  ? 1.7160 1.4499 1.2642 -0.0100 -0.1368 -0.1178 53  TYR A CE2 
1635 C CZ  . TYR E 53  ? 1.6483 1.4046 1.2064 -0.0125 -0.1415 -0.1158 53  TYR A CZ  
1636 O OH  . TYR E 53  ? 1.5870 1.3564 1.1572 -0.0088 -0.1512 -0.1048 53  TYR A OH  
1637 N N   . ILE E 54  ? 1.6406 1.3901 1.1765 -0.0273 -0.1056 -0.1579 54  ILE A N   
1638 C CA  . ILE E 54  ? 1.6888 1.4612 1.2327 -0.0276 -0.1064 -0.1581 54  ILE A CA  
1639 C C   . ILE E 54  ? 1.7377 1.5109 1.2791 -0.0233 -0.0992 -0.1631 54  ILE A C   
1640 O O   . ILE E 54  ? 1.7509 1.5380 1.2986 -0.0179 -0.0999 -0.1583 54  ILE A O   
1641 C CB  . ILE E 54  ? 1.7164 1.4990 1.2619 -0.0358 -0.1073 -0.1630 54  ILE A CB  
1642 C CG1 . ILE E 54  ? 1.7568 1.5420 1.3061 -0.0387 -0.1152 -0.1567 54  ILE A CG1 
1643 C CG2 . ILE E 54  ? 1.7223 1.5275 1.2748 -0.0361 -0.1072 -0.1643 54  ILE A CG2 
1644 C CD1 . ILE E 54  ? 1.7947 1.5890 1.3462 -0.0471 -0.1161 -0.1605 54  ILE A CD1 
1645 N N   . ALA E 55  ? 1.7600 1.5178 1.2921 -0.0253 -0.0925 -0.1721 55  ALA A N   
1646 C CA  . ALA E 55  ? 1.8084 1.5649 1.3363 -0.0214 -0.0859 -0.1779 55  ALA A CA  
1647 C C   . ALA E 55  ? 1.8367 1.5866 1.3647 -0.0127 -0.0838 -0.1726 55  ALA A C   
1648 O O   . ALA E 55  ? 1.8644 1.6194 1.3918 -0.0073 -0.0796 -0.1738 55  ALA A O   
1649 C CB  . ALA E 55  ? 1.8289 1.5698 1.3478 -0.0261 -0.0803 -0.1887 55  ALA A CB  
1650 N N   . SER E 56  ? 1.8490 1.5869 1.3773 -0.0113 -0.0866 -0.1665 56  SER A N   
1651 C CA  . SER E 56  ? 1.8697 1.5987 1.3980 -0.0039 -0.0844 -0.1616 56  SER A CA  
1652 C C   . SER E 56  ? 1.8458 1.5900 1.3849 0.0021  -0.0895 -0.1498 56  SER A C   
1653 O O   . SER E 56  ? 1.8657 1.6055 1.4070 0.0087  -0.0878 -0.1442 56  SER A O   
1654 C CB  . SER E 56  ? 1.8786 1.5859 1.4017 -0.0046 -0.0847 -0.1605 56  SER A CB  
1655 O OG  . SER E 56  ? 1.8794 1.5875 1.4061 -0.0060 -0.0929 -0.1526 56  SER A OG  
1656 N N   . HIS E 57  ? 1.7953 1.5578 1.3423 -0.0003 -0.0958 -0.1456 57  HIS A N   
1657 C CA  . HIS E 57  ? 1.7769 1.5559 1.3363 0.0050  -0.1017 -0.1335 57  HIS A CA  
1658 C C   . HIS E 57  ? 1.8938 1.6963 1.4595 0.0062  -0.1005 -0.1340 57  HIS A C   
1659 O O   . HIS E 57  ? 1.9305 1.7443 1.4977 0.0003  -0.1031 -0.1377 57  HIS A O   
1660 C CB  . HIS E 57  ? 1.6850 1.4658 1.2503 0.0021  -0.1123 -0.1256 57  HIS A CB  
1661 C CG  . HIS E 57  ? 1.6303 1.3889 1.1901 0.0026  -0.1149 -0.1225 57  HIS A CG  
1662 N ND1 . HIS E 57  ? 1.6264 1.3654 1.1741 -0.0017 -0.1109 -0.1309 57  HIS A ND1 
1663 C CD2 . HIS E 57  ? 1.5914 1.3441 1.1562 0.0069  -0.1216 -0.1116 57  HIS A CD2 
1664 C CE1 . HIS E 57  ? 1.6103 1.3326 1.1550 0.0002  -0.1145 -0.1256 57  HIS A CE1 
1665 N NE2 . HIS E 57  ? 1.5812 1.3107 1.1357 0.0052  -0.1213 -0.1141 57  HIS A NE2 
1666 N N   . ASP E 58  ? 1.9716 1.7816 1.5410 0.0141  -0.0963 -0.1300 58  ASP A N   
1667 C CA  . ASP E 58  ? 2.0293 1.8610 1.6034 0.0166  -0.0942 -0.1301 58  ASP A CA  
1668 C C   . ASP E 58  ? 2.0085 1.8618 1.5967 0.0147  -0.1035 -0.1212 58  ASP A C   
1669 O O   . ASP E 58  ? 1.9927 1.8616 1.5830 0.0108  -0.1043 -0.1250 58  ASP A O   
1670 C CB  . ASP E 58  ? 2.0945 1.9298 1.6708 0.0269  -0.0881 -0.1249 58  ASP A CB  
1671 C CG  . ASP E 58  ? 2.1916 2.0467 1.7693 0.0305  -0.0842 -0.1266 58  ASP A CG  
1672 O OD1 . ASP E 58  ? 2.2432 2.1125 1.8307 0.0390  -0.0835 -0.1162 58  ASP A OD1 
1673 O OD2 . ASP E 58  ? 2.2466 2.1029 1.8159 0.0251  -0.0817 -0.1379 58  ASP A OD2 
1674 N N   . ASP E 59  ? 1.9874 1.8408 1.5856 0.0174  -0.1110 -0.1090 59  ASP A N   
1675 C CA  . ASP E 59  ? 1.9567 1.8283 1.5691 0.0158  -0.1215 -0.0995 59  ASP A CA  
1676 C C   . ASP E 59  ? 1.8654 1.7396 1.4742 0.0060  -0.1248 -0.1074 59  ASP A C   
1677 O O   . ASP E 59  ? 1.9018 1.7971 1.5194 0.0037  -0.1286 -0.1058 59  ASP A O   
1678 C CB  . ASP E 59  ? 2.0062 1.8693 1.6259 0.0184  -0.1303 -0.0874 59  ASP A CB  
1679 C CG  . ASP E 59  ? 2.0711 1.9062 1.6776 0.0154  -0.1293 -0.0928 59  ASP A CG  
1680 O OD1 . ASP E 59  ? 2.0468 1.8737 1.6547 0.0131  -0.1383 -0.0876 59  ASP A OD1 
1681 O OD2 . ASP E 59  ? 2.1270 1.9480 1.7215 0.0156  -0.1197 -0.1022 59  ASP A OD2 
1682 N N   . ILE E 60  ? 1.7410 1.5941 1.3374 0.0005  -0.1232 -0.1156 60  ILE A N   
1683 C CA  . ILE E 60  ? 1.6135 1.4668 1.2059 -0.0086 -0.1254 -0.1228 60  ILE A CA  
1684 C C   . ILE E 60  ? 1.6425 1.5008 1.2284 -0.0125 -0.1177 -0.1344 60  ILE A C   
1685 O O   . ILE E 60  ? 1.6353 1.5067 1.2245 -0.0187 -0.1201 -0.1374 60  ILE A O   
1686 C CB  . ILE E 60  ? 1.5016 1.3300 1.0830 -0.0124 -0.1258 -0.1266 60  ILE A CB  
1687 C CG1 . ILE E 60  ? 1.4595 1.2791 1.0448 -0.0080 -0.1336 -0.1156 60  ILE A CG1 
1688 C CG2 . ILE E 60  ? 1.4837 1.3133 1.0624 -0.0212 -0.1281 -0.1323 60  ILE A CG2 
1689 C CD1 . ILE E 60  ? 1.4460 1.2858 1.0472 -0.0054 -0.1436 -0.1036 60  ILE A CD1 
1690 N N   . ALA E 61  ? 1.6943 1.5416 1.2710 -0.0090 -0.1090 -0.1408 61  ALA A N   
1691 C CA  . ALA E 61  ? 1.7510 1.5986 1.3193 -0.0126 -0.1022 -0.1525 61  ALA A CA  
1692 C C   . ALA E 61  ? 1.8094 1.6822 1.3852 -0.0124 -0.1031 -0.1516 61  ALA A C   
1693 O O   . ALA E 61  ? 1.8583 1.7365 1.4315 -0.0192 -0.1025 -0.1591 61  ALA A O   
1694 C CB  . ALA E 61  ? 1.7354 1.5670 1.2928 -0.0075 -0.0935 -0.1585 61  ALA A CB  
1695 N N   . LYS E 62  ? 1.8050 1.6934 1.3910 -0.0046 -0.1048 -0.1417 62  LYS A N   
1696 C CA  . LYS E 62  ? 1.7866 1.7003 1.3807 -0.0033 -0.1055 -0.1396 62  LYS A CA  
1697 C C   . LYS E 62  ? 1.7982 1.7285 1.4028 -0.0110 -0.1137 -0.1369 62  LYS A C   
1698 O O   . LYS E 62  ? 1.8049 1.7518 1.4122 -0.0141 -0.1134 -0.1403 62  LYS A O   
1699 C CB  . LYS E 62  ? 1.7302 1.6569 1.3342 0.0077  -0.1051 -0.1279 62  LYS A CB  
1700 C CG  . LYS E 62  ? 1.7213 1.6357 1.3150 0.0160  -0.0957 -0.1309 62  LYS A CG  
1701 C CD  . LYS E 62  ? 1.7335 1.6654 1.3378 0.0269  -0.0943 -0.1194 62  LYS A CD  
1702 C CE  . LYS E 62  ? 1.7106 1.6518 1.3327 0.0292  -0.1033 -0.1038 62  LYS A CE  
1703 N NZ  . LYS E 62  ? 1.7063 1.6695 1.3427 0.0390  -0.1032 -0.0908 62  LYS A NZ  
1704 N N   . ASP E 63  ? 1.8150 1.7401 1.4250 -0.0140 -0.1211 -0.1311 63  ASP A N   
1705 C CA  . ASP E 63  ? 1.8318 1.7713 1.4517 -0.0209 -0.1294 -0.1280 63  ASP A CA  
1706 C C   . ASP E 63  ? 1.8244 1.7457 1.4379 -0.0279 -0.1327 -0.1312 63  ASP A C   
1707 O O   . ASP E 63  ? 1.8273 1.7467 1.4467 -0.0273 -0.1407 -0.1231 63  ASP A O   
1708 C CB  . ASP E 63  ? 1.8891 1.8481 1.5267 -0.0156 -0.1380 -0.1137 63  ASP A CB  
1709 C CG  . ASP E 63  ? 1.9534 1.9295 1.6025 -0.0225 -0.1468 -0.1106 63  ASP A CG  
1710 O OD1 . ASP E 63  ? 1.9830 1.9594 1.6270 -0.0310 -0.1451 -0.1196 63  ASP A OD1 
1711 O OD2 . ASP E 63  ? 1.9701 1.9591 1.6339 -0.0194 -0.1559 -0.0988 63  ASP A OD2 
1712 N N   . PRO E 64  ? 1.8093 1.7169 1.4107 -0.0342 -0.1269 -0.1426 64  PRO A N   
1713 C CA  . PRO E 64  ? 1.8177 1.7052 1.4108 -0.0399 -0.1273 -0.1465 64  PRO A CA  
1714 C C   . PRO E 64  ? 1.7912 1.6873 1.3910 -0.0469 -0.1347 -0.1437 64  PRO A C   
1715 O O   . PRO E 64  ? 1.8084 1.6898 1.4039 -0.0487 -0.1377 -0.1422 64  PRO A O   
1716 C CB  . PRO E 64  ? 1.8051 1.6810 1.3865 -0.0445 -0.1188 -0.1587 64  PRO A CB  
1717 C CG  . PRO E 64  ? 1.7992 1.6848 1.3802 -0.0394 -0.1138 -0.1613 64  PRO A CG  
1718 C CD  . PRO E 64  ? 1.7915 1.7026 1.3867 -0.0358 -0.1194 -0.1521 64  PRO A CD  
1719 N N   . LEU E 65  ? 1.7447 1.6640 1.3545 -0.0504 -0.1374 -0.1431 65  LEU A N   
1720 C CA  . LEU E 65  ? 1.6660 1.5931 1.2811 -0.0586 -0.1425 -0.1430 65  LEU A CA  
1721 C C   . LEU E 65  ? 1.7252 1.6485 1.3444 -0.0579 -0.1515 -0.1347 65  LEU A C   
1722 O O   . LEU E 65  ? 1.7564 1.6675 1.3698 -0.0630 -0.1522 -0.1371 65  LEU A O   
1723 C CB  . LEU E 65  ? 1.5275 1.4819 1.1541 -0.0623 -0.1443 -0.1431 65  LEU A CB  
1724 C CG  . LEU E 65  ? 1.4477 1.4000 1.0681 -0.0707 -0.1381 -0.1537 65  LEU A CG  
1725 C CD1 . LEU E 65  ? 1.4353 1.4140 1.0661 -0.0741 -0.1396 -0.1540 65  LEU A CD1 
1726 C CD2 . LEU E 65  ? 1.3828 1.3215 0.9987 -0.0784 -0.1389 -0.1563 65  LEU A CD2 
1727 N N   . PRO E 66  ? 1.7622 1.6953 1.3912 -0.0512 -0.1586 -0.1246 66  PRO A N   
1728 C CA  . PRO E 66  ? 1.7636 1.6925 1.3961 -0.0510 -0.1686 -0.1171 66  PRO A CA  
1729 C C   . PRO E 66  ? 1.7118 1.6104 1.3286 -0.0499 -0.1662 -0.1196 66  PRO A C   
1730 O O   . PRO E 66  ? 1.7307 1.6194 1.3435 -0.0523 -0.1713 -0.1180 66  PRO A O   
1731 C CB  . PRO E 66  ? 1.7947 1.7363 1.4401 -0.0430 -0.1761 -0.1055 66  PRO A CB  
1732 C CG  . PRO E 66  ? 1.8011 1.7610 1.4529 -0.0403 -0.1700 -0.1067 66  PRO A CG  
1733 C CD  . PRO E 66  ? 1.7908 1.7356 1.4273 -0.0431 -0.1582 -0.1189 66  PRO A CD  
1734 N N   . THR E 67  ? 1.6560 1.5400 1.2635 -0.0460 -0.1583 -0.1237 67  THR A N   
1735 C CA  . THR E 67  ? 1.6621 1.5180 1.2551 -0.0448 -0.1551 -0.1264 67  THR A CA  
1736 C C   . THR E 67  ? 1.6211 1.4670 1.2054 -0.0524 -0.1502 -0.1343 67  THR A C   
1737 O O   . THR E 67  ? 1.6229 1.4528 1.1996 -0.0532 -0.1525 -0.1332 67  THR A O   
1738 C CB  . THR E 67  ? 1.7093 1.5532 1.2954 -0.0397 -0.1470 -0.1296 67  THR A CB  
1739 O OG1 . THR E 67  ? 1.7430 1.5975 1.3387 -0.0324 -0.1509 -0.1212 67  THR A OG1 
1740 C CG2 . THR E 67  ? 1.7075 1.5230 1.2800 -0.0381 -0.1445 -0.1312 67  THR A CG2 
1741 N N   . CYS E 68  ? 1.5976 1.4526 1.1829 -0.0577 -0.1438 -0.1418 68  CYS A N   
1742 C CA  . CYS E 68  ? 1.6067 1.4538 1.1859 -0.0654 -0.1391 -0.1486 68  CYS A CA  
1743 C C   . CYS E 68  ? 1.6215 1.4746 1.2051 -0.0700 -0.1458 -0.1447 68  CYS A C   
1744 O O   . CYS E 68  ? 1.6535 1.4902 1.2288 -0.0720 -0.1445 -0.1455 68  CYS A O   
1745 C CB  . CYS E 68  ? 1.5975 1.4555 1.1790 -0.0705 -0.1329 -0.1563 68  CYS A CB  
1746 S SG  . CYS E 68  ? 1.6208 1.4683 1.1944 -0.0651 -0.1245 -0.1623 68  CYS A SG  
1747 N N   . ASP E 69  ? 1.5907 1.4675 1.1875 -0.0712 -0.1527 -0.1401 69  ASP A N   
1748 C CA  . ASP E 69  ? 1.5559 1.4398 1.1579 -0.0753 -0.1599 -0.1361 69  ASP A CA  
1749 C C   . ASP E 69  ? 1.5971 1.4616 1.1909 -0.0703 -0.1653 -0.1306 69  ASP A C   
1750 O O   . ASP E 69  ? 1.6246 1.4789 1.2124 -0.0733 -0.1661 -0.1308 69  ASP A O   
1751 C CB  . ASP E 69  ? 1.5595 1.4720 1.1784 -0.0756 -0.1678 -0.1305 69  ASP A CB  
1752 C CG  . ASP E 69  ? 1.6455 1.5771 1.2716 -0.0797 -0.1626 -0.1357 69  ASP A CG  
1753 O OD1 . ASP E 69  ? 1.7513 1.7045 1.3896 -0.0771 -0.1667 -0.1313 69  ASP A OD1 
1754 O OD2 . ASP E 69  ? 1.5372 1.4617 1.1566 -0.0852 -0.1547 -0.1437 69  ASP A OD2 
1755 N N   . ALA E 70  ? 1.6335 1.4922 1.2265 -0.0625 -0.1690 -0.1255 70  ALA A N   
1756 C CA  . ALA E 70  ? 1.6642 1.5022 1.2480 -0.0573 -0.1745 -0.1205 70  ALA A CA  
1757 C C   . ALA E 70  ? 1.6646 1.4776 1.2322 -0.0588 -0.1666 -0.1261 70  ALA A C   
1758 O O   . ALA E 70  ? 1.7062 1.5074 1.2664 -0.0592 -0.1697 -0.1243 70  ALA A O   
1759 C CB  . ALA E 70  ? 1.6930 1.5260 1.2776 -0.0493 -0.1774 -0.1151 70  ALA A CB  
1760 N N   . MET E 71  ? 1.6034 1.4082 1.1654 -0.0591 -0.1564 -0.1326 71  MET A N   
1761 C CA  . MET E 71  ? 1.5689 1.3493 1.1167 -0.0593 -0.1490 -0.1368 71  MET A CA  
1762 C C   . MET E 71  ? 1.5409 1.3210 1.0869 -0.0662 -0.1461 -0.1396 71  MET A C   
1763 O O   . MET E 71  ? 1.5842 1.3459 1.1196 -0.0651 -0.1448 -0.1387 71  MET A O   
1764 C CB  . MET E 71  ? 1.6224 1.3956 1.1665 -0.0587 -0.1393 -0.1432 71  MET A CB  
1765 C CG  . MET E 71  ? 1.6471 1.4178 1.1917 -0.0515 -0.1408 -0.1402 71  MET A CG  
1766 S SD  . MET E 71  ? 1.5129 1.2660 1.0506 -0.0442 -0.1495 -0.1314 71  MET A SD  
1767 C CE  . MET E 71  ? 1.2195 0.9858 0.7682 -0.0381 -0.1546 -0.1253 71  MET A CE  
1768 N N   . ILE E 72  ? 1.4984 1.2987 1.0549 -0.0730 -0.1449 -0.1426 72  ILE A N   
1769 C CA  . ILE E 72  ? 1.5537 1.3547 1.1101 -0.0800 -0.1421 -0.1445 72  ILE A CA  
1770 C C   . ILE E 72  ? 1.6120 1.4107 1.1666 -0.0784 -0.1503 -0.1381 72  ILE A C   
1771 O O   . ILE E 72  ? 1.6717 1.4573 1.2185 -0.0798 -0.1475 -0.1378 72  ILE A O   
1772 C CB  . ILE E 72  ? 1.5747 1.3991 1.1438 -0.0878 -0.1409 -0.1481 72  ILE A CB  
1773 C CG1 . ILE E 72  ? 1.6135 1.4404 1.1835 -0.0880 -0.1346 -0.1541 72  ILE A CG1 
1774 C CG2 . ILE E 72  ? 1.5683 1.3906 1.1373 -0.0955 -0.1366 -0.1500 72  ILE A CG2 
1775 C CD1 . ILE E 72  ? 1.6160 1.4648 1.1968 -0.0950 -0.1338 -0.1579 72  ILE A CD1 
1776 N N   . TRP E 73  ? 1.5815 1.3926 1.1434 -0.0750 -0.1605 -0.1326 73  TRP A N   
1777 C CA  . TRP E 73  ? 1.5561 1.3632 1.1155 -0.0725 -0.1699 -0.1263 73  TRP A CA  
1778 C C   . TRP E 73  ? 1.5335 1.3109 1.0750 -0.0661 -0.1689 -0.1247 73  TRP A C   
1779 O O   . TRP E 73  ? 1.5836 1.3481 1.1158 -0.0671 -0.1661 -0.1250 73  TRP A O   
1780 C CB  . TRP E 73  ? 1.5976 1.4216 1.1687 -0.0692 -0.1820 -0.1198 73  TRP A CB  
1781 C CG  . TRP E 73  ? 1.6926 1.5152 1.2630 -0.0679 -0.1928 -0.1138 73  TRP A CG  
1782 C CD1 . TRP E 73  ? 1.6952 1.5339 1.2746 -0.0735 -0.1970 -0.1128 73  TRP A CD1 
1783 C CD2 . TRP E 73  ? 1.7418 1.5448 1.3015 -0.0605 -0.2012 -0.1082 73  TRP A CD2 
1784 N NE1 . TRP E 73  ? 1.6847 1.5149 1.2593 -0.0697 -0.2077 -0.1070 73  TRP A NE1 
1785 C CE2 . TRP E 73  ? 1.7211 1.5289 1.2831 -0.0616 -0.2107 -0.1041 73  TRP A CE2 
1786 C CE3 . TRP E 73  ? 1.7852 1.5667 1.3335 -0.0531 -0.2021 -0.1062 73  TRP A CE3 
1787 C CZ2 . TRP E 73  ? 1.7641 1.5547 1.3162 -0.0552 -0.2214 -0.0984 73  TRP A CZ2 
1788 C CZ3 . TRP E 73  ? 1.7962 1.5609 1.3350 -0.0471 -0.2126 -0.1002 73  TRP A CZ3 
1789 C CH2 . TRP E 73  ? 1.7951 1.5640 1.3354 -0.0480 -0.2223 -0.0965 73  TRP A CH2 
1790 N N   . PHE E 74  ? 1.5539 1.3203 1.0906 -0.0594 -0.1706 -0.1228 74  PHE A N   
1791 C CA  . PHE E 74  ? 1.6368 1.3751 1.1566 -0.0528 -0.1706 -0.1209 74  PHE A CA  
1792 C C   . PHE E 74  ? 1.7632 1.4848 1.2714 -0.0550 -0.1595 -0.1254 74  PHE A C   
1793 O O   . PHE E 74  ? 1.8168 1.5189 1.3115 -0.0513 -0.1600 -0.1231 74  PHE A O   
1794 C CB  . PHE E 74  ? 1.6444 1.3740 1.1619 -0.0473 -0.1695 -0.1204 74  PHE A CB  
1795 C CG  . PHE E 74  ? 1.6631 1.4046 1.1909 -0.0434 -0.1805 -0.1139 74  PHE A CG  
1796 C CD1 . PHE E 74  ? 1.6817 1.4113 1.2040 -0.0376 -0.1918 -0.1067 74  PHE A CD1 
1797 C CD2 . PHE E 74  ? 1.6698 1.4333 1.2124 -0.0451 -0.1796 -0.1145 74  PHE A CD2 
1798 C CE1 . PHE E 74  ? 1.6957 1.4360 1.2291 -0.0341 -0.2024 -0.0996 74  PHE A CE1 
1799 C CE2 . PHE E 74  ? 1.6777 1.4525 1.2310 -0.0410 -0.1893 -0.1072 74  PHE A CE2 
1800 C CZ  . PHE E 74  ? 1.6996 1.4631 1.2493 -0.0357 -0.2009 -0.0995 74  PHE A CZ  
1801 N N   . SER E 75  ? 1.8372 1.5662 1.3509 -0.0605 -0.1497 -0.1314 75  SER A N   
1802 C CA  . SER E 75  ? 1.9275 1.6436 1.4339 -0.0635 -0.1393 -0.1350 75  SER A CA  
1803 C C   . SER E 75  ? 1.9927 1.7098 1.4977 -0.0667 -0.1402 -0.1327 75  SER A C   
1804 O O   . SER E 75  ? 2.0893 1.7867 1.5810 -0.0627 -0.1386 -0.1301 75  SER A O   
1805 C CB  . SER E 75  ? 1.9600 1.6865 1.4749 -0.0698 -0.1307 -0.1414 75  SER A CB  
1806 O OG  . SER E 75  ? 1.9808 1.7027 1.4945 -0.0751 -0.1232 -0.1433 75  SER A OG  
1807 N N   . ARG E 76  ? 1.9520 1.6918 1.4704 -0.0739 -0.1423 -0.1335 76  ARG A N   
1808 C CA  . ARG E 76  ? 1.8891 1.6320 1.4083 -0.0780 -0.1424 -0.1315 76  ARG A CA  
1809 C C   . ARG E 76  ? 1.8525 1.5899 1.3651 -0.0725 -0.1529 -0.1256 76  ARG A C   
1810 O O   . ARG E 76  ? 1.8303 1.5614 1.3372 -0.0728 -0.1529 -0.1232 76  ARG A O   
1811 C CB  . ARG E 76  ? 1.8450 1.6145 1.3813 -0.0874 -0.1427 -0.1338 76  ARG A CB  
1812 C CG  . ARG E 76  ? 1.8750 1.6668 1.4234 -0.0875 -0.1534 -0.1318 76  ARG A CG  
1813 C CD  . ARG E 76  ? 1.9493 1.7659 1.5133 -0.0967 -0.1539 -0.1331 76  ARG A CD  
1814 N NE  . ARG E 76  ? 1.9564 1.7721 1.5221 -0.1036 -0.1431 -0.1382 76  ARG A NE  
1815 C CZ  . ARG E 76  ? 1.9852 1.8047 1.5551 -0.1107 -0.1393 -0.1382 76  ARG A CZ  
1816 N NH1 . ARG E 76  ? 1.9976 1.8225 1.5697 -0.1118 -0.1447 -0.1338 76  ARG A NH1 
1817 N NH2 . ARG E 76  ? 1.9797 1.7973 1.5520 -0.1168 -0.1303 -0.1422 76  ARG A NH2 
1818 N N   . ALA E 77  ? 1.8683 1.6066 1.3812 -0.0670 -0.1620 -0.1230 77  ALA A N   
1819 C CA  . ALA E 77  ? 1.8948 1.6258 1.4012 -0.0611 -0.1737 -0.1172 77  ALA A CA  
1820 C C   . ALA E 77  ? 1.9345 1.6343 1.4198 -0.0533 -0.1709 -0.1158 77  ALA A C   
1821 O O   . ALA E 77  ? 1.9805 1.6669 1.4556 -0.0468 -0.1802 -0.1112 77  ALA A O   
1822 C CB  . ALA E 77  ? 1.9280 1.6720 1.4444 -0.0584 -0.1847 -0.1139 77  ALA A CB  
1823 N N   . LEU E 78  ? 1.9290 1.6166 1.4079 -0.0538 -0.1586 -0.1196 78  LEU A N   
1824 C CA  . LEU E 78  ? 2.0004 1.6590 1.4598 -0.0469 -0.1538 -0.1184 78  LEU A CA  
1825 C C   . LEU E 78  ? 2.1774 1.8308 1.6340 -0.0507 -0.1416 -0.1202 78  LEU A C   
1826 O O   . LEU E 78  ? 2.2773 1.9491 1.7467 -0.0586 -0.1387 -0.1219 78  LEU A O   
1827 C CB  . LEU E 78  ? 1.9530 1.5995 1.4077 -0.0423 -0.1511 -0.1198 78  LEU A CB  
1828 C CG  . LEU E 78  ? 1.9464 1.5704 1.3851 -0.0330 -0.1587 -0.1153 78  LEU A CG  
1829 C CD1 . LEU E 78  ? 1.9292 1.5492 1.3693 -0.0295 -0.1604 -0.1156 78  LEU A CD1 
1830 C CD2 . LEU E 78  ? 1.9985 1.5972 1.4185 -0.0282 -0.1514 -0.1145 78  LEU A CD2 
1831 N N   . ASP E 79  ? 2.2306 1.8599 1.6716 -0.0452 -0.1342 -0.1192 79  ASP A N   
1832 C CA  . ASP E 79  ? 2.3090 1.9357 1.7505 -0.0491 -0.1224 -0.1198 79  ASP A CA  
1833 C C   . ASP E 79  ? 2.3193 1.9500 1.7699 -0.0537 -0.1128 -0.1245 79  ASP A C   
1834 O O   . ASP E 79  ? 2.3329 1.9484 1.7762 -0.0493 -0.1080 -0.1255 79  ASP A O   
1835 C CB  . ASP E 79  ? 2.4089 2.0102 1.8311 -0.0415 -0.1179 -0.1154 79  ASP A CB  
1836 C CG  . ASP E 79  ? 2.5254 2.1031 1.9332 -0.0335 -0.1139 -0.1150 79  ASP A CG  
1837 O OD1 . ASP E 79  ? 2.5842 2.1647 1.9983 -0.0350 -0.1115 -0.1186 79  ASP A OD1 
1838 O OD2 . ASP E 79  ? 2.5554 2.1112 1.9448 -0.0253 -0.1131 -0.1111 79  ASP A OD2 
1839 N N   . ILE E 80  ? 2.3217 1.9734 1.7885 -0.0630 -0.1106 -0.1274 80  ILE A N   
1840 C CA  . ILE E 80  ? 2.3369 1.9941 1.8133 -0.0684 -0.1028 -0.1322 80  ILE A CA  
1841 C C   . ILE E 80  ? 2.3710 2.0429 1.8600 -0.0778 -0.0986 -0.1328 80  ILE A C   
1842 O O   . ILE E 80  ? 2.3385 2.0274 1.8353 -0.0821 -0.1046 -0.1320 80  ILE A O   
1843 C CB  . ILE E 80  ? 2.3115 1.9817 1.7960 -0.0693 -0.1081 -0.1365 80  ILE A CB  
1844 C CG1 . ILE E 80  ? 2.3236 1.9762 1.7973 -0.0612 -0.1081 -0.1365 80  ILE A CG1 
1845 C CG2 . ILE E 80  ? 2.2938 1.9773 1.7914 -0.0774 -0.1025 -0.1419 80  ILE A CG2 
1846 C CD1 . ILE E 80  ? 2.3315 1.9776 1.7963 -0.0540 -0.1183 -0.1322 80  ILE A CD1 
1847 N N   . GLU E 81  ? 2.4472 2.1131 1.9392 -0.0812 -0.0889 -0.1340 81  GLU A N   
1848 C CA  . GLU E 81  ? 2.5033 2.1803 2.0073 -0.0902 -0.0843 -0.1336 81  GLU A CA  
1849 C C   . GLU E 81  ? 2.5225 2.2249 2.0416 -0.0986 -0.0898 -0.1381 81  GLU A C   
1850 O O   . GLU E 81  ? 2.5234 2.2326 2.0458 -0.0987 -0.0926 -0.1429 81  GLU A O   
1851 C CB  . GLU E 81  ? 2.5529 2.2183 2.0589 -0.0921 -0.0739 -0.1338 81  GLU A CB  
1852 C CG  . GLU E 81  ? 2.5994 2.2440 2.0946 -0.0861 -0.0666 -0.1272 81  GLU A CG  
1853 C CD  . GLU E 81  ? 2.6473 2.2736 2.1246 -0.0747 -0.0687 -0.1253 81  GLU A CD  
1854 O OE1 . GLU E 81  ? 2.6570 2.2823 2.1315 -0.0716 -0.0729 -0.1294 81  GLU A OE1 
1855 O OE2 . GLU E 81  ? 2.6686 2.2810 2.1344 -0.0687 -0.0661 -0.1195 81  GLU A OE2 
1856 N N   . ASN E 82  ? 2.5207 2.2370 2.0488 -0.1054 -0.0910 -0.1361 82  ASN A N   
1857 C CA  . ASN E 82  ? 2.4826 2.2240 2.0249 -0.1133 -0.0967 -0.1394 82  ASN A CA  
1858 C C   . ASN E 82  ? 2.5188 2.2667 2.0700 -0.1193 -0.0933 -0.1453 82  ASN A C   
1859 O O   . ASN E 82  ? 2.5426 2.3035 2.0985 -0.1201 -0.0980 -0.1499 82  ASN A O   
1860 C CB  . ASN E 82  ? 2.3863 2.1391 1.9368 -0.1200 -0.0971 -0.1358 82  ASN A CB  
1861 C CG  . ASN E 82  ? 2.2993 2.0789 1.8642 -0.1274 -0.1040 -0.1384 82  ASN A CG  
1862 O OD1 . ASN E 82  ? 2.2619 2.0518 1.8281 -0.1247 -0.1111 -0.1408 82  ASN A OD1 
1863 N ND2 . ASN E 82  ? 2.2763 2.0676 1.8529 -0.1368 -0.1018 -0.1374 82  ASN A ND2 
1864 N N   . ASN E 83  ? 2.4954 2.2338 2.0489 -0.1233 -0.0852 -0.1447 83  ASN A N   
1865 C CA  . ASN E 83  ? 2.4400 2.1783 1.9991 -0.1278 -0.0818 -0.1500 83  ASN A CA  
1866 C C   . ASN E 83  ? 2.4538 2.1857 2.0052 -0.1206 -0.0835 -0.1544 83  ASN A C   
1867 O O   . ASN E 83  ? 2.4531 2.1973 2.0088 -0.1222 -0.0873 -0.1596 83  ASN A O   
1868 C CB  . ASN E 83  ? 2.3554 2.0769 1.9145 -0.1292 -0.0730 -0.1468 83  ASN A CB  
1869 C CG  . ASN E 83  ? 2.2917 1.9920 1.8373 -0.1194 -0.0689 -0.1421 83  ASN A CG  
1870 O OD1 . ASN E 83  ? 2.3165 2.0137 1.8520 -0.1118 -0.0732 -0.1415 83  ASN A OD1 
1871 N ND2 . ASN E 83  ? 2.2471 1.9325 1.7927 -0.1193 -0.0609 -0.1383 83  ASN A ND2 
1872 N N   . ASP E 84  ? 2.4580 2.1704 1.9975 -0.1122 -0.0806 -0.1517 84  ASP A N   
1873 C CA  . ASP E 84  ? 2.4489 2.1522 1.9807 -0.1051 -0.0813 -0.1549 84  ASP A CA  
1874 C C   . ASP E 84  ? 2.3964 2.1159 1.9305 -0.1037 -0.0892 -0.1580 84  ASP A C   
1875 O O   . ASP E 84  ? 2.4231 2.1484 1.9606 -0.1047 -0.0896 -0.1634 84  ASP A O   
1876 C CB  . ASP E 84  ? 2.4574 2.1405 1.9754 -0.0959 -0.0794 -0.1501 84  ASP A CB  
1877 C CG  . ASP E 84  ? 2.4549 2.1285 1.9650 -0.0884 -0.0807 -0.1525 84  ASP A CG  
1878 O OD1 . ASP E 84  ? 2.4405 2.1171 1.9548 -0.0901 -0.0796 -0.1579 84  ASP A OD1 
1879 O OD2 . ASP E 84  ? 2.4593 2.1215 1.9583 -0.0807 -0.0831 -0.1488 84  ASP A OD2 
1880 N N   . VAL E 85  ? 2.3009 2.0274 1.8335 -0.1011 -0.0958 -0.1541 85  VAL A N   
1881 C CA  . VAL E 85  ? 2.2173 1.9603 1.7541 -0.0995 -0.1038 -0.1553 85  VAL A CA  
1882 C C   . VAL E 85  ? 2.1445 1.9074 1.6935 -0.1071 -0.1042 -0.1604 85  VAL A C   
1883 O O   . VAL E 85  ? 2.1756 1.9463 1.7266 -0.1049 -0.1066 -0.1636 85  VAL A O   
1884 C CB  . VAL E 85  ? 2.2034 1.9538 1.7400 -0.0974 -0.1118 -0.1498 85  VAL A CB  
1885 C CG1 . VAL E 85  ? 2.2165 1.9749 1.7593 -0.1043 -0.1109 -0.1475 85  VAL A CG1 
1886 C CG2 . VAL E 85  ? 2.1761 1.9458 1.7203 -0.0962 -0.1203 -0.1501 85  VAL A CG2 
1887 N N   . LEU E 86  ? 2.0328 1.8031 1.5897 -0.1156 -0.1017 -0.1608 86  LEU A N   
1888 C CA  . LEU E 86  ? 1.9048 1.6932 1.4723 -0.1229 -0.1026 -0.1656 86  LEU A CA  
1889 C C   . LEU E 86  ? 1.8652 1.6455 1.4305 -0.1231 -0.0980 -0.1720 86  LEU A C   
1890 O O   . LEU E 86  ? 1.8714 1.6643 1.4408 -0.1244 -0.1001 -0.1765 86  LEU A O   
1891 C CB  . LEU E 86  ? 1.8522 1.6519 1.4297 -0.1327 -0.1022 -0.1641 86  LEU A CB  
1892 C CG  . LEU E 86  ? 1.8402 1.6273 1.4189 -0.1382 -0.0951 -0.1630 86  LEU A CG  
1893 C CD1 . LEU E 86  ? 1.8298 1.6128 1.4108 -0.1423 -0.0914 -0.1689 86  LEU A CD1 
1894 C CD2 . LEU E 86  ? 1.8446 1.6442 1.4331 -0.1463 -0.0961 -0.1592 86  LEU A CD2 
1895 N N   . VAL E 87  ? 1.8049 1.5644 1.3638 -0.1214 -0.0918 -0.1721 87  VAL A N   
1896 C CA  . VAL E 87  ? 1.7196 1.4693 1.2760 -0.1207 -0.0879 -0.1778 87  VAL A CA  
1897 C C   . VAL E 87  ? 1.6201 1.3702 1.1706 -0.1126 -0.0905 -0.1801 87  VAL A C   
1898 O O   . VAL E 87  ? 1.5636 1.3173 1.1145 -0.1125 -0.0903 -0.1858 87  VAL A O   
1899 C CB  . VAL E 87  ? 1.7411 1.4682 1.2925 -0.1193 -0.0811 -0.1761 87  VAL A CB  
1900 C CG1 . VAL E 87  ? 1.7642 1.4888 1.3192 -0.1237 -0.0786 -0.1700 87  VAL A CG1 
1901 C CG2 . VAL E 87  ? 1.7169 1.4286 1.2574 -0.1094 -0.0799 -0.1745 87  VAL A CG2 
1902 N N   . LEU E 88  ? 1.6007 1.3465 1.1455 -0.1056 -0.0930 -0.1753 88  LEU A N   
1903 C CA  . LEU E 88  ? 1.6261 1.3743 1.1673 -0.0982 -0.0966 -0.1756 88  LEU A CA  
1904 C C   . LEU E 88  ? 1.7518 1.5230 1.3015 -0.1007 -0.1011 -0.1779 88  LEU A C   
1905 O O   . LEU E 88  ? 1.8024 1.5764 1.3516 -0.0987 -0.1001 -0.1825 88  LEU A O   
1906 C CB  . LEU E 88  ? 1.5197 1.2627 1.0555 -0.0916 -0.1009 -0.1690 88  LEU A CB  
1907 C CG  . LEU E 88  ? 1.4570 1.1997 0.9895 -0.0835 -0.1050 -0.1676 88  LEU A CG  
1908 C CD1 . LEU E 88  ? 1.4554 1.2076 0.9917 -0.0828 -0.1041 -0.1726 88  LEU A CD1 
1909 C CD2 . LEU E 88  ? 1.4498 1.1694 0.9713 -0.0770 -0.1020 -0.1658 88  LEU A CD2 
1910 N N   . GLN E 89  ? 1.7724 1.5601 1.3294 -0.1046 -0.1060 -0.1745 89  GLN A N   
1911 C CA  . GLN E 89  ? 1.7999 1.6114 1.3662 -0.1071 -0.1106 -0.1758 89  GLN A CA  
1912 C C   . GLN E 89  ? 1.8052 1.6203 1.3731 -0.1111 -0.1069 -0.1831 89  GLN A C   
1913 O O   . GLN E 89  ? 1.8037 1.6287 1.3726 -0.1078 -0.1082 -0.1855 89  GLN A O   
1914 C CB  . GLN E 89  ? 1.7932 1.6207 1.3686 -0.1134 -0.1150 -0.1719 89  GLN A CB  
1915 C CG  . GLN E 89  ? 1.7975 1.6515 1.3840 -0.1165 -0.1199 -0.1726 89  GLN A CG  
1916 C CD  . GLN E 89  ? 1.7683 1.6391 1.3644 -0.1208 -0.1259 -0.1674 89  GLN A CD  
1917 O OE1 . GLN E 89  ? 1.7329 1.5950 1.3267 -0.1217 -0.1263 -0.1636 89  GLN A OE1 
1918 N NE2 . GLN E 89  ? 1.7701 1.6650 1.3770 -0.1230 -0.1306 -0.1671 89  GLN A NE2 
1919 N N   . GLN E 90  ? 1.8238 1.6298 1.3915 -0.1177 -0.1025 -0.1862 90  GLN A N   
1920 C CA  . GLN E 90  ? 1.8251 1.6305 1.3930 -0.1218 -0.0997 -0.1932 90  GLN A CA  
1921 C C   . GLN E 90  ? 1.8847 1.6809 1.4446 -0.1141 -0.0976 -0.1972 90  GLN A C   
1922 O O   . GLN E 90  ? 1.9203 1.7266 1.4804 -0.1125 -0.0987 -0.2011 90  GLN A O   
1923 C CB  . GLN E 90  ? 1.8139 1.6043 1.3817 -0.1282 -0.0952 -0.1944 90  GLN A CB  
1924 C CG  . GLN E 90  ? 1.8216 1.6226 1.3987 -0.1373 -0.0966 -0.1913 90  GLN A CG  
1925 C CD  . GLN E 90  ? 1.8802 1.6993 1.4625 -0.1365 -0.1019 -0.1862 90  GLN A CD  
1926 O OE1 . GLN E 90  ? 1.8791 1.7148 1.4644 -0.1343 -0.1061 -0.1872 90  GLN A OE1 
1927 N NE2 . GLN E 90  ? 1.9560 1.7715 1.5396 -0.1376 -0.1017 -0.1802 90  GLN A NE2 
1928 N N   . ARG E 91  ? 1.8890 1.6660 1.4416 -0.1087 -0.0944 -0.1957 91  ARG A N   
1929 C CA  . ARG E 91  ? 1.8686 1.6349 1.4138 -0.1015 -0.0919 -0.1992 91  ARG A CA  
1930 C C   . ARG E 91  ? 1.8925 1.6727 1.4385 -0.0948 -0.0954 -0.1976 91  ARG A C   
1931 O O   . ARG E 91  ? 1.9727 1.7534 1.5156 -0.0911 -0.0938 -0.2021 91  ARG A O   
1932 C CB  . ARG E 91  ? 1.7946 1.5387 1.3327 -0.0970 -0.0882 -0.1970 91  ARG A CB  
1933 C CG  . ARG E 91  ? 1.7261 1.4594 1.2574 -0.0896 -0.0856 -0.2004 91  ARG A CG  
1934 C CD  . ARG E 91  ? 1.7235 1.4340 1.2487 -0.0867 -0.0810 -0.1999 91  ARG A CD  
1935 N NE  . ARG E 91  ? 1.7911 1.4926 1.3104 -0.0790 -0.0792 -0.2015 91  ARG A NE  
1936 C CZ  . ARG E 91  ? 1.9216 1.6249 1.4393 -0.0769 -0.0780 -0.2073 91  ARG A CZ  
1937 N NH1 . ARG E 91  ? 1.9800 1.6933 1.5003 -0.0816 -0.0789 -0.2124 91  ARG A NH1 
1938 N NH2 . ARG E 91  ? 1.9800 1.6742 1.4926 -0.0697 -0.0760 -0.2078 91  ARG A NH2 
1939 N N   . LEU E 92  ? 1.7582 1.5494 1.3086 -0.0929 -0.1004 -0.1908 92  LEU A N   
1940 C CA  . LEU E 92  ? 1.6272 1.4320 1.1806 -0.0863 -0.1045 -0.1870 92  LEU A CA  
1941 C C   . LEU E 92  ? 1.5828 1.4084 1.1423 -0.0881 -0.1060 -0.1899 92  LEU A C   
1942 O O   . LEU E 92  ? 1.6192 1.4495 1.1774 -0.0820 -0.1053 -0.1909 92  LEU A O   
1943 C CB  . LEU E 92  ? 1.5461 1.3571 1.1039 -0.0847 -0.1107 -0.1787 92  LEU A CB  
1944 C CG  . LEU E 92  ? 1.5274 1.3182 1.0773 -0.0795 -0.1105 -0.1746 92  LEU A CG  
1945 C CD1 . LEU E 92  ? 1.5716 1.3691 1.1250 -0.0757 -0.1185 -0.1662 92  LEU A CD1 
1946 C CD2 . LEU E 92  ? 1.4662 1.2434 1.0091 -0.0729 -0.1064 -0.1771 92  LEU A CD2 
1947 N N   . TYR E 93  ? 1.5309 1.3684 1.0968 -0.0963 -0.1077 -0.1910 93  TYR A N   
1948 C CA  . TYR E 93  ? 1.5473 1.4032 1.1182 -0.0990 -0.1087 -0.1944 93  TYR A CA  
1949 C C   . TYR E 93  ? 1.5260 1.3713 1.0884 -0.0980 -0.1036 -0.2028 93  TYR A C   
1950 O O   . TYR E 93  ? 1.5597 1.4149 1.1212 -0.0939 -0.1034 -0.2051 93  TYR A O   
1951 C CB  . TYR E 93  ? 1.6325 1.5013 1.2119 -0.1089 -0.1114 -0.1940 93  TYR A CB  
1952 C CG  . TYR E 93  ? 1.7250 1.6079 1.3134 -0.1092 -0.1174 -0.1860 93  TYR A CG  
1953 C CD1 . TYR E 93  ? 1.7617 1.6481 1.3513 -0.1008 -0.1210 -0.1797 93  TYR A CD1 
1954 C CD2 . TYR E 93  ? 1.7199 1.6122 1.3163 -0.1177 -0.1199 -0.1842 93  TYR A CD2 
1955 C CE1 . TYR E 93  ? 1.7355 1.6337 1.3334 -0.1007 -0.1278 -0.1722 93  TYR A CE1 
1956 C CE2 . TYR E 93  ? 1.6991 1.6037 1.3034 -0.1176 -0.1259 -0.1770 93  TYR A CE2 
1957 C CZ  . TYR E 93  ? 1.6998 1.6069 1.3046 -0.1090 -0.1302 -0.1712 93  TYR A CZ  
1958 O OH  . TYR E 93  ? 1.6972 1.6154 1.3099 -0.1087 -0.1374 -0.1639 93  TYR A OH  
1959 N N   . GLY E 94  ? 1.4609 1.2856 1.0169 -0.1011 -0.0997 -0.2071 94  GLY A N   
1960 C CA  . GLY E 94  ? 1.3558 1.1675 0.9033 -0.0994 -0.0956 -0.2148 94  GLY A CA  
1961 C C   . GLY E 94  ? 1.2629 1.0718 0.8044 -0.0888 -0.0938 -0.2148 94  GLY A C   
1962 O O   . GLY E 94  ? 1.2659 1.0801 0.8038 -0.0854 -0.0928 -0.2191 94  GLY A O   
1963 N N   . LEU E 95  ? 1.1759 0.9762 0.7164 -0.0835 -0.0934 -0.2095 95  LEU A N   
1964 C CA  . LEU E 95  ? 1.1631 0.9606 0.6997 -0.0736 -0.0920 -0.2075 95  LEU A CA  
1965 C C   . LEU E 95  ? 1.2062 1.0248 0.7474 -0.0687 -0.0942 -0.2049 95  LEU A C   
1966 O O   . LEU E 95  ? 1.1922 1.0096 0.7284 -0.0621 -0.0911 -0.2075 95  LEU A O   
1967 C CB  . LEU E 95  ? 1.0467 0.8362 0.5841 -0.0699 -0.0935 -0.2001 95  LEU A CB  
1968 C CG  . LEU E 95  ? 1.0484 0.8409 0.5858 -0.0602 -0.0939 -0.1953 95  LEU A CG  
1969 C CD1 . LEU E 95  ? 1.1239 0.9015 0.6526 -0.0552 -0.0881 -0.2011 95  LEU A CD1 
1970 C CD2 . LEU E 95  ? 1.0441 0.8309 0.5832 -0.0570 -0.0974 -0.1871 95  LEU A CD2 
1971 N N   . VAL E 96  ? 1.3120 1.1501 0.8631 -0.0713 -0.0994 -0.1992 96  VAL A N   
1972 C CA  . VAL E 96  ? 1.4443 1.3044 1.0014 -0.0670 -0.1014 -0.1962 96  VAL A CA  
1973 C C   . VAL E 96  ? 1.5725 1.4355 1.1240 -0.0683 -0.0982 -0.2046 96  VAL A C   
1974 O O   . VAL E 96  ? 1.6108 1.4729 1.1566 -0.0608 -0.0948 -0.2066 96  VAL A O   
1975 C CB  . VAL E 96  ? 1.1060 0.9893 0.6765 -0.0703 -0.1082 -0.1888 96  VAL A CB  
1976 C CG1 . VAL E 96  ? 1.0121 0.8909 0.5868 -0.0693 -0.1126 -0.1809 96  VAL A CG1 
1977 C CG2 . VAL E 96  ? 1.2448 1.1362 0.8186 -0.0806 -0.1094 -0.1932 96  VAL A CG2 
1978 N N   . LYS E 97  ? 1.6348 1.4993 1.1872 -0.0778 -0.0992 -0.2095 97  LYS A N   
1979 C CA  . LYS E 97  ? 1.7104 1.5794 1.2581 -0.0797 -0.0977 -0.2168 97  LYS A CA  
1980 C C   . LYS E 97  ? 1.7799 1.6327 1.3149 -0.0722 -0.0926 -0.2226 97  LYS A C   
1981 O O   . LYS E 97  ? 1.8610 1.7208 1.3912 -0.0670 -0.0910 -0.2254 97  LYS A O   
1982 C CB  . LYS E 97  ? 1.7365 1.5986 1.2840 -0.0911 -0.0986 -0.2222 97  LYS A CB  
1983 C CG  . LYS E 97  ? 1.7539 1.6187 1.2957 -0.0936 -0.0982 -0.2300 97  LYS A CG  
1984 C CD  . LYS E 97  ? 1.6929 1.5840 1.2442 -0.0968 -0.1021 -0.2270 97  LYS A CD  
1985 C CE  . LYS E 97  ? 1.6378 1.5351 1.1999 -0.1079 -0.1058 -0.2240 97  LYS A CE  
1986 N NZ  . LYS E 97  ? 1.6034 1.5281 1.1780 -0.1094 -0.1100 -0.2179 97  LYS A NZ  
1987 N N   . LEU E 98  ? 1.7094 1.5405 1.2387 -0.0713 -0.0900 -0.2242 98  LEU A N   
1988 C CA  . LEU E 98  ? 1.6159 1.4310 1.1343 -0.0636 -0.0852 -0.2287 98  LEU A CA  
1989 C C   . LEU E 98  ? 1.5917 1.4179 1.1110 -0.0526 -0.0838 -0.2232 98  LEU A C   
1990 O O   . LEU E 98  ? 1.6462 1.4767 1.1593 -0.0470 -0.0813 -0.2266 98  LEU A O   
1991 C CB  . LEU E 98  ? 1.5272 1.3204 1.0427 -0.0641 -0.0831 -0.2286 98  LEU A CB  
1992 C CG  . LEU E 98  ? 1.4766 1.2470 0.9814 -0.0628 -0.0792 -0.2367 98  LEU A CG  
1993 C CD1 . LEU E 98  ? 1.4789 1.2453 0.9794 -0.0698 -0.0803 -0.2451 98  LEU A CD1 
1994 C CD2 . LEU E 98  ? 1.4575 1.2106 0.9632 -0.0647 -0.0780 -0.2345 98  LEU A CD2 
1995 N N   . LEU E 99  ? 1.4945 1.3249 1.0214 -0.0493 -0.0855 -0.2141 99  LEU A N   
1996 C CA  . LEU E 99  ? 1.4479 1.2853 0.9767 -0.0386 -0.0841 -0.2075 99  LEU A CA  
1997 C C   . LEU E 99  ? 1.5078 1.3675 1.0402 -0.0345 -0.0845 -0.2056 99  LEU A C   
1998 O O   . LEU E 99  ? 1.5422 1.4018 1.0680 -0.0262 -0.0801 -0.2073 99  LEU A O   
1999 C CB  . LEU E 99  ? 1.3388 1.1795 0.8774 -0.0373 -0.0881 -0.1970 99  LEU A CB  
2000 C CG  . LEU E 99  ? 1.3196 1.1382 0.8541 -0.0393 -0.0874 -0.1974 99  LEU A CG  
2001 C CD1 . LEU E 99  ? 1.3243 1.1471 0.8675 -0.0388 -0.0929 -0.1873 99  LEU A CD1 
2002 C CD2 . LEU E 99  ? 1.3247 1.1253 0.8501 -0.0322 -0.0816 -0.2003 99  LEU A CD2 
2003 N N   . GLU E 100 ? 1.5768 1.4555 1.1194 -0.0403 -0.0896 -0.2021 100 GLU A N   
2004 C CA  . GLU E 100 ? 1.6846 1.5869 1.2328 -0.0370 -0.0907 -0.1990 100 GLU A CA  
2005 C C   . GLU E 100 ? 1.7415 1.6422 1.2786 -0.0378 -0.0873 -0.2090 100 GLU A C   
2006 O O   . GLU E 100 ? 1.8229 1.7332 1.3570 -0.0297 -0.0845 -0.2083 100 GLU A O   
2007 C CB  . GLU E 100 ? 1.7027 1.6254 1.2654 -0.0440 -0.0975 -0.1930 100 GLU A CB  
2008 C CG  . GLU E 100 ? 1.7289 1.6620 1.3044 -0.0397 -0.1020 -0.1808 100 GLU A CG  
2009 C CD  . GLU E 100 ? 1.8030 1.7590 1.3930 -0.0454 -0.1088 -0.1752 100 GLU A CD  
2010 O OE1 . GLU E 100 ? 1.9012 1.8618 1.4909 -0.0542 -0.1098 -0.1812 100 GLU A OE1 
2011 O OE2 . GLU E 100 ? 1.7587 1.7281 1.3610 -0.0411 -0.1136 -0.1645 100 GLU A OE2 
2012 N N   . PHE E 101 ? 1.3590 1.4296 0.9744 -0.1047 -0.1740 -0.0295 101 PHE A N   
2013 C CA  . PHE E 101 ? 1.2813 1.3639 0.9352 -0.0923 -0.1713 -0.0394 101 PHE A CA  
2014 C C   . PHE E 101 ? 1.2764 1.3950 0.9725 -0.0905 -0.1826 -0.0423 101 PHE A C   
2015 O O   . PHE E 101 ? 1.3025 1.4370 1.0214 -0.0882 -0.1884 -0.0341 101 PHE A O   
2016 C CB  . PHE E 101 ? 1.2264 1.2992 0.9034 -0.0781 -0.1602 -0.0359 101 PHE A CB  
2017 C CG  . PHE E 101 ? 1.1635 1.2445 0.8760 -0.0659 -0.1563 -0.0454 101 PHE A CG  
2018 C CD1 . PHE E 101 ? 1.1411 1.2514 0.8948 -0.0619 -0.1638 -0.0499 101 PHE A CD1 
2019 C CD2 . PHE E 101 ? 1.1641 1.2234 0.8702 -0.0587 -0.1447 -0.0494 101 PHE A CD2 
2020 C CE1 . PHE E 101 ? 1.1186 1.2347 0.9028 -0.0525 -0.1600 -0.0578 101 PHE A CE1 
2021 C CE2 . PHE E 101 ? 1.1446 1.2114 0.8836 -0.0482 -0.1421 -0.0570 101 PHE A CE2 
2022 C CZ  . PHE E 101 ? 1.1041 1.1986 0.8807 -0.0459 -0.1498 -0.0608 101 PHE A CZ  
2023 N N   . ASP E 102 ? 1.2632 1.3935 0.9690 -0.0923 -0.1858 -0.0544 102 ASP A N   
2024 C CA  . ASP E 102 ? 1.2782 1.4420 1.0279 -0.0900 -0.1940 -0.0594 102 ASP A CA  
2025 C C   . ASP E 102 ? 1.2249 1.3934 1.0148 -0.0760 -0.1875 -0.0635 102 ASP A C   
2026 O O   . ASP E 102 ? 1.2463 1.4027 1.0310 -0.0743 -0.1822 -0.0717 102 ASP A O   
2027 C CB  . ASP E 102 ? 1.3506 1.5262 1.0891 -0.1024 -0.2011 -0.0713 102 ASP A CB  
2028 C CG  . ASP E 102 ? 1.3981 1.6083 1.1838 -0.1007 -0.2078 -0.0783 102 ASP A CG  
2029 O OD1 . ASP E 102 ? 1.4095 1.6305 1.2362 -0.0881 -0.2052 -0.0752 102 ASP A OD1 
2030 O OD2 . ASP E 102 ? 1.4171 1.6367 1.2023 -0.1091 -0.2119 -0.0860 102 ASP A OD2 
2031 N N   . TYR E 103 ? 1.1378 1.3228 0.9665 -0.0663 -0.1886 -0.0573 103 TYR A N   
2032 C CA  . TYR E 103 ? 1.0371 1.2310 0.9074 -0.0541 -0.1834 -0.0610 103 TYR A CA  
2033 C C   . TYR E 103 ? 0.9665 1.1825 0.8620 -0.0577 -0.1882 -0.0732 103 TYR A C   
2034 O O   . TYR E 103 ? 0.9347 1.1495 0.8478 -0.0529 -0.1832 -0.0800 103 TYR A O   
2035 C CB  . TYR E 103 ? 1.0016 1.2060 0.9040 -0.0438 -0.1836 -0.0510 103 TYR A CB  
2036 C CG  . TYR E 103 ? 1.0173 1.1982 0.9075 -0.0366 -0.1741 -0.0422 103 TYR A CG  
2037 C CD1 . TYR E 103 ? 1.0570 1.2315 0.9669 -0.0256 -0.1642 -0.0442 103 TYR A CD1 
2038 C CD2 . TYR E 103 ? 1.0211 1.1862 0.8799 -0.0420 -0.1747 -0.0322 103 TYR A CD2 
2039 C CE1 . TYR E 103 ? 1.1132 1.2675 1.0125 -0.0199 -0.1546 -0.0374 103 TYR A CE1 
2040 C CE2 . TYR E 103 ? 1.0710 1.2139 0.9176 -0.0372 -0.1650 -0.0255 103 TYR A CE2 
