data_3U0Z
# 
_entry.id   3U0Z 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3U0Z         
RCSB  RCSB068168   
WWPDB D_1000068168 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1Q43 'HCN2I 443-640 in the presence of cAMP, selenomethionine derivative'   unspecified 
PDB 3OTF 'Structural basis for the cAMP-dependent gating in human HCN4 channel' unspecified 
PDB 3U10 .                                                                      unspecified 
PDB 3U11 .                                                                      unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3U0Z 
_pdbx_database_status.recvd_initial_deposition_date   2011-09-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lolicato, M.'   1  
'Nardini, M.'    2  
'Gazzarrini, S.' 3  
'Moller, S.'     4  
'Bertinetti, D.' 5  
'Herberg, F.W.'  6  
'Bolognesi, M.'  7  
'Martin, H.'     8  
'Fasolini, M.'   9  
'Bertrand, J.A.' 10 
'Arrigoni, C.'   11 
'Thiel, G.'      12 
'Moroni, A.'     13 
# 
_citation.id                        primary 
_citation.title                     
;Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                44811 
_citation.page_last                 44820 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22006928 
_citation.pdbx_database_id_DOI      10.1074/jbc.M111.297606 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lolicato, M.'   1  
primary 'Nardini, M.'    2  
primary 'Gazzarrini, S.' 3  
primary 'Moller, S.'     4  
primary 'Bertinetti, D.' 5  
primary 'Herberg, F.W.'  6  
primary 'Bolognesi, M.'  7  
primary 'Martin, H.'     8  
primary 'Fasolini, M.'   9  
primary 'Bertrand, J.A.' 10 
primary 'Arrigoni, C.'   11 
primary 'Thiel, G.'      12 
primary 'Moroni, A.'     13 
# 
_cell.entry_id           3U0Z 
_cell.length_a           97.670 
_cell.length_b           97.670 
_cell.length_c           113.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3U0Z 
_symmetry.space_group_name_H-M             'I 4' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                79 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1' 24531.117 2  ? ? 
'C-TERMINAL DOMAIN (UNP RESIDUES 390-592)' ? 
2 non-polymer syn "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE"                                           329.206   2  ? ? ? ? 
3 water       nat water                                                                            18.015    49 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Brain cyclic nucleotide-gated channel 1, BCNG-1, Hyperpolarization-activated cation channel 2, HAC-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;QGPSSPMDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILSELNDPLREEIVNFNCRKLVATM
PLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGEICLLTKGRRTASV
RADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;QGPSSPMDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILSELNDPLREEIVNFNCRKLVATM
PLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGEICLLTKGRRTASV
RADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   GLY n 
1 3   PRO n 
1 4   SER n 
1 5   SER n 
1 6   PRO n 
1 7   MET n 
1 8   ASP n 
1 9   SER n 
1 10  SER n 
1 11  ARG n 
1 12  ARG n 
1 13  GLN n 
1 14  TYR n 
1 15  GLN n 
1 16  GLU n 
1 17  LYS n 
1 18  TYR n 
1 19  LYS n 
1 20  GLN n 
1 21  VAL n 
1 22  GLU n 
1 23  GLN n 
1 24  TYR n 
1 25  MET n 
1 26  SER n 
1 27  PHE n 
1 28  HIS n 
1 29  LYS n 
1 30  LEU n 
1 31  PRO n 
1 32  ALA n 
1 33  ASP n 
1 34  MET n 
1 35  ARG n 
1 36  GLN n 
1 37  LYS n 
1 38  ILE n 
1 39  HIS n 
1 40  ASP n 
1 41  TYR n 
1 42  TYR n 
1 43  GLU n 
1 44  HIS n 
1 45  ARG n 
1 46  TYR n 
1 47  GLN n 
1 48  GLY n 
1 49  LYS n 
1 50  ILE n 
1 51  PHE n 
1 52  ASP n 
1 53  GLU n 
1 54  GLU n 
1 55  ASN n 
1 56  ILE n 
1 57  LEU n 
1 58  SER n 
1 59  GLU n 
1 60  LEU n 
1 61  ASN n 
1 62  ASP n 
1 63  PRO n 
1 64  LEU n 
1 65  ARG n 
1 66  GLU n 
1 67  GLU n 
1 68  ILE n 
1 69  VAL n 
1 70  ASN n 
1 71  PHE n 
1 72  ASN n 
1 73  CYS n 
1 74  ARG n 
1 75  LYS n 
1 76  LEU n 
1 77  VAL n 
1 78  ALA n 
1 79  THR n 
1 80  MET n 
1 81  PRO n 
1 82  LEU n 
1 83  PHE n 
1 84  ALA n 
1 85  ASN n 
1 86  ALA n 
1 87  ASP n 
1 88  PRO n 
1 89  ASN n 
1 90  PHE n 
1 91  VAL n 
1 92  THR n 
1 93  ALA n 
1 94  MET n 
1 95  LEU n 
1 96  SER n 
1 97  LYS n 
1 98  LEU n 
1 99  ARG n 
1 100 PHE n 
1 101 GLU n 
1 102 VAL n 
1 103 PHE n 
1 104 GLN n 
1 105 PRO n 
1 106 GLY n 
1 107 ASP n 
1 108 TYR n 
1 109 ILE n 
1 110 ILE n 
1 111 ARG n 
1 112 GLU n 
1 113 GLY n 
1 114 ALA n 
1 115 VAL n 
1 116 GLY n 
1 117 LYS n 
1 118 LYS n 
1 119 MET n 
1 120 TYR n 
1 121 PHE n 
1 122 ILE n 
1 123 GLN n 
1 124 HIS n 
1 125 GLY n 
1 126 VAL n 
1 127 ALA n 
1 128 GLY n 
1 129 VAL n 
1 130 ILE n 
1 131 THR n 
1 132 LYS n 
1 133 SER n 
1 134 SER n 
1 135 LYS n 
1 136 GLU n 
1 137 MET n 
1 138 LYS n 
1 139 LEU n 
1 140 THR n 
1 141 ASP n 
1 142 GLY n 
1 143 SER n 
1 144 TYR n 
1 145 PHE n 
1 146 GLY n 
1 147 GLU n 
1 148 ILE n 
1 149 CYS n 
1 150 LEU n 
1 151 LEU n 
1 152 THR n 
1 153 LYS n 
1 154 GLY n 
1 155 ARG n 
1 156 ARG n 
1 157 THR n 
1 158 ALA n 
1 159 SER n 
1 160 VAL n 
1 161 ARG n 
1 162 ALA n 
1 163 ASP n 
1 164 THR n 
1 165 TYR n 
1 166 CYS n 
1 167 ARG n 
1 168 LEU n 
1 169 TYR n 
1 170 SER n 
1 171 LEU n 
1 172 SER n 
1 173 VAL n 
1 174 ASP n 
1 175 ASN n 
1 176 PHE n 
1 177 ASN n 
1 178 GLU n 
1 179 VAL n 
1 180 LEU n 
1 181 GLU n 
1 182 GLU n 
1 183 TYR n 
1 184 PRO n 
1 185 MET n 
1 186 MET n 
1 187 ARG n 
1 188 ARG n 
1 189 ALA n 
1 190 PHE n 
1 191 GLU n 
1 192 THR n 
1 193 VAL n 
1 194 ALA n 
1 195 ILE n 
1 196 ASP n 
1 197 ARG n 
1 198 LEU n 
1 199 ASP n 
1 200 ARG n 
1 201 ILE n 
1 202 GLY n 
1 203 LYS n 
1 204 LYS n 
1 205 ASN n 
1 206 SER n 
1 207 ILE n 
1 208 LEU n 
1 209 LEU n 
1 210 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Hcn1, Bcng1, Hac2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'K12 Rosetta codon plus' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'modified pET-24 with LIC cloning cassette' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HCN1_MOUSE 
_struct_ref.pdbx_db_accession          O88704 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILSELNDPLREEIVNFNCRKLVATMPLFANAD
PNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGEICLLTKGRRTASVRADTYCR
LYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLQ
;
_struct_ref.pdbx_align_begin           390 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3U0Z A 8 ? 210 ? O88704 390 ? 592 ? 390 592 
2 1 3U0Z B 8 ? 210 ? O88704 390 ? 592 ? 390 592 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3U0Z GLN A 1 ? UNP O88704 ? ? 'EXPRESSION TAG' 383 1  
1 3U0Z GLY A 2 ? UNP O88704 ? ? 'EXPRESSION TAG' 384 2  
1 3U0Z PRO A 3 ? UNP O88704 ? ? 'EXPRESSION TAG' 385 3  
1 3U0Z SER A 4 ? UNP O88704 ? ? 'EXPRESSION TAG' 386 4  
1 3U0Z SER A 5 ? UNP O88704 ? ? 'EXPRESSION TAG' 387 5  
1 3U0Z PRO A 6 ? UNP O88704 ? ? 'EXPRESSION TAG' 388 6  
1 3U0Z MET A 7 ? UNP O88704 ? ? 'EXPRESSION TAG' 389 7  
2 3U0Z GLN B 1 ? UNP O88704 ? ? 'EXPRESSION TAG' 383 8  
2 3U0Z GLY B 2 ? UNP O88704 ? ? 'EXPRESSION TAG' 384 9  
2 3U0Z PRO B 3 ? UNP O88704 ? ? 'EXPRESSION TAG' 385 10 
2 3U0Z SER B 4 ? UNP O88704 ? ? 'EXPRESSION TAG' 386 11 
2 3U0Z SER B 5 ? UNP O88704 ? ? 'EXPRESSION TAG' 387 12 
2 3U0Z PRO B 6 ? UNP O88704 ? ? 'EXPRESSION TAG' 388 13 
2 3U0Z MET B 7 ? UNP O88704 ? ? 'EXPRESSION TAG' 389 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                  'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                               ?                  'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                  'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                  'C4 H7 N O4'      133.103 
CMP non-polymer         . "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" 'CYCLIC AMP; CAMP' 'C10 H12 N5 O6 P' 329.206 
CYS 'L-peptide linking' y CYSTEINE                               ?                  'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ?                  'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                  'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                ?                  'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?                  'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                  ?                  'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?                  'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                  'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                  'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                             ?                  'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                  'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                ?                  'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                 ?                  'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                              ?                  'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                               ?                  'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                 ?                  'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3U0Z 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.75 
_exptl_crystal.density_percent_sol   55.29 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            278 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_details    '20-22% PEG 3350, 0.4M Sodium Acetate buffer (pH 5.0), VAPOR DIFFUSION, temperature 278K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2010-02-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(311)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97238 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97238 
# 
_reflns.entry_id                     3U0Z 
_reflns.observed_criterion_sigma_I   12.5 
_reflns.observed_criterion_sigma_F   12.5 
_reflns.d_resolution_low             43.78 
_reflns.d_resolution_high            2.90 
_reflns.number_obs                   11821 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.12 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.90 
_reflns_shell.d_res_low                   3.06 
_reflns_shell.percent_possible_all        100 
_reflns_shell.Rmerge_I_obs                0.485 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             6.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3U0Z 
_refine.ls_number_reflns_obs                     11258 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             43.78 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    99.97 
_refine.ls_R_factor_obs                          0.20812 
_refine.ls_R_factor_all                          0.20812 
_refine.ls_R_factor_R_work                       0.20496 
_refine.ls_R_factor_R_free                       0.27497 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  560 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.927 
_refine.correlation_coeff_Fo_to_Fc_free          0.857 
_refine.B_iso_mean                               38.646 
_refine.aniso_B[1][1]                            -0.05 
_refine.aniso_B[2][2]                            -0.05 
_refine.aniso_B[3][3]                            0.11 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1Q43 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.444 
_refine.overall_SU_ML                            0.312 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             16.696 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3278 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             49 
_refine_hist.number_atoms_total               3371 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        43.78 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.016  0.022  ? 3399 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1.708  1.978  ? 4570 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 7.178  5.000  ? 397  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 34.042 23.220 ? 177  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 22.151 15.000 ? 632  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 21.400 15.000 ? 33   ? 'X-RAY DIFFRACTION' 
r_chiral_restr         0.112  0.200  ? 478  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.007  0.021  ? 2573 ? 'X-RAY DIFFRACTION' 
r_mcbond_it            0.658  1.500  ? 1981 ? 'X-RAY DIFFRACTION' 
r_mcangle_it           1.359  2.000  ? 3195 ? 'X-RAY DIFFRACTION' 
r_scbond_it            2.004  3.000  ? 1418 ? 'X-RAY DIFFRACTION' 
r_scangle_it           3.492  4.500  ? 1374 ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 794 0.02 0.05 'tight positional'  1 1 'X-RAY DIFFRACTION' ? ? ? 
1 A 836 0.03 0.50 'medium positional' 1 2 'X-RAY DIFFRACTION' ? ? ? 
1 A 794 0.17 0.50 'tight thermal'     1 3 'X-RAY DIFFRACTION' ? ? ? 
1 A 836 0.22 2.00 'medium thermal'    1 4 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.900 
_refine_ls_shell.d_res_low                        2.975 
_refine_ls_shell.number_reflns_R_work             828 
_refine_ls_shell.R_factor_R_work                  0.300 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.484 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             47 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 390 A 588 1 2 ? ? ? ? ? ? ? ? 1 ? 
2 B 390 B 588 1 2 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3U0Z 
_struct.title                     
'Tetramerization dynamics of the C-terminus underlies isoform-specific cAMP-gating in HCN channels' 
_struct.pdbx_descriptor           'Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3U0Z 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            'helix, beta sheet, TRANSPORT PROTEIN, cNMP binding' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 8   ? LYS A 29  ? ASP A 390 LYS A 411 1 ? 22 
HELX_P HELX_P2  2  PRO A 31  ? GLN A 47  ? PRO A 413 GLN A 429 1 ? 17 
HELX_P HELX_P3  3  ASP A 52  ? GLU A 59  ? ASP A 434 GLU A 441 1 ? 8  
HELX_P HELX_P4  4  ASN A 61  ? CYS A 73  ? ASN A 443 CYS A 455 1 ? 13 
HELX_P HELX_P5  5  CYS A 73  ? THR A 79  ? CYS A 455 THR A 461 1 ? 7  
HELX_P HELX_P6  6  MET A 80  ? ASN A 85  ? MET A 462 ASN A 467 1 ? 6  
HELX_P HELX_P7  7  ASP A 87  ? LYS A 97  ? ASP A 469 LYS A 479 1 ? 11 
HELX_P HELX_P8  8  GLY A 146 ? LYS A 153 ? GLY A 528 LYS A 535 1 ? 8  
HELX_P HELX_P9  9  VAL A 173 ? TYR A 183 ? VAL A 555 TYR A 565 1 ? 11 
HELX_P HELX_P10 10 PRO A 184 ? GLY A 202 ? PRO A 566 GLY A 584 1 ? 19 
HELX_P HELX_P11 11 SER B 9   ? LYS B 29  ? SER B 391 LYS B 411 1 ? 21 
HELX_P HELX_P12 12 PRO B 31  ? GLN B 47  ? PRO B 413 GLN B 429 1 ? 17 
HELX_P HELX_P13 13 ASP B 52  ? GLU B 59  ? ASP B 434 GLU B 441 1 ? 8  
HELX_P HELX_P14 14 ASN B 61  ? CYS B 73  ? ASN B 443 CYS B 455 1 ? 13 
HELX_P HELX_P15 15 CYS B 73  ? THR B 79  ? CYS B 455 THR B 461 1 ? 7  
HELX_P HELX_P16 16 MET B 80  ? ASN B 85  ? MET B 462 ASN B 467 1 ? 6  
HELX_P HELX_P17 17 ASP B 87  ? LEU B 98  ? ASP B 469 LEU B 480 1 ? 12 
HELX_P HELX_P18 18 GLY B 146 ? LYS B 153 ? GLY B 528 LYS B 535 1 ? 8  
HELX_P HELX_P19 19 VAL B 173 ? TYR B 183 ? VAL B 555 TYR B 565 1 ? 11 
HELX_P HELX_P20 20 PRO B 184 ? ILE B 201 ? PRO B 566 ILE B 583 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 99  ? PHE A 103 ? ARG A 481 PHE A 485 
A 2 CYS A 166 ? SER A 172 ? CYS A 548 SER A 554 
A 3 LYS A 118 ? HIS A 124 ? LYS A 500 HIS A 506 
A 4 TYR A 144 ? PHE A 145 ? TYR A 526 PHE A 527 
B 1 TYR A 108 ? ILE A 110 ? TYR A 490 ILE A 492 
B 2 SER A 159 ? ALA A 162 ? SER A 541 ALA A 544 
B 3 ALA A 127 ? ILE A 130 ? ALA A 509 ILE A 512 
B 4 MET A 137 ? LEU A 139 ? MET A 519 LEU A 521 
C 1 ARG B 99  ? PHE B 103 ? ARG B 481 PHE B 485 
C 2 CYS B 166 ? SER B 172 ? CYS B 548 SER B 554 
C 3 LYS B 118 ? HIS B 124 ? LYS B 500 HIS B 506 
C 4 TYR B 144 ? PHE B 145 ? TYR B 526 PHE B 527 
D 1 TYR B 108 ? ILE B 110 ? TYR B 490 ILE B 492 
D 2 SER B 159 ? ALA B 162 ? SER B 541 ALA B 544 
D 3 ALA B 127 ? ILE B 130 ? ALA B 509 ILE B 512 
D 4 MET B 137 ? LEU B 139 ? MET B 519 LEU B 521 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 99  ? N ARG A 481 O SER A 170 ? O SER A 552 
A 2 3 O ARG A 167 ? O ARG A 549 N HIS A 124 ? N HIS A 506 
A 3 4 N TYR A 120 ? N TYR A 502 O PHE A 145 ? O PHE A 527 
B 1 2 N ILE A 110 ? N ILE A 492 O VAL A 160 ? O VAL A 542 
B 2 3 O SER A 159 ? O SER A 541 N ILE A 130 ? N ILE A 512 
B 3 4 N ALA A 127 ? N ALA A 509 O LEU A 139 ? O LEU A 521 
C 1 2 N ARG B 99  ? N ARG B 481 O SER B 170 ? O SER B 552 
C 2 3 O ARG B 167 ? O ARG B 549 N HIS B 124 ? N HIS B 506 
C 3 4 N TYR B 120 ? N TYR B 502 O PHE B 145 ? O PHE B 527 
D 1 2 N ILE B 110 ? N ILE B 492 O VAL B 160 ? O VAL B 542 
D 2 3 O SER B 159 ? O SER B 541 N ILE B 130 ? N ILE B 512 
D 3 4 N ALA B 127 ? N ALA B 509 O LEU B 139 ? O LEU B 521 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CMP A 646' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CMP B 646' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 VAL A 129 ? VAL A 511 . ? 1_555 ? 
2  AC1 11 PHE A 145 ? PHE A 527 . ? 1_555 ? 
3  AC1 11 GLY A 146 ? GLY A 528 . ? 1_555 ? 
4  AC1 11 GLU A 147 ? GLU A 529 . ? 1_555 ? 
5  AC1 11 ILE A 148 ? ILE A 530 . ? 1_555 ? 
6  AC1 11 CYS A 149 ? CYS A 531 . ? 1_555 ? 
7  AC1 11 ARG A 156 ? ARG A 538 . ? 1_555 ? 
8  AC1 11 THR A 157 ? THR A 539 . ? 1_555 ? 
9  AC1 11 ALA A 158 ? ALA A 540 . ? 1_555 ? 
10 AC1 11 ARG A 197 ? ARG A 579 . ? 1_555 ? 
11 AC1 11 ARG A 200 ? ARG A 582 . ? 1_555 ? 
12 AC2 11 VAL B 129 ? VAL B 511 . ? 1_555 ? 
13 AC2 11 PHE B 145 ? PHE B 527 . ? 1_555 ? 
14 AC2 11 GLY B 146 ? GLY B 528 . ? 1_555 ? 
15 AC2 11 GLU B 147 ? GLU B 529 . ? 1_555 ? 
16 AC2 11 ILE B 148 ? ILE B 530 . ? 1_555 ? 
17 AC2 11 CYS B 149 ? CYS B 531 . ? 1_555 ? 
18 AC2 11 ARG B 156 ? ARG B 538 . ? 1_555 ? 
19 AC2 11 THR B 157 ? THR B 539 . ? 1_555 ? 
20 AC2 11 ALA B 158 ? ALA B 540 . ? 1_555 ? 
21 AC2 11 ARG B 197 ? ARG B 579 . ? 1_555 ? 
22 AC2 11 ARG B 200 ? ARG B 582 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3U0Z 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3U0Z 
_atom_sites.fract_transf_matrix[1][1]   0.010239 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010239 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008834 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ASP A 1 8   ? -41.228 -32.438 -26.556 1.00 62.54 ? 390 ASP A N     1 
ATOM   2    C CA    . ASP A 1 8   ? -42.454 -32.302 -27.404 1.00 62.67 ? 390 ASP A CA    1 
ATOM   3    C C     . ASP A 1 8   ? -43.421 -33.516 -27.374 1.00 62.45 ? 390 ASP A C     1 
ATOM   4    O O     . ASP A 1 8   ? -44.582 -33.375 -27.760 1.00 62.40 ? 390 ASP A O     1 
ATOM   5    C CB    . ASP A 1 8   ? -42.072 -31.933 -28.850 1.00 62.92 ? 390 ASP A CB    1 
ATOM   6    C CG    . ASP A 1 8   ? -43.296 -31.607 -29.723 1.00 63.65 ? 390 ASP A CG    1 
ATOM   7    O OD1   . ASP A 1 8   ? -43.903 -30.522 -29.519 1.00 63.78 ? 390 ASP A OD1   1 
ATOM   8    O OD2   . ASP A 1 8   ? -43.641 -32.439 -30.611 1.00 63.61 ? 390 ASP A OD2   1 
ATOM   9    N N     . SER A 1 9   ? -42.960 -34.693 -26.931 1.00 62.33 ? 391 SER A N     1 
ATOM   10   C CA    . SER A 1 9   ? -43.885 -35.813 -26.602 1.00 62.56 ? 391 SER A CA    1 
ATOM   11   C C     . SER A 1 9   ? -44.923 -35.346 -25.568 1.00 62.75 ? 391 SER A C     1 
ATOM   12   O O     . SER A 1 9   ? -46.067 -35.859 -25.511 1.00 63.00 ? 391 SER A O     1 
ATOM   13   C CB    . SER A 1 9   ? -43.143 -37.022 -26.005 1.00 62.26 ? 391 SER A CB    1 
ATOM   14   O OG    . SER A 1 9   ? -42.326 -37.651 -26.967 1.00 62.08 ? 391 SER A OG    1 
ATOM   15   N N     . SER A 1 10  ? -44.486 -34.377 -24.749 1.00 62.32 ? 392 SER A N     1 
ATOM   16   C CA    . SER A 1 10  ? -45.263 -33.847 -23.632 1.00 61.56 ? 392 SER A CA    1 
ATOM   17   C C     . SER A 1 10  ? -46.291 -32.812 -24.081 1.00 60.89 ? 392 SER A C     1 
ATOM   18   O O     . SER A 1 10  ? -47.400 -32.822 -23.555 1.00 60.87 ? 392 SER A O     1 
ATOM   19   C CB    . SER A 1 10  ? -44.356 -33.332 -22.492 1.00 61.62 ? 392 SER A CB    1 
ATOM   20   O OG    . SER A 1 10  ? -43.343 -32.457 -22.954 1.00 61.31 ? 392 SER A OG    1 
ATOM   21   N N     . ARG A 1 11  ? -45.957 -31.948 -25.050 1.00 60.09 ? 393 ARG A N     1 
ATOM   22   C CA    . ARG A 1 11  ? -46.999 -31.096 -25.656 1.00 59.55 ? 393 ARG A CA    1 
ATOM   23   C C     . ARG A 1 11  ? -48.067 -31.932 -26.421 1.00 59.47 ? 393 ARG A C     1 
ATOM   24   O O     . ARG A 1 11  ? -49.124 -31.398 -26.808 1.00 59.39 ? 393 ARG A O     1 
ATOM   25   C CB    . ARG A 1 11  ? -46.431 -29.967 -26.516 1.00 59.04 ? 393 ARG A CB    1 
ATOM   26   C CG    . ARG A 1 11  ? -47.477 -28.880 -26.780 1.00 60.05 ? 393 ARG A CG    1 
ATOM   27   C CD    . ARG A 1 11  ? -47.028 -27.816 -27.780 1.00 61.50 ? 393 ARG A CD    1 
ATOM   28   N NE    . ARG A 1 11  ? -46.040 -26.908 -27.186 1.00 63.47 ? 393 ARG A NE    1 
ATOM   29   C CZ    . ARG A 1 11  ? -44.738 -26.891 -27.488 1.00 64.04 ? 393 ARG A CZ    1 
ATOM   30   N NH1   . ARG A 1 11  ? -44.235 -27.725 -28.405 1.00 64.39 ? 393 ARG A NH1   1 
ATOM   31   N NH2   . ARG A 1 11  ? -43.927 -26.032 -26.876 1.00 63.47 ? 393 ARG A NH2   1 
ATOM   32   N N     . ARG A 1 12  ? -47.793 -33.238 -26.599 1.00 59.25 ? 394 ARG A N     1 
ATOM   33   C CA    . ARG A 1 12  ? -48.782 -34.225 -27.103 1.00 58.97 ? 394 ARG A CA    1 
ATOM   34   C C     . ARG A 1 12  ? -49.758 -34.888 -26.124 1.00 58.34 ? 394 ARG A C     1 
ATOM   35   O O     . ARG A 1 12  ? -50.969 -34.769 -26.301 1.00 58.45 ? 394 ARG A O     1 
ATOM   36   C CB    . ARG A 1 12  ? -48.110 -35.422 -27.812 1.00 59.19 ? 394 ARG A CB    1 
ATOM   37   C CG    . ARG A 1 12  ? -49.025 -36.671 -27.985 1.00 59.66 ? 394 ARG A CG    1 
ATOM   38   C CD    . ARG A 1 12  ? -50.267 -36.393 -28.848 1.00 61.53 ? 394 ARG A CD    1 
ATOM   39   N NE    . ARG A 1 12  ? -49.912 -36.005 -30.219 1.00 63.10 ? 394 ARG A NE    1 
ATOM   40   C CZ    . ARG A 1 12  ? -50.784 -35.778 -31.208 1.00 64.11 ? 394 ARG A CZ    1 
ATOM   41   N NH1   . ARG A 1 12  ? -52.098 -35.883 -30.986 1.00 64.21 ? 394 ARG A NH1   1 
ATOM   42   N NH2   . ARG A 1 12  ? -50.339 -35.443 -32.425 1.00 63.10 ? 394 ARG A NH2   1 
ATOM   43   N N     . GLN A 1 13  ? -49.215 -35.606 -25.130 1.00 57.68 ? 395 GLN A N     1 
ATOM   44   C CA    . GLN A 1 13  ? -49.845 -35.993 -23.845 1.00 56.69 ? 395 GLN A CA    1 
ATOM   45   C C     . GLN A 1 13  ? -50.828 -34.953 -23.243 1.00 55.74 ? 395 GLN A C     1 
ATOM   46   O O     . GLN A 1 13  ? -51.945 -35.302 -22.820 1.00 55.33 ? 395 GLN A O     1 
ATOM   47   C CB    . GLN A 1 13  ? -48.735 -36.219 -22.807 1.00 56.84 ? 395 GLN A CB    1 
ATOM   48   C CG    . GLN A 1 13  ? -47.972 -37.533 -22.935 1.00 58.08 ? 395 GLN A CG    1 
ATOM   49   C CD    . GLN A 1 13  ? -48.318 -38.559 -21.818 1.00 60.35 ? 395 GLN A CD    1 
ATOM   50   O OE1   . GLN A 1 13  ? -48.328 -39.777 -22.059 1.00 60.76 ? 395 GLN A OE1   1 
ATOM   51   N NE2   . GLN A 1 13  ? -48.593 -38.065 -20.600 1.00 59.77 ? 395 GLN A NE2   1 
ATOM   52   N N     . TYR A 1 14  ? -50.390 -33.687 -23.223 1.00 54.52 ? 396 TYR A N     1 
ATOM   53   C CA    . TYR A 1 14  ? -51.163 -32.566 -22.708 1.00 53.68 ? 396 TYR A CA    1 
ATOM   54   C C     . TYR A 1 14  ? -52.512 -32.525 -23.356 1.00 53.35 ? 396 TYR A C     1 
ATOM   55   O O     . TYR A 1 14  ? -53.532 -32.499 -22.667 1.00 53.55 ? 396 TYR A O     1 
ATOM   56   C CB    . TYR A 1 14  ? -50.462 -31.234 -22.979 1.00 53.38 ? 396 TYR A CB    1 
ATOM   57   C CG    . TYR A 1 14  ? -51.288 -30.024 -22.575 1.00 53.67 ? 396 TYR A CG    1 
ATOM   58   C CD1   . TYR A 1 14  ? -51.366 -29.618 -21.233 1.00 54.45 ? 396 TYR A CD1   1 
ATOM   59   C CD2   . TYR A 1 14  ? -51.999 -29.286 -23.521 1.00 53.82 ? 396 TYR A CD2   1 
ATOM   60   C CE1   . TYR A 1 14  ? -52.121 -28.500 -20.848 1.00 53.55 ? 396 TYR A CE1   1 
ATOM   61   C CE2   . TYR A 1 14  ? -52.760 -28.168 -23.146 1.00 53.84 ? 396 TYR A CE2   1 
ATOM   62   C CZ    . TYR A 1 14  ? -52.815 -27.781 -21.807 1.00 53.80 ? 396 TYR A CZ    1 
ATOM   63   O OH    . TYR A 1 14  ? -53.555 -26.673 -21.432 1.00 55.21 ? 396 TYR A OH    1 
ATOM   64   N N     . GLN A 1 15  ? -52.504 -32.522 -24.686 1.00 52.84 ? 397 GLN A N     1 
ATOM   65   C CA    . GLN A 1 15  ? -53.723 -32.353 -25.458 1.00 52.53 ? 397 GLN A CA    1 
ATOM   66   C C     . GLN A 1 15  ? -54.611 -33.575 -25.481 1.00 51.93 ? 397 GLN A C     1 
ATOM   67   O O     . GLN A 1 15  ? -55.821 -33.461 -25.677 1.00 52.32 ? 397 GLN A O     1 
ATOM   68   C CB    . GLN A 1 15  ? -53.420 -31.853 -26.860 1.00 52.48 ? 397 GLN A CB    1 
ATOM   69   C CG    . GLN A 1 15  ? -53.402 -30.341 -26.897 1.00 54.81 ? 397 GLN A CG    1 
ATOM   70   C CD    . GLN A 1 15  ? -52.630 -29.798 -28.068 1.00 58.19 ? 397 GLN A CD    1 
ATOM   71   O OE1   . GLN A 1 15  ? -52.618 -30.400 -29.146 1.00 59.06 ? 397 GLN A OE1   1 
ATOM   72   N NE2   . GLN A 1 15  ? -51.968 -28.647 -27.867 1.00 59.82 ? 397 GLN A NE2   1 
ATOM   73   N N     . GLU A 1 16  ? -54.040 -34.741 -25.249 1.00 51.14 ? 398 GLU A N     1 
ATOM   74   C CA    . GLU A 1 16  ? -54.886 -35.909 -25.139 1.00 51.08 ? 398 GLU A CA    1 
ATOM   75   C C     . GLU A 1 16  ? -55.491 -35.994 -23.746 1.00 50.23 ? 398 GLU A C     1 
ATOM   76   O O     . GLU A 1 16  ? -56.626 -36.475 -23.572 1.00 50.33 ? 398 GLU A O     1 
ATOM   77   C CB    . GLU A 1 16  ? -54.129 -37.182 -25.495 1.00 51.52 ? 398 GLU A CB    1 
ATOM   78   C CG    . GLU A 1 16  ? -54.054 -37.374 -26.997 1.00 53.72 ? 398 GLU A CG    1 
ATOM   79   C CD    . GLU A 1 16  ? -54.108 -38.840 -27.399 1.00 57.30 ? 398 GLU A CD    1 
ATOM   80   O OE1   . GLU A 1 16  ? -54.552 -39.679 -26.565 1.00 58.19 ? 398 GLU A OE1   1 
ATOM   81   O OE2   . GLU A 1 16  ? -53.706 -39.142 -28.552 1.00 56.96 ? 398 GLU A OE2   1 
ATOM   82   N N     . LYS A 1 17  ? -54.735 -35.530 -22.752 1.00 48.91 ? 399 LYS A N     1 
ATOM   83   C CA    . LYS A 1 17  ? -55.238 -35.566 -21.395 1.00 47.41 ? 399 LYS A CA    1 
ATOM   84   C C     . LYS A 1 17  ? -56.380 -34.604 -21.251 1.00 46.02 ? 399 LYS A C     1 
ATOM   85   O O     . LYS A 1 17  ? -57.441 -34.997 -20.781 1.00 45.45 ? 399 LYS A O     1 
ATOM   86   C CB    . LYS A 1 17  ? -54.129 -35.334 -20.386 1.00 47.67 ? 399 LYS A CB    1 
ATOM   87   C CG    . LYS A 1 17  ? -53.586 -36.655 -19.847 1.00 48.07 ? 399 LYS A CG    1 
ATOM   88   C CD    . LYS A 1 17  ? -52.103 -36.571 -19.516 1.00 47.13 ? 399 LYS A CD    1 
ATOM   89   C CE    . LYS A 1 17  ? -51.674 -37.847 -18.826 1.00 48.31 ? 399 LYS A CE    1 
ATOM   90   N NZ    . LYS A 1 17  ? -51.838 -37.796 -17.336 1.00 48.94 ? 399 LYS A NZ    1 
ATOM   91   N N     . TYR A 1 18  ? -56.188 -33.375 -21.721 1.00 44.68 ? 400 TYR A N     1 
ATOM   92   C CA    . TYR A 1 18  ? -57.296 -32.444 -21.757 1.00 44.48 ? 400 TYR A CA    1 
ATOM   93   C C     . TYR A 1 18  ? -58.442 -32.912 -22.680 1.00 44.63 ? 400 TYR A C     1 
ATOM   94   O O     . TYR A 1 18  ? -59.582 -32.519 -22.479 1.00 45.01 ? 400 TYR A O     1 
ATOM   95   C CB    . TYR A 1 18  ? -56.876 -30.976 -21.991 1.00 44.33 ? 400 TYR A CB    1 
ATOM   96   C CG    . TYR A 1 18  ? -58.039 -30.005 -21.799 1.00 45.04 ? 400 TYR A CG    1 
ATOM   97   C CD1   . TYR A 1 18  ? -58.611 -29.778 -20.525 1.00 45.10 ? 400 TYR A CD1   1 
ATOM   98   C CD2   . TYR A 1 18  ? -58.611 -29.351 -22.895 1.00 46.23 ? 400 TYR A CD2   1 
ATOM   99   C CE1   . TYR A 1 18  ? -59.727 -28.911 -20.362 1.00 45.55 ? 400 TYR A CE1   1 
ATOM   100  C CE2   . TYR A 1 18  ? -59.709 -28.472 -22.739 1.00 46.79 ? 400 TYR A CE2   1 
ATOM   101  C CZ    . TYR A 1 18  ? -60.260 -28.263 -21.482 1.00 46.66 ? 400 TYR A CZ    1 
ATOM   102  O OH    . TYR A 1 18  ? -61.336 -27.409 -21.388 1.00 47.32 ? 400 TYR A OH    1 
ATOM   103  N N     . LYS A 1 19  ? -58.170 -33.770 -23.660 1.00 44.41 ? 401 LYS A N     1 
ATOM   104  C CA    . LYS A 1 19  ? -59.273 -34.450 -24.338 1.00 44.21 ? 401 LYS A CA    1 
ATOM   105  C C     . LYS A 1 19  ? -60.009 -35.441 -23.409 1.00 43.69 ? 401 LYS A C     1 
ATOM   106  O O     . LYS A 1 19  ? -61.237 -35.553 -23.459 1.00 43.87 ? 401 LYS A O     1 
ATOM   107  C CB    . LYS A 1 19  ? -58.805 -35.150 -25.618 1.00 44.83 ? 401 LYS A CB    1 
ATOM   108  C CG    . LYS A 1 19  ? -59.085 -34.385 -26.949 1.00 47.08 ? 401 LYS A CG    1 
ATOM   109  C CD    . LYS A 1 19  ? -58.620 -35.210 -28.204 1.00 49.75 ? 401 LYS A CD    1 
ATOM   110  C CE    . LYS A 1 19  ? -58.082 -34.309 -29.368 1.00 50.43 ? 401 LYS A CE    1 
ATOM   111  N NZ    . LYS A 1 19  ? -57.265 -35.051 -30.407 1.00 48.80 ? 401 LYS A NZ    1 
ATOM   112  N N     . GLN A 1 20  ? -59.282 -36.168 -22.563 1.00 43.20 ? 402 GLN A N     1 
ATOM   113  C CA    . GLN A 1 20  ? -59.944 -37.063 -21.608 1.00 42.62 ? 402 GLN A CA    1 
ATOM   114  C C     . GLN A 1 20  ? -60.823 -36.241 -20.636 1.00 41.93 ? 402 GLN A C     1 
ATOM   115  O O     . GLN A 1 20  ? -61.971 -36.617 -20.344 1.00 41.36 ? 402 GLN A O     1 
ATOM   116  C CB    . GLN A 1 20  ? -58.915 -37.886 -20.836 1.00 42.90 ? 402 GLN A CB    1 
ATOM   117  C CG    . GLN A 1 20  ? -58.539 -39.241 -21.455 1.00 44.85 ? 402 GLN A CG    1 
ATOM   118  C CD    . GLN A 1 20  ? -57.873 -40.198 -20.417 1.00 49.18 ? 402 GLN A CD    1 
ATOM   119  O OE1   . GLN A 1 20  ? -56.635 -40.176 -20.235 1.00 49.38 ? 402 GLN A OE1   1 
ATOM   120  N NE2   . GLN A 1 20  ? -58.700 -41.034 -19.729 1.00 48.80 ? 402 GLN A NE2   1 
ATOM   121  N N     . VAL A 1 21  ? -60.266 -35.113 -20.163 1.00 40.90 ? 403 VAL A N     1 
ATOM   122  C CA    . VAL A 1 21  ? -60.944 -34.208 -19.230 1.00 39.69 ? 403 VAL A CA    1 
ATOM   123  C C     . VAL A 1 21  ? -62.288 -33.780 -19.826 1.00 39.89 ? 403 VAL A C     1 
ATOM   124  O O     . VAL A 1 21  ? -63.328 -34.085 -19.235 1.00 40.44 ? 403 VAL A O     1 
ATOM   125  C CB    . VAL A 1 21  ? -60.046 -32.991 -18.838 1.00 39.34 ? 403 VAL A CB    1 
ATOM   126  C CG1   . VAL A 1 21  ? -60.876 -31.812 -18.420 1.00 37.89 ? 403 VAL A CG1   1 
ATOM   127  C CG2   . VAL A 1 21  ? -59.045 -33.369 -17.730 1.00 37.91 ? 403 VAL A CG2   1 
ATOM   128  N N     . GLU A 1 22  ? -62.268 -33.140 -21.004 1.00 39.14 ? 404 GLU A N     1 
ATOM   129  C CA    . GLU A 1 22  ? -63.485 -32.794 -21.753 1.00 38.94 ? 404 GLU A CA    1 
ATOM   130  C C     . GLU A 1 22  ? -64.491 -33.916 -21.818 1.00 38.82 ? 404 GLU A C     1 
ATOM   131  O O     . GLU A 1 22  ? -65.689 -33.668 -21.749 1.00 39.03 ? 404 GLU A O     1 
ATOM   132  C CB    . GLU A 1 22  ? -63.178 -32.429 -23.191 1.00 38.76 ? 404 GLU A CB    1 
ATOM   133  C CG    . GLU A 1 22  ? -62.401 -31.160 -23.379 1.00 41.19 ? 404 GLU A CG    1 
ATOM   134  C CD    . GLU A 1 22  ? -62.175 -30.847 -24.856 1.00 44.21 ? 404 GLU A CD    1 
ATOM   135  O OE1   . GLU A 1 22  ? -61.037 -30.423 -25.232 1.00 44.27 ? 404 GLU A OE1   1 
ATOM   136  O OE2   . GLU A 1 22  ? -63.153 -31.039 -25.634 1.00 46.00 ? 404 GLU A OE2   1 
ATOM   137  N N     . GLN A 1 23  ? -64.037 -35.148 -21.979 1.00 38.45 ? 405 GLN A N     1 
ATOM   138  C CA    . GLN A 1 23  ? -65.014 -36.219 -22.067 1.00 39.31 ? 405 GLN A CA    1 
ATOM   139  C C     . GLN A 1 23  ? -65.756 -36.401 -20.768 1.00 38.93 ? 405 GLN A C     1 
ATOM   140  O O     . GLN A 1 23  ? -67.005 -36.468 -20.757 1.00 39.53 ? 405 GLN A O     1 
ATOM   141  C CB    . GLN A 1 23  ? -64.374 -37.538 -22.428 1.00 39.89 ? 405 GLN A CB    1 
ATOM   142  C CG    . GLN A 1 23  ? -64.105 -37.685 -23.906 1.00 42.94 ? 405 GLN A CG    1 
ATOM   143  C CD    . GLN A 1 23  ? -63.231 -38.890 -24.182 1.00 46.03 ? 405 GLN A CD    1 
ATOM   144  O OE1   . GLN A 1 23  ? -62.214 -38.784 -24.896 1.00 45.58 ? 405 GLN A OE1   1 
ATOM   145  N NE2   . GLN A 1 23  ? -63.609 -40.055 -23.592 1.00 45.45 ? 405 GLN A NE2   1 
ATOM   146  N N     . TYR A 1 24  ? -64.977 -36.503 -19.685 1.00 37.96 ? 406 TYR A N     1 
ATOM   147  C CA    . TYR A 1 24  ? -65.508 -36.662 -18.336 1.00 36.49 ? 406 TYR A CA    1 
ATOM   148  C C     . TYR A 1 24  ? -66.580 -35.579 -18.065 1.00 35.88 ? 406 TYR A C     1 
ATOM   149  O O     . TYR A 1 24  ? -67.717 -35.886 -17.636 1.00 34.95 ? 406 TYR A O     1 
ATOM   150  C CB    . TYR A 1 24  ? -64.366 -36.581 -17.314 1.00 36.33 ? 406 TYR A CB    1 
ATOM   151  C CG    . TYR A 1 24  ? -64.843 -36.655 -15.880 1.00 35.83 ? 406 TYR A CG    1 
ATOM   152  C CD1   . TYR A 1 24  ? -65.090 -35.495 -15.145 1.00 34.02 ? 406 TYR A CD1   1 
ATOM   153  C CD2   . TYR A 1 24  ? -65.075 -37.896 -15.265 1.00 37.40 ? 406 TYR A CD2   1 
ATOM   154  C CE1   . TYR A 1 24  ? -65.562 -35.564 -13.834 1.00 34.69 ? 406 TYR A CE1   1 
ATOM   155  C CE2   . TYR A 1 24  ? -65.529 -37.977 -13.945 1.00 37.29 ? 406 TYR A CE2   1 
ATOM   156  C CZ    . TYR A 1 24  ? -65.781 -36.803 -13.242 1.00 35.80 ? 406 TYR A CZ    1 
ATOM   157  O OH    . TYR A 1 24  ? -66.245 -36.885 -11.948 1.00 35.88 ? 406 TYR A OH    1 
ATOM   158  N N     . MET A 1 25  ? -66.215 -34.329 -18.350 1.00 34.77 ? 407 MET A N     1 
ATOM   159  C CA    . MET A 1 25  ? -67.137 -33.235 -18.186 1.00 34.85 ? 407 MET A CA    1 
ATOM   160  C C     . MET A 1 25  ? -68.439 -33.518 -18.932 1.00 35.09 ? 407 MET A C     1 
ATOM   161  O O     . MET A 1 25  ? -69.484 -33.573 -18.294 1.00 34.76 ? 407 MET A O     1 
ATOM   162  C CB    . MET A 1 25  ? -66.499 -31.932 -18.605 1.00 34.77 ? 407 MET A CB    1 
ATOM   163  C CG    . MET A 1 25  ? -65.249 -31.630 -17.819 1.00 35.62 ? 407 MET A CG    1 
ATOM   164  S SD    . MET A 1 25  ? -64.646 -29.958 -18.094 1.00 42.10 ? 407 MET A SD    1 
ATOM   165  C CE    . MET A 1 25  ? -64.468 -29.933 -19.897 1.00 41.21 ? 407 MET A CE    1 
ATOM   166  N N     . SER A 1 26  ? -68.381 -33.755 -20.252 1.00 35.80 ? 408 SER A N     1 
ATOM   167  C CA    . SER A 1 26  ? -69.575 -34.235 -21.023 1.00 36.57 ? 408 SER A CA    1 
ATOM   168  C C     . SER A 1 26  ? -70.360 -35.369 -20.341 1.00 36.04 ? 408 SER A C     1 
ATOM   169  O O     . SER A 1 26  ? -71.572 -35.241 -20.092 1.00 35.69 ? 408 SER A O     1 
ATOM   170  C CB    . SER A 1 26  ? -69.207 -34.714 -22.427 1.00 36.48 ? 408 SER A CB    1 
ATOM   171  O OG    . SER A 1 26  ? -68.512 -33.706 -23.109 1.00 39.33 ? 408 SER A OG    1 
ATOM   172  N N     . PHE A 1 27  ? -69.696 -36.474 -20.032 1.00 35.38 ? 409 PHE A N     1 
ATOM   173  C CA    . PHE A 1 27  ? -70.480 -37.539 -19.461 1.00 35.87 ? 409 PHE A CA    1 
ATOM   174  C C     . PHE A 1 27  ? -71.213 -37.081 -18.192 1.00 35.99 ? 409 PHE A C     1 
ATOM   175  O O     . PHE A 1 27  ? -72.324 -37.563 -17.925 1.00 36.88 ? 409 PHE A O     1 
ATOM   176  C CB    . PHE A 1 27  ? -69.688 -38.825 -19.190 1.00 36.06 ? 409 PHE A CB    1 
ATOM   177  C CG    . PHE A 1 27  ? -70.520 -39.891 -18.542 1.00 36.63 ? 409 PHE A CG    1 
ATOM   178  C CD1   . PHE A 1 27  ? -71.622 -40.445 -19.222 1.00 37.14 ? 409 PHE A CD1   1 
ATOM   179  C CD2   . PHE A 1 27  ? -70.261 -40.290 -17.231 1.00 39.03 ? 409 PHE A CD2   1 
ATOM   180  C CE1   . PHE A 1 27  ? -72.449 -41.411 -18.618 1.00 38.79 ? 409 PHE A CE1   1 
ATOM   181  C CE2   . PHE A 1 27  ? -71.091 -41.290 -16.587 1.00 40.87 ? 409 PHE A CE2   1 
ATOM   182  C CZ    . PHE A 1 27  ? -72.191 -41.846 -17.295 1.00 39.35 ? 409 PHE A CZ    1 
ATOM   183  N N     . HIS A 1 28  ? -70.607 -36.162 -17.421 1.00 35.44 ? 410 HIS A N     1 
ATOM   184  C CA    . HIS A 1 28  ? -71.214 -35.699 -16.160 1.00 34.30 ? 410 HIS A CA    1 
ATOM   185  C C     . HIS A 1 28  ? -72.059 -34.413 -16.317 1.00 34.21 ? 410 HIS A C     1 
ATOM   186  O O     . HIS A 1 28  ? -72.702 -33.952 -15.372 1.00 34.13 ? 410 HIS A O     1 
ATOM   187  C CB    . HIS A 1 28  ? -70.179 -35.597 -15.032 1.00 33.94 ? 410 HIS A CB    1 
ATOM   188  C CG    . HIS A 1 28  ? -69.707 -36.925 -14.520 1.00 33.31 ? 410 HIS A CG    1 
ATOM   189  N ND1   . HIS A 1 28  ? -70.453 -37.704 -13.654 1.00 31.94 ? 410 HIS A ND1   1 
ATOM   190  C CD2   . HIS A 1 28  ? -68.564 -37.613 -14.754 1.00 31.71 ? 410 HIS A CD2   1 
ATOM   191  C CE1   . HIS A 1 28  ? -69.795 -38.818 -13.386 1.00 30.20 ? 410 HIS A CE1   1 
ATOM   192  N NE2   . HIS A 1 28  ? -68.644 -38.786 -14.036 1.00 31.69 ? 410 HIS A NE2   1 
ATOM   193  N N     . LYS A 1 29  ? -72.095 -33.878 -17.531 1.00 33.68 ? 411 LYS A N     1 
ATOM   194  C CA    . LYS A 1 29  ? -72.932 -32.719 -17.862 1.00 33.43 ? 411 LYS A CA    1 
ATOM   195  C C     . LYS A 1 29  ? -72.688 -31.486 -16.963 1.00 32.16 ? 411 LYS A C     1 
ATOM   196  O O     . LYS A 1 29  ? -73.642 -30.818 -16.529 1.00 33.00 ? 411 LYS A O     1 
ATOM   197  C CB    . LYS A 1 29  ? -74.424 -33.103 -17.892 1.00 33.88 ? 411 LYS A CB    1 
ATOM   198  C CG    . LYS A 1 29  ? -74.784 -34.285 -18.806 1.00 36.71 ? 411 LYS A CG    1 
ATOM   199  C CD    . LYS A 1 29  ? -76.131 -34.952 -18.400 1.00 41.52 ? 411 LYS A CD    1 
ATOM   200  C CE    . LYS A 1 29  ? -75.971 -36.486 -18.098 1.00 43.88 ? 411 LYS A CE    1 
ATOM   201  N NZ    . LYS A 1 29  ? -77.065 -37.003 -17.228 1.00 44.61 ? 411 LYS A NZ    1 
ATOM   202  N N     . LEU A 1 30  ? -71.422 -31.182 -16.699 1.00 30.02 ? 412 LEU A N     1 
ATOM   203  C CA    . LEU A 1 30  ? -71.054 -30.046 -15.883 1.00 28.44 ? 412 LEU A CA    1 
ATOM   204  C C     . LEU A 1 30  ? -71.463 -28.762 -16.591 1.00 28.25 ? 412 LEU A C     1 
ATOM   205  O O     . LEU A 1 30  ? -71.451 -28.721 -17.804 1.00 28.76 ? 412 LEU A O     1 
ATOM   206  C CB    . LEU A 1 30  ? -69.552 -30.081 -15.622 1.00 27.89 ? 412 LEU A CB    1 
ATOM   207  C CG    . LEU A 1 30  ? -68.956 -30.971 -14.494 1.00 26.82 ? 412 LEU A CG    1 
ATOM   208  C CD1   . LEU A 1 30  ? -69.715 -32.228 -14.132 1.00 24.54 ? 412 LEU A CD1   1 
ATOM   209  C CD2   . LEU A 1 30  ? -67.599 -31.373 -14.860 1.00 25.09 ? 412 LEU A CD2   1 
ATOM   210  N N     . PRO A 1 31  ? -71.883 -27.732 -15.845 1.00 27.83 ? 413 PRO A N     1 
ATOM   211  C CA    . PRO A 1 31  ? -72.255 -26.400 -16.348 1.00 27.95 ? 413 PRO A CA    1 
ATOM   212  C C     . PRO A 1 31  ? -71.151 -25.654 -17.037 1.00 28.46 ? 413 PRO A C     1 
ATOM   213  O O     . PRO A 1 31  ? -69.996 -25.810 -16.672 1.00 28.47 ? 413 PRO A O     1 
ATOM   214  C CB    . PRO A 1 31  ? -72.588 -25.609 -15.077 1.00 27.64 ? 413 PRO A CB    1 
ATOM   215  C CG    . PRO A 1 31  ? -72.209 -26.487 -13.948 1.00 28.56 ? 413 PRO A CG    1 
ATOM   216  C CD    . PRO A 1 31  ? -72.264 -27.894 -14.443 1.00 27.83 ? 413 PRO A CD    1 
ATOM   217  N N     . ALA A 1 32  ? -71.511 -24.610 -17.890 1.00 29.28 ? 414 ALA A N     1 
ATOM   218  C CA    . ALA A 1 32  ? -70.582 -23.885 -18.765 1.00 29.52 ? 414 ALA A CA    1 
ATOM   219  C C     . ALA A 1 32  ? -69.428 -23.203 -18.028 1.00 29.92 ? 414 ALA A C     1 
ATOM   220  O O     . ALA A 1 32  ? -68.268 -23.349 -18.419 1.00 30.43 ? 414 ALA A O     1 
ATOM   221  C CB    . ALA A 1 32  ? -71.342 -22.875 -19.623 1.00 28.98 ? 414 ALA A CB    1 
ATOM   222  N N     . ASP A 1 33  ? -69.750 -22.463 -16.967 1.00 30.05 ? 415 ASP A N     1 
ATOM   223  C CA    . ASP A 1 33  ? -68.744 -21.718 -16.203 1.00 30.67 ? 415 ASP A CA    1 
ATOM   224  C C     . ASP A 1 33  ? -67.876 -22.603 -15.304 1.00 29.50 ? 415 ASP A C     1 
ATOM   225  O O     . ASP A 1 33  ? -66.812 -22.177 -14.847 1.00 29.62 ? 415 ASP A O     1 
ATOM   226  C CB    . ASP A 1 33  ? -69.387 -20.574 -15.402 1.00 31.41 ? 415 ASP A CB    1 
ATOM   227  C CG    . ASP A 1 33  ? -70.621 -21.012 -14.628 1.00 35.31 ? 415 ASP A CG    1 
ATOM   228  O OD1   . ASP A 1 33  ? -71.708 -20.453 -14.885 1.00 38.35 ? 415 ASP A OD1   1 
ATOM   229  O OD2   . ASP A 1 33  ? -70.510 -21.910 -13.765 1.00 39.03 ? 415 ASP A OD2   1 
ATOM   230  N N     . MET A 1 34  ? -68.335 -23.829 -15.057 1.00 28.83 ? 416 MET A N     1 
ATOM   231  C CA    . MET A 1 34  ? -67.548 -24.825 -14.331 1.00 28.39 ? 416 MET A CA    1 
ATOM   232  C C     . MET A 1 34  ? -66.556 -25.502 -15.277 1.00 28.66 ? 416 MET A C     1 
ATOM   233  O O     . MET A 1 34  ? -65.430 -25.814 -14.883 1.00 29.12 ? 416 MET A O     1 
ATOM   234  C CB    . MET A 1 34  ? -68.459 -25.863 -13.672 1.00 28.33 ? 416 MET A CB    1 
ATOM   235  C CG    . MET A 1 34  ? -67.779 -26.717 -12.607 1.00 29.00 ? 416 MET A CG    1 
ATOM   236  S SD    . MET A 1 34  ? -68.897 -27.878 -11.793 1.00 31.62 ? 416 MET A SD    1 
ATOM   237  C CE    . MET A 1 34  ? -69.852 -26.778 -10.749 1.00 31.45 ? 416 MET A CE    1 
ATOM   238  N N     . ARG A 1 35  ? -66.919 -25.930 -16.483 1.00 28.85 ? 417 ARG A N     1 
ATOM   239  C CA    . ARG A 1 35  ? -66.018 -26.340 -17.567 1.00 28.24 ? 417 ARG A CA    1 
ATOM   240  C C     . ARG A 1 35  ? -65.047 -25.212 -17.871 1.00 28.22 ? 417 ARG A C     1 
ATOM   241  O O     . ARG A 1 35  ? -63.892 -25.462 -18.089 1.00 28.22 ? 417 ARG A O     1 
ATOM   242  C CB    . ARG A 1 35  ? -66.777 -26.686 -18.831 1.00 28.23 ? 417 ARG A CB    1 
ATOM   243  C CG    . ARG A 1 35  ? -67.497 -28.018 -18.823 1.00 28.05 ? 417 ARG A CG    1 
ATOM   244  C CD    . ARG A 1 35  ? -68.421 -28.146 -20.061 1.00 28.66 ? 417 ARG A CD    1 
ATOM   245  N NE    . ARG A 1 35  ? -69.491 -29.065 -19.738 1.00 31.58 ? 417 ARG A NE    1 
ATOM   246  C CZ    . ARG A 1 35  ? -69.861 -30.137 -20.438 1.00 35.59 ? 417 ARG A CZ    1 
ATOM   247  N NH1   . ARG A 1 35  ? -69.296 -30.461 -21.612 1.00 37.57 ? 417 ARG A NH1   1 
ATOM   248  N NH2   . ARG A 1 35  ? -70.831 -30.902 -19.949 1.00 36.66 ? 417 ARG A NH2   1 
ATOM   249  N N     . GLN A 1 36  ? -65.496 -23.967 -17.865 1.00 28.58 ? 418 GLN A N     1 
ATOM   250  C CA    . GLN A 1 36  ? -64.559 -22.868 -18.041 1.00 29.65 ? 418 GLN A CA    1 
ATOM   251  C C     . GLN A 1 36  ? -63.506 -22.891 -16.947 1.00 30.08 ? 418 GLN A C     1 
ATOM   252  O O     . GLN A 1 36  ? -62.318 -23.078 -17.237 1.00 30.76 ? 418 GLN A O     1 
ATOM   253  C CB    . GLN A 1 36  ? -65.261 -21.521 -18.056 1.00 29.89 ? 418 GLN A CB    1 
ATOM   254  C CG    . GLN A 1 36  ? -64.400 -20.421 -18.657 1.00 32.39 ? 418 GLN A CG    1 
ATOM   255  C CD    . GLN A 1 36  ? -64.019 -20.708 -20.102 1.00 37.81 ? 418 GLN A CD    1 
ATOM   256  O OE1   . GLN A 1 36  ? -62.843 -20.593 -20.504 1.00 41.35 ? 418 GLN A OE1   1 
ATOM   257  N NE2   . GLN A 1 36  ? -65.012 -21.091 -20.899 1.00 39.13 ? 418 GLN A NE2   1 
ATOM   258  N N     . LYS A 1 37  ? -63.968 -22.745 -15.681 1.00 30.23 ? 419 LYS A N     1 
ATOM   259  C CA    . LYS A 1 37  ? -63.090 -22.855 -14.509 1.00 30.39 ? 419 LYS A CA    1 
ATOM   260  C C     . LYS A 1 37  ? -62.060 -23.998 -14.593 1.00 30.28 ? 419 LYS A C     1 
ATOM   261  O O     . LYS A 1 37  ? -60.889 -23.813 -14.296 1.00 30.24 ? 419 LYS A O     1 
ATOM   262  C CB    . LYS A 1 37  ? -63.909 -22.990 -13.223 1.00 30.35 ? 419 LYS A CB    1 
ATOM   263  C CG    . LYS A 1 37  ? -63.169 -22.450 -12.003 1.00 32.17 ? 419 LYS A CG    1 
ATOM   264  C CD    . LYS A 1 37  ? -64.012 -22.359 -10.742 1.00 34.00 ? 419 LYS A CD    1 
ATOM   265  C CE    . LYS A 1 37  ? -63.395 -21.354 -9.765  1.00 34.51 ? 419 LYS A CE    1 
ATOM   266  N NZ    . LYS A 1 37  ? -62.660 -22.037 -8.643  1.00 34.44 ? 419 LYS A NZ    1 
ATOM   267  N N     . ILE A 1 38  ? -62.475 -25.166 -14.998 1.00 30.27 ? 420 ILE A N     1 
ATOM   268  C CA    . ILE A 1 38  ? -61.571 -26.294 -15.078 1.00 30.75 ? 420 ILE A CA    1 
ATOM   269  C C     . ILE A 1 38  ? -60.582 -26.138 -16.246 1.00 32.16 ? 420 ILE A C     1 
ATOM   270  O O     . ILE A 1 38  ? -59.407 -26.495 -16.136 1.00 32.48 ? 420 ILE A O     1 
ATOM   271  C CB    . ILE A 1 38  ? -62.350 -27.596 -15.263 1.00 30.41 ? 420 ILE A CB    1 
ATOM   272  C CG1   . ILE A 1 38  ? -63.080 -27.975 -13.973 1.00 28.31 ? 420 ILE A CG1   1 
ATOM   273  C CG2   . ILE A 1 38  ? -61.417 -28.697 -15.733 1.00 29.17 ? 420 ILE A CG2   1 
ATOM   274  C CD1   . ILE A 1 38  ? -63.954 -29.165 -14.131 1.00 25.74 ? 420 ILE A CD1   1 
ATOM   275  N N     . HIS A 1 39  ? -61.062 -25.617 -17.371 1.00 33.08 ? 421 HIS A N     1 
ATOM   276  C CA    . HIS A 1 39  ? -60.198 -25.377 -18.499 1.00 34.06 ? 421 HIS A CA    1 
ATOM   277  C C     . HIS A 1 39  ? -59.128 -24.318 -18.108 1.00 34.31 ? 421 HIS A C     1 
