data_3U1K
# 
_entry.id   3U1K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3U1K         
RCSB  RCSB068189   
WWPDB D_1000068189 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3U1K 
_pdbx_database_status.recvd_initial_deposition_date   2011-09-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lin, C.L.'  1 
'Yuan, H.S.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of human polynucleotide phosphorylase: insights into its domain function in RNA binding and degradation' 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            40 
_citation.page_first                4146 
_citation.page_last                 4157 
_citation.year                      2012 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22210891 
_citation.pdbx_database_id_DOI      10.1093/nar/gkr1281 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lin, C.L.'    1 
primary 'Wang, Y.-T.'  2 
primary 'Yang, W.-Z.'  3 
primary 'Hsiao, Y.-Y.' 4 
primary 'Yuan, H.S.'   5 
# 
_cell.entry_id           3U1K 
_cell.length_a           289.753 
_cell.length_b           289.753 
_cell.length_c           92.785 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              36 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3U1K 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                146 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Polyribonucleotide nucleotidyltransferase 1, mitochondrial' 68809.609 4    2.7.7.8 ? 'UNP residues 46-669' ? 
2 non-polymer syn 'CITRIC ACID'                                                192.124   8    ?       ? ?                     ? 
3 water       nat water                                                        18.015    1172 ?       ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;3'-5' RNA exonuclease OLD35, PNPase old-35, Polynucleotide phosphorylase 1, PNPase 1, Polynucleotide phosphorylase-like protein
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMASAVAVDLGNRKLEISSGKLARFADGSAVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDYRQKAAAAGRIPTNYLRR
EVGTSDKEILTSRIIDRSIRPLFPAGYFYDTQVLCNLLAVDGVNEPDVLAINGASVALSLSDIPWNGPVGAVRIGIIDGE
YVVNPTRKEMSSSTLNLVVAGAPKSQIVMLEASAENILQQDFCHAIKVGVKYTQQIIQGIQQLVKETGVTKRTPQKLFTP
SPEIVKYTHKLAMERLYAVFTDYEHDKVSRDEAVNKIRLDTEEQLKEKFPEADPYEIIESFNVVAKEVFRSIVLNEYKRC
DGRDLTSLRNVSCEVDMFKTLHGSALFQRGQTQVLCTVTFDSLESGIKSDQVITAINGIKDKNFMLHYEFPPYATNEIGK
VTGLNRRELGHGALAEKALYPVIPRDFPFTIRVTSEVLESNGSSSMASACGGSLALMDSGVPISSAVAGVAIGLVTKTDP
EKGEIEDYRLLTDILGIEDYNGDMDFKIAGTNKGITALQADIKLPGIPIKIVMEAIQQASVAKKEILQIMNKTISKPRAS
RKENGPVVETVQVPLSKRAKFVGPGGYNLKKLQAETGVTISQVDEETFSVFAPTPSAMHEARDFITEICK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMASAVAVDLGNRKLEISSGKLARFADGSAVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDYRQKAAAAGRIPTNYLRR
EVGTSDKEILTSRIIDRSIRPLFPAGYFYDTQVLCNLLAVDGVNEPDVLAINGASVALSLSDIPWNGPVGAVRIGIIDGE
YVVNPTRKEMSSSTLNLVVAGAPKSQIVMLEASAENILQQDFCHAIKVGVKYTQQIIQGIQQLVKETGVTKRTPQKLFTP
SPEIVKYTHKLAMERLYAVFTDYEHDKVSRDEAVNKIRLDTEEQLKEKFPEADPYEIIESFNVVAKEVFRSIVLNEYKRC
DGRDLTSLRNVSCEVDMFKTLHGSALFQRGQTQVLCTVTFDSLESGIKSDQVITAINGIKDKNFMLHYEFPPYATNEIGK
VTGLNRRELGHGALAEKALYPVIPRDFPFTIRVTSEVLESNGSSSMASACGGSLALMDSGVPISSAVAGVAIGLVTKTDP
EKGEIEDYRLLTDILGIEDYNGDMDFKIAGTNKGITALQADIKLPGIPIKIVMEAIQQASVAKKEILQIMNKTISKPRAS
RKENGPVVETVQVPLSKRAKFVGPGGYNLKKLQAETGVTISQVDEETFSVFAPTPSAMHEARDFITEICK
;
_entity_poly.pdbx_strand_id                 A,C,B,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   SER n 
1 7   ALA n 
1 8   VAL n 
1 9   ALA n 
1 10  VAL n 
1 11  ASP n 
1 12  LEU n 
1 13  GLY n 
1 14  ASN n 
1 15  ARG n 
1 16  LYS n 
1 17  LEU n 
1 18  GLU n 
1 19  ILE n 
1 20  SER n 
1 21  SER n 
1 22  GLY n 
1 23  LYS n 
1 24  LEU n 
1 25  ALA n 
1 26  ARG n 
1 27  PHE n 
1 28  ALA n 
1 29  ASP n 
1 30  GLY n 
1 31  SER n 
1 32  ALA n 
1 33  VAL n 
1 34  VAL n 
1 35  GLN n 
1 36  SER n 
1 37  GLY n 
1 38  ASP n 
1 39  THR n 
1 40  ALA n 
1 41  VAL n 
1 42  MET n 
1 43  VAL n 
1 44  THR n 
1 45  ALA n 
1 46  VAL n 
1 47  SER n 
1 48  LYS n 
1 49  THR n 
1 50  LYS n 
1 51  PRO n 
1 52  SER n 
1 53  PRO n 
1 54  SER n 
1 55  GLN n 
1 56  PHE n 
1 57  MET n 
1 58  PRO n 
1 59  LEU n 
1 60  VAL n 
1 61  VAL n 
1 62  ASP n 
1 63  TYR n 
1 64  ARG n 
1 65  GLN n 
1 66  LYS n 
1 67  ALA n 
1 68  ALA n 
1 69  ALA n 
1 70  ALA n 
1 71  GLY n 
1 72  ARG n 
1 73  ILE n 
1 74  PRO n 
1 75  THR n 
1 76  ASN n 
1 77  TYR n 
1 78  LEU n 
1 79  ARG n 
1 80  ARG n 
1 81  GLU n 
1 82  VAL n 
1 83  GLY n 
1 84  THR n 
1 85  SER n 
1 86  ASP n 
1 87  LYS n 
1 88  GLU n 
1 89  ILE n 
1 90  LEU n 
1 91  THR n 
1 92  SER n 
1 93  ARG n 
1 94  ILE n 
1 95  ILE n 
1 96  ASP n 
1 97  ARG n 
1 98  SER n 
1 99  ILE n 
1 100 ARG n 
1 101 PRO n 
1 102 LEU n 
1 103 PHE n 
1 104 PRO n 
1 105 ALA n 
1 106 GLY n 
1 107 TYR n 
1 108 PHE n 
1 109 TYR n 
1 110 ASP n 
1 111 THR n 
1 112 GLN n 
1 113 VAL n 
1 114 LEU n 
1 115 CYS n 
1 116 ASN n 
1 117 LEU n 
1 118 LEU n 
1 119 ALA n 
1 120 VAL n 
1 121 ASP n 
1 122 GLY n 
1 123 VAL n 
1 124 ASN n 
1 125 GLU n 
1 126 PRO n 
1 127 ASP n 
1 128 VAL n 
1 129 LEU n 
1 130 ALA n 
1 131 ILE n 
1 132 ASN n 
1 133 GLY n 
1 134 ALA n 
1 135 SER n 
1 136 VAL n 
1 137 ALA n 
1 138 LEU n 
1 139 SER n 
1 140 LEU n 
1 141 SER n 
1 142 ASP n 
1 143 ILE n 
1 144 PRO n 
1 145 TRP n 
1 146 ASN n 
1 147 GLY n 
1 148 PRO n 
1 149 VAL n 
1 150 GLY n 
1 151 ALA n 
1 152 VAL n 
1 153 ARG n 
1 154 ILE n 
1 155 GLY n 
1 156 ILE n 
1 157 ILE n 
1 158 ASP n 
1 159 GLY n 
1 160 GLU n 
1 161 TYR n 
1 162 VAL n 
1 163 VAL n 
1 164 ASN n 
1 165 PRO n 
1 166 THR n 
1 167 ARG n 
1 168 LYS n 
1 169 GLU n 
1 170 MET n 
1 171 SER n 
1 172 SER n 
1 173 SER n 
1 174 THR n 
1 175 LEU n 
1 176 ASN n 
1 177 LEU n 
1 178 VAL n 
1 179 VAL n 
1 180 ALA n 
1 181 GLY n 
1 182 ALA n 
1 183 PRO n 
1 184 LYS n 
1 185 SER n 
1 186 GLN n 
1 187 ILE n 
1 188 VAL n 
1 189 MET n 
1 190 LEU n 
1 191 GLU n 
1 192 ALA n 
1 193 SER n 
1 194 ALA n 
1 195 GLU n 
1 196 ASN n 
1 197 ILE n 
1 198 LEU n 
1 199 GLN n 
1 200 GLN n 
1 201 ASP n 
1 202 PHE n 
1 203 CYS n 
1 204 HIS n 
1 205 ALA n 
1 206 ILE n 
1 207 LYS n 
1 208 VAL n 
1 209 GLY n 
1 210 VAL n 
1 211 LYS n 
1 212 TYR n 
1 213 THR n 
1 214 GLN n 
1 215 GLN n 
1 216 ILE n 
1 217 ILE n 
1 218 GLN n 
1 219 GLY n 
1 220 ILE n 
1 221 GLN n 
1 222 GLN n 
1 223 LEU n 
1 224 VAL n 
1 225 LYS n 
1 226 GLU n 
1 227 THR n 
1 228 GLY n 
1 229 VAL n 
1 230 THR n 
1 231 LYS n 
1 232 ARG n 
1 233 THR n 
1 234 PRO n 
1 235 GLN n 
1 236 LYS n 
1 237 LEU n 
1 238 PHE n 
1 239 THR n 
1 240 PRO n 
1 241 SER n 
1 242 PRO n 
1 243 GLU n 
1 244 ILE n 
1 245 VAL n 
1 246 LYS n 
1 247 TYR n 
1 248 THR n 
1 249 HIS n 
1 250 LYS n 
1 251 LEU n 
1 252 ALA n 
1 253 MET n 
1 254 GLU n 
1 255 ARG n 
1 256 LEU n 
1 257 TYR n 
1 258 ALA n 
1 259 VAL n 
1 260 PHE n 
1 261 THR n 
1 262 ASP n 
1 263 TYR n 
1 264 GLU n 
1 265 HIS n 
1 266 ASP n 
1 267 LYS n 
1 268 VAL n 
1 269 SER n 
1 270 ARG n 
1 271 ASP n 
1 272 GLU n 
1 273 ALA n 
1 274 VAL n 
1 275 ASN n 
1 276 LYS n 
1 277 ILE n 
1 278 ARG n 
1 279 LEU n 
1 280 ASP n 
1 281 THR n 
1 282 GLU n 
1 283 GLU n 
1 284 GLN n 
1 285 LEU n 
1 286 LYS n 
1 287 GLU n 
1 288 LYS n 
1 289 PHE n 
1 290 PRO n 
1 291 GLU n 
1 292 ALA n 
1 293 ASP n 
1 294 PRO n 
1 295 TYR n 
1 296 GLU n 
1 297 ILE n 
1 298 ILE n 
1 299 GLU n 
1 300 SER n 
1 301 PHE n 
1 302 ASN n 
1 303 VAL n 
1 304 VAL n 
1 305 ALA n 
1 306 LYS n 
1 307 GLU n 
1 308 VAL n 
1 309 PHE n 
1 310 ARG n 
1 311 SER n 
1 312 ILE n 
1 313 VAL n 
1 314 LEU n 
1 315 ASN n 
1 316 GLU n 
1 317 TYR n 
1 318 LYS n 
1 319 ARG n 
1 320 CYS n 
1 321 ASP n 
1 322 GLY n 
1 323 ARG n 
1 324 ASP n 
1 325 LEU n 
1 326 THR n 
1 327 SER n 
1 328 LEU n 
1 329 ARG n 
1 330 ASN n 
1 331 VAL n 
1 332 SER n 
1 333 CYS n 
1 334 GLU n 
1 335 VAL n 
1 336 ASP n 
1 337 MET n 
1 338 PHE n 
1 339 LYS n 
1 340 THR n 
1 341 LEU n 
1 342 HIS n 
1 343 GLY n 
1 344 SER n 
1 345 ALA n 
1 346 LEU n 
1 347 PHE n 
1 348 GLN n 
1 349 ARG n 
1 350 GLY n 
1 351 GLN n 
1 352 THR n 
1 353 GLN n 
1 354 VAL n 
1 355 LEU n 
1 356 CYS n 
1 357 THR n 
1 358 VAL n 
1 359 THR n 
1 360 PHE n 
1 361 ASP n 
1 362 SER n 
1 363 LEU n 
1 364 GLU n 
1 365 SER n 
1 366 GLY n 
1 367 ILE n 
1 368 LYS n 
1 369 SER n 
1 370 ASP n 
1 371 GLN n 
1 372 VAL n 
1 373 ILE n 
1 374 THR n 
1 375 ALA n 
1 376 ILE n 
1 377 ASN n 
1 378 GLY n 
1 379 ILE n 
1 380 LYS n 
1 381 ASP n 
1 382 LYS n 
1 383 ASN n 
1 384 PHE n 
1 385 MET n 
1 386 LEU n 
1 387 HIS n 
1 388 TYR n 
1 389 GLU n 
1 390 PHE n 
1 391 PRO n 
1 392 PRO n 
1 393 TYR n 
1 394 ALA n 
1 395 THR n 
1 396 ASN n 
1 397 GLU n 
1 398 ILE n 
1 399 GLY n 
1 400 LYS n 
1 401 VAL n 
1 402 THR n 
1 403 GLY n 
1 404 LEU n 
1 405 ASN n 
1 406 ARG n 
1 407 ARG n 
1 408 GLU n 
1 409 LEU n 
1 410 GLY n 
1 411 HIS n 
1 412 GLY n 
1 413 ALA n 
1 414 LEU n 
1 415 ALA n 
1 416 GLU n 
1 417 LYS n 
1 418 ALA n 
1 419 LEU n 
1 420 TYR n 
1 421 PRO n 
1 422 VAL n 
1 423 ILE n 
1 424 PRO n 
1 425 ARG n 
1 426 ASP n 
1 427 PHE n 
1 428 PRO n 
1 429 PHE n 
1 430 THR n 
1 431 ILE n 
1 432 ARG n 
1 433 VAL n 
1 434 THR n 
1 435 SER n 
1 436 GLU n 
1 437 VAL n 
1 438 LEU n 
1 439 GLU n 
1 440 SER n 
1 441 ASN n 
1 442 GLY n 
1 443 SER n 
1 444 SER n 
1 445 SER n 
1 446 MET n 
1 447 ALA n 
1 448 SER n 
1 449 ALA n 
1 450 CYS n 
1 451 GLY n 
1 452 GLY n 
1 453 SER n 
1 454 LEU n 
1 455 ALA n 
1 456 LEU n 
1 457 MET n 
1 458 ASP n 
1 459 SER n 
1 460 GLY n 
1 461 VAL n 
1 462 PRO n 
1 463 ILE n 
1 464 SER n 
1 465 SER n 
1 466 ALA n 
1 467 VAL n 
1 468 ALA n 
1 469 GLY n 
1 470 VAL n 
1 471 ALA n 
1 472 ILE n 
1 473 GLY n 
1 474 LEU n 
1 475 VAL n 
1 476 THR n 
1 477 LYS n 
1 478 THR n 
1 479 ASP n 
1 480 PRO n 
1 481 GLU n 
1 482 LYS n 
1 483 GLY n 
1 484 GLU n 
1 485 ILE n 
1 486 GLU n 
1 487 ASP n 
1 488 TYR n 
1 489 ARG n 
1 490 LEU n 
1 491 LEU n 
1 492 THR n 
1 493 ASP n 
1 494 ILE n 
1 495 LEU n 
1 496 GLY n 
1 497 ILE n 
1 498 GLU n 
1 499 ASP n 
1 500 TYR n 
1 501 ASN n 
1 502 GLY n 
1 503 ASP n 
1 504 MET n 
1 505 ASP n 
1 506 PHE n 
1 507 LYS n 
1 508 ILE n 
1 509 ALA n 
1 510 GLY n 
1 511 THR n 
1 512 ASN n 
1 513 LYS n 
1 514 GLY n 
1 515 ILE n 
1 516 THR n 
1 517 ALA n 
1 518 LEU n 
1 519 GLN n 
1 520 ALA n 
1 521 ASP n 
1 522 ILE n 
1 523 LYS n 
1 524 LEU n 
1 525 PRO n 
1 526 GLY n 
1 527 ILE n 
1 528 PRO n 
1 529 ILE n 
1 530 LYS n 
1 531 ILE n 
1 532 VAL n 
1 533 MET n 
1 534 GLU n 
1 535 ALA n 
1 536 ILE n 
1 537 GLN n 
1 538 GLN n 
1 539 ALA n 
1 540 SER n 
1 541 VAL n 
1 542 ALA n 
1 543 LYS n 
1 544 LYS n 
1 545 GLU n 
1 546 ILE n 
1 547 LEU n 
1 548 GLN n 
1 549 ILE n 
1 550 MET n 
1 551 ASN n 
1 552 LYS n 
1 553 THR n 
1 554 ILE n 
1 555 SER n 
1 556 LYS n 
1 557 PRO n 
1 558 ARG n 
1 559 ALA n 
1 560 SER n 
1 561 ARG n 
1 562 LYS n 
1 563 GLU n 
1 564 ASN n 
1 565 GLY n 
1 566 PRO n 
1 567 VAL n 
1 568 VAL n 
1 569 GLU n 
1 570 THR n 
1 571 VAL n 
1 572 GLN n 
1 573 VAL n 
1 574 PRO n 
1 575 LEU n 
1 576 SER n 
1 577 LYS n 
1 578 ARG n 
1 579 ALA n 
1 580 LYS n 
1 581 PHE n 
1 582 VAL n 
1 583 GLY n 
1 584 PRO n 
1 585 GLY n 
1 586 GLY n 
1 587 TYR n 
1 588 ASN n 
1 589 LEU n 
1 590 LYS n 
1 591 LYS n 
1 592 LEU n 
1 593 GLN n 
1 594 ALA n 
1 595 GLU n 
1 596 THR n 
1 597 GLY n 
1 598 VAL n 
1 599 THR n 
1 600 ILE n 
1 601 SER n 
1 602 GLN n 
1 603 VAL n 
1 604 ASP n 
1 605 GLU n 
1 606 GLU n 
1 607 THR n 
1 608 PHE n 
1 609 SER n 
1 610 VAL n 
1 611 PHE n 
1 612 ALA n 
1 613 PRO n 
1 614 THR n 
1 615 PRO n 
1 616 SER n 
1 617 ALA n 
1 618 MET n 
1 619 HIS n 
1 620 GLU n 
1 621 ALA n 
1 622 ARG n 
1 623 ASP n 
1 624 PHE n 
1 625 ILE n 
1 626 THR n 
1 627 GLU n 
1 628 ILE n 
1 629 CYS n 
1 630 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PNPT1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) RIPL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PNPT1_HUMAN 
_struct_ref.pdbx_db_accession          Q8TCS8 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AVAVDLGNRKLEISSGKLARFADGSAVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDYRQKAAAAGRIPTNYLRREIGTSD
KEILTSRIIDRSIRPLFPAGYFYDTQVLCNLLAVDGVNEPDVLAINGASVALSLSDIPWNGPVGAVRIGIIDGEYVVNPT
RKEMSSSTLNLVVAGAPKSQIVMLEASAENILQQDFCHAIKVGVKYTQQIIQGIQQLVKETGVTKRTPQKLFTPSPEIVK
YTHKLAMERLYAVFTDYEHDKVSRDEAVNKIRLDTEEQLKEKFPEADPYEIIESFNVVAKEVFRSIVLNEYKRCDGRDLT
SLRNVSCEVDMFKTLHGSALFQRGQTQVLCTVTFDSLESGIKSDQVITAINGIKDKNFMLHYEFPPYATNEIGKVTGLNR
RELGHGALAEKALYPVIPRDFPFTIRVTSEVLESNGSSSMASACGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIE
DYRLLTDILGIEDYNGDMDFKIAGTNKGITALQADIKLPGIPIKIVMEAIQQASVAKKEILQIMNKTISKPRASRKENGP
VVETVQVPLSKRAKFVGPGGYNLKKLQAETGVTISQVDEETFSVFAPTPSAMHEARDFITEICK
;
_struct_ref.pdbx_align_begin           46 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3U1K A 7 ? 630 ? Q8TCS8 46 ? 669 ? 46 669 
2 1 3U1K C 7 ? 630 ? Q8TCS8 46 ? 669 ? 46 669 
3 1 3U1K B 7 ? 630 ? Q8TCS8 46 ? 669 ? 46 669 
4 1 3U1K D 7 ? 630 ? Q8TCS8 46 ? 669 ? 46 669 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3U1K GLY A 1  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 40  1  
1 3U1K SER A 2  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 41  2  
1 3U1K HIS A 3  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 42  3  
1 3U1K MET A 4  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 43  4  
1 3U1K ALA A 5  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 44  5  
1 3U1K SER A 6  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 45  6  
1 3U1K VAL A 82 ? UNP Q8TCS8 ILE 121 'SEE REMARK 999' 121 7  
2 3U1K GLY C 1  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 40  8  
2 3U1K SER C 2  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 41  9  
2 3U1K HIS C 3  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 42  10 
2 3U1K MET C 4  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 43  11 
2 3U1K ALA C 5  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 44  12 
2 3U1K SER C 6  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 45  13 
2 3U1K VAL C 82 ? UNP Q8TCS8 ILE 121 'SEE REMARK 999' 121 14 
3 3U1K GLY B 1  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 40  15 
3 3U1K SER B 2  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 41  16 
3 3U1K HIS B 3  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 42  17 
3 3U1K MET B 4  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 43  18 
3 3U1K ALA B 5  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 44  19 
3 3U1K SER B 6  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 45  20 
3 3U1K VAL B 82 ? UNP Q8TCS8 ILE 121 'SEE REMARK 999' 121 21 
4 3U1K GLY D 1  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 40  22 
4 3U1K SER D 2  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 41  23 
4 3U1K HIS D 3  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 42  24 
4 3U1K MET D 4  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 43  25 
4 3U1K ALA D 5  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 44  26 
4 3U1K SER D 6  ? UNP Q8TCS8 ?   ?   'EXPRESSION TAG' 45  27 
4 3U1K VAL D 82 ? UNP Q8TCS8 ILE 121 'SEE REMARK 999' 121 28 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CIT non-polymer         . 'CITRIC ACID'   ? 'C6 H8 O7'       192.124 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3U1K 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.72 
_exptl_crystal.density_percent_sol   54.84 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_details    
;10%(v/v) 2-Propanol, 0.1M Sodium citrate tribasic dihydrate, 26%(v/v) Polyethylene glycol 400 , pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX300HE' 
_diffrn_detector.pdbx_collection_date   2011-02-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSRRC BEAMLINE BL13C1' 
_diffrn_source.pdbx_synchrotron_site       NSRRC 
_diffrn_source.pdbx_synchrotron_beamline   BL13C1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     3U1K 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.13 
_reflns.number_obs                   162293 
_reflns.number_all                   162293 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.046 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        30.8 
_reflns.B_iso_Wilson_estimate        34.390 
_reflns.pdbx_redundancy              3.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.13 
_reflns_shell.d_res_low                   2.21 
_reflns_shell.percent_possible_all        100 
_reflns_shell.Rmerge_I_obs                0.311 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         4.7 
_reflns_shell.pdbx_redundancy             3.1 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           16272 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3U1K 
_refine.ls_number_reflns_obs                     162282 
_refine.ls_number_reflns_all                     162282 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.97 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.5 
_refine.ls_d_res_high                            2.130 
_refine.ls_percent_reflns_obs                    99.96 
_refine.ls_R_factor_obs                          0.1821 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1799 
_refine.ls_R_factor_R_free                       0.2230 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_number_reflns_R_free                  8129 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               42.4901 
_refine.aniso_B[1][1]                            -3.1554 
_refine.aniso_B[2][2]                            -3.1554 
_refine.aniso_B[3][3]                            7.3758 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.338 
_refine.solvent_model_param_bsol                 39.924 
_refine.pdbx_solvent_vdw_probe_radii             1.10 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.83 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      3GCM 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.52 
_refine.overall_FOM_work_R_set                   0.8390 
_refine.B_iso_max                                110.850 
_refine.B_iso_min                                14.590 
_refine.pdbx_overall_phase_error                 23.7500 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        18929 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         104 
_refine_hist.number_atoms_solvent             1172 
_refine_hist.number_atoms_total               20205 
_refine_hist.d_res_high                       2.130 
_refine_hist.d_res_low                        28.5 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           19327 0.007  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          26174 1.071  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     3063  0.079  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      3390  0.004  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 7262  15.781 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
2.1303 2.1545  30 100.0000 5144 . 0.2256 0.3156 . 278 . 5422 . 'X-RAY DIFFRACTION' . 
2.1545 2.1799  30 100.0000 5176 . 0.2171 0.2864 . 273 . 5449 . 'X-RAY DIFFRACTION' . 
2.1799 2.2064  30 100.0000 5098 . 0.2079 0.2836 . 288 . 5386 . 'X-RAY DIFFRACTION' . 
2.2064 2.2343  30 100.0000 5111 . 0.2048 0.2544 . 277 . 5388 . 'X-RAY DIFFRACTION' . 
2.2343 2.2637  30 100.0000 5194 . 0.2027 0.2793 . 273 . 5467 . 'X-RAY DIFFRACTION' . 
2.2637 2.2947  30 100.0000 5059 . 0.2054 0.2594 . 272 . 5331 . 'X-RAY DIFFRACTION' . 
2.2947 2.3275  30 100.0000 5125 . 0.2022 0.2748 . 300 . 5425 . 'X-RAY DIFFRACTION' . 
2.3275 2.3622  30 100.0000 5147 . 0.1954 0.2512 . 253 . 5400 . 'X-RAY DIFFRACTION' . 
2.3622 2.3991  30 100.0000 5114 . 0.1933 0.2571 . 322 . 5436 . 'X-RAY DIFFRACTION' . 
2.3991 2.4384  30 100.0000 5123 . 0.1998 0.2895 . 268 . 5391 . 'X-RAY DIFFRACTION' . 
2.4384 2.4805  30 100.0000 5135 . 0.2007 0.2793 . 272 . 5407 . 'X-RAY DIFFRACTION' . 
2.4805 2.5255  30 100.0000 5155 . 0.2073 0.2822 . 256 . 5411 . 'X-RAY DIFFRACTION' . 
2.5255 2.5741  30 100.0000 5182 . 0.1931 0.2637 . 267 . 5449 . 'X-RAY DIFFRACTION' . 
2.5741 2.6266  30 100.0000 5156 . 0.1891 0.2701 . 241 . 5397 . 'X-RAY DIFFRACTION' . 
2.6266 2.6837  30 100.0000 5110 . 0.1964 0.2656 . 267 . 5377 . 'X-RAY DIFFRACTION' . 
2.6837 2.7460  30 100.0000 5205 . 0.2034 0.2644 . 252 . 5457 . 'X-RAY DIFFRACTION' . 
2.7460 2.8146  30 100.0000 5147 . 0.2025 0.2587 . 253 . 5400 . 'X-RAY DIFFRACTION' . 
2.8146 2.8907  30 100.0000 5139 . 0.2054 0.2571 . 277 . 5416 . 'X-RAY DIFFRACTION' . 
2.8907 2.9756  30 100.0000 5119 . 0.2121 0.2745 . 263 . 5382 . 'X-RAY DIFFRACTION' . 
2.9756 3.0716  30 100.0000 5145 . 0.2055 0.2403 . 271 . 5416 . 'X-RAY DIFFRACTION' . 
3.0716 3.1812  30 100.0000 5115 . 0.2048 0.2675 . 285 . 5400 . 'X-RAY DIFFRACTION' . 
3.1812 3.3084  30 100.0000 5133 . 0.1963 0.2272 . 294 . 5427 . 'X-RAY DIFFRACTION' . 
3.3084 3.4587  30 100.0000 5134 . 0.1872 0.2205 . 265 . 5399 . 'X-RAY DIFFRACTION' . 
3.4587 3.6407  30 100.0000 5174 . 0.1769 0.2383 . 247 . 5421 . 'X-RAY DIFFRACTION' . 
3.6407 3.8683  30 100.0000 5172 . 0.1692 0.2001 . 264 . 5436 . 'X-RAY DIFFRACTION' . 
3.8683 4.1661  30 100.0000 5101 . 0.1544 0.1933 . 275 . 5376 . 'X-RAY DIFFRACTION' . 
4.1661 4.5838  30 100.0000 5128 . 0.1395 0.1692 . 282 . 5410 . 'X-RAY DIFFRACTION' . 
4.5838 5.2435  30 100.0000 5140 . 0.1412 0.1675 . 270 . 5410 . 'X-RAY DIFFRACTION' . 
5.2435 6.5925  30 100.0000 5165 . 0.1727 0.1915 . 262 . 5427 . 'X-RAY DIFFRACTION' . 
6.5925 28.3685 30 99.0000  5107 . 0.1597 0.1668 . 262 . 5369 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  3U1K 
_struct.title                     'Crystal structure of human PNPase' 
_struct.pdbx_descriptor           'Polyribonucleotide nucleotidyltransferase 1, mitochondrial (E.C.2.7.7.8)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3U1K 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'RNase PH, KH domain, exoribonuclease, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 85  ? ARG A 100 ? SER A 124 ARG A 139 1 ? 16 
HELX_P HELX_P2  2  PRO A 101 ? PHE A 103 ? PRO A 140 PHE A 142 5 ? 3  
HELX_P HELX_P3  3  GLU A 125 ? SER A 141 ? GLU A 164 SER A 180 1 ? 17 
HELX_P HELX_P4  4  THR A 166 ? SER A 172 ? THR A 205 SER A 211 1 ? 7  
HELX_P HELX_P5  5  LEU A 198 ? GLY A 228 ? LEU A 237 GLY A 267 1 ? 31 
HELX_P HELX_P6  6  SER A 241 ? THR A 261 ? SER A 280 THR A 300 1 ? 21 
HELX_P HELX_P7  7  ASP A 266 ? PHE A 289 ? ASP A 305 PHE A 328 1 ? 24 
HELX_P HELX_P8  8  ASP A 293 ? TYR A 317 ? ASP A 332 TYR A 356 1 ? 25 
HELX_P HELX_P9  9  SER A 362 ? ILE A 367 ? SER A 401 ILE A 406 5 ? 6  
HELX_P HELX_P10 10 ASP A 370 ? GLY A 378 ? ASP A 409 GLY A 417 1 ? 9  
HELX_P HELX_P11 11 LYS A 380 ? LYS A 382 ? LYS A 419 LYS A 421 5 ? 3  
HELX_P HELX_P12 12 PRO A 391 ? ASN A 396 ? PRO A 430 ASN A 435 5 ? 6  
HELX_P HELX_P13 13 ASN A 405 ? TYR A 420 ? ASN A 444 TYR A 459 1 ? 16 
HELX_P HELX_P14 14 PRO A 421 ? ILE A 423 ? PRO A 460 ILE A 462 5 ? 3  
HELX_P HELX_P15 15 SER A 443 ? SER A 459 ? SER A 482 SER A 498 1 ? 17 
HELX_P HELX_P16 16 LEU A 495 ? ASN A 501 ? LEU A 534 ASN A 540 1 ? 7  
HELX_P HELX_P17 17 PRO A 528 ? ILE A 554 ? PRO A 567 ILE A 593 1 ? 27 
HELX_P HELX_P18 18 PRO A 574 ? GLY A 583 ? PRO A 613 GLY A 622 1 ? 10 
HELX_P HELX_P19 19 GLY A 586 ? GLY A 597 ? GLY A 625 GLY A 636 1 ? 12 
HELX_P HELX_P20 20 THR A 614 ? ILE A 625 ? THR A 653 ILE A 664 1 ? 12 
HELX_P HELX_P21 21 SER B 85  ? ARG B 100 ? SER C 124 ARG C 139 1 ? 16 
HELX_P HELX_P22 22 PRO B 101 ? PHE B 103 ? PRO C 140 PHE C 142 5 ? 3  
HELX_P HELX_P23 23 GLU B 125 ? SER B 141 ? GLU C 164 SER C 180 1 ? 17 
HELX_P HELX_P24 24 THR B 166 ? SER B 172 ? THR C 205 SER C 211 1 ? 7  
HELX_P HELX_P25 25 LEU B 198 ? GLY B 228 ? LEU C 237 GLY C 267 1 ? 31 
HELX_P HELX_P26 26 SER B 241 ? THR B 261 ? SER C 280 THR C 300 1 ? 21 
HELX_P HELX_P27 27 ASP B 266 ? PHE B 289 ? ASP C 305 PHE C 328 1 ? 24 
HELX_P HELX_P28 28 ASP B 293 ? TYR B 317 ? ASP C 332 TYR C 356 1 ? 25 
HELX_P HELX_P29 29 SER B 362 ? ILE B 367 ? SER C 401 ILE C 406 5 ? 6  
HELX_P HELX_P30 30 ASP B 370 ? GLY B 378 ? ASP C 409 GLY C 417 1 ? 9  
HELX_P HELX_P31 31 LYS B 380 ? LYS B 382 ? LYS C 419 LYS C 421 5 ? 3  
HELX_P HELX_P32 32 PRO B 391 ? ASN B 396 ? PRO C 430 ASN C 435 5 ? 6  
HELX_P HELX_P33 33 ASN B 405 ? TYR B 420 ? ASN C 444 TYR C 459 1 ? 16 
HELX_P HELX_P34 34 PRO B 421 ? ILE B 423 ? PRO C 460 ILE C 462 5 ? 3  
HELX_P HELX_P35 35 SER B 443 ? GLY B 460 ? SER C 482 GLY C 499 1 ? 18 
HELX_P HELX_P36 36 LEU B 495 ? ASN B 501 ? LEU C 534 ASN C 540 1 ? 7  
HELX_P HELX_P37 37 ILE B 529 ? ILE B 554 ? ILE C 568 ILE C 593 1 ? 26 
HELX_P HELX_P38 38 PRO B 574 ? GLY B 583 ? PRO C 613 GLY C 622 1 ? 10 
HELX_P HELX_P39 39 GLY B 586 ? GLY B 597 ? GLY C 625 GLY C 636 1 ? 12 
HELX_P HELX_P40 40 THR B 614 ? CYS B 629 ? THR C 653 CYS C 668 1 ? 16 
HELX_P HELX_P41 41 SER C 85  ? ARG C 100 ? SER B 124 ARG B 139 1 ? 16 
HELX_P HELX_P42 42 PRO C 101 ? PHE C 103 ? PRO B 140 PHE B 142 5 ? 3  
HELX_P HELX_P43 43 GLU C 125 ? SER C 141 ? GLU B 164 SER B 180 1 ? 17 
HELX_P HELX_P44 44 THR C 166 ? SER C 173 ? THR B 205 SER B 212 1 ? 8  
HELX_P HELX_P45 45 LEU C 198 ? GLY C 228 ? LEU B 237 GLY B 267 1 ? 31 
HELX_P HELX_P46 46 SER C 241 ? THR C 261 ? SER B 280 THR B 300 1 ? 21 
HELX_P HELX_P47 47 ASP C 266 ? PHE C 289 ? ASP B 305 PHE B 328 1 ? 24 
HELX_P HELX_P48 48 ASP C 293 ? TYR C 317 ? ASP B 332 TYR B 356 1 ? 25 
HELX_P HELX_P49 49 LEU C 363 ? ILE C 367 ? LEU B 402 ILE B 406 5 ? 5  
HELX_P HELX_P50 50 LYS C 380 ? LYS C 382 ? LYS B 419 LYS B 421 5 ? 3  
HELX_P HELX_P51 51 PRO C 391 ? ASN C 396 ? PRO B 430 ASN B 435 5 ? 6  
HELX_P HELX_P52 52 ASN C 405 ? TYR C 420 ? ASN B 444 TYR B 459 1 ? 16 
HELX_P HELX_P53 53 PRO C 421 ? ILE C 423 ? PRO B 460 ILE B 462 5 ? 3  
HELX_P HELX_P54 54 SER C 443 ? GLY C 460 ? SER B 482 GLY B 499 1 ? 18 
HELX_P HELX_P55 55 LEU C 495 ? ASN C 501 ? LEU B 534 ASN B 540 1 ? 7  
HELX_P HELX_P56 56 ILE C 529 ? ILE C 554 ? ILE B 568 ILE B 593 1 ? 26 
HELX_P HELX_P57 57 LYS C 577 ? GLY C 583 ? LYS B 616 GLY B 622 1 ? 7  
HELX_P HELX_P58 58 GLY C 586 ? GLY C 597 ? GLY B 625 GLY B 636 1 ? 12 
HELX_P HELX_P59 59 THR C 614 ? GLU C 627 ? THR B 653 GLU B 666 1 ? 14 
HELX_P HELX_P60 60 SER D 85  ? ARG D 100 ? SER D 124 ARG D 139 1 ? 16 
HELX_P HELX_P61 61 PRO D 101 ? PHE D 103 ? PRO D 140 PHE D 142 5 ? 3  
HELX_P HELX_P62 62 GLU D 125 ? SER D 141 ? GLU D 164 SER D 180 1 ? 17 
HELX_P HELX_P63 63 THR D 166 ? SER D 171 ? THR D 205 SER D 210 1 ? 6  
HELX_P HELX_P64 64 LEU D 198 ? GLY D 228 ? LEU D 237 GLY D 267 1 ? 31 
HELX_P HELX_P65 65 SER D 241 ? THR D 261 ? SER D 280 THR D 300 1 ? 21 
HELX_P HELX_P66 66 ASP D 266 ? PHE D 289 ? ASP D 305 PHE D 328 1 ? 24 
HELX_P HELX_P67 67 ASP D 293 ? TYR D 317 ? ASP D 332 TYR D 356 1 ? 25 
HELX_P HELX_P68 68 LEU D 363 ? ILE D 367 ? LEU D 402 ILE D 406 5 ? 5  
HELX_P HELX_P69 69 ASP D 370 ? GLY D 378 ? ASP D 409 GLY D 417 1 ? 9  
HELX_P HELX_P70 70 LYS D 380 ? LYS D 382 ? LYS D 419 LYS D 421 5 ? 3  
HELX_P HELX_P71 71 PRO D 391 ? ASN D 396 ? PRO D 430 ASN D 435 5 ? 6  
HELX_P HELX_P72 72 ASN D 405 ? TYR D 420 ? ASN D 444 TYR D 459 1 ? 16 
HELX_P HELX_P73 73 PRO D 421 ? ILE D 423 ? PRO D 460 ILE D 462 5 ? 3  
HELX_P HELX_P74 74 SER D 443 ? GLY D 460 ? SER D 482 GLY D 499 1 ? 18 
HELX_P HELX_P75 75 LEU D 495 ? ASN D 501 ? LEU D 534 ASN D 540 1 ? 7  
HELX_P HELX_P76 76 PRO D 528 ? ILE D 554 ? PRO D 567 ILE D 593 1 ? 27 
HELX_P HELX_P77 77 PRO D 574 ? GLY D 583 ? PRO D 613 GLY D 622 1 ? 10 
HELX_P HELX_P78 78 GLY D 586 ? THR D 596 ? GLY D 625 THR D 635 1 ? 11 
HELX_P HELX_P79 79 SER D 616 ? CYS D 629 ? SER D 655 CYS D 668 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  LEU 12  A . ? LEU 51  A GLY 13  A ? GLY 52  A 1 12.29 
2  GLY 147 A . ? GLY 186 A PRO 148 A ? PRO 187 A 1 2.94  
3  ALA 292 A . ? ALA 331 A ASP 293 A ? ASP 332 A 1 -4.83 
4  GLY 147 B . ? GLY 186 C PRO 148 B ? PRO 187 C 1 -0.40 
5  GLY 403 B . ? GLY 442 C LEU 404 B ? LEU 443 C 1 1.07  
6  GLY 83  C . ? GLY 122 B THR 84  C ? THR 123 B 1 -7.51 
7  GLY 147 C . ? GLY 186 B PRO 148 C ? PRO 187 B 1 1.87  
8  LEU 575 C . ? LEU 614 B SER 576 C ? SER 615 B 1 3.18  
9  GLY 147 D . ? GLY 186 D PRO 148 D ? PRO 187 D 1 -0.44 
10 GLY 585 D . ? GLY 624 D GLY 586 D ? GLY 625 D 1 -4.46 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 8 ? 
D ? 5 ? 
E ? 3 ? 
F ? 6 ? 
G ? 2 ? 
H ? 8 ? 
I ? 5 ? 
J ? 5 ? 
K ? 3 ? 
L ? 6 ? 
M ? 2 ? 
N ? 8 ? 
O ? 5 ? 
P ? 5 ? 
Q ? 3 ? 
R ? 6 ? 
S ? 2 ? 
T ? 8 ? 
U ? 5 ? 
V ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? parallel      
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
H 5 6 ? anti-parallel 
H 6 7 ? anti-parallel 
H 7 8 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
L 5 6 ? parallel      
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
N 4 5 ? anti-parallel 
N 5 6 ? anti-parallel 
N 6 7 ? anti-parallel 
N 7 8 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
P 4 5 ? parallel      
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
R 4 5 ? anti-parallel 
R 5 6 ? parallel      
S 1 2 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
T 3 4 ? anti-parallel 
T 4 5 ? anti-parallel 
T 5 6 ? anti-parallel 
T 6 7 ? anti-parallel 
T 7 8 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
U 4 5 ? parallel      
V 1 2 ? anti-parallel 
V 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 6   ? ASP A 11  ? SER A 45  ASP A 50  
A 2 LYS A 16  ? SER A 21  ? LYS A 55  SER A 60  
A 3 GLY A 30  ? SER A 36  ? GLY A 69  SER A 75  
A 4 THR A 39  ? SER A 47  ? THR A 78  SER A 86  
A 5 THR A 111 ? ALA A 119 ? THR A 150 ALA A 158 
A 6 LEU A 59  ? ARG A 64  ? LEU A 98  ARG A 103 
B 1 ALA A 67  ? ALA A 68  ? ALA A 106 ALA A 107 
B 2 ILE A 73  ? PRO A 74  ? ILE A 112 PRO A 113 
C 1 GLU A 160 ? VAL A 163 ? GLU A 199 VAL A 202 
C 2 GLY A 150 ? ILE A 157 ? GLY A 189 ILE A 196 
C 3 SER A 173 ? ALA A 182 ? SER A 212 ALA A 221 
C 4 GLN A 186 ? ILE A 197 ? GLN A 225 ILE A 236 
C 5 ILE A 515 ? ILE A 522 ? ILE A 554 ILE A 561 
C 6 MET A 504 ? GLY A 510 ? MET A 543 GLY A 549 
C 7 ALA A 468 ? THR A 478 ? ALA A 507 THR A 517 
C 8 ILE A 485 ? THR A 492 ? ILE A 524 THR A 531 
D 1 VAL A 331 ? VAL A 335 ? VAL A 370 VAL A 374 
D 2 GLY A 343 ? ARG A 349 ? GLY A 382 ARG A 388 
D 3 THR A 352 ? ASP A 361 ? THR A 391 ASP A 400 
D 4 THR A 430 ? GLU A 439 ? THR A 469 GLU A 478 
D 5 PHE A 384 ? GLU A 389 ? PHE A 423 GLU A 428 
E 1 VAL A 567 ? GLN A 572 ? VAL A 606 GLN A 611 
E 2 THR A 607 ? ALA A 612 ? THR A 646 ALA A 651 
E 3 THR A 599 ? GLN A 602 ? THR A 638 GLN A 641 
F 1 SER B 6   ? LEU B 12  ? SER C 45  LEU C 51  
F 2 ARG B 15  ? SER B 21  ? ARG C 54  SER C 60  
F 3 GLY B 30  ? SER B 36  ? GLY C 69  SER C 75  
F 4 THR B 39  ? SER B 47  ? THR C 78  SER C 86  
F 5 THR B 111 ? ALA B 119 ? THR C 150 ALA C 158 
F 6 LEU B 59  ? ARG B 64  ? LEU C 98  ARG C 103 
G 1 ALA B 67  ? ALA B 68  ? ALA C 106 ALA C 107 
G 2 ILE B 73  ? PRO B 74  ? ILE C 112 PRO C 113 
H 1 GLU B 160 ? VAL B 163 ? GLU C 199 VAL C 202 
H 2 GLY B 150 ? ILE B 157 ? GLY C 189 ILE C 196 
H 3 LEU B 175 ? ALA B 182 ? LEU C 214 ALA C 221 
H 4 GLN B 186 ? ILE B 197 ? GLN C 225 ILE C 236 
H 5 ILE B 515 ? ILE B 522 ? ILE C 554 ILE C 561 
H 6 MET B 504 ? GLY B 510 ? MET C 543 GLY C 549 
H 7 ALA B 468 ? LYS B 477 ? ALA C 507 LYS C 516 
H 8 ASP B 487 ? THR B 492 ? ASP C 526 THR C 531 
I 1 GLU B 160 ? VAL B 163 ? GLU C 199 VAL C 202 
I 2 GLY B 150 ? ILE B 157 ? GLY C 189 ILE C 196 
I 3 LEU B 175 ? ALA B 182 ? LEU C 214 ALA C 221 
I 4 GLN B 186 ? ILE B 197 ? GLN C 225 ILE C 236 
I 5 ILE B 527 ? PRO B 528 ? ILE C 566 PRO C 567 
J 1 VAL B 331 ? VAL B 335 ? VAL C 370 VAL C 374 
J 2 GLY B 343 ? ARG B 349 ? GLY C 382 ARG C 388 
J 3 THR B 352 ? ASP B 361 ? THR C 391 ASP C 400 
J 4 THR B 430 ? GLU B 439 ? THR C 469 GLU C 478 
J 5 PHE B 384 ? GLU B 389 ? PHE C 423 GLU C 428 
K 1 VAL B 567 ? GLN B 572 ? VAL C 606 GLN C 611 
K 2 THR B 607 ? ALA B 612 ? THR C 646 ALA C 651 
K 3 THR B 599 ? GLN B 602 ? THR C 638 GLN C 641 
L 1 SER C 6   ? ASP C 11  ? SER B 45  ASP B 50  
L 2 LYS C 16  ? SER C 21  ? LYS B 55  SER B 60  
L 3 GLY C 30  ? SER C 36  ? GLY B 69  SER B 75  
L 4 THR C 39  ? SER C 47  ? THR B 78  SER B 86  
L 5 THR C 111 ? ALA C 119 ? THR B 150 ALA B 158 
L 6 LEU C 59  ? ARG C 64  ? LEU B 98  ARG B 103 
M 1 ALA C 67  ? ALA C 68  ? ALA B 106 ALA B 107 
M 2 ILE C 73  ? PRO C 74  ? ILE B 112 PRO B 113 
N 1 GLU C 160 ? VAL C 163 ? GLU B 199 VAL B 202 
N 2 GLY C 150 ? ILE C 157 ? GLY B 189 ILE B 196 
N 3 LEU C 175 ? ALA C 182 ? LEU B 214 ALA B 221 
N 4 GLN C 186 ? ILE C 197 ? GLN B 225 ILE B 236 
N 5 ILE C 515 ? ILE C 522 ? ILE B 554 ILE B 561 
N 6 MET C 504 ? GLY C 510 ? MET B 543 GLY B 549 
N 7 ALA C 468 ? ASP C 479 ? ALA B 507 ASP B 518 
N 8 GLU C 484 ? THR C 492 ? GLU B 523 THR B 531 
O 1 GLU C 160 ? VAL C 163 ? GLU B 199 VAL B 202 
O 2 GLY C 150 ? ILE C 157 ? GLY B 189 ILE B 196 
O 3 LEU C 175 ? ALA C 182 ? LEU B 214 ALA B 221 
O 4 GLN C 186 ? ILE C 197 ? GLN B 225 ILE B 236 
O 5 ILE C 527 ? PRO C 528 ? ILE B 566 PRO B 567 
P 1 VAL C 331 ? VAL C 335 ? VAL B 370 VAL B 374 
P 2 GLY C 343 ? ARG C 349 ? GLY B 382 ARG B 388 
P 3 THR C 352 ? ASP C 361 ? THR B 391 ASP B 400 
P 4 THR C 430 ? GLU C 439 ? THR B 469 GLU B 478 
P 5 PHE C 384 ? GLU C 389 ? PHE B 423 GLU B 428 
Q 1 VAL C 567 ? GLN C 572 ? VAL B 606 GLN B 611 
Q 2 THR C 607 ? ALA C 612 ? THR B 646 ALA B 651 
Q 3 THR C 599 ? GLN C 602 ? THR B 638 GLN B 641 
R 1 SER D 6   ? LEU D 12  ? SER D 45  LEU D 51  
R 2 ARG D 15  ? SER D 21  ? ARG D 54  SER D 60  
R 3 GLY D 30  ? SER D 36  ? GLY D 69  SER D 75  
R 4 THR D 39  ? SER D 47  ? THR D 78  SER D 86  
R 5 THR D 111 ? ALA D 119 ? THR D 150 ALA D 158 
R 6 LEU D 59  ? ARG D 64  ? LEU D 98  ARG D 103 
S 1 ALA D 67  ? ALA D 68  ? ALA D 106 ALA D 107 
S 2 ILE D 73  ? PRO D 74  ? ILE D 112 PRO D 113 
T 1 GLU D 160 ? VAL D 163 ? GLU D 199 VAL D 202 
T 2 GLY D 150 ? ILE D 157 ? GLY D 189 ILE D 196 
T 3 LEU D 175 ? ALA D 182 ? LEU D 214 ALA D 221 
T 4 GLN D 186 ? ILE D 197 ? GLN D 225 ILE D 236 
T 5 ILE D 515 ? ILE D 522 ? ILE D 554 ILE D 561 
T 6 MET D 504 ? GLY D 510 ? MET D 543 GLY D 549 
T 7 ALA D 468 ? LYS D 477 ? ALA D 507 LYS D 516 
T 8 ASP D 487 ? THR D 492 ? ASP D 526 THR D 531 
U 1 VAL D 331 ? VAL D 335 ? VAL D 370 VAL D 374 
U 2 GLY D 343 ? ARG D 349 ? GLY D 382 ARG D 388 
U 3 THR D 352 ? ASP D 361 ? THR D 391 ASP D 400 
U 4 THR D 430 ? GLU D 439 ? THR D 469 GLU D 478 
U 5 PHE D 384 ? GLU D 389 ? PHE D 423 GLU D 428 
V 1 VAL D 567 ? GLN D 572 ? VAL D 606 GLN D 611 
V 2 THR D 607 ? ALA D 612 ? THR D 646 ALA D 651 
V 3 THR D 599 ? GLN D 602 ? THR D 638 GLN D 641 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 10  ? N VAL A 49  O LEU A 17  ? O LEU A 56  
A 2 3 N GLU A 18  ? N GLU A 57  O GLN A 35  ? O GLN A 74  
A 3 4 N VAL A 34  ? N VAL A 73  O VAL A 41  ? O VAL A 80  
A 4 5 N MET A 42  ? N MET A 81  O ASN A 116 ? O ASN A 155 
A 5 6 O VAL A 113 ? O VAL A 152 N ASP A 62  ? N ASP A 101 
B 1 2 N ALA A 68  ? N ALA A 107 O ILE A 73  ? O ILE A 112 
C 1 2 O VAL A 162 ? O VAL A 201 N GLY A 155 ? N GLY A 194 
C 2 3 N GLY A 150 ? N GLY A 189 O GLY A 181 ? O GLY A 220 
C 3 4 N VAL A 178 ? N VAL A 217 O GLU A 191 ? O GLU A 230 
C 4 5 N LEU A 190 ? N LEU A 229 O ALA A 520 ? O ALA A 559 
C 5 6 O ASP A 521 ? O ASP A 560 N ASP A 505 ? N ASP A 544 
C 6 7 O PHE A 506 ? O PHE A 545 N ILE A 472 ? N ILE A 511 
C 7 8 N VAL A 475 ? N VAL A 514 O ARG A 489 ? O ARG A 528 
D 1 2 N SER A 332 ? N SER A 371 O GLN A 348 ? O GLN A 387 
D 2 3 N ALA A 345 ? N ALA A 384 O CYS A 356 ? O CYS A 395 
D 3 4 N GLN A 353 ? N GLN A 392 O GLU A 439 ? O GLU A 478 
D 4 5 O VAL A 433 ? O VAL A 472 N HIS A 387 ? N HIS A 426 
E 1 2 N GLU A 569 ? N GLU A 608 O VAL A 610 ? O VAL A 649 
E 2 3 O PHE A 611 ? O PHE A 650 N THR A 599 ? N THR A 638 
F 1 2 N VAL B 10  ? N VAL C 49  O LEU B 17  ? O LEU C 56  
F 2 3 N GLU B 18  ? N GLU C 57  O GLN B 35  ? O GLN C 74  
F 3 4 N VAL B 34  ? N VAL C 73  O VAL B 41  ? O VAL C 80  
F 4 5 N MET B 42  ? N MET C 81  O ASN B 116 ? O ASN C 155 
F 5 6 O VAL B 113 ? O VAL C 152 N ASP B 62  ? N ASP C 101 
G 1 2 N ALA B 68  ? N ALA C 107 O ILE B 73  ? O ILE C 112 
H 1 2 O VAL B 162 ? O VAL C 201 N GLY B 155 ? N GLY C 194 
H 2 3 N ILE B 154 ? N ILE C 193 O LEU B 177 ? O LEU C 216 
H 3 4 N VAL B 178 ? N VAL C 217 O GLU B 191 ? O GLU C 230 
H 4 5 N ALA B 192 ? N ALA C 231 O LEU B 518 ? O LEU C 557 
H 5 6 O GLN B 519 ? O GLN C 558 N LYS B 507 ? N LYS C 546 
H 6 7 O PHE B 506 ? O PHE C 545 N ILE B 472 ? N ILE C 511 
H 7 8 N LYS B 477 ? N LYS C 516 O ASP B 487 ? O ASP C 526 
I 1 2 O VAL B 162 ? O VAL C 201 N GLY B 155 ? N GLY C 194 
I 2 3 N ILE B 154 ? N ILE C 193 O LEU B 177 ? O LEU C 216 
I 3 4 N VAL B 178 ? N VAL C 217 O GLU B 191 ? O GLU C 230 
I 4 5 N ILE B 187 ? N ILE C 226 O ILE B 527 ? O ILE C 566 
J 1 2 N SER B 332 ? N SER C 371 O GLN B 348 ? O GLN C 387 
J 2 3 N ALA B 345 ? N ALA C 384 O CYS B 356 ? O CYS C 395 
J 3 4 N THR B 359 ? N THR C 398 O ARG B 432 ? O ARG C 471 
J 4 5 O SER B 435 ? O SER C 474 N HIS B 387 ? N HIS C 426 
K 1 2 N VAL B 571 ? N VAL C 610 O PHE B 608 ? O PHE C 647 
K 2 3 O PHE B 611 ? O PHE C 650 N THR B 599 ? N THR C 638 
L 1 2 N VAL C 10  ? N VAL B 49  O LEU C 17  ? O LEU B 56  
L 2 3 N GLU C 18  ? N GLU B 57  O GLN C 35  ? O GLN B 74  
L 3 4 N VAL C 34  ? N VAL B 73  O VAL C 41  ? O VAL B 80  
L 4 5 N MET C 42  ? N MET B 81  O ASN C 116 ? O ASN B 155 
L 5 6 O VAL C 113 ? O VAL B 152 N ASP C 62  ? N ASP B 101 
M 1 2 N ALA C 68  ? N ALA B 107 O ILE C 73  ? O ILE B 112 
N 1 2 O VAL C 162 ? O VAL B 201 N GLY C 155 ? N GLY B 194 
N 2 3 N GLY C 150 ? N GLY B 189 O GLY C 181 ? O GLY B 220 
N 3 4 N VAL C 178 ? N VAL B 217 O GLU C 191 ? O GLU B 230 
N 4 5 N LEU C 190 ? N LEU B 229 O ALA C 520 ? O ALA B 559 
N 5 6 O GLN C 519 ? O GLN B 558 N LYS C 507 ? N LYS B 546 
N 6 7 O PHE C 506 ? O PHE B 545 N ILE C 472 ? N ILE B 511 
N 7 8 N LYS C 477 ? N LYS B 516 O ASP C 487 ? O ASP B 526 
O 1 2 O VAL C 162 ? O VAL B 201 N GLY C 155 ? N GLY B 194 
O 2 3 N GLY C 150 ? N GLY B 189 O GLY C 181 ? O GLY B 220 
O 3 4 N VAL C 178 ? N VAL B 217 O GLU C 191 ? O GLU B 230 
O 4 5 N ILE C 187 ? N ILE B 226 O ILE C 527 ? O ILE B 566 
P 1 2 N GLU C 334 ? N GLU B 373 O LEU C 346 ? O LEU B 385 
P 2 3 N ALA C 345 ? N ALA B 384 O CYS C 356 ? O CYS B 395 
P 3 4 N THR C 357 ? N THR B 396 O THR C 434 ? O THR B 473 
P 4 5 O SER C 435 ? O SER B 474 N HIS C 387 ? N HIS B 426 
Q 1 2 N VAL C 571 ? N VAL B 610 O PHE C 608 ? O PHE B 647 
Q 2 3 O SER C 609 ? O SER B 648 N SER C 601 ? N SER B 640 
R 1 2 N VAL D 8   ? N VAL D 47  O ILE D 19  ? O ILE D 58  
R 2 3 N GLU D 18  ? N GLU D 57  O GLN D 35  ? O GLN D 74  
R 3 4 N VAL D 34  ? N VAL D 73  O VAL D 41  ? O VAL D 80  
R 4 5 N MET D 42  ? N MET D 81  O ASN D 116 ? O ASN D 155 
R 5 6 O VAL D 113 ? O VAL D 152 N ASP D 62  ? N ASP D 101 
S 1 2 N ALA D 68  ? N ALA D 107 O ILE D 73  ? O ILE D 112 
T 1 2 O VAL D 162 ? O VAL D 201 N GLY D 155 ? N GLY D 194 
T 2 3 N GLY D 150 ? N GLY D 189 O GLY D 181 ? O GLY D 220 
T 3 4 N ASN D 176 ? N ASN D 215 O SER D 193 ? O SER D 232 
T 4 5 N ALA D 192 ? N ALA D 231 O LEU D 518 ? O LEU D 557 
T 5 6 O GLN D 519 ? O GLN D 558 N LYS D 507 ? N LYS D 546 
T 6 7 O PHE D 506 ? O PHE D 545 N ILE D 472 ? N ILE D 511 
T 7 8 N GLY D 473 ? N GLY D 512 O LEU D 491 ? O LEU D 530 
U 1 2 N SER D 332 ? N SER D 371 O GLN D 348 ? O GLN D 387 
U 2 3 N ALA D 345 ? N ALA D 384 O CYS D 356 ? O CYS D 395 
U 3 4 N LEU D 355 ? N LEU D 394 O GLU D 436 ? O GLU D 475 
U 4 5 O VAL D 433 ? O VAL D 472 N HIS D 387 ? N HIS D 426 
V 1 2 N VAL D 567 ? N VAL D 606 O ALA D 612 ? O ALA D 651 
V 2 3 O SER D 609 ? O SER D 648 N SER D 601 ? N SER D 640 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CIT A 1'   
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CIT A 670' 
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CIT C 1'   
AC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CIT C 670' 
AC5 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CIT B 1'   
AC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CIT B 670' 
AC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CIT D 1'   
AC8 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CIT D 670' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 HOH M .   ? HOH A 9   . ? 1_555 ? 