2041 C CZ  . TYR E 103 ? 1.1371 1.2754 1.0047 -0.0260 -0.1547 -0.0286 103 TYR A CZ  
2042 O OH  . TYR E 103 ? 1.2178 1.3352 1.0739 -0.0220 -0.1442 -0.0231 103 TYR A OH  
2043 N N   . SER E 104 ? 0.9456 1.1805 0.8398 -0.0679 -0.1977 -0.0768 104 SER A N   
2044 C CA  . SER E 104 ? 0.9628 1.2238 0.8887 -0.0715 -0.2022 -0.0882 104 SER A CA  
2045 C C   . SER E 104 ? 1.0519 1.3041 0.9783 -0.0731 -0.1969 -0.0996 104 SER A C   
2046 O O   . SER E 104 ? 1.0354 1.3053 0.9931 -0.0741 -0.1975 -0.1085 104 SER A O   
2047 C CB  . SER E 104 ? 0.9300 1.2061 0.8403 -0.0861 -0.2117 -0.0934 104 SER A CB  
2048 O OG  . SER E 104 ? 0.8904 1.1831 0.8167 -0.0939 -0.2135 -0.1083 104 SER A OG  
2049 N N   . ASN E 105 ? 1.1777 1.4016 1.0683 -0.0745 -0.1922 -0.0997 105 ASN A N   
2050 C CA  . ASN E 105 ? 1.2517 1.4626 1.1420 -0.0742 -0.1877 -0.1082 105 ASN A CA  
2051 C C   . ASN E 105 ? 1.2364 1.4435 1.1574 -0.0591 -0.1796 -0.1035 105 ASN A C   
2052 O O   . ASN E 105 ? 1.2364 1.4562 1.1902 -0.0570 -0.1786 -0.1090 105 ASN A O   
2053 C CB  . ASN E 105 ? 1.3768 1.5581 1.2172 -0.0811 -0.1868 -0.1105 105 ASN A CB  
2054 C CG  . ASN E 105 ? 1.5427 1.7254 1.3489 -0.0976 -0.1944 -0.1163 105 ASN A CG  
2055 O OD1 . ASN E 105 ? 1.6992 1.8982 1.5238 -0.1008 -0.1973 -0.1165 105 ASN A OD1 
2056 N ND2 . ASN E 105 ? 1.5572 1.7048 1.3228 -0.0994 -0.1901 -0.1152 105 ASN A ND2 
2057 N N   . VAL E 106 ? 1.2498 1.4394 1.1597 -0.0498 -0.1732 -0.0938 106 VAL A N   
2058 C CA  . VAL E 106 ? 1.2579 1.4432 1.1944 -0.0363 -0.1649 -0.0899 106 VAL A CA  
2059 C C   . VAL E 106 ? 1.1766 1.3876 1.1609 -0.0300 -0.1653 -0.0889 106 VAL A C   
2060 O O   . VAL E 106 ? 1.1867 1.3991 1.1969 -0.0230 -0.1601 -0.0904 106 VAL A O   
2061 C CB  . VAL E 106 ? 1.0151 1.1805 0.9332 -0.0285 -0.1575 -0.0795 106 VAL A CB  
2062 C CG1 . VAL E 106 ? 1.0194 1.1921 0.9304 -0.0307 -0.1616 -0.0705 106 VAL A CG1 
2063 C CG2 . VAL E 106 ? 1.0167 1.1791 0.9621 -0.0151 -0.1484 -0.0759 106 VAL A CG2 
2064 N N   . ILE E 107 ? 1.1069 1.3379 1.1029 -0.0329 -0.1717 -0.0867 107 ILE A N   
2065 C CA  . ILE E 107 ? 1.0218 1.2745 1.0614 -0.0252 -0.1718 -0.0839 107 ILE A CA  
2066 C C   . ILE E 107 ? 0.9941 1.2570 1.0657 -0.0240 -0.1686 -0.0922 107 ILE A C   
2067 O O   . ILE E 107 ? 1.0637 1.3314 1.1643 -0.0141 -0.1634 -0.0880 107 ILE A O   
2068 C CB  . ILE E 107 ? 0.9434 1.2194 0.9952 -0.0299 -0.1811 -0.0834 107 ILE A CB  
2069 C CG1 . ILE E 107 ? 1.0285 1.2985 1.0629 -0.0276 -0.1846 -0.0709 107 ILE A CG1 
2070 C CG2 . ILE E 107 ? 0.8458 1.1450 0.9453 -0.0241 -0.1810 -0.0856 107 ILE A CG2 
2071 C CD1 . ILE E 107 ? 1.0788 1.3223 1.0660 -0.0323 -0.1821 -0.0672 107 ILE A CD1 
2072 N N   . ALA E 108 ? 0.9081 1.1737 0.9734 -0.0355 -0.1717 -0.1039 108 ALA A N   
2073 C CA  . ALA E 108 ? 0.7986 1.0751 0.8940 -0.0376 -0.1694 -0.1122 108 ALA A CA  
2074 C C   . ALA E 108 ? 0.7458 1.0072 0.8482 -0.0300 -0.1618 -0.1099 108 ALA A C   
2075 O O   . ALA E 108 ? 0.7047 0.9738 0.8344 -0.0300 -0.1587 -0.1140 108 ALA A O   
2076 C CB  . ALA E 108 ? 0.7413 1.0215 0.8242 -0.0539 -0.1745 -0.1257 108 ALA A CB  
2077 N N   . ILE E 109 ? 0.7582 0.9980 0.8360 -0.0241 -0.1584 -0.1038 109 ILE A N   
2078 C CA  . ILE E 109 ? 0.8019 1.0292 0.8893 -0.0155 -0.1510 -0.1010 109 ILE A CA  
2079 C C   . ILE E 109 ? 0.8790 1.1162 0.9954 -0.0030 -0.1452 -0.0918 109 ILE A C   
2080 O O   . ILE E 109 ? 0.9389 1.1809 1.0821 0.0017  -0.1404 -0.0916 109 ILE A O   
2081 C CB  . ILE E 109 ? 1.1801 1.3811 1.2339 -0.0130 -0.1484 -0.0987 109 ILE A CB  
2082 C CG1 . ILE E 109 ? 1.2413 1.4295 1.2662 -0.0254 -0.1545 -0.1082 109 ILE A CG1 
2083 C CG2 . ILE E 109 ? 1.1471 1.3383 1.2157 -0.0025 -0.1404 -0.0952 109 ILE A CG2 
2084 C CD1 . ILE E 109 ? 1.2802 1.4698 1.2759 -0.0355 -0.1611 -0.1107 109 ILE A CD1 
2085 N N   . LEU E 110 ? 0.8963 1.1355 1.0053 0.0011  -0.1464 -0.0840 110 LEU A N   
2086 C CA  . LEU E 110 ? 0.8770 1.1258 1.0108 0.0110  -0.1433 -0.0755 110 LEU A CA  
2087 C C   . LEU E 110 ? 0.8895 1.1604 1.0602 0.0101  -0.1448 -0.0799 110 LEU A C   
2088 O O   . LEU E 110 ? 0.9099 1.1831 1.1041 0.0150  -0.1387 -0.0799 110 LEU A O   
2089 C CB  . LEU E 110 ? 0.8624 1.1116 0.9805 0.0112  -0.1483 -0.0681 110 LEU A CB  
2090 C CG  . LEU E 110 ? 0.8438 1.0975 0.9788 0.0204  -0.1469 -0.0579 110 LEU A CG  
2091 C CD1 . LEU E 110 ? 0.8537 1.0880 0.9769 0.0277  -0.1376 -0.0515 110 LEU A CD1 
2092 C CD2 . LEU E 110 ? 0.8718 1.1306 0.9950 0.0167  -0.1560 -0.0525 110 LEU A CD2 
2093 N N   . GLN E 111 ? 0.8692 1.1559 1.0442 0.0027  -0.1524 -0.0847 111 GLN A N   
2094 C CA  . GLN E 111 ? 0.8362 1.1445 1.0467 0.0009  -0.1532 -0.0902 111 GLN A CA  
2095 C C   . GLN E 111 ? 0.8577 1.1624 1.0818 -0.0013 -0.1467 -0.0963 111 GLN A C   
2096 O O   . GLN E 111 ? 0.8645 1.1732 1.1142 0.0059  -0.1408 -0.0927 111 GLN A O   
2097 C CB  . GLN E 111 ? 0.7813 1.1047 0.9897 -0.0106 -0.1612 -0.0990 111 GLN A CB  
2098 C CG  . GLN E 111 ? 0.7937 1.1230 0.9911 -0.0095 -0.1690 -0.0927 111 GLN A CG  
2099 C CD  . GLN E 111 ? 0.8407 1.1859 1.0351 -0.0217 -0.1768 -0.1022 111 GLN A CD  
2100 O OE1 . GLN E 111 ? 0.8789 1.2300 1.0779 -0.0318 -0.1759 -0.1144 111 GLN A OE1 
2101 N NE2 . GLN E 111 ? 0.8609 1.2129 1.0467 -0.0220 -0.1847 -0.0967 111 GLN A NE2 
2102 N N   . LYS E 112 ? 0.8513 1.1451 1.0547 -0.0112 -0.1479 -0.1042 112 LYS A N   
2103 C CA  . LYS E 112 ? 0.8330 1.1239 1.0483 -0.0167 -0.1442 -0.1109 112 LYS A CA  
2104 C C   . LYS E 112 ? 0.8261 1.1137 1.0628 -0.0059 -0.1359 -0.1035 112 LYS A C   
2105 O O   . LYS E 112 ? 0.8237 1.1195 1.0857 -0.0088 -0.1322 -0.1069 112 LYS A O   
2106 C CB  . LYS E 112 ? 0.8431 1.1141 1.0265 -0.0249 -0.1469 -0.1161 112 LYS A CB  
2107 C CG  . LYS E 112 ? 0.8209 1.0847 1.0131 -0.0312 -0.1446 -0.1216 112 LYS A CG  
2108 C CD  . LYS E 112 ? 0.8162 1.0953 1.0238 -0.0451 -0.1468 -0.1325 112 LYS A CD  
2109 C CE  . LYS E 112 ? 0.8300 1.1014 1.0427 -0.0564 -0.1459 -0.1396 112 LYS A CE  
2110 N NZ  . LYS E 112 ? 0.8770 1.1254 1.0579 -0.0645 -0.1513 -0.1436 112 LYS A NZ  
2111 N N   . ILE E 113 ? 0.8585 1.1333 1.0838 0.0050  -0.1323 -0.0943 113 ILE A N   
2112 C CA  . ILE E 113 ? 0.9323 1.2033 1.1745 0.0148  -0.1240 -0.0876 113 ILE A CA  
2113 C C   . ILE E 113 ? 1.0279 1.3109 1.2930 0.0241  -0.1207 -0.0801 113 ILE A C   
2114 O O   . ILE E 113 ? 1.0743 1.3631 1.3640 0.0275  -0.1150 -0.0783 113 ILE A O   
2115 C CB  . ILE E 113 ? 0.9477 1.1986 1.1680 0.0205  -0.1207 -0.0836 113 ILE A CB  
2116 C CG1 . ILE E 113 ? 0.9376 1.1797 1.1300 0.0236  -0.1230 -0.0792 113 ILE A CG1 
2117 C CG2 . ILE E 113 ? 0.9718 1.2115 1.1799 0.0118  -0.1236 -0.0912 113 ILE A CG2 
2118 C CD1 . ILE E 113 ? 0.5253 0.7477 0.6841 0.0192  -0.1252 -0.0832 113 ILE A CD1 
2119 N N   . SER E 114 ? 1.0681 1.3537 1.3234 0.0273  -0.1251 -0.0757 114 SER A N   
2120 C CA  . SER E 114 ? 1.0730 1.3650 1.3441 0.0366  -0.1235 -0.0672 114 SER A CA  
2121 C C   . SER E 114 ? 1.0290 1.3370 1.3338 0.0357  -0.1215 -0.0707 114 SER A C   
2122 O O   . SER E 114 ? 1.0654 1.3736 1.3875 0.0419  -0.1147 -0.0663 114 SER A O   
2123 C CB  . SER E 114 ? 1.1098 1.4053 1.3686 0.0367  -0.1316 -0.0635 114 SER A CB  
2124 O OG  . SER E 114 ? 1.1414 1.4199 1.3668 0.0365  -0.1320 -0.0599 114 SER A OG  
2125 N N   . ILE E 115 ? 0.9504 1.2712 1.2631 0.0265  -0.1266 -0.0796 115 ILE A N   
2126 C CA  . ILE E 115 ? 0.8640 1.2002 1.2084 0.0234  -0.1241 -0.0850 115 ILE A CA  
2127 C C   . ILE E 115 ? 0.8330 1.1633 1.1879 0.0213  -0.1156 -0.0866 115 ILE A C   
2128 O O   . ILE E 115 ? 0.8740 1.2087 1.2511 0.0267  -0.1096 -0.0827 115 ILE A O   
2129 C CB  . ILE E 115 ? 0.8566 1.2054 1.2037 0.0112  -0.1298 -0.0967 115 ILE A CB  
2130 C CG1 . ILE E 115 ? 0.9935 1.3587 1.3753 0.0081  -0.1260 -0.1028 115 ILE A CG1 
2131 C CG2 . ILE E 115 ? 0.7746 1.1124 1.0989 -0.0006 -0.1307 -0.1047 115 ILE A CG2 
2132 C CD1 . ILE E 115 ? 1.1379 1.5142 1.5228 -0.0064 -0.1291 -0.1165 115 ILE A CD1 
2133 N N   . ASN E 116 ? 0.8143 1.1339 1.1524 0.0130  -0.1157 -0.0919 116 ASN A N   
2134 C CA  . ASN E 116 ? 0.8242 1.1365 1.1699 0.0100  -0.1093 -0.0926 116 ASN A CA  
2135 C C   . ASN E 116 ? 0.7827 1.0875 1.1321 0.0223  -0.1023 -0.0820 116 ASN A C   
2136 O O   . ASN E 116 ? 0.7990 1.1017 1.1611 0.0212  -0.0962 -0.0809 116 ASN A O   
2137 C CB  . ASN E 116 ? 0.9431 1.2419 1.2661 -0.0001 -0.1129 -0.0990 116 ASN A CB  
2138 C CG  . ASN E 116 ? 0.9975 1.3023 1.3202 -0.0165 -0.1176 -0.1114 116 ASN A CG  
2139 O OD1 . ASN E 116 ? 1.0414 1.3474 1.3776 -0.0262 -0.1146 -0.1167 116 ASN A OD1 
2140 N ND2 . ASN E 116 ? 0.9872 1.2948 1.2925 -0.0211 -0.1247 -0.1164 116 ASN A ND2 
2141 N N   . LEU E 117 ? 0.7143 1.0143 1.0511 0.0325  -0.1030 -0.0744 117 LEU A N   
2142 C CA  . LEU E 117 ? 0.7137 1.0072 1.0540 0.0429  -0.0956 -0.0655 117 LEU A CA  
2143 C C   . LEU E 117 ? 0.8614 1.1642 1.2214 0.0501  -0.0928 -0.0595 117 LEU A C   
2144 O O   . LEU E 117 ? 0.9187 1.2180 1.2856 0.0567  -0.0858 -0.0532 117 LEU A O   
2145 C CB  . LEU E 117 ? 0.6045 0.8839 0.9190 0.0489  -0.0957 -0.0609 117 LEU A CB  
2146 C CG  . LEU E 117 ? 0.5308 0.7973 0.8335 0.0474  -0.0931 -0.0631 117 LEU A CG  
2147 C CD1 . LEU E 117 ? 0.5219 0.7755 0.8059 0.0556  -0.0893 -0.0576 117 LEU A CD1 
2148 C CD2 . LEU E 117 ? 0.4996 0.7685 0.8230 0.0464  -0.0870 -0.0629 117 LEU A CD2 
2149 N N   . TRP E 118 ? 0.9251 1.2398 1.2946 0.0485  -0.0986 -0.0620 118 TRP A N   
2150 C CA  . TRP E 118 ? 0.9786 1.3022 1.3693 0.0549  -0.0973 -0.0573 118 TRP A CA  
2151 C C   . TRP E 118 ? 1.0444 1.3764 1.4608 0.0501  -0.0913 -0.0619 118 TRP A C   
2152 O O   . TRP E 118 ? 1.0884 1.4213 1.5196 0.0555  -0.0854 -0.0568 118 TRP A O   
2153 C CB  . TRP E 118 ? 0.9809 1.3144 1.3741 0.0558  -0.1067 -0.0580 118 TRP A CB  
2154 C CG  . TRP E 118 ? 1.0369 1.3614 1.4076 0.0617  -0.1122 -0.0503 118 TRP A CG  
2155 C CD1 . TRP E 118 ? 1.0882 1.4085 1.4351 0.0577  -0.1190 -0.0517 118 TRP A CD1 
2156 C CD2 . TRP E 118 ? 1.0614 1.3785 1.4292 0.0709  -0.1115 -0.0400 118 TRP A CD2 
2157 N NE1 . TRP E 118 ? 1.1185 1.4291 1.4483 0.0635  -0.1221 -0.0427 118 TRP A NE1 
2158 C CE2 . TRP E 118 ? 1.1022 1.4104 1.4442 0.0714  -0.1179 -0.0356 118 TRP A CE2 
2159 C CE3 . TRP E 118 ? 1.0640 1.3797 1.4463 0.0777  -0.1060 -0.0342 118 TRP A CE3 
2160 C CZ2 . TRP E 118 ? 1.1303 1.4276 1.4606 0.0775  -0.1192 -0.0258 118 TRP A CZ2 
2161 C CZ3 . TRP E 118 ? 1.1018 1.4070 1.4719 0.0843  -0.1076 -0.0247 118 TRP A CZ3 
2162 C CH2 . TRP E 118 ? 1.1262 1.4221 1.4707 0.0838  -0.1143 -0.0208 118 TRP A CH2 
2163 N N   . ASN E 119 ? 1.0764 1.4131 1.4958 0.0385  -0.0925 -0.0718 119 ASN A N   
2164 C CA  . ASN E 119 ? 1.1212 1.4646 1.5628 0.0307  -0.0865 -0.0774 119 ASN A CA  
2165 C C   . ASN E 119 ? 1.0992 1.4338 1.5437 0.0329  -0.0776 -0.0714 119 ASN A C   
2166 O O   . ASN E 119 ? 1.1438 1.4679 1.5738 0.0302  -0.0767 -0.0707 119 ASN A O   
2167 C CB  . ASN E 119 ? 1.1474 1.4918 1.5832 0.0156  -0.0895 -0.0889 119 ASN A CB  
2168 C CG  . ASN E 119 ? 1.1353 1.4842 1.5908 0.0043  -0.0830 -0.0956 119 ASN A CG  
2169 O OD1 . ASN E 119 ? 1.0949 1.4500 1.5722 0.0079  -0.0766 -0.0931 119 ASN A OD1 
2170 N ND2 . ASN E 119 ? 1.1292 1.4734 1.5754 -0.0105 -0.0847 -0.1044 119 ASN A ND2 
2171 N N   . PRO E 120 ? 1.0815 1.4204 1.5452 0.0377  -0.0713 -0.0670 120 PRO A N   
2172 C CA  . PRO E 120 ? 1.0584 1.3904 1.5258 0.0401  -0.0623 -0.0604 120 PRO A CA  
2173 C C   . PRO E 120 ? 1.0810 1.4113 1.5545 0.0267  -0.0575 -0.0658 120 PRO A C   
2174 O O   . PRO E 120 ? 1.0726 1.3958 1.5444 0.0261  -0.0517 -0.0610 120 PRO A O   
2175 C CB  . PRO E 120 ? 1.0540 1.3920 1.5397 0.0471  -0.0584 -0.0561 120 PRO A CB  
2176 C CG  . PRO E 120 ? 1.0541 1.4045 1.5555 0.0422  -0.0626 -0.0646 120 PRO A CG  
2177 C CD  . PRO E 120 ? 1.0573 1.4088 1.5422 0.0399  -0.0724 -0.0693 120 PRO A CD  
2178 N N   . SER E 121 ? 1.0921 1.4291 1.5733 0.0151  -0.0599 -0.0759 121 SER A N   
2179 C CA  . SER E 121 ? 1.1177 1.4498 1.6001 -0.0006 -0.0562 -0.0815 121 SER A CA  
2180 C C   . SER E 121 ? 1.1799 1.5059 1.6434 -0.0086 -0.0645 -0.0876 121 SER A C   
2181 O O   . SER E 121 ? 1.2015 1.5323 1.6600 -0.0143 -0.0708 -0.0960 121 SER A O   
2182 C CB  . SER E 121 ? 1.1016 1.4330 1.5880 -0.0108 -0.0505 -0.0868 121 SER A CB  
2183 O OG  . SER E 121 ? 1.0923 1.4280 1.5726 -0.0174 -0.0568 -0.0962 121 SER A OG  
2184 N N   . THR E 122 ? 1.2388 1.5530 1.6903 -0.0090 -0.0645 -0.0831 122 THR A N   
2185 C CA  . THR E 122 ? 1.2663 1.5707 1.6986 -0.0176 -0.0721 -0.0883 122 THR A CA  
2186 C C   . THR E 122 ? 1.3129 1.6085 1.7481 -0.0285 -0.0692 -0.0874 122 THR A C   
2187 O O   . THR E 122 ? 1.2630 1.5537 1.6999 -0.0218 -0.0653 -0.0790 122 THR A O   
2188 C CB  . THR E 122 ? 1.2521 1.5491 1.6659 -0.0051 -0.0762 -0.0827 122 THR A CB  
2189 O OG1 . THR E 122 ? 1.2747 1.5697 1.6947 0.0059  -0.0693 -0.0727 122 THR A OG1 
2190 C CG2 . THR E 122 ? 1.2274 1.5314 1.6350 0.0033  -0.0803 -0.0834 122 THR A CG2 
2191 N N   . ASP E 123 ? 1.4342 1.7257 1.8663 -0.0461 -0.0706 -0.0957 123 ASP A N   
2192 C CA  . ASP E 123 ? 1.6154 1.8915 2.0394 -0.0589 -0.0674 -0.0930 123 ASP A CA  
2193 C C   . ASP E 123 ? 1.6923 1.9580 2.1030 -0.0625 -0.0779 -0.0947 123 ASP A C   
2194 O O   . ASP E 123 ? 1.7045 1.9630 2.1175 -0.0629 -0.0784 -0.0889 123 ASP A O   
2195 C CB  . ASP E 123 ? 1.7357 2.0014 2.1451 -0.0755 -0.0630 -0.0978 123 ASP A CB  
2196 C CG  . ASP E 123 ? 1.8510 2.0967 2.2424 -0.0906 -0.0624 -0.0948 123 ASP A CG  
2197 O OD1 . ASP E 123 ? 1.8576 2.0997 2.2540 -0.0935 -0.0539 -0.0886 123 ASP A OD1 
2198 O OD2 . ASP E 123 ? 1.9168 2.1492 2.2867 -0.0994 -0.0708 -0.0976 123 ASP A OD2 
2199 N N   . SER E 124 ? 1.7766 2.0418 2.1732 -0.0644 -0.0867 -0.1026 124 SER A N   
2200 C CA  . SER E 124 ? 1.8691 2.1193 2.2449 -0.0712 -0.0974 -0.1063 124 SER A CA  
2201 C C   . SER E 124 ? 1.8640 2.1062 2.2353 -0.0572 -0.0995 -0.0973 124 SER A C   
2202 O O   . SER E 124 ? 1.8603 2.0874 2.2166 -0.0623 -0.1078 -0.0985 124 SER A O   
2203 C CB  . SER E 124 ? 1.9691 2.2197 2.3261 -0.0736 -0.1048 -0.1152 124 SER A CB  
2204 O OG  . SER E 124 ? 2.0134 2.2766 2.3765 -0.0731 -0.0988 -0.1180 124 SER A OG  
2205 N N   . LEU E 125 ? 1.8524 2.1036 2.2354 -0.0399 -0.0918 -0.0888 125 LEU A N   
2206 C CA  . LEU E 125 ? 1.8420 2.0870 2.2228 -0.0263 -0.0912 -0.0807 125 LEU A CA  
2207 C C   . LEU E 125 ? 1.8109 2.0594 2.2111 -0.0239 -0.0832 -0.0723 125 LEU A C   
2208 O O   . LEU E 125 ? 1.8168 2.0764 2.2320 -0.0212 -0.0744 -0.0689 125 LEU A O   
2209 C CB  . LEU E 125 ? 1.8653 2.1140 2.2378 -0.0092 -0.0894 -0.0778 125 LEU A CB  
2210 C CG  . LEU E 125 ? 1.8908 2.1536 2.2720 -0.0021 -0.0835 -0.0763 125 LEU A CG  
2211 C CD1 . LEU E 125 ? 1.9112 2.1828 2.3149 -0.0030 -0.0746 -0.0717 125 LEU A CD1 
2212 C CD2 . LEU E 125 ? 1.8872 2.1498 2.2596 0.0142  -0.0814 -0.0711 125 LEU A CD2 
2213 N N   . GLN E 126 ? 1.8540 2.0925 2.2533 -0.0257 -0.0870 -0.0691 126 GLN A N   
2214 C CA  . GLN E 126 ? 1.9785 2.2190 2.3944 -0.0254 -0.0813 -0.0612 126 GLN A CA  
2215 C C   . GLN E 126 ? 2.0211 2.2644 2.4396 -0.0067 -0.0767 -0.0548 126 GLN A C   
2216 O O   . GLN E 126 ? 2.1442 2.3902 2.5755 -0.0028 -0.0716 -0.0480 126 GLN A O   
2217 C CB  . GLN E 126 ? 2.0554 2.2820 2.4671 -0.0376 -0.0908 -0.0619 126 GLN A CB  
2218 C CG  . GLN E 126 ? 2.4706 2.6851 2.8638 -0.0315 -0.1010 -0.0658 126 GLN A CG  
2219 C CD  . GLN E 126 ? 2.4698 2.6677 2.8478 -0.0484 -0.1141 -0.0722 126 GLN A CD  
2220 O OE1 . GLN E 126 ? 2.4607 2.6568 2.8361 -0.0660 -0.1160 -0.0773 126 GLN A OE1 
2221 N NE2 . GLN E 126 ? 2.4754 2.6600 2.8425 -0.0436 -0.1232 -0.0724 126 GLN A NE2 
2222 N N   . SER E 127 ? 1.9647 2.2063 2.3694 0.0038  -0.0786 -0.0576 127 SER A N   
2223 C CA  . SER E 127 ? 1.9456 2.1858 2.3492 0.0191  -0.0754 -0.0535 127 SER A CA  
2224 C C   . SER E 127 ? 1.8884 2.1403 2.3053 0.0279  -0.0636 -0.0470 127 SER A C   
2225 O O   . SER E 127 ? 1.8930 2.1527 2.3119 0.0277  -0.0593 -0.0468 127 SER A O   
2226 C CB  . SER E 127 ? 2.0103 2.2447 2.3940 0.0264  -0.0791 -0.0579 127 SER A CB  
2227 O OG  . SER E 127 ? 2.0453 2.2672 2.4142 0.0175  -0.0904 -0.0642 127 SER A OG  
2228 N N   . LYS E 128 ? 1.8401 2.0929 2.2664 0.0350  -0.0589 -0.0420 128 LYS A N   
2229 C CA  . LYS E 128 ? 1.8195 2.0819 2.2566 0.0427  -0.0475 -0.0358 128 LYS A CA  
2230 C C   . LYS E 128 ? 1.7770 2.0420 2.2036 0.0531  -0.0424 -0.0360 128 LYS A C   
2231 O O   . LYS E 128 ? 1.8066 2.0785 2.2372 0.0535  -0.0366 -0.0331 128 LYS A O   
2232 C CB  . LYS E 128 ? 1.8591 2.1216 2.3074 0.0477  -0.0447 -0.0320 128 LYS A CB  
2233 C CG  . LYS E 128 ? 1.8960 2.1623 2.3453 0.0610  -0.0357 -0.0298 128 LYS A CG  
2234 C CD  . LYS E 128 ? 1.9368 2.1976 2.3913 0.0638  -0.0405 -0.0312 128 LYS A CD  
2235 C CE  . LYS E 128 ? 1.9549 2.2183 2.4118 0.0764  -0.0318 -0.0309 128 LYS A CE  
2236 N NZ  . LYS E 128 ? 1.9356 2.2098 2.4099 0.0736  -0.0249 -0.0249 128 LYS A NZ  
2237 N N   . HIS E 129 ? 1.6894 1.9474 2.1013 0.0604  -0.0451 -0.0393 129 HIS A N   
2238 C CA  . HIS E 129 ? 1.6515 1.9102 2.0513 0.0678  -0.0414 -0.0390 129 HIS A CA  
2239 C C   . HIS E 129 ? 1.6012 1.8627 1.9966 0.0610  -0.0471 -0.0416 129 HIS A C   
2240 O O   . HIS E 129 ? 1.6060 1.8661 2.0026 0.0510  -0.0541 -0.0457 129 HIS A O   
2241 C CB  . HIS E 129 ? 1.7040 1.9530 2.0867 0.0750  -0.0428 -0.0421 129 HIS A CB  
2242 C CG  . HIS E 129 ? 1.7595 2.0003 2.1420 0.0740  -0.0484 -0.0455 129 HIS A CG  
2243 N ND1 . HIS E 129 ? 1.7996 2.0342 2.1761 0.0651  -0.0592 -0.0500 129 HIS A ND1 
2244 C CD2 . HIS E 129 ? 1.7748 2.0119 2.1624 0.0809  -0.0449 -0.0455 129 HIS A CD2 
2245 C CE1 . HIS E 129 ? 1.8067 2.0326 2.1835 0.0665  -0.0632 -0.0518 129 HIS A CE1 
2246 N NE2 . HIS E 129 ? 1.7915 2.0194 2.1765 0.0767  -0.0546 -0.0492 129 HIS A NE2 
2247 N N   . PHE E 130 ? 1.5754 1.8403 1.9653 0.0658  -0.0445 -0.0397 130 PHE A N   
2248 C CA  . PHE E 130 ? 1.5746 1.8451 1.9655 0.0607  -0.0489 -0.0417 130 PHE A CA  
2249 C C   . PHE E 130 ? 1.5788 1.8574 1.9888 0.0538  -0.0456 -0.0402 130 PHE A C   
2250 O O   . PHE E 130 ? 1.5905 1.8737 2.0055 0.0465  -0.0494 -0.0440 130 PHE A O   
2251 C CB  . PHE E 130 ? 1.5373 1.8039 1.9171 0.0533  -0.0589 -0.0489 130 PHE A CB  
2252 C CG  . PHE E 130 ? 1.4975 1.7537 1.8569 0.0579  -0.0623 -0.0509 130 PHE A CG  
2253 C CD1 . PHE E 130 ? 1.4896 1.7380 1.8383 0.0515  -0.0701 -0.0568 130 PHE A CD1 
2254 C CD2 . PHE E 130 ? 1.5136 1.7663 1.8629 0.0677  -0.0576 -0.0472 130 PHE A CD2 
2255 C CE1 . PHE E 130 ? 1.5243 1.7615 1.8529 0.0557  -0.0727 -0.0588 130 PHE A CE1 
2256 C CE2 . PHE E 130 ? 1.5402 1.7820 1.8698 0.0710  -0.0595 -0.0493 130 PHE A CE2 
2257 C CZ  . PHE E 130 ? 1.5479 1.7822 1.8675 0.0656  -0.0668 -0.0550 130 PHE A CZ  
2258 N N   . LYS E 131 ? 1.5808 1.8611 2.0013 0.0556  -0.0379 -0.0350 131 LYS A N   
2259 C CA  . LYS E 131 ? 1.6092 1.8957 2.0457 0.0489  -0.0332 -0.0327 131 LYS A CA  
2260 C C   . LYS E 131 ? 1.5968 1.8884 2.0356 0.0535  -0.0305 -0.0305 131 LYS A C   
2261 O O   . LYS E 131 ? 1.6062 1.9028 2.0552 0.0473  -0.0307 -0.0324 131 LYS A O   
2262 C CB  . LYS E 131 ? 1.6632 1.9502 2.1084 0.0495  -0.0256 -0.0271 131 LYS A CB  
2263 C CG  . LYS E 131 ? 1.6945 1.9865 2.1477 0.0516  -0.0164 -0.0211 131 LYS A CG  
2264 C CD  . LYS E 131 ? 1.6989 1.9947 2.1641 0.0411  -0.0149 -0.0217 131 LYS A CD  
2265 C CE  . LYS E 131 ? 1.7052 2.0040 2.1754 0.0446  -0.0060 -0.0158 131 LYS A CE  
2266 N NZ  . LYS E 131 ? 1.7038 2.0055 2.1857 0.0351  -0.0033 -0.0169 131 LYS A NZ  
2267 N N   . THR E 132 ? 1.5446 1.8337 1.9735 0.0639  -0.0282 -0.0267 132 THR A N   
2268 C CA  . THR E 132 ? 1.4683 1.7595 1.8966 0.0691  -0.0277 -0.0238 132 THR A CA  
2269 C C   . THR E 132 ? 1.4045 1.6959 1.8242 0.0701  -0.0370 -0.0278 132 THR A C   
2270 O O   . THR E 132 ? 1.3897 1.6791 1.8023 0.0663  -0.0428 -0.0331 132 THR A O   
2271 C CB  . THR E 132 ? 1.4883 1.7744 1.9064 0.0778  -0.0218 -0.0179 132 THR A CB  
2272 O OG1 . THR E 132 ? 1.5386 1.8185 1.9391 0.0829  -0.0266 -0.0190 132 THR A OG1 
2273 C CG2 . THR E 132 ? 1.4533 1.7383 1.8740 0.0775  -0.0142 -0.0160 132 THR A CG2 
2274 N N   . CYS E 133 ? 1.3568 1.6500 1.7764 0.0748  -0.0391 -0.0253 133 CYS A N   
2275 C CA  . CYS E 133 ? 1.3428 1.6360 1.7526 0.0765  -0.0483 -0.0277 133 CYS A CA  
2276 C C   . CYS E 133 ? 1.3318 1.6150 1.7199 0.0829  -0.0488 -0.0241 133 CYS A C   
2277 O O   . CYS E 133 ? 1.3703 1.6506 1.7447 0.0830  -0.0559 -0.0260 133 CYS A O   
2278 C CB  . CYS E 133 ? 1.3374 1.6375 1.7591 0.0782  -0.0521 -0.0268 133 CYS A CB  
2279 S SG  . CYS E 133 ? 1.2709 1.5834 1.7109 0.0687  -0.0568 -0.0361 133 CYS A SG  
2280 N N   . GLN E 134 ? 1.2643 1.5418 1.6484 0.0869  -0.0406 -0.0193 134 GLN A N   
2281 C CA  . GLN E 134 ? 1.2109 1.4776 1.5742 0.0917  -0.0391 -0.0165 134 GLN A CA  
2282 C C   . GLN E 134 ? 1.2151 1.4766 1.5672 0.0906  -0.0387 -0.0210 134 GLN A C   
2283 O O   . GLN E 134 ? 1.2368 1.4894 1.5695 0.0924  -0.0405 -0.0210 134 GLN A O   
2284 C CB  . GLN E 134 ? 1.1407 1.4030 1.5023 0.0952  -0.0297 -0.0113 134 GLN A CB  
2285 C CG  . GLN E 134 ? 1.1134 1.3634 1.4521 0.0984  -0.0279 -0.0089 134 GLN A CG  
2286 C CD  . GLN E 134 ? 1.0702 1.3151 1.4049 0.1003  -0.0187 -0.0045 134 GLN A CD  
2287 O OE1 . GLN E 134 ? 1.0476 1.2985 1.3961 0.0997  -0.0119 -0.0036 134 GLN A OE1 
2288 N NE2 . GLN E 134 ? 1.0596 1.2925 1.3734 0.1012  -0.0184 -0.0018 134 GLN A NE2 
2289 N N   . ASP E 135 ? 1.2224 1.4878 1.5858 0.0871  -0.0366 -0.0245 135 ASP A N   
2290 C CA  . ASP E 135 ? 1.2622 1.5217 1.6165 0.0864  -0.0376 -0.0289 135 ASP A CA  
2291 C C   . ASP E 135 ? 1.2854 1.5432 1.6279 0.0829  -0.0476 -0.0331 135 ASP A C   
2292 O O   . ASP E 135 ? 1.3683 1.6169 1.6915 0.0844  -0.0494 -0.0346 135 ASP A O   
2293 C CB  . ASP E 135 ? 1.2831 1.5466 1.6530 0.0824  -0.0356 -0.0311 135 ASP A CB  
2294 C CG  . ASP E 135 ? 1.3243 1.5909 1.7060 0.0849  -0.0257 -0.0267 135 ASP A CG  
2295 O OD1 . ASP E 135 ? 1.3399 1.6018 1.7133 0.0907  -0.0191 -0.0246 135 ASP A OD1 
2296 O OD2 . ASP E 135 ? 1.3405 1.6137 1.7386 0.0801  -0.0241 -0.0256 135 ASP A OD2 
2297 N N   . LYS E 136 ? 1.1992 1.4657 1.5529 0.0776  -0.0534 -0.0353 136 LYS A N   
2298 C CA  . LYS E 136 ? 1.1161 1.3839 1.4610 0.0731  -0.0629 -0.0398 136 LYS A CA  
2299 C C   . LYS E 136 ? 1.0863 1.3482 1.4125 0.0775  -0.0658 -0.0364 136 LYS A C   
2300 O O   . LYS E 136 ? 1.1295 1.3830 1.4356 0.0766  -0.0689 -0.0385 136 LYS A O   
2301 C CB  . LYS E 136 ? 1.0710 1.3511 1.4340 0.0681  -0.0666 -0.0420 136 LYS A CB  
2302 C CG  . LYS E 136 ? 1.0348 1.3201 1.4162 0.0614  -0.0632 -0.0450 136 LYS A CG  
2303 C CD  . LYS E 136 ? 1.0305 1.3257 1.4237 0.0532  -0.0683 -0.0510 136 LYS A CD  
2304 C CE  . LYS E 136 ? 1.0375 1.3356 1.4464 0.0437  -0.0647 -0.0545 136 LYS A CE  
2305 N NZ  . LYS E 136 ? 1.0660 1.3720 1.4834 0.0331  -0.0691 -0.0628 136 LYS A NZ  
2306 N N   . LEU E 137 ? 0.9746 1.2396 1.3063 0.0815  -0.0650 -0.0308 137 LEU A N   
2307 C CA  . LEU E 137 ? 0.9295 1.1881 1.2439 0.0843  -0.0692 -0.0265 137 LEU A CA  
2308 C C   . LEU E 137 ? 0.9800 1.2237 1.2709 0.0866  -0.0643 -0.0246 137 LEU A C   
2309 O O   . LEU E 137 ? 1.0278 1.2637 1.2982 0.0855  -0.0690 -0.0232 137 LEU A O   
2310 C CB  . LEU E 137 ? 0.8408 1.1029 1.1657 0.0882  -0.0696 -0.0204 137 LEU A CB  
2311 C CG  . LEU E 137 ? 0.7938 1.0700 1.1392 0.0859  -0.0762 -0.0230 137 LEU A CG  
2312 C CD1 . LEU E 137 ? 0.7915 1.0688 1.1431 0.0906  -0.0799 -0.0167 137 LEU A CD1 
2313 C CD2 . LEU E 137 ? 0.8168 1.0966 1.1540 0.0807  -0.0853 -0.0283 137 LEU A CD2 
2314 N N   . LYS E 138 ? 0.9557 1.1955 1.2497 0.0890  -0.0546 -0.0249 138 LYS A N   
2315 C CA  . LYS E 138 ? 0.9272 1.1537 1.2018 0.0908  -0.0484 -0.0253 138 LYS A CA  
2316 C C   . LYS E 138 ? 0.8180 1.0387 1.0777 0.0877  -0.0530 -0.0306 138 LYS A C   
2317 O O   . LYS E 138 ? 0.8647 1.0748 1.1009 0.0862  -0.0551 -0.0299 138 LYS A O   
2318 C CB  . LYS E 138 ? 0.9630 1.1900 1.2493 0.0941  -0.0374 -0.0260 138 LYS A CB  
2319 C CG  . LYS E 138 ? 1.0523 1.2673 1.3228 0.0967  -0.0282 -0.0253 138 LYS A CG  
2320 C CD  . LYS E 138 ? 1.1196 1.3384 1.4052 0.0998  -0.0173 -0.0256 138 LYS A CD  
2321 C CE  . LYS E 138 ? 1.1453 1.3749 1.4496 0.0998  -0.0168 -0.0215 138 LYS A CE  
2322 N NZ  . LYS E 138 ? 1.1326 1.3731 1.4586 0.0982  -0.0187 -0.0238 138 LYS A NZ  
2323 N N   . LEU E 139 ? 0.7145 0.9407 0.9859 0.0854  -0.0550 -0.0357 139 LEU A N   
2324 C CA  . LEU E 139 ? 0.7237 0.9427 0.9796 0.0819  -0.0599 -0.0411 139 LEU A CA  
2325 C C   . LEU E 139 ? 0.7128 0.9312 0.9520 0.0775  -0.0690 -0.0408 139 LEU A C   
2326 O O   . LEU E 139 ? 0.7636 0.9700 0.9780 0.0765  -0.0696 -0.0408 139 LEU A O   
2327 C CB  . LEU E 139 ? 0.7100 0.9348 0.9805 0.0778  -0.0635 -0.0463 139 LEU A CB  
2328 C CG  . LEU E 139 ? 0.7459 0.9604 0.9986 0.0741  -0.0686 -0.0522 139 LEU A CG  
2329 C CD1 . LEU E 139 ? 0.7448 0.9464 0.9881 0.0799  -0.0611 -0.0526 139 LEU A CD1 
2330 C CD2 . LEU E 139 ? 0.7590 0.9778 1.0230 0.0673  -0.0746 -0.0574 139 LEU A CD2 
2331 N N   . LEU E 140 ? 0.6460 0.8774 0.8992 0.0745  -0.0757 -0.0406 140 LEU A N   
2332 C CA  . LEU E 140 ? 0.6882 0.9225 0.9300 0.0698  -0.0854 -0.0411 140 LEU A CA  
2333 C C   . LEU E 140 ? 0.7589 0.9838 0.9805 0.0718  -0.0857 -0.0348 140 LEU A C   
2334 O O   . LEU E 140 ? 0.7514 0.9713 0.9523 0.0674  -0.0919 -0.0350 140 LEU A O   
2335 C CB  . LEU E 140 ? 0.7324 0.9837 0.9972 0.0677  -0.0910 -0.0417 140 LEU A CB  
2336 C CG  . LEU E 140 ? 0.7960 1.0525 1.0528 0.0646  -0.1009 -0.0407 140 LEU A CG  
2337 C CD1 . LEU E 140 ? 0.7957 1.0539 1.0414 0.0563  -0.1074 -0.0484 140 LEU A CD1 
2338 C CD2 . LEU E 140 ? 0.8065 1.0784 1.0889 0.0664  -0.1045 -0.0387 140 LEU A CD2 
2339 N N   . LEU E 141 ? 0.8170 1.0385 1.0427 0.0769  -0.0794 -0.0290 141 LEU A N   
2340 C CA  . LEU E 141 ? 0.8638 1.0729 1.0668 0.0767  -0.0797 -0.0231 141 LEU A CA  
2341 C C   . LEU E 141 ? 0.9999 1.1929 1.1760 0.0744  -0.0752 -0.0258 141 LEU A C   
2342 O O   . LEU E 141 ? 1.0455 1.2298 1.1976 0.0696  -0.0802 -0.0241 141 LEU A O   
2343 C CB  . LEU E 141 ? 0.7463 0.9510 0.9537 0.0811  -0.0728 -0.0173 141 LEU A CB  
2344 C CG  . LEU E 141 ? 0.6507 0.8395 0.8294 0.0779  -0.0744 -0.0119 141 LEU A CG  
2345 C CD1 . LEU E 141 ? 0.6473 0.8414 0.8266 0.0758  -0.0873 -0.0063 141 LEU A CD1 
2346 C CD2 . LEU E 141 ? 0.5904 0.7664 0.7600 0.0794  -0.0639 -0.0088 141 LEU A CD2 
2347 N N   . ASP E 142 ? 1.0271 1.2154 1.2072 0.0776  -0.0656 -0.0298 142 ASP A N   
2348 C CA  . ASP E 142 ? 1.0411 1.2134 1.1977 0.0763  -0.0604 -0.0331 142 ASP A CA  
2349 C C   . ASP E 142 ? 1.0311 1.2007 1.1692 0.0701  -0.0698 -0.0358 142 ASP A C   
2350 O O   . ASP E 142 ? 1.0633 1.2217 1.1749 0.0655  -0.0719 -0.0332 142 ASP A O   
2351 C CB  . ASP E 142 ? 1.0491 1.2209 1.2186 0.0808  -0.0526 -0.0386 142 ASP A CB  
2352 C CG  . ASP E 142 ? 1.0806 1.2354 1.2277 0.0804  -0.0474 -0.0428 142 ASP A CG  
2353 O OD1 . ASP E 142 ? 1.0765 1.2290 1.2200 0.0789  -0.0518 -0.0479 142 ASP A OD1 
2354 O OD2 . ASP E 142 ? 1.0943 1.2368 1.2264 0.0809  -0.0387 -0.0412 142 ASP A OD2 
2355 N N   . PHE E 143 ? 0.9664 1.1463 1.1181 0.0686  -0.0755 -0.0409 143 PHE A N   
2356 C CA  . PHE E 143 ? 0.9170 1.0950 1.0523 0.0618  -0.0841 -0.0455 143 PHE A CA  
2357 C C   . PHE E 143 ? 0.8635 1.0439 0.9835 0.0561  -0.0928 -0.0417 143 PHE A C   
2358 O O   . PHE E 143 ? 0.8360 1.0059 0.9282 0.0505  -0.0960 -0.0428 143 PHE A O   
2359 C CB  . PHE E 143 ? 0.7556 0.9454 0.9105 0.0595  -0.0891 -0.0518 143 PHE A CB  
2360 C CG  . PHE E 143 ? 0.7524 0.9484 0.8982 0.0508  -0.1000 -0.0558 143 PHE A CG  
2361 C CD1 . PHE E 143 ? 0.7197 0.9143 0.8624 0.0451  -0.1044 -0.0635 143 PHE A CD1 
2362 C CD2 . PHE E 143 ? 0.7923 0.9958 0.9333 0.0476  -0.1066 -0.0521 143 PHE A CD2 
2363 C CE1 . PHE E 143 ? 0.7347 0.9354 0.8680 0.0358  -0.1138 -0.0681 143 PHE A CE1 
2364 C CE2 . PHE E 143 ? 0.8080 1.0192 0.9422 0.0394  -0.1161 -0.0562 143 PHE A CE2 
2365 C CZ  . PHE E 143 ? 0.7741 0.9843 0.9040 0.0331  -0.1193 -0.0647 143 PHE A CZ  
2366 N N   . GLN E 144 ? 0.8276 1.0217 0.9660 0.0573  -0.0972 -0.0372 144 GLN A N   
2367 C CA  . GLN E 144 ? 0.8343 1.0333 0.9635 0.0525  -0.1073 -0.0332 144 GLN A CA  
2368 C C   . GLN E 144 ? 0.8811 1.0612 0.9795 0.0504  -0.1044 -0.0274 144 GLN A C   
2369 O O   . GLN E 144 ? 0.9202 1.0949 0.9948 0.0436  -0.1110 -0.0253 144 GLN A O   
2370 C CB  . GLN E 144 ? 0.8021 1.0171 0.9591 0.0562  -0.1117 -0.0288 144 GLN A CB  
2371 C CG  . GLN E 144 ? 0.7539 0.9881 0.9425 0.0568  -0.1139 -0.0347 144 GLN A CG  
2372 C CD  . GLN E 144 ? 0.7324 0.9832 0.9417 0.0573  -0.1224 -0.0322 144 GLN A CD  
2373 O OE1 . GLN E 144 ? 0.7568 1.0048 0.9601 0.0588  -0.1270 -0.0246 144 GLN A OE1 
2374 N NE2 . GLN E 144 ? 0.7068 0.9742 0.9404 0.0554  -0.1248 -0.0387 144 GLN A NE2 
2375 N N   . TRP E 145 ? 0.8853 1.0550 0.9837 0.0554  -0.0938 -0.0251 145 TRP A N   
2376 C CA  . TRP E 145 ? 0.8876 1.0376 0.9581 0.0527  -0.0884 -0.0204 145 TRP A CA  
2377 C C   . TRP E 145 ? 0.9750 1.1095 1.0150 0.0473  -0.0859 -0.0244 145 TRP A C   
2378 O O   . TRP E 145 ? 0.9943 1.1192 1.0071 0.0397  -0.0908 -0.0208 145 TRP A O   
2379 C CB  . TRP E 145 ? 0.7910 0.9349 0.8708 0.0588  -0.0758 -0.0198 145 TRP A CB  
2380 C CG  . TRP E 145 ? 0.7954 0.9195 0.8492 0.0550  -0.0689 -0.0157 145 TRP A CG  
2381 C CD1 . TRP E 145 ? 0.7819 0.8936 0.8070 0.0466  -0.0744 -0.0100 145 TRP A CD1 
2382 C CD2 . TRP E 145 ? 0.8405 0.9539 0.8932 0.0579  -0.0548 -0.0171 145 TRP A CD2 
2383 N NE1 . TRP E 145 ? 0.7931 0.8852 0.7977 0.0432  -0.0642 -0.0080 145 TRP A NE1 
2384 C CE2 . TRP E 145 ? 0.8226 0.9161 0.8444 0.0503  -0.0516 -0.0129 145 TRP A CE2 
2385 C CE3 . TRP E 145 ? 0.8410 0.9601 0.9160 0.0654  -0.0445 -0.0218 145 TRP A CE3 
2386 C CZ2 . TRP E 145 ? 0.8488 0.9279 0.8612 0.0495  -0.0376 -0.0143 145 TRP A CZ2 
2387 C CZ3 . TRP E 145 ? 0.8634 0.9700 0.9308 0.0657  -0.0311 -0.0229 145 TRP A CZ3 
2388 C CH2 . TRP E 145 ? 0.8656 0.9524 0.9020 0.0577  -0.0273 -0.0197 145 TRP A CH2 
2389 N N   . LYS E 146 ? 1.0288 1.1603 1.0732 0.0508  -0.0792 -0.0317 146 LYS A N   
2390 C CA  . LYS E 146 ? 1.0334 1.1490 1.0499 0.0466  -0.0769 -0.0363 146 LYS A CA  
2391 C C   . LYS E 146 ? 1.0539 1.1727 1.0524 0.0379  -0.0891 -0.0361 146 LYS A C   
2392 O O   . LYS E 146 ? 1.0949 1.1987 1.0605 0.0307  -0.0896 -0.0340 146 LYS A O   
2393 C CB  . LYS E 146 ? 0.9433 1.0595 0.9741 0.0523  -0.0723 -0.0442 146 LYS A CB  
2394 C CG  . LYS E 146 ? 0.8961 0.9967 0.9009 0.0485  -0.0723 -0.0499 146 LYS A CG  
2395 C CD  . LYS E 146 ? 0.9269 1.0049 0.9045 0.0477  -0.0613 -0.0491 146 LYS A CD  
2396 C CE  . LYS E 146 ? 0.9853 1.0465 0.9423 0.0469  -0.0591 -0.0559 146 LYS A CE  
2397 N NZ  . LYS E 146 ? 0.9785 1.0370 0.9102 0.0376  -0.0703 -0.0572 146 LYS A NZ  
2398 N N   . PHE E 147 ? 1.0274 1.1658 1.0477 0.0377  -0.0984 -0.0386 147 PHE A N   
2399 C CA  . PHE E 147 ? 1.0452 1.1911 1.0539 0.0293  -0.1102 -0.0401 147 PHE A CA  
2400 C C   . PHE E 147 ? 1.1455 1.2877 1.1330 0.0228  -0.1160 -0.0321 147 PHE A C   
2401 O O   . PHE E 147 ? 1.2102 1.3443 1.1679 0.0141  -0.1206 -0.0324 147 PHE A O   
2402 C CB  . PHE E 147 ? 1.0099 1.1799 1.0520 0.0305  -0.1175 -0.0435 147 PHE A CB  
2403 C CG  . PHE E 147 ? 1.0327 1.2118 1.0668 0.0215  -0.1278 -0.0490 147 PHE A CG  
2404 C CD1 . PHE E 147 ? 1.0343 1.2174 1.0753 0.0190  -0.1292 -0.0582 147 PHE A CD1 
2405 C CD2 . PHE E 147 ? 1.0926 1.2763 1.1121 0.0146  -0.1366 -0.0450 147 PHE A CD2 
2406 C CE1 . PHE E 147 ? 1.0431 1.2342 1.0752 0.0092  -0.1382 -0.0644 147 PHE A CE1 
2407 C CE2 . PHE E 147 ? 1.1020 1.2956 1.1145 0.0056  -0.1456 -0.0509 147 PHE A CE2 
2408 C CZ  . PHE E 147 ? 1.0766 1.2737 1.0948 0.0027  -0.1460 -0.0611 147 PHE A CZ  
2409 N N   . ASN E 148 ? 1.1197 1.2665 1.1208 0.0262  -0.1166 -0.0246 148 ASN A N   
2410 C CA  . ASN E 148 ? 1.1264 1.2687 1.1090 0.0197  -0.1238 -0.0157 148 ASN A CA  
2411 C C   . ASN E 148 ? 1.1447 1.2603 1.0902 0.0142  -0.1161 -0.0112 148 ASN A C   
2412 O O   . ASN E 148 ? 1.1462 1.2524 1.0617 0.0044  -0.1214 -0.0071 148 ASN A O   
2413 C CB  . ASN E 148 ? 1.1463 1.3012 1.1559 0.0248  -0.1288 -0.0091 148 ASN A CB  
2414 C CG  . ASN E 148 ? 1.1420 1.3221 1.1775 0.0250  -0.1413 -0.0105 148 ASN A CG  
2415 O OD1 . ASN E 148 ? 1.1549 1.3471 1.2011 0.0243  -0.1429 -0.0189 148 ASN A OD1 
2416 N ND2 . ASN E 148 ? 1.1287 1.3159 1.1739 0.0252  -0.1506 -0.0026 148 ASN A ND2 
2417 N N   . THR E 149 ? 1.1499 1.2535 1.0976 0.0197  -0.1031 -0.0121 149 THR A N   
2418 C CA  . THR E 149 ? 1.2230 1.3008 1.1383 0.0143  -0.0934 -0.0091 149 THR A CA  
2419 C C   . THR E 149 ? 1.2418 1.3023 1.1325 0.0121  -0.0838 -0.0160 149 THR A C   
2420 O O   . THR E 149 ? 1.3006 1.3387 1.1583 0.0047  -0.0770 -0.0138 149 THR A O   
2421 C CB  . THR E 149 ? 1.2818 1.3542 1.2100 0.0201  -0.0828 -0.0076 149 THR A CB  
2422 O OG1 . THR E 149 ? 1.3833 1.4304 1.2784 0.0121  -0.0742 -0.0043 149 THR A OG1 
2423 C CG2 . THR E 149 ? 1.2155 1.2929 1.1669 0.0303  -0.0720 -0.0163 149 THR A CG2 
2424 N N   . ASN E 150 ? 1.1958 1.2648 1.1009 0.0177  -0.0836 -0.0243 150 ASN A N   
2425 C CA  . ASN E 150 ? 1.1821 1.2340 1.0676 0.0175  -0.0749 -0.0314 150 ASN A CA  
2426 C C   . ASN E 150 ? 1.1226 1.1546 0.9989 0.0202  -0.0584 -0.0324 150 ASN A C   
2427 O O   . ASN E 150 ? 1.0998 1.1098 0.9419 0.0128  -0.0519 -0.0315 150 ASN A O   
2428 C CB  . ASN E 150 ? 1.2122 1.2536 1.0605 0.0064  -0.0815 -0.0311 150 ASN A CB  
2429 C CG  . ASN E 150 ? 1.2070 1.2257 1.0289 0.0053  -0.0719 -0.0374 150 ASN A CG  
2430 O OD1 . ASN E 150 ? 1.2579 1.2545 1.0516 0.0004  -0.0624 -0.0353 150 ASN A OD1 
2431 N ND2 . ASN E 150 ? 1.1619 1.1843 0.9918 0.0093  -0.0745 -0.0453 150 ASN A ND2 
2432 N N   . VAL E 151 ? 1.0720 1.1121 0.9790 0.0301  -0.0512 -0.0347 151 VAL A N   
2433 C CA  . VAL E 151 ? 1.0240 1.0491 0.9277 0.0327  -0.0351 -0.0365 151 VAL A CA  
2434 C C   . VAL E 151 ? 1.0118 1.0389 0.9379 0.0435  -0.0262 -0.0451 151 VAL A C   
2435 O O   . VAL E 151 ? 0.9246 0.9694 0.8796 0.0504  -0.0323 -0.0476 151 VAL A O   
2436 C CB  . VAL E 151 ? 0.9735 1.0041 0.8906 0.0332  -0.0329 -0.0306 151 VAL A CB  
2437 C CG1 . VAL E 151 ? 1.0058 1.0237 0.9237 0.0360  -0.0153 -0.0345 151 VAL A CG1 
2438 C CG2 . VAL E 151 ? 0.9280 0.9514 0.8195 0.0218  -0.0410 -0.0215 151 VAL A CG2 
2439 N N   . SER E 152 ? 1.1198 1.1284 1.0331 0.0443  -0.0117 -0.0496 152 SER A N   
2440 C CA  . SER E 152 ? 1.1926 1.2027 1.1295 0.0550  -0.0022 -0.0574 152 SER A CA  
2441 C C   . SER E 152 ? 1.2162 1.2463 1.1913 0.0629  -0.0008 -0.0564 152 SER A C   
2442 O O   . SER E 152 ? 1.1784 1.2138 1.1557 0.0596  -0.0013 -0.0505 152 SER A O   
2443 C CB  . SER E 152 ? 1.2186 1.2065 1.1377 0.0540  0.0151  -0.0622 152 SER A CB  
2444 O OG  . SER E 152 ? 1.2185 1.2130 1.1684 0.0647  0.0256  -0.0682 152 SER A OG  
2445 N N   . PHE E 153 ? 1.2840 1.3244 1.2877 0.0725  -0.0002 -0.0616 153 PHE A N   
2446 C CA  . PHE E 153 ? 1.3353 1.3937 1.3747 0.0797  0.0027  -0.0611 153 PHE A CA  
2447 C C   . PHE E 153 ? 1.4147 1.4671 1.4552 0.0802  0.0182  -0.0619 153 PHE A C   
2448 O O   . PHE E 153 ? 1.4958 1.5557 1.5428 0.0783  0.0188  -0.0571 153 PHE A O   