ATOM   278  O O     . HIS A 1 39  ? -57.935 -24.556 -18.249 1.00 34.00 ? 421 HIS A O     1 
ATOM   279  C CB    . HIS A 1 39  ? -61.029 -24.985 -19.715 1.00 34.64 ? 421 HIS A CB    1 
ATOM   280  C CG    . HIS A 1 39  ? -60.222 -24.411 -20.835 1.00 37.81 ? 421 HIS A CG    1 
ATOM   281  N ND1   . HIS A 1 39  ? -59.534 -25.202 -21.738 1.00 40.07 ? 421 HIS A ND1   1 
ATOM   282  C CD2   . HIS A 1 39  ? -59.967 -23.124 -21.185 1.00 38.99 ? 421 HIS A CD2   1 
ATOM   283  C CE1   . HIS A 1 39  ? -58.887 -24.426 -22.593 1.00 39.34 ? 421 HIS A CE1   1 
ATOM   284  N NE2   . HIS A 1 39  ? -59.133 -23.164 -22.279 1.00 40.12 ? 421 HIS A NE2   1 
ATOM   285  N N     . ASP A 1 40  ? -59.541 -23.181 -17.573 1.00 34.41 ? 422 ASP A N     1 
ATOM   286  C CA    . ASP A 1 40  ? -58.577 -22.230 -17.091 1.00 35.26 ? 422 ASP A CA    1 
ATOM   287  C C     . ASP A 1 40  ? -57.482 -22.869 -16.267 1.00 35.80 ? 422 ASP A C     1 
ATOM   288  O O     . ASP A 1 40  ? -56.296 -22.627 -16.490 1.00 36.45 ? 422 ASP A O     1 
ATOM   289  C CB    . ASP A 1 40  ? -59.260 -21.219 -16.214 1.00 35.62 ? 422 ASP A CB    1 
ATOM   290  C CG    . ASP A 1 40  ? -59.481 -19.923 -16.912 1.00 38.88 ? 422 ASP A CG    1 
ATOM   291  O OD1   . ASP A 1 40  ? -59.977 -19.934 -18.073 1.00 42.06 ? 422 ASP A OD1   1 
ATOM   292  O OD2   . ASP A 1 40  ? -59.153 -18.880 -16.297 1.00 43.20 ? 422 ASP A OD2   1 
ATOM   293  N N     . TYR A 1 41  ? -57.872 -23.681 -15.292 1.00 36.23 ? 423 TYR A N     1 
ATOM   294  C CA    . TYR A 1 41  ? -56.921 -24.159 -14.305 1.00 36.13 ? 423 TYR A CA    1 
ATOM   295  C C     . TYR A 1 41  ? -55.913 -25.031 -15.005 1.00 37.03 ? 423 TYR A C     1 
ATOM   296  O O     . TYR A 1 41  ? -54.720 -24.922 -14.773 1.00 37.04 ? 423 TYR A O     1 
ATOM   297  C CB    . TYR A 1 41  ? -57.621 -24.913 -13.181 1.00 35.49 ? 423 TYR A CB    1 
ATOM   298  C CG    . TYR A 1 41  ? -56.753 -25.938 -12.491 1.00 33.37 ? 423 TYR A CG    1 
ATOM   299  C CD1   . TYR A 1 41  ? -56.077 -25.638 -11.290 1.00 29.61 ? 423 TYR A CD1   1 
ATOM   300  C CD2   . TYR A 1 41  ? -56.609 -27.214 -13.038 1.00 31.71 ? 423 TYR A CD2   1 
ATOM   301  C CE1   . TYR A 1 41  ? -55.273 -26.594 -10.659 1.00 28.77 ? 423 TYR A CE1   1 
ATOM   302  C CE2   . TYR A 1 41  ? -55.815 -28.172 -12.414 1.00 31.45 ? 423 TYR A CE2   1 
ATOM   303  C CZ    . TYR A 1 41  ? -55.156 -27.860 -11.237 1.00 28.96 ? 423 TYR A CZ    1 
ATOM   304  O OH    . TYR A 1 41  ? -54.409 -28.846 -10.684 1.00 26.91 ? 423 TYR A OH    1 
ATOM   305  N N     . TYR A 1 42  ? -56.400 -25.874 -15.895 1.00 37.87 ? 424 TYR A N     1 
ATOM   306  C CA    . TYR A 1 42  ? -55.519 -26.692 -16.676 1.00 38.89 ? 424 TYR A CA    1 
ATOM   307  C C     . TYR A 1 42  ? -54.408 -25.936 -17.383 1.00 39.27 ? 424 TYR A C     1 
ATOM   308  O O     . TYR A 1 42  ? -53.241 -26.283 -17.263 1.00 39.38 ? 424 TYR A O     1 
ATOM   309  C CB    . TYR A 1 42  ? -56.310 -27.404 -17.708 1.00 38.82 ? 424 TYR A CB    1 
ATOM   310  C CG    . TYR A 1 42  ? -55.862 -28.790 -17.769 1.00 40.24 ? 424 TYR A CG    1 
ATOM   311  C CD1   . TYR A 1 42  ? -55.019 -29.219 -18.807 1.00 42.06 ? 424 TYR A CD1   1 
ATOM   312  C CD2   . TYR A 1 42  ? -56.241 -29.690 -16.768 1.00 39.27 ? 424 TYR A CD2   1 
ATOM   313  C CE1   . TYR A 1 42  ? -54.583 -30.533 -18.866 1.00 42.00 ? 424 TYR A CE1   1 
ATOM   314  C CE2   . TYR A 1 42  ? -55.816 -30.990 -16.802 1.00 41.16 ? 424 TYR A CE2   1 
ATOM   315  C CZ    . TYR A 1 42  ? -54.982 -31.411 -17.857 1.00 42.66 ? 424 TYR A CZ    1 
ATOM   316  O OH    . TYR A 1 42  ? -54.551 -32.712 -17.906 1.00 45.45 ? 424 TYR A OH    1 
ATOM   317  N N     . GLU A 1 43  ? -54.769 -24.905 -18.123 1.00 39.92 ? 425 GLU A N     1 
ATOM   318  C CA    . GLU A 1 43  ? -53.765 -24.104 -18.772 1.00 41.02 ? 425 GLU A CA    1 
ATOM   319  C C     . GLU A 1 43  ? -52.743 -23.641 -17.734 1.00 41.20 ? 425 GLU A C     1 
ATOM   320  O O     . GLU A 1 43  ? -51.562 -23.917 -17.883 1.00 41.47 ? 425 GLU A O     1 
ATOM   321  C CB    . GLU A 1 43  ? -54.393 -22.937 -19.534 1.00 41.10 ? 425 GLU A CB    1 
ATOM   322  C CG    . GLU A 1 43  ? -55.022 -23.356 -20.870 1.00 43.99 ? 425 GLU A CG    1 
ATOM   323  C CD    . GLU A 1 43  ? -55.888 -22.243 -21.530 1.00 48.45 ? 425 GLU A CD    1 
ATOM   324  O OE1   . GLU A 1 43  ? -56.065 -21.150 -20.940 1.00 49.04 ? 425 GLU A OE1   1 
ATOM   325  O OE2   . GLU A 1 43  ? -56.400 -22.459 -22.658 1.00 50.78 ? 425 GLU A OE2   1 
ATOM   326  N N     . HIS A 1 44  ? -53.195 -22.980 -16.668 1.00 41.21 ? 426 HIS A N     1 
ATOM   327  C CA    . HIS A 1 44  ? -52.280 -22.470 -15.648 1.00 40.86 ? 426 HIS A CA    1 
ATOM   328  C C     . HIS A 1 44  ? -51.510 -23.570 -14.935 1.00 40.90 ? 426 HIS A C     1 
ATOM   329  O O     . HIS A 1 44  ? -50.346 -23.424 -14.610 1.00 40.81 ? 426 HIS A O     1 
ATOM   330  C CB    . HIS A 1 44  ? -53.022 -21.604 -14.642 1.00 40.77 ? 426 HIS A CB    1 
ATOM   331  C CG    . HIS A 1 44  ? -53.454 -20.290 -15.204 1.00 41.34 ? 426 HIS A CG    1 
ATOM   332  N ND1   . HIS A 1 44  ? -52.628 -19.189 -15.231 1.00 41.65 ? 426 HIS A ND1   1 
ATOM   333  C CD2   . HIS A 1 44  ? -54.615 -19.903 -15.786 1.00 41.85 ? 426 HIS A CD2   1 
ATOM   334  C CE1   . HIS A 1 44  ? -53.264 -18.179 -15.801 1.00 42.33 ? 426 HIS A CE1   1 
ATOM   335  N NE2   . HIS A 1 44  ? -54.472 -18.586 -16.144 1.00 41.50 ? 426 HIS A NE2   1 
ATOM   336  N N     . ARG A 1 45  ? -52.153 -24.662 -14.654 1.00 41.18 ? 427 ARG A N     1 
ATOM   337  C CA    . ARG A 1 45  ? -51.495 -25.735 -13.907 1.00 41.67 ? 427 ARG A CA    1 
ATOM   338  C C     . ARG A 1 45  ? -50.388 -26.415 -14.718 1.00 42.71 ? 427 ARG A C     1 
ATOM   339  O O     . ARG A 1 45  ? -49.290 -26.642 -14.206 1.00 43.27 ? 427 ARG A O     1 
ATOM   340  C CB    . ARG A 1 45  ? -52.531 -26.763 -13.422 1.00 20.00 ? 427 ARG A CB    1 
ATOM   341  C CG    . ARG A 1 45  ? -51.967 -28.013 -12.740 1.00 20.00 ? 427 ARG A CG    1 
ATOM   342  C CD    . ARG A 1 45  ? -51.298 -27.702 -11.407 1.00 20.00 ? 427 ARG A CD    1 
ATOM   343  N NE    . ARG A 1 45  ? -50.783 -28.906 -10.757 1.00 20.00 ? 427 ARG A NE    1 
ATOM   344  C CZ    . ARG A 1 45  ? -49.596 -29.456 -11.006 1.00 20.00 ? 427 ARG A CZ    1 
ATOM   345  N NH1   . ARG A 1 45  ? -48.776 -28.921 -11.904 1.00 20.00 ? 427 ARG A NH1   1 
ATOM   346  N NH2   . ARG A 1 45  ? -49.227 -30.551 -10.357 1.00 20.00 ? 427 ARG A NH2   1 
ATOM   347  N N     . TYR A 1 46  ? -50.681 -26.726 -15.979 1.00 43.60 ? 428 TYR A N     1 
ATOM   348  C CA    . TYR A 1 46  ? -49.745 -27.462 -16.831 1.00 44.51 ? 428 TYR A CA    1 
ATOM   349  C C     . TYR A 1 46  ? -49.138 -26.611 -17.951 1.00 45.41 ? 428 TYR A C     1 
ATOM   350  O O     . TYR A 1 46  ? -48.056 -26.928 -18.453 1.00 45.17 ? 428 TYR A O     1 
ATOM   351  C CB    . TYR A 1 46  ? -50.416 -28.713 -17.408 1.00 20.00 ? 428 TYR A CB    1 
ATOM   352  C CG    . TYR A 1 46  ? -50.932 -29.675 -16.355 1.00 20.00 ? 428 TYR A CG    1 
ATOM   353  C CD1   . TYR A 1 46  ? -50.054 -30.471 -15.618 1.00 20.00 ? 428 TYR A CD1   1 
ATOM   354  C CD2   . TYR A 1 46  ? -52.299 -29.791 -16.100 1.00 20.00 ? 428 TYR A CD2   1 
ATOM   355  C CE1   . TYR A 1 46  ? -50.524 -31.355 -14.650 1.00 20.00 ? 428 TYR A CE1   1 
ATOM   356  C CE2   . TYR A 1 46  ? -52.779 -30.674 -15.136 1.00 20.00 ? 428 TYR A CE2   1 
ATOM   357  C CZ    . TYR A 1 46  ? -51.886 -31.452 -14.415 1.00 20.00 ? 428 TYR A CZ    1 
ATOM   358  O OH    . TYR A 1 46  ? -52.354 -32.325 -13.461 1.00 20.00 ? 428 TYR A OH    1 
ATOM   359  N N     . GLN A 1 47  ? -49.840 -25.542 -18.328 1.00 46.86 ? 429 GLN A N     1 
ATOM   360  C CA    . GLN A 1 47  ? -49.399 -24.597 -19.369 1.00 48.66 ? 429 GLN A CA    1 
ATOM   361  C C     . GLN A 1 47  ? -49.050 -25.252 -20.714 1.00 49.94 ? 429 GLN A C     1 
ATOM   362  O O     . GLN A 1 47  ? -48.041 -24.916 -21.341 1.00 50.16 ? 429 GLN A O     1 
ATOM   363  C CB    . GLN A 1 47  ? -48.249 -23.710 -18.863 1.00 48.37 ? 429 GLN A CB    1 
ATOM   364  C CG    . GLN A 1 47  ? -48.686 -22.603 -17.909 1.00 50.00 ? 429 GLN A CG    1 
ATOM   365  C CD    . GLN A 1 47  ? -47.536 -21.718 -17.459 1.00 53.62 ? 429 GLN A CD    1 
ATOM   366  O OE1   . GLN A 1 47  ? -46.479 -22.205 -17.053 1.00 54.75 ? 429 GLN A OE1   1 
ATOM   367  N NE2   . GLN A 1 47  ? -47.742 -20.407 -17.520 1.00 53.78 ? 429 GLN A NE2   1 
ATOM   368  N N     . GLY A 1 48  ? -49.895 -26.186 -21.143 1.00 51.29 ? 430 GLY A N     1 
ATOM   369  C CA    . GLY A 1 48  ? -49.754 -26.831 -22.449 1.00 52.55 ? 430 GLY A CA    1 
ATOM   370  C C     . GLY A 1 48  ? -48.838 -28.042 -22.495 1.00 53.59 ? 430 GLY A C     1 
ATOM   371  O O     . GLY A 1 48  ? -48.666 -28.648 -23.555 1.00 53.99 ? 430 GLY A O     1 
ATOM   372  N N     . LYS A 1 49  ? -48.252 -28.397 -21.353 1.00 54.53 ? 431 LYS A N     1 
ATOM   373  C CA    . LYS A 1 49  ? -47.310 -29.516 -21.278 1.00 55.81 ? 431 LYS A CA    1 
ATOM   374  C C     . LYS A 1 49  ? -47.455 -30.470 -20.051 1.00 56.51 ? 431 LYS A C     1 
ATOM   375  O O     . LYS A 1 49  ? -47.699 -30.047 -18.903 1.00 56.99 ? 431 LYS A O     1 
ATOM   376  C CB    . LYS A 1 49  ? -45.864 -29.006 -21.273 1.00 56.09 ? 431 LYS A CB    1 
ATOM   377  C CG    . LYS A 1 49  ? -45.377 -28.456 -22.607 1.00 57.01 ? 431 LYS A CG    1 
ATOM   378  C CD    . LYS A 1 49  ? -43.988 -27.854 -22.479 1.00 56.44 ? 431 LYS A CD    1 
ATOM   379  C CE    . LYS A 1 49  ? -43.529 -27.240 -23.791 1.00 56.21 ? 431 LYS A CE    1 
ATOM   380  N NZ    . LYS A 1 49  ? -42.184 -26.613 -23.671 1.00 55.62 ? 431 LYS A NZ    1 
ATOM   381  N N     . ILE A 1 50  ? -47.289 -31.759 -20.301 1.00 56.85 ? 432 ILE A N     1 
ATOM   382  C CA    . ILE A 1 50  ? -47.341 -32.705 -19.197 1.00 57.54 ? 432 ILE A CA    1 
ATOM   383  C C     . ILE A 1 50  ? -46.175 -33.710 -19.249 1.00 58.33 ? 432 ILE A C     1 
ATOM   384  O O     . ILE A 1 50  ? -45.926 -34.306 -20.314 1.00 59.02 ? 432 ILE A O     1 
ATOM   385  C CB    . ILE A 1 50  ? -48.743 -33.374 -19.116 1.00 57.15 ? 432 ILE A CB    1 
ATOM   386  C CG1   . ILE A 1 50  ? -49.757 -32.345 -18.591 1.00 57.47 ? 432 ILE A CG1   1 
ATOM   387  C CG2   . ILE A 1 50  ? -48.709 -34.603 -18.223 1.00 56.91 ? 432 ILE A CG2   1 
ATOM   388  C CD1   . ILE A 1 50  ? -51.179 -32.807 -18.492 1.00 57.23 ? 432 ILE A CD1   1 
ATOM   389  N N     . PHE A 1 51  ? -45.461 -33.869 -18.120 1.00 58.40 ? 433 PHE A N     1 
ATOM   390  C CA    . PHE A 1 51  ? -44.411 -34.904 -17.968 1.00 58.54 ? 433 PHE A CA    1 
ATOM   391  C C     . PHE A 1 51  ? -44.229 -35.435 -16.527 1.00 58.52 ? 433 PHE A C     1 
ATOM   392  O O     . PHE A 1 51  ? -44.685 -34.818 -15.562 1.00 58.48 ? 433 PHE A O     1 
ATOM   393  C CB    . PHE A 1 51  ? -43.083 -34.492 -18.643 1.00 58.77 ? 433 PHE A CB    1 
ATOM   394  C CG    . PHE A 1 51  ? -42.512 -33.147 -18.179 1.00 60.63 ? 433 PHE A CG    1 
ATOM   395  C CD1   . PHE A 1 51  ? -43.274 -32.226 -17.419 1.00 61.68 ? 433 PHE A CD1   1 
ATOM   396  C CD2   . PHE A 1 51  ? -41.193 -32.785 -18.538 1.00 60.42 ? 433 PHE A CD2   1 
ATOM   397  C CE1   . PHE A 1 51  ? -42.712 -30.982 -17.012 1.00 61.57 ? 433 PHE A CE1   1 
ATOM   398  C CE2   . PHE A 1 51  ? -40.627 -31.549 -18.132 1.00 59.09 ? 433 PHE A CE2   1 
ATOM   399  C CZ    . PHE A 1 51  ? -41.385 -30.653 -17.372 1.00 59.81 ? 433 PHE A CZ    1 
ATOM   400  N N     . ASP A 1 52  ? -43.572 -36.583 -16.398 1.00 58.59 ? 434 ASP A N     1 
ATOM   401  C CA    . ASP A 1 52  ? -43.665 -37.400 -15.187 1.00 58.98 ? 434 ASP A CA    1 
ATOM   402  C C     . ASP A 1 52  ? -42.433 -36.942 -14.408 1.00 58.61 ? 434 ASP A C     1 
ATOM   403  O O     . ASP A 1 52  ? -41.506 -37.718 -14.212 1.00 58.52 ? 434 ASP A O     1 
ATOM   404  C CB    . ASP A 1 52  ? -43.481 -38.887 -15.573 1.00 59.75 ? 434 ASP A CB    1 
ATOM   405  C CG    . ASP A 1 52  ? -44.417 -39.848 -14.804 1.00 61.41 ? 434 ASP A CG    1 
ATOM   406  O OD1   . ASP A 1 52  ? -45.470 -40.221 -15.380 1.00 64.45 ? 434 ASP A OD1   1 
ATOM   407  O OD2   . ASP A 1 52  ? -44.102 -40.256 -13.652 1.00 62.31 ? 434 ASP A OD2   1 
ATOM   408  N N     . GLU A 1 53  ? -42.423 -35.689 -13.964 1.00 58.35 ? 435 GLU A N     1 
ATOM   409  C CA    . GLU A 1 53  ? -41.386 -35.161 -13.057 1.00 58.04 ? 435 GLU A CA    1 
ATOM   410  C C     . GLU A 1 53  ? -40.856 -36.206 -12.089 1.00 57.30 ? 435 GLU A C     1 
ATOM   411  O O     . GLU A 1 53  ? -39.688 -36.595 -12.180 1.00 57.00 ? 435 GLU A O     1 
ATOM   412  C CB    . GLU A 1 53  ? -41.896 -33.931 -12.292 1.00 58.36 ? 435 GLU A CB    1 
ATOM   413  C CG    . GLU A 1 53  ? -42.351 -32.815 -13.246 1.00 60.69 ? 435 GLU A CG    1 
ATOM   414  C CD    . GLU A 1 53  ? -42.404 -31.402 -12.634 1.00 62.92 ? 435 GLU A CD    1 
ATOM   415  O OE1   . GLU A 1 53  ? -43.107 -31.218 -11.610 1.00 65.14 ? 435 GLU A OE1   1 
ATOM   416  O OE2   . GLU A 1 53  ? -41.780 -30.469 -13.210 1.00 62.07 ? 435 GLU A OE2   1 
ATOM   417  N N     . GLU A 1 54  ? -41.726 -36.680 -11.192 1.00 56.62 ? 436 GLU A N     1 
ATOM   418  C CA    . GLU A 1 54  ? -41.362 -37.735 -10.228 1.00 55.85 ? 436 GLU A CA    1 
ATOM   419  C C     . GLU A 1 54  ? -40.582 -38.906 -10.839 1.00 54.63 ? 436 GLU A C     1 
ATOM   420  O O     . GLU A 1 54  ? -39.411 -39.095 -10.504 1.00 54.49 ? 436 GLU A O     1 
ATOM   421  C CB    . GLU A 1 54  ? -42.575 -38.222 -9.411  1.00 56.49 ? 436 GLU A CB    1 
ATOM   422  C CG    . GLU A 1 54  ? -42.639 -37.666 -7.966  1.00 58.14 ? 436 GLU A CG    1 
ATOM   423  C CD    . GLU A 1 54  ? -41.373 -38.003 -7.131  1.00 61.21 ? 436 GLU A CD    1 
ATOM   424  O OE1   . GLU A 1 54  ? -40.581 -38.899 -7.548  1.00 61.46 ? 436 GLU A OE1   1 
ATOM   425  O OE2   . GLU A 1 54  ? -41.172 -37.364 -6.060  1.00 61.50 ? 436 GLU A OE2   1 
ATOM   426  N N     . ASN A 1 55  ? -41.217 -39.661 -11.740 1.00 53.45 ? 437 ASN A N     1 
ATOM   427  C CA    . ASN A 1 55  ? -40.554 -40.749 -12.495 1.00 52.09 ? 437 ASN A CA    1 
ATOM   428  C C     . ASN A 1 55  ? -39.105 -40.436 -12.814 1.00 51.04 ? 437 ASN A C     1 
ATOM   429  O O     . ASN A 1 55  ? -38.205 -41.205 -12.482 1.00 51.24 ? 437 ASN A O     1 
ATOM   430  C CB    . ASN A 1 55  ? -41.295 -41.050 -13.811 1.00 52.24 ? 437 ASN A CB    1 
ATOM   431  C CG    . ASN A 1 55  ? -40.767 -42.307 -14.538 1.00 52.92 ? 437 ASN A CG    1 
ATOM   432  O OD1   . ASN A 1 55  ? -40.617 -43.375 -13.934 1.00 54.37 ? 437 ASN A OD1   1 
ATOM   433  N ND2   . ASN A 1 55  ? -40.516 -42.181 -15.851 1.00 52.59 ? 437 ASN A ND2   1 
ATOM   434  N N     . ILE A 1 56  ? -38.889 -39.285 -13.437 1.00 49.67 ? 438 ILE A N     1 
ATOM   435  C CA    . ILE A 1 56  ? -37.584 -38.894 -13.956 1.00 48.46 ? 438 ILE A CA    1 
ATOM   436  C C     . ILE A 1 56  ? -36.547 -38.635 -12.856 1.00 47.24 ? 438 ILE A C     1 
ATOM   437  O O     . ILE A 1 56  ? -35.355 -38.855 -13.054 1.00 46.49 ? 438 ILE A O     1 
ATOM   438  C CB    . ILE A 1 56  ? -37.748 -37.678 -14.887 1.00 48.88 ? 438 ILE A CB    1 
ATOM   439  C CG1   . ILE A 1 56  ? -38.659 -38.067 -16.073 1.00 50.49 ? 438 ILE A CG1   1 
ATOM   440  C CG2   . ILE A 1 56  ? -36.403 -37.177 -15.387 1.00 48.79 ? 438 ILE A CG2   1 
ATOM   441  C CD1   . ILE A 1 56  ? -39.886 -37.121 -16.307 1.00 53.37 ? 438 ILE A CD1   1 
ATOM   442  N N     . LEU A 1 57  ? -37.003 -38.187 -11.693 1.00 45.98 ? 439 LEU A N     1 
ATOM   443  C CA    . LEU A 1 57  ? -36.078 -37.962 -10.597 1.00 44.80 ? 439 LEU A CA    1 
ATOM   444  C C     . LEU A 1 57  ? -35.711 -39.282 -9.922  1.00 44.62 ? 439 LEU A C     1 
ATOM   445  O O     . LEU A 1 57  ? -34.590 -39.446 -9.419  1.00 44.38 ? 439 LEU A O     1 
ATOM   446  C CB    . LEU A 1 57  ? -36.627 -36.913 -9.607  1.00 44.79 ? 439 LEU A CB    1 
ATOM   447  C CG    . LEU A 1 57  ? -36.899 -35.469 -10.105 1.00 42.69 ? 439 LEU A CG    1 
ATOM   448  C CD1   . LEU A 1 57  ? -37.200 -34.539 -8.939  1.00 41.14 ? 439 LEU A CD1   1 
ATOM   449  C CD2   . LEU A 1 57  ? -35.758 -34.886 -10.946 1.00 37.39 ? 439 LEU A CD2   1 
ATOM   450  N N     . SER A 1 58  ? -36.655 -40.227 -9.954  1.00 44.25 ? 440 SER A N     1 
ATOM   451  C CA    . SER A 1 58  ? -36.495 -41.597 -9.400  1.00 44.06 ? 440 SER A CA    1 
ATOM   452  C C     . SER A 1 58  ? -35.358 -42.449 -9.993  1.00 43.34 ? 440 SER A C     1 
ATOM   453  O O     . SER A 1 58  ? -34.873 -43.395 -9.355  1.00 43.33 ? 440 SER A O     1 
ATOM   454  C CB    . SER A 1 58  ? -37.789 -42.360 -9.614  1.00 44.27 ? 440 SER A CB    1 
ATOM   455  O OG    . SER A 1 58  ? -38.864 -41.443 -9.706  1.00 46.55 ? 440 SER A OG    1 
ATOM   456  N N     . GLU A 1 59  ? -34.962 -42.115 -11.223 1.00 42.17 ? 441 GLU A N     1 
ATOM   457  C CA    . GLU A 1 59  ? -33.933 -42.831 -11.958 1.00 40.63 ? 441 GLU A CA    1 
ATOM   458  C C     . GLU A 1 59  ? -32.560 -42.398 -11.494 1.00 38.90 ? 441 GLU A C     1 
ATOM   459  O O     . GLU A 1 59  ? -31.560 -43.103 -11.687 1.00 39.04 ? 441 GLU A O     1 
ATOM   460  C CB    . GLU A 1 59  ? -34.086 -42.517 -13.437 1.00 41.27 ? 441 GLU A CB    1 
ATOM   461  C CG    . GLU A 1 59  ? -35.514 -42.695 -13.985 1.00 45.09 ? 441 GLU A CG    1 
ATOM   462  C CD    . GLU A 1 59  ? -35.608 -42.429 -15.498 1.00 50.11 ? 441 GLU A CD    1 
ATOM   463  O OE1   . GLU A 1 59  ? -34.693 -42.879 -16.224 1.00 51.74 ? 441 GLU A OE1   1 
ATOM   464  O OE2   . GLU A 1 59  ? -36.586 -41.781 -15.967 1.00 52.76 ? 441 GLU A OE2   1 
ATOM   465  N N     . LEU A 1 60  ? -32.520 -41.215 -10.894 1.00 36.64 ? 442 LEU A N     1 
ATOM   466  C CA    . LEU A 1 60  ? -31.290 -40.643 -10.395 1.00 34.37 ? 442 LEU A CA    1 
ATOM   467  C C     . LEU A 1 60  ? -31.068 -40.964 -8.924  1.00 33.85 ? 442 LEU A C     1 
ATOM   468  O O     . LEU A 1 60  ? -31.957 -41.459 -8.260  1.00 34.22 ? 442 LEU A O     1 
ATOM   469  C CB    . LEU A 1 60  ? -31.335 -39.141 -10.578 1.00 33.73 ? 442 LEU A CB    1 
ATOM   470  C CG    . LEU A 1 60  ? -31.654 -38.583 -11.963 1.00 31.93 ? 442 LEU A CG    1 
ATOM   471  C CD1   . LEU A 1 60  ? -31.605 -37.090 -11.853 1.00 28.85 ? 442 LEU A CD1   1 
ATOM   472  C CD2   . LEU A 1 60  ? -30.698 -39.092 -13.067 1.00 29.94 ? 442 LEU A CD2   1 
ATOM   473  N N     . ASN A 1 61  ? -29.869 -40.662 -8.433  1.00 32.91 ? 443 ASN A N     1 
ATOM   474  C CA    . ASN A 1 61  ? -29.466 -40.874 -7.058  1.00 31.70 ? 443 ASN A CA    1 
ATOM   475  C C     . ASN A 1 61  ? -29.777 -39.635 -6.252  1.00 31.65 ? 443 ASN A C     1 
ATOM   476  O O     . ASN A 1 61  ? -30.354 -38.717 -6.783  1.00 31.63 ? 443 ASN A O     1 
ATOM   477  C CB    . ASN A 1 61  ? -27.983 -41.173 -7.022  1.00 31.06 ? 443 ASN A CB    1 
ATOM   478  C CG    . ASN A 1 61  ? -27.151 -39.978 -7.366  1.00 29.93 ? 443 ASN A CG    1 
ATOM   479  O OD1   . ASN A 1 61  ? -27.675 -38.897 -7.615  1.00 29.48 ? 443 ASN A OD1   1 
ATOM   480  N ND2   . ASN A 1 61  ? -25.848 -40.158 -7.407  1.00 28.41 ? 443 ASN A ND2   1 
ATOM   481  N N     . ASP A 1 62  ? -29.384 -39.598 -4.980  1.00 32.31 ? 444 ASP A N     1 
ATOM   482  C CA    . ASP A 1 62  ? -29.711 -38.463 -4.094  1.00 32.36 ? 444 ASP A CA    1 
ATOM   483  C C     . ASP A 1 62  ? -28.895 -37.246 -4.369  1.00 31.52 ? 444 ASP A C     1 
ATOM   484  O O     . ASP A 1 62  ? -29.450 -36.174 -4.457  1.00 31.96 ? 444 ASP A O     1 
ATOM   485  C CB    . ASP A 1 62  ? -29.550 -38.809 -2.609  1.00 33.43 ? 444 ASP A CB    1 
ATOM   486  C CG    . ASP A 1 62  ? -30.786 -39.418 -2.028  1.00 35.84 ? 444 ASP A CG    1 
ATOM   487  O OD1   . ASP A 1 62  ? -31.874 -38.989 -2.446  1.00 39.78 ? 444 ASP A OD1   1 
ATOM   488  O OD2   . ASP A 1 62  ? -30.677 -40.323 -1.170  1.00 38.87 ? 444 ASP A OD2   1 
ATOM   489  N N     . PRO A 1 63  ? -27.562 -37.388 -4.461  1.00 30.82 ? 445 PRO A N     1 
ATOM   490  C CA    . PRO A 1 63  ? -26.759 -36.197 -4.719  1.00 30.18 ? 445 PRO A CA    1 
ATOM   491  C C     . PRO A 1 63  ? -27.314 -35.357 -5.877  1.00 30.22 ? 445 PRO A C     1 
ATOM   492  O O     . PRO A 1 63  ? -27.559 -34.131 -5.709  1.00 30.11 ? 445 PRO A O     1 
ATOM   493  C CB    . PRO A 1 63  ? -25.409 -36.785 -5.067  1.00 30.14 ? 445 PRO A CB    1 
ATOM   494  C CG    . PRO A 1 63  ? -25.341 -37.969 -4.184  1.00 30.69 ? 445 PRO A CG    1 
ATOM   495  C CD    . PRO A 1 63  ? -26.715 -38.563 -4.190  1.00 30.09 ? 445 PRO A CD    1 
ATOM   496  N N     . LEU A 1 64  ? -27.538 -36.015 -7.021  1.00 29.54 ? 446 LEU A N     1 
ATOM   497  C CA    . LEU A 1 64  ? -28.079 -35.341 -8.199  1.00 29.18 ? 446 LEU A CA    1 
ATOM   498  C C     . LEU A 1 64  ? -29.467 -34.791 -7.933  1.00 28.99 ? 446 LEU A C     1 
ATOM   499  O O     . LEU A 1 64  ? -29.761 -33.670 -8.295  1.00 29.39 ? 446 LEU A O     1 
ATOM   500  C CB    . LEU A 1 64  ? -28.095 -36.249 -9.431  1.00 28.79 ? 446 LEU A CB    1 
ATOM   501  C CG    . LEU A 1 64  ? -26.749 -36.728 -9.979  1.00 28.22 ? 446 LEU A CG    1 
ATOM   502  C CD1   . LEU A 1 64  ? -26.953 -37.895 -10.885 1.00 26.83 ? 446 LEU A CD1   1 
ATOM   503  C CD2   . LEU A 1 64  ? -26.046 -35.624 -10.714 1.00 28.29 ? 446 LEU A CD2   1 
ATOM   504  N N     . ARG A 1 65  ? -30.314 -35.574 -7.295  1.00 28.99 ? 447 ARG A N     1 
ATOM   505  C CA    . ARG A 1 65  ? -31.670 -35.153 -6.985  1.00 29.38 ? 447 ARG A CA    1 
ATOM   506  C C     . ARG A 1 65  ? -31.632 -33.891 -6.111  1.00 29.10 ? 447 ARG A C     1 
ATOM   507  O O     . ARG A 1 65  ? -32.458 -33.010 -6.274  1.00 29.12 ? 447 ARG A O     1 
ATOM   508  C CB    . ARG A 1 65  ? -32.381 -36.286 -6.261  1.00 29.68 ? 447 ARG A CB    1 
ATOM   509  C CG    . ARG A 1 65  ? -33.815 -36.527 -6.629  1.00 32.79 ? 447 ARG A CG    1 
ATOM   510  C CD    . ARG A 1 65  ? -34.377 -37.718 -5.815  1.00 36.07 ? 447 ARG A CD    1 
ATOM   511  N NE    . ARG A 1 65  ? -33.911 -39.014 -6.322  1.00 37.26 ? 447 ARG A NE    1 
ATOM   512  C CZ    . ARG A 1 65  ? -33.359 -39.974 -5.578  1.00 39.00 ? 447 ARG A CZ    1 
ATOM   513  N NH1   . ARG A 1 65  ? -33.198 -39.829 -4.271  1.00 38.78 ? 447 ARG A NH1   1 
ATOM   514  N NH2   . ARG A 1 65  ? -32.969 -41.103 -6.141  1.00 40.10 ? 447 ARG A NH2   1 
ATOM   515  N N     . GLU A 1 66  ? -30.647 -33.785 -5.223  1.00 29.20 ? 448 GLU A N     1 
ATOM   516  C CA    . GLU A 1 66  ? -30.536 -32.642 -4.320  1.00 29.84 ? 448 GLU A CA    1 
ATOM   517  C C     . GLU A 1 66  ? -29.976 -31.387 -5.013  1.00 29.60 ? 448 GLU A C     1 
ATOM   518  O O     . GLU A 1 66  ? -30.514 -30.316 -4.832  1.00 28.77 ? 448 GLU A O     1 
ATOM   519  C CB    . GLU A 1 66  ? -29.697 -33.010 -3.089  1.00 30.64 ? 448 GLU A CB    1 
ATOM   520  C CG    . GLU A 1 66  ? -30.276 -34.139 -2.185  1.00 33.22 ? 448 GLU A CG    1 
ATOM   521  C CD    . GLU A 1 66  ? -29.366 -34.582 -0.980  1.00 37.27 ? 448 GLU A CD    1 
ATOM   522  O OE1   . GLU A 1 66  ? -28.302 -33.962 -0.702  1.00 38.89 ? 448 GLU A OE1   1 
ATOM   523  O OE2   . GLU A 1 66  ? -29.737 -35.572 -0.289  1.00 37.93 ? 448 GLU A OE2   1 
ATOM   524  N N     . GLU A 1 67  ? -28.909 -31.525 -5.807  1.00 29.73 ? 449 GLU A N     1 
ATOM   525  C CA    . GLU A 1 67  ? -28.435 -30.427 -6.668  1.00 30.11 ? 449 GLU A CA    1 
ATOM   526  C C     . GLU A 1 67  ? -29.572 -29.811 -7.446  1.00 29.88 ? 449 GLU A C     1 
ATOM   527  O O     . GLU A 1 67  ? -29.699 -28.594 -7.487  1.00 30.68 ? 449 GLU A O     1 
ATOM   528  C CB    . GLU A 1 67  ? -27.387 -30.886 -7.674  1.00 29.89 ? 449 GLU A CB    1 
ATOM   529  C CG    . GLU A 1 67  ? -26.102 -31.405 -7.037  1.00 35.63 ? 449 GLU A CG    1 
ATOM   530  C CD    . GLU A 1 67  ? -24.944 -31.595 -8.037  1.00 41.26 ? 449 GLU A CD    1 
ATOM   531  O OE1   . GLU A 1 67  ? -24.192 -32.606 -7.903  1.00 40.63 ? 449 GLU A OE1   1 
ATOM   532  O OE2   . GLU A 1 67  ? -24.796 -30.731 -8.953  1.00 43.41 ? 449 GLU A OE2   1 
ATOM   533  N N     . ILE A 1 68  ? -30.396 -30.644 -8.073  1.00 29.16 ? 450 ILE A N     1 
ATOM   534  C CA    . ILE A 1 68  ? -31.438 -30.157 -8.944  1.00 28.30 ? 450 ILE A CA    1 
ATOM   535  C C     . ILE A 1 68  ? -32.509 -29.418 -8.196  1.00 28.73 ? 450 ILE A C     1 
ATOM   536  O O     . ILE A 1 68  ? -32.786 -28.273 -8.509  1.00 29.42 ? 450 ILE A O     1 
ATOM   537  C CB    . ILE A 1 68  ? -32.101 -31.274 -9.674  1.00 28.17 ? 450 ILE A CB    1 
ATOM   538  C CG1   . ILE A 1 68  ? -31.098 -31.916 -10.622 1.00 28.28 ? 450 ILE A CG1   1 
ATOM   539  C CG2   . ILE A 1 68  ? -33.326 -30.762 -10.433 1.00 26.90 ? 450 ILE A CG2   1 
ATOM   540  C CD1   . ILE A 1 68  ? -31.607 -33.166 -11.273 1.00 27.81 ? 450 ILE A CD1   1 
ATOM   541  N N     . VAL A 1 69  ? -33.131 -30.063 -7.216  1.00 28.39 ? 451 VAL A N     1 
ATOM   542  C CA    . VAL A 1 69  ? -34.201 -29.421 -6.463  1.00 28.10 ? 451 VAL A CA    1 
ATOM   543  C C     . VAL A 1 69  ? -33.669 -28.075 -5.896  1.00 28.75 ? 451 VAL A C     1 
ATOM   544  O O     . VAL A 1 69  ? -34.385 -27.049 -5.866  1.00 30.09 ? 451 VAL A O     1 
ATOM   545  C CB    . VAL A 1 69  ? -34.778 -30.384 -5.363  1.00 27.80 ? 451 VAL A CB    1 
ATOM   546  C CG1   . VAL A 1 69  ? -35.916 -29.784 -4.650  1.00 26.72 ? 451 VAL A CG1   1 
ATOM   547  C CG2   . VAL A 1 69  ? -35.271 -31.652 -5.993  1.00 28.42 ? 451 VAL A CG2   1 
ATOM   548  N N     . ASN A 1 70  ? -32.402 -28.057 -5.481  1.00 28.03 ? 452 ASN A N     1 
ATOM   549  C CA    . ASN A 1 70  ? -31.804 -26.832 -4.987  1.00 26.96 ? 452 ASN A CA    1 
ATOM   550  C C     . ASN A 1 70  ? -31.725 -25.760 -6.062  1.00 27.22 ? 452 ASN A C     1 
ATOM   551  O O     . ASN A 1 70  ? -32.014 -24.602 -5.816  1.00 27.79 ? 452 ASN A O     1 
ATOM   552  C CB    . ASN A 1 70  ? -30.473 -27.118 -4.312  1.00 25.84 ? 452 ASN A CB    1 
ATOM   553  C CG    . ASN A 1 70  ? -30.649 -27.392 -2.838  1.00 24.97 ? 452 ASN A CG    1 
ATOM   554  O OD1   . ASN A 1 70  ? -31.025 -26.498 -2.095  1.00 25.07 ? 452 ASN A OD1   1 
ATOM   555  N ND2   . ASN A 1 70  ? -30.446 -28.631 -2.412  1.00 20.63 ? 452 ASN A ND2   1 
ATOM   556  N N     . PHE A 1 71  ? -31.411 -26.159 -7.276  1.00 26.94 ? 453 PHE A N     1 
ATOM   557  C CA    . PHE A 1 71  ? -31.301 -25.214 -8.321  1.00 27.07 ? 453 PHE A CA    1 
ATOM   558  C C     . PHE A 1 71  ? -32.660 -24.631 -8.718  1.00 28.50 ? 453 PHE A C     1 
ATOM   559  O O     . PHE A 1 71  ? -32.803 -23.397 -8.905  1.00 29.21 ? 453 PHE A O     1 
ATOM   560  C CB    . PHE A 1 71  ? -30.639 -25.874 -9.479  1.00 26.16 ? 453 PHE A CB    1 
ATOM   561  C CG    . PHE A 1 71  ? -30.360 -24.965 -10.576 1.00 25.51 ? 453 PHE A CG    1 
ATOM   562  C CD1   . PHE A 1 71  ? -29.185 -24.239 -10.595 1.00 25.60 ? 453 PHE A CD1   1 
ATOM   563  C CD2   . PHE A 1 71  ? -31.268 -24.828 -11.625 1.00 25.27 ? 453 PHE A CD2   1 
ATOM   564  C CE1   . PHE A 1 71  ? -28.909 -23.363 -11.667 1.00 27.59 ? 453 PHE A CE1   1 
ATOM   565  C CE2   . PHE A 1 71  ? -31.012 -23.966 -12.697 1.00 24.44 ? 453 PHE A CE2   1 
ATOM   566  C CZ    . PHE A 1 71  ? -29.846 -23.226 -12.723 1.00 26.00 ? 453 PHE A CZ    1 
ATOM   567  N N     . ASN A 1 72  ? -33.657 -25.501 -8.851  1.00 29.11 ? 454 ASN A N     1 
ATOM   568  C CA    . ASN A 1 72  ? -34.971 -25.088 -9.308  1.00 29.58 ? 454 ASN A CA    1 
ATOM   569  C C     . ASN A 1 72  ? -35.684 -24.203 -8.294  1.00 30.27 ? 454 ASN A C     1 
ATOM   570  O O     . ASN A 1 72  ? -36.476 -23.341 -8.661  1.00 30.56 ? 454 ASN A O     1 
ATOM   571  C CB    . ASN A 1 72  ? -35.814 -26.310 -9.576  1.00 29.66 ? 454 ASN A CB    1 
ATOM   572  C CG    . ASN A 1 72  ? -35.370 -27.075 -10.804 1.00 30.59 ? 454 ASN A CG    1 
ATOM   573  O OD1   . ASN A 1 72  ? -34.513 -26.625 -11.567 1.00 33.27 ? 454 ASN A OD1   1 
ATOM   574  N ND2   . ASN A 1 72  ? -35.961 -28.246 -11.004 1.00 29.80 ? 454 ASN A ND2   1 
ATOM   575  N N     . CYS A 1 73  ? -35.393 -24.410 -7.015  1.00 30.54 ? 455 CYS A N     1 
ATOM   576  C CA    . CYS A 1 73  ? -36.047 -23.660 -5.971  1.00 30.90 ? 455 CYS A CA    1 
ATOM   577  C C     . CYS A 1 73  ? -35.191 -22.518 -5.444  1.00 30.42 ? 455 CYS A C     1 
ATOM   578  O O     . CYS A 1 73  ? -35.485 -21.935 -4.406  1.00 30.57 ? 455 CYS A O     1 
ATOM   579  C CB    . CYS A 1 73  ? -36.446 -24.602 -4.855  1.00 31.14 ? 455 CYS A CB    1 
ATOM   580  S SG    . CYS A 1 73  ? -37.855 -25.611 -5.298  1.00 35.19 ? 455 CYS A SG    1 
ATOM   581  N N     . ARG A 1 74  ? -34.145 -22.195 -6.187  1.00 29.93 ? 456 ARG A N     1 
ATOM   582  C CA    . ARG A 1 74  ? -33.222 -21.127 -5.869  1.00 29.43 ? 456 ARG A CA    1 
ATOM   583  C C     . ARG A 1 74  ? -33.827 -19.805 -5.464  1.00 30.00 ? 456 ARG A C     1 
ATOM   584  O O     . ARG A 1 74  ? -33.369 -19.227 -4.497  1.00 30.79 ? 456 ARG A O     1 
ATOM   585  C CB    . ARG A 1 74  ? -32.287 -20.892 -7.042  1.00 29.51 ? 456 ARG A CB    1 
ATOM   586  C CG    . ARG A 1 74  ? -30.874 -21.094 -6.693  1.00 27.61 ? 456 ARG A CG    1 
ATOM   587  C CD    . ARG A 1 74  ? -30.098 -21.589 -7.830  1.00 25.59 ? 456 ARG A CD    1 
ATOM   588  N NE    . ARG A 1 74  ? -29.805 -20.621 -8.884  1.00 25.20 ? 456 ARG A NE    1 
ATOM   589  C CZ    . ARG A 1 74  ? -30.558 -20.495 -9.964  1.00 28.58 ? 456 ARG A CZ    1 
ATOM   590  N NH1   . ARG A 1 74  ? -31.660 -21.226 -10.068 1.00 29.87 ? 456 ARG A NH1   1 
ATOM   591  N NH2   . ARG A 1 74  ? -30.235 -19.649 -10.926 1.00 28.20 ? 456 ARG A NH2   1 
ATOM   592  N N     . LYS A 1 75  ? -34.811 -19.284 -6.195  1.00 30.62 ? 457 LYS A N     1 
ATOM   593  C CA    . LYS A 1 75  ? -35.429 -18.008 -5.784  1.00 30.80 ? 457 LYS A CA    1 
ATOM   594  C C     . LYS A 1 75  ? -36.313 -18.170 -4.553  1.00 30.58 ? 457 LYS A C     1 
ATOM   595  O O     . LYS A 1 75  ? -36.351 -17.301 -3.720  1.00 30.40 ? 457 LYS A O     1 
ATOM   596  C CB    . LYS A 1 75  ? -36.215 -17.374 -6.927  1.00 31.45 ? 457 LYS A CB    1 
ATOM   597  C CG    . LYS A 1 75  ? -36.709 -15.972 -6.633  1.00 32.89 ? 457 LYS A CG    1 
ATOM   598  C CD    . LYS A 1 75  ? -37.764 -15.522 -7.626  1.00 35.47 ? 457 LYS A CD    1 
ATOM   599  C CE    . LYS A 1 75  ? -38.772 -14.586 -6.930  1.00 37.80 ? 457 LYS A CE    1 
ATOM   600  N NZ    . LYS A 1 75  ? -39.572 -13.820 -7.932  1.00 40.21 ? 457 LYS A NZ    1 
ATOM   601  N N     . LEU A 1 76  ? -37.004 -19.293 -4.432  1.00 30.91 ? 458 LEU A N     1 
ATOM   602  C CA    . LEU A 1 76  ? -37.807 -19.566 -3.260  1.00 31.68 ? 458 LEU A CA    1 
ATOM   603  C C     . LEU A 1 76  ? -37.001 -19.547 -1.975  1.00 32.13 ? 458 LEU A C     1 
ATOM   604  O O     . LEU A 1 76  ? -37.401 -18.931 -1.008  1.00 32.34 ? 458 LEU A O     1 
ATOM   605  C CB    . LEU A 1 76  ? -38.499 -20.906 -3.414  1.00 31.98 ? 458 LEU A CB    1 
ATOM   606  C CG    . LEU A 1 76  ? -39.742 -21.200 -2.564  1.00 33.68 ? 458 LEU A CG    1 
ATOM   607  C CD1   . LEU A 1 76  ? -39.436 -22.207 -1.461  1.00 34.44 ? 458 LEU A CD1   1 
ATOM   608  C CD2   . LEU A 1 76  ? -40.452 -19.934 -2.005  1.00 36.27 ? 458 LEU A CD2   1 
ATOM   609  N N     . VAL A 1 77  ? -35.856 -20.206 -1.971  1.00 32.63 ? 459 VAL A N     1 
ATOM   610  C CA    . VAL A 1 77  ? -35.026 -20.272 -0.785  1.00 33.11 ? 459 VAL A CA    1 
ATOM   611  C C     . VAL A 1 77  ? -34.500 -18.889 -0.452  1.00 33.67 ? 459 VAL A C     1 
ATOM   612  O O     . VAL A 1 77  ? -34.456 -18.501 0.709   1.00 33.41 ? 459 VAL A O     1 
ATOM   613  C CB    . VAL A 1 77  ? -33.842 -21.258 -1.000  1.00 33.29 ? 459 VAL A CB    1 
ATOM   614  C CG1   . VAL A 1 77  ? -32.708 -21.006 -0.031  1.00 32.18 ? 459 VAL A CG1   1 
ATOM   615  C CG2   . VAL A 1 77  ? -34.329 -22.708 -0.924  1.00 33.59 ? 459 VAL A CG2   1 
ATOM   616  N N     . ALA A 1 78  ? -34.118 -18.147 -1.485  1.00 34.18 ? 460 ALA A N     1 
ATOM   617  C CA    . ALA A 1 78  ? -33.432 -16.884 -1.303  1.00 34.92 ? 460 ALA A CA    1 
ATOM   618  C C     . ALA A 1 78  ? -34.319 -15.749 -0.800  1.00 36.12 ? 460 ALA A C     1 
ATOM   619  O O     . ALA A 1 78  ? -33.818 -14.859 -0.114  1.00 36.92 ? 460 ALA A O     1 
ATOM   620  C CB    . ALA A 1 78  ? -32.746 -16.493 -2.554  1.00 34.67 ? 460 ALA A CB    1 
ATOM   621  N N     . THR A 1 79  ? -35.620 -15.774 -1.119  1.00 36.96 ? 461 THR A N     1 
ATOM   622  C CA    . THR A 1 79  ? -36.576 -14.752 -0.646  1.00 37.45 ? 461 THR A CA    1 
ATOM   623  C C     . THR A 1 79  ? -37.379 -15.129 0.583   1.00 37.75 ? 461 THR A C     1 
ATOM   624  O O     . THR A 1 79  ? -38.397 -14.518 0.855   1.00 38.37 ? 461 THR A O     1 
ATOM   625  C CB    . THR A 1 79  ? -37.589 -14.422 -1.709  1.00 37.15 ? 461 THR A CB    1 
ATOM   626  O OG1   . THR A 1 79  ? -37.952 -15.628 -2.374  1.00 38.69 ? 461 THR A OG1   1 
ATOM   627  C CG2   . THR A 1 79  ? -36.990 -13.522 -2.715  1.00 38.04 ? 461 THR A CG2   1 
ATOM   628  N N     . MET A 1 80  ? -36.910 -16.109 1.337   1.00 38.18 ? 462 MET A N     1 
ATOM   629  C CA    . MET A 1 80  ? -37.644 -16.662 2.457   1.00 38.28 ? 462 MET A CA    1 
ATOM   630  C C     . MET A 1 80  ? -36.841 -16.680 3.718   1.00 37.60 ? 462 MET A C     1 
ATOM   631  O O     . MET A 1 80  ? -36.202 -17.672 4.031   1.00 36.91 ? 462 MET A O     1 
ATOM   632  C CB    . MET A 1 80  ? -37.935 -18.087 2.138   1.00 39.35 ? 462 MET A CB    1 
ATOM   633  C CG    . MET A 1 80  ? -39.310 -18.340 1.729   1.00 42.59 ? 462 MET A CG    1 
ATOM   634  S SD    . MET A 1 80  ? -40.056 -19.361 2.984   1.00 46.39 ? 462 MET A SD    1 
ATOM   635  C CE    . MET A 1 80  ? -41.571 -19.494 2.034   1.00 47.42 ? 462 MET A CE    1 
ATOM   636  N N     . PRO A 1 81  ? -36.879 -15.593 4.469   1.00 37.64 ? 463 PRO A N     1 
ATOM   637  C CA    . PRO A 1 81  ? -36.082 -15.533 5.676   1.00 37.90 ? 463 PRO A CA    1 
ATOM   638  C C     . PRO A 1 81  ? -35.833 -16.867 6.397   1.00 38.10 ? 463 PRO A C     1 
ATOM   639  O O     . PRO A 1 81  ? -34.717 -17.136 6.795   1.00 38.36 ? 463 PRO A O     1 
ATOM   640  C CB    . PRO A 1 81  ? -36.921 -14.639 6.581   1.00 38.10 ? 463 PRO A CB    1 
ATOM   641  C CG    . PRO A 1 81  ? -37.764 -13.773 5.614   1.00 37.73 ? 463 PRO A CG    1 
ATOM   642  C CD    . PRO A 1 81  ? -37.651 -14.360 4.248   1.00 37.43 ? 463 PRO A CD    1 
ATOM   643  N N     . LEU A 1 82  ? -36.857 -17.702 6.539   1.00 38.53 ? 464 LEU A N     1 
ATOM   644  C CA    . LEU A 1 82  ? -36.748 -19.002 7.225   1.00 38.47 ? 464 LEU A CA    1 
ATOM   645  C C     . LEU A 1 82  ? -35.830 -20.027 6.572   1.00 38.40 ? 464 LEU A C     1 
ATOM   646  O O     . LEU A 1 82  ? -35.199 -20.839 7.256   1.00 38.52 ? 464 LEU A O     1 
ATOM   647  C CB    . LEU A 1 82  ? -38.123 -19.648 7.326   1.00 38.66 ? 464 LEU A CB    1 
ATOM   648  C CG    . LEU A 1 82  ? -38.111 -20.876 8.244   1.00 40.02 ? 464 LEU A CG    1 
ATOM   649  C CD1   . LEU A 1 82  ? -38.578 -20.503 9.666   1.00 41.21 ? 464 LEU A CD1   1 
ATOM   650  C CD2   . LEU A 1 82  ? -38.930 -22.035 7.662   1.00 40.05 ? 464 LEU A CD2   1 
ATOM   651  N N     . PHE A 1 83  ? -35.821 -20.039 5.247   1.00 37.95 ? 465 PHE A N     1 
ATOM   652  C CA    . PHE A 1 83  ? -34.984 -20.961 4.512   1.00 37.47 ? 465 PHE A CA    1 
ATOM   653  C C     . PHE A 1 83  ? -33.635 -20.340 4.288   1.00 36.67 ? 465 PHE A C     1 
ATOM   654  O O     . PHE A 1 83  ? -32.623 -20.900 4.620   1.00 36.18 ? 465 PHE A O     1 
ATOM   655  C CB    . PHE A 1 83  ? -35.628 -21.274 3.167   1.00 38.01 ? 465 PHE A CB    1 
ATOM   656  C CG    . PHE A 1 83  ? -36.714 -22.328 3.230   1.00 38.40 ? 465 PHE A CG    1 
ATOM   657  C CD1   . PHE A 1 83  ? -37.195 -22.794 4.458   1.00 38.63 ? 465 PHE A CD1   1 
ATOM   658  C CD2   . PHE A 1 83  ? -37.273 -22.824 2.045   1.00 38.04 ? 465 PHE A CD2   1 
ATOM   659  C CE1   . PHE A 1 83  ? -38.181 -23.752 4.499   1.00 38.73 ? 465 PHE A CE1   1 
ATOM   660  C CE2   . PHE A 1 83  ? -38.261 -23.761 2.067   1.00 37.26 ? 465 PHE A CE2   1 
ATOM   661  C CZ    . PHE A 1 83  ? -38.716 -24.238 3.299   1.00 39.53 ? 465 PHE A CZ    1 
ATOM   662  N N     . ALA A 1 84  ? -33.645 -19.151 3.731   1.00 36.42 ? 466 ALA A N     1 
ATOM   663  C CA    . ALA A 1 84  ? -32.449 -18.365 3.535   1.00 36.20 ? 466 ALA A CA    1 
ATOM   664  C C     . ALA A 1 84  ? -31.466 -18.331 4.694   1.00 36.00 ? 466 ALA A C     1 
ATOM   665  O O     . ALA A 1 84  ? -30.274 -18.228 4.471   1.00 36.38 ? 466 ALA A O     1 
ATOM   666  C CB    . ALA A 1 84  ? -32.843 -16.980 3.186   1.00 36.39 ? 466 ALA A CB    1 
ATOM   667  N N     . ASN A 1 85  ? -31.959 -18.399 5.919   1.00 36.12 ? 467 ASN A N     1 
ATOM   668  C CA    . ASN A 1 85  ? -31.106 -18.256 7.105   1.00 36.58 ? 467 ASN A CA    1 
ATOM   669  C C     . ASN A 1 85  ? -30.948 -19.533 7.891   1.00 36.31 ? 467 ASN A C     1 
ATOM   670  O O     . ASN A 1 85  ? -30.769 -19.485 9.106   1.00 37.06 ? 467 ASN A O     1 
ATOM   671  C CB    . ASN A 1 85  ? -31.652 -17.181 8.045   1.00 36.72 ? 467 ASN A CB    1 
ATOM   672  C CG    . ASN A 1 85  ? -31.419 -15.802 7.520   1.00 38.03 ? 467 ASN A CG    1 
ATOM   673  O OD1   . ASN A 1 85  ? -30.308 -15.257 7.628   1.00 40.20 ? 467 ASN A OD1   1 
ATOM   674  N ND2   . ASN A 1 85  ? -32.451 -15.228 6.910   1.00 37.25 ? 467 ASN A ND2   1 
ATOM   675  N N     . ALA A 1 86  ? -30.997 -20.662 7.193   1.00 35.63 ? 468 ALA A N     1 
ATOM   676  C CA    . ALA A 1 86  ? -31.070 -21.968 7.811   1.00 34.96 ? 468 ALA A CA    1 
ATOM   677  C C     . ALA A 1 86  ? -29.983 -22.923 7.298   1.00 35.07 ? 468 ALA A C     1 
ATOM   678  O O     . ALA A 1 86  ? -29.320 -22.674 6.292   1.00 35.12 ? 468 ALA A O     1 
ATOM   679  C CB    . ALA A 1 86  ? -32.455 -22.550 7.579   1.00 34.55 ? 468 ALA A CB    1 
ATOM   680  N N     . ASP A 1 87  ? -29.791 -24.008 8.032   1.00 35.43 ? 469 ASP A N     1 
ATOM   681  C CA    . ASP A 1 87  ? -28.940 -25.094 7.621   1.00 35.79 ? 469 ASP A CA    1 
ATOM   682  C C     . ASP A 1 87  ? -29.387 -25.563 6.215   1.00 35.63 ? 469 ASP A C     1 
ATOM   683  O O     . ASP A 1 87  ? -30.505 -26.063 6.056   1.00 35.51 ? 469 ASP A O     1 
ATOM   684  C CB    . ASP A 1 87  ? -29.029 -26.205 8.673   1.00 35.58 ? 469 ASP A CB    1 
ATOM   685  C CG    . ASP A 1 87  ? -28.102 -27.381 8.387   1.00 37.82 ? 469 ASP A CG    1 
ATOM   686  O OD1   . ASP A 1 87  ? -27.558 -27.500 7.260   1.00 39.75 ? 469 ASP A OD1   1 
ATOM   687  O OD2   . ASP A 1 87  ? -27.929 -28.217 9.301   1.00 40.35 ? 469 ASP A OD2   1 
ATOM   688  N N     . PRO A 1 88  ? -28.516 -25.375 5.190   1.00 35.28 ? 470 PRO A N     1 
ATOM   689  C CA    . PRO A 1 88  ? -28.793 -25.840 3.833   1.00 34.68 ? 470 PRO A CA    1 
ATOM   690  C C     . PRO A 1 88  ? -29.285 -27.262 3.758   1.00 33.89 ? 470 PRO A C     1 
ATOM   691  O O     . PRO A 1 88  ? -29.985 -27.613 2.815   1.00 34.20 ? 470 PRO A O     1 
ATOM   692  C CB    . PRO A 1 88  ? -27.435 -25.697 3.143   1.00 34.37 ? 470 PRO A CB    1 
ATOM   693  C CG    . PRO A 1 88  ? -26.949 -24.427 3.713   1.00 35.23 ? 470 PRO A CG    1 
ATOM   694  C CD    . PRO A 1 88  ? -27.291 -24.550 5.203   1.00 35.32 ? 470 PRO A CD    1 
ATOM   695  N N     . ASN A 1 89  ? -28.940 -28.064 4.744   1.00 32.92 ? 471 ASN A N     1 
ATOM   696  C CA    . ASN A 1 89  ? -29.384 -29.434 4.745   1.00 32.88 ? 471 ASN A CA    1 
ATOM   697  C C     . ASN A 1 89  ? -30.856 -29.576 5.121   1.00 31.69 ? 471 ASN A C     1 
ATOM   698  O O     . ASN A 1 89  ? -31.585 -30.394 4.536   1.00 31.33 ? 471 ASN A O     1 
ATOM   699  C CB    . ASN A 1 89  ? -28.462 -30.315 5.614   1.00 33.70 ? 471 ASN A CB    1 
ATOM   700  C CG    . ASN A 1 89  ? -27.076 -30.539 4.972   1.00 34.14 ? 471 ASN A CG    1 
ATOM   701  O OD1   . ASN A 1 89  ? -26.070 -30.467 5.653   1.00 36.70 ? 471 ASN A OD1   1 
ATOM   702  N ND2   . ASN A 1 89  ? -27.034 -30.793 3.662   1.00 34.61 ? 471 ASN A ND2   1 
ATOM   703  N N     . PHE A 1 90  ? -31.272 -28.765 6.087   1.00 30.57 ? 472 PHE A N     1 
ATOM   704  C CA    . PHE A 1 90  ? -32.671 -28.632 6.449   1.00 29.43 ? 472 PHE A CA    1 
ATOM   705  C C     . PHE A 1 90  ? -33.454 -28.176 5.228   1.00 29.36 ? 472 PHE A C     1 
ATOM   706  O O     . PHE A 1 90  ? -34.411 -28.821 4.803   1.00 29.85 ? 472 PHE A O     1 
ATOM   707  C CB    . PHE A 1 90  ? -32.830 -27.603 7.553   1.00 28.73 ? 472 PHE A CB    1 
ATOM   708  C CG    . PHE A 1 90  ? -34.227 -27.151 7.731   1.00 28.23 ? 472 PHE A CG    1 
ATOM   709  C CD1   . PHE A 1 90  ? -35.092 -27.848 8.568   1.00 27.46 ? 472 PHE A CD1   1 
ATOM   710  C CD2   . PHE A 1 90  ? -34.711 -26.059 7.024   1.00 27.20 ? 472 PHE A CD2   1 
ATOM   711  C CE1   . PHE A 1 90  ? -36.408 -27.441 8.716   1.00 26.72 ? 472 PHE A CE1   1 
ATOM   712  C CE2   . PHE A 1 90  ? -36.027 -25.645 7.168   1.00 26.04 ? 472 PHE A CE2   1 
ATOM   713  C CZ    . PHE A 1 90  ? -36.871 -26.325 8.010   1.00 26.33 ? 472 PHE A CZ    1 
ATOM   714  N N     . VAL A 1 91  ? -33.040 -27.057 4.657   1.00 28.71 ? 473 VAL A N     1 
ATOM   715  C CA    . VAL A 1 91  ? -33.552 -26.655 3.375   1.00 28.11 ? 473 VAL A CA    1 
ATOM   716  C C     . VAL A 1 91  ? -33.663 -27.883 2.461   1.00 28.03 ? 473 VAL A C     1 
ATOM   717  O O     . VAL A 1 91  ? -34.756 -28.290 2.130   1.00 28.31 ? 473 VAL A O     1 
ATOM   718  C CB    . VAL A 1 91  ? -32.754 -25.492 2.798   1.00 27.83 ? 473 VAL A CB    1 
ATOM   719  C CG1   . VAL A 1 91  ? -33.277 -25.117 1.470   1.00 28.14 ? 473 VAL A CG1   1 
ATOM   720  C CG2   . VAL A 1 91  ? -32.907 -24.314 3.697   1.00 26.45 ? 473 VAL A CG2   1 
ATOM   721  N N     . THR A 1 92  ? -32.565 -28.539 2.131   1.00 28.41 ? 474 THR A N     1 
ATOM   722  C CA    . THR A 1 92  ? -32.640 -29.708 1.227   1.00 28.18 ? 474 THR A CA    1 
ATOM   723  C C     . THR A 1 92  ? -33.682 -30.720 1.665   1.00 28.66 ? 474 THR A C     1 
ATOM   724  O O     . THR A 1 92  ? -34.517 -31.126 0.863   1.00 28.66 ? 474 THR A O     1 
ATOM   725  C CB    . THR A 1 92  ? -31.280 -30.400 1.008   1.00 27.86 ? 474 THR A CB    1 
ATOM   726  O OG1   . THR A 1 92  ? -30.322 -29.424 0.637   1.00 26.53 ? 474 THR A OG1   1 
ATOM   727  C CG2   . THR A 1 92  ? -31.359 -31.410 -0.109  1.00 26.76 ? 474 THR A CG2   1 
ATOM   728  N N     . ALA A 1 93  ? -33.644 -31.132 2.924   1.00 29.17 ? 475 ALA A N     1 
ATOM   729  C CA    . ALA A 1 93  ? -34.663 -32.050 3.403   1.00 29.62 ? 475 ALA A CA    1 
ATOM   730  C C     . ALA A 1 93  ? -36.019 -31.501 3.001   1.00 30.10 ? 475 ALA A C     1 
ATOM   731  O O     . ALA A 1 93  ? -36.769 -32.187 2.305   1.00 30.41 ? 475 ALA A O     1 
ATOM   732  C CB    . ALA A 1 93  ? -34.580 -32.240 4.895   1.00 29.35 ? 475 ALA A CB    1 
ATOM   733  N N     . MET A 1 94  ? -36.313 -30.260 3.388   1.00 30.08 ? 476 MET A N     1 
ATOM   734  C CA    . MET A 1 94  ? -37.617 -29.664 3.101   1.00 30.69 ? 476 MET A CA    1 
ATOM   735  C C     . MET A 1 94  ? -37.977 -29.693 1.643   1.00 30.25 ? 476 MET A C     1 
ATOM   736  O O     . MET A 1 94  ? -38.967 -30.265 1.279   1.00 30.50 ? 476 MET A O     1 
ATOM   737  C CB    . MET A 1 94  ? -37.671 -28.214 3.550   1.00 31.31 ? 476 MET A CB    1 
ATOM   738  C CG    . MET A 1 94  ? -37.656 -28.045 5.030   1.00 32.90 ? 476 MET A CG    1 
ATOM   739  S SD    . MET A 1 94  ? -39.234 -28.543 5.651   1.00 34.04 ? 476 MET A SD    1 
ATOM   740  C CE    . MET A 1 94  ? -39.938 -26.978 6.171   1.00 34.66 ? 476 MET A CE    1 
ATOM   741  N N     . LEU A 1 95  ? -37.176 -29.054 0.807   1.00 30.05 ? 477 LEU A N     1 
ATOM   742  C CA    . LEU A 1 95  ? -37.430 -29.018 -0.614  1.00 29.78 ? 477 LEU A CA    1 
ATOM   743  C C     . LEU A 1 95  ? -37.771 -30.384 -1.212  1.00 30.59 ? 477 LEU A C     1 
ATOM   744  O O     . LEU A 1 95  ? -38.556 -30.445 -2.138  1.00 30.51 ? 477 LEU A O     1 
ATOM   745  C CB    . LEU A 1 95  ? -36.223 -28.449 -1.315  1.00 29.25 ? 477 LEU A CB    1 
ATOM   746  C CG    . LEU A 1 95  ? -36.176 -26.990 -1.740  1.00 28.94 ? 477 LEU A CG    1 
ATOM   747  C CD1   . LEU A 1 95  ? -36.778 -26.058 -0.758  1.00 28.10 ? 477 LEU A CD1   1 
ATOM   748  C CD2   . LEU A 1 95  ? -34.722 -26.596 -1.975  1.00 30.77 ? 477 LEU A CD2   1 
ATOM   749  N N     . SER A 1 96  ? -37.188 -31.470 -0.683  1.00 31.46 ? 478 SER A N     1 
ATOM   750  C CA    . SER A 1 96  ? -37.375 -32.825 -1.219  1.00 31.82 ? 478 SER A CA    1 
ATOM   751  C C     . SER A 1 96  ? -38.799 -33.237 -1.189  1.00 32.33 ? 478 SER A C     1 
ATOM   752  O O     . SER A 1 96  ? -39.206 -33.982 -2.052  1.00 33.20 ? 478 SER A O     1 