2  AC1 10 PHE A 390 ? PHE A 429 . ? 1_555 ? 
3  AC1 10 HIS A 411 ? HIS A 450 . ? 1_555 ? 
4  AC1 10 GLY A 442 ? GLY A 481 . ? 1_555 ? 
5  AC1 10 SER A 443 ? SER A 482 . ? 1_555 ? 
6  AC1 10 SER A 444 ? SER A 483 . ? 1_555 ? 
7  AC1 10 SER A 445 ? SER A 484 . ? 1_555 ? 
8  AC1 10 ASP A 505 ? ASP A 544 . ? 1_555 ? 
9  AC1 10 LYS A 507 ? LYS A 546 . ? 1_555 ? 
10 AC1 10 HOH M .   ? HOH A 673 . ? 1_555 ? 
11 AC2 8  ARG A 93  ? ARG A 132 . ? 1_555 ? 
12 AC2 8  ARG A 407 ? ARG A 446 . ? 1_555 ? 
13 AC2 8  HIS A 411 ? HIS A 450 . ? 1_555 ? 
14 AC2 8  ASP A 499 ? ASP A 538 . ? 1_555 ? 
15 AC2 8  ASP A 505 ? ASP A 544 . ? 1_555 ? 
16 AC2 8  LYS A 507 ? LYS A 546 . ? 1_555 ? 
17 AC2 8  ASP A 521 ? ASP A 560 . ? 1_555 ? 
18 AC2 8  HOH M .   ? HOH A 802 . ? 1_555 ? 
19 AC3 8  ARG B 93  ? ARG C 132 . ? 1_555 ? 
20 AC3 8  ARG B 407 ? ARG C 446 . ? 1_555 ? 
21 AC3 8  HIS B 411 ? HIS C 450 . ? 1_555 ? 
22 AC3 8  ASP B 499 ? ASP C 538 . ? 1_555 ? 
23 AC3 8  ASP B 505 ? ASP C 544 . ? 1_555 ? 
24 AC3 8  LYS B 507 ? LYS C 546 . ? 1_555 ? 
25 AC3 8  ASP B 521 ? ASP C 560 . ? 1_555 ? 
26 AC3 8  HOH N .   ? HOH C 982 . ? 1_555 ? 
27 AC4 12 HOH N .   ? HOH C 24  . ? 1_555 ? 
28 AC4 12 PHE B 390 ? PHE C 429 . ? 1_555 ? 
29 AC4 12 ARG B 407 ? ARG C 446 . ? 1_555 ? 
30 AC4 12 HIS B 411 ? HIS C 450 . ? 1_555 ? 
31 AC4 12 GLY B 442 ? GLY C 481 . ? 1_555 ? 
32 AC4 12 SER B 443 ? SER C 482 . ? 1_555 ? 
33 AC4 12 SER B 444 ? SER C 483 . ? 1_555 ? 
34 AC4 12 SER B 445 ? SER C 484 . ? 1_555 ? 
35 AC4 12 ASP B 505 ? ASP C 544 . ? 1_555 ? 
36 AC4 12 LYS B 507 ? LYS C 546 . ? 1_555 ? 
37 AC4 12 HOH N .   ? HOH C 732 . ? 1_555 ? 
38 AC4 12 HOH N .   ? HOH C 850 . ? 1_555 ? 
39 AC5 12 HOH O .   ? HOH B 12  . ? 1_555 ? 
40 AC5 12 PHE C 390 ? PHE B 429 . ? 1_555 ? 
41 AC5 12 HIS C 411 ? HIS B 450 . ? 1_555 ? 
42 AC5 12 GLY C 442 ? GLY B 481 . ? 1_555 ? 
43 AC5 12 SER C 443 ? SER B 482 . ? 1_555 ? 
44 AC5 12 SER C 444 ? SER B 483 . ? 1_555 ? 
45 AC5 12 SER C 445 ? SER B 484 . ? 1_555 ? 
46 AC5 12 ASP C 505 ? ASP B 544 . ? 1_555 ? 
47 AC5 12 LYS C 507 ? LYS B 546 . ? 1_555 ? 
48 AC5 12 HOH O .   ? HOH B 717 . ? 1_555 ? 
49 AC5 12 HOH O .   ? HOH B 804 . ? 1_555 ? 
50 AC5 12 HOH O .   ? HOH B 908 . ? 1_555 ? 
51 AC6 9  ARG C 93  ? ARG B 132 . ? 1_555 ? 
52 AC6 9  ARG C 407 ? ARG B 446 . ? 1_555 ? 
53 AC6 9  HIS C 411 ? HIS B 450 . ? 1_555 ? 
54 AC6 9  ASP C 499 ? ASP B 538 . ? 1_555 ? 
55 AC6 9  ASP C 505 ? ASP B 544 . ? 1_555 ? 
56 AC6 9  LYS C 507 ? LYS B 546 . ? 1_555 ? 
57 AC6 9  ASP C 521 ? ASP B 560 . ? 1_555 ? 
58 AC6 9  HOH O .   ? HOH B 747 . ? 1_555 ? 
59 AC6 9  HOH O .   ? HOH B 908 . ? 1_555 ? 
60 AC7 8  ARG D 93  ? ARG D 132 . ? 1_555 ? 
61 AC7 8  ARG D 407 ? ARG D 446 . ? 1_555 ? 
62 AC7 8  HIS D 411 ? HIS D 450 . ? 1_555 ? 
63 AC7 8  ASP D 499 ? ASP D 538 . ? 1_555 ? 
64 AC7 8  ASP D 505 ? ASP D 544 . ? 1_555 ? 
65 AC7 8  LYS D 507 ? LYS D 546 . ? 1_555 ? 
66 AC7 8  ASP D 521 ? ASP D 560 . ? 1_555 ? 
67 AC7 8  CIT L .   ? CIT D 670 . ? 1_555 ? 
68 AC8 13 CIT K .   ? CIT D 1   . ? 1_555 ? 
69 AC8 13 PHE D 390 ? PHE D 429 . ? 1_555 ? 
70 AC8 13 ARG D 407 ? ARG D 446 . ? 1_555 ? 
71 AC8 13 HIS D 411 ? HIS D 450 . ? 1_555 ? 
72 AC8 13 GLY D 442 ? GLY D 481 . ? 1_555 ? 
73 AC8 13 SER D 443 ? SER D 482 . ? 1_555 ? 
74 AC8 13 SER D 444 ? SER D 483 . ? 1_555 ? 
75 AC8 13 SER D 445 ? SER D 484 . ? 1_555 ? 
76 AC8 13 ASP D 505 ? ASP D 544 . ? 1_555 ? 
77 AC8 13 LYS D 507 ? LYS D 546 . ? 1_555 ? 
78 AC8 13 HOH P .   ? HOH D 683 . ? 1_555 ? 
79 AC8 13 HOH P .   ? HOH D 735 . ? 1_555 ? 
80 AC8 13 HOH P .   ? HOH D 871 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3U1K 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3U1K 
_atom_sites.fract_transf_matrix[1][1]   0.003451 
_atom_sites.fract_transf_matrix[1][2]   0.001993 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003985 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010778 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . MET A 1 4   ? -30.980  -22.323 -7.076  1.00 49.02  ? 43   MET A N   1 
ATOM   2     C CA  . MET A 1 4   ? -31.709  -23.497 -6.603  1.00 52.33  ? 43   MET A CA  1 
ATOM   3     C C   . MET A 1 4   ? -31.114  -24.098 -5.335  1.00 43.94  ? 43   MET A C   1 
ATOM   4     O O   . MET A 1 4   ? -30.057  -24.733 -5.373  1.00 49.00  ? 43   MET A O   1 
ATOM   5     C CB  . MET A 1 4   ? -31.778  -24.587 -7.677  1.00 44.79  ? 43   MET A CB  1 
ATOM   6     C CG  . MET A 1 4   ? -32.753  -25.707 -7.298  1.00 54.34  ? 43   MET A CG  1 
ATOM   7     S SD  . MET A 1 4   ? -32.420  -27.295 -8.087  1.00 47.67  ? 43   MET A SD  1 
ATOM   8     C CE  . MET A 1 4   ? -30.658  -27.151 -8.286  1.00 42.73  ? 43   MET A CE  1 
ATOM   9     N N   . ALA A 1 5   ? -31.804  -23.913 -4.217  1.00 40.05  ? 44   ALA A N   1 
ATOM   10    C CA  . ALA A 1 5   ? -31.368  -24.485 -2.952  1.00 40.46  ? 44   ALA A CA  1 
ATOM   11    C C   . ALA A 1 5   ? -31.121  -25.990 -3.074  1.00 46.90  ? 44   ALA A C   1 
ATOM   12    O O   . ALA A 1 5   ? -31.977  -26.731 -3.569  1.00 43.89  ? 44   ALA A O   1 
ATOM   13    C CB  . ALA A 1 5   ? -32.385  -24.186 -1.853  1.00 42.41  ? 44   ALA A CB  1 
ATOM   14    N N   . SER A 1 6   ? -29.933  -26.419 -2.646  1.00 38.38  ? 45   SER A N   1 
ATOM   15    C CA  . SER A 1 6   ? -29.563  -27.831 -2.587  1.00 38.39  ? 45   SER A CA  1 
ATOM   16    C C   . SER A 1 6   ? -28.685  -28.063 -1.374  1.00 38.63  ? 45   SER A C   1 
ATOM   17    O O   . SER A 1 6   ? -27.991  -27.151 -0.916  1.00 34.61  ? 45   SER A O   1 
ATOM   18    C CB  . SER A 1 6   ? -28.798  -28.247 -3.833  1.00 37.19  ? 45   SER A CB  1 
ATOM   19    O OG  . SER A 1 6   ? -29.445  -27.768 -4.993  1.00 50.30  ? 45   SER A OG  1 
ATOM   20    N N   . ALA A 1 7   ? -28.702  -29.285 -0.858  1.00 31.11  ? 46   ALA A N   1 
ATOM   21    C CA  . ALA A 1 7   ? -27.932  -29.594 0.341   1.00 37.35  ? 46   ALA A CA  1 
ATOM   22    C C   . ALA A 1 7   ? -27.656  -31.080 0.477   1.00 40.33  ? 46   ALA A C   1 
ATOM   23    O O   . ALA A 1 7   ? -28.487  -31.917 0.111   1.00 37.69  ? 46   ALA A O   1 
ATOM   24    C CB  . ALA A 1 7   ? -28.638  -29.061 1.586   1.00 30.08  ? 46   ALA A CB  1 
ATOM   25    N N   . VAL A 1 8   ? -26.477  -31.406 0.991   1.00 32.90  ? 47   VAL A N   1 
ATOM   26    C CA  . VAL A 1 8   ? -26.134  -32.792 1.251   1.00 28.49  ? 47   VAL A CA  1 
ATOM   27    C C   . VAL A 1 8   ? -25.321  -32.842 2.531   1.00 35.90  ? 47   VAL A C   1 
ATOM   28    O O   . VAL A 1 8   ? -24.633  -31.882 2.885   1.00 37.13  ? 47   VAL A O   1 
ATOM   29    C CB  . VAL A 1 8   ? -25.357  -33.428 0.058   1.00 38.91  ? 47   VAL A CB  1 
ATOM   30    C CG1 . VAL A 1 8   ? -24.010  -32.771 -0.123  1.00 35.68  ? 47   VAL A CG1 1 
ATOM   31    C CG2 . VAL A 1 8   ? -25.183  -34.936 0.245   1.00 42.82  ? 47   VAL A CG2 1 
ATOM   32    N N   . ALA A 1 9   ? -25.423  -33.949 3.249   1.00 30.86  ? 48   ALA A N   1 
ATOM   33    C CA  . ALA A 1 9   ? -24.604  -34.139 4.429   1.00 34.16  ? 48   ALA A CA  1 
ATOM   34    C C   . ALA A 1 9   ? -23.666  -35.307 4.158   1.00 36.84  ? 48   ALA A C   1 
ATOM   35    O O   . ALA A 1 9   ? -24.060  -36.313 3.572   1.00 36.67  ? 48   ALA A O   1 
ATOM   36    C CB  . ALA A 1 9   ? -25.462  -34.390 5.649   1.00 36.70  ? 48   ALA A CB  1 
ATOM   37    N N   . VAL A 1 10  ? -22.416  -35.149 4.563   1.00 34.36  ? 49   VAL A N   1 
ATOM   38    C CA  . VAL A 1 10  ? -21.437  -36.209 4.421   1.00 30.04  ? 49   VAL A CA  1 
ATOM   39    C C   . VAL A 1 10  ? -21.031  -36.615 5.810   1.00 33.99  ? 49   VAL A C   1 
ATOM   40    O O   . VAL A 1 10  ? -20.601  -35.780 6.608   1.00 36.16  ? 49   VAL A O   1 
ATOM   41    C CB  . VAL A 1 10  ? -20.188  -35.764 3.645   1.00 29.41  ? 49   VAL A CB  1 
ATOM   42    C CG1 . VAL A 1 10  ? -19.149  -36.898 3.617   1.00 36.97  ? 49   VAL A CG1 1 
ATOM   43    C CG2 . VAL A 1 10  ? -20.556  -35.349 2.230   1.00 32.63  ? 49   VAL A CG2 1 
ATOM   44    N N   . ASP A 1 11  ? -21.170  -37.902 6.095   1.00 31.73  ? 50   ASP A N   1 
ATOM   45    C CA  . ASP A 1 11  ? -20.822  -38.441 7.397   1.00 42.07  ? 50   ASP A CA  1 
ATOM   46    C C   . ASP A 1 11  ? -19.312  -38.702 7.506   1.00 44.50  ? 50   ASP A C   1 
ATOM   47    O O   . ASP A 1 11  ? -18.699  -39.270 6.604   1.00 48.70  ? 50   ASP A O   1 
ATOM   48    C CB  . ASP A 1 11  ? -21.624  -39.720 7.650   1.00 56.22  ? 50   ASP A CB  1 
ATOM   49    C CG  . ASP A 1 11  ? -21.614  -40.136 9.103   1.00 70.09  ? 50   ASP A CG  1 
ATOM   50    O OD1 . ASP A 1 11  ? -22.007  -39.315 9.962   1.00 71.04  ? 50   ASP A OD1 1 
ATOM   51    O OD2 . ASP A 1 11  ? -21.206  -41.286 9.385   1.00 76.63  ? 50   ASP A OD2 1 
ATOM   52    N N   . LEU A 1 12  ? -18.756  -38.286 8.642   1.00 47.07  ? 51   LEU A N   1 
ATOM   53    C CA  . LEU A 1 12  ? -17.336  -38.347 8.997   1.00 55.46  ? 51   LEU A CA  1 
ATOM   54    C C   . LEU A 1 12  ? -16.640  -39.704 9.034   1.00 66.72  ? 51   LEU A C   1 
ATOM   55    O O   . LEU A 1 12  ? -15.582  -39.841 8.434   1.00 81.16  ? 51   LEU A O   1 
ATOM   56    C CB  . LEU A 1 12  ? -17.170  -37.723 10.382  1.00 54.40  ? 51   LEU A CB  1 
ATOM   57    C CG  . LEU A 1 12  ? -15.851  -37.565 11.126  1.00 60.55  ? 51   LEU A CG  1 
ATOM   58    C CD1 . LEU A 1 12  ? -15.241  -38.921 11.488  1.00 65.63  ? 51   LEU A CD1 1 
ATOM   59    C CD2 . LEU A 1 12  ? -14.925  -36.702 10.286  1.00 69.04  ? 51   LEU A CD2 1 
ATOM   60    N N   . GLY A 1 13  ? -17.192  -40.695 9.740   1.00 71.62  ? 52   GLY A N   1 
ATOM   61    C CA  . GLY A 1 13  ? -18.543  -40.664 10.277  1.00 68.62  ? 52   GLY A CA  1 
ATOM   62    C C   . GLY A 1 13  ? -18.817  -40.017 11.627  1.00 66.85  ? 52   GLY A C   1 
ATOM   63    O O   . GLY A 1 13  ? -19.976  -39.743 11.942  1.00 80.96  ? 52   GLY A O   1 
ATOM   64    N N   . ASN A 1 14  ? -17.784  -39.753 12.421  1.00 56.18  ? 53   ASN A N   1 
ATOM   65    C CA  . ASN A 1 14  ? -17.990  -39.155 13.743  1.00 67.49  ? 53   ASN A CA  1 
ATOM   66    C C   . ASN A 1 14  ? -18.681  -37.782 13.727  1.00 73.01  ? 53   ASN A C   1 
ATOM   67    O O   . ASN A 1 14  ? -19.445  -37.435 14.633  1.00 70.75  ? 53   ASN A O   1 
ATOM   68    C CB  . ASN A 1 14  ? -16.669  -39.078 14.516  1.00 81.30  ? 53   ASN A CB  1 
ATOM   69    C CG  . ASN A 1 14  ? -16.865  -38.662 15.972  1.00 92.21  ? 53   ASN A CG  1 
ATOM   70    O OD1 . ASN A 1 14  ? -18.001  -38.507 16.438  1.00 91.06  ? 53   ASN A OD1 1 
ATOM   71    N ND2 . ASN A 1 14  ? -15.756  -38.484 16.700  1.00 80.19  ? 53   ASN A ND2 1 
ATOM   72    N N   . ARG A 1 15  ? -18.426  -37.007 12.684  1.00 63.23  ? 54   ARG A N   1 
ATOM   73    C CA  . ARG A 1 15  ? -18.997  -35.676 12.579  1.00 59.23  ? 54   ARG A CA  1 
ATOM   74    C C   . ARG A 1 15  ? -19.451  -35.368 11.154  1.00 56.30  ? 54   ARG A C   1 
ATOM   75    O O   . ARG A 1 15  ? -18.784  -35.704 10.189  1.00 57.69  ? 54   ARG A O   1 
ATOM   76    C CB  . ARG A 1 15  ? -17.988  -34.641 13.061  1.00 63.53  ? 54   ARG A CB  1 
ATOM   77    C CG  . ARG A 1 15  ? -18.460  -33.208 12.958  1.00 57.45  ? 54   ARG A CG  1 
ATOM   78    C CD  . ARG A 1 15  ? -17.522  -32.323 13.749  1.00 68.36  ? 54   ARG A CD  1 
ATOM   79    N NE  . ARG A 1 15  ? -17.568  -32.657 15.170  1.00 71.11  ? 54   ARG A NE  1 
ATOM   80    C CZ  . ARG A 1 15  ? -16.891  -32.010 16.113  1.00 67.19  ? 54   ARG A CZ  1 
ATOM   81    N NH1 . ARG A 1 15  ? -16.110  -30.989 15.781  1.00 56.69  ? 54   ARG A NH1 1 
ATOM   82    N NH2 . ARG A 1 15  ? -17.000  -32.379 17.387  1.00 63.26  ? 54   ARG A NH2 1 
ATOM   83    N N   . LYS A 1 16  ? -20.597  -34.721 11.033  1.00 42.29  ? 55   LYS A N   1 
ATOM   84    C CA  . LYS A 1 16  ? -21.221  -34.493 9.742   1.00 36.80  ? 55   LYS A CA  1 
ATOM   85    C C   . LYS A 1 16  ? -20.707  -33.217 9.048   1.00 42.22  ? 55   LYS A C   1 
ATOM   86    O O   . LYS A 1 16  ? -20.519  -32.186 9.681   1.00 40.00  ? 55   LYS A O   1 
ATOM   87    C CB  . LYS A 1 16  ? -22.722  -34.396 9.971   1.00 46.14  ? 55   LYS A CB  1 
ATOM   88    C CG  . LYS A 1 16  ? -23.573  -34.499 8.754   1.00 53.43  ? 55   LYS A CG  1 
ATOM   89    C CD  . LYS A 1 16  ? -24.992  -34.858 9.171   1.00 62.02  ? 55   LYS A CD  1 
ATOM   90    C CE  . LYS A 1 16  ? -25.013  -36.178 9.928   1.00 67.62  ? 55   LYS A CE  1 
ATOM   91    N NZ  . LYS A 1 16  ? -26.386  -36.562 10.376  1.00 67.43  ? 55   LYS A NZ  1 
ATOM   92    N N   . LEU A 1 17  ? -20.483  -33.304 7.741   1.00 29.78  ? 56   LEU A N   1 
ATOM   93    C CA  . LEU A 1 17  ? -20.154  -32.155 6.920   1.00 32.31  ? 56   LEU A CA  1 
ATOM   94    C C   . LEU A 1 17  ? -21.388  -31.746 6.116   1.00 32.15  ? 56   LEU A C   1 
ATOM   95    O O   . LEU A 1 17  ? -21.884  -32.531 5.315   1.00 33.92  ? 56   LEU A O   1 
ATOM   96    C CB  . LEU A 1 17  ? -19.016  -32.528 5.970   1.00 33.26  ? 56   LEU A CB  1 
ATOM   97    C CG  . LEU A 1 17  ? -18.454  -31.394 5.123   1.00 41.79  ? 56   LEU A CG  1 
ATOM   98    C CD1 . LEU A 1 17  ? -17.782  -30.380 6.038   1.00 39.75  ? 56   LEU A CD1 1 
ATOM   99    C CD2 . LEU A 1 17  ? -17.471  -31.923 4.092   1.00 33.44  ? 56   LEU A CD2 1 
ATOM   100   N N   . GLU A 1 18  ? -21.886  -30.530 6.328   1.00 32.64  ? 57   GLU A N   1 
ATOM   101   C CA  . GLU A 1 18  ? -23.114  -30.072 5.656   1.00 34.86  ? 57   GLU A CA  1 
ATOM   102   C C   . GLU A 1 18  ? -22.767  -29.131 4.517   1.00 32.85  ? 57   GLU A C   1 
ATOM   103   O O   . GLU A 1 18  ? -22.221  -28.043 4.736   1.00 34.85  ? 57   GLU A O   1 
ATOM   104   C CB  . GLU A 1 18  ? -24.054  -29.335 6.623   1.00 28.58  ? 57   GLU A CB  1 
ATOM   105   C CG  . GLU A 1 18  ? -24.389  -30.082 7.907   1.00 43.59  ? 57   GLU A CG  1 
ATOM   106   C CD  . GLU A 1 18  ? -25.465  -31.143 7.719   1.00 48.58  ? 57   GLU A CD  1 
ATOM   107   O OE1 . GLU A 1 18  ? -26.076  -31.214 6.623   1.00 47.46  ? 57   GLU A OE1 1 
ATOM   108   O OE2 . GLU A 1 18  ? -25.697  -31.913 8.675   1.00 55.61  ? 57   GLU A OE2 1 
ATOM   109   N N   . ILE A 1 19  ? -23.097  -29.543 3.301   1.00 32.80  ? 58   ILE A N   1 
ATOM   110   C CA  . ILE A 1 19  ? -22.767  -28.764 2.118   1.00 32.78  ? 58   ILE A CA  1 
ATOM   111   C C   . ILE A 1 19  ? -24.036  -28.294 1.418   1.00 37.22  ? 58   ILE A C   1 
ATOM   112   O O   . ILE A 1 19  ? -24.930  -29.092 1.148   1.00 32.00  ? 58   ILE A O   1 
ATOM   113   C CB  . ILE A 1 19  ? -21.953  -29.595 1.126   1.00 33.57  ? 58   ILE A CB  1 
ATOM   114   C CG1 . ILE A 1 19  ? -20.683  -30.116 1.794   1.00 35.95  ? 58   ILE A CG1 1 
ATOM   115   C CG2 . ILE A 1 19  ? -21.650  -28.783 -0.122  1.00 27.58  ? 58   ILE A CG2 1 
ATOM   116   C CD1 . ILE A 1 19  ? -19.933  -31.099 0.944   1.00 33.99  ? 58   ILE A CD1 1 
ATOM   117   N N   . SER A 1 20  ? -24.112  -27.000 1.124   1.00 31.43  ? 59   SER A N   1 
ATOM   118   C CA  . SER A 1 20  ? -25.277  -26.469 0.446   1.00 30.99  ? 59   SER A CA  1 
ATOM   119   C C   . SER A 1 20  ? -24.927  -25.333 -0.484  1.00 32.43  ? 59   SER A C   1 
ATOM   120   O O   . SER A 1 20  ? -23.789  -24.847 -0.518  1.00 29.55  ? 59   SER A O   1 
ATOM   121   C CB  . SER A 1 20  ? -26.332  -26.004 1.455   1.00 30.27  ? 59   SER A CB  1 
ATOM   122   O OG  . SER A 1 20  ? -25.849  -24.909 2.209   1.00 31.94  ? 59   SER A OG  1 
ATOM   123   N N   . SER A 1 21  ? -25.934  -24.912 -1.239  1.00 24.29  ? 60   SER A N   1 
ATOM   124   C CA  . SER A 1 21  ? -25.789  -23.842 -2.195  1.00 28.43  ? 60   SER A CA  1 
ATOM   125   C C   . SER A 1 21  ? -27.165  -23.399 -2.648  1.00 33.02  ? 60   SER A C   1 
ATOM   126   O O   . SER A 1 21  ? -28.154  -24.127 -2.480  1.00 33.56  ? 60   SER A O   1 
ATOM   127   C CB  . SER A 1 21  ? -24.997  -24.330 -3.406  1.00 26.23  ? 60   SER A CB  1 
ATOM   128   O OG  . SER A 1 21  ? -24.718  -23.268 -4.301  1.00 29.76  ? 60   SER A OG  1 
ATOM   129   N N   . GLY A 1 22  ? -27.223  -22.213 -3.242  1.00 30.09  ? 61   GLY A N   1 
ATOM   130   C CA  . GLY A 1 22  ? -28.435  -21.762 -3.885  1.00 32.93  ? 61   GLY A CA  1 
ATOM   131   C C   . GLY A 1 22  ? -29.245  -20.737 -3.119  1.00 34.67  ? 61   GLY A C   1 
ATOM   132   O O   . GLY A 1 22  ? -30.278  -20.302 -3.608  1.00 32.73  ? 61   GLY A O   1 
ATOM   133   N N   . LYS A 1 23  ? -28.792  -20.350 -1.928  1.00 28.53  ? 62   LYS A N   1 
ATOM   134   C CA  . LYS A 1 23  ? -29.475  -19.306 -1.151  1.00 28.88  ? 62   LYS A CA  1 
ATOM   135   C C   . LYS A 1 23  ? -28.700  -17.987 -1.081  1.00 31.54  ? 62   LYS A C   1 
ATOM   136   O O   . LYS A 1 23  ? -29.282  -16.901 -1.101  1.00 35.32  ? 62   LYS A O   1 
ATOM   137   C CB  . LYS A 1 23  ? -29.762  -19.785 0.270   1.00 29.29  ? 62   LYS A CB  1 
ATOM   138   C CG  . LYS A 1 23  ? -30.858  -20.835 0.376   1.00 53.54  ? 62   LYS A CG  1 
ATOM   139   C CD  . LYS A 1 23  ? -30.982  -21.335 1.811   1.00 51.47  ? 62   LYS A CD  1 
ATOM   140   C CE  . LYS A 1 23  ? -32.316  -22.030 2.043   1.00 69.94  ? 62   LYS A CE  1 
ATOM   141   N NZ  . LYS A 1 23  ? -32.492  -23.258 1.206   1.00 70.89  ? 62   LYS A NZ  1 
ATOM   142   N N   . LEU A 1 24  ? -27.382  -18.088 -1.000  1.00 23.49  ? 63   LEU A N   1 
ATOM   143   C CA  . LEU A 1 24  ? -26.549  -16.925 -0.736  1.00 29.22  ? 63   LEU A CA  1 
ATOM   144   C C   . LEU A 1 24  ? -25.683  -16.548 -1.944  1.00 32.42  ? 63   LEU A C   1 
ATOM   145   O O   . LEU A 1 24  ? -25.195  -17.428 -2.664  1.00 27.38  ? 63   LEU A O   1 
ATOM   146   C CB  . LEU A 1 24  ? -25.669  -17.234 0.486   1.00 31.62  ? 63   LEU A CB  1 
ATOM   147   C CG  . LEU A 1 24  ? -26.102  -16.749 1.878   1.00 39.37  ? 63   LEU A CG  1 
ATOM   148   C CD1 . LEU A 1 24  ? -27.605  -16.506 2.011   1.00 33.51  ? 63   LEU A CD1 1 
ATOM   149   C CD2 . LEU A 1 24  ? -25.594  -17.673 2.973   1.00 31.95  ? 63   LEU A CD2 1 
ATOM   150   N N   . ALA A 1 25  ? -25.499  -15.244 -2.163  1.00 25.62  ? 64   ALA A N   1 
ATOM   151   C CA  . ALA A 1 25  ? -24.578  -14.738 -3.188  1.00 27.64  ? 64   ALA A CA  1 
ATOM   152   C C   . ALA A 1 25  ? -24.798  -15.389 -4.546  1.00 32.45  ? 64   ALA A C   1 
ATOM   153   O O   . ALA A 1 25  ? -23.860  -15.893 -5.172  1.00 25.60  ? 64   ALA A O   1 
ATOM   154   C CB  . ALA A 1 25  ? -23.108  -14.911 -2.751  1.00 21.56  ? 64   ALA A CB  1 
ATOM   155   N N   . ARG A 1 26  ? -26.040  -15.352 -5.007  1.00 26.93  ? 65   ARG A N   1 
ATOM   156   C CA  . ARG A 1 26  ? -26.435  -16.089 -6.203  1.00 24.04  ? 65   ARG A CA  1 
ATOM   157   C C   . ARG A 1 26  ? -26.032  -15.444 -7.529  1.00 28.28  ? 65   ARG A C   1 
ATOM   158   O O   . ARG A 1 26  ? -26.233  -16.044 -8.576  1.00 27.99  ? 65   ARG A O   1 
ATOM   159   C CB  . ARG A 1 26  ? -27.947  -16.383 -6.159  1.00 25.96  ? 65   ARG A CB  1 
ATOM   160   C CG  . ARG A 1 26  ? -28.331  -17.331 -5.019  1.00 24.09  ? 65   ARG A CG  1 
ATOM   161   C CD  . ARG A 1 26  ? -29.825  -17.231 -4.684  1.00 32.78  ? 65   ARG A CD  1 
ATOM   162   N NE  . ARG A 1 26  ? -30.186  -15.862 -4.318  1.00 29.64  ? 65   ARG A NE  1 
ATOM   163   C CZ  . ARG A 1 26  ? -31.413  -15.470 -3.983  1.00 38.75  ? 65   ARG A CZ  1 
ATOM   164   N NH1 . ARG A 1 26  ? -32.413  -16.348 -3.973  1.00 29.60  ? 65   ARG A NH1 1 
ATOM   165   N NH2 . ARG A 1 26  ? -31.639  -14.196 -3.661  1.00 28.37  ? 65   ARG A NH2 1 
ATOM   166   N N   . PHE A 1 27  ? -25.478  -14.229 -7.491  1.00 27.32  ? 66   PHE A N   1 
ATOM   167   C CA  . PHE A 1 27  ? -24.919  -13.618 -8.693  1.00 26.37  ? 66   PHE A CA  1 
ATOM   168   C C   . PHE A 1 27  ? -23.572  -14.245 -9.090  1.00 31.55  ? 66   PHE A C   1 
ATOM   169   O O   . PHE A 1 27  ? -23.216  -14.242 -10.265 1.00 30.40  ? 66   PHE A O   1 
ATOM   170   C CB  . PHE A 1 27  ? -24.743  -12.109 -8.530  1.00 26.28  ? 66   PHE A CB  1 
ATOM   171   C CG  . PHE A 1 27  ? -26.010  -11.307 -8.731  1.00 31.27  ? 66   PHE A CG  1 
ATOM   172   C CD1 . PHE A 1 27  ? -26.832  -11.530 -9.830  1.00 33.66  ? 66   PHE A CD1 1 
ATOM   173   C CD2 . PHE A 1 27  ? -26.368  -10.309 -7.827  1.00 29.63  ? 66   PHE A CD2 1 
ATOM   174   C CE1 . PHE A 1 27  ? -28.003  -10.774 -10.020 1.00 40.68  ? 66   PHE A CE1 1 
ATOM   175   C CE2 . PHE A 1 27  ? -27.544  -9.540  -8.007  1.00 28.96  ? 66   PHE A CE2 1 
ATOM   176   C CZ  . PHE A 1 27  ? -28.354  -9.774  -9.108  1.00 30.20  ? 66   PHE A CZ  1 
ATOM   177   N N   . ALA A 1 28  ? -22.819  -14.769 -8.122  1.00 28.74  ? 67   ALA A N   1 
ATOM   178   C CA  . ALA A 1 28  ? -21.493  -15.334 -8.420  1.00 28.33  ? 67   ALA A CA  1 
ATOM   179   C C   . ALA A 1 28  ? -21.579  -16.533 -9.362  1.00 24.97  ? 67   ALA A C   1 
ATOM   180   O O   . ALA A 1 28  ? -22.532  -17.307 -9.297  1.00 29.31  ? 67   ALA A O   1 
ATOM   181   C CB  . ALA A 1 28  ? -20.759  -15.732 -7.131  1.00 22.79  ? 67   ALA A CB  1 
ATOM   182   N N   . ASP A 1 29  ? -20.583  -16.687 -10.230 1.00 26.96  ? 68   ASP A N   1 
ATOM   183   C CA  . ASP A 1 29  ? -20.503  -17.870 -11.085 1.00 29.35  ? 68   ASP A CA  1 
ATOM   184   C C   . ASP A 1 29  ? -20.734  -19.149 -10.274 1.00 28.85  ? 68   ASP A C   1 
ATOM   185   O O   . ASP A 1 29  ? -21.484  -20.037 -10.693 1.00 24.86  ? 68   ASP A O   1 
ATOM   186   C CB  . ASP A 1 29  ? -19.161  -17.919 -11.821 1.00 26.61  ? 68   ASP A CB  1 
ATOM   187   C CG  . ASP A 1 29  ? -19.054  -16.861 -12.886 1.00 28.89  ? 68   ASP A CG  1 
ATOM   188   O OD1 . ASP A 1 29  ? -20.111  -16.468 -13.432 1.00 29.80  ? 68   ASP A OD1 1 
ATOM   189   O OD2 . ASP A 1 29  ? -17.925  -16.417 -13.173 1.00 35.85  ? 68   ASP A OD2 1 
ATOM   190   N N   . GLY A 1 30  ? -20.108  -19.227 -9.105  1.00 25.09  ? 69   GLY A N   1 
ATOM   191   C CA  . GLY A 1 30  ? -20.368  -20.318 -8.181  1.00 22.03  ? 69   GLY A CA  1 
ATOM   192   C C   . GLY A 1 30  ? -20.366  -19.844 -6.738  1.00 24.61  ? 69   GLY A C   1 
ATOM   193   O O   . GLY A 1 30  ? -19.713  -18.857 -6.396  1.00 29.30  ? 69   GLY A O   1 
ATOM   194   N N   . SER A 1 31  ? -21.082  -20.562 -5.883  1.00 24.46  ? 70   SER A N   1 
ATOM   195   C CA  . SER A 1 31  ? -21.159  -20.225 -4.473  1.00 24.10  ? 70   SER A CA  1 
ATOM   196   C C   . SER A 1 31  ? -21.526  -21.485 -3.727  1.00 25.61  ? 70   SER A C   1 
ATOM   197   O O   . SER A 1 31  ? -22.157  -22.379 -4.276  1.00 32.27  ? 70   SER A O   1 
ATOM   198   C CB  . SER A 1 31  ? -22.237  -19.157 -4.219  1.00 28.99  ? 70   SER A CB  1 
ATOM   199   O OG  . SER A 1 31  ? -22.284  -18.805 -2.845  1.00 33.23  ? 70   SER A OG  1 
ATOM   200   N N   . ALA A 1 32  ? -21.129  -21.557 -2.468  1.00 27.01  ? 71   ALA A N   1 
ATOM   201   C CA  . ALA A 1 32  ? -21.407  -22.732 -1.661  1.00 24.89  ? 71   ALA A CA  1 
ATOM   202   C C   . ALA A 1 32  ? -21.257  -22.353 -0.206  1.00 27.57  ? 71   ALA A C   1 
ATOM   203   O O   . ALA A 1 32  ? -20.503  -21.421 0.138   1.00 24.64  ? 71   ALA A O   1 
ATOM   204   C CB  . ALA A 1 32  ? -20.426  -23.871 -2.012  1.00 26.44  ? 71   ALA A CB  1 
ATOM   205   N N   . VAL A 1 33  ? -21.986  -23.048 0.651   1.00 21.37  ? 72   VAL A N   1 
ATOM   206   C CA  . VAL A 1 33  ? -21.670  -22.987 2.061   1.00 23.69  ? 72   VAL A CA  1 
ATOM   207   C C   . VAL A 1 33  ? -21.434  -24.380 2.637   1.00 28.68  ? 72   VAL A C   1 
ATOM   208   O O   . VAL A 1 33  ? -22.089  -25.371 2.255   1.00 26.34  ? 72   VAL A O   1 
ATOM   209   C CB  . VAL A 1 33  ? -22.642  -22.087 2.909   1.00 35.66  ? 72   VAL A CB  1 
ATOM   210   C CG1 . VAL A 1 33  ? -23.740  -21.508 2.067   1.00 27.82  ? 72   VAL A CG1 1 
ATOM   211   C CG2 . VAL A 1 33  ? -23.173  -22.817 4.141   1.00 29.62  ? 72   VAL A CG2 1 
ATOM   212   N N   . VAL A 1 34  ? -20.436  -24.446 3.512   1.00 22.91  ? 73   VAL A N   1 
ATOM   213   C CA  . VAL A 1 34  ? -20.033  -25.692 4.128   1.00 26.50  ? 73   VAL A CA  1 
ATOM   214   C C   . VAL A 1 34  ? -20.037  -25.468 5.622   1.00 29.88  ? 73   VAL A C   1 
ATOM   215   O O   . VAL A 1 34  ? -19.487  -24.479 6.117   1.00 27.52  ? 73   VAL A O   1 
ATOM   216   C CB  . VAL A 1 34  ? -18.623  -26.118 3.647   1.00 25.68  ? 73   VAL A CB  1 
ATOM   217   C CG1 . VAL A 1 34  ? -18.252  -27.471 4.200   1.00 24.97  ? 73   VAL A CG1 1 
ATOM   218   C CG2 . VAL A 1 34  ? -18.594  -26.144 2.124   1.00 25.16  ? 73   VAL A CG2 1 
ATOM   219   N N   . GLN A 1 35  ? -20.694  -26.371 6.337   1.00 23.73  ? 74   GLN A N   1 
ATOM   220   C CA  . GLN A 1 35  ? -20.830  -26.236 7.775   1.00 24.79  ? 74   GLN A CA  1 
ATOM   221   C C   . GLN A 1 35  ? -20.479  -27.534 8.490   1.00 26.38  ? 74   GLN A C   1 
ATOM   222   O O   . GLN A 1 35  ? -20.745  -28.625 7.985   1.00 27.99  ? 74   GLN A O   1 
ATOM   223   C CB  . GLN A 1 35  ? -22.265  -25.806 8.118   1.00 23.44  ? 74   GLN A CB  1 
ATOM   224   C CG  . GLN A 1 35  ? -22.543  -25.699 9.604   1.00 28.23  ? 74   GLN A CG  1 
ATOM   225   C CD  . GLN A 1 35  ? -23.930  -25.117 9.884   1.00 45.55  ? 74   GLN A CD  1 
ATOM   226   O OE1 . GLN A 1 35  ? -24.542  -24.490 9.008   1.00 36.89  ? 74   GLN A OE1 1 
ATOM   227   N NE2 . GLN A 1 35  ? -24.435  -25.333 11.096  1.00 38.11  ? 74   GLN A NE2 1 
ATOM   228   N N   . SER A 1 36  ? -19.849  -27.400 9.651   1.00 25.85  ? 75   SER A N   1 
ATOM   229   C CA  . SER A 1 36  ? -19.630  -28.518 10.551  1.00 27.79  ? 75   SER A CA  1 
ATOM   230   C C   . SER A 1 36  ? -19.873  -27.990 11.952  1.00 25.34  ? 75   SER A C   1 
ATOM   231   O O   . SER A 1 36  ? -19.312  -26.961 12.334  1.00 26.20  ? 75   SER A O   1 
ATOM   232   C CB  . SER A 1 36  ? -18.196  -29.048 10.432  1.00 30.60  ? 75   SER A CB  1 
ATOM   233   O OG  . SER A 1 36  ? -18.114  -30.347 10.974  1.00 40.99  ? 75   SER A OG  1 
ATOM   234   N N   . GLY A 1 37  ? -20.700  -28.687 12.724  1.00 25.44  ? 76   GLY A N   1 
ATOM   235   C CA  . GLY A 1 37  ? -21.128  -28.171 14.010  1.00 29.99  ? 76   GLY A CA  1 
ATOM   236   C C   . GLY A 1 37  ? -21.769  -26.816 13.765  1.00 24.78  ? 76   GLY A C   1 
ATOM   237   O O   . GLY A 1 37  ? -22.612  -26.697 12.891  1.00 24.97  ? 76   GLY A O   1 
ATOM   238   N N   . ASP A 1 38  ? -21.354  -25.793 14.505  1.00 26.65  ? 77   ASP A N   1 
ATOM   239   C CA  . ASP A 1 38  ? -21.909  -24.453 14.313  1.00 22.82  ? 77   ASP A CA  1 
ATOM   240   C C   . ASP A 1 38  ? -20.922  -23.507 13.623  1.00 29.32  ? 77   ASP A C   1 
ATOM   241   O O   . ASP A 1 38  ? -21.053  -22.282 13.711  1.00 25.41  ? 77   ASP A O   1 
ATOM   242   C CB  . ASP A 1 38  ? -22.373  -23.877 15.647  1.00 28.80  ? 77   ASP A CB  1 
ATOM   243   C CG  . ASP A 1 38  ? -23.469  -24.710 16.284  1.00 33.09  ? 77   ASP A CG  1 
ATOM   244   O OD1 . ASP A 1 38  ? -24.362  -25.168 15.546  1.00 29.58  ? 77   ASP A OD1 1 
ATOM   245   O OD2 . ASP A 1 38  ? -23.428  -24.912 17.512  1.00 43.31  ? 77   ASP A OD2 1 
ATOM   246   N N   . THR A 1 39  ? -19.938  -24.073 12.925  1.00 26.24  ? 78   THR A N   1 
ATOM   247   C CA  . THR A 1 39  ? -19.073  -23.256 12.070  1.00 23.67  ? 78   THR A CA  1 
ATOM   248   C C   . THR A 1 39  ? -19.560  -23.342 10.638  1.00 25.11  ? 78   THR A C   1 
ATOM   249   O O   . THR A 1 39  ? -19.820  -24.432 10.143  1.00 23.32  ? 78   THR A O   1 
ATOM   250   C CB  . THR A 1 39  ? -17.605  -23.701 12.148  1.00 23.17  ? 78   THR A CB  1 
ATOM   251   O OG1 . THR A 1 39  ? -17.148  -23.531 13.494  1.00 21.95  ? 78   THR A OG1 1 
ATOM   252   C CG2 . THR A 1 39  ? -16.727  -22.877 11.182  1.00 24.42  ? 78   THR A CG2 1 
ATOM   253   N N   . ALA A 1 40  ? -19.709  -22.192 9.984   1.00 22.69  ? 79   ALA A N   1 
ATOM   254   C CA  . ALA A 1 40  ? -20.194  -22.168 8.605   1.00 28.04  ? 79   ALA A CA  1 
ATOM   255   C C   . ALA A 1 40  ? -19.389  -21.216 7.737   1.00 23.80  ? 79   ALA A C   1 
ATOM   256   O O   . ALA A 1 40  ? -19.132  -20.067 8.106   1.00 23.38  ? 79   ALA A O   1 
ATOM   257   C CB  . ALA A 1 40  ? -21.694  -21.822 8.541   1.00 24.71  ? 79   ALA A CB  1 
ATOM   258   N N   . VAL A 1 41  ? -18.988  -21.715 6.580   1.00 29.47  ? 80   VAL A N   1 
ATOM   259   C CA  . VAL A 1 41  ? -18.183  -20.941 5.661   1.00 24.65  ? 80   VAL A CA  1 
ATOM   260   C C   . VAL A 1 41  ? -18.840  -20.877 4.288   1.00 25.36  ? 80   VAL A C   1 
ATOM   261   O O   . VAL A 1 41  ? -19.299  -21.886 3.755   1.00 27.99  ? 80   VAL A O   1 
ATOM   262   C CB  . VAL A 1 41  ? -16.768  -21.537 5.549   1.00 28.75  ? 80   VAL A CB  1 
ATOM   263   C CG1 . VAL A 1 41  ? -15.930  -20.737 4.572   1.00 32.30  ? 80   VAL A CG1 1 
ATOM   264   C CG2 . VAL A 1 41  ? -16.093  -21.575 6.929   1.00 23.09  ? 80   VAL A CG2 1 
ATOM   265   N N   . MET A 1 42  ? -18.891  -19.680 3.721   1.00 24.88  ? 81   MET A N   1 
ATOM   266   C CA  . MET A 1 42  ? -19.335  -19.514 2.348   1.00 26.18  ? 81   MET A CA  1 
ATOM   267   C C   . MET A 1 42  ? -18.126  -19.261 1.472   1.00 24.85  ? 81   MET A C   1 
ATOM   268   O O   . MET A 1 42  ? -17.232  -18.496 1.843   1.00 22.84  ? 81   MET A O   1 
ATOM   269   C CB  . MET A 1 42  ? -20.276  -18.315 2.231   1.00 23.07  ? 81   MET A CB  1 
ATOM   270   C CG  . MET A 1 42  ? -20.923  -18.156 0.865   1.00 27.50  ? 81   MET A CG  1 
ATOM   271   S SD  . MET A 1 42  ? -22.050  -16.727 0.826   1.00 31.71  ? 81   MET A SD  1 
ATOM   272   C CE  . MET A 1 42  ? -20.850  -15.404 0.799   1.00 26.80  ? 81   MET A CE  1 
ATOM   273   N N   . VAL A 1 43  ? -18.119  -19.871 0.295   1.00 24.19  ? 82   VAL A N   1 
ATOM   274   C CA  . VAL A 1 43  ? -17.055  -19.637 -0.653  1.00 26.84  ? 82   VAL A CA  1 
ATOM   275   C C   . VAL A 1 43  ? -17.658  -19.276 -1.998  1.00 26.74  ? 82   VAL A C   1 
ATOM   276   O O   . VAL A 1 43  ? -18.637  -19.879 -2.435  1.00 24.00  ? 82   VAL A O   1 
ATOM   277   C CB  . VAL A 1 43  ? -16.110  -20.866 -0.790  1.00 23.36  ? 82   VAL A CB  1 
ATOM   278   C CG1 . VAL A 1 43  ? -15.020  -20.565 -1.792  1.00 22.97  ? 82   VAL A CG1 1 
ATOM   279   C CG2 . VAL A 1 43  ? -15.463  -21.187 0.544   1.00 23.34  ? 82   VAL A CG2 1 
ATOM   280   N N   . THR A 1 44  ? -17.087  -18.278 -2.655  1.00 21.39  ? 83   THR A N   1 
ATOM   281   C CA  . THR A 1 44  ? -17.568  -17.923 -3.979  1.00 22.06  ? 83   THR A CA  1 
ATOM   282   C C   . THR A 1 44  ? -16.459  -18.114 -5.010  1.00 27.96  ? 83   THR A C   1 
ATOM   283   O O   . THR A 1 44  ? -15.273  -18.118 -4.671  1.00 25.79  ? 83   THR A O   1 
ATOM   284   C CB  . THR A 1 44  ? -18.074  -16.436 -4.038  1.00 24.76  ? 83   THR A CB  1 
ATOM   285   O OG1 . THR A 1 44  ? -17.022  -15.551 -3.629  1.00 22.88  ? 83   THR A OG1 1 
ATOM   286   C CG2 . THR A 1 44  ? -19.264  -16.226 -3.111  1.00 21.45  ? 83   THR A CG2 1 
ATOM   287   N N   . ALA A 1 45  ? -16.860  -18.257 -6.267  1.00 22.58  ? 84   ALA A N   1 
ATOM   288   C CA  . ALA A 1 45  ? -15.927  -18.359 -7.375  1.00 23.94  ? 84   ALA A CA  1 
ATOM   289   C C   . ALA A 1 45  ? -16.430  -17.495 -8.521  1.00 28.74  ? 84   ALA A C   1 
ATOM   290   O O   . ALA A 1 45  ? -17.586  -17.599 -8.935  1.00 27.73  ? 84   ALA A O   1 
ATOM   291   C CB  . ALA A 1 45  ? -15.794  -19.809 -7.821  1.00 26.66  ? 84   ALA A CB  1 
ATOM   292   N N   . VAL A 1 46  ? -15.553  -16.637 -9.029  1.00 28.78  ? 85   VAL A N   1 
ATOM   293   C CA  . VAL A 1 46  ? -15.878  -15.768 -10.146 1.00 29.17  ? 85   VAL A CA  1 
ATOM   294   C C   . VAL A 1 46  ? -14.762  -15.870 -11.179 1.00 26.21  ? 85   VAL A C   1 
ATOM   295   O O   . VAL A 1 46  ? -13.586  -15.803 -10.830 1.00 27.50  ? 85   VAL A O   1 
ATOM   296   C CB  . VAL A 1 46  ? -16.013  -14.297 -9.686  1.00 29.05  ? 85   VAL A CB  1 
ATOM   297   C CG1 . VAL A 1 46  ? -16.285  -13.387 -10.874 1.00 33.34  ? 85   VAL A CG1 1 
ATOM   298   C CG2 . VAL A 1 46  ? -17.131  -14.156 -8.649  1.00 20.06  ? 85   VAL A CG2 1 
ATOM   299   N N   . SER A 1 47  ? -15.118  -16.056 -12.444 1.00 26.26  ? 86   SER A N   1 
ATOM   300   C CA  . SER A 1 47  ? -14.097  -16.167 -13.490 1.00 26.62  ? 86   SER A CA  1 