2449 C CB  . PHE E 153 ? 1.2673 1.3342 1.3346 0.0889  0.0020  -0.0668 153 PHE A CB  
2450 C CG  . PHE E 153 ? 1.1909 1.2735 1.2923 0.0958  0.0081  -0.0666 153 PHE A CG  
2451 C CD1 . PHE E 153 ? 1.1006 1.2024 1.2259 0.0971  -0.0011 -0.0631 153 PHE A CD1 
2452 C CD2 . PHE E 153 ? 1.1911 1.2694 1.3000 0.0999  0.0237  -0.0705 153 PHE A CD2 
2453 C CE1 . PHE E 153 ? 1.0465 1.1620 1.2006 0.1023  0.0044  -0.0624 153 PHE A CE1 
2454 C CE2 . PHE E 153 ? 1.1427 1.2364 1.2818 0.1053  0.0290  -0.0703 153 PHE A CE2 
2455 C CZ  . PHE E 153 ? 1.0665 1.1784 1.2272 0.1064  0.0191  -0.0658 153 PHE A CZ  
2456 N N   . GLU E 154 ? 1.3980 1.4371 1.4337 0.0832  0.0309  -0.0689 154 GLU A N   
2457 C CA  . GLU E 154 ? 1.4264 1.4594 1.4641 0.0832  0.0478  -0.0721 154 GLU A CA  
2458 C C   . GLU E 154 ? 1.4294 1.4530 1.4412 0.0719  0.0497  -0.0661 154 GLU A C   
2459 O O   . GLU E 154 ? 1.4732 1.5008 1.4931 0.0706  0.0568  -0.0650 154 GLU A O   
2460 C CB  . GLU E 154 ? 1.5265 1.5422 1.5551 0.0858  0.0608  -0.0810 154 GLU A CB  
2461 C CG  . GLU E 154 ? 1.6241 1.6322 1.6540 0.0849  0.0805  -0.0867 154 GLU A CG  
2462 C CD  . GLU E 154 ? 1.7437 1.7261 1.7327 0.0729  0.0896  -0.0873 154 GLU A CD  
2463 O OE1 . GLU E 154 ? 1.7719 1.7447 1.7325 0.0651  0.0792  -0.0816 154 GLU A OE1 
2464 O OE2 . GLU E 154 ? 1.8090 1.7807 1.7936 0.0700  0.1074  -0.0937 154 GLU A OE2 
2465 N N   . ASP E 155 ? 1.4111 1.4215 1.3905 0.0628  0.0425  -0.0619 155 ASP A N   
2466 C CA  . ASP E 155 ? 1.4299 1.4318 1.3843 0.0512  0.0393  -0.0542 155 ASP A CA  
2467 C C   . ASP E 155 ? 1.4039 1.4258 1.3787 0.0531  0.0269  -0.0467 155 ASP A C   
2468 O O   . ASP E 155 ? 1.4357 1.4551 1.4052 0.0478  0.0283  -0.0421 155 ASP A O   
2469 C CB  . ASP E 155 ? 1.5116 1.4974 1.4290 0.0412  0.0320  -0.0505 155 ASP A CB  
2470 C CG  . ASP E 155 ? 1.5731 1.5335 1.4624 0.0359  0.0467  -0.0567 155 ASP A CG  
2471 O OD1 . ASP E 155 ? 1.6132 1.5650 1.5043 0.0356  0.0632  -0.0622 155 ASP A OD1 
2472 O OD2 . ASP E 155 ? 1.5573 1.5058 1.4218 0.0314  0.0425  -0.0566 155 ASP A OD2 
2473 N N   . ARG E 156 ? 1.3499 1.3903 1.3475 0.0602  0.0150  -0.0460 156 ARG A N   
2474 C CA  . ARG E 156 ? 1.2597 1.3200 1.2808 0.0631  0.0047  -0.0403 156 ARG A CA  
2475 C C   . ARG E 156 ? 1.1597 1.2278 1.2030 0.0677  0.0142  -0.0411 156 ARG A C   
2476 O O   . ARG E 156 ? 1.1214 1.1963 1.1704 0.0661  0.0093  -0.0350 156 ARG A O   
2477 C CB  . ARG E 156 ? 1.2362 1.3137 1.2791 0.0691  -0.0066 -0.0417 156 ARG A CB  
2478 C CG  . ARG E 156 ? 1.2227 1.3058 1.2562 0.0638  -0.0226 -0.0364 156 ARG A CG  
2479 C CD  . ARG E 156 ? 1.1668 1.2653 1.2209 0.0682  -0.0318 -0.0398 156 ARG A CD  
2480 N NE  . ARG E 156 ? 1.1066 1.1948 1.1491 0.0687  -0.0296 -0.0463 156 ARG A NE  
2481 C CZ  . ARG E 156 ? 1.0737 1.1698 1.1331 0.0730  -0.0337 -0.0512 156 ARG A CZ  
2482 N NH1 . ARG E 156 ? 1.2114 1.2950 1.2570 0.0731  -0.0326 -0.0568 156 ARG A NH1 
2483 N NH2 . ARG E 156 ? 0.9575 1.0724 1.0464 0.0764  -0.0391 -0.0505 156 ARG A NH2 
2484 N N   . THR E 157 ? 1.1112 1.1787 1.1674 0.0735  0.0274  -0.0486 157 THR A N   
2485 C CA  . THR E 157 ? 1.1009 1.1751 1.1758 0.0768  0.0384  -0.0505 157 THR A CA  
2486 C C   . THR E 157 ? 1.1932 1.2490 1.2439 0.0684  0.0516  -0.0519 157 THR A C   
2487 O O   . THR E 157 ? 1.2823 1.3417 1.3424 0.0683  0.0601  -0.0529 157 THR A O   
2488 C CB  . THR E 157 ? 0.8123 0.8970 0.9165 0.0870  0.0463  -0.0581 157 THR A CB  
2489 O OG1 . THR E 157 ? 0.8363 0.9095 0.9349 0.0866  0.0635  -0.0655 157 THR A OG1 
2490 C CG2 . THR E 157 ? 0.7199 0.8062 0.8280 0.0913  0.0375  -0.0605 157 THR A CG2 
2491 N N   . THR E 158 ? 1.2327 1.2680 1.2507 0.0600  0.0536  -0.0523 158 THR A N   
2492 C CA  . THR E 158 ? 1.3098 1.3247 1.3009 0.0491  0.0661  -0.0537 158 THR A CA  
2493 C C   . THR E 158 ? 1.3528 1.3625 1.3271 0.0396  0.0576  -0.0444 158 THR A C   
2494 O O   . THR E 158 ? 1.3535 1.3509 1.3134 0.0313  0.0672  -0.0453 158 THR A O   
2495 C CB  . THR E 158 ? 1.6080 1.5994 1.5668 0.0415  0.0731  -0.0576 158 THR A CB  
2496 O OG1 . THR E 158 ? 1.6243 1.5986 1.5674 0.0335  0.0916  -0.0638 158 THR A OG1 
2497 C CG2 . THR E 158 ? 1.6190 1.5987 1.5462 0.0311  0.0594  -0.0485 158 THR A CG2 
2498 N N   . VAL E 159 ? 1.3804 1.3993 1.3573 0.0405  0.0395  -0.0359 159 VAL A N   
2499 C CA  . VAL E 159 ? 1.4352 1.4472 1.3947 0.0316  0.0289  -0.0263 159 VAL A CA  
2500 C C   . VAL E 159 ? 1.4661 1.4890 1.4447 0.0350  0.0282  -0.0236 159 VAL A C   
2501 O O   . VAL E 159 ? 1.4345 1.4788 1.4443 0.0453  0.0228  -0.0230 159 VAL A O   
2502 C CB  . VAL E 159 ? 1.4455 1.4639 1.4016 0.0313  0.0097  -0.0186 159 VAL A CB  
2503 C CG1 . VAL E 159 ? 1.4134 1.4562 1.4034 0.0439  0.0031  -0.0211 159 VAL A CG1 
2504 C CG2 . VAL E 159 ? 1.4562 1.4727 1.4048 0.0255  -0.0033 -0.0085 159 VAL A CG2 
2505 N N   . SER E 160 ? 1.5270 1.5332 1.4844 0.0248  0.0339  -0.0219 160 SER A N   
2506 C CA  . SER E 160 ? 1.5017 1.5134 1.4697 0.0255  0.0327  -0.0187 160 SER A CA  
2507 C C   . SER E 160 ? 1.4341 1.4444 1.3945 0.0222  0.0132  -0.0071 160 SER A C   
2508 O O   . SER E 160 ? 1.4500 1.4414 1.3800 0.0109  0.0065  -0.0016 160 SER A O   
2509 C CB  . SER E 160 ? 1.5701 1.5625 1.5161 0.0146  0.0481  -0.0233 160 SER A CB  
2510 O OG  . SER E 160 ? 1.5949 1.5887 1.5442 0.0130  0.0455  -0.0194 160 SER A OG  
2511 N N   . LEU E 161 ? 1.3418 1.3712 1.3298 0.0315  0.0042  -0.0032 161 LEU A N   
2512 C CA  . LEU E 161 ? 1.2941 1.3247 1.2807 0.0304  -0.0148 0.0072  161 LEU A CA  
2513 C C   . LEU E 161 ? 1.3772 1.3822 1.3292 0.0166  -0.0193 0.0138  161 LEU A C   
2514 O O   . LEU E 161 ? 1.3670 1.3646 1.3048 0.0114  -0.0348 0.0220  161 LEU A O   
2515 C CB  . LEU E 161 ? 1.1525 1.2038 1.1723 0.0412  -0.0198 0.0093  161 LEU A CB  
2516 C CG  . LEU E 161 ? 0.9891 1.0504 1.0216 0.0451  -0.0391 0.0179  161 LEU A CG  
2517 C CD1 . LEU E 161 ? 0.9638 1.0483 1.0331 0.0567  -0.0392 0.0164  161 LEU A CD1 
2518 C CD2 . LEU E 161 ? 0.9293 0.9725 0.9402 0.0371  -0.0487 0.0265  161 LEU A CD2 
2519 N N   . LYS E 162 ? 1.4730 1.4640 1.4107 0.0098  -0.0062 0.0100  162 LYS A N   
2520 C CA  . LYS E 162 ? 1.6010 1.5645 1.5025 -0.0056 -0.0099 0.0155  162 LYS A CA  
2521 C C   . LYS E 162 ? 1.6536 1.5968 1.5220 -0.0181 -0.0132 0.0180  162 LYS A C   
2522 O O   . LYS E 162 ? 1.7080 1.6292 1.5465 -0.0313 -0.0231 0.0259  162 LYS A O   
2523 C CB  . LYS E 162 ? 1.6952 1.6465 1.5847 -0.0127 0.0079  0.0083  162 LYS A CB  
2524 C CG  . LYS E 162 ? 1.7846 1.7427 1.6879 -0.0081 0.0052  0.0109  162 LYS A CG  
2525 C CD  . LYS E 162 ? 1.8793 1.8272 1.7708 -0.0158 0.0239  0.0025  162 LYS A CD  
2526 C CE  . LYS E 162 ? 1.8981 1.8675 1.8189 -0.0053 0.0417  -0.0087 162 LYS A CE  
2527 N NZ  . LYS E 162 ? 1.9274 1.8919 1.8424 -0.0114 0.0590  -0.0167 162 LYS A NZ  
2528 N N   . ASP E 163 ? 1.6467 1.5963 1.5194 -0.0146 -0.0055 0.0118  163 ASP A N   
2529 C CA  . ASP E 163 ? 1.6724 1.6043 1.5145 -0.0258 -0.0076 0.0139  163 ASP A CA  
2530 C C   . ASP E 163 ? 1.6384 1.5759 1.4806 -0.0252 -0.0304 0.0249  163 ASP A C   
2531 O O   . ASP E 163 ? 1.6787 1.5969 1.4894 -0.0385 -0.0385 0.0316  163 ASP A O   
2532 C CB  . ASP E 163 ? 1.7196 1.6585 1.5694 -0.0201 0.0058  0.0041  163 ASP A CB  
2533 C CG  . ASP E 163 ? 1.8170 1.7447 1.6591 -0.0243 0.0292  -0.0072 163 ASP A CG  
2534 O OD1 . ASP E 163 ? 1.9633 1.8818 1.7983 -0.0305 0.0359  -0.0085 163 ASP A OD1 
2535 O OD2 . ASP E 163 ? 1.8287 1.7567 1.6722 -0.0215 0.0407  -0.0152 163 ASP A OD2 
2536 N N   . LEU E 164 ? 1.5510 1.5155 1.4294 -0.0103 -0.0402 0.0264  164 LEU A N   
2537 C CA  . LEU E 164 ? 1.4612 1.4367 1.3476 -0.0075 -0.0608 0.0349  164 LEU A CA  
2538 C C   . LEU E 164 ? 1.5254 1.4835 1.3897 -0.0183 -0.0769 0.0466  164 LEU A C   
2539 O O   . LEU E 164 ? 1.6026 1.5492 1.4604 -0.0220 -0.0764 0.0491  164 LEU A O   
2540 C CB  . LEU E 164 ? 1.3239 1.3297 1.2540 0.0091  -0.0664 0.0335  164 LEU A CB  
2541 C CG  . LEU E 164 ? 1.2459 1.2674 1.1911 0.0134  -0.0864 0.0402  164 LEU A CG  
2542 C CD1 . LEU E 164 ? 1.2586 1.2800 1.1901 0.0091  -0.0890 0.0390  164 LEU A CD1 
2543 C CD2 . LEU E 164 ? 1.1718 1.2211 1.1595 0.0283  -0.0885 0.0371  164 LEU A CD2 
2544 N N   . GLN E 165 ? 1.4692 1.4251 1.3213 -0.0238 -0.0919 0.0538  165 GLN A N   
2545 C CA  . GLN E 165 ? 1.4327 1.3719 1.2638 -0.0347 -0.1096 0.0660  165 GLN A CA  
2546 C C   . GLN E 165 ? 1.3431 1.3028 1.1973 -0.0270 -0.1310 0.0733  165 GLN A C   
2547 O O   . GLN E 165 ? 1.2778 1.2484 1.1340 -0.0264 -0.1354 0.0727  165 GLN A O   
2548 C CB  . GLN E 165 ? 1.4929 1.4035 1.2781 -0.0538 -0.1078 0.0693  165 GLN A CB  
2549 C CG  . GLN E 165 ? 1.5331 1.4205 1.2917 -0.0642 -0.0861 0.0616  165 GLN A CG  
2550 C CD  . GLN E 165 ? 1.6275 1.4871 1.3413 -0.0836 -0.0832 0.0642  165 GLN A CD  
2551 O OE1 . GLN E 165 ? 1.6565 1.5164 1.3599 -0.0884 -0.0969 0.0716  165 GLN A OE1 
2552 N NE2 . GLN E 165 ? 1.6590 1.4944 1.3454 -0.0958 -0.0648 0.0579  165 GLN A NE2 
2553 N N   . CYS E 166 ? 1.3209 1.2850 1.1919 -0.0218 -0.1443 0.0798  166 CYS A N   
2554 C CA  . CYS E 166 ? 1.2913 1.2753 1.1877 -0.0141 -0.1647 0.0863  166 CYS A CA  
2555 C C   . CYS E 166 ? 1.3471 1.3178 1.2165 -0.0274 -0.1809 0.0963  166 CYS A C   
2556 O O   . CYS E 166 ? 1.3605 1.3015 1.1920 -0.0431 -0.1826 0.1024  166 CYS A O   
2557 C CB  . CYS E 166 ? 1.2546 1.2426 1.1729 -0.0060 -0.1747 0.0911  166 CYS A CB  
2558 S SG  . CYS E 166 ? 1.9762 1.9863 1.9273 0.0032  -0.2008 0.0994  166 CYS A SG  
2559 N N   . ILE E 167 ? 1.3818 1.3745 1.2695 -0.0223 -0.1920 0.0972  167 ILE A N   
2560 C CA  . ILE E 167 ? 1.4497 1.4354 1.3189 -0.0331 -0.2105 0.1076  167 ILE A CA  
2561 C C   . ILE E 167 ? 1.5089 1.5146 1.4128 -0.0230 -0.2316 0.1141  167 ILE A C   
2562 O O   . ILE E 167 ? 1.4738 1.5098 1.4142 -0.0103 -0.2338 0.1085  167 ILE A O   
2563 C CB  . ILE E 167 ? 1.4249 1.4203 1.2853 -0.0368 -0.2067 0.1033  167 ILE A CB  
2564 C CG1 . ILE E 167 ? 1.4595 1.4306 1.2815 -0.0484 -0.1870 0.0981  167 ILE A CG1 
2565 C CG2 . ILE E 167 ? 1.4186 1.4144 1.2682 -0.0459 -0.2280 0.1140  167 ILE A CG2 
2566 C CD1 . ILE E 167 ? 1.5108 1.4456 1.2908 -0.0661 -0.1878 0.1062  167 ILE A CD1 
2567 N N   . LEU E 168 ? 1.6192 1.6067 1.5118 -0.0290 -0.2471 0.1253  168 LEU A N   
2568 C CA  . LEU E 168 ? 1.6760 1.6793 1.5983 -0.0211 -0.2700 0.1330  168 LEU A CA  
2569 C C   . LEU E 168 ? 1.7702 1.7526 1.6611 -0.0373 -0.2893 0.1467  168 LEU A C   
2570 O O   . LEU E 168 ? 1.8087 1.7592 1.6673 -0.0497 -0.2936 0.1546  168 LEU A O   
2571 C CB  . LEU E 168 ? 1.6487 1.6506 1.5929 -0.0105 -0.2727 0.1341  168 LEU A CB  
2572 C CG  . LEU E 168 ? 1.5662 1.5924 1.5475 0.0064  -0.2567 0.1220  168 LEU A CG  
2573 C CD1 . LEU E 168 ? 1.5526 1.5698 1.5439 0.0131  -0.2568 0.1237  168 LEU A CD1 
2574 C CD2 . LEU E 168 ? 1.5243 1.5870 1.5487 0.0192  -0.2632 0.1173  168 LEU A CD2 
2575 N N   . ASP E 169 ? 1.7998 1.7999 1.6989 -0.0384 -0.3009 0.1492  169 ASP A N   
2576 C CA  . ASP E 169 ? 1.8709 1.8553 1.7442 -0.0534 -0.3213 0.1629  169 ASP A CA  
2577 C C   . ASP E 169 ? 1.9604 1.9764 1.8769 -0.0416 -0.3419 0.1662  169 ASP A C   
2578 O O   . ASP E 169 ? 1.9927 2.0385 1.9329 -0.0343 -0.3380 0.1580  169 ASP A O   
2579 C CB  . ASP E 169 ? 1.8079 1.7819 1.6426 -0.0692 -0.3122 0.1618  169 ASP A CB  
2580 C CG  . ASP E 169 ? 1.7728 1.7043 1.5531 -0.0898 -0.3059 0.1677  169 ASP A CG  
2581 O OD1 . ASP E 169 ? 1.7657 1.6800 1.5370 -0.0895 -0.2920 0.1632  169 ASP A OD1 
2582 O OD2 . ASP E 169 ? 1.7614 1.6764 1.5074 -0.1075 -0.3149 0.1767  169 ASP A OD2 
2583 N N   . ASP E 170 ? 1.9954 2.0056 1.9242 -0.0393 -0.3633 0.1770  170 ASP A N   
2584 C CA  . ASP E 170 ? 1.9909 2.0305 1.9619 -0.0286 -0.3844 0.1806  170 ASP A CA  
2585 C C   . ASP E 170 ? 2.0034 2.0366 1.9542 -0.0434 -0.4063 0.1937  170 ASP A C   
2586 O O   . ASP E 170 ? 2.0478 2.1094 2.0294 -0.0375 -0.4209 0.1949  170 ASP A O   
2587 C CB  . ASP E 170 ? 2.0020 2.0457 2.0086 -0.0135 -0.3951 0.1830  170 ASP A CB  
2588 C CG  . ASP E 170 ? 1.9616 2.0230 1.9989 0.0032  -0.3743 0.1687  170 ASP A CG  
2589 O OD1 . ASP E 170 ? 1.9027 1.9589 1.9210 -0.0001 -0.3510 0.1594  170 ASP A OD1 
2590 O OD2 . ASP E 170 ? 2.0077 2.0884 2.0886 0.0193  -0.3811 0.1666  170 ASP A OD2 
2591 N N   . GLU E 171 ? 1.9397 1.9361 1.8370 -0.0640 -0.4066 0.2026  171 GLU A N   
2592 C CA  . GLU E 171 ? 1.8418 1.8289 1.7113 -0.0816 -0.4237 0.2148  171 GLU A CA  
2593 C C   . GLU E 171 ? 1.7981 1.8185 1.6835 -0.0783 -0.4179 0.2064  171 GLU A C   
2594 O O   . GLU E 171 ? 1.8343 1.8780 1.7422 -0.0765 -0.4366 0.2111  171 GLU A O   
2595 C CB  . GLU E 171 ? 1.7601 1.7041 1.5655 -0.1055 -0.4141 0.2201  171 GLU A CB  
2596 C CG  . GLU E 171 ? 1.6979 1.6029 1.4761 -0.1161 -0.4242 0.2310  171 GLU A CG  
2597 C CD  . GLU E 171 ? 1.7018 1.5727 1.4348 -0.1292 -0.4000 0.2255  171 GLU A CD  
2598 O OE1 . GLU E 171 ? 1.7013 1.5826 1.4496 -0.1166 -0.3769 0.2113  171 GLU A OE1 
2599 O OE2 . GLU E 171 ? 1.7185 1.5518 1.4013 -0.1526 -0.4043 0.2352  171 GLU A OE2 
2600 N N   . ASN E 172 ? 1.6880 1.7099 1.5613 -0.0775 -0.3916 0.1933  172 ASN A N   
2601 C CA  . ASN E 172 ? 1.5676 1.6116 1.4415 -0.0784 -0.3817 0.1843  172 ASN A CA  
2602 C C   . ASN E 172 ? 1.5003 1.5830 1.4246 -0.0577 -0.3719 0.1690  172 ASN A C   
2603 O O   . ASN E 172 ? 1.4332 1.5354 1.3606 -0.0575 -0.3633 0.1599  172 ASN A O   
2604 C CB  . ASN E 172 ? 1.5501 1.5664 1.3749 -0.0921 -0.3595 0.1801  172 ASN A CB  
2605 C CG  . ASN E 172 ? 1.5263 1.5049 1.3220 -0.0997 -0.3532 0.1848  172 ASN A CG  
2606 O OD1 . ASN E 172 ? 1.4892 1.4694 1.3093 -0.0872 -0.3516 0.1822  172 ASN A OD1 
2607 N ND2 . ASN E 172 ? 1.5653 1.5091 1.3073 -0.1216 -0.3503 0.1921  172 ASN A ND2 
2608 N N   . GLY E 173 ? 1.4778 1.5701 1.4398 -0.0415 -0.3731 0.1661  173 GLY A N   
2609 C CA  . GLY E 173 ? 1.3602 1.4868 1.3698 -0.0231 -0.3638 0.1520  173 GLY A CA  
2610 C C   . GLY E 173 ? 1.2743 1.4000 1.2728 -0.0214 -0.3368 0.1382  173 GLY A C   
2611 O O   . GLY E 173 ? 1.2409 1.3895 1.2515 -0.0186 -0.3294 0.1279  173 GLY A O   
2612 N N   . LYS E 174 ? 1.2516 1.3509 1.2276 -0.0233 -0.3226 0.1378  174 LYS A N   
2613 C CA  . LYS E 174 ? 1.2516 1.3462 1.2140 -0.0227 -0.2974 0.1258  174 LYS A CA  
2614 C C   . LYS E 174 ? 1.1651 1.2550 1.1430 -0.0117 -0.2839 0.1202  174 LYS A C   
2615 O O   . LYS E 174 ? 1.1957 1.2674 1.1682 -0.0123 -0.2899 0.1278  174 LYS A O   
2616 C CB  . LYS E 174 ? 1.3744 1.4375 1.2814 -0.0411 -0.2891 0.1297  174 LYS A CB  
2617 C CG  . LYS E 174 ? 1.4469 1.5141 1.3332 -0.0532 -0.2975 0.1332  174 LYS A CG  
2618 C CD  . LYS E 174 ? 1.5139 1.5448 1.3442 -0.0740 -0.2965 0.1425  174 LYS A CD  
2619 C CE  . LYS E 174 ? 1.5334 1.5412 1.3352 -0.0780 -0.2713 0.1345  174 LYS A CE  
2620 N NZ  . LYS E 174 ? 1.5802 1.5502 1.3271 -0.0996 -0.2689 0.1429  174 LYS A NZ  
2621 N N   . CYS E 175 ? 1.0775 1.1831 1.0733 -0.0025 -0.2663 0.1070  175 CYS A N   
2622 C CA  . CYS E 175 ? 1.0867 1.1855 1.0901 0.0054  -0.2502 0.1011  175 CYS A CA  
2623 C C   . CYS E 175 ? 1.0966 1.2006 1.0969 0.0075  -0.2290 0.0885  175 CYS A C   
2624 O O   . CYS E 175 ? 1.1064 1.2296 1.1169 0.0090  -0.2279 0.0817  175 CYS A O   
2625 C CB  . CYS E 175 ? 1.0567 1.1756 1.1058 0.0209  -0.2558 0.0995  175 CYS A CB  
2626 S SG  . CYS E 175 ? 2.2282 2.3883 2.3241 0.0328  -0.2554 0.0879  175 CYS A SG  
2627 N N   . GLY E 176 ? 1.1043 1.1910 1.0910 0.0074  -0.2126 0.0851  176 GLY A N   
2628 C CA  . GLY E 176 ? 1.1092 1.1982 1.0926 0.0095  -0.1928 0.0738  176 GLY A CA  
2629 C C   . GLY E 176 ? 1.1486 1.2177 1.1176 0.0088  -0.1760 0.0711  176 GLY A C   
2630 O O   . GLY E 176 ? 1.2095 1.2632 1.1711 0.0065  -0.1790 0.0774  176 GLY A O   
2631 N N   . LEU E 177 ? 1.1580 1.2277 1.1235 0.0105  -0.1586 0.0613  177 LEU A N   
2632 C CA  . LEU E 177 ? 1.1855 1.2381 1.1377 0.0093  -0.1408 0.0570  177 LEU A CA  
2633 C C   . LEU E 177 ? 1.3539 1.3897 1.2729 -0.0002 -0.1286 0.0527  177 LEU A C   
2634 O O   . LEU E 177 ? 1.3677 1.4147 1.2928 0.0033  -0.1232 0.0453  177 LEU A O   
2635 C CB  . LEU E 177 ? 1.0549 1.1264 1.0417 0.0228  -0.1300 0.0483  177 LEU A CB  
2636 C CG  . LEU E 177 ? 0.9907 1.0793 1.0116 0.0326  -0.1401 0.0514  177 LEU A CG  
2637 C CD1 . LEU E 177 ? 0.9522 1.0670 1.0086 0.0437  -0.1357 0.0429  177 LEU A CD1 
2638 C CD2 . LEU E 177 ? 0.9900 1.0647 1.0074 0.0330  -0.1346 0.0543  177 LEU A CD2 
2639 N N   . ALA E 178 ? 1.4586 1.4662 1.3416 -0.0130 -0.1242 0.0570  178 ALA A N   
2640 C CA  . ALA E 178 ? 1.5014 1.4898 1.3493 -0.0239 -0.1130 0.0537  178 ALA A CA  
2641 C C   . ALA E 178 ? 1.5311 1.5030 1.3670 -0.0257 -0.0914 0.0460  178 ALA A C   
2642 O O   . ALA E 178 ? 1.6076 1.5749 1.4502 -0.0240 -0.0865 0.0459  178 ALA A O   
2643 C CB  . ALA E 178 ? 1.5474 1.5146 1.3579 -0.0406 -0.1246 0.0643  178 ALA A CB  
2644 N N   . HIS E 179 ? 1.4404 1.4039 1.2595 -0.0291 -0.0781 0.0389  179 HIS A N   
2645 C CA  . HIS E 179 ? 1.4270 1.3742 1.2340 -0.0318 -0.0570 0.0309  179 HIS A CA  
2646 C C   . HIS E 179 ? 1.6118 1.5328 1.3760 -0.0470 -0.0495 0.0306  179 HIS A C   
2647 O O   . HIS E 179 ? 1.6826 1.6068 1.4405 -0.0466 -0.0499 0.0282  179 HIS A O   
2648 C CB  . HIS E 179 ? 1.2625 1.2300 1.1030 -0.0160 -0.0457 0.0199  179 HIS A CB  
2649 C CG  . HIS E 179 ? 1.1982 1.1558 1.0383 -0.0152 -0.0250 0.0111  179 HIS A CG  
2650 N ND1 . HIS E 179 ? 1.1902 1.1439 1.0279 -0.0126 -0.0094 0.0012  179 HIS A ND1 
2651 C CD2 . HIS E 179 ? 1.2021 1.1535 1.0447 -0.0167 -0.0172 0.0103  179 HIS A CD2 
2652 C CE1 . HIS E 179 ? 1.2107 1.1578 1.0518 -0.0121 0.0073  -0.0056 179 HIS A CE1 
2653 N NE2 . HIS E 179 ? 1.2463 1.1919 1.0893 -0.0152 0.0032  -0.0005 179 HIS A NE2 
2654 N N   . SER E 180 ? 1.6753 1.5688 1.4079 -0.0619 -0.0431 0.0334  180 SER A N   
2655 C CA  . SER E 180 ? 1.7446 1.6095 1.4330 -0.0792 -0.0349 0.0336  180 SER A CA  
2656 C C   . SER E 180 ? 1.7460 1.5989 1.4289 -0.0792 -0.0094 0.0208  180 SER A C   
2657 O O   . SER E 180 ? 1.7839 1.6137 1.4338 -0.0915 0.0023  0.0178  180 SER A O   
2658 C CB  . SER E 180 ? 1.7824 1.6219 1.4369 -0.0982 -0.0438 0.0444  180 SER A CB  
2659 O OG  . SER E 180 ? 1.7633 1.5996 1.4272 -0.0974 -0.0406 0.0438  180 SER A OG  
2660 N N   . SER E 181 ? 1.7237 1.5937 1.4410 -0.0649 -0.0007 0.0129  181 SER A N   
2661 C CA  . SER E 181 ? 1.7453 1.6094 1.4667 -0.0621 0.0228  0.0000  181 SER A CA  
2662 C C   . SER E 181 ? 1.7296 1.6040 1.4631 -0.0512 0.0292  -0.0079 181 SER A C   
2663 O O   . SER E 181 ? 1.7316 1.6096 1.4573 -0.0515 0.0173  -0.0032 181 SER A O   
2664 C CB  . SER E 181 ? 1.7795 1.6587 1.5329 -0.0518 0.0279  -0.0042 181 SER A CB  
2665 O OG  . SER E 181 ? 1.8454 1.7094 1.5810 -0.0640 0.0243  0.0019  181 SER A OG  
2666 N N   . LYS E 182 ? 1.7402 1.6176 1.4906 -0.0428 0.0475  -0.0200 182 LYS A N   
2667 C CA  . LYS E 182 ? 1.7316 1.6113 1.4870 -0.0349 0.0556  -0.0283 182 LYS A CA  
2668 C C   . LYS E 182 ? 1.6825 1.5809 1.4516 -0.0253 0.0390  -0.0247 182 LYS A C   
2669 O O   . LYS E 182 ? 1.7483 1.6359 1.4939 -0.0303 0.0375  -0.0245 182 LYS A O   
2670 C CB  . LYS E 182 ? 1.7711 1.6593 1.5557 -0.0229 0.0736  -0.0409 182 LYS A CB  
2671 C CG  . LYS E 182 ? 1.8034 1.6977 1.6046 -0.0222 0.0797  -0.0424 182 LYS A CG  
2672 C CD  . LYS E 182 ? 1.8242 1.7299 1.6567 -0.0101 0.0967  -0.0547 182 LYS A CD  
2673 C CE  . LYS E 182 ? 1.9159 1.8109 1.7420 -0.0189 0.1123  -0.0599 182 LYS A CE  
2674 N NZ  . LYS E 182 ? 1.9953 1.8580 1.7780 -0.0376 0.1242  -0.0621 182 LYS A NZ  
2675 N N   . PRO E 183 ? 1.5523 1.4779 1.3577 -0.0126 0.0272  -0.0225 183 PRO A N   
2676 C CA  . PRO E 183 ? 1.4866 1.4255 1.2954 -0.0094 0.0098  -0.0176 183 PRO A CA  
2677 C C   . PRO E 183 ? 1.4100 1.3418 1.1945 -0.0222 -0.0054 -0.0057 183 PRO A C   
2678 O O   . PRO E 183 ? 1.4339 1.3636 1.2189 -0.0264 -0.0090 0.0001  183 PRO A O   
2679 C CB  . PRO E 183 ? 1.4606 1.4290 1.3144 0.0060  0.0027  -0.0190 183 PRO A CB  
2680 C CG  . PRO E 183 ? 1.4637 1.4332 1.3369 0.0136  0.0200  -0.0279 183 PRO A CG  
2681 C CD  . PRO E 183 ? 1.5123 1.4581 1.3575 0.0008  0.0316  -0.0273 183 PRO A CD  
2682 N N   . ASN E 184 ? 1.3283 1.2558 1.0911 -0.0286 -0.0148 -0.0019 184 ASN A N   
2683 C CA  . ASN E 184 ? 1.2710 1.1930 1.0117 -0.0408 -0.0305 0.0098  184 ASN A CA  
2684 C C   . ASN E 184 ? 1.1975 1.1456 0.9604 -0.0335 -0.0493 0.0134  184 ASN A C   
2685 O O   . ASN E 184 ? 1.1707 1.1237 0.9291 -0.0322 -0.0522 0.0101  184 ASN A O   
2686 C CB  . ASN E 184 ? 1.3243 1.2189 1.0177 -0.0572 -0.0262 0.0122  184 ASN A CB  
2687 C CG  . ASN E 184 ? 1.3997 1.2825 1.0659 -0.0730 -0.0401 0.0251  184 ASN A CG  
2688 O OD1 . ASN E 184 ? 1.4224 1.3196 1.0933 -0.0733 -0.0586 0.0324  184 ASN A OD1 
2689 N ND2 . ASN E 184 ? 1.4641 1.3203 1.1018 -0.0870 -0.0313 0.0278  184 ASN A ND2 
2690 N N   . PHE E 185 ? 1.1948 1.1590 0.9814 -0.0292 -0.0617 0.0195  185 PHE A N   
2691 C CA  . PHE E 185 ? 1.2243 1.2153 1.0372 -0.0217 -0.0783 0.0216  185 PHE A CA  
2692 C C   . PHE E 185 ? 1.2600 1.2617 1.0883 -0.0216 -0.0942 0.0312  185 PHE A C   
2693 O O   . PHE E 185 ? 1.3162 1.3066 1.1406 -0.0246 -0.0920 0.0355  185 PHE A O   
2694 C CB  . PHE E 185 ? 1.1921 1.2036 1.0408 -0.0065 -0.0727 0.0117  185 PHE A CB  
2695 C CG  . PHE E 185 ? 1.1732 1.1941 1.0526 0.0032  -0.0671 0.0100  185 PHE A CG  
2696 C CD1 . PHE E 185 ? 1.1435 1.1857 1.0536 0.0102  -0.0789 0.0136  185 PHE A CD1 
2697 C CD2 . PHE E 185 ? 1.1947 1.2040 1.0731 0.0054  -0.0496 0.0041  185 PHE A CD2 
2698 C CE1 . PHE E 185 ? 1.1491 1.1991 1.0851 0.0185  -0.0736 0.0124  185 PHE A CE1 
2699 C CE2 . PHE E 185 ? 1.1712 1.1900 1.0768 0.0137  -0.0445 0.0026  185 PHE A CE2 
2700 C CZ  . PHE E 185 ? 1.1508 1.1893 1.0839 0.0199  -0.0566 0.0071  185 PHE A CZ  
2701 N N   . VAL E 186 ? 1.2413 1.2635 1.0853 -0.0189 -0.1104 0.0341  186 VAL A N   
2702 C CA  . VAL E 186 ? 1.2309 1.2656 1.0939 -0.0172 -0.1267 0.0427  186 VAL A CA  
2703 C C   . VAL E 186 ? 1.1671 1.2338 1.0716 -0.0049 -0.1353 0.0384  186 VAL A C   
2704 O O   . VAL E 186 ? 1.1952 1.2738 1.1004 -0.0058 -0.1405 0.0349  186 VAL A O   
2705 C CB  . VAL E 186 ? 0.9445 0.9677 0.7777 -0.0314 -0.1413 0.0537  186 VAL A CB  
2706 C CG1 . VAL E 186 ? 0.9327 0.9749 0.7917 -0.0276 -0.1613 0.0614  186 VAL A CG1 
2707 C CG2 . VAL E 186 ? 0.9757 0.9666 0.7718 -0.0446 -0.1349 0.0596  186 VAL A CG2 
2708 N N   . LEU E 187 ? 1.0598 1.1394 0.9971 0.0053  -0.1362 0.0383  187 LEU A N   
2709 C CA  . LEU E 187 ? 0.9937 1.1022 0.9697 0.0154  -0.1435 0.0341  187 LEU A CA  
2710 C C   . LEU E 187 ? 1.0149 1.1352 1.0061 0.0156  -0.1618 0.0425  187 LEU A C   
2711 O O   . LEU E 187 ? 1.0565 1.1639 1.0391 0.0125  -0.1674 0.0514  187 LEU A O   
2712 C CB  . LEU E 187 ? 0.9110 1.0287 0.9167 0.0269  -0.1326 0.0278  187 LEU A CB  
2713 C CG  . LEU E 187 ? 0.8230 0.9378 0.8263 0.0297  -0.1172 0.0179  187 LEU A CG  
2714 C CD1 . LEU E 187 ? 0.7724 0.9013 0.8101 0.0407  -0.1100 0.0126  187 LEU A CD1 
2715 C CD2 . LEU E 187 ? 0.7898 0.9125 0.7873 0.0267  -0.1213 0.0125  187 LEU A CD2 
2716 N N   . VAL E 188 ? 1.0152 1.1595 1.0292 0.0188  -0.1713 0.0391  188 VAL A N   
2717 C CA  . VAL E 188 ? 0.9786 1.1382 1.0130 0.0203  -0.1889 0.0455  188 VAL A CA  
2718 C C   . VAL E 188 ? 0.9864 1.1747 1.0663 0.0313  -0.1913 0.0385  188 VAL A C   
2719 O O   . VAL E 188 ? 0.8999 1.0999 0.9908 0.0338  -0.1836 0.0283  188 VAL A O   
2720 C CB  . VAL E 188 ? 1.0355 1.1954 1.0485 0.0096  -0.2016 0.0500  188 VAL A CB  
2721 C CG1 . VAL E 188 ? 1.0316 1.2152 1.0749 0.0130  -0.2194 0.0533  188 VAL A CG1 
2722 C CG2 . VAL E 188 ? 1.0280 1.1587 0.9996 -0.0021 -0.2031 0.0603  188 VAL A CG2 
2723 N N   . PRO E 189 ? 0.9467 1.1444 1.0524 0.0373  -0.2018 0.0439  189 PRO A N   
2724 C CA  . PRO E 189 ? 0.9424 1.1664 1.0917 0.0469  -0.2032 0.0371  189 PRO A CA  
2725 C C   . PRO E 189 ? 0.8629 1.1103 1.0268 0.0444  -0.2120 0.0313  189 PRO A C   
2726 O O   . PRO E 189 ? 0.7936 1.0442 0.9506 0.0391  -0.2260 0.0372  189 PRO A O   
2727 C CB  . PRO E 189 ? 0.9206 1.1442 1.0885 0.0531  -0.2131 0.0457  189 PRO A CB  
2728 C CG  . PRO E 189 ? 0.9618 1.1658 1.0980 0.0444  -0.2240 0.0573  189 PRO A CG  
2729 C CD  . PRO E 189 ? 0.9773 1.1599 1.0728 0.0351  -0.2123 0.0562  189 PRO A CD  
2730 N N   . ASN E 190 ? 0.9207 1.1846 1.1053 0.0475  -0.2042 0.0197  190 ASN A N   
2731 C CA  . ASN E 190 ? 0.9584 1.2468 1.1628 0.0452  -0.2121 0.0127  190 ASN A CA  
2732 C C   . ASN E 190 ? 1.0326 1.3415 1.2823 0.0545  -0.2162 0.0105  190 ASN A C   
2733 O O   . ASN E 190 ? 1.0141 1.3283 1.2847 0.0601  -0.2058 0.0039  190 ASN A O   
2734 C CB  . ASN E 190 ? 0.9654 1.2586 1.1635 0.0407  -0.2024 0.0006  190 ASN A CB  
2735 C CG  . ASN E 190 ? 0.9530 1.2664 1.1573 0.0339  -0.2110 -0.0063 190 ASN A CG  
2736 O OD1 . ASN E 190 ? 0.9297 1.2549 1.1443 0.0330  -0.2242 -0.0017 190 ASN A OD1 
2737 N ND2 . ASN E 190 ? 0.9850 1.3023 1.1829 0.0285  -0.2043 -0.0174 190 ASN A ND2 
2738 N N   . PHE E 191 ? 1.0836 1.4035 1.3485 0.0558  -0.2314 0.0162  191 PHE A N   
2739 C CA  . PHE E 191 ? 1.1161 1.4542 1.4250 0.0653  -0.2363 0.0149  191 PHE A CA  
2740 C C   . PHE E 191 ? 1.2111 1.5779 1.5494 0.0638  -0.2368 0.0019  191 PHE A C   
2741 O O   . PHE E 191 ? 1.2636 1.6474 1.6408 0.0708  -0.2363 -0.0033 191 PHE A O   
2742 C CB  . PHE E 191 ? 1.0827 1.4184 1.3967 0.0683  -0.2537 0.0273  191 PHE A CB  
2743 C CG  . PHE E 191 ? 1.0706 1.3774 1.3592 0.0695  -0.2539 0.0397  191 PHE A CG  
2744 C CD1 . PHE E 191 ? 1.0072 1.3058 1.3089 0.0782  -0.2465 0.0411  191 PHE A CD1 
2745 C CD2 . PHE E 191 ? 1.0959 1.3829 1.3461 0.0605  -0.2614 0.0498  191 PHE A CD2 
2746 C CE1 . PHE E 191 ? 0.9835 1.2552 1.2600 0.0777  -0.2465 0.0516  191 PHE A CE1 
2747 C CE2 . PHE E 191 ? 1.0826 1.3418 1.3077 0.0595  -0.2611 0.0603  191 PHE A CE2 
2748 C CZ  . PHE E 191 ? 1.0092 1.2610 1.2475 0.0681  -0.2538 0.0608  191 PHE A CZ  
2749 N N   . GLN E 192 ? 1.2463 1.6173 1.5642 0.0535  -0.2376 -0.0035 192 GLN A N   
2750 C CA  . GLN E 192 ? 1.2613 1.6581 1.6010 0.0490  -0.2384 -0.0166 192 GLN A CA  
2751 C C   . GLN E 192 ? 1.2247 1.6216 1.5647 0.0461  -0.2229 -0.0291 192 GLN A C   
2752 O O   . GLN E 192 ? 1.2105 1.6275 1.5731 0.0425  -0.2207 -0.0417 192 GLN A O   
2753 C CB  . GLN E 192 ? 1.3236 1.7245 1.6384 0.0380  -0.2483 -0.0159 192 GLN A CB  
2754 C CG  . GLN E 192 ? 1.4256 1.8219 1.7325 0.0385  -0.2646 -0.0015 192 GLN A CG  
2755 C CD  . GLN E 192 ? 1.5758 1.9404 1.8494 0.0396  -0.2632 0.0122  192 GLN A CD  
2756 O OE1 . GLN E 192 ? 1.6448 1.9919 1.9028 0.0411  -0.2495 0.0108  192 GLN A OE1 
2757 N NE2 . GLN E 192 ? 1.6872 2.0444 1.9503 0.0381  -0.2777 0.0252  192 GLN A NE2 
2758 N N   . SER E 193 ? 1.1972 1.5712 1.5121 0.0469  -0.2125 -0.0259 193 SER A N   
2759 C CA  . SER E 193 ? 1.1415 1.5124 1.4577 0.0455  -0.1985 -0.0355 193 SER A CA  
2760 C C   . SER E 193 ? 1.0943 1.4457 1.4046 0.0529  -0.1887 -0.0289 193 SER A C   
2761 O O   . SER E 193 ? 1.1110 1.4435 1.3914 0.0504  -0.1819 -0.0270 193 SER A O   
2762 C CB  . SER E 193 ? 1.1322 1.4965 1.4166 0.0344  -0.1955 -0.0425 193 SER A CB  
2763 O OG  . SER E 193 ? 1.1299 1.4957 1.4225 0.0320  -0.1849 -0.0531 193 SER A OG  
2764 N N   . PRO E 194 ? 1.0500 1.4062 1.3889 0.0620  -0.1877 -0.0255 194 PRO A N   
2765 C CA  . PRO E 194 ? 1.0132 1.3523 1.3478 0.0688  -0.1789 -0.0191 194 PRO A CA  
2766 C C   . PRO E 194 ? 0.9479 1.2779 1.2711 0.0661  -0.1652 -0.0252 194 PRO A C   
2767 O O   . PRO E 194 ? 0.9438 1.2550 1.2452 0.0677  -0.1587 -0.0198 194 PRO A O   
2768 C CB  . PRO E 194 ? 1.0232 1.3750 1.3966 0.0770  -0.1791 -0.0193 194 PRO A CB  
2769 C CG  . PRO E 194 ? 1.0343 1.4043 1.4264 0.0768  -0.1928 -0.0199 194 PRO A CG  
2770 C CD  . PRO E 194 ? 1.0361 1.4140 1.4132 0.0663  -0.1952 -0.0279 194 PRO A CD  
2771 N N   . PHE E 195 ? 0.9066 1.2495 1.2446 0.0613  -0.1611 -0.0365 195 PHE A N   
2772 C CA  . PHE E 195 ? 0.8926 1.2278 1.2250 0.0588  -0.1494 -0.0422 195 PHE A CA  
2773 C C   . PHE E 195 ? 0.8693 1.1870 1.1649 0.0543  -0.1473 -0.0413 195 PHE A C   
2774 O O   . PHE E 195 ? 0.8214 1.1254 1.1069 0.0566  -0.1382 -0.0399 195 PHE A O   
2775 C CB  . PHE E 195 ? 0.8924 1.2434 1.2453 0.0519  -0.1472 -0.0547 195 PHE A CB  
2776 C CG  . PHE E 195 ? 0.9039 1.2707 1.2946 0.0561  -0.1462 -0.0568 195 PHE A CG  
2777 C CD1 . PHE E 195 ? 0.8766 1.2389 1.2824 0.0622  -0.1373 -0.0536 195 PHE A CD1 
2778 C CD2 . PHE E 195 ? 0.9166 1.3029 1.3280 0.0537  -0.1538 -0.0623 195 PHE A CD2 
2779 C CE1 . PHE E 195 ? 0.8502 1.2253 1.2894 0.0658  -0.1356 -0.0555 195 PHE A CE1 
2780 C CE2 . PHE E 195 ? 0.9082 1.3085 1.3560 0.0580  -0.1521 -0.0649 195 PHE A CE2 
2781 C CZ  . PHE E 195 ? 0.8810 1.2747 1.3418 0.0641  -0.1428 -0.0614 195 PHE A CZ  
2782 N N   . THR E 196 ? 0.9138 1.2321 1.1897 0.0480  -0.1554 -0.0423 196 THR A N   
2783 C CA  . THR E 196 ? 0.9684 1.2685 1.2066 0.0435  -0.1538 -0.0410 196 THR A CA  
2784 C C   . THR E 196 ? 1.0246 1.3083 1.2415 0.0472  -0.1550 -0.0292 196 THR A C   
2785 O O   . THR E 196 ? 1.0374 1.3047 1.2216 0.0431  -0.1536 -0.0272 196 THR A O   
2786 C CB  . THR E 196 ? 0.9774 1.2827 1.1985 0.0330  -0.1609 -0.0477 196 THR A CB  
2787 O OG1 . THR E 196 ? 1.0073 1.3258 1.2351 0.0317  -0.1722 -0.0443 196 THR A OG1 
2788 C CG2 . THR E 196 ? 0.9488 1.2656 1.1848 0.0269  -0.1585 -0.0603 196 THR A CG2 
2789 N N   . CYS E 197 ? 1.0461 1.3329 1.2804 0.0540  -0.1577 -0.0218 197 CYS A N   
2790 C CA  . CYS E 197 ? 1.0635 1.3328 1.2779 0.0564  -0.1586 -0.0108 197 CYS A CA  
2791 C C   . CYS E 197 ? 1.1135 1.3679 1.3235 0.0613  -0.1456 -0.0091 197 CYS A C   
2792 O O   . CYS E 197 ? 1.0805 1.3416 1.3155 0.0673  -0.1401 -0.0105 197 CYS A O   
2793 C CB  . CYS E 197 ? 1.0223 1.2993 1.2546 0.0607  -0.1692 -0.0032 197 CYS A CB  
2794 S SG  . CYS E 197 ? 0.7741 1.0269 0.9784 0.0607  -0.1723 0.0105  197 CYS A SG  
2795 N N   . PRO E 198 ? 1.1930 1.4271 1.3709 0.0583  -0.1402 -0.0063 198 PRO A N   
2796 C CA  . PRO E 198 ? 1.2163 1.4355 1.3865 0.0618  -0.1272 -0.0056 198 PRO A CA  
2797 C C   . PRO E 198 ? 1.2682 1.4817 1.4451 0.0667  -0.1262 0.0023  198 PRO A C   
2798 O O   . PRO E 198 ? 1.3073 1.5181 1.4938 0.0715  -0.1158 0.0012  198 PRO A O   
2799 C CB  . PRO E 198 ? 1.1924 1.3918 1.3246 0.0555  -0.1242 -0.0045 198 PRO A CB  
2800 C CG  . PRO E 198 ? 1.2251 1.4247 1.3432 0.0494  -0.1371 0.0010  198 PRO A CG  
2801 C CD  . PRO E 198 ? 1.2121 1.4359 1.3579 0.0503  -0.1465 -0.0033 198 PRO A CD  
2802 N N   . ILE E 199 ? 1.2386 1.4500 1.4105 0.0652  -0.1374 0.0102  199 ILE A N   
2803 C CA  . ILE E 199 ? 1.1681 1.3725 1.3455 0.0693  -0.1380 0.0177  199 ILE A CA  
2804 C C   . ILE E 199 ? 1.0988 1.3210 1.3132 0.0770  -0.1384 0.0153  199 ILE A C   
2805 O O   . ILE E 199 ? 1.1092 1.3284 1.3319 0.0813  -0.1288 0.0149  199 ILE A O   
2806 C CB  . ILE E 199 ? 0.6218 0.8152 0.7822 0.0653  -0.1509 0.0280  199 ILE A CB  
2807 C CG1 . ILE E 199 ? 0.5965 0.8022 0.7595 0.0615  -0.1653 0.0287  199 ILE A CG1 
2808 C CG2 . ILE E 199 ? 0.6056 0.7736 0.7271 0.0576  -0.1457 0.0320  199 ILE A CG2 
2809 C CD1 . ILE E 199 ? 0.6059 0.7934 0.7323 0.0518  -0.1720 0.0360  199 ILE A CD1 
2810 N N   . PHE E 200 ? 1.0482 1.2888 1.2847 0.0781  -0.1485 0.0134  200 PHE A N   
2811 C CA  . PHE E 200 ? 1.0232 1.2796 1.2954 0.0848  -0.1479 0.0109  200 PHE A CA  
2812 C C   . PHE E 200 ? 1.0487 1.3057 1.3295 0.0869  -0.1328 0.0048  200 PHE A C   
2813 O O   . PHE E 200 ? 1.0808 1.3384 1.3774 0.0921  -0.1272 0.0064  200 PHE A O   
2814 C CB  . PHE E 200 ? 0.9642 1.2427 1.2600 0.0840  -0.1569 0.0052  200 PHE A CB  
2815 C CG  . PHE E 200 ? 0.9358 1.2306 1.2685 0.0894  -0.1539 0.0005  200 PHE A CG  
2816 C CD1 . PHE E 200 ? 0.9479 1.2576 1.2973 0.0864  -0.1488 -0.0101 200 PHE A CD1 
2817 C CD2 . PHE E 200 ? 0.9728 1.2659 1.3212 0.0965  -0.1560 0.0065  200 PHE A CD2 
2818 C CE1 . PHE E 200 ? 0.9869 1.3102 1.3690 0.0897  -0.1449 -0.0149 200 PHE A CE1 
2819 C CE2 . PHE E 200 ? 0.9828 1.2895 1.3644 0.1011  -0.1521 0.0020  200 PHE A CE2 
2820 C CZ  . PHE E 200 ? 0.9932 1.3152 1.3919 0.0974  -0.1460 -0.0088 200 PHE A CZ  
2821 N N   . THR E 201 ? 1.0131 1.2684 1.2812 0.0824  -0.1268 -0.0014 201 THR A N   
2822 C CA  . THR E 201 ? 0.9601 1.2127 1.2309 0.0835  -0.1135 -0.0063 201 THR A CA  
2823 C C   . THR E 201 ? 0.9891 1.2264 1.2489 0.0867  -0.1044 -0.0009 201 THR A C   
2824 O O   . THR E 201 ? 0.9814 1.2218 1.2570 0.0904  -0.0962 -0.0016 201 THR A O   
2825 C CB  . THR E 201 ? 0.8751 1.1238 1.1283 0.0781  -0.1107 -0.0126 201 THR A CB  
2826 O OG1 . THR E 201 ? 0.8287 1.0919 1.0923 0.0739  -0.1180 -0.0189 201 THR A OG1 
2827 C CG2 . THR E 201 ? 0.8218 1.0668 1.0787 0.0797  -0.0984 -0.0168 201 THR A CG2 
2828 N N   . MET E 202 ? 1.0018 1.2225 1.2335 0.0840  -0.1056 0.0042  202 MET A N   
2829 C CA  . MET E 202 ? 1.0072 1.2118 1.2245 0.0850  -0.0970 0.0084  202 MET A CA  
2830 C C   . MET E 202 ? 0.9457 1.1500 1.1750 0.0891  -0.0995 0.0146  202 MET A C   
2831 O O   . MET E 202 ? 0.9425 1.1388 1.1689 0.0907  -0.0903 0.0161  202 MET A O   
2832 C CB  . MET E 202 ? 1.0811 1.2665 1.2635 0.0788  -0.0984 0.0121  202 MET A CB  
2833 C CG  . MET E 202 ? 1.1391 1.3061 1.3029 0.0774  -0.0886 0.0151  202 MET A CG  
2834 S SD  . MET E 202 ? 0.8566 0.9989 0.9784 0.0676  -0.0922 0.0206  202 MET A SD  
2835 C CE  . MET E 202 ? 1.8748 2.0255 2.0003 0.0657  -0.1128 0.0266  202 MET A CE  
2836 N N   . ALA E 203 ? 0.8982 1.1110 1.1406 0.0907  -0.1122 0.0180  203 ALA A N   
2837 C CA  . ALA E 203 ? 0.8922 1.1042 1.1468 0.0951  -0.1171 0.0240  203 ALA A CA  
2838 C C   . ALA E 203 ? 0.8698 1.0942 1.1521 0.1002  -0.1084 0.0198  203 ALA A C   
2839 O O   . ALA E 203 ? 0.9051 1.1223 1.1876 0.1026  -0.1019 0.0229  203 ALA A O   
2840 C CB  . ALA E 203 ? 0.8866 1.1065 1.1515 0.0961  -0.1336 0.0276  203 ALA A CB  
2841 N N   . VAL E 204 ? 0.7529 0.9949 1.0566 0.1004  -0.1079 0.0127  204 VAL A N   
2842 C CA  . VAL E 204 ? 0.6528 0.9053 0.9808 0.1031  -0.0989 0.0087  204 VAL A CA  
2843 C C   . VAL E 204 ? 0.6657 0.9093 0.9823 0.1022  -0.0851 0.0077  204 VAL A C   
2844 O O   . VAL E 204 ? 0.7170 0.9562 1.0369 0.1046  -0.0780 0.0107  204 VAL A O   
2845 C CB  . VAL E 204 ? 0.5563 0.8269 0.9055 0.1007  -0.1003 0.0003  204 VAL A CB  
2846 C CG1 . VAL E 204 ? 0.5114 0.7905 0.8834 0.1013  -0.0906 -0.0035 204 VAL A CG1 
2847 C CG2 . VAL E 204 ? 0.4808 0.7620 0.8437 0.1017  -0.1134 0.0006  204 VAL A CG2 
2848 N N   . TYR E 205 ? 0.6502 0.8905 0.9524 0.0986  -0.0814 0.0036  205 TYR A N   
2849 C CA  . TYR E 205 ? 0.6934 0.9271 0.9877 0.0982  -0.0688 0.0016  205 TYR A CA  
2850 C C   . TYR E 205 ? 0.7730 0.9928 1.0529 0.0994  -0.0628 0.0072  205 TYR A C   
2851 O O   . TYR E 205 ? 0.7879 1.0071 1.0718 0.1003  -0.0519 0.0063  205 TYR A O   
2852 C CB  . TYR E 205 ? 0.6968 0.9246 0.9729 0.0948  -0.0676 -0.0026 205 TYR A CB  
2853 C CG  . TYR E 205 ? 0.6780 0.8974 0.9450 0.0952  -0.0550 -0.0044 205 TYR A CG  
2854 C CD1 . TYR E 205 ? 0.6840 0.9111 0.9693 0.0969  -0.0463 -0.0071 205 TYR A CD1 
2855 C CD2 . TYR E 205 ? 0.6947 0.8987 0.9357 0.0931  -0.0514 -0.0036 205 TYR A CD2 