ATOM   753  C CB    . SER A 1 96  ? -36.614 -33.878 -0.418  1.00 31.93 ? 478 SER A CB    1 
ATOM   754  O OG    . SER A 1 96  ? -35.232 -33.635 -0.466  1.00 32.97 ? 478 SER A OG    1 
ATOM   755  N N     . LYS A 1 97  ? -39.552 -32.768 -0.195  1.00 32.53 ? 479 LYS A N     1 
ATOM   756  C CA    . LYS A 1 97  ? -40.908 -33.254 0.074   1.00 32.43 ? 479 LYS A CA    1 
ATOM   757  C C     . LYS A 1 97  ? -42.011 -32.287 -0.365  1.00 31.57 ? 479 LYS A C     1 
ATOM   758  O O     . LYS A 1 97  ? -43.184 -32.544 -0.119  1.00 31.94 ? 479 LYS A O     1 
ATOM   759  C CB    . LYS A 1 97  ? -41.077 -33.592 1.568   1.00 33.09 ? 479 LYS A CB    1 
ATOM   760  C CG    . LYS A 1 97  ? -39.848 -34.154 2.267   1.00 36.03 ? 479 LYS A CG    1 
ATOM   761  C CD    . LYS A 1 97  ? -40.030 -35.585 2.755   1.00 42.04 ? 479 LYS A CD    1 
ATOM   762  C CE    . LYS A 1 97  ? -38.735 -36.428 2.563   1.00 44.98 ? 479 LYS A CE    1 
ATOM   763  N NZ    . LYS A 1 97  ? -38.719 -37.135 1.213   1.00 43.66 ? 479 LYS A NZ    1 
ATOM   764  N N     . LEU A 1 98  ? -41.660 -31.194 -1.026  1.00 30.98 ? 480 LEU A N     1 
ATOM   765  C CA    . LEU A 1 98  ? -42.673 -30.231 -1.457  1.00 30.98 ? 480 LEU A CA    1 
ATOM   766  C C     . LEU A 1 98  ? -43.401 -30.722 -2.686  1.00 31.91 ? 480 LEU A C     1 
ATOM   767  O O     . LEU A 1 98  ? -42.776 -31.229 -3.592  1.00 33.18 ? 480 LEU A O     1 
ATOM   768  C CB    . LEU A 1 98  ? -42.045 -28.880 -1.762  1.00 30.11 ? 480 LEU A CB    1 
ATOM   769  C CG    . LEU A 1 98  ? -41.257 -28.169 -0.666  1.00 28.41 ? 480 LEU A CG    1 
ATOM   770  C CD1   . LEU A 1 98  ? -40.907 -26.797 -1.128  1.00 26.32 ? 480 LEU A CD1   1 
ATOM   771  C CD2   . LEU A 1 98  ? -42.054 -28.095 0.601   1.00 26.32 ? 480 LEU A CD2   1 
ATOM   772  N N     . ARG A 1 99  ? -44.717 -30.586 -2.723  1.00 32.68 ? 481 ARG A N     1 
ATOM   773  C CA    . ARG A 1 99  ? -45.481 -30.869 -3.938  1.00 33.58 ? 481 ARG A CA    1 
ATOM   774  C C     . ARG A 1 99  ? -46.118 -29.576 -4.452  1.00 32.62 ? 481 ARG A C     1 
ATOM   775  O O     . ARG A 1 99  ? -46.648 -28.795 -3.677  1.00 32.18 ? 481 ARG A O     1 
ATOM   776  C CB    . ARG A 1 99  ? -46.549 -31.946 -3.666  1.00 34.61 ? 481 ARG A CB    1 
ATOM   777  C CG    . ARG A 1 99  ? -46.158 -33.362 -4.095  1.00 39.82 ? 481 ARG A CG    1 
ATOM   778  C CD    . ARG A 1 99  ? -45.882 -34.479 -3.075  1.00 47.63 ? 481 ARG A CD    1 
ATOM   779  N NE    . ARG A 1 99  ? -44.654 -35.174 -3.507  1.00 53.33 ? 481 ARG A NE    1 
ATOM   780  C CZ    . ARG A 1 99  ? -43.773 -35.809 -2.714  1.00 54.71 ? 481 ARG A CZ    1 
ATOM   781  N NH1   . ARG A 1 99  ? -43.943 -35.920 -1.396  1.00 53.03 ? 481 ARG A NH1   1 
ATOM   782  N NH2   . ARG A 1 99  ? -42.694 -36.351 -3.263  1.00 55.40 ? 481 ARG A NH2   1 
ATOM   783  N N     . PHE A 1 100 ? -46.049 -29.358 -5.758  1.00 31.97 ? 482 PHE A N     1 
ATOM   784  C CA    . PHE A 1 100 ? -46.537 -28.147 -6.403  1.00 31.27 ? 482 PHE A CA    1 
ATOM   785  C C     . PHE A 1 100 ? -48.064 -28.099 -6.564  1.00 31.70 ? 482 PHE A C     1 
ATOM   786  O O     . PHE A 1 100 ? -48.696 -29.104 -6.821  1.00 32.24 ? 482 PHE A O     1 
ATOM   787  C CB    . PHE A 1 100 ? -45.889 -28.080 -7.772  1.00 31.09 ? 482 PHE A CB    1 
ATOM   788  C CG    . PHE A 1 100 ? -46.285 -26.892 -8.578  1.00 31.41 ? 482 PHE A CG    1 
ATOM   789  C CD1   . PHE A 1 100 ? -45.947 -25.606 -8.165  1.00 31.86 ? 482 PHE A CD1   1 
ATOM   790  C CD2   . PHE A 1 100 ? -47.001 -27.048 -9.755  1.00 31.35 ? 482 PHE A CD2   1 
ATOM   791  C CE1   . PHE A 1 100 ? -46.324 -24.492 -8.906  1.00 30.99 ? 482 PHE A CE1   1 
ATOM   792  C CE2   . PHE A 1 100 ? -47.378 -25.940 -10.496 1.00 32.13 ? 482 PHE A CE2   1 
ATOM   793  C CZ    . PHE A 1 100 ? -47.032 -24.663 -10.074 1.00 30.15 ? 482 PHE A CZ    1 
ATOM   794  N N     . GLU A 1 101 ? -48.665 -26.922 -6.453  1.00 32.08 ? 483 GLU A N     1 
ATOM   795  C CA    . GLU A 1 101 ? -50.121 -26.792 -6.518  1.00 32.60 ? 483 GLU A CA    1 
ATOM   796  C C     . GLU A 1 101 ? -50.535 -25.440 -7.070  1.00 31.94 ? 483 GLU A C     1 
ATOM   797  O O     . GLU A 1 101 ? -49.826 -24.451 -6.878  1.00 31.51 ? 483 GLU A O     1 
ATOM   798  C CB    . GLU A 1 101 ? -50.749 -26.944 -5.128  1.00 33.24 ? 483 GLU A CB    1 
ATOM   799  C CG    . GLU A 1 101 ? -50.520 -28.294 -4.427  1.00 37.70 ? 483 GLU A CG    1 
ATOM   800  C CD    . GLU A 1 101 ? -51.600 -28.629 -3.376  1.00 44.15 ? 483 GLU A CD    1 
ATOM   801  O OE1   . GLU A 1 101 ? -52.802 -28.298 -3.606  1.00 47.29 ? 483 GLU A OE1   1 
ATOM   802  O OE2   . GLU A 1 101 ? -51.245 -29.240 -2.331  1.00 45.85 ? 483 GLU A OE2   1 
ATOM   803  N N     . VAL A 1 102 ? -51.695 -25.395 -7.735  1.00 31.57 ? 484 VAL A N     1 
ATOM   804  C CA    . VAL A 1 102 ? -52.210 -24.133 -8.268  1.00 31.48 ? 484 VAL A CA    1 
ATOM   805  C C     . VAL A 1 102 ? -53.615 -23.877 -7.775  1.00 30.85 ? 484 VAL A C     1 
ATOM   806  O O     . VAL A 1 102 ? -54.424 -24.784 -7.756  1.00 30.59 ? 484 VAL A O     1 
ATOM   807  C CB    . VAL A 1 102 ? -52.116 -24.026 -9.835  1.00 31.57 ? 484 VAL A CB    1 
ATOM   808  C CG1   . VAL A 1 102 ? -52.810 -22.795 -10.307 1.00 32.17 ? 484 VAL A CG1   1 
ATOM   809  C CG2   . VAL A 1 102 ? -50.675 -23.907 -10.292 1.00 31.10 ? 484 VAL A CG2   1 
ATOM   810  N N     . PHE A 1 103 ? -53.873 -22.637 -7.367  1.00 30.61 ? 485 PHE A N     1 
ATOM   811  C CA    . PHE A 1 103 ? -55.184 -22.181 -6.918  1.00 30.97 ? 485 PHE A CA    1 
ATOM   812  C C     . PHE A 1 103 ? -55.644 -21.018 -7.754  1.00 31.74 ? 485 PHE A C     1 
ATOM   813  O O     . PHE A 1 103 ? -54.804 -20.268 -8.212  1.00 32.55 ? 485 PHE A O     1 
ATOM   814  C CB    . PHE A 1 103 ? -55.126 -21.778 -5.461  1.00 30.31 ? 485 PHE A CB    1 
ATOM   815  C CG    . PHE A 1 103 ? -55.082 -22.936 -4.562  1.00 30.53 ? 485 PHE A CG    1 
ATOM   816  C CD1   . PHE A 1 103 ? -53.880 -23.523 -4.226  1.00 31.50 ? 485 PHE A CD1   1 
ATOM   817  C CD2   . PHE A 1 103 ? -56.249 -23.507 -4.098  1.00 30.61 ? 485 PHE A CD2   1 
ATOM   818  C CE1   . PHE A 1 103 ? -53.849 -24.658 -3.416  1.00 30.84 ? 485 PHE A CE1   1 
ATOM   819  C CE2   . PHE A 1 103 ? -56.218 -24.639 -3.277  1.00 30.12 ? 485 PHE A CE2   1 
ATOM   820  C CZ    . PHE A 1 103 ? -55.025 -25.216 -2.942  1.00 28.88 ? 485 PHE A CZ    1 
ATOM   821  N N     . GLN A 1 104 ? -56.956 -20.863 -7.962  1.00 32.38 ? 486 GLN A N     1 
ATOM   822  C CA    . GLN A 1 104 ? -57.474 -19.768 -8.801  1.00 33.13 ? 486 GLN A CA    1 
ATOM   823  C C     . GLN A 1 104 ? -58.101 -18.735 -7.906  1.00 33.36 ? 486 GLN A C     1 
ATOM   824  O O     . GLN A 1 104 ? -58.508 -19.081 -6.799  1.00 33.15 ? 486 GLN A O     1 
ATOM   825  C CB    . GLN A 1 104 ? -58.524 -20.264 -9.775  1.00 33.10 ? 486 GLN A CB    1 
ATOM   826  C CG    . GLN A 1 104 ? -58.011 -21.219 -10.797 1.00 35.17 ? 486 GLN A CG    1 
ATOM   827  C CD    . GLN A 1 104 ? -59.136 -22.049 -11.387 1.00 38.27 ? 486 GLN A CD    1 
ATOM   828  O OE1   . GLN A 1 104 ? -59.740 -22.867 -10.691 1.00 40.09 ? 486 GLN A OE1   1 
ATOM   829  N NE2   . GLN A 1 104 ? -59.437 -21.836 -12.668 1.00 38.37 ? 486 GLN A NE2   1 
ATOM   830  N N     . PRO A 1 105 ? -58.215 -17.475 -8.385  1.00 33.75 ? 487 PRO A N     1 
ATOM   831  C CA    . PRO A 1 105 ? -58.673 -16.346 -7.570  1.00 34.19 ? 487 PRO A CA    1 
ATOM   832  C C     . PRO A 1 105 ? -60.040 -16.593 -6.897  1.00 35.12 ? 487 PRO A C     1 
ATOM   833  O O     . PRO A 1 105 ? -61.000 -16.944 -7.573  1.00 35.59 ? 487 PRO A O     1 
ATOM   834  C CB    . PRO A 1 105 ? -58.776 -15.215 -8.595  1.00 33.89 ? 487 PRO A CB    1 
ATOM   835  C CG    . PRO A 1 105 ? -57.840 -15.575 -9.651  1.00 32.99 ? 487 PRO A CG    1 
ATOM   836  C CD    . PRO A 1 105 ? -57.985 -17.057 -9.778  1.00 33.59 ? 487 PRO A CD    1 
ATOM   837  N N     . GLY A 1 106 ? -60.119 -16.438 -5.577  1.00 35.58 ? 488 GLY A N     1 
ATOM   838  C CA    . GLY A 1 106 ? -61.354 -16.682 -4.842  1.00 36.13 ? 488 GLY A CA    1 
ATOM   839  C C     . GLY A 1 106 ? -61.464 -18.091 -4.293  1.00 36.91 ? 488 GLY A C     1 
ATOM   840  O O     . GLY A 1 106 ? -62.419 -18.426 -3.604  1.00 37.00 ? 488 GLY A O     1 
ATOM   841  N N     . ASP A 1 107 ? -60.502 -18.943 -4.600  1.00 37.85 ? 489 ASP A N     1 
ATOM   842  C CA    . ASP A 1 107 ? -60.463 -20.265 -3.979  1.00 39.00 ? 489 ASP A CA    1 
ATOM   843  C C     . ASP A 1 107 ? -60.128 -20.174 -2.487  1.00 39.19 ? 489 ASP A C     1 
ATOM   844  O O     . ASP A 1 107 ? -59.361 -19.305 -2.052  1.00 39.37 ? 489 ASP A O     1 
ATOM   845  C CB    . ASP A 1 107 ? -59.418 -21.154 -4.660  1.00 39.48 ? 489 ASP A CB    1 
ATOM   846  C CG    . ASP A 1 107 ? -59.886 -21.712 -6.005  1.00 41.85 ? 489 ASP A CG    1 
ATOM   847  O OD1   . ASP A 1 107 ? -61.071 -21.457 -6.414  1.00 43.78 ? 489 ASP A OD1   1 
ATOM   848  O OD2   . ASP A 1 107 ? -59.047 -22.414 -6.641  1.00 41.63 ? 489 ASP A OD2   1 
ATOM   849  N N     . TYR A 1 108 ? -60.696 -21.099 -1.723  1.00 39.26 ? 490 TYR A N     1 
ATOM   850  C CA    . TYR A 1 108 ? -60.445 -21.233 -0.303  1.00 39.25 ? 490 TYR A CA    1 
ATOM   851  C C     . TYR A 1 108 ? -59.397 -22.271 -0.044  1.00 38.59 ? 490 TYR A C     1 
ATOM   852  O O     . TYR A 1 108 ? -59.697 -23.465 0.046   1.00 39.56 ? 490 TYR A O     1 
ATOM   853  C CB    . TYR A 1 108 ? -61.730 -21.635 0.411   1.00 39.97 ? 490 TYR A CB    1 
ATOM   854  C CG    . TYR A 1 108 ? -62.483 -20.427 0.863   1.00 43.59 ? 490 TYR A CG    1 
ATOM   855  C CD1   . TYR A 1 108 ? -61.781 -19.313 1.351   1.00 45.66 ? 490 TYR A CD1   1 
ATOM   856  C CD2   . TYR A 1 108 ? -63.879 -20.368 0.811   1.00 46.19 ? 490 TYR A CD2   1 
ATOM   857  C CE1   . TYR A 1 108 ? -62.426 -18.175 1.785   1.00 46.37 ? 490 TYR A CE1   1 
ATOM   858  C CE2   . TYR A 1 108 ? -64.542 -19.210 1.245   1.00 47.72 ? 490 TYR A CE2   1 
ATOM   859  C CZ    . TYR A 1 108 ? -63.788 -18.120 1.729   1.00 47.33 ? 490 TYR A CZ    1 
ATOM   860  O OH    . TYR A 1 108 ? -64.368 -16.959 2.170   1.00 48.81 ? 490 TYR A OH    1 
ATOM   861  N N     . ILE A 1 109 ? -58.158 -21.837 0.084   1.00 37.47 ? 491 ILE A N     1 
ATOM   862  C CA    . ILE A 1 109 ? -57.084 -22.783 0.302   1.00 36.62 ? 491 ILE A CA    1 
ATOM   863  C C     . ILE A 1 109 ? -57.239 -23.434 1.673   1.00 36.75 ? 491 ILE A C     1 
ATOM   864  O O     . ILE A 1 109 ? -57.084 -24.633 1.802   1.00 36.55 ? 491 ILE A O     1 
ATOM   865  C CB    . ILE A 1 109 ? -55.712 -22.107 0.152   1.00 36.54 ? 491 ILE A CB    1 
ATOM   866  C CG1   . ILE A 1 109 ? -55.634 -21.393 -1.193  1.00 35.22 ? 491 ILE A CG1   1 
ATOM   867  C CG2   . ILE A 1 109 ? -54.577 -23.126 0.286   1.00 35.73 ? 491 ILE A CG2   1 
ATOM   868  C CD1   . ILE A 1 109 ? -54.755 -20.170 -1.203  1.00 32.69 ? 491 ILE A CD1   1 
ATOM   869  N N     . ILE A 1 110 ? -57.562 -22.632 2.684   1.00 37.08 ? 492 ILE A N     1 
ATOM   870  C CA    . ILE A 1 110 ? -57.788 -23.128 4.036   1.00 37.33 ? 492 ILE A CA    1 
ATOM   871  C C     . ILE A 1 110 ? -59.036 -22.459 4.581   1.00 37.24 ? 492 ILE A C     1 
ATOM   872  O O     . ILE A 1 110 ? -59.226 -21.263 4.350   1.00 36.71 ? 492 ILE A O     1 
ATOM   873  C CB    . ILE A 1 110 ? -56.559 -22.854 4.960   1.00 37.74 ? 492 ILE A CB    1 
ATOM   874  C CG1   . ILE A 1 110 ? -55.462 -23.909 4.720   1.00 37.55 ? 492 ILE A CG1   1 
ATOM   875  C CG2   . ILE A 1 110 ? -56.968 -22.802 6.453   1.00 37.38 ? 492 ILE A CG2   1 
ATOM   876  C CD1   . ILE A 1 110 ? -54.060 -23.482 5.158   1.00 37.50 ? 492 ILE A CD1   1 
ATOM   877  N N     . ARG A 1 111 ? -59.868 -23.257 5.274   1.00 37.44 ? 493 ARG A N     1 
ATOM   878  C CA    . ARG A 1 111 ? -61.097 -22.823 5.967   1.00 37.24 ? 493 ARG A CA    1 
ATOM   879  C C     . ARG A 1 111 ? -60.939 -22.936 7.461   1.00 37.21 ? 493 ARG A C     1 
ATOM   880  O O     . ARG A 1 111 ? -60.769 -24.065 7.985   1.00 37.25 ? 493 ARG A O     1 
ATOM   881  C CB    . ARG A 1 111 ? -62.240 -23.751 5.638   1.00 37.60 ? 493 ARG A CB    1 
ATOM   882  C CG    . ARG A 1 111 ? -62.548 -23.865 4.184   1.00 39.68 ? 493 ARG A CG    1 
ATOM   883  C CD    . ARG A 1 111 ? -63.749 -24.730 3.973   1.00 42.17 ? 493 ARG A CD    1 
ATOM   884  N NE    . ARG A 1 111 ? -64.539 -24.183 2.878   1.00 45.74 ? 493 ARG A NE    1 
ATOM   885  C CZ    . ARG A 1 111 ? -64.368 -24.495 1.596   1.00 47.52 ? 493 ARG A CZ    1 
ATOM   886  N NH1   . ARG A 1 111 ? -63.423 -25.372 1.234   1.00 48.80 ? 493 ARG A NH1   1 
ATOM   887  N NH2   . ARG A 1 111 ? -65.152 -23.930 0.679   1.00 46.81 ? 493 ARG A NH2   1 
ATOM   888  N N     . GLU A 1 112 ? -61.014 -21.780 8.136   1.00 36.72 ? 494 GLU A N     1 
ATOM   889  C CA    . GLU A 1 112 ? -61.077 -21.694 9.597   1.00 36.22 ? 494 GLU A CA    1 
ATOM   890  C C     . GLU A 1 112 ? -62.031 -22.765 10.151  1.00 36.01 ? 494 GLU A C     1 
ATOM   891  O O     . GLU A 1 112 ? -63.154 -22.924 9.683   1.00 36.22 ? 494 GLU A O     1 
ATOM   892  C CB    . GLU A 1 112 ? -61.531 -20.300 10.021  1.00 35.78 ? 494 GLU A CB    1 
ATOM   893  C CG    . GLU A 1 112 ? -61.521 -20.079 11.526  1.00 37.06 ? 494 GLU A CG    1 
ATOM   894  C CD    . GLU A 1 112 ? -61.767 -18.612 11.928  1.00 42.46 ? 494 GLU A CD    1 
ATOM   895  O OE1   . GLU A 1 112 ? -61.655 -18.308 13.141  1.00 42.84 ? 494 GLU A OE1   1 
ATOM   896  O OE2   . GLU A 1 112 ? -62.064 -17.743 11.045  1.00 45.67 ? 494 GLU A OE2   1 
ATOM   897  N N     . GLY A 1 113 ? -61.581 -23.518 11.132  1.00 35.60 ? 495 GLY A N     1 
ATOM   898  C CA    . GLY A 1 113 ? -62.422 -24.543 11.669  1.00 35.29 ? 495 GLY A CA    1 
ATOM   899  C C     . GLY A 1 113 ? -61.891 -25.893 11.277  1.00 35.67 ? 495 GLY A C     1 
ATOM   900  O O     . GLY A 1 113 ? -61.786 -26.787 12.124  1.00 35.30 ? 495 GLY A O     1 
ATOM   901  N N     . ALA A 1 114 ? -61.536 -26.036 9.997   1.00 36.10 ? 496 ALA A N     1 
ATOM   902  C CA    . ALA A 1 114 ? -61.209 -27.352 9.407   1.00 36.23 ? 496 ALA A CA    1 
ATOM   903  C C     . ALA A 1 114 ? -60.013 -28.084 10.062  1.00 36.41 ? 496 ALA A C     1 
ATOM   904  O O     . ALA A 1 114 ? -59.193 -27.479 10.764  1.00 36.31 ? 496 ALA A O     1 
ATOM   905  C CB    . ALA A 1 114 ? -61.033 -27.224 7.906   1.00 35.83 ? 496 ALA A CB    1 
ATOM   906  N N     . VAL A 1 115 ? -59.929 -29.392 9.881   1.00 36.53 ? 497 VAL A N     1 
ATOM   907  C CA    . VAL A 1 115 ? -58.741 -30.090 10.347  1.00 37.09 ? 497 VAL A CA    1 
ATOM   908  C C     . VAL A 1 115 ? -57.712 -29.941 9.247   1.00 37.11 ? 497 VAL A C     1 
ATOM   909  O O     . VAL A 1 115 ? -58.080 -29.986 8.080   1.00 38.06 ? 497 VAL A O     1 
ATOM   910  C CB    . VAL A 1 115 ? -59.004 -31.575 10.571  1.00 37.59 ? 497 VAL A CB    1 
ATOM   911  C CG1   . VAL A 1 115 ? -57.669 -32.350 10.704  1.00 37.45 ? 497 VAL A CG1   1 
ATOM   912  C CG2   . VAL A 1 115 ? -59.896 -31.783 11.804  1.00 37.89 ? 497 VAL A CG2   1 
ATOM   913  N N     . GLY A 1 116 ? -56.442 -29.757 9.591   1.00 36.36 ? 498 GLY A N     1 
ATOM   914  C CA    . GLY A 1 116 ? -55.455 -29.421 8.584   1.00 35.47 ? 498 GLY A CA    1 
ATOM   915  C C     . GLY A 1 116 ? -54.386 -30.481 8.482   1.00 35.47 ? 498 GLY A C     1 
ATOM   916  O O     . GLY A 1 116 ? -53.831 -30.902 9.495   1.00 35.28 ? 498 GLY A O     1 
ATOM   917  N N     . LYS A 1 117 ? -54.081 -30.880 7.244   1.00 35.50 ? 499 LYS A N     1 
ATOM   918  C CA    . LYS A 1 117 ? -53.092 -31.916 6.945   1.00 35.46 ? 499 LYS A CA    1 
ATOM   919  C C     . LYS A 1 117 ? -51.937 -31.497 5.985   1.00 34.68 ? 499 LYS A C     1 
ATOM   920  O O     . LYS A 1 117 ? -51.107 -32.329 5.622   1.00 34.44 ? 499 LYS A O     1 
ATOM   921  C CB    . LYS A 1 117 ? -53.828 -33.143 6.403   1.00 36.19 ? 499 LYS A CB    1 
ATOM   922  C CG    . LYS A 1 117 ? -54.572 -34.002 7.485   1.00 38.59 ? 499 LYS A CG    1 
ATOM   923  C CD    . LYS A 1 117 ? -55.273 -35.248 6.869   1.00 41.33 ? 499 LYS A CD    1 
ATOM   924  C CE    . LYS A 1 117 ? -56.603 -34.872 6.138   1.00 43.46 ? 499 LYS A CE    1 
ATOM   925  N NZ    . LYS A 1 117 ? -57.533 -36.056 5.959   1.00 44.99 ? 499 LYS A NZ    1 
ATOM   926  N N     . LYS A 1 118 ? -51.889 -30.240 5.691   1.00 33.92 ? 500 LYS A N     1 
ATOM   927  C CA    . LYS A 1 118 ? -50.948 -29.629 4.731   1.00 32.76 ? 500 LYS A CA    1 
ATOM   928  C C     . LYS A 1 118 ? -50.495 -28.269 5.237   1.00 31.87 ? 500 LYS A C     1 
ATOM   929  O O     . LYS A 1 118 ? -51.292 -27.577 5.851   1.00 31.84 ? 500 LYS A O     1 
ATOM   930  C CB    . LYS A 1 118 ? -51.703 -29.279 3.452   1.00 32.78 ? 500 LYS A CB    1 
ATOM   931  C CG    . LYS A 1 118 ? -51.887 -30.359 2.471   1.00 33.68 ? 500 LYS A CG    1 
ATOM   932  C CD    . LYS A 1 118 ? -52.499 -29.792 1.209   1.00 35.33 ? 500 LYS A CD    1 
ATOM   933  C CE    . LYS A 1 118 ? -52.560 -30.833 0.099   1.00 38.35 ? 500 LYS A CE    1 
ATOM   934  N NZ    . LYS A 1 118 ? -53.788 -30.649 -0.739  1.00 39.69 ? 500 LYS A NZ    1 
ATOM   935  N N     . MET A 1 119 ? -49.274 -27.815 4.861   1.00 30.83 ? 501 MET A N     1 
ATOM   936  C CA    . MET A 1 119 ? -48.946 -26.377 4.882   1.00 30.52 ? 501 MET A CA    1 
ATOM   937  C C     . MET A 1 119 ? -48.398 -25.889 3.535   1.00 30.17 ? 501 MET A C     1 
ATOM   938  O O     . MET A 1 119 ? -48.028 -26.702 2.707   1.00 30.23 ? 501 MET A O     1 
ATOM   939  C CB    . MET A 1 119 ? -47.956 -26.055 5.959   1.00 30.45 ? 501 MET A CB    1 
ATOM   940  C CG    . MET A 1 119 ? -46.574 -26.551 5.650   1.00 31.14 ? 501 MET A CG    1 
ATOM   941  S SD    . MET A 1 119 ? -45.481 -25.631 6.697   1.00 32.81 ? 501 MET A SD    1 
ATOM   942  C CE    . MET A 1 119 ? -45.970 -23.979 6.239   1.00 34.46 ? 501 MET A CE    1 
ATOM   943  N N     . TYR A 1 120 ? -48.308 -24.575 3.332   1.00 29.58 ? 502 TYR A N     1 
ATOM   944  C CA    . TYR A 1 120 ? -48.037 -24.025 1.998   1.00 29.28 ? 502 TYR A CA    1 
ATOM   945  C C     . TYR A 1 120 ? -46.917 -23.004 1.918   1.00 28.59 ? 502 TYR A C     1 
ATOM   946  O O     . TYR A 1 120 ? -46.778 -22.184 2.800   1.00 28.81 ? 502 TYR A O     1 
ATOM   947  C CB    . TYR A 1 120 ? -49.310 -23.383 1.416   1.00 29.28 ? 502 TYR A CB    1 
ATOM   948  C CG    . TYR A 1 120 ? -50.473 -24.346 1.257   1.00 30.69 ? 502 TYR A CG    1 
ATOM   949  C CD1   . TYR A 1 120 ? -51.413 -24.520 2.288   1.00 32.48 ? 502 TYR A CD1   1 
ATOM   950  C CD2   . TYR A 1 120 ? -50.642 -25.088 0.080   1.00 29.95 ? 502 TYR A CD2   1 
ATOM   951  C CE1   . TYR A 1 120 ? -52.481 -25.403 2.147   1.00 30.70 ? 502 TYR A CE1   1 
ATOM   952  C CE2   . TYR A 1 120 ? -51.704 -25.963 -0.067  1.00 29.10 ? 502 TYR A CE2   1 
ATOM   953  C CZ    . TYR A 1 120 ? -52.623 -26.106 0.969   1.00 30.78 ? 502 TYR A CZ    1 
ATOM   954  O OH    . TYR A 1 120 ? -53.680 -26.976 0.833   1.00 32.95 ? 502 TYR A OH    1 
ATOM   955  N N     . PHE A 1 121 ? -46.158 -23.023 0.829   1.00 28.20 ? 503 PHE A N     1 
ATOM   956  C CA    . PHE A 1 121 ? -45.169 -21.975 0.554   1.00 28.04 ? 503 PHE A CA    1 
ATOM   957  C C     . PHE A 1 121 ? -45.583 -21.254 -0.703  1.00 28.20 ? 503 PHE A C     1 
ATOM   958  O O     . PHE A 1 121 ? -45.822 -21.890 -1.713  1.00 28.03 ? 503 PHE A O     1 
ATOM   959  C CB    . PHE A 1 121 ? -43.725 -22.528 0.451   1.00 27.37 ? 503 PHE A CB    1 
ATOM   960  C CG    . PHE A 1 121 ? -43.264 -23.184 1.698   1.00 25.65 ? 503 PHE A CG    1 
ATOM   961  C CD1   . PHE A 1 121 ? -42.634 -22.449 2.677   1.00 24.05 ? 503 PHE A CD1   1 
ATOM   962  C CD2   . PHE A 1 121 ? -43.542 -24.535 1.940   1.00 26.49 ? 503 PHE A CD2   1 
ATOM   963  C CE1   . PHE A 1 121 ? -42.232 -23.035 3.880   1.00 25.01 ? 503 PHE A CE1   1 
ATOM   964  C CE2   . PHE A 1 121 ? -43.161 -25.150 3.145   1.00 25.28 ? 503 PHE A CE2   1 
ATOM   965  C CZ    . PHE A 1 121 ? -42.498 -24.397 4.117   1.00 24.95 ? 503 PHE A CZ    1 
ATOM   966  N N     . ILE A 1 122 ? -45.690 -19.933 -0.621  1.00 28.50 ? 504 ILE A N     1 
ATOM   967  C CA    . ILE A 1 122 ? -46.039 -19.135 -1.767  1.00 29.19 ? 504 ILE A CA    1 
ATOM   968  C C     . ILE A 1 122 ? -44.830 -18.910 -2.649  1.00 30.33 ? 504 ILE A C     1 
ATOM   969  O O     . ILE A 1 122 ? -43.881 -18.251 -2.257  1.00 30.16 ? 504 ILE A O     1 
ATOM   970  C CB    . ILE A 1 122 ? -46.619 -17.805 -1.341  1.00 28.94 ? 504 ILE A CB    1 
ATOM   971  C CG1   . ILE A 1 122 ? -47.749 -18.058 -0.364  1.00 28.08 ? 504 ILE A CG1   1 
ATOM   972  C CG2   . ILE A 1 122 ? -47.089 -17.019 -2.548  1.00 28.23 ? 504 ILE A CG2   1 
ATOM   973  C CD1   . ILE A 1 122 ? -48.166 -16.862 0.409   1.00 29.12 ? 504 ILE A CD1   1 
ATOM   974  N N     . GLN A 1 123 ? -44.885 -19.465 -3.848  1.00 31.92 ? 505 GLN A N     1 
ATOM   975  C CA    . GLN A 1 123 ? -43.914 -19.176 -4.878  1.00 33.78 ? 505 GLN A CA    1 
ATOM   976  C C     . GLN A 1 123 ? -44.225 -17.896 -5.592  1.00 34.64 ? 505 GLN A C     1 
ATOM   977  O O     . GLN A 1 123 ? -43.472 -16.962 -5.510  1.00 34.73 ? 505 GLN A O     1 
ATOM   978  C CB    . GLN A 1 123 ? -43.919 -20.254 -5.908  1.00 33.80 ? 505 GLN A CB    1 
ATOM   979  C CG    . GLN A 1 123 ? -42.639 -20.270 -6.630  1.00 37.48 ? 505 GLN A CG    1 
ATOM   980  C CD    . GLN A 1 123 ? -42.797 -20.649 -8.045  1.00 41.77 ? 505 GLN A CD    1 
ATOM   981  O OE1   . GLN A 1 123 ? -43.898 -20.727 -8.578  1.00 45.12 ? 505 GLN A OE1   1 
ATOM   982  N NE2   . GLN A 1 123 ? -41.688 -20.894 -8.683  1.00 45.04 ? 505 GLN A NE2   1 
ATOM   983  N N     . HIS A 1 124 ? -45.333 -17.873 -6.321  1.00 36.28 ? 506 HIS A N     1 
ATOM   984  C CA    . HIS A 1 124 ? -45.861 -16.631 -6.878  1.00 37.61 ? 506 HIS A CA    1 
ATOM   985  C C     . HIS A 1 124 ? -47.342 -16.463 -6.613  1.00 37.21 ? 506 HIS A C     1 
ATOM   986  O O     . HIS A 1 124 ? -48.127 -17.374 -6.888  1.00 37.43 ? 506 HIS A O     1 
ATOM   987  C CB    . HIS A 1 124 ? -45.647 -16.563 -8.396  1.00 38.63 ? 506 HIS A CB    1 
ATOM   988  C CG    . HIS A 1 124 ? -46.014 -15.231 -8.985  1.00 41.83 ? 506 HIS A CG    1 
ATOM   989  N ND1   . HIS A 1 124 ? -45.372 -14.057 -8.630  1.00 44.01 ? 506 HIS A ND1   1 
ATOM   990  C CD2   . HIS A 1 124 ? -46.972 -14.881 -9.880  1.00 43.59 ? 506 HIS A CD2   1 
ATOM   991  C CE1   . HIS A 1 124 ? -45.909 -13.046 -9.293  1.00 44.99 ? 506 HIS A CE1   1 
ATOM   992  N NE2   . HIS A 1 124 ? -46.882 -13.518 -10.058 1.00 44.98 ? 506 HIS A NE2   1 
ATOM   993  N N     . GLY A 1 125 ? -47.728 -15.288 -6.132  1.00 36.73 ? 507 GLY A N     1 
ATOM   994  C CA    . GLY A 1 125 ? -49.139 -14.989 -5.921  1.00 36.65 ? 507 GLY A CA    1 
ATOM   995  C C     . GLY A 1 125 ? -49.399 -14.143 -4.702  1.00 36.91 ? 507 GLY A C     1 
ATOM   996  O O     . GLY A 1 125 ? -48.462 -13.799 -3.967  1.00 37.45 ? 507 GLY A O     1 
ATOM   997  N N     . VAL A 1 126 ? -50.659 -13.774 -4.490  1.00 36.64 ? 508 VAL A N     1 
ATOM   998  C CA    . VAL A 1 126 ? -51.039 -13.064 -3.271  1.00 36.88 ? 508 VAL A CA    1 
ATOM   999  C C     . VAL A 1 126 ? -52.174 -13.797 -2.608  1.00 37.03 ? 508 VAL A C     1 
ATOM   1000 O O     . VAL A 1 126 ? -53.066 -14.295 -3.273  1.00 37.53 ? 508 VAL A O     1 
ATOM   1001 C CB    . VAL A 1 126 ? -51.464 -11.628 -3.554  1.00 37.03 ? 508 VAL A CB    1 
ATOM   1002 C CG1   . VAL A 1 126 ? -51.841 -10.915 -2.269  1.00 36.79 ? 508 VAL A CG1   1 
ATOM   1003 C CG2   . VAL A 1 126 ? -50.328 -10.889 -4.214  1.00 37.91 ? 508 VAL A CG2   1 
ATOM   1004 N N     . ALA A 1 127 ? -52.142 -13.874 -1.289  1.00 37.15 ? 509 ALA A N     1 
ATOM   1005 C CA    . ALA A 1 127 ? -53.177 -14.575 -0.555  1.00 37.13 ? 509 ALA A CA    1 
ATOM   1006 C C     . ALA A 1 127 ? -53.587 -13.801 0.690   1.00 37.49 ? 509 ALA A C     1 
ATOM   1007 O O     . ALA A 1 127 ? -52.757 -13.136 1.312   1.00 37.52 ? 509 ALA A O     1 
ATOM   1008 C CB    . ALA A 1 127 ? -52.694 -15.949 -0.194  1.00 37.08 ? 509 ALA A CB    1 
ATOM   1009 N N     . GLY A 1 128 ? -54.788 -13.964 1.165   1.00 38.02 ? 510 GLY A N     1 
ATOM   1010 C CA    . GLY A 1 128 ? -55.372 -13.179 2.252   1.00 38.72 ? 510 GLY A CA    1 
ATOM   1011 C C     . GLY A 1 128 ? -55.790 -14.010 3.450   1.00 39.44 ? 510 GLY A C     1 
ATOM   1012 O O     . GLY A 1 128 ? -56.361 -15.091 3.297   1.00 39.28 ? 510 GLY A O     1 
ATOM   1013 N N     . VAL A 1 129 ? -55.505 -13.495 4.645   1.00 40.26 ? 511 VAL A N     1 
ATOM   1014 C CA    . VAL A 1 129 ? -55.846 -14.169 5.899   1.00 41.71 ? 511 VAL A CA    1 
ATOM   1015 C C     . VAL A 1 129 ? -57.091 -13.529 6.518   1.00 42.61 ? 511 VAL A C     1 
ATOM   1016 O O     . VAL A 1 129 ? -57.107 -12.329 6.804   1.00 42.85 ? 511 VAL A O     1 
ATOM   1017 C CB    . VAL A 1 129 ? -54.664 -14.143 6.906   1.00 41.71 ? 511 VAL A CB    1 
ATOM   1018 C CG1   . VAL A 1 129 ? -55.013 -14.909 8.177   1.00 42.11 ? 511 VAL A CG1   1 
ATOM   1019 C CG2   . VAL A 1 129 ? -53.402 -14.718 6.274   1.00 41.07 ? 511 VAL A CG2   1 
ATOM   1020 N N     . ILE A 1 130 ? -58.129 -14.342 6.715   1.00 44.18 ? 512 ILE A N     1 
ATOM   1021 C CA    . ILE A 1 130 ? -59.421 -13.867 7.218   1.00 46.32 ? 512 ILE A CA    1 
ATOM   1022 C C     . ILE A 1 130 ? -59.840 -14.605 8.491   1.00 47.66 ? 512 ILE A C     1 
ATOM   1023 O O     . ILE A 1 130 ? -59.704 -15.827 8.588   1.00 47.89 ? 512 ILE A O     1 
ATOM   1024 C CB    . ILE A 1 130 ? -60.554 -14.022 6.150   1.00 46.33 ? 512 ILE A CB    1 
ATOM   1025 C CG1   . ILE A 1 130 ? -60.086 -13.596 4.745   1.00 45.60 ? 512 ILE A CG1   1 
ATOM   1026 C CG2   . ILE A 1 130 ? -61.832 -13.281 6.579   1.00 47.02 ? 512 ILE A CG2   1 
ATOM   1027 C CD1   . ILE A 1 130 ? -59.821 -12.099 4.565   1.00 45.21 ? 512 ILE A CD1   1 
ATOM   1028 N N     . THR A 1 131 ? -60.344 -13.846 9.461   1.00 49.23 ? 513 THR A N     1 
ATOM   1029 C CA    . THR A 1 131 ? -60.972 -14.398 10.661  1.00 51.12 ? 513 THR A CA    1 
ATOM   1030 C C     . THR A 1 131 ? -62.294 -13.648 10.872  1.00 52.26 ? 513 THR A C     1 
ATOM   1031 O O     . THR A 1 131 ? -62.782 -12.987 9.951   1.00 52.87 ? 513 THR A O     1 
ATOM   1032 C CB    . THR A 1 131 ? -60.051 -14.266 11.903  1.00 51.32 ? 513 THR A CB    1 
ATOM   1033 O OG1   . THR A 1 131 ? -58.677 -14.332 11.500  1.00 51.51 ? 513 THR A OG1   1 
ATOM   1034 C CG2   . THR A 1 131 ? -60.328 -15.376 12.911  1.00 51.33 ? 513 THR A CG2   1 
ATOM   1035 N N     . LYS A 1 132 ? -62.876 -13.757 12.066  1.00 53.06 ? 514 LYS A N     1 
ATOM   1036 C CA    . LYS A 1 132 ? -64.075 -12.994 12.410  1.00 54.14 ? 514 LYS A CA    1 
ATOM   1037 C C     . LYS A 1 132 ? -63.729 -11.514 12.585  1.00 55.36 ? 514 LYS A C     1 
ATOM   1038 O O     . LYS A 1 132 ? -63.409 -11.063 13.689  1.00 55.17 ? 514 LYS A O     1 
ATOM   1039 C CB    . LYS A 1 132 ? -64.748 -13.557 13.669  1.00 53.88 ? 514 LYS A CB    1 
ATOM   1040 C CG    . LYS A 1 132 ? -65.717 -14.711 13.417  1.00 53.68 ? 514 LYS A CG    1 
ATOM   1041 C CD    . LYS A 1 132 ? -65.008 -16.058 13.331  1.00 53.75 ? 514 LYS A CD    1 
ATOM   1042 C CE    . LYS A 1 132 ? -65.997 -17.185 13.085  1.00 53.37 ? 514 LYS A CE    1 
ATOM   1043 N NZ    . LYS A 1 132 ? -65.321 -18.509 13.000  1.00 54.18 ? 514 LYS A NZ    1 
ATOM   1044 N N     . SER A 1 133 ? -63.789 -10.780 11.473  1.00 56.58 ? 515 SER A N     1 
ATOM   1045 C CA    . SER A 1 133 ? -63.438 -9.354  11.408  1.00 57.94 ? 515 SER A CA    1 
ATOM   1046 C C     . SER A 1 133 ? -61.995 -9.063  11.843  1.00 58.40 ? 515 SER A C     1 
ATOM   1047 O O     . SER A 1 133 ? -61.755 -8.313  12.795  1.00 58.46 ? 515 SER A O     1 
ATOM   1048 C CB    . SER A 1 133 ? -64.445 -8.494  12.186  1.00 58.29 ? 515 SER A CB    1 
ATOM   1049 O OG    . SER A 1 133 ? -65.745 -8.608  11.635  1.00 58.80 ? 515 SER A OG    1 
ATOM   1050 N N     . SER A 1 134 ? -61.044 -9.670  11.136  1.00 58.71 ? 516 SER A N     1 
ATOM   1051 C CA    . SER A 1 134 ? -59.621 -9.414  11.352  1.00 58.93 ? 516 SER A CA    1 
ATOM   1052 C C     . SER A 1 134 ? -59.036 -8.610  10.190  1.00 58.86 ? 516 SER A C     1 
ATOM   1053 O O     . SER A 1 134 ? -57.814 -8.481  10.063  1.00 58.73 ? 516 SER A O     1 
ATOM   1054 C CB    . SER A 1 134 ? -58.859 -10.731 11.528  1.00 20.00 ? 516 SER A CB    1 
ATOM   1055 O OG    . SER A 1 134 ? -58.905 -11.510 10.344  1.00 20.00 ? 516 SER A OG    1 
ATOM   1056 N N     . LYS A 1 135 ? -59.928 -8.071  9.356   1.00 58.77 ? 517 LYS A N     1 
ATOM   1057 C CA    . LYS A 1 135 ? -59.572 -7.317  8.144   1.00 58.89 ? 517 LYS A CA    1 
ATOM   1058 C C     . LYS A 1 135 ? -58.796 -8.164  7.125   1.00 58.47 ? 517 LYS A C     1 
ATOM   1059 O O     . LYS A 1 135 ? -58.845 -9.397  7.166   1.00 58.72 ? 517 LYS A O     1 
ATOM   1060 C CB    . LYS A 1 135 ? -58.826 -6.018  8.488   1.00 58.97 ? 517 LYS A CB    1 
ATOM   1061 C CG    . LYS A 1 135 ? -59.687 -4.969  9.178   1.00 60.04 ? 517 LYS A CG    1 
ATOM   1062 C CD    . LYS A 1 135 ? -58.889 -3.713  9.487   1.00 61.39 ? 517 LYS A CD    1 
ATOM   1063 C CE    . LYS A 1 135 ? -59.752 -2.669  10.177  1.00 62.01 ? 517 LYS A CE    1 
ATOM   1064 N NZ    . LYS A 1 135 ? -58.985 -1.431  10.488  1.00 62.26 ? 517 LYS A NZ    1 
ATOM   1065 N N     . GLU A 1 136 ? -58.095 -7.496  6.211   1.00 57.49 ? 518 GLU A N     1 
ATOM   1066 C CA    . GLU A 1 136 ? -57.343 -8.173  5.159   1.00 56.68 ? 518 GLU A CA    1 
ATOM   1067 C C     . GLU A 1 136 ? -55.845 -8.192  5.464   1.00 55.50 ? 518 GLU A C     1 
ATOM   1068 O O     . GLU A 1 136 ? -55.182 -7.150  5.448   1.00 55.67 ? 518 GLU A O     1 
ATOM   1069 C CB    . GLU A 1 136 ? -57.619 -7.518  3.798   1.00 57.04 ? 518 GLU A CB    1 
ATOM   1070 C CG    . GLU A 1 136 ? -56.979 -8.210  2.592   1.00 59.73 ? 518 GLU A CG    1 
ATOM   1071 C CD    . GLU A 1 136 ? -57.650 -9.525  2.231   1.00 63.21 ? 518 GLU A CD    1 
ATOM   1072 O OE1   . GLU A 1 136 ? -57.376 -10.542 2.900   1.00 64.28 ? 518 GLU A OE1   1 
ATOM   1073 O OE2   . GLU A 1 136 ? -58.441 -9.543  1.264   1.00 64.46 ? 518 GLU A OE2   1 
ATOM   1074 N N     . MET A 1 137 ? -55.327 -9.384  5.749   1.00 53.36 ? 519 MET A N     1 
ATOM   1075 C CA    . MET A 1 137 ? -53.899 -9.579  5.991   1.00 51.23 ? 519 MET A CA    1 
ATOM   1076 C C     . MET A 1 137 ? -53.277 -10.313 4.807   1.00 49.64 ? 519 MET A C     1 
ATOM   1077 O O     . MET A 1 137 ? -53.582 -11.482 4.558   1.00 49.46 ? 519 MET A O     1 
ATOM   1078 C CB    . MET A 1 137 ? -53.662 -10.345 7.296   1.00 51.21 ? 519 MET A CB    1 
ATOM   1079 C CG    . MET A 1 137 ? -54.230 -9.663  8.536   1.00 52.47 ? 519 MET A CG    1 
ATOM   1080 S SD    . MET A 1 137 ? -53.517 -10.270 10.077  1.00 56.57 ? 519 MET A SD    1 
ATOM   1081 C CE    . MET A 1 137 ? -51.916 -9.466  10.047  1.00 54.82 ? 519 MET A CE    1 
ATOM   1082 N N     . LYS A 1 138 ? -52.329 -9.691  3.998   1.00 47.96 ? 520 LYS A N     1 
ATOM   1083 C CA    . LYS A 1 138 ? -51.873 -10.300 2.771   1.00 46.87 ? 520 LYS A CA    1 
ATOM   1084 C C     . LYS A 1 138 ? -50.491 -10.919 2.886   1.00 46.11 ? 520 LYS A C     1 
ATOM   1085 O O     . LYS A 1 138 ? -49.588 -10.338 3.498   1.00 46.30 ? 520 LYS A O     1 
ATOM   1086 C CB    . LYS A 1 138 ? -51.984 -9.325  1.609   1.00 46.83 ? 520 LYS A CB    1 
ATOM   1087 C CG    . LYS A 1 138 ? -53.432 -9.206  1.143   1.00 47.10 ? 520 LYS A CG    1 
ATOM   1088 C CD    . LYS A 1 138 ? -53.831 -7.776  0.827   1.00 48.15 ? 520 LYS A CD    1 
ATOM   1089 C CE    . LYS A 1 138 ? -53.932 -7.551  -0.676  1.00 48.60 ? 520 LYS A CE    1 
ATOM   1090 N NZ    . LYS A 1 138 ? -54.278 -6.145  -0.981  1.00 49.99 ? 520 LYS A NZ    1 
ATOM   1091 N N     . LEU A 1 139 ? -50.355 -12.121 2.326   1.00 44.75 ? 521 LEU A N     1 
ATOM   1092 C CA    . LEU A 1 139 ? -49.077 -12.825 2.232   1.00 43.27 ? 521 LEU A CA    1 
ATOM   1093 C C     . LEU A 1 139 ? -48.721 -12.985 0.776   1.00 42.67 ? 521 LEU A C     1 
ATOM   1094 O O     . LEU A 1 139 ? -49.593 -13.200 -0.066  1.00 42.02 ? 521 LEU A O     1 
ATOM   1095 C CB    . LEU A 1 139 ? -49.156 -14.193 2.880   1.00 43.18 ? 521 LEU A CB    1 
ATOM   1096 C CG    . LEU A 1 139 ? -49.613 -14.192 4.329   1.00 42.32 ? 521 LEU A CG    1 
ATOM   1097 C CD1   . LEU A 1 139 ? -49.680 -15.621 4.907   1.00 40.51 ? 521 LEU A CD1   1 
ATOM   1098 C CD2   . LEU A 1 139 ? -48.709 -13.275 5.141   1.00 41.85 ? 521 LEU A CD2   1 
ATOM   1099 N N     . THR A 1 140 ? -47.429 -12.868 0.486   1.00 42.31 ? 522 THR A N     1 
ATOM   1100 C CA    . THR A 1 140 ? -46.948 -12.784 -0.900  1.00 41.97 ? 522 THR A CA    1 
ATOM   1101 C C     . THR A 1 140 ? -45.698 -13.689 -1.115  1.00 41.39 ? 522 THR A C     1 
ATOM   1102 O O     . THR A 1 140 ? -45.342 -14.451 -0.218  1.00 41.45 ? 522 THR A O     1 
ATOM   1103 C CB    . THR A 1 140 ? -46.802 -11.286 -1.336  1.00 41.45 ? 522 THR A CB    1 
ATOM   1104 O OG1   . THR A 1 140 ? -46.769 -11.192 -2.757  1.00 41.40 ? 522 THR A OG1   1 
ATOM   1105 C CG2   . THR A 1 140 ? -45.572 -10.656 -0.753  1.00 42.52 ? 522 THR A CG2   1 
ATOM   1106 N N     . ASP A 1 141 ? -45.056 -13.626 -2.281  1.00 40.65 ? 523 ASP A N     1 
ATOM   1107 C CA    . ASP A 1 141 ? -43.914 -14.508 -2.595  1.00 40.14 ? 523 ASP A CA    1 
ATOM   1108 C C     . ASP A 1 141 ? -42.938 -14.641 -1.431  1.00 38.78 ? 523 ASP A C     1 
ATOM   1109 O O     . ASP A 1 141 ? -42.597 -13.655 -0.771  1.00 38.49 ? 523 ASP A O     1 
ATOM   1110 C CB    . ASP A 1 141 ? -43.150 -14.038 -3.841  1.00 40.68 ? 523 ASP A CB    1 
ATOM   1111 C CG    . ASP A 1 141 ? -44.076 -13.554 -4.977  1.00 44.61 ? 523 ASP A CG    1 
ATOM   1112 O OD1   . ASP A 1 141 ? -45.189 -13.023 -4.708  1.00 49.24 ? 523 ASP A OD1   1 
ATOM   1113 O OD2   . ASP A 1 141 ? -43.681 -13.679 -6.163  1.00 48.02 ? 523 ASP A OD2   1 
ATOM   1114 N N     . GLY A 1 142 ? -42.501 -15.873 -1.191  1.00 37.43 ? 524 GLY A N     1 
ATOM   1115 C CA    . GLY A 1 142 ? -41.586 -16.184 -0.102  1.00 35.56 ? 524 GLY A CA    1 
ATOM   1116 C C     . GLY A 1 142 ? -42.249 -16.059 1.256   1.00 34.23 ? 524 GLY A C     1 
ATOM   1117 O O     . GLY A 1 142 ? -41.588 -15.788 2.233   1.00 34.81 ? 524 GLY A O     1 
ATOM   1118 N N     . SER A 1 143 ? -43.559 -16.239 1.321   1.00 32.45 ? 525 SER A N     1 
ATOM   1119 C CA    . SER A 1 143 ? -44.261 -16.332 2.583   1.00 31.00 ? 525 SER A CA    1 
ATOM   1120 C C     . SER A 1 143 ? -44.758 -17.740 2.764   1.00 29.25 ? 525 SER A C     1 
ATOM   1121 O O     . SER A 1 143 ? -44.845 -18.473 1.772   1.00 28.59 ? 525 SER A O     1 
ATOM   1122 C CB    . SER A 1 143 ? -45.464 -15.404 2.586   1.00 31.89 ? 525 SER A CB    1 
ATOM   1123 O OG    . SER A 1 143 ? -45.179 -14.197 3.273   1.00 35.05 ? 525 SER A OG    1 
ATOM   1124 N N     . TYR A 1 144 ? -45.091 -18.121 4.008   1.00 27.06 ? 526 TYR A N     1 
ATOM   1125 C CA    . TYR A 1 144 ? -45.745 -19.402 4.253   1.00 25.56 ? 526 TYR A CA    1 
ATOM   1126 C C     . TYR A 1 144 ? -46.950 -19.309 5.171   1.00 24.99 ? 526 TYR A C     1 
ATOM   1127 O O     . TYR A 1 144 ? -47.058 -18.424 6.006   1.00 24.67 ? 526 TYR A O     1 
ATOM   1128 C CB    . TYR A 1 144 ? -44.766 -20.451 4.761   1.00 25.15 ? 526 TYR A CB    1 
ATOM   1129 C CG    . TYR A 1 144 ? -44.200 -20.123 6.081   1.00 25.78 ? 526 TYR A CG    1 
ATOM   1130 C CD1   . TYR A 1 144 ? -44.903 -20.411 7.244   1.00 26.46 ? 526 TYR A CD1   1 
ATOM   1131 C CD2   . TYR A 1 144 ? -42.959 -19.504 6.186   1.00 27.22 ? 526 TYR A CD2   1 
ATOM   1132 C CE1   . TYR A 1 144 ? -44.385 -20.076 8.501   1.00 27.90 ? 526 TYR A CE1   1 
ATOM   1133 C CE2   . TYR A 1 144 ? -42.421 -19.167 7.424   1.00 27.89 ? 526 TYR A CE2   1 
ATOM   1134 C CZ    . TYR A 1 144 ? -43.134 -19.465 8.585   1.00 28.75 ? 526 TYR A CZ    1 
ATOM   1135 O OH    . TYR A 1 144 ? -42.617 -19.136 9.823   1.00 29.56 ? 526 TYR A OH    1 
ATOM   1136 N N     . PHE A 1 145 ? -47.867 -20.250 5.015   1.00 24.51 ? 527 PHE A N     1 
ATOM   1137 C CA    . PHE A 1 145 ? -49.027 -20.309 5.884   1.00 24.04 ? 527 PHE A CA    1 
ATOM   1138 C C     . PHE A 1 145 ? -49.507 -21.736 6.010   1.00 23.59 ? 527 PHE A C     1 
ATOM   1139 O O     . PHE A 1 145 ? -49.143 -22.608 5.214   1.00 22.18 ? 527 PHE A O     1 
ATOM   1140 C CB    . PHE A 1 145 ? -50.150 -19.417 5.346   1.00 24.56 ? 527 PHE A CB    1 
ATOM   1141 C CG    . PHE A 1 145 ? -50.574 -19.774 3.955   1.00 24.35 ? 527 PHE A CG    1 
ATOM   1142 C CD1   . PHE A 1 145 ? -51.529 -20.767 3.745   1.00 23.81 ? 527 PHE A CD1   1 
ATOM   1143 C CD2   . PHE A 1 145 ? -49.977 -19.160 2.861   1.00 23.89 ? 527 PHE A CD2   1 
ATOM   1144 C CE1   . PHE A 1 145 ? -51.904 -21.128 2.493   1.00 23.62 ? 527 PHE A CE1   1 
ATOM   1145 C CE2   . PHE A 1 145 ? -50.341 -19.508 1.599   1.00 25.29 ? 527 PHE A CE2   1 
ATOM   1146 C CZ    . PHE A 1 145 ? -51.318 -20.492 1.406   1.00 26.14 ? 527 PHE A CZ    1 
ATOM   1147 N N     . GLY A 1 146 ? -50.315 -21.961 7.037   1.00 23.70 ? 528 GLY A N     1 
ATOM   1148 C CA    . GLY A 1 146 ? -50.817 -23.288 7.318   1.00 24.98 ? 528 GLY A CA    1 
ATOM   1149 C C     . GLY A 1 146 ? -49.943 -24.082 8.269   1.00 25.71 ? 528 GLY A C     1 
ATOM   1150 O O     . GLY A 1 146 ? -50.118 -25.306 8.426   1.00 25.52 ? 528 GLY A O     1 
ATOM   1151 N N     . GLU A 1 147 ? -49.003 -23.395 8.913   1.00 26.42 ? 529 GLU A N     1 
ATOM   1152 C CA    . GLU A 1 147 ? -48.081 -24.067 9.814   1.00 27.31 ? 529 GLU A CA    1 
ATOM   1153 C C     . GLU A 1 147 ? -48.738 -24.281 11.174  1.00 28.71 ? 529 GLU A C     1 
ATOM   1154 O O     . GLU A 1 147 ? -48.529 -25.302 11.807  1.00 28.96 ? 529 GLU A O     1 
ATOM   1155 C CB    . GLU A 1 147 ? -46.777 -23.289 9.951   1.00 26.27 ? 529 GLU A CB    1 
ATOM   1156 C CG    . GLU A 1 147 ? -46.824 -22.136 10.945  1.00 25.19 ? 529 GLU A CG    1 
ATOM   1157 C CD    . GLU A 1 147 ? -47.342 -20.821 10.371  1.00 23.53 ? 529 GLU A CD    1 
ATOM   1158 O OE1   . GLU A 1 147 ? -48.115 -20.823 9.393   1.00 23.17 ? 529 GLU A OE1   1 
ATOM   1159 O OE2   . GLU A 1 147 ? -46.959 -19.766 10.901  1.00 22.30 ? 529 GLU A OE2   1 
ATOM   1160 N N     . ILE A 1 148 ? -49.556 -23.320 11.602  1.00 30.38 ? 530 ILE A N     1 
ATOM   1161 C CA    . ILE A 1 148 ? -50.015 -23.241 12.986  1.00 32.01 ? 530 ILE A CA    1 
ATOM   1162 C C     . ILE A 1 148 ? -50.820 -24.477 13.347  1.00 33.64 ? 530 ILE A C     1 
ATOM   1163 O O     . ILE A 1 148 ? -50.545 -25.170 14.333  1.00 33.57 ? 530 ILE A O     1 
ATOM   1164 C CB    . ILE A 1 148 ? -50.888 -22.016 13.200  1.00 31.83 ? 530 ILE A CB    1 
ATOM   1165 C CG1   . ILE A 1 148 ? -50.100 -20.743 12.936  1.00 31.90 ? 530 ILE A CG1   1 
ATOM   1166 C CG2   . ILE A 1 148 ? -51.473 -22.007 14.586  1.00 31.22 ? 530 ILE A CG2   1 
ATOM   1167 C CD1   . ILE A 1 148 ? -50.963 -19.509 13.075  1.00 31.81 ? 530 ILE A CD1   1 
ATOM   1168 N N     . CYS A 1 149 ? -51.828 -24.742 12.534  1.00 35.30 ? 531 CYS A N     1 
ATOM   1169 C CA    . CYS A 1 149 ? -52.583 -25.948 12.675  1.00 36.93 ? 531 CYS A CA    1 
ATOM   1170 C C     . CYS A 1 149 ? -51.648 -27.139 12.939  1.00 36.40 ? 531 CYS A C     1 
ATOM   1171 O O     . CYS A 1 149 ? -51.713 -27.731 14.010  1.00 36.86 ? 531 CYS A O     1 
ATOM   1172 C CB    . CYS A 1 149 ? -53.415 -26.166 11.429  1.00 37.31 ? 531 CYS A CB    1 
ATOM   1173 S SG    . CYS A 1 149 ? -54.328 -27.668 11.527  1.00 44.37 ? 531 CYS A SG    1 
ATOM   1174 N N     . LEU A 1 150 ? -50.771 -27.464 11.990  1.00 36.05 ? 532 LEU A N     1 
ATOM   1175 C CA    . LEU A 1 150 ? -49.832 -28.609 12.124  1.00 36.09 ? 532 LEU A CA    1 
ATOM   1176 C C     . LEU A 1 150 ? -49.056 -28.737 13.455  1.00 35.82 ? 532 LEU A C     1 
ATOM   1177 O O     . LEU A 1 150 ? -48.853 -29.833 13.985  1.00 35.16 ? 532 LEU A O     1 
ATOM   1178 C CB    . LEU A 1 150 ? -48.801 -28.569 11.002  1.00 35.95 ? 532 LEU A CB    1 
ATOM   1179 C CG    . LEU A 1 150 ? -49.141 -29.112 9.623   1.00 35.91 ? 532 LEU A CG    1 
ATOM   1180 C CD1   . LEU A 1 150 ? -50.616 -28.923 9.233   1.00 34.01 ? 532 LEU A CD1   1 
ATOM   1181 C CD2   . LEU A 1 150 ? -48.173 -28.432 8.642   1.00 34.83 ? 532 LEU A CD2   1 
ATOM   1182 N N     . LEU A 1 151 ? -48.588 -27.601 13.949  1.00 35.92 ? 533 LEU A N     1 
ATOM   1183 C CA    . LEU A 1 151 ? -47.878 -27.567 15.192  1.00 35.95 ? 533 LEU A CA    1 
ATOM   1184 C C     . LEU A 1 151 ? -48.815 -27.982 16.321  1.00 36.30 ? 533 LEU A C     1 
ATOM   1185 O O     . LEU A 1 151 ? -48.544 -28.958 17.000  1.00 36.92 ? 533 LEU A O     1 
ATOM   1186 C CB    . LEU A 1 151 ? -47.279 -26.181 15.432  1.00 35.42 ? 533 LEU A CB    1 
ATOM   1187 C CG    . LEU A 1 151 ? -46.106 -25.716 14.581  1.00 34.03 ? 533 LEU A CG    1 
ATOM   1188 C CD1   . LEU A 1 151 ? -45.914 -24.303 14.865  1.00 34.18 ? 533 LEU A CD1   1 
ATOM   1189 C CD2   . LEU A 1 151 ? -44.818 -26.424 14.899  1.00 32.21 ? 533 LEU A CD2   1 
ATOM   1190 N N     . THR A 1 152 ? -49.910 -27.320 16.453  1.00 36.57 ? 534 THR A N     1 
ATOM   1191 C CA    . THR A 1 152 ? -50.811 -27.436 17.602  1.00 36.33 ? 534 THR A CA    1 
ATOM   1192 C C     . THR A 1 152 ? -51.666 -28.704 17.571  1.00 36.84 ? 534 THR A C     1 
ATOM   1193 O O     . THR A 1 152 ? -52.238 -29.094 18.594  1.00 37.37 ? 534 THR A O     1 
ATOM   1194 C CB    . THR A 1 152 ? -51.741 -26.205 17.728  1.00 36.53 ? 534 THR A CB    1 
ATOM   1195 O OG1   . THR A 1 152 ? -52.439 -25.998 16.493  1.00 35.41 ? 534 THR A OG1   1 
ATOM   1196 C CG2   . THR A 1 152 ? -50.942 -24.954 18.075  1.00 34.61 ? 534 THR A CG2   1 
ATOM   1197 N N     . LYS A 1 153 ? -51.748 -29.334 16.397  1.00 36.85 ? 535 LYS A N     1 
ATOM   1198 C CA    . LYS A 1 153 ? -52.558 -30.544 16.169  1.00 36.19 ? 535 LYS A CA    1 
ATOM   1199 C C     . LYS A 1 153 ? -54.067 -30.300 16.316  1.00 35.49 ? 535 LYS A C     1 
ATOM   1200 O O     . LYS A 1 153 ? -54.857 -31.248 16.346  1.00 35.44 ? 535 LYS A O     1 
ATOM   1201 C CB    . LYS A 1 153 ? -52.104 -31.706 17.069  1.00 36.29 ? 535 LYS A CB    1 
ATOM   1202 C CG    . LYS A 1 153 ? -50.677 -32.178 16.829  1.00 37.08 ? 535 LYS A CG    1 
ATOM   1203 C CD    . LYS A 1 153 ? -50.287 -33.266 17.820  1.00 40.48 ? 535 LYS A CD    1 
ATOM   1204 C CE    . LYS A 1 153 ? -48.830 -33.679 17.661  1.00 42.72 ? 535 LYS A CE    1 
ATOM   1205 N NZ    . LYS A 1 153 ? -48.579 -34.427 16.396  1.00 44.02 ? 535 LYS A NZ    1 
ATOM   1206 N N     . GLY A 1 154 ? -54.428 -28.972 16.614  1.00 34.95 ? 536 GLY A N     1 
ATOM   1207 C CA    . GLY A 1 154 ? -55.810 -28.529 16.676  1.00 34.49 ? 536 GLY A CA    1 
ATOM   1208 C C     . GLY A 1 154 ? -56.085 -27.959 15.286  1.00 34.59 ? 536 GLY A C     1 
ATOM   1209 O O     . GLY A 1 154 ? -55.386 -28.255 14.317  1.00 34.89 ? 536 GLY A O     1 
ATOM   1210 N N     . ARG A 1 155 ? -57.101 -27.119 15.183  1.00 34.54 ? 537 ARG A N     1 
ATOM   1211 C CA    . ARG A 1 155 ? -57.856 -26.823 13.976  1.00 34.56 ? 537 ARG A CA    1 
ATOM   1212 C C     . ARG A 1 155 ? -57.364 -25.550 13.314  1.00 34.82 ? 537 ARG A C     1 
ATOM   1213 O O     . ARG A 1 155 ? -56.751 -24.700 13.960  1.00 35.49 ? 537 ARG A O     1 
ATOM   1214 C CB    . ARG A 1 155 ? -59.348 -26.619 14.308  1.00 34.69 ? 537 ARG A CB    1 
ATOM   1215 C CG    . ARG A 1 155 ? -60.093 -27.783 14.948  1.00 33.64 ? 537 ARG A CG    1 
ATOM   1216 C CD    . ARG A 1 155 ? -60.067 -29.001 14.087  1.00 33.59 ? 537 ARG A CD    1 
ATOM   1217 N NE    . ARG A 1 155 ? -60.833 -30.102 14.668  1.00 35.66 ? 537 ARG A NE    1 
ATOM   1218 C CZ    . ARG A 1 155 ? -62.058 -30.479 14.290  1.00 34.41 ? 537 ARG A CZ    1 
ATOM   1219 N NH1   . ARG A 1 155 ? -62.707 -29.849 13.313  1.00 33.93 ? 537 ARG A NH1   1 
ATOM   1220 N NH2   . ARG A 1 155 ? -62.636 -31.500 14.898  1.00 33.74 ? 537 ARG A NH2   1 
ATOM   1221 N N     . ARG A 1 156 ? -57.680 -25.392 12.033  1.00 34.61 ? 538 ARG A N     1 
ATOM   1222 C CA    . ARG A 1 156 ? -57.312 -24.178 11.312  1.00 34.27 ? 538 ARG A CA    1 
ATOM   1223 C C     . ARG A 1 156 ? -57.807 -22.907 12.007  1.00 33.79 ? 538 ARG A C     1 
ATOM   1224 O O     . ARG A 1 156 ? -58.997 -22.714 12.268  1.00 33.37 ? 538 ARG A O     1 
ATOM   1225 C CB    . ARG A 1 156 ? -57.814 -24.217 9.874   1.00 34.45 ? 538 ARG A CB    1 
ATOM   1226 C CG    . ARG A 1 156 ? -57.259 -25.338 9.067   1.00 34.53 ? 538 ARG A CG    1 
ATOM   1227 C CD    . ARG A 1 156 ? -55.808 -25.198 8.790   1.00 34.02 ? 538 ARG A CD    1 