ATOM   301   C C   . SER A 1 47  ? -14.552  -15.401 -14.731 1.00 30.25  ? 86   SER A C   1 
ATOM   302   O O   . SER A 1 47  ? -15.643  -15.647 -15.263 1.00 29.94  ? 86   SER A O   1 
ATOM   303   C CB  . SER A 1 47  ? -13.847  -17.650 -13.813 1.00 32.91  ? 86   SER A CB  1 
ATOM   304   O OG  . SER A 1 47  ? -12.775  -17.853 -14.721 1.00 30.27  ? 86   SER A OG  1 
ATOM   305   N N   . LYS A 1 48  ? -13.731  -14.460 -15.179 1.00 26.91  ? 87   LYS A N   1 
ATOM   306   C CA  . LYS A 1 48  ? -14.094  -13.618 -16.319 1.00 36.37  ? 87   LYS A CA  1 
ATOM   307   C C   . LYS A 1 48  ? -14.182  -14.417 -17.618 1.00 34.66  ? 87   LYS A C   1 
ATOM   308   O O   . LYS A 1 48  ? -13.571  -15.475 -17.754 1.00 32.64  ? 87   LYS A O   1 
ATOM   309   C CB  . LYS A 1 48  ? -13.106  -12.458 -16.484 1.00 30.20  ? 87   LYS A CB  1 
ATOM   310   C CG  . LYS A 1 48  ? -12.910  -11.602 -15.235 1.00 37.41  ? 87   LYS A CG  1 
ATOM   311   C CD  . LYS A 1 48  ? -13.857  -10.404 -15.197 1.00 51.56  ? 87   LYS A CD  1 
ATOM   312   C CE  . LYS A 1 48  ? -15.315  -10.840 -15.273 1.00 61.79  ? 87   LYS A CE  1 
ATOM   313   N NZ  . LYS A 1 48  ? -16.276  -9.705  -15.126 1.00 60.37  ? 87   LYS A NZ  1 
ATOM   314   N N   . THR A 1 49  ? -14.938  -13.894 -18.574 1.00 31.73  ? 88   THR A N   1 
ATOM   315   C CA  . THR A 1 49  ? -15.166  -14.590 -19.832 1.00 35.43  ? 88   THR A CA  1 
ATOM   316   C C   . THR A 1 49  ? -14.219  -14.078 -20.907 1.00 38.17  ? 88   THR A C   1 
ATOM   317   O O   . THR A 1 49  ? -14.041  -14.715 -21.940 1.00 41.15  ? 88   THR A O   1 
ATOM   318   C CB  . THR A 1 49  ? -16.609  -14.383 -20.315 1.00 43.95  ? 88   THR A CB  1 
ATOM   319   O OG1 . THR A 1 49  ? -16.863  -12.979 -20.445 1.00 39.20  ? 88   THR A OG1 1 
ATOM   320   C CG2 . THR A 1 49  ? -17.589  -14.970 -19.318 1.00 40.16  ? 88   THR A CG2 1 
ATOM   321   N N   . LYS A 1 50  ? -13.622  -12.916 -20.657 1.00 42.15  ? 89   LYS A N   1 
ATOM   322   C CA  . LYS A 1 50  ? -12.653  -12.326 -21.574 1.00 39.12  ? 89   LYS A CA  1 
ATOM   323   C C   . LYS A 1 50  ? -11.240  -12.721 -21.164 1.00 38.97  ? 89   LYS A C   1 
ATOM   324   O O   . LYS A 1 50  ? -10.904  -12.683 -19.986 1.00 41.06  ? 89   LYS A O   1 
ATOM   325   C CB  . LYS A 1 50  ? -12.785  -10.806 -21.568 1.00 42.99  ? 89   LYS A CB  1 
ATOM   326   C CG  . LYS A 1 50  ? -14.123  -10.311 -21.020 1.00 62.11  ? 89   LYS A CG  1 
ATOM   327   C CD  . LYS A 1 50  ? -14.198  -10.391 -19.478 1.00 47.72  ? 89   LYS A CD  1 
ATOM   328   C CE  . LYS A 1 50  ? -15.620  -10.149 -18.983 1.00 55.21  ? 89   LYS A CE  1 
ATOM   329   N NZ  . LYS A 1 50  ? -16.296  -9.050  -19.757 1.00 67.35  ? 89   LYS A NZ  1 
ATOM   330   N N   . PRO A 1 51  ? -10.400  -13.102 -22.140 1.00 44.14  ? 90   PRO A N   1 
ATOM   331   C CA  . PRO A 1 51  ? -9.040   -13.555 -21.830 1.00 48.27  ? 90   PRO A CA  1 
ATOM   332   C C   . PRO A 1 51  ? -8.254   -12.511 -21.061 1.00 43.78  ? 90   PRO A C   1 
ATOM   333   O O   . PRO A 1 51  ? -8.438   -11.310 -21.259 1.00 36.69  ? 90   PRO A O   1 
ATOM   334   C CB  . PRO A 1 51  ? -8.414   -13.759 -23.212 1.00 42.49  ? 90   PRO A CB  1 
ATOM   335   C CG  . PRO A 1 51  ? -9.580   -14.059 -24.096 1.00 51.45  ? 90   PRO A CG  1 
ATOM   336   C CD  . PRO A 1 51  ? -10.685  -13.172 -23.583 1.00 44.83  ? 90   PRO A CD  1 
ATOM   337   N N   . SER A 1 52  ? -7.378   -12.981 -20.185 1.00 43.47  ? 91   SER A N   1 
ATOM   338   C CA  . SER A 1 52  ? -6.511   -12.098 -19.433 1.00 48.69  ? 91   SER A CA  1 
ATOM   339   C C   . SER A 1 52  ? -5.387   -11.580 -20.322 1.00 56.97  ? 91   SER A C   1 
ATOM   340   O O   . SER A 1 52  ? -4.873   -12.317 -21.163 1.00 56.36  ? 91   SER A O   1 
ATOM   341   C CB  . SER A 1 52  ? -5.916   -12.844 -18.242 1.00 48.79  ? 91   SER A CB  1 
ATOM   342   O OG  . SER A 1 52  ? -4.979   -12.025 -17.569 1.00 54.66  ? 91   SER A OG  1 
ATOM   343   N N   . PRO A 1 53  ? -5.007   -10.304 -20.143 1.00 59.33  ? 92   PRO A N   1 
ATOM   344   C CA  . PRO A 1 53  ? -3.815   -9.778  -20.814 1.00 70.65  ? 92   PRO A CA  1 
ATOM   345   C C   . PRO A 1 53  ? -2.625   -10.636 -20.427 1.00 58.06  ? 92   PRO A C   1 
ATOM   346   O O   . PRO A 1 53  ? -1.676   -10.768 -21.193 1.00 73.09  ? 92   PRO A O   1 
ATOM   347   C CB  . PRO A 1 53  ? -3.660   -8.378  -20.213 1.00 72.86  ? 92   PRO A CB  1 
ATOM   348   C CG  . PRO A 1 53  ? -5.028   -8.012  -19.737 1.00 75.42  ? 92   PRO A CG  1 
ATOM   349   C CD  . PRO A 1 53  ? -5.642   -9.300  -19.272 1.00 60.91  ? 92   PRO A CD  1 
ATOM   350   N N   . SER A 1 54  ? -2.684   -11.209 -19.231 1.00 63.81  ? 93   SER A N   1 
ATOM   351   C CA  . SER A 1 54  ? -1.681   -12.166 -18.793 1.00 68.51  ? 93   SER A CA  1 
ATOM   352   C C   . SER A 1 54  ? -1.593   -13.296 -19.808 1.00 66.42  ? 93   SER A C   1 
ATOM   353   O O   . SER A 1 54  ? -2.575   -13.632 -20.470 1.00 68.07  ? 93   SER A O   1 
ATOM   354   C CB  . SER A 1 54  ? -2.045   -12.751 -17.421 1.00 61.61  ? 93   SER A CB  1 
ATOM   355   O OG  . SER A 1 54  ? -1.987   -11.774 -16.397 1.00 68.53  ? 93   SER A OG  1 
ATOM   356   N N   . GLN A 1 55  ? -0.411   -13.880 -19.936 1.00 70.71  ? 94   GLN A N   1 
ATOM   357   C CA  . GLN A 1 55  ? -0.278   -15.100 -20.709 1.00 68.36  ? 94   GLN A CA  1 
ATOM   358   C C   . GLN A 1 55  ? -0.126   -16.255 -19.739 1.00 61.47  ? 94   GLN A C   1 
ATOM   359   O O   . GLN A 1 55  ? 0.766    -17.093 -19.867 1.00 66.92  ? 94   GLN A O   1 
ATOM   360   C CB  . GLN A 1 55  ? 0.895    -15.022 -21.681 1.00 80.12  ? 94   GLN A CB  1 
ATOM   361   C CG  . GLN A 1 55  ? 0.505    -15.455 -23.075 1.00 73.77  ? 94   GLN A CG  1 
ATOM   362   C CD  . GLN A 1 55  ? -0.738   -14.739 -23.576 1.00 82.86  ? 94   GLN A CD  1 
ATOM   363   O OE1 . GLN A 1 55  ? -0.879   -13.525 -23.409 1.00 83.24  ? 94   GLN A OE1 1 
ATOM   364   N NE2 . GLN A 1 55  ? -1.651   -15.490 -24.193 1.00 77.33  ? 94   GLN A NE2 1 
ATOM   365   N N   . PHE A 1 56  ? -1.012   -16.262 -18.750 1.00 58.29  ? 95   PHE A N   1 
ATOM   366   C CA  . PHE A 1 56  ? -1.115   -17.345 -17.784 1.00 54.96  ? 95   PHE A CA  1 
ATOM   367   C C   . PHE A 1 56  ? -2.486   -17.255 -17.116 1.00 55.63  ? 95   PHE A C   1 
ATOM   368   O O   . PHE A 1 56  ? -3.227   -16.290 -17.329 1.00 48.93  ? 95   PHE A O   1 
ATOM   369   C CB  . PHE A 1 56  ? -0.003   -17.256 -16.730 1.00 54.09  ? 95   PHE A CB  1 
ATOM   370   C CG  . PHE A 1 56  ? 0.038    -15.940 -15.996 1.00 56.00  ? 95   PHE A CG  1 
ATOM   371   C CD1 . PHE A 1 56  ? -0.836   -15.684 -14.948 1.00 58.77  ? 95   PHE A CD1 1 
ATOM   372   C CD2 . PHE A 1 56  ? 0.953    -14.961 -16.354 1.00 61.74  ? 95   PHE A CD2 1 
ATOM   373   C CE1 . PHE A 1 56  ? -0.806   -14.470 -14.274 1.00 55.85  ? 95   PHE A CE1 1 
ATOM   374   C CE2 . PHE A 1 56  ? 0.996    -13.748 -15.682 1.00 66.37  ? 95   PHE A CE2 1 
ATOM   375   C CZ  . PHE A 1 56  ? 0.113    -13.502 -14.641 1.00 71.13  ? 95   PHE A CZ  1 
ATOM   376   N N   . MET A 1 57  ? -2.823   -18.253 -16.310 1.00 47.19  ? 96   MET A N   1 
ATOM   377   C CA  . MET A 1 57  ? -4.066   -18.202 -15.565 1.00 46.54  ? 96   MET A CA  1 
ATOM   378   C C   . MET A 1 57  ? -3.926   -17.392 -14.293 1.00 40.08  ? 96   MET A C   1 
ATOM   379   O O   . MET A 1 57  ? -3.197   -17.781 -13.377 1.00 37.11  ? 96   MET A O   1 
ATOM   380   C CB  . MET A 1 57  ? -4.546   -19.589 -15.191 1.00 47.40  ? 96   MET A CB  1 
ATOM   381   C CG  . MET A 1 57  ? -5.884   -19.515 -14.495 1.00 44.40  ? 96   MET A CG  1 
ATOM   382   S SD  . MET A 1 57  ? -6.394   -21.107 -13.887 1.00 37.08  ? 96   MET A SD  1 
ATOM   383   C CE  . MET A 1 57  ? -5.016   -21.454 -12.801 1.00 39.95  ? 96   MET A CE  1 
ATOM   384   N N   . PRO A 1 58  ? -4.639   -16.261 -14.227 1.00 35.58  ? 97   PRO A N   1 
ATOM   385   C CA  . PRO A 1 58  ? -4.604   -15.450 -13.018 1.00 40.47  ? 97   PRO A CA  1 
ATOM   386   C C   . PRO A 1 58  ? -5.654   -15.975 -12.051 1.00 33.61  ? 97   PRO A C   1 
ATOM   387   O O   . PRO A 1 58  ? -6.843   -15.736 -12.235 1.00 30.30  ? 97   PRO A O   1 
ATOM   388   C CB  . PRO A 1 58  ? -4.980   -14.047 -13.523 1.00 43.07  ? 97   PRO A CB  1 
ATOM   389   C CG  . PRO A 1 58  ? -5.352   -14.223 -15.029 1.00 45.09  ? 97   PRO A CG  1 
ATOM   390   C CD  . PRO A 1 58  ? -5.541   -15.690 -15.238 1.00 31.09  ? 97   PRO A CD  1 
ATOM   391   N N   . LEU A 1 59  ? -5.198   -16.705 -11.045 1.00 31.74  ? 98   LEU A N   1 
ATOM   392   C CA  . LEU A 1 59  ? -6.062   -17.251 -10.018 1.00 30.22  ? 98   LEU A CA  1 
ATOM   393   C C   . LEU A 1 59  ? -5.637   -16.690 -8.669  1.00 30.23  ? 98   LEU A C   1 
ATOM   394   O O   . LEU A 1 59  ? -4.458   -16.746 -8.305  1.00 29.62  ? 98   LEU A O   1 
ATOM   395   C CB  . LEU A 1 59  ? -5.958   -18.776 -10.001 1.00 26.86  ? 98   LEU A CB  1 
ATOM   396   C CG  . LEU A 1 59  ? -6.598   -19.447 -8.777  1.00 33.31  ? 98   LEU A CG  1 
ATOM   397   C CD1 . LEU A 1 59  ? -8.107   -19.370 -8.862  1.00 29.00  ? 98   LEU A CD1 1 
ATOM   398   C CD2 . LEU A 1 59  ? -6.134   -20.900 -8.632  1.00 30.10  ? 98   LEU A CD2 1 
ATOM   399   N N   . VAL A 1 60  ? -6.586   -16.131 -7.931  1.00 26.49  ? 99   VAL A N   1 
ATOM   400   C CA  . VAL A 1 60  ? -6.287   -15.670 -6.581  1.00 27.89  ? 99   VAL A CA  1 
ATOM   401   C C   . VAL A 1 60  ? -7.335   -16.178 -5.610  1.00 29.60  ? 99   VAL A C   1 
ATOM   402   O O   . VAL A 1 60  ? -8.533   -16.145 -5.904  1.00 25.94  ? 99   VAL A O   1 
ATOM   403   C CB  . VAL A 1 60  ? -6.189   -14.130 -6.478  1.00 36.66  ? 99   VAL A CB  1 
ATOM   404   C CG1 . VAL A 1 60  ? -7.489   -13.484 -6.901  1.00 39.85  ? 99   VAL A CG1 1 
ATOM   405   C CG2 . VAL A 1 60  ? -5.851   -13.721 -5.052  1.00 40.97  ? 99   VAL A CG2 1 
ATOM   406   N N   . VAL A 1 61  ? -6.869   -16.653 -4.459  1.00 29.88  ? 100  VAL A N   1 
ATOM   407   C CA  . VAL A 1 61  ? -7.746   -17.125 -3.399  1.00 31.98  ? 100  VAL A CA  1 
ATOM   408   C C   . VAL A 1 61  ? -7.631   -16.186 -2.215  1.00 30.75  ? 100  VAL A C   1 
ATOM   409   O O   . VAL A 1 61  ? -6.530   -15.932 -1.742  1.00 30.35  ? 100  VAL A O   1 
ATOM   410   C CB  . VAL A 1 61  ? -7.340   -18.525 -2.895  1.00 27.55  ? 100  VAL A CB  1 
ATOM   411   C CG1 . VAL A 1 61  ? -8.138   -18.882 -1.629  1.00 27.91  ? 100  VAL A CG1 1 
ATOM   412   C CG2 . VAL A 1 61  ? -7.517   -19.575 -3.980  1.00 22.31  ? 100  VAL A CG2 1 
ATOM   413   N N   . ASP A 1 62  ? -8.759   -15.685 -1.720  1.00 24.55  ? 101  ASP A N   1 
ATOM   414   C CA  . ASP A 1 62  ? -8.741   -14.813 -0.539  1.00 27.00  ? 101  ASP A CA  1 
ATOM   415   C C   . ASP A 1 62  ? -9.615   -15.341 0.582   1.00 35.30  ? 101  ASP A C   1 
ATOM   416   O O   . ASP A 1 62  ? -10.828  -15.160 0.570   1.00 31.12  ? 101  ASP A O   1 
ATOM   417   C CB  . ASP A 1 62  ? -9.184   -13.385 -0.874  1.00 26.62  ? 101  ASP A CB  1 
ATOM   418   C CG  . ASP A 1 62  ? -8.210   -12.676 -1.795  1.00 38.48  ? 101  ASP A CG  1 
ATOM   419   O OD1 . ASP A 1 62  ? -7.066   -12.399 -1.360  1.00 41.16  ? 101  ASP A OD1 1 
ATOM   420   O OD2 . ASP A 1 62  ? -8.588   -12.403 -2.955  1.00 41.18  ? 101  ASP A OD2 1 
ATOM   421   N N   . TYR A 1 63  ? -8.984   -15.974 1.557   1.00 31.38  ? 102  TYR A N   1 
ATOM   422   C CA  . TYR A 1 63  ? -9.678   -16.444 2.746   1.00 36.72  ? 102  TYR A CA  1 
ATOM   423   C C   . TYR A 1 63  ? -9.521   -15.365 3.807   1.00 34.60  ? 102  TYR A C   1 
ATOM   424   O O   . TYR A 1 63  ? -8.407   -14.954 4.090   1.00 25.05  ? 102  TYR A O   1 
ATOM   425   C CB  . TYR A 1 63  ? -9.041   -17.756 3.214   1.00 29.89  ? 102  TYR A CB  1 
ATOM   426   C CG  . TYR A 1 63  ? -9.526   -18.275 4.542   1.00 25.35  ? 102  TYR A CG  1 
ATOM   427   C CD1 . TYR A 1 63  ? -10.498  -19.257 4.601   1.00 25.91  ? 102  TYR A CD1 1 
ATOM   428   C CD2 . TYR A 1 63  ? -8.980   -17.818 5.739   1.00 27.47  ? 102  TYR A CD2 1 
ATOM   429   C CE1 . TYR A 1 63  ? -10.935  -19.757 5.815   1.00 31.18  ? 102  TYR A CE1 1 
ATOM   430   C CE2 . TYR A 1 63  ? -9.412   -18.313 6.965   1.00 24.33  ? 102  TYR A CE2 1 
ATOM   431   C CZ  . TYR A 1 63  ? -10.389  -19.282 6.990   1.00 31.66  ? 102  TYR A CZ  1 
ATOM   432   O OH  . TYR A 1 63  ? -10.829  -19.803 8.181   1.00 31.38  ? 102  TYR A OH  1 
ATOM   433   N N   . ARG A 1 64  ? -10.638  -14.912 4.375   1.00 27.30  ? 103  ARG A N   1 
ATOM   434   C CA  . ARG A 1 64  ? -10.641  -13.850 5.371   1.00 36.07  ? 103  ARG A CA  1 
ATOM   435   C C   . ARG A 1 64  ? -11.407  -14.311 6.600   1.00 38.76  ? 103  ARG A C   1 
ATOM   436   O O   . ARG A 1 64  ? -12.454  -14.930 6.475   1.00 31.64  ? 103  ARG A O   1 
ATOM   437   C CB  . ARG A 1 64  ? -11.349  -12.608 4.813   1.00 34.44  ? 103  ARG A CB  1 
ATOM   438   C CG  . ARG A 1 64  ? -10.661  -11.944 3.637   1.00 54.00  ? 103  ARG A CG  1 
ATOM   439   C CD  . ARG A 1 64  ? -10.224  -10.524 3.999   1.00 60.40  ? 103  ARG A CD  1 
ATOM   440   N NE  . ARG A 1 64  ? -10.901  -9.507  3.192   1.00 66.24  ? 103  ARG A NE  1 
ATOM   441   C CZ  . ARG A 1 64  ? -12.046  -8.911  3.524   1.00 60.16  ? 103  ARG A CZ  1 
ATOM   442   N NH1 . ARG A 1 64  ? -12.666  -9.216  4.659   1.00 59.02  ? 103  ARG A NH1 1 
ATOM   443   N NH2 . ARG A 1 64  ? -12.575  -8.003  2.715   1.00 57.79  ? 103  ARG A NH2 1 
ATOM   444   N N   . GLN A 1 65  ? -10.903  -14.003 7.787   1.00 39.11  ? 104  GLN A N   1 
ATOM   445   C CA  . GLN A 1 65  ? -11.703  -14.173 8.996   1.00 35.34  ? 104  GLN A CA  1 
ATOM   446   C C   . GLN A 1 65  ? -12.256  -12.814 9.467   1.00 36.54  ? 104  GLN A C   1 
ATOM   447   O O   . GLN A 1 65  ? -11.812  -11.757 9.004   1.00 31.72  ? 104  GLN A O   1 
ATOM   448   C CB  . GLN A 1 65  ? -10.894  -14.869 10.095  1.00 32.40  ? 104  GLN A CB  1 
ATOM   449   C CG  . GLN A 1 65  ? -9.546   -14.244 10.380  1.00 45.75  ? 104  GLN A CG  1 
ATOM   450   C CD  . GLN A 1 65  ? -8.583   -15.199 11.096  1.00 51.28  ? 104  GLN A CD  1 
ATOM   451   O OE1 . GLN A 1 65  ? -8.692   -16.430 10.983  1.00 40.98  ? 104  GLN A OE1 1 
ATOM   452   N NE2 . GLN A 1 65  ? -7.643   -14.628 11.843  1.00 44.21  ? 104  GLN A NE2 1 
ATOM   453   N N   . LYS A 1 66  ? -13.239  -12.845 10.361  1.00 33.61  ? 105  LYS A N   1 
ATOM   454   C CA  . LYS A 1 66  ? -13.833  -11.617 10.896  1.00 33.70  ? 105  LYS A CA  1 
ATOM   455   C C   . LYS A 1 66  ? -13.403  -11.368 12.343  1.00 41.46  ? 105  LYS A C   1 
ATOM   456   O O   . LYS A 1 66  ? -13.569  -10.267 12.862  1.00 38.08  ? 105  LYS A O   1 
ATOM   457   C CB  . LYS A 1 66  ? -15.363  -11.675 10.809  1.00 42.38  ? 105  LYS A CB  1 
ATOM   458   C CG  . LYS A 1 66  ? -15.896  -11.817 9.391   1.00 43.13  ? 105  LYS A CG  1 
ATOM   459   C CD  . LYS A 1 66  ? -17.376  -12.178 9.377   1.00 32.95  ? 105  LYS A CD  1 
ATOM   460   C CE  . LYS A 1 66  ? -17.848  -12.504 7.958   1.00 37.04  ? 105  LYS A CE  1 
ATOM   461   N NZ  . LYS A 1 66  ? -19.292  -12.944 7.934   1.00 39.30  ? 105  LYS A NZ  1 
ATOM   462   N N   . ALA A 1 67  ? -12.851  -12.397 12.985  1.00 38.72  ? 106  ALA A N   1 
ATOM   463   C CA  . ALA A 1 67  ? -12.331  -12.283 14.348  1.00 44.46  ? 106  ALA A CA  1 
ATOM   464   C C   . ALA A 1 67  ? -11.095  -13.173 14.568  1.00 43.84  ? 106  ALA A C   1 
ATOM   465   O O   . ALA A 1 67  ? -10.834  -14.092 13.787  1.00 39.55  ? 106  ALA A O   1 
ATOM   466   C CB  . ALA A 1 67  ? -13.424  -12.626 15.365  1.00 40.72  ? 106  ALA A CB  1 
ATOM   467   N N   . ALA A 1 68  ? -10.349  -12.897 15.637  1.00 37.78  ? 107  ALA A N   1 
ATOM   468   C CA  . ALA A 1 68  ? -9.196   -13.710 16.021  1.00 37.47  ? 107  ALA A CA  1 
ATOM   469   C C   . ALA A 1 68  ? -9.516   -14.639 17.203  1.00 47.01  ? 107  ALA A C   1 
ATOM   470   O O   . ALA A 1 68  ? -10.580  -14.530 17.820  1.00 42.50  ? 107  ALA A O   1 
ATOM   471   C CB  . ALA A 1 68  ? -7.988   -12.807 16.350  1.00 40.98  ? 107  ALA A CB  1 
ATOM   472   N N   . ALA A 1 69  ? -8.594   -15.556 17.504  1.00 42.01  ? 108  ALA A N   1 
ATOM   473   C CA  . ALA A 1 69  ? -8.724   -16.453 18.657  1.00 40.87  ? 108  ALA A CA  1 
ATOM   474   C C   . ALA A 1 69  ? -10.038  -17.233 18.674  1.00 47.31  ? 108  ALA A C   1 
ATOM   475   O O   . ALA A 1 69  ? -10.903  -16.982 19.513  1.00 46.58  ? 108  ALA A O   1 
ATOM   476   C CB  . ALA A 1 69  ? -8.570   -15.670 19.957  1.00 44.87  ? 108  ALA A CB  1 
ATOM   477   N N   . ALA A 1 70  ? -10.186  -18.176 17.750  1.00 49.55  ? 109  ALA A N   1 
ATOM   478   C CA  . ALA A 1 70  ? -11.363  -19.035 17.728  1.00 50.15  ? 109  ALA A CA  1 
ATOM   479   C C   . ALA A 1 70  ? -12.655  -18.224 17.651  1.00 46.94  ? 109  ALA A C   1 
ATOM   480   O O   . ALA A 1 70  ? -13.663  -18.619 18.228  1.00 43.17  ? 109  ALA A O   1 
ATOM   481   C CB  . ALA A 1 70  ? -11.378  -19.944 18.959  1.00 55.81  ? 109  ALA A CB  1 
ATOM   482   N N   . GLY A 1 71  ? -12.610  -17.086 16.957  1.00 42.61  ? 110  GLY A N   1 
ATOM   483   C CA  . GLY A 1 71  ? -13.791  -16.274 16.709  1.00 48.50  ? 110  GLY A CA  1 
ATOM   484   C C   . GLY A 1 71  ? -14.230  -15.411 17.880  1.00 51.48  ? 110  GLY A C   1 
ATOM   485   O O   . GLY A 1 71  ? -15.384  -14.984 17.952  1.00 37.47  ? 110  GLY A O   1 
ATOM   486   N N   . ARG A 1 72  ? -13.306  -15.148 18.798  1.00 47.68  ? 111  ARG A N   1 
ATOM   487   C CA  . ARG A 1 72  ? -13.646  -14.469 20.044  1.00 44.07  ? 111  ARG A CA  1 
ATOM   488   C C   . ARG A 1 72  ? -13.276  -12.993 20.054  1.00 45.68  ? 111  ARG A C   1 
ATOM   489   O O   . ARG A 1 72  ? -13.919  -12.192 20.740  1.00 44.68  ? 111  ARG A O   1 
ATOM   490   C CB  . ARG A 1 72  ? -13.014  -15.199 21.232  1.00 39.27  ? 111  ARG A CB  1 
ATOM   491   C CG  . ARG A 1 72  ? -13.621  -16.571 21.438  1.00 47.01  ? 111  ARG A CG  1 
ATOM   492   C CD  . ARG A 1 72  ? -12.901  -17.354 22.510  1.00 54.64  ? 111  ARG A CD  1 
ATOM   493   N NE  . ARG A 1 72  ? -13.415  -18.716 22.570  1.00 58.94  ? 111  ARG A NE  1 
ATOM   494   C CZ  . ARG A 1 72  ? -12.892  -19.684 23.311  1.00 61.41  ? 111  ARG A CZ  1 
ATOM   495   N NH1 . ARG A 1 72  ? -11.828  -19.441 24.071  1.00 52.45  ? 111  ARG A NH1 1 
ATOM   496   N NH2 . ARG A 1 72  ? -13.436  -20.895 23.288  1.00 54.21  ? 111  ARG A NH2 1 
ATOM   497   N N   . ILE A 1 73  ? -12.240  -12.639 19.295  1.00 44.86  ? 112  ILE A N   1 
ATOM   498   C CA  . ILE A 1 73  ? -11.779  -11.254 19.238  1.00 49.35  ? 112  ILE A CA  1 
ATOM   499   C C   . ILE A 1 73  ? -12.067  -10.636 17.873  1.00 45.23  ? 112  ILE A C   1 
ATOM   500   O O   . ILE A 1 73  ? -11.322  -10.869 16.907  1.00 45.82  ? 112  ILE A O   1 
ATOM   501   C CB  . ILE A 1 73  ? -10.265  -11.122 19.561  1.00 43.68  ? 112  ILE A CB  1 
ATOM   502   C CG1 . ILE A 1 73  ? -9.935   -11.814 20.889  1.00 42.90  ? 112  ILE A CG1 1 
ATOM   503   C CG2 . ILE A 1 73  ? -9.869   -9.649  19.609  1.00 36.77  ? 112  ILE A CG2 1 
ATOM   504   C CD1 . ILE A 1 73  ? -10.620  -11.174 22.096  1.00 51.02  ? 112  ILE A CD1 1 
ATOM   505   N N   . PRO A 1 74  ? -13.152  -9.846  17.790  1.00 39.33  ? 113  PRO A N   1 
ATOM   506   C CA  . PRO A 1 74  ? -13.531  -9.194  16.530  1.00 41.16  ? 113  PRO A CA  1 
ATOM   507   C C   . PRO A 1 74  ? -12.379  -8.375  15.942  1.00 45.84  ? 113  PRO A C   1 
ATOM   508   O O   . PRO A 1 74  ? -11.662  -7.700  16.685  1.00 41.81  ? 113  PRO A O   1 
ATOM   509   C CB  . PRO A 1 74  ? -14.700  -8.297  16.943  1.00 40.84  ? 113  PRO A CB  1 
ATOM   510   C CG  . PRO A 1 74  ? -15.322  -9.041  18.118  1.00 41.17  ? 113  PRO A CG  1 
ATOM   511   C CD  . PRO A 1 74  ? -14.145  -9.617  18.860  1.00 36.03  ? 113  PRO A CD  1 
ATOM   512   N N   . THR A 1 75  ? -12.208  -8.442  14.622  1.00 37.49  ? 114  THR A N   1 
ATOM   513   C CA  . THR A 1 75  ? -11.071  -7.798  13.963  1.00 41.87  ? 114  THR A CA  1 
ATOM   514   C C   . THR A 1 75  ? -11.419  -7.212  12.593  1.00 45.55  ? 114  THR A C   1 
ATOM   515   O O   . THR A 1 75  ? -10.613  -6.487  12.003  1.00 37.76  ? 114  THR A O   1 
ATOM   516   C CB  . THR A 1 75  ? -9.896   -8.790  13.774  1.00 46.52  ? 114  THR A CB  1 
ATOM   517   O OG1 . THR A 1 75  ? -10.378  -9.981  13.136  1.00 35.68  ? 114  THR A OG1 1 
ATOM   518   C CG2 . THR A 1 75  ? -9.256   -9.150  15.115  1.00 38.93  ? 114  THR A CG2 1 
ATOM   519   N N   . ASN A 1 76  ? -12.607  -7.529  12.085  1.00 38.86  ? 115  ASN A N   1 
ATOM   520   C CA  . ASN A 1 76  ? -12.978  -7.101  10.738  1.00 35.23  ? 115  ASN A CA  1 
ATOM   521   C C   . ASN A 1 76  ? -13.077  -5.579  10.589  1.00 41.13  ? 115  ASN A C   1 
ATOM   522   O O   . ASN A 1 76  ? -12.910  -5.036  9.495   1.00 41.98  ? 115  ASN A O   1 
ATOM   523   C CB  . ASN A 1 76  ? -14.258  -7.804  10.273  1.00 39.65  ? 115  ASN A CB  1 
ATOM   524   C CG  . ASN A 1 76  ? -15.470  -7.446  11.114  1.00 45.08  ? 115  ASN A CG  1 
ATOM   525   O OD1 . ASN A 1 76  ? -15.358  -6.848  12.191  1.00 48.44  ? 115  ASN A OD1 1 
ATOM   526   N ND2 . ASN A 1 76  ? -16.645  -7.821  10.626  1.00 48.31  ? 115  ASN A ND2 1 
ATOM   527   N N   . TYR A 1 77  ? -13.328  -4.893  11.699  1.00 42.17  ? 116  TYR A N   1 
ATOM   528   C CA  . TYR A 1 77  ? -13.403  -3.436  11.688  1.00 49.20  ? 116  TYR A CA  1 
ATOM   529   C C   . TYR A 1 77  ? -11.997  -2.857  11.595  1.00 57.36  ? 116  TYR A C   1 
ATOM   530   O O   . TYR A 1 77  ? -11.813  -1.640  11.499  1.00 58.09  ? 116  TYR A O   1 
ATOM   531   C CB  . TYR A 1 77  ? -14.125  -2.921  12.937  1.00 49.52  ? 116  TYR A CB  1 
ATOM   532   C CG  . TYR A 1 77  ? -13.396  -3.176  14.241  1.00 50.03  ? 116  TYR A CG  1 
ATOM   533   C CD1 . TYR A 1 77  ? -13.577  -4.368  14.945  1.00 43.43  ? 116  TYR A CD1 1 
ATOM   534   C CD2 . TYR A 1 77  ? -12.532  -2.223  14.774  1.00 53.76  ? 116  TYR A CD2 1 
ATOM   535   C CE1 . TYR A 1 77  ? -12.920  -4.599  16.146  1.00 47.79  ? 116  TYR A CE1 1 
ATOM   536   C CE2 . TYR A 1 77  ? -11.874  -2.442  15.974  1.00 52.34  ? 116  TYR A CE2 1 
ATOM   537   C CZ  . TYR A 1 77  ? -12.068  -3.631  16.655  1.00 48.87  ? 116  TYR A CZ  1 
ATOM   538   O OH  . TYR A 1 77  ? -11.406  -3.853  17.842  1.00 47.85  ? 116  TYR A OH  1 
ATOM   539   N N   . LEU A 1 78  ? -11.020  -3.764  11.607  1.00 60.02  ? 117  LEU A N   1 
ATOM   540   C CA  . LEU A 1 78  ? -9.591   -3.448  11.551  1.00 70.55  ? 117  LEU A CA  1 
ATOM   541   C C   . LEU A 1 78  ? -9.079   -2.821  12.848  1.00 67.36  ? 117  LEU A C   1 
ATOM   542   O O   . LEU A 1 78  ? -8.688   -3.534  13.777  1.00 62.02  ? 117  LEU A O   1 
ATOM   543   C CB  . LEU A 1 78  ? -9.244   -2.586  10.329  1.00 62.06  ? 117  LEU A CB  1 
ATOM   544   C CG  . LEU A 1 78  ? -8.793   -3.345  9.081   1.00 57.52  ? 117  LEU A CG  1 
ATOM   545   C CD1 . LEU A 1 78  ? -8.444   -2.371  7.954   1.00 67.54  ? 117  LEU A CD1 1 
ATOM   546   C CD2 . LEU A 1 78  ? -7.597   -4.221  9.408   1.00 65.90  ? 117  LEU A CD2 1 
ATOM   547   N N   . THR A 1 84  ? -5.281   -10.927 6.057   1.00 60.42  ? 123  THR A N   1 
ATOM   548   C CA  . THR A 1 84  ? -4.008   -10.255 6.283   1.00 44.48  ? 123  THR A CA  1 
ATOM   549   C C   . THR A 1 84  ? -3.200   -10.867 7.445   1.00 52.06  ? 123  THR A C   1 
ATOM   550   O O   . THR A 1 84  ? -1.975   -10.733 7.497   1.00 52.62  ? 123  THR A O   1 
ATOM   551   C CB  . THR A 1 84  ? -4.199   -8.736  6.473   1.00 67.68  ? 123  THR A CB  1 
ATOM   552   O OG1 . THR A 1 84  ? -2.925   -8.085  6.433   1.00 61.71  ? 123  THR A OG1 1 
ATOM   553   C CG2 . THR A 1 84  ? -4.915   -8.423  7.798   1.00 68.98  ? 123  THR A CG2 1 
ATOM   554   N N   . SER A 1 85  ? -3.878   -11.545 8.368   1.00 43.16  ? 124  SER A N   1 
ATOM   555   C CA  . SER A 1 85  ? -3.184   -12.331 9.386   1.00 46.53  ? 124  SER A CA  1 
ATOM   556   C C   . SER A 1 85  ? -2.410   -13.491 8.742   1.00 39.19  ? 124  SER A C   1 
ATOM   557   O O   . SER A 1 85  ? -2.631   -13.824 7.575   1.00 39.77  ? 124  SER A O   1 
ATOM   558   C CB  . SER A 1 85  ? -4.177   -12.891 10.400  1.00 41.84  ? 124  SER A CB  1 
ATOM   559   O OG  . SER A 1 85  ? -4.873   -14.005 9.863   1.00 42.29  ? 124  SER A OG  1 
ATOM   560   N N   . ASP A 1 86  ? -1.509   -14.103 9.508   1.00 38.26  ? 125  ASP A N   1 
ATOM   561   C CA  . ASP A 1 86  ? -0.788   -15.291 9.049   1.00 43.89  ? 125  ASP A CA  1 
ATOM   562   C C   . ASP A 1 86  ? -1.765   -16.401 8.645   1.00 35.51  ? 125  ASP A C   1 
ATOM   563   O O   . ASP A 1 86  ? -1.673   -16.978 7.555   1.00 34.25  ? 125  ASP A O   1 
ATOM   564   C CB  . ASP A 1 86  ? 0.137    -15.806 10.154  1.00 45.53  ? 125  ASP A CB  1 
ATOM   565   C CG  . ASP A 1 86  ? 1.493    -15.101 10.175  1.00 52.43  ? 125  ASP A CG  1 
ATOM   566   O OD1 . ASP A 1 86  ? 1.593    -13.935 9.721   1.00 43.96  ? 125  ASP A OD1 1 
ATOM   567   O OD2 . ASP A 1 86  ? 2.462    -15.726 10.662  1.00 56.89  ? 125  ASP A OD2 1 
ATOM   568   N N   . LYS A 1 87  ? -2.694   -16.689 9.548   1.00 36.41  ? 126  LYS A N   1 
ATOM   569   C CA  . LYS A 1 87  ? -3.723   -17.700 9.349   1.00 36.90  ? 126  LYS A CA  1 
ATOM   570   C C   . LYS A 1 87  ? -4.465   -17.498 8.027   1.00 30.71  ? 126  LYS A C   1 
ATOM   571   O O   . LYS A 1 87  ? -4.678   -18.441 7.270   1.00 37.87  ? 126  LYS A O   1 
ATOM   572   C CB  . LYS A 1 87  ? -4.707   -17.673 10.526  1.00 42.49  ? 126  LYS A CB  1 
ATOM   573   C CG  . LYS A 1 87  ? -5.742   -18.783 10.501  1.00 48.15  ? 126  LYS A CG  1 
ATOM   574   C CD  . LYS A 1 87  ? -5.068   -20.147 10.478  1.00 48.24  ? 126  LYS A CD  1 
ATOM   575   C CE  . LYS A 1 87  ? -6.095   -21.261 10.517  1.00 43.23  ? 126  LYS A CE  1 
ATOM   576   N NZ  . LYS A 1 87  ? -7.143   -21.010 9.484   1.00 51.14  ? 126  LYS A NZ  1 
ATOM   577   N N   . GLU A 1 88  ? -4.838   -16.260 7.742   1.00 31.85  ? 127  GLU A N   1 
ATOM   578   C CA  . GLU A 1 88  ? -5.554   -15.959 6.518   1.00 32.48  ? 127  GLU A CA  1 
ATOM   579   C C   . GLU A 1 88  ? -4.722   -16.243 5.275   1.00 32.13  ? 127  GLU A C   1 
ATOM   580   O O   . GLU A 1 88  ? -5.198   -16.863 4.325   1.00 30.48  ? 127  GLU A O   1 
ATOM   581   C CB  . GLU A 1 88  ? -6.040   -14.508 6.530   1.00 32.49  ? 127  GLU A CB  1 
ATOM   582   C CG  . GLU A 1 88  ? -7.145   -14.260 7.573   1.00 41.24  ? 127  GLU A CG  1 
ATOM   583   C CD  . GLU A 1 88  ? -7.430   -12.780 7.792   1.00 38.67  ? 127  GLU A CD  1 
ATOM   584   O OE1 . GLU A 1 88  ? -6.484   -12.029 8.099   1.00 47.53  ? 127  GLU A OE1 1 
ATOM   585   O OE2 . GLU A 1 88  ? -8.597   -12.369 7.654   1.00 36.70  ? 127  GLU A OE2 1 
ATOM   586   N N   . ILE A 1 89  ? -3.481   -15.779 5.287   1.00 27.15  ? 128  ILE A N   1 
ATOM   587   C CA  . ILE A 1 89  ? -2.568   -15.998 4.172   1.00 28.85  ? 128  ILE A CA  1 
ATOM   588   C C   . ILE A 1 89  ? -2.244   -17.479 3.974   1.00 26.24  ? 128  ILE A C   1 
ATOM   589   O O   . ILE A 1 89  ? -2.332   -17.990 2.863   1.00 30.92  ? 128  ILE A O   1 
ATOM   590   C CB  . ILE A 1 89  ? -1.268   -15.182 4.366   1.00 31.46  ? 128  ILE A CB  1 
ATOM   591   C CG1 . ILE A 1 89  ? -1.589   -13.685 4.286   1.00 40.96  ? 128  ILE A CG1 1 
ATOM   592   C CG2 . ILE A 1 89  ? -0.214   -15.576 3.333   1.00 29.83  ? 128  ILE A CG2 1 
ATOM   593   C CD1 . ILE A 1 89  ? -0.441   -12.789 4.702   1.00 48.88  ? 128  ILE A CD1 1 
ATOM   594   N N   . LEU A 1 90  ? -1.886   -18.174 5.048   1.00 27.65  ? 129  LEU A N   1 
ATOM   595   C CA  . LEU A 1 90  ? -1.564   -19.596 4.927   1.00 29.02  ? 129  LEU A CA  1 
ATOM   596   C C   . LEU A 1 90  ? -2.783   -20.395 4.474   1.00 30.11  ? 129  LEU A C   1 
ATOM   597   O O   . LEU A 1 90  ? -2.676   -21.319 3.668   1.00 26.28  ? 129  LEU A O   1 
ATOM   598   C CB  . LEU A 1 90  ? -1.016   -20.156 6.240   1.00 31.14  ? 129  LEU A CB  1 
ATOM   599   C CG  . LEU A 1 90  ? 0.309    -19.557 6.736   1.00 35.74  ? 129  LEU A CG  1 
ATOM   600   C CD1 . LEU A 1 90  ? 0.590    -20.007 8.170   1.00 28.86  ? 129  LEU A CD1 1 
ATOM   601   C CD2 . LEU A 1 90  ? 1.450    -19.947 5.802   1.00 31.97  ? 129  LEU A CD2 1 
ATOM   602   N N   . THR A 1 91  ? -3.953   -20.037 4.983   1.00 27.51  ? 130  THR A N   1 
ATOM   603   C CA  . THR A 1 91  ? -5.166   -20.745 4.581   1.00 29.14  ? 130  THR A CA  1 
ATOM   604   C C   . THR A 1 91  ? -5.485   -20.488 3.112   1.00 24.05  ? 130  THR A C   1 
ATOM   605   O O   . THR A 1 91  ? -5.869   -21.402 2.386   1.00 27.33  ? 130  THR A O   1 
ATOM   606   C CB  . THR A 1 91  ? -6.366   -20.370 5.469   1.00 28.55  ? 130  THR A CB  1 
ATOM   607   O OG1 . THR A 1 91  ? -6.073   -20.739 6.824   1.00 27.48  ? 130  THR A OG1 1 
ATOM   608   C CG2 . THR A 1 91  ? -7.624   -21.097 4.996   1.00 26.02  ? 130  THR A CG2 1 
ATOM   609   N N   . SER A 1 92  ? -5.306   -19.250 2.665   1.00 25.52  ? 131  SER A N   1 
ATOM   610   C CA  . SER A 1 92  ? -5.551   -18.929 1.263   1.00 27.39  ? 131  SER A CA  1 
ATOM   611   C C   . SER A 1 92  ? -4.673   -19.789 0.370   1.00 28.27  ? 131  SER A C   1 
ATOM   612   O O   . SER A 1 92  ? -5.114   -20.300 -0.658  1.00 23.00  ? 131  SER A O   1 
ATOM   613   C CB  . SER A 1 92  ? -5.241   -17.462 0.977   1.00 26.18  ? 131  SER A CB  1 
ATOM   614   O OG  . SER A 1 92  ? -6.129   -16.614 1.668   1.00 33.65  ? 131  SER A OG  1 
ATOM   615   N N   . ARG A 1 93  ? -3.413   -19.919 0.764   1.00 25.60  ? 132  ARG A N   1 
ATOM   616   C CA  . ARG A 1 93  ? -2.440   -20.660 -0.029  1.00 22.89  ? 132  ARG A CA  1 
ATOM   617   C C   . ARG A 1 93  ? -2.779   -22.142 -0.066  1.00 28.30  ? 132  ARG A C   1 
ATOM   618   O O   . ARG A 1 93  ? -2.685   -22.774 -1.119  1.00 22.98  ? 132  ARG A O   1 
ATOM   619   C CB  . ARG A 1 93  ? -1.020   -20.413 0.504   1.00 21.38  ? 132  ARG A CB  1 
ATOM   620   C CG  . ARG A 1 93  ? -0.508   -18.984 0.199   1.00 26.60  ? 132  ARG A CG  1 
ATOM   621   C CD  . ARG A 1 93  ? 0.824    -18.656 0.884   1.00 30.18  ? 132  ARG A CD  1 
ATOM   622   N NE  . ARG A 1 93  ? 1.904    -19.575 0.512   1.00 32.24  ? 132  ARG A NE  1 
ATOM   623   C CZ  . ARG A 1 93  ? 2.597    -19.517 -0.628  1.00 34.60  ? 132  ARG A CZ  1 
ATOM   624   N NH1 . ARG A 1 93  ? 2.332    -18.593 -1.540  1.00 32.38  ? 132  ARG A NH1 1 
ATOM   625   N NH2 . ARG A 1 93  ? 3.557    -20.407 -0.866  1.00 36.78  ? 132  ARG A NH2 1 
ATOM   626   N N   . ILE A 1 94  ? -3.200   -22.692 1.071   1.00 21.00  ? 133  ILE A N   1 
ATOM   627   C CA  . ILE A 1 94  ? -3.621   -24.085 1.091   1.00 29.57  ? 133  ILE A CA  1 
ATOM   628   C C   . ILE A 1 94  ? -4.815   -24.315 0.160   1.00 31.65  ? 133  ILE A C   1 
ATOM   629   O O   . ILE A 1 94  ? -4.885   -25.332 -0.529  1.00 31.62  ? 133  ILE A O   1 
ATOM   630   C CB  . ILE A 1 94  ? -3.977   -24.562 2.514   1.00 30.30  ? 133  ILE A CB  1 
ATOM   631   C CG1 . ILE A 1 94  ? -2.714   -24.711 3.355   1.00 40.58  ? 133  ILE A CG1 1 
ATOM   632   C CG2 . ILE A 1 94  ? -4.671   -25.904 2.467   1.00 40.54  ? 133  ILE A CG2 1 
ATOM   633   C CD1 . ILE A 1 94  ? -2.989   -25.176 4.769   1.00 38.84  ? 133  ILE A CD1 1 
ATOM   634   N N   . ILE A 1 95  ? -5.764   -23.384 0.137   1.00 32.25  ? 134  ILE A N   1 
ATOM   635   C CA  . ILE A 1 95  ? -6.920   -23.562 -0.744  1.00 25.49  ? 134  ILE A CA  1 
ATOM   636   C C   . ILE A 1 95  ? -6.468   -23.471 -2.194  1.00 23.89  ? 134  ILE A C   1 
ATOM   637   O O   . ILE A 1 95  ? -6.857   -24.284 -3.025  1.00 21.64  ? 134  ILE A O   1 
ATOM   638   C CB  . ILE A 1 95  ? -8.022   -22.511 -0.487  1.00 24.44  ? 134  ILE A CB  1 
ATOM   639   C CG1 . ILE A 1 95  ? -8.669   -22.742 0.889   1.00 20.37  ? 134  ILE A CG1 1 
ATOM   640   C CG2 . ILE A 1 95  ? -9.086   -22.546 -1.615  1.00 20.83  ? 134  ILE A CG2 1 
ATOM   641   C CD1 . ILE A 1 95  ? -9.314   -21.488 1.439   1.00 25.32  ? 134  ILE A CD1 1 
ATOM   642   N N   . ASP A 1 96  ? -5.646   -22.468 -2.488  1.00 21.83  ? 135  ASP A N   1 