2856 C CE1 . TYR E 205 ? 0.6897 0.9113 0.9701 0.0977  -0.0352 -0.0089 205 TYR A CE1 
2857 C CE2 . TYR E 205 ? 0.7302 0.9280 0.9660 0.0938  -0.0390 -0.0064 205 TYR A CE2 
2858 C CZ  . TYR E 205 ? 0.7488 0.9564 1.0056 0.0966  -0.0313 -0.0091 205 TYR A CZ  
2859 O OH  . TYR E 205 ? 0.8015 1.0051 1.0564 0.0976  -0.0193 -0.0121 205 TYR A OH  
2860 N N   . TYR E 206 ? 0.8172 1.0253 1.0792 0.0983  -0.0705 0.0129  206 TYR A N   
2861 C CA  . TYR E 206 ? 0.8341 1.0260 1.0777 0.0973  -0.0661 0.0179  206 TYR A CA  
2862 C C   . TYR E 206 ? 0.8565 1.0501 1.1137 0.1009  -0.0666 0.0221  206 TYR A C   
2863 O O   . TYR E 206 ? 0.8674 1.0523 1.1162 0.1002  -0.0580 0.0238  206 TYR A O   
2864 C CB  . TYR E 206 ? 0.8569 1.0323 1.0726 0.0926  -0.0747 0.0228  206 TYR A CB  
2865 C CG  . TYR E 206 ? 0.8782 1.0430 1.0704 0.0874  -0.0678 0.0192  206 TYR A CG  
2866 C CD1 . TYR E 206 ? 0.8993 1.0455 1.0613 0.0808  -0.0722 0.0232  206 TYR A CD1 
2867 C CD2 . TYR E 206 ? 0.8967 1.0687 1.0965 0.0887  -0.0570 0.0119  206 TYR A CD2 
2868 C CE1 . TYR E 206 ? 0.9304 1.0656 1.0704 0.0755  -0.0644 0.0194  206 TYR A CE1 
2869 C CE2 . TYR E 206 ? 0.9321 1.0937 1.1119 0.0848  -0.0503 0.0082  206 TYR A CE2 
2870 C CZ  . TYR E 206 ? 0.9383 1.0816 1.0881 0.0782  -0.0532 0.0116  206 TYR A CZ  
2871 O OH  . TYR E 206 ? 0.9582 1.0900 1.0875 0.0738  -0.0451 0.0074  206 TYR A OH  
2872 N N   . TYR E 207 ? 0.8700 1.0747 1.1479 0.1044  -0.0762 0.0234  207 TYR A N   
2873 C CA  . TYR E 207 ? 0.8674 1.0747 1.1615 0.1084  -0.0754 0.0265  207 TYR A CA  
2874 C C   . TYR E 207 ? 0.7956 1.0104 1.1022 0.1086  -0.0609 0.0224  207 TYR A C   
2875 O O   . TYR E 207 ? 0.8044 1.0116 1.1050 0.1086  -0.0535 0.0252  207 TYR A O   
2876 C CB  . TYR E 207 ? 0.9224 1.1425 1.2409 0.1123  -0.0867 0.0267  207 TYR A CB  
2877 C CG  . TYR E 207 ? 1.0114 1.2316 1.3453 0.1168  -0.0867 0.0303  207 TYR A CG  
2878 C CD1 . TYR E 207 ? 1.0996 1.3044 1.4209 0.1188  -0.0947 0.0379  207 TYR A CD1 
2879 C CD2 . TYR E 207 ? 1.0631 1.2969 1.4226 0.1184  -0.0790 0.0261  207 TYR A CD2 
2880 C CE1 . TYR E 207 ? 1.1489 1.3519 1.4831 0.1233  -0.0948 0.0412  207 TYR A CE1 
2881 C CE2 . TYR E 207 ? 1.0997 1.3323 1.4722 0.1222  -0.0779 0.0292  207 TYR A CE2 
2882 C CZ  . TYR E 207 ? 1.1607 1.3779 1.5206 0.1252  -0.0859 0.0366  207 TYR A CZ  
2883 O OH  . TYR E 207 ? 1.1854 1.3998 1.5572 0.1294  -0.0849 0.0396  207 TYR A OH  
2884 N N   . LEU E 208 ? 0.7537 0.9825 1.0758 0.1076  -0.0573 0.0160  208 LEU A N   
2885 C CA  . LEU E 208 ? 0.7993 1.0348 1.1332 0.1067  -0.0448 0.0128  208 LEU A CA  
2886 C C   . LEU E 208 ? 0.9136 1.1394 1.2292 0.1049  -0.0341 0.0127  208 LEU A C   
2887 O O   . LEU E 208 ? 0.9001 1.1280 1.2214 0.1045  -0.0239 0.0127  208 LEU A O   
2888 C CB  . LEU E 208 ? 0.8001 1.0495 1.1510 0.1045  -0.0443 0.0061  208 LEU A CB  
2889 C CG  . LEU E 208 ? 0.8087 1.0708 1.1807 0.1040  -0.0519 0.0031  208 LEU A CG  
2890 C CD1 . LEU E 208 ? 0.8248 1.0873 1.1883 0.1034  -0.0630 0.0014  208 LEU A CD1 
2891 C CD2 . LEU E 208 ? 0.8120 1.0849 1.2009 0.0996  -0.0460 -0.0029 208 LEU A CD2 
2892 N N   . ARG E 209 ? 1.0115 1.2272 1.3056 0.1033  -0.0360 0.0122  209 ARG A N   
2893 C CA  . ARG E 209 ? 1.0786 1.2857 1.3567 0.1012  -0.0251 0.0104  209 ARG A CA  
2894 C C   . ARG E 209 ? 1.2157 1.4103 1.4786 0.0999  -0.0203 0.0148  209 ARG A C   
2895 O O   . ARG E 209 ? 1.2629 1.4571 1.5246 0.0987  -0.0085 0.0133  209 ARG A O   
2896 C CB  . ARG E 209 ? 1.0677 1.2662 1.3262 0.0988  -0.0277 0.0079  209 ARG A CB  
2897 C CG  . ARG E 209 ? 1.0688 1.2565 1.3093 0.0962  -0.0162 0.0052  209 ARG A CG  
2898 C CD  . ARG E 209 ? 1.0619 1.2410 1.2841 0.0935  -0.0189 0.0025  209 ARG A CD  
2899 N NE  . ARG E 209 ? 1.0622 1.2261 1.2614 0.0894  -0.0091 0.0006  209 ARG A NE  
2900 C CZ  . ARG E 209 ? 1.0726 1.2248 1.2510 0.0855  -0.0090 -0.0016 209 ARG A CZ  
2901 N NH1 . ARG E 209 ? 1.0688 1.2232 1.2458 0.0855  -0.0188 -0.0016 209 ARG A NH1 
2902 N NH2 . ARG E 209 ? 1.1024 1.2404 1.2606 0.0807  0.0016  -0.0043 209 ARG A NH2 
2903 N N   . PHE E 210 ? 1.2753 1.4596 1.5268 0.0996  -0.0302 0.0204  210 PHE A N   
2904 C CA  . PHE E 210 ? 1.3178 1.4858 1.5490 0.0968  -0.0281 0.0249  210 PHE A CA  
2905 C C   . PHE E 210 ? 1.4147 1.5847 1.6580 0.0998  -0.0295 0.0294  210 PHE A C   
2906 O O   . PHE E 210 ? 1.4485 1.6170 1.6900 0.0984  -0.0190 0.0294  210 PHE A O   
2907 C CB  . PHE E 210 ? 1.2412 1.3918 1.4468 0.0929  -0.0386 0.0289  210 PHE A CB  
2908 C CG  . PHE E 210 ? 1.1710 1.3140 1.3575 0.0879  -0.0336 0.0247  210 PHE A CG  
2909 C CD1 . PHE E 210 ? 1.1319 1.2659 1.3023 0.0832  -0.0200 0.0211  210 PHE A CD1 
2910 C CD2 . PHE E 210 ? 1.1575 1.3025 1.3419 0.0875  -0.0417 0.0238  210 PHE A CD2 
2911 C CE1 . PHE E 210 ? 1.1084 1.2347 1.2622 0.0787  -0.0141 0.0164  210 PHE A CE1 
2912 C CE2 . PHE E 210 ? 1.1412 1.2774 1.3065 0.0826  -0.0361 0.0198  210 PHE A CE2 
2913 C CZ  . PHE E 210 ? 1.1208 1.2475 1.2714 0.0785  -0.0220 0.0160  210 PHE A CZ  
2914 N N   . HIS E 211 ? 1.4063 1.5795 1.6615 0.1036  -0.0422 0.0330  211 HIS A N   
2915 C CA  . HIS E 211 ? 1.3517 1.5269 1.6211 0.1073  -0.0446 0.0368  211 HIS A CA  
2916 C C   . HIS E 211 ? 1.2424 1.4331 1.5338 0.1081  -0.0325 0.0329  211 HIS A C   
2917 O O   . HIS E 211 ? 1.2693 1.4572 1.5608 0.1076  -0.0251 0.0351  211 HIS A O   
2918 C CB  . HIS E 211 ? 1.4003 1.5809 1.6851 0.1119  -0.0599 0.0391  211 HIS A CB  
2919 C CG  . HIS E 211 ? 1.4331 1.6177 1.7378 0.1168  -0.0625 0.0418  211 HIS A CG  
2920 N ND1 . HIS E 211 ? 1.4892 1.6611 1.7883 0.1198  -0.0740 0.0483  211 HIS A ND1 
2921 C CD2 . HIS E 211 ? 1.4171 1.6159 1.7473 0.1188  -0.0556 0.0388  211 HIS A CD2 
2922 C CE1 . HIS E 211 ? 1.4813 1.6599 1.8026 0.1244  -0.0731 0.0487  211 HIS A CE1 
2923 N NE2 . HIS E 211 ? 1.4440 1.6389 1.7839 0.1233  -0.0614 0.0429  211 HIS A NE2 
2924 N N   . GLY E 212 ? 1.1407 1.3462 1.4479 0.1081  -0.0307 0.0274  212 GLY A N   
2925 C CA  . GLY E 212 ? 1.0928 1.3122 1.4205 0.1073  -0.0210 0.0239  212 GLY A CA  
2926 C C   . GLY E 212 ? 1.1012 1.3289 1.4514 0.1097  -0.0252 0.0248  212 GLY A C   
2927 O O   . GLY E 212 ? 1.0527 1.2763 1.4041 0.1131  -0.0356 0.0278  212 GLY A O   
2928 N N   . VAL E 213 ? 1.1902 1.4292 1.5592 0.1074  -0.0174 0.0221  213 VAL A N   
2929 C CA  . VAL E 213 ? 1.3376 1.5823 1.7266 0.1084  -0.0184 0.0229  213 VAL A CA  
2930 C C   . VAL E 213 ? 1.5288 1.7701 1.9172 0.1061  -0.0068 0.0262  213 VAL A C   
2931 O O   . VAL E 213 ? 1.5518 1.7980 1.9416 0.1015  0.0030  0.0247  213 VAL A O   
2932 C CB  . VAL E 213 ? 1.2739 1.5339 1.6861 0.1058  -0.0206 0.0165  213 VAL A CB  
2933 C CG1 . VAL E 213 ? 1.2675 1.5303 1.6734 0.1057  -0.0279 0.0125  213 VAL A CG1 
2934 C CG2 . VAL E 213 ? 1.2475 1.5148 1.6705 0.0996  -0.0096 0.0141  213 VAL A CG2 
2935 N N   . LYS E 214 ? 1.6588 1.8909 2.0442 0.1091  -0.0086 0.0310  214 LYS A N   
2936 C CA  . LYS E 214 ? 1.7407 1.9681 2.1234 0.1064  0.0022  0.0345  214 LYS A CA  
2937 C C   . LYS E 214 ? 1.8339 2.0742 2.2380 0.1011  0.0106  0.0313  214 LYS A C   
2938 O O   . LYS E 214 ? 1.8353 2.0854 2.2600 0.1008  0.0067  0.0271  214 LYS A O   
2939 C CB  . LYS E 214 ? 1.6996 1.9155 2.0803 0.1108  -0.0023 0.0394  214 LYS A CB  
2940 C CG  . LYS E 214 ? 1.6787 1.8763 2.0317 0.1132  -0.0081 0.0444  214 LYS A CG  
2941 C CD  . LYS E 214 ? 1.6798 1.8767 2.0277 0.1162  -0.0209 0.0432  214 LYS A CD  
2942 C CE  . LYS E 214 ? 1.7441 1.9247 2.0593 0.1139  -0.0232 0.0458  214 LYS A CE  
2943 N NZ  . LYS E 214 ? 1.7493 1.9203 2.0544 0.1170  -0.0392 0.0484  214 LYS A NZ  
2944 N N   . LYS E 215 ? 1.9136 2.1533 2.3116 0.0957  0.0224  0.0333  215 LYS A N   
2945 C CA  . LYS E 215 ? 1.9324 2.1811 2.3466 0.0886  0.0314  0.0321  215 LYS A CA  
2946 C C   . LYS E 215 ? 1.9137 2.1753 2.3426 0.0849  0.0292  0.0261  215 LYS A C   
2947 O O   . LYS E 215 ? 1.8817 2.1506 2.3260 0.0777  0.0340  0.0241  215 LYS A O   
2948 C CB  . LYS E 215 ? 1.9467 2.1935 2.3747 0.0891  0.0314  0.0329  215 LYS A CB  
2949 C CG  . LYS E 215 ? 1.9193 2.1740 2.3650 0.0801  0.0404  0.0310  215 LYS A CG  
2950 C CD  . LYS E 215 ? 1.9065 2.1567 2.3632 0.0807  0.0427  0.0318  215 LYS A CD  
2951 C CE  . LYS E 215 ? 1.9096 2.1446 2.3472 0.0853  0.0449  0.0386  215 LYS A CE  
2952 N NZ  . LYS E 215 ? 1.9222 2.1534 2.3390 0.0805  0.0533  0.0429  215 LYS A NZ  
2953 N N   . TYR E 216 ? 1.9384 2.2009 2.3601 0.0885  0.0223  0.0234  216 TYR A N   
2954 C CA  . TYR E 216 ? 1.9446 2.2166 2.3746 0.0847  0.0209  0.0182  216 TYR A CA  
2955 C C   . TYR E 216 ? 1.9615 2.2315 2.3770 0.0867  0.0216  0.0175  216 TYR A C   
2956 O O   . TYR E 216 ? 1.9687 2.2428 2.3860 0.0828  0.0284  0.0173  216 TYR A O   
2957 C CB  . TYR E 216 ? 1.9314 2.2093 2.3740 0.0853  0.0111  0.0128  216 TYR A CB  
2958 C CG  . TYR E 216 ? 1.9024 2.1839 2.3628 0.0824  0.0118  0.0115  216 TYR A CG  
2959 C CD1 . TYR E 216 ? 1.8804 2.1692 2.3563 0.0730  0.0161  0.0077  216 TYR A CD1 
2960 C CD2 . TYR E 216 ? 1.8947 2.1713 2.3564 0.0886  0.0080  0.0140  216 TYR A CD2 
2961 C CE1 . TYR E 216 ? 1.8700 2.1614 2.3621 0.0692  0.0183  0.0055  216 TYR A CE1 
2962 C CE2 . TYR E 216 ? 1.8794 2.1594 2.3594 0.0865  0.0096  0.0119  216 TYR A CE2 
2963 C CZ  . TYR E 216 ? 1.8726 2.1603 2.3679 0.0765  0.0155  0.0073  216 TYR A CZ  
2964 O OH  . TYR E 216 ? 1.8658 2.1562 2.3794 0.0733  0.0186  0.0043  216 TYR A OH  
2965 N N   . TYR E 217 ? 1.9436 2.2071 2.3454 0.0925  0.0144  0.0171  217 TYR A N   
2966 C CA  . TYR E 217 ? 1.8909 2.1518 2.2794 0.0940  0.0147  0.0150  217 TYR A CA  
2967 C C   . TYR E 217 ? 1.7752 2.0231 2.1408 0.0974  0.0148  0.0182  217 TYR A C   
2968 O O   . TYR E 217 ? 1.7802 2.0210 2.1385 0.1005  0.0063  0.0202  217 TYR A O   
2969 C CB  . TYR E 217 ? 1.9759 2.2402 2.3673 0.0953  0.0051  0.0101  217 TYR A CB  
2970 C CG  . TYR E 217 ? 2.0222 2.2966 2.4340 0.0910  0.0020  0.0066  217 TYR A CG  
2971 C CD1 . TYR E 217 ? 2.0488 2.3297 2.4712 0.0854  0.0066  0.0042  217 TYR A CD1 
2972 C CD2 . TYR E 217 ? 2.0346 2.3117 2.4553 0.0917  -0.0057 0.0053  217 TYR A CD2 
2973 C CE1 . TYR E 217 ? 2.0481 2.3360 2.4864 0.0792  0.0039  0.0006  217 TYR A CE1 
2974 C CE2 . TYR E 217 ? 2.0344 2.3204 2.4731 0.0861  -0.0073 0.0008  217 TYR A CE2 
2975 C CZ  . TYR E 217 ? 2.0384 2.3288 2.4844 0.0791  -0.0024 -0.0016 217 TYR A CZ  
2976 O OH  . TYR E 217 ? 2.0250 2.3220 2.4860 0.0713  -0.0041 -0.0065 217 TYR A OH  
2977 N N   . LYS E 218 ? 1.6494 1.8942 2.0037 0.0958  0.0240  0.0186  218 LYS A N   
2978 C CA  . LYS E 218 ? 1.5687 1.7994 1.8985 0.0965  0.0252  0.0208  218 LYS A CA  
2979 C C   . LYS E 218 ? 1.5236 1.7467 1.8404 0.0988  0.0163  0.0190  218 LYS A C   
2980 O O   . LYS E 218 ? 1.4892 1.7171 1.8092 0.0992  0.0156  0.0144  218 LYS A O   
2981 C CB  . LYS E 218 ? 1.5616 1.7926 1.8833 0.0935  0.0376  0.0191  218 LYS A CB  
2982 C CG  . LYS E 218 ? 1.5460 1.7840 1.8737 0.0940  0.0401  0.0132  218 LYS A CG  
2983 C CD  . LYS E 218 ? 1.5319 1.7723 1.8557 0.0916  0.0527  0.0108  218 LYS A CD  
2984 C CE  . LYS E 218 ? 1.5004 1.7505 1.8377 0.0883  0.0603  0.0136  218 LYS A CE  
2985 N NZ  . LYS E 218 ? 1.4905 1.7463 1.8280 0.0861  0.0721  0.0105  218 LYS A NZ  
2986 N N   . GLY E 219 ? 1.5278 1.7380 1.8290 0.0999  0.0089  0.0229  219 GLY A N   
2987 C CA  . GLY E 219 ? 1.5437 1.7436 1.8266 0.1000  0.0018  0.0221  219 GLY A CA  
2988 C C   . GLY E 219 ? 1.5432 1.7357 1.8075 0.0961  0.0124  0.0191  219 GLY A C   
2989 O O   . GLY E 219 ? 1.5707 1.7658 1.8362 0.0940  0.0234  0.0186  219 GLY A O   
2990 N N   . ASP E 220 ? 1.5209 1.7046 1.7686 0.0945  0.0101  0.0167  220 ASP A N   
2991 C CA  . ASP E 220 ? 1.5241 1.6992 1.7532 0.0900  0.0211  0.0129  220 ASP A CA  
2992 C C   . ASP E 220 ? 1.5080 1.6637 1.7097 0.0848  0.0202  0.0169  220 ASP A C   
2993 O O   . ASP E 220 ? 1.5420 1.6891 1.7262 0.0792  0.0306  0.0139  220 ASP A O   
2994 C CB  . ASP E 220 ? 1.5665 1.7384 1.7876 0.0893  0.0203  0.0082  220 ASP A CB  
2995 C CG  . ASP E 220 ? 1.5448 1.7332 1.7900 0.0938  0.0197  0.0042  220 ASP A CG  
2996 O OD1 . ASP E 220 ? 1.5425 1.7443 1.8103 0.0966  0.0180  0.0056  220 ASP A OD1 
2997 O OD2 . ASP E 220 ? 1.5339 1.7204 1.7741 0.0936  0.0210  -0.0005 220 ASP A OD2 
2998 N N   . GLY E 221 ? 1.4655 1.6138 1.6635 0.0863  0.0071  0.0232  221 GLY A N   
2999 C CA  . GLY E 221 ? 1.4550 1.5816 1.6250 0.0812  0.0021  0.0280  221 GLY A CA  
3000 C C   . GLY E 221 ? 1.4274 1.5392 1.5742 0.0762  -0.0037 0.0274  221 GLY A C   
3001 O O   . GLY E 221 ? 1.4139 1.5297 1.5601 0.0748  0.0032  0.0215  221 GLY A O   
3002 N N   . TYR E 222 ? 1.4075 1.5007 1.5338 0.0728  -0.0161 0.0337  222 TYR A N   
3003 C CA  . TYR E 222 ? 1.4006 1.4776 1.5027 0.0665  -0.0237 0.0349  222 TYR A CA  
3004 C C   . TYR E 222 ? 1.5003 1.5560 1.5683 0.0549  -0.0142 0.0321  222 TYR A C   
3005 O O   . TYR E 222 ? 1.5007 1.5408 1.5446 0.0468  -0.0161 0.0315  222 TYR A O   
3006 C CB  . TYR E 222 ? 1.3282 1.3949 1.4254 0.0677  -0.0435 0.0437  222 TYR A CB  
3007 C CG  . TYR E 222 ? 1.2402 1.3270 1.3708 0.0783  -0.0537 0.0459  222 TYR A CG  
3008 C CD1 . TYR E 222 ? 1.2417 1.3318 1.3760 0.0795  -0.0661 0.0477  222 TYR A CD1 
3009 C CD2 . TYR E 222 ? 1.1937 1.2957 1.3509 0.0857  -0.0504 0.0458  222 TYR A CD2 
3010 C CE1 . TYR E 222 ? 1.2394 1.3484 1.4040 0.0880  -0.0748 0.0484  222 TYR A CE1 
3011 C CE2 . TYR E 222 ? 1.1868 1.3064 1.3741 0.0938  -0.0587 0.0466  222 TYR A CE2 
3012 C CZ  . TYR E 222 ? 1.2258 1.3493 1.4172 0.0950  -0.0707 0.0475  222 TYR A CZ  
3013 O OH  . TYR E 222 ? 1.2419 1.3839 1.4636 0.1021  -0.0781 0.0470  222 TYR A OH  
3014 N N   . GLN E 223 ? 1.6146 1.6694 1.6795 0.0528  -0.0033 0.0301  223 GLN A N   
3015 C CA  . GLN E 223 ? 1.7698 1.8048 1.8020 0.0404  0.0069  0.0263  223 GLN A CA  
3016 C C   . GLN E 223 ? 1.8364 1.8726 1.8627 0.0357  0.0192  0.0176  223 GLN A C   
3017 O O   . GLN E 223 ? 1.8723 1.8872 1.8679 0.0244  0.0199  0.0161  223 GLN A O   
3018 C CB  . GLN E 223 ? 1.8224 1.8620 1.8571 0.0397  0.0190  0.0240  223 GLN A CB  
3019 C CG  . GLN E 223 ? 1.8670 1.9032 1.9052 0.0439  0.0088  0.0322  223 GLN A CG  
3020 C CD  . GLN E 223 ? 1.8529 1.9142 1.9306 0.0570  0.0056  0.0343  223 GLN A CD  
3021 O OE1 . GLN E 223 ? 1.8350 1.9174 1.9362 0.0613  0.0170  0.0291  223 GLN A OE1 
3022 N NE2 . GLN E 223 ? 1.8560 1.9146 1.9415 0.0628  -0.0102 0.0419  223 GLN A NE2 
3023 N N   . ILE E 224 ? 1.8583 1.9184 1.9146 0.0441  0.0280  0.0121  224 ILE A N   
3024 C CA  . ILE E 224 ? 1.8837 1.9475 1.9400 0.0417  0.0410  0.0030  224 ILE A CA  
3025 C C   . ILE E 224 ? 1.8930 1.9423 1.9302 0.0368  0.0339  0.0037  224 ILE A C   
3026 O O   . ILE E 224 ? 1.9461 1.9920 1.9758 0.0326  0.0447  -0.0038 224 ILE A O   
3027 C CB  . ILE E 224 ? 1.5824 1.6740 1.6764 0.0529  0.0478  -0.0016 224 ILE A CB  
3028 C CG1 . ILE E 224 ? 1.5128 1.6120 1.6198 0.0592  0.0380  -0.0005 224 ILE A CG1 
3029 C CG2 . ILE E 224 ? 1.5886 1.6958 1.7055 0.0594  0.0470  0.0021  224 ILE A CG2 
3030 C CD1 . ILE E 224 ? 1.4801 1.5861 1.6012 0.0656  0.0214  0.0076  224 ILE A CD1 
3031 N N   . LEU E 225 ? 1.8343 1.8748 1.8638 0.0370  0.0159  0.0125  225 LEU A N   
3032 C CA  . LEU E 225 ? 1.7988 1.8232 1.8058 0.0301  0.0080  0.0146  225 LEU A CA  
3033 C C   . LEU E 225 ? 1.9204 1.9166 1.8871 0.0138  0.0151  0.0119  225 LEU A C   
3034 O O   . LEU E 225 ? 1.9865 1.9676 1.9314 0.0056  0.0128  0.0120  225 LEU A O   
3035 C CB  . LEU E 225 ? 1.6667 1.6890 1.6759 0.0335  -0.0137 0.0250  225 LEU A CB  
3036 C CG  . LEU E 225 ? 1.5211 1.5667 1.5615 0.0451  -0.0204 0.0252  225 LEU A CG  
3037 C CD1 . LEU E 225 ? 1.4855 1.5557 1.5605 0.0559  -0.0128 0.0215  225 LEU A CD1 
3038 C CD2 . LEU E 225 ? 1.4584 1.5022 1.5006 0.0473  -0.0413 0.0345  225 LEU A CD2 
3039 N N   . SER E 226 ? 1.9405 1.9288 1.8956 0.0078  0.0240  0.0094  226 SER A N   
3040 C CA  . SER E 226 ? 1.9881 1.9504 1.9051 -0.0093 0.0337  0.0046  226 SER A CA  
3041 C C   . SER E 226 ? 2.0356 2.0068 1.9591 -0.0111 0.0573  -0.0086 226 SER A C   
3042 O O   . SER E 226 ? 2.0928 2.0554 2.0034 -0.0182 0.0669  -0.0155 226 SER A O   
3043 C CB  . SER E 226 ? 1.9656 1.9082 1.8581 -0.0179 0.0273  0.0099  226 SER A CB  
3044 O OG  . SER E 226 ? 1.9792 1.8971 1.8347 -0.0360 0.0388  0.0034  226 SER A OG  
3045 N N   . GLN E 227 ? 2.0382 2.0272 1.9831 -0.0046 0.0665  -0.0121 227 GLN A N   
3046 C CA  . GLN E 227 ? 2.0700 2.0690 2.0233 -0.0064 0.0884  -0.0245 227 GLN A CA  
3047 C C   . GLN E 227 ? 2.0770 2.0906 2.0517 0.0008  0.0968  -0.0317 227 GLN A C   
3048 O O   . GLN E 227 ? 2.0850 2.1055 2.0670 -0.0007 0.1149  -0.0427 227 GLN A O   
3049 C CB  . GLN E 227 ? 2.0730 2.0928 2.0510 0.0016  0.0933  -0.0246 227 GLN A CB  
3050 C CG  . GLN E 227 ? 2.0891 2.1290 2.0991 0.0170  0.0797  -0.0161 227 GLN A CG  
3051 C CD  . GLN E 227 ? 2.1364 2.1867 2.1584 0.0209  0.0799  -0.0124 227 GLN A CD  
3052 O OE1 . GLN E 227 ? 2.1240 2.1875 2.1685 0.0312  0.0694  -0.0054 227 GLN A OE1 
3053 N NE2 . GLN E 227 ? 2.1923 2.2361 2.1982 0.0116  0.0924  -0.0176 227 GLN A NE2 
3054 N N   . LEU E 228 ? 2.0774 2.0959 2.0628 0.0088  0.0835  -0.0258 228 LEU A N   
3055 C CA  . LEU E 228 ? 2.0548 2.0850 2.0583 0.0160  0.0888  -0.0314 228 LEU A CA  
3056 C C   . LEU E 228 ? 2.1321 2.1408 2.1073 0.0067  0.0867  -0.0318 228 LEU A C   
3057 O O   . LEU E 228 ? 2.1869 2.1782 2.1384 -0.0001 0.0723  -0.0232 228 LEU A O   
3058 C CB  . LEU E 228 ? 1.9760 2.0298 2.0140 0.0315  0.0771  -0.0260 228 LEU A CB  
3059 C CG  . LEU E 228 ? 1.9157 1.9960 1.9906 0.0425  0.0856  -0.0305 228 LEU A CG  
3060 C CD1 . LEU E 228 ? 1.8745 1.9735 1.9781 0.0547  0.0728  -0.0250 228 LEU A CD1 
3061 C CD2 . LEU E 228 ? 1.9150 1.9994 1.9973 0.0426  0.1029  -0.0421 228 LEU A CD2 
3062 N N   . GLU E 229 ? 2.1152 2.1246 2.0932 0.0062  0.1013  -0.0419 229 GLU A N   
3063 C CA  . GLU E 229 ? 2.0727 2.0627 2.0256 -0.0023 0.1023  -0.0436 229 GLU A CA  
3064 C C   . GLU E 229 ? 1.9384 1.9363 1.9026 0.0069  0.0892  -0.0382 229 GLU A C   
3065 O O   . GLU E 229 ? 1.9137 1.8956 1.8540 -0.0001 0.0774  -0.0313 229 GLU A O   
3066 C CB  . GLU E 229 ? 2.1363 2.1246 2.0901 -0.0056 0.1246  -0.0576 229 GLU A CB  
3067 C CG  . GLU E 229 ? 2.2189 2.1831 2.1384 -0.0240 0.1359  -0.0627 229 GLU A CG  
3068 C CD  . GLU E 229 ? 2.2834 2.2353 2.1818 -0.0320 0.1223  -0.0526 229 GLU A CD  
3069 O OE1 . GLU E 229 ? 2.3285 2.2590 2.1977 -0.0414 0.1089  -0.0441 229 GLU A OE1 
3070 O OE2 . GLU E 229 ? 2.2923 2.2557 2.2036 -0.0286 0.1240  -0.0526 229 GLU A OE2 
3071 N N   . HIS E 230 ? 1.8395 1.8617 1.8394 0.0215  0.0910  -0.0415 230 HIS A N   
3072 C CA  . HIS E 230 ? 1.7574 1.7880 1.7687 0.0298  0.0799  -0.0381 230 HIS A CA  
3073 C C   . HIS E 230 ? 1.7176 1.7710 1.7594 0.0421  0.0666  -0.0317 230 HIS A C   
3074 O O   . HIS E 230 ? 1.7537 1.8260 1.8241 0.0505  0.0722  -0.0349 230 HIS A O   
3075 C CB  . HIS E 230 ? 1.6912 1.7259 1.7134 0.0348  0.0923  -0.0481 230 HIS A CB  
3076 C CG  . HIS E 230 ? 1.6277 1.6722 1.6630 0.0438  0.0809  -0.0453 230 HIS A CG  
3077 N ND1 . HIS E 230 ? 1.5875 1.6509 1.6543 0.0561  0.0834  -0.0502 230 HIS A ND1 
3078 C CD2 . HIS E 230 ? 1.5954 1.6331 1.6156 0.0414  0.0661  -0.0382 230 HIS A CD2 
3079 C CE1 . HIS E 230 ? 1.5566 1.6231 1.6253 0.0602  0.0711  -0.0468 230 HIS A CE1 
3080 N NE2 . HIS E 230 ? 1.5649 1.6170 1.6061 0.0516  0.0609  -0.0397 230 HIS A NE2 
3081 N N   . ILE E 231 ? 1.6303 1.6818 1.6659 0.0422  0.0492  -0.0230 231 ILE A N   
3082 C CA  . ILE E 231 ? 1.4896 1.5596 1.5500 0.0513  0.0354  -0.0163 231 ILE A CA  
3083 C C   . ILE E 231 ? 1.3582 1.4392 1.4318 0.0580  0.0260  -0.0158 231 ILE A C   
3084 O O   . ILE E 231 ? 1.3856 1.4619 1.4480 0.0554  0.0122  -0.0097 231 ILE A O   
3085 C CB  . ILE E 231 ? 1.4875 1.5473 1.5324 0.0459  0.0219  -0.0065 231 ILE A CB  
3086 C CG1 . ILE E 231 ? 1.5231 1.5571 1.5297 0.0330  0.0180  -0.0034 231 ILE A CG1 
3087 C CG2 . ILE E 231 ? 1.4711 1.5296 1.5167 0.0440  0.0288  -0.0065 231 ILE A CG2 
3088 C CD1 . ILE E 231 ? 1.5297 1.5529 1.5216 0.0279  0.0008  0.0075  231 ILE A CD1 
3089 N N   . PRO E 232 ? 1.1782 1.2740 1.2758 0.0662  0.0327  -0.0224 232 PRO A N   
3090 C CA  . PRO E 232 ? 1.1225 1.2263 1.2296 0.0713  0.0252  -0.0235 232 PRO A CA  
3091 C C   . PRO E 232 ? 1.0793 1.1926 1.1947 0.0733  0.0080  -0.0161 232 PRO A C   
3092 O O   . PRO E 232 ? 1.0709 1.1932 1.2006 0.0758  0.0041  -0.0119 232 PRO A O   
3093 C CB  . PRO E 232 ? 1.0844 1.2050 1.2219 0.0801  0.0331  -0.0298 232 PRO A CB  
3094 C CG  . PRO E 232 ? 1.0651 1.1925 1.2149 0.0810  0.0402  -0.0291 232 PRO A CG  
3095 C CD  . PRO E 232 ? 1.1185 1.2267 1.2388 0.0714  0.0451  -0.0277 232 PRO A CD  
3096 N N   . ILE E 233 ? 1.1087 1.2201 1.2154 0.0719  -0.0016 -0.0151 233 ILE A N   
3097 C CA  . ILE E 233 ? 1.1472 1.2682 1.2615 0.0730  -0.0179 -0.0094 233 ILE A CA  
3098 C C   . ILE E 233 ? 1.1930 1.3357 1.3416 0.0810  -0.0203 -0.0111 233 ILE A C   
3099 O O   . ILE E 233 ? 1.2032 1.3561 1.3657 0.0829  -0.0297 -0.0066 233 ILE A O   
3100 C CB  . ILE E 233 ? 1.0209 1.1356 1.1170 0.0688  -0.0259 -0.0094 233 ILE A CB  
3101 C CG1 . ILE E 233 ? 1.0492 1.1418 1.1099 0.0588  -0.0266 -0.0052 233 ILE A CG1 
3102 C CG2 . ILE E 233 ? 1.0246 1.1538 1.1343 0.0707  -0.0415 -0.0060 233 ILE A CG2 
3103 C CD1 . ILE E 233 ? 1.0888 1.1649 1.1330 0.0544  -0.0108 -0.0088 233 ILE A CD1 
3104 N N   . ILE E 234 ? 1.2201 1.3690 1.3823 0.0852  -0.0119 -0.0177 234 ILE A N   
3105 C CA  . ILE E 234 ? 1.2387 1.4057 1.4318 0.0910  -0.0120 -0.0192 234 ILE A CA  
3106 C C   . ILE E 234 ? 1.2718 1.4409 1.4764 0.0943  0.0021  -0.0236 234 ILE A C   
3107 O O   . ILE E 234 ? 1.3382 1.4980 1.5324 0.0940  0.0111  -0.0286 234 ILE A O   
3108 C CB  . ILE E 234 ? 0.8082 0.9847 1.0122 0.0922  -0.0208 -0.0222 234 ILE A CB  
3109 C CG1 . ILE E 234 ? 0.8693 1.0432 1.0750 0.0944  -0.0143 -0.0292 234 ILE A CG1 
3110 C CG2 . ILE E 234 ? 0.7748 0.9465 0.9611 0.0877  -0.0326 -0.0196 234 ILE A CG2 
3111 C CD1 . ILE E 234 ? 0.9125 1.0918 1.1231 0.0938  -0.0236 -0.0324 234 ILE A CD1 
3112 N N   . ARG E 235 ? 1.2475 1.4288 1.4739 0.0972  0.0044  -0.0219 235 ARG A N   
3113 C CA  . ARG E 235 ? 1.2927 1.4766 1.5286 0.0992  0.0178  -0.0249 235 ARG A CA  
3114 C C   . ARG E 235 ? 1.3087 1.5067 1.5716 0.1037  0.0198  -0.0283 235 ARG A C   
3115 O O   . ARG E 235 ? 1.2692 1.4785 1.5494 0.1044  0.0129  -0.0258 235 ARG A O   
3116 C CB  . ARG E 235 ? 1.3306 1.5147 1.5658 0.0975  0.0209  -0.0200 235 ARG A CB  
3117 C CG  . ARG E 235 ? 1.3810 1.5727 1.6310 0.0992  0.0334  -0.0224 235 ARG A CG  
3118 C CD  . ARG E 235 ? 1.4382 1.6256 1.6793 0.0958  0.0368  -0.0179 235 ARG A CD  
3119 N NE  . ARG E 235 ? 1.4959 1.6647 1.7072 0.0900  0.0400  -0.0181 235 ARG A NE  
3120 C CZ  . ARG E 235 ? 1.5245 1.6811 1.7159 0.0862  0.0299  -0.0130 235 ARG A CZ  
3121 N NH1 . ARG E 235 ? 1.5300 1.6930 1.7305 0.0888  0.0165  -0.0079 235 ARG A NH1 
3122 N NH2 . ARG E 235 ? 1.5291 1.6669 1.6917 0.0791  0.0331  -0.0132 235 ARG A NH2 
3123 N N   . GLY E 236 ? 1.3884 1.5848 1.6551 0.1062  0.0294  -0.0341 236 GLY A N   
3124 C CA  . GLY E 236 ? 1.4089 1.6174 1.7013 0.1103  0.0312  -0.0369 236 GLY A CA  
3125 C C   . GLY E 236 ? 1.4216 1.6405 1.7302 0.1107  0.0393  -0.0349 236 GLY A C   
3126 O O   . GLY E 236 ? 1.4698 1.6883 1.7720 0.1079  0.0397  -0.0302 236 GLY A O   
3127 N N   . LYS E 237 ? 1.3904 1.6182 1.7195 0.1141  0.0452  -0.0383 237 LYS A N   
3128 C CA  . LYS E 237 ? 1.3768 1.6155 1.7212 0.1138  0.0533  -0.0364 237 LYS A CA  
3129 C C   . LYS E 237 ? 1.4415 1.6729 1.7676 0.1106  0.0631  -0.0363 237 LYS A C   
3130 O O   . LYS E 237 ? 1.4694 1.7031 1.7931 0.1075  0.0636  -0.0312 237 LYS A O   
3131 C CB  . LYS E 237 ? 1.3704 1.6180 1.7371 0.1179  0.0596  -0.0411 237 LYS A CB  
3132 C CG  . LYS E 237 ? 1.3221 1.5823 1.7135 0.1180  0.0523  -0.0379 237 LYS A CG  
3133 C CD  . LYS E 237 ? 1.3083 1.5791 1.7095 0.1144  0.0563  -0.0323 237 LYS A CD  
3134 C CE  . LYS E 237 ? 1.2578 1.5394 1.6821 0.1125  0.0497  -0.0288 237 LYS A CE  
3135 N NZ  . LYS E 237 ? 1.2302 1.5177 1.6742 0.1165  0.0513  -0.0328 237 LYS A NZ  
3136 N N   . SER E 238 ? 1.4367 1.6574 1.7480 0.1106  0.0708  -0.0421 238 SER A N   
3137 C CA  . SER E 238 ? 1.4556 1.6671 1.7471 0.1056  0.0809  -0.0433 238 SER A CA  
3138 C C   . SER E 238 ? 1.4666 1.6629 1.7300 0.1004  0.0735  -0.0385 238 SER A C   
3139 O O   . SER E 238 ? 1.4299 1.6189 1.6833 0.1007  0.0643  -0.0375 238 SER A O   
3140 C CB  . SER E 238 ? 1.4897 1.6955 1.7773 0.1060  0.0942  -0.0526 238 SER A CB  
3141 O OG  . SER E 238 ? 1.4750 1.6960 1.7890 0.1100  0.1031  -0.0568 238 SER A OG  
3142 N N   . LEU E 239 ? 1.5225 1.7137 1.7725 0.0952  0.0770  -0.0353 239 LEU A N   
3143 C CA  . LEU E 239 ? 1.5718 1.7479 1.7958 0.0899  0.0689  -0.0297 239 LEU A CA  
3144 C C   . LEU E 239 ? 1.5853 1.7434 1.7833 0.0856  0.0686  -0.0325 239 LEU A C   
3145 O O   . LEU E 239 ? 1.6023 1.7513 1.7852 0.0834  0.0569  -0.0273 239 LEU A O   
3146 C CB  . LEU E 239 ? 1.5872 1.7575 1.7980 0.0840  0.0741  -0.0270 239 LEU A CB  
3147 C CG  . LEU E 239 ? 1.5477 1.7276 1.7710 0.0856  0.0688  -0.0200 239 LEU A CG  
3148 C CD1 . LEU E 239 ? 1.5507 1.7221 1.7569 0.0789  0.0769  -0.0194 239 LEU A CD1 
3149 C CD2 . LEU E 239 ? 1.5400 1.7168 1.7607 0.0871  0.0527  -0.0127 239 LEU A CD2 
3150 N N   . ASP E 240 ? 1.5687 1.7213 1.7613 0.0839  0.0817  -0.0407 240 ASP A N   
3151 C CA  . ASP E 240 ? 1.5524 1.6846 1.7156 0.0771  0.0842  -0.0435 240 ASP A CA  
3152 C C   . ASP E 240 ? 1.4860 1.6164 1.6512 0.0811  0.0814  -0.0471 240 ASP A C   
3153 O O   . ASP E 240 ? 1.5102 1.6230 1.6502 0.0752  0.0833  -0.0491 240 ASP A O   
3154 C CB  . ASP E 240 ? 1.6069 1.7301 1.7576 0.0703  0.1018  -0.0513 240 ASP A CB  
3155 C CG  . ASP E 240 ? 1.6502 1.7902 1.8296 0.0768  0.1145  -0.0594 240 ASP A CG  
3156 O OD1 . ASP E 240 ? 1.6292 1.7880 1.8373 0.0853  0.1090  -0.0568 240 ASP A OD1 
3157 O OD2 . ASP E 240 ? 1.7904 1.9249 1.9642 0.0728  0.1301  -0.0685 240 ASP A OD2 
3158 N N   . GLN E 241 ? 1.3838 1.5304 1.5763 0.0900  0.0766  -0.0476 241 GLN A N   
3159 C CA  . GLN E 241 ? 1.3296 1.4737 1.5240 0.0940  0.0745  -0.0519 241 GLN A CA  
3160 C C   . GLN E 241 ? 1.2617 1.4117 1.4620 0.0971  0.0579  -0.0466 241 GLN A C   
3161 O O   . GLN E 241 ? 1.2331 1.3956 1.4487 0.0990  0.0496  -0.0412 241 GLN A O   
3162 C CB  . GLN E 241 ? 1.3540 1.5086 1.5737 0.1010  0.0850  -0.0598 241 GLN A CB  
3163 C CG  . GLN E 241 ? 1.4455 1.5925 1.6583 0.0978  0.1032  -0.0683 241 GLN A CG  
3164 C CD  . GLN E 241 ? 1.5994 1.7270 1.7887 0.0943  0.1087  -0.0739 241 GLN A CD  
3165 O OE1 . GLN E 241 ? 1.5896 1.7032 1.7533 0.0889  0.1002  -0.0695 241 GLN A OE1 
3166 N NE2 . GLN E 241 ? 1.7737 1.9005 1.9723 0.0971  0.1232  -0.0839 241 GLN A NE2 
3167 N N   . TYR E 242 ? 1.2484 1.3885 1.4349 0.0965  0.0539  -0.0487 242 TYR A N   
3168 C CA  . TYR E 242 ? 1.1839 1.3288 1.3747 0.0987  0.0396  -0.0461 242 TYR A CA  
3169 C C   . TYR E 242 ? 1.1853 1.3437 1.4051 0.1062  0.0398  -0.0501 242 TYR A C   
3170 O O   . TYR E 242 ? 1.2232 1.3827 1.4541 0.1100  0.0509  -0.0560 242 TYR A O   
3171 C CB  . TYR E 242 ? 1.1179 1.2459 1.2817 0.0949  0.0376  -0.0481 242 TYR A CB  
3172 C CG  . TYR E 242 ? 1.0438 1.1719 1.1978 0.0922  0.0218  -0.0433 242 TYR A CG  
3173 C CD1 . TYR E 242 ? 1.0214 1.1451 1.1587 0.0861  0.0141  -0.0364 242 TYR A CD1 
3174 C CD2 . TYR E 242 ? 0.9640 1.0959 1.1244 0.0951  0.0143  -0.0460 242 TYR A CD2 
3175 C CE1 . TYR E 242 ? 1.0027 1.1283 1.1331 0.0836  -0.0001 -0.0326 242 TYR A CE1 
3176 C CE2 . TYR E 242 ? 0.9267 1.0595 1.0774 0.0915  0.0006  -0.0427 242 TYR A CE2 
3177 C CZ  . TYR E 242 ? 0.9321 1.0629 1.0690 0.0861  -0.0062 -0.0362 242 TYR A CZ  
3178 O OH  . TYR E 242 ? 0.8840 1.0178 1.0138 0.0826  -0.0197 -0.0335 242 TYR A OH  
3179 N N   . PRO E 243 ? 1.1386 1.3072 1.3714 0.1076  0.0273  -0.0472 243 PRO A N   
3180 C CA  . PRO E 243 ? 1.1493 1.3284 1.4076 0.1129  0.0257  -0.0503 243 PRO A CA  
3181 C C   . PRO E 243 ? 1.2411 1.4099 1.4941 0.1161  0.0291  -0.0572 243 PRO A C   
3182 O O   . PRO E 243 ? 1.2823 1.4367 1.5102 0.1132  0.0279  -0.0586 243 PRO A O   
3183 C CB  . PRO E 243 ? 1.0722 1.2585 1.3356 0.1105  0.0110  -0.0467 243 PRO A CB  
3184 C CG  . PRO E 243 ? 1.0703 1.2566 1.3220 0.1062  0.0072  -0.0408 243 PRO A CG  
3185 C CD  . PRO E 243 ? 1.1139 1.2846 1.3393 0.1037  0.0140  -0.0415 243 PRO A CD  
3186 N N   . ARG E 244 ? 1.2879 1.4633 1.5640 0.1220  0.0331  -0.0612 244 ARG A N   
3187 C CA  . ARG E 244 ? 1.3521 1.5180 1.6272 0.1264  0.0351  -0.0679 244 ARG A CA  
3188 C C   . ARG E 244 ? 1.4469 1.6056 1.7098 0.1243  0.0210  -0.0677 244 ARG A C   
3189 O O   . ARG E 244 ? 1.4967 1.6628 1.7629 0.1205  0.0097  -0.0634 244 ARG A O   
3190 C CB  . ARG E 244 ? 1.2974 1.4740 1.6040 0.1334  0.0396  -0.0711 244 ARG A CB  
3191 C CG  . ARG E 244 ? 1.2872 1.4707 1.6046 0.1351  0.0549  -0.0730 244 ARG A CG  
3192 C CD  . ARG E 244 ? 1.3450 1.5134 1.6353 0.1317  0.0659  -0.0765 244 ARG A CD  
3193 N NE  . ARG E 244 ? 1.3887 1.5611 1.6872 0.1324  0.0823  -0.0809 244 ARG A NE  
3194 C CZ  . ARG E 244 ? 1.4199 1.5899 1.7033 0.1259  0.0896  -0.0789 244 ARG A CZ  
3195 N NH1 . ARG E 244 ? 1.4027 1.5666 1.6640 0.1193  0.0811  -0.0720 244 ARG A NH1 
3196 N NH2 . ARG E 244 ? 1.4669 1.6404 1.7573 0.1255  0.1049  -0.0842 244 ARG A NH2 
3197 N N   . GLU E 245 ? 1.4748 1.6181 1.7224 0.1260  0.0223  -0.0730 245 GLU A N   
3198 C CA  . GLU E 245 ? 1.4841 1.6177 1.7145 0.1229  0.0098  -0.0737 245 GLU A CA  
3199 C C   . GLU E 245 ? 1.4498 1.5914 1.6985 0.1233  -0.0030 -0.0731 245 GLU A C   
3200 O O   . GLU E 245 ? 1.4405 1.5867 1.6844 0.1170  -0.0142 -0.0699 245 GLU A O   
3201 C CB  . GLU E 245 ? 1.5382 1.6528 1.7515 0.1258  0.0146  -0.0801 245 GLU A CB  
3202 C CG  . GLU E 245 ? 1.5909 1.6929 1.7811 0.1234  0.0275  -0.0817 245 GLU A CG  
3203 C CD  . GLU E 245 ? 1.5723 1.6819 1.7802 0.1269  0.0424  -0.0834 245 GLU A CD  
3204 O OE1 . GLU E 245 ? 1.5649 1.6875 1.8040 0.1335  0.0440  -0.0850 245 GLU A OE1 
3205 O OE2 . GLU E 245 ? 1.5690 1.6711 1.7585 0.1220  0.0522  -0.0831 245 GLU A OE2 
3206 N N   . LEU E 246 ? 1.4451 1.5876 1.7146 0.1299  -0.0015 -0.0767 246 LEU A N   
3207 C CA  . LEU E 246 ? 1.4601 1.6060 1.7444 0.1291  -0.0145 -0.0765 246 LEU A CA  
3208 C C   . LEU E 246 ? 1.5076 1.6685 1.8018 0.1224  -0.0214 -0.0707 246 LEU A C   
3209 O O   . LEU E 246 ? 1.5801 1.7401 1.8693 0.1159  -0.0338 -0.0702 246 LEU A O   
3210 C CB  . LEU E 246 ? 1.4276 1.5781 1.7412 0.1374  -0.0107 -0.0790 246 LEU A CB  
3211 C CG  . LEU E 246 ? 1.4246 1.5888 1.7600 0.1423  0.0034  -0.0782 246 LEU A CG  
3212 C CD1 . LEU E 246 ? 1.4165 1.5990 1.7745 0.1389  -0.0001 -0.0722 246 LEU A CD1 
3213 C CD2 . LEU E 246 ? 1.4152 1.5771 1.7698 0.1520  0.0102  -0.0840 246 LEU A CD2 
3214 N N   . THR E 247 ? 1.4817 1.6554 1.7886 0.1233  -0.0125 -0.0670 247 THR A N   
3215 C CA  . THR E 247 ? 1.4683 1.6559 1.7860 0.1177  -0.0169 -0.0615 247 THR A CA  
3216 C C   . THR E 247 ? 1.4795 1.6635 1.7776 0.1100  -0.0276 -0.0607 247 THR A C   
3217 O O   . THR E 247 ? 1.5030 1.6914 1.8077 0.1040  -0.0377 -0.0602 247 THR A O   
3218 C CB  . THR E 247 ? 1.4500 1.6468 1.7720 0.1188  -0.0058 -0.0576 247 THR A CB  
3219 O OG1 . THR E 247 ? 1.4961 1.6826 1.7928 0.1184  -0.0006 -0.0584 247 THR A OG1 
3220 C CG2 . THR E 247 ? 1.4161 1.6203 1.7603 0.1248  0.0048  -0.0585 247 THR A CG2 
3221 N N   . LEU E 248 ? 1.4409 1.6172 1.7152 0.1091  -0.0249 -0.0607 248 LEU A N   
3222 C CA  . LEU E 248 ? 1.3721 1.5447 1.6259 0.1022  -0.0343 -0.0604 248 LEU A CA  
3223 C C   . LEU E 248 ? 1.4087 1.5725 1.6540 0.0985  -0.0450 -0.0650 248 LEU A C   
3224 O O   . LEU E 248 ? 1.4337 1.6022 1.6793 0.0913  -0.0550 -0.0653 248 LEU A O   
3225 C CB  . LEU E 248 ? 1.2905 1.4527 1.5180 0.1021  -0.0289 -0.0597 248 LEU A CB  
3226 C CG  . LEU E 248 ? 1.2388 1.4043 1.4685 0.1045  -0.0181 -0.0559 248 LEU A CG  
3227 C CD1 . LEU E 248 ? 1.2652 1.4160 1.4655 0.1025  -0.0137 -0.0560 248 LEU A CD1 
3228 C CD2 . LEU E 248 ? 1.1992 1.3780 1.4390 0.1014  -0.0222 -0.0504 248 LEU A CD2 
3229 N N   . GLY E 249 ? 1.4388 1.5893 1.6770 0.1032  -0.0427 -0.0692 249 GLY A N   
3230 C CA  . GLY E 249 ? 1.4636 1.6025 1.6907 0.0998  -0.0533 -0.0737 249 GLY A CA  
3231 C C   . GLY E 249 ? 1.4731 1.6195 1.7190 0.0947  -0.0634 -0.0737 249 GLY A C   
3232 O O   . GLY E 249 ? 1.4821 1.6199 1.7158 0.0880  -0.0746 -0.0771 249 GLY A O   
3233 N N   . ASN E 250 ? 1.4385 1.5992 1.7123 0.0970  -0.0590 -0.0699 250 ASN A N   
3234 C CA  . ASN E 250 ? 1.3955 1.5650 1.6876 0.0900  -0.0669 -0.0686 250 ASN A CA  
3235 C C   . ASN E 250 ? 1.3195 1.4994 1.6089 0.0814  -0.0702 -0.0667 250 ASN A C   
3236 O O   . ASN E 250 ? 1.2987 1.4778 1.5843 0.0714  -0.0802 -0.0692 250 ASN A O   
3237 C CB  . ASN E 250 ? 1.4287 1.6090 1.7509 0.0954  -0.0603 -0.0649 250 ASN A CB  
3238 C CG  . ASN E 250 ? 1.4947 1.6809 1.8343 0.0870  -0.0686 -0.0632 250 ASN A CG  
3239 O OD1 . ASN E 250 ? 1.5443 1.7305 1.8760 0.0764  -0.0768 -0.0643 250 ASN A OD1 
3240 N ND2 . ASN E 250 ? 1.5050 1.6965 1.8683 0.0906  -0.0661 -0.0606 250 ASN A ND2 
3241 N N   . TRP E 251 ? 1.2995 1.4883 1.5902 0.0847  -0.0619 -0.0629 251 TRP A N   
3242 C CA  . TRP E 251 ? 1.3508 1.5502 1.6423 0.0780  -0.0650 -0.0611 251 TRP A CA  
3243 C C   . TRP E 251 ? 1.3431 1.5364 1.6127 0.0699  -0.0750 -0.0656 251 TRP A C   
3244 O O   . TRP E 251 ? 1.3846 1.5851 1.6584 0.0611  -0.0813 -0.0672 251 TRP A O   
3245 C CB  . TRP E 251 ? 1.4048 1.6108 1.6964 0.0832  -0.0562 -0.0563 251 TRP A CB  
3246 C CG  . TRP E 251 ? 1.4839 1.6979 1.7964 0.0889  -0.0464 -0.0521 251 TRP A CG  
3247 C CD1 . TRP E 251 ? 1.5265 1.7398 1.8534 0.0929  -0.0425 -0.0525 251 TRP A CD1 
3248 C CD2 . TRP E 251 ? 1.5437 1.7671 1.8645 0.0908  -0.0398 -0.0469 251 TRP A CD2 
3249 N NE1 . TRP E 251 ? 1.5498 1.7726 1.8928 0.0965  -0.0331 -0.0482 251 TRP A NE1 
3250 C CE2 . TRP E 251 ? 1.5671 1.7952 1.9053 0.0951  -0.0313 -0.0447 251 TRP A CE2 
3251 C CE3 . TRP E 251 ? 1.5773 1.8052 1.8925 0.0892  -0.0410 -0.0438 251 TRP A CE3 
3252 C CZ2 . TRP E 251 ? 1.6068 1.8427 1.9540 0.0972  -0.0234 -0.0399 251 TRP A CZ2 
3253 C CZ3 . TRP E 251 ? 1.6035 1.8381 1.9285 0.0919  -0.0339 -0.0387 251 TRP A CZ3 
3254 C CH2 . TRP E 251 ? 1.6109 1.8490 1.9504 0.0955  -0.0249 -0.0369 251 TRP A CH2 
3255 N N   . TYR E 252 ? 1.2947 1.4745 1.5405 0.0723  -0.0758 -0.0682 252 TYR A N   
3256 C CA  . TYR E 252 ? 1.2263 1.3996 1.4467 0.0650  -0.0839 -0.0720 252 TYR A CA  
3257 C C   . TYR E 252 ? 1.2043 1.3733 1.4203 0.0546  -0.0951 -0.0778 252 TYR A C   
3258 O O   . TYR E 252 ? 1.2056 1.3817 1.4185 0.0453  -0.1013 -0.0803 252 TYR A O   
3259 C CB  . TYR E 252 ? 1.1895 1.3471 1.3836 0.0696  -0.0807 -0.0729 252 TYR A CB  
3260 C CG  . TYR E 252 ? 1.1586 1.3189 1.3393 0.0702  -0.0771 -0.0691 252 TYR A CG  
3261 C CD1 . TYR E 252 ? 1.1843 1.3476 1.3494 0.0622  -0.0850 -0.0701 252 TYR A CD1 
3262 C CD2 . TYR E 252 ? 1.1145 1.2742 1.2979 0.0777  -0.0664 -0.0647 252 TYR A CD2 