ATOM   1228 N NE    . ARG A 1 156 ? -55.460 -25.942 7.579   1.00 35.66 ? 538 ARG A NE    1 
ATOM   1229 C CZ    . ARG A 1 156 ? -54.212 -26.229 7.242   1.00 35.77 ? 538 ARG A CZ    1 
ATOM   1230 N NH1   . ARG A 1 156 ? -53.217 -25.847 8.047   1.00 36.72 ? 538 ARG A NH1   1 
ATOM   1231 N NH2   . ARG A 1 156 ? -53.952 -26.890 6.126   1.00 32.90 ? 538 ARG A NH2   1 
ATOM   1232 N N     . THR A 1 157 ? -56.860 -22.028 12.268  1.00 33.24 ? 539 THR A N     1 
ATOM   1233 C CA    . THR A 1 157 ? -57.095 -20.879 13.118  1.00 32.59 ? 539 THR A CA    1 
ATOM   1234 C C     . THR A 1 157 ? -57.546 -19.655 12.307  1.00 31.99 ? 539 THR A C     1 
ATOM   1235 O O     . THR A 1 157 ? -57.704 -18.569 12.845  1.00 32.01 ? 539 THR A O     1 
ATOM   1236 C CB    . THR A 1 157 ? -55.820 -20.566 13.938  1.00 32.53 ? 539 THR A CB    1 
ATOM   1237 O OG1   . THR A 1 157 ? -54.763 -20.188 13.044  1.00 34.60 ? 539 THR A OG1   1 
ATOM   1238 C CG2   . THR A 1 157 ? -55.372 -21.784 14.709  1.00 30.84 ? 539 THR A CG2   1 
ATOM   1239 N N     . ALA A 1 158 ? -57.755 -19.833 11.008  1.00 31.53 ? 540 ALA A N     1 
ATOM   1240 C CA    . ALA A 1 158 ? -58.207 -18.742 10.134  1.00 30.87 ? 540 ALA A CA    1 
ATOM   1241 C C     . ALA A 1 158 ? -58.360 -19.263 8.706   1.00 30.77 ? 540 ALA A C     1 
ATOM   1242 O O     . ALA A 1 158 ? -57.906 -20.349 8.378   1.00 30.43 ? 540 ALA A O     1 
ATOM   1243 C CB    . ALA A 1 158 ? -57.269 -17.526 10.220  1.00 30.17 ? 540 ALA A CB    1 
ATOM   1244 N N     . SER A 1 159 ? -59.020 -18.503 7.858   1.00 31.39 ? 541 SER A N     1 
ATOM   1245 C CA    . SER A 1 159 ? -59.222 -18.945 6.491   1.00 32.20 ? 541 SER A CA    1 
ATOM   1246 C C     . SER A 1 159 ? -58.208 -18.298 5.538   1.00 32.92 ? 541 SER A C     1 
ATOM   1247 O O     . SER A 1 159 ? -57.791 -17.148 5.739   1.00 33.16 ? 541 SER A O     1 
ATOM   1248 C CB    . SER A 1 159 ? -60.669 -18.662 6.062   1.00 31.96 ? 541 SER A CB    1 
ATOM   1249 O OG    . SER A 1 159 ? -61.581 -19.327 6.916   1.00 30.94 ? 541 SER A OG    1 
ATOM   1250 N N     . VAL A 1 160 ? -57.793 -19.022 4.507   1.00 33.65 ? 542 VAL A N     1 
ATOM   1251 C CA    . VAL A 1 160 ? -56.862 -18.427 3.539   1.00 34.91 ? 542 VAL A CA    1 
ATOM   1252 C C     . VAL A 1 160 ? -57.412 -18.466 2.093   1.00 35.86 ? 542 VAL A C     1 
ATOM   1253 O O     . VAL A 1 160 ? -57.660 -19.537 1.533   1.00 36.49 ? 542 VAL A O     1 
ATOM   1254 C CB    . VAL A 1 160 ? -55.435 -19.072 3.635   1.00 34.75 ? 542 VAL A CB    1 
ATOM   1255 C CG1   . VAL A 1 160 ? -54.420 -18.236 2.908   1.00 34.56 ? 542 VAL A CG1   1 
ATOM   1256 C CG2   . VAL A 1 160 ? -54.990 -19.224 5.069   1.00 33.97 ? 542 VAL A CG2   1 
ATOM   1257 N N     . ARG A 1 161 ? -57.603 -17.306 1.490   1.00 36.59 ? 543 ARG A N     1 
ATOM   1258 C CA    . ARG A 1 161 ? -58.250 -17.242 0.186   1.00 37.96 ? 543 ARG A CA    1 
ATOM   1259 C C     . ARG A 1 161 ? -57.216 -16.764 -0.799  1.00 38.08 ? 543 ARG A C     1 
ATOM   1260 O O     . ARG A 1 161 ? -56.366 -15.944 -0.451  1.00 37.98 ? 543 ARG A O     1 
ATOM   1261 C CB    . ARG A 1 161 ? -59.421 -16.241 0.215   1.00 38.70 ? 543 ARG A CB    1 
ATOM   1262 C CG    . ARG A 1 161 ? -60.608 -16.497 -0.787  1.00 42.62 ? 543 ARG A CG    1 
ATOM   1263 C CD    . ARG A 1 161 ? -61.866 -15.601 -0.483  1.00 47.48 ? 543 ARG A CD    1 
ATOM   1264 N NE    . ARG A 1 161 ? -61.411 -14.321 0.051   1.00 51.50 ? 543 ARG A NE    1 
ATOM   1265 C CZ    . ARG A 1 161 ? -61.006 -13.296 -0.700  1.00 53.61 ? 543 ARG A CZ    1 
ATOM   1266 N NH1   . ARG A 1 161 ? -61.064 -13.378 -2.038  1.00 53.65 ? 543 ARG A NH1   1 
ATOM   1267 N NH2   . ARG A 1 161 ? -60.568 -12.182 -0.105  1.00 53.19 ? 543 ARG A NH2   1 
ATOM   1268 N N     . ALA A 1 162 ? -57.282 -17.284 -2.022  1.00 38.37 ? 544 ALA A N     1 
ATOM   1269 C CA    . ALA A 1 162 ? -56.406 -16.837 -3.101  1.00 38.88 ? 544 ALA A CA    1 
ATOM   1270 C C     . ALA A 1 162 ? -56.943 -15.545 -3.708  1.00 39.67 ? 544 ALA A C     1 
ATOM   1271 O O     . ALA A 1 162 ? -58.076 -15.499 -4.211  1.00 40.16 ? 544 ALA A O     1 
ATOM   1272 C CB    . ALA A 1 162 ? -56.269 -17.920 -4.167  1.00 38.31 ? 544 ALA A CB    1 
ATOM   1273 N N     . ASP A 1 163 ? -56.147 -14.482 -3.652  1.00 40.24 ? 545 ASP A N     1 
ATOM   1274 C CA    . ASP A 1 163 ? -56.582 -13.205 -4.221  1.00 40.23 ? 545 ASP A CA    1 
ATOM   1275 C C     . ASP A 1 163 ? -56.205 -13.118 -5.689  1.00 39.64 ? 545 ASP A C     1 
ATOM   1276 O O     . ASP A 1 163 ? -56.848 -12.408 -6.448  1.00 40.40 ? 545 ASP A O     1 
ATOM   1277 C CB    . ASP A 1 163 ? -56.061 -12.019 -3.405  1.00 40.62 ? 545 ASP A CB    1 
ATOM   1278 C CG    . ASP A 1 163 ? -56.670 -11.960 -1.980  1.00 42.30 ? 545 ASP A CG    1 
ATOM   1279 O OD1   . ASP A 1 163 ? -57.721 -12.608 -1.710  1.00 42.06 ? 545 ASP A OD1   1 
ATOM   1280 O OD2   . ASP A 1 163 ? -56.088 -11.248 -1.125  1.00 44.86 ? 545 ASP A OD2   1 
ATOM   1281 N N     . THR A 1 164 ? -55.183 -13.865 -6.089  1.00 38.81 ? 546 THR A N     1 
ATOM   1282 C CA    . THR A 1 164 ? -54.787 -13.973 -7.495  1.00 38.03 ? 546 THR A CA    1 
ATOM   1283 C C     . THR A 1 164 ? -54.664 -15.445 -7.858  1.00 37.76 ? 546 THR A C     1 
ATOM   1284 O O     . THR A 1 164 ? -55.041 -16.302 -7.082  1.00 37.98 ? 546 THR A O     1 
ATOM   1285 C CB    . THR A 1 164 ? -53.437 -13.262 -7.789  1.00 37.64 ? 546 THR A CB    1 
ATOM   1286 O OG1   . THR A 1 164 ? -52.356 -14.092 -7.367  1.00 36.54 ? 546 THR A OG1   1 
ATOM   1287 C CG2   . THR A 1 164 ? -53.347 -11.958 -7.062  1.00 37.07 ? 546 THR A CG2   1 
ATOM   1288 N N     . TYR A 1 165 ? -54.155 -15.737 -9.049  1.00 37.60 ? 547 TYR A N     1 
ATOM   1289 C CA    . TYR A 1 165 ? -53.707 -17.082 -9.349  1.00 36.86 ? 547 TYR A CA    1 
ATOM   1290 C C     . TYR A 1 165 ? -52.573 -17.281 -8.399  1.00 36.59 ? 547 TYR A C     1 
ATOM   1291 O O     . TYR A 1 165 ? -51.750 -16.376 -8.256  1.00 36.95 ? 547 TYR A O     1 
ATOM   1292 C CB    . TYR A 1 165 ? -53.244 -17.186 -10.788 1.00 36.27 ? 547 TYR A CB    1 
ATOM   1293 C CG    . TYR A 1 165 ? -54.369 -17.601 -11.664 1.00 37.51 ? 547 TYR A CG    1 
ATOM   1294 C CD1   . TYR A 1 165 ? -55.197 -16.657 -12.280 1.00 38.56 ? 547 TYR A CD1   1 
ATOM   1295 C CD2   . TYR A 1 165 ? -54.645 -18.954 -11.851 1.00 39.24 ? 547 TYR A CD2   1 
ATOM   1296 C CE1   . TYR A 1 165 ? -56.272 -17.060 -13.090 1.00 40.69 ? 547 TYR A CE1   1 
ATOM   1297 C CE2   . TYR A 1 165 ? -55.699 -19.375 -12.650 1.00 41.39 ? 547 TYR A CE2   1 
ATOM   1298 C CZ    . TYR A 1 165 ? -56.517 -18.432 -13.266 1.00 43.44 ? 547 TYR A CZ    1 
ATOM   1299 O OH    . TYR A 1 165 ? -57.568 -18.900 -14.040 1.00 45.32 ? 547 TYR A OH    1 
ATOM   1300 N N     . CYS A 1 166 ? -52.550 -18.422 -7.711  1.00 35.92 ? 548 CYS A N     1 
ATOM   1301 C CA    . CYS A 1 166 ? -51.500 -18.699 -6.732  1.00 35.20 ? 548 CYS A CA    1 
ATOM   1302 C C     . CYS A 1 166 ? -50.680 -19.902 -7.041  1.00 34.80 ? 548 CYS A C     1 
ATOM   1303 O O     . CYS A 1 166 ? -51.192 -21.019 -7.099  1.00 35.65 ? 548 CYS A O     1 
ATOM   1304 C CB    . CYS A 1 166 ? -52.082 -18.859 -5.355  1.00 34.91 ? 548 CYS A CB    1 
ATOM   1305 S SG    . CYS A 1 166 ? -52.354 -17.252 -4.640  1.00 36.85 ? 548 CYS A SG    1 
ATOM   1306 N N     . ARG A 1 167 ? -49.391 -19.693 -7.231  1.00 33.71 ? 549 ARG A N     1 
ATOM   1307 C CA    . ARG A 1 167 ? -48.528 -20.828 -7.434  1.00 32.89 ? 549 ARG A CA    1 
ATOM   1308 C C     . ARG A 1 167 ? -47.944 -21.192 -6.076  1.00 31.53 ? 549 ARG A C     1 
ATOM   1309 O O     . ARG A 1 167 ? -47.364 -20.338 -5.417  1.00 31.17 ? 549 ARG A O     1 
ATOM   1310 C CB    . ARG A 1 167 ? -47.489 -20.494 -8.497  1.00 33.41 ? 549 ARG A CB    1 
ATOM   1311 C CG    . ARG A 1 167 ? -48.125 -20.214 -9.859  1.00 35.58 ? 549 ARG A CG    1 
ATOM   1312 C CD    . ARG A 1 167 ? -47.114 -19.852 -10.923 1.00 39.00 ? 549 ARG A CD    1 
ATOM   1313 N NE    . ARG A 1 167 ? -46.740 -21.011 -11.746 1.00 41.40 ? 549 ARG A NE    1 
ATOM   1314 C CZ    . ARG A 1 167 ? -45.611 -21.735 -11.614 1.00 43.37 ? 549 ARG A CZ    1 
ATOM   1315 N NH1   . ARG A 1 167 ? -44.681 -21.472 -10.675 1.00 42.29 ? 549 ARG A NH1   1 
ATOM   1316 N NH2   . ARG A 1 167 ? -45.399 -22.757 -12.437 1.00 43.95 ? 549 ARG A NH2   1 
ATOM   1317 N N     . LEU A 1 168 ? -48.149 -22.433 -5.638  1.00 30.38 ? 550 LEU A N     1 
ATOM   1318 C CA    . LEU A 1 168 ? -47.801 -22.839 -4.262  1.00 29.74 ? 550 LEU A CA    1 
ATOM   1319 C C     . LEU A 1 168 ? -47.052 -24.141 -4.148  1.00 29.00 ? 550 LEU A C     1 
ATOM   1320 O O     . LEU A 1 168 ? -47.214 -25.004 -4.959  1.00 28.57 ? 550 LEU A O     1 
ATOM   1321 C CB    . LEU A 1 168 ? -49.056 -22.981 -3.404  1.00 29.67 ? 550 LEU A CB    1 
ATOM   1322 C CG    . LEU A 1 168 ? -49.987 -21.797 -3.178  1.00 30.22 ? 550 LEU A CG    1 
ATOM   1323 C CD1   . LEU A 1 168 ? -51.223 -22.199 -2.371  1.00 30.27 ? 550 LEU A CD1   1 
ATOM   1324 C CD2   . LEU A 1 168 ? -49.235 -20.687 -2.498  1.00 30.59 ? 550 LEU A CD2   1 
ATOM   1325 N N     . TYR A 1 169 ? -46.247 -24.281 -3.113  1.00 29.04 ? 551 TYR A N     1 
ATOM   1326 C CA    . TYR A 1 169 ? -45.675 -25.571 -2.774  1.00 29.94 ? 551 TYR A CA    1 
ATOM   1327 C C     . TYR A 1 169 ? -46.195 -25.978 -1.412  1.00 30.08 ? 551 TYR A C     1 
ATOM   1328 O O     . TYR A 1 169 ? -46.162 -25.202 -0.477  1.00 30.57 ? 551 TYR A O     1 
ATOM   1329 C CB    . TYR A 1 169 ? -44.143 -25.541 -2.782  1.00 29.97 ? 551 TYR A CB    1 
ATOM   1330 C CG    . TYR A 1 169 ? -43.566 -25.623 -4.168  1.00 31.47 ? 551 TYR A CG    1 
ATOM   1331 C CD1   . TYR A 1 169 ? -43.437 -26.856 -4.814  1.00 34.09 ? 551 TYR A CD1   1 
ATOM   1332 C CD2   . TYR A 1 169 ? -43.174 -24.479 -4.852  1.00 32.96 ? 551 TYR A CD2   1 
ATOM   1333 C CE1   . TYR A 1 169 ? -42.923 -26.960 -6.116  1.00 36.17 ? 551 TYR A CE1   1 
ATOM   1334 C CE2   . TYR A 1 169 ? -42.660 -24.557 -6.151  1.00 36.87 ? 551 TYR A CE2   1 
ATOM   1335 C CZ    . TYR A 1 169 ? -42.536 -25.806 -6.788  1.00 38.29 ? 551 TYR A CZ    1 
ATOM   1336 O OH    . TYR A 1 169 ? -42.014 -25.910 -8.072  1.00 39.78 ? 551 TYR A OH    1 
ATOM   1337 N N     . SER A 1 170 ? -46.683 -27.200 -1.311  1.00 29.95 ? 552 SER A N     1 
ATOM   1338 C CA    . SER A 1 170 ? -47.271 -27.670 -0.088  1.00 29.44 ? 552 SER A CA    1 
ATOM   1339 C C     . SER A 1 170 ? -46.463 -28.814 0.538   1.00 29.16 ? 552 SER A C     1 
ATOM   1340 O O     . SER A 1 170 ? -45.716 -29.518 -0.138  1.00 28.69 ? 552 SER A O     1 
ATOM   1341 C CB    . SER A 1 170 ? -48.704 -28.090 -0.353  1.00 29.46 ? 552 SER A CB    1 
ATOM   1342 O OG    . SER A 1 170 ? -48.740 -29.170 -1.259  1.00 30.40 ? 552 SER A OG    1 
ATOM   1343 N N     . LEU A 1 171 ? -46.625 -28.976 1.842   1.00 28.92 ? 553 LEU A N     1 
ATOM   1344 C CA    . LEU A 1 171 ? -45.873 -29.933 2.609   1.00 29.30 ? 553 LEU A CA    1 
ATOM   1345 C C     . LEU A 1 171 ? -46.827 -30.642 3.511   1.00 29.68 ? 553 LEU A C     1 
ATOM   1346 O O     . LEU A 1 171 ? -47.433 -30.005 4.351   1.00 30.16 ? 553 LEU A O     1 
ATOM   1347 C CB    . LEU A 1 171 ? -44.883 -29.199 3.478   1.00 29.43 ? 553 LEU A CB    1 
ATOM   1348 C CG    . LEU A 1 171 ? -43.942 -30.029 4.334   1.00 29.90 ? 553 LEU A CG    1 
ATOM   1349 C CD1   . LEU A 1 171 ? -43.111 -30.991 3.482   1.00 30.76 ? 553 LEU A CD1   1 
ATOM   1350 C CD2   . LEU A 1 171 ? -43.048 -29.078 5.096   1.00 29.03 ? 553 LEU A CD2   1 
ATOM   1351 N N     . SER A 1 172 ? -46.974 -31.952 3.343   1.00 30.27 ? 554 SER A N     1 
ATOM   1352 C CA    . SER A 1 172 ? -47.938 -32.716 4.123   1.00 31.03 ? 554 SER A CA    1 
ATOM   1353 C C     . SER A 1 172 ? -47.481 -32.947 5.565   1.00 31.66 ? 554 SER A C     1 
ATOM   1354 O O     . SER A 1 172 ? -46.290 -32.940 5.870   1.00 32.00 ? 554 SER A O     1 
ATOM   1355 C CB    . SER A 1 172 ? -48.154 -34.045 3.486   1.00 30.61 ? 554 SER A CB    1 
ATOM   1356 O OG    . SER A 1 172 ? -47.017 -34.821 3.783   1.00 32.56 ? 554 SER A OG    1 
ATOM   1357 N N     . VAL A 1 173 ? -48.439 -33.176 6.451   1.00 32.37 ? 555 VAL A N     1 
ATOM   1358 C CA    . VAL A 1 173 ? -48.131 -33.253 7.861   1.00 32.92 ? 555 VAL A CA    1 
ATOM   1359 C C     . VAL A 1 173 ? -47.033 -34.274 8.168   1.00 33.54 ? 555 VAL A C     1 
ATOM   1360 O O     . VAL A 1 173 ? -46.083 -33.946 8.855   1.00 34.14 ? 555 VAL A O     1 
ATOM   1361 C CB    . VAL A 1 173 ? -49.397 -33.407 8.739   1.00 32.80 ? 555 VAL A CB    1 
ATOM   1362 C CG1   . VAL A 1 173 ? -49.989 -34.791 8.643   1.00 32.54 ? 555 VAL A CG1   1 
ATOM   1363 C CG2   . VAL A 1 173 ? -49.082 -33.046 10.173  1.00 32.95 ? 555 VAL A CG2   1 
ATOM   1364 N N     . ASP A 1 174 ? -47.104 -35.484 7.632   1.00 34.04 ? 556 ASP A N     1 
ATOM   1365 C CA    . ASP A 1 174 ? -46.113 -36.479 8.024   1.00 34.85 ? 556 ASP A CA    1 
ATOM   1366 C C     . ASP A 1 174 ? -44.713 -35.967 7.704   1.00 34.66 ? 556 ASP A C     1 
ATOM   1367 O O     . ASP A 1 174 ? -43.773 -36.089 8.501   1.00 34.39 ? 556 ASP A O     1 
ATOM   1368 C CB    . ASP A 1 174 ? -46.388 -37.814 7.338   1.00 35.51 ? 556 ASP A CB    1 
ATOM   1369 C CG    . ASP A 1 174 ? -47.762 -38.419 7.717   1.00 38.46 ? 556 ASP A CG    1 
ATOM   1370 O OD1   . ASP A 1 174 ? -48.293 -38.137 8.826   1.00 39.58 ? 556 ASP A OD1   1 
ATOM   1371 O OD2   . ASP A 1 174 ? -48.318 -39.195 6.894   1.00 41.62 ? 556 ASP A OD2   1 
ATOM   1372 N N     . ASN A 1 175 ? -44.605 -35.357 6.532   1.00 34.56 ? 557 ASN A N     1 
ATOM   1373 C CA    . ASN A 1 175 ? -43.351 -34.817 6.052   1.00 34.14 ? 557 ASN A CA    1 
ATOM   1374 C C     . ASN A 1 175 ? -42.825 -33.654 6.886   1.00 34.45 ? 557 ASN A C     1 
ATOM   1375 O O     . ASN A 1 175 ? -41.633 -33.555 7.148   1.00 34.52 ? 557 ASN A O     1 
ATOM   1376 C CB    . ASN A 1 175 ? -43.510 -34.392 4.606   1.00 33.97 ? 557 ASN A CB    1 
ATOM   1377 C CG    . ASN A 1 175 ? -43.562 -35.551 3.676   1.00 32.58 ? 557 ASN A CG    1 
ATOM   1378 O OD1   . ASN A 1 175 ? -42.964 -36.580 3.957   1.00 33.05 ? 557 ASN A OD1   1 
ATOM   1379 N ND2   . ASN A 1 175 ? -44.266 -35.400 2.551   1.00 29.53 ? 557 ASN A ND2   1 
ATOM   1380 N N     . PHE A 1 176 ? -43.722 -32.763 7.289   1.00 34.75 ? 558 PHE A N     1 
ATOM   1381 C CA    . PHE A 1 176 ? -43.392 -31.643 8.167   1.00 34.52 ? 558 PHE A CA    1 
ATOM   1382 C C     . PHE A 1 176 ? -42.778 -32.165 9.462   1.00 34.88 ? 558 PHE A C     1 
ATOM   1383 O O     . PHE A 1 176 ? -41.767 -31.647 9.911   1.00 34.96 ? 558 PHE A O     1 
ATOM   1384 C CB    . PHE A 1 176 ? -44.682 -30.889 8.434   1.00 34.20 ? 558 PHE A CB    1 
ATOM   1385 C CG    . PHE A 1 176 ? -44.550 -29.706 9.334   1.00 33.52 ? 558 PHE A CG    1 
ATOM   1386 C CD1   . PHE A 1 176 ? -44.073 -28.503 8.863   1.00 32.49 ? 558 PHE A CD1   1 
ATOM   1387 C CD2   . PHE A 1 176 ? -45.007 -29.767 10.632  1.00 33.54 ? 558 PHE A CD2   1 
ATOM   1388 C CE1   . PHE A 1 176 ? -44.014 -27.408 9.696   1.00 32.78 ? 558 PHE A CE1   1 
ATOM   1389 C CE2   . PHE A 1 176 ? -44.933 -28.663 11.472  1.00 32.40 ? 558 PHE A CE2   1 
ATOM   1390 C CZ    . PHE A 1 176 ? -44.442 -27.494 11.008  1.00 31.31 ? 558 PHE A CZ    1 
ATOM   1391 N N     . ASN A 1 177 ? -43.372 -33.211 10.033  1.00 35.30 ? 559 ASN A N     1 
ATOM   1392 C CA    . ASN A 1 177 ? -42.873 -33.816 11.266  1.00 35.99 ? 559 ASN A CA    1 
ATOM   1393 C C     . ASN A 1 177 ? -41.608 -34.666 11.150  1.00 36.72 ? 559 ASN A C     1 
ATOM   1394 O O     . ASN A 1 177 ? -40.761 -34.659 12.055  1.00 37.04 ? 559 ASN A O     1 
ATOM   1395 C CB    . ASN A 1 177 ? -43.954 -34.646 11.925  1.00 35.80 ? 559 ASN A CB    1 
ATOM   1396 C CG    . ASN A 1 177 ? -44.926 -33.812 12.674  1.00 35.53 ? 559 ASN A CG    1 
ATOM   1397 O OD1   . ASN A 1 177 ? -44.568 -33.032 13.568  1.00 35.45 ? 559 ASN A OD1   1 
ATOM   1398 N ND2   . ASN A 1 177 ? -46.179 -33.959 12.317  1.00 34.39 ? 559 ASN A ND2   1 
ATOM   1399 N N     . GLU A 1 178 ? -41.494 -35.428 10.067  1.00 37.13 ? 560 GLU A N     1 
ATOM   1400 C CA    . GLU A 1 178 ? -40.290 -36.185 9.836   1.00 37.66 ? 560 GLU A CA    1 
ATOM   1401 C C     . GLU A 1 178 ? -39.133 -35.179 9.852   1.00 37.11 ? 560 GLU A C     1 
ATOM   1402 O O     . GLU A 1 178 ? -38.232 -35.293 10.664  1.00 37.55 ? 560 GLU A O     1 
ATOM   1403 C CB    . GLU A 1 178 ? -40.427 -36.941 8.522   1.00 38.19 ? 560 GLU A CB    1 
ATOM   1404 C CG    . GLU A 1 178 ? -39.341 -37.980 8.170   1.00 42.66 ? 560 GLU A CG    1 
ATOM   1405 C CD    . GLU A 1 178 ? -39.556 -38.629 6.739   1.00 49.55 ? 560 GLU A CD    1 
ATOM   1406 O OE1   . GLU A 1 178 ? -40.654 -39.236 6.517   1.00 51.40 ? 560 GLU A OE1   1 
ATOM   1407 O OE2   . GLU A 1 178 ? -38.644 -38.531 5.843   1.00 50.66 ? 560 GLU A OE2   1 
ATOM   1408 N N     . VAL A 1 179 ? -39.189 -34.146 9.020   1.00 36.38 ? 561 VAL A N     1 
ATOM   1409 C CA    . VAL A 1 179 ? -38.100 -33.193 8.970   1.00 35.79 ? 561 VAL A CA    1 
ATOM   1410 C C     . VAL A 1 179 ? -37.876 -32.514 10.307  1.00 36.16 ? 561 VAL A C     1 
ATOM   1411 O O     . VAL A 1 179 ? -36.741 -32.338 10.719  1.00 36.50 ? 561 VAL A O     1 
ATOM   1412 C CB    . VAL A 1 179 ? -38.307 -32.109 7.928   1.00 35.56 ? 561 VAL A CB    1 
ATOM   1413 C CG1   . VAL A 1 179 ? -37.128 -31.156 7.954   1.00 35.21 ? 561 VAL A CG1   1 
ATOM   1414 C CG2   . VAL A 1 179 ? -38.484 -32.697 6.540   1.00 34.36 ? 561 VAL A CG2   1 
ATOM   1415 N N     . LEU A 1 180 ? -38.945 -32.119 10.981  1.00 36.54 ? 562 LEU A N     1 
ATOM   1416 C CA    . LEU A 1 180 ? -38.805 -31.440 12.263  1.00 36.82 ? 562 LEU A CA    1 
ATOM   1417 C C     . LEU A 1 180 ? -38.312 -32.325 13.421  1.00 37.52 ? 562 LEU A C     1 
ATOM   1418 O O     . LEU A 1 180 ? -37.727 -31.826 14.387  1.00 37.73 ? 562 LEU A O     1 
ATOM   1419 C CB    . LEU A 1 180 ? -40.077 -30.695 12.623  1.00 36.40 ? 562 LEU A CB    1 
ATOM   1420 C CG    . LEU A 1 180 ? -40.349 -29.426 11.830  1.00 36.43 ? 562 LEU A CG    1 
ATOM   1421 C CD1   . LEU A 1 180 ? -41.335 -28.633 12.604  1.00 36.72 ? 562 LEU A CD1   1 
ATOM   1422 C CD2   . LEU A 1 180 ? -39.107 -28.603 11.598  1.00 36.58 ? 562 LEU A CD2   1 
ATOM   1423 N N     . GLU A 1 181 ? -38.525 -33.628 13.315  1.00 38.28 ? 563 GLU A N     1 
ATOM   1424 C CA    . GLU A 1 181 ? -37.778 -34.578 14.126  1.00 40.03 ? 563 GLU A CA    1 
ATOM   1425 C C     . GLU A 1 181 ? -36.258 -34.412 13.966  1.00 40.34 ? 563 GLU A C     1 
ATOM   1426 O O     . GLU A 1 181 ? -35.532 -34.277 14.948  1.00 40.29 ? 563 GLU A O     1 
ATOM   1427 C CB    . GLU A 1 181 ? -38.174 -36.008 13.775  1.00 40.49 ? 563 GLU A CB    1 
ATOM   1428 C CG    . GLU A 1 181 ? -39.190 -36.633 14.727  1.00 44.42 ? 563 GLU A CG    1 
ATOM   1429 C CD    . GLU A 1 181 ? -38.528 -37.589 15.740  1.00 49.20 ? 563 GLU A CD    1 
ATOM   1430 O OE1   . GLU A 1 181 ? -37.869 -38.581 15.279  1.00 49.97 ? 563 GLU A OE1   1 
ATOM   1431 O OE2   . GLU A 1 181 ? -38.676 -37.350 16.983  1.00 49.44 ? 563 GLU A OE2   1 
ATOM   1432 N N     . GLU A 1 182 ? -35.776 -34.396 12.729  1.00 40.91 ? 564 GLU A N     1 
ATOM   1433 C CA    . GLU A 1 182 ? -34.353 -34.240 12.504  1.00 41.80 ? 564 GLU A CA    1 
ATOM   1434 C C     . GLU A 1 182 ? -33.822 -32.857 12.891  1.00 41.94 ? 564 GLU A C     1 
ATOM   1435 O O     . GLU A 1 182 ? -32.695 -32.748 13.329  1.00 42.76 ? 564 GLU A O     1 
ATOM   1436 C CB    . GLU A 1 182 ? -33.983 -34.560 11.060  1.00 42.04 ? 564 GLU A CB    1 
ATOM   1437 C CG    . GLU A 1 182 ? -34.601 -35.846 10.510  1.00 45.25 ? 564 GLU A CG    1 
ATOM   1438 C CD    . GLU A 1 182 ? -34.434 -35.971 8.994   1.00 49.04 ? 564 GLU A CD    1 
ATOM   1439 O OE1   . GLU A 1 182 ? -34.960 -36.956 8.405   1.00 49.34 ? 564 GLU A OE1   1 
ATOM   1440 O OE2   . GLU A 1 182 ? -33.777 -35.076 8.396   1.00 51.02 ? 564 GLU A OE2   1 
ATOM   1441 N N     . TYR A 1 183 ? -34.605 -31.796 12.737  1.00 41.98 ? 565 TYR A N     1 
ATOM   1442 C CA    . TYR A 1 183 ? -34.095 -30.459 13.057  1.00 41.67 ? 565 TYR A CA    1 
ATOM   1443 C C     . TYR A 1 183 ? -34.958 -29.734 14.093  1.00 41.82 ? 565 TYR A C     1 
ATOM   1444 O O     . TYR A 1 183 ? -35.672 -28.805 13.767  1.00 41.50 ? 565 TYR A O     1 
ATOM   1445 C CB    . TYR A 1 183 ? -33.964 -29.618 11.791  1.00 41.31 ? 565 TYR A CB    1 
ATOM   1446 C CG    . TYR A 1 183 ? -33.148 -30.245 10.699  1.00 40.05 ? 565 TYR A CG    1 
ATOM   1447 C CD1   . TYR A 1 183 ? -31.819 -29.890 10.520  1.00 40.75 ? 565 TYR A CD1   1 
ATOM   1448 C CD2   . TYR A 1 183 ? -33.708 -31.172 9.822   1.00 38.84 ? 565 TYR A CD2   1 
ATOM   1449 C CE1   . TYR A 1 183 ? -31.046 -30.458 9.489   1.00 41.10 ? 565 TYR A CE1   1 
ATOM   1450 C CE2   . TYR A 1 183 ? -32.951 -31.754 8.800   1.00 38.84 ? 565 TYR A CE2   1 
ATOM   1451 C CZ    . TYR A 1 183 ? -31.619 -31.384 8.638   1.00 40.61 ? 565 TYR A CZ    1 
ATOM   1452 O OH    . TYR A 1 183 ? -30.844 -31.927 7.633   1.00 41.95 ? 565 TYR A OH    1 
ATOM   1453 N N     . PRO A 1 184 ? -34.864 -30.139 15.360  1.00 42.27 ? 566 PRO A N     1 
ATOM   1454 C CA    . PRO A 1 184 ? -35.699 -29.558 16.419  1.00 42.57 ? 566 PRO A CA    1 
ATOM   1455 C C     . PRO A 1 184 ? -35.588 -28.027 16.557  1.00 42.57 ? 566 PRO A C     1 
ATOM   1456 O O     . PRO A 1 184 ? -36.582 -27.371 16.863  1.00 42.66 ? 566 PRO A O     1 
ATOM   1457 C CB    . PRO A 1 184 ? -35.163 -30.222 17.688  1.00 42.64 ? 566 PRO A CB    1 
ATOM   1458 C CG    . PRO A 1 184 ? -34.314 -31.369 17.216  1.00 42.46 ? 566 PRO A CG    1 
ATOM   1459 C CD    . PRO A 1 184 ? -33.778 -30.966 15.907  1.00 42.22 ? 566 PRO A CD    1 
ATOM   1460 N N     . MET A 1 185 ? -34.388 -27.489 16.344  1.00 42.43 ? 567 MET A N     1 
ATOM   1461 C CA    . MET A 1 185 ? -34.103 -26.054 16.404  1.00 42.84 ? 567 MET A CA    1 
ATOM   1462 C C     . MET A 1 185 ? -34.997 -25.276 15.510  1.00 41.67 ? 567 MET A C     1 
ATOM   1463 O O     . MET A 1 185 ? -35.261 -24.091 15.716  1.00 42.04 ? 567 MET A O     1 
ATOM   1464 C CB    . MET A 1 185 ? -32.686 -25.794 15.916  1.00 44.12 ? 567 MET A CB    1 
ATOM   1465 C CG    . MET A 1 185 ? -31.625 -26.503 16.718  1.00 49.38 ? 567 MET A CG    1 
ATOM   1466 S SD    . MET A 1 185 ? -31.632 -25.792 18.384  1.00 59.71 ? 567 MET A SD    1 
ATOM   1467 C CE    . MET A 1 185 ? -32.795 -26.832 19.340  1.00 58.41 ? 567 MET A CE    1 
ATOM   1468 N N     . MET A 1 186 ? -35.453 -25.965 14.492  1.00 40.23 ? 568 MET A N     1 
ATOM   1469 C CA    . MET A 1 186 ? -36.184 -25.361 13.442  1.00 39.02 ? 568 MET A CA    1 
ATOM   1470 C C     . MET A 1 186 ? -37.664 -25.389 13.786  1.00 37.62 ? 568 MET A C     1 
ATOM   1471 O O     . MET A 1 186 ? -38.459 -24.672 13.190  1.00 37.17 ? 568 MET A O     1 
ATOM   1472 C CB    . MET A 1 186 ? -35.870 -26.144 12.189  1.00 39.59 ? 568 MET A CB    1 
ATOM   1473 C CG    . MET A 1 186 ? -35.480 -25.289 11.008  1.00 41.15 ? 568 MET A CG    1 
ATOM   1474 S SD    . MET A 1 186 ? -34.503 -23.825 11.329  1.00 41.14 ? 568 MET A SD    1 
ATOM   1475 C CE    . MET A 1 186 ? -35.457 -22.663 10.339  1.00 40.71 ? 568 MET A CE    1 
ATOM   1476 N N     . ARG A 1 187 ? -38.013 -26.216 14.767  1.00 36.52 ? 569 ARG A N     1 
ATOM   1477 C CA    A ARG A 1 187 ? -39.351 -26.211 15.326  0.50 35.40 ? 569 ARG A CA    1 
ATOM   1478 C CA    B ARG A 1 187 ? -39.348 -26.226 15.336  0.50 36.14 ? 569 ARG A CA    1 
ATOM   1479 C C     . ARG A 1 187 ? -39.555 -24.918 16.082  1.00 35.96 ? 569 ARG A C     1 
ATOM   1480 O O     . ARG A 1 187 ? -40.578 -24.276 15.941  1.00 36.29 ? 569 ARG A O     1 
ATOM   1481 C CB    A ARG A 1 187 ? -39.569 -27.392 16.260  0.50 34.58 ? 569 ARG A CB    1 
ATOM   1482 C CB    B ARG A 1 187 ? -39.522 -27.410 16.284  0.50 35.84 ? 569 ARG A CB    1 
ATOM   1483 C CG    A ARG A 1 187 ? -41.021 -27.719 16.476  0.50 30.92 ? 569 ARG A CG    1 
ATOM   1484 C CG    B ARG A 1 187 ? -40.872 -28.081 16.198  0.50 35.60 ? 569 ARG A CG    1 
ATOM   1485 C CD    A ARG A 1 187 ? -41.183 -29.093 17.094  0.50 24.97 ? 569 ARG A CD    1 
ATOM   1486 C CD    B ARG A 1 187 ? -41.042 -29.177 17.255  0.50 35.76 ? 569 ARG A CD    1 
ATOM   1487 N NE    A ARG A 1 187 ? -42.267 -29.844 16.471  0.50 18.15 ? 569 ARG A NE    1 
ATOM   1488 N NE    B ARG A 1 187 ? -40.753 -30.547 16.803  0.50 34.83 ? 569 ARG A NE    1 
ATOM   1489 C CZ    A ARG A 1 187 ? -43.540 -29.699 16.784  0.50 12.71 ? 569 ARG A CZ    1 
ATOM   1490 C CZ    B ARG A 1 187 ? -39.656 -31.233 17.120  0.50 34.29 ? 569 ARG A CZ    1 
ATOM   1491 N NH1   A ARG A 1 187 ? -43.897 -28.842 17.710  0.50 8.15  ? 569 ARG A NH1   1 
ATOM   1492 N NH1   B ARG A 1 187 ? -38.710 -30.677 17.867  0.50 35.44 ? 569 ARG A NH1   1 
ATOM   1493 N NH2   A ARG A 1 187 ? -44.450 -30.416 16.164  0.50 13.68 ? 569 ARG A NH2   1 
ATOM   1494 N NH2   B ARG A 1 187 ? -39.497 -32.475 16.687  0.50 33.20 ? 569 ARG A NH2   1 
ATOM   1495 N N     . ARG A 1 188 ? -38.572 -24.505 16.862  1.00 36.07 ? 570 ARG A N     1 
ATOM   1496 C CA    . ARG A 1 188 ? -38.774 -23.295 17.639  1.00 36.84 ? 570 ARG A CA    1 
ATOM   1497 C C     . ARG A 1 188 ? -38.924 -22.093 16.750  1.00 35.72 ? 570 ARG A C     1 
ATOM   1498 O O     . ARG A 1 188 ? -39.632 -21.160 17.091  1.00 35.24 ? 570 ARG A O     1 
ATOM   1499 C CB    . ARG A 1 188 ? -37.685 -23.100 18.686  1.00 38.09 ? 570 ARG A CB    1 
ATOM   1500 C CG    . ARG A 1 188 ? -37.702 -24.204 19.792  1.00 42.52 ? 570 ARG A CG    1 
ATOM   1501 C CD    . ARG A 1 188 ? -36.397 -24.188 20.585  1.00 48.85 ? 570 ARG A CD    1 
ATOM   1502 N NE    . ARG A 1 188 ? -35.307 -23.923 19.641  1.00 53.28 ? 570 ARG A NE    1 
ATOM   1503 C CZ    . ARG A 1 188 ? -34.225 -23.193 19.898  1.00 55.38 ? 570 ARG A CZ    1 
ATOM   1504 N NH1   . ARG A 1 188 ? -34.051 -22.650 21.100  1.00 57.15 ? 570 ARG A NH1   1 
ATOM   1505 N NH2   . ARG A 1 188 ? -33.312 -23.002 18.946  1.00 55.30 ? 570 ARG A NH2   1 
ATOM   1506 N N     . ALA A 1 189 ? -38.284 -22.150 15.590  1.00 35.04 ? 571 ALA A N     1 
ATOM   1507 C CA    . ALA A 1 189 ? -38.405 -21.102 14.590  1.00 34.55 ? 571 ALA A CA    1 
ATOM   1508 C C     . ALA A 1 189 ? -39.854 -20.949 14.128  1.00 34.47 ? 571 ALA A C     1 
ATOM   1509 O O     . ALA A 1 189 ? -40.392 -19.832 14.016  1.00 34.69 ? 571 ALA A O     1 
ATOM   1510 C CB    . ALA A 1 189 ? -37.536 -21.424 13.432  1.00 34.35 ? 571 ALA A CB    1 
ATOM   1511 N N     . PHE A 1 190 ? -40.488 -22.087 13.859  1.00 33.93 ? 572 PHE A N     1 
ATOM   1512 C CA    . PHE A 1 190 ? -41.871 -22.087 13.425  1.00 32.87 ? 572 PHE A CA    1 
ATOM   1513 C C     . PHE A 1 190 ? -42.740 -21.585 14.525  1.00 32.38 ? 572 PHE A C     1 
ATOM   1514 O O     . PHE A 1 190 ? -43.504 -20.661 14.300  1.00 32.69 ? 572 PHE A O     1 
ATOM   1515 C CB    . PHE A 1 190 ? -42.323 -23.469 12.949  1.00 32.81 ? 572 PHE A CB    1 
ATOM   1516 C CG    . PHE A 1 190 ? -41.970 -23.744 11.523  1.00 32.18 ? 572 PHE A CG    1 
ATOM   1517 C CD1   . PHE A 1 190 ? -42.622 -23.068 10.492  1.00 32.06 ? 572 PHE A CD1   1 
ATOM   1518 C CD2   . PHE A 1 190 ? -40.971 -24.645 11.201  1.00 31.65 ? 572 PHE A CD2   1 
ATOM   1519 C CE1   . PHE A 1 190 ? -42.297 -23.300 9.162   1.00 32.24 ? 572 PHE A CE1   1 
ATOM   1520 C CE2   . PHE A 1 190 ? -40.633 -24.891 9.863   1.00 32.02 ? 572 PHE A CE2   1 
ATOM   1521 C CZ    . PHE A 1 190 ? -41.294 -24.214 8.843   1.00 32.09 ? 572 PHE A CZ    1 
ATOM   1522 N N     . GLU A 1 191 ? -42.549 -22.157 15.716  1.00 31.86 ? 573 GLU A N     1 
ATOM   1523 C CA    . GLU A 1 191 ? -43.358 -21.891 16.904  1.00 31.47 ? 573 GLU A CA    1 
ATOM   1524 C C     . GLU A 1 191 ? -43.395 -20.389 17.204  1.00 31.22 ? 573 GLU A C     1 
ATOM   1525 O O     . GLU A 1 191 ? -44.468 -19.814 17.420  1.00 30.83 ? 573 GLU A O     1 
ATOM   1526 C CB    . GLU A 1 191 ? -42.846 -22.727 18.108  1.00 31.57 ? 573 GLU A CB    1 
ATOM   1527 C CG    . GLU A 1 191 ? -43.117 -24.269 17.998  1.00 32.39 ? 573 GLU A CG    1 
ATOM   1528 C CD    . GLU A 1 191 ? -42.625 -25.130 19.182  1.00 34.65 ? 573 GLU A CD    1 
ATOM   1529 O OE1   . GLU A 1 191 ? -43.284 -26.139 19.491  1.00 33.92 ? 573 GLU A OE1   1 
ATOM   1530 O OE2   . GLU A 1 191 ? -41.597 -24.820 19.819  1.00 36.84 ? 573 GLU A OE2   1 
ATOM   1531 N N     . THR A 1 192 ? -42.225 -19.755 17.158  1.00 30.49 ? 574 THR A N     1 
ATOM   1532 C CA    . THR A 1 192 ? -42.098 -18.343 17.439  1.00 30.15 ? 574 THR A CA    1 
ATOM   1533 C C     . THR A 1 192 ? -42.912 -17.462 16.516  1.00 30.20 ? 574 THR A C     1 
ATOM   1534 O O     . THR A 1 192 ? -43.640 -16.586 16.995  1.00 30.99 ? 574 THR A O     1 
ATOM   1535 C CB    . THR A 1 192 ? -40.657 -17.929 17.373  1.00 30.03 ? 574 THR A CB    1 
ATOM   1536 O OG1   . THR A 1 192 ? -39.991 -18.545 18.460  1.00 31.19 ? 574 THR A OG1   1 
ATOM   1537 C CG2   . THR A 1 192 ? -40.500 -16.427 17.519  1.00 30.44 ? 574 THR A CG2   1 
ATOM   1538 N N     . VAL A 1 193 ? -42.787 -17.657 15.205  1.00 29.79 ? 575 VAL A N     1 
ATOM   1539 C CA    . VAL A 1 193 ? -43.591 -16.867 14.251  1.00 29.19 ? 575 VAL A CA    1 
ATOM   1540 C C     . VAL A 1 193 ? -45.096 -17.141 14.424  1.00 29.12 ? 575 VAL A C     1 
ATOM   1541 O O     . VAL A 1 193 ? -45.912 -16.251 14.263  1.00 28.55 ? 575 VAL A O     1 
ATOM   1542 C CB    . VAL A 1 193 ? -43.149 -17.106 12.784  1.00 29.31 ? 575 VAL A CB    1 
ATOM   1543 C CG1   . VAL A 1 193 ? -43.994 -16.274 11.824  1.00 28.12 ? 575 VAL A CG1   1 
ATOM   1544 C CG2   . VAL A 1 193 ? -41.694 -16.757 12.632  1.00 28.09 ? 575 VAL A CG2   1 
ATOM   1545 N N     . ALA A 1 194 ? -45.438 -18.382 14.763  1.00 29.40 ? 576 ALA A N     1 
ATOM   1546 C CA    . ALA A 1 194 ? -46.813 -18.781 15.060  1.00 29.94 ? 576 ALA A CA    1 
ATOM   1547 C C     . ALA A 1 194 ? -47.395 -18.067 16.276  1.00 30.40 ? 576 ALA A C     1 
ATOM   1548 O O     . ALA A 1 194 ? -48.525 -17.589 16.227  1.00 30.74 ? 576 ALA A O     1 
ATOM   1549 C CB    . ALA A 1 194 ? -46.913 -20.290 15.240  1.00 29.59 ? 576 ALA A CB    1 
ATOM   1550 N N     . ILE A 1 195 ? -46.646 -17.984 17.370  1.00 30.63 ? 577 ILE A N     1 
ATOM   1551 C CA    . ILE A 1 195 ? -47.158 -17.215 18.477  1.00 30.89 ? 577 ILE A CA    1 
ATOM   1552 C C     . ILE A 1 195 ? -47.315 -15.756 18.067  1.00 31.92 ? 577 ILE A C     1 
ATOM   1553 O O     . ILE A 1 195 ? -48.340 -15.163 18.398  1.00 32.00 ? 577 ILE A O     1 
ATOM   1554 C CB    . ILE A 1 195 ? -46.384 -17.399 19.777  1.00 30.82 ? 577 ILE A CB    1 
ATOM   1555 C CG1   . ILE A 1 195 ? -46.022 -18.873 19.942  1.00 31.07 ? 577 ILE A CG1   1 
ATOM   1556 C CG2   . ILE A 1 195 ? -47.275 -17.055 20.921  1.00 28.86 ? 577 ILE A CG2   1 
ATOM   1557 C CD1   . ILE A 1 195 ? -45.185 -19.199 21.140  1.00 32.17 ? 577 ILE A CD1   1 
ATOM   1558 N N     . ASP A 1 196 ? -46.373 -15.181 17.306  1.00 32.59 ? 578 ASP A N     1 
ATOM   1559 C CA    . ASP A 1 196 ? -46.596 -13.797 16.823  1.00 34.14 ? 578 ASP A CA    1 
ATOM   1560 C C     . ASP A 1 196 ? -47.846 -13.652 15.944  1.00 33.87 ? 578 ASP A C     1 
ATOM   1561 O O     . ASP A 1 196 ? -48.558 -12.654 16.012  1.00 34.48 ? 578 ASP A O     1 
ATOM   1562 C CB    . ASP A 1 196 ? -45.370 -13.186 16.129  1.00 34.88 ? 578 ASP A CB    1 
ATOM   1563 C CG    . ASP A 1 196 ? -44.074 -13.332 16.961  1.00 39.62 ? 578 ASP A CG    1 
ATOM   1564 O OD1   . ASP A 1 196 ? -44.138 -13.364 18.230  1.00 42.03 ? 578 ASP A OD1   1 
ATOM   1565 O OD2   . ASP A 1 196 ? -42.971 -13.421 16.333  1.00 44.65 ? 578 ASP A OD2   1 
ATOM   1566 N N     . ARG A 1 197 ? -48.119 -14.656 15.132  1.00 33.49 ? 579 ARG A N     1 
ATOM   1567 C CA    . ARG A 1 197 ? -49.224 -14.578 14.231  1.00 33.29 ? 579 ARG A CA    1 
ATOM   1568 C C     . ARG A 1 197 ? -50.516 -14.593 15.025  1.00 33.76 ? 579 ARG A C     1 
ATOM   1569 O O     . ARG A 1 197 ? -51.363 -13.724 14.821  1.00 33.70 ? 579 ARG A O     1 
ATOM   1570 C CB    . ARG A 1 197 ? -49.136 -15.695 13.203  1.00 33.19 ? 579 ARG A CB    1 
ATOM   1571 C CG    . ARG A 1 197 ? -48.070 -15.439 12.153  1.00 32.42 ? 579 ARG A CG    1 
ATOM   1572 C CD    . ARG A 1 197 ? -47.806 -16.614 11.224  1.00 30.26 ? 579 ARG A CD    1 
ATOM   1573 N NE    . ARG A 1 197 ? -47.404 -16.057 9.936   1.00 31.40 ? 579 ARG A NE    1 
ATOM   1574 C CZ    . ARG A 1 197 ? -47.241 -16.723 8.791   1.00 30.36 ? 579 ARG A CZ    1 
ATOM   1575 N NH1   . ARG A 1 197 ? -47.427 -18.051 8.707   1.00 29.36 ? 579 ARG A NH1   1 
ATOM   1576 N NH2   . ARG A 1 197 ? -46.872 -16.029 7.718   1.00 28.21 ? 579 ARG A NH2   1 
ATOM   1577 N N     . LEU A 1 198 ? -50.607 -15.541 16.020  1.00 34.49 ? 580 LEU A N     1 
ATOM   1578 C CA    . LEU A 1 198 ? -51.784 -15.627 16.883  1.00 35.54 ? 580 LEU A CA    1 
ATOM   1579 C C     . LEU A 1 198 ? -51.927 -14.384 17.762  1.00 36.99 ? 580 LEU A C     1 
ATOM   1580 O O     . LEU A 1 198 ? -53.037 -14.012 18.148  1.00 36.91 ? 580 LEU A O     1 
ATOM   1581 C CB    . LEU A 1 198 ? -51.728 -16.886 17.756  1.00 34.43 ? 580 LEU A CB    1 
ATOM   1582 C CG    . LEU A 1 198 ? -51.942 -18.250 17.089  1.00 33.26 ? 580 LEU A CG    1 
ATOM   1583 C CD1   . LEU A 1 198 ? -51.439 -19.370 17.987  1.00 32.22 ? 580 LEU A CD1   1 
ATOM   1584 C CD2   . LEU A 1 198 ? -53.404 -18.471 16.717  1.00 33.87 ? 580 LEU A CD2   1 
ATOM   1585 N N     . ASP A 1 199 ? -50.796 -13.750 18.069  1.00 38.69 ? 581 ASP A N     1 
ATOM   1586 C CA    . ASP A 1 199 ? -50.767 -12.525 18.867  1.00 40.48 ? 581 ASP A CA    1 
ATOM   1587 C C     . ASP A 1 199 ? -51.239 -11.315 18.061  1.00 41.13 ? 581 ASP A C     1 
ATOM   1588 O O     . ASP A 1 199 ? -51.806 -10.373 18.621  1.00 41.14 ? 581 ASP A O     1 
ATOM   1589 C CB    . ASP A 1 199 ? -49.354 -12.280 19.411  1.00 41.23 ? 581 ASP A CB    1 
ATOM   1590 C CG    . ASP A 1 199 ? -49.307 -11.182 20.466  1.00 43.81 ? 581 ASP A CG    1 
ATOM   1591 O OD1   . ASP A 1 199 ? -50.311 -10.983 21.185  1.00 45.98 ? 581 ASP A OD1   1 
ATOM   1592 O OD2   . ASP A 1 199 ? -48.254 -10.521 20.582  1.00 45.36 ? 581 ASP A OD2   1 
ATOM   1593 N N     . ARG A 1 200 ? -51.007 -11.351 16.750  1.00 42.12 ? 582 ARG A N     1 
ATOM   1594 C CA    . ARG A 1 200 ? -51.357 -10.243 15.863  1.00 43.05 ? 582 ARG A CA    1 
ATOM   1595 C C     . ARG A 1 200 ? -52.856 -10.191 15.549  1.00 43.57 ? 582 ARG A C     1 
ATOM   1596 O O     . ARG A 1 200 ? -53.374 -9.144  15.151  1.00 44.36 ? 582 ARG A O     1 
ATOM   1597 C CB    . ARG A 1 200 ? -50.537 -10.311 14.570  1.00 43.17 ? 582 ARG A CB    1 
ATOM   1598 C CG    . ARG A 1 200 ? -50.231 -8.947  13.957  1.00 45.12 ? 582 ARG A CG    1 
ATOM   1599 C CD    . ARG A 1 200 ? -49.415 -9.053  12.671  1.00 49.42 ? 582 ARG A CD    1 
ATOM   1600 N NE    . ARG A 1 200 ? -48.058 -9.554  12.893  1.00 53.15 ? 582 ARG A NE    1 
ATOM   1601 C CZ    . ARG A 1 200 ? -47.621 -10.752 12.513  1.00 53.67 ? 582 ARG A CZ    1 
ATOM   1602 N NH1   . ARG A 1 200 ? -48.427 -11.597 11.880  1.00 52.51 ? 582 ARG A NH1   1 
ATOM   1603 N NH2   . ARG A 1 200 ? -46.369 -11.109 12.764  1.00 51.70 ? 582 ARG A NH2   1 
ATOM   1604 N N     . ILE A 1 201 ? -53.544 -11.317 15.735  1.00 43.78 ? 583 ILE A N     1 
ATOM   1605 C CA    . ILE A 1 201 ? -54.990 -11.398 15.495  1.00 43.94 ? 583 ILE A CA    1 
ATOM   1606 C C     . ILE A 1 201 ? -55.810 -11.481 16.790  1.00 44.09 ? 583 ILE A C     1 
ATOM   1607 O O     . ILE A 1 201 ? -57.020 -11.234 16.783  1.00 43.81 ? 583 ILE A O     1 
ATOM   1608 C CB    . ILE A 1 201 ? -55.366 -12.568 14.540  1.00 43.72 ? 583 ILE A CB    1 
ATOM   1609 C CG1   . ILE A 1 201 ? -54.826 -13.906 15.064  1.00 43.45 ? 583 ILE A CG1   1 
ATOM   1610 C CG2   . ILE A 1 201 ? -54.882 -12.271 13.119  1.00 44.41 ? 583 ILE A CG2   1 
ATOM   1611 C CD1   . ILE A 1 201 ? -55.437 -15.133 14.402  1.00 42.40 ? 583 ILE A CD1   1 
ATOM   1612 N N     . GLY A 1 202 ? -55.144 -11.824 17.892  1.00 44.37 ? 584 GLY A N     1 
ATOM   1613 C CA    . GLY A 1 202 ? -55.786 -11.896 19.202  1.00 44.58 ? 584 GLY A CA    1 
ATOM   1614 C C     . GLY A 1 202 ? -56.341 -13.269 19.529  1.00 44.75 ? 584 GLY A C     1 
ATOM   1615 O O     . GLY A 1 202 ? -57.519 -13.405 19.872  1.00 44.68 ? 584 GLY A O     1 
ATOM   1616 N N     . LYS A 1 203 ? -55.610 -14.369 19.392  1.00 44.79 ? 585 LYS A N     1 
ATOM   1617 C CA    . LYS A 1 203 ? -56.050 -15.715 19.694  1.00 44.73 ? 585 LYS A CA    1 
ATOM   1618 C C     . LYS A 1 203 ? -55.092 -16.358 20.670  1.00 45.34 ? 585 LYS A C     1 
ATOM   1619 O O     . LYS A 1 203 ? -53.954 -15.978 20.752  1.00 46.04 ? 585 LYS A O     1 
ATOM   1620 C CB    . LYS A 1 203 ? -56.062 -16.543 18.446  1.00 44.32 ? 585 LYS A CB    1 
ATOM   1621 C CG    . LYS A 1 203 ? -57.140 -16.222 17.514  1.00 43.39 ? 585 LYS A CG    1 
ATOM   1622 C CD    . LYS A 1 203 ? -57.712 -17.468 16.933  1.00 42.19 ? 585 LYS A CD    1 
ATOM   1623 C CE    . LYS A 1 203 ? -58.472 -17.174 15.680  1.00 41.44 ? 585 LYS A CE    1 
ATOM   1624 N NZ    . LYS A 1 203 ? -59.920 -17.196 15.852  1.00 39.19 ? 585 LYS A NZ    1 
ATOM   1625 N N     . LYS A 1 204 ? -55.544 -17.342 21.424  1.00 45.42 ? 586 LYS A N     1 
ATOM   1626 C CA    . LYS A 1 204 ? -54.614 -18.097 22.264  1.00 44.98 ? 586 LYS A CA    1 
ATOM   1627 C C     . LYS A 1 204 ? -54.963 -19.560 22.479  1.00 44.32 ? 586 LYS A C     1 
ATOM   1628 O O     . LYS A 1 204 ? -56.111 -19.956 22.617  1.00 44.50 ? 586 LYS A O     1 
ATOM   1629 C CB    . LYS A 1 204 ? -54.249 -17.391 23.565  1.00 44.07 ? 586 LYS A CB    1 
ATOM   1630 C CG    . LYS A 1 204 ? -55.340 -16.645 24.212  1.00 43.39 ? 586 LYS A CG    1 
ATOM   1631 C CD    . LYS A 1 204 ? -54.784 -15.463 24.959  1.00 42.02 ? 586 LYS A CD    1 
ATOM   1632 C CE    . LYS A 1 204 ? -55.301 -15.449 26.379  1.00 46.16 ? 586 LYS A CE    1 
ATOM   1633 N NZ    . LYS A 1 204 ? -55.174 -14.151 27.058  1.00 45.15 ? 586 LYS A NZ    1 
ATOM   1634 N N     . ASN A 1 205 ? -53.901 -20.342 22.490  1.00 46.77 ? 587 ASN A N     1 
ATOM   1635 C CA    . ASN A 1 205 ? -53.968 -21.756 22.315  1.00 47.19 ? 587 ASN A CA    1 
ATOM   1636 C C     . ASN A 1 205 ? -53.071 -22.479 23.239  1.00 46.88 ? 587 ASN A C     1 
ATOM   1637 O O     . ASN A 1 205 ? -51.979 -22.053 23.499  1.00 46.78 ? 587 ASN A O     1 
ATOM   1638 C CB    . ASN A 1 205 ? -53.501 -22.089 20.917  1.00 47.55 ? 587 ASN A CB    1 
ATOM   1639 C CG    . ASN A 1 205 ? -53.829 -23.487 20.524  1.00 49.04 ? 587 ASN A CG    1 
ATOM   1640 O OD1   . ASN A 1 205 ? -53.350 -24.448 21.102  1.00 48.45 ? 587 ASN A OD1   1 
ATOM   1641 N ND2   . ASN A 1 205 ? -54.649 -23.609 19.523  1.00 49.82 ? 587 ASN A ND2   1 
ATOM   1642 N N     . SER A 1 206 ? -53.542 -23.615 23.681  1.00 46.55 ? 588 SER A N     1 
ATOM   1643 C CA    . SER A 1 206 ? -52.790 -24.496 24.589  1.00 46.71 ? 588 SER A CA    1 
ATOM   1644 C C     . SER A 1 206 ? -51.323 -24.773 24.215  1.00 46.95 ? 588 SER A C     1 
ATOM   1645 O O     . SER A 1 206 ? -50.675 -25.665 24.798  1.00 47.01 ? 588 SER A O     1 
ATOM   1646 C CB    . SER A 1 206 ? -53.527 -25.838 24.745  1.00 46.83 ? 588 SER A CB    1 
ATOM   1647 O OG    . SER A 1 206 ? -53.744 -26.441 23.481  1.00 46.33 ? 588 SER A OG    1 
ATOM   1648 N N     . ASP B 1 8   ? -16.397 -7.598  17.361  1.00 62.53 ? 390 ASP B N     1 
ATOM   1649 C CA    . ASP B 1 8   ? -16.534 -6.370  18.204  1.00 62.65 ? 390 ASP B CA    1 
ATOM   1650 C C     . ASP B 1 8   ? -15.315 -5.411  18.168  1.00 62.46 ? 390 ASP B C     1 
ATOM   1651 O O     . ASP B 1 8   ? -15.457 -4.241  18.527  1.00 62.43 ? 390 ASP B O     1 
ATOM   1652 C CB    . ASP B 1 8   ? -16.909 -6.752  19.649  1.00 62.90 ? 390 ASP B CB    1 
ATOM   1653 C CG    . ASP B 1 8   ? -17.241 -5.528  20.528  1.00 63.63 ? 390 ASP B CG    1 
ATOM   1654 O OD1   . ASP B 1 8   ? -18.314 -4.901  20.312  1.00 63.72 ? 390 ASP B OD1   1 
ATOM   1655 O OD2   . ASP B 1 8   ? -16.428 -5.208  21.443  1.00 63.62 ? 390 ASP B OD2   1 
ATOM   1656 N N     . SER B 1 9   ? -14.136 -5.880  17.739  1.00 62.31 ? 391 SER B N     1 
ATOM   1657 C CA    . SER B 1 9   ? -13.017 -4.958  17.401  1.00 62.51 ? 391 SER B CA    1 
ATOM   1658 C C     . SER B 1 9   ? -13.479 -3.922  16.366  1.00 62.68 ? 391 SER B C     1 
ATOM   1659 O O     . SER B 1 9   ? -12.954 -2.785  16.296  1.00 62.93 ? 391 SER B O     1 
ATOM   1660 C CB    . SER B 1 9   ? -11.817 -5.708  16.804  1.00 62.17 ? 391 SER B CB    1 
ATOM   1661 O OG    . SER B 1 9   ? -11.195 -6.515  17.776  1.00 62.10 ? 391 SER B OG    1 
ATOM   1662 N N     . SER B 1 10  ? -14.456 -4.352  15.560  1.00 62.25 ? 392 SER B N     1 
ATOM   1663 C CA    . SER B 1 10  ? -14.976 -3.577  14.442  1.00 61.56 ? 392 SER B CA    1 
ATOM   1664 C C     . SER B 1 10  ? -16.021 -2.544  14.886  1.00 60.97 ? 392 SER B C     1 
ATOM   1665 O O     . SER B 1 10  ? -16.027 -1.441  14.335  1.00 60.96 ? 392 SER B O     1 
ATOM   1666 C CB    . SER B 1 10  ? -15.484 -4.491  13.302  1.00 61.66 ? 392 SER B CB    1 
ATOM   1667 O OG    . SER B 1 10  ? -16.396 -5.480  13.758  1.00 61.31 ? 392 SER B OG    1 
ATOM   1668 N N     . ARG B 1 11  ? -16.872 -2.869  15.873  1.00 60.13 ? 393 ARG B N     1 
ATOM   1669 C CA    . ARG B 1 11  ? -17.734 -1.827  16.483  1.00 59.58 ? 393 ARG B CA    1 
ATOM   1670 C C     . ARG B 1 11  ? -16.909 -0.758  17.262  1.00 59.44 ? 393 ARG B C     1 
ATOM   1671 O O     . ARG B 1 11  ? -17.444 0.294   17.667  1.00 59.34 ? 393 ARG B O     1 
ATOM   1672 C CB    . ARG B 1 11  ? -18.878 -2.398  17.331  1.00 59.05 ? 393 ARG B CB    1 
ATOM   1673 C CG    . ARG B 1 11  ? -19.968 -1.350  17.596  1.00 59.94 ? 393 ARG B CG    1 
ATOM   1674 C CD    . ARG B 1 11  ? -21.036 -1.800  18.595  1.00 61.43 ? 393 ARG B CD    1 
ATOM   1675 N NE    . ARG B 1 11  ? -21.951 -2.796  18.015  1.00 63.48 ? 393 ARG B NE    1 
ATOM   1676 C CZ    . ARG B 1 11  ? -21.947 -4.107  18.295  1.00 64.00 ? 393 ARG B CZ    1 
ATOM   1677 N NH1   . ARG B 1 11  ? -21.084 -4.624  19.175  1.00 64.35 ? 393 ARG B NH1   1 
ATOM   1678 N NH2   . ARG B 1 11  ? -22.819 -4.916  17.698  1.00 63.39 ? 393 ARG B NH2   1 
ATOM   1679 N N     . ARG B 1 12  ? -15.609 -1.036  17.441  1.00 59.21 ? 394 ARG B N     1 
ATOM   1680 C CA    . ARG B 1 12  ? -14.630 -0.045  17.937  1.00 58.97 ? 394 ARG B CA    1 
ATOM   1681 C C     . ARG B 1 12  ? -14.070 0.897   16.862  1.00 58.30 ? 394 ARG B C     1 
ATOM   1682 O O     . ARG B 1 12  ? -14.314 2.100   16.925  1.00 58.49 ? 394 ARG B O     1 
ATOM   1683 C CB    . ARG B 1 12  ? -13.433 -0.714  18.649  1.00 59.18 ? 394 ARG B CB    1 
ATOM   1684 C CG    . ARG B 1 12  ? -12.183 0.205   18.784  1.00 59.66 ? 394 ARG B CG    1 
ATOM   1685 C CD    . ARG B 1 12  ? -12.474 1.447   19.644  1.00 61.59 ? 394 ARG B CD    1 
ATOM   1686 N NE    . ARG B 1 12  ? -12.864 1.086   21.017  1.00 63.19 ? 394 ARG B NE    1 
ATOM   1687 C CZ    . ARG B 1 12  ? -13.083 1.955   22.006  1.00 64.06 ? 394 ARG B CZ    1 
ATOM   1688 N NH1   . ARG B 1 12  ? -12.973 3.272   21.789  1.00 64.12 ? 394 ARG B NH1   1 
ATOM   1689 N NH2   . ARG B 1 12  ? -13.417 1.503   23.214  1.00 63.06 ? 394 ARG B NH2   1 
ATOM   1690 N N     . GLN B 1 13  ? -13.302 0.338   15.916  1.00 57.64 ? 395 GLN B N     1 
ATOM   1691 C CA    . GLN B 1 13  ? -12.885 0.983   14.651  1.00 56.68 ? 395 GLN B CA    1 
ATOM   1692 C C     . GLN B 1 13  ? -13.928 1.988   14.110  1.00 55.73 ? 395 GLN B C     1 
ATOM   1693 O O     . GLN B 1 13  ? -13.596 3.139   13.775  1.00 55.36 ? 395 GLN B O     1 
ATOM   1694 C CB    . GLN B 1 13  ? -12.624 -0.111  13.605  1.00 56.82 ? 395 GLN B CB    1 
ATOM   1695 C CG    . GLN B 1 13  ? -11.300 -0.854  13.755  1.00 58.02 ? 395 GLN B CG    1 
ATOM   1696 C CD    . GLN B 1 13  ? -10.282 -0.507  12.643  1.00 60.28 ? 395 GLN B CD    1 
ATOM   1697 O OE1   . GLN B 1 13  ? -9.064  -0.484  12.876  1.00 60.70 ? 395 GLN B OE1   1 
ATOM   1698 N NE2   . GLN B 1 13  ? -10.782 -0.245  11.431  1.00 59.82 ? 395 GLN B NE2   1 
ATOM   1699 N N     . TYR B 1 14  ? -15.184 1.539   14.049  1.00 54.47 ? 396 TYR B N     1 
ATOM   1700 C CA    . TYR B 1 14  ? -16.293 2.327   13.536  1.00 53.65 ? 396 TYR B CA    1 
ATOM   1701 C C     . TYR B 1 14  ? -16.327 3.681   14.177  1.00 53.30 ? 396 TYR B C     1 
ATOM   1702 O O     . TYR B 1 14  ? -16.360 4.703   13.489  1.00 53.45 ? 396 TYR B O     1 