ATOM   643   C CA  . ASP A 1 96  ? -5.096   -22.296 -3.823  1.00 22.89  ? 135  ASP A CA  1 
ATOM   644   C C   . ASP A 1 96  ? -4.466   -23.618 -4.324  1.00 26.44  ? 135  ASP A C   1 
ATOM   645   O O   . ASP A 1 96  ? -4.793   -24.098 -5.413  1.00 24.84  ? 135  ASP A O   1 
ATOM   646   C CB  . ASP A 1 96  ? -4.056   -21.160 -3.814  1.00 25.79  ? 135  ASP A CB  1 
ATOM   647   C CG  . ASP A 1 96  ? -3.541   -20.814 -5.207  1.00 28.35  ? 135  ASP A CG  1 
ATOM   648   O OD1 . ASP A 1 96  ? -2.837   -21.644 -5.814  1.00 31.74  ? 135  ASP A OD1 1 
ATOM   649   O OD2 . ASP A 1 96  ? -3.826   -19.702 -5.689  1.00 31.41  ? 135  ASP A OD2 1 
ATOM   650   N N   . ARG A 1 97  ? -3.579   -24.207 -3.522  1.00 25.08  ? 136  ARG A N   1 
ATOM   651   C CA  . ARG A 1 97  ? -2.879   -25.418 -3.935  1.00 26.53  ? 136  ARG A CA  1 
ATOM   652   C C   . ARG A 1 97  ? -3.851   -26.585 -4.131  1.00 31.72  ? 136  ARG A C   1 
ATOM   653   O O   . ARG A 1 97  ? -3.563   -27.513 -4.889  1.00 24.44  ? 136  ARG A O   1 
ATOM   654   C CB  . ARG A 1 97  ? -1.788   -25.803 -2.928  1.00 25.10  ? 136  ARG A CB  1 
ATOM   655   C CG  . ARG A 1 97  ? -0.475   -25.030 -3.083  1.00 35.47  ? 136  ARG A CG  1 
ATOM   656   C CD  . ARG A 1 97  ? 0.686    -25.718 -2.327  1.00 43.51  ? 136  ARG A CD  1 
ATOM   657   N NE  . ARG A 1 97  ? 0.491    -25.682 -0.880  1.00 33.25  ? 136  ARG A NE  1 
ATOM   658   C CZ  . ARG A 1 97  ? 0.776    -24.623 -0.118  1.00 46.30  ? 136  ARG A CZ  1 
ATOM   659   N NH1 . ARG A 1 97  ? 1.297    -23.523 -0.663  1.00 42.50  ? 136  ARG A NH1 1 
ATOM   660   N NH2 . ARG A 1 97  ? 0.554    -24.662 1.191   1.00 37.45  ? 136  ARG A NH2 1 
ATOM   661   N N   . SER A 1 98  ? -4.993   -26.546 -3.440  1.00 22.38  ? 137  SER A N   1 
ATOM   662   C CA  . SER A 1 98  ? -5.968   -27.630 -3.550  1.00 17.97  ? 137  SER A CA  1 
ATOM   663   C C   . SER A 1 98  ? -6.814   -27.535 -4.818  1.00 19.30  ? 137  SER A C   1 
ATOM   664   O O   . SER A 1 98  ? -7.431   -28.516 -5.226  1.00 27.09  ? 137  SER A O   1 
ATOM   665   C CB  . SER A 1 98  ? -6.896   -27.684 -2.332  1.00 24.14  ? 137  SER A CB  1 
ATOM   666   O OG  . SER A 1 98  ? -6.198   -27.927 -1.130  1.00 26.64  ? 137  SER A OG  1 
ATOM   667   N N   . ILE A 1 99  ? -6.884   -26.358 -5.431  1.00 27.23  ? 138  ILE A N   1 
ATOM   668   C CA  . ILE A 1 99  ? -7.746   -26.212 -6.598  1.00 22.57  ? 138  ILE A CA  1 
ATOM   669   C C   . ILE A 1 99  ? -7.008   -25.879 -7.891  1.00 26.18  ? 138  ILE A C   1 
ATOM   670   O O   . ILE A 1 99  ? -7.474   -26.216 -8.983  1.00 25.53  ? 138  ILE A O   1 
ATOM   671   C CB  . ILE A 1 99  ? -8.850   -25.154 -6.366  1.00 28.97  ? 138  ILE A CB  1 
ATOM   672   C CG1 . ILE A 1 99  ? -8.249   -23.736 -6.311  1.00 25.98  ? 138  ILE A CG1 1 
ATOM   673   C CG2 . ILE A 1 99  ? -9.638   -25.494 -5.101  1.00 25.61  ? 138  ILE A CG2 1 
ATOM   674   C CD1 . ILE A 1 99  ? -9.241   -22.637 -5.886  1.00 27.02  ? 138  ILE A CD1 1 
ATOM   675   N N   . ARG A 1 100 ? -5.867   -25.205 -7.769  1.00 24.31  ? 139  ARG A N   1 
ATOM   676   C CA  . ARG A 1 100 ? -5.150   -24.715 -8.945  1.00 27.17  ? 139  ARG A CA  1 
ATOM   677   C C   . ARG A 1 100 ? -4.872   -25.805 -10.003 1.00 25.77  ? 139  ARG A C   1 
ATOM   678   O O   . ARG A 1 100 ? -5.046   -25.568 -11.189 1.00 30.33  ? 139  ARG A O   1 
ATOM   679   C CB  . ARG A 1 100 ? -3.854   -24.003 -8.526  1.00 29.15  ? 139  ARG A CB  1 
ATOM   680   C CG  . ARG A 1 100 ? -2.998   -23.506 -9.683  1.00 32.57  ? 139  ARG A CG  1 
ATOM   681   C CD  . ARG A 1 100 ? -1.794   -22.722 -9.179  1.00 36.26  ? 139  ARG A CD  1 
ATOM   682   N NE  . ARG A 1 100 ? -2.187   -21.496 -8.490  1.00 32.79  ? 139  ARG A NE  1 
ATOM   683   C CZ  . ARG A 1 100 ? -2.376   -20.334 -9.102  1.00 38.22  ? 139  ARG A CZ  1 
ATOM   684   N NH1 . ARG A 1 100 ? -2.204   -20.245 -10.417 1.00 35.16  ? 139  ARG A NH1 1 
ATOM   685   N NH2 . ARG A 1 100 ? -2.740   -19.264 -8.406  1.00 30.41  ? 139  ARG A NH2 1 
ATOM   686   N N   . PRO A 1 101 ? -4.454   -27.011 -9.575  1.00 32.55  ? 140  PRO A N   1 
ATOM   687   C CA  . PRO A 1 101 ? -4.029   -28.067 -10.518 1.00 29.54  ? 140  PRO A CA  1 
ATOM   688   C C   . PRO A 1 101 ? -5.155   -28.598 -11.413 1.00 32.40  ? 140  PRO A C   1 
ATOM   689   O O   . PRO A 1 101 ? -4.895   -29.301 -12.401 1.00 30.39  ? 140  PRO A O   1 
ATOM   690   C CB  . PRO A 1 101 ? -3.567   -29.193 -9.588  1.00 30.92  ? 140  PRO A CB  1 
ATOM   691   C CG  . PRO A 1 101 ? -3.207   -28.503 -8.319  1.00 38.00  ? 140  PRO A CG  1 
ATOM   692   C CD  . PRO A 1 101 ? -4.188   -27.385 -8.177  1.00 26.34  ? 140  PRO A CD  1 
ATOM   693   N N   . LEU A 1 102 ? -6.392   -28.272 -11.067 1.00 30.24  ? 141  LEU A N   1 
ATOM   694   C CA  . LEU A 1 102 ? -7.551   -28.880 -11.728 1.00 31.60  ? 141  LEU A CA  1 
ATOM   695   C C   . LEU A 1 102 ? -8.179   -28.019 -12.807 1.00 28.24  ? 141  LEU A C   1 
ATOM   696   O O   . LEU A 1 102 ? -9.130   -28.446 -13.462 1.00 32.02  ? 141  LEU A O   1 
ATOM   697   C CB  . LEU A 1 102 ? -8.607   -29.268 -10.695 1.00 27.13  ? 141  LEU A CB  1 
ATOM   698   C CG  . LEU A 1 102 ? -8.040   -30.323 -9.744  1.00 34.25  ? 141  LEU A CG  1 
ATOM   699   C CD1 . LEU A 1 102 ? -9.117   -30.857 -8.859  1.00 37.09  ? 141  LEU A CD1 1 
ATOM   700   C CD2 . LEU A 1 102 ? -7.445   -31.449 -10.566 1.00 35.74  ? 141  LEU A CD2 1 
ATOM   701   N N   . PHE A 1 103 ? -7.670   -26.802 -12.976 1.00 26.54  ? 142  PHE A N   1 
ATOM   702   C CA  . PHE A 1 103 ? -8.087   -25.972 -14.094 1.00 26.30  ? 142  PHE A CA  1 
ATOM   703   C C   . PHE A 1 103 ? -7.442   -26.516 -15.355 1.00 28.94  ? 142  PHE A C   1 
ATOM   704   O O   . PHE A 1 103 ? -6.349   -27.087 -15.287 1.00 31.85  ? 142  PHE A O   1 
ATOM   705   C CB  . PHE A 1 103 ? -7.694   -24.509 -13.869 1.00 33.92  ? 142  PHE A CB  1 
ATOM   706   C CG  . PHE A 1 103 ? -8.523   -23.825 -12.821 1.00 27.15  ? 142  PHE A CG  1 
ATOM   707   C CD1 . PHE A 1 103 ? -8.092   -23.770 -11.505 1.00 21.81  ? 142  PHE A CD1 1 
ATOM   708   C CD2 . PHE A 1 103 ? -9.745   -23.264 -13.147 1.00 27.75  ? 142  PHE A CD2 1 
ATOM   709   C CE1 . PHE A 1 103 ? -8.865   -23.161 -10.534 1.00 25.25  ? 142  PHE A CE1 1 
ATOM   710   C CE2 . PHE A 1 103 ? -10.516  -22.651 -12.179 1.00 26.28  ? 142  PHE A CE2 1 
ATOM   711   C CZ  . PHE A 1 103 ? -10.070  -22.608 -10.868 1.00 25.91  ? 142  PHE A CZ  1 
ATOM   712   N N   . PRO A 1 104 ? -8.121   -26.362 -16.503 1.00 28.73  ? 143  PRO A N   1 
ATOM   713   C CA  . PRO A 1 104 ? -7.572   -26.835 -17.783 1.00 35.75  ? 143  PRO A CA  1 
ATOM   714   C C   . PRO A 1 104 ? -6.391   -25.995 -18.231 1.00 37.69  ? 143  PRO A C   1 
ATOM   715   O O   . PRO A 1 104 ? -6.318   -24.806 -17.907 1.00 37.63  ? 143  PRO A O   1 
ATOM   716   C CB  . PRO A 1 104 ? -8.741   -26.678 -18.767 1.00 37.76  ? 143  PRO A CB  1 
ATOM   717   C CG  . PRO A 1 104 ? -9.705   -25.727 -18.098 1.00 37.68  ? 143  PRO A CG  1 
ATOM   718   C CD  . PRO A 1 104 ? -9.514   -25.889 -16.624 1.00 32.25  ? 143  PRO A CD  1 
ATOM   719   N N   . ALA A 1 105 ? -5.466   -26.616 -18.959 1.00 37.92  ? 144  ALA A N   1 
ATOM   720   C CA  . ALA A 1 105 ? -4.323   -25.895 -19.493 1.00 38.87  ? 144  ALA A CA  1 
ATOM   721   C C   . ALA A 1 105 ? -4.853   -24.830 -20.421 1.00 29.70  ? 144  ALA A C   1 
ATOM   722   O O   . ALA A 1 105 ? -5.878   -25.025 -21.063 1.00 34.49  ? 144  ALA A O   1 
ATOM   723   C CB  . ALA A 1 105 ? -3.393   -26.844 -20.246 1.00 38.72  ? 144  ALA A CB  1 
ATOM   724   N N   . GLY A 1 106 ? -4.160   -23.702 -20.481 1.00 35.14  ? 145  GLY A N   1 
ATOM   725   C CA  . GLY A 1 106 ? -4.554   -22.618 -21.360 1.00 39.60  ? 145  GLY A CA  1 
ATOM   726   C C   . GLY A 1 106 ? -5.721   -21.781 -20.865 1.00 38.10  ? 145  GLY A C   1 
ATOM   727   O O   . GLY A 1 106 ? -6.187   -20.900 -21.583 1.00 36.53  ? 145  GLY A O   1 
ATOM   728   N N   . TYR A 1 107 ? -6.195   -22.034 -19.647 1.00 39.85  ? 146  TYR A N   1 
ATOM   729   C CA  . TYR A 1 107 ? -7.357   -21.295 -19.144 1.00 35.38  ? 146  TYR A CA  1 
ATOM   730   C C   . TYR A 1 107 ? -6.957   -19.915 -18.607 1.00 33.32  ? 146  TYR A C   1 
ATOM   731   O O   . TYR A 1 107 ? -6.925   -19.695 -17.402 1.00 34.18  ? 146  TYR A O   1 
ATOM   732   C CB  . TYR A 1 107 ? -8.147   -22.120 -18.108 1.00 36.22  ? 146  TYR A CB  1 
ATOM   733   C CG  . TYR A 1 107 ? -9.455   -21.472 -17.720 1.00 28.41  ? 146  TYR A CG  1 
ATOM   734   C CD1 . TYR A 1 107 ? -10.539  -21.488 -18.586 1.00 31.53  ? 146  TYR A CD1 1 
ATOM   735   C CD2 . TYR A 1 107 ? -9.596   -20.817 -16.498 1.00 28.48  ? 146  TYR A CD2 1 
ATOM   736   C CE1 . TYR A 1 107 ? -11.746  -20.871 -18.250 1.00 32.00  ? 146  TYR A CE1 1 
ATOM   737   C CE2 . TYR A 1 107 ? -10.805  -20.191 -16.147 1.00 31.93  ? 146  TYR A CE2 1 
ATOM   738   C CZ  . TYR A 1 107 ? -11.871  -20.220 -17.028 1.00 32.92  ? 146  TYR A CZ  1 
ATOM   739   O OH  . TYR A 1 107 ? -13.061  -19.600 -16.697 1.00 31.95  ? 146  TYR A OH  1 
ATOM   740   N N   . PHE A 1 108 ? -6.653   -18.986 -19.512 1.00 33.77  ? 147  PHE A N   1 
ATOM   741   C CA  . PHE A 1 108 ? -6.134   -17.667 -19.126 1.00 37.87  ? 147  PHE A CA  1 
ATOM   742   C C   . PHE A 1 108 ? -7.247   -16.648 -18.840 1.00 38.98  ? 147  PHE A C   1 
ATOM   743   O O   . PHE A 1 108 ? -7.404   -15.649 -19.557 1.00 35.49  ? 147  PHE A O   1 
ATOM   744   C CB  . PHE A 1 108 ? -5.169   -17.121 -20.187 1.00 46.84  ? 147  PHE A CB  1 
ATOM   745   C CG  . PHE A 1 108 ? -3.937   -17.974 -20.396 1.00 42.04  ? 147  PHE A CG  1 
ATOM   746   C CD1 . PHE A 1 108 ? -3.714   -19.107 -19.623 1.00 45.91  ? 147  PHE A CD1 1 
ATOM   747   C CD2 . PHE A 1 108 ? -3.000   -17.630 -21.356 1.00 52.60  ? 147  PHE A CD2 1 
ATOM   748   C CE1 . PHE A 1 108 ? -2.583   -19.889 -19.807 1.00 45.78  ? 147  PHE A CE1 1 
ATOM   749   C CE2 . PHE A 1 108 ? -1.864   -18.404 -21.548 1.00 53.21  ? 147  PHE A CE2 1 
ATOM   750   C CZ  . PHE A 1 108 ? -1.657   -19.536 -20.776 1.00 53.20  ? 147  PHE A CZ  1 
ATOM   751   N N   . TYR A 1 109 ? -8.013   -16.916 -17.787 1.00 34.53  ? 148  TYR A N   1 
ATOM   752   C CA  . TYR A 1 109 ? -9.145   -16.072 -17.401 1.00 31.99  ? 148  TYR A CA  1 
ATOM   753   C C   . TYR A 1 109 ? -9.078   -15.743 -15.926 1.00 33.25  ? 148  TYR A C   1 
ATOM   754   O O   . TYR A 1 109 ? -8.986   -16.633 -15.070 1.00 29.01  ? 148  TYR A O   1 
ATOM   755   C CB  . TYR A 1 109 ? -10.489  -16.740 -17.757 1.00 34.15  ? 148  TYR A CB  1 
ATOM   756   C CG  . TYR A 1 109 ? -10.598  -17.030 -19.235 1.00 35.60  ? 148  TYR A CG  1 
ATOM   757   C CD1 . TYR A 1 109 ? -10.100  -18.209 -19.763 1.00 36.27  ? 148  TYR A CD1 1 
ATOM   758   C CD2 . TYR A 1 109 ? -11.159  -16.105 -20.109 1.00 33.61  ? 148  TYR A CD2 1 
ATOM   759   C CE1 . TYR A 1 109 ? -10.173  -18.474 -21.116 1.00 33.79  ? 148  TYR A CE1 1 
ATOM   760   C CE2 . TYR A 1 109 ? -11.233  -16.357 -21.469 1.00 37.52  ? 148  TYR A CE2 1 
ATOM   761   C CZ  . TYR A 1 109 ? -10.732  -17.542 -21.968 1.00 40.20  ? 148  TYR A CZ  1 
ATOM   762   O OH  . TYR A 1 109 ? -10.793  -17.805 -23.320 1.00 41.84  ? 148  TYR A OH  1 
ATOM   763   N N   . ASP A 1 110 ? -9.095   -14.443 -15.659 1.00 30.95  ? 149  ASP A N   1 
ATOM   764   C CA  . ASP A 1 110 ? -9.086   -13.886 -14.321 1.00 33.34  ? 149  ASP A CA  1 
ATOM   765   C C   . ASP A 1 110 ? -10.117  -14.571 -13.451 1.00 34.58  ? 149  ASP A C   1 
ATOM   766   O O   . ASP A 1 110 ? -11.313  -14.510 -13.743 1.00 28.51  ? 149  ASP A O   1 
ATOM   767   C CB  . ASP A 1 110 ? -9.426   -12.398 -14.400 1.00 37.84  ? 149  ASP A CB  1 
ATOM   768   C CG  . ASP A 1 110 ? -8.388   -11.545 -13.758 1.00 59.11  ? 149  ASP A CG  1 
ATOM   769   O OD1 . ASP A 1 110 ? -8.362   -11.513 -12.508 1.00 53.46  ? 149  ASP A OD1 1 
ATOM   770   O OD2 . ASP A 1 110 ? -7.593   -10.924 -14.501 1.00 74.89  ? 149  ASP A OD2 1 
ATOM   771   N N   . THR A 1 111 ? -9.656   -15.206 -12.376 1.00 31.41  ? 150  THR A N   1 
ATOM   772   C CA  . THR A 1 111 ? -10.529  -16.027 -11.543 1.00 29.01  ? 150  THR A CA  1 
ATOM   773   C C   . THR A 1 111 ? -10.273  -15.744 -10.064 1.00 35.33  ? 150  THR A C   1 
ATOM   774   O O   . THR A 1 111 ? -9.118   -15.700 -9.616  1.00 30.18  ? 150  THR A O   1 
ATOM   775   C CB  . THR A 1 111 ? -10.314  -17.507 -11.838 1.00 29.68  ? 150  THR A CB  1 
ATOM   776   O OG1 . THR A 1 111 ? -10.442  -17.725 -13.247 1.00 33.44  ? 150  THR A OG1 1 
ATOM   777   C CG2 . THR A 1 111 ? -11.335  -18.352 -11.101 1.00 29.57  ? 150  THR A CG2 1 
ATOM   778   N N   . GLN A 1 112 ? -11.340  -15.528 -9.306  1.00 25.46  ? 151  GLN A N   1 
ATOM   779   C CA  . GLN A 1 112 ? -11.176  -15.197 -7.901  1.00 26.02  ? 151  GLN A CA  1 
ATOM   780   C C   . GLN A 1 112 ? -12.066  -16.053 -7.023  1.00 27.67  ? 151  GLN A C   1 
ATOM   781   O O   . GLN A 1 112 ? -13.258  -16.217 -7.301  1.00 28.44  ? 151  GLN A O   1 
ATOM   782   C CB  . GLN A 1 112 ? -11.434  -13.711 -7.645  1.00 26.18  ? 151  GLN A CB  1 
ATOM   783   C CG  . GLN A 1 112 ? -11.206  -13.284 -6.195  1.00 24.25  ? 151  GLN A CG  1 
ATOM   784   C CD  . GLN A 1 112 ? -11.439  -11.787 -6.001  1.00 30.04  ? 151  GLN A CD  1 
ATOM   785   O OE1 . GLN A 1 112 ? -12.431  -11.233 -6.483  1.00 28.90  ? 151  GLN A OE1 1 
ATOM   786   N NE2 . GLN A 1 112 ? -10.517  -11.127 -5.302  1.00 32.74  ? 151  GLN A NE2 1 
ATOM   787   N N   . VAL A 1 113 ? -11.460  -16.630 -5.983  1.00 27.01  ? 152  VAL A N   1 
ATOM   788   C CA  . VAL A 1 113 ? -12.181  -17.419 -4.993  1.00 24.50  ? 152  VAL A CA  1 
ATOM   789   C C   . VAL A 1 113 ? -12.136  -16.715 -3.639  1.00 28.10  ? 152  VAL A C   1 
ATOM   790   O O   . VAL A 1 113 ? -11.061  -16.472 -3.104  1.00 28.06  ? 152  VAL A O   1 
ATOM   791   C CB  . VAL A 1 113 ? -11.570  -18.820 -4.863  1.00 27.74  ? 152  VAL A CB  1 
ATOM   792   C CG1 . VAL A 1 113 ? -12.276  -19.601 -3.788  1.00 26.30  ? 152  VAL A CG1 1 
ATOM   793   C CG2 . VAL A 1 113 ? -11.628  -19.546 -6.214  1.00 23.30  ? 152  VAL A CG2 1 
ATOM   794   N N   . LEU A 1 114 ? -13.301  -16.372 -3.093  1.00 23.85  ? 153  LEU A N   1 
ATOM   795   C CA  . LEU A 1 114 ? -13.376  -15.640 -1.824  1.00 23.39  ? 153  LEU A CA  1 
ATOM   796   C C   . LEU A 1 114 ? -14.099  -16.449 -0.755  1.00 30.16  ? 153  LEU A C   1 
ATOM   797   O O   . LEU A 1 114 ? -15.088  -17.117 -1.042  1.00 27.31  ? 153  LEU A O   1 
ATOM   798   C CB  . LEU A 1 114 ? -14.112  -14.310 -2.019  1.00 27.79  ? 153  LEU A CB  1 
ATOM   799   C CG  . LEU A 1 114 ? -13.386  -13.247 -2.843  1.00 33.26  ? 153  LEU A CG  1 
ATOM   800   C CD1 . LEU A 1 114 ? -14.334  -12.130 -3.286  1.00 32.26  ? 153  LEU A CD1 1 
ATOM   801   C CD2 . LEU A 1 114 ? -12.239  -12.683 -2.037  1.00 41.19  ? 153  LEU A CD2 1 
ATOM   802   N N   . CYS A 1 115 ? -13.625  -16.358 0.483   1.00 29.54  ? 154  CYS A N   1 
ATOM   803   C CA  . CYS A 1 115 ? -14.202  -17.116 1.588   1.00 29.62  ? 154  CYS A CA  1 
ATOM   804   C C   . CYS A 1 115 ? -14.740  -16.175 2.663   1.00 33.46  ? 154  CYS A C   1 
ATOM   805   O O   . CYS A 1 115 ? -14.060  -15.243 3.080   1.00 37.29  ? 154  CYS A O   1 
ATOM   806   C CB  . CYS A 1 115 ? -13.144  -18.038 2.199   1.00 27.57  ? 154  CYS A CB  1 
ATOM   807   S SG  . CYS A 1 115 ? -12.304  -19.042 0.991   1.00 31.19  ? 154  CYS A SG  1 
ATOM   808   N N   . ASN A 1 116 ? -15.965  -16.432 3.104   1.00 36.21  ? 155  ASN A N   1 
ATOM   809   C CA  . ASN A 1 116 ? -16.617  -15.641 4.143   1.00 30.91  ? 155  ASN A CA  1 
ATOM   810   C C   . ASN A 1 116 ? -16.953  -16.556 5.319   1.00 31.40  ? 155  ASN A C   1 
ATOM   811   O O   . ASN A 1 116 ? -17.740  -17.491 5.166   1.00 27.72  ? 155  ASN A O   1 
ATOM   812   C CB  . ASN A 1 116 ? -17.898  -15.012 3.575   1.00 29.62  ? 155  ASN A CB  1 
ATOM   813   C CG  . ASN A 1 116 ? -18.642  -14.127 4.582   1.00 39.71  ? 155  ASN A CG  1 
ATOM   814   O OD1 . ASN A 1 116 ? -18.627  -14.368 5.792   1.00 33.37  ? 155  ASN A OD1 1 
ATOM   815   N ND2 . ASN A 1 116 ? -19.310  -13.092 4.068   1.00 38.83  ? 155  ASN A ND2 1 
ATOM   816   N N   . LEU A 1 117 ? -16.353  -16.304 6.481   1.00 30.41  ? 156  LEU A N   1 
ATOM   817   C CA  . LEU A 1 117 ? -16.706  -17.055 7.683   1.00 25.40  ? 156  LEU A CA  1 
ATOM   818   C C   . LEU A 1 117 ? -18.037  -16.531 8.236   1.00 29.76  ? 156  LEU A C   1 
ATOM   819   O O   . LEU A 1 117 ? -18.081  -15.516 8.940   1.00 33.36  ? 156  LEU A O   1 
ATOM   820   C CB  . LEU A 1 117 ? -15.594  -16.969 8.732   1.00 28.70  ? 156  LEU A CB  1 
ATOM   821   C CG  . LEU A 1 117 ? -14.443  -17.984 8.602   1.00 34.66  ? 156  LEU A CG  1 
ATOM   822   C CD1 . LEU A 1 117 ? -13.943  -18.117 7.178   1.00 27.20  ? 156  LEU A CD1 1 
ATOM   823   C CD2 . LEU A 1 117 ? -13.283  -17.659 9.564   1.00 41.85  ? 156  LEU A CD2 1 
ATOM   824   N N   . LEU A 1 118 ? -19.124  -17.211 7.882   1.00 24.18  ? 157  LEU A N   1 
ATOM   825   C CA  . LEU A 1 118 ? -20.457  -16.784 8.286   1.00 30.04  ? 157  LEU A CA  1 
ATOM   826   C C   . LEU A 1 118 ? -20.583  -16.881 9.806   1.00 35.31  ? 157  LEU A C   1 
ATOM   827   O O   . LEU A 1 118 ? -21.223  -16.048 10.442  1.00 29.70  ? 157  LEU A O   1 
ATOM   828   C CB  . LEU A 1 118 ? -21.526  -17.639 7.601   1.00 31.21  ? 157  LEU A CB  1 
ATOM   829   C CG  . LEU A 1 118 ? -21.486  -17.653 6.071   1.00 36.54  ? 157  LEU A CG  1 
ATOM   830   C CD1 . LEU A 1 118 ? -22.468  -18.679 5.495   1.00 35.94  ? 157  LEU A CD1 1 
ATOM   831   C CD2 . LEU A 1 118 ? -21.772  -16.268 5.525   1.00 27.43  ? 157  LEU A CD2 1 
ATOM   832   N N   . ALA A 1 119 ? -19.948  -17.900 10.376  1.00 28.57  ? 158  ALA A N   1 
ATOM   833   C CA  . ALA A 1 119 ? -20.022  -18.169 11.804  1.00 27.74  ? 158  ALA A CA  1 
ATOM   834   C C   . ALA A 1 119 ? -18.936  -19.162 12.183  1.00 26.31  ? 158  ALA A C   1 
ATOM   835   O O   . ALA A 1 119 ? -18.636  -20.087 11.436  1.00 24.28  ? 158  ALA A O   1 
ATOM   836   C CB  . ALA A 1 119 ? -21.393  -18.726 12.171  1.00 29.25  ? 158  ALA A CB  1 
ATOM   837   N N   . VAL A 1 120 ? -18.372  -18.981 13.364  1.00 25.63  ? 159  VAL A N   1 
ATOM   838   C CA  . VAL A 1 120 ? -17.301  -19.834 13.843  1.00 27.00  ? 159  VAL A CA  1 
ATOM   839   C C   . VAL A 1 120 ? -17.659  -20.204 15.269  1.00 39.47  ? 159  VAL A C   1 
ATOM   840   O O   . VAL A 1 120 ? -18.003  -19.331 16.062  1.00 39.70  ? 159  VAL A O   1 
ATOM   841   C CB  . VAL A 1 120 ? -15.951  -19.074 13.828  1.00 38.24  ? 159  VAL A CB  1 
ATOM   842   C CG1 . VAL A 1 120 ? -14.868  -19.893 14.484  1.00 41.01  ? 159  VAL A CG1 1 
ATOM   843   C CG2 . VAL A 1 120 ? -15.558  -18.727 12.401  1.00 35.72  ? 159  VAL A CG2 1 
ATOM   844   N N   . ASP A 1 121 ? -17.595  -21.487 15.606  1.00 33.68  ? 160  ASP A N   1 
ATOM   845   C CA  . ASP A 1 121 ? -18.037  -21.906 16.931  1.00 35.55  ? 160  ASP A CA  1 
ATOM   846   C C   . ASP A 1 121 ? -16.883  -22.163 17.908  1.00 40.00  ? 160  ASP A C   1 
ATOM   847   O O   . ASP A 1 121 ? -17.108  -22.581 19.042  1.00 37.66  ? 160  ASP A O   1 
ATOM   848   C CB  . ASP A 1 121 ? -18.961  -23.126 16.857  1.00 26.98  ? 160  ASP A CB  1 
ATOM   849   C CG  . ASP A 1 121 ? -18.271  -24.356 16.347  1.00 27.86  ? 160  ASP A CG  1 
ATOM   850   O OD1 . ASP A 1 121 ? -17.047  -24.307 16.104  1.00 34.54  ? 160  ASP A OD1 1 
ATOM   851   O OD2 . ASP A 1 121 ? -18.961  -25.386 16.202  1.00 31.27  ? 160  ASP A OD2 1 
ATOM   852   N N   . GLY A 1 122 ? -15.657  -21.909 17.469  1.00 33.06  ? 161  GLY A N   1 
ATOM   853   C CA  . GLY A 1 122 ? -14.502  -22.085 18.332  1.00 32.75  ? 161  GLY A CA  1 
ATOM   854   C C   . GLY A 1 122 ? -14.184  -23.549 18.598  1.00 34.63  ? 161  GLY A C   1 
ATOM   855   O O   . GLY A 1 122 ? -13.314  -23.858 19.410  1.00 42.89  ? 161  GLY A O   1 
ATOM   856   N N   . VAL A 1 123 ? -14.877  -24.447 17.904  1.00 33.21  ? 162  VAL A N   1 
ATOM   857   C CA  . VAL A 1 123 ? -14.686  -25.886 18.075  1.00 29.71  ? 162  VAL A CA  1 
ATOM   858   C C   . VAL A 1 123 ? -14.310  -26.550 16.750  1.00 38.40  ? 162  VAL A C   1 
ATOM   859   O O   . VAL A 1 123 ? -13.313  -27.301 16.664  1.00 31.83  ? 162  VAL A O   1 
ATOM   860   C CB  . VAL A 1 123 ? -15.965  -26.554 18.611  1.00 35.22  ? 162  VAL A CB  1 
ATOM   861   C CG1 . VAL A 1 123 ? -15.885  -28.088 18.484  1.00 28.48  ? 162  VAL A CG1 1 
ATOM   862   C CG2 . VAL A 1 123 ? -16.247  -26.104 20.057  1.00 35.16  ? 162  VAL A CG2 1 
ATOM   863   N N   . ASN A 1 124 ? -15.116  -26.276 15.725  1.00 25.98  ? 163  ASN A N   1 
ATOM   864   C CA  . ASN A 1 124 ? -14.882  -26.808 14.387  1.00 30.02  ? 163  ASN A CA  1 
ATOM   865   C C   . ASN A 1 124 ? -14.164  -25.793 13.515  1.00 28.29  ? 163  ASN A C   1 
ATOM   866   O O   . ASN A 1 124 ? -14.661  -24.676 13.318  1.00 25.71  ? 163  ASN A O   1 
ATOM   867   C CB  . ASN A 1 124 ? -16.204  -27.180 13.725  1.00 26.58  ? 163  ASN A CB  1 
ATOM   868   C CG  . ASN A 1 124 ? -16.897  -28.335 14.420  1.00 35.75  ? 163  ASN A CG  1 
ATOM   869   O OD1 . ASN A 1 124 ? -16.678  -29.492 14.079  1.00 39.03  ? 163  ASN A OD1 1 
ATOM   870   N ND2 . ASN A 1 124 ? -17.741  -28.022 15.398  1.00 29.14  ? 163  ASN A ND2 1 
ATOM   871   N N   . GLU A 1 125 ? -13.016  -26.204 12.982  1.00 26.82  ? 164  GLU A N   1 
ATOM   872   C CA  . GLU A 1 125 ? -12.116  -25.340 12.211  1.00 30.61  ? 164  GLU A CA  1 
ATOM   873   C C   . GLU A 1 125 ? -12.690  -24.960 10.861  1.00 25.32  ? 164  GLU A C   1 
ATOM   874   O O   . GLU A 1 125 ? -13.088  -25.825 10.096  1.00 26.38  ? 164  GLU A O   1 
ATOM   875   C CB  . GLU A 1 125 ? -10.772  -26.052 11.981  1.00 25.28  ? 164  GLU A CB  1 
ATOM   876   C CG  . GLU A 1 125 ? -9.926   -26.123 13.221  1.00 34.76  ? 164  GLU A CG  1 
ATOM   877   C CD  . GLU A 1 125 ? -9.497   -24.754 13.692  1.00 40.23  ? 164  GLU A CD  1 
ATOM   878   O OE1 . GLU A 1 125 ? -9.575   -24.494 14.909  1.00 49.83  ? 164  GLU A OE1 1 
ATOM   879   O OE2 . GLU A 1 125 ? -9.080   -23.936 12.844  1.00 45.97  ? 164  GLU A OE2 1 
ATOM   880   N N   . PRO A 1 126 ? -12.711  -23.661 10.558  1.00 26.50  ? 165  PRO A N   1 
ATOM   881   C CA  . PRO A 1 126 ? -13.262  -23.227 9.267   1.00 26.76  ? 165  PRO A CA  1 
ATOM   882   C C   . PRO A 1 126 ? -12.321  -23.444 8.082   1.00 25.96  ? 165  PRO A C   1 
ATOM   883   O O   . PRO A 1 126 ? -12.825  -23.545 6.967   1.00 25.43  ? 165  PRO A O   1 
ATOM   884   C CB  . PRO A 1 126 ? -13.524  -21.739 9.487   1.00 22.27  ? 165  PRO A CB  1 
ATOM   885   C CG  . PRO A 1 126 ? -12.500  -21.334 10.559  1.00 26.22  ? 165  PRO A CG  1 
ATOM   886   C CD  . PRO A 1 126 ? -12.391  -22.533 11.454  1.00 27.10  ? 165  PRO A CD  1 
ATOM   887   N N   . ASP A 1 127 ? -11.005  -23.535 8.302   1.00 24.92  ? 166  ASP A N   1 
ATOM   888   C CA  . ASP A 1 127 ? -10.074  -23.667 7.167   1.00 28.81  ? 166  ASP A CA  1 
ATOM   889   C C   . ASP A 1 127 ? -10.397  -24.836 6.222   1.00 24.89  ? 166  ASP A C   1 
ATOM   890   O O   . ASP A 1 127 ? -10.479  -24.664 5.010   1.00 25.24  ? 166  ASP A O   1 
ATOM   891   C CB  . ASP A 1 127 ? -8.583   -23.663 7.596   1.00 29.45  ? 166  ASP A CB  1 
ATOM   892   C CG  . ASP A 1 127 ? -8.212   -24.779 8.586   1.00 28.55  ? 166  ASP A CG  1 
ATOM   893   O OD1 . ASP A 1 127 ? -9.005   -25.703 8.855   1.00 25.28  ? 166  ASP A OD1 1 
ATOM   894   O OD2 . ASP A 1 127 ? -7.085   -24.722 9.106   1.00 29.24  ? 166  ASP A OD2 1 
ATOM   895   N N   . VAL A 1 128 ? -10.608  -26.015 6.784   1.00 23.86  ? 167  VAL A N   1 
ATOM   896   C CA  . VAL A 1 128 ? -10.919  -27.186 5.977   1.00 21.55  ? 167  VAL A CA  1 
ATOM   897   C C   . VAL A 1 128 ? -12.274  -27.040 5.296   1.00 28.16  ? 167  VAL A C   1 
ATOM   898   O O   . VAL A 1 128 ? -12.457  -27.459 4.157   1.00 25.04  ? 167  VAL A O   1 
ATOM   899   C CB  . VAL A 1 128 ? -10.851  -28.467 6.842   1.00 29.33  ? 167  VAL A CB  1 
ATOM   900   C CG1 . VAL A 1 128 ? -11.424  -29.660 6.102   1.00 33.38  ? 167  VAL A CG1 1 
ATOM   901   C CG2 . VAL A 1 128 ? -9.396   -28.740 7.239   1.00 32.89  ? 167  VAL A CG2 1 
ATOM   902   N N   . LEU A 1 129 ? -13.228  -26.429 5.994   1.00 24.66  ? 168  LEU A N   1 
ATOM   903   C CA  . LEU A 1 129 ? -14.526  -26.133 5.405   1.00 18.98  ? 168  LEU A CA  1 
ATOM   904   C C   . LEU A 1 129 ? -14.349  -25.290 4.147   1.00 24.72  ? 168  LEU A C   1 
ATOM   905   O O   . LEU A 1 129 ? -15.024  -25.503 3.133   1.00 23.79  ? 168  LEU A O   1 
ATOM   906   C CB  . LEU A 1 129 ? -15.413  -25.400 6.428   1.00 19.67  ? 168  LEU A CB  1 
ATOM   907   C CG  . LEU A 1 129 ? -16.243  -26.297 7.361   1.00 31.84  ? 168  LEU A CG  1 
ATOM   908   C CD1 . LEU A 1 129 ? -15.634  -27.675 7.576   1.00 32.82  ? 168  LEU A CD1 1 
ATOM   909   C CD2 . LEU A 1 129 ? -16.588  -25.647 8.677   1.00 21.13  ? 168  LEU A CD2 1 
ATOM   910   N N   . ALA A 1 130 ? -13.437  -24.326 4.213   1.00 20.84  ? 169  ALA A N   1 
ATOM   911   C CA  . ALA A 1 130 ? -13.252  -23.395 3.099   1.00 24.73  ? 169  ALA A CA  1 
ATOM   912   C C   . ALA A 1 130 ? -12.665  -24.105 1.882   1.00 26.69  ? 169  ALA A C   1 
ATOM   913   O O   . ALA A 1 130 ? -13.105  -23.875 0.756   1.00 25.71  ? 169  ALA A O   1 
ATOM   914   C CB  . ALA A 1 130 ? -12.370  -22.236 3.512   1.00 23.46  ? 169  ALA A CB  1 
ATOM   915   N N   . ILE A 1 131 ? -11.686  -24.983 2.102   1.00 25.32  ? 170  ILE A N   1 
ATOM   916   C CA  . ILE A 1 131 ? -11.151  -25.778 0.987   1.00 25.78  ? 170  ILE A CA  1 
ATOM   917   C C   . ILE A 1 131 ? -12.298  -26.522 0.275   1.00 25.49  ? 170  ILE A C   1 
ATOM   918   O O   . ILE A 1 131 ? -12.447  -26.443 -0.943  1.00 25.66  ? 170  ILE A O   1 
ATOM   919   C CB  . ILE A 1 131 ? -10.099  -26.797 1.435   1.00 23.32  ? 170  ILE A CB  1 
ATOM   920   C CG1 . ILE A 1 131 ? -8.951   -26.128 2.202   1.00 22.42  ? 170  ILE A CG1 1 
ATOM   921   C CG2 . ILE A 1 131 ? -9.549   -27.544 0.221   1.00 24.58  ? 170  ILE A CG2 1 
ATOM   922   C CD1 . ILE A 1 131 ? -7.957   -27.154 2.802   1.00 21.66  ? 170  ILE A CD1 1 
ATOM   923   N N   . ASN A 1 132 ? -13.123  -27.230 1.041   1.00 20.37  ? 171  ASN A N   1 
ATOM   924   C CA  . ASN A 1 132 ? -14.274  -27.919 0.456   1.00 29.27  ? 171  ASN A CA  1 
ATOM   925   C C   . ASN A 1 132 ? -15.249  -26.944 -0.204  1.00 24.22  ? 171  ASN A C   1 
ATOM   926   O O   . ASN A 1 132 ? -15.865  -27.251 -1.232  1.00 23.72  ? 171  ASN A O   1 
ATOM   927   C CB  . ASN A 1 132 ? -15.008  -28.758 1.513   1.00 22.55  ? 171  ASN A CB  1 
ATOM   928   C CG  . ASN A 1 132 ? -14.188  -29.965 1.978   1.00 25.72  ? 171  ASN A CG  1 
ATOM   929   O OD1 . ASN A 1 132 ? -14.057  -30.952 1.250   1.00 23.06  ? 171  ASN A OD1 1 
ATOM   930   N ND2 . ASN A 1 132 ? -13.663  -29.898 3.200   1.00 21.83  ? 171  ASN A ND2 1 
ATOM   931   N N   . GLY A 1 133 ? -15.396  -25.774 0.404   1.00 22.36  ? 172  GLY A N   1 
ATOM   932   C CA  . GLY A 1 133 ? -16.285  -24.746 -0.129  1.00 28.36  ? 172  GLY A CA  1 
ATOM   933   C C   . GLY A 1 133 ? -15.851  -24.311 -1.521  1.00 26.31  ? 172  GLY A C   1 
ATOM   934   O O   . GLY A 1 133 ? -16.666  -24.182 -2.431  1.00 25.17  ? 172  GLY A O   1 
ATOM   935   N N   . ALA A 1 134 ? -14.552  -24.084 -1.685  1.00 23.79  ? 173  ALA A N   1 
ATOM   936   C CA  . ALA A 1 134 ? -13.993  -23.713 -2.985  1.00 23.74  ? 173  ALA A CA  1 
ATOM   937   C C   . ALA A 1 134 ? -14.287  -24.779 -4.036  1.00 23.21  ? 173  ALA A C   1 
ATOM   938   O O   . ALA A 1 134 ? -14.656  -24.468 -5.167  1.00 23.13  ? 173  ALA A O   1 
ATOM   939   C CB  . ALA A 1 134 ? -12.480  -23.484 -2.866  1.00 26.37  ? 173  ALA A CB  1 
ATOM   940   N N   . SER A 1 135 ? -14.133  -26.038 -3.642  1.00 20.84  ? 174  SER A N   1 
ATOM   941   C CA  . SER A 1 135 ? -14.395  -27.169 -4.523  1.00 24.96  ? 174  SER A CA  1 
ATOM   942   C C   . SER A 1 135 ? -15.859  -27.220 -4.946  1.00 25.11  ? 174  SER A C   1 
ATOM   943   O O   . SER A 1 135 ? -16.179  -27.398 -6.129  1.00 23.85  ? 174  SER A O   1 
ATOM   944   C CB  . SER A 1 135 ? -14.021  -28.487 -3.828  1.00 24.07  ? 174  SER A CB  1 
ATOM   945   O OG  . SER A 1 135 ? -14.487  -29.599 -4.568  1.00 23.59  ? 174  SER A OG  1 
ATOM   946   N N   . VAL A 1 136 ? -16.768  -27.073 -3.996  1.00 26.10  ? 175  VAL A N   1 
ATOM   947   C CA  . VAL A 1 136 ? -18.167  -27.125 -4.420  1.00 27.16  ? 175  VAL A CA  1 
ATOM   948   C C   . VAL A 1 136 ? -18.622  -25.888 -5.221  1.00 25.35  ? 175  VAL A C   1 
ATOM   949   O O   . VAL A 1 136 ? -19.342  -26.040 -6.207  1.00 24.09  ? 175  VAL A O   1 
ATOM   950   C CB  . VAL A 1 136 ? -19.175  -27.690 -3.343  1.00 34.77  ? 175  VAL A CB  1 
ATOM   951   C CG1 . VAL A 1 136 ? -18.523  -27.918 -1.990  1.00 30.80  ? 175  VAL A CG1 1 
ATOM   952   C CG2 . VAL A 1 136 ? -20.468  -26.897 -3.278  1.00 22.53  ? 175  VAL A CG2 1 
ATOM   953   N N   . ALA A 1 137 ? -18.124  -24.696 -4.875  1.00 24.31  ? 176  ALA A N   1 
ATOM   954   C CA  . ALA A 1 137 ? -18.435  -23.502 -5.667  1.00 26.66  ? 176  ALA A CA  1 
ATOM   955   C C   . ALA A 1 137 ? -17.976  -23.648 -7.118  1.00 29.44  ? 176  ALA A C   1 
ATOM   956   O O   . ALA A 1 137 ? -18.728  -23.342 -8.050  1.00 24.13  ? 176  ALA A O   1 
ATOM   957   C CB  . ALA A 1 137 ? -17.840  -22.235 -5.033  1.00 21.02  ? 176  ALA A CB  1 
ATOM   958   N N   . LEU A 1 138 ? -16.741  -24.113 -7.308  1.00 26.23  ? 177  LEU A N   1 
ATOM   959   C CA  . LEU A 1 138 ? -16.225  -24.352 -8.654  1.00 26.16  ? 177  LEU A CA  1 
ATOM   960   C C   . LEU A 1 138 ? -17.038  -25.443 -9.343  1.00 25.34  ? 177  LEU A C   1 
ATOM   961   O O   . LEU A 1 138 ? -17.403  -25.309 -10.517 1.00 24.42  ? 177  LEU A O   1 
ATOM   962   C CB  . LEU A 1 138 ? -14.714  -24.714 -8.630  1.00 23.25  ? 177  LEU A CB  1 
ATOM   963   C CG  . LEU A 1 138 ? -13.743  -23.549 -8.373  1.00 28.24  ? 177  LEU A CG  1 
ATOM   964   C CD1 . LEU A 1 138 ? -12.301  -24.027 -8.083  1.00 25.79  ? 177  LEU A CD1 1 
ATOM   965   C CD2 . LEU A 1 138 ? -13.753  -22.573 -9.544  1.00 24.80  ? 177  LEU A CD2 1 
ATOM   966   N N   . SER A 1 139 ? -17.337  -26.515 -8.616  1.00 22.37  ? 178  SER A N   1 
ATOM   967   C CA  . SER A 1 139 ? -18.074  -27.635 -9.204  1.00 25.11  ? 178  SER A CA  1 
ATOM   968   C C   . SER A 1 139 ? -19.464  -27.234 -9.694  1.00 31.28  ? 178  SER A C   1 
ATOM   969   O O   . SER A 1 139 ? -19.903  -27.687 -10.746 1.00 29.92  ? 178  SER A O   1 
ATOM   970   C CB  . SER A 1 139 ? -18.187  -28.813 -8.237  1.00 23.49  ? 178  SER A CB  1 
ATOM   971   O OG  . SER A 1 139 ? -16.909  -29.226 -7.789  1.00 28.19  ? 178  SER A OG  1 
ATOM   972   N N   . LEU A 1 140 ? -20.141  -26.377 -8.933  1.00 28.29  ? 179  LEU A N   1 
ATOM   973   C CA  . LEU A 1 140 ? -21.510  -25.989 -9.247  1.00 25.30  ? 179  LEU A CA  1 
ATOM   974   C C   . LEU A 1 140 ? -21.536  -24.825 -10.228 1.00 31.17  ? 179  LEU A C   1 
ATOM   975   O O   . LEU A 1 140 ? -22.578  -24.480 -10.758 1.00 33.97  ? 179  LEU A O   1 
ATOM   976   C CB  . LEU A 1 140 ? -22.289  -25.662 -7.968  1.00 26.65  ? 179  LEU A CB  1 
ATOM   977   C CG  . LEU A 1 140 ? -22.464  -26.849 -7.003  1.00 34.91  ? 179  LEU A CG  1 
ATOM   978   C CD1 . LEU A 1 140 ? -23.181  -26.447 -5.717  1.00 28.17  ? 179  LEU A CD1 1 
ATOM   979   C CD2 . LEU A 1 140 ? -23.189  -28.021 -7.676  1.00 31.16  ? 179  LEU A CD2 1 
ATOM   980   N N   . SER A 1 141 ? -20.373  -24.246 -10.493 1.00 27.04  ? 180  SER A N   1 
ATOM   981   C CA  . SER A 1 141 ? -20.286  -23.095 -11.379 1.00 27.46  ? 180  SER A CA  1 
ATOM   982   C C   . SER A 1 141 ? -20.151  -23.524 -12.837 1.00 28.35  ? 180  SER A C   1 
ATOM   983   O O   . SER A 1 141 ? -19.945  -24.697 -13.121 1.00 25.78  ? 180  SER A O   1 
ATOM   984   C CB  . SER A 1 141 ? -19.070  -22.250 -11.014 1.00 25.58  ? 180  SER A CB  1 
ATOM   985   O OG  . SER A 1 141 ? -17.892  -22.879 -11.489 1.00 27.60  ? 180  SER A OG  1 