3263 C CE1 . TYR E 252 ? 1.1949 1.3605 1.3486 0.0623  -0.0834 -0.0658 252 TYR A CE1 
3264 C CE2 . TYR E 252 ? 1.1368 1.2967 1.3062 0.0767  -0.0646 -0.0606 252 TYR A CE2 
3265 C CZ  . TYR E 252 ? 1.1696 1.3324 1.3247 0.0693  -0.0737 -0.0607 252 TYR A CZ  
3266 O OH  . TYR E 252 ? 1.1565 1.3193 1.2984 0.0680  -0.0734 -0.0558 252 TYR A OH  
3267 N N   . PRO E 253 ? 1.1977 1.3545 1.4133 0.0555  -0.0981 -0.0804 253 PRO A N   
3268 C CA  . PRO E 253 ? 1.2211 1.3706 1.4285 0.0438  -0.1099 -0.0860 253 PRO A CA  
3269 C C   . PRO E 253 ? 1.1633 1.3267 1.3919 0.0347  -0.1125 -0.0859 253 PRO A C   
3270 O O   . PRO E 253 ? 1.1732 1.3352 1.3927 0.0218  -0.1210 -0.0913 253 PRO A O   
3271 C CB  . PRO E 253 ? 1.2615 1.3963 1.4713 0.0487  -0.1120 -0.0869 253 PRO A CB  
3272 C CG  . PRO E 253 ? 1.2462 1.3885 1.4782 0.0617  -0.1003 -0.0815 253 PRO A CG  
3273 C CD  . PRO E 253 ? 1.2250 1.3742 1.4488 0.0664  -0.0917 -0.0788 253 PRO A CD  
3274 N N   . THR E 254 ? 1.1333 1.3092 1.3887 0.0407  -0.1045 -0.0803 254 THR A N   
3275 C CA  . THR E 254 ? 1.0641 1.2527 1.3413 0.0328  -0.1046 -0.0792 254 THR A CA  
3276 C C   . THR E 254 ? 0.9681 1.1675 1.2421 0.0247  -0.1063 -0.0820 254 THR A C   
3277 O O   . THR E 254 ? 0.8997 1.1030 1.1797 0.0122  -0.1108 -0.0860 254 THR A O   
3278 C CB  . THR E 254 ? 1.0959 1.2963 1.3981 0.0419  -0.0939 -0.0720 254 THR A CB  
3279 O OG1 . THR E 254 ? 1.1591 1.3520 1.4651 0.0518  -0.0903 -0.0697 254 THR A OG1 
3280 C CG2 . THR E 254 ? 1.0462 1.2554 1.3696 0.0329  -0.0942 -0.0707 254 THR A CG2 
3281 N N   . ILE E 255 ? 0.9830 1.1871 1.2483 0.0314  -0.1026 -0.0801 255 ILE A N   
3282 C CA  . ILE E 255 ? 1.0305 1.2454 1.2931 0.0252  -0.1052 -0.0827 255 ILE A CA  
3283 C C   . ILE E 255 ? 1.1788 1.3858 1.4161 0.0146  -0.1149 -0.0906 255 ILE A C   
3284 O O   . ILE E 255 ? 1.2010 1.4164 1.4408 0.0036  -0.1191 -0.0961 255 ILE A O   
3285 C CB  . ILE E 255 ? 0.9853 1.2077 1.2481 0.0352  -0.0993 -0.0769 255 ILE A CB  
3286 C CG1 . ILE E 255 ? 0.9777 1.2132 1.2432 0.0292  -0.1031 -0.0793 255 ILE A CG1 
3287 C CG2 . ILE E 255 ? 1.0290 1.2383 1.2669 0.0417  -0.0987 -0.0756 255 ILE A CG2 
3288 C CD1 . ILE E 255 ? 0.9632 1.2105 1.2525 0.0213  -0.1027 -0.0821 255 ILE A CD1 
3289 N N   . PHE E 256 ? 1.2551 1.4458 1.4680 0.0175  -0.1177 -0.0917 256 PHE A N   
3290 C CA  . PHE E 256 ? 1.2915 1.4716 1.4751 0.0077  -0.1266 -0.0989 256 PHE A CA  
3291 C C   . PHE E 256 ? 1.3316 1.5057 1.5127 -0.0071 -0.1350 -0.1064 256 PHE A C   
3292 O O   . PHE E 256 ? 1.3537 1.5277 1.5188 -0.0196 -0.1418 -0.1137 256 PHE A O   
3293 C CB  . PHE E 256 ? 1.2861 1.4473 1.4447 0.0148  -0.1264 -0.0979 256 PHE A CB  
3294 C CG  . PHE E 256 ? 1.2985 1.4602 1.4384 0.0189  -0.1239 -0.0954 256 PHE A CG  
3295 C CD1 . PHE E 256 ? 1.3265 1.4782 1.4342 0.0114  -0.1304 -0.1001 256 PHE A CD1 
3296 C CD2 . PHE E 256 ? 1.2762 1.4476 1.4290 0.0289  -0.1155 -0.0881 256 PHE A CD2 
3297 C CE1 . PHE E 256 ? 1.3441 1.4958 1.4335 0.0138  -0.1284 -0.0970 256 PHE A CE1 
3298 C CE2 . PHE E 256 ? 1.3013 1.4716 1.4355 0.0311  -0.1141 -0.0852 256 PHE A CE2 
3299 C CZ  . PHE E 256 ? 1.3405 1.5013 1.4436 0.0234  -0.1206 -0.0893 256 PHE A CZ  
3300 N N   . LYS E 257 ? 1.3616 1.5300 1.5574 -0.0065 -0.1348 -0.1047 257 LYS A N   
3301 C CA  . LYS E 257 ? 1.3950 1.5594 1.5945 -0.0217 -0.1417 -0.1102 257 LYS A CA  
3302 C C   . LYS E 257 ? 1.4057 1.5885 1.6219 -0.0314 -0.1394 -0.1133 257 LYS A C   
3303 O O   . LYS E 257 ? 1.4551 1.6377 1.6596 -0.0466 -0.1454 -0.1219 257 LYS A O   
3304 C CB  . LYS E 257 ? 1.3957 1.5548 1.6143 -0.0179 -0.1405 -0.1053 257 LYS A CB  
3305 C CG  . LYS E 257 ? 1.4342 1.5762 1.6425 -0.0076 -0.1424 -0.1027 257 LYS A CG  
3306 C CD  . LYS E 257 ? 1.4422 1.5833 1.6748 -0.0040 -0.1412 -0.0975 257 LYS A CD  
3307 C CE  . LYS E 257 ? 1.4583 1.5953 1.6971 0.0138  -0.1351 -0.0920 257 LYS A CE  
3308 N NZ  . LYS E 257 ? 1.4872 1.6264 1.7525 0.0173  -0.1337 -0.0868 257 LYS A NZ  
3309 N N   . TYR E 258 ? 1.3372 1.5354 1.5810 -0.0230 -0.1303 -0.1067 258 TYR A N   
3310 C CA  . TYR E 258 ? 1.2676 1.4830 1.5315 -0.0303 -0.1266 -0.1090 258 TYR A CA  
3311 C C   . TYR E 258 ? 1.2424 1.4659 1.4941 -0.0372 -0.1302 -0.1161 258 TYR A C   
3312 O O   . TYR E 258 ? 1.2020 1.4329 1.4597 -0.0511 -0.1317 -0.1238 258 TYR A O   
3313 C CB  . TYR E 258 ? 1.3080 1.5374 1.5978 -0.0170 -0.1161 -0.1000 258 TYR A CB  
3314 C CG  . TYR E 258 ? 1.3618 1.6079 1.6746 -0.0230 -0.1113 -0.1017 258 TYR A CG  
3315 C CD1 . TYR E 258 ? 1.3682 1.6184 1.7037 -0.0246 -0.1051 -0.0978 258 TYR A CD1 
3316 C CD2 . TYR E 258 ? 1.3954 1.6534 1.7080 -0.0270 -0.1128 -0.1072 258 TYR A CD2 
3317 C CE1 . TYR E 258 ? 1.3788 1.6427 1.7348 -0.0300 -0.0997 -0.0996 258 TYR A CE1 
3318 C CE2 . TYR E 258 ? 1.3896 1.6628 1.7254 -0.0316 -0.1080 -0.1094 258 TYR A CE2 
3319 C CZ  . TYR E 258 ? 1.4030 1.6784 1.7599 -0.0331 -0.1011 -0.1057 258 TYR A CZ  
3320 O OH  . TYR E 258 ? 1.4307 1.7198 1.8101 -0.0377 -0.0955 -0.1083 258 TYR A OH  
3321 N N   . CYS E 259 ? 1.2800 1.5020 1.5145 -0.0282 -0.1312 -0.1140 259 CYS A N   
3322 C CA  . CYS E 259 ? 1.3172 1.5469 1.5383 -0.0342 -0.1355 -0.1199 259 CYS A CA  
3323 C C   . CYS E 259 ? 1.3882 1.6030 1.5773 -0.0475 -0.1448 -0.1288 259 CYS A C   
3324 O O   . CYS E 259 ? 1.4685 1.6895 1.6448 -0.0563 -0.1492 -0.1357 259 CYS A O   
3325 C CB  . CYS E 259 ? 1.3230 1.5576 1.5387 -0.0202 -0.1327 -0.1126 259 CYS A CB  
3326 S SG  . CYS E 259 ? 0.8901 1.1407 1.1387 -0.0057 -0.1231 -0.1025 259 CYS A SG  
3327 N N   . GLN E 260 ? 1.3369 1.5319 1.5134 -0.0493 -0.1484 -0.1289 260 GLN A N   
3328 C CA  . GLN E 260 ? 1.2865 1.4628 1.4304 -0.0620 -0.1581 -0.1369 260 GLN A CA  
3329 C C   . GLN E 260 ? 1.2301 1.4007 1.3439 -0.0587 -0.1610 -0.1375 260 GLN A C   
3330 O O   . GLN E 260 ? 1.2029 1.3716 1.2941 -0.0719 -0.1674 -0.1460 260 GLN A O   
3331 C CB  . GLN E 260 ? 1.3281 1.5086 1.4708 -0.0829 -0.1629 -0.1481 260 GLN A CB  
3332 C CG  . GLN E 260 ? 1.4022 1.5800 1.5645 -0.0911 -0.1616 -0.1483 260 GLN A CG  
3333 C CD  . GLN E 260 ? 1.5069 1.6778 1.6573 -0.1074 -0.1539 -0.1456 260 GLN A CD  
3334 O OE1 . GLN E 260 ? 1.5783 1.7265 1.7107 -0.1200 -0.1531 -0.1409 260 GLN A OE1 
3335 N NE2 . GLN E 260 ? 1.5202 1.7096 1.6804 -0.1066 -0.1494 -0.1479 260 GLN A NE2 
3336 N N   . LEU E 261 ? 1.2073 1.3750 1.3201 -0.0422 -0.1558 -0.1287 261 LEU A N   
3337 C CA  . LEU E 261 ? 1.1970 1.3550 1.2789 -0.0387 -0.1574 -0.1278 261 LEU A CA  
3338 C C   . LEU E 261 ? 1.2497 1.3856 1.3188 -0.0294 -0.1566 -0.1240 261 LEU A C   
3339 O O   . LEU E 261 ? 1.2682 1.4043 1.3600 -0.0190 -0.1511 -0.1183 261 LEU A O   
3340 C CB  . LEU E 261 ? 1.1607 1.3347 1.2524 -0.0282 -0.1510 -0.1207 261 LEU A CB  
3341 C CG  . LEU E 261 ? 1.1614 1.3588 1.2693 -0.0350 -0.1520 -0.1239 261 LEU A CG  
3342 C CD1 . LEU E 261 ? 1.1668 1.3776 1.2891 -0.0224 -0.1462 -0.1148 261 LEU A CD1 
3343 C CD2 . LEU E 261 ? 1.1747 1.3710 1.2548 -0.0495 -0.1601 -0.1328 261 LEU A CD2 
3344 N N   . PRO E 262 ? 1.2952 1.4119 1.3280 -0.0330 -0.1618 -0.1274 262 PRO A N   
3345 C CA  . PRO E 262 ? 1.3192 1.4126 1.3373 -0.0245 -0.1614 -0.1251 262 PRO A CA  
3346 C C   . PRO E 262 ? 1.3215 1.4176 1.3495 -0.0073 -0.1503 -0.1163 262 PRO A C   
3347 O O   . PRO E 262 ? 1.3442 1.4508 1.3684 -0.0050 -0.1460 -0.1129 262 PRO A O   
3348 C CB  . PRO E 262 ? 1.3521 1.4273 1.3260 -0.0340 -0.1687 -0.1310 262 PRO A CB  
3349 C CG  . PRO E 262 ? 1.3437 1.4367 1.3113 -0.0414 -0.1687 -0.1326 262 PRO A CG  
3350 C CD  . PRO E 262 ? 1.3238 1.4403 1.3269 -0.0455 -0.1679 -0.1337 262 PRO A CD  
3351 N N   . TYR E 263 ? 1.2993 1.3856 1.3395 0.0036  -0.1462 -0.1130 263 TYR A N   
3352 C CA  . TYR E 263 ? 1.2395 1.3292 1.2932 0.0189  -0.1344 -0.1056 263 TYR A CA  
3353 C C   . TYR E 263 ? 1.1483 1.2155 1.1812 0.0271  -0.1309 -0.1056 263 TYR A C   
3354 O O   . TYR E 263 ? 1.1190 1.1701 1.1485 0.0280  -0.1356 -0.1087 263 TYR A O   
3355 C CB  . TYR E 263 ? 1.2386 1.3412 1.3318 0.0261  -0.1294 -0.1016 263 TYR A CB  
3356 C CG  . TYR E 263 ? 1.2145 1.3181 1.3218 0.0412  -0.1172 -0.0955 263 TYR A CG  
3357 C CD1 . TYR E 263 ? 1.1635 1.2796 1.2763 0.0461  -0.1088 -0.0902 263 TYR A CD1 
3358 C CD2 . TYR E 263 ? 1.2192 1.3111 1.3346 0.0499  -0.1146 -0.0954 263 TYR A CD2 
3359 C CE1 . TYR E 263 ? 1.1377 1.2535 1.2611 0.0579  -0.0973 -0.0856 263 TYR A CE1 
3360 C CE2 . TYR E 263 ? 1.1963 1.2901 1.3252 0.0626  -0.1025 -0.0912 263 TYR A CE2 
3361 C CZ  . TYR E 263 ? 1.1397 1.2450 1.2713 0.0659  -0.0936 -0.0866 263 TYR A CZ  
3362 O OH  . TYR E 263 ? 1.0956 1.2015 1.2384 0.0767  -0.0812 -0.0834 263 TYR A OH  
3363 N N   . THR E 264 ? 1.1006 1.1660 1.1202 0.0327  -0.1225 -0.1019 264 THR A N   
3364 C CA  . THR E 264 ? 1.0995 1.1444 1.1017 0.0409  -0.1160 -0.1018 264 THR A CA  
3365 C C   . THR E 264 ? 1.0987 1.1514 1.1180 0.0521  -0.1021 -0.0957 264 THR A C   
3366 O O   . THR E 264 ? 1.1339 1.1952 1.1469 0.0503  -0.0980 -0.0917 264 THR A O   
3367 C CB  . THR E 264 ? 1.1241 1.1528 1.0823 0.0333  -0.1188 -0.1042 264 THR A CB  
3368 O OG1 . THR E 264 ? 1.1515 1.1784 1.0932 0.0198  -0.1318 -0.1098 264 THR A OG1 
3369 C CG2 . THR E 264 ? 1.1399 1.1426 1.0782 0.0401  -0.1138 -0.1061 264 THR A CG2 
3370 N N   . LYS E 265 ? 1.0644 1.1136 1.1048 0.0630  -0.0952 -0.0954 265 LYS A N   
3371 C CA  . LYS E 265 ? 1.0697 1.1273 1.1289 0.0727  -0.0815 -0.0907 265 LYS A CA  
3372 C C   . LYS E 265 ? 1.1124 1.1589 1.1443 0.0730  -0.0724 -0.0890 265 LYS A C   
3373 O O   . LYS E 265 ? 1.0379 1.0939 1.0750 0.0741  -0.0649 -0.0842 265 LYS A O   
3374 C CB  . LYS E 265 ? 1.0493 1.1033 1.1332 0.0837  -0.0759 -0.0922 265 LYS A CB  
3375 C CG  . LYS E 265 ? 1.0477 1.1113 1.1526 0.0927  -0.0614 -0.0887 265 LYS A CG  
3376 C CD  . LYS E 265 ? 1.0219 1.0885 1.1585 0.1023  -0.0581 -0.0901 265 LYS A CD  
3377 C CE  . LYS E 265 ? 0.9738 1.0537 1.1346 0.1097  -0.0443 -0.0871 265 LYS A CE  
3378 N NZ  . LYS E 265 ? 0.9664 1.0336 1.1185 0.1165  -0.0303 -0.0901 265 LYS A NZ  
3379 N N   . LYS E 266 ? 1.2755 1.3000 1.2768 0.0711  -0.0733 -0.0929 266 LYS A N   
3380 C CA  . LYS E 266 ? 1.4308 1.4407 1.4017 0.0696  -0.0643 -0.0917 266 LYS A CA  
3381 C C   . LYS E 266 ? 1.4908 1.5106 1.4467 0.0604  -0.0668 -0.0864 266 LYS A C   
3382 O O   . LYS E 266 ? 1.5383 1.5540 1.4822 0.0599  -0.0577 -0.0826 266 LYS A O   
3383 C CB  . LYS E 266 ? 1.4777 1.4615 1.4145 0.0669  -0.0671 -0.0970 266 LYS A CB  
3384 C CG  . LYS E 266 ? 1.5074 1.4749 1.4053 0.0611  -0.0601 -0.0954 266 LYS A CG  
3385 C CD  . LYS E 266 ? 1.5600 1.5007 1.4390 0.0661  -0.0521 -0.1004 266 LYS A CD  
3386 C CE  . LYS E 266 ? 1.5806 1.5052 1.4233 0.0599  -0.0419 -0.0982 266 LYS A CE  
3387 N NZ  . LYS E 266 ? 1.6056 1.5044 1.4342 0.0659  -0.0302 -0.1034 266 LYS A NZ  
3388 N N   . HIS E 267 ? 1.5113 1.5438 1.4684 0.0525  -0.0793 -0.0865 267 HIS A N   
3389 C CA  . HIS E 267 ? 1.5568 1.6009 1.5036 0.0443  -0.0833 -0.0818 267 HIS A CA  
3390 C C   . HIS E 267 ? 1.5470 1.6057 1.5169 0.0494  -0.0760 -0.0752 267 HIS A C   
3391 O O   . HIS E 267 ? 1.6052 1.6606 1.5585 0.0461  -0.0722 -0.0702 267 HIS A O   
3392 C CB  . HIS E 267 ? 1.5840 1.6426 1.5360 0.0359  -0.0970 -0.0844 267 HIS A CB  
3393 C CG  . HIS E 267 ? 1.6247 1.6684 1.5444 0.0268  -0.1056 -0.0903 267 HIS A CG  
3394 N ND1 . HIS E 267 ? 1.6538 1.6719 1.5446 0.0279  -0.1018 -0.0930 267 HIS A ND1 
3395 C CD2 . HIS E 267 ? 1.6331 1.6830 1.5436 0.0158  -0.1173 -0.0946 267 HIS A CD2 
3396 C CE1 . HIS E 267 ? 1.6683 1.6766 1.5316 0.0180  -0.1116 -0.0982 267 HIS A CE1 
3397 N NE2 . HIS E 267 ? 1.6548 1.6825 1.5293 0.0100  -0.1210 -0.0995 267 HIS A NE2 
3398 N N   . TRP E 268 ? 1.4371 1.5107 1.4434 0.0561  -0.0747 -0.0750 268 TRP A N   
3399 C CA  . TRP E 268 ? 1.2964 1.3841 1.3246 0.0603  -0.0687 -0.0691 268 TRP A CA  
3400 C C   . TRP E 268 ? 1.2965 1.3770 1.3326 0.0687  -0.0545 -0.0680 268 TRP A C   
3401 O O   . TRP E 268 ? 1.3114 1.3989 1.3562 0.0701  -0.0491 -0.0629 268 TRP A O   
3402 C CB  . TRP E 268 ? 1.1704 1.2796 1.2323 0.0614  -0.0746 -0.0687 268 TRP A CB  
3403 C CG  . TRP E 268 ? 1.1328 1.2519 1.1890 0.0524  -0.0864 -0.0695 268 TRP A CG  
3404 C CD1 . TRP E 268 ? 1.1350 1.2651 1.1892 0.0481  -0.0904 -0.0650 268 TRP A CD1 
3405 C CD2 . TRP E 268 ? 1.1427 1.2615 1.1937 0.0456  -0.0961 -0.0758 268 TRP A CD2 
3406 N NE1 . TRP E 268 ? 1.1186 1.2573 1.1693 0.0396  -0.1013 -0.0686 268 TRP A NE1 
3407 C CE2 . TRP E 268 ? 1.1390 1.2705 1.1862 0.0371  -0.1047 -0.0756 268 TRP A CE2 
3408 C CE3 . TRP E 268 ? 1.1686 1.2768 1.2176 0.0452  -0.0990 -0.0819 268 TRP A CE3 
3409 C CZ2 . TRP E 268 ? 1.1534 1.2880 1.1941 0.0275  -0.1146 -0.0821 268 TRP A CZ2 
3410 C CZ3 . TRP E 268 ? 1.1775 1.2865 1.2178 0.0352  -0.1101 -0.0876 268 TRP A CZ3 
3411 C CH2 . TRP E 268 ? 1.1673 1.2897 1.2030 0.0260  -0.1171 -0.0881 268 TRP A CH2 
3412 N N   . PHE E 269 ? 1.2798 1.3465 1.3138 0.0740  -0.0485 -0.0730 269 PHE A N   
3413 C CA  . PHE E 269 ? 1.2118 1.2726 1.2544 0.0815  -0.0337 -0.0734 269 PHE A CA  
3414 C C   . PHE E 269 ? 1.1669 1.2056 1.1771 0.0789  -0.0243 -0.0746 269 PHE A C   
3415 O O   . PHE E 269 ? 1.1344 1.1671 1.1484 0.0832  -0.0106 -0.0757 269 PHE A O   
3416 C CB  . PHE E 269 ? 1.2184 1.2819 1.2891 0.0907  -0.0309 -0.0780 269 PHE A CB  
3417 C CG  . PHE E 269 ? 1.1817 1.2669 1.2871 0.0933  -0.0352 -0.0755 269 PHE A CG  
3418 C CD1 . PHE E 269 ? 1.1699 1.2648 1.3018 0.1002  -0.0254 -0.0744 269 PHE A CD1 
3419 C CD2 . PHE E 269 ? 1.1828 1.2784 1.2926 0.0874  -0.0485 -0.0747 269 PHE A CD2 
3420 C CE1 . PHE E 269 ? 1.1692 1.2829 1.3306 0.1016  -0.0290 -0.0716 269 PHE A CE1 
3421 C CE2 . PHE E 269 ? 1.1813 1.2954 1.3214 0.0885  -0.0515 -0.0725 269 PHE A CE2 
3422 C CZ  . PHE E 269 ? 1.1719 1.2947 1.3373 0.0957  -0.0419 -0.0705 269 PHE A CZ  
3423 N N   . GLN E 270 ? 1.1516 1.1783 1.1290 0.0709  -0.0309 -0.0747 270 GLN A N   
3424 C CA  . GLN E 270 ? 1.1936 1.1974 1.1358 0.0664  -0.0221 -0.0753 270 GLN A CA  
3425 C C   . GLN E 270 ? 1.2044 1.2043 1.1139 0.0543  -0.0315 -0.0710 270 GLN A C   
3426 O O   . GLN E 270 ? 1.2072 1.2200 1.1205 0.0505  -0.0450 -0.0701 270 GLN A O   
3427 C CB  . GLN E 270 ? 1.2054 1.1902 1.1394 0.0716  -0.0169 -0.0829 270 GLN A CB  
3428 C CG  . GLN E 270 ? 1.2425 1.2263 1.2026 0.0826  -0.0028 -0.0872 270 GLN A CG  
3429 C CD  . GLN E 270 ? 1.3565 1.3328 1.3070 0.0803  0.0131  -0.0858 270 GLN A CD  
3430 O OE1 . GLN E 270 ? 1.4892 1.4562 1.4090 0.0699  0.0137  -0.0814 270 GLN A OE1 
3431 N NE2 . GLN E 270 ? 1.3538 1.3336 1.3300 0.0887  0.0259  -0.0897 270 GLN A NE2 
3432 N N   . VAL E 271 ? 1.1887 1.1712 1.0664 0.0473  -0.0240 -0.0685 271 VAL A N   
3433 C CA  . VAL E 271 ? 1.1563 1.1349 1.0018 0.0349  -0.0324 -0.0631 271 VAL A CA  
3434 C C   . VAL E 271 ? 1.2554 1.2313 1.0853 0.0311  -0.0438 -0.0670 271 VAL A C   
3435 O O   . VAL E 271 ? 1.3435 1.3050 1.1660 0.0349  -0.0406 -0.0735 271 VAL A O   
3436 C CB  . VAL E 271 ? 1.0557 1.0097 0.8639 0.0270  -0.0213 -0.0610 271 VAL A CB  
3437 C CG1 . VAL E 271 ? 1.0761 1.0304 0.8575 0.0138  -0.0304 -0.0529 271 VAL A CG1 
3438 C CG2 . VAL E 271 ? 1.0107 0.9610 0.8330 0.0316  -0.0059 -0.0612 271 VAL A CG2 
3439 N N   . ASN E 272 ? 1.2465 1.2361 1.0717 0.0235  -0.0572 -0.0636 272 ASN A N   
3440 C CA  . ASN E 272 ? 1.2664 1.2540 1.0738 0.0173  -0.0684 -0.0678 272 ASN A CA  
3441 C C   . ASN E 272 ? 1.3024 1.2766 1.0654 0.0041  -0.0712 -0.0641 272 ASN A C   
3442 O O   . ASN E 272 ? 1.3155 1.3023 1.0764 -0.0027 -0.0779 -0.0576 272 ASN A O   
3443 C CB  . ASN E 272 ? 1.2215 1.2357 1.0574 0.0172  -0.0814 -0.0684 272 ASN A CB  
3444 C CG  . ASN E 272 ? 1.2028 1.2168 1.0178 0.0076  -0.0934 -0.0727 272 ASN A CG  
3445 O OD1 . ASN E 272 ? 1.2203 1.2132 1.0013 0.0028  -0.0926 -0.0760 272 ASN A OD1 
3446 N ND2 . ASN E 272 ? 1.1887 1.2256 1.0229 0.0041  -0.1043 -0.0733 272 ASN A ND2 
3447 N N   . GLN E 273 ? 1.3236 1.2728 1.0519 0.0005  -0.0669 -0.0681 273 GLN A N   
3448 C CA  . GLN E 273 ? 1.3184 1.2495 0.9995 -0.0126 -0.0661 -0.0641 273 GLN A CA  
3449 C C   . GLN E 273 ? 1.3612 1.2983 1.0180 -0.0250 -0.0802 -0.0635 273 GLN A C   
3450 O O   . GLN E 273 ? 1.3564 1.2894 0.9851 -0.0364 -0.0822 -0.0570 273 GLN A O   
3451 C CB  . GLN E 273 ? 1.2826 1.1816 0.9331 -0.0123 -0.0528 -0.0678 273 GLN A CB  
3452 C CG  . GLN E 273 ? 1.9508 1.8365 1.5933 -0.0134 -0.0374 -0.0630 273 GLN A CG  
3453 C CD  . GLN E 273 ? 1.9883 1.8899 1.6762 -0.0014 -0.0310 -0.0627 273 GLN A CD  
3454 O OE1 . GLN E 273 ? 2.0098 1.9338 1.7343 0.0068  -0.0388 -0.0646 273 GLN A OE1 
3455 N NE2 . GLN E 273 ? 2.0067 1.8955 1.6908 -0.0014 -0.0159 -0.0611 273 GLN A NE2 
3456 N N   . GLU E 274 ? 1.3870 1.3340 1.0543 -0.0241 -0.0903 -0.0702 274 GLU A N   
3457 C CA  . GLU E 274 ? 1.4189 1.3785 1.0719 -0.0359 -0.1041 -0.0704 274 GLU A CA  
3458 C C   . GLU E 274 ? 1.4171 1.4012 1.0921 -0.0376 -0.1088 -0.0624 274 GLU A C   
3459 O O   . GLU E 274 ? 1.4411 1.4342 1.1000 -0.0487 -0.1178 -0.0590 274 GLU A O   
3460 C CB  . GLU E 274 ? 1.4296 1.3998 1.0994 -0.0346 -0.1137 -0.0794 274 GLU A CB  
3461 C CG  . GLU E 274 ? 1.5162 1.4980 1.1682 -0.0486 -0.1272 -0.0822 274 GLU A CG  
3462 C CD  . GLU E 274 ? 1.6134 1.6279 1.2973 -0.0501 -0.1349 -0.0786 274 GLU A CD  
3463 O OE1 . GLU E 274 ? 1.7495 1.7793 1.4751 -0.0394 -0.1322 -0.0769 274 GLU A OE1 
3464 O OE2 . GLU E 274 ? 1.5858 1.6108 1.2534 -0.0619 -0.1435 -0.0776 274 GLU A OE2 
3465 N N   . TRP E 275 ? 1.3892 1.3831 1.0999 -0.0268 -0.1027 -0.0592 275 TRP A N   
3466 C CA  . TRP E 275 ? 1.3551 1.3698 1.0883 -0.0269 -0.1071 -0.0513 275 TRP A CA  
3467 C C   . TRP E 275 ? 1.3442 1.3455 1.0553 -0.0321 -0.1011 -0.0418 275 TRP A C   
3468 O O   . TRP E 275 ? 1.3810 1.3576 1.0698 -0.0320 -0.0890 -0.0417 275 TRP A O   
3469 C CB  . TRP E 275 ? 1.3567 1.3896 1.1388 -0.0140 -0.1050 -0.0525 275 TRP A CB  
3470 C CG  . TRP E 275 ? 1.3105 1.3647 1.1184 -0.0130 -0.1149 -0.0589 275 TRP A CG  
3471 C CD1 . TRP E 275 ? 1.2848 1.3395 1.0758 -0.0213 -0.1234 -0.0654 275 TRP A CD1 
3472 C CD2 . TRP E 275 ? 1.2987 1.3755 1.1517 -0.0048 -0.1169 -0.0597 275 TRP A CD2 
3473 N NE1 . TRP E 275 ? 1.2593 1.3351 1.0821 -0.0196 -0.1302 -0.0708 275 TRP A NE1 
3474 C CE2 . TRP E 275 ? 1.2524 1.3420 1.1139 -0.0093 -0.1262 -0.0672 275 TRP A CE2 
3475 C CE3 . TRP E 275 ? 1.2600 1.3462 1.1451 0.0048  -0.1114 -0.0552 275 TRP A CE3 
3476 C CZ2 . TRP E 275 ? 1.1967 1.3076 1.0978 -0.0048 -0.1295 -0.0702 275 TRP A CZ2 
3477 C CZ3 . TRP E 275 ? 1.2032 1.3110 1.1272 0.0100  -0.1150 -0.0577 275 TRP A CZ3 
3478 C CH2 . TRP E 275 ? 1.1559 1.2757 1.0879 0.0052  -0.1237 -0.0650 275 TRP A CH2 
3479 N N   . PRO E 276 ? 1.2409 1.2582 0.9590 -0.0371 -0.1101 -0.0340 276 PRO A N   
3480 C CA  . PRO E 276 ? 1.2694 1.2766 0.9710 -0.0431 -0.1075 -0.0236 276 PRO A CA  
3481 C C   . PRO E 276 ? 1.2908 1.2926 1.0132 -0.0338 -0.0961 -0.0215 276 PRO A C   
3482 O O   . PRO E 276 ? 1.2820 1.2961 1.0403 -0.0217 -0.0931 -0.0265 276 PRO A O   
3483 C CB  . PRO E 276 ? 1.2099 1.2420 0.9277 -0.0473 -0.1230 -0.0176 276 PRO A CB  
3484 C CG  . PRO E 276 ? 1.1570 1.2146 0.9139 -0.0387 -0.1290 -0.0251 276 PRO A CG  
3485 C CD  . PRO E 276 ? 1.1871 1.2333 0.9298 -0.0382 -0.1242 -0.0352 276 PRO A CD  
3486 N N   . GLN E 277 ? 1.3359 1.3187 1.0338 -0.0409 -0.0897 -0.0143 277 GLN A N   
3487 C CA  . GLN E 277 ? 1.2705 1.2448 0.9809 -0.0352 -0.0778 -0.0125 277 GLN A CA  
3488 C C   . GLN E 277 ? 1.2958 1.2617 0.9888 -0.0458 -0.0810 -0.0012 277 GLN A C   
3489 O O   . GLN E 277 ? 1.3279 1.2894 0.9929 -0.0583 -0.0901 0.0053  277 GLN A O   
3490 C CB  . GLN E 277 ? 1.2800 1.2284 0.9709 -0.0338 -0.0601 -0.0190 277 GLN A CB  
3491 C CG  . GLN E 277 ? 1.2247 1.1756 0.9274 -0.0243 -0.0573 -0.0298 277 GLN A CG  
3492 C CD  . GLN E 277 ? 1.2328 1.1564 0.9132 -0.0235 -0.0410 -0.0360 277 GLN A CD  
3493 O OE1 . GLN E 277 ? 1.3378 1.2504 0.9981 -0.0251 -0.0411 -0.0413 277 GLN A OE1 
3494 N NE2 . GLN E 277 ? 1.1491 1.0611 0.8330 -0.0213 -0.0267 -0.0359 277 GLN A NE2 
3495 N N   . PHE E 278 ? 1.2570 1.2196 0.9645 -0.0419 -0.0739 0.0014  278 PHE A N   
3496 C CA  . PHE E 278 ? 1.3148 1.2624 0.9994 -0.0539 -0.0753 0.0116  278 PHE A CA  
3497 C C   . PHE E 278 ? 1.3385 1.2527 0.9826 -0.0639 -0.0588 0.0099  278 PHE A C   
3498 O O   . PHE E 278 ? 1.3531 1.2589 1.0011 -0.0568 -0.0438 0.0005  278 PHE A O   
3499 C CB  . PHE E 278 ? 1.2982 1.2537 1.0117 -0.0473 -0.0748 0.0147  278 PHE A CB  
3500 C CG  . PHE E 278 ? 1.2737 1.2574 1.0207 -0.0412 -0.0922 0.0196  278 PHE A CG  
3501 C CD1 . PHE E 278 ? 1.2843 1.2735 1.0205 -0.0503 -0.1090 0.0287  278 PHE A CD1 
3502 C CD2 . PHE E 278 ? 1.2116 1.2158 1.0015 -0.0266 -0.0914 0.0150  278 PHE A CD2 
3503 C CE1 . PHE E 278 ? 1.2446 1.2601 1.0144 -0.0439 -0.1244 0.0324  278 PHE A CE1 
3504 C CE2 . PHE E 278 ? 1.1623 1.1910 0.9832 -0.0211 -0.1060 0.0188  278 PHE A CE2 
3505 C CZ  . PHE E 278 ? 1.1911 1.2257 1.0030 -0.0292 -0.1224 0.0272  278 PHE A CZ  
3506 N N   . PRO E 279 ? 1.3485 1.2432 0.9544 -0.0809 -0.0615 0.0190  279 PRO A N   
3507 C CA  . PRO E 279 ? 1.4262 1.2868 0.9923 -0.0927 -0.0446 0.0180  279 PRO A CA  
3508 C C   . PRO E 279 ? 1.5603 1.4131 1.1421 -0.0875 -0.0295 0.0136  279 PRO A C   
3509 O O   . PRO E 279 ? 1.5806 1.4548 1.2027 -0.0742 -0.0326 0.0116  279 PRO A O   
3510 C CB  . PRO E 279 ? 1.3701 1.2165 0.9005 -0.1123 -0.0548 0.0311  279 PRO A CB  
3511 C CG  . PRO E 279 ? 1.3203 1.1934 0.8663 -0.1103 -0.0769 0.0370  279 PRO A CG  
3512 C CD  . PRO E 279 ? 1.3017 1.2052 0.9004 -0.0905 -0.0808 0.0307  279 PRO A CD  
3513 N N   . ASP E 280 ? 1.6997 1.5223 1.2498 -0.0984 -0.0124 0.0115  280 ASP A N   
3514 C CA  . ASP E 280 ? 1.8123 1.6256 1.3721 -0.0974 0.0020  0.0078  280 ASP A CA  
3515 C C   . ASP E 280 ? 2.0337 1.8177 1.5523 -0.1192 0.0054  0.0158  280 ASP A C   
3516 O O   . ASP E 280 ? 2.0853 1.8486 1.5625 -0.1349 0.0053  0.0204  280 ASP A O   
3517 C CB  . ASP E 280 ? 1.7634 1.5685 1.3313 -0.0883 0.0238  -0.0060 280 ASP A CB  
3518 C CG  . ASP E 280 ? 1.7671 1.5635 1.3445 -0.0886 0.0397  -0.0109 280 ASP A CG  
3519 O OD1 . ASP E 280 ? 1.8677 1.6353 1.4105 -0.1050 0.0521  -0.0105 280 ASP A OD1 
3520 O OD2 . ASP E 280 ? 1.7206 1.5386 1.3392 -0.0735 0.0399  -0.0153 280 ASP A OD2 
3521 N N   . PHE E 281 ? 2.2038 1.9848 1.7319 -0.1213 0.0083  0.0174  281 PHE A N   
3522 C CA  . PHE E 281 ? 2.3947 2.1475 1.8843 -0.1433 0.0091  0.0256  281 PHE A CA  
3523 C C   . PHE E 281 ? 2.4873 2.2236 1.9760 -0.1472 0.0288  0.0180  281 PHE A C   
3524 O O   . PHE E 281 ? 2.4387 2.1917 1.9621 -0.1350 0.0296  0.0143  281 PHE A O   
3525 C CB  . PHE E 281 ? 2.4670 2.2311 1.9610 -0.1477 -0.0157 0.0398  281 PHE A CB  
3526 C CG  . PHE E 281 ? 2.5044 2.2805 1.9915 -0.1491 -0.0343 0.0478  281 PHE A CG  
3527 C CD1 . PHE E 281 ? 2.5608 2.3146 2.0025 -0.1703 -0.0407 0.0578  281 PHE A CD1 
3528 C CD2 . PHE E 281 ? 2.4754 2.2845 1.9997 -0.1307 -0.0446 0.0446  281 PHE A CD2 
3529 C CE1 . PHE E 281 ? 2.5603 2.3264 1.9953 -0.1724 -0.0574 0.0647  281 PHE A CE1 
3530 C CE2 . PHE E 281 ? 2.4710 2.2917 1.9883 -0.1331 -0.0607 0.0506  281 PHE A CE2 
3531 C CZ  . PHE E 281 ? 2.5138 2.3139 1.9870 -0.1536 -0.0672 0.0605  281 PHE A CZ  
3532 N N   . SER E 282 ? 2.6254 2.3281 2.0727 -0.1654 0.0453  0.0154  282 SER A N   
3533 C CA  . SER E 282 ? 2.7327 2.4154 2.1719 -0.1737 0.0656  0.0075  282 SER A CA  
3534 C C   . SER E 282 ? 2.8002 2.4503 2.1919 -0.2017 0.0628  0.0175  282 SER A C   
3535 O O   . SER E 282 ? 2.8278 2.4658 2.1872 -0.2155 0.0507  0.0284  282 SER A O   
3536 C CB  . SER E 282 ? 2.7916 2.4614 2.2254 -0.1711 0.0917  -0.0073 282 SER A CB  
3537 O OG  . SER E 282 ? 2.8484 2.4945 2.2666 -0.1840 0.1125  -0.0150 282 SER A OG  
3538 N N   . GLU E 293 ? 2.2887 2.1427 1.9748 -0.1093 -0.1941 0.1245  293 GLU A N   
3539 C CA  . GLU E 293 ? 2.3228 2.1468 1.9599 -0.1326 -0.1966 0.1319  293 GLU A CA  
3540 C C   . GLU E 293 ? 2.2513 2.0905 1.8878 -0.1330 -0.2015 0.1330  293 GLU A C   
3541 O O   . GLU E 293 ? 2.2095 2.0555 1.8447 -0.1296 -0.1840 0.1228  293 GLU A O   
3542 C CB  . GLU E 293 ? 2.3918 2.1872 1.9936 -0.1459 -0.1715 0.1235  293 GLU A CB  
3543 C CG  . GLU E 293 ? 2.4420 2.2011 1.9887 -0.1729 -0.1717 0.1307  293 GLU A CG  
3544 C CD  . GLU E 293 ? 2.4155 2.1744 1.9452 -0.1774 -0.1569 0.1243  293 GLU A CD  
3545 O OE1 . GLU E 293 ? 2.3576 2.1452 1.9186 -0.1593 -0.1491 0.1150  293 GLU A OE1 
3546 O OE2 . GLU E 293 ? 2.4441 2.1723 1.9271 -0.1999 -0.1531 0.1285  293 GLU A OE2 
3547 N N   . SER E 294 ? 2.2148 2.0592 1.8522 -0.1372 -0.2259 0.1454  294 SER A N   
3548 C CA  . SER E 294 ? 2.1666 2.0284 1.8055 -0.1376 -0.2326 0.1468  294 SER A CA  
3549 C C   . SER E 294 ? 2.1373 1.9874 1.7532 -0.1537 -0.2566 0.1629  294 SER A C   
3550 O O   . SER E 294 ? 2.1617 1.9869 1.7574 -0.1660 -0.2684 0.1736  294 SER A O   
3551 C CB  . SER E 294 ? 2.1344 2.0391 1.8269 -0.1142 -0.2366 0.1397  294 SER A CB  
3552 O OG  . SER E 294 ? 2.1487 2.0698 1.8710 -0.1066 -0.2605 0.1486  294 SER A OG  
3553 N N   . ASP E 295 ? 2.0794 1.9477 1.6982 -0.1541 -0.2640 0.1643  295 ASP A N   
3554 C CA  . ASP E 295 ? 2.0819 1.9426 1.6781 -0.1701 -0.2856 0.1790  295 ASP A CA  
3555 C C   . ASP E 295 ? 2.0380 1.9370 1.6662 -0.1591 -0.2975 0.1777  295 ASP A C   
3556 O O   . ASP E 295 ? 2.0587 1.9858 1.7205 -0.1413 -0.2871 0.1650  295 ASP A O   
3557 C CB  . ASP E 295 ? 2.1083 1.9318 1.6435 -0.1961 -0.2760 0.1833  295 ASP A CB  
3558 C CG  . ASP E 295 ? 2.1499 1.9792 1.6721 -0.1961 -0.2562 0.1723  295 ASP A CG  
3559 O OD1 . ASP E 295 ? 2.1478 1.9603 1.6296 -0.2149 -0.2570 0.1783  295 ASP A OD1 
3560 O OD2 . ASP E 295 ? 2.2191 2.0678 1.7693 -0.1783 -0.2400 0.1581  295 ASP A OD2 
3561 N N   . SER E 296 ? 2.0046 1.9052 1.6239 -0.1698 -0.3201 0.1909  296 SER A N   
3562 C CA  . SER E 296 ? 1.9348 1.8730 1.5861 -0.1605 -0.3335 0.1900  296 SER A CA  
3563 C C   . SER E 296 ? 1.9332 1.8896 1.5885 -0.1535 -0.3142 0.1751  296 SER A C   
3564 O O   . SER E 296 ? 1.9603 1.9498 1.6599 -0.1345 -0.3123 0.1648  296 SER A O   
3565 C CB  . SER E 296 ? 1.8868 1.8183 1.5137 -0.1788 -0.3558 0.2057  296 SER A CB  
3566 O OG  . SER E 296 ? 1.8563 1.7451 1.4240 -0.2033 -0.3502 0.2139  296 SER A OG  
3567 N N   . GLU E 297 ? 1.8825 1.8166 1.4911 -0.1694 -0.3005 0.1739  297 GLU A N   
3568 C CA  . GLU E 297 ? 1.8039 1.7534 1.4132 -0.1639 -0.2849 0.1607  297 GLU A CA  
3569 C C   . GLU E 297 ? 1.6924 1.6347 1.3033 -0.1540 -0.2580 0.1458  297 GLU A C   
3570 O O   . GLU E 297 ? 1.6489 1.6084 1.2708 -0.1453 -0.2474 0.1340  297 GLU A O   
3571 C CB  . GLU E 297 ? 1.8755 1.8104 1.4372 -0.1847 -0.2862 0.1666  297 GLU A CB  
3572 C CG  . GLU E 297 ? 1.9369 1.8883 1.5046 -0.1920 -0.3132 0.1793  297 GLU A CG  
3573 C CD  . GLU E 297 ? 2.0529 1.9774 1.5640 -0.2184 -0.3176 0.1912  297 GLU A CD  
3574 O OE1 . GLU E 297 ? 2.0372 1.9316 1.5039 -0.2308 -0.2981 0.1880  297 GLU A OE1 
3575 O OE2 . GLU E 297 ? 2.1847 2.1181 1.6961 -0.2272 -0.3407 0.2038  297 GLU A OE2 
3576 N N   . ASN E 298 ? 1.6782 1.5969 1.2806 -0.1550 -0.2477 0.1458  298 ASN A N   
3577 C CA  . ASN E 298 ? 1.6375 1.5517 1.2450 -0.1451 -0.2228 0.1316  298 ASN A CA  
3578 C C   . ASN E 298 ? 1.5961 1.5121 1.2330 -0.1324 -0.2197 0.1291  298 ASN A C   
3579 O O   . ASN E 298 ? 1.6228 1.5314 1.2626 -0.1359 -0.2342 0.1393  298 ASN A O   
3580 C CB  . ASN E 298 ? 1.6795 1.5575 1.2352 -0.1620 -0.2036 0.1298  298 ASN A CB  
3581 C CG  . ASN E 298 ? 1.7479 1.6051 1.2573 -0.1854 -0.2136 0.1421  298 ASN A CG  
3582 O OD1 . ASN E 298 ? 1.7539 1.6173 1.2483 -0.1903 -0.2138 0.1409  298 ASN A OD1 
3583 N ND2 . ASN E 298 ? 1.7937 1.6247 1.2781 -0.2011 -0.2222 0.1543  298 ASN A ND2 
3584 N N   . THR E 299 ? 1.5781 1.5030 1.2361 -0.1182 -0.2014 0.1158  299 THR A N   
3585 C CA  . THR E 299 ? 1.6103 1.5395 1.2977 -0.1058 -0.1986 0.1131  299 THR A CA  
3586 C C   . THR E 299 ? 1.6908 1.5907 1.3535 -0.1124 -0.1785 0.1088  299 THR A C   
3587 O O   . THR E 299 ? 1.8036 1.6797 1.4455 -0.1239 -0.1830 0.1168  299 THR A O   
3588 C CB  . THR E 299 ? 1.5505 1.5149 1.2885 -0.0837 -0.1958 0.1025  299 THR A CB  
3589 O OG1 . THR E 299 ? 1.5698 1.5369 1.3036 -0.0799 -0.1775 0.0904  299 THR A OG1 
3590 C CG2 . THR E 299 ? 1.5070 1.5008 1.2732 -0.0777 -0.2165 0.1067  299 THR A CG2 
3591 N N   . ILE E 300 ? 1.6202 1.5205 1.2842 -0.1063 -0.1569 0.0960  300 ILE A N   
3592 C CA  . ILE E 300 ? 1.5862 1.4607 1.2303 -0.1122 -0.1373 0.0908  300 ILE A CA  
3593 C C   . ILE E 300 ? 1.6105 1.4548 1.2043 -0.1318 -0.1268 0.0915  300 ILE A C   
3594 O O   . ILE E 300 ? 1.7108 1.5266 1.2689 -0.1505 -0.1301 0.1001  300 ILE A O   
3595 C CB  . ILE E 300 ? 2.7863 2.6769 2.4636 -0.0941 -0.1195 0.0768  300 ILE A CB  
3596 C CG1 . ILE E 300 ? 2.7121 2.5817 2.3794 -0.0984 -0.1046 0.0733  300 ILE A CG1 
3597 C CG2 . ILE E 300 ? 2.8219 2.7190 2.4983 -0.0890 -0.1057 0.0662  300 ILE A CG2 
3598 C CD1 . ILE E 300 ? 2.5657 2.4323 2.2411 -0.0994 -0.1181 0.0819  300 ILE A CD1 
3599 N N   . GLY E 301 ? 1.5806 1.4287 1.1694 -0.1286 -0.1143 0.0827  301 GLY A N   
3600 C CA  . GLY E 301 ? 1.6560 1.4798 1.1983 -0.1466 -0.1085 0.0849  301 GLY A CA  
3601 C C   . GLY E 301 ? 1.6876 1.5288 1.2300 -0.1455 -0.1209 0.0875  301 GLY A C   
3602 O O   . GLY E 301 ? 1.6859 1.5096 1.1895 -0.1605 -0.1189 0.0906  301 GLY A O   
3603 N N   . ILE E 302 ? 1.6777 1.5534 1.2635 -0.1285 -0.1333 0.0860  302 ILE A N   
3604 C CA  . ILE E 302 ? 1.6482 1.5465 1.2446 -0.1221 -0.1392 0.0821  302 ILE A CA  
3605 C C   . ILE E 302 ? 1.6903 1.6069 1.2937 -0.1256 -0.1636 0.0924  302 ILE A C   
3606 O O   . ILE E 302 ? 1.7190 1.6499 1.3502 -0.1197 -0.1785 0.0986  302 ILE A O   
3607 C CB  . ILE E 302 ? 1.5280 1.4529 1.1685 -0.1006 -0.1320 0.0695  302 ILE A CB  
3608 C CG1 . ILE E 302 ? 1.5100 1.4189 1.1461 -0.0965 -0.1084 0.0590  302 ILE A CG1 
3609 C CG2 . ILE E 302 ? 1.4704 1.4148 1.1169 -0.0964 -0.1370 0.0643  302 ILE A CG2 
3610 C CD1 . ILE E 302 ? 1.4821 1.4146 1.1637 -0.0763 -0.1025 0.0490  302 ILE A CD1 
3611 N N   . PRO E 303 ? 1.6426 1.5578 1.2198 -0.1358 -0.1678 0.0942  303 PRO A N   
3612 C CA  . PRO E 303 ? 1.5921 1.5299 1.1801 -0.1378 -0.1900 0.1016  303 PRO A CA  
3613 C C   . PRO E 303 ? 1.5356 1.5112 1.1791 -0.1175 -0.1974 0.0947  303 PRO A C   
3614 O O   . PRO E 303 ? 1.4745 1.4597 1.1385 -0.1044 -0.1843 0.0824  303 PRO A O   
3615 C CB  . PRO E 303 ? 1.5646 1.4977 1.1199 -0.1476 -0.1861 0.0986  303 PRO A CB  
3616 C CG  . PRO E 303 ? 1.6061 1.5039 1.1207 -0.1574 -0.1653 0.0955  303 PRO A CG  
3617 C CD  . PRO E 303 ? 1.6305 1.5253 1.1699 -0.1443 -0.1513 0.0880  303 PRO A CD  
3618 N N   . ASP E 304 ? 1.5360 1.5323 1.2035 -0.1157 -0.2182 0.1026  304 ASP A N   
3619 C CA  . ASP E 304 ? 1.4660 1.4968 1.1876 -0.0975 -0.2257 0.0968  304 ASP A CA  
3620 C C   . ASP E 304 ? 1.4772 1.5328 1.2139 -0.0912 -0.2236 0.0853  304 ASP A C   
3621 O O   . ASP E 304 ? 1.4633 1.5394 1.2377 -0.0762 -0.2192 0.0756  304 ASP A O   
3622 C CB  . ASP E 304 ? 1.4144 1.4590 1.1578 -0.0974 -0.2486 0.1082  304 ASP A CB  
3623 C CG  . ASP E 304 ? 1.4015 1.4242 1.1395 -0.0998 -0.2511 0.1176  304 ASP A CG  
3624 O OD1 . ASP E 304 ? 1.4246 1.4289 1.1541 -0.0974 -0.2339 0.1127  304 ASP A OD1 
3625 O OD2 . ASP E 304 ? 1.4040 1.4276 1.1463 -0.1043 -0.2705 0.1296  304 ASP A OD2 
3626 N N   . PHE E 305 ? 1.4868 1.5392 1.1924 -0.1037 -0.2265 0.0862  305 PHE A N   
3627 C CA  . PHE E 305 ? 1.4402 1.5140 1.1564 -0.0995 -0.2246 0.0746  305 PHE A CA  
3628 C C   . PHE E 305 ? 1.3487 1.4176 1.0713 -0.0890 -0.2054 0.0613  305 PHE A C   
3629 O O   . PHE E 305 ? 1.2609 1.3522 1.0114 -0.0795 -0.2045 0.0507  305 PHE A O   
3630 C CB  . PHE E 305 ? 1.5159 1.5846 1.1923 -0.1160 -0.2299 0.0774  305 PHE A CB  
3631 C CG  . PHE E 305 ? 1.5680 1.5992 1.1893 -0.1300 -0.2169 0.0806  305 PHE A CG  
3632 C CD1 . PHE E 305 ? 1.5325 1.5524 1.1316 -0.1305 -0.2015 0.0699  305 PHE A CD1 
3633 C CD2 . PHE E 305 ? 1.6452 1.6514 1.2356 -0.1438 -0.2206 0.0941  305 PHE A CD2 
3634 C CE1 . PHE E 305 ? 1.5628 1.5477 1.1120 -0.1431 -0.1886 0.0721  305 PHE A CE1 
3635 C CE2 . PHE E 305 ? 1.6912 1.6621 1.2301 -0.1581 -0.2073 0.0963  305 PHE A CE2 
3636 C CZ  . PHE E 305 ? 1.6495 1.6101 1.1685 -0.1572 -0.1907 0.0850  305 PHE A CZ  
3637 N N   . TYR E 306 ? 1.3726 1.4122 1.0703 -0.0915 -0.1902 0.0619  306 TYR A N   
3638 C CA  . TYR E 306 ? 1.4090 1.4429 1.1153 -0.0810 -0.1722 0.0503  306 TYR A CA  
3639 C C   . TYR E 306 ? 1.4393 1.4971 1.1976 -0.0638 -0.1734 0.0453  306 TYR A C   
3640 O O   . TYR E 306 ? 1.4583 1.5308 1.2393 -0.0540 -0.1681 0.0344  306 TYR A O   
3641 C CB  . TYR E 306 ? 1.4353 1.4358 1.1126 -0.0862 -0.1569 0.0529  306 TYR A CB  
3642 C CG  . TYR E 306 ? 1.4536 1.4273 1.0837 -0.0977 -0.1447 0.0502  306 TYR A CG  
3643 C CD1 . TYR E 306 ? 1.4398 1.4005 1.0660 -0.0913 -0.1260 0.0398  306 TYR A CD1 
3644 C CD2 . TYR E 306 ? 1.4628 1.4235 1.0523 -0.1151 -0.1516 0.0582  306 TYR A CD2 
3645 C CE1 . TYR E 306 ? 1.4357 1.3706 1.0197 -0.1010 -0.1143 0.0370  306 TYR A CE1 
3646 C CE2 . TYR E 306 ? 1.4561 1.3904 1.0007 -0.1260 -0.1394 0.0558  306 TYR A CE2 
3647 C CZ  . TYR E 306 ? 1.4609 1.3821 1.0034 -0.1184 -0.1206 0.0449  306 TYR A CZ  
3648 O OH  . TYR E 306 ? 1.5069 1.4008 1.0060 -0.1283 -0.1080 0.0419  306 TYR A OH  
3649 N N   . ILE E 307 ? 1.4249 1.4850 1.2001 -0.0614 -0.1808 0.0537  307 ILE A N   
3650 C CA  . ILE E 307 ? 1.3488 1.4283 1.1704 -0.0462 -0.1819 0.0505  307 ILE A CA  
3651 C C   . ILE E 307 ? 1.2436 1.3570 1.1015 -0.0393 -0.1937 0.0457  307 ILE A C   
3652 O O   . ILE E 307 ? 1.1611 1.2903 1.0487 -0.0284 -0.1879 0.0360  307 ILE A O   
3653 C CB  . ILE E 307 ? 1.3756 1.4454 1.2006 -0.0471 -0.1880 0.0615  307 ILE A CB  
3654 C CG1 . ILE E 307 ? 1.4143 1.4494 1.2011 -0.0561 -0.1743 0.0643  307 ILE A CG1 
3655 C CG2 . ILE E 307 ? 1.3373 1.4249 1.2075 -0.0317 -0.1882 0.0585  307 ILE A CG2 
3656 C CD1 . ILE E 307 ? 1.4274 1.4468 1.2069 -0.0614 -0.1805 0.0753  307 ILE A CD1 
3657 N N   . GLU E 308 ? 1.2569 1.3812 1.1119 -0.0467 -0.2100 0.0522  308 GLU A N   
3658 C CA  . GLU E 308 ? 1.2838 1.4410 1.1728 -0.0419 -0.2214 0.0471  308 GLU A CA  
3659 C C   . GLU E 308 ? 1.3142 1.4805 1.2023 -0.0413 -0.2134 0.0336  308 GLU A C   
3660 O O   . GLU E 308 ? 1.3205 1.5108 1.2438 -0.0333 -0.2146 0.0248  308 GLU A O   
3661 C CB  . GLU E 308 ? 1.3378 1.5026 1.2167 -0.0524 -0.2394 0.0561  308 GLU A CB  
3662 C CG  . GLU E 308 ? 1.4598 1.6150 1.3396 -0.0540 -0.2505 0.0703  308 GLU A CG  
3663 C CD  . GLU E 308 ? 1.5956 1.7591 1.4674 -0.0644 -0.2698 0.0799  308 GLU A CD  
3664 O OE1 . GLU E 308 ? 1.7122 1.8528 1.5523 -0.0758 -0.2757 0.0925  308 GLU A OE1 
3665 O OE2 . GLU E 308 ? 1.6055 1.7984 1.5029 -0.0621 -0.2792 0.0748  308 GLU A OE2 
3666 N N   . LYS E 309 ? 1.3305 1.4756 1.1764 -0.0508 -0.2053 0.0321  309 LYS A N   
3667 C CA  . LYS E 309 ? 1.2663 1.4148 1.1037 -0.0521 -0.1988 0.0200  309 LYS A CA  
3668 C C   . LYS E 309 ? 1.1897 1.3362 1.0462 -0.0404 -0.1849 0.0105  309 LYS A C   
3669 O O   . LYS E 309 ? 1.1666 1.3295 1.0431 -0.0364 -0.1845 0.0001  309 LYS A O   