ATOM   1703 C CB    . TYR B 1 14  ? -17.625 1.638   13.808  1.00 53.36 ? 396 TYR B CB    1 
ATOM   1704 C CG    . TYR B 1 14  ? -18.829 2.463   13.393  1.00 53.71 ? 396 TYR B CG    1 
ATOM   1705 C CD1   . TYR B 1 14  ? -19.237 2.526   12.050  1.00 54.42 ? 396 TYR B CD1   1 
ATOM   1706 C CD2   . TYR B 1 14  ? -19.565 3.184   14.334  1.00 53.92 ? 396 TYR B CD2   1 
ATOM   1707 C CE1   . TYR B 1 14  ? -20.354 3.278   11.657  1.00 53.54 ? 396 TYR B CE1   1 
ATOM   1708 C CE2   . TYR B 1 14  ? -20.688 3.943   13.951  1.00 53.90 ? 396 TYR B CE2   1 
ATOM   1709 C CZ    . TYR B 1 14  ? -21.074 3.982   12.610  1.00 53.79 ? 396 TYR B CZ    1 
ATOM   1710 O OH    . TYR B 1 14  ? -22.177 4.723   12.223  1.00 55.12 ? 396 TYR B OH    1 
ATOM   1711 N N     . GLN B 1 15  ? -16.319 3.674   15.503  1.00 52.82 ? 397 GLN B N     1 
ATOM   1712 C CA    . GLN B 1 15  ? -16.487 4.892   16.266  1.00 52.52 ? 397 GLN B CA    1 
ATOM   1713 C C     . GLN B 1 15  ? -15.253 5.768   16.308  1.00 51.91 ? 397 GLN B C     1 
ATOM   1714 O O     . GLN B 1 15  ? -15.348 6.976   16.546  1.00 52.26 ? 397 GLN B O     1 
ATOM   1715 C CB    . GLN B 1 15  ? -17.013 4.590   17.656  1.00 52.51 ? 397 GLN B CB    1 
ATOM   1716 C CG    . GLN B 1 15  ? -18.523 4.540   17.660  1.00 54.87 ? 397 GLN B CG    1 
ATOM   1717 C CD    . GLN B 1 15  ? -19.078 3.798   18.853  1.00 58.34 ? 397 GLN B CD    1 
ATOM   1718 O OE1   . GLN B 1 15  ? -18.486 3.834   19.946  1.00 59.27 ? 397 GLN B OE1   1 
ATOM   1719 N NE2   . GLN B 1 15  ? -20.223 3.110   18.660  1.00 59.72 ? 397 GLN B NE2   1 
ATOM   1720 N N     . GLU B 1 16  ? -14.096 5.192   16.051  1.00 51.08 ? 398 GLU B N     1 
ATOM   1721 C CA    . GLU B 1 16  ? -12.929 6.048   15.938  1.00 51.09 ? 398 GLU B CA    1 
ATOM   1722 C C     . GLU B 1 16  ? -12.845 6.662   14.557  1.00 50.07 ? 398 GLU B C     1 
ATOM   1723 O O     . GLU B 1 16  ? -12.403 7.802   14.396  1.00 50.14 ? 398 GLU B O     1 
ATOM   1724 C CB    . GLU B 1 16  ? -11.646 5.311   16.300  1.00 51.50 ? 398 GLU B CB    1 
ATOM   1725 C CG    . GLU B 1 16  ? -11.467 5.222   17.803  1.00 53.62 ? 398 GLU B CG    1 
ATOM   1726 C CD    . GLU B 1 16  ? -10.011 5.272   18.209  1.00 57.23 ? 398 GLU B CD    1 
ATOM   1727 O OE1   . GLU B 1 16  ? -9.165  5.730   17.380  1.00 58.18 ? 398 GLU B OE1   1 
ATOM   1728 O OE2   . GLU B 1 16  ? -9.723  4.851   19.359  1.00 56.95 ? 398 GLU B OE2   1 
ATOM   1729 N N     . LYS B 1 17  ? -13.276 5.902   13.558  1.00 48.88 ? 399 LYS B N     1 
ATOM   1730 C CA    . LYS B 1 17  ? -13.261 6.412   12.201  1.00 47.44 ? 399 LYS B CA    1 
ATOM   1731 C C     . LYS B 1 17  ? -14.240 7.548   12.067  1.00 46.09 ? 399 LYS B C     1 
ATOM   1732 O O     . LYS B 1 17  ? -13.858 8.609   11.584  1.00 45.57 ? 399 LYS B O     1 
ATOM   1733 C CB    . LYS B 1 17  ? -13.492 5.306   11.188  1.00 47.66 ? 399 LYS B CB    1 
ATOM   1734 C CG    . LYS B 1 17  ? -12.163 4.753   10.670  1.00 48.05 ? 399 LYS B CG    1 
ATOM   1735 C CD    . LYS B 1 17  ? -12.255 3.271   10.332  1.00 47.06 ? 399 LYS B CD    1 
ATOM   1736 C CE    . LYS B 1 17  ? -10.966 2.841   9.656   1.00 48.14 ? 399 LYS B CE    1 
ATOM   1737 N NZ    . LYS B 1 17  ? -10.990 3.015   8.168   1.00 48.75 ? 399 LYS B NZ    1 
ATOM   1738 N N     . TYR B 1 18  ? -15.463 7.354   12.559  1.00 44.76 ? 400 TYR B N     1 
ATOM   1739 C CA    . TYR B 1 18  ? -16.394 8.455   12.581  1.00 44.49 ? 400 TYR B CA    1 
ATOM   1740 C C     . TYR B 1 18  ? -15.932 9.582   13.518  1.00 44.66 ? 400 TYR B C     1 
ATOM   1741 O O     . TYR B 1 18  ? -16.337 10.721  13.337  1.00 45.18 ? 400 TYR B O     1 
ATOM   1742 C CB    . TYR B 1 18  ? -17.866 8.041   12.798  1.00 44.42 ? 400 TYR B CB    1 
ATOM   1743 C CG    . TYR B 1 18  ? -18.835 9.214   12.605  1.00 44.98 ? 400 TYR B CG    1 
ATOM   1744 C CD1   . TYR B 1 18  ? -19.055 9.788   11.341  1.00 45.08 ? 400 TYR B CD1   1 
ATOM   1745 C CD2   . TYR B 1 18  ? -19.484 9.784   13.690  1.00 46.12 ? 400 TYR B CD2   1 
ATOM   1746 C CE1   . TYR B 1 18  ? -19.915 10.901  11.172  1.00 45.50 ? 400 TYR B CE1   1 
ATOM   1747 C CE2   . TYR B 1 18  ? -20.354 10.879  13.534  1.00 46.84 ? 400 TYR B CE2   1 
ATOM   1748 C CZ    . TYR B 1 18  ? -20.563 11.436  12.282  1.00 46.67 ? 400 TYR B CZ    1 
ATOM   1749 O OH    . TYR B 1 18  ? -21.419 12.521  12.182  1.00 47.19 ? 400 TYR B OH    1 
ATOM   1750 N N     . LYS B 1 19  ? -15.065 9.302   14.486  1.00 44.35 ? 401 LYS B N     1 
ATOM   1751 C CA    . LYS B 1 19  ? -14.383 10.403  15.155  1.00 44.20 ? 401 LYS B CA    1 
ATOM   1752 C C     . LYS B 1 19  ? -13.412 11.156  14.209  1.00 43.74 ? 401 LYS B C     1 
ATOM   1753 O O     . LYS B 1 19  ? -13.320 12.392  14.252  1.00 43.89 ? 401 LYS B O     1 
ATOM   1754 C CB    . LYS B 1 19  ? -13.664 9.931   16.422  1.00 44.85 ? 401 LYS B CB    1 
ATOM   1755 C CG    . LYS B 1 19  ? -14.418 10.206  17.756  1.00 47.13 ? 401 LYS B CG    1 
ATOM   1756 C CD    . LYS B 1 19  ? -13.581 9.785   19.012  1.00 49.67 ? 401 LYS B CD    1 
ATOM   1757 C CE    . LYS B 1 19  ? -14.480 9.286   20.190  1.00 50.43 ? 401 LYS B CE    1 
ATOM   1758 N NZ    . LYS B 1 19  ? -13.730 8.483   21.239  1.00 48.78 ? 401 LYS B NZ    1 
ATOM   1759 N N     . GLN B 1 20  ? -12.688 10.435  13.352  1.00 43.21 ? 402 GLN B N     1 
ATOM   1760 C CA    . GLN B 1 20  ? -11.791 11.101  12.401  1.00 42.61 ? 402 GLN B CA    1 
ATOM   1761 C C     . GLN B 1 20  ? -12.604 11.974  11.432  1.00 41.86 ? 402 GLN B C     1 
ATOM   1762 O O     . GLN B 1 20  ? -12.228 13.120  11.138  1.00 41.32 ? 402 GLN B O     1 
ATOM   1763 C CB    . GLN B 1 20  ? -10.970 10.077  11.623  1.00 42.94 ? 402 GLN B CB    1 
ATOM   1764 C CG    . GLN B 1 20  ? -9.641  9.673   12.253  1.00 44.91 ? 402 GLN B CG    1 
ATOM   1765 C CD    . GLN B 1 20  ? -8.689  9.010   11.226  1.00 49.19 ? 402 GLN B CD    1 
ATOM   1766 O OE1   . GLN B 1 20  ? -8.713  7.775   11.049  1.00 49.44 ? 402 GLN B OE1   1 
ATOM   1767 N NE2   . GLN B 1 20  ? -7.851  9.834   10.542  1.00 48.85 ? 402 GLN B NE2   1 
ATOM   1768 N N     . VAL B 1 21  ? -13.729 11.420  10.959  1.00 40.88 ? 403 VAL B N     1 
ATOM   1769 C CA    . VAL B 1 21  ? -14.643 12.114  10.033  1.00 39.71 ? 403 VAL B CA    1 
ATOM   1770 C C     . VAL B 1 21  ? -15.067 13.465  10.634  1.00 39.88 ? 403 VAL B C     1 
ATOM   1771 O O     . VAL B 1 21  ? -14.752 14.506  10.053  1.00 40.35 ? 403 VAL B O     1 
ATOM   1772 C CB    . VAL B 1 21  ? -15.863 11.225  9.631   1.00 39.26 ? 403 VAL B CB    1 
ATOM   1773 C CG1   . VAL B 1 21  ? -17.045 12.061  9.248   1.00 37.89 ? 403 VAL B CG1   1 
ATOM   1774 C CG2   . VAL B 1 21  ? -15.496 10.261  8.492   1.00 37.89 ? 403 VAL B CG2   1 
ATOM   1775 N N     . GLU B 1 22  ? -15.715 13.441  11.805  1.00 39.06 ? 404 GLU B N     1 
ATOM   1776 C CA    . GLU B 1 22  ? -16.038 14.649  12.568  1.00 38.99 ? 404 GLU B CA    1 
ATOM   1777 C C     . GLU B 1 22  ? -14.910 15.661  12.630  1.00 38.90 ? 404 GLU B C     1 
ATOM   1778 O O     . GLU B 1 22  ? -15.156 16.866  12.564  1.00 39.05 ? 404 GLU B O     1 
ATOM   1779 C CB    . GLU B 1 22  ? -16.389 14.315  14.009  1.00 38.82 ? 404 GLU B CB    1 
ATOM   1780 C CG    . GLU B 1 22  ? -17.673 13.556  14.199  1.00 41.18 ? 404 GLU B CG    1 
ATOM   1781 C CD    . GLU B 1 22  ? -17.981 13.328  15.669  1.00 44.17 ? 404 GLU B CD    1 
ATOM   1782 O OE1   . GLU B 1 22  ? -18.450 12.208  16.039  1.00 44.24 ? 404 GLU B OE1   1 
ATOM   1783 O OE2   . GLU B 1 22  ? -17.740 14.284  16.456  1.00 45.99 ? 404 GLU B OE2   1 
ATOM   1784 N N     . GLN B 1 23  ? -13.678 15.206  12.789  1.00 38.51 ? 405 GLN B N     1 
ATOM   1785 C CA    . GLN B 1 23  ? -12.613 16.184  12.881  1.00 39.33 ? 405 GLN B CA    1 
ATOM   1786 C C     . GLN B 1 23  ? -12.420 16.927  11.582  1.00 38.98 ? 405 GLN B C     1 
ATOM   1787 O O     . GLN B 1 23  ? -12.349 18.170  11.573  1.00 39.64 ? 405 GLN B O     1 
ATOM   1788 C CB    . GLN B 1 23  ? -11.301 15.542  13.242  1.00 39.90 ? 405 GLN B CB    1 
ATOM   1789 C CG    . GLN B 1 23  ? -11.134 15.303  14.706  1.00 42.88 ? 405 GLN B CG    1 
ATOM   1790 C CD    . GLN B 1 23  ? -9.941  14.418  14.954  1.00 46.02 ? 405 GLN B CD    1 
ATOM   1791 O OE1   . GLN B 1 23  ? -10.045 13.386  15.649  1.00 45.59 ? 405 GLN B OE1   1 
ATOM   1792 N NE2   . GLN B 1 23  ? -8.786  14.796  14.354  1.00 45.47 ? 405 GLN B NE2   1 
ATOM   1793 N N     . TYR B 1 24  ? -12.309 16.155  10.496  1.00 38.02 ? 406 TYR B N     1 
ATOM   1794 C CA    . TYR B 1 24  ? -12.173 16.693  9.142   1.00 36.47 ? 406 TYR B CA    1 
ATOM   1795 C C     . TYR B 1 24  ? -13.273 17.739  8.890   1.00 35.81 ? 406 TYR B C     1 
ATOM   1796 O O     . TYR B 1 24  ? -12.992 18.872  8.456   1.00 35.04 ? 406 TYR B O     1 
ATOM   1797 C CB    . TYR B 1 24  ? -12.251 15.550  8.121   1.00 36.29 ? 406 TYR B CB    1 
ATOM   1798 C CG    . TYR B 1 24  ? -12.187 16.013  6.689   1.00 35.74 ? 406 TYR B CG    1 
ATOM   1799 C CD1   . TYR B 1 24  ? -13.355 16.268  5.965   1.00 34.06 ? 406 TYR B CD1   1 
ATOM   1800 C CD2   . TYR B 1 24  ? -10.951 16.216  6.055   1.00 37.45 ? 406 TYR B CD2   1 
ATOM   1801 C CE1   . TYR B 1 24  ? -13.299 16.723  4.649   1.00 34.73 ? 406 TYR B CE1   1 
ATOM   1802 C CE2   . TYR B 1 24  ? -10.880 16.656  4.718   1.00 37.30 ? 406 TYR B CE2   1 
ATOM   1803 C CZ    . TYR B 1 24  ? -12.066 16.920  4.033   1.00 35.80 ? 406 TYR B CZ    1 
ATOM   1804 O OH    . TYR B 1 24  ? -12.022 17.372  2.739   1.00 35.70 ? 406 TYR B OH    1 
ATOM   1805 N N     . MET B 1 25  ? -14.513 17.367  9.191   1.00 34.72 ? 407 MET B N     1 
ATOM   1806 C CA    . MET B 1 25  ? -15.607 18.284  9.010   1.00 34.81 ? 407 MET B CA    1 
ATOM   1807 C C     . MET B 1 25  ? -15.332 19.580  9.747   1.00 34.97 ? 407 MET B C     1 
ATOM   1808 O O     . MET B 1 25  ? -15.293 20.621  9.108   1.00 34.71 ? 407 MET B O     1 
ATOM   1809 C CB    . MET B 1 25  ? -16.919 17.654  9.404   1.00 34.70 ? 407 MET B CB    1 
ATOM   1810 C CG    . MET B 1 25  ? -17.213 16.436  8.584   1.00 35.63 ? 407 MET B CG    1 
ATOM   1811 S SD    . MET B 1 25  ? -18.877 15.818  8.842   1.00 42.30 ? 407 MET B SD    1 
ATOM   1812 C CE    . MET B 1 25  ? -18.923 15.592  10.656  1.00 41.10 ? 407 MET B CE    1 
ATOM   1813 N N     . SER B 1 26  ? -15.083 19.524  11.060  1.00 35.69 ? 408 SER B N     1 
ATOM   1814 C CA    . SER B 1 26  ? -14.606 20.724  11.820  1.00 36.50 ? 408 SER B CA    1 
ATOM   1815 C C     . SER B 1 26  ? -13.477 21.503  11.130  1.00 35.99 ? 408 SER B C     1 
ATOM   1816 O O     . SER B 1 26  ? -13.631 22.688  10.822  1.00 35.73 ? 408 SER B O     1 
ATOM   1817 C CB    . SER B 1 26  ? -14.131 20.363  13.223  1.00 36.54 ? 408 SER B CB    1 
ATOM   1818 O OG    . SER B 1 26  ? -15.156 19.679  13.919  1.00 39.62 ? 408 SER B OG    1 
ATOM   1819 N N     . PHE B 1 27  ? -12.349 20.858  10.866  1.00 35.35 ? 409 PHE B N     1 
ATOM   1820 C CA    . PHE B 1 27  ? -11.297 21.634  10.265  1.00 35.85 ? 409 PHE B CA    1 
ATOM   1821 C C     . PHE B 1 27  ? -11.752 22.347  8.978   1.00 36.00 ? 409 PHE B C     1 
ATOM   1822 O O     . PHE B 1 27  ? -11.233 23.427  8.669   1.00 36.97 ? 409 PHE B O     1 
ATOM   1823 C CB    . PHE B 1 27  ? -10.001 20.847  10.015  1.00 36.09 ? 409 PHE B CB    1 
ATOM   1824 C CG    . PHE B 1 27  ? -8.939  21.677  9.346   1.00 36.68 ? 409 PHE B CG    1 
ATOM   1825 C CD1   . PHE B 1 27  ? -8.371  22.777  10.018  1.00 37.25 ? 409 PHE B CD1   1 
ATOM   1826 C CD2   . PHE B 1 27  ? -8.565  21.426  8.022   1.00 38.98 ? 409 PHE B CD2   1 
ATOM   1827 C CE1   . PHE B 1 27  ? -7.410  23.608  9.397   1.00 38.85 ? 409 PHE B CE1   1 
ATOM   1828 C CE2   . PHE B 1 27  ? -7.576  22.255  7.369   1.00 40.76 ? 409 PHE B CE2   1 
ATOM   1829 C CZ    . PHE B 1 27  ? -7.004  23.352  8.068   1.00 39.22 ? 409 PHE B CZ    1 
ATOM   1830 N N     . HIS B 1 28  ? -12.692 21.755  8.224   1.00 35.42 ? 410 HIS B N     1 
ATOM   1831 C CA    . HIS B 1 28  ? -13.153 22.369  6.962   1.00 34.38 ? 410 HIS B CA    1 
ATOM   1832 C C     . HIS B 1 28  ? -14.442 23.219  7.123   1.00 34.25 ? 410 HIS B C     1 
ATOM   1833 O O     . HIS B 1 28  ? -14.925 23.831  6.173   1.00 34.16 ? 410 HIS B O     1 
ATOM   1834 C CB    . HIS B 1 28  ? -13.243 21.341  5.815   1.00 33.99 ? 410 HIS B CB    1 
ATOM   1835 C CG    . HIS B 1 28  ? -11.908 20.862  5.321   1.00 33.43 ? 410 HIS B CG    1 
ATOM   1836 N ND1   . HIS B 1 28  ? -11.123 21.596  4.447   1.00 32.06 ? 410 HIS B ND1   1 
ATOM   1837 C CD2   . HIS B 1 28  ? -11.214 19.727  5.586   1.00 31.66 ? 410 HIS B CD2   1 
ATOM   1838 C CE1   . HIS B 1 28  ? -10.002 20.938  4.202   1.00 30.22 ? 410 HIS B CE1   1 
ATOM   1839 N NE2   . HIS B 1 28  ? -10.033 19.801  4.878   1.00 31.72 ? 410 HIS B NE2   1 
ATOM   1840 N N     . LYS B 1 29  ? -14.956 23.282  8.347   1.00 33.75 ? 411 LYS B N     1 
ATOM   1841 C CA    . LYS B 1 29  ? -16.124 24.106  8.679   1.00 33.46 ? 411 LYS B CA    1 
ATOM   1842 C C     . LYS B 1 29  ? -17.355 23.856  7.785   1.00 32.08 ? 411 LYS B C     1 
ATOM   1843 O O     . LYS B 1 29  ? -18.014 24.800  7.342   1.00 32.75 ? 411 LYS B O     1 
ATOM   1844 C CB    . LYS B 1 29  ? -15.750 25.600  8.722   1.00 33.93 ? 411 LYS B CB    1 
ATOM   1845 C CG    . LYS B 1 29  ? -14.566 25.949  9.626   1.00 36.59 ? 411 LYS B CG    1 
ATOM   1846 C CD    . LYS B 1 29  ? -13.907 27.294  9.216   1.00 41.45 ? 411 LYS B CD    1 
ATOM   1847 C CE    . LYS B 1 29  ? -12.374 27.143  8.914   1.00 43.80 ? 411 LYS B CE    1 
ATOM   1848 N NZ    . LYS B 1 29  ? -11.877 28.193  7.974   1.00 44.48 ? 411 LYS B NZ    1 
ATOM   1849 N N     . LEU B 1 30  ? -17.669 22.587  7.544   1.00 30.11 ? 412 LEU B N     1 
ATOM   1850 C CA    . LEU B 1 30  ? -18.808 22.205  6.719   1.00 28.54 ? 412 LEU B CA    1 
ATOM   1851 C C     . LEU B 1 30  ? -20.106 22.606  7.413   1.00 28.34 ? 412 LEU B C     1 
ATOM   1852 O O     . LEU B 1 30  ? -20.176 22.551  8.624   1.00 28.84 ? 412 LEU B O     1 
ATOM   1853 C CB    . LEU B 1 30  ? -18.760 20.708  6.460   1.00 27.82 ? 412 LEU B CB    1 
ATOM   1854 C CG    . LEU B 1 30  ? -17.888 20.118  5.321   1.00 26.88 ? 412 LEU B CG    1 
ATOM   1855 C CD1   . LEU B 1 30  ? -16.628 20.863  4.935   1.00 24.50 ? 412 LEU B CD1   1 
ATOM   1856 C CD2   . LEU B 1 30  ? -17.506 18.755  5.689   1.00 25.18 ? 412 LEU B CD2   1 
ATOM   1857 N N     . PRO B 1 31  ? -21.113 23.070  6.660   1.00 27.92 ? 413 PRO B N     1 
ATOM   1858 C CA    . PRO B 1 31  ? -22.440 23.448  7.160   1.00 27.98 ? 413 PRO B CA    1 
ATOM   1859 C C     . PRO B 1 31  ? -23.196 22.328  7.840   1.00 28.54 ? 413 PRO B C     1 
ATOM   1860 O O     . PRO B 1 31  ? -23.055 21.172  7.450   1.00 28.44 ? 413 PRO B O     1 
ATOM   1861 C CB    . PRO B 1 31  ? -23.219 23.793  5.886   1.00 27.71 ? 413 PRO B CB    1 
ATOM   1862 C CG    . PRO B 1 31  ? -22.363 23.374  4.754   1.00 28.48 ? 413 PRO B CG    1 
ATOM   1863 C CD    . PRO B 1 31  ? -20.954 23.410  5.244   1.00 27.96 ? 413 PRO B CD    1 
ATOM   1864 N N     . ALA B 1 32  ? -24.200 22.638  8.745   1.00 29.30 ? 414 ALA B N     1 
ATOM   1865 C CA    . ALA B 1 32  ? -24.894 21.695  9.629   1.00 29.61 ? 414 ALA B CA    1 
ATOM   1866 C C     . ALA B 1 32  ? -25.631 20.570  8.900   1.00 29.92 ? 414 ALA B C     1 
ATOM   1867 O O     . ALA B 1 32  ? -25.536 19.407  9.299   1.00 30.38 ? 414 ALA B O     1 
ATOM   1868 C CB    . ALA B 1 32  ? -25.846 22.444  10.558  1.00 29.04 ? 414 ALA B CB    1 
ATOM   1869 N N     . ASP B 1 33  ? -26.359 20.917  7.840   1.00 30.10 ? 415 ASP B N     1 
ATOM   1870 C CA    . ASP B 1 33  ? -27.130 19.935  7.072   1.00 30.60 ? 415 ASP B CA    1 
ATOM   1871 C C     . ASP B 1 33  ? -26.256 19.043  6.181   1.00 29.55 ? 415 ASP B C     1 
ATOM   1872 O O     . ASP B 1 33  ? -26.681 17.960  5.771   1.00 29.78 ? 415 ASP B O     1 
ATOM   1873 C CB    . ASP B 1 33  ? -28.240 20.613  6.255   1.00 31.34 ? 415 ASP B CB    1 
ATOM   1874 C CG    . ASP B 1 33  ? -27.727 21.749  5.387   1.00 35.15 ? 415 ASP B CG    1 
ATOM   1875 O OD1   . ASP B 1 33  ? -27.152 22.715  5.934   1.00 38.30 ? 415 ASP B OD1   1 
ATOM   1876 O OD2   . ASP B 1 33  ? -27.913 21.683  4.154   1.00 39.14 ? 415 ASP B OD2   1 
ATOM   1877 N N     . MET B 1 34  ? -25.041 19.506  5.889   1.00 28.85 ? 416 MET B N     1 
ATOM   1878 C CA    . MET B 1 34  ? -24.057 18.711  5.155   1.00 28.42 ? 416 MET B CA    1 
ATOM   1879 C C     . MET B 1 34  ? -23.376 17.714  6.092   1.00 28.72 ? 416 MET B C     1 
ATOM   1880 O O     . MET B 1 34  ? -23.075 16.587  5.695   1.00 29.10 ? 416 MET B O     1 
ATOM   1881 C CB    . MET B 1 34  ? -23.020 19.614  4.483   1.00 28.42 ? 416 MET B CB    1 
ATOM   1882 C CG    . MET B 1 34  ? -22.178 18.927  3.412   1.00 28.87 ? 416 MET B CG    1 
ATOM   1883 S SD    . MET B 1 34  ? -20.999 20.032  2.605   1.00 31.44 ? 416 MET B SD    1 
ATOM   1884 C CE    . MET B 1 34  ? -22.084 21.015  1.570   1.00 31.43 ? 416 MET B CE    1 
ATOM   1885 N N     . ARG B 1 35  ? -22.909 18.059  7.277   1.00 28.85 ? 417 ARG B N     1 
ATOM   1886 C CA    . ARG B 1 35  ? -22.498 17.163  8.366   1.00 28.23 ? 417 ARG B CA    1 
ATOM   1887 C C     . ARG B 1 35  ? -23.610 16.174  8.671   1.00 28.26 ? 417 ARG B C     1 
ATOM   1888 O O     . ARG B 1 35  ? -23.338 15.016  8.886   1.00 28.06 ? 417 ARG B O     1 
ATOM   1889 C CB    . ARG B 1 35  ? -22.166 17.932  9.629   1.00 28.17 ? 417 ARG B CB    1 
ATOM   1890 C CG    . ARG B 1 35  ? -20.833 18.650  9.615   1.00 28.01 ? 417 ARG B CG    1 
ATOM   1891 C CD    . ARG B 1 35  ? -20.699 19.576  10.846  1.00 28.70 ? 417 ARG B CD    1 
ATOM   1892 N NE    . ARG B 1 35  ? -19.771 20.638  10.514  1.00 31.57 ? 417 ARG B NE    1 
ATOM   1893 C CZ    . ARG B 1 35  ? -18.723 21.036  11.231  1.00 35.42 ? 417 ARG B CZ    1 
ATOM   1894 N NH1   . ARG B 1 35  ? -18.420 20.504  12.420  1.00 37.43 ? 417 ARG B NH1   1 
ATOM   1895 N NH2   . ARG B 1 35  ? -17.965 22.005  10.741  1.00 36.64 ? 417 ARG B NH2   1 
ATOM   1896 N N     . GLN B 1 36  ? -24.863 16.623  8.677   1.00 28.69 ? 418 GLN B N     1 
ATOM   1897 C CA    . GLN B 1 36  ? -25.976 15.702  8.848   1.00 29.55 ? 418 GLN B CA    1 
ATOM   1898 C C     . GLN B 1 36  ? -25.943 14.660  7.756   1.00 29.91 ? 418 GLN B C     1 
ATOM   1899 O O     . GLN B 1 36  ? -25.680 13.496  8.041   1.00 30.61 ? 418 GLN B O     1 
ATOM   1900 C CB    . GLN B 1 36  ? -27.317 16.412  8.858   1.00 29.77 ? 418 GLN B CB    1 
ATOM   1901 C CG    . GLN B 1 36  ? -28.424 15.556  9.461   1.00 32.36 ? 418 GLN B CG    1 
ATOM   1902 C CD    . GLN B 1 36  ? -28.134 15.173  10.921  1.00 37.91 ? 418 GLN B CD    1 
ATOM   1903 O OE1   . GLN B 1 36  ? -28.280 14.004  11.323  1.00 41.27 ? 418 GLN B OE1   1 
ATOM   1904 N NE2   . GLN B 1 36  ? -27.701 16.156  11.718  1.00 39.05 ? 418 GLN B NE2   1 
ATOM   1905 N N     . LYS B 1 37  ? -26.153 15.082  6.507   1.00 30.12 ? 419 LYS B N     1 
ATOM   1906 C CA    . LYS B 1 37  ? -26.034 14.201  5.340   1.00 30.31 ? 419 LYS B CA    1 
ATOM   1907 C C     . LYS B 1 37  ? -24.884 13.181  5.408   1.00 30.27 ? 419 LYS B C     1 
ATOM   1908 O O     . LYS B 1 37  ? -25.074 12.016  5.096   1.00 30.14 ? 419 LYS B O     1 
ATOM   1909 C CB    . LYS B 1 37  ? -25.904 15.013  4.053   1.00 30.37 ? 419 LYS B CB    1 
ATOM   1910 C CG    . LYS B 1 37  ? -26.409 14.247  2.816   1.00 32.12 ? 419 LYS B CG    1 
ATOM   1911 C CD    . LYS B 1 37  ? -26.676 15.151  1.618   1.00 34.19 ? 419 LYS B CD    1 
ATOM   1912 C CE    . LYS B 1 37  ? -27.641 14.518  0.609   1.00 34.58 ? 419 LYS B CE    1 
ATOM   1913 N NZ    . LYS B 1 37  ? -26.927 14.083  -0.656  1.00 34.63 ? 419 LYS B NZ    1 
ATOM   1914 N N     . ILE B 1 38  ? -23.695 13.622  5.787   1.00 30.24 ? 420 ILE B N     1 
ATOM   1915 C CA    . ILE B 1 38  ? -22.568 12.722  5.881   1.00 30.62 ? 420 ILE B CA    1 
ATOM   1916 C C     . ILE B 1 38  ? -22.736 11.747  7.058   1.00 32.10 ? 420 ILE B C     1 
ATOM   1917 O O     . ILE B 1 38  ? -22.437 10.553  6.945   1.00 32.49 ? 420 ILE B O     1 
ATOM   1918 C CB    . ILE B 1 38  ? -21.264 13.500  6.054   1.00 30.43 ? 420 ILE B CB    1 
ATOM   1919 C CG1   . ILE B 1 38  ? -20.895 14.259  4.765   1.00 28.32 ? 420 ILE B CG1   1 
ATOM   1920 C CG2   . ILE B 1 38  ? -20.158 12.560  6.538   1.00 29.08 ? 420 ILE B CG2   1 
ATOM   1921 C CD1   . ILE B 1 38  ? -19.705 15.110  4.899   1.00 25.55 ? 420 ILE B CD1   1 
ATOM   1922 N N     . HIS B 1 39  ? -23.219 12.247  8.189   1.00 33.05 ? 421 HIS B N     1 
ATOM   1923 C CA    . HIS B 1 39  ? -23.474 11.384  9.312   1.00 34.08 ? 421 HIS B CA    1 
ATOM   1924 C C     . HIS B 1 39  ? -24.525 10.300  8.909   1.00 34.35 ? 421 HIS B C     1 
ATOM   1925 O O     . HIS B 1 39  ? -24.272 9.101   9.026   1.00 34.07 ? 421 HIS B O     1 
ATOM   1926 C CB    . HIS B 1 39  ? -23.875 12.215  10.530  1.00 34.67 ? 421 HIS B CB    1 
ATOM   1927 C CG    . HIS B 1 39  ? -24.424 11.399  11.653  1.00 37.71 ? 421 HIS B CG    1 
ATOM   1928 N ND1   . HIS B 1 39  ? -23.617 10.699  12.529  1.00 40.02 ? 421 HIS B ND1   1 
ATOM   1929 C CD2   . HIS B 1 39  ? -25.701 11.131  12.016  1.00 39.05 ? 421 HIS B CD2   1 
ATOM   1930 C CE1   . HIS B 1 39  ? -24.373 10.038  13.388  1.00 39.28 ? 421 HIS B CE1   1 
ATOM   1931 N NE2   . HIS B 1 39  ? -25.640 10.282  13.098  1.00 40.14 ? 421 HIS B NE2   1 
ATOM   1932 N N     . ASP B 1 40  ? -25.672 10.704  8.385   1.00 34.43 ? 422 ASP B N     1 
ATOM   1933 C CA    . ASP B 1 40  ? -26.607 9.727   7.889   1.00 35.25 ? 422 ASP B CA    1 
ATOM   1934 C C     . ASP B 1 40  ? -25.950 8.632   7.061   1.00 35.76 ? 422 ASP B C     1 
ATOM   1935 O O     . ASP B 1 40  ? -26.191 7.447   7.263   1.00 36.41 ? 422 ASP B O     1 
ATOM   1936 C CB    . ASP B 1 40  ? -27.612 10.402  7.011   1.00 35.53 ? 422 ASP B CB    1 
ATOM   1937 C CG    . ASP B 1 40  ? -28.898 10.600  7.688   1.00 38.75 ? 422 ASP B CG    1 
ATOM   1938 O OD1   . ASP B 1 40  ? -28.909 11.103  8.836   1.00 42.00 ? 422 ASP B OD1   1 
ATOM   1939 O OD2   . ASP B 1 40  ? -29.915 10.253  7.060   1.00 43.19 ? 422 ASP B OD2   1 
ATOM   1940 N N     . TYR B 1 41  ? -25.122 9.025   6.106   1.00 36.16 ? 423 TYR B N     1 
ATOM   1941 C CA    . TYR B 1 41  ? -24.666 8.082   5.105   1.00 36.14 ? 423 TYR B CA    1 
ATOM   1942 C C     . TYR B 1 41  ? -23.791 7.071   5.791   1.00 37.04 ? 423 TYR B C     1 
ATOM   1943 O O     . TYR B 1 41  ? -23.881 5.886   5.535   1.00 37.03 ? 423 TYR B O     1 
ATOM   1944 C CB    . TYR B 1 41  ? -23.927 8.784   3.966   1.00 35.49 ? 423 TYR B CB    1 
ATOM   1945 C CG    . TYR B 1 41  ? -22.902 7.922   3.278   1.00 33.27 ? 423 TYR B CG    1 
ATOM   1946 C CD1   . TYR B 1 41  ? -23.199 7.245   2.087   1.00 29.74 ? 423 TYR B CD1   1 
ATOM   1947 C CD2   . TYR B 1 41  ? -21.630 7.781   3.822   1.00 31.83 ? 423 TYR B CD2   1 
ATOM   1948 C CE1   . TYR B 1 41  ? -22.241 6.437   1.456   1.00 28.94 ? 423 TYR B CE1   1 
ATOM   1949 C CE2   . TYR B 1 41  ? -20.667 6.984   3.202   1.00 31.56 ? 423 TYR B CE2   1 
ATOM   1950 C CZ    . TYR B 1 41  ? -20.975 6.321   2.028   1.00 29.08 ? 423 TYR B CZ    1 
ATOM   1951 O OH    . TYR B 1 41  ? -19.990 5.565   1.479   1.00 26.88 ? 423 TYR B OH    1 
ATOM   1952 N N     . TYR B 1 42  ? -22.964 7.552   6.697   1.00 37.92 ? 424 TYR B N     1 
ATOM   1953 C CA    . TYR B 1 42  ? -22.149 6.666   7.467   1.00 38.82 ? 424 TYR B CA    1 
ATOM   1954 C C     . TYR B 1 42  ? -22.938 5.571   8.135   1.00 39.17 ? 424 TYR B C     1 
ATOM   1955 O O     . TYR B 1 42  ? -22.637 4.401   7.975   1.00 39.32 ? 424 TYR B O     1 
ATOM   1956 C CB    . TYR B 1 42  ? -21.446 7.442   8.526   1.00 38.76 ? 424 TYR B CB    1 
ATOM   1957 C CG    . TYR B 1 42  ? -20.056 7.000   8.581   1.00 40.27 ? 424 TYR B CG    1 
ATOM   1958 C CD1   . TYR B 1 42  ? -19.625 6.138   9.596   1.00 42.17 ? 424 TYR B CD1   1 
ATOM   1959 C CD2   . TYR B 1 42  ? -19.150 7.406   7.591   1.00 39.34 ? 424 TYR B CD2   1 
ATOM   1960 C CE1   . TYR B 1 42  ? -18.306 5.706   9.643   1.00 42.13 ? 424 TYR B CE1   1 
ATOM   1961 C CE2   . TYR B 1 42  ? -17.847 6.990   7.616   1.00 41.05 ? 424 TYR B CE2   1 
ATOM   1962 C CZ    . TYR B 1 42  ? -17.426 6.138   8.641   1.00 42.68 ? 424 TYR B CZ    1 
ATOM   1963 O OH    . TYR B 1 42  ? -16.120 5.721   8.670   1.00 45.56 ? 424 TYR B OH    1 
ATOM   1964 N N     . GLU B 1 43  ? -23.953 5.944   8.890   1.00 39.89 ? 425 GLU B N     1 
ATOM   1965 C CA    . GLU B 1 43  ? -24.744 4.928   9.546   1.00 41.13 ? 425 GLU B CA    1 
ATOM   1966 C C     . GLU B 1 43  ? -25.210 3.902   8.509   1.00 41.24 ? 425 GLU B C     1 
ATOM   1967 O O     . GLU B 1 43  ? -24.942 2.718   8.653   1.00 41.56 ? 425 GLU B O     1 
ATOM   1968 C CB    . GLU B 1 43  ? -25.906 5.541   10.331  1.00 41.20 ? 425 GLU B CB    1 
ATOM   1969 C CG    . GLU B 1 43  ? -25.465 6.159   11.664  1.00 43.97 ? 425 GLU B CG    1 
ATOM   1970 C CD    . GLU B 1 43  ? -26.544 7.058   12.296  1.00 48.44 ? 425 GLU B CD    1 
ATOM   1971 O OE1   . GLU B 1 43  ? -27.643 7.209   11.714  1.00 49.22 ? 425 GLU B OE1   1 
ATOM   1972 O OE2   . GLU B 1 43  ? -26.298 7.623   13.386  1.00 50.82 ? 425 GLU B OE2   1 
ATOM   1973 N N     . HIS B 1 44  ? -25.862 4.355   7.444   1.00 41.18 ? 426 HIS B N     1 
ATOM   1974 C CA    . HIS B 1 44  ? -26.371 3.431   6.442   1.00 40.85 ? 426 HIS B CA    1 
ATOM   1975 C C     . HIS B 1 44  ? -25.278 2.666   5.721   1.00 40.89 ? 426 HIS B C     1 
ATOM   1976 O O     . HIS B 1 44  ? -25.435 1.510   5.375   1.00 40.95 ? 426 HIS B O     1 
ATOM   1977 C CB    . HIS B 1 44  ? -27.248 4.157   5.442   1.00 40.76 ? 426 HIS B CB    1 
ATOM   1978 C CG    . HIS B 1 44  ? -28.558 4.582   6.014   1.00 41.21 ? 426 HIS B CG    1 
ATOM   1979 N ND1   . HIS B 1 44  ? -29.651 3.748   6.057   1.00 41.49 ? 426 HIS B ND1   1 
ATOM   1980 C CD2   . HIS B 1 44  ? -28.947 5.743   6.587   1.00 41.66 ? 426 HIS B CD2   1 
ATOM   1981 C CE1   . HIS B 1 44  ? -30.663 4.381   6.623   1.00 42.14 ? 426 HIS B CE1   1 
ATOM   1982 N NE2   . HIS B 1 44  ? -30.262 5.593   6.953   1.00 41.49 ? 426 HIS B NE2   1 
ATOM   1983 N N     . ARG B 1 45  ? -24.192 3.331   5.449   1.00 41.17 ? 427 ARG B N     1 
ATOM   1984 C CA    . ARG B 1 45  ? -23.149 2.662   4.766   1.00 41.63 ? 427 ARG B CA    1 
ATOM   1985 C C     . ARG B 1 45  ? -22.462 1.576   5.529   1.00 42.70 ? 427 ARG B C     1 
ATOM   1986 O O     . ARG B 1 45  ? -22.263 0.476   5.008   1.00 43.29 ? 427 ARG B O     1 
ATOM   1987 C CB    . ARG B 1 45  ? -22.089 3.733   4.263   1.00 20.00 ? 427 ARG B CB    1 
ATOM   1988 C CG    . ARG B 1 45  ? -20.823 3.165   3.616   1.00 20.00 ? 427 ARG B CG    1 
ATOM   1989 C CD    . ARG B 1 45  ? -21.097 2.509   2.267   1.00 20.00 ? 427 ARG B CD    1 
ATOM   1990 N NE    . ARG B 1 45  ? -19.874 2.010   1.639   1.00 20.00 ? 427 ARG B NE    1 
ATOM   1991 C CZ    . ARG B 1 45  ? -19.325 0.821   1.882   1.00 20.00 ? 427 ARG B CZ    1 
ATOM   1992 N NH1   . ARG B 1 45  ? -19.879 -0.017  2.751   1.00 20.00 ? 427 ARG B NH1   1 
ATOM   1993 N NH2   . ARG B 1 45  ? -18.212 0.469   1.255   1.00 20.00 ? 427 ARG B NH2   1 
ATOM   1994 N N     . TYR B 1 46  ? -22.130 1.855   6.788   1.00 43.54 ? 428 TYR B N     1 
ATOM   1995 C CA    . TYR B 1 46  ? -21.399 0.901   7.625   1.00 44.53 ? 428 TYR B CA    1 
ATOM   1996 C C     . TYR B 1 46  ? -22.258 0.263   8.721   1.00 45.46 ? 428 TYR B C     1 
ATOM   1997 O O     . TYR B 1 46  ? -21.959 -0.844  9.178   1.00 45.33 ? 428 TYR B O     1 
ATOM   1998 C CB    . TYR B 1 46  ? -20.155 1.561   8.229   1.00 20.00 ? 428 TYR B CB    1 
ATOM   1999 C CG    . TYR B 1 46  ? -19.187 2.107   7.199   1.00 20.00 ? 428 TYR B CG    1 
ATOM   2000 C CD1   . TYR B 1 46  ? -18.388 1.251   6.439   1.00 20.00 ? 428 TYR B CD1   1 
ATOM   2001 C CD2   . TYR B 1 46  ? -19.067 3.481   6.987   1.00 20.00 ? 428 TYR B CD2   1 
ATOM   2002 C CE1   . TYR B 1 46  ? -17.497 1.748   5.492   1.00 20.00 ? 428 TYR B CE1   1 
ATOM   2003 C CE2   . TYR B 1 46  ? -18.177 3.989   6.043   1.00 20.00 ? 428 TYR B CE2   1 
ATOM   2004 C CZ    . TYR B 1 46  ? -17.397 3.117   5.299   1.00 20.00 ? 428 TYR B CZ    1 
ATOM   2005 O OH    . TYR B 1 46  ? -16.518 3.613   4.365   1.00 20.00 ? 428 TYR B OH    1 
ATOM   2006 N N     . GLN B 1 47  ? -23.315 0.967   9.128   1.00 46.86 ? 429 GLN B N     1 
ATOM   2007 C CA    . GLN B 1 47  ? -24.265 0.500   10.151  1.00 48.68 ? 429 GLN B CA    1 
ATOM   2008 C C     . GLN B 1 47  ? -23.613 0.098   11.482  1.00 49.89 ? 429 GLN B C     1 
ATOM   2009 O O     . GLN B 1 47  ? -23.948 -0.936  12.067  1.00 50.25 ? 429 GLN B O     1 
ATOM   2010 C CB    . GLN B 1 47  ? -25.162 -0.624  9.606   1.00 48.42 ? 429 GLN B CB    1 
ATOM   2011 C CG    . GLN B 1 47  ? -26.257 -0.147  8.656   1.00 49.90 ? 429 GLN B CG    1 
ATOM   2012 C CD    . GLN B 1 47  ? -27.142 -1.277  8.156   1.00 53.61 ? 429 GLN B CD    1 
ATOM   2013 O OE1   . GLN B 1 47  ? -26.655 -2.317  7.709   1.00 54.75 ? 429 GLN B OE1   1 
ATOM   2014 N NE2   . GLN B 1 47  ? -28.453 -1.071  8.218   1.00 53.76 ? 429 GLN B NE2   1 
ATOM   2015 N N     . GLY B 1 48  ? -22.683 0.929   11.949  1.00 51.26 ? 430 GLY B N     1 
ATOM   2016 C CA    . GLY B 1 48  ? -22.045 0.738   13.251  1.00 52.57 ? 430 GLY B CA    1 
ATOM   2017 C C     . GLY B 1 48  ? -20.842 -0.190  13.272  1.00 53.62 ? 430 GLY B C     1 
ATOM   2018 O O     . GLY B 1 48  ? -20.240 -0.400  14.327  1.00 54.03 ? 430 GLY B O     1 
ATOM   2019 N N     . LYS B 1 49  ? -20.489 -0.744  12.113  1.00 54.54 ? 431 LYS B N     1 
ATOM   2020 C CA    . LYS B 1 49  ? -19.378 -1.693  12.011  1.00 55.83 ? 431 LYS B CA    1 
ATOM   2021 C C     . LYS B 1 49  ? -18.360 -1.410  10.855  1.00 56.49 ? 431 LYS B C     1 
ATOM   2022 O O     . LYS B 1 49  ? -18.776 -1.176  9.700   1.00 56.99 ? 431 LYS B O     1 
ATOM   2023 C CB    . LYS B 1 49  ? -19.900 -3.134  11.961  1.00 56.08 ? 431 LYS B CB    1 
ATOM   2024 C CG    . LYS B 1 49  ? -20.453 -3.657  13.280  1.00 57.04 ? 431 LYS B CG    1 
ATOM   2025 C CD    . LYS B 1 49  ? -21.066 -5.037  13.110  1.00 56.39 ? 431 LYS B CD    1 
ATOM   2026 C CE    . LYS B 1 49  ? -21.680 -5.530  14.409  1.00 56.07 ? 431 LYS B CE    1 
ATOM   2027 N NZ    . LYS B 1 49  ? -22.318 -6.866  14.250  1.00 55.54 ? 431 LYS B NZ    1 
ATOM   2028 N N     . ILE B 1 50  ? -17.073 -1.578  11.108  1.00 56.81 ? 432 ILE B N     1 
ATOM   2029 C CA    . ILE B 1 50  ? -16.130 -1.516  10.003  1.00 57.55 ? 432 ILE B CA    1 
ATOM   2030 C C     . ILE B 1 50  ? -15.108 -2.666  10.056  1.00 58.39 ? 432 ILE B C     1 
ATOM   2031 O O     . ILE B 1 50  ? -14.502 -2.907  11.116  1.00 59.13 ? 432 ILE B O     1 
ATOM   2032 C CB    . ILE B 1 50  ? -15.478 -0.118  9.913   1.00 57.10 ? 432 ILE B CB    1 
ATOM   2033 C CG1   . ILE B 1 50  ? -16.516 0.880   9.382   1.00 57.40 ? 432 ILE B CG1   1 
ATOM   2034 C CG2   . ILE B 1 50  ? -14.255 -0.157  9.021   1.00 56.86 ? 432 ILE B CG2   1 
ATOM   2035 C CD1   . ILE B 1 50  ? -16.075 2.311   9.276   1.00 57.32 ? 432 ILE B CD1   1 
ATOM   2036 N N     . PHE B 1 51  ? -14.950 -3.379  8.930   1.00 58.46 ? 433 PHE B N     1 
ATOM   2037 C CA    . PHE B 1 51  ? -13.923 -4.430  8.783   1.00 58.61 ? 433 PHE B CA    1 
ATOM   2038 C C     . PHE B 1 51  ? -13.385 -4.609  7.336   1.00 58.50 ? 433 PHE B C     1 
ATOM   2039 O O     . PHE B 1 51  ? -13.994 -4.148  6.374   1.00 58.41 ? 433 PHE B O     1 
ATOM   2040 C CB    . PHE B 1 51  ? -14.340 -5.752  9.478   1.00 58.79 ? 433 PHE B CB    1 
ATOM   2041 C CG    . PHE B 1 51  ? -15.676 -6.338  9.006   1.00 60.69 ? 433 PHE B CG    1 
ATOM   2042 C CD1   . PHE B 1 51  ? -16.599 -5.582  8.237   1.00 61.77 ? 433 PHE B CD1   1 
ATOM   2043 C CD2   . PHE B 1 51  ? -16.029 -7.666  9.360   1.00 60.46 ? 433 PHE B CD2   1 
ATOM   2044 C CE1   . PHE B 1 51  ? -17.846 -6.159  7.817   1.00 61.68 ? 433 PHE B CE1   1 
ATOM   2045 C CE2   . PHE B 1 51  ? -17.264 -8.245  8.945   1.00 59.09 ? 433 PHE B CE2   1 
ATOM   2046 C CZ    . PHE B 1 51  ? -18.165 -7.494  8.175   1.00 59.91 ? 433 PHE B CZ    1 
ATOM   2047 N N     . ASP B 1 52  ? -12.234 -5.260  7.203   1.00 58.61 ? 434 ASP B N     1 
ATOM   2048 C CA    . ASP B 1 52  ? -11.428 -5.165  5.986   1.00 59.02 ? 434 ASP B CA    1 
ATOM   2049 C C     . ASP B 1 52  ? -11.893 -6.395  5.203   1.00 58.69 ? 434 ASP B C     1 
ATOM   2050 O O     . ASP B 1 52  ? -11.121 -7.329  5.010   1.00 58.61 ? 434 ASP B O     1 
ATOM   2051 C CB    . ASP B 1 52  ? -9.939  -5.365  6.355   1.00 59.80 ? 434 ASP B CB    1 
ATOM   2052 C CG    . ASP B 1 52  ? -8.979  -4.417  5.599   1.00 61.38 ? 434 ASP B CG    1 
ATOM   2053 O OD1   . ASP B 1 52  ? -8.643  -3.350  6.169   1.00 64.39 ? 434 ASP B OD1   1 
ATOM   2054 O OD2   . ASP B 1 52  ? -8.519  -4.747  4.474   1.00 62.22 ? 434 ASP B OD2   1 
ATOM   2055 N N     . GLU B 1 53  ? -13.143 -6.396  4.742   1.00 58.43 ? 435 GLU B N     1 
ATOM   2056 C CA    . GLU B 1 53  ? -13.672 -7.446  3.843   1.00 58.08 ? 435 GLU B CA    1 
ATOM   2057 C C     . GLU B 1 53  ? -12.619 -7.970  2.875   1.00 57.36 ? 435 GLU B C     1 
ATOM   2058 O O     . GLU B 1 53  ? -12.206 -9.132  2.969   1.00 57.12 ? 435 GLU B O     1 
ATOM   2059 C CB    . GLU B 1 53  ? -14.920 -6.962  3.091   1.00 58.36 ? 435 GLU B CB    1 
ATOM   2060 C CG    . GLU B 1 53  ? -16.028 -6.494  4.052   1.00 60.67 ? 435 GLU B CG    1 
ATOM   2061 C CD    . GLU B 1 53  ? -17.437 -6.437  3.450   1.00 62.90 ? 435 GLU B CD    1 
ATOM   2062 O OE1   . GLU B 1 53  ? -17.627 -5.720  2.436   1.00 65.03 ? 435 GLU B OE1   1 
ATOM   2063 O OE2   . GLU B 1 53  ? -18.359 -7.078  4.025   1.00 62.05 ? 435 GLU B OE2   1 
ATOM   2064 N N     . GLU B 1 54  ? -12.163 -7.099  1.974   1.00 56.65 ? 436 GLU B N     1 
ATOM   2065 C CA    . GLU B 1 54  ? -11.100 -7.451  1.022   1.00 55.90 ? 436 GLU B CA    1 
ATOM   2066 C C     . GLU B 1 54  ? -9.935  -8.243  1.638   1.00 54.70 ? 436 GLU B C     1 
ATOM   2067 O O     . GLU B 1 54  ? -9.756  -9.420  1.304   1.00 54.54 ? 436 GLU B O     1 
ATOM   2068 C CB    . GLU B 1 54  ? -10.607 -6.224  0.223   1.00 56.49 ? 436 GLU B CB    1 
ATOM   2069 C CG    . GLU B 1 54  ? -11.144 -6.141  -1.225  1.00 58.17 ? 436 GLU B CG    1 
ATOM   2070 C CD    . GLU B 1 54  ? -10.812 -7.405  -2.063  1.00 61.26 ? 436 GLU B CD    1 
ATOM   2071 O OE1   . GLU B 1 54  ? -9.898  -8.184  -1.647  1.00 61.52 ? 436 GLU B OE1   1 
ATOM   2072 O OE2   . GLU B 1 54  ? -11.468 -7.615  -3.128  1.00 61.47 ? 436 GLU B OE2   1 
ATOM   2073 N N     . ASN B 1 55  ? -9.174  -7.611  2.539   1.00 53.52 ? 437 ASN B N     1 
ATOM   2074 C CA    . ASN B 1 55  ? -8.090  -8.284  3.303   1.00 52.20 ? 437 ASN B CA    1 
ATOM   2075 C C     . ASN B 1 55  ? -8.407  -9.740  3.620   1.00 51.04 ? 437 ASN B C     1 
ATOM   2076 O O     . ASN B 1 55  ? -7.653  -10.641 3.264   1.00 51.22 ? 437 ASN B O     1 
ATOM   2077 C CB    . ASN B 1 55  ? -7.781  -7.535  4.621   1.00 52.33 ? 437 ASN B CB    1 
ATOM   2078 C CG    . ASN B 1 55  ? -6.513  -8.045  5.333   1.00 52.87 ? 437 ASN B CG    1 
ATOM   2079 O OD1   . ASN B 1 55  ? -5.456  -8.188  4.720   1.00 54.38 ? 437 ASN B OD1   1 
ATOM   2080 N ND2   . ASN B 1 55  ? -6.619  -8.293  6.639   1.00 52.62 ? 437 ASN B ND2   1 
ATOM   2081 N N     . ILE B 1 56  ? -9.543  -9.955  4.269   1.00 49.67 ? 438 ILE B N     1 
ATOM   2082 C CA    . ILE B 1 56  ? -9.941  -11.261 4.781   1.00 48.46 ? 438 ILE B CA    1 
ATOM   2083 C C     . ILE B 1 56  ? -10.208 -12.291 3.672   1.00 47.31 ? 438 ILE B C     1 
ATOM   2084 O O     . ILE B 1 56  ? -10.021 -13.492 3.871   1.00 46.57 ? 438 ILE B O     1 
ATOM   2085 C CB    . ILE B 1 56  ? -11.159 -11.092 5.710   1.00 48.82 ? 438 ILE B CB    1 
ATOM   2086 C CG1   . ILE B 1 56  ? -10.770 -10.211 6.911   1.00 50.43 ? 438 ILE B CG1   1 
ATOM   2087 C CG2   . ILE B 1 56  ? -11.673 -12.422 6.195   1.00 48.70 ? 438 ILE B CG2   1 
ATOM   2088 C CD1   . ILE B 1 56  ? -11.685 -8.975  7.131   1.00 53.38 ? 438 ILE B CD1   1 
ATOM   2089 N N     . LEU B 1 57  ? -10.628 -11.825 2.500   1.00 46.03 ? 439 LEU B N     1 
ATOM   2090 C CA    . LEU B 1 57  ? -10.858 -12.748 1.399   1.00 44.87 ? 439 LEU B CA    1 
ATOM   2091 C C     . LEU B 1 57  ? -9.540  -13.143 0.726   1.00 44.68 ? 439 LEU B C     1 
ATOM   2092 O O     . LEU B 1 57  ? -9.388  -14.259 0.203   1.00 44.52 ? 439 LEU B O     1 
ATOM   2093 C CB    . LEU B 1 57  ? -11.906 -12.192 0.401   1.00 44.82 ? 439 LEU B CB    1 
ATOM   2094 C CG    . LEU B 1 57  ? -13.355 -11.927 0.888   1.00 42.67 ? 439 LEU B CG    1 
ATOM   2095 C CD1   . LEU B 1 57  ? -14.255 -11.662 -0.300  1.00 41.17 ? 439 LEU B CD1   1 
ATOM   2096 C CD2   . LEU B 1 57  ? -13.941 -13.060 1.741   1.00 37.34 ? 439 LEU B CD2   1 
ATOM   2097 N N     . SER B 1 58  ? -8.584  -12.218 0.771   1.00 44.37 ? 440 SER B N     1 
ATOM   2098 C CA    . SER B 1 58  ? -7.236  -12.379 0.186   1.00 44.07 ? 440 SER B CA    1 
ATOM   2099 C C     . SER B 1 58  ? -6.379  -13.491 0.811   1.00 43.35 ? 440 SER B C     1 
ATOM   2100 O O     . SER B 1 58  ? -5.412  -13.974 0.196   1.00 43.38 ? 440 SER B O     1 
ATOM   2101 C CB    . SER B 1 58  ? -6.493  -11.072 0.360   1.00 44.34 ? 440 SER B CB    1 
ATOM   2102 O OG    . SER B 1 58  ? -7.434  -10.013 0.467   1.00 46.66 ? 440 SER B OG    1 
ATOM   2103 N N     . GLU B 1 59  ? -6.731  -13.879 2.038   1.00 42.10 ? 441 GLU B N     1 
ATOM   2104 C CA    . GLU B 1 59  ? -6.026  -14.913 2.774   1.00 40.58 ? 441 GLU B CA    1 
ATOM   2105 C C     . GLU B 1 59  ? -6.468  -16.287 2.313   1.00 38.88 ? 441 GLU B C     1 
ATOM   2106 O O     . GLU B 1 59  ? -5.779  -17.298 2.521   1.00 39.02 ? 441 GLU B O     1 
ATOM   2107 C CB    . GLU B 1 59  ? -6.327  -14.754 4.249   1.00 41.21 ? 441 GLU B CB    1 
ATOM   2108 C CG    . GLU B 1 59  ? -6.125  -13.324 4.787   1.00 45.14 ? 441 GLU B CG    1 
ATOM   2109 C CD    . GLU B 1 59  ? -6.383  -13.218 6.303   1.00 50.23 ? 441 GLU B CD    1 
ATOM   2110 O OE1   . GLU B 1 59  ? -5.907  -14.106 7.054   1.00 51.84 ? 441 GLU B OE1   1 
ATOM   2111 O OE2   . GLU B 1 59  ? -7.054  -12.249 6.751   1.00 53.01 ? 441 GLU B OE2   1 
ATOM   2112 N N     . LEU B 1 60  ? -7.634  -16.317 1.683   1.00 36.61 ? 442 LEU B N     1 
ATOM   2113 C CA    . LEU B 1 60  ? -8.204  -17.543 1.186   1.00 34.33 ? 442 LEU B CA    1 
ATOM   2114 C C     . LEU B 1 60  ? -7.858  -17.780 -0.281  1.00 33.88 ? 442 LEU B C     1 
ATOM   2115 O O     . LEU B 1 60  ? -7.346  -16.893 -0.939  1.00 34.21 ? 442 LEU B O     1 
ATOM   2116 C CB    . LEU B 1 60  ? -9.701  -17.488 1.364   1.00 33.61 ? 442 LEU B CB    1 
ATOM   2117 C CG    . LEU B 1 60  ? -10.231 -17.178 2.760   1.00 31.83 ? 442 LEU B CG    1 
ATOM   2118 C CD1   . LEU B 1 60  ? -11.711 -17.250 2.667   1.00 28.95 ? 442 LEU B CD1   1 
ATOM   2119 C CD2   . LEU B 1 60  ? -9.717  -18.129 3.852   1.00 29.89 ? 442 LEU B CD2   1 
ATOM   2120 N N     . ASN B 1 61  ? -8.142  -18.988 -0.772  1.00 32.90 ? 443 ASN B N     1 
ATOM   2121 C CA    . ASN B 1 61  ? -7.923  -19.387 -2.147  1.00 31.64 ? 443 ASN B CA    1 
ATOM   2122 C C     . ASN B 1 61  ? -9.165  -19.100 -2.939  1.00 31.63 ? 443 ASN B C     1 
ATOM   2123 O O     . ASN B 1 61  ? -10.093 -18.567 -2.388  1.00 31.70 ? 443 ASN B O     1 
ATOM   2124 C CB    . ASN B 1 61  ? -7.632  -20.866 -2.192  1.00 31.08 ? 443 ASN B CB    1 
ATOM   2125 C CG    . ASN B 1 61  ? -8.834  -21.697 -1.856  1.00 29.87 ? 443 ASN B CG    1 
ATOM   2126 O OD1   . ASN B 1 61  ? -9.895  -21.172 -1.540  1.00 29.02 ? 443 ASN B OD1   1 
ATOM   2127 N ND2   . ASN B 1 61  ? -8.681  -23.004 -1.911  1.00 28.56 ? 443 ASN B ND2   1 
ATOM   2128 N N     . ASP B 1 62  ? -9.202  -19.465 -4.221  1.00 32.38 ? 444 ASP B N     1 
ATOM   2129 C CA    . ASP B 1 62  ? -10.352 -19.137 -5.100  1.00 32.45 ? 444 ASP B CA    1 
ATOM   2130 C C     . ASP B 1 62  ? -11.582 -19.947 -4.829  1.00 31.60 ? 444 ASP B C     1 
ATOM   2131 O O     . ASP B 1 62  ? -12.665 -19.378 -4.777  1.00 32.04 ? 444 ASP B O     1 
ATOM   2132 C CB    . ASP B 1 62  ? -10.020 -19.285 -6.590  1.00 33.58 ? 444 ASP B CB    1 
ATOM   2133 C CG    . ASP B 1 62  ? -9.391  -18.042 -7.168  1.00 36.14 ? 444 ASP B CG    1 
ATOM   2134 O OD1   . ASP B 1 62  ? -9.788  -16.950 -6.719  1.00 39.90 ? 444 ASP B OD1   1 
ATOM   2135 O OD2   . ASP B 1 62  ? -8.498  -18.152 -8.053  1.00 39.01 ? 444 ASP B OD2   1 
ATOM   2136 N N     . PRO B 1 63  ? -11.441 -21.282 -4.708  1.00 30.76 ? 445 PRO B N     1 
ATOM   2137 C CA    . PRO B 1 63  ? -12.629 -22.090 -4.463  1.00 30.17 ? 445 PRO B CA    1 
ATOM   2138 C C     . PRO B 1 63  ? -13.456 -21.548 -3.305  1.00 30.16 ? 445 PRO B C     1 
ATOM   2139 O O     . PRO B 1 63  ? -14.677 -21.317 -3.468  1.00 30.10 ? 445 PRO B O     1 
ATOM   2140 C CB    . PRO B 1 63  ? -12.045 -23.442 -4.120  1.00 30.12 ? 445 PRO B CB    1 
ATOM   2141 C CG    . PRO B 1 63  ? -10.860 -23.507 -4.985  1.00 30.65 ? 445 PRO B CG    1 
ATOM   2142 C CD    . PRO B 1 63  ? -10.266 -22.126 -4.976  1.00 30.07 ? 445 PRO B CD    1 
ATOM   2143 N N     . LEU B 1 64  ? -12.796 -21.312 -2.168  1.00 29.42 ? 446 LEU B N     1 
ATOM   2144 C CA    . LEU B 1 64  ? -13.480 -20.778 -0.999  1.00 29.14 ? 446 LEU B CA    1 
ATOM   2145 C C     . LEU B 1 64  ? -14.041 -19.389 -1.257  1.00 28.99 ? 446 LEU B C     1 
ATOM   2146 O O     . LEU B 1 64  ? -15.169 -19.103 -0.893  1.00 29.22 ? 446 LEU B O     1 
ATOM   2147 C CB    . LEU B 1 64  ? -12.570 -20.770 0.224   1.00 28.83 ? 446 LEU B CB    1 
ATOM   2148 C CG    . LEU B 1 64  ? -12.103 -22.115 0.785   1.00 28.17 ? 446 LEU B CG    1 
ATOM   2149 C CD1   . LEU B 1 64  ? -10.996 -21.890 1.758   1.00 26.82 ? 446 LEU B CD1   1 
ATOM   2150 C CD2   . LEU B 1 64  ? -13.225 -22.844 1.466   1.00 28.21 ? 446 LEU B CD2   1 
ATOM   2151 N N     . ARG B 1 65  ? -13.260 -18.539 -1.901  1.00 29.01 ? 447 ARG B N     1 
ATOM   2152 C CA    . ARG B 1 65  ? -13.678 -17.177 -2.228  1.00 29.45 ? 447 ARG B CA    1 
ATOM   2153 C C     . ARG B 1 65  ? -14.936 -17.202 -3.103  1.00 29.08 ? 447 ARG B C     1 
ATOM   2154 O O     . ARG B 1 65  ? -15.814 -16.391 -2.934  1.00 29.07 ? 447 ARG B O     1 
ATOM   2155 C CB    . ARG B 1 65  ? -12.532 -16.461 -2.948  1.00 29.74 ? 447 ARG B CB    1 
ATOM   2156 C CG    . ARG B 1 65  ? -12.306 -15.008 -2.594  1.00 32.76 ? 447 ARG B CG    1 
ATOM   2157 C CD    . ARG B 1 65  ? -11.109 -14.424 -3.386  1.00 36.09 ? 447 ARG B CD    1 
ATOM   2158 N NE    . ARG B 1 65  ? -9.811  -14.887 -2.872  1.00 37.46 ? 447 ARG B NE    1 
ATOM   2159 C CZ    . ARG B 1 65  ? -8.858  -15.476 -3.603  1.00 39.10 ? 447 ARG B CZ    1 
ATOM   2160 N NH1   . ARG B 1 65  ? -9.007  -15.684 -4.906  1.00 38.93 ? 447 ARG B NH1   1 
ATOM   2161 N NH2   . ARG B 1 65  ? -7.731  -15.857 -3.033  1.00 40.05 ? 447 ARG B NH2   1 
ATOM   2162 N N     . GLU B 1 66  ? -15.028 -18.159 -4.016  1.00 29.35 ? 448 GLU B N     1 
ATOM   2163 C CA    . GLU B 1 66  ? -16.200 -18.312 -4.885  1.00 29.97 ? 448 GLU B CA    1 
ATOM   2164 C C     . GLU B 1 66  ? -17.456 -18.895 -4.167  1.00 29.72 ? 448 GLU B C     1 
ATOM   2165 O O     . GLU B 1 66  ? -18.542 -18.381 -4.347  1.00 29.07 ? 448 GLU B O     1 
ATOM   2166 C CB    . GLU B 1 66  ? -15.827 -19.153 -6.113  1.00 30.65 ? 448 GLU B CB    1 
ATOM   2167 C CG    . GLU B 1 66  ? -14.716 -18.557 -7.016  1.00 33.27 ? 448 GLU B CG    1 
ATOM   2168 C CD    . GLU B 1 66  ? -14.248 -19.468 -8.206  1.00 37.31 ? 448 GLU B CD    1 
ATOM   2169 O OE1   . GLU B 1 66  ? -14.849 -20.551 -8.448  1.00 39.06 ? 448 GLU B OE1   1 
ATOM   2170 O OE2   . GLU B 1 66  ? -13.266 -19.084 -8.912  1.00 37.87 ? 448 GLU B OE2   1 
ATOM   2171 N N     . GLU B 1 67  ? -17.313 -19.949 -3.355  1.00 29.70 ? 449 GLU B N     1 
ATOM   2172 C CA    . GLU B 1 67  ? -18.425 -20.424 -2.508  1.00 30.07 ? 449 GLU B CA    1 
ATOM   2173 C C     . GLU B 1 67  ? -19.042 -19.286 -1.737  1.00 29.93 ? 449 GLU B C     1 
ATOM   2174 O O     . GLU B 1 67  ? -20.260 -19.156 -1.691  1.00 30.70 ? 449 GLU B O     1 
ATOM   2175 C CB    . GLU B 1 67  ? -17.985 -21.470 -1.497  1.00 29.84 ? 449 GLU B CB    1 
ATOM   2176 C CG    . GLU B 1 67  ? -17.435 -22.746 -2.127  1.00 35.61 ? 449 GLU B CG    1 
ATOM   2177 C CD    . GLU B 1 67  ? -17.272 -23.911 -1.139  1.00 41.21 ? 449 GLU B CD    1 