ATOM   986   N N   . ASP A 1 142 ? -20.240  -22.560 -13.750 1.00 26.99  ? 181  ASP A N   1 
ATOM   987   C CA  . ASP A 1 142 ? -19.995  -22.817 -15.168 1.00 28.59  ? 181  ASP A CA  1 
ATOM   988   C C   . ASP A 1 142 ? -18.517  -22.693 -15.540 1.00 29.08  ? 181  ASP A C   1 
ATOM   989   O O   . ASP A 1 142 ? -18.179  -22.618 -16.723 1.00 32.95  ? 181  ASP A O   1 
ATOM   990   C CB  . ASP A 1 142 ? -20.841  -21.881 -16.042 1.00 28.74  ? 181  ASP A CB  1 
ATOM   991   C CG  . ASP A 1 142 ? -20.337  -20.441 -16.041 1.00 34.29  ? 181  ASP A CG  1 
ATOM   992   O OD1 . ASP A 1 142 ? -19.370  -20.122 -15.318 1.00 35.58  ? 181  ASP A OD1 1 
ATOM   993   O OD2 . ASP A 1 142 ? -20.927  -19.608 -16.767 1.00 35.73  ? 181  ASP A OD2 1 
ATOM   994   N N   . ILE A 1 143 ? -17.642  -22.664 -14.536 1.00 26.73  ? 182  ILE A N   1 
ATOM   995   C CA  . ILE A 1 143 ? -16.197  -22.559 -14.760 1.00 27.58  ? 182  ILE A CA  1 
ATOM   996   C C   . ILE A 1 143 ? -15.557  -23.938 -14.959 1.00 26.98  ? 182  ILE A C   1 
ATOM   997   O O   . ILE A 1 143 ? -15.727  -24.826 -14.127 1.00 28.00  ? 182  ILE A O   1 
ATOM   998   C CB  . ILE A 1 143 ? -15.493  -21.873 -13.575 1.00 28.72  ? 182  ILE A CB  1 
ATOM   999   C CG1 . ILE A 1 143 ? -16.131  -20.518 -13.281 1.00 25.28  ? 182  ILE A CG1 1 
ATOM   1000  C CG2 . ILE A 1 143 ? -13.964  -21.750 -13.818 1.00 27.51  ? 182  ILE A CG2 1 
ATOM   1001  C CD1 . ILE A 1 143 ? -15.742  -19.958 -11.922 1.00 29.01  ? 182  ILE A CD1 1 
ATOM   1002  N N   . PRO A 1 144 ? -14.835  -24.119 -16.075 1.00 28.93  ? 183  PRO A N   1 
ATOM   1003  C CA  . PRO A 1 144 ? -14.139  -25.381 -16.363 1.00 32.08  ? 183  PRO A CA  1 
ATOM   1004  C C   . PRO A 1 144 ? -13.180  -25.706 -15.242 1.00 26.25  ? 183  PRO A C   1 
ATOM   1005  O O   . PRO A 1 144 ? -12.304  -24.897 -14.935 1.00 29.77  ? 183  PRO A O   1 
ATOM   1006  C CB  . PRO A 1 144 ? -13.351  -25.068 -17.637 1.00 30.25  ? 183  PRO A CB  1 
ATOM   1007  C CG  . PRO A 1 144 ? -14.094  -23.937 -18.273 1.00 35.78  ? 183  PRO A CG  1 
ATOM   1008  C CD  . PRO A 1 144 ? -14.630  -23.116 -17.135 1.00 31.27  ? 183  PRO A CD  1 
ATOM   1009  N N   . TRP A 1 145 ? -13.367  -26.866 -14.628 1.00 29.89  ? 184  TRP A N   1 
ATOM   1010  C CA  . TRP A 1 145 ? -12.567  -27.287 -13.484 1.00 30.70  ? 184  TRP A CA  1 
ATOM   1011  C C   . TRP A 1 145 ? -12.741  -28.788 -13.318 1.00 31.84  ? 184  TRP A C   1 
ATOM   1012  O O   . TRP A 1 145 ? -13.861  -29.268 -13.152 1.00 33.71  ? 184  TRP A O   1 
ATOM   1013  C CB  . TRP A 1 145 ? -13.022  -26.554 -12.222 1.00 26.26  ? 184  TRP A CB  1 
ATOM   1014  C CG  . TRP A 1 145 ? -12.099  -26.726 -11.042 1.00 28.27  ? 184  TRP A CG  1 
ATOM   1015  C CD1 . TRP A 1 145 ? -10.809  -26.264 -10.922 1.00 23.94  ? 184  TRP A CD1 1 
ATOM   1016  C CD2 . TRP A 1 145 ? -12.398  -27.398 -9.811  1.00 28.38  ? 184  TRP A CD2 1 
ATOM   1017  N NE1 . TRP A 1 145 ? -10.295  -26.608 -9.687  1.00 29.12  ? 184  TRP A NE1 1 
ATOM   1018  C CE2 . TRP A 1 145 ? -11.250  -27.313 -8.990  1.00 29.43  ? 184  TRP A CE2 1 
ATOM   1019  C CE3 . TRP A 1 145 ? -13.529  -28.069 -9.321  1.00 21.78  ? 184  TRP A CE3 1 
ATOM   1020  C CZ2 . TRP A 1 145 ? -11.202  -27.869 -7.712  1.00 26.59  ? 184  TRP A CZ2 1 
ATOM   1021  C CZ3 . TRP A 1 145 ? -13.482  -28.619 -8.050  1.00 22.16  ? 184  TRP A CZ3 1 
ATOM   1022  C CH2 . TRP A 1 145 ? -12.331  -28.517 -7.258  1.00 21.61  ? 184  TRP A CH2 1 
ATOM   1023  N N   . ASN A 1 146 ? -11.635  -29.525 -13.358 1.00 29.36  ? 185  ASN A N   1 
ATOM   1024  C CA  . ASN A 1 146 ? -11.669  -30.990 -13.403 1.00 30.92  ? 185  ASN A CA  1 
ATOM   1025  C C   . ASN A 1 146 ? -11.697  -31.633 -12.002 1.00 30.58  ? 185  ASN A C   1 
ATOM   1026  O O   . ASN A 1 146 ? -10.777  -32.339 -11.605 1.00 33.17  ? 185  ASN A O   1 
ATOM   1027  C CB  . ASN A 1 146 ? -10.479  -31.491 -14.243 1.00 32.63  ? 185  ASN A CB  1 
ATOM   1028  C CG  . ASN A 1 146 ? -10.405  -33.014 -14.337 1.00 48.59  ? 185  ASN A CG  1 
ATOM   1029  O OD1 . ASN A 1 146 ? -11.379  -33.720 -14.074 1.00 50.79  ? 185  ASN A OD1 1 
ATOM   1030  N ND2 . ASN A 1 146 ? -9.231   -33.525 -14.723 1.00 51.63  ? 185  ASN A ND2 1 
ATOM   1031  N N   . GLY A 1 147 ? -12.752  -31.347 -11.244 1.00 34.50  ? 186  GLY A N   1 
ATOM   1032  C CA  . GLY A 1 147 ? -12.909  -31.890 -9.909  1.00 27.45  ? 186  GLY A CA  1 
ATOM   1033  C C   . GLY A 1 147 ? -14.003  -32.945 -9.897  1.00 34.55  ? 186  GLY A C   1 
ATOM   1034  O O   . GLY A 1 147 ? -14.275  -33.567 -10.915 1.00 34.18  ? 186  GLY A O   1 
ATOM   1035  N N   . PRO A 1 148 ? -14.674  -33.124 -8.751  1.00 31.06  ? 187  PRO A N   1 
ATOM   1036  C CA  . PRO A 1 148 ? -14.467  -32.332 -7.531  1.00 23.70  ? 187  PRO A CA  1 
ATOM   1037  C C   . PRO A 1 148 ? -13.256  -32.743 -6.705  1.00 26.66  ? 187  PRO A C   1 
ATOM   1038  O O   . PRO A 1 148 ? -12.716  -33.837 -6.859  1.00 27.68  ? 187  PRO A O   1 
ATOM   1039  C CB  . PRO A 1 148 ? -15.722  -32.637 -6.699  1.00 27.43  ? 187  PRO A CB  1 
ATOM   1040  C CG  . PRO A 1 148 ? -16.730  -33.223 -7.685  1.00 32.76  ? 187  PRO A CG  1 
ATOM   1041  C CD  . PRO A 1 148 ? -15.879  -33.964 -8.671  1.00 25.45  ? 187  PRO A CD  1 
ATOM   1042  N N   . VAL A 1 149 ? -12.883  -31.854 -5.792  1.00 23.63  ? 188  VAL A N   1 
ATOM   1043  C CA  . VAL A 1 149 ? -11.937  -32.135 -4.730  1.00 22.87  ? 188  VAL A CA  1 
ATOM   1044  C C   . VAL A 1 149 ? -12.647  -32.280 -3.380  1.00 27.10  ? 188  VAL A C   1 
ATOM   1045  O O   . VAL A 1 149 ? -13.679  -31.650 -3.134  1.00 25.26  ? 188  VAL A O   1 
ATOM   1046  C CB  . VAL A 1 149 ? -10.913  -30.992 -4.665  1.00 22.43  ? 188  VAL A CB  1 
ATOM   1047  C CG1 . VAL A 1 149 ? -10.159  -30.975 -3.350  1.00 27.11  ? 188  VAL A CG1 1 
ATOM   1048  C CG2 . VAL A 1 149 ? -9.972   -31.107 -5.843  1.00 25.07  ? 188  VAL A CG2 1 
ATOM   1049  N N   . GLY A 1 150 ? -12.103  -33.131 -2.519  1.00 26.83  ? 189  GLY A N   1 
ATOM   1050  C CA  . GLY A 1 150 ? -12.548  -33.229 -1.137  1.00 25.16  ? 189  GLY A CA  1 
ATOM   1051  C C   . GLY A 1 150 ? -11.335  -33.034 -0.241  1.00 32.48  ? 189  GLY A C   1 
ATOM   1052  O O   . GLY A 1 150 ? -10.206  -33.413 -0.619  1.00 21.97  ? 189  GLY A O   1 
ATOM   1053  N N   . ALA A 1 151 ? -11.558  -32.459 0.939   1.00 23.19  ? 190  ALA A N   1 
ATOM   1054  C CA  . ALA A 1 151 ? -10.463  -32.206 1.874   1.00 25.02  ? 190  ALA A CA  1 
ATOM   1055  C C   . ALA A 1 151 ? -10.789  -32.490 3.342   1.00 26.13  ? 190  ALA A C   1 
ATOM   1056  O O   . ALA A 1 151 ? -11.869  -32.163 3.826   1.00 26.23  ? 190  ALA A O   1 
ATOM   1057  C CB  . ALA A 1 151 ? -9.966   -30.747 1.722   1.00 22.03  ? 190  ALA A CB  1 
ATOM   1058  N N   . VAL A 1 152 ? -9.833   -33.071 4.058   1.00 25.82  ? 191  VAL A N   1 
ATOM   1059  C CA  . VAL A 1 152 ? -9.968   -33.253 5.496   1.00 19.43  ? 191  VAL A CA  1 
ATOM   1060  C C   . VAL A 1 152 ? -8.651   -32.962 6.187   1.00 24.86  ? 191  VAL A C   1 
ATOM   1061  O O   . VAL A 1 152 ? -7.591   -32.986 5.558   1.00 24.28  ? 191  VAL A O   1 
ATOM   1062  C CB  . VAL A 1 152 ? -10.400  -34.686 5.859   1.00 27.26  ? 191  VAL A CB  1 
ATOM   1063  C CG1 . VAL A 1 152 ? -11.717  -35.037 5.156   1.00 22.09  ? 191  VAL A CG1 1 
ATOM   1064  C CG2 . VAL A 1 152 ? -9.285   -35.700 5.499   1.00 25.46  ? 191  VAL A CG2 1 
ATOM   1065  N N   . ARG A 1 153 ? -8.724   -32.677 7.480   1.00 25.08  ? 192  ARG A N   1 
ATOM   1066  C CA  . ARG A 1 153 ? -7.542   -32.672 8.326   1.00 25.37  ? 192  ARG A CA  1 
ATOM   1067  C C   . ARG A 1 153 ? -7.500   -34.021 9.040   1.00 29.75  ? 192  ARG A C   1 
ATOM   1068  O O   . ARG A 1 153 ? -8.546   -34.545 9.403   1.00 26.79  ? 192  ARG A O   1 
ATOM   1069  C CB  . ARG A 1 153 ? -7.623   -31.541 9.354   1.00 24.00  ? 192  ARG A CB  1 
ATOM   1070  C CG  . ARG A 1 153 ? -6.534   -31.633 10.430  1.00 29.54  ? 192  ARG A CG  1 
ATOM   1071  C CD  . ARG A 1 153 ? -6.467   -30.379 11.282  1.00 26.88  ? 192  ARG A CD  1 
ATOM   1072  N NE  . ARG A 1 153 ? -5.903   -29.244 10.563  1.00 28.81  ? 192  ARG A NE  1 
ATOM   1073  C CZ  . ARG A 1 153 ? -6.594   -28.186 10.149  1.00 28.78  ? 192  ARG A CZ  1 
ATOM   1074  N NH1 . ARG A 1 153 ? -7.900   -28.101 10.383  1.00 31.45  ? 192  ARG A NH1 1 
ATOM   1075  N NH2 . ARG A 1 153 ? -5.979   -27.200 9.494   1.00 23.88  ? 192  ARG A NH2 1 
ATOM   1076  N N   . ILE A 1 154 ? -6.313   -34.601 9.205   1.00 28.16  ? 193  ILE A N   1 
ATOM   1077  C CA  . ILE A 1 154 ? -6.166   -35.802 10.020  1.00 25.20  ? 193  ILE A CA  1 
ATOM   1078  C C   . ILE A 1 154 ? -5.283   -35.458 11.209  1.00 28.70  ? 193  ILE A C   1 
ATOM   1079  O O   . ILE A 1 154 ? -4.230   -34.834 11.058  1.00 30.61  ? 193  ILE A O   1 
ATOM   1080  C CB  . ILE A 1 154 ? -5.590   -37.013 9.225   1.00 26.18  ? 193  ILE A CB  1 
ATOM   1081  C CG1 . ILE A 1 154 ? -6.539   -37.440 8.099   1.00 29.90  ? 193  ILE A CG1 1 
ATOM   1082  C CG2 . ILE A 1 154 ? -5.341   -38.213 10.144  1.00 24.99  ? 193  ILE A CG2 1 
ATOM   1083  C CD1 . ILE A 1 154 ? -7.920   -38.006 8.574   1.00 27.39  ? 193  ILE A CD1 1 
ATOM   1084  N N   . GLY A 1 155 ? -5.747   -35.823 12.399  1.00 29.27  ? 194  GLY A N   1 
ATOM   1085  C CA  . GLY A 1 155 ? -4.979   -35.674 13.616  1.00 26.21  ? 194  GLY A CA  1 
ATOM   1086  C C   . GLY A 1 155 ? -4.616   -37.028 14.210  1.00 26.73  ? 194  GLY A C   1 
ATOM   1087  O O   . GLY A 1 155 ? -5.173   -38.050 13.829  1.00 28.85  ? 194  GLY A O   1 
ATOM   1088  N N   . ILE A 1 156 ? -3.652   -37.031 15.122  1.00 32.12  ? 195  ILE A N   1 
ATOM   1089  C CA  . ILE A 1 156 ? -3.348   -38.217 15.917  1.00 33.84  ? 195  ILE A CA  1 
ATOM   1090  C C   . ILE A 1 156 ? -3.428   -37.816 17.383  1.00 35.58  ? 195  ILE A C   1 
ATOM   1091  O O   . ILE A 1 156 ? -2.582   -37.090 17.888  1.00 32.71  ? 195  ILE A O   1 
ATOM   1092  C CB  . ILE A 1 156 ? -1.973   -38.830 15.564  1.00 33.52  ? 195  ILE A CB  1 
ATOM   1093  C CG1 . ILE A 1 156 ? -1.936   -39.214 14.080  1.00 26.83  ? 195  ILE A CG1 1 
ATOM   1094  C CG2 . ILE A 1 156 ? -1.707   -40.077 16.411  1.00 35.88  ? 195  ILE A CG2 1 
ATOM   1095  C CD1 . ILE A 1 156 ? -0.590   -39.747 13.611  1.00 30.01  ? 195  ILE A CD1 1 
ATOM   1096  N N   . ILE A 1 157 ? -4.491   -38.251 18.049  1.00 41.53  ? 196  ILE A N   1 
ATOM   1097  C CA  . ILE A 1 157 ? -4.749   -37.817 19.410  1.00 40.01  ? 196  ILE A CA  1 
ATOM   1098  C C   . ILE A 1 157 ? -4.704   -39.035 20.307  1.00 43.07  ? 196  ILE A C   1 
ATOM   1099  O O   . ILE A 1 157 ? -5.444   -39.996 20.101  1.00 36.70  ? 196  ILE A O   1 
ATOM   1100  C CB  . ILE A 1 157 ? -6.134   -37.120 19.567  1.00 44.62  ? 196  ILE A CB  1 
ATOM   1101  C CG1 . ILE A 1 157 ? -6.123   -35.705 18.975  1.00 40.64  ? 196  ILE A CG1 1 
ATOM   1102  C CG2 . ILE A 1 157 ? -6.522   -37.040 21.032  1.00 42.91  ? 196  ILE A CG2 1 
ATOM   1103  C CD1 . ILE A 1 157 ? -6.182   -35.669 17.461  1.00 38.53  ? 196  ILE A CD1 1 
ATOM   1104  N N   . ASP A 1 158 ? -3.809   -39.005 21.284  1.00 45.90  ? 197  ASP A N   1 
ATOM   1105  C CA  . ASP A 1 158 ? -3.741   -40.080 22.249  1.00 47.45  ? 197  ASP A CA  1 
ATOM   1106  C C   . ASP A 1 158 ? -3.712   -41.430 21.539  1.00 40.74  ? 197  ASP A C   1 
ATOM   1107  O O   . ASP A 1 158 ? -4.369   -42.375 21.965  1.00 42.08  ? 197  ASP A O   1 
ATOM   1108  C CB  . ASP A 1 158 ? -4.956   -40.004 23.174  1.00 44.25  ? 197  ASP A CB  1 
ATOM   1109  C CG  . ASP A 1 158 ? -4.844   -40.935 24.351  1.00 56.65  ? 197  ASP A CG  1 
ATOM   1110  O OD1 . ASP A 1 158 ? -3.706   -41.104 24.851  1.00 50.85  ? 197  ASP A OD1 1 
ATOM   1111  O OD2 . ASP A 1 158 ? -5.887   -41.494 24.765  1.00 45.83  ? 197  ASP A OD2 1 
ATOM   1112  N N   . GLY A 1 159 ? -2.964   -41.514 20.445  1.00 42.32  ? 198  GLY A N   1 
ATOM   1113  C CA  . GLY A 1 159 ? -2.784   -42.776 19.748  1.00 38.53  ? 198  GLY A CA  1 
ATOM   1114  C C   . GLY A 1 159 ? -3.790   -43.079 18.651  1.00 47.88  ? 198  GLY A C   1 
ATOM   1115  O O   . GLY A 1 159 ? -3.656   -44.087 17.956  1.00 46.82  ? 198  GLY A O   1 
ATOM   1116  N N   . GLU A 1 160 ? -4.800   -42.228 18.473  1.00 36.34  ? 199  GLU A N   1 
ATOM   1117  C CA  . GLU A 1 160 ? -5.828   -42.530 17.472  1.00 40.85  ? 199  GLU A CA  1 
ATOM   1118  C C   . GLU A 1 160 ? -5.892   -41.541 16.313  1.00 34.46  ? 199  GLU A C   1 
ATOM   1119  O O   . GLU A 1 160 ? -5.697   -40.336 16.495  1.00 37.84  ? 199  GLU A O   1 
ATOM   1120  C CB  . GLU A 1 160 ? -7.209   -42.645 18.129  1.00 40.04  ? 199  GLU A CB  1 
ATOM   1121  C CG  . GLU A 1 160 ? -7.362   -43.871 19.015  1.00 51.24  ? 199  GLU A CG  1 
ATOM   1122  C CD  . GLU A 1 160 ? -8.741   -43.966 19.643  1.00 70.82  ? 199  GLU A CD  1 
ATOM   1123  O OE1 . GLU A 1 160 ? -9.039   -45.017 20.252  1.00 77.89  ? 199  GLU A OE1 1 
ATOM   1124  O OE2 . GLU A 1 160 ? -9.524   -42.992 19.528  1.00 73.54  ? 199  GLU A OE2 1 
ATOM   1125  N N   . TYR A 1 161 ? -6.182   -42.062 15.125  1.00 31.60  ? 200  TYR A N   1 
ATOM   1126  C CA  . TYR A 1 161 ? -6.371   -41.220 13.952  1.00 40.21  ? 200  TYR A CA  1 
ATOM   1127  C C   . TYR A 1 161 ? -7.773   -40.610 13.990  1.00 43.09  ? 200  TYR A C   1 
ATOM   1128  O O   . TYR A 1 161 ? -8.775   -41.325 14.067  1.00 39.36  ? 200  TYR A O   1 
ATOM   1129  C CB  . TYR A 1 161 ? -6.147   -42.025 12.667  1.00 41.34  ? 200  TYR A CB  1 
ATOM   1130  C CG  . TYR A 1 161 ? -4.738   -42.594 12.532  1.00 40.86  ? 200  TYR A CG  1 
ATOM   1131  C CD1 . TYR A 1 161 ? -3.712   -41.846 11.966  1.00 34.38  ? 200  TYR A CD1 1 
ATOM   1132  C CD2 . TYR A 1 161 ? -4.442   -43.885 12.964  1.00 40.85  ? 200  TYR A CD2 1 
ATOM   1133  C CE1 . TYR A 1 161 ? -2.421   -42.366 11.838  1.00 36.02  ? 200  TYR A CE1 1 
ATOM   1134  C CE2 . TYR A 1 161 ? -3.154   -44.414 12.840  1.00 47.42  ? 200  TYR A CE2 1 
ATOM   1135  C CZ  . TYR A 1 161 ? -2.147   -43.646 12.277  1.00 41.71  ? 200  TYR A CZ  1 
ATOM   1136  O OH  . TYR A 1 161 ? -0.872   -44.161 12.154  1.00 40.18  ? 200  TYR A OH  1 
ATOM   1137  N N   . VAL A 1 162 ? -7.830   -39.285 13.965  1.00 33.77  ? 201  VAL A N   1 
ATOM   1138  C CA  . VAL A 1 162 ? -9.082   -38.557 14.078  1.00 35.36  ? 201  VAL A CA  1 
ATOM   1139  C C   . VAL A 1 162 ? -9.235   -37.635 12.872  1.00 35.69  ? 201  VAL A C   1 
ATOM   1140  O O   . VAL A 1 162 ? -8.354   -36.829 12.586  1.00 29.57  ? 201  VAL A O   1 
ATOM   1141  C CB  . VAL A 1 162 ? -9.086   -37.695 15.356  1.00 35.91  ? 201  VAL A CB  1 
ATOM   1142  C CG1 . VAL A 1 162 ? -10.309  -36.794 15.389  1.00 41.65  ? 201  VAL A CG1 1 
ATOM   1143  C CG2 . VAL A 1 162 ? -9.028   -38.574 16.592  1.00 36.83  ? 201  VAL A CG2 1 
ATOM   1144  N N   . VAL A 1 163 ? -10.337  -37.757 12.148  1.00 33.48  ? 202  VAL A N   1 
ATOM   1145  C CA  . VAL A 1 163 ? -10.570  -36.863 11.017  1.00 33.93  ? 202  VAL A CA  1 
ATOM   1146  C C   . VAL A 1 163 ? -11.246  -35.568 11.484  1.00 36.85  ? 202  VAL A C   1 
ATOM   1147  O O   . VAL A 1 163 ? -12.083  -35.580 12.386  1.00 35.90  ? 202  VAL A O   1 
ATOM   1148  C CB  . VAL A 1 163 ? -11.324  -37.575 9.864   1.00 39.13  ? 202  VAL A CB  1 
ATOM   1149  C CG1 . VAL A 1 163 ? -12.434  -38.431 10.402  1.00 45.77  ? 202  VAL A CG1 1 
ATOM   1150  C CG2 . VAL A 1 163 ? -11.823  -36.580 8.826   1.00 33.26  ? 202  VAL A CG2 1 
ATOM   1151  N N   . ASN A 1 164 ? -10.839  -34.449 10.889  1.00 32.98  ? 203  ASN A N   1 
ATOM   1152  C CA  . ASN A 1 164 ? -11.339  -33.129 11.255  1.00 33.07  ? 203  ASN A CA  1 
ATOM   1153  C C   . ASN A 1 164 ? -11.402  -32.921 12.760  1.00 38.65  ? 203  ASN A C   1 
ATOM   1154  O O   . ASN A 1 164 ? -12.463  -32.636 13.316  1.00 36.94  ? 203  ASN A O   1 
ATOM   1155  C CB  . ASN A 1 164 ? -12.700  -32.863 10.607  1.00 33.97  ? 203  ASN A CB  1 
ATOM   1156  C CG  . ASN A 1 164 ? -12.617  -32.867 9.099   1.00 37.67  ? 203  ASN A CG  1 
ATOM   1157  O OD1 . ASN A 1 164 ? -11.565  -32.557 8.525   1.00 26.50  ? 203  ASN A OD1 1 
ATOM   1158  N ND2 . ASN A 1 164 ? -13.714  -33.241 8.442   1.00 35.79  ? 203  ASN A ND2 1 
ATOM   1159  N N   . PRO A 1 165 ? -10.255  -33.069 13.427  1.00 33.97  ? 204  PRO A N   1 
ATOM   1160  C CA  . PRO A 1 165 ? -10.204  -32.897 14.875  1.00 33.17  ? 204  PRO A CA  1 
ATOM   1161  C C   . PRO A 1 165 ? -10.683  -31.515 15.278  1.00 37.35  ? 204  PRO A C   1 
ATOM   1162  O O   . PRO A 1 165 ? -10.479  -30.538 14.540  1.00 30.42  ? 204  PRO A O   1 
ATOM   1163  C CB  . PRO A 1 165 ? -8.709   -33.039 15.190  1.00 35.66  ? 204  PRO A CB  1 
ATOM   1164  C CG  . PRO A 1 165 ? -8.021   -32.679 13.905  1.00 32.78  ? 204  PRO A CG  1 
ATOM   1165  C CD  . PRO A 1 165 ? -8.918   -33.274 12.853  1.00 28.11  ? 204  PRO A CD  1 
ATOM   1166  N N   . THR A 1 166 ? -11.321  -31.444 16.442  1.00 31.59  ? 205  THR A N   1 
ATOM   1167  C CA  . THR A 1 166 ? -11.749  -30.171 17.002  1.00 36.32  ? 205  THR A CA  1 
ATOM   1168  C C   . THR A 1 166 ? -10.518  -29.401 17.435  1.00 34.62  ? 205  THR A C   1 
ATOM   1169  O O   . THR A 1 166 ? -9.410   -29.959 17.515  1.00 34.01  ? 205  THR A O   1 
ATOM   1170  C CB  . THR A 1 166 ? -12.632  -30.355 18.245  1.00 34.91  ? 205  THR A CB  1 
ATOM   1171  O OG1 . THR A 1 166 ? -11.861  -30.975 19.279  1.00 32.57  ? 205  THR A OG1 1 
ATOM   1172  C CG2 . THR A 1 166 ? -13.850  -31.227 17.934  1.00 31.92  ? 205  THR A CG2 1 
ATOM   1173  N N   . ARG A 1 167 ? -10.723  -28.123 17.722  1.00 27.61  ? 206  ARG A N   1 
ATOM   1174  C CA  . ARG A 1 167 ? -9.631   -27.245 18.099  1.00 36.33  ? 206  ARG A CA  1 
ATOM   1175  C C   . ARG A 1 167 ? -8.965   -27.770 19.370  1.00 42.87  ? 206  ARG A C   1 
ATOM   1176  O O   . ARG A 1 167 ? -7.734   -27.754 19.498  1.00 35.61  ? 206  ARG A O   1 
ATOM   1177  C CB  . ARG A 1 167 ? -10.124  -25.797 18.222  1.00 33.16  ? 206  ARG A CB  1 
ATOM   1178  C CG  . ARG A 1 167 ? -9.973   -25.148 19.573  1.00 48.47  ? 206  ARG A CG  1 
ATOM   1179  C CD  . ARG A 1 167 ? -10.306  -23.656 19.483  1.00 54.70  ? 206  ARG A CD  1 
ATOM   1180  N NE  . ARG A 1 167 ? -9.407   -22.971 18.562  1.00 55.41  ? 206  ARG A NE  1 
ATOM   1181  C CZ  . ARG A 1 167 ? -8.437   -22.142 18.939  1.00 68.43  ? 206  ARG A CZ  1 
ATOM   1182  N NH1 . ARG A 1 167 ? -8.255   -21.871 20.227  1.00 67.80  ? 206  ARG A NH1 1 
ATOM   1183  N NH2 . ARG A 1 167 ? -7.656   -21.572 18.028  1.00 67.21  ? 206  ARG A NH2 1 
ATOM   1184  N N   . LYS A 1 168 ? -9.786   -28.285 20.279  1.00 35.33  ? 207  LYS A N   1 
ATOM   1185  C CA  . LYS A 1 168 ? -9.293   -28.876 21.513  1.00 41.09  ? 207  LYS A CA  1 
ATOM   1186  C C   . LYS A 1 168 ? -8.468   -30.129 21.206  1.00 44.75  ? 207  LYS A C   1 
ATOM   1187  O O   . LYS A 1 168 ? -7.394   -30.325 21.773  1.00 44.36  ? 207  LYS A O   1 
ATOM   1188  C CB  . LYS A 1 168 ? -10.476  -29.206 22.433  1.00 46.03  ? 207  LYS A CB  1 
ATOM   1189  C CG  . LYS A 1 168 ? -10.169  -30.118 23.614  1.00 52.77  ? 207  LYS A CG  1 
ATOM   1190  C CD  . LYS A 1 168 ? -11.468  -30.633 24.265  1.00 64.50  ? 207  LYS A CD  1 
ATOM   1191  C CE  . LYS A 1 168 ? -11.456  -32.159 24.439  1.00 69.71  ? 207  LYS A CE  1 
ATOM   1192  N NZ  . LYS A 1 168 ? -12.737  -32.692 25.006  1.00 71.37  ? 207  LYS A NZ  1 
ATOM   1193  N N   . GLU A 1 169 ? -8.968   -30.970 20.302  1.00 37.88  ? 208  GLU A N   1 
ATOM   1194  C CA  . GLU A 1 169 ? -8.244   -32.174 19.888  1.00 37.88  ? 208  GLU A CA  1 
ATOM   1195  C C   . GLU A 1 169 ? -6.908   -31.833 19.200  1.00 40.28  ? 208  GLU A C   1 
ATOM   1196  O O   . GLU A 1 169 ? -5.895   -32.498 19.419  1.00 38.56  ? 208  GLU A O   1 
ATOM   1197  C CB  . GLU A 1 169 ? -9.129   -33.047 18.993  1.00 36.41  ? 208  GLU A CB  1 
ATOM   1198  C CG  . GLU A 1 169 ? -10.369  -33.582 19.709  1.00 37.84  ? 208  GLU A CG  1 
ATOM   1199  C CD  . GLU A 1 169 ? -11.303  -34.346 18.787  1.00 42.73  ? 208  GLU A CD  1 
ATOM   1200  O OE1 . GLU A 1 169 ? -11.493  -33.911 17.633  1.00 36.48  ? 208  GLU A OE1 1 
ATOM   1201  O OE2 . GLU A 1 169 ? -11.845  -35.387 19.218  1.00 49.55  ? 208  GLU A OE2 1 
ATOM   1202  N N   . MET A 1 170 ? -6.911   -30.780 18.390  1.00 37.41  ? 209  MET A N   1 
ATOM   1203  C CA  . MET A 1 170 ? -5.706   -30.335 17.692  1.00 40.75  ? 209  MET A CA  1 
ATOM   1204  C C   . MET A 1 170 ? -4.592   -29.966 18.676  1.00 43.22  ? 209  MET A C   1 
ATOM   1205  O O   . MET A 1 170 ? -3.413   -30.251 18.438  1.00 36.17  ? 209  MET A O   1 
ATOM   1206  C CB  . MET A 1 170 ? -6.023   -29.158 16.754  1.00 33.05  ? 209  MET A CB  1 
ATOM   1207  C CG  . MET A 1 170 ? -6.925   -29.551 15.573  1.00 31.41  ? 209  MET A CG  1 
ATOM   1208  S SD  . MET A 1 170 ? -7.222   -28.225 14.381  1.00 36.78  ? 209  MET A SD  1 
ATOM   1209  C CE  . MET A 1 170 ? -5.546   -27.728 13.953  1.00 30.52  ? 209  MET A CE  1 
ATOM   1210  N N   . SER A 1 171 ? -4.979   -29.360 19.795  1.00 36.92  ? 210  SER A N   1 
ATOM   1211  C CA  . SER A 1 171 ? -4.019   -28.890 20.782  1.00 43.33  ? 210  SER A CA  1 
ATOM   1212  C C   . SER A 1 171 ? -3.273   -30.045 21.440  1.00 39.24  ? 210  SER A C   1 
ATOM   1213  O O   . SER A 1 171 ? -2.180   -29.857 21.965  1.00 49.81  ? 210  SER A O   1 
ATOM   1214  C CB  . SER A 1 171 ? -4.696   -28.002 21.837  1.00 43.62  ? 210  SER A CB  1 
ATOM   1215  O OG  . SER A 1 171 ? -5.554   -28.767 22.665  1.00 54.69  ? 210  SER A OG  1 
ATOM   1216  N N   . SER A 1 172 ? -3.845   -31.244 21.389  1.00 44.23  ? 211  SER A N   1 
ATOM   1217  C CA  . SER A 1 172 ? -3.135   -32.422 21.882  1.00 39.96  ? 211  SER A CA  1 
ATOM   1218  C C   . SER A 1 172 ? -2.845   -33.435 20.774  1.00 39.56  ? 211  SER A C   1 
ATOM   1219  O O   . SER A 1 172 ? -2.687   -34.620 21.042  1.00 36.12  ? 211  SER A O   1 
ATOM   1220  C CB  . SER A 1 172 ? -3.903   -33.093 23.031  1.00 47.77  ? 211  SER A CB  1 
ATOM   1221  O OG  . SER A 1 172 ? -5.010   -33.840 22.555  1.00 46.50  ? 211  SER A OG  1 
ATOM   1222  N N   . SER A 1 173 ? -2.784   -32.974 19.531  1.00 33.03  ? 212  SER A N   1 
ATOM   1223  C CA  . SER A 1 173 ? -2.472   -33.873 18.429  1.00 34.42  ? 212  SER A CA  1 
ATOM   1224  C C   . SER A 1 173 ? -0.976   -33.861 18.099  1.00 37.02  ? 212  SER A C   1 
ATOM   1225  O O   . SER A 1 173 ? -0.323   -32.817 18.146  1.00 32.72  ? 212  SER A O   1 
ATOM   1226  C CB  . SER A 1 173 ? -3.269   -33.500 17.188  1.00 31.47  ? 212  SER A CB  1 
ATOM   1227  O OG  . SER A 1 173 ? -2.932   -34.342 16.112  1.00 25.90  ? 212  SER A OG  1 
ATOM   1228  N N   . THR A 1 174 ? -0.444   -35.029 17.764  1.00 29.26  ? 213  THR A N   1 
ATOM   1229  C CA  . THR A 1 174 ? 0.944    -35.126 17.336  1.00 37.16  ? 213  THR A CA  1 
ATOM   1230  C C   . THR A 1 174 ? 1.026    -34.950 15.824  1.00 34.59  ? 213  THR A C   1 
ATOM   1231  O O   . THR A 1 174 ? 2.099    -35.050 15.242  1.00 29.01  ? 213  THR A O   1 
ATOM   1232  C CB  . THR A 1 174 ? 1.538    -36.492 17.691  1.00 28.18  ? 213  THR A CB  1 
ATOM   1233  O OG1 . THR A 1 174 ? 0.797    -37.509 17.018  1.00 31.68  ? 213  THR A OG1 1 
ATOM   1234  C CG2 . THR A 1 174 ? 1.479    -36.734 19.184  1.00 30.74  ? 213  THR A CG2 1 
ATOM   1235  N N   . LEU A 1 175 ? -0.122   -34.695 15.199  1.00 29.15  ? 214  LEU A N   1 
ATOM   1236  C CA  . LEU A 1 175 ? -0.198   -34.531 13.758  1.00 24.90  ? 214  LEU A CA  1 
ATOM   1237  C C   . LEU A 1 175 ? -1.243   -33.495 13.343  1.00 32.15  ? 214  LEU A C   1 
ATOM   1238  O O   . LEU A 1 175 ? -2.389   -33.542 13.795  1.00 24.79  ? 214  LEU A O   1 
ATOM   1239  C CB  . LEU A 1 175 ? -0.534   -35.861 13.087  1.00 23.63  ? 214  LEU A CB  1 
ATOM   1240  C CG  . LEU A 1 175 ? -0.646   -35.754 11.566  1.00 25.78  ? 214  LEU A CG  1 
ATOM   1241  C CD1 . LEU A 1 175 ? 0.684    -35.337 10.959  1.00 25.12  ? 214  LEU A CD1 1 
ATOM   1242  C CD2 . LEU A 1 175 ? -1.109   -37.069 10.976  1.00 24.24  ? 214  LEU A CD2 1 
ATOM   1243  N N   . ASN A 1 176 ? -0.825   -32.581 12.469  1.00 24.43  ? 215  ASN A N   1 
ATOM   1244  C CA  . ASN A 1 176 ? -1.713   -31.676 11.762  1.00 24.83  ? 215  ASN A CA  1 
ATOM   1245  C C   . ASN A 1 176 ? -1.520   -31.815 10.252  1.00 27.18  ? 215  ASN A C   1 
ATOM   1246  O O   . ASN A 1 176 ? -0.715   -31.096 9.661   1.00 23.97  ? 215  ASN A O   1 
ATOM   1247  C CB  . ASN A 1 176 ? -1.454   -30.220 12.182  1.00 23.87  ? 215  ASN A CB  1 
ATOM   1248  C CG  . ASN A 1 176 ? -2.438   -29.247 11.539  1.00 26.65  ? 215  ASN A CG  1 
ATOM   1249  O OD1 . ASN A 1 176 ? -3.166   -29.599 10.599  1.00 24.95  ? 215  ASN A OD1 1 
ATOM   1250  N ND2 . ASN A 1 176 ? -2.455   -28.014 12.035  1.00 28.69  ? 215  ASN A ND2 1 
ATOM   1251  N N   . LEU A 1 177 ? -2.267   -32.731 9.637   1.00 25.39  ? 216  LEU A N   1 
ATOM   1252  C CA  . LEU A 1 177 ? -2.119   -33.051 8.226   1.00 24.41  ? 216  LEU A CA  1 
ATOM   1253  C C   . LEU A 1 177 ? -3.392   -32.656 7.509   1.00 28.45  ? 216  LEU A C   1 
ATOM   1254  O O   . LEU A 1 177 ? -4.480   -33.049 7.919   1.00 20.87  ? 216  LEU A O   1 
ATOM   1255  C CB  . LEU A 1 177 ? -1.956   -34.565 8.075   1.00 22.81  ? 216  LEU A CB  1 
ATOM   1256  C CG  . LEU A 1 177 ? -1.451   -35.303 6.822   1.00 36.03  ? 216  LEU A CG  1 
ATOM   1257  C CD1 . LEU A 1 177 ? -2.289   -36.547 6.523   1.00 29.17  ? 216  LEU A CD1 1 
ATOM   1258  C CD2 . LEU A 1 177 ? -1.299   -34.439 5.588   1.00 26.39  ? 216  LEU A CD2 1 
ATOM   1259  N N   . VAL A 1 178 ? -3.271   -31.906 6.424   1.00 22.43  ? 217  VAL A N   1 
ATOM   1260  C CA  . VAL A 1 178 ? -4.453   -31.599 5.634   1.00 27.10  ? 217  VAL A CA  1 
ATOM   1261  C C   . VAL A 1 178 ? -4.262   -32.281 4.306   1.00 25.98  ? 217  VAL A C   1 
ATOM   1262  O O   . VAL A 1 178 ? -3.207   -32.150 3.696   1.00 24.47  ? 217  VAL A O   1 
ATOM   1263  C CB  . VAL A 1 178 ? -4.653   -30.079 5.401   1.00 23.61  ? 217  VAL A CB  1 
ATOM   1264  C CG1 . VAL A 1 178 ? -5.824   -29.845 4.447   1.00 22.13  ? 217  VAL A CG1 1 
ATOM   1265  C CG2 . VAL A 1 178 ? -4.883   -29.347 6.712   1.00 21.65  ? 217  VAL A CG2 1 
ATOM   1266  N N   . VAL A 1 179 ? -5.268   -33.028 3.862   1.00 25.68  ? 218  VAL A N   1 
ATOM   1267  C CA  . VAL A 1 179 ? -5.179   -33.625 2.541   1.00 21.75  ? 218  VAL A CA  1 
ATOM   1268  C C   . VAL A 1 179 ? -6.349   -33.274 1.635   1.00 26.38  ? 218  VAL A C   1 
ATOM   1269  O O   . VAL A 1 179 ? -7.519   -33.323 2.040   1.00 27.42  ? 218  VAL A O   1 
ATOM   1270  C CB  . VAL A 1 179 ? -4.929   -35.157 2.596   1.00 34.13  ? 218  VAL A CB  1 
ATOM   1271  C CG1 . VAL A 1 179 ? -4.902   -35.642 4.019   1.00 30.40  ? 218  VAL A CG1 1 
ATOM   1272  C CG2 . VAL A 1 179 ? -5.940   -35.919 1.748   1.00 28.79  ? 218  VAL A CG2 1 
ATOM   1273  N N   . ALA A 1 180 ? -6.008   -32.889 0.410   1.00 23.29  ? 219  ALA A N   1 
ATOM   1274  C CA  . ALA A 1 180 ? -6.994   -32.656 -0.627  1.00 23.74  ? 219  ALA A CA  1 
ATOM   1275  C C   . ALA A 1 180 ? -6.865   -33.755 -1.656  1.00 31.14  ? 219  ALA A C   1 
ATOM   1276  O O   . ALA A 1 180 ? -5.772   -34.022 -2.158  1.00 27.50  ? 219  ALA A O   1 
ATOM   1277  C CB  . ALA A 1 180 ? -6.800   -31.275 -1.276  1.00 21.45  ? 219  ALA A CB  1 
ATOM   1278  N N   . GLY A 1 181 ? -7.992   -34.396 -1.943  1.00 25.42  ? 220  GLY A N   1 
ATOM   1279  C CA  . GLY A 1 181 ? -8.032   -35.522 -2.841  1.00 21.69  ? 220  GLY A CA  1 
ATOM   1280  C C   . GLY A 1 181 ? -8.974   -35.275 -4.001  1.00 26.25  ? 220  GLY A C   1 
ATOM   1281  O O   . GLY A 1 181 ? -9.944   -34.520 -3.901  1.00 26.59  ? 220  GLY A O   1 
ATOM   1282  N N   . ALA A 1 182 ? -8.650   -35.887 -5.128  1.00 25.60  ? 221  ALA A N   1 
ATOM   1283  C CA  . ALA A 1 182 ? -9.482   -35.825 -6.308  1.00 29.98  ? 221  ALA A CA  1 
ATOM   1284  C C   . ALA A 1 182 ? -10.044  -37.226 -6.524  1.00 26.00  ? 221  ALA A C   1 
ATOM   1285  O O   . ALA A 1 182 ? -9.721   -38.147 -5.766  1.00 26.65  ? 221  ALA A O   1 
ATOM   1286  C CB  . ALA A 1 182 ? -8.658   -35.367 -7.502  1.00 28.28  ? 221  ALA A CB  1 
ATOM   1287  N N   . PRO A 1 183 ? -10.894  -37.397 -7.548  1.00 27.60  ? 222  PRO A N   1 
ATOM   1288  C CA  . PRO A 1 183 ? -11.513  -38.709 -7.768  1.00 27.48  ? 222  PRO A CA  1 
ATOM   1289  C C   . PRO A 1 183 ? -10.477  -39.800 -8.022  1.00 33.52  ? 222  PRO A C   1 
ATOM   1290  O O   . PRO A 1 183 ? -9.332   -39.502 -8.377  1.00 30.85  ? 222  PRO A O   1 
ATOM   1291  C CB  . PRO A 1 183 ? -12.374  -38.494 -9.021  1.00 35.18  ? 222  PRO A CB  1 
ATOM   1292  C CG  . PRO A 1 183 ? -12.625  -37.007 -9.060  1.00 37.03  ? 222  PRO A CG  1 
ATOM   1293  C CD  . PRO A 1 183 ? -11.362  -36.388 -8.518  1.00 24.64  ? 222  PRO A CD  1 
ATOM   1294  N N   . LYS A 1 184 ? -10.891  -41.049 -7.833  1.00 28.87  ? 223  LYS A N   1 
ATOM   1295  C CA  . LYS A 1 184 ? -10.007  -42.198 -7.970  1.00 33.57  ? 223  LYS A CA  1 
ATOM   1296  C C   . LYS A 1 184 ? -8.854   -42.060 -6.996  1.00 32.40  ? 223  LYS A C   1 
ATOM   1297  O O   . LYS A 1 184 ? -7.742   -42.480 -7.290  1.00 30.12  ? 223  LYS A O   1 
ATOM   1298  C CB  . LYS A 1 184 ? -9.484   -42.318 -9.402  1.00 33.08  ? 223  LYS A CB  1 
ATOM   1299  C CG  . LYS A 1 184 ? -10.541  -42.682 -10.428 1.00 36.89  ? 223  LYS A CG  1 
ATOM   1300  C CD  . LYS A 1 184 ? -10.280  -41.994 -11.760 1.00 42.64  ? 223  LYS A CD  1 
ATOM   1301  C CE  . LYS A 1 184 ? -10.114  -42.972 -12.911 1.00 53.85  ? 223  LYS A CE  1 
ATOM   1302  N NZ  . LYS A 1 184 ? -8.692   -43.436 -13.085 1.00 63.45  ? 223  LYS A NZ  1 
ATOM   1303  N N   . SER A 1 185 ? -9.129   -41.451 -5.844  1.00 28.79  ? 224  SER A N   1 
ATOM   1304  C CA  . SER A 1 185 ? -8.170   -41.397 -4.751  1.00 28.57  ? 224  SER A CA  1 
ATOM   1305  C C   . SER A 1 185 ? -6.840   -40.742 -5.150  1.00 26.71  ? 224  SER A C   1 
ATOM   1306  O O   . SER A 1 185 ? -5.778   -41.154 -4.697  1.00 29.57  ? 224  SER A O   1 
ATOM   1307  C CB  . SER A 1 185 ? -7.894   -42.814 -4.241  1.00 34.38  ? 224  SER A CB  1 
ATOM   1308  O OG  . SER A 1 185 ? -9.005   -43.351 -3.552  1.00 39.05  ? 224  SER A OG  1 
ATOM   1309  N N   . GLN A 1 186 ? -6.896   -39.731 -6.001  1.00 29.28  ? 225  GLN A N   1 
ATOM   1310  C CA  . GLN A 1 186 ? -5.688   -39.013 -6.365  1.00 30.19  ? 225  GLN A CA  1 
ATOM   1311  C C   . GLN A 1 186 ? -5.424   -37.895 -5.360  1.00 28.48  ? 225  GLN A C   1 
ATOM   1312  O O   . GLN A 1 186 ? -6.342   -37.201 -4.935  1.00 32.24  ? 225  GLN A O   1 
ATOM   1313  C CB  . GLN A 1 186 ? -5.805   -38.451 -7.786  1.00 26.57  ? 225  GLN A CB  1 
ATOM   1314  C CG  . GLN A 1 186 ? -6.039   -39.510 -8.845  1.00 27.85  ? 225  GLN A CG  1 
ATOM   1315  C CD  . GLN A 1 186 ? -4.868   -40.472 -8.932  1.00 36.80  ? 225  GLN A CD  1 
ATOM   1316  O OE1 . GLN A 1 186 ? -3.773   -40.098 -9.362  1.00 30.26  ? 225  GLN A OE1 1 
ATOM   1317  N NE2 . GLN A 1 186 ? -5.087   -41.711 -8.498  1.00 36.30  ? 225  GLN A NE2 1 
ATOM   1318  N N   . ILE A 1 187 ? -4.169   -37.724 -4.985  1.00 26.59  ? 226  ILE A N   1 
ATOM   1319  C CA  . ILE A 1 187 ? -3.787   -36.670 -4.055  1.00 25.43  ? 226  ILE A CA  1 
ATOM   1320  C C   . ILE A 1 187 ? -3.443   -35.392 -4.797  1.00 32.22  ? 226  ILE A C   1 
ATOM   1321  O O   . ILE A 1 187 ? -2.562   -35.381 -5.665  1.00 25.94  ? 226  ILE A O   1 
ATOM   1322  C CB  . ILE A 1 187 ? -2.593   -37.092 -3.187  1.00 26.11  ? 226  ILE A CB  1 
ATOM   1323  C CG1 . ILE A 1 187 ? -2.975   -38.307 -2.332  1.00 28.36  ? 226  ILE A CG1 1 
ATOM   1324  C CG2 . ILE A 1 187 ? -2.116   -35.916 -2.322  1.00 20.14  ? 226  ILE A CG2 1 
ATOM   1325  C CD1 . ILE A 1 187 ? -1.849   -38.852 -1.456  1.00 31.45  ? 226  ILE A CD1 1 
ATOM   1326  N N   . VAL A 1 188 ? -4.137   -34.312 -4.442  1.00 27.60  ? 227  VAL A N   1 
ATOM   1327  C CA  . VAL A 1 188 ? -3.930   -33.020 -5.089  1.00 26.60  ? 227  VAL A CA  1 