3670 C CB  . LYS E 309 ? 1.3692 1.4926 1.1533 -0.0657 -0.1942 0.0220  309 LYS A CB  
3671 C CG  . LYS E 309 ? 1.4250 1.5449 1.1942 -0.0672 -0.1863 0.0098  309 LYS A CG  
3672 C CD  . LYS E 309 ? 1.4442 1.5920 1.2306 -0.0694 -0.1969 0.0021  309 LYS A CD  
3673 C CE  . LYS E 309 ? 1.4676 1.6074 1.2319 -0.0734 -0.1903 -0.0094 309 LYS A CE  
3674 N NZ  . LYS E 309 ? 1.4616 1.6259 1.2356 -0.0790 -0.2002 -0.0177 309 LYS A NZ  
3675 N N   . MET E 310 ? 1.1754 1.3014 1.0250 -0.0362 -0.1737 0.0138  310 MET A N   
3676 C CA  . MET E 310 ? 1.1639 1.2864 1.0293 -0.0257 -0.1601 0.0053  310 MET A CA  
3677 C C   . MET E 310 ? 1.1849 1.3293 1.0985 -0.0135 -0.1621 0.0034  310 MET A C   
3678 O O   . MET E 310 ? 1.1509 1.3022 1.0857 -0.0056 -0.1550 -0.0052 310 MET A O   
3679 C CB  . MET E 310 ? 1.1658 1.2594 1.0067 -0.0263 -0.1461 0.0082  310 MET A CB  
3680 C CG  . MET E 310 ? 1.2028 1.2726 0.9980 -0.0365 -0.1395 0.0066  310 MET A CG  
3681 S SD  . MET E 310 ? 1.0952 1.1300 0.8581 -0.0408 -0.1237 0.0112  310 MET A SD  
3682 C CE  . MET E 310 ? 1.1476 1.1860 0.9458 -0.0247 -0.1099 0.0032  310 MET A CE  
3683 N N   . ASN E 311 ? 1.2119 1.3658 1.1416 -0.0124 -0.1721 0.0117  311 ASN A N   
3684 C CA  . ASN E 311 ? 1.2021 1.3775 1.1768 -0.0017 -0.1755 0.0103  311 ASN A CA  
3685 C C   . ASN E 311 ? 1.1863 1.3895 1.1840 -0.0029 -0.1884 0.0065  311 ASN A C   
3686 O O   . ASN E 311 ? 1.1886 1.4120 1.2252 0.0050  -0.1920 0.0043  311 ASN A O   
3687 C CB  . ASN E 311 ? 1.2171 1.3851 1.1982 0.0016  -0.1781 0.0209  311 ASN A CB  
3688 C CG  . ASN E 311 ? 1.2652 1.4038 1.2162 -0.0012 -0.1659 0.0246  311 ASN A CG  
3689 O OD1 . ASN E 311 ? 1.3277 1.4469 1.2417 -0.0120 -0.1668 0.0304  311 ASN A OD1 
3690 N ND2 . ASN E 311 ? 1.2357 1.3708 1.2019 0.0075  -0.1537 0.0207  311 ASN A ND2 
3691 N N   . ARG E 312 ? 1.1643 1.3680 1.1373 -0.0136 -0.1946 0.0054  312 ARG A N   
3692 C CA  . ARG E 312 ? 1.1330 1.3626 1.1235 -0.0168 -0.2046 -0.0010 312 ARG A CA  
3693 C C   . ARG E 312 ? 1.0639 1.3174 1.0936 -0.0113 -0.2167 0.0029  312 ARG A C   
3694 O O   . ARG E 312 ? 1.0122 1.2905 1.0732 -0.0088 -0.2203 -0.0056 312 ARG A O   
3695 C CB  . ARG E 312 ? 1.1765 1.4143 1.1802 -0.0142 -0.1967 -0.0149 312 ARG A CB  
3696 C CG  . ARG E 312 ? 1.1953 1.4556 1.2076 -0.0212 -0.2045 -0.0244 312 ARG A CG  
3697 C CD  . ARG E 312 ? 1.1926 1.4574 1.2161 -0.0201 -0.1967 -0.0380 312 ARG A CD  
3698 N NE  . ARG E 312 ? 1.1624 1.4338 1.2230 -0.0086 -0.1903 -0.0397 312 ARG A NE  
3699 C CZ  . ARG E 312 ? 1.1174 1.3715 1.1750 -0.0016 -0.1794 -0.0380 312 ARG A CZ  
3700 N NH1 . ARG E 312 ? 1.1019 1.3312 1.1235 -0.0041 -0.1732 -0.0351 312 ARG A NH1 
3701 N NH2 . ARG E 312 ? 1.0987 1.3605 1.1898 0.0077  -0.1743 -0.0393 312 ARG A NH2 
3702 N N   . THR E 313 ? 1.0837 1.3286 1.1114 -0.0098 -0.2229 0.0153  313 THR A N   
3703 C CA  . THR E 313 ? 1.0946 1.3596 1.1574 -0.0044 -0.2361 0.0202  313 THR A CA  
3704 C C   . THR E 313 ? 1.2010 1.4534 1.2443 -0.0101 -0.2482 0.0350  313 THR A C   
3705 O O   . THR E 313 ? 1.2463 1.4711 1.2568 -0.0144 -0.2430 0.0426  313 THR A O   
3706 C CB  . THR E 313 ? 1.0210 1.2925 1.1217 0.0091  -0.2305 0.0182  313 THR A CB  
3707 O OG1 . THR E 313 ? 1.0349 1.3279 1.1727 0.0149  -0.2434 0.0210  313 THR A OG1 
3708 C CG2 . THR E 313 ? 0.9608 1.2054 1.0434 0.0120  -0.2227 0.0263  313 THR A CG2 
3709 N N   . LYS E 314 ? 1.2576 1.5302 1.3213 -0.0110 -0.2644 0.0388  314 LYS A N   
3710 C CA  . LYS E 314 ? 1.3703 1.6327 1.4184 -0.0170 -0.2789 0.0536  314 LYS A CA  
3711 C C   . LYS E 314 ? 1.3535 1.5966 1.4043 -0.0102 -0.2769 0.0622  314 LYS A C   
3712 O O   . LYS E 314 ? 1.3513 1.6014 1.4328 0.0018  -0.2702 0.0572  314 LYS A O   
3713 C CB  . LYS E 314 ? 1.4829 1.7747 1.5649 -0.0154 -0.2971 0.0551  314 LYS A CB  
3714 C CG  . LYS E 314 ? 1.5885 1.9045 1.6757 -0.0212 -0.2982 0.0437  314 LYS A CG  
3715 C CD  . LYS E 314 ? 1.7092 2.0075 1.7438 -0.0365 -0.2946 0.0449  314 LYS A CD  
3716 C CE  . LYS E 314 ? 1.7975 2.0874 1.8074 -0.0476 -0.3103 0.0597  314 LYS A CE  
3717 N NZ  . LYS E 314 ? 1.8626 2.1366 1.8209 -0.0636 -0.3064 0.0602  314 LYS A NZ  
3718 N N   . LEU E 315 ? 1.3307 1.5482 1.3471 -0.0193 -0.2823 0.0751  315 LEU A N   
3719 C CA  . LEU E 315 ? 1.3088 1.5061 1.3240 -0.0152 -0.2824 0.0839  315 LEU A CA  
3720 C C   . LEU E 315 ? 1.3569 1.5693 1.4096 -0.0070 -0.3004 0.0908  315 LEU A C   
3721 O O   . LEU E 315 ? 1.3966 1.6211 1.4556 -0.0113 -0.3179 0.0969  315 LEU A O   
3722 C CB  . LEU E 315 ? 1.2313 1.3944 1.1954 -0.0300 -0.2827 0.0951  315 LEU A CB  
3723 C CG  . LEU E 315 ? 1.1448 1.2842 1.0740 -0.0350 -0.2617 0.0894  315 LEU A CG  
3724 C CD1 . LEU E 315 ? 1.1435 1.2476 1.0275 -0.0490 -0.2618 0.1008  315 LEU A CD1 
3725 C CD2 . LEU E 315 ? 1.1004 1.2425 1.0545 -0.0214 -0.2470 0.0809  315 LEU A CD2 
3726 N N   . GLN E 316 ? 1.3666 1.5771 1.4432 0.0046  -0.2961 0.0902  316 GLN A N   
3727 C CA  . GLN E 316 ? 1.3699 1.5910 1.4817 0.0137  -0.3120 0.0966  316 GLN A CA  
3728 C C   . GLN E 316 ? 1.4236 1.6164 1.5216 0.0146  -0.3128 0.1064  316 GLN A C   
3729 O O   . GLN E 316 ? 1.4195 1.5883 1.4869 0.0099  -0.2980 0.1057  316 GLN A O   
3730 C CB  . GLN E 316 ? 1.3510 1.6029 1.5141 0.0283  -0.3082 0.0850  316 GLN A CB  
3731 C CG  . GLN E 316 ? 1.4064 1.6546 1.5717 0.0342  -0.2866 0.0745  316 GLN A CG  
3732 C CD  . GLN E 316 ? 1.5170 1.7844 1.6888 0.0329  -0.2761 0.0607  316 GLN A CD  
3733 O OE1 . GLN E 316 ? 1.6098 1.9025 1.8034 0.0326  -0.2844 0.0557  316 GLN A OE1 
3734 N NE2 . GLN E 316 ? 1.5643 1.8199 1.7178 0.0317  -0.2582 0.0539  316 GLN A NE2 
3735 N N   . PRO E 317 ? 1.4036 1.5978 1.5214 0.0192  -0.3313 0.1159  317 PRO A N   
3736 C CA  . PRO E 317 ? 1.3523 1.5227 1.4647 0.0221  -0.3341 0.1241  317 PRO A CA  
3737 C C   . PRO E 317 ? 1.1935 1.3742 1.3392 0.0375  -0.3213 0.1150  317 PRO A C   
3738 O O   . PRO E 317 ? 1.1157 1.3261 1.3011 0.0477  -0.3192 0.1056  317 PRO A O   
3739 C CB  . PRO E 317 ? 1.3706 1.5454 1.5006 0.0235  -0.3604 0.1359  317 PRO A CB  
3740 C CG  . PRO E 317 ? 1.3780 1.5908 1.5466 0.0298  -0.3670 0.1286  317 PRO A CG  
3741 C CD  . PRO E 317 ? 1.4110 1.6293 1.5570 0.0212  -0.3522 0.1196  317 PRO A CD  
3742 N N   . CYS E 318 ? 1.1951 1.3515 1.3240 0.0378  -0.3124 0.1174  318 CYS A N   
3743 C CA  . CYS E 318 ? 1.1625 1.3269 1.3198 0.0510  -0.3002 0.1098  318 CYS A CA  
3744 C C   . CYS E 318 ? 1.2714 1.4525 1.4717 0.0633  -0.3162 0.1128  318 CYS A C   
3745 O O   . CYS E 318 ? 1.3166 1.4849 1.5122 0.0614  -0.3353 0.1246  318 CYS A O   
3746 C CB  . CYS E 318 ? 1.1526 1.2859 1.2793 0.0469  -0.2891 0.1128  318 CYS A CB  
3747 S SG  . CYS E 318 ? 2.1667 2.3018 2.3207 0.0609  -0.2781 0.1080  318 CYS A SG  
3748 N N   . PRO E 319 ? 1.2513 1.4605 1.4938 0.0753  -0.3091 0.1019  319 PRO A N   
3749 C CA  . PRO E 319 ? 1.2258 1.4491 1.5092 0.0870  -0.3235 0.1045  319 PRO A CA  
3750 C C   . PRO E 319 ? 1.2450 1.4447 1.5217 0.0916  -0.3225 0.1106  319 PRO A C   
3751 O O   . PRO E 319 ? 1.2516 1.4332 1.5019 0.0876  -0.3063 0.1086  319 PRO A O   
3752 C CB  . PRO E 319 ? 1.1553 1.4106 1.4799 0.0963  -0.3113 0.0898  319 PRO A CB  
3753 C CG  . PRO E 319 ? 1.1620 1.4100 1.4663 0.0928  -0.2886 0.0818  319 PRO A CG  
3754 C CD  . PRO E 319 ? 1.2490 1.4744 1.5040 0.0789  -0.2882 0.0878  319 PRO A CD  
3755 N N   . GLN E 320 ? 1.2359 1.4350 1.5353 0.0996  -0.3395 0.1177  320 GLN A N   
3756 C CA  . GLN E 320 ? 1.1765 1.3550 1.4732 0.1051  -0.3383 0.1221  320 GLN A CA  
3757 C C   . GLN E 320 ? 1.1145 1.3148 1.4574 0.1203  -0.3300 0.1129  320 GLN A C   
3758 O O   . GLN E 320 ? 1.0451 1.2661 1.4274 0.1295  -0.3413 0.1116  320 GLN A O   
3759 C CB  . GLN E 320 ? 1.2012 1.3593 1.4893 0.1037  -0.3634 0.1369  320 GLN A CB  
3760 C CG  . GLN E 320 ? 1.2387 1.3658 1.5069 0.1044  -0.3628 0.1431  320 GLN A CG  
3761 C CD  . GLN E 320 ? 1.3155 1.4085 1.5450 0.0926  -0.3823 0.1582  320 GLN A CD  
3762 O OE1 . GLN E 320 ? 1.4213 1.5162 1.6506 0.0879  -0.4024 0.1662  320 GLN A OE1 
3763 N NE2 . GLN E 320 ? 1.3284 1.3893 1.5238 0.0865  -0.3766 0.1620  320 GLN A NE2 
3764 N N   . VAL E 321 ? 1.1698 1.3675 1.5088 0.1221  -0.3085 0.1053  321 VAL A N   
3765 C CA  . VAL E 321 ? 1.2627 1.4700 1.6350 0.1344  -0.2996 0.0993  321 VAL A CA  
3766 C C   . VAL E 321 ? 1.3604 1.5416 1.7231 0.1383  -0.3075 0.1088  321 VAL A C   
3767 O O   . VAL E 321 ? 1.4086 1.5614 1.7319 0.1293  -0.3142 0.1182  321 VAL A O   
3768 C CB  . VAL E 321 ? 1.2523 1.4666 1.6235 0.1337  -0.2746 0.0883  321 VAL A CB  
3769 C CG1 . VAL E 321 ? 1.2766 1.4627 1.6008 0.1239  -0.2647 0.0923  321 VAL A CG1 
3770 C CG2 . VAL E 321 ? 1.2393 1.4609 1.6421 0.1448  -0.2661 0.0836  321 VAL A CG2 
3771 N N   . HIS E 322 ? 1.4211 1.6107 1.8190 0.1508  -0.3083 0.1066  322 HIS A N   
3772 C CA  . HIS E 322 ? 1.5734 1.7370 1.9594 0.1545  -0.3097 0.1132  322 HIS A CA  
3773 C C   . HIS E 322 ? 1.6264 1.7845 2.0043 0.1549  -0.2857 0.1066  322 HIS A C   
3774 O O   . HIS E 322 ? 1.6962 1.8303 2.0561 0.1554  -0.2852 0.1120  322 HIS A O   
3775 C CB  . HIS E 322 ? 1.6497 1.8184 2.0733 0.1679  -0.3256 0.1165  322 HIS A CB  
3776 C CG  . HIS E 322 ? 1.6640 1.8635 2.1371 0.1790  -0.3143 0.1046  322 HIS A CG  
3777 N ND1 . HIS E 322 ? 1.6508 1.8796 2.1432 0.1770  -0.3023 0.0930  322 HIS A ND1 
3778 C CD2 . HIS E 322 ? 1.6682 1.8719 2.1739 0.1911  -0.3133 0.1022  322 HIS A CD2 
3779 C CE1 . HIS E 322 ? 1.6278 1.8775 2.1622 0.1864  -0.2940 0.0837  322 HIS A CE1 
3780 N NE2 . HIS E 322 ? 1.6403 1.8756 2.1842 0.1953  -0.2999 0.0890  322 HIS A NE2 
3781 N N   . VAL E 323 ? 1.5959 1.7750 1.9850 0.1537  -0.2667 0.0954  323 VAL A N   
3782 C CA  . VAL E 323 ? 1.5549 1.7339 1.9455 0.1555  -0.2452 0.0889  323 VAL A CA  
3783 C C   . VAL E 323 ? 1.5181 1.6835 1.8697 0.1447  -0.2300 0.0876  323 VAL A C   
3784 O O   . VAL E 323 ? 1.5605 1.7335 1.9013 0.1379  -0.2267 0.0842  323 VAL A O   
3785 C CB  . VAL E 323 ? 1.2369 1.4474 1.6690 0.1613  -0.2333 0.0767  323 VAL A CB  
3786 C CG1 . VAL E 323 ? 1.2279 1.4382 1.6558 0.1596  -0.2103 0.0703  323 VAL A CG1 
3787 C CG2 . VAL E 323 ? 1.2294 1.4521 1.7030 0.1729  -0.2441 0.0764  323 VAL A CG2 
3788 N N   . HIS E 324 ? 1.3945 1.5402 1.7250 0.1430  -0.2203 0.0898  324 HIS A N   
3789 C CA  . HIS E 324 ? 1.2489 1.3825 1.5443 0.1328  -0.2058 0.0880  324 HIS A CA  
3790 C C   . HIS E 324 ? 1.1143 1.2581 1.4182 0.1339  -0.1833 0.0795  324 HIS A C   
3791 O O   . HIS E 324 ? 1.1085 1.2437 1.4123 0.1367  -0.1765 0.0806  324 HIS A O   
3792 C CB  . HIS E 324 ? 1.2869 1.3867 1.5412 0.1254  -0.2122 0.0970  324 HIS A CB  
3793 C CG  . HIS E 324 ? 1.3282 1.4147 1.5675 0.1211  -0.2342 0.1061  324 HIS A CG  
3794 N ND1 . HIS E 324 ? 1.3850 1.4415 1.5805 0.1093  -0.2397 0.1131  324 HIS A ND1 
3795 C CD2 . HIS E 324 ? 1.3418 1.4407 1.6038 0.1259  -0.2523 0.1092  324 HIS A CD2 
3796 C CE1 . HIS E 324 ? 1.4186 1.4684 1.6093 0.1066  -0.2608 0.1211  324 HIS A CE1 
3797 N NE2 . HIS E 324 ? 1.3921 1.4684 1.6237 0.1171  -0.2690 0.1190  324 HIS A NE2 
3798 N N   . LEU E 325 ? 1.0431 1.2049 1.3542 0.1312  -0.1726 0.0715  325 LEU A N   
3799 C CA  . LEU E 325 ? 1.0466 1.2164 1.3612 0.1300  -0.1521 0.0641  325 LEU A CA  
3800 C C   . LEU E 325 ? 1.1583 1.3104 1.4364 0.1215  -0.1416 0.0647  325 LEU A C   
3801 O O   . LEU E 325 ? 1.2036 1.3545 1.4783 0.1204  -0.1263 0.0616  325 LEU A O   
3802 C CB  . LEU E 325 ? 0.9539 1.1496 1.2934 0.1306  -0.1460 0.0549  325 LEU A CB  
3803 C CG  . LEU E 325 ? 0.8840 1.0997 1.2639 0.1380  -0.1481 0.0507  325 LEU A CG  
3804 C CD1 . LEU E 325 ? 0.8807 1.0955 1.2726 0.1435  -0.1675 0.0563  325 LEU A CD1 
3805 C CD2 . LEU E 325 ? 0.8716 1.1102 1.2704 0.1357  -0.1422 0.0409  325 LEU A CD2 
3806 N N   . PHE E 326 ? 1.1657 1.3051 1.4171 0.1147  -0.1492 0.0682  326 PHE A N   
3807 C CA  . PHE E 326 ? 1.1881 1.3081 1.4032 0.1056  -0.1401 0.0687  326 PHE A CA  
3808 C C   . PHE E 326 ? 1.2105 1.3027 1.3982 0.1014  -0.1478 0.0770  326 PHE A C   
3809 O O   . PHE E 326 ? 1.1930 1.2783 1.3839 0.1041  -0.1653 0.0841  326 PHE A O   
3810 C CB  . PHE E 326 ? 1.1811 1.3004 1.3790 0.0985  -0.1413 0.0669  326 PHE A CB  
3811 C CG  . PHE E 326 ? 1.1256 1.2659 1.3397 0.0999  -0.1293 0.0576  326 PHE A CG  
3812 C CD1 . PHE E 326 ? 1.0966 1.2376 1.3057 0.0981  -0.1113 0.0517  326 PHE A CD1 
3813 C CD2 . PHE E 326 ? 1.0701 1.2289 1.3038 0.1025  -0.1368 0.0548  326 PHE A CD2 
3814 C CE1 . PHE E 326 ? 1.0482 1.2065 1.2717 0.0992  -0.1021 0.0437  326 PHE A CE1 
3815 C CE2 . PHE E 326 ? 1.0055 1.1809 1.2512 0.1026  -0.1269 0.0462  326 PHE A CE2 
3816 C CZ  . PHE E 326 ? 0.9923 1.1667 1.2328 0.1012  -0.1101 0.0410  326 PHE A CZ  
3817 N N   . PRO E 327 ? 1.3019 1.3778 1.4624 0.0943  -0.1352 0.0758  327 PRO A N   
3818 C CA  . PRO E 327 ? 1.4022 1.4490 1.5308 0.0876  -0.1400 0.0822  327 PRO A CA  
3819 C C   . PRO E 327 ? 1.4852 1.5121 1.5895 0.0803  -0.1584 0.0901  327 PRO A C   
3820 O O   . PRO E 327 ? 1.5059 1.5354 1.6023 0.0753  -0.1600 0.0888  327 PRO A O   
3821 C CB  . PRO E 327 ? 1.3828 1.4212 1.4867 0.0787  -0.1207 0.0763  327 PRO A CB  
3822 C CG  . PRO E 327 ? 1.3044 1.3693 1.4364 0.0850  -0.1055 0.0680  327 PRO A CG  
3823 C CD  . PRO E 327 ? 1.2738 1.3591 1.4332 0.0918  -0.1151 0.0673  327 PRO A CD  
3824 N N   . THR E 328 ? 1.4930 1.4990 1.5846 0.0793  -0.1728 0.0984  328 THR A N   
3825 C CA  . THR E 328 ? 1.5593 1.5420 1.6232 0.0701  -0.1912 0.1069  328 THR A CA  
3826 C C   . THR E 328 ? 1.5879 1.5380 1.6042 0.0546  -0.1856 0.1082  328 THR A C   
3827 O O   . THR E 328 ? 1.5787 1.5043 1.5637 0.0430  -0.1984 0.1148  328 THR A O   
3828 C CB  . THR E 328 ? 1.6060 1.5842 1.6853 0.0778  -0.2141 0.1161  328 THR A CB  
3829 O OG1 . THR E 328 ? 1.6222 1.6320 1.7491 0.0927  -0.2145 0.1124  328 THR A OG1 
3830 C CG2 . THR E 328 ? 1.6347 1.5977 1.6954 0.0698  -0.2351 0.1249  328 THR A CG2 
3831 N N   . ASP E 329 ? 1.6884 1.6384 1.6988 0.0533  -0.1661 0.1014  329 ASP A N   
3832 C CA  . ASP E 329 ? 1.8551 1.7768 1.8219 0.0381  -0.1575 0.1003  329 ASP A CA  
3833 C C   . ASP E 329 ? 1.9221 1.8522 1.8813 0.0318  -0.1357 0.0902  329 ASP A C   
3834 O O   . ASP E 329 ? 2.0557 2.0073 2.0369 0.0390  -0.1188 0.0824  329 ASP A O   
3835 C CB  . ASP E 329 ? 1.9427 1.8532 1.9028 0.0393  -0.1529 0.1006  329 ASP A CB  
3836 C CG  . ASP E 329 ? 1.9749 1.9130 1.9667 0.0503  -0.1342 0.0929  329 ASP A CG  
3837 O OD1 . ASP E 329 ? 1.9459 1.9100 1.9623 0.0558  -0.1237 0.0864  329 ASP A OD1 
3838 O OD2 . ASP E 329 ? 2.0342 1.9662 2.0243 0.0525  -0.1305 0.0935  329 ASP A OD2 
3839 N N   . LEU E 330 ? 1.8852 1.7969 1.8122 0.0178  -0.1360 0.0903  330 LEU A N   
3840 C CA  . LEU E 330 ? 1.8538 1.7744 1.7770 0.0131  -0.1168 0.0806  330 LEU A CA  
3841 C C   . LEU E 330 ? 1.9415 1.8351 1.8230 -0.0050 -0.1177 0.0815  330 LEU A C   
3842 O O   . LEU E 330 ? 1.9888 1.8616 1.8497 -0.0128 -0.1366 0.0908  330 LEU A O   
3843 C CB  . LEU E 330 ? 1.7630 1.7160 1.7241 0.0259  -0.1156 0.0774  330 LEU A CB  
3844 C CG  . LEU E 330 ? 1.6848 1.6680 1.6871 0.0412  -0.1063 0.0722  330 LEU A CG  
3845 C CD1 . LEU E 330 ? 1.6426 1.6528 1.6775 0.0513  -0.1102 0.0704  330 LEU A CD1 
3846 C CD2 . LEU E 330 ? 1.6738 1.6614 1.6730 0.0388  -0.0832 0.0627  330 LEU A CD2 
3847 N N   . PRO E 331 ? 1.9679 1.8608 1.8367 -0.0125 -0.0970 0.0717  331 PRO A N   
3848 C CA  . PRO E 331 ? 2.0219 1.8897 1.8515 -0.0306 -0.0945 0.0709  331 PRO A CA  
3849 C C   . PRO E 331 ? 2.0444 1.9129 1.8755 -0.0305 -0.1123 0.0788  331 PRO A C   
3850 O O   . PRO E 331 ? 2.0253 1.9215 1.8913 -0.0161 -0.1158 0.0787  331 PRO A O   
3851 C CB  . PRO E 331 ? 2.0174 1.8990 1.8538 -0.0304 -0.0696 0.0579  331 PRO A CB  
3852 C CG  . PRO E 331 ? 1.9859 1.8876 1.8494 -0.0187 -0.0579 0.0524  331 PRO A CG  
3853 C CD  . PRO E 331 ? 1.9478 1.8639 1.8398 -0.0044 -0.0751 0.0608  331 PRO A CD  
3854 N N   . PRO E 332 ? 2.0877 1.9254 1.8801 -0.0474 -0.1238 0.0857  332 PRO A N   
3855 C CA  . PRO E 332 ? 2.1028 1.9377 1.8919 -0.0499 -0.1430 0.0949  332 PRO A CA  
3856 C C   . PRO E 332 ? 2.0798 1.9355 1.8835 -0.0453 -0.1334 0.0891  332 PRO A C   
3857 O O   . PRO E 332 ? 2.0926 1.9636 1.9150 -0.0380 -0.1472 0.0944  332 PRO A O   
3858 C CB  . PRO E 332 ? 2.1700 1.9637 1.9066 -0.0738 -0.1491 0.1002  332 PRO A CB  
3859 C CG  . PRO E 332 ? 2.2256 2.0007 1.9438 -0.0803 -0.1423 0.0974  332 PRO A CG  
3860 C CD  . PRO E 332 ? 2.1379 1.9401 1.8853 -0.0672 -0.1192 0.0850  332 PRO A CD  
3861 N N   . ASP E 333 ? 2.0300 1.8862 1.8258 -0.0496 -0.1100 0.0777  333 ASP A N   
3862 C CA  . ASP E 333 ? 1.9514 1.8228 1.7563 -0.0466 -0.0995 0.0713  333 ASP A CA  
3863 C C   . ASP E 333 ? 1.8383 1.7460 1.6894 -0.0264 -0.1042 0.0705  333 ASP A C   
3864 O O   . ASP E 333 ? 1.8349 1.7516 1.6922 -0.0243 -0.1143 0.0741  333 ASP A O   
3865 C CB  . ASP E 333 ? 1.9524 1.8219 1.7496 -0.0509 -0.0726 0.0581  333 ASP A CB  
3866 C CG  . ASP E 333 ? 2.0011 1.8469 1.7716 -0.0633 -0.0641 0.0554  333 ASP A CG  
3867 O OD1 . ASP E 333 ? 2.0005 1.8414 1.7606 -0.0697 -0.0423 0.0444  333 ASP A OD1 
3868 O OD2 . ASP E 333 ? 2.0473 1.8790 1.8071 -0.0669 -0.0792 0.0639  333 ASP A OD2 
3869 N N   . ILE E 334 ? 1.7393 1.6669 1.6210 -0.0130 -0.0966 0.0656  334 ILE A N   
3870 C CA  . ILE E 334 ? 1.6140 1.5754 1.5394 0.0048  -0.0973 0.0627  334 ILE A CA  
3871 C C   . ILE E 334 ? 1.6568 1.6293 1.6047 0.0138  -0.1189 0.0718  334 ILE A C   
3872 O O   . ILE E 334 ? 1.7030 1.7009 1.6824 0.0252  -0.1237 0.0707  334 ILE A O   
3873 C CB  . ILE E 334 ? 1.4476 1.4251 1.3961 0.0140  -0.0798 0.0540  334 ILE A CB  
3874 C CG1 . ILE E 334 ? 1.4105 1.3659 1.3319 0.0033  -0.0678 0.0510  334 ILE A CG1 
3875 C CG2 . ILE E 334 ? 1.3978 1.3939 1.3631 0.0199  -0.0653 0.0443  334 ILE A CG2 
3876 C CD1 . ILE E 334 ? 1.4010 1.3417 1.2956 -0.0089 -0.0508 0.0431  334 ILE A CD1 
3877 N N   . GLN E 335 ? 1.6368 1.5898 1.5688 0.0084  -0.1318 0.0802  335 GLN A N   
3878 C CA  . GLN E 335 ? 1.5781 1.5401 1.5330 0.0178  -0.1521 0.0885  335 GLN A CA  
3879 C C   . GLN E 335 ? 1.5667 1.5448 1.5378 0.0219  -0.1661 0.0920  335 GLN A C   
3880 O O   . GLN E 335 ? 1.5491 1.5541 1.5574 0.0352  -0.1693 0.0900  335 GLN A O   
3881 C CB  . GLN E 335 ? 1.5720 1.5052 1.5008 0.0090  -0.1669 0.0983  335 GLN A CB  
3882 C CG  . GLN E 335 ? 1.5339 1.4779 1.4921 0.0218  -0.1837 0.1047  335 GLN A CG  
3883 C CD  . GLN E 335 ? 1.5003 1.4634 1.4883 0.0348  -0.1708 0.0981  335 GLN A CD  
3884 O OE1 . GLN E 335 ? 1.5605 1.5091 1.5361 0.0324  -0.1658 0.0982  335 GLN A OE1 
3885 N NE2 . GLN E 335 ? 1.4197 1.4142 1.4451 0.0472  -0.1651 0.0923  335 GLN A NE2 
3886 N N   . ALA E 336 ? 1.5693 1.5301 1.5107 0.0091  -0.1741 0.0972  336 ALA A N   
3887 C CA  . ALA E 336 ? 1.5424 1.5160 1.4939 0.0105  -0.1887 0.1015  336 ALA A CA  
3888 C C   . ALA E 336 ? 1.4590 1.4656 1.4442 0.0225  -0.1797 0.0924  336 ALA A C   
3889 O O   . ALA E 336 ? 1.4564 1.4847 1.4702 0.0311  -0.1921 0.0941  336 ALA A O   
3890 C CB  . ALA E 336 ? 1.5954 1.5448 1.5052 -0.0072 -0.1919 0.1059  336 ALA A CB  
3891 N N   . VAL E 337 ? 1.3753 1.3849 1.3569 0.0222  -0.1586 0.0824  337 VAL A N   
3892 C CA  . VAL E 337 ? 1.2587 1.2964 1.2715 0.0335  -0.1482 0.0730  337 VAL A CA  
3893 C C   . VAL E 337 ? 1.2372 1.2970 1.2903 0.0476  -0.1524 0.0723  337 VAL A C   
3894 O O   . VAL E 337 ? 1.2287 1.3104 1.3094 0.0551  -0.1612 0.0717  337 VAL A O   
3895 C CB  . VAL E 337 ? 1.1609 1.1962 1.1669 0.0326  -0.1250 0.0631  337 VAL A CB  
3896 C CG1 . VAL E 337 ? 1.0606 1.1237 1.0997 0.0439  -0.1165 0.0543  337 VAL A CG1 
3897 C CG2 . VAL E 337 ? 1.1769 1.1905 1.1449 0.0190  -0.1171 0.0617  337 VAL A CG2 
3898 N N   . PHE E 338 ? 1.2224 1.2763 1.2782 0.0505  -0.1448 0.0715  338 PHE A N   
3899 C CA  . PHE E 338 ? 1.1935 1.2674 1.2863 0.0632  -0.1457 0.0700  338 PHE A CA  
3900 C C   . PHE E 338 ? 1.2741 1.3551 1.3861 0.0688  -0.1663 0.0773  338 PHE A C   
3901 O O   . PHE E 338 ? 1.2855 1.3883 1.4329 0.0794  -0.1679 0.0746  338 PHE A O   
3902 C CB  . PHE E 338 ? 1.1409 1.2051 1.2297 0.0640  -0.1345 0.0688  338 PHE A CB  
3903 C CG  . PHE E 338 ? 1.0744 1.1391 1.1557 0.0615  -0.1133 0.0601  338 PHE A CG  
3904 C CD1 . PHE E 338 ? 0.9952 1.0823 1.1055 0.0702  -0.1018 0.0526  338 PHE A CD1 
3905 C CD2 . PHE E 338 ? 1.0930 1.1352 1.1388 0.0498  -0.1050 0.0591  338 PHE A CD2 
3906 C CE1 . PHE E 338 ? 0.9757 1.0638 1.0815 0.0684  -0.0835 0.0449  338 PHE A CE1 
3907 C CE2 . PHE E 338 ? 1.0657 1.1097 1.1080 0.0484  -0.0852 0.0503  338 PHE A CE2 
3908 C CZ  . PHE E 338 ? 1.0085 1.0759 1.0816 0.0583  -0.0751 0.0435  338 PHE A CZ  
3909 N N   . ASP E 339 ? 1.3389 1.4015 1.4284 0.0612  -0.1822 0.0865  339 ASP A N   
3910 C CA  . ASP E 339 ? 1.3999 1.4697 1.5087 0.0665  -0.2034 0.0937  339 ASP A CA  
3911 C C   . ASP E 339 ? 1.4007 1.4951 1.5297 0.0694  -0.2075 0.0898  339 ASP A C   
3912 O O   . ASP E 339 ? 1.4179 1.5344 1.5825 0.0792  -0.2155 0.0886  339 ASP A O   
3913 C CB  . ASP E 339 ? 1.5152 1.5572 1.5926 0.0561  -0.2206 0.1053  339 ASP A CB  
3914 C CG  . ASP E 339 ? 1.6330 1.6840 1.7325 0.0619  -0.2440 0.1130  339 ASP A CG  
3915 O OD1 . ASP E 339 ? 1.6753 1.7416 1.8095 0.0746  -0.2473 0.1119  339 ASP A OD1 
3916 O OD2 . ASP E 339 ? 1.7499 1.7935 1.8336 0.0537  -0.2586 0.1200  339 ASP A OD2 
3917 N N   . LEU E 340 ? 1.3807 1.4709 1.4865 0.0605  -0.2013 0.0871  340 LEU A N   
3918 C CA  . LEU E 340 ? 1.3315 1.4440 1.4522 0.0620  -0.2028 0.0819  340 LEU A CA  
3919 C C   . LEU E 340 ? 1.2514 1.3912 1.4097 0.0731  -0.1921 0.0716  340 LEU A C   
3920 O O   . LEU E 340 ? 1.2618 1.4238 1.4511 0.0797  -0.2006 0.0696  340 LEU A O   
3921 C CB  . LEU E 340 ? 1.0553 1.1560 1.1417 0.0503  -0.1955 0.0800  340 LEU A CB  
3922 C CG  . LEU E 340 ? 1.0510 1.1723 1.1478 0.0505  -0.1972 0.0745  340 LEU A CG  
3923 C CD1 . LEU E 340 ? 1.0943 1.2274 1.2054 0.0512  -0.2184 0.0809  340 LEU A CD1 
3924 C CD2 . LEU E 340 ? 1.0280 1.1359 1.0897 0.0394  -0.1886 0.0722  340 LEU A CD2 
3925 N N   . LEU E 341 ? 1.1831 1.3210 1.3383 0.0741  -0.1735 0.0647  341 LEU A N   
3926 C CA  . LEU E 341 ? 1.0787 1.2383 1.2660 0.0828  -0.1624 0.0557  341 LEU A CA  
3927 C C   . LEU E 341 ? 1.1006 1.2737 1.3221 0.0924  -0.1693 0.0571  341 LEU A C   
3928 O O   . LEU E 341 ? 1.1184 1.3142 1.3711 0.0982  -0.1679 0.0507  341 LEU A O   
3929 C CB  . LEU E 341 ? 0.9651 1.1161 1.1422 0.0822  -0.1434 0.0510  341 LEU A CB  
3930 C CG  . LEU E 341 ? 0.8209 0.9682 0.9798 0.0768  -0.1305 0.0445  341 LEU A CG  
3931 C CD1 . LEU E 341 ? 0.8385 0.9645 0.9600 0.0663  -0.1347 0.0494  341 LEU A CD1 
3932 C CD2 . LEU E 341 ? 0.7444 0.8882 0.9028 0.0784  -0.1123 0.0392  341 LEU A CD2 
3933 N N   . ASN E 342 ? 1.0679 1.2254 1.2824 0.0934  -0.1763 0.0650  342 ASN A N   
3934 C CA  . ASN E 342 ? 0.9611 1.1285 1.2061 0.1025  -0.1853 0.0674  342 ASN A CA  
3935 C C   . ASN E 342 ? 0.9117 1.0974 1.1787 0.1050  -0.2007 0.0677  342 ASN A C   
3936 O O   . ASN E 342 ? 0.9003 1.1084 1.2021 0.1120  -0.1998 0.0616  342 ASN A O   
3937 C CB  . ASN E 342 ? 0.9478 1.0915 1.1765 0.1019  -0.1937 0.0771  342 ASN A CB  
3938 C CG  . ASN E 342 ? 0.9267 1.0786 1.1868 0.1123  -0.2017 0.0792  342 ASN A CG  
3939 O OD1 . ASN E 342 ? 0.8982 1.0652 1.1844 0.1191  -0.1909 0.0728  342 ASN A OD1 
3940 N ND2 . ASN E 342 ? 0.9570 1.0985 1.2152 0.1133  -0.2210 0.0884  342 ASN A ND2 
3941 N N   . SER E 343 ? 0.8596 1.0360 1.1057 0.0982  -0.2140 0.0741  343 SER A N   
3942 C CA  . SER E 343 ? 0.8180 1.0119 1.0840 0.0998  -0.2301 0.0751  343 SER A CA  
3943 C C   . SER E 343 ? 0.8037 1.0250 1.0931 0.1015  -0.2226 0.0637  343 SER A C   
3944 O O   . SER E 343 ? 0.8260 1.0695 1.1516 0.1082  -0.2278 0.0594  343 SER A O   
3945 C CB  . SER E 343 ? 0.8170 0.9954 1.0510 0.0895  -0.2435 0.0838  343 SER A CB  
3946 O OG  . SER E 343 ? 0.7883 0.9856 1.0425 0.0909  -0.2590 0.0846  343 SER A OG  
3947 N N   . VAL E 344 ? 0.8149 1.0337 1.0835 0.0948  -0.2103 0.0582  344 VAL A N   
3948 C CA  . VAL E 344 ? 0.8231 1.0640 1.1082 0.0945  -0.2037 0.0473  344 VAL A CA  
3949 C C   . VAL E 344 ? 0.8942 1.1515 1.2144 0.1026  -0.1941 0.0395  344 VAL A C   
3950 O O   . VAL E 344 ? 0.8851 1.1647 1.2364 0.1058  -0.1977 0.0333  344 VAL A O   
3951 C CB  . VAL E 344 ? 0.8342 1.0654 1.0894 0.0869  -0.1912 0.0430  344 VAL A CB  
3952 C CG1 . VAL E 344 ? 0.8472 1.0984 1.1143 0.0848  -0.1877 0.0326  344 VAL A CG1 
3953 C CG2 . VAL E 344 ? 0.8412 1.0512 1.0577 0.0778  -0.1981 0.0513  344 VAL A CG2 
3954 N N   . LEU E 345 ? 0.9900 1.2356 1.3044 0.1048  -0.1815 0.0398  345 LEU A N   
3955 C CA  . LEU E 345 ? 1.0511 1.3086 1.3938 0.1107  -0.1707 0.0334  345 LEU A CA  
3956 C C   . LEU E 345 ? 0.9894 1.2609 1.3669 0.1182  -0.1801 0.0337  345 LEU A C   
3957 O O   . LEU E 345 ? 0.9628 1.2550 1.3693 0.1198  -0.1775 0.0253  345 LEU A O   
3958 C CB  . LEU E 345 ? 1.2094 1.4491 1.5382 0.1121  -0.1599 0.0371  345 LEU A CB  
3959 C CG  . LEU E 345 ? 1.2891 1.5385 1.6406 0.1160  -0.1462 0.0308  345 LEU A CG  
3960 C CD1 . LEU E 345 ? 1.3093 1.5656 1.6568 0.1111  -0.1343 0.0224  345 LEU A CD1 
3961 C CD2 . LEU E 345 ? 1.3616 1.5942 1.7025 0.1183  -0.1393 0.0363  345 LEU A CD2 
3962 N N   . VAL E 346 ? 0.9501 1.2093 1.3244 0.1220  -0.1912 0.0433  346 VAL A N   
3963 C CA  . VAL E 346 ? 0.9572 1.2271 1.3646 0.1303  -0.2009 0.0444  346 VAL A CA  
3964 C C   . VAL E 346 ? 0.8882 1.1804 1.3184 0.1304  -0.2124 0.0401  346 VAL A C   
3965 O O   . VAL E 346 ? 0.8920 1.2023 1.3590 0.1366  -0.2146 0.0351  346 VAL A O   
3966 C CB  . VAL E 346 ? 1.1053 1.3542 1.5006 0.1337  -0.2135 0.0565  346 VAL A CB  
3967 C CG1 . VAL E 346 ? 1.1145 1.3756 1.5458 0.1429  -0.2269 0.0578  346 VAL A CG1 
3968 C CG2 . VAL E 346 ? 1.1620 1.3917 1.5411 0.1345  -0.2014 0.0592  346 VAL A CG2 
3969 N N   . THR E 347 ? 0.8468 1.1381 1.2553 0.1229  -0.2189 0.0415  347 THR A N   
3970 C CA  . THR E 347 ? 0.8389 1.1515 1.2662 0.1217  -0.2302 0.0376  347 THR A CA  
3971 C C   . THR E 347 ? 0.7979 1.1338 1.2491 0.1202  -0.2188 0.0233  347 THR A C   
3972 O O   . THR E 347 ? 0.7463 1.1041 1.2324 0.1236  -0.2234 0.0170  347 THR A O   
3973 C CB  . THR E 347 ? 0.8539 1.1589 1.2485 0.1123  -0.2391 0.0425  347 THR A CB  
3974 O OG1 . THR E 347 ? 0.9113 1.1923 1.2809 0.1113  -0.2501 0.0558  347 THR A OG1 
3975 C CG2 . THR E 347 ? 0.8408 1.1695 1.2564 0.1110  -0.2515 0.0386  347 THR A CG2 
3976 N N   . SER E 348 ? 0.8612 1.1917 1.2934 0.1144  -0.2040 0.0180  348 SER A N   
3977 C CA  . SER E 348 ? 0.9029 1.2518 1.3503 0.1101  -0.1943 0.0048  348 SER A CA  
3978 C C   . SER E 348 ? 0.9149 1.2683 1.3849 0.1135  -0.1800 -0.0017 348 SER A C   
3979 O O   . SER E 348 ? 0.9252 1.2925 1.4088 0.1087  -0.1719 -0.0127 348 SER A O   
3980 C CB  . SER E 348 ? 0.9344 1.2754 1.3483 0.1007  -0.1883 0.0020  348 SER A CB  
3981 O OG  . SER E 348 ? 0.9722 1.3102 1.3648 0.0957  -0.2005 0.0068  348 SER A OG  
3982 N N   . LEU E 349 ? 0.8858 1.2263 1.3575 0.1202  -0.1770 0.0052  349 LEU A N   
3983 C CA  . LEU E 349 ? 0.8363 1.1781 1.3240 0.1223  -0.1626 0.0005  349 LEU A CA  
3984 C C   . LEU E 349 ? 0.7713 1.1345 1.2996 0.1242  -0.1611 -0.0088 349 LEU A C   
3985 O O   . LEU E 349 ? 0.7253 1.0952 1.2658 0.1203  -0.1483 -0.0172 349 LEU A O   
3986 C CB  . LEU E 349 ? 0.8406 1.1627 1.3178 0.1282  -0.1596 0.0101  349 LEU A CB  
3987 C CG  . LEU E 349 ? 0.8507 1.1676 1.3257 0.1264  -0.1421 0.0070  349 LEU A CG  
3988 C CD1 . LEU E 349 ? 0.8668 1.1831 1.3222 0.1183  -0.1340 0.0019  349 LEU A CD1 
3989 C CD2 . LEU E 349 ? 0.9010 1.1972 1.3585 0.1304  -0.1395 0.0165  349 LEU A CD2 
3990 N N   . PRO E 350 ? 0.7900 1.1634 1.3401 0.1298  -0.1742 -0.0073 350 PRO A N   
3991 C CA  . PRO E 350 ? 0.8119 1.2062 1.3990 0.1301  -0.1711 -0.0179 350 PRO A CA  
3992 C C   . PRO E 350 ? 0.8436 1.2506 1.4281 0.1181  -0.1623 -0.0305 350 PRO A C   
3993 O O   . PRO E 350 ? 0.8598 1.2700 1.4532 0.1125  -0.1480 -0.0389 350 PRO A O   
3994 C CB  . PRO E 350 ? 0.8140 1.2144 1.4108 0.1349  -0.1866 -0.0136 350 PRO A CB  
3995 C CG  . PRO E 350 ? 0.7910 1.1743 1.3724 0.1420  -0.2007 0.0006  350 PRO A CG  
3996 C CD  . PRO E 350 ? 0.7787 1.1431 1.3198 0.1354  -0.1912 0.0041  350 PRO A CD  
3997 N N   . LEU E 351 ? 0.8173 1.2295 1.3875 0.1133  -0.1714 -0.0316 351 LEU A N   
3998 C CA  . LEU E 351 ? 0.8369 1.2590 1.4017 0.1014  -0.1646 -0.0434 351 LEU A CA  
3999 C C   . LEU E 351 ? 0.8247 1.2392 1.3828 0.0963  -0.1494 -0.0480 351 LEU A C   
4000 O O   . LEU E 351 ? 0.8276 1.2459 1.3921 0.0880  -0.1375 -0.0572 351 LEU A O   
4001 C CB  . LEU E 351 ? 0.8614 1.2821 1.3983 0.0957  -0.1743 -0.0416 351 LEU A CB  
4002 C CG  . LEU E 351 ? 0.8341 1.2689 1.3688 0.0838  -0.1729 -0.0545 351 LEU A CG  
4003 C CD1 . LEU E 351 ? 0.9044 1.3562 1.4625 0.0809  -0.1733 -0.0615 351 LEU A CD1 
4004 C CD2 . LEU E 351 ? 0.7850 1.2115 1.2838 0.0787  -0.1810 -0.0497 351 LEU A CD2 
4005 N N   . LEU E 352 ? 0.8097 1.2039 1.3395 0.0982  -0.1456 -0.0390 352 LEU A N   
4006 C CA  . LEU E 352 ? 0.7620 1.1472 1.2810 0.0931  -0.1318 -0.0419 352 LEU A CA  
4007 C C   . LEU E 352 ? 0.8733 1.2650 1.4211 0.0932  -0.1213 -0.0472 352 LEU A C   
4008 O O   . LEU E 352 ? 0.8693 1.2621 1.4186 0.0847  -0.1112 -0.0546 352 LEU A O   
4009 C CB  . LEU E 352 ? 0.6333 0.9971 1.1235 0.0972  -0.1291 -0.0309 352 LEU A CB  
4010 C CG  . LEU E 352 ? 0.5411 0.8962 1.0222 0.0930  -0.1154 -0.0328 352 LEU A CG  
4011 C CD1 . LEU E 352 ? 0.5353 0.8932 1.0044 0.0829  -0.1135 -0.0413 352 LEU A CD1 
4012 C CD2 . LEU E 352 ? 0.5202 0.8562 0.9771 0.0979  -0.1124 -0.0226 352 LEU A CD2 
4013 N N   . TYR E 353 ? 0.9634 1.3564 1.5303 0.1017  -0.1237 -0.0428 353 TYR A N   
4014 C CA  . TYR E 353 ? 1.0575 1.4473 1.6377 0.1010  -0.1111 -0.0447 353 TYR A CA  
4015 C C   . TYR E 353 ? 1.0764 1.4756 1.6670 0.0909  -0.1044 -0.0562 353 TYR A C   
4016 O O   . TYR E 353 ? 1.0940 1.4897 1.6897 0.0846  -0.0915 -0.0610 353 TYR A O   
4017 C CB  . TYR E 353 ? 1.1539 1.5390 1.7457 0.1131  -0.1168 -0.0362 353 TYR A CB  
4018 C CG  . TYR E 353 ? 1.2236 1.6049 1.8297 0.1136  -0.1050 -0.0381 353 TYR A CG  
4019 C CD1 . TYR E 353 ? 1.2483 1.6190 1.8499 0.1128  -0.0934 -0.0354 353 TYR A CD1 
4020 C CD2 . TYR E 353 ? 1.2582 1.6465 1.8828 0.1147  -0.1054 -0.0428 353 TYR A CD2 
4021 C CE1 . TYR E 353 ? 1.2690 1.6353 1.8824 0.1126  -0.0827 -0.0371 353 TYR A CE1 
4022 C CE2 . TYR E 353 ? 1.2842 1.6682 1.9223 0.1151  -0.0945 -0.0451 353 TYR A CE2 
4023 C CZ  . TYR E 353 ? 1.2749 1.6474 1.9065 0.1138  -0.0833 -0.0421 353 TYR A CZ  
4024 O OH  . TYR E 353 ? 1.2553 1.6227 1.8991 0.1134  -0.0725 -0.0442 353 TYR A OH  
4025 N N   . ARG E 354 ? 1.0352 1.4460 1.6287 0.0889  -0.1136 -0.0604 354 ARG A N   
4026 C CA  . ARG E 354 ? 0.9932 1.4139 1.5970 0.0792  -0.1086 -0.0719 354 ARG A CA  
4027 C C   . ARG E 354 ? 0.9253 1.3458 1.5146 0.0646  -0.1023 -0.0811 354 ARG A C   
4028 O O   . ARG E 354 ? 0.9230 1.3457 1.5175 0.0539  -0.0938 -0.0912 354 ARG A O   
4029 C CB  . ARG E 354 ? 1.0241 1.4581 1.6365 0.0823  -0.1211 -0.0726 354 ARG A CB  
4030 C CG  . ARG E 354 ? 1.0940 1.5284 1.7236 0.0956  -0.1281 -0.0648 354 ARG A CG  
4031 C CD  . ARG E 354 ? 1.1342 1.5738 1.7870 0.0945  -0.1196 -0.0723 354 ARG A CD  
4032 N NE  . ARG E 354 ? 1.1513 1.5849 1.8190 0.1073  -0.1218 -0.0648 354 ARG A NE  
4033 C CZ  . ARG E 354 ? 1.1529 1.5823 1.8358 0.1081  -0.1107 -0.0685 354 ARG A CZ  
4034 N NH1 . ARG E 354 ? 1.1422 1.5723 1.8270 0.0961  -0.0967 -0.0794 354 ARG A NH1 
4035 N NH2 . ARG E 354 ? 1.1899 1.6127 1.8848 0.1201  -0.1141 -0.0613 354 ARG A NH2 
4036 N N   . VAL E 355 ? 0.8795 1.2960 1.4502 0.0642  -0.1071 -0.0779 355 VAL A N   
4037 C CA  . VAL E 355 ? 0.8083 1.2225 1.3629 0.0513  -0.1033 -0.0856 355 VAL A CA  
4038 C C   . VAL E 355 ? 0.8481 1.2499 1.3976 0.0485  -0.0922 -0.0838 355 VAL A C   
4039 O O   . VAL E 355 ? 0.9061 1.3039 1.4550 0.0369  -0.0827 -0.0910 355 VAL A O   
4040 C CB  . VAL E 355 ? 0.7136 1.1301 1.2505 0.0520  -0.1149 -0.0842 355 VAL A CB  
4041 C CG1 . VAL E 355 ? 0.7144 1.1262 1.2341 0.0393  -0.1110 -0.0921 355 VAL A CG1 
4042 C CG2 . VAL E 355 ? 0.6671 1.0962 1.2068 0.0526  -0.1263 -0.0860 355 VAL A CG2 
4043 N N   . PHE E 356 ? 0.8508 1.2457 1.3957 0.0584  -0.0937 -0.0741 356 PHE A N   
4044 C CA  . PHE E 356 ? 0.9118 1.2958 1.4520 0.0563  -0.0836 -0.0713 356 PHE A CA  
4045 C C   . PHE E 356 ? 0.9735 1.3517 1.5241 0.0663  -0.0784 -0.0626 356 PHE A C   
4046 O O   . PHE E 356 ? 1.0047 1.3769 1.5503 0.0748  -0.0797 -0.0542 356 PHE A O   
4047 C CB  . PHE E 356 ? 0.9658 1.3439 1.4875 0.0580  -0.0874 -0.0678 356 PHE A CB  
4048 C CG  . PHE E 356 ? 1.0172 1.3966 1.5215 0.0485  -0.0928 -0.0753 356 PHE A CG  
4049 C CD1 . PHE E 356 ? 1.0037 1.3833 1.5074 0.0348  -0.0881 -0.0849 356 PHE A CD1 
4050 C CD2 . PHE E 356 ? 1.0228 1.4006 1.5080 0.0521  -0.1027 -0.0722 356 PHE A CD2 
4051 C CE1 . PHE E 356 ? 0.9552 1.3335 1.4398 0.0257  -0.0937 -0.0916 356 PHE A CE1 
4052 C CE2 . PHE E 356 ? 0.9926 1.3698 1.4589 0.0430  -0.1074 -0.0789 356 PHE A CE2 
4053 C CZ  . PHE E 356 ? 0.9547 1.3319 1.4205 0.0302  -0.1030 -0.0887 356 PHE A CZ  
4054 N N   . PRO E 357 ? 1.0003 1.3793 1.5650 0.0646  -0.0719 -0.0652 357 PRO A N   
4055 C CA  . PRO E 357 ? 0.9864 1.3591 1.5606 0.0733  -0.0668 -0.0579 357 PRO A CA  
4056 C C   . PRO E 357 ? 0.9449 1.3072 1.5108 0.0703  -0.0568 -0.0538 357 PRO A C   
4057 O O   . PRO E 357 ? 0.9276 1.2833 1.4964 0.0778  -0.0530 -0.0462 357 PRO A O   
4058 C CB  . PRO E 357 ? 1.0160 1.3918 1.6059 0.0684  -0.0604 -0.0649 357 PRO A CB  
4059 C CG  . PRO E 357 ? 1.0063 1.3857 1.5909 0.0531  -0.0571 -0.0759 357 PRO A CG  
4060 C CD  . PRO E 357 ? 0.9953 1.3799 1.5670 0.0534  -0.0680 -0.0761 357 PRO A CD  
4061 N N   . THR E 358 ? 0.9116 1.2724 1.4668 0.0591  -0.0533 -0.0589 358 THR A N   
4062 C CA  . THR E 358 ? 0.8568 1.2087 1.4041 0.0540  -0.0442 -0.0559 358 THR A CA  
4063 C C   . THR E 358 ? 0.8468 1.1960 1.3840 0.0617  -0.0484 -0.0489 358 THR A C   
4064 O O   . THR E 358 ? 0.8420 1.1851 1.3724 0.0581  -0.0421 -0.0464 358 THR A O   
4065 C CB  . THR E 358 ? 0.8210 1.1707 1.3616 0.0376  -0.0398 -0.0645 358 THR A CB  
4066 O OG1 . THR E 358 ? 0.8213 1.1780 1.3567 0.0339  -0.0489 -0.0716 358 THR A OG1 
4067 C CG2 . THR E 358 ? 0.7788 1.1258 1.3280 0.0281  -0.0306 -0.0699 358 THR A CG2 
4068 N N   . HIS E 359 ? 0.8453 1.1970 1.3780 0.0714  -0.0588 -0.0455 359 HIS A N   
4069 C CA  . HIS E 359 ? 0.8968 1.2369 1.4034 0.0766  -0.0610 -0.0380 359 HIS A CA  
4070 C C   . HIS E 359 ? 0.9273 1.2568 1.4283 0.0832  -0.0544 -0.0284 359 HIS A C   
4071 O O   . HIS E 359 ? 0.9392 1.2688 1.4522 0.0886  -0.0533 -0.0250 359 HIS A O   
4072 C CB  . HIS E 359 ? 0.9435 1.2840 1.4389 0.0828  -0.0730 -0.0357 359 HIS A CB  
4073 C CG  . HIS E 359 ? 0.9897 1.3188 1.4567 0.0843  -0.0749 -0.0314 359 HIS A CG  
4074 N ND1 . HIS E 359 ? 1.0159 1.3325 1.4680 0.0902  -0.0710 -0.0228 359 HIS A ND1 
4075 C CD2 . HIS E 359 ? 0.9874 1.3154 1.4379 0.0800  -0.0796 -0.0351 359 HIS A CD2 
4076 C CE1 . HIS E 359 ? 1.0247 1.3334 1.4541 0.0896  -0.0726 -0.0219 359 HIS A CE1 