ATOM   2178 O OE1   . GLU B 1 67  ? -16.258 -24.660 -1.245  1.00 40.54 ? 449 GLU B OE1   1 
ATOM   2179 O OE2   . GLU B 1 67  ? -18.164 -24.073 -0.260  1.00 43.32 ? 449 GLU B OE2   1 
ATOM   2180 N N     . ILE B 1 68  ? -18.202 -18.454 -1.129  1.00 29.31 ? 450 ILE B N     1 
ATOM   2181 C CA    . ILE B 1 68  ? -18.680 -17.405 -0.253  1.00 28.42 ? 450 ILE B CA    1 
ATOM   2182 C C     . ILE B 1 68  ? -19.425 -16.326 -0.991  1.00 28.92 ? 450 ILE B C     1 
ATOM   2183 O O     . ILE B 1 68  ? -20.586 -16.061 -0.678  1.00 29.52 ? 450 ILE B O     1 
ATOM   2184 C CB    . ILE B 1 68  ? -17.559 -16.747 0.477   1.00 28.19 ? 450 ILE B CB    1 
ATOM   2185 C CG1   . ILE B 1 68  ? -16.942 -17.763 1.427   1.00 28.22 ? 450 ILE B CG1   1 
ATOM   2186 C CG2   . ILE B 1 68  ? -18.064 -15.500 1.216   1.00 26.78 ? 450 ILE B CG2   1 
ATOM   2187 C CD1   . ILE B 1 68  ? -15.709 -17.269 2.112   1.00 27.85 ? 450 ILE B CD1   1 
ATOM   2188 N N     . VAL B 1 69  ? -18.772 -15.684 -1.956  1.00 28.51 ? 451 VAL B N     1 
ATOM   2189 C CA    . VAL B 1 69  ? -19.419 -14.623 -2.710  1.00 28.17 ? 451 VAL B CA    1 
ATOM   2190 C C     . VAL B 1 69  ? -20.771 -15.165 -3.258  1.00 28.78 ? 451 VAL B C     1 
ATOM   2191 O O     . VAL B 1 69  ? -21.812 -14.463 -3.242  1.00 29.90 ? 451 VAL B O     1 
ATOM   2192 C CB    . VAL B 1 69  ? -18.474 -14.082 -3.814  1.00 27.93 ? 451 VAL B CB    1 
ATOM   2193 C CG1   . VAL B 1 69  ? -19.071 -12.911 -4.509  1.00 27.04 ? 451 VAL B CG1   1 
ATOM   2194 C CG2   . VAL B 1 69  ? -17.187 -13.614 -3.188  1.00 28.62 ? 451 VAL B CG2   1 
ATOM   2195 N N     . ASN B 1 70  ? -20.773 -16.432 -3.687  1.00 28.04 ? 452 ASN B N     1 
ATOM   2196 C CA    . ASN B 1 70  ? -21.981 -17.040 -4.200  1.00 27.02 ? 452 ASN B CA    1 
ATOM   2197 C C     . ASN B 1 70  ? -23.069 -17.123 -3.141  1.00 27.32 ? 452 ASN B C     1 
ATOM   2198 O O     . ASN B 1 70  ? -24.220 -16.788 -3.391  1.00 27.72 ? 452 ASN B O     1 
ATOM   2199 C CB    . ASN B 1 70  ? -21.666 -18.354 -4.884  1.00 25.92 ? 452 ASN B CB    1 
ATOM   2200 C CG    . ASN B 1 70  ? -21.429 -18.157 -6.362  1.00 25.11 ? 452 ASN B CG    1 
ATOM   2201 O OD1   . ASN B 1 70  ? -22.353 -17.767 -7.068  1.00 25.05 ? 452 ASN B OD1   1 
ATOM   2202 N ND2   . ASN B 1 70  ? -20.190 -18.352 -6.835  1.00 20.40 ? 452 ASN B ND2   1 
ATOM   2203 N N     . PHE B 1 71  ? -22.683 -17.481 -1.934  1.00 26.98 ? 453 PHE B N     1 
ATOM   2204 C CA    . PHE B 1 71  ? -23.630 -17.557 -0.880  1.00 27.09 ? 453 PHE B CA    1 
ATOM   2205 C C     . PHE B 1 71  ? -24.207 -16.189 -0.470  1.00 28.53 ? 453 PHE B C     1 
ATOM   2206 O O     . PHE B 1 71  ? -25.427 -16.059 -0.237  1.00 29.03 ? 453 PHE B O     1 
ATOM   2207 C CB    . PHE B 1 71  ? -22.967 -18.208 0.279   1.00 26.21 ? 453 PHE B CB    1 
ATOM   2208 C CG    . PHE B 1 71  ? -23.865 -18.468 1.379   1.00 25.52 ? 453 PHE B CG    1 
ATOM   2209 C CD1   . PHE B 1 71  ? -24.602 -19.626 1.403   1.00 25.52 ? 453 PHE B CD1   1 
ATOM   2210 C CD2   . PHE B 1 71  ? -23.980 -17.564 2.431   1.00 25.40 ? 453 PHE B CD2   1 
ATOM   2211 C CE1   . PHE B 1 71  ? -25.463 -19.888 2.481   1.00 27.67 ? 453 PHE B CE1   1 
ATOM   2212 C CE2   . PHE B 1 71  ? -24.846 -17.822 3.518   1.00 24.57 ? 453 PHE B CE2   1 
ATOM   2213 C CZ    . PHE B 1 71  ? -25.586 -18.965 3.542   1.00 25.82 ? 453 PHE B CZ    1 
ATOM   2214 N N     . ASN B 1 72  ? -23.345 -15.175 -0.372  1.00 29.11 ? 454 ASN B N     1 
ATOM   2215 C CA    . ASN B 1 72  ? -23.758 -13.885 0.134   1.00 29.51 ? 454 ASN B CA    1 
ATOM   2216 C C     . ASN B 1 72  ? -24.650 -13.187 -0.869  1.00 30.31 ? 454 ASN B C     1 
ATOM   2217 O O     . ASN B 1 72  ? -25.544 -12.419 -0.496  1.00 30.65 ? 454 ASN B O     1 
ATOM   2218 C CB    . ASN B 1 72  ? -22.549 -13.015 0.389   1.00 29.65 ? 454 ASN B CB    1 
ATOM   2219 C CG    . ASN B 1 72  ? -21.746 -13.448 1.598   1.00 30.63 ? 454 ASN B CG    1 
ATOM   2220 O OD1   . ASN B 1 72  ? -22.182 -14.287 2.387   1.00 33.66 ? 454 ASN B OD1   1 
ATOM   2221 N ND2   . ASN B 1 72  ? -20.561 -12.861 1.757   1.00 29.70 ? 454 ASN B ND2   1 
ATOM   2222 N N     . CYS B 1 73  ? -24.413 -13.458 -2.147  1.00 30.55 ? 455 CYS B N     1 
ATOM   2223 C CA    . CYS B 1 73  ? -25.166 -12.813 -3.198  1.00 30.96 ? 455 CYS B CA    1 
ATOM   2224 C C     . CYS B 1 73  ? -26.308 -13.672 -3.736  1.00 30.46 ? 455 CYS B C     1 
ATOM   2225 O O     . CYS B 1 73  ? -26.874 -13.381 -4.793  1.00 30.59 ? 455 CYS B O     1 
ATOM   2226 C CB    . CYS B 1 73  ? -24.214 -12.405 -4.307  1.00 31.29 ? 455 CYS B CB    1 
ATOM   2227 S SG    . CYS B 1 73  ? -23.264 -10.965 -3.824  1.00 35.76 ? 455 CYS B SG    1 
ATOM   2228 N N     . ARG B 1 74  ? -26.648 -14.714 -2.987  1.00 29.98 ? 456 ARG B N     1 
ATOM   2229 C CA    . ARG B 1 74  ? -27.729 -15.640 -3.314  1.00 29.49 ? 456 ARG B CA    1 
ATOM   2230 C C     . ARG B 1 74  ? -29.054 -15.026 -3.721  1.00 29.94 ? 456 ARG B C     1 
ATOM   2231 O O     . ARG B 1 74  ? -29.641 -15.465 -4.693  1.00 30.38 ? 456 ARG B O     1 
ATOM   2232 C CB    . ARG B 1 74  ? -27.968 -16.587 -2.152  1.00 29.53 ? 456 ARG B CB    1 
ATOM   2233 C CG    . ARG B 1 74  ? -27.743 -18.001 -2.513  1.00 27.54 ? 456 ARG B CG    1 
ATOM   2234 C CD    . ARG B 1 74  ? -27.262 -18.780 -1.369  1.00 25.38 ? 456 ARG B CD    1 
ATOM   2235 N NE    . ARG B 1 74  ? -28.217 -19.045 -0.304  1.00 24.92 ? 456 ARG B NE    1 
ATOM   2236 C CZ    . ARG B 1 74  ? -28.317 -18.301 0.791   1.00 28.62 ? 456 ARG B CZ    1 
ATOM   2237 N NH1   . ARG B 1 74  ? -27.566 -17.215 0.916   1.00 29.86 ? 456 ARG B NH1   1 
ATOM   2238 N NH2   . ARG B 1 74  ? -29.167 -18.622 1.762   1.00 28.27 ? 456 ARG B NH2   1 
ATOM   2239 N N     . LYS B 1 75  ? -29.554 -14.034 -2.991  1.00 30.58 ? 457 LYS B N     1 
ATOM   2240 C CA    . LYS B 1 75  ? -30.816 -13.401 -3.406  1.00 30.93 ? 457 LYS B CA    1 
ATOM   2241 C C     . LYS B 1 75  ? -30.640 -12.524 -4.644  1.00 30.65 ? 457 LYS B C     1 
ATOM   2242 O O     . LYS B 1 75  ? -31.505 -12.480 -5.494  1.00 30.38 ? 457 LYS B O     1 
ATOM   2243 C CB    . LYS B 1 75  ? -31.451 -12.607 -2.264  1.00 31.62 ? 457 LYS B CB    1 
ATOM   2244 C CG    . LYS B 1 75  ? -32.870 -12.130 -2.542  1.00 32.91 ? 457 LYS B CG    1 
ATOM   2245 C CD    . LYS B 1 75  ? -33.277 -11.048 -1.575  1.00 35.46 ? 457 LYS B CD    1 
ATOM   2246 C CE    . LYS B 1 75  ? -34.246 -10.069 -2.249  1.00 37.77 ? 457 LYS B CE    1 
ATOM   2247 N NZ    . LYS B 1 75  ? -34.975 -9.275  -1.207  1.00 40.13 ? 457 LYS B NZ    1 
ATOM   2248 N N     . LEU B 1 76  ? -29.511 -11.846 -4.758  1.00 30.92 ? 458 LEU B N     1 
ATOM   2249 C CA    . LEU B 1 76  ? -29.255 -11.029 -5.932  1.00 31.82 ? 458 LEU B CA    1 
ATOM   2250 C C     . LEU B 1 76  ? -29.293 -11.832 -7.228  1.00 32.30 ? 458 LEU B C     1 
ATOM   2251 O O     . LEU B 1 76  ? -29.950 -11.439 -8.180  1.00 32.57 ? 458 LEU B O     1 
ATOM   2252 C CB    . LEU B 1 76  ? -27.923 -10.319 -5.792  1.00 32.01 ? 458 LEU B CB    1 
ATOM   2253 C CG    . LEU B 1 76  ? -27.675 -9.072  -6.643  1.00 33.71 ? 458 LEU B CG    1 
ATOM   2254 C CD1   . LEU B 1 76  ? -26.650 -9.337  -7.734  1.00 34.77 ? 458 LEU B CD1   1 
ATOM   2255 C CD2   . LEU B 1 76  ? -28.954 -8.429  -7.232  1.00 36.27 ? 458 LEU B CD2   1 
ATOM   2256 N N     . VAL B 1 77  ? -28.602 -12.964 -7.256  1.00 32.69 ? 459 VAL B N     1 
ATOM   2257 C CA    . VAL B 1 77  ? -28.561 -13.799 -8.437  1.00 33.15 ? 459 VAL B CA    1 
ATOM   2258 C C     . VAL B 1 77  ? -29.953 -14.342 -8.727  1.00 33.81 ? 459 VAL B C     1 
ATOM   2259 O O     . VAL B 1 77  ? -30.351 -14.458 -9.889  1.00 33.69 ? 459 VAL B O     1 
ATOM   2260 C CB    . VAL B 1 77  ? -27.583 -14.987 -8.237  1.00 33.38 ? 459 VAL B CB    1 
ATOM   2261 C CG1   . VAL B 1 77  ? -27.866 -16.120 -9.212  1.00 32.15 ? 459 VAL B CG1   1 
ATOM   2262 C CG2   . VAL B 1 77  ? -26.128 -14.516 -8.312  1.00 33.64 ? 459 VAL B CG2   1 
ATOM   2263 N N     . ALA B 1 78  ? -30.694 -14.670 -7.672  1.00 34.21 ? 460 ALA B N     1 
ATOM   2264 C CA    . ALA B 1 78  ? -31.943 -15.380 -7.845  1.00 34.99 ? 460 ALA B CA    1 
ATOM   2265 C C     . ALA B 1 78  ? -33.087 -14.512 -8.356  1.00 36.08 ? 460 ALA B C     1 
ATOM   2266 O O     . ALA B 1 78  ? -33.976 -15.034 -9.012  1.00 36.85 ? 460 ALA B O     1 
ATOM   2267 C CB    . ALA B 1 78  ? -32.326 -16.079 -6.591  1.00 34.64 ? 460 ALA B CB    1 
ATOM   2268 N N     . THR B 1 79  ? -33.061 -13.204 -8.080  1.00 36.97 ? 461 THR B N     1 
ATOM   2269 C CA    . THR B 1 79  ? -34.104 -12.264 -8.549  1.00 37.44 ? 461 THR B CA    1 
ATOM   2270 C C     . THR B 1 79  ? -33.709 -11.458 -9.764  1.00 37.81 ? 461 THR B C     1 
ATOM   2271 O O     . THR B 1 79  ? -34.294 -10.414 -10.025 1.00 38.34 ? 461 THR B O     1 
ATOM   2272 C CB    . THR B 1 79  ? -34.436 -11.241 -7.504  1.00 37.08 ? 461 THR B CB    1 
ATOM   2273 O OG1   . THR B 1 79  ? -33.225 -10.863 -6.849  1.00 38.79 ? 461 THR B OG1   1 
ATOM   2274 C CG2   . THR B 1 79  ? -35.332 -11.832 -6.484  1.00 37.98 ? 461 THR B CG2   1 
ATOM   2275 N N     . MET B 1 80  ? -32.742 -11.956 -10.521 1.00 38.29 ? 462 MET B N     1 
ATOM   2276 C CA    . MET B 1 80  ? -32.160 -11.228 -11.639 1.00 38.50 ? 462 MET B CA    1 
ATOM   2277 C C     . MET B 1 80  ? -32.147 -12.012 -12.924 1.00 37.75 ? 462 MET B C     1 
ATOM   2278 O O     . MET B 1 80  ? -31.158 -12.654 -13.256 1.00 37.01 ? 462 MET B O     1 
ATOM   2279 C CB    . MET B 1 80  ? -30.731 -10.946 -11.297 1.00 39.48 ? 462 MET B CB    1 
ATOM   2280 C CG    . MET B 1 80  ? -30.454 -9.557  -10.941 1.00 42.70 ? 462 MET B CG    1 
ATOM   2281 S SD    . MET B 1 80  ? -29.419 -8.832  -12.206 1.00 46.33 ? 462 MET B SD    1 
ATOM   2282 C CE    . MET B 1 80  ? -29.333 -7.284  -11.295 1.00 47.39 ? 462 MET B CE    1 
ATOM   2283 N N     . PRO B 1 81  ? -33.241 -11.956 -13.670 1.00 37.77 ? 463 PRO B N     1 
ATOM   2284 C CA    . PRO B 1 81  ? -33.303 -12.765 -14.871 1.00 37.91 ? 463 PRO B CA    1 
ATOM   2285 C C     . PRO B 1 81  ? -31.932 -13.000 -15.522 1.00 38.08 ? 463 PRO B C     1 
ATOM   2286 O O     . PRO B 1 81  ? -31.575 -14.127 -15.790 1.00 38.37 ? 463 PRO B O     1 
ATOM   2287 C CB    . PRO B 1 81  ? -34.214 -11.948 -15.783 1.00 38.09 ? 463 PRO B CB    1 
ATOM   2288 C CG    . PRO B 1 81  ? -35.084 -11.100 -14.818 1.00 37.83 ? 463 PRO B CG    1 
ATOM   2289 C CD    . PRO B 1 81  ? -34.472 -11.173 -13.448 1.00 37.57 ? 463 PRO B CD    1 
ATOM   2290 N N     . LEU B 1 82  ? -31.159 -11.949 -15.746 1.00 38.45 ? 464 LEU B N     1 
ATOM   2291 C CA    . LEU B 1 82  ? -29.858 -12.066 -16.408 1.00 38.50 ? 464 LEU B CA    1 
ATOM   2292 C C     . LEU B 1 82  ? -28.856 -13.017 -15.764 1.00 38.42 ? 464 LEU B C     1 
ATOM   2293 O O     . LEU B 1 82  ? -28.084 -13.683 -16.452 1.00 38.58 ? 464 LEU B O     1 
ATOM   2294 C CB    . LEU B 1 82  ? -29.193 -10.702 -16.467 1.00 38.64 ? 464 LEU B CB    1 
ATOM   2295 C CG    . LEU B 1 82  ? -27.983 -10.710 -17.414 1.00 40.10 ? 464 LEU B CG    1 
ATOM   2296 C CD1   . LEU B 1 82  ? -28.382 -10.241 -18.839 1.00 41.20 ? 464 LEU B CD1   1 
ATOM   2297 C CD2   . LEU B 1 82  ? -26.790 -9.904  -16.861 1.00 40.13 ? 464 LEU B CD2   1 
ATOM   2298 N N     . PHE B 1 83  ? -28.824 -13.022 -14.440 1.00 38.00 ? 465 PHE B N     1 
ATOM   2299 C CA    . PHE B 1 83  ? -27.899 -13.857 -13.713 1.00 37.47 ? 465 PHE B CA    1 
ATOM   2300 C C     . PHE B 1 83  ? -28.525 -15.210 -13.505 1.00 36.71 ? 465 PHE B C     1 
ATOM   2301 O O     . PHE B 1 83  ? -27.967 -16.219 -13.850 1.00 36.23 ? 465 PHE B O     1 
ATOM   2302 C CB    . PHE B 1 83  ? -27.589 -13.217 -12.358 1.00 38.05 ? 465 PHE B CB    1 
ATOM   2303 C CG    . PHE B 1 83  ? -26.525 -12.137 -12.406 1.00 38.33 ? 465 PHE B CG    1 
ATOM   2304 C CD1   . PHE B 1 83  ? -26.011 -11.692 -13.618 1.00 38.48 ? 465 PHE B CD1   1 
ATOM   2305 C CD2   . PHE B 1 83  ? -26.071 -11.553 -11.221 1.00 38.04 ? 465 PHE B CD2   1 
ATOM   2306 C CE1   . PHE B 1 83  ? -25.053 -10.719 -13.650 1.00 38.70 ? 465 PHE B CE1   1 
ATOM   2307 C CE2   . PHE B 1 83  ? -25.128 -10.570 -11.237 1.00 37.39 ? 465 PHE B CE2   1 
ATOM   2308 C CZ    . PHE B 1 83  ? -24.605 -10.155 -12.456 1.00 39.56 ? 465 PHE B CZ    1 
ATOM   2309 N N     . ALA B 1 84  ? -29.714 -15.204 -12.945 1.00 36.46 ? 466 ALA B N     1 
ATOM   2310 C CA    . ALA B 1 84  ? -30.481 -16.409 -12.720 1.00 36.19 ? 466 ALA B CA    1 
ATOM   2311 C C     . ALA B 1 84  ? -30.499 -17.391 -13.876 1.00 36.03 ? 466 ALA B C     1 
ATOM   2312 O O     . ALA B 1 84  ? -30.563 -18.589 -13.662 1.00 36.43 ? 466 ALA B O     1 
ATOM   2313 C CB    . ALA B 1 84  ? -31.881 -16.035 -12.355 1.00 36.29 ? 466 ALA B CB    1 
ATOM   2314 N N     . ASN B 1 85  ? -30.454 -16.892 -15.099 1.00 36.26 ? 467 ASN B N     1 
ATOM   2315 C CA    . ASN B 1 85  ? -30.584 -17.742 -16.292 1.00 36.65 ? 467 ASN B CA    1 
ATOM   2316 C C     . ASN B 1 85  ? -29.299 -17.878 -17.058 1.00 36.24 ? 467 ASN B C     1 
ATOM   2317 O O     . ASN B 1 85  ? -29.331 -18.002 -18.274 1.00 37.17 ? 467 ASN B O     1 
ATOM   2318 C CB    . ASN B 1 85  ? -31.657 -17.196 -17.248 1.00 36.73 ? 467 ASN B CB    1 
ATOM   2319 C CG    . ASN B 1 85  ? -33.037 -17.431 -16.731 1.00 38.11 ? 467 ASN B CG    1 
ATOM   2320 O OD1   . ASN B 1 85  ? -33.557 -18.557 -16.795 1.00 40.33 ? 467 ASN B OD1   1 
ATOM   2321 N ND2   . ASN B 1 85  ? -33.634 -16.389 -16.161 1.00 37.30 ? 467 ASN B ND2   1 
ATOM   2322 N N     . ALA B 1 86  ? -28.179 -17.857 -16.354 1.00 35.50 ? 468 ALA B N     1 
ATOM   2323 C CA    . ALA B 1 86  ? -26.880 -17.790 -16.983 1.00 35.00 ? 468 ALA B CA    1 
ATOM   2324 C C     . ALA B 1 86  ? -25.911 -18.873 -16.471 1.00 35.12 ? 468 ALA B C     1 
ATOM   2325 O O     . ALA B 1 86  ? -26.147 -19.521 -15.450 1.00 35.16 ? 468 ALA B O     1 
ATOM   2326 C CB    . ALA B 1 86  ? -26.302 -16.397 -16.786 1.00 34.65 ? 468 ALA B CB    1 
ATOM   2327 N N     . ASP B 1 87  ? -24.837 -19.085 -17.220 1.00 35.42 ? 469 ASP B N     1 
ATOM   2328 C CA    . ASP B 1 87  ? -23.728 -19.918 -16.798 1.00 35.73 ? 469 ASP B CA    1 
ATOM   2329 C C     . ASP B 1 87  ? -23.275 -19.466 -15.379 1.00 35.54 ? 469 ASP B C     1 
ATOM   2330 O O     . ASP B 1 87  ? -22.818 -18.336 -15.198 1.00 35.55 ? 469 ASP B O     1 
ATOM   2331 C CB    . ASP B 1 87  ? -22.615 -19.815 -17.855 1.00 35.52 ? 469 ASP B CB    1 
ATOM   2332 C CG    . ASP B 1 87  ? -21.430 -20.746 -17.591 1.00 37.82 ? 469 ASP B CG    1 
ATOM   2333 O OD1   . ASP B 1 87  ? -21.285 -21.309 -16.483 1.00 39.83 ? 469 ASP B OD1   1 
ATOM   2334 O OD2   . ASP B 1 87  ? -20.601 -20.899 -18.510 1.00 40.39 ? 469 ASP B OD2   1 
ATOM   2335 N N     . PRO B 1 88  ? -23.438 -20.343 -14.365 1.00 35.14 ? 470 PRO B N     1 
ATOM   2336 C CA    . PRO B 1 88  ? -22.987 -20.042 -13.016 1.00 34.62 ? 470 PRO B CA    1 
ATOM   2337 C C     . PRO B 1 88  ? -21.560 -19.553 -12.943 1.00 33.92 ? 470 PRO B C     1 
ATOM   2338 O O     . PRO B 1 88  ? -21.200 -18.863 -11.994 1.00 34.22 ? 470 PRO B O     1 
ATOM   2339 C CB    . PRO B 1 88  ? -23.128 -21.386 -12.313 1.00 34.40 ? 470 PRO B CB    1 
ATOM   2340 C CG    . PRO B 1 88  ? -24.398 -21.894 -12.887 1.00 35.21 ? 470 PRO B CG    1 
ATOM   2341 C CD    . PRO B 1 88  ? -24.261 -21.570 -14.371 1.00 35.35 ? 470 PRO B CD    1 
ATOM   2342 N N     . ASN B 1 89  ? -20.766 -19.887 -13.938 1.00 32.94 ? 471 ASN B N     1 
ATOM   2343 C CA    . ASN B 1 89  ? -19.397 -19.456 -13.939 1.00 32.78 ? 471 ASN B CA    1 
ATOM   2344 C C     . ASN B 1 89  ? -19.247 -17.992 -14.331 1.00 31.59 ? 471 ASN B C     1 
ATOM   2345 O O     . ASN B 1 89  ? -18.416 -17.267 -13.761 1.00 31.28 ? 471 ASN B O     1 
ATOM   2346 C CB    . ASN B 1 89  ? -18.532 -20.402 -14.790 1.00 33.63 ? 471 ASN B CB    1 
ATOM   2347 C CG    . ASN B 1 89  ? -18.312 -21.774 -14.113 1.00 33.99 ? 471 ASN B CG    1 
ATOM   2348 O OD1   . ASN B 1 89  ? -18.312 -22.798 -14.771 1.00 36.61 ? 471 ASN B OD1   1 
ATOM   2349 N ND2   . ASN B 1 89  ? -18.126 -21.781 -12.800 1.00 34.52 ? 471 ASN B ND2   1 
ATOM   2350 N N     . PHE B 1 90  ? -20.060 -17.574 -15.294 1.00 30.48 ? 472 PHE B N     1 
ATOM   2351 C CA    . PHE B 1 90  ? -20.203 -16.170 -15.642 1.00 29.36 ? 472 PHE B CA    1 
ATOM   2352 C C     . PHE B 1 90  ? -20.656 -15.384 -14.417 1.00 29.34 ? 472 PHE B C     1 
ATOM   2353 O O     . PHE B 1 90  ? -20.008 -14.424 -13.994 1.00 29.68 ? 472 PHE B O     1 
ATOM   2354 C CB    . PHE B 1 90  ? -21.241 -16.006 -16.728 1.00 28.65 ? 472 PHE B CB    1 
ATOM   2355 C CG    . PHE B 1 90  ? -21.691 -14.601 -16.903 1.00 28.23 ? 472 PHE B CG    1 
ATOM   2356 C CD1   . PHE B 1 90  ? -20.983 -13.726 -17.727 1.00 27.42 ? 472 PHE B CD1   1 
ATOM   2357 C CD2   . PHE B 1 90  ? -22.803 -14.125 -16.222 1.00 27.28 ? 472 PHE B CD2   1 
ATOM   2358 C CE1   . PHE B 1 90  ? -21.389 -12.414 -17.881 1.00 26.65 ? 472 PHE B CE1   1 
ATOM   2359 C CE2   . PHE B 1 90  ? -23.220 -12.801 -16.366 1.00 26.05 ? 472 PHE B CE2   1 
ATOM   2360 C CZ    . PHE B 1 90  ? -22.521 -11.951 -17.189 1.00 26.40 ? 472 PHE B CZ    1 
ATOM   2361 N N     . VAL B 1 91  ? -21.774 -15.802 -13.841 1.00 28.67 ? 473 VAL B N     1 
ATOM   2362 C CA    . VAL B 1 91  ? -22.181 -15.282 -12.567 1.00 28.05 ? 473 VAL B CA    1 
ATOM   2363 C C     . VAL B 1 91  ? -20.955 -15.171 -11.648 1.00 28.00 ? 473 VAL B C     1 
ATOM   2364 O O     . VAL B 1 91  ? -20.533 -14.078 -11.321 1.00 28.24 ? 473 VAL B O     1 
ATOM   2365 C CB    . VAL B 1 91  ? -23.353 -16.078 -11.994 1.00 27.80 ? 473 VAL B CB    1 
ATOM   2366 C CG1   . VAL B 1 91  ? -23.731 -15.565 -10.659 1.00 28.14 ? 473 VAL B CG1   1 
ATOM   2367 C CG2   . VAL B 1 91  ? -24.534 -15.917 -12.887 1.00 26.49 ? 473 VAL B CG2   1 
ATOM   2368 N N     . THR B 1 92  ? -20.317 -16.276 -11.299 1.00 28.49 ? 474 THR B N     1 
ATOM   2369 C CA    . THR B 1 92  ? -19.131 -16.202 -10.415 1.00 28.23 ? 474 THR B CA    1 
ATOM   2370 C C     . THR B 1 92  ? -18.117 -15.154 -10.852 1.00 28.76 ? 474 THR B C     1 
ATOM   2371 O O     . THR B 1 92  ? -17.752 -14.293 -10.049 1.00 28.60 ? 474 THR B O     1 
ATOM   2372 C CB    . THR B 1 92  ? -18.448 -17.550 -10.220 1.00 27.78 ? 474 THR B CB    1 
ATOM   2373 O OG1   . THR B 1 92  ? -19.422 -18.466 -9.763  1.00 26.45 ? 474 THR B OG1   1 
ATOM   2374 C CG2   . THR B 1 92  ? -17.377 -17.451 -9.161  1.00 26.96 ? 474 THR B CG2   1 
ATOM   2375 N N     . ALA B 1 93  ? -17.679 -15.207 -12.109 1.00 29.20 ? 475 ALA B N     1 
ATOM   2376 C CA    . ALA B 1 93  ? -16.782 -14.174 -12.610 1.00 29.57 ? 475 ALA B CA    1 
ATOM   2377 C C     . ALA B 1 93  ? -17.327 -12.805 -12.216 1.00 30.07 ? 475 ALA B C     1 
ATOM   2378 O O     . ALA B 1 93  ? -16.636 -12.045 -11.550 1.00 30.34 ? 475 ALA B O     1 
ATOM   2379 C CB    . ALA B 1 93  ? -16.609 -14.279 -14.097 1.00 29.28 ? 475 ALA B CB    1 
ATOM   2380 N N     . MET B 1 94  ? -18.573 -12.510 -12.580 1.00 30.16 ? 476 MET B N     1 
ATOM   2381 C CA    . MET B 1 94  ? -19.168 -11.206 -12.295 1.00 30.64 ? 476 MET B CA    1 
ATOM   2382 C C     . MET B 1 94  ? -19.159 -10.855 -10.839 1.00 30.28 ? 476 MET B C     1 
ATOM   2383 O O     . MET B 1 94  ? -18.636 -9.839  -10.463 1.00 30.65 ? 476 MET B O     1 
ATOM   2384 C CB    . MET B 1 94  ? -20.619 -11.172 -12.723 1.00 31.29 ? 476 MET B CB    1 
ATOM   2385 C CG    . MET B 1 94  ? -20.811 -11.189 -14.195 1.00 32.93 ? 476 MET B CG    1 
ATOM   2386 S SD    . MET B 1 94  ? -20.321 -9.604  -14.818 1.00 34.53 ? 476 MET B SD    1 
ATOM   2387 C CE    . MET B 1 94  ? -21.889 -8.884  -15.311 1.00 34.66 ? 476 MET B CE    1 
ATOM   2388 N N     . LEU B 1 95  ? -19.771 -11.685 -10.013 1.00 30.11 ? 477 LEU B N     1 
ATOM   2389 C CA    . LEU B 1 95  ? -19.811 -11.440 -8.582  1.00 29.86 ? 477 LEU B CA    1 
ATOM   2390 C C     . LEU B 1 95  ? -18.451 -11.092 -7.973  1.00 30.59 ? 477 LEU B C     1 
ATOM   2391 O O     . LEU B 1 95  ? -18.395 -10.319 -7.036  1.00 30.54 ? 477 LEU B O     1 
ATOM   2392 C CB    . LEU B 1 95  ? -20.378 -12.653 -7.889  1.00 29.28 ? 477 LEU B CB    1 
ATOM   2393 C CG    . LEU B 1 95  ? -21.837 -12.705 -7.463  1.00 28.99 ? 477 LEU B CG    1 
ATOM   2394 C CD1   . LEU B 1 95  ? -22.761 -12.067 -8.439  1.00 28.29 ? 477 LEU B CD1   1 
ATOM   2395 C CD2   . LEU B 1 95  ? -22.235 -14.152 -7.256  1.00 30.66 ? 477 LEU B CD2   1 
ATOM   2396 N N     . SER B 1 96  ? -17.356 -11.648 -8.509  1.00 31.49 ? 478 SER B N     1 
ATOM   2397 C CA    . SER B 1 96  ? -16.011 -11.438 -7.955  1.00 31.86 ? 478 SER B CA    1 
ATOM   2398 C C     . SER B 1 96  ? -15.626 -10.006 -8.010  1.00 32.37 ? 478 SER B C     1 
ATOM   2399 O O     . SER B 1 96  ? -14.893 -9.565  -7.156  1.00 33.23 ? 478 SER B O     1 
ATOM   2400 C CB    . SER B 1 96  ? -14.935 -12.198 -8.722  1.00 31.87 ? 478 SER B CB    1 
ATOM   2401 O OG    . SER B 1 96  ? -15.200 -13.575 -8.685  1.00 33.01 ? 478 SER B OG    1 
ATOM   2402 N N     . LYS B 1 97  ? -16.103 -9.280  -9.017  1.00 32.55 ? 479 LYS B N     1 
ATOM   2403 C CA    . LYS B 1 97  ? -15.608 -7.935  -9.301  1.00 32.47 ? 479 LYS B CA    1 
ATOM   2404 C C     . LYS B 1 97  ? -16.546 -6.819  -8.834  1.00 31.60 ? 479 LYS B C     1 
ATOM   2405 O O     . LYS B 1 97  ? -16.248 -5.657  -9.027  1.00 31.94 ? 479 LYS B O     1 
ATOM   2406 C CB    . LYS B 1 97  ? -15.310 -7.785  -10.802 1.00 33.16 ? 479 LYS B CB    1 
ATOM   2407 C CG    . LYS B 1 97  ? -14.720 -9.020  -11.498 1.00 36.01 ? 479 LYS B CG    1 
ATOM   2408 C CD    . LYS B 1 97  ? -13.279 -8.826  -11.967 1.00 42.02 ? 479 LYS B CD    1 
ATOM   2409 C CE    . LYS B 1 97  ? -12.427 -10.114 -11.756 1.00 44.99 ? 479 LYS B CE    1 
ATOM   2410 N NZ    . LYS B 1 97  ? -11.746 -10.139 -10.393 1.00 43.62 ? 479 LYS B NZ    1 
ATOM   2411 N N     . LEU B 1 98  ? -17.658 -7.156  -8.204  1.00 31.12 ? 480 LEU B N     1 
ATOM   2412 C CA    . LEU B 1 98  ? -18.614 -6.142  -7.752  1.00 31.09 ? 480 LEU B CA    1 
ATOM   2413 C C     . LEU B 1 98  ? -18.130 -5.425  -6.515  1.00 31.94 ? 480 LEU B C     1 
ATOM   2414 O O     . LEU B 1 98  ? -17.644 -6.063  -5.614  1.00 33.21 ? 480 LEU B O     1 
ATOM   2415 C CB    . LEU B 1 98  ? -19.956 -6.794  -7.427  1.00 30.25 ? 480 LEU B CB    1 
ATOM   2416 C CG    . LEU B 1 98  ? -20.683 -7.597  -8.508  1.00 28.51 ? 480 LEU B CG    1 
ATOM   2417 C CD1   . LEU B 1 98  ? -22.073 -7.924  -8.028  1.00 26.25 ? 480 LEU B CD1   1 
ATOM   2418 C CD2   . LEU B 1 98  ? -20.728 -6.848  -9.812  1.00 26.30 ? 480 LEU B CD2   1 
ATOM   2419 N N     . ARG B 1 99  ? -18.347 -4.133  -6.425  1.00 32.69 ? 481 ARG B N     1 
ATOM   2420 C CA    . ARG B 1 99  ? -18.028 -3.408  -5.220  1.00 33.55 ? 481 ARG B CA    1 
ATOM   2421 C C     . ARG B 1 99  ? -19.295 -2.753  -4.700  1.00 32.64 ? 481 ARG B C     1 
ATOM   2422 O O     . ARG B 1 99  ? -20.061 -2.272  -5.449  1.00 32.26 ? 481 ARG B O     1 
ATOM   2423 C CB    . ARG B 1 99  ? -16.942 -2.382  -5.448  1.00 20.00 ? 481 ARG B CB    1 
ATOM   2424 C CG    . ARG B 1 99  ? -15.813 -2.832  -6.312  1.00 20.00 ? 481 ARG B CG    1 
ATOM   2425 C CD    . ARG B 1 99  ? -14.601 -3.405  -5.587  1.00 20.00 ? 481 ARG B CD    1 
ATOM   2426 N NE    . ARG B 1 99  ? -13.675 -3.966  -6.570  1.00 20.00 ? 481 ARG B NE    1 
ATOM   2427 C CZ    . ARG B 1 99  ? -13.269 -5.227  -6.609  1.00 20.00 ? 481 ARG B CZ    1 
ATOM   2428 N NH1   . ARG B 1 99  ? -13.646 -6.083  -5.681  1.00 20.00 ? 481 ARG B NH1   1 
ATOM   2429 N NH2   . ARG B 1 99  ? -12.464 -5.620  -7.574  1.00 20.00 ? 481 ARG B NH2   1 
ATOM   2430 N N     . PHE B 1 100 ? -19.501 -2.773  -3.402  1.00 32.01 ? 482 PHE B N     1 
ATOM   2431 C CA    . PHE B 1 100 ? -20.698 -2.288  -2.766  1.00 31.29 ? 482 PHE B CA    1 
ATOM   2432 C C     . PHE B 1 100 ? -20.726 -0.759  -2.639  1.00 31.70 ? 482 PHE B C     1 
ATOM   2433 O O     . PHE B 1 100 ? -19.702 -0.131  -2.454  1.00 32.21 ? 482 PHE B O     1 
ATOM   2434 C CB    . PHE B 1 100 ? -20.751 -2.925  -1.393  1.00 31.09 ? 482 PHE B CB    1 
ATOM   2435 C CG    . PHE B 1 100 ? -21.940 -2.549  -0.599  1.00 31.32 ? 482 PHE B CG    1 
ATOM   2436 C CD1   . PHE B 1 100 ? -23.216 -2.920  -1.006  1.00 31.77 ? 482 PHE B CD1   1 
ATOM   2437 C CD2   . PHE B 1 100 ? -21.797 -1.816  0.560   1.00 31.34 ? 482 PHE B CD2   1 
ATOM   2438 C CE1   . PHE B 1 100 ? -24.331 -2.540  -0.275  1.00 31.12 ? 482 PHE B CE1   1 
ATOM   2439 C CE2   . PHE B 1 100 ? -22.912 -1.440  1.291   1.00 32.24 ? 482 PHE B CE2   1 
ATOM   2440 C CZ    . PHE B 1 100 ? -24.178 -1.800  0.872   1.00 30.05 ? 482 PHE B CZ    1 
ATOM   2441 N N     . GLU B 1 101 ? -21.901 -0.153  -2.730  1.00 32.00 ? 483 GLU B N     1 
ATOM   2442 C CA    . GLU B 1 101 ? -22.023 1.292   -2.640  1.00 32.54 ? 483 GLU B CA    1 
ATOM   2443 C C     . GLU B 1 101 ? -23.388 1.683   -2.081  1.00 31.96 ? 483 GLU B C     1 
ATOM   2444 O O     . GLU B 1 101 ? -24.365 0.939   -2.244  1.00 31.46 ? 483 GLU B O     1 
ATOM   2445 C CB    . GLU B 1 101 ? -21.868 1.931   -4.021  1.00 33.20 ? 483 GLU B CB    1 
ATOM   2446 C CG    . GLU B 1 101 ? -20.531 1.689   -4.726  1.00 37.71 ? 483 GLU B CG    1 
ATOM   2447 C CD    . GLU B 1 101 ? -20.201 2.751   -5.798  1.00 44.15 ? 483 GLU B CD    1 
ATOM   2448 O OE1   . GLU B 1 101 ? -20.556 3.946   -5.589  1.00 47.37 ? 483 GLU B OE1   1 
ATOM   2449 O OE2   . GLU B 1 101 ? -19.570 2.395   -6.835  1.00 45.88 ? 483 GLU B OE2   1 
ATOM   2450 N N     . VAL B 1 102 ? -23.457 2.853   -1.437  1.00 31.55 ? 484 VAL B N     1 
ATOM   2451 C CA    . VAL B 1 102 ? -24.728 3.358   -0.911  1.00 31.43 ? 484 VAL B CA    1 
ATOM   2452 C C     . VAL B 1 102 ? -24.976 4.770   -1.394  1.00 30.93 ? 484 VAL B C     1 
ATOM   2453 O O     . VAL B 1 102 ? -24.073 5.590   -1.366  1.00 30.74 ? 484 VAL B O     1 
ATOM   2454 C CB    . VAL B 1 102 ? -24.820 3.290   0.660   1.00 31.48 ? 484 VAL B CB    1 
ATOM   2455 C CG1   . VAL B 1 102 ? -26.074 3.908   1.122   1.00 32.11 ? 484 VAL B CG1   1 
ATOM   2456 C CG2   . VAL B 1 102 ? -24.841 1.853   1.162   1.00 31.21 ? 484 VAL B CG2   1 
ATOM   2457 N N     . PHE B 1 103 ? -26.204 5.034   -1.824  1.00 30.60 ? 485 PHE B N     1 
ATOM   2458 C CA    . PHE B 1 103 ? -26.633 6.343   -2.275  1.00 30.86 ? 485 PHE B CA    1 
ATOM   2459 C C     . PHE B 1 103 ? -27.793 6.798   -1.435  1.00 31.79 ? 485 PHE B C     1 
ATOM   2460 O O     . PHE B 1 103 ? -28.547 5.949   -0.985  1.00 32.56 ? 485 PHE B O     1 
ATOM   2461 C CB    . PHE B 1 103 ? -27.049 6.263   -3.725  1.00 30.31 ? 485 PHE B CB    1 
ATOM   2462 C CG    . PHE B 1 103 ? -25.903 6.227   -4.634  1.00 30.61 ? 485 PHE B CG    1 
ATOM   2463 C CD1   . PHE B 1 103 ? -25.344 5.027   -5.009  1.00 31.57 ? 485 PHE B CD1   1 
ATOM   2464 C CD2   . PHE B 1 103 ? -25.311 7.404   -5.072  1.00 30.69 ? 485 PHE B CD2   1 
ATOM   2465 C CE1   . PHE B 1 103 ? -24.219 5.007   -5.834  1.00 30.93 ? 485 PHE B CE1   1 
ATOM   2466 C CE2   . PHE B 1 103 ? -24.189 7.387   -5.892  1.00 29.92 ? 485 PHE B CE2   1 
ATOM   2467 C CZ    . PHE B 1 103 ? -23.643 6.198   -6.272  1.00 28.88 ? 485 PHE B CZ    1 
ATOM   2468 N N     . GLN B 1 104 ? -27.949 8.113   -1.220  1.00 32.41 ? 486 GLN B N     1 
ATOM   2469 C CA    . GLN B 1 104 ? -29.049 8.636   -0.395  1.00 33.05 ? 486 GLN B CA    1 
ATOM   2470 C C     . GLN B 1 104 ? -30.092 9.254   -1.293  1.00 33.30 ? 486 GLN B C     1 
ATOM   2471 O O     . GLN B 1 104 ? -29.745 9.674   -2.394  1.00 32.95 ? 486 GLN B O     1 
ATOM   2472 C CB    . GLN B 1 104 ? -28.538 9.688   0.561   1.00 33.03 ? 486 GLN B CB    1 
ATOM   2473 C CG    . GLN B 1 104 ? -27.580 9.170   1.571   1.00 35.25 ? 486 GLN B CG    1 
ATOM   2474 C CD    . GLN B 1 104 ? -26.782 10.291  2.194   1.00 38.30 ? 486 GLN B CD    1 
ATOM   2475 O OE1   . GLN B 1 104 ? -25.987 10.945  1.517   1.00 39.98 ? 486 GLN B OE1   1 
ATOM   2476 N NE2   . GLN B 1 104 ? -26.998 10.535  3.483   1.00 38.42 ? 486 GLN B NE2   1 
ATOM   2477 N N     . PRO B 1 105 ? -31.359 9.348   -0.817  1.00 33.72 ? 487 PRO B N     1 
ATOM   2478 C CA    . PRO B 1 105 ? -32.499 9.806   -1.623  1.00 34.20 ? 487 PRO B CA    1 
ATOM   2479 C C     . PRO B 1 105 ? -32.254 11.174  -2.271  1.00 35.09 ? 487 PRO B C     1 
ATOM   2480 O O     . PRO B 1 105 ? -31.910 12.113  -1.567  1.00 35.74 ? 487 PRO B O     1 
ATOM   2481 C CB    . PRO B 1 105 ? -33.623 9.917   -0.585  1.00 33.89 ? 487 PRO B CB    1 
ATOM   2482 C CG    . PRO B 1 105 ? -33.256 9.002   0.474   1.00 32.95 ? 487 PRO B CG    1 
ATOM   2483 C CD    . PRO B 1 105 ? -31.769 9.105   0.578   1.00 33.54 ? 487 PRO B CD    1 
ATOM   2484 N N     . GLY B 1 106 ? -32.412 11.290  -3.590  1.00 35.51 ? 488 GLY B N     1 
ATOM   2485 C CA    . GLY B 1 106 ? -32.155 12.548  -4.281  1.00 36.02 ? 488 GLY B CA    1 
ATOM   2486 C C     . GLY B 1 106 ? -30.766 12.640  -4.882  1.00 36.87 ? 488 GLY B C     1 
ATOM   2487 O O     . GLY B 1 106 ? -30.451 13.587  -5.591  1.00 37.05 ? 488 GLY B O     1 
ATOM   2488 N N     . ASP B 1 107 ? -29.916 11.665  -4.605  1.00 37.81 ? 489 ASP B N     1 
ATOM   2489 C CA    . ASP B 1 107 ? -28.592 11.640  -5.213  1.00 38.95 ? 489 ASP B CA    1 
ATOM   2490 C C     . ASP B 1 107 ? -28.675 11.314  -6.693  1.00 39.08 ? 489 ASP B C     1 
ATOM   2491 O O     . ASP B 1 107 ? -29.556 10.585  -7.135  1.00 39.28 ? 489 ASP B O     1 
ATOM   2492 C CB    . ASP B 1 107 ? -27.707 10.597  -4.533  1.00 39.49 ? 489 ASP B CB    1 
ATOM   2493 C CG    . ASP B 1 107 ? -27.156 11.063  -3.195  1.00 41.82 ? 489 ASP B CG    1 
ATOM   2494 O OD1   . ASP B 1 107 ? -27.417 12.242  -2.794  1.00 43.65 ? 489 ASP B OD1   1 
ATOM   2495 O OD2   . ASP B 1 107 ? -26.453 10.230  -2.556  1.00 41.76 ? 489 ASP B OD2   1 
ATOM   2496 N N     . TYR B 1 108 ? -27.724 11.841  -7.444  1.00 39.29 ? 490 TYR B N     1 
ATOM   2497 C CA    . TYR B 1 108 ? -27.608 11.599  -8.870  1.00 39.34 ? 490 TYR B CA    1 
ATOM   2498 C C     . TYR B 1 108 ? -26.571 10.546  -9.148  1.00 38.62 ? 490 TYR B C     1 
ATOM   2499 O O     . TYR B 1 108 ? -25.370 10.841  -9.208  1.00 39.55 ? 490 TYR B O     1 
ATOM   2500 C CB    . TYR B 1 108 ? -27.223 12.897  -9.573  1.00 40.03 ? 490 TYR B CB    1 
ATOM   2501 C CG    . TYR B 1 108 ? -28.433 13.640  -10.021 1.00 43.50 ? 490 TYR B CG    1 
ATOM   2502 C CD1   . TYR B 1 108 ? -29.547 12.935  -10.482 1.00 45.49 ? 490 TYR B CD1   1 
ATOM   2503 C CD2   . TYR B 1 108 ? -28.482 15.033  -10.002 1.00 46.26 ? 490 TYR B CD2   1 
ATOM   2504 C CE1   . TYR B 1 108 ? -30.677 13.576  -10.920 1.00 46.40 ? 490 TYR B CE1   1 
ATOM   2505 C CE2   . TYR B 1 108 ? -29.637 15.698  -10.445 1.00 47.75 ? 490 TYR B CE2   1 
ATOM   2506 C CZ    . TYR B 1 108 ? -30.727 14.941  -10.898 1.00 47.33 ? 490 TYR B CZ    1 
ATOM   2507 O OH    . TYR B 1 108 ? -31.884 15.517  -11.340 1.00 48.64 ? 490 TYR B OH    1 
ATOM   2508 N N     . ILE B 1 109 ? -27.009 9.312   -9.309  1.00 37.40 ? 491 ILE B N     1 
ATOM   2509 C CA    . ILE B 1 109 ? -26.064 8.239   -9.517  1.00 36.54 ? 491 ILE B CA    1 
ATOM   2510 C C     . ILE B 1 109 ? -25.405 8.392   -10.885 1.00 36.70 ? 491 ILE B C     1 
ATOM   2511 O O     . ILE B 1 109 ? -24.211 8.215   -11.023 1.00 36.46 ? 491 ILE B O     1 
ATOM   2512 C CB    . ILE B 1 109 ? -26.741 6.884   -9.382  1.00 36.48 ? 491 ILE B CB    1 
ATOM   2513 C CG1   . ILE B 1 109 ? -27.462 6.793   -8.038  1.00 35.35 ? 491 ILE B CG1   1 
ATOM   2514 C CG2   . ILE B 1 109 ? -25.727 5.753   -9.547  1.00 35.66 ? 491 ILE B CG2   1 
ATOM   2515 C CD1   . ILE B 1 109 ? -28.702 5.911   -8.040  1.00 32.55 ? 491 ILE B CD1   1 
ATOM   2516 N N     . ILE B 1 110 ? -26.194 8.745   -11.889 1.00 37.07 ? 492 ILE B N     1 
ATOM   2517 C CA    . ILE B 1 110 ? -25.687 8.955   -13.239 1.00 37.28 ? 492 ILE B CA    1 
ATOM   2518 C C     . ILE B 1 110 ? -26.360 10.189  -13.802 1.00 37.15 ? 492 ILE B C     1 
ATOM   2519 O O     . ILE B 1 110 ? -27.559 10.373  -13.593 1.00 36.59 ? 492 ILE B O     1 
ATOM   2520 C CB    . ILE B 1 110 ? -25.957 7.714   -14.161 1.00 37.75 ? 492 ILE B CB    1 
ATOM   2521 C CG1   . ILE B 1 110 ? -24.903 6.618   -13.919 1.00 37.51 ? 492 ILE B CG1   1 
ATOM   2522 C CG2   . ILE B 1 110 ? -26.011 8.112   -15.665 1.00 37.40 ? 492 ILE B CG2   1 
ATOM   2523 C CD1   . ILE B 1 110 ? -25.346 5.215   -14.349 1.00 37.48 ? 492 ILE B CD1   1 
ATOM   2524 N N     . ARG B 1 111 ? -25.560 11.018  -14.490 1.00 37.34 ? 493 ARG B N     1 
ATOM   2525 C CA    . ARG B 1 111 ? -25.999 12.246  -15.181 1.00 37.32 ? 493 ARG B CA    1 
ATOM   2526 C C     . ARG B 1 111 ? -25.891 12.082  -16.673 1.00 37.24 ? 493 ARG B C     1 
ATOM   2527 O O     . ARG B 1 111 ? -24.767 11.891  -17.196 1.00 37.23 ? 493 ARG B O     1 
ATOM   2528 C CB    . ARG B 1 111 ? -25.082 13.410  -14.854 1.00 37.63 ? 493 ARG B CB    1 
ATOM   2529 C CG    . ARG B 1 111 ? -24.991 13.740  -13.401 1.00 39.72 ? 493 ARG B CG    1 
ATOM   2530 C CD    . ARG B 1 111 ? -24.126 14.937  -13.182 1.00 42.13 ? 493 ARG B CD    1 
ATOM   2531 N NE    . ARG B 1 111 ? -24.679 15.706  -12.081 1.00 45.63 ? 493 ARG B NE    1 
ATOM   2532 C CZ    . ARG B 1 111 ? -24.359 15.536  -10.803 1.00 47.45 ? 493 ARG B CZ    1 
ATOM   2533 N NH1   . ARG B 1 111 ? -23.457 14.610  -10.447 1.00 48.73 ? 493 ARG B NH1   1 
ATOM   2534 N NH2   . ARG B 1 111 ? -24.939 16.305  -9.887  1.00 46.71 ? 493 ARG B NH2   1 
ATOM   2535 N N     . GLU B 1 112 ? -27.046 12.181  -17.348 1.00 36.68 ? 494 GLU B N     1 
ATOM   2536 C CA    . GLU B 1 112 ? -27.135 12.229  -18.805 1.00 36.08 ? 494 GLU B CA    1 
ATOM   2537 C C     . GLU B 1 112 ? -26.087 13.190  -19.354 1.00 35.88 ? 494 GLU B C     1 
ATOM   2538 O O     . GLU B 1 112 ? -25.945 14.312  -18.894 1.00 36.13 ? 494 GLU B O     1 
ATOM   2539 C CB    . GLU B 1 112 ? -28.530 12.676  -19.228 1.00 35.76 ? 494 GLU B CB    1 
ATOM   2540 C CG    . GLU B 1 112 ? -28.746 12.698  -20.724 1.00 37.01 ? 494 GLU B CG    1 
ATOM   2541 C CD    . GLU B 1 112 ? -30.212 12.951  -21.128 1.00 42.54 ? 494 GLU B CD    1 
ATOM   2542 O OE1   . GLU B 1 112 ? -30.498 12.882  -22.353 1.00 42.98 ? 494 GLU B OE1   1 
ATOM   2543 O OE2   . GLU B 1 112 ? -31.095 13.205  -20.242 1.00 45.76 ? 494 GLU B OE2   1 
ATOM   2544 N N     . GLY B 1 113 ? -25.326 12.742  -20.326 1.00 35.62 ? 495 GLY B N     1 
ATOM   2545 C CA    . GLY B 1 113 ? -24.308 13.587  -20.863 1.00 35.29 ? 495 GLY B CA    1 
ATOM   2546 C C     . GLY B 1 113 ? -22.958 13.065  -20.461 1.00 35.69 ? 495 GLY B C     1 
ATOM   2547 O O     . GLY B 1 113 ? -22.055 12.978  -21.300 1.00 35.34 ? 495 GLY B O     1 
ATOM   2548 N N     . ALA B 1 114 ? -22.821 12.703  -19.178 1.00 36.26 ? 496 ALA B N     1 
ATOM   2549 C CA    . ALA B 1 114 ? -21.500 12.383  -18.568 1.00 36.33 ? 496 ALA B CA    1 
ATOM   2550 C C     . ALA B 1 114 ? -20.760 11.181  -19.214 1.00 36.40 ? 496 ALA B C     1 
ATOM   2551 O O     . ALA B 1 114 ? -21.363 10.370  -19.926 1.00 36.36 ? 496 ALA B O     1 
ATOM   2552 C CB    . ALA B 1 114 ? -21.631 12.229  -17.062 1.00 35.82 ? 496 ALA B CB    1 
ATOM   2553 N N     . VAL B 1 115 ? -19.450 11.097  -19.030 1.00 36.48 ? 497 VAL B N     1 
ATOM   2554 C CA    . VAL B 1 115 ? -18.748 9.920   -19.511 1.00 37.06 ? 497 VAL B CA    1 
ATOM   2555 C C     . VAL B 1 115 ? -18.886 8.901   -18.406 1.00 37.06 ? 497 VAL B C     1 
ATOM   2556 O O     . VAL B 1 115 ? -18.840 9.287   -17.246 1.00 37.98 ? 497 VAL B O     1 
ATOM   2557 C CB    . VAL B 1 115 ? -17.268 10.182  -19.748 1.00 37.47 ? 497 VAL B CB    1 
ATOM   2558 C CG1   . VAL B 1 115 ? -16.510 8.841   -19.904 1.00 37.40 ? 497 VAL B CG1   1 
ATOM   2559 C CG2   . VAL B 1 115 ? -17.077 11.077  -20.972 1.00 37.74 ? 497 VAL B CG2   1 
ATOM   2560 N N     . GLY B 1 116 ? -19.068 7.624   -18.738 1.00 36.36 ? 498 GLY B N     1 
ATOM   2561 C CA    . GLY B 1 116 ? -19.425 6.638   -17.731 1.00 35.40 ? 498 GLY B CA    1 
ATOM   2562 C C     . GLY B 1 116 ? -18.385 5.557   -17.649 1.00 35.39 ? 498 GLY B C     1 
ATOM   2563 O O     . GLY B 1 116 ? -17.983 5.011   -18.675 1.00 35.31 ? 498 GLY B O     1 
ATOM   2564 N N     . LYS B 1 117 ? -17.982 5.234   -16.417 1.00 35.51 ? 499 LYS B N     1 
ATOM   2565 C CA    . LYS B 1 117 ? -16.928 4.253   -16.125 1.00 35.35 ? 499 LYS B CA    1 
ATOM   2566 C C     . LYS B 1 117 ? -17.341 3.096   -15.173 1.00 34.67 ? 499 LYS B C     1 
ATOM   2567 O O     . LYS B 1 117 ? -16.509 2.279   -14.790 1.00 34.58 ? 499 LYS B O     1 
ATOM   2568 C CB    . LYS B 1 117 ? -15.713 4.995   -15.576 1.00 35.95 ? 499 LYS B CB    1 
ATOM   2569 C CG    . LYS B 1 117 ? -14.830 5.703   -16.658 1.00 38.56 ? 499 LYS B CG    1 
ATOM   2570 C CD    . LYS B 1 117 ? -13.557 6.387   -16.064 1.00 41.32 ? 499 LYS B CD    1 
ATOM   2571 C CE    . LYS B 1 117 ? -13.904 7.719   -15.304 1.00 43.60 ? 499 LYS B CE    1 
ATOM   2572 N NZ    . LYS B 1 117 ? -12.714 8.663   -15.147 1.00 44.99 ? 499 LYS B NZ    1 
ATOM   2573 N N     . LYS B 1 118 ? -18.635 3.034   -14.836 1.00 34.03 ? 500 LYS B N     1 
ATOM   2574 C CA    . LYS B 1 118 ? -19.256 2.103   -13.873 1.00 32.82 ? 500 LYS B CA    1 
ATOM   2575 C C     . LYS B 1 118 ? -20.613 1.632   -14.386 1.00 31.87 ? 500 LYS B C     1 
ATOM   2576 O O     . LYS B 1 118 ? -21.319 2.412   -15.010 1.00 31.69 ? 500 LYS B O     1 
ATOM   2577 C CB    . LYS B 1 118 ? -19.596 2.868   -12.594 1.00 32.76 ? 500 LYS B CB    1 
ATOM   2578 C CG    . LYS B 1 118 ? -18.496 3.070   -11.639 1.00 33.64 ? 500 LYS B CG    1 
ATOM   2579 C CD    . LYS B 1 118 ? -19.055 3.661   -10.371 1.00 35.43 ? 500 LYS B CD    1 
ATOM   2580 C CE    . LYS B 1 118 ? -18.009 3.733   -9.262  1.00 38.45 ? 500 LYS B CE    1 
ATOM   2581 N NZ    . LYS B 1 118 ? -18.410 4.771   -8.247  1.00 39.82 ? 500 LYS B NZ    1 
ATOM   2582 N N     . MET B 1 119 ? -21.016 0.406   -14.073 1.00 30.91 ? 501 MET B N     1 
ATOM   2583 C CA    . MET B 1 119 ? -22.457 0.081   -14.070 1.00 30.62 ? 501 MET B CA    1 
ATOM   2584 C C     . MET B 1 119 ? -22.918 -0.477  -12.728 1.00 30.19 ? 501 MET B C     1 
ATOM   2585 O O     . MET B 1 119 ? -22.092 -0.875  -11.925 1.00 30.14 ? 501 MET B O     1 
ATOM   2586 C CB    . MET B 1 119 ? -22.813 -0.901  -15.145 1.00 30.47 ? 501 MET B CB    1 
ATOM   2587 C CG    . MET B 1 119 ? -22.337 -2.287  -14.847 1.00 31.21 ? 501 MET B CG    1 
ATOM   2588 S SD    . MET B 1 119 ? -23.274 -3.372  -15.906 1.00 33.16 ? 501 MET B SD    1 
ATOM   2589 C CE    . MET B 1 119 ? -24.919 -2.861  -15.428 1.00 34.41 ? 501 MET B CE    1 
ATOM   2590 N N     . TYR B 1 120 ? -24.232 -0.546  -12.514 1.00 29.67 ? 502 TYR B N     1 
ATOM   2591 C CA    . TYR B 1 120 ? -24.789 -0.813  -11.182 1.00 29.30 ? 502 TYR B CA    1 
ATOM   2592 C C     . TYR B 1 120 ? -25.818 -1.938  -11.126 1.00 28.62 ? 502 TYR B C     1 
ATOM   2593 O O     . TYR B 1 120 ? -26.597 -2.112  -12.044 1.00 28.72 ? 502 TYR B O     1 
ATOM   2594 C CB    . TYR B 1 120 ? -25.434 0.468   -10.622 1.00 29.26 ? 502 TYR B CB    1 
ATOM   2595 C CG    . TYR B 1 120 ? -24.472 1.635   -10.467 1.00 30.56 ? 502 TYR B CG    1 
ATOM   2596 C CD1   . TYR B 1 120 ? -24.289 2.566   -11.500 1.00 32.45 ? 502 TYR B CD1   1 
ATOM   2597 C CD2   . TYR B 1 120 ? -23.744 1.819   -9.290  1.00 30.01 ? 502 TYR B CD2   1 
ATOM   2598 C CE1   . TYR B 1 120 ? -23.406 3.634   -11.361 1.00 30.60 ? 502 TYR B CE1   1 
ATOM   2599 C CE2   . TYR B 1 120 ? -22.867 2.877   -9.147  1.00 29.09 ? 502 TYR B CE2   1 
ATOM   2600 C CZ    . TYR B 1 120 ? -22.712 3.782   -10.185 1.00 30.68 ? 502 TYR B CZ    1 
ATOM   2601 O OH    . TYR B 1 120 ? -21.844 4.841   -10.042 1.00 32.79 ? 502 TYR B OH    1 
ATOM   2602 N N     . PHE B 1 121 ? -25.830 -2.673  -10.021 1.00 28.28 ? 503 PHE B N     1 
ATOM   2603 C CA    . PHE B 1 121 ? -26.867 -3.672  -9.741  1.00 28.02 ? 503 PHE B CA    1 
ATOM   2604 C C     . PHE B 1 121 ? -27.589 -3.258  -8.477  1.00 28.12 ? 503 PHE B C     1 
ATOM   2605 O O     . PHE B 1 121 ? -26.952 -3.006  -7.467  1.00 27.92 ? 503 PHE B O     1 
ATOM   2606 C CB    . PHE B 1 121 ? -26.284 -5.103  -9.631  1.00 27.31 ? 503 PHE B CB    1 
ATOM   2607 C CG    . PHE B 1 121 ? -25.649 -5.569  -10.885 1.00 25.62 ? 503 PHE B CG    1 
ATOM   2608 C CD1   . PHE B 1 121 ? -26.397 -6.196  -11.858 1.00 23.93 ? 503 PHE B CD1   1 
ATOM   2609 C CD2   . PHE B 1 121 ? -24.304 -5.302  -11.136 1.00 26.50 ? 503 PHE B CD2   1 
ATOM   2610 C CE1   . PHE B 1 121 ? -25.826 -6.594  -13.048 1.00 24.82 ? 503 PHE B CE1   1 
ATOM   2611 C CE2   . PHE B 1 121 ? -23.711 -5.681  -12.338 1.00 25.02 ? 503 PHE B CE2   1 
ATOM   2612 C CZ    . PHE B 1 121 ? -24.474 -6.326  -13.291 1.00 24.84 ? 503 PHE B CZ    1 
ATOM   2613 N N     . ILE B 1 122 ? -28.909 -3.160  -8.555  1.00 28.39 ? 504 ILE B N     1 
ATOM   2614 C CA    . ILE B 1 122 ? -29.701 -2.809  -7.409  1.00 29.15 ? 504 ILE B CA    1 
ATOM   2615 C C     . ILE B 1 122 ? -29.908 -4.020  -6.521  1.00 30.35 ? 504 ILE B C     1 
ATOM   2616 O O     . ILE B 1 122 ? -30.512 -5.005  -6.919  1.00 30.10 ? 504 ILE B O     1 
ATOM   2617 C CB    . ILE B 1 122 ? -31.033 -2.226  -7.825  1.00 28.92 ? 504 ILE B CB    1 
ATOM   2618 C CG1   . ILE B 1 122 ? -30.779 -1.104  -8.818  1.00 28.25 ? 504 ILE B CG1   1 
ATOM   2619 C CG2   . ILE B 1 122 ? -31.787 -1.714  -6.618  1.00 28.19 ? 504 ILE B CG2   1 
ATOM   2620 C CD1   . ILE B 1 122 ? -31.983 -0.663  -9.562  1.00 29.27 ? 504 ILE B CD1   1 
ATOM   2621 N N     . GLN B 1 123 ? -29.380 -3.935  -5.311  1.00 31.91 ? 505 GLN B N     1 
ATOM   2622 C CA    . GLN B 1 123 ? -29.646 -4.914  -4.297  1.00 33.75 ? 505 GLN B CA    1 
ATOM   2623 C C     . GLN B 1 123 ? -30.924 -4.616  -3.569  1.00 34.74 ? 505 GLN B C     1 
ATOM   2624 O O     . GLN B 1 123 ? -31.850 -5.404  -3.607  1.00 35.02 ? 505 GLN B O     1 
ATOM   2625 C CB    . GLN B 1 123 ? -28.562 -4.908  -3.282  1.00 33.81 ? 505 GLN B CB    1 
ATOM   2626 C CG    . GLN B 1 123 ? -28.561 -6.180  -2.550  1.00 37.51 ? 505 GLN B CG    1 
ATOM   2627 C CD    . GLN B 1 123 ? -28.162 -6.035  -1.145  1.00 41.71 ? 505 GLN B CD    1 
ATOM   2628 O OE1   . GLN B 1 123 ? -27.918 -4.948  -0.648  1.00 45.20 ? 505 GLN B OE1   1 
ATOM   2629 N NE2   . GLN B 1 123 ? -28.080 -7.144  -0.475  1.00 45.09 ? 505 GLN B NE2   1 
ATOM   2630 N N     . HIS B 1 124 ? -30.961 -3.486  -2.877  1.00 36.24 ? 506 HIS B N     1 
ATOM   2631 C CA    . HIS B 1 124 ? -32.209 -2.977  -2.321  1.00 37.60 ? 506 HIS B CA    1 
ATOM   2632 C C     . HIS B 1 124 ? -32.377 -1.497  -2.591  1.00 37.25 ? 506 HIS B C     1 
ATOM   2633 O O     . HIS B 1 124 ? -31.464 -0.698  -2.317  1.00 37.41 ? 506 HIS B O     1 
ATOM   2634 C CB    . HIS B 1 124 ? -32.284 -3.198  -0.803  1.00 38.57 ? 506 HIS B CB    1 
ATOM   2635 C CG    . HIS B 1 124 ? -33.621 -2.844  -0.216  1.00 41.80 ? 506 HIS B CG    1 
ATOM   2636 N ND1   . HIS B 1 124 ? -34.788 -3.511  -0.555  1.00 44.04 ? 506 HIS B ND1   1 
ATOM   2637 C CD2   . HIS B 1 124 ? -33.981 -1.882  0.670   1.00 43.61 ? 506 HIS B CD2   1 
ATOM   2638 C CE1   . HIS B 1 124 ? -35.803 -2.982  0.107   1.00 44.94 ? 506 HIS B CE1   1 
ATOM   2639 N NE2   . HIS B 1 124 ? -35.342 -1.992  0.856   1.00 45.04 ? 506 HIS B NE2   1 
ATOM   2640 N N     . GLY B 1 125 ? -33.553 -1.128  -3.080  1.00 36.70 ? 507 GLY B N     1 
ATOM   2641 C CA    . GLY B 1 125 ? -33.865 0.278   -3.274  1.00 36.74 ? 507 GLY B CA    1 
ATOM   2642 C C     . GLY B 1 125 ? -34.704 0.538   -4.500  1.00 36.97 ? 507 GLY B C     1 
ATOM   2643 O O     . GLY B 1 125 ? -35.048 -0.403  -5.240  1.00 37.32 ? 507 GLY B O     1 
ATOM   2644 N N     . VAL B 1 126 ? -35.069 1.802   -4.704  1.00 36.60 ? 508 VAL B N     1 
ATOM   2645 C CA    . VAL B 1 126 ? -35.780 2.186   -5.916  1.00 36.93 ? 508 VAL B CA    1 
ATOM   2646 C C     . VAL B 1 126 ? -35.055 3.318   -6.594  1.00 37.10 ? 508 VAL B C     1 
ATOM   2647 O O     . VAL B 1 126 ? -34.555 4.222   -5.939  1.00 37.76 ? 508 VAL B O     1 
ATOM   2648 C CB    . VAL B 1 126 ? -37.210 2.630   -5.623  1.00 37.06 ? 508 VAL B CB    1 
ATOM   2649 C CG1   . VAL B 1 126 ? -37.920 3.026   -6.907  1.00 36.80 ? 508 VAL B CG1   1 
ATOM   2650 C CG2   . VAL B 1 126 ? -37.954 1.504   -4.963  1.00 37.93 ? 508 VAL B CG2   1 
ATOM   2651 N N     . ALA B 1 127 ? -34.998 3.284   -7.912  1.00 37.12 ? 509 ALA B N     1 
ATOM   2652 C CA    . ALA B 1 127 ? -34.321 4.331   -8.639  1.00 37.09 ? 509 ALA B CA    1 
ATOM   2653 C C     . ALA B 1 127 ? -35.085 4.750   -9.895  1.00 37.44 ? 509 ALA B C     1 