ATOM   1328  C C   . VAL A 1 188 ? -3.006   -32.111 -4.279  1.00 26.00  ? 227  VAL A C   1 
ATOM   1329  O O   . VAL A 1 188 ? -2.226   -31.330 -4.834  1.00 24.75  ? 227  VAL A O   1 
ATOM   1330  C CB  . VAL A 1 188 ? -5.287   -32.322 -5.320  1.00 33.49  ? 227  VAL A CB  1 
ATOM   1331  C CG1 . VAL A 1 188 ? -5.096   -30.925 -5.823  1.00 31.66  ? 227  VAL A CG1 1 
ATOM   1332  C CG2 . VAL A 1 188 ? -6.141   -33.145 -6.294  1.00 29.51  ? 227  VAL A CG2 1 
ATOM   1333  N N   . MET A 1 189 ? -3.076   -32.237 -2.962  1.00 24.83  ? 228  MET A N   1 
ATOM   1334  C CA  . MET A 1 189 ? -2.380   -31.328 -2.061  1.00 22.94  ? 228  MET A CA  1 
ATOM   1335  C C   . MET A 1 189 ? -2.198   -32.034 -0.727  1.00 22.61  ? 228  MET A C   1 
ATOM   1336  O O   . MET A 1 189 ? -3.120   -32.699 -0.248  1.00 25.96  ? 228  MET A O   1 
ATOM   1337  C CB  . MET A 1 189 ? -3.238   -30.057 -1.860  1.00 30.61  ? 228  MET A CB  1 
ATOM   1338  C CG  . MET A 1 189 ? -2.600   -28.904 -1.072  1.00 26.92  ? 228  MET A CG  1 
ATOM   1339  S SD  . MET A 1 189 ? -2.447   -29.130 0.718   1.00 28.58  ? 228  MET A SD  1 
ATOM   1340  C CE  . MET A 1 189 ? -4.117   -29.561 1.167   1.00 27.87  ? 228  MET A CE  1 
ATOM   1341  N N   . LEU A 1 190 ? -1.000   -31.923 -0.162  1.00 23.83  ? 229  LEU A N   1 
ATOM   1342  C CA  . LEU A 1 190 ? -0.729   -32.422 1.176   1.00 23.61  ? 229  LEU A CA  1 
ATOM   1343  C C   . LEU A 1 190 ? -0.037   -31.341 2.000   1.00 30.23  ? 229  LEU A C   1 
ATOM   1344  O O   . LEU A 1 190 ? 1.022    -30.845 1.615   1.00 31.99  ? 229  LEU A O   1 
ATOM   1345  C CB  . LEU A 1 190 ? 0.145    -33.675 1.121   1.00 23.17  ? 229  LEU A CB  1 
ATOM   1346  C CG  . LEU A 1 190 ? -0.465   -34.914 0.464   1.00 27.48  ? 229  LEU A CG  1 
ATOM   1347  C CD1 . LEU A 1 190 ? 0.556    -36.038 0.403   1.00 25.39  ? 229  LEU A CD1 1 
ATOM   1348  C CD2 . LEU A 1 190 ? -1.713   -35.359 1.210   1.00 27.76  ? 229  LEU A CD2 1 
ATOM   1349  N N   . GLU A 1 191 ? -0.625   -30.982 3.135   1.00 26.76  ? 230  GLU A N   1 
ATOM   1350  C CA  . GLU A 1 191 ? 0.001    -30.035 4.047   1.00 24.93  ? 230  GLU A CA  1 
ATOM   1351  C C   . GLU A 1 191 ? 0.015    -30.649 5.438   1.00 27.96  ? 230  GLU A C   1 
ATOM   1352  O O   . GLU A 1 191 ? -1.033   -31.045 5.949   1.00 26.92  ? 230  GLU A O   1 
ATOM   1353  C CB  . GLU A 1 191 ? -0.760   -28.709 4.056   1.00 28.57  ? 230  GLU A CB  1 
ATOM   1354  C CG  . GLU A 1 191 ? -0.038   -27.584 4.780   1.00 32.32  ? 230  GLU A CG  1 
ATOM   1355  C CD  . GLU A 1 191 ? 1.211    -27.129 4.052   1.00 42.48  ? 230  GLU A CD  1 
ATOM   1356  O OE1 . GLU A 1 191 ? 1.297    -27.345 2.825   1.00 39.87  ? 230  GLU A OE1 1 
ATOM   1357  O OE2 . GLU A 1 191 ? 2.105    -26.552 4.704   1.00 39.48  ? 230  GLU A OE2 1 
ATOM   1358  N N   . ALA A 1 192 ? 1.185    -30.735 6.061   1.00 28.54  ? 231  ALA A N   1 
ATOM   1359  C CA  . ALA A 1 192 ? 1.251    -31.325 7.392   1.00 24.14  ? 231  ALA A CA  1 
ATOM   1360  C C   . ALA A 1 192 ? 2.298    -30.733 8.330   1.00 28.96  ? 231  ALA A C   1 
ATOM   1361  O O   . ALA A 1 192 ? 3.377    -30.317 7.908   1.00 25.37  ? 231  ALA A O   1 
ATOM   1362  C CB  . ALA A 1 192 ? 1.438    -32.837 7.285   1.00 24.07  ? 231  ALA A CB  1 
ATOM   1363  N N   . SER A 1 193 ? 1.957    -30.722 9.613   1.00 26.11  ? 232  SER A N   1 
ATOM   1364  C CA  . SER A 1 193 ? 2.876    -30.376 10.683  1.00 29.00  ? 232  SER A CA  1 
ATOM   1365  C C   . SER A 1 193 ? 2.779    -31.524 11.678  1.00 32.70  ? 232  SER A C   1 
ATOM   1366  O O   . SER A 1 193 ? 1.677    -31.922 12.054  1.00 26.47  ? 232  SER A O   1 
ATOM   1367  C CB  . SER A 1 193 ? 2.484    -29.053 11.341  1.00 37.88  ? 232  SER A CB  1 
ATOM   1368  O OG  . SER A 1 193 ? 1.209    -29.140 11.950  1.00 29.76  ? 232  SER A OG  1 
ATOM   1369  N N   . ALA A 1 194 ? 3.914    -32.070 12.098  1.00 24.43  ? 233  ALA A N   1 
ATOM   1370  C CA  . ALA A 1 194 ? 3.888    -33.201 13.020  1.00 28.38  ? 233  ALA A CA  1 
ATOM   1371  C C   . ALA A 1 194 ? 4.936    -33.118 14.123  1.00 28.69  ? 233  ALA A C   1 
ATOM   1372  O O   . ALA A 1 194 ? 6.000    -32.527 13.943  1.00 29.33  ? 233  ALA A O   1 
ATOM   1373  C CB  . ALA A 1 194 ? 4.030    -34.510 12.252  1.00 23.28  ? 233  ALA A CB  1 
ATOM   1374  N N   . GLU A 1 195 ? 4.627    -33.727 15.264  1.00 29.40  ? 234  GLU A N   1 
ATOM   1375  C CA  . GLU A 1 195 ? 5.568    -33.790 16.371  1.00 28.35  ? 234  GLU A CA  1 
ATOM   1376  C C   . GLU A 1 195 ? 6.640    -34.881 16.159  1.00 26.88  ? 234  GLU A C   1 
ATOM   1377  O O   . GLU A 1 195 ? 6.782    -35.794 16.980  1.00 24.73  ? 234  GLU A O   1 
ATOM   1378  C CB  . GLU A 1 195 ? 4.826    -34.010 17.690  1.00 26.99  ? 234  GLU A CB  1 
ATOM   1379  C CG  . GLU A 1 195 ? 4.058    -32.788 18.162  1.00 36.23  ? 234  GLU A CG  1 
ATOM   1380  C CD  . GLU A 1 195 ? 4.975    -31.604 18.453  1.00 40.82  ? 234  GLU A CD  1 
ATOM   1381  O OE1 . GLU A 1 195 ? 4.810    -30.539 17.821  1.00 43.54  ? 234  GLU A OE1 1 
ATOM   1382  O OE2 . GLU A 1 195 ? 5.863    -31.740 19.315  1.00 39.98  ? 234  GLU A OE2 1 
ATOM   1383  N N   . ASN A 1 196 ? 7.382    -34.780 15.058  1.00 25.60  ? 235  ASN A N   1 
ATOM   1384  C CA  . ASN A 1 196 ? 8.497    -35.689 14.786  1.00 24.91  ? 235  ASN A CA  1 
ATOM   1385  C C   . ASN A 1 196 ? 8.052    -37.139 14.784  1.00 29.38  ? 235  ASN A C   1 
ATOM   1386  O O   . ASN A 1 196 ? 8.676    -37.967 15.429  1.00 29.36  ? 235  ASN A O   1 
ATOM   1387  C CB  . ASN A 1 196 ? 9.599    -35.498 15.838  1.00 28.35  ? 235  ASN A CB  1 
ATOM   1388  C CG  . ASN A 1 196 ? 10.925   -36.184 15.460  1.00 36.32  ? 235  ASN A CG  1 
ATOM   1389  O OD1 . ASN A 1 196 ? 11.254   -36.341 14.279  1.00 29.82  ? 235  ASN A OD1 1 
ATOM   1390  N ND2 . ASN A 1 196 ? 11.685   -36.596 16.473  1.00 25.36  ? 235  ASN A ND2 1 
ATOM   1391  N N   . ILE A 1 197 ? 6.982    -37.448 14.054  1.00 27.24  ? 236  ILE A N   1 
ATOM   1392  C CA  . ILE A 1 197 ? 6.357    -38.765 14.143  1.00 30.99  ? 236  ILE A CA  1 
ATOM   1393  C C   . ILE A 1 197 ? 6.888    -39.782 13.142  1.00 27.39  ? 236  ILE A C   1 
ATOM   1394  O O   . ILE A 1 197 ? 7.478    -39.416 12.128  1.00 29.30  ? 236  ILE A O   1 
ATOM   1395  C CB  . ILE A 1 197 ? 4.826    -38.675 13.949  1.00 27.04  ? 236  ILE A CB  1 
ATOM   1396  C CG1 . ILE A 1 197 ? 4.486    -38.454 12.472  1.00 25.19  ? 236  ILE A CG1 1 
ATOM   1397  C CG2 . ILE A 1 197 ? 4.242    -37.588 14.839  1.00 32.79  ? 236  ILE A CG2 1 
ATOM   1398  C CD1 . ILE A 1 197 ? 2.994    -38.592 12.149  1.00 33.58  ? 236  ILE A CD1 1 
ATOM   1399  N N   . LEU A 1 198 ? 6.619    -41.057 13.413  1.00 29.57  ? 237  LEU A N   1 
ATOM   1400  C CA  . LEU A 1 198 ? 7.109    -42.159 12.585  1.00 26.30  ? 237  LEU A CA  1 
ATOM   1401  C C   . LEU A 1 198 ? 6.593    -42.087 11.159  1.00 31.49  ? 237  LEU A C   1 
ATOM   1402  O O   . LEU A 1 198 ? 5.429    -41.742 10.918  1.00 34.15  ? 237  LEU A O   1 
ATOM   1403  C CB  . LEU A 1 198 ? 6.735    -43.506 13.205  1.00 28.24  ? 237  LEU A CB  1 
ATOM   1404  C CG  . LEU A 1 198 ? 7.433    -43.838 14.522  1.00 38.23  ? 237  LEU A CG  1 
ATOM   1405  C CD1 . LEU A 1 198 ? 6.832    -45.096 15.144  1.00 38.42  ? 237  LEU A CD1 1 
ATOM   1406  C CD2 . LEU A 1 198 ? 8.956    -43.997 14.298  1.00 36.79  ? 237  LEU A CD2 1 
ATOM   1407  N N   . GLN A 1 199 ? 7.457    -42.431 10.213  1.00 27.89  ? 238  GLN A N   1 
ATOM   1408  C CA  . GLN A 1 199 ? 7.088    -42.401 8.806   1.00 30.28  ? 238  GLN A CA  1 
ATOM   1409  C C   . GLN A 1 199 ? 5.833    -43.221 8.582   1.00 33.60  ? 238  GLN A C   1 
ATOM   1410  O O   . GLN A 1 199 ? 4.939    -42.819 7.833   1.00 31.82  ? 238  GLN A O   1 
ATOM   1411  C CB  . GLN A 1 199 ? 8.221    -42.936 7.937   1.00 31.86  ? 238  GLN A CB  1 
ATOM   1412  C CG  . GLN A 1 199 ? 7.890    -43.038 6.468   1.00 31.81  ? 238  GLN A CG  1 
ATOM   1413  C CD  . GLN A 1 199 ? 9.085    -43.511 5.640   1.00 41.90  ? 238  GLN A CD  1 
ATOM   1414  O OE1 . GLN A 1 199 ? 10.199   -43.003 5.792   1.00 34.55  ? 238  GLN A OE1 1 
ATOM   1415  N NE2 . GLN A 1 199 ? 8.855    -44.488 4.767   1.00 33.70  ? 238  GLN A NE2 1 
ATOM   1416  N N   . GLN A 1 200 ? 5.781    -44.375 9.241   1.00 33.15  ? 239  GLN A N   1 
ATOM   1417  C CA  . GLN A 1 200 ? 4.689    -45.325 9.073   1.00 34.25  ? 239  GLN A CA  1 
ATOM   1418  C C   . GLN A 1 200 ? 3.360    -44.733 9.531   1.00 27.29  ? 239  GLN A C   1 
ATOM   1419  O O   . GLN A 1 200 ? 2.340    -44.946 8.889   1.00 27.75  ? 239  GLN A O   1 
ATOM   1420  C CB  . GLN A 1 200 ? 4.985    -46.629 9.829   1.00 38.13  ? 239  GLN A CB  1 
ATOM   1421  C CG  . GLN A 1 200 ? 3.751    -47.487 10.118  1.00 49.47  ? 239  GLN A CG  1 
ATOM   1422  C CD  . GLN A 1 200 ? 4.082    -48.803 10.828  1.00 73.20  ? 239  GLN A CD  1 
ATOM   1423  O OE1 . GLN A 1 200 ? 5.214    -49.300 10.759  1.00 69.66  ? 239  GLN A OE1 1 
ATOM   1424  N NE2 . GLN A 1 200 ? 3.088    -49.372 11.511  1.00 66.47  ? 239  GLN A NE2 1 
ATOM   1425  N N   . ASP A 1 201 ? 3.376    -44.003 10.641  1.00 28.51  ? 240  ASP A N   1 
ATOM   1426  C CA  . ASP A 1 201 ? 2.168    -43.347 11.135  1.00 31.03  ? 240  ASP A CA  1 
ATOM   1427  C C   . ASP A 1 201 ? 1.760    -42.197 10.201  1.00 36.63  ? 240  ASP A C   1 
ATOM   1428  O O   . ASP A 1 201 ? 0.588    -42.059 9.841   1.00 33.89  ? 240  ASP A O   1 
ATOM   1429  C CB  . ASP A 1 201 ? 2.387    -42.805 12.552  1.00 28.43  ? 240  ASP A CB  1 
ATOM   1430  C CG  . ASP A 1 201 ? 2.670    -43.915 13.572  1.00 40.05  ? 240  ASP A CG  1 
ATOM   1431  O OD1 . ASP A 1 201 ? 2.466    -45.097 13.236  1.00 34.00  ? 240  ASP A OD1 1 
ATOM   1432  O OD2 . ASP A 1 201 ? 3.098    -43.608 14.701  1.00 44.20  ? 240  ASP A OD2 1 
ATOM   1433  N N   . PHE A 1 202 ? 2.733    -41.367 9.827   1.00 32.62  ? 241  PHE A N   1 
ATOM   1434  C CA  . PHE A 1 202 ? 2.502    -40.283 8.874   1.00 32.16  ? 241  PHE A CA  1 
ATOM   1435  C C   . PHE A 1 202 ? 1.837    -40.804 7.593   1.00 34.48  ? 241  PHE A C   1 
ATOM   1436  O O   . PHE A 1 202 ? 0.811    -40.277 7.151   1.00 32.72  ? 241  PHE A O   1 
ATOM   1437  C CB  . PHE A 1 202 ? 3.819    -39.584 8.538   1.00 29.01  ? 241  PHE A CB  1 
ATOM   1438  C CG  . PHE A 1 202 ? 3.647    -38.298 7.793   1.00 27.52  ? 241  PHE A CG  1 
ATOM   1439  C CD1 . PHE A 1 202 ? 3.653    -38.280 6.411   1.00 33.64  ? 241  PHE A CD1 1 
ATOM   1440  C CD2 . PHE A 1 202 ? 3.469    -37.108 8.475   1.00 29.38  ? 241  PHE A CD2 1 
ATOM   1441  C CE1 . PHE A 1 202 ? 3.484    -37.089 5.714   1.00 33.67  ? 241  PHE A CE1 1 
ATOM   1442  C CE2 . PHE A 1 202 ? 3.301    -35.917 7.789   1.00 25.90  ? 241  PHE A CE2 1 
ATOM   1443  C CZ  . PHE A 1 202 ? 3.307    -35.910 6.412   1.00 27.02  ? 241  PHE A CZ  1 
ATOM   1444  N N   . CYS A 1 203 ? 2.415    -41.853 7.015   1.00 32.61  ? 242  CYS A N   1 
ATOM   1445  C CA  . CYS A 1 203 ? 1.890    -42.467 5.792   1.00 25.59  ? 242  CYS A CA  1 
ATOM   1446  C C   . CYS A 1 203 ? 0.492    -43.079 5.951   1.00 33.82  ? 242  CYS A C   1 
ATOM   1447  O O   . CYS A 1 203 ? -0.318   -43.060 5.017   1.00 27.90  ? 242  CYS A O   1 
ATOM   1448  C CB  . CYS A 1 203 ? 2.857    -43.544 5.278   1.00 36.75  ? 242  CYS A CB  1 
ATOM   1449  S SG  . CYS A 1 203 ? 4.457    -42.900 4.637   1.00 32.72  ? 242  CYS A SG  1 
ATOM   1450  N N   . HIS A 1 204 ? 0.216    -43.655 7.114   1.00 32.19  ? 243  HIS A N   1 
ATOM   1451  C CA  . HIS A 1 204 ? -1.117   -44.189 7.359   1.00 32.84  ? 243  HIS A CA  1 
ATOM   1452  C C   . HIS A 1 204 ? -2.140   -43.050 7.452   1.00 30.12  ? 243  HIS A C   1 
ATOM   1453  O O   . HIS A 1 204 ? -3.275   -43.192 7.005   1.00 30.48  ? 243  HIS A O   1 
ATOM   1454  C CB  . HIS A 1 204 ? -1.171   -45.045 8.625   1.00 32.84  ? 243  HIS A CB  1 
ATOM   1455  C CG  . HIS A 1 204 ? -2.502   -45.707 8.834   1.00 38.60  ? 243  HIS A CG  1 
ATOM   1456  N ND1 . HIS A 1 204 ? -3.338   -45.392 9.883   1.00 42.14  ? 243  HIS A ND1 1 
ATOM   1457  C CD2 . HIS A 1 204 ? -3.151   -46.648 8.106   1.00 45.92  ? 243  HIS A CD2 1 
ATOM   1458  C CE1 . HIS A 1 204 ? -4.439   -46.121 9.803   1.00 48.34  ? 243  HIS A CE1 1 
ATOM   1459  N NE2 . HIS A 1 204 ? -4.350   -46.893 8.734   1.00 45.61  ? 243  HIS A NE2 1 
ATOM   1460  N N   . ALA A 1 205 ? -1.735   -41.928 8.043   1.00 28.99  ? 244  ALA A N   1 
ATOM   1461  C CA  . ALA A 1 205 ? -2.601   -40.757 8.112   1.00 32.41  ? 244  ALA A CA  1 
ATOM   1462  C C   . ALA A 1 205 ? -3.018   -40.319 6.710   1.00 25.25  ? 244  ALA A C   1 
ATOM   1463  O O   . ALA A 1 205 ? -4.201   -40.046 6.447   1.00 28.70  ? 244  ALA A O   1 
ATOM   1464  C CB  . ALA A 1 205 ? -1.906   -39.622 8.857   1.00 29.99  ? 244  ALA A CB  1 
ATOM   1465  N N   . ILE A 1 206 ? -2.052   -40.273 5.801   1.00 24.09  ? 245  ILE A N   1 
ATOM   1466  C CA  . ILE A 1 206 ? -2.349   -39.915 4.421   1.00 26.58  ? 245  ILE A CA  1 
ATOM   1467  C C   . ILE A 1 206 ? -3.423   -40.829 3.790   1.00 24.41  ? 245  ILE A C   1 
ATOM   1468  O O   . ILE A 1 206 ? -4.344   -40.354 3.143   1.00 26.06  ? 245  ILE A O   1 
ATOM   1469  C CB  . ILE A 1 206 ? -1.078   -39.885 3.545   1.00 23.78  ? 245  ILE A CB  1 
ATOM   1470  C CG1 . ILE A 1 206 ? -0.125   -38.778 4.022   1.00 26.08  ? 245  ILE A CG1 1 
ATOM   1471  C CG2 . ILE A 1 206 ? -1.453   -39.645 2.099   1.00 25.42  ? 245  ILE A CG2 1 
ATOM   1472  C CD1 . ILE A 1 206 ? 1.251    -38.792 3.330   1.00 29.65  ? 245  ILE A CD1 1 
ATOM   1473  N N   . LYS A 1 207 ? -3.312   -42.135 3.992   1.00 31.44  ? 246  LYS A N   1 
ATOM   1474  C CA  . LYS A 1 207 ? -4.261   -43.071 3.392   1.00 29.96  ? 246  LYS A CA  1 
ATOM   1475  C C   . LYS A 1 207 ? -5.662   -42.934 3.975   1.00 28.69  ? 246  LYS A C   1 
ATOM   1476  O O   . LYS A 1 207 ? -6.666   -43.007 3.255   1.00 27.54  ? 246  LYS A O   1 
ATOM   1477  C CB  . LYS A 1 207 ? -3.773   -44.508 3.565   1.00 34.51  ? 246  LYS A CB  1 
ATOM   1478  C CG  . LYS A 1 207 ? -2.544   -44.821 2.735   1.00 41.05  ? 246  LYS A CG  1 
ATOM   1479  C CD  . LYS A 1 207 ? -2.031   -46.234 2.985   1.00 46.20  ? 246  LYS A CD  1 
ATOM   1480  C CE  . LYS A 1 207 ? -0.629   -46.424 2.388   1.00 52.21  ? 246  LYS A CE  1 
ATOM   1481  N NZ  . LYS A 1 207 ? 0.023    -47.682 2.865   1.00 49.68  ? 246  LYS A NZ  1 
ATOM   1482  N N   . VAL A 1 208 ? -5.726   -42.753 5.287   1.00 27.71  ? 247  VAL A N   1 
ATOM   1483  C CA  . VAL A 1 208 ? -7.000   -42.508 5.941   1.00 30.32  ? 247  VAL A CA  1 
ATOM   1484  C C   . VAL A 1 208 ? -7.616   -41.213 5.401   1.00 27.65  ? 247  VAL A C   1 
ATOM   1485  O O   . VAL A 1 208 ? -8.801   -41.160 5.083   1.00 26.80  ? 247  VAL A O   1 
ATOM   1486  C CB  . VAL A 1 208 ? -6.829   -42.407 7.458   1.00 33.65  ? 247  VAL A CB  1 
ATOM   1487  C CG1 . VAL A 1 208 ? -8.103   -41.870 8.096   1.00 39.77  ? 247  VAL A CG1 1 
ATOM   1488  C CG2 . VAL A 1 208 ? -6.459   -43.766 8.029   1.00 33.99  ? 247  VAL A CG2 1 
ATOM   1489  N N   . GLY A 1 209 ? -6.790   -40.177 5.276   1.00 28.75  ? 248  GLY A N   1 
ATOM   1490  C CA  . GLY A 1 209 ? -7.259   -38.878 4.823   1.00 24.80  ? 248  GLY A CA  1 
ATOM   1491  C C   . GLY A 1 209 ? -7.853   -38.976 3.439   1.00 28.29  ? 248  GLY A C   1 
ATOM   1492  O O   . GLY A 1 209 ? -8.950   -38.461 3.162   1.00 27.06  ? 248  GLY A O   1 
ATOM   1493  N N   . VAL A 1 210 ? -7.134   -39.660 2.559   1.00 24.32  ? 249  VAL A N   1 
ATOM   1494  C CA  . VAL A 1 210 ? -7.594   -39.802 1.190   1.00 21.39  ? 249  VAL A CA  1 
ATOM   1495  C C   . VAL A 1 210 ? -8.941   -40.524 1.156   1.00 28.20  ? 249  VAL A C   1 
ATOM   1496  O O   . VAL A 1 210 ? -9.845   -40.127 0.421   1.00 27.60  ? 249  VAL A O   1 
ATOM   1497  C CB  . VAL A 1 210 ? -6.558   -40.527 0.317   1.00 33.90  ? 249  VAL A CB  1 
ATOM   1498  C CG1 . VAL A 1 210 ? -7.107   -40.755 -1.079  1.00 25.50  ? 249  VAL A CG1 1 
ATOM   1499  C CG2 . VAL A 1 210 ? -5.249   -39.715 0.267   1.00 24.04  ? 249  VAL A CG2 1 
ATOM   1500  N N   . LYS A 1 211 ? -9.077   -41.577 1.957   1.00 29.49  ? 250  LYS A N   1 
ATOM   1501  C CA  . LYS A 1 211 ? -10.340  -42.312 2.026   1.00 35.80  ? 250  LYS A CA  1 
ATOM   1502  C C   . LYS A 1 211 ? -11.497  -41.337 2.253   1.00 30.99  ? 250  LYS A C   1 
ATOM   1503  O O   . LYS A 1 211 ? -12.493  -41.349 1.532   1.00 28.29  ? 250  LYS A O   1 
ATOM   1504  C CB  . LYS A 1 211 ? -10.280  -43.360 3.142   1.00 33.39  ? 250  LYS A CB  1 
ATOM   1505  C CG  . LYS A 1 211 ? -11.637  -43.850 3.631   1.00 49.85  ? 250  LYS A CG  1 
ATOM   1506  C CD  . LYS A 1 211 ? -11.563  -44.340 5.082   1.00 52.54  ? 250  LYS A CD  1 
ATOM   1507  C CE  . LYS A 1 211 ? -12.945  -44.545 5.702   1.00 66.41  ? 250  LYS A CE  1 
ATOM   1508  N NZ  . LYS A 1 211 ? -12.843  -44.996 7.124   1.00 66.30  ? 250  LYS A NZ  1 
ATOM   1509  N N   . TYR A 1 212 ? -11.346  -40.476 3.249   1.00 29.30  ? 251  TYR A N   1 
ATOM   1510  C CA  . TYR A 1 212 ? -12.395  -39.528 3.595   1.00 31.10  ? 251  TYR A CA  1 
ATOM   1511  C C   . TYR A 1 212 ? -12.671  -38.507 2.497   1.00 31.33  ? 251  TYR A C   1 
ATOM   1512  O O   . TYR A 1 212 ? -13.812  -38.093 2.315   1.00 27.32  ? 251  TYR A O   1 
ATOM   1513  C CB  . TYR A 1 212 ? -12.078  -38.824 4.915   1.00 30.64  ? 251  TYR A CB  1 
ATOM   1514  C CG  . TYR A 1 212 ? -12.247  -39.722 6.114   1.00 37.99  ? 251  TYR A CG  1 
ATOM   1515  C CD1 . TYR A 1 212 ? -11.189  -39.969 6.984   1.00 41.27  ? 251  TYR A CD1 1 
ATOM   1516  C CD2 . TYR A 1 212 ? -13.469  -40.332 6.376   1.00 33.84  ? 251  TYR A CD2 1 
ATOM   1517  C CE1 . TYR A 1 212 ? -11.349  -40.795 8.086   1.00 42.68  ? 251  TYR A CE1 1 
ATOM   1518  C CE2 . TYR A 1 212 ? -13.633  -41.164 7.469   1.00 44.91  ? 251  TYR A CE2 1 
ATOM   1519  C CZ  . TYR A 1 212 ? -12.574  -41.389 8.324   1.00 50.90  ? 251  TYR A CZ  1 
ATOM   1520  O OH  . TYR A 1 212 ? -12.749  -42.213 9.415   1.00 52.55  ? 251  TYR A OH  1 
ATOM   1521  N N   . THR A 1 213 ? -11.641  -38.097 1.761   1.00 26.35  ? 252  THR A N   1 
ATOM   1522  C CA  . THR A 1 213 ? -11.881  -37.128 0.700   1.00 29.82  ? 252  THR A CA  1 
ATOM   1523  C C   . THR A 1 213 ? -12.792  -37.723 -0.354  1.00 24.58  ? 252  THR A C   1 
ATOM   1524  O O   . THR A 1 213 ? -13.548  -37.000 -0.990  1.00 26.88  ? 252  THR A O   1 
ATOM   1525  C CB  . THR A 1 213 ? -10.592  -36.602 0.027   1.00 29.20  ? 252  THR A CB  1 
ATOM   1526  O OG1 . THR A 1 213 ? -9.904   -37.680 -0.626  1.00 25.47  ? 252  THR A OG1 1 
ATOM   1527  C CG2 . THR A 1 213 ? -9.684   -35.916 1.052   1.00 21.61  ? 252  THR A CG2 1 
ATOM   1528  N N   . GLN A 1 214 ? -12.712  -39.039 -0.536  1.00 25.70  ? 253  GLN A N   1 
ATOM   1529  C CA  . GLN A 1 214 ? -13.507  -39.710 -1.558  1.00 26.96  ? 253  GLN A CA  1 
ATOM   1530  C C   . GLN A 1 214 ? -14.987  -39.702 -1.170  1.00 28.49  ? 253  GLN A C   1 
ATOM   1531  O O   . GLN A 1 214 ? -15.858  -39.621 -2.025  1.00 29.72  ? 253  GLN A O   1 
ATOM   1532  C CB  . GLN A 1 214 ? -13.030  -41.156 -1.775  1.00 30.25  ? 253  GLN A CB  1 
ATOM   1533  C CG  . GLN A 1 214 ? -11.556  -41.296 -2.204  1.00 30.97  ? 253  GLN A CG  1 
ATOM   1534  C CD  . GLN A 1 214 ? -11.216  -40.477 -3.428  1.00 28.56  ? 253  GLN A CD  1 
ATOM   1535  O OE1 . GLN A 1 214 ? -11.493  -40.879 -4.562  1.00 27.45  ? 253  GLN A OE1 1 
ATOM   1536  N NE2 . GLN A 1 214 ? -10.625  -39.305 -3.207  1.00 24.45  ? 253  GLN A NE2 1 
ATOM   1537  N N   . GLN A 1 215 ? -15.263  -39.810 0.123   1.00 23.83  ? 254  GLN A N   1 
ATOM   1538  C CA  . GLN A 1 215 ? -16.627  -39.679 0.608   1.00 35.72  ? 254  GLN A CA  1 
ATOM   1539  C C   . GLN A 1 215 ? -17.165  -38.274 0.321   1.00 34.54  ? 254  GLN A C   1 
ATOM   1540  O O   . GLN A 1 215 ? -18.305  -38.118 -0.110  1.00 32.25  ? 254  GLN A O   1 
ATOM   1541  C CB  . GLN A 1 215 ? -16.692  -40.007 2.102   1.00 32.20  ? 254  GLN A CB  1 
ATOM   1542  C CG  . GLN A 1 215 ? -16.408  -41.491 2.377   1.00 40.40  ? 254  GLN A CG  1 
ATOM   1543  C CD  . GLN A 1 215 ? -16.162  -41.821 3.848   1.00 45.57  ? 254  GLN A CD  1 
ATOM   1544  O OE1 . GLN A 1 215 ? -15.439  -42.771 4.166   1.00 62.80  ? 254  GLN A OE1 1 
ATOM   1545  N NE2 . GLN A 1 215 ? -16.779  -41.055 4.748   1.00 53.99  ? 254  GLN A NE2 1 
ATOM   1546  N N   . ILE A 1 216 ? -16.337  -37.256 0.540   1.00 29.27  ? 255  ILE A N   1 
ATOM   1547  C CA  . ILE A 1 216 ? -16.781  -35.886 0.308   1.00 24.67  ? 255  ILE A CA  1 
ATOM   1548  C C   . ILE A 1 216 ? -17.042  -35.670 -1.173  1.00 26.53  ? 255  ILE A C   1 
ATOM   1549  O O   . ILE A 1 216 ? -18.024  -35.034 -1.559  1.00 27.12  ? 255  ILE A O   1 
ATOM   1550  C CB  . ILE A 1 216 ? -15.777  -34.846 0.834   1.00 27.20  ? 255  ILE A CB  1 
ATOM   1551  C CG1 . ILE A 1 216 ? -15.593  -35.009 2.339   1.00 25.42  ? 255  ILE A CG1 1 
ATOM   1552  C CG2 . ILE A 1 216 ? -16.253  -33.429 0.488   1.00 24.76  ? 255  ILE A CG2 1 
ATOM   1553  C CD1 . ILE A 1 216 ? -14.656  -34.010 2.952   1.00 26.55  ? 255  ILE A CD1 1 
ATOM   1554  N N   . ILE A 1 217 ? -16.171  -36.219 -2.011  1.00 25.27  ? 256  ILE A N   1 
ATOM   1555  C CA  . ILE A 1 217 ? -16.378  -36.102 -3.448  1.00 28.93  ? 256  ILE A CA  1 
ATOM   1556  C C   . ILE A 1 217 ? -17.714  -36.729 -3.864  1.00 30.07  ? 256  ILE A C   1 
ATOM   1557  O O   . ILE A 1 217 ? -18.426  -36.187 -4.701  1.00 30.38  ? 256  ILE A O   1 
ATOM   1558  C CB  . ILE A 1 217 ? -15.198  -36.698 -4.252  1.00 28.75  ? 256  ILE A CB  1 
ATOM   1559  C CG1 . ILE A 1 217 ? -13.926  -35.866 -4.012  1.00 24.53  ? 256  ILE A CG1 1 
ATOM   1560  C CG2 . ILE A 1 217 ? -15.525  -36.743 -5.741  1.00 27.95  ? 256  ILE A CG2 1 
ATOM   1561  C CD1 . ILE A 1 217 ? -12.625  -36.548 -4.491  1.00 25.48  ? 256  ILE A CD1 1 
ATOM   1562  N N   . GLN A 1 218 ? -18.057  -37.863 -3.268  1.00 30.32  ? 257  GLN A N   1 
ATOM   1563  C CA  . GLN A 1 218 ? -19.318  -38.516 -3.597  1.00 38.51  ? 257  GLN A CA  1 
ATOM   1564  C C   . GLN A 1 218 ? -20.492  -37.563 -3.299  1.00 32.11  ? 257  GLN A C   1 
ATOM   1565  O O   . GLN A 1 218 ? -21.380  -37.374 -4.125  1.00 31.85  ? 257  GLN A O   1 
ATOM   1566  C CB  . GLN A 1 218 ? -19.448  -39.833 -2.830  1.00 35.64  ? 257  GLN A CB  1 
ATOM   1567  C CG  . GLN A 1 218 ? -20.722  -40.591 -3.135  1.00 55.96  ? 257  GLN A CG  1 
ATOM   1568  C CD  . GLN A 1 218 ? -20.725  -41.980 -2.526  1.00 73.20  ? 257  GLN A CD  1 
ATOM   1569  O OE1 . GLN A 1 218 ? -19.801  -42.356 -1.793  1.00 74.43  ? 257  GLN A OE1 1 
ATOM   1570  N NE2 . GLN A 1 218 ? -21.762  -42.756 -2.831  1.00 82.25  ? 257  GLN A NE2 1 
ATOM   1571  N N   . GLY A 1 219 ? -20.475  -36.933 -2.131  1.00 28.43  ? 258  GLY A N   1 
ATOM   1572  C CA  . GLY A 1 219 ? -21.499  -35.953 -1.797  1.00 30.50  ? 258  GLY A CA  1 
ATOM   1573  C C   . GLY A 1 219 ? -21.569  -34.797 -2.784  1.00 34.40  ? 258  GLY A C   1 
ATOM   1574  O O   . GLY A 1 219 ? -22.650  -34.355 -3.197  1.00 26.49  ? 258  GLY A O   1 
ATOM   1575  N N   . ILE A 1 220 ? -20.406  -34.302 -3.178  1.00 29.57  ? 259  ILE A N   1 
ATOM   1576  C CA  . ILE A 1 220 ? -20.360  -33.185 -4.102  1.00 27.63  ? 259  ILE A CA  1 
ATOM   1577  C C   . ILE A 1 220 ? -20.909  -33.581 -5.473  1.00 26.72  ? 259  ILE A C   1 
ATOM   1578  O O   . ILE A 1 220 ? -21.644  -32.813 -6.091  1.00 26.76  ? 259  ILE A O   1 
ATOM   1579  C CB  . ILE A 1 220 ? -18.933  -32.611 -4.250  1.00 23.38  ? 259  ILE A CB  1 
ATOM   1580  C CG1 . ILE A 1 220 ? -18.432  -32.073 -2.904  1.00 23.63  ? 259  ILE A CG1 1 
ATOM   1581  C CG2 . ILE A 1 220 ? -18.935  -31.498 -5.264  1.00 24.78  ? 259  ILE A CG2 1 
ATOM   1582  C CD1 . ILE A 1 220 ? -16.990  -31.506 -2.948  1.00 27.52  ? 259  ILE A CD1 1 
ATOM   1583  N N   . GLN A 1 221 ? -20.546  -34.772 -5.943  1.00 26.82  ? 260  GLN A N   1 
ATOM   1584  C CA  . GLN A 1 221 ? -21.054  -35.281 -7.218  1.00 31.94  ? 260  GLN A CA  1 
ATOM   1585  C C   . GLN A 1 221 ? -22.598  -35.356 -7.224  1.00 31.29  ? 260  GLN A C   1 
ATOM   1586  O O   . GLN A 1 221 ? -23.224  -35.089 -8.242  1.00 27.70  ? 260  GLN A O   1 
ATOM   1587  C CB  . GLN A 1 221 ? -20.427  -36.644 -7.572  1.00 27.86  ? 260  GLN A CB  1 
ATOM   1588  C CG  . GLN A 1 221 ? -18.927  -36.587 -7.981  1.00 35.24  ? 260  GLN A CG  1 
ATOM   1589  C CD  . GLN A 1 221 ? -18.232  -37.965 -7.954  1.00 44.03  ? 260  GLN A CD  1 
ATOM   1590  O OE1 . GLN A 1 221 ? -18.729  -38.910 -7.335  1.00 54.57  ? 260  GLN A OE1 1 
ATOM   1591  N NE2 . GLN A 1 221 ? -17.076  -38.073 -8.626  1.00 39.47  ? 260  GLN A NE2 1 
ATOM   1592  N N   . GLN A 1 222 ? -23.201  -35.720 -6.092  1.00 29.17  ? 261  GLN A N   1 
ATOM   1593  C CA  . GLN A 1 222 ? -24.666  -35.734 -5.968  1.00 29.27  ? 261  GLN A CA  1 
ATOM   1594  C C   . GLN A 1 222 ? -25.225  -34.330 -6.184  1.00 36.67  ? 261  GLN A C   1 
ATOM   1595  O O   . GLN A 1 222 ? -26.173  -34.125 -6.945  1.00 33.26  ? 261  GLN A O   1 
ATOM   1596  C CB  . GLN A 1 222 ? -25.081  -36.224 -4.586  1.00 30.23  ? 261  GLN A CB  1 
ATOM   1597  C CG  . GLN A 1 222 ? -26.585  -36.067 -4.313  1.00 37.66  ? 261  GLN A CG  1 
ATOM   1598  C CD  . GLN A 1 222 ? -27.427  -36.992 -5.187  1.00 39.78  ? 261  GLN A CD  1 
ATOM   1599  O OE1 . GLN A 1 222 ? -26.964  -38.054 -5.606  1.00 37.55  ? 261  GLN A OE1 1 
ATOM   1600  N NE2 . GLN A 1 222 ? -28.660  -36.579 -5.486  1.00 32.93  ? 261  GLN A NE2 1 
ATOM   1601  N N   . LEU A 1 223 ? -24.617  -33.367 -5.499  1.00 29.48  ? 262  LEU A N   1 
ATOM   1602  C CA  . LEU A 1 223 ? -25.015  -31.970 -5.568  1.00 32.69  ? 262  LEU A CA  1 
ATOM   1603  C C   . LEU A 1 223 ? -24.951  -31.465 -7.004  1.00 34.73  ? 262  LEU A C   1 
ATOM   1604  O O   . LEU A 1 223 ? -25.870  -30.786 -7.480  1.00 35.55  ? 262  LEU A O   1 
ATOM   1605  C CB  . LEU A 1 223 ? -24.080  -31.146 -4.685  1.00 29.15  ? 262  LEU A CB  1 
ATOM   1606  C CG  . LEU A 1 223 ? -24.572  -30.097 -3.692  1.00 46.92  ? 262  LEU A CG  1 
ATOM   1607  C CD1 . LEU A 1 223 ? -25.847  -30.514 -2.954  1.00 36.00  ? 262  LEU A CD1 1 
ATOM   1608  C CD2 . LEU A 1 223 ? -23.441  -29.798 -2.709  1.00 31.05  ? 262  LEU A CD2 1 
ATOM   1609  N N   . VAL A 1 224 ? -23.867  -31.810 -7.695  1.00 32.42  ? 263  VAL A N   1 
ATOM   1610  C CA  . VAL A 1 224 ? -23.668  -31.398 -9.083  1.00 29.52  ? 263  VAL A CA  1 
ATOM   1611  C C   . VAL A 1 224 ? -24.738  -31.990 -9.995  1.00 31.65  ? 263  VAL A C   1 
ATOM   1612  O O   . VAL A 1 224 ? -25.251  -31.336 -10.902 1.00 28.79  ? 263  VAL A O   1 
ATOM   1613  C CB  . VAL A 1 224 ? -22.277  -31.831 -9.594  1.00 32.56  ? 263  VAL A CB  1 
ATOM   1614  C CG1 . VAL A 1 224 ? -22.198  -31.693 -11.100 1.00 30.59  ? 263  VAL A CG1 1 
ATOM   1615  C CG2 . VAL A 1 224 ? -21.183  -31.002 -8.918  1.00 25.80  ? 263  VAL A CG2 1 
ATOM   1616  N N   . LYS A 1 225 ? -25.074  -33.243 -9.745  1.00 29.62  ? 264  LYS A N   1 
ATOM   1617  C CA  . LYS A 1 225 ? -26.044  -33.934 -10.559 1.00 31.75  ? 264  LYS A CA  1 
ATOM   1618  C C   . LYS A 1 225 ? -27.446  -33.328 -10.373 1.00 31.22  ? 264  LYS A C   1 
ATOM   1619  O O   . LYS A 1 225 ? -28.219  -33.233 -11.320 1.00 32.67  ? 264  LYS A O   1 
ATOM   1620  C CB  . LYS A 1 225 ? -26.030  -35.411 -10.181 1.00 34.85  ? 264  LYS A CB  1 
ATOM   1621  C CG  . LYS A 1 225 ? -26.783  -36.313 -11.128 1.00 50.10  ? 264  LYS A CG  1 
ATOM   1622  C CD  . LYS A 1 225 ? -27.924  -36.989 -10.409 1.00 42.42  ? 264  LYS A CD  1 
ATOM   1623  C CE  . LYS A 1 225 ? -27.567  -37.264 -8.962  1.00 51.05  ? 264  LYS A CE  1 
ATOM   1624  N NZ  . LYS A 1 225 ? -27.195  -38.681 -8.714  1.00 57.09  ? 264  LYS A NZ  1 
ATOM   1625  N N   . GLU A 1 226 ? -27.765  -32.915 -9.151  1.00 31.88  ? 265  GLU A N   1 
ATOM   1626  C CA  . GLU A 1 226 ? -29.072  -32.329 -8.860  1.00 32.32  ? 265  GLU A CA  1 
ATOM   1627  C C   . GLU A 1 226 ? -29.189  -30.939 -9.451  1.00 37.71  ? 265  GLU A C   1 
ATOM   1628  O O   . GLU A 1 226 ? -30.268  -30.531 -9.892  1.00 31.44  ? 265  GLU A O   1 
ATOM   1629  C CB  . GLU A 1 226 ? -29.318  -32.267 -7.353  1.00 29.20  ? 265  GLU A CB  1 
ATOM   1630  C CG  . GLU A 1 226 ? -29.441  -33.623 -6.692  1.00 27.06  ? 265  GLU A CG  1 
ATOM   1631  C CD  . GLU A 1 226 ? -29.802  -33.519 -5.215  1.00 36.24  ? 265  GLU A CD  1 
ATOM   1632  O OE1 . GLU A 1 226 ? -30.087  -32.394 -4.733  1.00 34.96  ? 265  GLU A OE1 1 
ATOM   1633  O OE2 . GLU A 1 226 ? -29.808  -34.563 -4.534  1.00 36.90  ? 265  GLU A OE2 1 
ATOM   1634  N N   . THR A 1 227 ? -28.066  -30.226 -9.480  1.00 30.31  ? 266  THR A N   1 
ATOM   1635  C CA  . THR A 1 227 ? -28.050  -28.832 -9.903  1.00 33.40  ? 266  THR A CA  1 
ATOM   1636  C C   . THR A 1 227 ? -28.179  -28.707 -11.412 1.00 38.00  ? 266  THR A C   1 
ATOM   1637  O O   . THR A 1 227 ? -28.708  -27.715 -11.917 1.00 35.33  ? 266  THR A O   1 
ATOM   1638  C CB  . THR A 1 227 ? -26.752  -28.136 -9.457  1.00 33.31  ? 266  THR A CB  1 
ATOM   1639  O OG1 . THR A 1 227 ? -26.703  -28.081 -8.028  1.00 38.65  ? 266  THR A OG1 1 
ATOM   1640  C CG2 . THR A 1 227 ? -26.674  -26.723 -10.010 1.00 41.61  ? 266  THR A CG2 1 
ATOM   1641  N N   . GLY A 1 228 ? -27.688  -29.717 -12.125 1.00 38.24  ? 267  GLY A N   1 
ATOM   1642  C CA  . GLY A 1 228 ? -27.683  -29.697 -13.578 1.00 36.92  ? 267  GLY A CA  1 
ATOM   1643  C C   . GLY A 1 228 ? -26.711  -28.665 -14.121 1.00 42.27  ? 267  GLY A C   1 
ATOM   1644  O O   . GLY A 1 228 ? -27.114  -27.649 -14.692 1.00 38.42  ? 267  GLY A O   1 
ATOM   1645  N N   . VAL A 1 229 ? -25.420  -28.936 -13.964 1.00 32.54  ? 268  VAL A N   1 
ATOM   1646  C CA  . VAL A 1 229 ? -24.399  -27.953 -14.299 1.00 34.90  ? 268  VAL A CA  1 
ATOM   1647  C C   . VAL A 1 229 ? -23.985  -28.049 -15.764 1.00 39.34  ? 268  VAL A C   1 
ATOM   1648  O O   . VAL A 1 229 ? -23.728  -29.136 -16.281 1.00 42.93  ? 268  VAL A O   1 
ATOM   1649  C CB  . VAL A 1 229 ? -23.152  -28.135 -13.420 1.00 32.12  ? 268  VAL A CB  1 
ATOM   1650  C CG1 . VAL A 1 229 ? -22.087  -27.117 -13.791 1.00 32.63  ? 268  VAL A CG1 1 
ATOM   1651  C CG2 . VAL A 1 229 ? -23.512  -28.023 -11.955 1.00 30.56  ? 268  VAL A CG2 1 
ATOM   1652  N N   . THR A 1 230 ? -23.935  -26.903 -16.428 1.00 34.03  ? 269  THR A N   1 
ATOM   1653  C CA  . THR A 1 230 ? -23.443  -26.823 -17.793 1.00 35.47  ? 269  THR A CA  1 
ATOM   1654  C C   . THR A 1 230 ? -22.261  -25.867 -17.797 1.00 36.11  ? 269  THR A C   1 
ATOM   1655  O O   . THR A 1 230 ? -22.420  -24.691 -17.504 1.00 35.82  ? 269  THR A O   1 
ATOM   1656  C CB  . THR A 1 230 ? -24.542  -26.311 -18.748 1.00 43.51  ? 269  THR A CB  1 
ATOM   1657  O OG1 . THR A 1 230 ? -25.553  -27.319 -18.889 1.00 44.32  ? 269  THR A OG1 1 
ATOM   1658  C CG2 . THR A 1 230 ? -23.968  -25.976 -20.123 1.00 39.34  ? 269  THR A CG2 1 
ATOM   1659  N N   . LYS A 1 231 ? -21.067  -26.376 -18.095 1.00 31.54  ? 270  LYS A N   1 
ATOM   1660  C CA  . LYS A 1 231 ? -19.873  -25.539 -18.098 1.00 30.20  ? 270  LYS A CA  1 
ATOM   1661  C C   . LYS A 1 231 ? -19.883  -24.582 -19.273 1.00 32.73  ? 270  LYS A C   1 
ATOM   1662  O O   . LYS A 1 231 ? -20.401  -24.908 -20.340 1.00 33.41  ? 270  LYS A O   1 
ATOM   1663  C CB  . LYS A 1 231 ? -18.602  -26.395 -18.142 1.00 31.83  ? 270  LYS A CB  1 
ATOM   1664  C CG  . LYS A 1 231 ? -18.361  -27.191 -16.878 1.00 33.37  ? 270  LYS A CG  1 
ATOM   1665  C CD  . LYS A 1 231 ? -18.213  -26.276 -15.655 1.00 24.26  ? 270  LYS A CD  1 
ATOM   1666  C CE  . LYS A 1 231 ? -18.000  -27.115 -14.399 1.00 28.69  ? 270  LYS A CE  1 
ATOM   1667  N NZ  . LYS A 1 231 ? -17.708  -26.297 -13.184 1.00 24.12  ? 270  LYS A NZ  1 
ATOM   1668  N N   . ARG A 1 232 ? -19.315  -23.397 -19.073 1.00 31.32  ? 271  ARG A N   1 
ATOM   1669  C CA  . ARG A 1 232 ? -19.131  -22.445 -20.164 1.00 35.70  ? 271  ARG A CA  1 