4077 N NE2 . HIS E 359 ? 1.0083 1.3231 1.4359 0.0839  -0.0779 -0.0289 359 HIS A NE2 
4078 N N   . ASP E 360 ? 0.9513 1.2715 1.4334 0.0830  -0.0503 -0.0245 360 ASP A N   
4079 C CA  . ASP E 360 ? 0.9642 1.2744 1.4379 0.0879  -0.0433 -0.0163 360 ASP A CA  
4080 C C   . ASP E 360 ? 1.0700 1.3742 1.5394 0.0973  -0.0481 -0.0093 360 ASP A C   
4081 O O   . ASP E 360 ? 1.1238 1.4228 1.5964 0.1002  -0.0426 -0.0044 360 ASP A O   
4082 C CB  . ASP E 360 ? 0.9298 1.2322 1.3833 0.0873  -0.0401 -0.0142 360 ASP A CB  
4083 C CG  . ASP E 360 ? 0.9268 1.2320 1.3858 0.0787  -0.0335 -0.0183 360 ASP A CG  
4084 O OD1 . ASP E 360 ? 0.8937 1.2064 1.3677 0.0712  -0.0337 -0.0244 360 ASP A OD1 
4085 O OD2 . ASP E 360 ? 0.9914 1.2909 1.4399 0.0788  -0.0283 -0.0157 360 ASP A OD2 
4086 N N   . ILE E 361 ? 1.0462 1.3496 1.5068 0.1011  -0.0591 -0.0086 361 ILE A N   
4087 C CA  . ILE E 361 ? 1.0362 1.3314 1.4894 0.1088  -0.0661 -0.0013 361 ILE A CA  
4088 C C   . ILE E 361 ? 1.0680 1.3663 1.5426 0.1131  -0.0667 0.0002  361 ILE A C   
4089 O O   . ILE E 361 ? 1.1190 1.4064 1.5864 0.1188  -0.0683 0.0074  361 ILE A O   
4090 C CB  . ILE E 361 ? 0.9944 1.2903 1.4379 0.1104  -0.0791 -0.0013 361 ILE A CB  
4091 C CG1 . ILE E 361 ? 0.9872 1.2679 1.4107 0.1158  -0.0854 0.0079  361 ILE A CG1 
4092 C CG2 . ILE E 361 ? 0.9661 1.2771 1.4340 0.1105  -0.0869 -0.0068 361 ILE A CG2 
4093 C CD1 . ILE E 361 ? 0.9889 1.2689 1.4021 0.1163  -0.0991 0.0094  361 ILE A CD1 
4094 N N   . PHE E 362 ? 1.0402 1.3521 1.5399 0.1098  -0.0651 -0.0072 362 PHE A N   
4095 C CA  . PHE E 362 ? 0.9940 1.3101 1.5174 0.1139  -0.0655 -0.0075 362 PHE A CA  
4096 C C   . PHE E 362 ? 1.0173 1.3268 1.5440 0.1126  -0.0526 -0.0047 362 PHE A C   
4097 O O   . PHE E 362 ? 0.9980 1.3072 1.5409 0.1165  -0.0511 -0.0039 362 PHE A O   
4098 C CB  . PHE E 362 ? 0.9771 1.3107 1.5266 0.1096  -0.0676 -0.0178 362 PHE A CB  
4099 C CG  . PHE E 362 ? 0.9682 1.3095 1.5152 0.1104  -0.0805 -0.0206 362 PHE A CG  
4100 C CD1 . PHE E 362 ? 0.9919 1.3313 1.5391 0.1190  -0.0933 -0.0150 362 PHE A CD1 
4101 C CD2 . PHE E 362 ? 0.9882 1.3375 1.5309 0.1018  -0.0807 -0.0283 362 PHE A CD2 
4102 C CE1 . PHE E 362 ? 0.9863 1.3329 1.5300 0.1188  -0.1054 -0.0167 362 PHE A CE1 
4103 C CE2 . PHE E 362 ? 0.9976 1.3534 1.5355 0.1018  -0.0923 -0.0306 362 PHE A CE2 
4104 C CZ  . PHE E 362 ? 0.9952 1.3503 1.5339 0.1101  -0.1044 -0.0246 362 PHE A CZ  
4105 N N   . LEU E 363 ? 1.0256 1.3297 1.5369 0.1072  -0.0433 -0.0033 363 LEU A N   
4106 C CA  . LEU E 363 ? 1.0447 1.3431 1.5571 0.1043  -0.0307 -0.0005 363 LEU A CA  
4107 C C   . LEU E 363 ? 1.1155 1.3987 1.6092 0.1105  -0.0299 0.0089  363 LEU A C   
4108 O O   . LEU E 363 ? 1.1121 1.3892 1.6043 0.1088  -0.0200 0.0123  363 LEU A O   
4109 C CB  . LEU E 363 ? 1.0056 1.3063 1.5128 0.0947  -0.0215 -0.0033 363 LEU A CB  
4110 C CG  . LEU E 363 ? 0.9288 1.2404 1.4559 0.0845  -0.0169 -0.0119 363 LEU A CG  
4111 C CD1 . LEU E 363 ? 0.9055 1.2279 1.4488 0.0855  -0.0260 -0.0192 363 LEU A CD1 
4112 C CD2 . LEU E 363 ? 0.8910 1.2036 1.4090 0.0759  -0.0134 -0.0144 363 LEU A CD2 
4113 N N   . ASP E 364 ? 1.2083 1.4841 1.6852 0.1164  -0.0401 0.0131  364 ASP A N   
4114 C CA  . ASP E 364 ? 1.3171 1.5763 1.7743 0.1212  -0.0408 0.0215  364 ASP A CA  
4115 C C   . ASP E 364 ? 1.3775 1.6329 1.8489 0.1271  -0.0442 0.0242  364 ASP A C   
4116 O O   . ASP E 364 ? 1.4191 1.6833 1.9112 0.1309  -0.0528 0.0209  364 ASP A O   
4117 C CB  . ASP E 364 ? 1.3629 1.6133 1.7975 0.1241  -0.0514 0.0252  364 ASP A CB  
4118 C CG  . ASP E 364 ? 1.3958 1.6283 1.8022 0.1240  -0.0477 0.0319  364 ASP A CG  
4119 O OD1 . ASP E 364 ? 1.3928 1.6237 1.7939 0.1200  -0.0349 0.0320  364 ASP A OD1 
4120 O OD2 . ASP E 364 ? 1.4372 1.6569 1.8260 0.1269  -0.0575 0.0369  364 ASP A OD2 
4121 N N   . PRO E 365 ? 1.3507 1.5932 1.8117 0.1279  -0.0375 0.0298  365 PRO A N   
4122 C CA  . PRO E 365 ? 1.3219 1.5592 1.7963 0.1347  -0.0426 0.0322  365 PRO A CA  
4123 C C   . PRO E 365 ? 1.2889 1.5211 1.7601 0.1422  -0.0603 0.0355  365 PRO A C   
4124 O O   . PRO E 365 ? 1.3043 1.5413 1.7979 0.1485  -0.0687 0.0343  365 PRO A O   
4125 C CB  . PRO E 365 ? 1.3882 1.6078 1.8419 0.1342  -0.0350 0.0390  365 PRO A CB  
4126 C CG  . PRO E 365 ? 1.3854 1.6058 1.8219 0.1260  -0.0231 0.0386  365 PRO A CG  
4127 C CD  . PRO E 365 ? 1.3619 1.5922 1.7970 0.1242  -0.0283 0.0345  365 PRO A CD  
4128 N N   . SER E 366 ? 1.2380 1.4598 1.6814 0.1412  -0.0659 0.0399  366 SER A N   
4129 C CA  . SER E 366 ? 1.2497 1.4618 1.6840 0.1466  -0.0831 0.0450  366 SER A CA  
4130 C C   . SER E 366 ? 1.2714 1.5002 1.7341 0.1508  -0.0942 0.0405  366 SER A C   
4131 O O   . SER E 366 ? 1.2862 1.5110 1.7576 0.1577  -0.1077 0.0441  366 SER A O   
4132 C CB  . SER E 366 ? 1.2489 1.4507 1.6508 0.1420  -0.0862 0.0480  366 SER A CB  
4133 O OG  . SER E 366 ? 1.3209 1.5121 1.7129 0.1455  -0.1036 0.0536  366 SER A OG  
4134 N N   . LEU E 367 ? 1.3128 1.5601 1.7897 0.1462  -0.0888 0.0324  367 LEU A N   
4135 C CA  . LEU E 367 ? 1.3775 1.6432 1.8833 0.1485  -0.0969 0.0261  367 LEU A CA  
4136 C C   . LEU E 367 ? 1.4210 1.6961 1.9603 0.1518  -0.0919 0.0213  367 LEU A C   
4137 O O   . LEU E 367 ? 1.4316 1.7224 1.9984 0.1541  -0.0980 0.0153  367 LEU A O   
4138 C CB  . LEU E 367 ? 1.3591 1.6397 1.8659 0.1411  -0.0934 0.0184  367 LEU A CB  
4139 C CG  . LEU E 367 ? 1.3554 1.6329 1.8393 0.1389  -0.1028 0.0205  367 LEU A CG  
4140 C CD1 . LEU E 367 ? 1.3502 1.6291 1.8408 0.1446  -0.1208 0.0238  367 LEU A CD1 
4141 C CD2 . LEU E 367 ? 1.3665 1.6250 1.8153 0.1366  -0.0988 0.0271  367 LEU A CD2 
4142 N N   . LYS E 368 ? 1.4458 1.7113 1.9825 0.1514  -0.0803 0.0236  368 LYS A N   
4143 C CA  . LYS E 368 ? 1.4296 1.7015 1.9956 0.1532  -0.0728 0.0190  368 LYS A CA  
4144 C C   . LYS E 368 ? 1.4953 1.7571 2.0718 0.1641  -0.0825 0.0242  368 LYS A C   
4145 O O   . LYS E 368 ? 1.5208 1.7882 2.1246 0.1670  -0.0776 0.0197  368 LYS A O   
4146 C CB  . LYS E 368 ? 1.3739 1.6406 1.9326 0.1458  -0.0542 0.0186  368 LYS A CB  
4147 C CG  . LYS E 368 ? 1.3202 1.5994 1.8801 0.1346  -0.0432 0.0115  368 LYS A CG  
4148 C CD  . LYS E 368 ? 1.2786 1.5761 1.8713 0.1305  -0.0398 0.0006  368 LYS A CD  
4149 C CE  . LYS E 368 ? 1.2586 1.5616 1.8525 0.1174  -0.0246 -0.0050 368 LYS A CE  
4150 N NZ  . LYS E 368 ? 1.2696 1.5723 1.8407 0.1115  -0.0243 -0.0039 368 LYS A NZ  
4151 N N   . THR E 369 ? 1.5522 1.7980 2.1068 0.1695  -0.0962 0.0333  369 THR A N   
4152 C CA  . THR E 369 ? 1.6250 1.8576 2.1860 0.1797  -0.1073 0.0394  369 THR A CA  
4153 C C   . THR E 369 ? 1.6697 1.9199 2.2718 0.1872  -0.1167 0.0335  369 THR A C   
4154 O O   . THR E 369 ? 1.6742 1.9452 2.2930 0.1840  -0.1183 0.0260  369 THR A O   
4155 C CB  . THR E 369 ? 1.1741 1.3847 1.7013 0.1821  -0.1225 0.0504  369 THR A CB  
4156 O OG1 . THR E 369 ? 1.3208 1.5332 1.8641 0.1905  -0.1426 0.0531  369 THR A OG1 
4157 C CG2 . THR E 369 ? 1.0988 1.3091 1.5975 0.1735  -0.1211 0.0511  369 THR A CG2 
4158 N N   . PRO E 370 ? 1.6939 1.9361 2.3130 0.1970  -0.1226 0.0362  370 PRO A N   
4159 C CA  . PRO E 370 ? 1.7115 1.9696 2.3663 0.2031  -0.1300 0.0297  370 PRO A CA  
4160 C C   . PRO E 370 ? 1.7308 1.9970 2.3828 0.2042  -0.1481 0.0313  370 PRO A C   
4161 O O   . PRO E 370 ? 1.7313 2.0152 2.3976 0.2010  -0.1477 0.0227  370 PRO A O   
4162 C CB  . PRO E 370 ? 1.7517 1.9917 2.4127 0.2141  -0.1372 0.0359  370 PRO A CB  
4163 C CG  . PRO E 370 ? 1.7641 1.9776 2.3873 0.2144  -0.1432 0.0484  370 PRO A CG  
4164 C CD  . PRO E 370 ? 1.7228 1.9381 2.3217 0.2018  -0.1247 0.0457  370 PRO A CD  
4165 N N   . GLN E 371 ? 1.7378 1.9886 2.3657 0.2064  -0.1629 0.0424  371 GLN A N   
4166 C CA  . GLN E 371 ? 1.7257 1.9822 2.3515 0.2074  -0.1820 0.0456  371 GLN A CA  
4167 C C   . GLN E 371 ? 1.6395 1.9131 2.2577 0.1973  -0.1757 0.0390  371 GLN A C   
4168 O O   . GLN E 371 ? 1.6494 1.9423 2.2836 0.1951  -0.1781 0.0318  371 GLN A O   
4169 C CB  . GLN E 371 ? 1.7898 2.0185 2.3796 0.2087  -0.1979 0.0593  371 GLN A CB  
4170 C CG  . GLN E 371 ? 1.8309 2.0380 2.3761 0.2002  -0.1869 0.0642  371 GLN A CG  
4171 C CD  . GLN E 371 ? 1.9261 2.1020 2.4406 0.2022  -0.2005 0.0765  371 GLN A CD  
4172 O OE1 . GLN E 371 ? 1.9655 2.1334 2.4950 0.2115  -0.2153 0.0813  371 GLN A OE1 
4173 N NE2 . GLN E 371 ? 1.9610 2.1183 2.4324 0.1931  -0.1959 0.0813  371 GLN A NE2 
4174 N N   . ASN E 372 ? 1.5507 1.8136 2.1343 0.1885  -0.1650 0.0410  372 ASN A N   
4175 C CA  . ASN E 372 ? 1.4396 1.7163 2.0147 0.1792  -0.1591 0.0348  372 ASN A CA  
4176 C C   . ASN E 372 ? 1.4024 1.7060 2.0138 0.1772  -0.1504 0.0217  372 ASN A C   
4177 O O   . ASN E 372 ? 1.4278 1.7479 2.0455 0.1731  -0.1548 0.0161  372 ASN A O   
4178 C CB  . ASN E 372 ? 1.3774 1.6410 1.9177 0.1709  -0.1451 0.0368  372 ASN A CB  
4179 C CG  . ASN E 372 ? 1.3540 1.5924 1.8555 0.1701  -0.1537 0.0479  372 ASN A CG  
4180 O OD1 . ASN E 372 ? 1.3754 1.6036 1.8742 0.1753  -0.1707 0.0552  372 ASN A OD1 
4181 N ND2 . ASN E 372 ? 1.3183 1.5462 1.7900 0.1628  -0.1421 0.0490  372 ASN A ND2 
4182 N N   . ILE E 373 ? 1.3300 1.6355 1.9596 0.1781  -0.1372 0.0167  373 ILE A N   
4183 C CA  . ILE E 373 ? 1.2583 1.5799 1.9037 0.1712  -0.1255 0.0040  373 ILE A CA  
4184 C C   . ILE E 373 ? 1.2927 1.6239 1.9535 0.1753  -0.1378 0.0017  373 ILE A C   
4185 O O   . ILE E 373 ? 1.3132 1.6607 1.9813 0.1685  -0.1354 -0.0074 373 ILE A O   
4186 C CB  . ILE E 373 ? 1.1732 1.4908 1.8292 0.1693  -0.1082 -0.0006 373 ILE A CB  
4187 C CG1 . ILE E 373 ? 1.0929 1.4249 1.7580 0.1575  -0.0941 -0.0138 373 ILE A CG1 
4188 C CG2 . ILE E 373 ? 1.2003 1.5104 1.8720 0.1794  -0.1137 0.0022  373 ILE A CG2 
4189 C CD1 . ILE E 373 ? 1.0746 1.4125 1.7242 0.1468  -0.0882 -0.0172 373 ILE A CD1 
4190 N N   . ALA E 374 ? 1.2916 1.6120 1.9565 0.1860  -0.1517 0.0102  374 ALA A N   
4191 C CA  . ALA E 374 ? 1.2805 1.6094 1.9606 0.1907  -0.1650 0.0094  374 ALA A CA  
4192 C C   . ALA E 374 ? 1.3074 1.6490 1.9799 0.1857  -0.1758 0.0089  374 ALA A C   
4193 O O   . ALA E 374 ? 1.3112 1.6702 1.9979 0.1822  -0.1756 0.0007  374 ALA A O   
4194 C CB  . ALA E 374 ? 1.2686 1.5800 1.9492 0.2025  -0.1809 0.0207  374 ALA A CB  
4195 N N   . PHE E 375 ? 1.3255 1.6579 1.9754 0.1850  -0.1852 0.0175  375 PHE A N   
4196 C CA  . PHE E 375 ? 1.3163 1.6580 1.9568 0.1805  -0.1972 0.0185  375 PHE A CA  
4197 C C   . PHE E 375 ? 1.3042 1.6613 1.9404 0.1694  -0.1848 0.0080  375 PHE A C   
4198 O O   . PHE E 375 ? 1.3297 1.7005 1.9664 0.1646  -0.1909 0.0041  375 PHE A O   
4199 C CB  . PHE E 375 ? 1.3388 1.6628 1.9560 0.1832  -0.2145 0.0323  375 PHE A CB  
4200 C CG  . PHE E 375 ? 1.2935 1.6107 1.8806 0.1747  -0.2060 0.0327  375 PHE A CG  
4201 C CD1 . PHE E 375 ? 1.2375 1.5602 1.8062 0.1668  -0.2106 0.0320  375 PHE A CD1 
4202 C CD2 . PHE E 375 ? 1.3150 1.6168 1.8837 0.1726  -0.1906 0.0339  375 PHE A CD2 
4203 C CE1 . PHE E 375 ? 1.2085 1.5211 1.7429 0.1579  -0.1998 0.0319  375 PHE A CE1 
4204 C CE2 . PHE E 375 ? 1.2896 1.5831 1.8256 0.1637  -0.1802 0.0339  375 PHE A CE2 
4205 C CZ  . PHE E 375 ? 1.2412 1.5398 1.7608 0.1568  -0.1848 0.0327  375 PHE A CZ  
4206 N N   . LEU E 376 ? 1.2434 1.5975 1.8746 0.1649  -0.1680 0.0036  376 LEU A N   
4207 C CA  . LEU E 376 ? 1.1952 1.5620 1.8229 0.1537  -0.1559 -0.0070 376 LEU A CA  
4208 C C   . LEU E 376 ? 1.2767 1.6596 1.9238 0.1491  -0.1502 -0.0182 376 LEU A C   
4209 O O   . LEU E 376 ? 1.2485 1.6441 1.8935 0.1399  -0.1475 -0.0264 376 LEU A O   
4210 C CB  . LEU E 376 ? 1.1231 1.4827 1.7439 0.1494  -0.1389 -0.0093 376 LEU A CB  
4211 C CG  . LEU E 376 ? 1.0958 1.4403 1.6964 0.1523  -0.1417 0.0005  376 LEU A CG  
4212 C CD1 . LEU E 376 ? 1.0735 1.4137 1.6634 0.1449  -0.1232 -0.0032 376 LEU A CD1 
4213 C CD2 . LEU E 376 ? 1.1123 1.4535 1.6860 0.1486  -0.1522 0.0045  376 LEU A CD2 
4214 N N   . THR E 377 ? 1.3686 1.7499 2.0346 0.1553  -0.1487 -0.0186 377 THR A N   
4215 C CA  . THR E 377 ? 1.3553 1.7504 2.0431 0.1518  -0.1423 -0.0295 377 THR A CA  
4216 C C   . THR E 377 ? 1.3879 1.7942 2.0890 0.1566  -0.1575 -0.0287 377 THR A C   
4217 O O   . THR E 377 ? 1.3545 1.7750 2.0741 0.1530  -0.1535 -0.0383 377 THR A O   
4218 C CB  . THR E 377 ? 1.4040 1.7915 2.1075 0.1558  -0.1313 -0.0316 377 THR A CB  
4219 O OG1 . THR E 377 ? 1.4732 1.8483 2.1631 0.1527  -0.1192 -0.0296 377 THR A OG1 
4220 C CG2 . THR E 377 ? 1.4406 1.8410 2.1645 0.1489  -0.1205 -0.0451 377 THR A CG2 
4221 N N   . GLY E 378 ? 1.4622 1.8620 2.1538 0.1638  -0.1750 -0.0171 378 GLY A N   
4222 C CA  . GLY E 378 ? 1.5690 1.9777 2.2724 0.1685  -0.1911 -0.0143 378 GLY A CA  
4223 C C   . GLY E 378 ? 1.6651 2.0920 2.3653 0.1595  -0.1948 -0.0203 378 GLY A C   
4224 O O   . GLY E 378 ? 1.6946 2.1295 2.3901 0.1492  -0.1824 -0.0301 378 GLY A O   
4225 N N   . THR E 379 ? 1.7256 2.1581 2.4275 0.1628  -0.2126 -0.0142 379 THR A N   
4226 C CA  . THR E 379 ? 1.7405 2.1905 2.4387 0.1543  -0.2180 -0.0189 379 THR A CA  
4227 C C   . THR E 379 ? 1.7609 2.2077 2.4321 0.1449  -0.2139 -0.0198 379 THR A C   
4228 O O   . THR E 379 ? 1.7659 2.1959 2.4188 0.1473  -0.2152 -0.0120 379 THR A O   
4229 C CB  . THR E 379 ? 1.7482 2.2002 2.4466 0.1592  -0.2400 -0.0086 379 THR A CB  
4230 O OG1 . THR E 379 ? 1.7707 2.2255 2.4957 0.1684  -0.2444 -0.0080 379 THR A OG1 
4231 C CG2 . THR E 379 ? 1.7268 2.1974 2.4209 0.1499  -0.2455 -0.0132 379 THR A CG2 
4232 N N   . LEU E 380 ? 1.7809 2.2433 2.4500 0.1342  -0.2090 -0.0299 380 LEU A N   
4233 C CA  . LEU E 380 ? 1.8184 2.2786 2.4628 0.1248  -0.2052 -0.0324 380 LEU A CA  
4234 C C   . LEU E 380 ? 1.8442 2.3040 2.4691 0.1234  -0.2231 -0.0239 380 LEU A C   
4235 O O   . LEU E 380 ? 1.8913 2.3603 2.5235 0.1249  -0.2362 -0.0204 380 LEU A O   
4236 C CB  . LEU E 380 ? 1.7917 2.2660 2.4403 0.1127  -0.1923 -0.0475 380 LEU A CB  
4237 C CG  . LEU E 380 ? 1.7814 2.2495 2.4116 0.1033  -0.1799 -0.0538 380 LEU A CG  
4238 C CD1 . LEU E 380 ? 1.7712 2.2233 2.4011 0.1086  -0.1694 -0.0503 380 LEU A CD1 
4239 C CD2 . LEU E 380 ? 1.7885 2.2685 2.4244 0.0909  -0.1687 -0.0686 380 LEU A CD2 
4240 N N   . PRO E 381 ? 1.8534 2.3018 2.4531 0.1202  -0.2243 -0.0203 381 PRO A N   
4241 C CA  . PRO E 381 ? 1.8677 2.3125 2.4456 0.1178  -0.2416 -0.0118 381 PRO A CA  
4242 C C   . PRO E 381 ? 1.8871 2.3503 2.4620 0.1080  -0.2461 -0.0189 381 PRO A C   
4243 O O   . PRO E 381 ? 1.9013 2.3688 2.4725 0.1076  -0.2619 -0.0121 381 PRO A O   
4244 C CB  . PRO E 381 ? 1.8509 2.2777 2.3989 0.1144  -0.2346 -0.0096 381 PRO A CB  
4245 C CG  . PRO E 381 ? 1.8092 2.2425 2.3717 0.1124  -0.2165 -0.0219 381 PRO A CG  
4246 C CD  . PRO E 381 ? 1.8035 2.2423 2.3936 0.1178  -0.2096 -0.0245 381 PRO A CD  
4247 N N   . LEU E 382 ? 1.8827 2.3557 2.4578 0.0991  -0.2324 -0.0323 382 LEU A N   
4248 C CA  . LEU E 382 ? 1.8869 2.3778 2.4614 0.0886  -0.2337 -0.0413 382 LEU A CA  
4249 C C   . LEU E 382 ? 1.8591 2.3582 2.4479 0.0823  -0.2155 -0.0557 382 LEU A C   
4250 O O   . LEU E 382 ? 1.8547 2.3438 2.4415 0.0821  -0.2026 -0.0593 382 LEU A O   
4251 C CB  . LEU E 382 ? 1.9048 2.3926 2.4476 0.0797  -0.2406 -0.0416 382 LEU A CB  
4252 C CG  . LEU E 382 ? 1.8966 2.3962 2.4291 0.0656  -0.2336 -0.0555 382 LEU A CG  
4253 C CD1 . LEU E 382 ? 1.9283 2.4473 2.4730 0.0600  -0.2389 -0.0593 382 LEU A CD1 
4254 C CD2 . LEU E 382 ? 1.8726 2.3605 2.3656 0.0582  -0.2372 -0.0545 382 LEU A CD2 
4255 N N   . ASP E 383 ? 1.8340 2.3502 2.4375 0.0766  -0.2146 -0.0636 383 ASP A N   
4256 C CA  . ASP E 383 ? 1.7925 2.3148 2.4101 0.0696  -0.1983 -0.0775 383 ASP A CA  
4257 C C   . ASP E 383 ? 1.7373 2.2509 2.3329 0.0587  -0.1877 -0.0857 383 ASP A C   
4258 O O   . ASP E 383 ? 1.7467 2.2582 2.3171 0.0525  -0.1940 -0.0851 383 ASP A O   
4259 C CB  . ASP E 383 ? 1.7876 2.3295 2.4169 0.0621  -0.2009 -0.0856 383 ASP A CB  
4260 C CG  . ASP E 383 ? 1.8056 2.3580 2.4656 0.0723  -0.2062 -0.0820 383 ASP A CG  
4261 O OD1 . ASP E 383 ? 1.7851 2.3436 2.4677 0.0715  -0.1953 -0.0915 383 ASP A OD1 
4262 O OD2 . ASP E 383 ? 1.8684 2.4222 2.5293 0.0804  -0.2217 -0.0700 383 ASP A OD2 
4263 N N   . ILE E 384 ? 1.6877 2.1956 2.2918 0.0558  -0.1720 -0.0934 384 ILE A N   
4264 C CA  . ILE E 384 ? 1.6582 2.1575 2.2431 0.0441  -0.1615 -0.1020 384 ILE A CA  
4265 C C   . ILE E 384 ? 1.6648 2.1713 2.2313 0.0297  -0.1643 -0.1113 384 ILE A C   
4266 O O   . ILE E 384 ? 1.6450 2.1434 2.1851 0.0230  -0.1654 -0.1127 384 ILE A O   
4267 C CB  . ILE E 384 ? 1.6304 2.1243 2.2286 0.0400  -0.1450 -0.1104 384 ILE A CB  
4268 C CG1 . ILE E 384 ? 1.6027 2.0848 2.1791 0.0282  -0.1359 -0.1172 384 ILE A CG1 
4269 C CG2 . ILE E 384 ? 1.6238 2.1308 2.2412 0.0342  -0.1409 -0.1209 384 ILE A CG2 
4270 C CD1 . ILE E 384 ? 1.5814 2.0507 2.1418 0.0341  -0.1378 -0.1081 384 ILE A CD1 
4271 N N   . GLU E 385 ? 1.6748 2.1961 2.2543 0.0253  -0.1664 -0.1174 385 GLU A N   
4272 C CA  . GLU E 385 ? 1.6644 2.1910 2.2277 0.0095  -0.1653 -0.1288 385 GLU A CA  
4273 C C   . GLU E 385 ? 1.6474 2.1709 2.1798 0.0061  -0.1768 -0.1240 385 GLU A C   
4274 O O   . GLU E 385 ? 1.6775 2.2014 2.1876 -0.0072 -0.1775 -0.1317 385 GLU A O   
4275 C CB  . GLU E 385 ? 1.6955 2.2403 2.2797 0.0074  -0.1675 -0.1344 385 GLU A CB  
4276 C CG  . GLU E 385 ? 1.7313 2.2785 2.3422 0.0070  -0.1542 -0.1437 385 GLU A CG  
4277 C CD  . GLU E 385 ? 1.8218 2.3744 2.4637 0.0234  -0.1569 -0.1352 385 GLU A CD  
4278 O OE1 . GLU E 385 ? 1.8650 2.4166 2.5048 0.0344  -0.1687 -0.1216 385 GLU A OE1 
4279 O OE2 . GLU E 385 ? 1.8455 2.4016 2.5120 0.0249  -0.1478 -0.1421 385 GLU A OE2 
4280 N N   . SER E 386 ? 1.6148 2.1338 2.1446 0.0180  -0.1859 -0.1111 386 SER A N   
4281 C CA  . SER E 386 ? 1.6034 2.1160 2.1028 0.0163  -0.1961 -0.1058 386 SER A CA  
4282 C C   . SER E 386 ? 1.5026 1.9989 1.9787 0.0117  -0.1886 -0.1097 386 SER A C   
4283 O O   . SER E 386 ? 1.4687 1.9600 1.9142 0.0026  -0.1921 -0.1134 386 SER A O   
4284 C CB  . SER E 386 ? 1.6777 2.1901 2.1824 0.0302  -0.2096 -0.0908 386 SER A CB  
4285 O OG  . SER E 386 ? 1.7220 2.2198 2.2051 0.0346  -0.2130 -0.0847 386 SER A OG  
4286 N N   . GLN E 387 ? 1.4318 1.9193 1.9212 0.0174  -0.1782 -0.1090 387 GLN A N   
4287 C CA  . GLN E 387 ? 1.3501 1.8229 1.8209 0.0146  -0.1721 -0.1110 387 GLN A CA  
4288 C C   . GLN E 387 ? 1.3557 1.8223 1.8181 -0.0001 -0.1602 -0.1235 387 GLN A C   
4289 O O   . GLN E 387 ? 1.3047 1.7585 1.7523 -0.0036 -0.1553 -0.1254 387 GLN A O   
4290 C CB  . GLN E 387 ? 1.2858 1.7500 1.7703 0.0278  -0.1682 -0.1020 387 GLN A CB  
4291 C CG  . GLN E 387 ? 1.0016 1.4501 1.4620 0.0369  -0.1748 -0.0879 387 GLN A CG  
4292 C CD  . GLN E 387 ? 1.0503 1.5030 1.5015 0.0400  -0.1888 -0.0797 387 GLN A CD  
4293 O OE1 . GLN E 387 ? 1.0888 1.5617 1.5557 0.0362  -0.1966 -0.0857 387 GLN A OE1 
4294 N NE2 . GLN E 387 ? 1.0572 1.4903 1.4822 0.0458  -0.1919 -0.0660 387 GLN A NE2 
4295 N N   . GLU E 388 ? 1.4487 1.9231 1.9184 -0.0093 -0.1565 -0.1320 388 GLU A N   
4296 C CA  . GLU E 388 ? 1.5014 1.9673 1.9601 -0.0246 -0.1460 -0.1440 388 GLU A CA  
4297 C C   . GLU E 388 ? 1.5257 1.9766 1.9486 -0.0342 -0.1474 -0.1469 388 GLU A C   
4298 O O   . GLU E 388 ? 1.5196 1.9564 1.9352 -0.0385 -0.1398 -0.1492 388 GLU A O   
4299 C CB  . GLU E 388 ? 1.5223 1.9989 1.9862 -0.0341 -0.1449 -0.1531 388 GLU A CB  
4300 C CG  . GLU E 388 ? 1.5534 2.0350 1.9935 -0.0414 -0.1552 -0.1546 388 GLU A CG  
4301 C CD  . GLU E 388 ? 1.5987 2.0913 2.0431 -0.0294 -0.1690 -0.1431 388 GLU A CD  
4302 O OE1 . GLU E 388 ? 1.6291 2.1227 2.0920 -0.0152 -0.1707 -0.1338 388 GLU A OE1 
4303 O OE2 . GLU E 388 ? 1.6461 2.1445 2.0736 -0.0345 -0.1781 -0.1428 388 GLU A OE2 
4304 N N   . HIS E 389 ? 1.5563 2.0087 1.9550 -0.0381 -0.1572 -0.1467 389 HIS A N   
4305 C CA  . HIS E 389 ? 1.5821 2.0179 1.9442 -0.0469 -0.1586 -0.1494 389 HIS A CA  
4306 C C   . HIS E 389 ? 1.5133 1.9398 1.8781 -0.0385 -0.1563 -0.1444 389 HIS A C   
4307 O O   . HIS E 389 ? 1.4960 1.9069 1.8467 -0.0459 -0.1505 -0.1484 389 HIS A O   
4308 C CB  . HIS E 389 ? 1.6457 2.0833 1.9811 -0.0473 -0.1707 -0.1459 389 HIS A CB  
4309 C CG  . HIS E 389 ? 1.6742 2.1077 1.9998 -0.0365 -0.1773 -0.1381 389 HIS A CG  
4310 N ND1 . HIS E 389 ? 1.6916 2.1015 1.9772 -0.0412 -0.1764 -0.1365 389 HIS A ND1 
4311 C CD2 . HIS E 389 ? 1.6871 2.1173 2.0232 -0.0209 -0.1781 -0.1238 389 HIS A CD2 
4312 C CE1 . HIS E 389 ? 1.7012 2.0953 1.9752 -0.0289 -0.1755 -0.1224 389 HIS A CE1 
4313 N NE2 . HIS E 389 ? 1.6969 2.1024 1.9997 -0.0171 -0.1765 -0.1146 389 HIS A NE2 
4314 N N   . LEU E 390 ? 1.4574 1.8922 1.8400 -0.0228 -0.1612 -0.1348 390 LEU A N   
4315 C CA  . LEU E 390 ? 1.3911 1.8062 1.7588 -0.0137 -0.1581 -0.1242 390 LEU A CA  
4316 C C   . LEU E 390 ? 1.3268 1.7361 1.7081 -0.0165 -0.1481 -0.1287 390 LEU A C   
4317 O O   . LEU E 390 ? 1.2793 1.6702 1.6394 -0.0196 -0.1445 -0.1278 390 LEU A O   
4318 C CB  . LEU E 390 ? 1.4186 1.8337 1.7975 0.0026  -0.1605 -0.1097 390 LEU A CB  
4319 C CG  . LEU E 390 ? 1.4534 1.8449 1.8033 0.0103  -0.1590 -0.0973 390 LEU A CG  
4320 C CD1 . LEU E 390 ? 1.4722 1.8620 1.8297 0.0240  -0.1621 -0.0835 390 LEU A CD1 
4321 C CD2 . LEU E 390 ? 1.4692 1.8456 1.8151 0.0100  -0.1490 -0.0980 390 LEU A CD2 
4322 N N   . LEU E 391 ? 1.3382 1.7597 1.7523 -0.0157 -0.1425 -0.1319 391 LEU A N   
4323 C CA  . LEU E 391 ? 1.3207 1.7323 1.7424 -0.0220 -0.1305 -0.1354 391 LEU A CA  
4324 C C   . LEU E 391 ? 1.3100 1.7078 1.7056 -0.0399 -0.1275 -0.1450 391 LEU A C   
4325 O O   . LEU E 391 ? 1.3007 1.6845 1.6893 -0.0446 -0.1224 -0.1455 391 LEU A O   
4326 C CB  . LEU E 391 ? 1.3421 1.7616 1.7925 -0.0193 -0.1229 -0.1354 391 LEU A CB  
4327 C CG  . LEU E 391 ? 1.3513 1.7853 1.8114 -0.0204 -0.1267 -0.1389 391 LEU A CG  
4328 C CD1 . LEU E 391 ? 1.3834 1.8141 1.8426 -0.0351 -0.1177 -0.1501 391 LEU A CD1 
4329 C CD2 . LEU E 391 ? 1.3682 1.8135 1.8572 -0.0054 -0.1282 -0.1309 391 LEU A CD2 
4330 N N   . ALA E 392 ? 1.2834 1.6828 1.6619 -0.0499 -0.1313 -0.1514 392 ALA A N   
4331 C CA  . ALA E 392 ? 1.1997 1.5814 1.5500 -0.0672 -0.1278 -0.1592 392 ALA A CA  
4332 C C   . ALA E 392 ? 1.1892 1.5526 1.5138 -0.0698 -0.1307 -0.1575 392 ALA A C   
4333 O O   . ALA E 392 ? 1.2913 1.6349 1.5942 -0.0824 -0.1270 -0.1610 392 ALA A O   
4334 C CB  . ALA E 392 ? 1.1472 1.5314 1.4785 -0.0760 -0.1324 -0.1645 392 ALA A CB  
4335 N N   . GLN E 393 ? 1.0984 1.4675 1.4258 -0.0572 -0.1375 -0.1516 393 GLN A N   
4336 C CA  . GLN E 393 ? 1.0637 1.4188 1.3648 -0.0577 -0.1431 -0.1511 393 GLN A CA  
4337 C C   . GLN E 393 ? 1.0266 1.3686 1.3345 -0.0532 -0.1370 -0.1458 393 GLN A C   
4338 O O   . GLN E 393 ? 1.0532 1.3761 1.3372 -0.0500 -0.1381 -0.1404 393 GLN A O   
4339 C CB  . GLN E 393 ? 1.0629 1.4159 1.3484 -0.0449 -0.1482 -0.1404 393 GLN A CB  
4340 C CG  . GLN E 393 ? 1.0648 1.3950 1.3107 -0.0452 -0.1514 -0.1368 393 GLN A CG  
4341 C CD  . GLN E 393 ? 1.1063 1.4379 1.3284 -0.0447 -0.1586 -0.1342 393 GLN A CD  
4342 O OE1 . GLN E 393 ? 1.1580 1.5076 1.3956 -0.0414 -0.1617 -0.1326 393 GLN A OE1 
4343 N NE2 . GLN E 393 ? 1.1324 1.4446 1.3166 -0.0485 -0.1617 -0.1340 393 GLN A NE2 
4344 N N   . LEU E 394 ? 1.0185 1.3679 1.3566 -0.0525 -0.1294 -0.1459 394 LEU A N   
4345 C CA  . LEU E 394 ? 1.0925 1.4292 1.4355 -0.0493 -0.1236 -0.1402 394 LEU A CA  
4346 C C   . LEU E 394 ? 1.1734 1.4948 1.5080 -0.0656 -0.1182 -0.1454 394 LEU A C   
4347 O O   . LEU E 394 ? 1.1816 1.4972 1.5041 -0.0778 -0.1153 -0.1503 394 LEU A O   
4348 C CB  . LEU E 394 ? 1.1408 1.4861 1.5128 -0.0348 -0.1164 -0.1305 394 LEU A CB  
4349 C CG  . LEU E 394 ? 1.1647 1.5302 1.5675 -0.0324 -0.1134 -0.1329 394 LEU A CG  
4350 C CD1 . LEU E 394 ? 1.2017 1.5614 1.5997 -0.0481 -0.1068 -0.1407 394 LEU A CD1 
4351 C CD2 . LEU E 394 ? 1.1419 1.5101 1.5693 -0.0198 -0.1061 -0.1235 394 LEU A CD2 
4352 N N   . ILE E 395 ? 1.2840 1.5947 1.6210 -0.0651 -0.1161 -0.1417 395 ILE A N   
4353 C CA  . ILE E 395 ? 1.4379 1.7276 1.7606 -0.0799 -0.1111 -0.1424 395 ILE A CA  
4354 C C   . ILE E 395 ? 1.6401 1.9299 1.9838 -0.0813 -0.1001 -0.1384 395 ILE A C   
4355 O O   . ILE E 395 ? 1.7035 1.9752 2.0337 -0.0940 -0.0960 -0.1377 395 ILE A O   
4356 C CB  . ILE E 395 ? 1.4200 1.6911 1.7214 -0.0831 -0.1177 -0.1414 395 ILE A CB  
4357 C CG1 . ILE E 395 ? 1.3862 1.6635 1.7019 -0.0657 -0.1199 -0.1347 395 ILE A CG1 
4358 C CG2 . ILE E 395 ? 1.4589 1.7192 1.7263 -0.0893 -0.1261 -0.1462 395 ILE A CG2 
4359 C CD1 . ILE E 395 ? 1.4126 1.6904 1.7110 -0.0537 -0.1239 -0.1309 395 ILE A CD1 
4360 N N   . ASP E 396 ? 1.7240 2.0314 2.0971 -0.0684 -0.0957 -0.1344 396 ASP A N   
4361 C CA  . ASP E 396 ? 1.7683 2.0756 2.1593 -0.0694 -0.0846 -0.1308 396 ASP A CA  
4362 C C   . ASP E 396 ? 1.8888 2.2122 2.2990 -0.0631 -0.0806 -0.1323 396 ASP A C   
4363 O O   . ASP E 396 ? 1.9222 2.2603 2.3491 -0.0480 -0.0832 -0.1279 396 ASP A O   
4364 C CB  . ASP E 396 ? 1.6865 1.9953 2.0940 -0.0587 -0.0817 -0.1218 396 ASP A CB  
4365 C CG  . ASP E 396 ? 1.6372 1.9279 2.0311 -0.0679 -0.0820 -0.1195 396 ASP A CG  
4366 O OD1 . ASP E 396 ? 1.6366 1.9119 2.0143 -0.0833 -0.0786 -0.1217 396 ASP A OD1 
4367 O OD2 . ASP E 396 ? 1.6103 1.9016 2.0093 -0.0592 -0.0858 -0.1147 396 ASP A OD2 
4368 N N   . LYS E 397 ? 1.9672 2.2863 2.3742 -0.0743 -0.0745 -0.1379 397 LYS A N   
4369 C CA  . LYS E 397 ? 2.0418 2.3753 2.4694 -0.0689 -0.0702 -0.1403 397 LYS A CA  
4370 C C   . LYS E 397 ? 2.0721 2.4071 2.5216 -0.0614 -0.0612 -0.1337 397 LYS A C   
4371 O O   . LYS E 397 ? 2.0522 2.3737 2.4964 -0.0690 -0.0545 -0.1313 397 LYS A O   
4372 C CB  . LYS E 397 ? 2.0678 2.3953 2.4848 -0.0832 -0.0658 -0.1493 397 LYS A CB  
4373 C CG  . LYS E 397 ? 2.0840 2.3945 2.4944 -0.0949 -0.0559 -0.1493 397 LYS A CG  
4374 C CD  . LYS E 397 ? 2.1075 2.4034 2.4922 -0.1112 -0.0547 -0.1559 397 LYS A CD  
4375 C CE  . LYS E 397 ? 2.1154 2.4230 2.5121 -0.1122 -0.0505 -0.1648 397 LYS A CE  
4376 N NZ  . LYS E 397 ? 2.1269 2.4181 2.4989 -0.1278 -0.0471 -0.1702 397 LYS A NZ  
4377 N N   . THR E 398 ? 2.1359 2.4855 2.6071 -0.0466 -0.0616 -0.1296 398 THR A N   
4378 C CA  . THR E 398 ? 2.1988 2.5484 2.6880 -0.0382 -0.0536 -0.1222 398 THR A CA  
4379 C C   . THR E 398 ? 2.2674 2.6153 2.7668 -0.0450 -0.0439 -0.1277 398 THR A C   
4380 O O   . THR E 398 ? 2.2903 2.6355 2.7814 -0.0572 -0.0425 -0.1371 398 THR A O   
4381 C CB  . THR E 398 ? 2.1892 2.5512 2.6939 -0.0190 -0.0584 -0.1140 398 THR A CB  
4382 O OG1 . THR E 398 ? 2.1982 2.5698 2.7200 -0.0141 -0.0570 -0.1163 398 THR A OG1 
4383 C CG2 . THR E 398 ? 2.1905 2.5586 2.6847 -0.0134 -0.0705 -0.1132 398 THR A CG2 
4384 N N   . GLY E 399 ? 2.3097 2.6582 2.8258 -0.0370 -0.0368 -0.1218 399 GLY A N   
4385 C CA  . GLY E 399 ? 2.3318 2.6787 2.8599 -0.0415 -0.0274 -0.1269 399 GLY A CA  
4386 C C   . GLY E 399 ? 2.3405 2.7012 2.8822 -0.0375 -0.0309 -0.1340 399 GLY A C   
4387 O O   . GLY E 399 ? 2.3288 2.6889 2.8770 -0.0450 -0.0243 -0.1426 399 GLY A O   
4388 N N   . THR E 400 ? 2.3486 2.7216 2.8942 -0.0255 -0.0416 -0.1301 400 THR A N   
4389 C CA  . THR E 400 ? 2.3434 2.7309 2.9009 -0.0213 -0.0473 -0.1354 400 THR A CA  
4390 C C   . THR E 400 ? 2.2453 2.6359 2.7848 -0.0303 -0.0550 -0.1423 400 THR A C   
4391 O O   . THR E 400 ? 2.2083 2.6005 2.7356 -0.0263 -0.0640 -0.1375 400 THR A O   
4392 C CB  . THR E 400 ? 2.4089 2.8070 2.9811 -0.0022 -0.0552 -0.1256 400 THR A CB  
4393 O OG1 . THR E 400 ? 2.4181 2.8136 2.9772 0.0044  -0.0620 -0.1166 400 THR A OG1 
4394 C CG2 . THR E 400 ? 2.4426 2.8379 3.0335 0.0065  -0.0477 -0.1204 400 THR A CG2 
4395 N N   . VAL E 401 ? 2.2148 2.6053 2.7514 -0.0428 -0.0511 -0.1538 401 VAL A N   
4396 C CA  . VAL E 401 ? 2.1991 2.5903 2.7155 -0.0532 -0.0572 -0.1610 401 VAL A CA  
4397 C C   . VAL E 401 ? 2.1627 2.5711 2.6922 -0.0500 -0.0621 -0.1668 401 VAL A C   
4398 O O   . VAL E 401 ? 2.1280 2.5407 2.6728 -0.0529 -0.0554 -0.1744 401 VAL A O   
4399 C CB  . VAL E 401 ? 2.2395 2.6136 2.7346 -0.0720 -0.0494 -0.1691 401 VAL A CB  
4400 C CG1 . VAL E 401 ? 2.2720 2.6458 2.7453 -0.0825 -0.0550 -0.1768 401 VAL A CG1 
4401 C CG2 . VAL E 401 ? 2.2369 2.5937 2.7154 -0.0760 -0.0473 -0.1622 401 VAL A CG2 
4402 N N   . SER E 402 ? 2.1703 2.5886 2.6940 -0.0440 -0.0740 -0.1632 402 SER A N   
4403 C CA  . SER E 402 ? 2.1805 2.6156 2.7139 -0.0415 -0.0806 -0.1674 402 SER A CA  
4404 C C   . SER E 402 ? 2.2194 2.6570 2.7290 -0.0457 -0.0915 -0.1677 402 SER A C   
4405 O O   . SER E 402 ? 2.2464 2.6710 2.7286 -0.0583 -0.0906 -0.1721 402 SER A O   
4406 C CB  . SER E 402 ? 2.1733 2.6219 2.7346 -0.0236 -0.0852 -0.1589 402 SER A CB  
4407 O OG  . SER E 402 ? 2.1774 2.6280 2.7628 -0.0217 -0.0760 -0.1630 402 SER A OG  
4408 N N   . MET F 1   ? 2.4767 2.1375 2.2758 -0.0220 -0.5560 -0.0574 1   MET D N   
4409 C CA  . MET F 1   ? 2.5107 2.1549 2.2999 -0.0168 -0.5609 -0.0635 1   MET D CA  
4410 C C   . MET F 1   ? 2.5682 2.1847 2.3329 -0.0160 -0.5735 -0.0575 1   MET D C   
4411 O O   . MET F 1   ? 2.5861 2.1958 2.3399 -0.0194 -0.5783 -0.0478 1   MET D O   
4412 C CB  . MET F 1   ? 2.4507 2.1468 2.3044 -0.0217 -0.5410 -0.0683 1   MET D CB  
4413 C CG  . MET F 1   ? 2.3868 2.1278 2.2952 -0.0306 -0.5256 -0.0623 1   MET D CG  
4414 S SD  . MET F 1   ? 3.0493 2.8543 3.0241 -0.0360 -0.4949 -0.0662 1   MET D SD  
4415 C CE  . MET F 1   ? 2.3050 2.0923 2.2593 -0.0288 -0.4989 -0.0753 1   MET D CE  
4416 N N   . SER F 2   ? 2.5722 2.1732 2.3283 -0.0115 -0.5788 -0.0623 2   SER D N   
4417 C CA  . SER F 2   ? 2.5618 2.1391 2.3000 -0.0107 -0.5899 -0.0577 2   SER D CA  
4418 C C   . SER F 2   ? 2.5081 2.1261 2.2996 -0.0201 -0.5795 -0.0509 2   SER D C   
4419 O O   . SER F 2   ? 2.5073 2.1088 2.2819 -0.0224 -0.5883 -0.0420 2   SER D O   
4420 C CB  . SER F 2   ? 2.5190 2.0840 2.2529 -0.0054 -0.5939 -0.0648 2   SER D CB  
4421 O OG  . SER F 2   ? 2.5316 2.0504 2.2082 0.0041  -0.6062 -0.0698 2   SER D OG  
4422 N N   . LYS F 3   ? 2.4492 2.1196 2.3018 -0.0251 -0.5592 -0.0546 3   LYS D N   
4423 C CA  . LYS F 3   ? 2.3961 2.1075 2.2998 -0.0328 -0.5451 -0.0496 3   LYS D CA  
4424 C C   . LYS F 3   ? 2.3581 2.1011 2.2910 -0.0402 -0.5336 -0.0435 3   LYS D C   
4425 O O   . LYS F 3   ? 2.2946 2.0755 2.2722 -0.0469 -0.5185 -0.0392 3   LYS D O   
4426 C CB  . LYS F 3   ? 2.3600 2.1087 2.3056 -0.0334 -0.5266 -0.0557 3   LYS D CB  
4427 C CG  . LYS F 3   ? 2.3330 2.1268 2.3165 -0.0366 -0.5034 -0.0595 3   LYS D CG  
4428 C CD  . LYS F 3   ? 2.3844 2.1800 2.3948 -0.0336 -0.5037 -0.0637 3   LYS D CD  
4429 C CE  . LYS F 3   ? 2.3718 2.1338 2.3523 -0.0258 -0.5182 -0.0705 3   LYS D CE  
4430 N NZ  . LYS F 3   ? 2.3511 2.1113 2.3578 -0.0218 -0.5215 -0.0747 3   LYS D NZ  
4431 N N   . LEU F 4   ? 2.3840 2.1099 2.2892 -0.0387 -0.5404 -0.0429 4   LEU D N   
4432 C CA  . LEU F 4   ? 2.3379 2.0865 2.2633 -0.0456 -0.5338 -0.0350 4   LEU D CA  
4433 C C   . LEU F 4   ? 2.4027 2.1281 2.3050 -0.0485 -0.5478 -0.0227 4   LEU D C   
4434 O O   . LEU F 4   ? 2.3589 2.1175 2.3041 -0.0564 -0.5375 -0.0155 4   LEU D O   
4435 C CB  . LEU F 4   ? 2.2575 1.9956 2.1590 -0.0431 -0.5367 -0.0368 4   LEU D CB  
4436 C CG  . LEU F 4   ? 2.1391 1.8888 2.0481 -0.0499 -0.5364 -0.0248 4   LEU D CG  
4437 C CD1 . LEU F 4   ? 2.0058 1.8067 1.9692 -0.0563 -0.5154 -0.0261 4   LEU D CD1 
4438 C CD2 . LEU F 4   ? 2.2027 1.8947 2.0313 -0.0430 -0.5580 -0.0174 4   LEU D CD2 
4439 N N   . ASP F 5   ? 2.4794 2.1472 2.3107 -0.0415 -0.5695 -0.0194 5   ASP D N   
4440 C CA  . ASP F 5   ? 2.4943 2.1354 2.2877 -0.0430 -0.5820 -0.0036 5   ASP D CA  
4441 C C   . ASP F 5   ? 2.3840 2.0555 2.2254 -0.0528 -0.5766 0.0059  5   ASP D C   
4442 O O   . ASP F 5   ? 2.3808 2.0639 2.2305 -0.0592 -0.5759 0.0205  5   ASP D O   
4443 C CB  . ASP F 5   ? 2.5965 2.1688 2.3025 -0.0321 -0.6017 -0.0008 5   ASP D CB  
4444 C CG  . ASP F 5   ? 2.6770 2.2104 2.3191 -0.0212 -0.6063 -0.0056 5   ASP D CG  
4445 O OD1 . ASP F 5   ? 2.7096 2.2447 2.3375 -0.0196 -0.5928 0.0021  5   ASP D OD1 
4446 O OD2 . ASP F 5   ? 2.7166 2.2187 2.3259 -0.0130 -0.6129 -0.0158 5   ASP D OD2 
4447 N N   . SER F 6   ? 2.2850 1.9700 2.1575 -0.0534 -0.5718 -0.0010 6   SER D N   
4448 C CA  . SER F 6   ? 2.1795 1.8900 2.0942 -0.0609 -0.5657 0.0060  6   SER D CA  
4449 C C   . SER F 6   ? 2.0696 1.8360 2.0485 -0.0709 -0.5450 0.0118  6   SER D C   
4450 O O   . SER F 6   ? 2.0565 1.8369 2.0591 -0.0778 -0.5428 0.0224  6   SER D O   
4451 C CB  . SER F 6   ? 2.1616 1.8833 2.1009 -0.0580 -0.5588 -0.0044 6   SER D CB  
4452 O OG  . SER F 6   ? 2.1270 1.8938 2.1126 -0.0583 -0.5356 -0.0142 6   SER D OG  
4453 N N   . LEU F 7   ? 1.9940 1.7928 2.0015 -0.0716 -0.5282 0.0049  7   LEU D N   
4454 C CA  . LEU F 7   ? 1.8738 1.7264 1.9409 -0.0800 -0.5047 0.0091  7   LEU D CA  
4455 C C   . LEU F 7   ? 1.8748 1.7269 1.9357 -0.0863 -0.5111 0.0235  7   LEU D C   
4456 O O   . LEU F 7   ? 1.7981 1.6956 1.9108 -0.0941 -0.4909 0.0285  7   LEU D O   
4457 C CB  . LEU F 7   ? 1.7662 1.6560 1.8663 -0.0776 -0.4805 -0.0039 7   LEU D CB  
4458 C CG  . LEU F 7   ? 1.6162 1.5633 1.7755 -0.0832 -0.4485 -0.0035 7   LEU D CG  
4459 C CD1 . LEU F 7   ? 1.5962 1.5514 1.7745 -0.0875 -0.4456 0.0044  7   LEU D CD1 
4460 C CD2 . LEU F 7   ? 1.5421 1.5158 1.7174 -0.0787 -0.4262 -0.0162 7   LEU D CD2 
4461 N N   . LEU F 8   ? 1.9486 1.7495 1.9416 -0.0817 -0.5364 0.0315  8   LEU D N   
4462 C CA  . LEU F 8   ? 1.9787 1.7743 1.9546 -0.0809 -0.5075 0.0505  8   LEU D CA  
4463 C C   . LEU F 8   ? 2.0174 1.7936 1.9758 -0.0816 -0.5000 0.0673  8   LEU D C   
4464 O O   . LEU F 8   ? 2.0127 1.7844 1.9584 -0.0805 -0.4666 0.0851  8   LEU D O   
4465 C CB  . LEU F 8   ? 2.0522 1.8032 1.9583 -0.0675 -0.4930 0.0515  8   LEU D CB  
4466 C CG  . LEU F 8   ? 2.0408 1.8161 1.9709 -0.0679 -0.4963 0.0366  8   LEU D CG  
4467 C CD1 . LEU F 8   ? 2.0943 1.8398 1.9918 -0.0624 -0.5349 0.0183  8   LEU D CD1 
4468 C CD2 . LEU F 8   ? 2.0647 1.8281 1.9639 -0.0600 -0.4610 0.0444  8   LEU D CD2 
4469 N N   . LYS F 9   ? 2.0546 1.8185 2.0116 -0.0834 -0.5329 0.0610  9   LYS D N   
4470 C CA  . LYS F 9   ? 2.0849 1.8470 2.0511 -0.0883 -0.5330 0.0736  9   LYS D CA  
4471 C C   . LYS F 9   ? 1.9372 1.7569 1.9775 -0.1006 -0.5112 0.0821  9   LYS D C   
4472 O O   . LYS F 9   ? 1.9559 1.7763 1.9952 -0.1024 -0.4829 0.1005  9   LYS D O   
4473 C CB  . LYS F 9   ? 2.1735 1.9321 2.1516 -0.0892 -0.5632 0.0592  9   LYS D CB  
4474 C CG  . LYS F 9   ? 2.2888 2.0142 2.2358 -0.0892 -0.5796 0.0718  9   LYS D CG  
4475 C CD  . LYS F 9   ? 2.3708 2.0498 2.2687 -0.0796 -0.5947 0.0618  9   LYS D CD  
4476 C CE  . LYS F 9   ? 2.3391 2.0398 2.2842 -0.0832 -0.5877 0.0551  9   LYS D CE  
4477 N NZ  . LYS F 9   ? 2.1836 1.9481 2.2107 -0.0916 -0.5612 0.0529  9   LYS D NZ  
4478 N N   . GLU F 10  ? 1.7952 1.6623 1.8975 -0.1075 -0.5186 0.0673  10  GLU D N   
4479 C CA  . GLU F 10  ? 1.6740 1.5954 1.8478 -0.1151 -0.4899 0.0676  10  GLU D CA  
4480 C C   . GLU F 10  ? 1.6205 1.5763 1.8324 -0.1267 -0.4780 0.0860  10  GLU D C   
4481 O O   . GLU F 10  ? 1.6019 1.5923 1.8620 -0.1332 -0.4573 0.0914  10  GLU D O   
4482 C CB  . GLU F 10  ? 1.6453 1.5978 1.8472 -0.1088 -0.4640 0.0470  10  GLU D CB  
4483 C CG  . GLU F 10  ? 1.6517 1.6577 1.9100 -0.1122 -0.4287 0.0450  10  GLU D CG  