ATOM   2654 O O     . ALA B 1 127 ? -35.728 3.939   -10.549 1.00 37.48 ? 509 ALA B O     1 
ATOM   2655 C CB    . ALA B 1 127 ? -32.931 3.887   -8.973  1.00 37.11 ? 509 ALA B CB    1 
ATOM   2656 N N     . GLY B 1 128 ? -35.060 5.979   -10.251 1.00 38.04 ? 510 GLY B N     1 
ATOM   2657 C CA    . GLY B 1 128 ? -35.828 6.519   -11.372 1.00 38.78 ? 510 GLY B CA    1 
ATOM   2658 C C     . GLY B 1 128 ? -34.967 6.941   -12.548 1.00 39.48 ? 510 GLY B C     1 
ATOM   2659 O O     . GLY B 1 128 ? -33.910 7.549   -12.369 1.00 39.17 ? 510 GLY B O     1 
ATOM   2660 N N     . VAL B 1 129 ? -35.430 6.616   -13.754 1.00 40.32 ? 511 VAL B N     1 
ATOM   2661 C CA    . VAL B 1 129 ? -34.727 6.963   -14.990 1.00 41.78 ? 511 VAL B CA    1 
ATOM   2662 C C     . VAL B 1 129 ? -35.386 8.182   -15.640 1.00 42.70 ? 511 VAL B C     1 
ATOM   2663 O O     . VAL B 1 129 ? -36.568 8.148   -15.991 1.00 43.01 ? 511 VAL B O     1 
ATOM   2664 C CB    . VAL B 1 129 ? -34.690 5.771   -15.985 1.00 41.75 ? 511 VAL B CB    1 
ATOM   2665 C CG1   . VAL B 1 129 ? -33.919 6.139   -17.247 1.00 42.17 ? 511 VAL B CG1   1 
ATOM   2666 C CG2   . VAL B 1 129 ? -34.074 4.540   -15.330 1.00 41.23 ? 511 VAL B CG2   1 
ATOM   2667 N N     . ILE B 1 130 ? -34.610 9.255   -15.788 1.00 44.30 ? 512 ILE B N     1 
ATOM   2668 C CA    . ILE B 1 130 ? -35.121 10.532  -16.294 1.00 46.34 ? 512 ILE B CA    1 
ATOM   2669 C C     . ILE B 1 130 ? -34.357 11.002  -17.535 1.00 47.62 ? 512 ILE B C     1 
ATOM   2670 O O     . ILE B 1 130 ? -33.126 10.937  -17.582 1.00 47.82 ? 512 ILE B O     1 
ATOM   2671 C CB    . ILE B 1 130 ? -35.061 11.656  -15.205 1.00 46.28 ? 512 ILE B CB    1 
ATOM   2672 C CG1   . ILE B 1 130 ? -35.528 11.148  -13.827 1.00 45.55 ? 512 ILE B CG1   1 
ATOM   2673 C CG2   . ILE B 1 130 ? -35.837 12.907  -15.649 1.00 47.07 ? 512 ILE B CG2   1 
ATOM   2674 C CD1   . ILE B 1 130 ? -37.013 10.788  -13.721 1.00 45.27 ? 512 ILE B CD1   1 
ATOM   2675 N N     . THR B 1 131 ? -35.072 11.467  -18.514 1.00 49.23 ? 513 THR B N     1 
ATOM   2676 C CA    . THR B 1 131 ? -34.520 12.095  -19.714 1.00 51.12 ? 513 THR B CA    1 
ATOM   2677 C C     . THR B 1 131 ? -35.269 13.417  -19.925 1.00 52.26 ? 513 THR B C     1 
ATOM   2678 O O     . THR B 1 131 ? -35.930 13.905  -19.004 1.00 52.87 ? 513 THR B O     1 
ATOM   2679 C CB    . THR B 1 131 ? -34.652 11.174  -20.956 1.00 51.32 ? 513 THR B CB    1 
ATOM   2680 O OG1   . THR B 1 131 ? -34.586 9.800   -20.553 1.00 51.51 ? 513 THR B OG1   1 
ATOM   2681 C CG2   . THR B 1 131 ? -33.542 11.450  -21.964 1.00 51.33 ? 513 THR B CG2   1 
ATOM   2682 N N     . LYS B 1 132 ? -35.160 13.999  -21.119 1.00 53.06 ? 514 LYS B N     1 
ATOM   2683 C CA    . LYS B 1 132 ? -35.923 15.198  -21.463 1.00 54.14 ? 514 LYS B CA    1 
ATOM   2684 C C     . LYS B 1 132 ? -37.403 14.852  -21.638 1.00 55.36 ? 514 LYS B C     1 
ATOM   2685 O O     . LYS B 1 132 ? -37.854 14.532  -22.742 1.00 55.17 ? 514 LYS B O     1 
ATOM   2686 C CB    . LYS B 1 132 ? -35.360 15.871  -22.722 1.00 53.88 ? 514 LYS B CB    1 
ATOM   2687 C CG    . LYS B 1 132 ? -34.206 16.840  -22.470 1.00 53.68 ? 514 LYS B CG    1 
ATOM   2688 C CD    . LYS B 1 132 ? -32.859 16.130  -22.384 1.00 53.75 ? 514 LYS B CD    1 
ATOM   2689 C CE    . LYS B 1 132 ? -31.732 17.119  -22.138 1.00 53.37 ? 514 LYS B CE    1 
ATOM   2690 N NZ    . LYS B 1 132 ? -30.408 16.443  -22.052 1.00 54.18 ? 514 LYS B NZ    1 
ATOM   2691 N N     . SER B 1 133 ? -38.137 14.912  -20.526 1.00 56.58 ? 515 SER B N     1 
ATOM   2692 C CA    . SER B 1 133 ? -39.563 14.562  -20.461 1.00 57.94 ? 515 SER B CA    1 
ATOM   2693 C C     . SER B 1 133 ? -39.854 13.119  -20.896 1.00 58.40 ? 515 SER B C     1 
ATOM   2694 O O     . SER B 1 133 ? -40.604 12.879  -21.848 1.00 58.46 ? 515 SER B O     1 
ATOM   2695 C CB    . SER B 1 133 ? -40.423 15.569  -21.239 1.00 58.29 ? 515 SER B CB    1 
ATOM   2696 O OG    . SER B 1 133 ? -40.309 16.869  -20.688 1.00 58.80 ? 515 SER B OG    1 
ATOM   2697 N N     . SER B 1 134 ? -39.287 12.205  -20.198 1.00 58.69 ? 516 SER B N     1 
ATOM   2698 C CA    . SER B 1 134 ? -39.541 10.783  -20.422 1.00 58.93 ? 516 SER B CA    1 
ATOM   2699 C C     . SER B 1 134 ? -40.320 10.182  -19.250 1.00 58.87 ? 516 SER B C     1 
ATOM   2700 O O     . SER B 1 134 ? -40.455 8.959   -19.143 1.00 58.84 ? 516 SER B O     1 
ATOM   2701 C CB    . SER B 1 134 ? -38.224 10.030  -20.630 1.00 20.00 ? 516 SER B CB    1 
ATOM   2702 O OG    . SER B 1 134 ? -37.421 10.069  -19.462 1.00 20.00 ? 516 SER B OG    1 
ATOM   2703 N N     . LYS B 1 135 ? -40.831 11.061  -18.385 1.00 58.77 ? 517 LYS B N     1 
ATOM   2704 C CA    . LYS B 1 135 ? -41.557 10.688  -17.161 1.00 58.85 ? 517 LYS B CA    1 
ATOM   2705 C C     . LYS B 1 135 ? -40.694 9.880   -16.183 1.00 58.40 ? 517 LYS B C     1 
ATOM   2706 O O     . LYS B 1 135 ? -39.465 9.874   -16.289 1.00 58.67 ? 517 LYS B O     1 
ATOM   2707 C CB    . LYS B 1 135 ? -42.872 9.962   -17.489 1.00 59.02 ? 517 LYS B CB    1 
ATOM   2708 C CG    . LYS B 1 135 ? -43.925 10.843  -18.147 1.00 60.11 ? 517 LYS B CG    1 
ATOM   2709 C CD    . LYS B 1 135 ? -45.191 10.060  -18.454 1.00 61.37 ? 517 LYS B CD    1 
ATOM   2710 C CE    . LYS B 1 135 ? -46.235 10.941  -19.120 1.00 61.98 ? 517 LYS B CE    1 
ATOM   2711 N NZ    . LYS B 1 135 ? -47.481 10.187  -19.431 1.00 62.10 ? 517 LYS B NZ    1 
ATOM   2712 N N     . GLU B 1 136 ? -41.342 9.215   -15.229 1.00 57.51 ? 518 GLU B N     1 
ATOM   2713 C CA    . GLU B 1 136 ? -40.642 8.404   -14.237 1.00 56.74 ? 518 GLU B CA    1 
ATOM   2714 C C     . GLU B 1 136 ? -40.636 6.923   -14.602 1.00 55.52 ? 518 GLU B C     1 
ATOM   2715 O O     . GLU B 1 136 ? -41.688 6.281   -14.666 1.00 55.51 ? 518 GLU B O     1 
ATOM   2716 C CB    . GLU B 1 136 ? -41.243 8.611   -12.842 1.00 57.14 ? 518 GLU B CB    1 
ATOM   2717 C CG    . GLU B 1 136 ? -40.673 9.805   -12.079 1.00 59.64 ? 518 GLU B CG    1 
ATOM   2718 C CD    . GLU B 1 136 ? -39.419 9.471   -11.278 1.00 63.23 ? 518 GLU B CD    1 
ATOM   2719 O OE1   . GLU B 1 136 ? -38.656 8.564   -11.677 1.00 64.37 ? 518 GLU B OE1   1 
ATOM   2720 O OE2   . GLU B 1 136 ? -39.193 10.128  -10.240 1.00 64.35 ? 518 GLU B OE2   1 
ATOM   2721 N N     . MET B 1 137 ? -39.439 6.396   -14.849 1.00 53.37 ? 519 MET B N     1 
ATOM   2722 C CA    . MET B 1 137 ? -39.251 4.974   -15.120 1.00 51.23 ? 519 MET B CA    1 
ATOM   2723 C C     . MET B 1 137 ? -38.529 4.332   -13.939 1.00 49.69 ? 519 MET B C     1 
ATOM   2724 O O     . MET B 1 137 ? -37.331 4.548   -13.735 1.00 49.45 ? 519 MET B O     1 
ATOM   2725 C CB    . MET B 1 137 ? -38.474 4.759   -16.423 1.00 51.24 ? 519 MET B CB    1 
ATOM   2726 C CG    . MET B 1 137 ? -39.120 5.394   -17.650 1.00 52.52 ? 519 MET B CG    1 
ATOM   2727 S SD    . MET B 1 137 ? -38.560 4.676   -19.206 1.00 56.63 ? 519 MET B SD    1 
ATOM   2728 C CE    . MET B 1 137 ? -39.474 3.135   -19.211 1.00 54.78 ? 519 MET B CE    1 
ATOM   2729 N N     . LYS B 1 138 ? -39.149 3.492   -13.191 1.00 48.05 ? 520 LYS B N     1 
ATOM   2730 C CA    . LYS B 1 138 ? -38.540 3.024   -11.973 1.00 46.90 ? 520 LYS B CA    1 
ATOM   2731 C C     . LYS B 1 138 ? -37.939 1.633   -12.099 1.00 46.14 ? 520 LYS B C     1 
ATOM   2732 O O     . LYS B 1 138 ? -38.519 0.737   -12.737 1.00 46.26 ? 520 LYS B O     1 
ATOM   2733 C CB    . LYS B 1 138 ? -39.510 3.149   -10.808 1.00 46.92 ? 520 LYS B CB    1 
ATOM   2734 C CG    . LYS B 1 138 ? -39.634 4.604   -10.370 1.00 47.10 ? 520 LYS B CG    1 
ATOM   2735 C CD    . LYS B 1 138 ? -41.070 4.995   -10.069 1.00 48.25 ? 520 LYS B CD    1 
ATOM   2736 C CE    . LYS B 1 138 ? -41.325 5.126   -8.564  1.00 48.87 ? 520 LYS B CE    1 
ATOM   2737 N NZ    . LYS B 1 138 ? -42.764 5.436   -8.277  1.00 50.11 ? 520 LYS B NZ    1 
ATOM   2738 N N     . LEU B 1 139 ? -36.744 1.491   -11.520 1.00 44.75 ? 521 LEU B N     1 
ATOM   2739 C CA    . LEU B 1 139 ? -36.029 0.224   -11.417 1.00 43.22 ? 521 LEU B CA    1 
ATOM   2740 C C     . LEU B 1 139 ? -35.870 -0.117  -9.950  1.00 42.69 ? 521 LEU B C     1 
ATOM   2741 O O     . LEU B 1 139 ? -35.666 0.765   -9.114  1.00 41.97 ? 521 LEU B O     1 
ATOM   2742 C CB    . LEU B 1 139 ? -34.660 0.313   -12.067 1.00 43.17 ? 521 LEU B CB    1 
ATOM   2743 C CG    . LEU B 1 139 ? -34.652 0.769   -13.520 1.00 42.33 ? 521 LEU B CG    1 
ATOM   2744 C CD1   . LEU B 1 139 ? -33.226 0.823   -14.099 1.00 40.49 ? 521 LEU B CD1   1 
ATOM   2745 C CD2   . LEU B 1 139 ? -35.577 -0.120  -14.340 1.00 41.93 ? 521 LEU B CD2   1 
ATOM   2746 N N     . THR B 1 140 ? -35.974 -1.410  -9.648  1.00 42.33 ? 522 THR B N     1 
ATOM   2747 C CA    . THR B 1 140 ? -36.073 -1.888  -8.264  1.00 41.90 ? 522 THR B CA    1 
ATOM   2748 C C     . THR B 1 140 ? -35.163 -3.127  -8.046  1.00 41.28 ? 522 THR B C     1 
ATOM   2749 O O     . THR B 1 140 ? -34.370 -3.451  -8.922  1.00 41.45 ? 522 THR B O     1 
ATOM   2750 C CB    . THR B 1 140 ? -37.582 -2.042  -7.860  1.00 41.46 ? 522 THR B CB    1 
ATOM   2751 O OG1   . THR B 1 140 ? -37.707 -2.128  -6.445  1.00 41.45 ? 522 THR B OG1   1 
ATOM   2752 C CG2   . THR B 1 140 ? -38.212 -3.242  -8.492  1.00 42.56 ? 522 THR B CG2   1 
ATOM   2753 N N     . ASP B 1 141 ? -35.246 -3.799  -6.902  1.00 40.47 ? 523 ASP B N     1 
ATOM   2754 C CA    . ASP B 1 141 ? -34.329 -4.910  -6.606  1.00 40.01 ? 523 ASP B CA    1 
ATOM   2755 C C     . ASP B 1 141 ? -34.210 -5.880  -7.776  1.00 38.66 ? 523 ASP B C     1 
ATOM   2756 O O     . ASP B 1 141 ? -35.189 -6.199  -8.453  1.00 38.41 ? 523 ASP B O     1 
ATOM   2757 C CB    . ASP B 1 141 ? -34.741 -5.678  -5.347  1.00 40.66 ? 523 ASP B CB    1 
ATOM   2758 C CG    . ASP B 1 141 ? -35.270 -4.766  -4.227  1.00 44.52 ? 523 ASP B CG    1 
ATOM   2759 O OD1   . ASP B 1 141 ? -35.839 -3.683  -4.515  1.00 49.12 ? 523 ASP B OD1   1 
ATOM   2760 O OD2   . ASP B 1 141 ? -35.132 -5.138  -3.036  1.00 48.11 ? 523 ASP B OD2   1 
ATOM   2761 N N     . GLY B 1 142 ? -32.988 -6.333  -8.009  1.00 37.35 ? 524 GLY B N     1 
ATOM   2762 C CA    . GLY B 1 142 ? -32.690 -7.260  -9.084  1.00 35.52 ? 524 GLY B CA    1 
ATOM   2763 C C     . GLY B 1 142 ? -32.787 -6.607  -10.443 1.00 34.22 ? 524 GLY B C     1 
ATOM   2764 O O     . GLY B 1 142 ? -33.038 -7.284  -11.432 1.00 34.80 ? 524 GLY B O     1 
ATOM   2765 N N     . SER B 1 143 ? -32.598 -5.293  -10.496 1.00 32.45 ? 525 SER B N     1 
ATOM   2766 C CA    . SER B 1 143 ? -32.496 -4.576  -11.761 1.00 31.13 ? 525 SER B CA    1 
ATOM   2767 C C     . SER B 1 143 ? -31.094 -4.081  -11.951 1.00 29.22 ? 525 SER B C     1 
ATOM   2768 O O     . SER B 1 143 ? -30.356 -4.016  -10.967 1.00 28.43 ? 525 SER B O     1 
ATOM   2769 C CB    . SER B 1 143 ? -33.429 -3.375  -11.775 1.00 31.86 ? 525 SER B CB    1 
ATOM   2770 O OG    . SER B 1 143 ? -34.594 -3.667  -12.522 1.00 35.03 ? 525 SER B OG    1 
ATOM   2771 N N     . TYR B 1 144 ? -30.729 -3.730  -13.194 1.00 26.96 ? 526 TYR B N     1 
ATOM   2772 C CA    . TYR B 1 144 ? -29.436 -3.105  -13.440 1.00 25.59 ? 526 TYR B CA    1 
ATOM   2773 C C     . TYR B 1 144 ? -29.522 -1.909  -14.354 1.00 24.99 ? 526 TYR B C     1 
ATOM   2774 O O     . TYR B 1 144 ? -30.379 -1.829  -15.213 1.00 24.87 ? 526 TYR B O     1 
ATOM   2775 C CB    . TYR B 1 144 ? -28.390 -4.098  -13.953 1.00 25.13 ? 526 TYR B CB    1 
ATOM   2776 C CG    . TYR B 1 144 ? -28.720 -4.651  -15.273 1.00 25.78 ? 526 TYR B CG    1 
ATOM   2777 C CD1   . TYR B 1 144 ? -28.461 -3.923  -16.439 1.00 26.51 ? 526 TYR B CD1   1 
ATOM   2778 C CD2   . TYR B 1 144 ? -29.322 -5.905  -15.384 1.00 27.35 ? 526 TYR B CD2   1 
ATOM   2779 C CE1   . TYR B 1 144 ? -28.808 -4.432  -17.706 1.00 27.86 ? 526 TYR B CE1   1 
ATOM   2780 C CE2   . TYR B 1 144 ? -29.684 -6.434  -16.640 1.00 28.05 ? 526 TYR B CE2   1 
ATOM   2781 C CZ    . TYR B 1 144 ? -29.412 -5.692  -17.800 1.00 28.82 ? 526 TYR B CZ    1 
ATOM   2782 O OH    . TYR B 1 144 ? -29.747 -6.198  -19.043 1.00 29.53 ? 526 TYR B OH    1 
ATOM   2783 N N     . PHE B 1 145 ? -28.607 -0.974  -14.170 1.00 24.49 ? 527 PHE B N     1 
ATOM   2784 C CA    . PHE B 1 145 ? -28.538 0.180   -15.047 1.00 24.13 ? 527 PHE B CA    1 
ATOM   2785 C C     . PHE B 1 145 ? -27.108 0.670   -15.166 1.00 23.73 ? 527 PHE B C     1 
ATOM   2786 O O     . PHE B 1 145 ? -26.241 0.319   -14.352 1.00 22.50 ? 527 PHE B O     1 
ATOM   2787 C CB    . PHE B 1 145 ? -29.424 1.293   -14.513 1.00 24.57 ? 527 PHE B CB    1 
ATOM   2788 C CG    . PHE B 1 145 ? -29.072 1.708   -13.129 1.00 24.45 ? 527 PHE B CG    1 
ATOM   2789 C CD1   . PHE B 1 145 ? -28.056 2.647   -12.912 1.00 23.94 ? 527 PHE B CD1   1 
ATOM   2790 C CD2   . PHE B 1 145 ? -29.716 1.132   -12.036 1.00 24.02 ? 527 PHE B CD2   1 
ATOM   2791 C CE1   . PHE B 1 145 ? -27.701 3.025   -11.645 1.00 23.51 ? 527 PHE B CE1   1 
ATOM   2792 C CE2   . PHE B 1 145 ? -29.365 1.508   -10.754 1.00 25.25 ? 527 PHE B CE2   1 
ATOM   2793 C CZ    . PHE B 1 145 ? -28.354 2.462   -10.561 1.00 25.80 ? 527 PHE B CZ    1 
ATOM   2794 N N     . GLY B 1 146 ? -26.870 1.468   -16.198 1.00 23.70 ? 528 GLY B N     1 
ATOM   2795 C CA    . GLY B 1 146 ? -25.534 1.951   -16.479 1.00 24.97 ? 528 GLY B CA    1 
ATOM   2796 C C     . GLY B 1 146 ? -24.757 1.082   -17.440 1.00 25.65 ? 528 GLY B C     1 
ATOM   2797 O O     . GLY B 1 146 ? -23.545 1.255   -17.616 1.00 25.54 ? 528 GLY B O     1 
ATOM   2798 N N     . GLU B 1 147 ? -25.447 0.145   -18.075 1.00 26.46 ? 529 GLU B N     1 
ATOM   2799 C CA    . GLU B 1 147 ? -24.781 -0.765  -18.983 1.00 27.37 ? 529 GLU B CA    1 
ATOM   2800 C C     . GLU B 1 147 ? -24.557 -0.096  -20.340 1.00 28.69 ? 529 GLU B C     1 
ATOM   2801 O O     . GLU B 1 147 ? -23.527 -0.308  -20.967 1.00 28.86 ? 529 GLU B O     1 
ATOM   2802 C CB    . GLU B 1 147 ? -25.578 -2.057  -19.134 1.00 26.32 ? 529 GLU B CB    1 
ATOM   2803 C CG    . GLU B 1 147 ? -26.716 -1.980  -20.155 1.00 25.16 ? 529 GLU B CG    1 
ATOM   2804 C CD    . GLU B 1 147 ? -28.033 -1.501  -19.575 1.00 23.47 ? 529 GLU B CD    1 
ATOM   2805 O OE1   . GLU B 1 147 ? -28.019 -0.720  -18.614 1.00 23.16 ? 529 GLU B OE1   1 
ATOM   2806 O OE2   . GLU B 1 147 ? -29.094 -1.932  -20.062 1.00 22.17 ? 529 GLU B OE2   1 
ATOM   2807 N N     . ILE B 1 148 ? -25.519 0.720   -20.771 1.00 30.35 ? 530 ILE B N     1 
ATOM   2808 C CA    . ILE B 1 148 ? -25.596 1.179   -22.163 1.00 32.04 ? 530 ILE B CA    1 
ATOM   2809 C C     . ILE B 1 148 ? -24.370 1.990   -22.543 1.00 33.60 ? 530 ILE B C     1 
ATOM   2810 O O     . ILE B 1 148 ? -23.683 1.702   -23.526 1.00 33.47 ? 530 ILE B O     1 
ATOM   2811 C CB    . ILE B 1 148 ? -26.826 2.053   -22.391 1.00 31.90 ? 530 ILE B CB    1 
ATOM   2812 C CG1   . ILE B 1 148 ? -28.102 1.272   -22.118 1.00 31.93 ? 530 ILE B CG1   1 
ATOM   2813 C CG2   . ILE B 1 148 ? -26.826 2.640   -23.787 1.00 31.28 ? 530 ILE B CG2   1 
ATOM   2814 C CD1   . ILE B 1 148 ? -29.322 2.125   -22.282 1.00 31.65 ? 530 ILE B CD1   1 
ATOM   2815 N N     . CYS B 1 149 ? -24.106 3.017   -21.750 1.00 35.23 ? 531 CYS B N     1 
ATOM   2816 C CA    . CYS B 1 149 ? -22.884 3.752   -21.881 1.00 36.83 ? 531 CYS B CA    1 
ATOM   2817 C C     . CYS B 1 149 ? -21.688 2.821   -22.135 1.00 36.32 ? 531 CYS B C     1 
ATOM   2818 O O     . CYS B 1 149 ? -21.075 2.902   -23.187 1.00 36.77 ? 531 CYS B O     1 
ATOM   2819 C CB    . CYS B 1 149 ? -22.650 4.580   -20.640 1.00 37.23 ? 531 CYS B CB    1 
ATOM   2820 S SG    . CYS B 1 149 ? -21.147 5.505   -20.802 1.00 44.29 ? 531 CYS B SG    1 
ATOM   2821 N N     . LEU B 1 150 ? -21.373 1.936   -21.192 1.00 36.01 ? 532 LEU B N     1 
ATOM   2822 C CA    . LEU B 1 150 ? -20.231 0.994   -21.321 1.00 36.06 ? 532 LEU B CA    1 
ATOM   2823 C C     . LEU B 1 150 ? -20.110 0.198   -22.632 1.00 35.80 ? 532 LEU B C     1 
ATOM   2824 O O     . LEU B 1 150 ? -19.007 -0.064  -23.123 1.00 35.22 ? 532 LEU B O     1 
ATOM   2825 C CB    . LEU B 1 150 ? -20.257 -0.026  -20.185 1.00 36.00 ? 532 LEU B CB    1 
ATOM   2826 C CG    . LEU B 1 150 ? -19.700 0.298   -18.808 1.00 35.73 ? 532 LEU B CG    1 
ATOM   2827 C CD1   . LEU B 1 150 ? -19.884 1.757   -18.428 1.00 33.97 ? 532 LEU B CD1   1 
ATOM   2828 C CD2   . LEU B 1 150 ? -20.376 -0.652  -17.817 1.00 34.66 ? 532 LEU B CD2   1 
ATOM   2829 N N     . LEU B 1 151 ? -21.252 -0.226  -23.157 1.00 35.90 ? 533 LEU B N     1 
ATOM   2830 C CA    . LEU B 1 151 ? -21.267 -0.966  -24.390 1.00 35.87 ? 533 LEU B CA    1 
ATOM   2831 C C     . LEU B 1 151 ? -20.856 -0.036  -25.528 1.00 36.24 ? 533 LEU B C     1 
ATOM   2832 O O     . LEU B 1 151 ? -19.881 -0.299  -26.205 1.00 36.81 ? 533 LEU B O     1 
ATOM   2833 C CB    . LEU B 1 151 ? -22.645 -1.569  -24.630 1.00 35.39 ? 533 LEU B CB    1 
ATOM   2834 C CG    . LEU B 1 151 ? -23.129 -2.717  -23.760 1.00 33.97 ? 533 LEU B CG    1 
ATOM   2835 C CD1   . LEU B 1 151 ? -24.556 -2.900  -24.060 1.00 34.11 ? 533 LEU B CD1   1 
ATOM   2836 C CD2   . LEU B 1 151 ? -22.408 -4.006  -24.045 1.00 32.10 ? 533 LEU B CD2   1 
ATOM   2837 N N     . THR B 1 152 ? -21.570 1.074   -25.694 1.00 36.58 ? 534 THR B N     1 
ATOM   2838 C CA    . THR B 1 152 ? -21.343 2.008   -26.803 1.00 36.37 ? 534 THR B CA    1 
ATOM   2839 C C     . THR B 1 152 ? -20.010 2.773   -26.761 1.00 36.95 ? 534 THR B C     1 
ATOM   2840 O O     . THR B 1 152 ? -19.511 3.241   -27.805 1.00 37.59 ? 534 THR B O     1 
ATOM   2841 C CB    . THR B 1 152 ? -22.464 3.046   -26.883 1.00 36.49 ? 534 THR B CB    1 
ATOM   2842 O OG1   . THR B 1 152 ? -22.525 3.796   -25.655 1.00 35.37 ? 534 THR B OG1   1 
ATOM   2843 C CG2   . THR B 1 152 ? -23.792 2.359   -27.198 1.00 34.54 ? 534 THR B CG2   1 
ATOM   2844 N N     . LYS B 1 153 ? -19.444 2.903   -25.562 1.00 36.79 ? 535 LYS B N     1 
ATOM   2845 C CA    . LYS B 1 153 ? -18.288 3.771   -25.309 1.00 36.20 ? 535 LYS B CA    1 
ATOM   2846 C C     . LYS B 1 153 ? -18.579 5.249   -25.618 1.00 35.58 ? 535 LYS B C     1 
ATOM   2847 O O     . LYS B 1 153 ? -17.656 6.050   -25.667 1.00 35.52 ? 535 LYS B O     1 
ATOM   2848 C CB    . LYS B 1 153 ? -17.039 3.276   -26.047 1.00 36.27 ? 535 LYS B CB    1 
ATOM   2849 C CG    . LYS B 1 153 ? -16.742 1.796   -25.895 1.00 36.99 ? 535 LYS B CG    1 
ATOM   2850 C CD    . LYS B 1 153 ? -15.447 1.487   -26.577 1.00 40.40 ? 535 LYS B CD    1 
ATOM   2851 C CE    . LYS B 1 153 ? -15.603 0.306   -27.525 1.00 42.70 ? 535 LYS B CE    1 
ATOM   2852 N NZ    . LYS B 1 153 ? -15.012 -0.932  -26.933 1.00 44.09 ? 535 LYS B NZ    1 
ATOM   2853 N N     . GLY B 1 154 ? -19.859 5.586   -25.822 1.00 35.04 ? 536 GLY B N     1 
ATOM   2854 C CA    . GLY B 1 154 ? -20.322 6.963   -25.886 1.00 34.49 ? 536 GLY B CA    1 
ATOM   2855 C C     . GLY B 1 154 ? -20.622 7.522   -24.504 1.00 34.48 ? 536 GLY B C     1 
ATOM   2856 O O     . GLY B 1 154 ? -19.896 7.283   -23.547 1.00 34.75 ? 536 GLY B O     1 
ATOM   2857 N N     . ARG B 1 155 ? -21.710 8.262   -24.392 1.00 34.50 ? 537 ARG B N     1 
ATOM   2858 C CA    . ARG B 1 155 ? -22.010 9.005   -23.174 1.00 34.53 ? 537 ARG B CA    1 
ATOM   2859 C C     . ARG B 1 155 ? -23.270 8.497   -22.501 1.00 34.78 ? 537 ARG B C     1 
ATOM   2860 O O     . ARG B 1 155 ? -24.151 7.949   -23.153 1.00 35.56 ? 537 ARG B O     1 
ATOM   2861 C CB    . ARG B 1 155 ? -22.234 10.491  -23.504 1.00 34.63 ? 537 ARG B CB    1 
ATOM   2862 C CG    . ARG B 1 155 ? -21.061 11.248  -24.126 1.00 33.72 ? 537 ARG B CG    1 
ATOM   2863 C CD    . ARG B 1 155 ? -19.817 11.155  -23.289 1.00 33.65 ? 537 ARG B CD    1 
ATOM   2864 N NE    . ARG B 1 155 ? -18.701 11.915  -23.853 1.00 35.68 ? 537 ARG B NE    1 
ATOM   2865 C CZ    . ARG B 1 155 ? -18.351 13.150  -23.487 1.00 34.33 ? 537 ARG B CZ    1 
ATOM   2866 N NH1   . ARG B 1 155 ? -19.020 13.803  -22.549 1.00 33.87 ? 537 ARG B NH1   1 
ATOM   2867 N NH2   . ARG B 1 155 ? -17.320 13.727  -24.064 1.00 33.65 ? 537 ARG B NH2   1 
ATOM   2868 N N     . ARG B 1 156 ? -23.398 8.748   -21.206 1.00 34.60 ? 538 ARG B N     1 
ATOM   2869 C CA    . ARG B 1 156 ? -24.641 8.445   -20.495 1.00 34.24 ? 538 ARG B CA    1 
ATOM   2870 C C     . ARG B 1 156 ? -25.914 8.959   -21.198 1.00 33.71 ? 538 ARG B C     1 
ATOM   2871 O O     . ARG B 1 156 ? -26.078 10.144  -21.477 1.00 33.22 ? 538 ARG B O     1 
ATOM   2872 C CB    . ARG B 1 156 ? -24.586 8.979   -19.069 1.00 34.45 ? 538 ARG B CB    1 
ATOM   2873 C CG    . ARG B 1 156 ? -23.479 8.420   -18.253 1.00 34.43 ? 538 ARG B CG    1 
ATOM   2874 C CD    . ARG B 1 156 ? -23.588 6.971   -18.032 1.00 33.85 ? 538 ARG B CD    1 
ATOM   2875 N NE    . ARG B 1 156 ? -22.861 6.620   -16.817 1.00 35.69 ? 538 ARG B NE    1 
ATOM   2876 C CZ    . ARG B 1 156 ? -22.625 5.369   -16.442 1.00 35.76 ? 538 ARG B CZ    1 
ATOM   2877 N NH1   . ARG B 1 156 ? -23.046 4.365   -17.218 1.00 36.59 ? 538 ARG B NH1   1 
ATOM   2878 N NH2   . ARG B 1 156 ? -21.974 5.120   -15.314 1.00 32.85 ? 538 ARG B NH2   1 
ATOM   2879 N N     . THR B 1 157 ? -26.826 8.035   -21.435 1.00 33.20 ? 539 THR B N     1 
ATOM   2880 C CA    . THR B 1 157 ? -27.965 8.279   -22.297 1.00 32.59 ? 539 THR B CA    1 
ATOM   2881 C C     . THR B 1 157 ? -29.193 8.710   -21.489 1.00 31.97 ? 539 THR B C     1 
ATOM   2882 O O     . THR B 1 157 ? -30.279 8.843   -22.018 1.00 32.04 ? 539 THR B O     1 
ATOM   2883 C CB    . THR B 1 157 ? -28.283 7.001   -23.098 1.00 32.59 ? 539 THR B CB    1 
ATOM   2884 O OG1   . THR B 1 157 ? -28.713 5.983   -22.184 1.00 34.65 ? 539 THR B OG1   1 
ATOM   2885 C CG2   . THR B 1 157 ? -27.051 6.502   -23.834 1.00 30.77 ? 539 THR B CG2   1 
ATOM   2886 N N     . ALA B 1 158 ? -29.022 8.917   -20.192 1.00 31.62 ? 540 ALA B N     1 
ATOM   2887 C CA    . ALA B 1 158 ? -30.118 9.356   -19.317 1.00 30.85 ? 540 ALA B CA    1 
ATOM   2888 C C     . ALA B 1 158 ? -29.588 9.503   -17.899 1.00 30.70 ? 540 ALA B C     1 
ATOM   2889 O O     . ALA B 1 158 ? -28.530 9.007   -17.562 1.00 30.21 ? 540 ALA B O     1 
ATOM   2890 C CB    . ALA B 1 158 ? -31.297 8.393   -19.372 1.00 30.12 ? 540 ALA B CB    1 
ATOM   2891 N N     . SER B 1 159 ? -30.322 10.209  -17.069 1.00 31.44 ? 541 SER B N     1 
ATOM   2892 C CA    . SER B 1 159 ? -29.906 10.388  -15.690 1.00 32.25 ? 541 SER B CA    1 
ATOM   2893 C C     . SER B 1 159 ? -30.557 9.353   -14.745 1.00 32.95 ? 541 SER B C     1 
ATOM   2894 O O     . SER B 1 159 ? -31.702 8.909   -14.955 1.00 32.99 ? 541 SER B O     1 
ATOM   2895 C CB    . SER B 1 159 ? -30.188 11.838  -15.247 1.00 31.98 ? 541 SER B CB    1 
ATOM   2896 O OG    . SER B 1 159 ? -29.430 12.747  -16.021 1.00 30.62 ? 541 SER B OG    1 
ATOM   2897 N N     . VAL B 1 160 ? -29.833 8.955   -13.707 1.00 33.78 ? 542 VAL B N     1 
ATOM   2898 C CA    . VAL B 1 160 ? -30.429 8.037   -12.726 1.00 35.01 ? 542 VAL B CA    1 
ATOM   2899 C C     . VAL B 1 160 ? -30.388 8.595   -11.283 1.00 35.89 ? 542 VAL B C     1 
ATOM   2900 O O     . VAL B 1 160 ? -29.317 8.834   -10.725 1.00 36.61 ? 542 VAL B O     1 
ATOM   2901 C CB    . VAL B 1 160 ? -29.798 6.606   -12.812 1.00 34.84 ? 542 VAL B CB    1 
ATOM   2902 C CG1   . VAL B 1 160 ? -30.681 5.610   -12.122 1.00 34.51 ? 542 VAL B CG1   1 
ATOM   2903 C CG2   . VAL B 1 160 ? -29.590 6.169   -14.266 1.00 34.14 ? 542 VAL B CG2   1 
ATOM   2904 N N     . ARG B 1 161 ? -31.550 8.801   -10.686 1.00 36.57 ? 543 ARG B N     1 
ATOM   2905 C CA    . ARG B 1 161 ? -31.619 9.431   -9.380  1.00 37.84 ? 543 ARG B CA    1 
ATOM   2906 C C     . ARG B 1 161 ? -32.085 8.368   -8.412  1.00 38.08 ? 543 ARG B C     1 
ATOM   2907 O O     . ARG B 1 161 ? -32.885 7.507   -8.778  1.00 37.88 ? 543 ARG B O     1 
ATOM   2908 C CB    . ARG B 1 161 ? -32.628 10.587  -9.397  1.00 38.57 ? 543 ARG B CB    1 
ATOM   2909 C CG    . ARG B 1 161 ? -32.372 11.764  -8.393  1.00 42.61 ? 543 ARG B CG    1 
ATOM   2910 C CD    . ARG B 1 161 ? -33.248 13.034  -8.690  1.00 47.48 ? 543 ARG B CD    1 
ATOM   2911 N NE    . ARG B 1 161 ? -34.517 12.583  -9.236  1.00 51.37 ? 543 ARG B NE    1 
ATOM   2912 C CZ    . ARG B 1 161 ? -35.541 12.176  -8.493  1.00 53.51 ? 543 ARG B CZ    1 
ATOM   2913 N NH1   . ARG B 1 161 ? -35.469 12.234  -7.156  1.00 53.61 ? 543 ARG B NH1   1 
ATOM   2914 N NH2   . ARG B 1 161 ? -36.644 11.737  -9.098  1.00 53.26 ? 543 ARG B NH2   1 
ATOM   2915 N N     . ALA B 1 162 ? -31.575 8.426   -7.183  1.00 38.42 ? 544 ALA B N     1 
ATOM   2916 C CA    . ALA B 1 162 ? -32.016 7.538   -6.123  1.00 38.85 ? 544 ALA B CA    1 
ATOM   2917 C C     . ALA B 1 162 ? -33.294 8.099   -5.497  1.00 39.72 ? 544 ALA B C     1 
ATOM   2918 O O     . ALA B 1 162 ? -33.319 9.233   -4.978  1.00 40.05 ? 544 ALA B O     1 
ATOM   2919 C CB    . ALA B 1 162 ? -30.923 7.372   -5.080  1.00 38.38 ? 544 ALA B CB    1 
ATOM   2920 N N     . ASP B 1 163 ? -34.366 7.315   -5.555  1.00 40.24 ? 545 ASP B N     1 
ATOM   2921 C CA    . ASP B 1 163 ? -35.627 7.756   -4.973  1.00 40.24 ? 545 ASP B CA    1 
ATOM   2922 C C     . ASP B 1 163 ? -35.685 7.391   -3.499  1.00 39.71 ? 545 ASP B C     1 
ATOM   2923 O O     . ASP B 1 163 ? -36.360 8.068   -2.734  1.00 40.43 ? 545 ASP B O     1 
ATOM   2924 C CB    . ASP B 1 163 ? -36.827 7.227   -5.768  1.00 40.67 ? 545 ASP B CB    1 
ATOM   2925 C CG    . ASP B 1 163 ? -36.900 7.815   -7.200  1.00 42.44 ? 545 ASP B CG    1 
ATOM   2926 O OD1   . ASP B 1 163 ? -36.235 8.854   -7.496  1.00 42.10 ? 545 ASP B OD1   1 
ATOM   2927 O OD2   . ASP B 1 163 ? -37.639 7.227   -8.031  1.00 45.03 ? 545 ASP B OD2   1 
ATOM   2928 N N     . THR B 1 164 ? -34.965 6.343   -3.100  1.00 38.85 ? 546 THR B N     1 
ATOM   2929 C CA    . THR B 1 164 ? -34.875 5.947   -1.685  1.00 38.07 ? 546 THR B CA    1 
ATOM   2930 C C     . THR B 1 164 ? -33.406 5.829   -1.333  1.00 37.73 ? 546 THR B C     1 
ATOM   2931 O O     . THR B 1 164 ? -32.567 6.190   -2.135  1.00 37.99 ? 546 THR B O     1 
ATOM   2932 C CB    . THR B 1 164 ? -35.586 4.596   -1.382  1.00 37.64 ? 546 THR B CB    1 
ATOM   2933 O OG1   . THR B 1 164 ? -34.763 3.512   -1.816  1.00 36.70 ? 546 THR B OG1   1 
ATOM   2934 C CG2   . THR B 1 164 ? -36.893 4.504   -2.096  1.00 37.02 ? 546 THR B CG2   1 
ATOM   2935 N N     . TYR B 1 165 ? -33.098 5.340   -0.134  1.00 37.48 ? 547 TYR B N     1 
ATOM   2936 C CA    . TYR B 1 165 ? -31.754 4.859   0.163   1.00 36.79 ? 547 TYR B CA    1 
ATOM   2937 C C     . TYR B 1 165 ? -31.558 3.716   -0.779  1.00 36.51 ? 547 TYR B C     1 
ATOM   2938 O O     . TYR B 1 165 ? -32.458 2.894   -0.919  1.00 36.96 ? 547 TYR B O     1 
ATOM   2939 C CB    . TYR B 1 165 ? -31.639 4.400   1.609   1.00 36.28 ? 547 TYR B CB    1 
ATOM   2940 C CG    . TYR B 1 165 ? -31.228 5.532   2.485   1.00 37.49 ? 547 TYR B CG    1 
ATOM   2941 C CD1   . TYR B 1 165 ? -32.179 6.358   3.090   1.00 38.43 ? 547 TYR B CD1   1 
ATOM   2942 C CD2   . TYR B 1 165 ? -29.871 5.820   2.671   1.00 39.13 ? 547 TYR B CD2   1 
ATOM   2943 C CE1   . TYR B 1 165 ? -31.782 7.441   3.882   1.00 40.59 ? 547 TYR B CE1   1 
ATOM   2944 C CE2   . TYR B 1 165 ? -29.455 6.878   3.453   1.00 41.08 ? 547 TYR B CE2   1 
ATOM   2945 C CZ    . TYR B 1 165 ? -30.409 7.694   4.057   1.00 43.38 ? 547 TYR B CZ    1 
ATOM   2946 O OH    . TYR B 1 165 ? -29.971 8.764   4.830   1.00 45.41 ? 547 TYR B OH    1 
ATOM   2947 N N     . CYS B 1 166 ? -30.419 3.687   -1.462  1.00 35.79 ? 548 CYS B N     1 
ATOM   2948 C CA    . CYS B 1 166 ? -30.151 2.659   -2.453  1.00 35.15 ? 548 CYS B CA    1 
ATOM   2949 C C     . CYS B 1 166 ? -28.953 1.817   -2.140  1.00 34.78 ? 548 CYS B C     1 
ATOM   2950 O O     . CYS B 1 166 ? -27.823 2.309   -2.065  1.00 35.55 ? 548 CYS B O     1 
ATOM   2951 C CB    . CYS B 1 166 ? -29.961 3.274   -3.819  1.00 34.96 ? 548 CYS B CB    1 
ATOM   2952 S SG    . CYS B 1 166 ? -31.534 3.427   -4.695  1.00 37.11 ? 548 CYS B SG    1 
ATOM   2953 N N     . ARG B 1 167 ? -29.179 0.528   -1.968  1.00 33.73 ? 549 ARG B N     1 
ATOM   2954 C CA    . ARG B 1 167 ? -28.041 -0.340  -1.779  1.00 32.92 ? 549 ARG B CA    1 
ATOM   2955 C C     . ARG B 1 167 ? -27.676 -0.916  -3.138  1.00 31.55 ? 549 ARG B C     1 
ATOM   2956 O O     . ARG B 1 167 ? -28.522 -1.514  -3.793  1.00 31.17 ? 549 ARG B O     1 
ATOM   2957 C CB    . ARG B 1 167 ? -28.350 -1.383  -0.709  1.00 33.44 ? 549 ARG B CB    1 
ATOM   2958 C CG    . ARG B 1 167 ? -28.621 -0.736  0.670   1.00 35.64 ? 549 ARG B CG    1 
ATOM   2959 C CD    . ARG B 1 167 ? -28.992 -1.749  1.738   1.00 38.98 ? 549 ARG B CD    1 
ATOM   2960 N NE    . ARG B 1 167 ? -27.842 -2.133  2.574   1.00 41.46 ? 549 ARG B NE    1 
ATOM   2961 C CZ    . ARG B 1 167 ? -27.110 -3.258  2.444   1.00 43.22 ? 549 ARG B CZ    1 
ATOM   2962 N NH1   . ARG B 1 167 ? -27.340 -4.178  1.494   1.00 42.22 ? 549 ARG B NH1   1 
ATOM   2963 N NH2   . ARG B 1 167 ? -26.112 -3.473  3.284   1.00 43.79 ? 549 ARG B NH2   1 
ATOM   2964 N N     . LEU B 1 168 ? -26.440 -0.676  -3.581  1.00 30.41 ? 550 LEU B N     1 
ATOM   2965 C CA    . LEU B 1 168 ? -26.009 -1.020  -4.948  1.00 29.72 ? 550 LEU B CA    1 
ATOM   2966 C C     . LEU B 1 168 ? -24.711 -1.799  -5.025  1.00 29.13 ? 550 LEU B C     1 
ATOM   2967 O O     . LEU B 1 168 ? -23.876 -1.684  -4.156  1.00 28.52 ? 550 LEU B O     1 
ATOM   2968 C CB    . LEU B 1 168 ? -25.837 0.238   -5.800  1.00 29.55 ? 550 LEU B CB    1 
ATOM   2969 C CG    . LEU B 1 168 ? -27.017 1.182   -6.040  1.00 30.21 ? 550 LEU B CG    1 
ATOM   2970 C CD1   . LEU B 1 168 ? -26.607 2.354   -6.909  1.00 30.21 ? 550 LEU B CD1   1 
ATOM   2971 C CD2   . LEU B 1 168 ? -28.178 0.453   -6.667  1.00 30.65 ? 550 LEU B CD2   1 
ATOM   2972 N N     . TYR B 1 169 ? -24.554 -2.587  -6.079  1.00 29.07 ? 551 TYR B N     1 
ATOM   2973 C CA    . TYR B 1 169 ? -23.262 -3.166  -6.403  1.00 29.93 ? 551 TYR B CA    1 
ATOM   2974 C C     . TYR B 1 169 ? -22.851 -2.663  -7.768  1.00 30.20 ? 551 TYR B C     1 
ATOM   2975 O O     . TYR B 1 169 ? -23.621 -2.731  -8.717  1.00 30.74 ? 551 TYR B O     1 
ATOM   2976 C CB    . TYR B 1 169 ? -23.289 -4.696  -6.387  1.00 30.01 ? 551 TYR B CB    1 
ATOM   2977 C CG    . TYR B 1 169 ? -23.213 -5.275  -5.004  1.00 31.43 ? 551 TYR B CG    1 
ATOM   2978 C CD1   . TYR B 1 169 ? -21.984 -5.387  -4.345  1.00 34.09 ? 551 TYR B CD1   1 
ATOM   2979 C CD2   . TYR B 1 169 ? -24.358 -5.683  -4.335  1.00 33.06 ? 551 TYR B CD2   1 
ATOM   2980 C CE1   . TYR B 1 169 ? -21.885 -5.901  -3.049  1.00 36.04 ? 551 TYR B CE1   1 
ATOM   2981 C CE2   . TYR B 1 169 ? -24.287 -6.203  -3.037  1.00 36.88 ? 551 TYR B CE2   1 
ATOM   2982 C CZ    . TYR B 1 169 ? -23.041 -6.303  -2.389  1.00 38.33 ? 551 TYR B CZ    1 
ATOM   2983 O OH    . TYR B 1 169 ? -22.948 -6.825  -1.101  1.00 39.88 ? 551 TYR B OH    1 
ATOM   2984 N N     . SER B 1 170 ? -21.636 -2.145  -7.859  1.00 30.09 ? 552 SER B N     1 
ATOM   2985 C CA    . SER B 1 170 ? -21.163 -1.535  -9.078  1.00 29.50 ? 552 SER B CA    1 
ATOM   2986 C C     . SER B 1 170 ? -20.030 -2.346  -9.711  1.00 29.27 ? 552 SER B C     1 
ATOM   2987 O O     . SER B 1 170 ? -19.323 -3.096  -9.027  1.00 28.75 ? 552 SER B O     1 
ATOM   2988 C CB    . SER B 1 170 ? -20.714 -0.125  -8.792  1.00 29.42 ? 552 SER B CB    1 
ATOM   2989 O OG    . SER B 1 170 ? -19.585 -0.147  -7.952  1.00 30.30 ? 552 SER B OG    1 
ATOM   2990 N N     . LEU B 1 171 ? -19.893 -2.193  -11.026 1.00 29.04 ? 553 LEU B N     1 
ATOM   2991 C CA    . LEU B 1 171 ? -18.938 -2.935  -11.810 1.00 29.37 ? 553 LEU B CA    1 
ATOM   2992 C C     . LEU B 1 171 ? -18.215 -1.981  -12.705 1.00 29.69 ? 553 LEU B C     1 
ATOM   2993 O O     . LEU B 1 171 ? -18.837 -1.372  -13.557 1.00 30.16 ? 553 LEU B O     1 
ATOM   2994 C CB    . LEU B 1 171 ? -19.673 -3.926  -12.675 1.00 29.46 ? 553 LEU B CB    1 
ATOM   2995 C CG    . LEU B 1 171 ? -18.816 -4.866  -13.512 1.00 30.00 ? 553 LEU B CG    1 
ATOM   2996 C CD1   . LEU B 1 171 ? -17.834 -5.691  -12.650 1.00 30.69 ? 553 LEU B CD1   1 
ATOM   2997 C CD2   . LEU B 1 171 ? -19.750 -5.768  -14.283 1.00 29.15 ? 553 LEU B CD2   1 
ATOM   2998 N N     . SER B 1 172 ? -16.909 -1.841  -12.517 1.00 30.26 ? 554 SER B N     1 
ATOM   2999 C CA    . SER B 1 172 ? -16.124 -0.893  -13.299 1.00 31.12 ? 554 SER B CA    1 
ATOM   3000 C C     . SER B 1 172 ? -15.888 -1.366  -14.738 1.00 31.72 ? 554 SER B C     1 
ATOM   3001 O O     . SER B 1 172 ? -15.910 -2.576  -15.029 1.00 31.98 ? 554 SER B O     1 
ATOM   3002 C CB    . SER B 1 172 ? -14.794 -0.671  -12.653 1.00 30.63 ? 554 SER B CB    1 
ATOM   3003 O OG    . SER B 1 172 ? -13.998 -1.781  -12.988 1.00 32.51 ? 554 SER B OG    1 
ATOM   3004 N N     . VAL B 1 173 ? -15.647 -0.405  -15.630 1.00 32.34 ? 555 VAL B N     1 
ATOM   3005 C CA    . VAL B 1 173 ? -15.575 -0.703  -17.049 1.00 32.88 ? 555 VAL B CA    1 
ATOM   3006 C C     . VAL B 1 173 ? -14.559 -1.818  -17.362 1.00 33.48 ? 555 VAL B C     1 
ATOM   3007 O O     . VAL B 1 173 ? -14.909 -2.791  -18.000 1.00 33.95 ? 555 VAL B O     1 
ATOM   3008 C CB    . VAL B 1 173 ? -15.423 0.576   -17.924 1.00 32.84 ? 555 VAL B CB    1 
ATOM   3009 C CG1   . VAL B 1 173 ? -14.022 1.163   -17.851 1.00 32.49 ? 555 VAL B CG1   1 
ATOM   3010 C CG2   . VAL B 1 173 ? -15.853 0.299   -19.368 1.00 32.97 ? 555 VAL B CG2   1 
ATOM   3011 N N     . ASP B 1 174 ? -13.333 -1.734  -16.870 1.00 34.02 ? 556 ASP B N     1 
ATOM   3012 C CA    . ASP B 1 174 ? -12.361 -2.746  -17.266 1.00 34.88 ? 556 ASP B CA    1 
ATOM   3013 C C     . ASP B 1 174 ? -12.888 -4.140  -16.923 1.00 34.70 ? 556 ASP B C     1 
ATOM   3014 O O     . ASP B 1 174 ? -12.743 -5.102  -17.693 1.00 34.44 ? 556 ASP B O     1 
ATOM   3015 C CB    . ASP B 1 174 ? -11.004 -2.488  -16.614 1.00 35.59 ? 556 ASP B CB    1 
ATOM   3016 C CG    . ASP B 1 174 ? -10.427 -1.078  -16.936 1.00 38.57 ? 556 ASP B CG    1 
ATOM   3017 O OD1   . ASP B 1 174 ? -10.753 -0.485  -18.007 1.00 39.40 ? 556 ASP B OD1   1 
ATOM   3018 O OD2   . ASP B 1 174 ? -9.628  -0.563  -16.098 1.00 41.82 ? 556 ASP B OD2   1 
ATOM   3019 N N     . ASN B 1 175 ? -13.537 -4.219  -15.768 1.00 34.60 ? 557 ASN B N     1 
ATOM   3020 C CA    . ASN B 1 175 ? -14.036 -5.470  -15.244 1.00 34.18 ? 557 ASN B CA    1 
ATOM   3021 C C     . ASN B 1 175 ? -15.193 -6.012  -16.070 1.00 34.43 ? 557 ASN B C     1 
ATOM   3022 O O     . ASN B 1 175 ? -15.284 -7.208  -16.329 1.00 34.40 ? 557 ASN B O     1 
ATOM   3023 C CB    . ASN B 1 175 ? -14.452 -5.284  -13.787 1.00 34.03 ? 557 ASN B CB    1 
ATOM   3024 C CG    . ASN B 1 175 ? -13.281 -5.250  -12.846 1.00 32.47 ? 557 ASN B CG    1 
ATOM   3025 O OD1   . ASN B 1 175 ? -12.258 -5.858  -13.117 1.00 32.85 ? 557 ASN B OD1   1 
ATOM   3026 N ND2   . ASN B 1 175 ? -13.434 -4.558  -11.719 1.00 29.44 ? 557 ASN B ND2   1 
ATOM   3027 N N     . PHE B 1 176 ? -16.084 -5.115  -16.476 1.00 34.72 ? 558 PHE B N     1 
ATOM   3028 C CA    . PHE B 1 176 ? -17.211 -5.451  -17.349 1.00 34.52 ? 558 PHE B CA    1 
ATOM   3029 C C     . PHE B 1 176 ? -16.702 -6.052  -18.657 1.00 34.94 ? 558 PHE B C     1 
ATOM   3030 O O     . PHE B 1 176 ? -17.230 -7.060  -19.106 1.00 35.17 ? 558 PHE B O     1 
ATOM   3031 C CB    . PHE B 1 176 ? -17.984 -4.175  -17.602 1.00 34.18 ? 558 PHE B CB    1 
ATOM   3032 C CG    . PHE B 1 176 ? -19.153 -4.310  -18.518 1.00 33.54 ? 558 PHE B CG    1 
ATOM   3033 C CD1   . PHE B 1 176 ? -20.364 -4.776  -18.057 1.00 32.35 ? 558 PHE B CD1   1 
ATOM   3034 C CD2   . PHE B 1 176 ? -19.076 -3.858  -19.829 1.00 33.75 ? 558 PHE B CD2   1 
ATOM   3035 C CE1   . PHE B 1 176 ? -21.449 -4.834  -18.895 1.00 32.61 ? 558 PHE B CE1   1 
ATOM   3036 C CE2   . PHE B 1 176 ? -20.184 -3.925  -20.684 1.00 32.30 ? 558 PHE B CE2   1 
ATOM   3037 C CZ    . PHE B 1 176 ? -21.358 -4.409  -20.215 1.00 31.23 ? 558 PHE B CZ    1 
ATOM   3038 N N     . ASN B 1 177 ? -15.656 -5.457  -19.237 1.00 35.36 ? 559 ASN B N     1 
ATOM   3039 C CA    . ASN B 1 177 ? -15.032 -5.963  -20.461 1.00 35.96 ? 559 ASN B CA    1 
ATOM   3040 C C     . ASN B 1 177 ? -14.182 -7.229  -20.346 1.00 36.68 ? 559 ASN B C     1 
ATOM   3041 O O     . ASN B 1 177 ? -14.186 -8.075  -21.260 1.00 36.91 ? 559 ASN B O     1 
ATOM   3042 C CB    . ASN B 1 177 ? -14.206 -4.879  -21.114 1.00 35.80 ? 559 ASN B CB    1 
ATOM   3043 C CG    . ASN B 1 177 ? -15.046 -3.934  -21.898 1.00 35.63 ? 559 ASN B CG    1 
ATOM   3044 O OD1   . ASN B 1 177 ? -15.814 -4.333  -22.789 1.00 35.42 ? 559 ASN B OD1   1 
ATOM   3045 N ND2   . ASN B 1 177 ? -14.927 -2.663  -21.571 1.00 34.42 ? 559 ASN B ND2   1 
ATOM   3046 N N     . GLU B 1 178 ? -13.435 -7.351  -19.252 1.00 37.10 ? 560 GLU B N     1 
ATOM   3047 C CA    . GLU B 1 178 ? -12.675 -8.556  -19.030 1.00 37.68 ? 560 GLU B CA    1 
ATOM   3048 C C     . GLU B 1 178 ? -13.682 -9.712  -19.059 1.00 37.08 ? 560 GLU B C     1 
ATOM   3049 O O     . GLU B 1 178 ? -13.572 -10.614 -19.871 1.00 37.43 ? 560 GLU B O     1 
ATOM   3050 C CB    . GLU B 1 178 ? -11.920 -8.436  -17.716 1.00 38.18 ? 560 GLU B CB    1 
ATOM   3051 C CG    . GLU B 1 178 ? -10.886 -9.520  -17.384 1.00 42.57 ? 560 GLU B CG    1 
ATOM   3052 C CD    . GLU B 1 178 ? -10.218 -9.296  -15.973 1.00 49.57 ? 560 GLU B CD    1 
ATOM   3053 O OE1   . GLU B 1 178 ? -9.613  -8.194  -15.761 1.00 51.45 ? 560 GLU B OE1   1 
ATOM   3054 O OE2   . GLU B 1 178 ? -10.304 -10.206 -15.079 1.00 50.75 ? 560 GLU B OE2   1 
ATOM   3055 N N     . VAL B 1 179 ? -14.715 -9.649  -18.235 1.00 36.36 ? 561 VAL B N     1 
ATOM   3056 C CA    . VAL B 1 179 ? -15.648 -10.746 -18.173 1.00 35.76 ? 561 VAL B CA    1 
ATOM   3057 C C     . VAL B 1 179 ? -16.343 -10.964 -19.495 1.00 36.08 ? 561 VAL B C     1 
ATOM   3058 O O     . VAL B 1 179 ? -16.545 -12.091 -19.888 1.00 36.33 ? 561 VAL B O     1 
ATOM   3059 C CB    . VAL B 1 179 ? -16.714 -10.546 -17.118 1.00 35.59 ? 561 VAL B CB    1 
ATOM   3060 C CG1   . VAL B 1 179 ? -17.665 -11.732 -17.129 1.00 35.28 ? 561 VAL B CG1   1 
ATOM   3061 C CG2   . VAL B 1 179 ? -16.099 -10.378 -15.758 1.00 34.26 ? 561 VAL B CG2   1 
ATOM   3062 N N     . LEU B 1 180 ? -16.729 -9.891  -20.170 1.00 36.53 ? 562 LEU B N     1 
ATOM   3063 C CA    . LEU B 1 180 ? -17.412 -10.018 -21.448 1.00 36.76 ? 562 LEU B CA    1 
ATOM   3064 C C     . LEU B 1 180 ? -16.532 -10.525 -22.589 1.00 37.52 ? 562 LEU B C     1 
ATOM   3065 O O     . LEU B 1 180 ? -17.043 -11.085 -23.561 1.00 37.82 ? 562 LEU B O     1 
ATOM   3066 C CB    . LEU B 1 180 ? -18.143 -8.749  -21.818 1.00 36.29 ? 562 LEU B CB    1 
ATOM   3067 C CG    . LEU B 1 180 ? -19.420 -8.476  -21.028 1.00 36.37 ? 562 LEU B CG    1 
ATOM   3068 C CD1   . LEU B 1 180 ? -20.203 -7.495  -21.809 1.00 36.68 ? 562 LEU B CD1   1 
ATOM   3069 C CD2   . LEU B 1 180 ? -20.279 -9.704  -20.779 1.00 36.46 ? 562 LEU B CD2   1 
ATOM   3070 N N     . GLU B 1 181 ? -15.223 -10.348 -22.466 1.00 38.38 ? 563 GLU B N     1 
ATOM   3071 C CA    . GLU B 1 181 ? -14.273 -11.070 -23.307 1.00 39.99 ? 563 GLU B CA    1 
ATOM   3072 C C     . GLU B 1 181 ? -14.413 -12.589 -23.161 1.00 40.30 ? 563 GLU B C     1 
ATOM   3073 O O     . GLU B 1 181 ? -14.515 -13.316 -24.148 1.00 40.36 ? 563 GLU B O     1 
ATOM   3074 C CB    . GLU B 1 181 ? -12.854 -10.661 -22.961 1.00 40.43 ? 563 GLU B CB    1 
ATOM   3075 C CG    . GLU B 1 181 ? -12.254 -9.657  -23.913 1.00 44.36 ? 563 GLU B CG    1 
ATOM   3076 C CD    . GLU B 1 181 ? -11.316 -10.329 -24.916 1.00 49.17 ? 563 GLU B CD    1 
ATOM   3077 O OE1   . GLU B 1 181 ? -10.331 -10.996 -24.452 1.00 49.94 ? 563 GLU B OE1   1 
ATOM   3078 O OE2   . GLU B 1 181 ? -11.572 -10.182 -26.155 1.00 49.42 ? 563 GLU B OE2   1 
ATOM   3079 N N     . GLU B 1 182 ? -14.442 -13.072 -21.930 1.00 40.80 ? 564 GLU B N     1 
ATOM   3080 C CA    . GLU B 1 182 ? -14.591 -14.495 -21.711 1.00 41.71 ? 564 GLU B CA    1 
ATOM   3081 C C     . GLU B 1 182 ? -15.979 -15.028 -22.098 1.00 41.94 ? 564 GLU B C     1 
ATOM   3082 O O     . GLU B 1 182 ? -16.093 -16.155 -22.540 1.00 42.73 ? 564 GLU B O     1 
ATOM   3083 C CB    . GLU B 1 182 ? -14.270 -14.858 -20.268 1.00 41.92 ? 564 GLU B CB    1 
ATOM   3084 C CG    . GLU B 1 182 ? -12.993 -14.222 -19.727 1.00 45.14 ? 564 GLU B CG    1 
ATOM   3085 C CD    . GLU B 1 182 ? -12.841 -14.417 -18.227 1.00 48.95 ? 564 GLU B CD    1 
ATOM   3086 O OE1   . GLU B 1 182 ? -11.828 -13.940 -17.654 1.00 49.29 ? 564 GLU B OE1   1 
ATOM   3087 O OE2   . GLU B 1 182 ? -13.746 -15.048 -17.623 1.00 51.11 ? 564 GLU B OE2   1 
ATOM   3088 N N     . TYR B 1 183 ? -17.040 -14.245 -21.936 1.00 42.05 ? 565 TYR B N     1 
ATOM   3089 C CA    . TYR B 1 183 ? -18.381 -14.748 -22.252 1.00 41.65 ? 565 TYR B CA    1 
ATOM   3090 C C     . TYR B 1 183 ? -19.111 -13.869 -23.277 1.00 41.81 ? 565 TYR B C     1 
ATOM   3091 O O     . TYR B 1 183 ? -20.038 -13.162 -22.938 1.00 41.44 ? 565 TYR B O     1 
ATOM   3092 C CB    . TYR B 1 183 ? -19.213 -14.880 -20.980 1.00 41.28 ? 565 TYR B CB    1 
ATOM   3093 C CG    . TYR B 1 183 ? -18.589 -15.683 -19.881 1.00 39.91 ? 565 TYR B CG    1 
ATOM   3094 C CD1   . TYR B 1 183 ? -18.914 -17.023 -19.718 1.00 40.80 ? 565 TYR B CD1   1 
ATOM   3095 C CD2   . TYR B 1 183 ? -17.697 -15.101 -18.980 1.00 38.61 ? 565 TYR B CD2   1 
ATOM   3096 C CE1   . TYR B 1 183 ? -18.347 -17.794 -18.676 1.00 41.18 ? 565 TYR B CE1   1 
ATOM   3097 C CE2   . TYR B 1 183 ? -17.119 -15.845 -17.946 1.00 38.68 ? 565 TYR B CE2   1 
ATOM   3098 C CZ    . TYR B 1 183 ? -17.453 -17.192 -17.796 1.00 40.65 ? 565 TYR B CZ    1 
ATOM   3099 O OH    . TYR B 1 183 ? -16.905 -17.950 -16.779 1.00 42.01 ? 565 TYR B OH    1 
ATOM   3100 N N     . PRO B 1 184 ? -18.710 -13.943 -24.547 1.00 42.21 ? 566 PRO B N     1 
ATOM   3101 C CA    . PRO B 1 184 ? -19.288 -13.107 -25.604 1.00 42.50 ? 566 PRO B CA    1 
ATOM   3102 C C     . PRO B 1 184 ? -20.811 -13.227 -25.728 1.00 42.50 ? 566 PRO B C     1 
ATOM   3103 O O     . PRO B 1 184 ? -21.478 -12.230 -26.003 1.00 42.62 ? 566 PRO B O     1 
ATOM   3104 C CB    . PRO B 1 184 ? -18.637 -13.648 -26.876 1.00 42.68 ? 566 PRO B CB    1 
ATOM   3105 C CG    . PRO B 1 184 ? -17.463 -14.482 -26.404 1.00 42.50 ? 566 PRO B CG    1 
ATOM   3106 C CD    . PRO B 1 184 ? -17.866 -15.019 -25.091 1.00 42.26 ? 566 PRO B CD    1 
ATOM   3107 N N     . MET B 1 185 ? -21.337 -14.433 -25.533 1.00 42.40 ? 567 MET B N     1 
ATOM   3108 C CA    . MET B 1 185 ? -22.781 -14.720 -25.588 1.00 42.94 ? 567 MET B CA    1 
ATOM   3109 C C     . MET B 1 185 ? -23.576 -13.810 -24.700 1.00 41.76 ? 567 MET B C     1 
ATOM   3110 O O     . MET B 1 185 ? -24.768 -13.555 -24.902 1.00 42.01 ? 567 MET B O     1 
ATOM   3111 C CB    . MET B 1 185 ? -23.049 -16.146 -25.112 1.00 44.16 ? 567 MET B CB    1 
ATOM   3112 C CG    . MET B 1 185 ? -22.319 -17.205 -25.912 1.00 49.40 ? 567 MET B CG    1 
ATOM   3113 S SD    . MET B 1 185 ? -22.983 -17.231 -27.595 1.00 59.59 ? 567 MET B SD    1 
ATOM   3114 C CE    . MET B 1 185 ? -21.965 -16.039 -28.538 1.00 58.41 ? 567 MET B CE    1 
ATOM   3115 N N     . MET B 1 186 ? -22.885 -13.334 -23.691 1.00 40.30 ? 568 MET B N     1 
ATOM   3116 C CA    . MET B 1 186 ? -23.491 -12.624 -22.631 1.00 39.06 ? 568 MET B CA    1 
ATOM   3117 C C     . MET B 1 186 ? -23.478 -11.133 -22.977 1.00 37.78 ? 568 MET B C     1 
ATOM   3118 O O     . MET B 1 186 ? -24.219 -10.336 -22.413 1.00 37.02 ? 568 MET B O     1 
ATOM   3119 C CB    . MET B 1 186 ? -22.678 -12.953 -21.392 1.00 39.48 ? 568 MET B CB    1 
ATOM   3120 C CG    . MET B 1 186 ? -23.497 -13.392 -20.209 1.00 41.04 ? 568 MET B CG    1 
ATOM   3121 S SD    . MET B 1 186 ? -24.959 -14.384 -20.533 1.00 41.34 ? 568 MET B SD    1 
ATOM   3122 C CE    . MET B 1 186 ? -26.136 -13.399 -19.575 1.00 40.81 ? 568 MET B CE    1 
ATOM   3123 N N     . ARG B 1 187 ? -22.630 -10.782 -23.937 1.00 36.82 ? 569 ARG B N     1 
ATOM   3124 C CA    . ARG B 1 187 ? -22.623 -9.470  -24.528 1.00 36.08 ? 569 ARG B CA    1 
ATOM   3125 C C     . ARG B 1 187 ? -23.910 -9.288  -25.286 1.00 36.13 ? 569 ARG B C     1 
ATOM   3126 O O     . ARG B 1 187 ? -24.555 -8.271  -25.160 1.00 36.46 ? 569 ARG B O     1 
ATOM   3127 C CB    . ARG B 1 187 ? -21.468 -9.339  -25.486 1.00 35.88 ? 569 ARG B CB    1 
ATOM   3128 C CG    . ARG B 1 187 ? -21.104 -7.933  -25.764 1.00 35.67 ? 569 ARG B CG    1 