ATOM   1670  C C   . ARG A 1 232 ? -18.189  -23.026 -21.230 1.00 44.83  ? 271  ARG A C   1 
ATOM   1671  O O   . ARG A 1 232 ? -17.409  -23.952 -20.965 1.00 36.07  ? 271  ARG A O   1 
ATOM   1672  C CB  . ARG A 1 232 ? -18.505  -21.156 -19.638 1.00 34.22  ? 271  ARG A CB  1 
ATOM   1673  C CG  . ARG A 1 232 ? -17.026  -21.322 -19.300 1.00 36.35  ? 271  ARG A CG  1 
ATOM   1674  C CD  . ARG A 1 232 ? -16.410  -20.044 -18.721 1.00 36.72  ? 271  ARG A CD  1 
ATOM   1675  N NE  . ARG A 1 232 ? -17.093  -19.604 -17.503 1.00 32.39  ? 271  ARG A NE  1 
ATOM   1676  C CZ  . ARG A 1 232 ? -16.819  -18.468 -16.868 1.00 34.39  ? 271  ARG A CZ  1 
ATOM   1677  N NH1 . ARG A 1 232 ? -15.873  -17.667 -17.339 1.00 30.73  ? 271  ARG A NH1 1 
ATOM   1678  N NH2 . ARG A 1 232 ? -17.495  -18.130 -15.771 1.00 29.66  ? 271  ARG A NH2 1 
ATOM   1679  N N   . THR A 1 233 ? -18.255  -22.462 -22.429 1.00 35.53  ? 272  THR A N   1 
ATOM   1680  C CA  . THR A 1 233 ? -17.255  -22.731 -23.449 1.00 38.15  ? 272  THR A CA  1 
ATOM   1681  C C   . THR A 1 233 ? -16.314  -21.538 -23.538 1.00 38.42  ? 272  THR A C   1 
ATOM   1682  O O   . THR A 1 233 ? -16.683  -20.510 -24.092 1.00 41.07  ? 272  THR A O   1 
ATOM   1683  C CB  . THR A 1 233 ? -17.909  -22.997 -24.821 1.00 39.38  ? 272  THR A CB  1 
ATOM   1684  O OG1 . THR A 1 233 ? -18.614  -24.243 -24.773 1.00 45.54  ? 272  THR A OG1 1 
ATOM   1685  C CG2 . THR A 1 233 ? -16.853  -23.086 -25.907 1.00 47.28  ? 272  THR A CG2 1 
ATOM   1686  N N   . PRO A 1 234 ? -15.093  -21.661 -22.976 1.00 35.32  ? 273  PRO A N   1 
ATOM   1687  C CA  . PRO A 1 234 ? -14.228  -20.481 -22.935 1.00 34.86  ? 273  PRO A CA  1 
ATOM   1688  C C   . PRO A 1 234 ? -14.001  -19.932 -24.338 1.00 43.98  ? 273  PRO A C   1 
ATOM   1689  O O   . PRO A 1 234 ? -14.026  -20.695 -25.300 1.00 39.71  ? 273  PRO A O   1 
ATOM   1690  C CB  . PRO A 1 234 ? -12.913  -21.004 -22.318 1.00 37.77  ? 273  PRO A CB  1 
ATOM   1691  C CG  . PRO A 1 234 ? -13.015  -22.498 -22.338 1.00 46.47  ? 273  PRO A CG  1 
ATOM   1692  C CD  . PRO A 1 234 ? -14.470  -22.845 -22.359 1.00 33.20  ? 273  PRO A CD  1 
ATOM   1693  N N   . GLN A 1 235 ? -13.815  -18.624 -24.455 1.00 41.00  ? 274  GLN A N   1 
ATOM   1694  C CA  . GLN A 1 235 ? -13.562  -18.016 -25.758 1.00 48.33  ? 274  GLN A CA  1 
ATOM   1695  C C   . GLN A 1 235 ? -12.450  -18.784 -26.474 1.00 53.72  ? 274  GLN A C   1 
ATOM   1696  O O   . GLN A 1 235 ? -12.592  -19.142 -27.646 1.00 46.52  ? 274  GLN A O   1 
ATOM   1697  C CB  . GLN A 1 235 ? -13.203  -16.544 -25.587 1.00 45.72  ? 274  GLN A CB  1 
ATOM   1698  C CG  . GLN A 1 235 ? -12.833  -15.811 -26.865 1.00 56.55  ? 274  GLN A CG  1 
ATOM   1699  C CD  . GLN A 1 235 ? -12.681  -14.314 -26.631 1.00 61.13  ? 274  GLN A CD  1 
ATOM   1700  O OE1 . GLN A 1 235 ? -13.491  -13.695 -25.930 1.00 54.85  ? 274  GLN A OE1 1 
ATOM   1701  N NE2 . GLN A 1 235 ? -11.632  -13.729 -27.203 1.00 59.69  ? 274  GLN A NE2 1 
ATOM   1702  N N   . LYS A 1 236 ? -11.355  -19.052 -25.761 1.00 44.91  ? 275  LYS A N   1 
ATOM   1703  C CA  . LYS A 1 236 ? -10.295  -19.924 -26.267 1.00 47.21  ? 275  LYS A CA  1 
ATOM   1704  C C   . LYS A 1 236 ? -9.439   -20.501 -25.145 1.00 40.63  ? 275  LYS A C   1 
ATOM   1705  O O   . LYS A 1 236 ? -9.215   -19.853 -24.117 1.00 42.63  ? 275  LYS A O   1 
ATOM   1706  C CB  . LYS A 1 236 ? -9.382   -19.180 -27.257 1.00 51.66  ? 275  LYS A CB  1 
ATOM   1707  C CG  . LYS A 1 236 ? -8.207   -20.042 -27.762 1.00 51.04  ? 275  LYS A CG  1 
ATOM   1708  C CD  . LYS A 1 236 ? -7.459   -19.406 -28.917 1.00 58.70  ? 275  LYS A CD  1 
ATOM   1709  C CE  . LYS A 1 236 ? -6.770   -18.113 -28.494 1.00 72.62  ? 275  LYS A CE  1 
ATOM   1710  N NZ  . LYS A 1 236 ? -5.881   -17.569 -29.594 1.00 66.98  ? 275  LYS A NZ  1 
ATOM   1711  N N   . LEU A 1 237 ? -8.962   -21.722 -25.342 1.00 44.39  ? 276  LEU A N   1 
ATOM   1712  C CA  . LEU A 1 237 ? -7.934   -22.270 -24.469 1.00 46.38  ? 276  LEU A CA  1 
ATOM   1713  C C   . LEU A 1 237 ? -6.584   -22.007 -25.127 1.00 49.59  ? 276  LEU A C   1 
ATOM   1714  O O   . LEU A 1 237 ? -6.338   -22.432 -26.255 1.00 50.97  ? 276  LEU A O   1 
ATOM   1715  C CB  . LEU A 1 237 ? -8.157   -23.763 -24.219 1.00 47.32  ? 276  LEU A CB  1 
ATOM   1716  C CG  . LEU A 1 237 ? -9.445   -24.099 -23.458 1.00 46.28  ? 276  LEU A CG  1 
ATOM   1717  C CD1 . LEU A 1 237 ? -9.620   -25.599 -23.303 1.00 46.21  ? 276  LEU A CD1 1 
ATOM   1718  C CD2 . LEU A 1 237 ? -9.458   -23.414 -22.092 1.00 40.10  ? 276  LEU A CD2 1 
ATOM   1719  N N   . PHE A 1 238 ? -5.718   -21.284 -24.431 1.00 40.00  ? 277  PHE A N   1 
ATOM   1720  C CA  . PHE A 1 238 ? -4.461   -20.857 -25.026 1.00 44.64  ? 277  PHE A CA  1 
ATOM   1721  C C   . PHE A 1 238 ? -3.364   -21.916 -24.949 1.00 40.41  ? 277  PHE A C   1 
ATOM   1722  O O   . PHE A 1 238 ? -2.364   -21.737 -24.257 1.00 49.06  ? 277  PHE A O   1 
ATOM   1723  C CB  . PHE A 1 238 ? -3.993   -19.561 -24.379 1.00 38.65  ? 277  PHE A CB  1 
ATOM   1724  C CG  . PHE A 1 238 ? -4.909   -18.414 -24.620 1.00 48.18  ? 277  PHE A CG  1 
ATOM   1725  C CD1 . PHE A 1 238 ? -4.627   -17.483 -25.604 1.00 51.53  ? 277  PHE A CD1 1 
ATOM   1726  C CD2 . PHE A 1 238 ? -6.062   -18.266 -23.869 1.00 43.98  ? 277  PHE A CD2 1 
ATOM   1727  C CE1 . PHE A 1 238 ? -5.481   -16.415 -25.831 1.00 60.95  ? 277  PHE A CE1 1 
ATOM   1728  C CE2 . PHE A 1 238 ? -6.917   -17.203 -24.090 1.00 49.72  ? 277  PHE A CE2 1 
ATOM   1729  C CZ  . PHE A 1 238 ? -6.630   -16.277 -25.074 1.00 52.05  ? 277  PHE A CZ  1 
ATOM   1730  N N   . THR A 1 239 ? -3.567   -23.020 -25.656 1.00 44.81  ? 278  THR A N   1 
ATOM   1731  C CA  . THR A 1 239 ? -2.525   -24.023 -25.826 1.00 53.42  ? 278  THR A CA  1 
ATOM   1732  C C   . THR A 1 239 ? -2.074   -24.005 -27.286 1.00 50.28  ? 278  THR A C   1 
ATOM   1733  O O   . THR A 1 239 ? -2.892   -23.858 -28.187 1.00 55.47  ? 278  THR A O   1 
ATOM   1734  C CB  . THR A 1 239 ? -3.006   -25.431 -25.416 1.00 48.63  ? 278  THR A CB  1 
ATOM   1735  O OG1 . THR A 1 239 ? -4.261   -25.721 -26.048 1.00 47.74  ? 278  THR A OG1 1 
ATOM   1736  C CG2 . THR A 1 239 ? -3.173   -25.519 -23.899 1.00 47.47  ? 278  THR A CG2 1 
ATOM   1737  N N   . PRO A 1 240 ? -0.765   -24.131 -27.523 1.00 45.54  ? 279  PRO A N   1 
ATOM   1738  C CA  . PRO A 1 240 ? -0.260   -24.046 -28.898 1.00 50.00  ? 279  PRO A CA  1 
ATOM   1739  C C   . PRO A 1 240 ? -0.779   -25.189 -29.763 1.00 50.43  ? 279  PRO A C   1 
ATOM   1740  O O   . PRO A 1 240 ? -0.949   -26.300 -29.264 1.00 48.97  ? 279  PRO A O   1 
ATOM   1741  C CB  . PRO A 1 240 ? 1.266    -24.130 -28.727 1.00 51.16  ? 279  PRO A CB  1 
ATOM   1742  C CG  . PRO A 1 240 ? 1.478    -24.739 -27.377 1.00 52.05  ? 279  PRO A CG  1 
ATOM   1743  C CD  . PRO A 1 240 ? 0.316    -24.290 -26.537 1.00 53.86  ? 279  PRO A CD  1 
ATOM   1744  N N   . SER A 1 241 ? -1.045   -24.912 -31.038 1.00 49.28  ? 280  SER A N   1 
ATOM   1745  C CA  . SER A 1 241 ? -1.530   -25.937 -31.956 1.00 53.27  ? 280  SER A CA  1 
ATOM   1746  C C   . SER A 1 241 ? -0.492   -27.043 -32.123 1.00 52.80  ? 280  SER A C   1 
ATOM   1747  O O   . SER A 1 241 ? 0.709    -26.781 -32.083 1.00 56.97  ? 280  SER A O   1 
ATOM   1748  C CB  . SER A 1 241 ? -1.851   -25.323 -33.319 1.00 62.77  ? 280  SER A CB  1 
ATOM   1749  O OG  . SER A 1 241 ? -0.678   -24.828 -33.942 1.00 53.22  ? 280  SER A OG  1 
ATOM   1750  N N   . PRO A 1 242 ? -0.953   -28.288 -32.302 1.00 49.34  ? 281  PRO A N   1 
ATOM   1751  C CA  . PRO A 1 242 ? -0.038   -29.408 -32.530 1.00 56.48  ? 281  PRO A CA  1 
ATOM   1752  C C   . PRO A 1 242 ? 0.907    -29.171 -33.717 1.00 64.89  ? 281  PRO A C   1 
ATOM   1753  O O   . PRO A 1 242 ? 2.005    -29.729 -33.733 1.00 62.81  ? 281  PRO A O   1 
ATOM   1754  C CB  . PRO A 1 242 ? -0.988   -30.576 -32.808 1.00 60.63  ? 281  PRO A CB  1 
ATOM   1755  C CG  . PRO A 1 242 ? -2.224   -30.227 -32.046 1.00 59.10  ? 281  PRO A CG  1 
ATOM   1756  C CD  . PRO A 1 242 ? -2.352   -28.735 -32.175 1.00 53.36  ? 281  PRO A CD  1 
ATOM   1757  N N   . GLU A 1 243 ? 0.492    -28.348 -34.679 1.00 58.81  ? 282  GLU A N   1 
ATOM   1758  C CA  . GLU A 1 243 ? 1.330    -28.030 -35.835 1.00 61.81  ? 282  GLU A CA  1 
ATOM   1759  C C   . GLU A 1 243 ? 2.596    -27.272 -35.457 1.00 61.44  ? 282  GLU A C   1 
ATOM   1760  O O   . GLU A 1 243 ? 3.704    -27.662 -35.839 1.00 53.83  ? 282  GLU A O   1 
ATOM   1761  C CB  . GLU A 1 243 ? 0.558    -27.200 -36.864 1.00 54.32  ? 282  GLU A CB  1 
ATOM   1762  C CG  . GLU A 1 243 ? -0.091   -28.003 -37.971 1.00 75.70  ? 282  GLU A CG  1 
ATOM   1763  C CD  . GLU A 1 243 ? -0.664   -27.117 -39.071 1.00 87.97  ? 282  GLU A CD  1 
ATOM   1764  O OE1 . GLU A 1 243 ? -0.264   -25.934 -39.161 1.00 73.16  ? 282  GLU A OE1 1 
ATOM   1765  O OE2 . GLU A 1 243 ? -1.518   -27.607 -39.845 1.00 89.26  ? 282  GLU A OE2 1 
ATOM   1766  N N   . ILE A 1 244 ? 2.424    -26.170 -34.732 1.00 52.87  ? 283  ILE A N   1 
ATOM   1767  C CA  . ILE A 1 244 ? 3.554    -25.328 -34.370 1.00 52.86  ? 283  ILE A CA  1 
ATOM   1768  C C   . ILE A 1 244 ? 4.481    -26.080 -33.418 1.00 55.59  ? 283  ILE A C   1 
ATOM   1769  O O   . ILE A 1 244 ? 5.700    -25.924 -33.466 1.00 46.22  ? 283  ILE A O   1 
ATOM   1770  C CB  . ILE A 1 244 ? 3.102    -23.994 -33.754 1.00 52.24  ? 283  ILE A CB  1 
ATOM   1771  C CG1 . ILE A 1 244 ? 2.008    -23.361 -34.616 1.00 60.17  ? 283  ILE A CG1 1 
ATOM   1772  C CG2 . ILE A 1 244 ? 4.274    -23.046 -33.632 1.00 52.36  ? 283  ILE A CG2 1 
ATOM   1773  C CD1 . ILE A 1 244 ? 1.551    -22.001 -34.141 1.00 58.43  ? 283  ILE A CD1 1 
ATOM   1774  N N   . VAL A 1 245 ? 3.897    -26.919 -32.571 1.00 50.63  ? 284  VAL A N   1 
ATOM   1775  C CA  . VAL A 1 245 ? 4.691    -27.712 -31.644 1.00 55.09  ? 284  VAL A CA  1 
ATOM   1776  C C   . VAL A 1 245 ? 5.525    -28.764 -32.370 1.00 55.07  ? 284  VAL A C   1 
ATOM   1777  O O   . VAL A 1 245 ? 6.722    -28.899 -32.106 1.00 51.29  ? 284  VAL A O   1 
ATOM   1778  C CB  . VAL A 1 245 ? 3.822    -28.386 -30.573 1.00 46.87  ? 284  VAL A CB  1 
ATOM   1779  C CG1 . VAL A 1 245 ? 4.648    -29.392 -29.787 1.00 41.46  ? 284  VAL A CG1 1 
ATOM   1780  C CG2 . VAL A 1 245 ? 3.208    -27.327 -29.646 1.00 40.80  ? 284  VAL A CG2 1 
ATOM   1781  N N   . LYS A 1 246 ? 4.895    -29.500 -33.283 1.00 54.46  ? 285  LYS A N   1 
ATOM   1782  C CA  . LYS A 1 246 ? 5.591    -30.527 -34.055 1.00 54.01  ? 285  LYS A CA  1 
ATOM   1783  C C   . LYS A 1 246 ? 6.772    -29.946 -34.818 1.00 54.78  ? 285  LYS A C   1 
ATOM   1784  O O   . LYS A 1 246 ? 7.865    -30.505 -34.795 1.00 61.85  ? 285  LYS A O   1 
ATOM   1785  C CB  . LYS A 1 246 ? 4.637    -31.245 -35.014 1.00 61.71  ? 285  LYS A CB  1 
ATOM   1786  C CG  . LYS A 1 246 ? 4.105    -32.571 -34.481 1.00 66.85  ? 285  LYS A CG  1 
ATOM   1787  C CD  . LYS A 1 246 ? 3.184    -33.265 -35.489 1.00 79.24  ? 285  LYS A CD  1 
ATOM   1788  C CE  . LYS A 1 246 ? 1.855    -32.531 -35.636 1.00 79.35  ? 285  LYS A CE  1 
ATOM   1789  N NZ  . LYS A 1 246 ? 0.947    -33.184 -36.628 1.00 89.64  ? 285  LYS A NZ  1 
ATOM   1790  N N   . TYR A 1 247 ? 6.549    -28.816 -35.481 1.00 54.86  ? 286  TYR A N   1 
ATOM   1791  C CA  . TYR A 1 247 ? 7.601    -28.150 -36.239 1.00 55.95  ? 286  TYR A CA  1 
ATOM   1792  C C   . TYR A 1 247 ? 8.722    -27.700 -35.308 1.00 62.03  ? 286  TYR A C   1 
ATOM   1793  O O   . TYR A 1 247 ? 9.896    -27.990 -35.552 1.00 54.70  ? 286  TYR A O   1 
ATOM   1794  C CB  . TYR A 1 247 ? 7.023    -26.957 -36.999 1.00 57.76  ? 286  TYR A CB  1 
ATOM   1795  C CG  . TYR A 1 247 ? 7.935    -26.365 -38.051 1.00 57.09  ? 286  TYR A CG  1 
ATOM   1796  C CD1 . TYR A 1 247 ? 8.141    -27.008 -39.267 1.00 59.11  ? 286  TYR A CD1 1 
ATOM   1797  C CD2 . TYR A 1 247 ? 8.562    -25.144 -37.840 1.00 57.01  ? 286  TYR A CD2 1 
ATOM   1798  C CE1 . TYR A 1 247 ? 8.966    -26.456 -40.238 1.00 62.62  ? 286  TYR A CE1 1 
ATOM   1799  C CE2 . TYR A 1 247 ? 9.386    -24.585 -38.802 1.00 66.07  ? 286  TYR A CE2 1 
ATOM   1800  C CZ  . TYR A 1 247 ? 9.586    -25.243 -39.997 1.00 69.31  ? 286  TYR A CZ  1 
ATOM   1801  O OH  . TYR A 1 247 ? 10.410   -24.677 -40.948 1.00 76.64  ? 286  TYR A OH  1 
ATOM   1802  N N   . THR A 1 248 ? 8.351    -27.002 -34.236 1.00 57.66  ? 287  THR A N   1 
ATOM   1803  C CA  . THR A 1 248 ? 9.316    -26.540 -33.237 1.00 54.22  ? 287  THR A CA  1 
ATOM   1804  C C   . THR A 1 248 ? 10.192   -27.687 -32.725 1.00 46.87  ? 287  THR A C   1 
ATOM   1805  O O   . THR A 1 248 ? 11.404   -27.529 -32.545 1.00 47.43  ? 287  THR A O   1 
ATOM   1806  C CB  . THR A 1 248 ? 8.611    -25.871 -32.036 1.00 46.21  ? 287  THR A CB  1 
ATOM   1807  O OG1 . THR A 1 248 ? 7.798    -24.790 -32.499 1.00 46.79  ? 287  THR A OG1 1 
ATOM   1808  C CG2 . THR A 1 248 ? 9.633    -25.332 -31.054 1.00 48.79  ? 287  THR A CG2 1 
ATOM   1809  N N   . HIS A 1 249 ? 9.568    -28.837 -32.489 1.00 45.33  ? 288  HIS A N   1 
ATOM   1810  C CA  . HIS A 1 249 ? 10.295   -30.029 -32.078 1.00 48.09  ? 288  HIS A CA  1 
ATOM   1811  C C   . HIS A 1 249 ? 11.339   -30.386 -33.137 1.00 52.25  ? 288  HIS A C   1 
ATOM   1812  O O   . HIS A 1 249 ? 12.494   -30.678 -32.821 1.00 44.12  ? 288  HIS A O   1 
ATOM   1813  C CB  . HIS A 1 249 ? 9.328    -31.193 -31.868 1.00 42.37  ? 288  HIS A CB  1 
ATOM   1814  C CG  . HIS A 1 249 ? 9.974    -32.429 -31.326 1.00 47.02  ? 288  HIS A CG  1 
ATOM   1815  N ND1 . HIS A 1 249 ? 9.971    -32.745 -29.984 1.00 58.48  ? 288  HIS A ND1 1 
ATOM   1816  C CD2 . HIS A 1 249 ? 10.636   -33.434 -31.945 1.00 49.29  ? 288  HIS A CD2 1 
ATOM   1817  C CE1 . HIS A 1 249 ? 10.606   -33.888 -29.799 1.00 55.70  ? 288  HIS A CE1 1 
ATOM   1818  N NE2 . HIS A 1 249 ? 11.020   -34.327 -30.974 1.00 56.55  ? 288  HIS A NE2 1 
ATOM   1819  N N   . LYS A 1 250 ? 10.929   -30.345 -34.400 1.00 56.76  ? 289  LYS A N   1 
ATOM   1820  C CA  . LYS A 1 250 ? 11.849   -30.612 -35.499 1.00 59.49  ? 289  LYS A CA  1 
ATOM   1821  C C   . LYS A 1 250 ? 13.042   -29.666 -35.419 1.00 49.06  ? 289  LYS A C   1 
ATOM   1822  O O   . LYS A 1 250 ? 14.192   -30.094 -35.469 1.00 52.11  ? 289  LYS A O   1 
ATOM   1823  C CB  . LYS A 1 250 ? 11.142   -30.442 -36.842 1.00 59.82  ? 289  LYS A CB  1 
ATOM   1824  C CG  . LYS A 1 250 ? 11.767   -31.243 -37.971 1.00 75.30  ? 289  LYS A CG  1 
ATOM   1825  C CD  . LYS A 1 250 ? 11.600   -32.737 -37.730 1.00 77.57  ? 289  LYS A CD  1 
ATOM   1826  C CE  . LYS A 1 250 ? 10.129   -33.110 -37.612 1.00 78.46  ? 289  LYS A CE  1 
ATOM   1827  N NZ  . LYS A 1 250 ? 9.943    -34.573 -37.397 1.00 72.93  ? 289  LYS A NZ  1 
ATOM   1828  N N   . LEU A 1 251 ? 12.753   -28.379 -35.272 1.00 49.22  ? 290  LEU A N   1 
ATOM   1829  C CA  . LEU A 1 251 ? 13.785   -27.350 -35.268 1.00 51.24  ? 290  LEU A CA  1 
ATOM   1830  C C   . LEU A 1 251 ? 14.748   -27.389 -34.079 1.00 62.08  ? 290  LEU A C   1 
ATOM   1831  O O   . LEU A 1 251 ? 15.938   -27.111 -34.239 1.00 54.03  ? 290  LEU A O   1 
ATOM   1832  C CB  . LEU A 1 251 ? 13.149   -25.963 -35.322 1.00 57.12  ? 290  LEU A CB  1 
ATOM   1833  C CG  . LEU A 1 251 ? 12.718   -25.434 -36.687 1.00 64.62  ? 290  LEU A CG  1 
ATOM   1834  C CD1 . LEU A 1 251 ? 11.707   -26.369 -37.326 1.00 68.35  ? 290  LEU A CD1 1 
ATOM   1835  C CD2 . LEU A 1 251 ? 12.144   -24.045 -36.530 1.00 59.84  ? 290  LEU A CD2 1 
ATOM   1836  N N   . ALA A 1 252 ? 14.243   -27.707 -32.890 1.00 50.99  ? 291  ALA A N   1 
ATOM   1837  C CA  . ALA A 1 252 ? 15.024   -27.457 -31.681 1.00 50.22  ? 291  ALA A CA  1 
ATOM   1838  C C   . ALA A 1 252 ? 15.407   -28.688 -30.870 1.00 42.97  ? 291  ALA A C   1 
ATOM   1839  O O   . ALA A 1 252 ? 16.210   -28.587 -29.940 1.00 43.42  ? 291  ALA A O   1 
ATOM   1840  C CB  . ALA A 1 252 ? 14.310   -26.453 -30.790 1.00 45.09  ? 291  ALA A CB  1 
ATOM   1841  N N   . MET A 1 253 ? 14.844   -29.842 -31.196 1.00 36.32  ? 292  MET A N   1 
ATOM   1842  C CA  . MET A 1 253 ? 15.048   -30.994 -30.327 1.00 41.23  ? 292  MET A CA  1 
ATOM   1843  C C   . MET A 1 253 ? 16.527   -31.337 -30.137 1.00 43.62  ? 292  MET A C   1 
ATOM   1844  O O   . MET A 1 253 ? 16.979   -31.564 -29.012 1.00 47.31  ? 292  MET A O   1 
ATOM   1845  C CB  . MET A 1 253 ? 14.251   -32.210 -30.805 1.00 43.74  ? 292  MET A CB  1 
ATOM   1846  C CG  . MET A 1 253 ? 14.418   -33.430 -29.921 1.00 49.91  ? 292  MET A CG  1 
ATOM   1847  S SD  . MET A 1 253 ? 15.868   -34.420 -30.347 1.00 66.20  ? 292  MET A SD  1 
ATOM   1848  C CE  . MET A 1 253 ? 15.791   -35.698 -29.090 1.00 67.48  ? 292  MET A CE  1 
ATOM   1849  N N   . GLU A 1 254 ? 17.290   -31.363 -31.225 1.00 45.21  ? 293  GLU A N   1 
ATOM   1850  C CA  . GLU A 1 254 ? 18.685   -31.796 -31.131 1.00 42.38  ? 293  GLU A CA  1 
ATOM   1851  C C   . GLU A 1 254 ? 19.552   -30.836 -30.316 1.00 33.20  ? 293  GLU A C   1 
ATOM   1852  O O   . GLU A 1 254 ? 20.380   -31.267 -29.510 1.00 42.51  ? 293  GLU A O   1 
ATOM   1853  C CB  . GLU A 1 254 ? 19.279   -32.084 -32.522 1.00 45.43  ? 293  GLU A CB  1 
ATOM   1854  C CG  . GLU A 1 254 ? 18.517   -33.189 -33.273 1.00 56.71  ? 293  GLU A CG  1 
ATOM   1855  C CD  . GLU A 1 254 ? 19.281   -33.787 -34.451 1.00 77.07  ? 293  GLU A CD  1 
ATOM   1856  O OE1 . GLU A 1 254 ? 18.755   -34.740 -35.072 1.00 77.32  ? 293  GLU A OE1 1 
ATOM   1857  O OE2 . GLU A 1 254 ? 20.400   -33.316 -34.755 1.00 73.63  ? 293  GLU A OE2 1 
ATOM   1858  N N   . ARG A 1 255 ? 19.360   -29.537 -30.508 1.00 39.50  ? 294  ARG A N   1 
ATOM   1859  C CA  . ARG A 1 255 ? 20.080   -28.563 -29.700 1.00 40.66  ? 294  ARG A CA  1 
ATOM   1860  C C   . ARG A 1 255 ? 19.660   -28.656 -28.231 1.00 40.72  ? 294  ARG A C   1 
ATOM   1861  O O   . ARG A 1 255 ? 20.505   -28.613 -27.335 1.00 36.40  ? 294  ARG A O   1 
ATOM   1862  C CB  . ARG A 1 255 ? 19.892   -27.146 -30.242 1.00 34.01  ? 294  ARG A CB  1 
ATOM   1863  C CG  . ARG A 1 255 ? 20.520   -26.927 -31.611 1.00 41.48  ? 294  ARG A CG  1 
ATOM   1864  C CD  . ARG A 1 255 ? 19.924   -25.714 -32.313 1.00 42.35  ? 294  ARG A CD  1 
ATOM   1865  N NE  . ARG A 1 255 ? 20.529   -24.461 -31.861 1.00 57.21  ? 294  ARG A NE  1 
ATOM   1866  C CZ  . ARG A 1 255 ? 20.157   -23.254 -32.287 1.00 59.18  ? 294  ARG A CZ  1 
ATOM   1867  N NH1 . ARG A 1 255 ? 19.176   -23.135 -33.181 1.00 45.60  ? 294  ARG A NH1 1 
ATOM   1868  N NH2 . ARG A 1 255 ? 20.771   -22.166 -31.827 1.00 54.48  ? 294  ARG A NH2 1 
ATOM   1869  N N   . LEU A 1 256 ? 18.358   -28.800 -27.981 1.00 36.61  ? 295  LEU A N   1 
ATOM   1870  C CA  . LEU A 1 256 ? 17.876   -28.905 -26.608 1.00 37.68  ? 295  LEU A CA  1 
ATOM   1871  C C   . LEU A 1 256 ? 18.437   -30.171 -25.944 1.00 36.83  ? 295  LEU A C   1 
ATOM   1872  O O   . LEU A 1 256 ? 18.941   -30.116 -24.821 1.00 40.65  ? 295  LEU A O   1 
ATOM   1873  C CB  . LEU A 1 256 ? 16.335   -28.829 -26.540 1.00 33.60  ? 295  LEU A CB  1 
ATOM   1874  C CG  . LEU A 1 256 ? 15.733   -27.451 -26.866 1.00 35.76  ? 295  LEU A CG  1 
ATOM   1875  C CD1 . LEU A 1 256 ? 14.226   -27.509 -27.118 1.00 33.65  ? 295  LEU A CD1 1 
ATOM   1876  C CD2 . LEU A 1 256 ? 16.059   -26.413 -25.785 1.00 33.49  ? 295  LEU A CD2 1 
ATOM   1877  N N   . TYR A 1 257 ? 18.388   -31.303 -26.638 1.00 34.90  ? 296  TYR A N   1 
ATOM   1878  C CA  . TYR A 1 257 ? 18.985   -32.534 -26.099 1.00 35.19  ? 296  TYR A CA  1 
ATOM   1879  C C   . TYR A 1 257 ? 20.476   -32.353 -25.788 1.00 35.34  ? 296  TYR A C   1 
ATOM   1880  O O   . TYR A 1 257 ? 20.971   -32.788 -24.745 1.00 34.25  ? 296  TYR A O   1 
ATOM   1881  C CB  . TYR A 1 257 ? 18.773   -33.716 -27.052 1.00 35.17  ? 296  TYR A CB  1 
ATOM   1882  C CG  . TYR A 1 257 ? 19.357   -35.017 -26.549 1.00 42.65  ? 296  TYR A CG  1 
ATOM   1883  C CD1 . TYR A 1 257 ? 18.578   -35.932 -25.845 1.00 36.56  ? 296  TYR A CD1 1 
ATOM   1884  C CD2 . TYR A 1 257 ? 20.695   -35.331 -26.772 1.00 40.64  ? 296  TYR A CD2 1 
ATOM   1885  C CE1 . TYR A 1 257 ? 19.118   -37.121 -25.373 1.00 43.96  ? 296  TYR A CE1 1 
ATOM   1886  C CE2 . TYR A 1 257 ? 21.243   -36.513 -26.309 1.00 32.68  ? 296  TYR A CE2 1 
ATOM   1887  C CZ  . TYR A 1 257 ? 20.459   -37.407 -25.616 1.00 49.28  ? 296  TYR A CZ  1 
ATOM   1888  O OH  . TYR A 1 257 ? 21.024   -38.586 -25.163 1.00 42.53  ? 296  TYR A OH  1 
ATOM   1889  N N   . ALA A 1 258 ? 21.197   -31.697 -26.687 1.00 35.52  ? 297  ALA A N   1 
ATOM   1890  C CA  . ALA A 1 258 ? 22.607   -31.418 -26.426 1.00 38.59  ? 297  ALA A CA  1 
ATOM   1891  C C   . ALA A 1 258 ? 22.787   -30.596 -25.138 1.00 43.57  ? 297  ALA A C   1 
ATOM   1892  O O   . ALA A 1 258 ? 23.600   -30.944 -24.278 1.00 43.62  ? 297  ALA A O   1 
ATOM   1893  C CB  . ALA A 1 258 ? 23.263   -30.720 -27.628 1.00 36.89  ? 297  ALA A CB  1 
ATOM   1894  N N   . VAL A 1 259 ? 22.029   -29.509 -25.003 1.00 34.74  ? 298  VAL A N   1 
ATOM   1895  C CA  . VAL A 1 259 ? 22.134   -28.680 -23.802 1.00 38.80  ? 298  VAL A CA  1 
ATOM   1896  C C   . VAL A 1 259 ? 21.831   -29.471 -22.524 1.00 38.99  ? 298  VAL A C   1 
ATOM   1897  O O   . VAL A 1 259 ? 22.546   -29.353 -21.525 1.00 39.81  ? 298  VAL A O   1 
ATOM   1898  C CB  . VAL A 1 259 ? 21.237   -27.430 -23.867 1.00 33.63  ? 298  VAL A CB  1 
ATOM   1899  C CG1 . VAL A 1 259 ? 21.109   -26.798 -22.493 1.00 31.98  ? 298  VAL A CG1 1 
ATOM   1900  C CG2 . VAL A 1 259 ? 21.795   -26.426 -24.879 1.00 34.92  ? 298  VAL A CG2 1 
ATOM   1901  N N   . PHE A 1 260 ? 20.787   -30.291 -22.563 1.00 37.29  ? 299  PHE A N   1 
ATOM   1902  C CA  . PHE A 1 260 ? 20.352   -31.004 -21.372 1.00 29.87  ? 299  PHE A CA  1 
ATOM   1903  C C   . PHE A 1 260 ? 21.174   -32.261 -21.069 1.00 42.74  ? 299  PHE A C   1 
ATOM   1904  O O   . PHE A 1 260 ? 21.009   -32.861 -20.002 1.00 35.17  ? 299  PHE A O   1 
ATOM   1905  C CB  . PHE A 1 260 ? 18.856   -31.319 -21.446 1.00 37.87  ? 299  PHE A CB  1 
ATOM   1906  C CG  . PHE A 1 260 ? 17.968   -30.086 -21.430 1.00 32.29  ? 299  PHE A CG  1 
ATOM   1907  C CD1 . PHE A 1 260 ? 18.333   -28.956 -20.714 1.00 31.03  ? 299  PHE A CD1 1 
ATOM   1908  C CD2 . PHE A 1 260 ? 16.766   -30.068 -22.124 1.00 33.84  ? 299  PHE A CD2 1 
ATOM   1909  C CE1 . PHE A 1 260 ? 17.523   -27.832 -20.690 1.00 29.58  ? 299  PHE A CE1 1 
ATOM   1910  C CE2 . PHE A 1 260 ? 15.940   -28.939 -22.106 1.00 32.79  ? 299  PHE A CE2 1 
ATOM   1911  C CZ  . PHE A 1 260 ? 16.320   -27.825 -21.394 1.00 34.23  ? 299  PHE A CZ  1 
ATOM   1912  N N   . THR A 1 261 ? 22.062   -32.655 -21.984 1.00 36.08  ? 300  THR A N   1 
ATOM   1913  C CA  . THR A 1 261 ? 23.002   -33.748 -21.688 1.00 38.41  ? 300  THR A CA  1 
ATOM   1914  C C   . THR A 1 261 ? 24.447   -33.256 -21.460 1.00 47.08  ? 300  THR A C   1 
ATOM   1915  O O   . THR A 1 261 ? 25.374   -34.056 -21.322 1.00 40.80  ? 300  THR A O   1 
ATOM   1916  C CB  . THR A 1 261 ? 22.964   -34.900 -22.744 1.00 37.47  ? 300  THR A CB  1 
ATOM   1917  O OG1 . THR A 1 261 ? 23.121   -34.364 -24.064 1.00 41.13  ? 300  THR A OG1 1 
ATOM   1918  C CG2 . THR A 1 261 ? 21.645   -35.667 -22.666 1.00 32.91  ? 300  THR A CG2 1 
ATOM   1919  N N   . ASP A 1 262 ? 24.624   -31.939 -21.398 1.00 35.23  ? 301  ASP A N   1 
ATOM   1920  C CA  . ASP A 1 262 ? 25.915   -31.356 -21.062 1.00 42.17  ? 301  ASP A CA  1 
ATOM   1921  C C   . ASP A 1 262 ? 25.998   -31.082 -19.555 1.00 42.64  ? 301  ASP A C   1 
ATOM   1922  O O   . ASP A 1 262 ? 25.425   -30.117 -19.051 1.00 41.77  ? 301  ASP A O   1 
ATOM   1923  C CB  . ASP A 1 262 ? 26.135   -30.073 -21.868 1.00 36.70  ? 301  ASP A CB  1 
ATOM   1924  C CG  . ASP A 1 262 ? 27.553   -29.515 -21.735 1.00 39.93  ? 301  ASP A CG  1 
ATOM   1925  O OD1 . ASP A 1 262 ? 27.938   -28.715 -22.614 1.00 48.45  ? 301  ASP A OD1 1 
ATOM   1926  O OD2 . ASP A 1 262 ? 28.274   -29.855 -20.766 1.00 39.14  ? 301  ASP A OD2 1 
ATOM   1927  N N   . TYR A 1 263 ? 26.727   -31.939 -18.849 1.00 42.77  ? 302  TYR A N   1 
ATOM   1928  C CA  . TYR A 1 263 ? 26.821   -31.882 -17.394 1.00 42.73  ? 302  TYR A CA  1 
ATOM   1929  C C   . TYR A 1 263 ? 27.693   -30.745 -16.892 1.00 45.11  ? 302  TYR A C   1 
ATOM   1930  O O   . TYR A 1 263 ? 27.720   -30.457 -15.696 1.00 47.76  ? 302  TYR A O   1 
ATOM   1931  C CB  . TYR A 1 263 ? 27.348   -33.208 -16.849 1.00 49.42  ? 302  TYR A CB  1 
ATOM   1932  C CG  . TYR A 1 263 ? 26.552   -34.395 -17.318 1.00 45.08  ? 302  TYR A CG  1 
ATOM   1933  C CD1 . TYR A 1 263 ? 25.265   -34.235 -17.809 1.00 38.10  ? 302  TYR A CD1 1 
ATOM   1934  C CD2 . TYR A 1 263 ? 27.090   -35.677 -17.285 1.00 43.84  ? 302  TYR A CD2 1 
ATOM   1935  C CE1 . TYR A 1 263 ? 24.523   -35.327 -18.254 1.00 43.25  ? 302  TYR A CE1 1 
ATOM   1936  C CE2 . TYR A 1 263 ? 26.361   -36.770 -17.723 1.00 43.20  ? 302  TYR A CE2 1 
ATOM   1937  C CZ  . TYR A 1 263 ? 25.079   -36.587 -18.206 1.00 45.46  ? 302  TYR A CZ  1 
ATOM   1938  O OH  . TYR A 1 263 ? 24.355   -37.668 -18.643 1.00 49.88  ? 302  TYR A OH  1 
ATOM   1939  N N   . GLU A 1 264 ? 28.403   -30.091 -17.797 1.00 41.64  ? 303  GLU A N   1 
ATOM   1940  C CA  . GLU A 1 264 ? 29.240   -28.966 -17.391 1.00 49.47  ? 303  GLU A CA  1 
ATOM   1941  C C   . GLU A 1 264 ? 28.448   -27.672 -17.200 1.00 42.06  ? 303  GLU A C   1 
ATOM   1942  O O   . GLU A 1 264 ? 28.990   -26.666 -16.745 1.00 37.54  ? 303  GLU A O   1 
ATOM   1943  C CB  . GLU A 1 264 ? 30.400   -28.756 -18.372 1.00 47.84  ? 303  GLU A CB  1 
ATOM   1944  C CG  . GLU A 1 264 ? 31.341   -29.954 -18.459 1.00 60.85  ? 303  GLU A CG  1 
ATOM   1945  C CD  . GLU A 1 264 ? 32.723   -29.594 -18.989 1.00 70.83  ? 303  GLU A CD  1 
ATOM   1946  O OE1 . GLU A 1 264 ? 33.658   -30.396 -18.778 1.00 75.81  ? 303  GLU A OE1 1 
ATOM   1947  O OE2 . GLU A 1 264 ? 32.876   -28.516 -19.608 1.00 55.93  ? 303  GLU A OE2 1 
ATOM   1948  N N   . HIS A 1 265 ? 27.165   -27.682 -17.539 1.00 36.40  ? 304  HIS A N   1 
ATOM   1949  C CA  . HIS A 1 265 ? 26.368   -26.482 -17.304 1.00 39.81  ? 304  HIS A CA  1 
ATOM   1950  C C   . HIS A 1 265 ? 26.183   -26.221 -15.803 1.00 41.92  ? 304  HIS A C   1 
ATOM   1951  O O   . HIS A 1 265 ? 26.227   -27.148 -14.996 1.00 35.63  ? 304  HIS A O   1 
ATOM   1952  C CB  . HIS A 1 265 ? 25.017   -26.560 -18.024 1.00 35.00  ? 304  HIS A CB  1 
ATOM   1953  C CG  . HIS A 1 265 ? 25.084   -26.196 -19.478 1.00 37.81  ? 304  HIS A CG  1 
ATOM   1954  N ND1 . HIS A 1 265 ? 25.448   -24.941 -19.914 1.00 39.90  ? 304  HIS A ND1 1 
ATOM   1955  C CD2 . HIS A 1 265 ? 24.833   -26.925 -20.592 1.00 35.07  ? 304  HIS A CD2 1 
ATOM   1956  C CE1 . HIS A 1 265 ? 25.414   -24.911 -21.236 1.00 43.32  ? 304  HIS A CE1 1 
ATOM   1957  N NE2 . HIS A 1 265 ? 25.037   -26.099 -21.670 1.00 36.95  ? 304  HIS A NE2 1 
ATOM   1958  N N   . ASP A 1 266 ? 26.040   -24.950 -15.434 1.00 33.21  ? 305  ASP A N   1 
ATOM   1959  C CA  . ASP A 1 266 ? 25.517   -24.587 -14.120 1.00 39.92  ? 305  ASP A CA  1 
ATOM   1960  C C   . ASP A 1 266 ? 24.172   -23.926 -14.401 1.00 40.31  ? 305  ASP A C   1 
ATOM   1961  O O   . ASP A 1 266 ? 23.738   -23.894 -15.555 1.00 30.89  ? 305  ASP A O   1 
ATOM   1962  C CB  . ASP A 1 266 ? 26.459   -23.636 -13.374 1.00 40.65  ? 305  ASP A CB  1 
ATOM   1963  C CG  . ASP A 1 266 ? 26.431   -22.220 -13.938 1.00 44.30  ? 305  ASP A CG  1 
ATOM   1964  O OD1 . ASP A 1 266 ? 27.008   -22.009 -15.017 1.00 53.95  ? 305  ASP A OD1 1 
ATOM   1965  O OD2 . ASP A 1 266 ? 25.835   -21.318 -13.304 1.00 55.83  ? 305  ASP A OD2 1 
ATOM   1966  N N   . LYS A 1 267 ? 23.509   -23.396 -13.376 1.00 32.05  ? 306  LYS A N   1 
ATOM   1967  C CA  . LYS A 1 267 ? 22.161   -22.866 -13.573 1.00 35.70  ? 306  LYS A CA  1 
ATOM   1968  C C   . LYS A 1 267 ? 22.113   -21.821 -14.680 1.00 37.17  ? 306  LYS A C   1 
ATOM   1969  O O   . LYS A 1 267 ? 21.252   -21.864 -15.572 1.00 33.34  ? 306  LYS A O   1 
ATOM   1970  C CB  . LYS A 1 267 ? 21.609   -22.243 -12.286 1.00 34.01  ? 306  LYS A CB  1 
ATOM   1971  C CG  . LYS A 1 267 ? 20.188   -21.713 -12.437 1.00 31.00  ? 306  LYS A CG  1 
ATOM   1972  C CD  . LYS A 1 267 ? 19.850   -20.737 -11.320 1.00 35.26  ? 306  LYS A CD  1 
ATOM   1973  C CE  . LYS A 1 267 ? 18.437   -20.217 -11.435 1.00 38.73  ? 306  LYS A CE  1 
ATOM   1974  N NZ  . LYS A 1 267 ? 18.102   -19.266 -10.330 1.00 39.35  ? 306  LYS A NZ  1 
ATOM   1975  N N   . VAL A 1 268 ? 23.042   -20.879 -14.602 1.00 37.74  ? 307  VAL A N   1 
ATOM   1976  C CA  . VAL A 1 268 ? 23.043   -19.721 -15.484 1.00 35.09  ? 307  VAL A CA  1 
ATOM   1977  C C   . VAL A 1 268 ? 23.439   -20.080 -16.913 1.00 35.92  ? 307  VAL A C   1 
ATOM   1978  O O   . VAL A 1 268 ? 22.745   -19.703 -17.856 1.00 40.51  ? 307  VAL A O   1 
ATOM   1979  C CB  . VAL A 1 268 ? 23.935   -18.592 -14.927 1.00 45.41  ? 307  VAL A CB  1 
ATOM   1980  C CG1 . VAL A 1 268 ? 24.372   -17.653 -16.044 1.00 51.18  ? 307  VAL A CG1 1 
ATOM   1981  C CG2 . VAL A 1 268 ? 23.193   -17.833 -13.810 1.00 44.32  ? 307  VAL A CG2 1 
ATOM   1982  N N   . SER A 1 269 ? 24.529   -20.828 -17.074 1.00 36.90  ? 308  SER A N   1 
ATOM   1983  C CA  . SER A 1 269 ? 24.963   -21.238 -18.410 1.00 38.44  ? 308  SER A CA  1 
ATOM   1984  C C   . SER A 1 269 ? 23.900   -22.087 -19.114 1.00 40.04  ? 308  SER A C   1 
ATOM   1985  O O   . SER A 1 269 ? 23.641   -21.900 -20.302 1.00 42.11  ? 308  SER A O   1 
ATOM   1986  C CB  . SER A 1 269 ? 26.326   -21.944 -18.372 1.00 34.65  ? 308  SER A CB  1 
ATOM   1987  O OG  . SER A 1 269 ? 26.238   -23.272 -17.880 1.00 39.09  ? 308  SER A OG  1 
ATOM   1988  N N   . ARG A 1 270 ? 23.260   -22.993 -18.377 1.00 38.97  ? 309  ARG A N   1 
ATOM   1989  C CA  . ARG A 1 270 ? 22.185   -23.801 -18.952 1.00 35.42  ? 309  ARG A CA  1 
ATOM   1990  C C   . ARG A 1 270 ? 21.011   -22.950 -19.442 1.00 38.57  ? 309  ARG A C   1 
ATOM   1991  O O   . ARG A 1 270 ? 20.499   -23.156 -20.544 1.00 31.04  ? 309  ARG A O   1 
ATOM   1992  C CB  . ARG A 1 270 ? 21.671   -24.854 -17.963 1.00 31.32  ? 309  ARG A CB  1 
ATOM   1993  C CG  . ARG A 1 270 ? 20.615   -25.765 -18.580 1.00 29.26  ? 309  ARG A CG  1 
ATOM   1994  C CD  . ARG A 1 270 ? 20.060   -26.749 -17.574 1.00 28.28  ? 309  ARG A CD  1 
ATOM   1995  N NE  . ARG A 1 270 ? 21.114   -27.501 -16.895 1.00 32.20  ? 309  ARG A NE  1 
ATOM   1996  C CZ  . ARG A 1 270 ? 21.490   -27.272 -15.640 1.00 36.96  ? 309  ARG A CZ  1 
ATOM   1997  N NH1 . ARG A 1 270 ? 20.890   -26.321 -14.939 1.00 30.49  ? 309  ARG A NH1 1 
ATOM   1998  N NH2 . ARG A 1 270 ? 22.450   -27.996 -15.079 1.00 35.85  ? 309  ARG A NH2 1 
ATOM   1999  N N   . ASP A 1 271 ? 20.577   -21.998 -18.626 1.00 35.59  ? 310  ASP A N   1 
ATOM   2000  C CA  . ASP A 1 271 ? 19.454   -21.147 -19.014 1.00 40.77  ? 310  ASP A CA  1 
ATOM   2001  C C   . ASP A 1 271 ? 19.793   -20.261 -20.216 1.00 42.42  ? 310  ASP A C   1 
ATOM   2002  O O   . ASP A 1 271 ? 18.982   -20.093 -21.123 1.00 39.98  ? 310  ASP A O   1 
ATOM   2003  C CB  . ASP A 1 271 ? 18.965   -20.297 -17.831 1.00 38.15  ? 310  ASP A CB  1 
ATOM   2004  C CG  . ASP A 1 271 ? 18.232   -21.128 -16.780 1.00 48.66  ? 310  ASP A CG  1 
ATOM   2005  O OD1 . ASP A 1 271 ? 17.788   -22.255 -17.107 1.00 44.59  ? 310  ASP A OD1 1 
ATOM   2006  O OD2 . ASP A 1 271 ? 18.103   -20.658 -15.630 1.00 41.36  ? 310  ASP A OD2 1 
ATOM   2007  N N   . GLU A 1 272 ? 20.989   -19.690 -20.221 1.00 36.40  ? 311  GLU A N   1 
ATOM   2008  C CA  . GLU A 1 272 ? 21.396   -18.859 -21.349 1.00 47.51  ? 311  GLU A CA  1 
ATOM   2009  C C   . GLU A 1 272 ? 21.491   -19.692 -22.632 1.00 43.65  ? 311  GLU A C   1 
ATOM   2010  O O   . GLU A 1 272 ? 21.141   -19.219 -23.709 1.00 41.63  ? 311  GLU A O   1 
ATOM   2011  C CB  . GLU A 1 272 ? 22.686   -18.091 -21.026 1.00 41.42  ? 311  GLU A CB  1 
ATOM   2012  C CG  . GLU A 1 272 ? 22.470   -17.151 -19.817 1.00 61.49  ? 311  GLU A CG  1 