4484 C CD  . GLU F 10  ? 1.7183 1.7324 1.9910 -0.1105 -0.4193 0.0422  10  GLU D CD  
4485 O OE1 . GLU F 10  ? 1.7292 1.7216 1.9790 -0.1038 -0.4292 0.0329  10  GLU D OE1 
4486 O OE2 . GLU F 10  ? 1.7132 1.7544 2.0186 -0.1158 -0.4017 0.0496  10  GLU D OE2 
4487 N N   . LEU F 11  ? 1.6046 1.5400 1.7761 -0.1190 -0.4521 0.0927  11  LEU D N   
4488 C CA  . LEU F 11  ? 1.6035 1.5658 1.7976 -0.1221 -0.4106 0.1070  11  LEU D CA  
4489 C C   . LEU F 11  ? 1.6343 1.5629 1.7827 -0.1175 -0.3836 0.1289  11  LEU D C   
4490 O O   . LEU F 11  ? 1.7237 1.6122 1.8301 -0.1136 -0.3982 0.1334  11  LEU D O   
4491 C CB  . LEU F 11  ? 1.6632 1.6275 1.8443 -0.1161 -0.3969 0.0999  11  LEU D CB  
4492 C CG  . LEU F 11  ? 1.8079 1.7133 1.9074 -0.1015 -0.4033 0.0950  11  LEU D CG  
4493 C CD1 . LEU F 11  ? 1.8442 1.7456 1.9420 -0.0993 -0.4393 0.0725  11  LEU D CD1 
4494 C CD2 . LEU F 11  ? 1.8642 1.7154 1.8999 -0.0945 -0.4066 0.1064  11  LEU D CD2 
4495 N N   . PRO F 12  ? 1.6006 1.5478 1.7602 -0.1188 -0.3443 0.1429  12  PRO D N   
4496 C CA  . PRO F 12  ? 1.6404 1.5555 1.7497 -0.1125 -0.3121 0.1632  12  PRO D CA  
4497 C C   . PRO F 12  ? 1.7358 1.5897 1.7586 -0.0975 -0.3150 0.1615  12  PRO D C   
4498 O O   . PRO F 12  ? 1.7493 1.5986 1.7588 -0.0916 -0.3210 0.1480  12  PRO D O   
4499 C CB  . PRO F 12  ? 1.5709 1.5252 1.7154 -0.1157 -0.2749 0.1703  12  PRO D CB  
4500 C CG  . PRO F 12  ? 1.4775 1.4926 1.7059 -0.1280 -0.2855 0.1595  12  PRO D CG  
4501 C CD  . PRO F 12  ? 1.4830 1.4939 1.7202 -0.1295 -0.3299 0.1409  12  PRO D CD  
4502 N N   . THR F 13  ? 1.7963 1.6049 1.7618 -0.0916 -0.3098 0.1751  13  THR D N   
4503 C CA  . THR F 13  ? 1.8687 1.6190 1.7505 -0.0772 -0.3110 0.1744  13  THR D CA  
4504 C C   . THR F 13  ? 1.8884 1.6420 1.7547 -0.0703 -0.2825 0.1745  13  THR D C   
4505 O O   . THR F 13  ? 1.9032 1.6356 1.7369 -0.0616 -0.2940 0.1608  13  THR D O   
4506 C CB  . THR F 13  ? 1.9890 1.6947 1.8128 -0.0723 -0.2998 0.1933  13  THR D CB  
4507 O OG1 . THR F 13  ? 2.0126 1.7406 1.8559 -0.0771 -0.2614 0.2130  13  THR D OG1 
4508 C CG2 . THR F 13  ? 1.9595 1.6516 1.7862 -0.0769 -0.3310 0.1926  13  THR D CG2 
4509 N N   . ARG F 14  ? 1.8820 1.6625 1.7723 -0.0742 -0.2454 0.1898  14  ARG D N   
4510 C CA  . ARG F 14  ? 1.9137 1.6974 1.7885 -0.0674 -0.2147 0.1921  14  ARG D CA  
4511 C C   . ARG F 14  ? 1.8414 1.6516 1.7489 -0.0677 -0.2261 0.1726  14  ARG D C   
4512 O O   . ARG F 14  ? 1.8982 1.6831 1.7632 -0.0570 -0.2248 0.1645  14  ARG D O   
4513 C CB  . ARG F 14  ? 1.9350 1.7523 1.8434 -0.0738 -0.1750 0.2110  14  ARG D CB  
4514 C CG  . ARG F 14  ? 2.0002 1.8133 1.8817 -0.0651 -0.1409 0.2160  14  ARG D CG  
4515 C CD  . ARG F 14  ? 2.0024 1.8550 1.9251 -0.0723 -0.1027 0.2331  14  ARG D CD  
4516 N NE  . ARG F 14  ? 2.0529 1.8857 1.9483 -0.0730 -0.0862 0.2540  14  ARG D NE  
4517 C CZ  . ARG F 14  ? 2.0383 1.9013 1.9663 -0.0802 -0.0551 0.2713  14  ARG D CZ  
4518 N NH1 . ARG F 14  ? 2.0487 1.9632 2.0379 -0.0872 -0.0373 0.2699  14  ARG D NH1 
4519 N NH2 . ARG F 14  ? 2.0075 1.8497 1.9074 -0.0809 -0.0421 0.2901  14  ARG D NH2 
4520 N N   . THR F 15  ? 1.6994 1.5609 1.6826 -0.0801 -0.2378 0.1650  15  THR D N   
4521 C CA  . THR F 15  ? 1.5903 1.4832 1.6127 -0.0823 -0.2486 0.1473  15  THR D CA  
4522 C C   . THR F 15  ? 1.5761 1.4423 1.5732 -0.0775 -0.2896 0.1273  15  THR D C   
4523 O O   . THR F 15  ? 1.5242 1.4034 1.5355 -0.0764 -0.2998 0.1121  15  THR D O   
4524 C CB  . THR F 15  ? 1.3932 1.3531 1.5067 -0.0975 -0.2443 0.1471  15  THR D CB  
4525 O OG1 . THR F 15  ? 1.3716 1.3553 1.5039 -0.1002 -0.2033 0.1642  15  THR D OG1 
4526 C CG2 . THR F 15  ? 1.3245 1.3173 1.4801 -0.1009 -0.2602 0.1281  15  THR D CG2 
4527 N N   . ALA F 16  ? 1.6443 1.4723 1.6027 -0.0746 -0.3127 0.1277  16  ALA D N   
4528 C CA  . ALA F 16  ? 1.7151 1.5079 1.6352 -0.0679 -0.3493 0.1108  16  ALA D CA  
4529 C C   . ALA F 16  ? 1.8053 1.5515 1.6521 -0.0532 -0.3375 0.1104  16  ALA D C   
4530 O O   . ALA F 16  ? 1.7995 1.5320 1.6272 -0.0473 -0.3546 0.0946  16  ALA D O   
4531 C CB  . ALA F 16  ? 1.7446 1.5072 1.6398 -0.0681 -0.3740 0.1134  16  ALA D CB  
4532 N N   . HIS F 17  ? 1.8854 1.6062 1.6900 -0.0475 -0.3087 0.1284  17  HIS D N   
4533 C CA  . HIS F 17  ? 1.9759 1.6465 1.7028 -0.0327 -0.2969 0.1306  17  HIS D CA  
4534 C C   . HIS F 17  ? 1.9024 1.5887 1.6357 -0.0282 -0.2771 0.1245  17  HIS D C   
4535 O O   . HIS F 17  ? 1.9621 1.6195 1.6541 -0.0183 -0.2882 0.1121  17  HIS D O   
4536 C CB  . HIS F 17  ? 2.0670 1.7126 1.7534 -0.0290 -0.2692 0.1525  17  HIS D CB  
4537 C CG  . HIS F 17  ? 2.1904 1.7894 1.8000 -0.0140 -0.2520 0.1563  17  HIS D CG  
4538 N ND1 . HIS F 17  ? 2.2386 1.8056 1.8046 -0.0036 -0.2701 0.1404  17  HIS D ND1 
4539 C CD2 . HIS F 17  ? 2.2595 1.8397 1.8290 -0.0077 -0.2181 0.1737  17  HIS D CD2 
4540 C CE1 . HIS F 17  ? 2.3079 1.8377 1.8096 0.0089  -0.2484 0.1475  17  HIS D CE1 
4541 N NE2 . HIS F 17  ? 2.3260 1.8634 1.8283 0.0067  -0.2165 0.1678  17  HIS D NE2 
4542 N N   . LEU F 18  ? 1.7374 1.4696 1.5232 -0.0355 -0.2480 0.1334  18  LEU D N   
4543 C CA  . LEU F 18  ? 1.6074 1.3626 1.4111 -0.0331 -0.2284 0.1283  18  LEU D CA  
4544 C C   . LEU F 18  ? 1.5176 1.2810 1.3389 -0.0334 -0.2590 0.1058  18  LEU D C   
4545 O O   . LEU F 18  ? 1.5222 1.2681 1.3129 -0.0241 -0.2555 0.0973  18  LEU D O   
4546 C CB  . LEU F 18  ? 1.4959 1.3075 1.3683 -0.0443 -0.1995 0.1398  18  LEU D CB  
4547 C CG  . LEU F 18  ? 1.4187 1.2755 1.3415 -0.0479 -0.1816 0.1349  18  LEU D CG  
4548 C CD1 . LEU F 18  ? 1.2957 1.2044 1.2978 -0.0619 -0.2035 0.1236  18  LEU D CD1 
4549 C CD2 . LEU F 18  ? 1.4913 1.3211 1.3701 -0.0354 -0.1805 0.1239  18  LEU D CD2 
4550 N N   . TYR F 19  ? 1.4815 1.2703 1.3506 -0.0439 -0.2893 0.0960  19  TYR D N   
4551 C CA  . TYR F 19  ? 1.4866 1.2823 1.3715 -0.0449 -0.3212 0.0748  19  TYR D CA  
4552 C C   . TYR F 19  ? 1.6597 1.3959 1.4693 -0.0322 -0.3442 0.0651  19  TYR D C   
4553 O O   . TYR F 19  ? 1.6774 1.4041 1.4722 -0.0266 -0.3542 0.0513  19  TYR D O   
4554 C CB  . TYR F 19  ? 1.3636 1.1969 1.3117 -0.0583 -0.3503 0.0668  19  TYR D CB  
4555 C CG  . TYR F 19  ? 1.2188 1.1176 1.2507 -0.0719 -0.3348 0.0708  19  TYR D CG  
4556 C CD1 . TYR F 19  ? 1.1585 1.0793 1.2064 -0.0722 -0.2954 0.0834  19  TYR D CD1 
4557 C CD2 . TYR F 19  ? 1.1581 1.0975 1.2533 -0.0842 -0.3599 0.0617  19  TYR D CD2 
4558 C CE1 . TYR F 19  ? 1.0774 1.0582 1.2019 -0.0847 -0.2815 0.0871  19  TYR D CE1 
4559 C CE2 . TYR F 19  ? 1.0929 1.0925 1.2646 -0.0966 -0.3463 0.0651  19  TYR D CE2 
4560 C CZ  . TYR F 19  ? 1.0628 1.0828 1.2489 -0.0969 -0.3071 0.0779  19  TYR D CZ  
4561 O OH  . TYR F 19  ? 1.0144 1.0948 1.2770 -0.1094 -0.2936 0.0813  19  TYR D OH  
4562 N N   . ARG F 20  ? 1.8093 1.5057 1.5723 -0.0280 -0.3533 0.0721  20  ARG D N   
4563 C CA  . ARG F 20  ? 1.9118 1.5494 1.5997 -0.0157 -0.3743 0.0640  20  ARG D CA  
4564 C C   . ARG F 20  ? 1.9373 1.5482 1.5758 -0.0029 -0.3539 0.0627  20  ARG D C   
4565 O O   . ARG F 20  ? 1.9927 1.5828 1.6052 0.0037  -0.3732 0.0471  20  ARG D O   
4566 C CB  . ARG F 20  ? 1.9968 1.5944 1.6369 -0.0121 -0.3777 0.0762  20  ARG D CB  
4567 C CG  . ARG F 20  ? 1.9831 1.5855 1.6472 -0.0202 -0.4129 0.0706  20  ARG D CG  
4568 C CD  . ARG F 20  ? 2.1205 1.6677 1.7174 -0.0126 -0.4243 0.0775  20  ARG D CD  
4569 N NE  . ARG F 20  ? 2.1811 1.7388 1.7991 -0.0204 -0.4187 0.0927  20  ARG D NE  
4570 C CZ  . ARG F 20  ? 2.3396 1.8840 1.9323 -0.0181 -0.3885 0.1126  20  ARG D CZ  
4571 N NH1 . ARG F 20  ? 2.4797 2.0001 2.0243 -0.0078 -0.3605 0.1197  20  ARG D NH1 
4572 N NH2 . ARG F 20  ? 2.3482 1.9033 1.9636 -0.0260 -0.3864 0.1254  20  ARG D NH2 
4573 N N   . SER F 21  ? 1.8665 1.4794 1.4940 0.0005  -0.3149 0.0787  21  SER D N   
4574 C CA  . SER F 21  ? 1.8066 1.3972 1.3900 0.0128  -0.2922 0.0785  21  SER D CA  
4575 C C   . SER F 21  ? 1.7606 1.3830 1.3838 0.0109  -0.2931 0.0645  21  SER D C   
4576 O O   . SER F 21  ? 1.8204 1.4144 1.4039 0.0208  -0.3024 0.0524  21  SER D O   
4577 C CB  . SER F 21  ? 1.7986 1.3897 1.3673 0.0159  -0.2493 0.0992  21  SER D CB  
4578 O OG  . SER F 21  ? 1.7243 1.3710 1.3657 0.0031  -0.2309 0.1083  21  SER D OG  
4579 N N   . ILE F 22  ? 1.6252 1.3056 1.3257 -0.0017 -0.2836 0.0663  22  ILE D N   
4580 C CA  . ILE F 22  ? 1.5504 1.2642 1.2934 -0.0048 -0.2853 0.0535  22  ILE D CA  
4581 C C   . ILE F 22  ? 1.5834 1.2778 1.3113 -0.0025 -0.3250 0.0332  22  ILE D C   
4582 O O   . ILE F 22  ? 1.5615 1.2456 1.2728 0.0042  -0.3278 0.0220  22  ILE D O   
4583 C CB  . ILE F 22  ? 1.3792 1.1599 1.2133 -0.0209 -0.2810 0.0552  22  ILE D CB  
4584 C CG1 . ILE F 22  ? 1.3246 1.1316 1.1809 -0.0232 -0.2381 0.0736  22  ILE D CG1 
4585 C CG2 . ILE F 22  ? 1.2940 1.1048 1.1698 -0.0251 -0.2953 0.0385  22  ILE D CG2 
4586 C CD1 . ILE F 22  ? 1.3556 1.1423 1.1702 -0.0109 -0.2084 0.0775  22  ILE D CD1 
4587 N N   . TRP F 23  ? 1.6529 1.3426 1.3874 -0.0081 -0.3561 0.0284  23  TRP D N   
4588 C CA  . TRP F 23  ? 1.7400 1.4095 1.4581 -0.0062 -0.3958 0.0099  23  TRP D CA  
4589 C C   . TRP F 23  ? 1.8742 1.4834 1.5083 0.0101  -0.3973 0.0056  23  TRP D C   
4590 O O   . TRP F 23  ? 1.9089 1.5105 1.5323 0.0148  -0.4070 -0.0079 23  TRP D O   
4591 C CB  . TRP F 23  ? 1.7396 1.4056 1.4662 -0.0128 -0.4256 0.0084  23  TRP D CB  
4592 C CG  . TRP F 23  ? 1.7771 1.4215 1.4850 -0.0107 -0.4668 -0.0102 23  TRP D CG  
4593 C CD1 . TRP F 23  ? 1.8732 1.4633 1.5147 -0.0013 -0.4880 -0.0144 23  TRP D CD1 
4594 C CD2 . TRP F 23  ? 1.7597 1.4366 1.5155 -0.0183 -0.4918 -0.0272 23  TRP D CD2 
4595 N NE1 . TRP F 23  ? 1.8909 1.4776 1.5363 -0.0026 -0.5249 -0.0330 23  TRP D NE1 
4596 C CE2 . TRP F 23  ? 1.8257 1.4654 1.5409 -0.0130 -0.5280 -0.0411 23  TRP D CE2 
4597 C CE3 . TRP F 23  ? 1.6919 1.4262 1.5211 -0.0292 -0.4873 -0.0318 23  TRP D CE3 
4598 C CZ2 . TRP F 23  ? 1.8156 1.4769 1.5661 -0.0177 -0.5487 -0.0576 23  TRP D CZ2 
4599 C CZ3 . TRP F 23  ? 1.6827 1.4356 1.5419 -0.0347 -0.5185 -0.0496 23  TRP D CZ3 
4600 C CH2 . TRP F 23  ? 1.7353 1.4554 1.5605 -0.0272 -0.5310 -0.0595 23  TRP D CH2 
4601 N N   . HIS F 24  ? 1.9646 1.5311 1.5389 0.0186  -0.3871 0.0172  24  HIS D N   
4602 C CA  . HIS F 24  ? 2.0738 1.5807 1.5653 0.0342  -0.3914 0.0127  24  HIS D CA  
4603 C C   . HIS F 24  ? 2.1691 1.6737 1.6469 0.0424  -0.3723 0.0075  24  HIS D C   
4604 O O   . HIS F 24  ? 2.2576 1.7365 1.7042 0.0497  -0.3914 -0.0075 24  HIS D O   
4605 C CB  . HIS F 24  ? 2.1123 1.5797 1.5451 0.0421  -0.3737 0.0291  24  HIS D CB  
4606 C CG  . HIS F 24  ? 2.2098 1.6153 1.5567 0.0577  -0.3813 0.0240  24  HIS D CG  
4607 N ND1 . HIS F 24  ? 2.2763 1.6441 1.5840 0.0610  -0.4156 0.0156  24  HIS D ND1 
4608 C CD2 . HIS F 24  ? 2.2693 1.6444 1.5625 0.0711  -0.3598 0.0256  24  HIS D CD2 
4609 C CE1 . HIS F 24  ? 2.3902 1.7068 1.6233 0.0756  -0.4146 0.0124  24  HIS D CE1 
4610 N NE2 . HIS F 24  ? 2.3796 1.6996 1.6024 0.0821  -0.3810 0.0182  24  HIS D NE2 
4611 N N   . LYS F 25  ? 2.1346 1.6656 1.6353 0.0415  -0.3346 0.0201  25  LYS D N   
4612 C CA  . LYS F 25  ? 2.0827 1.6183 1.5798 0.0482  -0.3148 0.0157  25  LYS D CA  
4613 C C   . LYS F 25  ? 2.0116 1.5684 1.5463 0.0428  -0.3419 -0.0032 25  LYS D C   
4614 O O   . LYS F 25  ? 2.0558 1.5815 1.5515 0.0516  -0.3577 -0.0164 25  LYS D O   
4615 C CB  . LYS F 25  ? 1.9904 1.5718 1.5375 0.0422  -0.2769 0.0292  25  LYS D CB  
4616 C CG  . LYS F 25  ? 1.9846 1.5468 1.4914 0.0501  -0.2407 0.0476  25  LYS D CG  
4617 C CD  . LYS F 25  ? 1.9970 1.5242 1.4611 0.0519  -0.2514 0.0557  25  LYS D CD  
4618 C CE  . LYS F 25  ? 2.0307 1.5380 1.4529 0.0594  -0.2161 0.0748  25  LYS D CE  
4619 N NZ  . LYS F 25  ? 2.0771 1.5371 1.4401 0.0646  -0.2309 0.0795  25  LYS D NZ  
4620 N N   . TYR F 26  ? 1.9086 1.5199 1.5210 0.0279  -0.3471 -0.0039 26  TYR D N   
4621 C CA  . TYR F 26  ? 1.8483 1.4912 1.5084 0.0210  -0.3658 -0.0194 26  TYR D CA  
4622 C C   . TYR F 26  ? 1.9008 1.5067 1.5220 0.0264  -0.4047 -0.0374 26  TYR D C   
4623 O O   . TYR F 26  ? 1.9602 1.5564 1.5682 0.0320  -0.4100 -0.0491 26  TYR D O   
4624 C CB  . TYR F 26  ? 1.7432 1.4479 1.4896 0.0036  -0.3697 -0.0171 26  TYR D CB  
4625 C CG  . TYR F 26  ? 1.6716 1.4148 1.4745 -0.0055 -0.3906 -0.0326 26  TYR D CG  
4626 C CD1 . TYR F 26  ? 1.6338 1.3998 1.4607 -0.0051 -0.3741 -0.0360 26  TYR D CD1 
4627 C CD2 . TYR F 26  ? 1.6487 1.4062 1.4815 -0.0148 -0.4273 -0.0434 26  TYR D CD2 
4628 C CE1 . TYR F 26  ? 1.5735 1.3757 1.4533 -0.0143 -0.3945 -0.0497 26  TYR D CE1 
4629 C CE2 . TYR F 26  ? 1.5730 1.3660 1.4568 -0.0237 -0.4479 -0.0572 26  TYR D CE2 
4630 C CZ  . TYR F 26  ? 1.5210 1.3370 1.4292 -0.0238 -0.4317 -0.0602 26  TYR D CZ  
4631 O OH  . TYR F 26  ? 1.4241 1.2762 1.3836 -0.0331 -0.4521 -0.0733 26  TYR D OH  
4632 N N   . THR F 27  ? 1.9094 1.4907 1.5065 0.0259  -0.4306 -0.0391 27  THR D N   
4633 C CA  . THR F 27  ? 1.9530 1.4964 1.5090 0.0315  -0.4678 -0.0555 27  THR D CA  
4634 C C   . THR F 27  ? 2.0557 1.5404 1.5292 0.0486  -0.4640 -0.0596 27  THR D C   
4635 O O   . THR F 27  ? 2.0685 1.5357 1.5234 0.0531  -0.4853 -0.0753 27  THR D O   
4636 C CB  . THR F 27  ? 2.0445 1.5773 1.5974 0.0264  -0.4991 -0.0575 27  THR D CB  
4637 O OG1 . THR F 27  ? 2.1197 1.6212 1.6279 0.0323  -0.4842 -0.0425 27  THR D OG1 
4638 C CG2 . THR F 27  ? 1.9452 1.5370 1.5821 0.0095  -0.5103 -0.0587 27  THR D CG2 
4639 N N   . GLU F 28  ? 2.1576 1.6130 1.5828 0.0580  -0.4368 -0.0452 28  GLU D N   
4640 C CA  . GLU F 28  ? 2.3120 1.7152 1.6600 0.0747  -0.4261 -0.0463 28  GLU D CA  
4641 C C   . GLU F 28  ? 2.3492 1.7641 1.7066 0.0792  -0.4097 -0.0527 28  GLU D C   
4642 O O   . GLU F 28  ? 2.4239 1.7986 1.7253 0.0922  -0.4113 -0.0605 28  GLU D O   
4643 C CB  . GLU F 28  ? 2.4051 1.7859 1.7119 0.0816  -0.3957 -0.0275 28  GLU D CB  
4644 C CG  . GLU F 28  ? 2.5298 1.8583 1.7703 0.0891  -0.4132 -0.0259 28  GLU D CG  
4645 C CD  . GLU F 28  ? 2.5719 1.9053 1.8350 0.0797  -0.4528 -0.0343 28  GLU D CD  
4646 O OE1 . GLU F 28  ? 2.6438 1.9315 1.8514 0.0869  -0.4767 -0.0403 28  GLU D OE1 
4647 O OE2 . GLU F 28  ? 2.5309 1.9134 1.8660 0.0655  -0.4601 -0.0349 28  GLU D OE2 
4648 N N   . TRP F 29  ? 2.2763 1.7462 1.7047 0.0686  -0.3939 -0.0493 29  TRP D N   
4649 C CA  . TRP F 29  ? 2.2312 1.7200 1.6811 0.0703  -0.3820 -0.0563 29  TRP D CA  
4650 C C   . TRP F 29  ? 2.2457 1.7413 1.7170 0.0655  -0.4183 -0.0758 29  TRP D C   
4651 O O   . TRP F 29  ? 2.3094 1.7850 1.7545 0.0738  -0.4213 -0.0863 29  TRP D O   
4652 C CB  . TRP F 29  ? 2.1322 1.6789 1.6523 0.0600  -0.3526 -0.0453 29  TRP D CB  
4653 C CG  . TRP F 29  ? 2.0692 1.6409 1.6198 0.0601  -0.3415 -0.0523 29  TRP D CG  
4654 C CD1 . TRP F 29  ? 2.1057 1.6563 1.6193 0.0728  -0.3178 -0.0518 29  TRP D CD1 
4655 C CD2 . TRP F 29  ? 1.9778 1.6012 1.6032 0.0468  -0.3530 -0.0603 29  TRP D CD2 
4656 N NE1 . TRP F 29  ? 2.0698 1.6544 1.6300 0.0683  -0.3146 -0.0592 29  TRP D NE1 
4657 C CE2 . TRP F 29  ? 1.9870 1.6168 1.6162 0.0522  -0.3358 -0.0642 29  TRP D CE2 
4658 C CE3 . TRP F 29  ? 1.8960 1.5610 1.5852 0.0310  -0.3764 -0.0647 29  TRP D CE3 
4659 C CZ2 . TRP F 29  ? 1.9029 1.5788 1.5971 0.0419  -0.3414 -0.0718 29  TRP D CZ2 
4660 C CZ3 . TRP F 29  ? 1.8328 1.5444 1.5864 0.0208  -0.3818 -0.0725 29  TRP D CZ3 
4661 C CH2 . TRP F 29  ? 1.8361 1.5526 1.5917 0.0261  -0.3644 -0.0756 29  TRP D CH2 
4662 N N   . LEU F 30  ? 2.2118 1.7354 1.7302 0.0523  -0.4459 -0.0807 30  LEU D N   
4663 C CA  . LEU F 30  ? 2.2435 1.7802 1.7900 0.0458  -0.4811 -0.0989 30  LEU D CA  
4664 C C   . LEU F 30  ? 2.3588 1.8400 1.8380 0.0568  -0.5089 -0.1122 30  LEU D C   
4665 O O   . LEU F 30  ? 2.3510 1.8338 1.8396 0.0549  -0.5340 -0.1277 30  LEU D O   
4666 C CB  . LEU F 30  ? 2.2250 1.7994 1.8296 0.0303  -0.5070 -0.1016 30  LEU D CB  
4667 C CG  . LEU F 30  ? 2.2186 1.8460 1.8898 0.0176  -0.4885 -0.0887 30  LEU D CG  
4668 C CD1 . LEU F 30  ? 2.2243 1.8707 1.9098 0.0202  -0.4490 -0.0789 30  LEU D CD1 
4669 C CD2 . LEU F 30  ? 2.2614 1.8766 1.9173 0.0167  -0.4870 -0.0770 30  LEU D CD2 
4670 N N   . LYS F 31  ? 2.4785 1.9111 1.8908 0.0675  -0.5064 -0.1063 31  LYS D N   
4671 C CA  . LYS F 31  ? 2.5906 1.9682 1.9349 0.0791  -0.5301 -0.1187 31  LYS D CA  
4672 C C   . LYS F 31  ? 2.6368 2.0073 1.9695 0.0865  -0.5222 -0.1278 31  LYS D C   
4673 O O   . LYS F 31  ? 2.6527 2.0028 1.9662 0.0895  -0.5493 -0.1434 31  LYS D O   
4674 C CB  . LYS F 31  ? 2.6813 2.0061 1.9501 0.0916  -0.5213 -0.1096 31  LYS D CB  
4675 C CG  . LYS F 31  ? 2.7073 2.0311 1.9804 0.0850  -0.5385 -0.1041 31  LYS D CG  
4676 C CD  . LYS F 31  ? 2.6561 2.0311 2.0068 0.0681  -0.5618 -0.1105 31  LYS D CD  
4677 C CE  . LYS F 31  ? 2.6767 2.0473 2.0341 0.0632  -0.5806 -0.1092 31  LYS D CE  
4678 N NZ  . LYS F 31  ? 2.6345 2.0368 2.0551 0.0567  -0.5827 -0.1170 31  LYS D NZ  
4679 N N   . THR F 32  ? 2.6651 2.0563 2.0151 0.0884  -0.4853 -0.1179 32  THR D N   
4680 C CA  . THR F 32  ? 2.7173 2.1031 2.0568 0.0963  -0.4708 -0.1237 32  THR D CA  
4681 C C   . THR F 32  ? 2.7400 2.1566 2.1300 0.0873  -0.4932 -0.1386 32  THR D C   
4682 O O   . THR F 32  ? 2.7173 2.1230 2.0933 0.0942  -0.4895 -0.1466 32  THR D O   
4683 C CB  . THR F 32  ? 2.5536 1.9625 1.9100 0.0984  -0.4252 -0.1083 32  THR D CB  
4684 O OG1 . THR F 32  ? 2.6350 2.0031 1.9267 0.1110  -0.4042 -0.0970 32  THR D OG1 
4685 C CG2 . THR F 32  ? 2.5440 1.9612 1.9094 0.1032  -0.4112 -0.1146 32  THR D CG2 
4686 N N   . MET F 33  ? 2.8047 2.2584 2.2515 0.0722  -0.5174 -0.1425 33  MET D N   
4687 C CA  . MET F 33  ? 2.8813 2.3687 2.3808 0.0621  -0.5390 -0.1557 33  MET D CA  
4688 C C   . MET F 33  ? 2.9033 2.3934 2.4244 0.0593  -0.5479 -0.1573 33  MET D C   
4689 O O   . MET F 33  ? 2.9291 2.3994 2.4281 0.0610  -0.5543 -0.1531 33  MET D O   
4690 C CB  . MET F 33  ? 2.8443 2.3998 2.4313 0.0459  -0.5271 -0.1485 33  MET D CB  
4691 C CG  . MET F 33  ? 2.8667 2.4418 2.4678 0.0482  -0.4823 -0.1324 33  MET D CG  
4692 S SD  . MET F 33  ? 4.1270 3.6709 3.6811 0.0644  -0.4562 -0.1340 33  MET D SD  
4693 C CE  . MET F 33  ? 1.4726 1.0428 1.0463 0.0652  -0.4055 -0.1129 33  MET D CE  
4694 N N   . PRO F 34  ? 2.8880 2.4032 2.4520 0.0556  -0.5449 -0.1617 34  PRO D N   
4695 C CA  . PRO F 34  ? 2.9093 2.4220 2.4843 0.0557  -0.5497 -0.1626 34  PRO D CA  
4696 C C   . PRO F 34  ? 2.9345 2.4722 2.5472 0.0470  -0.5489 -0.1553 34  PRO D C   
4697 O O   . PRO F 34  ? 2.9482 2.4569 2.5319 0.0523  -0.5578 -0.1556 34  PRO D O   
4698 C CB  . PRO F 34  ? 2.8264 2.3762 2.4537 0.0497  -0.5418 -0.1656 34  PRO D CB  
4699 C CG  . PRO F 34  ? 2.7646 2.3516 2.4301 0.0423  -0.5310 -0.1639 34  PRO D CG  
4700 C CD  . PRO F 34  ? 2.8219 2.3711 2.4274 0.0507  -0.5360 -0.1650 34  PRO D CD  
4701 N N   . ASP F 35  ? 2.9506 2.5405 2.6259 0.0344  -0.5375 -0.1489 35  ASP D N   
4702 C CA  . ASP F 35  ? 2.9619 2.5790 2.6756 0.0263  -0.5334 -0.1423 35  ASP D CA  
4703 C C   . ASP F 35  ? 2.9571 2.6220 2.7237 0.0148  -0.5207 -0.1350 35  ASP D C   
4704 O O   . ASP F 35  ? 2.9704 2.6457 2.7510 0.0104  -0.5196 -0.1292 35  ASP D O   
4705 C CB  . ASP F 35  ? 2.8889 2.5307 2.6398 0.0225  -0.5269 -0.1431 35  ASP D CB  
4706 C CG  . ASP F 35  ? 2.8098 2.4702 2.5868 0.0171  -0.5232 -0.1377 35  ASP D CG  
4707 O OD1 . ASP F 35  ? 2.8168 2.4585 2.5720 0.0187  -0.5307 -0.1347 35  ASP D OD1 
4708 O OD2 . ASP F 35  ? 2.7421 2.4340 2.5578 0.0116  -0.5124 -0.1365 35  ASP D OD2 
4709 N N   . ASP F 40  ? 2.8945 2.6619 2.8253 -0.0097 -0.4964 -0.1091 40  ASP D N   
4710 C CA  . ASP F 40  ? 2.9427 2.6998 2.8373 -0.0098 -0.4968 -0.1089 40  ASP D CA  
4711 C C   . ASP F 40  ? 2.8578 2.6296 2.7674 -0.0151 -0.4933 -0.1026 40  ASP D C   
4712 O O   . ASP F 40  ? 2.8842 2.6203 2.7560 -0.0111 -0.5094 -0.1013 40  ASP D O   
4713 C CB  . ASP F 40  ? 3.1029 2.8036 2.9413 -0.0001 -0.5198 -0.1121 40  ASP D CB  
4714 C CG  . ASP F 40  ? 3.2570 2.9125 3.0417 0.0068  -0.5360 -0.1136 40  ASP D CG  
4715 O OD1 . ASP F 40  ? 3.3188 2.9617 3.0876 0.0062  -0.5419 -0.1089 40  ASP D OD1 
4716 O OD2 . ASP F 40  ? 3.3016 2.9324 3.0560 0.0132  -0.5423 -0.1192 40  ASP D OD2 
4717 N N   . LEU F 41  ? 2.7612 2.5830 2.7211 -0.0238 -0.4717 -0.0982 41  LEU D N   
4718 C CA  . LEU F 41  ? 2.7053 2.5409 2.6805 -0.0289 -0.4686 -0.0919 41  LEU D CA  
4719 C C   . LEU F 41  ? 2.6406 2.5170 2.6537 -0.0360 -0.4503 -0.0887 41  LEU D C   
4720 O O   . LEU F 41  ? 2.6970 2.5619 2.6976 -0.0354 -0.4578 -0.0883 41  LEU D O   
4721 C CB  . LEU F 41  ? 2.6349 2.4867 2.6309 -0.0322 -0.4619 -0.0876 41  LEU D CB  
4722 C CG  . LEU F 41  ? 2.6346 2.4527 2.6024 -0.0270 -0.4780 -0.0885 41  LEU D CG  
4723 C CD1 . LEU F 41  ? 2.6456 2.4321 2.5917 -0.0192 -0.4916 -0.0950 41  LEU D CD1 
4724 C CD2 . LEU F 41  ? 2.5959 2.4251 2.5976 -0.0292 -0.4766 -0.0845 41  LEU D CD2 
4725 N N   . LYS F 42  ? 2.5241 2.4357 2.5809 -0.0406 -0.4329 -0.0864 42  LYS D N   
4726 C CA  . LYS F 42  ? 2.3955 2.3454 2.4900 -0.0473 -0.4143 -0.0821 42  LYS D CA  
4727 C C   . LYS F 42  ? 2.3455 2.3035 2.4396 -0.0475 -0.4085 -0.0855 42  LYS D C   
4728 O O   . LYS F 42  ? 2.3299 2.3165 2.4432 -0.0528 -0.3940 -0.0826 42  LYS D O   
4729 C CB  . LYS F 42  ? 2.2961 2.2618 2.4326 -0.0484 -0.4070 -0.0793 42  LYS D CB  
4730 C CG  . LYS F 42  ? 2.2178 2.1760 2.3592 -0.0479 -0.4123 -0.0763 42  LYS D CG  
4731 C CD  . LYS F 42  ? 2.1515 2.0990 2.3079 -0.0431 -0.4181 -0.0789 42  LYS D CD  
4732 C CE  . LYS F 42  ? 2.1477 2.0608 2.2733 -0.0360 -0.4361 -0.0851 42  LYS D CE  
4733 N NZ  . LYS F 42  ? 2.1476 2.0559 2.2579 -0.0343 -0.4370 -0.0895 42  LYS D NZ  
4734 N N   . LEU F 43  ? 2.3139 2.2461 2.3872 -0.0413 -0.4202 -0.0917 43  LEU D N   
4735 C CA  . LEU F 43  ? 2.2449 2.1775 2.3103 -0.0402 -0.4180 -0.0960 43  LEU D CA  
4736 C C   . LEU F 43  ? 2.3067 2.2279 2.3547 -0.0400 -0.4263 -0.0954 43  LEU D C   
4737 O O   . LEU F 43  ? 2.3000 2.2393 2.3653 -0.0431 -0.4186 -0.0945 43  LEU D O   
4738 C CB  . LEU F 43  ? 2.1530 2.0471 2.1795 -0.0324 -0.4350 -0.1026 43  LEU D CB  
4739 C CG  . LEU F 43  ? 2.0618 1.9262 2.0579 -0.0281 -0.4493 -0.1029 43  LEU D CG  
4740 C CD1 . LEU F 43  ? 2.1183 1.9292 2.0592 -0.0185 -0.4729 -0.1089 43  LEU D CD1 
4741 C CD2 . LEU F 43  ? 2.0392 1.8938 2.0543 -0.0246 -0.4570 -0.1034 43  LEU D CD2 
4742 N N   . PHE F 44  ? 2.3623 2.2434 2.3728 -0.0347 -0.4476 -0.0958 44  PHE D N   
4743 C CA  . PHE F 44  ? 2.3949 2.2440 2.3708 -0.0305 -0.4646 -0.0967 44  PHE D CA  
4744 C C   . PHE F 44  ? 2.2808 2.1612 2.2894 -0.0378 -0.4546 -0.0904 44  PHE D C   
4745 O O   . PHE F 44  ? 2.3497 2.2128 2.3366 -0.0349 -0.4641 -0.0919 44  PHE D O   
4746 C CB  . PHE F 44  ? 2.5062 2.2991 2.4206 -0.0223 -0.4890 -0.0974 44  PHE D CB  
4747 C CG  . PHE F 44  ? 2.5826 2.3479 2.4587 -0.0183 -0.5008 -0.0971 44  PHE D CG  
4748 C CD1 . PHE F 44  ? 2.6262 2.3764 2.4801 -0.0127 -0.5036 -0.1041 44  PHE D CD1 
4749 C CD2 . PHE F 44  ? 2.6192 2.3817 2.4885 -0.0214 -0.5055 -0.0887 44  PHE D CD2 
4750 C CE1 . PHE F 44  ? 2.6982 2.4242 2.5136 -0.0082 -0.5118 -0.1039 44  PHE D CE1 
4751 C CE2 . PHE F 44  ? 2.7210 2.4602 2.5519 -0.0174 -0.5141 -0.0869 44  PHE D CE2 
4752 C CZ  . PHE F 44  ? 2.7744 2.4954 2.5772 -0.0104 -0.5162 -0.0949 44  PHE D CZ  
4753 N N   . LEU F 45  ? 2.0950 2.0198 2.1523 -0.0464 -0.4349 -0.0834 45  LEU D N   
4754 C CA  . LEU F 45  ? 1.9504 1.9133 2.0481 -0.0541 -0.4197 -0.0769 45  LEU D CA  
4755 C C   . LEU F 45  ? 1.8083 1.8145 1.9452 -0.0586 -0.3932 -0.0779 45  LEU D C   
4756 O O   . LEU F 45  ? 1.7674 1.8023 1.9261 -0.0620 -0.3724 -0.0765 45  LEU D O   
4757 C CB  . LEU F 45  ? 1.9170 1.9021 2.0411 -0.0604 -0.4108 -0.0680 45  LEU D CB  
4758 C CG  . LEU F 45  ? 2.0063 1.9478 2.0889 -0.0568 -0.4372 -0.0648 45  LEU D CG  
4759 C CD1 . LEU F 45  ? 1.9678 1.9321 2.0796 -0.0639 -0.4294 -0.0547 45  LEU D CD1 
4760 C CD2 . LEU F 45  ? 2.0978 2.0030 2.1376 -0.0522 -0.4583 -0.0651 45  LEU D CD2 
4761 N N   . SER F 46  ? 1.7385 1.7457 1.8774 -0.0581 -0.3944 -0.0802 46  SER D N   
4762 C CA  . SER F 46  ? 1.6189 1.6627 1.7892 -0.0621 -0.3708 -0.0806 46  SER D CA  
4763 C C   . SER F 46  ? 1.5514 1.6089 1.7411 -0.0649 -0.3687 -0.0777 46  SER D C   
4764 O O   . SER F 46  ? 1.5868 1.6121 1.7497 -0.0606 -0.3923 -0.0798 46  SER D O   
4765 C CB  . SER F 46  ? 1.6199 1.6432 1.7666 -0.0565 -0.3778 -0.0888 46  SER D CB  
4766 O OG  . SER F 46  ? 1.5981 1.6556 1.7716 -0.0608 -0.3548 -0.0878 46  SER D OG  
4767 N N   . GLN F 47  ? 1.4826 1.5853 1.7121 -0.0715 -0.3399 -0.0727 47  GLN D N   
4768 C CA  . GLN F 47  ? 1.4921 1.6152 1.7490 -0.0750 -0.3328 -0.0685 47  GLN D CA  
4769 C C   . GLN F 47  ? 1.5426 1.6327 1.7747 -0.0687 -0.3577 -0.0762 47  GLN D C   
4770 O O   . GLN F 47  ? 1.5659 1.6482 1.7990 -0.0683 -0.3706 -0.0739 47  GLN D O   
4771 C CB  . GLN F 47  ? 1.4704 1.6374 1.7569 -0.0803 -0.2980 -0.0646 47  GLN D CB  
4772 C CG  . GLN F 47  ? 1.4759 1.6698 1.7699 -0.0845 -0.2729 -0.0592 47  GLN D CG  
4773 C CD  . GLN F 47  ? 1.5108 1.7172 1.8305 -0.0844 -0.2580 -0.0569 47  GLN D CD  
4774 O OE1 . GLN F 47  ? 1.6389 1.8394 1.9559 -0.0822 -0.2603 -0.0609 47  GLN D OE1 
4775 N NE2 . GLN F 47  ? 1.4456 1.6660 1.7885 -0.0860 -0.2443 -0.0506 47  GLN D NE2 
4776 N N   . LYS F 48  ? 1.5547 1.6233 1.7601 -0.0631 -0.3650 -0.0851 48  LYS D N   
4777 C CA  . LYS F 48  ? 1.5583 1.5909 1.7301 -0.0550 -0.3871 -0.0948 48  LYS D CA  
4778 C C   . LYS F 48  ? 1.5825 1.5657 1.7020 -0.0474 -0.4179 -0.0979 48  LYS D C   
4779 O O   . LYS F 48  ? 1.6021 1.5732 1.7011 -0.0397 -0.3939 -0.0909 48  LYS D O   
4780 C CB  . LYS F 48  ? 1.5508 1.5603 1.6938 -0.0494 -0.3922 -0.1029 48  LYS D CB  
4781 C CG  . LYS F 48  ? 1.4560 1.4997 1.6263 -0.0557 -0.3670 -0.0979 48  LYS D CG  
4782 C CD  . LYS F 48  ? 1.4417 1.4566 1.5798 -0.0500 -0.3779 -0.1038 48  LYS D CD  
4783 C CE  . LYS F 48  ? 1.4740 1.4511 1.5776 -0.0414 -0.3974 -0.1137 48  LYS D CE  
4784 N NZ  . LYS F 48  ? 1.4999 1.4541 1.5784 -0.0365 -0.4043 -0.1182 48  LYS D NZ  
4785 N N   . TYR F 49  ? 1.5915 1.5430 1.6733 -0.0436 -0.4311 -0.0981 49  TYR D N   
4786 C CA  . TYR F 49  ? 1.6656 1.5584 1.6725 -0.0309 -0.4374 -0.0957 49  TYR D CA  
4787 C C   . TYR F 49  ? 1.5954 1.4970 1.6053 -0.0300 -0.4010 -0.0768 49  TYR D C   
4788 O O   . TYR F 49  ? 1.6392 1.5052 1.5962 -0.0173 -0.3758 -0.0685 49  TYR D O   
4789 C CB  . TYR F 49  ? 1.7786 1.6377 1.7492 -0.0289 -0.4684 -0.1025 49  TYR D CB  
4790 C CG  . TYR F 49  ? 1.8897 1.7488 1.8641 -0.0265 -0.4629 -0.1095 49  TYR D CG  
4791 C CD1 . TYR F 49  ? 2.0070 1.8249 1.9320 -0.0160 -0.4753 -0.1197 49  TYR D CD1 
4792 C CD2 . TYR F 49  ? 1.8971 1.7955 1.9190 -0.0341 -0.4442 -0.1053 49  TYR D CD2 
4793 C CE1 . TYR F 49  ? 2.0416 1.8614 1.9733 -0.0147 -0.4709 -0.1242 49  TYR D CE1 
4794 C CE2 . TYR F 49  ? 1.9511 1.8492 1.9728 -0.0321 -0.4394 -0.1099 49  TYR D CE2 
4795 C CZ  . TYR F 49  ? 2.0182 1.8787 1.9988 -0.0231 -0.4536 -0.1188 49  TYR D CZ  
4796 O OH  . TYR F 49  ? 2.0228 1.8845 2.0061 -0.0218 -0.4493 -0.1221 49  TYR D OH  
4797 N N   . ILE F 50  ? 1.4782 1.4279 1.5505 -0.0436 -0.3987 -0.0702 50  ILE D N   
4798 C CA  . ILE F 50  ? 1.4131 1.3770 1.4967 -0.0448 -0.3658 -0.0521 50  ILE D CA  
4799 C C   . ILE F 50  ? 1.3796 1.3608 1.4757 -0.0415 -0.3276 -0.0435 50  ILE D C   
4800 O O   . ILE F 50  ? 1.4039 1.3628 1.4630 -0.0324 -0.2975 -0.0308 50  ILE D O   
4801 C CB  . ILE F 50  ? 1.3500 1.3669 1.5050 -0.0612 -0.3729 -0.0482 50  ILE D CB  
4802 C CG1 . ILE F 50  ? 1.3785 1.3826 1.5270 -0.0651 -0.4131 -0.0582 50  ILE D CG1 
4803 C CG2 . ILE F 50  ? 1.3178 1.3449 1.4798 -0.0622 -0.3406 -0.0292 50  ILE D CG2 
4804 C CD1 . ILE F 50  ? 1.3313 1.3798 1.5324 -0.0748 -0.3945 -0.0511 50  ILE D CD1 
4805 N N   . VAL F 51  ? 1.3171 1.3384 1.4656 -0.0490 -0.3294 -0.0506 51  VAL D N   
4806 C CA  . VAL F 51  ? 1.3137 1.3550 1.4799 -0.0466 -0.2961 -0.0443 51  VAL D CA  
4807 C C   . VAL F 51  ? 1.3420 1.3299 1.4352 -0.0289 -0.2831 -0.0459 51  VAL D C   
4808 O O   . VAL F 51  ? 1.3729 1.3548 1.4484 -0.0213 -0.2478 -0.0342 51  VAL D O   
4809 C CB  . VAL F 51  ? 1.2832 1.3753 1.5179 -0.0584 -0.3065 -0.0537 51  VAL D CB  
4810 C CG1 . VAL F 51  ? 1.2986 1.4081 1.5482 -0.0550 -0.2735 -0.0481 51  VAL D CG1 
4811 C CG2 . VAL F 51  ? 1.1941 1.3428 1.5037 -0.0759 -0.3160 -0.0514 51  VAL D CG2 
4812 N N   . LYS F 52  ? 1.3026 1.2523 1.3536 -0.0222 -0.3118 -0.0605 52  LYS D N   
4813 C CA  . LYS F 52  ? 1.3283 1.2238 1.3060 -0.0048 -0.3032 -0.0633 52  LYS D CA  
4814 C C   . LYS F 52  ? 1.3688 1.2269 1.2897 0.0059  -0.2807 -0.0498 52  LYS D C   
4815 O O   . LYS F 52  ? 1.3614 1.2043 1.2526 0.0164  -0.2493 -0.0418 52  LYS D O   
4816 C CB  . LYS F 52  ? 1.4112 1.2688 1.3499 0.0000  -0.3414 -0.0808 52  LYS D CB  
4817 C CG  . LYS F 52  ? 1.5367 1.3358 1.3971 0.0184  -0.3348 -0.0850 52  LYS D CG  
4818 C CD  . LYS F 52  ? 1.5895 1.3654 1.4299 0.0213  -0.3680 -0.1037 52  LYS D CD  
4819 C CE  . LYS F 52  ? 1.7214 1.4387 1.4830 0.0401  -0.3599 -0.1074 52  LYS D CE  
4820 N NZ  . LYS F 52  ? 1.8013 1.5263 1.5626 0.0474  -0.3198 -0.0980 52  LYS D NZ  
4821 N N   . TYR F 53  ? 1.4405 1.2850 1.3474 0.0031  -0.2969 -0.0472 53  TYR D N   
4822 C CA  . TYR F 53  ? 1.5282 1.3385 1.3835 0.0117  -0.2787 -0.0339 53  TYR D CA  
4823 C C   . TYR F 53  ? 1.4903 1.3272 1.3680 0.0105  -0.2362 -0.0157 53  TYR D C   
4824 O O   . TYR F 53  ? 1.4986 1.3058 1.3269 0.0228  -0.2093 -0.0069 53  TYR D O   
4825 C CB  . TYR F 53  ? 1.5669 1.3727 1.4239 0.0048  -0.3035 -0.0332 53  TYR D CB  
4826 C CG  . TYR F 53  ? 1.6578 1.4315 1.4667 0.0118  -0.2862 -0.0185 53  TYR D CG  
4827 C CD1 . TYR F 53  ? 1.6214 1.4263 1.4668 0.0035  -0.2654 -0.0027 53  TYR D CD1 
4828 C CD2 . TYR F 53  ? 1.7746 1.4869 1.5014 0.0266  -0.2908 -0.0203 53  TYR D CD2 
4829 C CE1 . TYR F 53  ? 1.6933 1.4688 1.4946 0.0095  -0.2499 0.0112  53  TYR D CE1 
4830 C CE2 . TYR F 53  ? 1.8432 1.5263 1.5254 0.0328  -0.2753 -0.0065 53  TYR D CE2 
4831 C CZ  . TYR F 53  ? 1.7963 1.5110 1.5158 0.0241  -0.2550 0.0094  53  TYR D CZ  
4832 O OH  . TYR F 53  ? 1.8456 1.5306 1.5200 0.0300  -0.2399 0.0235  53  TYR D OH  
4833 N N   . ILE F 54  ? 1.4542 1.3478 1.4067 -0.0045 -0.2307 -0.0101 54  ILE D N   
4834 C CA  . ILE F 54  ? 1.4834 1.4082 1.4656 -0.0077 -0.1921 0.0072  54  ILE D CA  
4835 C C   . ILE F 54  ? 1.4710 1.3979 1.4457 0.0007  -0.1611 0.0099  54  ILE D C   
4836 O O   . ILE F 54  ? 1.4597 1.3739 1.4058 0.0086  -0.1284 0.0233  54  ILE D O   
4837 C CB  . ILE F 54  ? 1.4611 1.4499 1.5303 -0.0260 -0.1947 0.0102  54  ILE D CB  
4838 C CG1 . ILE F 54  ? 1.4600 1.4467 1.5351 -0.0336 -0.2196 0.0107  54  ILE D CG1 
4839 C CG2 . ILE F 54  ? 1.4667 1.4909 1.5705 -0.0294 -0.1537 0.0270  54  ILE D CG2 
4840 C CD1 . ILE F 54  ? 1.3803 1.4283 1.5389 -0.0513 -0.2248 0.0128  54  ILE D CD1 
4841 N N   . ALA F 55  ? 1.4715 1.4148 1.4720 -0.0010 -0.1715 -0.0026 55  ALA D N   
4842 C CA  . ALA F 55  ? 1.4989 1.4479 1.4984 0.0063  -0.1435 -0.0009 55  ALA D CA  
4843 C C   . ALA F 55  ? 1.5744 1.4631 1.4899 0.0255  -0.1353 -0.0032 55  ALA D C   
4844 O O   . ALA F 55  ? 1.5674 1.4516 1.4653 0.0346  -0.1026 0.0046  55  ALA D O   
4845 C CB  . ALA F 55  ? 1.4494 1.4328 1.5010 -0.0014 -0.1581 -0.0136 55  ALA D CB  
4846 N N   . SER F 56  ? 1.6475 1.4906 1.5113 0.0319  -0.1651 -0.0140 56  SER D N   
4847 C CA  . SER F 56  ? 1.7458 1.5307 1.5297 0.0501  -0.1624 -0.0189 56  SER D CA  
4848 C C   . SER F 56  ? 1.8126 1.5637 1.5397 0.0604  -0.1385 -0.0046 56  SER D C   
4849 O O   . SER F 56  ? 1.8876 1.5925 1.5476 0.0762  -0.1299 -0.0061 56  SER D O   
4850 C CB  . SER F 56  ? 1.7587 1.5072 1.5080 0.0532  -0.2038 -0.0362 56  SER D CB  
4851 O OG  . SER F 56  ? 1.7434 1.4784 1.4802 0.0486  -0.2252 -0.0346 56  SER D OG  
4852 N N   . HIS F 57  ? 1.7797 1.5541 1.5340 0.0514  -0.1281 0.0092  57  HIS D N   
4853 C CA  . HIS F 57  ? 1.8247 1.5709 1.5301 0.0594  -0.1054 0.0243  57  HIS D CA  
4854 C C   . HIS F 57  ? 1.8668 1.6536 1.6126 0.0545  -0.0657 0.0415  57  HIS D C   
4855 O O   . HIS F 57  ? 1.8059 1.6385 1.6152 0.0398  -0.0647 0.0479  57  HIS D O   
4856 C CB  . HIS F 57  ? 1.7959 1.5272 1.4894 0.0538  -0.1289 0.0267  57  HIS D CB  
4857 C CG  . HIS F 57  ? 1.8386 1.5255 1.4850 0.0596  -0.1665 0.0112  57  HIS D CG  
4858 N ND1 . HIS F 57  ? 1.8585 1.5482 1.5196 0.0581  -0.1932 -0.0067 57  HIS D ND1 
4859 C CD2 . HIS F 57  ? 1.8815 1.5205 1.4668 0.0667  -0.1819 0.0111  57  HIS D CD2 
4860 C CE1 . HIS F 57  ? 1.9021 1.5476 1.5130 0.0642  -0.2234 -0.0172 57  HIS D CE1 
4861 N NE2 . HIS F 57  ? 1.9151 1.5290 1.4793 0.0696  -0.2173 -0.0068 57  HIS D NE2 
4862 N N   . ASP F 58  ? 1.9950 1.7658 1.7045 0.0670  -0.0331 0.0489  58  ASP D N   
4863 C CA  . ASP F 58  ? 2.0617 1.8690 1.8053 0.0636  0.0063  0.0655  58  ASP D CA  
4864 C C   . ASP F 58  ? 2.0953 1.9123 1.8485 0.0555  0.0144  0.0817  58  ASP D C   
4865 O O   . ASP F 58  ? 2.0617 1.9266 1.8753 0.0435  0.0309  0.0925  58  ASP D O   
4866 C CB  . ASP F 58  ? 2.1781 1.9582 1.8688 0.0802  0.0383  0.0706  58  ASP D CB  
4867 C CG  . ASP F 58  ? 2.2557 2.0742 1.9815 0.0771  0.0795  0.0875  58  ASP D CG  
4868 O OD1 . ASP F 58  ? 2.3593 2.1560 2.0397 0.0873  0.1074  0.0996  58  ASP D OD1 
4869 O OD2 . ASP F 58  ? 2.2361 2.1073 2.0352 0.0643  0.0840  0.0886  58  ASP D OD2 
4870 N N   . ASP F 59  ? 2.1314 1.9017 1.8237 0.0624  0.0023  0.0833  59  ASP D N   
4871 C CA  . ASP F 59  ? 2.0819 1.8527 1.7737 0.0559  0.0054  0.0977  59  ASP D CA  
4872 C C   . ASP F 59  ? 1.9362 1.7573 1.7067 0.0371  -0.0094 0.0981  59  ASP D C   
4873 O O   . ASP F 59  ? 1.9078 1.7676 1.7236 0.0279  0.0133  0.1119  59  ASP D O   
4874 C CB  . ASP F 59  ? 2.1665 1.8802 1.7878 0.0642  -0.0184 0.0938  59  ASP D CB  
4875 C CG  . ASP F 59  ? 2.2380 1.9159 1.8202 0.0738  -0.0459 0.0739  59  ASP D CG  
4876 O OD1 . ASP F 59  ? 2.2177 1.9189 1.8373 0.0707  -0.0550 0.0614  59  ASP D OD1 
4877 O OD2 . ASP F 59  ? 2.3222 1.9482 1.8360 0.0842  -0.0590 0.0708  59  ASP D OD2 
4878 N N   . ILE F 60  ? 1.8504 1.6711 1.6368 0.0315  -0.0476 0.0824  60  ILE D N   
4879 C CA  . ILE F 60  ? 1.6978 1.5668 1.5598 0.0141  -0.0659 0.0793  60  ILE D CA  
4880 C C   . ILE F 60  ? 1.6533 1.5795 1.5861 0.0056  -0.0457 0.0811  60  ILE D C   
4881 O O   . ILE F 60  ? 1.6172 1.5871 1.6060 -0.0065 -0.0325 0.0918  60  ILE D O   
4882 C CB  . ILE F 60  ? 1.5835 1.4434 1.4497 0.0113  -0.1098 0.0594  60  ILE D CB  
4883 C CG1 . ILE F 60  ? 1.5752 1.3714 1.3616 0.0236  -0.1315 0.0524  60  ILE D CG1 
4884 C CG2 . ILE F 60  ? 1.5092 1.4120 1.4433 -0.0059 -0.1310 0.0576  60  ILE D CG2 
4885 C CD1 . ILE F 60  ? 1.5598 1.3288 1.3096 0.0249  -0.1308 0.0645  60  ILE D CD1 
4886 N N   . ALA F 61  ? 1.6450 1.5698 1.5738 0.0122  -0.0429 0.0709  61  ALA D N   
4887 C CA  . ALA F 61  ? 1.5658 1.5433 1.5623 0.0039  -0.0304 0.0693  61  ALA D CA  
4888 C C   . ALA F 61  ? 1.5611 1.5768 1.5957 -0.0020 0.0071  0.0878  61  ALA D C   
4889 O O   . ALA F 61  ? 1.5087 1.5784 1.6160 -0.0155 0.0112  0.0900  61  ALA D O   
4890 C CB  . ALA F 61  ? 1.5600 1.5212 1.5317 0.0153  -0.0249 0.0592  61  ALA D CB  
4891 N N   . LYS F 62  ? 1.637