ATOM   3129 C CD    . ARG B 1 187 ? -19.672 -7.839  -26.286 1.00 35.92 ? 569 ARG B CD    1 
ATOM   3130 N NE    . ARG B 1 187 ? -18.951 -6.746  -25.632 1.00 35.39 ? 569 ARG B NE    1 
ATOM   3131 C CZ    . ARG B 1 187 ? -19.120 -5.443  -25.893 1.00 34.57 ? 569 ARG B CZ    1 
ATOM   3132 N NH1   . ARG B 1 187 ? -19.979 -5.027  -26.816 1.00 29.90 ? 569 ARG B NH1   1 
ATOM   3133 N NH2   . ARG B 1 187 ? -18.417 -4.539  -25.212 1.00 36.94 ? 569 ARG B NH2   1 
ATOM   3134 N N     . ARG B 1 188 ? -24.326 -10.277 -26.056 1.00 36.22 ? 570 ARG B N     1 
ATOM   3135 C CA    . ARG B 1 188 ? -25.536 -10.081 -26.827 1.00 36.84 ? 570 ARG B CA    1 
ATOM   3136 C C     . ARG B 1 188 ? -26.748 -9.927  -25.933 1.00 35.74 ? 570 ARG B C     1 
ATOM   3137 O O     . ARG B 1 188 ? -27.660 -9.179  -26.252 1.00 35.45 ? 570 ARG B O     1 
ATOM   3138 C CB    . ARG B 1 188 ? -25.712 -11.172 -27.870 1.00 38.13 ? 570 ARG B CB    1 
ATOM   3139 C CG    . ARG B 1 188 ? -24.580 -11.170 -28.951 1.00 42.50 ? 570 ARG B CG    1 
ATOM   3140 C CD    . ARG B 1 188 ? -24.610 -12.453 -29.768 1.00 48.76 ? 570 ARG B CD    1 
ATOM   3141 N NE    . ARG B 1 188 ? -24.897 -13.545 -28.840 1.00 53.26 ? 570 ARG B NE    1 
ATOM   3142 C CZ    . ARG B 1 188 ? -25.675 -14.595 -29.091 1.00 55.32 ? 570 ARG B CZ    1 
ATOM   3143 N NH1   . ARG B 1 188 ? -26.253 -14.732 -30.281 1.00 57.08 ? 570 ARG B NH1   1 
ATOM   3144 N NH2   . ARG B 1 188 ? -25.875 -15.514 -28.142 1.00 55.22 ? 570 ARG B NH2   1 
ATOM   3145 N N     . ALA B 1 189 ? -26.729 -10.603 -24.793 1.00 35.05 ? 571 ALA B N     1 
ATOM   3146 C CA    . ALA B 1 189 ? -27.771 -10.440 -23.782 1.00 34.55 ? 571 ALA B CA    1 
ATOM   3147 C C     . ALA B 1 189 ? -27.896 -8.983  -23.339 1.00 34.52 ? 571 ALA B C     1 
ATOM   3148 O O     . ALA B 1 189 ? -29.004 -8.431  -23.244 1.00 34.71 ? 571 ALA B O     1 
ATOM   3149 C CB    . ALA B 1 189 ? -27.469 -11.298 -22.606 1.00 34.33 ? 571 ALA B CB    1 
ATOM   3150 N N     . PHE B 1 190 ? -26.749 -8.356  -23.076 1.00 34.02 ? 572 PHE B N     1 
ATOM   3151 C CA    . PHE B 1 190 ? -26.731 -6.974  -22.637 1.00 32.90 ? 572 PHE B CA    1 
ATOM   3152 C C     . PHE B 1 190 ? -27.229 -6.116  -23.740 1.00 32.44 ? 572 PHE B C     1 
ATOM   3153 O O     . PHE B 1 190 ? -28.154 -5.330  -23.526 1.00 32.78 ? 572 PHE B O     1 
ATOM   3154 C CB    . PHE B 1 190 ? -25.342 -6.536  -22.165 1.00 32.81 ? 572 PHE B CB    1 
ATOM   3155 C CG    . PHE B 1 190 ? -25.075 -6.877  -20.732 1.00 32.27 ? 572 PHE B CG    1 
ATOM   3156 C CD1   . PHE B 1 190 ? -25.779 -6.240  -19.707 1.00 32.28 ? 572 PHE B CD1   1 
ATOM   3157 C CD2   . PHE B 1 190 ? -24.166 -7.853  -20.399 1.00 31.70 ? 572 PHE B CD2   1 
ATOM   3158 C CE1   . PHE B 1 190 ? -25.557 -6.566  -18.371 1.00 32.45 ? 572 PHE B CE1   1 
ATOM   3159 C CE2   . PHE B 1 190 ? -23.936 -8.188  -19.063 1.00 32.04 ? 572 PHE B CE2   1 
ATOM   3160 C CZ    . PHE B 1 190 ? -24.630 -7.547  -18.050 1.00 32.17 ? 572 PHE B CZ    1 
ATOM   3161 N N     . GLU B 1 191 ? -26.664 -6.336  -24.928 1.00 31.89 ? 573 GLU B N     1 
ATOM   3162 C CA    . GLU B 1 191 ? -26.919 -5.509  -26.106 1.00 31.56 ? 573 GLU B CA    1 
ATOM   3163 C C     . GLU B 1 191 ? -28.423 -5.449  -26.405 1.00 31.45 ? 573 GLU B C     1 
ATOM   3164 O O     . GLU B 1 191 ? -28.974 -4.344  -26.584 1.00 31.01 ? 573 GLU B O     1 
ATOM   3165 C CB    . GLU B 1 191 ? -26.095 -6.007  -27.306 1.00 31.59 ? 573 GLU B CB    1 
ATOM   3166 C CG    . GLU B 1 191 ? -24.556 -5.722  -27.201 1.00 32.45 ? 573 GLU B CG    1 
ATOM   3167 C CD    . GLU B 1 191 ? -23.706 -6.235  -28.397 1.00 34.86 ? 573 GLU B CD    1 
ATOM   3168 O OE1   . GLU B 1 191 ? -22.690 -5.585  -28.722 1.00 33.99 ? 573 GLU B OE1   1 
ATOM   3169 O OE2   . GLU B 1 191 ? -24.040 -7.273  -29.023 1.00 36.92 ? 573 GLU B OE2   1 
ATOM   3170 N N     . THR B 1 192 ? -29.076 -6.623  -26.382 1.00 30.56 ? 574 THR B N     1 
ATOM   3171 C CA    . THR B 1 192 ? -30.498 -6.745  -26.632 1.00 30.10 ? 574 THR B CA    1 
ATOM   3172 C C     . THR B 1 192 ? -31.363 -5.929  -25.706 1.00 30.23 ? 574 THR B C     1 
ATOM   3173 O O     . THR B 1 192 ? -32.244 -5.214  -26.188 1.00 31.16 ? 574 THR B O     1 
ATOM   3174 C CB    . THR B 1 192 ? -30.941 -8.169  -26.533 1.00 30.01 ? 574 THR B CB    1 
ATOM   3175 O OG1   . THR B 1 192 ? -30.321 -8.883  -27.582 1.00 31.32 ? 574 THR B OG1   1 
ATOM   3176 C CG2   . THR B 1 192 ? -32.440 -8.295  -26.721 1.00 30.29 ? 574 THR B CG2   1 
ATOM   3177 N N     . VAL B 1 193 ? -31.159 -6.037  -24.391 1.00 29.89 ? 575 VAL B N     1 
ATOM   3178 C CA    . VAL B 1 193 ? -31.970 -5.248  -23.421 1.00 29.23 ? 575 VAL B CA    1 
ATOM   3179 C C     . VAL B 1 193 ? -31.709 -3.739  -23.590 1.00 29.21 ? 575 VAL B C     1 
ATOM   3180 O O     . VAL B 1 193 ? -32.597 -2.919  -23.410 1.00 28.45 ? 575 VAL B O     1 
ATOM   3181 C CB    . VAL B 1 193 ? -31.722 -5.692  -21.946 1.00 29.23 ? 575 VAL B CB    1 
ATOM   3182 C CG1   . VAL B 1 193 ? -32.526 -4.856  -20.976 1.00 28.10 ? 575 VAL B CG1   1 
ATOM   3183 C CG2   . VAL B 1 193 ? -32.110 -7.125  -21.783 1.00 28.21 ? 575 VAL B CG2   1 
ATOM   3184 N N     . ALA B 1 194 ? -30.472 -3.402  -23.948 1.00 29.55 ? 576 ALA B N     1 
ATOM   3185 C CA    . ALA B 1 194 ? -30.081 -2.026  -24.246 1.00 30.10 ? 576 ALA B CA    1 
ATOM   3186 C C     . ALA B 1 194 ? -30.808 -1.452  -25.463 1.00 30.51 ? 576 ALA B C     1 
ATOM   3187 O O     . ALA B 1 194 ? -31.312 -0.329  -25.404 1.00 30.78 ? 576 ALA B O     1 
ATOM   3188 C CB    . ALA B 1 194 ? -28.561 -1.918  -24.433 1.00 29.83 ? 576 ALA B CB    1 
ATOM   3189 N N     . ILE B 1 195 ? -30.875 -2.196  -26.565 1.00 30.73 ? 577 ILE B N     1 
ATOM   3190 C CA    . ILE B 1 195 ? -31.647 -1.689  -27.681 1.00 30.93 ? 577 ILE B CA    1 
ATOM   3191 C C     . ILE B 1 195 ? -33.114 -1.538  -27.277 1.00 32.00 ? 577 ILE B C     1 
ATOM   3192 O O     . ILE B 1 195 ? -33.714 -0.517  -27.597 1.00 32.09 ? 577 ILE B O     1 
ATOM   3193 C CB    . ILE B 1 195 ? -31.447 -2.457  -28.972 1.00 30.79 ? 577 ILE B CB    1 
ATOM   3194 C CG1   . ILE B 1 195 ? -29.955 -2.774  -29.127 1.00 31.05 ? 577 ILE B CG1   1 
ATOM   3195 C CG2   . ILE B 1 195 ? -31.861 -1.588  -30.109 1.00 28.79 ? 577 ILE B CG2   1 
ATOM   3196 C CD1   . ILE B 1 195 ? -29.573 -3.628  -30.300 1.00 32.16 ? 577 ILE B CD1   1 
ATOM   3197 N N     . ASP B 1 196 ? -33.684 -2.481  -26.519 1.00 32.68 ? 578 ASP B N     1 
ATOM   3198 C CA    . ASP B 1 196 ? -35.064 -2.256  -26.025 1.00 34.16 ? 578 ASP B CA    1 
ATOM   3199 C C     . ASP B 1 196 ? -35.206 -1.015  -25.136 1.00 33.87 ? 578 ASP B C     1 
ATOM   3200 O O     . ASP B 1 196 ? -36.232 -0.347  -25.154 1.00 34.56 ? 578 ASP B O     1 
ATOM   3201 C CB    . ASP B 1 196 ? -35.670 -3.487  -25.327 1.00 34.92 ? 578 ASP B CB    1 
ATOM   3202 C CG    . ASP B 1 196 ? -35.509 -4.787  -26.154 1.00 39.55 ? 578 ASP B CG    1 
ATOM   3203 O OD1   . ASP B 1 196 ? -35.422 -4.722  -27.419 1.00 41.86 ? 578 ASP B OD1   1 
ATOM   3204 O OD2   . ASP B 1 196 ? -35.461 -5.889  -25.525 1.00 44.51 ? 578 ASP B OD2   1 
ATOM   3205 N N     . ARG B 1 197 ? -34.179 -0.704  -24.363 1.00 33.50 ? 579 ARG B N     1 
ATOM   3206 C CA    . ARG B 1 197 ? -34.271 0.389   -23.440 1.00 33.21 ? 579 ARG B CA    1 
ATOM   3207 C C     . ARG B 1 197 ? -34.237 1.689   -24.211 1.00 33.61 ? 579 ARG B C     1 
ATOM   3208 O O     . ARG B 1 197 ? -35.062 2.561   -23.966 1.00 33.45 ? 579 ARG B O     1 
ATOM   3209 C CB    . ARG B 1 197 ? -33.164 0.291   -22.402 1.00 33.17 ? 579 ARG B CB    1 
ATOM   3210 C CG    . ARG B 1 197 ? -33.425 -0.762  -21.340 1.00 32.41 ? 579 ARG B CG    1 
ATOM   3211 C CD    . ARG B 1 197 ? -32.244 -1.038  -20.408 1.00 30.39 ? 579 ARG B CD    1 
ATOM   3212 N NE    . ARG B 1 197 ? -32.786 -1.444  -19.111 1.00 31.47 ? 579 ARG B NE    1 
ATOM   3213 C CZ    . ARG B 1 197 ? -32.102 -1.612  -17.978 1.00 30.28 ? 579 ARG B CZ    1 
ATOM   3214 N NH1   . ARG B 1 197 ? -30.779 -1.434  -17.911 1.00 29.38 ? 579 ARG B NH1   1 
ATOM   3215 N NH2   . ARG B 1 197 ? -32.771 -1.982  -16.900 1.00 28.26 ? 579 ARG B NH2   1 
ATOM   3216 N N     . LEU B 1 198 ? -33.428 1.788   -25.257 1.00 34.39 ? 580 LEU B N     1 
ATOM   3217 C CA    . LEU B 1 198 ? -33.219 3.013   -26.029 1.00 35.36 ? 580 LEU B CA    1 
ATOM   3218 C C     . LEU B 1 198 ? -34.373 3.269   -26.998 1.00 36.85 ? 580 LEU B C     1 
ATOM   3219 O O     . LEU B 1 198 ? -34.656 4.417   -27.348 1.00 36.70 ? 580 LEU B O     1 
ATOM   3220 C CB    . LEU B 1 198 ? -31.892 2.953   -26.796 1.00 34.37 ? 580 LEU B CB    1 
ATOM   3221 C CG    . LEU B 1 198 ? -30.583 3.056   -26.004 1.00 33.26 ? 580 LEU B CG    1 
ATOM   3222 C CD1   . LEU B 1 198 ? -29.414 2.547   -26.834 1.00 32.19 ? 580 LEU B CD1   1 
ATOM   3223 C CD2   . LEU B 1 198 ? -30.325 4.479   -25.524 1.00 33.92 ? 580 LEU B CD2   1 
ATOM   3224 N N     . ASP B 1 199 ? -35.031 2.191   -27.422 1.00 38.69 ? 581 ASP B N     1 
ATOM   3225 C CA    . ASP B 1 199 ? -36.182 2.271   -28.320 1.00 40.50 ? 581 ASP B CA    1 
ATOM   3226 C C     . ASP B 1 199 ? -37.437 2.745   -27.586 1.00 41.05 ? 581 ASP B C     1 
ATOM   3227 O O     . ASP B 1 199 ? -38.301 3.393   -28.181 1.00 41.21 ? 581 ASP B O     1 
ATOM   3228 C CB    . ASP B 1 199 ? -36.438 0.908   -28.977 1.00 41.26 ? 581 ASP B CB    1 
ATOM   3229 C CG    . ASP B 1 199 ? -37.438 0.981   -30.123 1.00 43.68 ? 581 ASP B CG    1 
ATOM   3230 O OD1   . ASP B 1 199 ? -37.535 2.039   -30.782 1.00 45.80 ? 581 ASP B OD1   1 
ATOM   3231 O OD2   . ASP B 1 199 ? -38.125 -0.033  -30.371 1.00 45.12 ? 581 ASP B OD2   1 
ATOM   3232 N N     . ARG B 1 200 ? -37.525 2.424   -26.297 1.00 42.01 ? 582 ARG B N     1 
ATOM   3233 C CA    . ARG B 1 200 ? -38.688 2.773   -25.482 1.00 42.91 ? 582 ARG B CA    1 
ATOM   3234 C C     . ARG B 1 200 ? -38.701 4.252   -25.082 1.00 43.28 ? 582 ARG B C     1 
ATOM   3235 O O     . ARG B 1 200 ? -39.757 4.805   -24.765 1.00 44.16 ? 582 ARG B O     1 
ATOM   3236 C CB    . ARG B 1 200 ? -38.767 1.877   -24.241 1.00 42.97 ? 582 ARG B CB    1 
ATOM   3237 C CG    . ARG B 1 200 ? -40.190 1.592   -23.771 1.00 45.09 ? 582 ARG B CG    1 
ATOM   3238 C CD    . ARG B 1 200 ? -40.231 0.680   -22.548 1.00 49.47 ? 582 ARG B CD    1 
ATOM   3239 N NE    . ARG B 1 200 ? -39.759 -0.676  -22.828 1.00 53.30 ? 582 ARG B NE    1 
ATOM   3240 C CZ    . ARG B 1 200 ? -38.615 -1.189  -22.380 1.00 53.78 ? 582 ARG B CZ    1 
ATOM   3241 N NH1   . ARG B 1 200 ? -37.804 -0.465  -21.616 1.00 52.65 ? 582 ARG B NH1   1 
ATOM   3242 N NH2   . ARG B 1 200 ? -38.280 -2.433  -22.693 1.00 51.83 ? 582 ARG B NH2   1 
ATOM   3243 N N     . ILE B 1 201 ? -37.527 4.883   -25.102 1.00 43.24 ? 583 ILE B N     1 
ATOM   3244 C CA    . ILE B 1 201 ? -37.402 6.313   -24.798 1.00 43.32 ? 583 ILE B CA    1 
ATOM   3245 C C     . ILE B 1 201 ? -36.938 6.944   -26.107 1.00 43.24 ? 583 ILE B C     1 
ATOM   3246 O O     . ILE B 1 201 ? -36.267 7.973   -26.042 1.00 43.12 ? 583 ILE B O     1 
ATOM   3247 C CB    . ILE B 1 201 ? -36.304 6.599   -23.733 1.00 43.25 ? 583 ILE B CB    1 
ATOM   3248 C CG1   . ILE B 1 201 ? -34.957 5.991   -24.151 1.00 42.98 ? 583 ILE B CG1   1 
ATOM   3249 C CG2   . ILE B 1 201 ? -36.752 6.098   -22.357 1.00 43.88 ? 583 ILE B CG2   1 
ATOM   3250 C CD1   . ILE B 1 201 ? -33.763 6.494   -23.353 1.00 42.03 ? 583 ILE B CD1   1 
ATOM   3251 N N     . GLY B 1 202 ? -37.327 6.425   -27.263 1.00 43.14 ? 584 GLY B N     1 
ATOM   3252 C CA    . GLY B 1 202 ? -36.926 6.938   -28.567 1.00 42.80 ? 584 GLY B CA    1 
ATOM   3253 C C     . GLY B 1 202 ? -35.551 7.555   -28.686 1.00 42.55 ? 584 GLY B C     1 
ATOM   3254 O O     . GLY B 1 202 ? -35.444 8.751   -28.879 1.00 42.69 ? 584 GLY B O     1 
ATOM   3255 N N     . LYS B 1 203 ? -34.498 6.755   -28.555 1.00 42.29 ? 585 LYS B N     1 
ATOM   3256 C CA    . LYS B 1 203 ? -33.157 7.214   -28.923 1.00 41.84 ? 585 LYS B CA    1 
ATOM   3257 C C     . LYS B 1 203 ? -32.518 6.291   -29.964 1.00 42.65 ? 585 LYS B C     1 
ATOM   3258 O O     . LYS B 1 203 ? -32.998 5.167   -30.202 1.00 43.13 ? 585 LYS B O     1 
ATOM   3259 C CB    . LYS B 1 203 ? -32.253 7.355   -27.708 1.00 41.19 ? 585 LYS B CB    1 
ATOM   3260 C CG    . LYS B 1 203 ? -32.631 8.470   -26.751 1.00 39.36 ? 585 LYS B CG    1 
ATOM   3261 C CD    . LYS B 1 203 ? -31.417 8.856   -25.890 1.00 37.00 ? 585 LYS B CD    1 
ATOM   3262 C CE    . LYS B 1 203 ? -31.811 9.692   -24.659 1.00 35.92 ? 585 LYS B CE    1 
ATOM   3263 N NZ    . LYS B 1 203 ? -31.565 11.175  -24.746 1.00 34.48 ? 585 LYS B NZ    1 
ATOM   3264 N N     . LYS B 1 204 ? -31.468 6.786   -30.625 1.00 43.49 ? 586 LYS B N     1 
ATOM   3265 C CA    . LYS B 1 204 ? -30.783 6.010   -31.659 1.00 43.20 ? 586 LYS B CA    1 
ATOM   3266 C C     . LYS B 1 204 ? -29.290 6.340   -31.725 1.00 43.89 ? 586 LYS B C     1 
ATOM   3267 O O     . LYS B 1 204 ? -28.861 7.508   -31.871 1.00 42.99 ? 586 LYS B O     1 
ATOM   3268 C CB    . LYS B 1 204 ? -31.432 6.144   -33.042 1.00 42.77 ? 586 LYS B CB    1 
ATOM   3269 C CG    . LYS B 1 204 ? -32.874 5.703   -33.172 1.00 41.92 ? 586 LYS B CG    1 
ATOM   3270 C CD    . LYS B 1 204 ? -33.493 6.609   -34.235 1.00 41.96 ? 586 LYS B CD    1 
ATOM   3271 C CE    . LYS B 1 204 ? -34.311 5.828   -35.268 1.00 41.53 ? 586 LYS B CE    1 
ATOM   3272 N NZ    . LYS B 1 204 ? -34.597 6.658   -36.482 1.00 40.52 ? 586 LYS B NZ    1 
ATOM   3273 N N     . ASN B 1 205 ? -28.528 5.247   -31.664 1.00 44.66 ? 587 ASN B N     1 
ATOM   3274 C CA    . ASN B 1 205 ? -27.102 5.269   -31.451 1.00 45.13 ? 587 ASN B CA    1 
ATOM   3275 C C     . ASN B 1 205 ? -26.365 4.251   -32.320 1.00 44.93 ? 587 ASN B C     1 
ATOM   3276 O O     . ASN B 1 205 ? -26.760 3.078   -32.371 1.00 44.90 ? 587 ASN B O     1 
ATOM   3277 C CB    . ASN B 1 205 ? -26.837 4.981   -29.967 1.00 45.47 ? 587 ASN B CB    1 
ATOM   3278 C CG    . ASN B 1 205 ? -25.344 5.031   -29.601 1.00 46.96 ? 587 ASN B CG    1 
ATOM   3279 O OD1   . ASN B 1 205 ? -24.440 4.725   -30.423 1.00 46.93 ? 587 ASN B OD1   1 
ATOM   3280 N ND2   . ASN B 1 205 ? -25.081 5.398   -28.343 1.00 47.84 ? 587 ASN B ND2   1 
ATOM   3281 N N     . SER B 1 206 ? -25.268 4.722   -32.928 1.00 44.76 ? 588 SER B N     1 
ATOM   3282 C CA    . SER B 1 206 ? -24.375 3.961   -33.818 1.00 44.95 ? 588 SER B CA    1 
ATOM   3283 C C     . SER B 1 206 ? -24.108 2.499   -33.440 1.00 45.15 ? 588 SER B C     1 
ATOM   3284 O O     . SER B 1 206 ? -23.255 1.833   -34.054 1.00 45.34 ? 588 SER B O     1 
ATOM   3285 C CB    . SER B 1 206 ? -23.030 4.700   -33.964 1.00 45.01 ? 588 SER B CB    1 
ATOM   3286 O OG    . SER B 1 206 ? -22.436 4.931   -32.701 1.00 44.88 ? 588 SER B OG    1 
HETATM 3287 P P     . CMP C 2 .   ? -53.372 -22.521 10.366  1.00 24.49 ? 646 CMP A P     1 
HETATM 3288 O O1P   . CMP C 2 .   ? -54.006 -22.382 11.741  1.00 23.37 ? 646 CMP A O1P   1 
HETATM 3289 O O2P   . CMP C 2 .   ? -52.958 -23.960 10.100  1.00 22.78 ? 646 CMP A O2P   1 
HETATM 3290 O "O5'" . CMP C 2 .   ? -54.379 -22.061 9.209   1.00 24.89 ? 646 CMP A "O5'" 1 
HETATM 3291 C "C5'" . CMP C 2 .   ? -54.670 -20.686 9.011   1.00 25.83 ? 646 CMP A "C5'" 1 
HETATM 3292 C "C4'" . CMP C 2 .   ? -53.354 -20.001 8.762   1.00 26.02 ? 646 CMP A "C4'" 1 
HETATM 3293 O "O4'" . CMP C 2 .   ? -53.405 -18.580 8.604   1.00 26.30 ? 646 CMP A "O4'" 1 
HETATM 3294 C "C3'" . CMP C 2 .   ? -52.502 -20.164 9.992   1.00 27.20 ? 646 CMP A "C3'" 1 
HETATM 3295 O "O3'" . CMP C 2 .   ? -52.144 -21.524 10.127  1.00 25.57 ? 646 CMP A "O3'" 1 
HETATM 3296 C "C2'" . CMP C 2 .   ? -51.378 -19.211 9.674   1.00 27.60 ? 646 CMP A "C2'" 1 
HETATM 3297 O "O2'" . CMP C 2 .   ? -50.361 -19.935 8.965   1.00 30.17 ? 646 CMP A "O2'" 1 
HETATM 3298 C "C1'" . CMP C 2 .   ? -52.087 -18.101 8.869   1.00 27.84 ? 646 CMP A "C1'" 1 
HETATM 3299 N N9    . CMP C 2 .   ? -52.024 -16.919 9.771   1.00 30.43 ? 646 CMP A N9    1 
HETATM 3300 C C8    . CMP C 2 .   ? -52.507 -16.869 11.030  1.00 30.05 ? 646 CMP A C8    1 
HETATM 3301 N N7    . CMP C 2 .   ? -52.221 -15.676 11.611  1.00 31.04 ? 646 CMP A N7    1 
HETATM 3302 C C5    . CMP C 2 .   ? -51.522 -14.935 10.734  1.00 31.47 ? 646 CMP A C5    1 
HETATM 3303 C C6    . CMP C 2 .   ? -50.905 -13.584 10.729  1.00 32.43 ? 646 CMP A C6    1 
HETATM 3304 N N6    . CMP C 2 .   ? -50.999 -12.790 11.821  1.00 34.76 ? 646 CMP A N6    1 
HETATM 3305 N N1    . CMP C 2 .   ? -50.259 -13.163 9.617   1.00 32.24 ? 646 CMP A N1    1 
HETATM 3306 C C2    . CMP C 2 .   ? -50.166 -13.980 8.550   1.00 32.19 ? 646 CMP A C2    1 
HETATM 3307 N N3    . CMP C 2 .   ? -50.689 -15.225 8.479   1.00 30.74 ? 646 CMP A N3    1 
HETATM 3308 C C4    . CMP C 2 .   ? -51.383 -15.757 9.520   1.00 31.42 ? 646 CMP A C4    1 
HETATM 3309 P P     . CMP D 2 .   ? -26.272 4.528   -19.568 1.00 25.18 ? 646 CMP B P     1 
HETATM 3310 O O1P   . CMP D 2 .   ? -26.294 5.212   -20.924 1.00 24.20 ? 646 CMP B O1P   1 
HETATM 3311 O O2P   . CMP D 2 .   ? -24.871 4.069   -19.203 1.00 23.66 ? 646 CMP B O2P   1 
HETATM 3312 O "O5'" . CMP D 2 .   ? -26.794 5.578   -18.487 1.00 25.35 ? 646 CMP B "O5'" 1 
HETATM 3313 C "C5'" . CMP D 2 .   ? -28.171 5.847   -18.324 1.00 26.08 ? 646 CMP B "C5'" 1 
HETATM 3314 C "C4'" . CMP D 2 .   ? -28.812 4.529   -17.987 1.00 26.16 ? 646 CMP B "C4'" 1 
HETATM 3315 O "O4'" . CMP D 2 .   ? -30.234 4.573   -17.803 1.00 26.82 ? 646 CMP B "O4'" 1 
HETATM 3316 C "C3'" . CMP D 2 .   ? -28.669 3.650   -19.199 1.00 27.24 ? 646 CMP B "C3'" 1 
HETATM 3317 O "O3'" . CMP D 2 .   ? -27.307 3.308   -19.395 1.00 26.23 ? 646 CMP B "O3'" 1 
HETATM 3318 C "C2'" . CMP D 2 .   ? -29.626 2.538   -18.837 1.00 27.78 ? 646 CMP B "C2'" 1 
HETATM 3319 O "O2'" . CMP D 2 .   ? -28.918 1.540   -18.093 1.00 30.01 ? 646 CMP B "O2'" 1 
HETATM 3320 C "C1'" . CMP D 2 .   ? -30.747 3.266   -18.058 1.00 27.59 ? 646 CMP B "C1'" 1 
HETATM 3321 N N9    . CMP D 2 .   ? -31.936 3.207   -18.963 1.00 29.77 ? 646 CMP B N9    1 
HETATM 3322 C C8    . CMP D 2 .   ? -32.005 3.712   -20.215 1.00 28.44 ? 646 CMP B C8    1 
HETATM 3323 N N7    . CMP D 2 .   ? -33.196 3.423   -20.794 1.00 28.96 ? 646 CMP B N7    1 
HETATM 3324 C C5    . CMP D 2 .   ? -33.923 2.700   -19.929 1.00 30.30 ? 646 CMP B C5    1 
HETATM 3325 C C6    . CMP D 2 .   ? -35.260 2.065   -19.926 1.00 31.10 ? 646 CMP B C6    1 
HETATM 3326 N N6    . CMP D 2 .   ? -36.064 2.155   -21.001 1.00 33.54 ? 646 CMP B N6    1 
HETATM 3327 N N1    . CMP D 2 .   ? -35.668 1.402   -18.828 1.00 31.83 ? 646 CMP B N1    1 
HETATM 3328 C C2    . CMP D 2 .   ? -34.850 1.295   -17.763 1.00 31.61 ? 646 CMP B C2    1 
HETATM 3329 N N3    . CMP D 2 .   ? -33.615 1.827   -17.687 1.00 30.69 ? 646 CMP B N3    1 
HETATM 3330 C C4    . CMP D 2 .   ? -33.092 2.545   -18.722 1.00 31.03 ? 646 CMP B C4    1 
HETATM 3331 O O     . HOH E 3 .   ? -57.053 -9.519  -7.837  1.00 34.11 ? 3   HOH A O     1 
HETATM 3332 O O     . HOH E 3 .   ? -52.878 -28.089 -7.793  1.00 15.14 ? 5   HOH A O     1 
HETATM 3333 O O     . HOH E 3 .   ? -51.494 -8.780  21.804  1.00 27.93 ? 8   HOH A O     1 
HETATM 3334 O O     . HOH E 3 .   ? -55.395 -29.097 -3.462  1.00 42.29 ? 9   HOH A O     1 
HETATM 3335 O O     . HOH E 3 .   ? -52.076 -7.175  23.876  1.00 42.38 ? 10  HOH A O     1 
HETATM 3336 O O     . HOH E 3 .   ? -57.987 -27.156 6.091   1.00 22.04 ? 15  HOH A O     1 
HETATM 3337 O O     . HOH E 3 .   ? -54.894 -32.544 -29.778 1.00 44.47 ? 16  HOH A O     1 
HETATM 3338 O O     . HOH E 3 .   ? -28.169 -31.175 1.078   1.00 27.80 ? 20  HOH A O     1 
HETATM 3339 O O     . HOH E 3 .   ? -39.673 -24.144 22.102  1.00 57.58 ? 23  HOH A O     1 
HETATM 3340 O O     . HOH E 3 .   ? -63.255 -22.749 -2.324  1.00 18.21 ? 24  HOH A O     1 
HETATM 3341 O O     . HOH E 3 .   ? -52.780 -31.026 12.204  1.00 47.29 ? 27  HOH A O     1 
HETATM 3342 O O     . HOH E 3 .   ? -51.601 -24.144 -22.818 1.00 45.90 ? 28  HOH A O     1 
HETATM 3343 O O     . HOH E 3 .   ? -43.036 -12.210 1.449   1.00 47.89 ? 29  HOH A O     1 
HETATM 3344 O O     . HOH E 3 .   ? -27.076 -20.501 -8.945  1.00 18.69 ? 31  HOH A O     1 
HETATM 3345 O O     . HOH E 3 .   ? -51.264 -30.918 -8.529  1.00 41.65 ? 33  HOH A O     1 
HETATM 3346 O O     . HOH E 3 .   ? -44.333 -16.247 5.703   1.00 41.42 ? 34  HOH A O     1 
HETATM 3347 O O     . HOH E 3 .   ? -31.403 -42.980 -4.262  1.00 51.39 ? 36  HOH A O     1 
HETATM 3348 O O     . HOH E 3 .   ? -65.876 -19.576 -14.851 1.00 43.23 ? 37  HOH A O     1 
HETATM 3349 O O     . HOH E 3 .   ? -45.295 -11.282 2.310   1.00 35.12 ? 38  HOH A O     1 
HETATM 3350 O O     . HOH E 3 .   ? -64.999 -22.040 7.824   1.00 45.78 ? 41  HOH A O     1 
HETATM 3351 O O     . HOH E 3 .   ? -64.321 -27.119 -21.944 1.00 42.09 ? 44  HOH A O     1 
HETATM 3352 O O     . HOH E 3 .   ? -49.314 -30.564 -29.455 1.00 31.61 ? 45  HOH A O     1 
HETATM 3353 O O     . HOH E 3 .   ? -36.844 -39.159 -5.817  1.00 37.12 ? 48  HOH A O     1 
HETATM 3354 O O     . HOH E 3 .   ? -43.406 -28.523 -10.898 1.00 30.56 ? 50  HOH A O     1 
HETATM 3355 O O     . HOH F 3 .   ? -32.269 -4.578  -15.123 1.00 32.09 ? 1   HOH B O     1 
HETATM 3356 O O     . HOH F 3 .   ? -29.715 -17.867 -5.502  1.00 19.73 ? 2   HOH B O     1 
HETATM 3357 O O     . HOH F 3 .   ? -11.344 -2.044  -12.619 1.00 34.33 ? 4   HOH B O     1 
HETATM 3358 O O     . HOH F 3 .   ? -24.642 -9.523  -31.359 1.00 56.51 ? 6   HOH B O     1 
HETATM 3359 O O     . HOH F 3 .   ? -32.810 2.913   -31.158 1.00 52.29 ? 7   HOH B O     1 
HETATM 3360 O O     . HOH F 3 .   ? -20.819 4.201   -1.469  1.00 14.60 ? 11  HOH B O     1 
HETATM 3361 O O     . HOH F 3 .   ? -28.480 -21.014 -15.085 1.00 27.12 ? 12  HOH B O     1 
HETATM 3362 O O     . HOH F 3 .   ? -30.188 7.872   -34.579 1.00 40.32 ? 13  HOH B O     1 
HETATM 3363 O O     . HOH F 3 .   ? -20.970 6.954   -8.337  1.00 38.63 ? 14  HOH B O     1 
HETATM 3364 O O     . HOH F 3 .   ? -26.110 14.350  -6.660  1.00 19.44 ? 17  HOH B O     1 
HETATM 3365 O O     . HOH F 3 .   ? -37.426 -3.549  -11.492 1.00 41.24 ? 18  HOH B O     1 
HETATM 3366 O O     . HOH F 3 .   ? -19.047 -3.034  7.338   1.00 37.97 ? 19  HOH B O     1 
HETATM 3367 O O     . HOH F 3 .   ? -26.811 10.674  -24.695 1.00 30.24 ? 21  HOH B O     1 
HETATM 3368 O O     . HOH F 3 .   ? -25.305 -16.837 -6.124  1.00 26.80 ? 22  HOH B O     1 
HETATM 3369 O O     . HOH F 3 .   ? -17.829 3.807   -21.454 1.00 42.75 ? 25  HOH B O     1 
HETATM 3370 O O     . HOH F 3 .   ? -21.606 15.096  12.865  1.00 46.74 ? 26  HOH B O     1 
HETATM 3371 O O     . HOH F 3 .   ? -18.601 -21.228 -10.192 1.00 31.69 ? 30  HOH B O     1 
HETATM 3372 O O     . HOH F 3 .   ? -39.847 2.573   -31.240 1.00 34.86 ? 32  HOH B O     1 
HETATM 3373 O O     . HOH F 3 .   ? -17.388 -9.448  -26.060 1.00 39.72 ? 35  HOH B O     1 
HETATM 3374 O O     . HOH F 3 .   ? -16.325 -22.669 -5.155  1.00 53.75 ? 39  HOH B O     1 
HETATM 3375 O O     . HOH F 3 .   ? -16.753 -0.359  -9.038  1.00 45.95 ? 40  HOH B O     1 
HETATM 3376 O O     . HOH F 3 .   ? -22.724 11.235  -8.284  1.00 43.26 ? 42  HOH B O     1 
HETATM 3377 O O     . HOH F 3 .   ? -9.791  18.142  1.700   1.00 33.01 ? 46  HOH B O     1 
HETATM 3378 O O     . HOH F 3 .   ? -28.017 -11.717 -1.898  1.00 34.95 ? 47  HOH B O     1 
HETATM 3379 O O     . HOH F 3 .   ? -28.467 -21.796 -0.264  1.00 20.93 ? 49  HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLN 1   383 ?   ?   ?   A . n 
A 1 2   GLY 2   384 ?   ?   ?   A . n 
A 1 3   PRO 3   385 ?   ?   ?   A . n 
A 1 4   SER 4   386 ?   ?   ?   A . n 
A 1 5   SER 5   387 ?   ?   ?   A . n 
A 1 6   PRO 6   388 ?   ?   ?   A . n 
A 1 7   MET 7   389 ?   ?   ?   A . n 
A 1 8   ASP 8   390 390 ASP ASP A . n 
A 1 9   SER 9   391 391 SER SER A . n 
A 1 10  SER 10  392 392 SER SER A . n 
A 1 11  ARG 11  393 393 ARG ARG A . n 
A 1 12  ARG 12  394 394 ARG ARG A . n 
A 1 13  GLN 13  395 395 GLN GLN A . n 
A 1 14  TYR 14  396 396 TYR TYR A . n 
A 1 15  GLN 15  397 397 GLN GLN A . n 
A 1 16  GLU 16  398 398 GLU GLU A . n 
A 1 17  LYS 17  399 399 LYS LYS A . n 
A 1 18  TYR 18  400 400 TYR TYR A . n 
A 1 19  LYS 19  401 401 LYS LYS A . n 
A 1 20  GLN 20  402 402 GLN GLN A . n 
A 1 21  VAL 21  403 403 VAL VAL A . n 
A 1 22  GLU 22  404 404 GLU GLU A . n 
A 1 23  GLN 23  405 405 GLN GLN A . n 
A 1 24  TYR 24  406 406 TYR TYR A . n 
A 1 25  MET 25  407 407 MET MET A . n 
A 1 26  SER 26  408 408 SER SER A . n 
A 1 27  PHE 27  409 409 PHE PHE A . n 
A 1 28  HIS 28  410 410 HIS HIS A . n 
A 1 29  LYS 29  411 411 LYS LYS A . n 
A 1 30  LEU 30  412 412 LEU LEU A . n 
A 1 31  PRO 31  413 413 PRO PRO A . n 
A 1 32  ALA 32  414 414 ALA ALA A . n 
A 1 33  ASP 33  415 415 ASP ASP A . n 
A 1 34  MET 34  416 416 MET MET A . n 
A 1 35  ARG 35  417 417 ARG ARG A . n 
A 1 36  GLN 36  418 418 GLN GLN A . n 
A 1 37  LYS 37  419 419 LYS LYS A . n 
A 1 38  ILE 38  420 420 ILE ILE A . n 
A 1 39  HIS 39  421 421 HIS HIS A . n 
A 1 40  ASP 40  422 422 ASP ASP A . n 
A 1 41  TYR 41  423 423 TYR TYR A . n 
A 1 42  TYR 42  424 424 TYR TYR A . n 
A 1 43  GLU 43  425 425 GLU GLU A . n 
A 1 44  HIS 44  426 426 HIS HIS A . n 
A 1 45  ARG 45  427 427 ARG ARG A . n 
A 1 46  TYR 46  428 428 TYR TYR A . n 
A 1 47  GLN 47  429 429 GLN GLN A . n 
A 1 48  GLY 48  430 430 GLY GLY A . n 
A 1 49  LYS 49  431 431 LYS LYS A . n 
A 1 50  ILE 50  432 432 ILE ILE A . n 
A 1 51  PHE 51  433 433 PHE PHE A . n 
A 1 52  ASP 52  434 434 ASP ASP A . n 
A 1 53  GLU 53  435 435 GLU GLU A . n 
A 1 54  GLU 54  436 436 GLU GLU A . n 
A 1 55  ASN 55  437 437 ASN ASN A . n 
A 1 56  ILE 56  438 438 ILE ILE A . n 
A 1 57  LEU 57  439 439 LEU LEU A . n 
A 1 58  SER 58  440 440 SER SER A . n 
A 1 59  GLU 59  441 441 GLU GLU A . n 
A 1 60  LEU 60  442 442 LEU LEU A . n 
A 1 61  ASN 61  443 443 ASN ASN A . n 
A 1 62  ASP 62  444 444 ASP ASP A . n 
A 1 63  PRO 63  445 445 PRO PRO A . n 
A 1 64  LEU 64  446 446 LEU LEU A . n 
A 1 65  ARG 65  447 447 ARG ARG A . n 
A 1 66  GLU 66  448 448 GLU GLU A . n 
A 1 67  GLU 67  449 449 GLU GLU A . n 
A 1 68  ILE 68  450 450 ILE ILE A . n 
A 1 69  VAL 69  451 451 VAL VAL A . n 
A 1 70  ASN 70  452 452 ASN ASN A . n 
A 1 71  PHE 71  453 453 PHE PHE A . n 
A 1 72  ASN 72  454 454 ASN ASN A . n 
A 1 73  CYS 73  455 455 CYS CYS A . n 
A 1 74  ARG 74  456 456 ARG ARG A . n 
A 1 75  LYS 75  457 457 LYS LYS A . n 
A 1 76  LEU 76  458 458 LEU LEU A . n 
A 1 77  VAL 77  459 459 VAL VAL A . n 
A 1 78  ALA 78  460 460 ALA ALA A . n 
A 1 79  THR 79  461 461 THR THR A . n 
A 1 80  MET 80  462 462 MET MET A . n 
A 1 81  PRO 81  463 463 PRO PRO A . n 
A 1 82  LEU 82  464 464 LEU LEU A . n 
A 1 83  PHE 83  465 465 PHE PHE A . n 
A 1 84  ALA 84  466 466 ALA ALA A . n 
A 1 85  ASN 85  467 467 ASN ASN A . n 
A 1 86  ALA 86  468 468 ALA ALA A . n 
A 1 87  ASP 87  469 469 ASP ASP A . n 
A 1 88  PRO 88  470 470 PRO PRO A . n 
A 1 89  ASN 89  471 471 ASN ASN A . n 
A 1 90  PHE 90  472 472 PHE PHE A . n 
A 1 91  VAL 91  473 473 VAL VAL A . n 
A 1 92  THR 92  474 474 THR THR A . n 
A 1 93  ALA 93  475 475 ALA ALA A . n 
A 1 94  MET 94  476 476 MET MET A . n 
A 1 95  LEU 95  477 477 LEU LEU A . n 
A 1 96  SER 96  478 478 SER SER A . n 
A 1 97  LYS 97  479 479 LYS LYS A . n 
A 1 98  LEU 98  480 480 LEU LEU A . n 
A 1 99  ARG 99  481 481 ARG ARG A . n 
A 1 100 PHE 100 482 482 PHE PHE A . n 
A 1 101 GLU 101 483 483 GLU GLU A . n 
A 1 102 VAL 102 484 484 VAL VAL A . n 
A 1 103 PHE 103 485 485 PHE PHE A . n 
A 1 104 GLN 104 486 486 GLN GLN A . n 
A 1 105 PRO 105 487 487 PRO PRO A . n 
A 1 106 GLY 106 488 488 GLY GLY A . n 
A 1 107 ASP 107 489 489 ASP ASP A . n 
A 1 108 TYR 108 490 490 TYR TYR A . n 
A 1 109 ILE 109 491 491 ILE ILE A . n 
A 1 110 ILE 110 492 492 ILE ILE A . n 
A 1 111 ARG 111 493 493 ARG ARG A . n 
A 1 112 GLU 112 494 494 GLU GLU A . n 
A 1 113 GLY 113 495 495 GLY GLY A . n 
A 1 114 ALA 114 496 496 ALA ALA A . n 
A 1 115 VAL 115 497 497 VAL VAL A . n 
A 1 116 GLY 116 498 498 GLY GLY A . n 
A 1 117 LYS 117 499 499 LYS LYS A . n 
A 1 118 LYS 118 500 500 LYS LYS A . n 
A 1 119 MET 119 501 501 MET MET A . n 
A 1 120 TYR 120 502 502 TYR TYR A . n 
A 1 121 PHE 121 503 503 PHE PHE A . n 
A 1 122 ILE 122 504 504 ILE ILE A . n 
A 1 123 GLN 123 505 505 GLN GLN A . n 
A 1 124 HIS 124 506 506 HIS HIS A . n 
A 1 125 GLY 125 507 507 GLY GLY A . n 
A 1 126 VAL 126 508 508 VAL VAL A . n 
A 1 127 ALA 127 509 509 ALA ALA A . n 
A 1 128 GLY 128 510 510 GLY GLY A . n 
A 1 129 VAL 129 511 511 VAL VAL A . n 
A 1 130 ILE 130 512 512 ILE ILE A . n 
A 1 131 THR 131 513 513 THR THR A . n 
A 1 132 LYS 132 514 514 LYS LYS A . n 
A 1 133 SER 133 515 515 SER SER A . n 
A 1 134 SER 134 516 516 SER SER A . n 
A 1 135 LYS 135 517 517 LYS LYS A . n 
A 1 136 GLU 136 518 518 GLU GLU A . n 
A 1 137 MET 137 519 519 MET MET A . n 
A 1 138 LYS 138 520 520 LYS LYS A . n 
A 1 139 LEU 139 521 521 LEU LEU A . n 
A 1 140 THR 140 522 522 THR THR A . n 
A 1 141 ASP 141 523 523 ASP ASP A . n 
A 1 142 GLY 142 524 524 GLY GLY A . n 
A 1 143 SER 143 525 525 SER SER A . n 
A 1 144 TYR 144 526 526 TYR TYR A . n 
A 1 145 PHE 145 527 527 PHE PHE A . n 
A 1 146 GLY 146 528 528 GLY GLY A . n 
A 1 147 GLU 147 529 529 GLU GLU A . n 
A 1 148 ILE 148 530 530 ILE ILE A . n 
A 1 149 CYS 149 531 531 CYS CYS A . n 
A 1 150 LEU 150 532 532 LEU LEU A . n 
A 1 151 LEU 151 533 533 LEU LEU A . n 
A 1 152 THR 152 534 534 THR THR A . n 
A 1 153 LYS 153 535 535 LYS LYS A . n 
A 1 154 GLY 154 536 536 GLY GLY A . n 
A 1 155 ARG 155 537 537 ARG ARG A . n 
A 1 156 ARG 156 538 538 ARG ARG A . n 
A 1 157 THR 157 539 539 THR THR A . n 
A 1 158 ALA 158 540 540 ALA ALA A . n 
A 1 159 SER 159 541 541 SER SER A . n 
A 1 160 VAL 160 542 542 VAL VAL A . n 
A 1 161 ARG 161 543 543 ARG ARG A . n 
A 1 162 ALA 162 544 544 ALA ALA A . n 
A 1 163 ASP 163 545 545 ASP ASP A . n 
A 1 164 THR 164 546 546 THR THR A . n 
A 1 165 TYR 165 547 547 TYR TYR A . n 
A 1 166 CYS 166 548 548 CYS CYS A . n 
A 1 167 ARG 167 549 549 ARG ARG A . n 
A 1 168 LEU 168 550 550 LEU LEU A . n 
A 1 169 TYR 169 551 551 TYR TYR A . n 
A 1 170 SER 170 552 552 SER SER A . n 
A 1 171 LEU 171 553 553 LEU LEU A . n 
A 1 172 SER 172 554 554 SER SER A . n 
A 1 173 VAL 173 555 555 VAL VAL A . n 
A 1 174 ASP 174 556 556 ASP ASP A . n 
A 1 175 ASN 175 557 557 ASN ASN A . n 
A 1 176 PHE 176 558 558 PHE PHE A . n 
A 1 177 ASN 177 559 559 ASN ASN A . n 
A 1 178 GLU 178 560 560 GLU GLU A . n 
A 1 179 VAL 179 561 561 VAL VAL A . n 
A 1 180 LEU 180 562 562 LEU LEU A . n 
A 1 181 GLU 181 563 563 GLU GLU A . n 
A 1 182 GLU 182 564 564 GLU GLU A . n 
A 1 183 TYR 183 565 565 TYR TYR A . n 
A 1 184 PRO 184 566 566 PRO PRO A . n 
A 1 185 MET 185 567 567 MET MET A . n 
A 1 186 MET 186 568 568 MET MET A . n 
A 1 187 ARG 187 569 569 ARG ARG A . n 
A 1 188 ARG 188 570 570 ARG ARG A . n 
A 1 189 ALA 189 571 571 ALA ALA A . n 
A 1 190 PHE 190 572 572 PHE PHE A . n 
A 1 191 GLU 191 573 573 GLU GLU A . n 
A 1 192 THR 192 574 574 THR THR A . n 
A 1 193 VAL 193 575 575 VAL VAL A . n 
A 1 194 ALA 194 576 576 ALA ALA A . n 
A 1 195 ILE 195 577 577 ILE ILE A . n 
A 1 196 ASP 196 578 578 ASP ASP A . n 
A 1 197 ARG 197 579 579 ARG ARG A . n 
A 1 198 LEU 198 580 580 LEU LEU A . n 
A 1 199 ASP 199 581 581 ASP ASP A . n 
A 1 200 ARG 200 582 582 ARG ARG A . n 
A 1 201 ILE 201 583 583 ILE ILE A . n 
A 1 202 GLY 202 584 584 GLY GLY A . n 
A 1 203 LYS 203 585 585 LYS LYS A . n 
A 1 204 LYS 204 586 586 LYS LYS A . n 
A 1 205 ASN 205 587 587 ASN ASN A . n 
A 1 206 SER 206 588 588 SER SER A . n 
A 1 207 ILE 207 589 ?   ?   ?   A . n 
A 1 208 LEU 208 590 ?   ?   ?   A . n 
A 1 209 LEU 209 591 ?   ?   ?   A . n 
A 1 210 GLN 210 592 ?   ?   ?   A . n 
B 1 1   GLN 1   383 ?   ?   ?   B . n 
B 1 2   GLY 2   384 ?   ?   ?   B . n 
B 1 3   PRO 3   385 ?   ?   ?   B . n 
B 1 4   SER 4   386 ?   ?   ?   B . n 
B 1 5   SER 5   387 ?   ?   ?   B . n 
B 1 6   PRO 6   388 ?   ?   ?   B . n 
B 1 7   MET 7   389 ?   ?   ?   B . n 
B 1 8   ASP 8   390 390 ASP ASP B . n 
B 1 9   SER 9   391 391 SER SER B . n 
B 1 10  SER 10  392 392 SER SER B . n 
B 1 11  ARG 11  393 393 ARG ARG B . n 
B 1 12  ARG 12  394 394 ARG ARG B . n 
B 1 13  GLN 13  395 395 GLN GLN B . n 
B 1 14  TYR 14  396 396 TYR TYR B . n 
B 1 15  GLN 15  397 397 GLN GLN B . n 
B 1 16  GLU 16  398 398 GLU GLU B . n 
B 1 17  LYS 17  399 399 LYS LYS B . n 
B 1 18  TYR 18  400 400 TYR TYR B . n 
B 1 19  LYS 19  401 401 LYS LYS B . n 
B 1 20  GLN 20  402 402 GLN GLN B . n 
B 1 21  VAL 21  403 403 VAL VAL B . n 
B 1 22  GLU 22  404 404 GLU GLU B . n 
B 1 23  GLN 23  405 405 GLN GLN B . n 
B 1 24  TYR 24  406 406 TYR TYR B . n 
B 1 25  MET 25  407 407 MET MET B . n 
B 1 26  SER 26  408 408 SER SER B . n 
B 1 27  PHE 27  409 409 PHE PHE B . n 
B 1 28  HIS 28  410 410 HIS HIS B . n 
B 1 29  LYS 29  411 411 LYS LYS B . n 
B 1 30  LEU 30  412 412 LEU LEU B . n 
B 1 31  PRO 31  413 413 PRO PRO B . n 
B 1 32  ALA 32  414 414 ALA ALA B . n 
B 1 33  ASP 33  415 415 ASP ASP B . n 
B 1 34  MET 34  416 416 MET MET B . n 
B 1 35  ARG 35  417 417 ARG ARG B . n 
B 1 36  GLN 36  418 418 GLN GLN B . n 
B 1 37  LYS 37  419 419 LYS LYS B . n 
B 1 38  ILE 38  420 420 ILE ILE B . n 
B 1 39  HIS 39  421 421 HIS HIS B . n 
B 1 40  ASP 40  422 422 ASP ASP B . n 
B 1 41  TYR 41  423 423 TYR TYR B . n 
B 1 42  TYR 42  424 424 TYR TYR B . n 
B 1 43  GLU 43  425 425 GLU GLU B . n 
B 1 44  HIS 44  426 426 HIS HIS B . n 
B 1 45  ARG 45  427 427 ARG ARG B . n 
B 1 46  TYR 46  428 428 TYR TYR B . n 
B 1 47  GLN 47  429 429 GLN GLN B . n 
B 1 48  GLY 48  430 430 GLY GLY B . n 
B 1 49  LYS 49  431 431 LYS LYS B . n 
B 1 50  ILE 50  432 432 ILE ILE B . n 
B 1 51  PHE 51  433 433 PHE PHE B . n 
B 1 52  ASP 52  434 434 ASP ASP B . n 
B 1 53  GLU 53  435 435 GLU GLU B . n 
B 1 54  GLU 54  436 436 GLU GLU B . n 
B 1 55  ASN 55  437 437 ASN ASN B . n 
B 1 56  ILE 56  438 438 ILE ILE B . n 
B 1 57  LEU 57  439 439 LEU LEU B . n 
B 1 58  SER 58  440 440 SER SER B . n 
B 1 59  GLU 59  441 441 GLU GLU B . n 
B 1 60  LEU 60  442 442 LEU LEU B . n 
B 1 61  ASN 61  443 443 ASN ASN B . n 
B 1 62  ASP 62  444 444 ASP ASP B . n 
B 1 63  PRO 63  445 445 PRO PRO B . n 
B 1 64  LEU 64  446 446 LEU LEU B . n 
B 1 65  ARG 65  447 447 ARG ARG B . n 
B 1 66  GLU 66  448 448 GLU GLU B . n 
B 1 67  GLU 67  449 449 GLU GLU B . n 
B 1 68  ILE 68  450 450 ILE ILE B . n 
B 1 69  VAL 69  451 451 VAL VAL B . n 
B 1 70  ASN 70  452 452 ASN ASN B . n 
B 1 71  PHE 71  453 453 PHE PHE B . n 
B 1 72  ASN 72  454 454 ASN ASN B . n 
B 1 73  CYS 73  455 455 CYS CYS B . n 
B 1 74  ARG 74  456 456 ARG ARG B . n 
B 1 75  LYS 75  457 457 LYS LYS B . n 
B 1 76  LEU 76  458 458 LEU LEU B . n 
B 1 77  VAL 77  459 459 VAL VAL B . n 
B 1 78  ALA 78  460 460 ALA ALA B . n 
B 1 79  THR 79  461 461 THR THR B . n 
B 1 80  MET 80  462 462 MET MET B . n 
B 1 81  PRO 81  463 463 PRO PRO B . n 
B 1 82  LEU 82  464 464 LEU LEU B . n 
B 1 83  PHE 83  465 465 PHE PHE B . n 
B 1 84  ALA 84  466 466 ALA ALA B . n 
B 1 85  ASN 85  467 467 ASN ASN B . n 
B 1 86  ALA 86  468 468 ALA ALA B . n 
B 1 87  ASP 87  469 469 ASP ASP B . n 
B 1 88  PRO 88  470 470 PRO PRO B . n 
B 1 89  ASN 89  471 471 ASN ASN B . n 
B 1 90  PHE 90  472 472 PHE PHE B . n 
B 1 91  VAL 91  473 473 VAL VAL B . n 
B 1 92  THR 92  474 474 THR THR B . n 
B 1 93  ALA 93  475 475 ALA ALA B . n 
B 1 94  MET 94  476 476 MET MET B . n 
B 1 95  LEU 95  477 477 LEU LEU B . n 
B 1 96  SER 96  478 478 SER SER B . n 
B 1 97  LYS 97  479 479 LYS LYS B . n 
B 1 98  LEU 98  480 480 LEU LEU B . n 
B 1 99  ARG 99  481 481 ARG ARG B . n 
B 1 100 PHE 100 482 482 PHE PHE B . n 
B 1 101 GLU 101 483 483 GLU GLU B . n 
B 1 102 VAL 102 484 484 VAL VAL B . n 
B 1 103 PHE 103 485 485 PHE PHE B . n 
B 1 104 GLN 104 486 486 GLN GLN B . n 
B 1 105 PRO 105 487 487 PRO PRO B . n 
B 1 106 GLY 106 488 488 GLY GLY B . n 
B 1 107 ASP 107 489 489 ASP ASP B . n 
B 1 108 TYR 108 490 490 TYR TYR B . n 
B 1 109 ILE 109 491 491 ILE ILE B . n 
B 1 110 ILE 110 492 492 ILE ILE B . n 
B 1 111 ARG 111 493 493 ARG ARG B . n 
B 1 112 GLU 112 494 494 GLU GLU B . n 
B 1 113 GLY 113 495 495 GLY GLY B . n 
B 1 114 ALA 114 496 496 ALA ALA B . n 
B 1 115 VAL 115 497 497 VAL VAL B . n 
B 1 116 GLY 116 498 498 GLY GLY B . n 
B 1 117 LYS 117 499 499 LYS LYS B . n 
B 1 118 LYS 118 500 500 LYS LYS B . n 
B 1 119 MET 119 501 501 MET MET B . n 
B 1 120 TYR 120 502 502 TYR TYR B . n 
B 1 121 PHE 121 503 503 PHE PHE B . n 
B 1 122 ILE 122 504 504 ILE ILE B . n 
B 1 123 GLN 123 505 505 GLN GLN B . n 
B 1 124 HIS 124 506 506 HIS HIS B . n 
B 1 125 GLY 125 507 507 GLY GLY B . n 
B 1 126 VAL 126 508 508 VAL VAL B . n 
B 1 127 ALA 127 509 509 ALA ALA B . n 
B 1 128 GLY 128 510 510 GLY GLY B . n 
B 1 129 VAL 129 511 511 VAL VAL B . n 
B 1 130 ILE 130 512 512 ILE ILE B . n 
B 1 131 THR 131 513 513 THR THR B . n 
B 1 132 LYS 132 514 514 LYS LYS B . n 
B 1 133 SER 133 515 515 SER SER B . n 
B 1 134 SER 134 516 516 SER SER B . n 
B 1 135 LYS 135 517 517 LYS LYS B . n 
B 1 136 GLU 136 518 518 GLU GLU B . n 
B 1 137 MET 137 519 519 MET MET B . n 
B 1 138 LYS 138 520 520 LYS LYS B . n 
B 1 139 LEU 139 521 521 LEU LEU B . n 
B 1 140 THR 140 522 522 THR THR B . n 
B 1 141 ASP 141 523 523 ASP ASP B . n 
B 1 142 GLY 142 524 524 GLY GLY B . n 
B 1 143 SER 143 525 525 SER SER B . n 
B 1 144 TYR 144 526 526 TYR TYR B . n 
B 1 145 PHE 145 527 527 PHE PHE B . n 
B 1 146 GLY 146 528 528 GLY GLY B . n 
B 1 147 GLU 147 529 529 GLU GLU B . n 
B 1 148 ILE 148 530 530 ILE ILE B . n 
B 1 149 CYS 149 531 531 CYS CYS B . n 
B 1 150 LEU 150 532 532 LEU LEU B . n 
B 1 151 LEU 151 533 533 LEU LEU B . n 
B 1 152 THR 152 534 534 THR THR B . n 
B 1 153 LYS 153 535 535 LYS LYS B . n 
B 1 154 GLY 154 536 536 GLY GLY B . n 
B 1 155 ARG 155 537 537 ARG ARG B . n 
B 1 156 ARG 156 538 538 ARG ARG B . n 
B 1 157 THR 157 539 539 THR THR B . n 
B 1 158 ALA 158 540 540 ALA ALA B . n 
B 1 159 SER 159 541 541 SER SER B . n 
B 1 160 VAL 160 542 542 VAL VAL B . n 
B 1 161 ARG 161 543 543 ARG ARG B . n 
B 1 162 ALA 162 544 544 ALA ALA B . n 
B 1 163 ASP 163 545 545 ASP ASP B . n 
B 1 164 THR 164 546 546 THR THR B . n 
B 1 165 TYR 165 547 547 TYR TYR B . n 
B 1 166 CYS 166 548 548 CYS CYS B . n 
B 1 167 ARG 167 549 549 ARG ARG B . n 
B 1 168 LEU 168 550 550 LEU LEU B . n 
B 1 169 TYR 169 551 551 TYR TYR B . n 
B 1 170 SER 170 552 552 SER SER B . n 
B 1 171 LEU 171 553 553 LEU LEU B . n 
B 1 172 SER 172 554 554 SER SER B . n 
B 1 173 VAL 173 555 555 VAL VAL B . n 
B 1 174 ASP 174 556 556 ASP ASP B . n 
B 1 175 ASN 175 557 557 ASN ASN B . n 
B 1 176 PHE 176 558 558 PHE PHE B . n 
B 1 177 ASN 177 559 559 ASN ASN B . n 
B 1 178 GLU 178 560 560 GLU GLU B . n 
B 1 179 VAL 179 561 561 VAL VAL B . n 
B 1 180 LEU 180 562 562 LEU LEU B . n 
B 1 181 GLU 181 563 563 GLU GLU B . n 
B 1 182 GLU 182 564 564 GLU GLU B . n 
B 1 183 TYR 183 565 565 TYR TYR B . n 
B 1 184 PRO 184 566 566 PRO PRO B . n 
B 1 185 MET 185 567 567 MET MET B . n 
B 1 186 MET 186 568 568 MET MET B . n 
B 1 187 ARG 187 569 569 ARG ARG B . n 
B 1 188 ARG 188 570 570 ARG ARG B . n 
B 1 189 ALA 189 571 571 ALA ALA B . n 
B 1 190 PHE 190 572 572 PHE PHE B . n 
B 1 191 GLU 191 573 573 GLU GLU B . n 
B 1 192 THR 192 574 574 THR THR B . n 
B 1 193 VAL 193 575 575 VAL VAL B . n 
B 1 194 ALA 194 576 576 ALA ALA B . n 
B 1 195 ILE 195 577 577 ILE ILE B . n 
B 1 196 ASP 196 578 578 ASP ASP B . n 
B 1 197 ARG 197 579 579 ARG ARG B . n 
B 1 198 LEU 198 580 580 LEU LEU B . n 
B 1 199 ASP 199 581 581 ASP ASP B . n 
B 1 200 ARG 200 582 582 ARG ARG B . n 
B 1 201 ILE 201 583 583 ILE ILE B . n 
B 1 202 GLY 202 584 584 GLY GLY B . n 
B 1 203 LYS 203 585 585 LYS LYS B . n 
B 1 204 LYS 204 586 586 LYS LYS B . n 
B 1 205 ASN 205 587 587 ASN ASN B . n 
B 1 206 SER 206 588 588 SER SER B . n 
B 1 207 ILE 207 589 ?   ?   ?   B . n 
B 1 208 LEU 208 590 ?   ?   ?   B . n 
B 1 209 LEU 209 591 ?   ?   ?   B . n 
B 1 210 GLN 210 592 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2,3,4 A,C,E 
2 1,5,6,7 B,D,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 11250 ? 
1 MORE         -35   ? 
1 'SSA (A^2)'  40580 ? 
2 'ABSA (A^2)' 11280 ? 
2 MORE         -35   ? 
2 'SSA (A^2)'  40620 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_445 -x-1,-y-1,z -1.0000000000 0.0000000000  0.0000000000 -97.6700000000 0.0000000000  
-1.0000000000 0.0000000000 -97.6700000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_455 -y-1,x,z    0.0000000000  -1.0000000000 0.0000000000 -97.6700000000 1.0000000000  
0.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_545 y,-x-1,z    0.0000000000  1.0000000000  0.0000000000 0.0000000000   -1.0000000000 
0.0000000000  0.0000000000 -97.6700000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
5 'crystal symmetry operation' 2_555 -x,-y,z     -1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
-1.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
6 'crystal symmetry operation' 3_555 -y,x,z      0.0000000000  -1.0000000000 0.0000000000 0.0000000000   1.0000000000  
0.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
7 'crystal symmetry operation' 4_555 y,-x,z      0.0000000000  1.0000000000  0.0000000000 0.0000000000   -1.0000000000 
0.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-10-26 
2 'Structure model' 1 1 2013-07-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC   'data collection' Quantum  ? 1 
MOLREP phasing           .        ? 2 
REFMAC refinement        5.5.0102 ? 3 
MOSFLM 'data reduction'  .        ? 4 
SCALA  'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 517 ? ? 61.71 -160.39 
2 1 LYS B 517 ? ? 61.38 -163.31 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLN 383 ? A GLN 1   
2  1 Y 1 A GLY 384 ? A GLY 2   
3  1 Y 1 A PRO 385 ? A PRO 3   
4  1 Y 1 A SER 386 ? A SER 4   
5  1 Y 1 A SER 387 ? A SER 5   
6  1 Y 1 A PRO 388 ? A PRO 6   
7  1 Y 1 A MET 389 ? A MET 7   
8  1 Y 1 A ILE 589 ? A ILE 207 
9  1 Y 1 A LEU 590 ? A LEU 208 
10 1 Y 1 A LEU 591 ? A LEU 209 
11 1 Y 1 A GLN 592 ? A GLN 210 
12 1 Y 1 B GLN 383 ? B GLN 1   
13 1 Y 1 B GLY 384 ? B GLY 2   
14 1 Y 1 B PRO 385 ? B PRO 3   
15 1 Y 1 B SER 386 ? B SER 4   
16 1 Y 1 B SER 387 ? B SER 5   
17 1 Y 1 B PRO 388 ? B PRO 6   
18 1 Y 1 B MET 389 ? B MET 7   
19 1 Y 1 B ILE 589 ? B ILE 207 
20 1 Y 1 B LEU 590 ? B LEU 208 
21 1 Y 1 B LEU 591 ? B LEU 209 
22 1 Y 1 B GLN 592 ? B GLN 210 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" CMP 
3 water                                  HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CMP 1  646 646 CMP CMP A . 
D 2 CMP 1  646 646 CMP CMP B . 
E 3 HOH 1  3   3   HOH HOH A . 
E 3 HOH 2  5   5   HOH HOH A . 
E 3 HOH 3  8   8   HOH HOH A . 
E 3 HOH 4  9   9   HOH HOH A . 
E 3 HOH 5  10  10  HOH HOH A . 
E 3 HOH 6  15  15  HOH HOH A . 
E 3 HOH 7  16  16  HOH HOH A . 
E 3 HOH 8  20  20  HOH HOH A . 
E 3 HOH 9  23  23  HOH HOH A . 
E 3 HOH 10 24  24  HOH HOH A . 
E 3 HOH 11 27  27  HOH HOH A . 
E 3 HOH 12 28  28  HOH HOH A . 
E 3 HOH 13 29  29  HOH HOH A . 
E 3 HOH 14 31  31  HOH HOH A . 
E 3 HOH 15 33  33  HOH HOH A . 
E 3 HOH 16 34  34  HOH HOH A . 
E 3 HOH 17 36  36  HOH HOH A . 
E 3 HOH 18 37  37  HOH HOH A . 
E 3 HOH 19 38  38  HOH HOH A . 
E 3 HOH 20 41  41  HOH HOH A . 
E 3 HOH 21 44  44  HOH HOH A . 
E 3 HOH 22 45  45  HOH HOH A . 
E 3 HOH 23 48  48  HOH HOH A . 
E 3 HOH 24 50  50  HOH HOH A . 
F 3 HOH 1  1   1   HOH HOH B . 
F 3 HOH 2  2   2   HOH HOH B . 
F 3 HOH 3  4   4   HOH HOH B . 
F 3 HOH 4  6   6   HOH HOH B . 
F 3 HOH 5  7   7   HOH HOH B . 
F 3 HOH 6  11  11  HOH HOH B . 
F 3 HOH 7  12  12  HOH HOH B . 
F 3 HOH 8  13  13  HOH HOH B . 
F 3 HOH 9  14  14  HOH HOH B . 
F 3 HOH 10 17  17  HOH HOH B . 
F 3 HOH 11 18  18  HOH HOH B . 
F 3 HOH 12 19  19  HOH HOH B . 
F 3 HOH 13 21  21  HOH HOH B . 
F 3 HOH 14 22  22  HOH HOH B . 
F 3 HOH 15 25  25  HOH HOH B . 
F 3 HOH 16 26  26  HOH HOH B . 
F 3 HOH 17 30  30  HOH HOH B . 
F 3 HOH 18 32  32  HOH HOH B . 
F 3 HOH 19 35  35  HOH HOH B . 
F 3 HOH 20 39  39  HOH HOH B . 
F 3 HOH 21 40  40  HOH HOH B . 
F 3 HOH 22 42  42  HOH HOH B . 
F 3 HOH 23 46  46  HOH HOH B . 
F 3 HOH 24 47  47  HOH HOH B . 
F 3 HOH 25 49  49  HOH HOH B . 
#