ATOM   2013  C CD  . GLU A 1 272 ? 23.668   -16.276 -19.452 1.00 63.38  ? 311  GLU A CD  1 
ATOM   2014  O OE1 . GLU A 1 272 ? 24.815   -16.634 -19.796 1.00 59.59  ? 311  GLU A OE1 1 
ATOM   2015  O OE2 . GLU A 1 272 ? 23.447   -15.225 -18.800 1.00 54.81  ? 311  GLU A OE2 1 
ATOM   2016  N N   . ALA A 1 273 ? 21.917   -20.945 -22.504 1.00 40.96  ? 312  ALA A N   1 
ATOM   2017  C CA  . ALA A 1 273 ? 21.999   -21.839 -23.658 1.00 37.17  ? 312  ALA A CA  1 
ATOM   2018  C C   . ALA A 1 273 ? 20.621   -22.223 -24.237 1.00 43.90  ? 312  ALA A C   1 
ATOM   2019  O O   . ALA A 1 273 ? 20.442   -22.270 -25.462 1.00 42.44  ? 312  ALA A O   1 
ATOM   2020  C CB  . ALA A 1 273 ? 22.815   -23.077 -23.314 1.00 40.57  ? 312  ALA A CB  1 
ATOM   2021  N N   . VAL A 1 274 ? 19.633   -22.494 -23.389 1.00 37.81  ? 313  VAL A N   1 
ATOM   2022  C CA  . VAL A 1 274 ? 18.320   -22.776 -23.969 1.00 42.51  ? 313  VAL A CA  1 
ATOM   2023  C C   . VAL A 1 274 ? 17.702   -21.499 -24.539 1.00 44.42  ? 313  VAL A C   1 
ATOM   2024  O O   . VAL A 1 274 ? 17.018   -21.532 -25.563 1.00 42.92  ? 313  VAL A O   1 
ATOM   2025  C CB  . VAL A 1 274 ? 17.350   -23.584 -23.045 1.00 44.20  ? 313  VAL A CB  1 
ATOM   2026  C CG1 . VAL A 1 274 ? 18.038   -24.060 -21.781 1.00 36.73  ? 313  VAL A CG1 1 
ATOM   2027  C CG2 . VAL A 1 274 ? 16.061   -22.812 -22.756 1.00 34.86  ? 313  VAL A CG2 1 
ATOM   2028  N N   . ASN A 1 275 ? 17.991   -20.372 -23.898 1.00 45.48  ? 314  ASN A N   1 
ATOM   2029  C CA  . ASN A 1 275 ? 17.544   -19.072 -24.385 1.00 46.05  ? 314  ASN A CA  1 
ATOM   2030  C C   . ASN A 1 275 ? 18.072   -18.737 -25.781 1.00 43.38  ? 314  ASN A C   1 
ATOM   2031  O O   . ASN A 1 275 ? 17.360   -18.168 -26.604 1.00 49.37  ? 314  ASN A O   1 
ATOM   2032  C CB  . ASN A 1 275 ? 17.945   -17.966 -23.412 1.00 47.64  ? 314  ASN A CB  1 
ATOM   2033  C CG  . ASN A 1 275 ? 17.358   -16.622 -23.795 1.00 54.27  ? 314  ASN A CG  1 
ATOM   2034  O OD1 . ASN A 1 275 ? 16.163   -16.509 -24.080 1.00 52.16  ? 314  ASN A OD1 1 
ATOM   2035  N ND2 . ASN A 1 275 ? 18.200   -15.597 -23.824 1.00 59.05  ? 314  ASN A ND2 1 
ATOM   2036  N N   . LYS A 1 276 ? 19.326   -19.079 -26.040 1.00 48.88  ? 315  LYS A N   1 
ATOM   2037  C CA  . LYS A 1 276 ? 19.895   -18.886 -27.364 1.00 46.34  ? 315  LYS A CA  1 
ATOM   2038  C C   . LYS A 1 276 ? 19.129   -19.724 -28.386 1.00 52.02  ? 315  LYS A C   1 
ATOM   2039  O O   . LYS A 1 276 ? 18.813   -19.257 -29.482 1.00 46.39  ? 315  LYS A O   1 
ATOM   2040  C CB  . LYS A 1 276 ? 21.377   -19.254 -27.370 1.00 45.73  ? 315  LYS A CB  1 
ATOM   2041  C CG  . LYS A 1 276 ? 22.055   -18.956 -28.682 1.00 52.66  ? 315  LYS A CG  1 
ATOM   2042  C CD  . LYS A 1 276 ? 23.547   -19.223 -28.615 1.00 63.27  ? 315  LYS A CD  1 
ATOM   2043  C CE  . LYS A 1 276 ? 24.239   -18.730 -29.878 1.00 65.22  ? 315  LYS A CE  1 
ATOM   2044  N NZ  . LYS A 1 276 ? 23.561   -19.237 -31.109 1.00 68.97  ? 315  LYS A NZ  1 
ATOM   2045  N N   . ILE A 1 277 ? 18.827   -20.968 -28.028 1.00 46.85  ? 316  ILE A N   1 
ATOM   2046  C CA  . ILE A 1 277 ? 18.044   -21.816 -28.916 1.00 46.42  ? 316  ILE A CA  1 
ATOM   2047  C C   . ILE A 1 277 ? 16.657   -21.212 -29.114 1.00 47.74  ? 316  ILE A C   1 
ATOM   2048  O O   . ILE A 1 277 ? 16.105   -21.256 -30.212 1.00 47.35  ? 316  ILE A O   1 
ATOM   2049  C CB  . ILE A 1 277 ? 17.926   -23.259 -28.392 1.00 39.93  ? 316  ILE A CB  1 
ATOM   2050  C CG1 . ILE A 1 277 ? 19.314   -23.841 -28.125 1.00 47.61  ? 316  ILE A CG1 1 
ATOM   2051  C CG2 . ILE A 1 277 ? 17.197   -24.118 -29.397 1.00 38.86  ? 316  ILE A CG2 1 
ATOM   2052  C CD1 . ILE A 1 277 ? 19.282   -25.180 -27.436 1.00 44.97  ? 316  ILE A CD1 1 
ATOM   2053  N N   . ARG A 1 278 ? 16.112   -20.628 -28.052 1.00 45.31  ? 317  ARG A N   1 
ATOM   2054  C CA  . ARG A 1 278 ? 14.788   -20.010 -28.101 1.00 51.03  ? 317  ARG A CA  1 
ATOM   2055  C C   . ARG A 1 278 ? 14.722   -18.859 -29.098 1.00 55.73  ? 317  ARG A C   1 
ATOM   2056  O O   . ARG A 1 278 ? 13.805   -18.785 -29.912 1.00 49.49  ? 317  ARG A O   1 
ATOM   2057  C CB  . ARG A 1 278 ? 14.375   -19.501 -26.717 1.00 49.86  ? 317  ARG A CB  1 
ATOM   2058  C CG  . ARG A 1 278 ? 13.011   -18.812 -26.702 1.00 55.10  ? 317  ARG A CG  1 
ATOM   2059  C CD  . ARG A 1 278 ? 12.655   -18.269 -25.321 1.00 53.21  ? 317  ARG A CD  1 
ATOM   2060  N NE  . ARG A 1 278 ? 12.585   -19.324 -24.308 1.00 53.11  ? 317  ARG A NE  1 
ATOM   2061  C CZ  . ARG A 1 278 ? 13.470   -19.476 -23.325 1.00 61.16  ? 317  ARG A CZ  1 
ATOM   2062  N NH1 . ARG A 1 278 ? 14.494   -18.636 -23.213 1.00 56.95  ? 317  ARG A NH1 1 
ATOM   2063  N NH2 . ARG A 1 278 ? 13.331   -20.466 -22.450 1.00 61.09  ? 317  ARG A NH2 1 
ATOM   2064  N N   . LEU A 1 279 ? 15.690   -17.953 -29.015 1.00 54.66  ? 318  LEU A N   1 
ATOM   2065  C CA  . LEU A 1 279 ? 15.725   -16.793 -29.900 1.00 60.25  ? 318  LEU A CA  1 
ATOM   2066  C C   . LEU A 1 279 ? 15.736   -17.224 -31.367 1.00 65.95  ? 318  LEU A C   1 
ATOM   2067  O O   . LEU A 1 279 ? 14.864   -16.820 -32.139 1.00 66.06  ? 318  LEU A O   1 
ATOM   2068  C CB  . LEU A 1 279 ? 16.929   -15.901 -29.579 1.00 56.47  ? 318  LEU A CB  1 
ATOM   2069  C CG  . LEU A 1 279 ? 16.922   -15.219 -28.204 1.00 61.89  ? 318  LEU A CG  1 
ATOM   2070  C CD1 . LEU A 1 279 ? 18.288   -14.615 -27.886 1.00 56.39  ? 318  LEU A CD1 1 
ATOM   2071  C CD2 . LEU A 1 279 ? 15.821   -14.161 -28.104 1.00 53.98  ? 318  LEU A CD2 1 
ATOM   2072  N N   . ASP A 1 280 ? 16.711   -18.052 -31.740 1.00 60.86  ? 319  ASP A N   1 
ATOM   2073  C CA  . ASP A 1 280 ? 16.786   -18.595 -33.098 1.00 61.86  ? 319  ASP A CA  1 
ATOM   2074  C C   . ASP A 1 280 ? 15.483   -19.291 -33.492 1.00 64.27  ? 319  ASP A C   1 
ATOM   2075  O O   . ASP A 1 280 ? 14.840   -18.925 -34.475 1.00 70.36  ? 319  ASP A O   1 
ATOM   2076  C CB  . ASP A 1 280 ? 17.963   -19.569 -33.239 1.00 53.26  ? 319  ASP A CB  1 
ATOM   2077  C CG  . ASP A 1 280 ? 19.305   -18.860 -33.333 1.00 69.63  ? 319  ASP A CG  1 
ATOM   2078  O OD1 . ASP A 1 280 ? 19.562   -18.227 -34.379 1.00 85.46  ? 319  ASP A OD1 1 
ATOM   2079  O OD2 . ASP A 1 280 ? 20.112   -18.946 -32.379 1.00 61.66  ? 319  ASP A OD2 1 
ATOM   2080  N N   . THR A 1 281 ? 15.100   -20.292 -32.711 1.00 54.41  ? 320  THR A N   1 
ATOM   2081  C CA  . THR A 1 281 ? 13.874   -21.039 -32.953 1.00 55.51  ? 320  THR A CA  1 
ATOM   2082  C C   . THR A 1 281 ? 12.668   -20.116 -33.116 1.00 63.67  ? 320  THR A C   1 
ATOM   2083  O O   . THR A 1 281 ? 11.938   -20.206 -34.105 1.00 57.46  ? 320  THR A O   1 
ATOM   2084  C CB  . THR A 1 281 ? 13.592   -22.008 -31.800 1.00 53.46  ? 320  THR A CB  1 
ATOM   2085  O OG1 . THR A 1 281 ? 14.760   -22.795 -31.545 1.00 56.41  ? 320  THR A OG1 1 
ATOM   2086  C CG2 . THR A 1 281 ? 12.423   -22.929 -32.137 1.00 53.84  ? 320  THR A CG2 1 
ATOM   2087  N N   . GLU A 1 282 ? 12.466   -19.228 -32.143 1.00 62.72  ? 321  GLU A N   1 
ATOM   2088  C CA  . GLU A 1 282 ? 11.314   -18.326 -32.159 1.00 68.46  ? 321  GLU A CA  1 
ATOM   2089  C C   . GLU A 1 282 ? 11.237   -17.426 -33.398 1.00 67.61  ? 321  GLU A C   1 
ATOM   2090  O O   . GLU A 1 282 ? 10.146   -17.015 -33.793 1.00 74.40  ? 321  GLU A O   1 
ATOM   2091  C CB  . GLU A 1 282 ? 11.230   -17.495 -30.867 1.00 65.34  ? 321  GLU A CB  1 
ATOM   2092  C CG  . GLU A 1 282 ? 10.596   -18.244 -29.701 1.00 60.92  ? 321  GLU A CG  1 
ATOM   2093  C CD  . GLU A 1 282 ? 10.483   -17.410 -28.434 1.00 64.23  ? 321  GLU A CD  1 
ATOM   2094  O OE1 . GLU A 1 282 ? 9.801    -17.870 -27.489 1.00 67.90  ? 321  GLU A OE1 1 
ATOM   2095  O OE2 . GLU A 1 282 ? 11.072   -16.307 -28.376 1.00 56.24  ? 321  GLU A OE2 1 
ATOM   2096  N N   . GLU A 1 283 ? 12.373   -17.123 -34.019 1.00 64.26  ? 322  GLU A N   1 
ATOM   2097  C CA  . GLU A 1 283 ? 12.334   -16.313 -35.236 1.00 69.57  ? 322  GLU A CA  1 
ATOM   2098  C C   . GLU A 1 283 ? 12.022   -17.150 -36.470 1.00 71.78  ? 322  GLU A C   1 
ATOM   2099  O O   . GLU A 1 283 ? 11.435   -16.660 -37.433 1.00 77.54  ? 322  GLU A O   1 
ATOM   2100  C CB  . GLU A 1 283 ? 13.630   -15.529 -35.447 1.00 83.90  ? 322  GLU A CB  1 
ATOM   2101  C CG  . GLU A 1 283 ? 13.620   -14.703 -36.732 1.00 84.87  ? 322  GLU A CG  1 
ATOM   2102  C CD  . GLU A 1 283 ? 14.439   -13.433 -36.625 1.00 95.75  ? 322  GLU A CD  1 
ATOM   2103  O OE1 . GLU A 1 283 ? 15.671   -13.503 -36.824 1.00 95.15  ? 322  GLU A OE1 1 
ATOM   2104  O OE2 . GLU A 1 283 ? 13.849   -12.365 -36.340 1.00 93.34  ? 322  GLU A OE2 1 
ATOM   2105  N N   . GLN A 1 284 ? 12.420   -18.414 -36.439 1.00 71.86  ? 323  GLN A N   1 
ATOM   2106  C CA  . GLN A 1 284 ? 12.166   -19.308 -37.558 1.00 70.87  ? 323  GLN A CA  1 
ATOM   2107  C C   . GLN A 1 284 ? 10.701   -19.726 -37.558 1.00 68.25  ? 323  GLN A C   1 
ATOM   2108  O O   . GLN A 1 284 ? 10.131   -20.026 -38.607 1.00 69.90  ? 323  GLN A O   1 
ATOM   2109  C CB  . GLN A 1 284 ? 13.103   -20.522 -37.508 1.00 71.65  ? 323  GLN A CB  1 
ATOM   2110  C CG  . GLN A 1 284 ? 14.592   -20.137 -37.460 1.00 80.98  ? 323  GLN A CG  1 
ATOM   2111  C CD  . GLN A 1 284 ? 15.534   -21.337 -37.414 1.00 79.88  ? 323  GLN A CD  1 
ATOM   2112  O OE1 . GLN A 1 284 ? 15.274   -22.369 -38.034 1.00 87.07  ? 323  GLN A OE1 1 
ATOM   2113  N NE2 . GLN A 1 284 ? 16.637   -21.200 -36.679 1.00 73.80  ? 323  GLN A NE2 1 
ATOM   2114  N N   . LEU A 1 285 ? 10.086   -19.732 -36.377 1.00 70.33  ? 324  LEU A N   1 
ATOM   2115  C CA  . LEU A 1 285 ? 8.657    -20.010 -36.277 1.00 69.19  ? 324  LEU A CA  1 
ATOM   2116  C C   . LEU A 1 285 ? 7.844    -18.843 -36.819 1.00 62.31  ? 324  LEU A C   1 
ATOM   2117  O O   . LEU A 1 285 ? 6.873    -19.052 -37.546 1.00 55.59  ? 324  LEU A O   1 
ATOM   2118  C CB  . LEU A 1 285 ? 8.231    -20.308 -34.835 1.00 58.52  ? 324  LEU A CB  1 
ATOM   2119  C CG  . LEU A 1 285 ? 8.366    -21.733 -34.290 1.00 60.73  ? 324  LEU A CG  1 
ATOM   2120  C CD1 . LEU A 1 285 ? 8.237    -22.783 -35.389 1.00 55.46  ? 324  LEU A CD1 1 
ATOM   2121  C CD2 . LEU A 1 285 ? 9.674    -21.894 -33.556 1.00 55.11  ? 324  LEU A CD2 1 
ATOM   2122  N N   . LYS A 1 286 ? 8.238    -17.623 -36.452 1.00 64.83  ? 325  LYS A N   1 
ATOM   2123  C CA  . LYS A 1 286 ? 7.552    -16.412 -36.905 1.00 63.73  ? 325  LYS A CA  1 
ATOM   2124  C C   . LYS A 1 286 ? 7.383    -16.408 -38.416 1.00 67.51  ? 325  LYS A C   1 
ATOM   2125  O O   . LYS A 1 286 ? 6.419    -15.856 -38.935 1.00 67.52  ? 325  LYS A O   1 
ATOM   2126  C CB  . LYS A 1 286 ? 8.311    -15.150 -36.485 1.00 71.80  ? 325  LYS A CB  1 
ATOM   2127  C CG  . LYS A 1 286 ? 8.275    -14.849 -35.000 1.00 79.97  ? 325  LYS A CG  1 
ATOM   2128  C CD  . LYS A 1 286 ? 8.734    -13.423 -34.728 1.00 76.84  ? 325  LYS A CD  1 
ATOM   2129  C CE  . LYS A 1 286 ? 8.804    -13.120 -33.234 1.00 74.80  ? 325  LYS A CE  1 
ATOM   2130  N NZ  . LYS A 1 286 ? 9.984    -13.763 -32.585 1.00 83.27  ? 325  LYS A NZ  1 
ATOM   2131  N N   . GLU A 1 287 ? 8.336    -17.019 -39.113 1.00 67.32  ? 326  GLU A N   1 
ATOM   2132  C CA  . GLU A 1 287 ? 8.310    -17.076 -40.567 1.00 69.49  ? 326  GLU A CA  1 
ATOM   2133  C C   . GLU A 1 287 ? 7.411    -18.207 -41.051 1.00 73.24  ? 326  GLU A C   1 
ATOM   2134  O O   . GLU A 1 287 ? 6.512    -17.991 -41.863 1.00 80.91  ? 326  GLU A O   1 
ATOM   2135  C CB  . GLU A 1 287 ? 9.724    -17.270 -41.126 1.00 75.79  ? 326  GLU A CB  1 
ATOM   2136  C CG  . GLU A 1 287 ? 10.823   -16.530 -40.364 1.00 84.29  ? 326  GLU A CG  1 
ATOM   2137  C CD  . GLU A 1 287 ? 10.666   -15.013 -40.387 1.00 94.75  ? 326  GLU A CD  1 
ATOM   2138  O OE1 . GLU A 1 287 ? 9.697    -14.515 -41.004 1.00 96.96  ? 326  GLU A OE1 1 
ATOM   2139  O OE2 . GLU A 1 287 ? 11.519   -14.318 -39.785 1.00 93.03  ? 326  GLU A OE2 1 
ATOM   2140  N N   . LYS A 1 288 ? 7.660    -19.414 -40.557 1.00 65.40  ? 327  LYS A N   1 
ATOM   2141  C CA  . LYS A 1 288 ? 6.886    -20.573 -40.983 1.00 67.92  ? 327  LYS A CA  1 
ATOM   2142  C C   . LYS A 1 288 ? 5.406    -20.375 -40.671 1.00 64.53  ? 327  LYS A C   1 
ATOM   2143  O O   . LYS A 1 288 ? 4.537    -20.842 -41.408 1.00 67.23  ? 327  LYS A O   1 
ATOM   2144  C CB  . LYS A 1 288 ? 7.413    -21.850 -40.324 1.00 61.08  ? 327  LYS A CB  1 
ATOM   2145  C CG  . LYS A 1 288 ? 6.812    -23.136 -40.882 1.00 67.88  ? 327  LYS A CG  1 
ATOM   2146  C CD  . LYS A 1 288 ? 7.005    -23.221 -42.391 1.00 74.45  ? 327  LYS A CD  1 
ATOM   2147  C CE  . LYS A 1 288 ? 6.926    -24.658 -42.889 1.00 78.94  ? 327  LYS A CE  1 
ATOM   2148  N NZ  . LYS A 1 288 ? 5.654    -25.329 -42.503 1.00 72.88  ? 327  LYS A NZ  1 
ATOM   2149  N N   . PHE A 1 289 ? 5.127    -19.673 -39.576 1.00 68.39  ? 328  PHE A N   1 
ATOM   2150  C CA  . PHE A 1 289 ? 3.753    -19.383 -39.176 1.00 70.26  ? 328  PHE A CA  1 
ATOM   2151  C C   . PHE A 1 289 ? 3.574    -17.892 -38.910 1.00 70.79  ? 328  PHE A C   1 
ATOM   2152  O O   . PHE A 1 289 ? 3.401    -17.479 -37.763 1.00 68.79  ? 328  PHE A O   1 
ATOM   2153  C CB  . PHE A 1 289 ? 3.373    -20.164 -37.920 1.00 57.12  ? 328  PHE A CB  1 
ATOM   2154  C CG  . PHE A 1 289 ? 3.707    -21.625 -37.981 1.00 62.29  ? 328  PHE A CG  1 
ATOM   2155  C CD1 . PHE A 1 289 ? 2.821    -22.532 -38.541 1.00 64.70  ? 328  PHE A CD1 1 
ATOM   2156  C CD2 . PHE A 1 289 ? 4.901    -22.097 -37.456 1.00 58.61  ? 328  PHE A CD2 1 
ATOM   2157  C CE1 . PHE A 1 289 ? 3.125    -23.888 -38.587 1.00 67.63  ? 328  PHE A CE1 1 
ATOM   2158  C CE2 . PHE A 1 289 ? 5.208    -23.443 -37.498 1.00 57.47  ? 328  PHE A CE2 1 
ATOM   2159  C CZ  . PHE A 1 289 ? 4.319    -24.343 -38.065 1.00 60.70  ? 328  PHE A CZ  1 
ATOM   2160  N N   . PRO A 1 290 ? 3.595    -17.078 -39.976 1.00 78.74  ? 329  PRO A N   1 
ATOM   2161  C CA  . PRO A 1 290 ? 3.503    -15.621 -39.842 1.00 74.89  ? 329  PRO A CA  1 
ATOM   2162  C C   . PRO A 1 290 ? 2.122    -15.239 -39.343 1.00 75.36  ? 329  PRO A C   1 
ATOM   2163  O O   . PRO A 1 290 ? 1.892    -14.103 -38.920 1.00 68.18  ? 329  PRO A O   1 
ATOM   2164  C CB  . PRO A 1 290 ? 3.688    -15.134 -41.278 1.00 80.92  ? 329  PRO A CB  1 
ATOM   2165  C CG  . PRO A 1 290 ? 3.115    -16.244 -42.107 1.00 79.76  ? 329  PRO A CG  1 
ATOM   2166  C CD  . PRO A 1 290 ? 3.492    -17.512 -41.381 1.00 79.35  ? 329  PRO A CD  1 
ATOM   2167  N N   . GLU A 1 291 ? 1.213    -16.207 -39.388 1.00 70.71  ? 330  GLU A N   1 
ATOM   2168  C CA  . GLU A 1 291 ? -0.160   -16.002 -38.958 1.00 79.37  ? 330  GLU A CA  1 
ATOM   2169  C C   . GLU A 1 291 ? -0.276   -15.888 -37.441 1.00 76.97  ? 330  GLU A C   1 
ATOM   2170  O O   . GLU A 1 291 ? -1.221   -16.410 -36.849 1.00 74.08  ? 330  GLU A O   1 
ATOM   2171  C CB  . GLU A 1 291 ? -1.036   -17.151 -39.450 1.00 85.55  ? 330  GLU A CB  1 
ATOM   2172  C CG  . GLU A 1 291 ? -2.382   -16.708 -39.998 1.00 86.96  ? 330  GLU A CG  1 
ATOM   2173  C CD  . GLU A 1 291 ? -2.267   -16.087 -41.376 1.00 92.19  ? 330  GLU A CD  1 
ATOM   2174  O OE1 . GLU A 1 291 ? -1.159   -16.139 -41.958 1.00 86.63  ? 330  GLU A OE1 1 
ATOM   2175  O OE2 . GLU A 1 291 ? -3.282   -15.553 -41.877 1.00 90.03  ? 330  GLU A OE2 1 
ATOM   2176  N N   . ALA A 1 292 ? 0.682    -15.207 -36.816 1.00 85.54  ? 331  ALA A N   1 
ATOM   2177  C CA  . ALA A 1 292 ? 0.655    -15.004 -35.370 1.00 87.52  ? 331  ALA A CA  1 
ATOM   2178  C C   . ALA A 1 292 ? 0.805    -16.356 -34.670 1.00 76.13  ? 331  ALA A C   1 
ATOM   2179  O O   . ALA A 1 292 ? 0.930    -17.381 -35.344 1.00 65.89  ? 331  ALA A O   1 
ATOM   2180  C CB  . ALA A 1 292 ? -0.646   -14.308 -34.970 1.00 90.85  ? 331  ALA A CB  1 
ATOM   2181  N N   . ASP A 1 293 ? 0.825    -16.386 -33.337 1.00 80.43  ? 332  ASP A N   1 
ATOM   2182  C CA  . ASP A 1 293 ? 0.815    -15.222 -32.452 1.00 70.23  ? 332  ASP A CA  1 
ATOM   2183  C C   . ASP A 1 293 ? 2.058    -15.340 -31.572 1.00 62.73  ? 332  ASP A C   1 
ATOM   2184  O O   . ASP A 1 293 ? 2.365    -16.430 -31.090 1.00 64.96  ? 332  ASP A O   1 
ATOM   2185  C CB  . ASP A 1 293 ? -0.469   -15.242 -31.608 1.00 65.34  ? 332  ASP A CB  1 
ATOM   2186  C CG  . ASP A 1 293 ? -0.438   -14.268 -30.433 1.00 77.99  ? 332  ASP A CG  1 
ATOM   2187  O OD1 . ASP A 1 293 ? -1.350   -14.349 -29.584 1.00 72.79  ? 332  ASP A OD1 1 
ATOM   2188  O OD2 . ASP A 1 293 ? 0.481    -13.427 -30.344 1.00 80.49  ? 332  ASP A OD2 1 
ATOM   2189  N N   . PRO A 1 294 ? 2.799    -14.235 -31.383 1.00 67.20  ? 333  PRO A N   1 
ATOM   2190  C CA  . PRO A 1 294 ? 4.051    -14.315 -30.618 1.00 63.92  ? 333  PRO A CA  1 
ATOM   2191  C C   . PRO A 1 294 ? 3.936    -15.170 -29.353 1.00 65.31  ? 333  PRO A C   1 
ATOM   2192  O O   . PRO A 1 294 ? 4.813    -15.999 -29.095 1.00 62.79  ? 333  PRO A O   1 
ATOM   2193  C CB  . PRO A 1 294 ? 4.332    -12.852 -30.270 1.00 61.34  ? 333  PRO A CB  1 
ATOM   2194  C CG  . PRO A 1 294 ? 3.792    -12.107 -31.442 1.00 69.61  ? 333  PRO A CG  1 
ATOM   2195  C CD  . PRO A 1 294 ? 2.579    -12.884 -31.927 1.00 69.20  ? 333  PRO A CD  1 
ATOM   2196  N N   . TYR A 1 295 ? 2.862    -14.987 -28.590 1.00 69.59  ? 334  TYR A N   1 
ATOM   2197  C CA  . TYR A 1 295 ? 2.676    -15.740 -27.355 1.00 63.13  ? 334  TYR A CA  1 
ATOM   2198  C C   . TYR A 1 295 ? 2.516    -17.236 -27.603 1.00 60.70  ? 334  TYR A C   1 
ATOM   2199  O O   . TYR A 1 295 ? 3.014    -18.047 -26.830 1.00 58.60  ? 334  TYR A O   1 
ATOM   2200  C CB  . TYR A 1 295 ? 1.498    -15.190 -26.550 1.00 71.02  ? 334  TYR A CB  1 
ATOM   2201  C CG  . TYR A 1 295 ? 1.758    -13.816 -25.974 1.00 74.51  ? 334  TYR A CG  1 
ATOM   2202  C CD1 . TYR A 1 295 ? 2.345    -13.665 -24.724 1.00 80.99  ? 334  TYR A CD1 1 
ATOM   2203  C CD2 . TYR A 1 295 ? 1.429    -12.667 -26.686 1.00 81.73  ? 334  TYR A CD2 1 
ATOM   2204  C CE1 . TYR A 1 295 ? 2.587    -12.409 -24.188 1.00 92.82  ? 334  TYR A CE1 1 
ATOM   2205  C CE2 . TYR A 1 295 ? 1.669    -11.403 -26.162 1.00 89.78  ? 334  TYR A CE2 1 
ATOM   2206  C CZ  . TYR A 1 295 ? 2.249    -11.281 -24.913 1.00 93.01  ? 334  TYR A CZ  1 
ATOM   2207  O OH  . TYR A 1 295 ? 2.491    -10.030 -24.385 1.00 88.81  ? 334  TYR A OH  1 
ATOM   2208  N N   . GLU A 1 296 ? 1.831    -17.604 -28.682 1.00 53.86  ? 335  GLU A N   1 
ATOM   2209  C CA  . GLU A 1 296 ? 1.679    -19.014 -29.025 1.00 51.28  ? 335  GLU A CA  1 
ATOM   2210  C C   . GLU A 1 296 ? 3.011    -19.628 -29.475 1.00 58.26  ? 335  GLU A C   1 
ATOM   2211  O O   . GLU A 1 296 ? 3.309    -20.800 -29.214 1.00 47.45  ? 335  GLU A O   1 
ATOM   2212  C CB  . GLU A 1 296 ? 0.625    -19.182 -30.117 1.00 48.89  ? 335  GLU A CB  1 
ATOM   2213  C CG  . GLU A 1 296 ? 0.376    -20.626 -30.490 1.00 50.40  ? 335  GLU A CG  1 
ATOM   2214  C CD  . GLU A 1 296 ? -0.701   -20.787 -31.540 1.00 56.20  ? 335  GLU A CD  1 
ATOM   2215  O OE1 . GLU A 1 296 ? -1.129   -19.761 -32.110 1.00 68.60  ? 335  GLU A OE1 1 
ATOM   2216  O OE2 . GLU A 1 296 ? -1.121   -21.940 -31.790 1.00 58.41  ? 335  GLU A OE2 1 
ATOM   2217  N N   . ILE A 1 297 ? 3.812    -18.822 -30.157 1.00 53.25  ? 336  ILE A N   1 
ATOM   2218  C CA  . ILE A 1 297 ? 5.135    -19.252 -30.577 1.00 57.25  ? 336  ILE A CA  1 
ATOM   2219  C C   . ILE A 1 297 ? 6.000    -19.455 -29.341 1.00 53.76  ? 336  ILE A C   1 
ATOM   2220  O O   . ILE A 1 297 ? 6.745    -20.429 -29.240 1.00 49.82  ? 336  ILE A O   1 
ATOM   2221  C CB  . ILE A 1 297 ? 5.780    -18.225 -31.520 1.00 59.65  ? 336  ILE A CB  1 
ATOM   2222  C CG1 . ILE A 1 297 ? 4.965    -18.119 -32.811 1.00 64.55  ? 336  ILE A CG1 1 
ATOM   2223  C CG2 . ILE A 1 297 ? 7.222    -18.600 -31.819 1.00 48.54  ? 336  ILE A CG2 1 
ATOM   2224  C CD1 . ILE A 1 297 ? 5.476    -17.075 -33.778 1.00 57.57  ? 336  ILE A CD1 1 
ATOM   2225  N N   . ILE A 1 298 ? 5.884    -18.530 -28.397 1.00 50.31  ? 337  ILE A N   1 
ATOM   2226  C CA  . ILE A 1 298 ? 6.546    -18.666 -27.109 1.00 52.27  ? 337  ILE A CA  1 
ATOM   2227  C C   . ILE A 1 298 ? 6.083    -19.924 -26.354 1.00 50.63  ? 337  ILE A C   1 
ATOM   2228  O O   . ILE A 1 298 ? 6.911    -20.699 -25.877 1.00 42.65  ? 337  ILE A O   1 
ATOM   2229  C CB  . ILE A 1 298 ? 6.344    -17.407 -26.258 1.00 50.92  ? 337  ILE A CB  1 
ATOM   2230  C CG1 . ILE A 1 298 ? 7.087    -16.230 -26.893 1.00 48.75  ? 337  ILE A CG1 1 
ATOM   2231  C CG2 . ILE A 1 298 ? 6.828    -17.629 -24.836 1.00 49.92  ? 337  ILE A CG2 1 
ATOM   2232  C CD1 . ILE A 1 298 ? 6.950    -14.928 -26.115 1.00 56.11  ? 337  ILE A CD1 1 
ATOM   2233  N N   . GLU A 1 299 ? 4.769    -20.129 -26.263 1.00 44.77  ? 338  GLU A N   1 
ATOM   2234  C CA  . GLU A 1 299 ? 4.212    -21.325 -25.632 1.00 42.66  ? 338  GLU A CA  1 
ATOM   2235  C C   . GLU A 1 299 ? 4.796    -22.584 -26.257 1.00 45.81  ? 338  GLU A C   1 
ATOM   2236  O O   . GLU A 1 299 ? 5.117    -23.549 -25.559 1.00 41.72  ? 338  GLU A O   1 
ATOM   2237  C CB  . GLU A 1 299 ? 2.687    -21.373 -25.794 1.00 45.85  ? 338  GLU A CB  1 
ATOM   2238  C CG  . GLU A 1 299 ? 1.919    -20.292 -25.053 1.00 60.99  ? 338  GLU A CG  1 
ATOM   2239  C CD  . GLU A 1 299 ? 0.439    -20.222 -25.450 1.00 66.24  ? 338  GLU A CD  1 
ATOM   2240  O OE1 . GLU A 1 299 ? 0.011    -20.970 -26.362 1.00 53.48  ? 338  GLU A OE1 1 
ATOM   2241  O OE2 . GLU A 1 299 ? -0.297   -19.406 -24.848 1.00 67.30  ? 338  GLU A OE2 1 
ATOM   2242  N N   . SER A 1 300 ? 4.915    -22.578 -27.580 1.00 44.32  ? 339  SER A N   1 
ATOM   2243  C CA  . SER A 1 300 ? 5.331    -23.773 -28.303 1.00 44.31  ? 339  SER A CA  1 
ATOM   2244  C C   . SER A 1 300 ? 6.760    -24.201 -27.948 1.00 37.74  ? 339  SER A C   1 
ATOM   2245  O O   . SER A 1 300 ? 7.034    -25.387 -27.741 1.00 36.76  ? 339  SER A O   1 
ATOM   2246  C CB  . SER A 1 300 ? 5.181    -23.573 -29.813 1.00 45.33  ? 339  SER A CB  1 
ATOM   2247  O OG  . SER A 1 300 ? 5.192    -24.824 -30.484 1.00 51.48  ? 339  SER A OG  1 
ATOM   2248  N N   . PHE A 1 301 ? 7.667    -23.237 -27.884 1.00 41.51  ? 340  PHE A N   1 
ATOM   2249  C CA  . PHE A 1 301 ? 9.047    -23.544 -27.532 1.00 47.03  ? 340  PHE A CA  1 
ATOM   2250  C C   . PHE A 1 301 ? 9.145    -24.090 -26.107 1.00 45.83  ? 340  PHE A C   1 
ATOM   2251  O O   . PHE A 1 301 ? 9.917    -25.017 -25.848 1.00 38.67  ? 340  PHE A O   1 
ATOM   2252  C CB  . PHE A 1 301 ? 9.955    -22.324 -27.695 1.00 44.95  ? 340  PHE A CB  1 
ATOM   2253  C CG  . PHE A 1 301 ? 11.397   -22.605 -27.364 1.00 46.75  ? 340  PHE A CG  1 
ATOM   2254  C CD1 . PHE A 1 301 ? 12.271   -23.048 -28.342 1.00 42.96  ? 340  PHE A CD1 1 
ATOM   2255  C CD2 . PHE A 1 301 ? 11.870   -22.455 -26.068 1.00 45.13  ? 340  PHE A CD2 1 
ATOM   2256  C CE1 . PHE A 1 301 ? 13.589   -23.324 -28.043 1.00 42.15  ? 340  PHE A CE1 1 
ATOM   2257  C CE2 . PHE A 1 301 ? 13.189   -22.727 -25.761 1.00 42.85  ? 340  PHE A CE2 1 
ATOM   2258  C CZ  . PHE A 1 301 ? 14.049   -23.163 -26.753 1.00 46.94  ? 340  PHE A CZ  1 
ATOM   2259  N N   . ASN A 1 302 ? 8.369    -23.508 -25.191 1.00 37.29  ? 341  ASN A N   1 
ATOM   2260  C CA  . ASN A 1 302 ? 8.359    -23.962 -23.809 1.00 38.26  ? 341  ASN A CA  1 
ATOM   2261  C C   . ASN A 1 302 ? 7.847    -25.385 -23.696 1.00 34.42  ? 341  ASN A C   1 
ATOM   2262  O O   . ASN A 1 302 ? 8.414    -26.198 -22.965 1.00 39.98  ? 341  ASN A O   1 
ATOM   2263  C CB  . ASN A 1 302 ? 7.527    -23.028 -22.934 1.00 40.85  ? 341  ASN A CB  1 
ATOM   2264  C CG  . ASN A 1 302 ? 8.209    -21.708 -22.702 1.00 45.76  ? 341  ASN A CG  1 
ATOM   2265  O OD1 . ASN A 1 302 ? 9.435    -21.608 -22.806 1.00 51.25  ? 341  ASN A OD1 1 
ATOM   2266  N ND2 . ASN A 1 302 ? 7.426    -20.680 -22.386 1.00 49.08  ? 341  ASN A ND2 1 
ATOM   2267  N N   . VAL A 1 303 ? 6.786    -25.690 -24.433 1.00 33.70  ? 342  VAL A N   1 
ATOM   2268  C CA  . VAL A 1 303 ? 6.265    -27.051 -24.463 1.00 37.29  ? 342  VAL A CA  1 
ATOM   2269  C C   . VAL A 1 303 ? 7.341    -28.023 -24.951 1.00 38.14  ? 342  VAL A C   1 
ATOM   2270  O O   . VAL A 1 303 ? 7.511    -29.102 -24.394 1.00 32.38  ? 342  VAL A O   1 
ATOM   2271  C CB  . VAL A 1 303 ? 5.001    -27.167 -25.346 1.00 33.78  ? 342  VAL A CB  1 
ATOM   2272  C CG1 . VAL A 1 303 ? 4.663    -28.630 -25.627 1.00 39.53  ? 342  VAL A CG1 1 
ATOM   2273  C CG2 . VAL A 1 303 ? 3.832    -26.479 -24.675 1.00 39.53  ? 342  VAL A CG2 1 
ATOM   2274  N N   . VAL A 1 304 ? 8.083    -27.627 -25.979 1.00 42.77  ? 343  VAL A N   1 
ATOM   2275  C CA  . VAL A 1 304 ? 9.092    -28.515 -26.553 1.00 40.95  ? 343  VAL A CA  1 
ATOM   2276  C C   . VAL A 1 304 ? 10.314   -28.650 -25.639 1.00 32.84  ? 343  VAL A C   1 
ATOM   2277  O O   . VAL A 1 304 ? 10.789   -29.757 -25.394 1.00 34.99  ? 343  VAL A O   1 
ATOM   2278  C CB  . VAL A 1 304 ? 9.488    -28.081 -27.989 1.00 46.57  ? 343  VAL A CB  1 
ATOM   2279  C CG1 . VAL A 1 304 ? 10.658   -28.918 -28.515 1.00 36.32  ? 343  VAL A CG1 1 
ATOM   2280  C CG2 . VAL A 1 304 ? 8.287    -28.206 -28.916 1.00 41.41  ? 343  VAL A CG2 1 
ATOM   2281  N N   . ALA A 1 305 ? 10.807   -27.531 -25.118 1.00 33.42  ? 344  ALA A N   1 
ATOM   2282  C CA  . ALA A 1 305 ? 11.895   -27.566 -24.145 1.00 35.55  ? 344  ALA A CA  1 
ATOM   2283  C C   . ALA A 1 305 ? 11.519   -28.476 -22.985 1.00 38.19  ? 344  ALA A C   1 
ATOM   2284  O O   . ALA A 1 305 ? 12.331   -29.272 -22.513 1.00 37.31  ? 344  ALA A O   1 
ATOM   2285  C CB  . ALA A 1 305 ? 12.207   -26.166 -23.640 1.00 34.65  ? 344  ALA A CB  1 
ATOM   2286  N N   . LYS A 1 306 ? 10.276   -28.363 -22.532 1.00 33.10  ? 345  LYS A N   1 
ATOM   2287  C CA  . LYS A 1 306 ? 9.807    -29.184 -21.424 1.00 37.99  ? 345  LYS A CA  1 
ATOM   2288  C C   . LYS A 1 306 ? 9.810    -30.671 -21.776 1.00 29.71  ? 345  LYS A C   1 
ATOM   2289  O O   . LYS A 1 306 ? 10.291   -31.501 -21.005 1.00 35.40  ? 345  LYS A O   1 
ATOM   2290  C CB  . LYS A 1 306 ? 8.399    -28.753 -20.998 1.00 32.35  ? 345  LYS A CB  1 
ATOM   2291  C CG  . LYS A 1 306 ? 7.838    -29.547 -19.836 1.00 32.23  ? 345  LYS A CG  1 
ATOM   2292  C CD  . LYS A 1 306 ? 6.486    -29.006 -19.399 1.00 37.60  ? 345  LYS A CD  1 
ATOM   2293  C CE  . LYS A 1 306 ? 5.835    -29.907 -18.364 1.00 38.39  ? 345  LYS A CE  1 
ATOM   2294  N NZ  . LYS A 1 306 ? 4.813    -29.159 -17.575 1.00 45.35  ? 345  LYS A NZ  1 
ATOM   2295  N N   . GLU A 1 307 ? 9.258    -31.008 -22.934 1.00 30.66  ? 346  GLU A N   1 
ATOM   2296  C CA  . GLU A 1 307 ? 9.165    -32.409 -23.322 1.00 38.14  ? 346  GLU A CA  1 
ATOM   2297  C C   . GLU A 1 307 ? 10.543   -33.040 -23.540 1.00 34.89  ? 346  GLU A C   1 
ATOM   2298  O O   . GLU A 1 307 ? 10.792   -34.164 -23.106 1.00 36.49  ? 346  GLU A O   1 
ATOM   2299  C CB  . GLU A 1 307 ? 8.287    -32.581 -24.560 1.00 48.09  ? 346  GLU A CB  1 
ATOM   2300  C CG  . GLU A 1 307 ? 8.310    -34.004 -25.121 1.00 54.55  ? 346  GLU A CG  1 
ATOM   2301  C CD  . GLU A 1 307 ? 7.899    -35.053 -24.092 1.00 68.34  ? 346  GLU A CD  1 
ATOM   2302  O OE1 . GLU A 1 307 ? 8.453    -36.176 -24.132 1.00 65.04  ? 346  GLU A OE1 1 
ATOM   2303  O OE2 . GLU A 1 307 ? 7.020    -34.759 -23.247 1.00 64.38  ? 346  GLU A OE2 1 
ATOM   2304  N N   . VAL A 1 308 ? 11.442   -32.323 -24.209 1.00 35.11  ? 347  VAL A N   1 
ATOM   2305  C CA  . VAL A 1 308 ? 12.789   -32.846 -24.418 1.00 35.91  ? 347  VAL A CA  1 
ATOM   2306  C C   . VAL A 1 308 ? 13.456   -33.086 -23.070 1.00 38.60  ? 347  VAL A C   1 
ATOM   2307  O O   . VAL A 1 308 ? 13.991   -34.168 -22.804 1.00 31.62  ? 347  VAL A O   1 
ATOM   2308  C CB  . VAL A 1 308 ? 13.674   -31.897 -25.249 1.00 37.13  ? 347  VAL A CB  1 
ATOM   2309  C CG1 . VAL A 1 308 ? 15.083   -32.455 -25.332 1.00 31.07  ? 347  VAL A CG1 1 
ATOM   2310  C CG2 . VAL A 1 308 ? 13.089   -31.705 -26.646 1.00 35.91  ? 347  VAL A CG2 1 
ATOM   2311  N N   . PHE A 1 309 ? 13.412   -32.063 -22.223 1.00 36.93  ? 348  PHE A N   1 
ATOM   2312  C CA  . PHE A 1 309 ? 13.950   -32.152 -20.877 1.00 32.58  ? 348  PHE A CA  1 
ATOM   2313  C C   . PHE A 1 309 ? 13.455   -33.400 -20.162 1.00 34.75  ? 348  PHE A C   1 
ATOM   2314  O O   . PHE A 1 309 ? 14.253   -34.171 -19.643 1.00 32.81  ? 348  PHE A O   1 
ATOM   2315  C CB  . PHE A 1 309 ? 13.547   -30.918 -20.080 1.00 33.43  ? 348  PHE A CB  1 
ATOM   2316  C CG  . PHE A 1 309 ? 14.103   -30.888 -18.695 1.00 31.89  ? 348  PHE A CG  1 
ATOM   2317  C CD1 . PHE A 1 309 ? 15.319   -30.273 -18.434 1.00 31.80  ? 348  PHE A CD1 1 
ATOM   2318  C CD2 . PHE A 1 309 ? 13.407   -31.465 -17.647 1.00 27.52  ? 348  PHE A CD2 1 
ATOM   2319  C CE1 . PHE A 1 309 ? 15.835   -30.236 -17.149 1.00 29.07  ? 348  PHE A CE1 1 
ATOM   2320  C CE2 . PHE A 1 309 ? 13.908   -31.427 -16.363 1.00 31.70  ? 348  PHE A CE2 1 
ATOM   2321  C CZ  . PHE A 1 309 ? 15.130   -30.812 -16.111 1.00 31.92  ? 348  PHE A CZ  1 
ATOM   2322  N N   . ARG A 1 310 ? 12.136   -33.598 -20.141 1.00 29.43  ? 349  ARG A N   1 
ATOM   2323  C CA  . ARG A 1 310 ? 11.540   -34.731 -19.430 1.00 31.55  ? 349  ARG A CA  1 
ATOM   2324  C C   . ARG A 1 310 ? 11.845   -36.107 -20.050 1.00 37.47  ? 349  ARG A C   1 
ATOM   2325  O O   . ARG A 1 310 ? 12.073   -37.088 -19.331 1.00 32.41  ? 349  ARG A O   1 
ATOM   2326  C CB  . ARG A 1 310 ? 10.026   -34.530 -19.307 1.00 30.16  ? 349  ARG A CB  1 
ATOM   2327  C CG  . ARG A 1 310 ? 9.639    -33.283 -18.508 1.00 29.29  ? 349  ARG A CG  1 
ATOM   2328  C CD  . ARG A 1 310 ? 8.182    -32.880 -18.763 1.00 31.40  ? 349  ARG A CD  1 
ATOM   2329  N NE  . ARG A 1 310 ? 7.253    -33.942 -18.375 1.00 31.28  ? 349  ARG A NE  1 
ATOM   2330  C CZ  . ARG A 1 310 ? 6.554    -33.934 -17.243 1.00 35.32  ? 349  ARG A CZ  1 
ATOM   2331  N NH1 . ARG A 1 310 ? 6.681    -32.923 -16.386 1.00 26.95  ? 349  ARG A NH1 1 
ATOM   2332  N NH2 . ARG A 1 310 ? 5.724    -34.931 -16.971 1.00 38.90  ? 349  ARG A NH2 1 
ATOM   2333  N N   . SER A 1 311 ? 11.841   -36.178 -21.381 1.00 33.66  ? 350  SER A N   1 
ATOM   2334  C CA  . SER A 1 311 ? 12.119   -37.434 -22.078 1.00 37.43  ? 350  SER A CA  1 
ATOM   2335  C C   . SER A 1 311 ? 13.473   -38.023 -21.696 1.00 37.05  ? 350  SER A C   1 
ATOM   2336  O O   . SER A 1 311 ? 13.618   -39.241 -21.620 1.00 33.15  ? 350  SER A O   1 
ATOM   2337  C CB  . SER A 1 311 ? 12.056   -37.249 -23.595 1.00 43.54  ? 350  SER A CB  1 
ATOM   2338  O OG  . SER A 1 311 ? 13.087   -36.380 -24.042 1.00 43.64  ? 350  SER A OG  1 
ATOM   2339  N N   . ILE A 1 312 ? 14.460   -37.163 -21.452 1.00 33.57  ? 351  ILE A N   1 
ATOM   2340  C CA  . ILE A 1 312 ? 15.784   -37.638 -21.045 1.00 34.37  ? 351  ILE A CA  1 
ATOM   2341  C C   . ILE A 1 312 ? 15.757   -38.300 -19.672 1.00 38.52  ? 351  ILE A C   1 
ATOM   2342  O O   . ILE A 1 312 ? 16.337   -39.371 -19.471 1.00 34.83  ? 351  ILE A O   1 
ATOM   2343  C CB  . ILE A 1 312 ? 16.833   -36.508 -21.034 1.00 30.38  ? 351  ILE A CB  1 
ATOM   2344  C CG1 . ILE A 1 312 ? 16.986   -35.921 -22.442 1.00 35.24  ? 351  ILE A CG1 1 
ATOM   2345  C CG2 . ILE A 1 312 ? 18.175   -37.042 -20.523 1.00 33.86  ? 351  ILE A CG2 1 
ATOM   2346  C CD1 . ILE A 1 312 ? 17.657   -34.548 -22.490 1.00 36.84  ? 351  ILE A CD1 1 
ATOM   2347  N N   . VAL A 1 313 ? 15.101   -37.652 -18.716 1.00 35.40  ? 352  VAL A N   1 
ATOM   2348  C CA  . VAL A 1 313 ? 14.937   -38.237 -17.394 1.00 28.02  ? 352  VAL A CA  1 
ATOM   2349  C C   . VAL A 1 313 ? 14.241   -39.593 -17.509 1.00 37.02  ? 352  VAL A C   1 
ATOM   2350  O O   . VAL A 1 313 ? 14.661   -40.569 -16.893 1.00 39.74  ? 352  VAL A O   1 
ATOM   2351  C CB  . VAL A 1 313 ? 14.065   -37.336 -16.500 1.00 36.64  ? 352  VAL A CB  1 
ATOM   2352  C CG1 . VAL A 1 313 ? 13.715   -38.053 -15.207 1.00 31.88  ? 352  VAL A CG1 1 
ATOM   2353  C CG2 . VAL A 1 313 ? 14.763   -36.019 -16.224 1.00 42.25  ? 352  VAL A CG2 1 
ATOM   2354  N N   . LEU A 1 314 ? 13.163   -39.639 -18.291 1.00 30.17  ? 353  LEU A N   1 
ATOM   2355  C CA  . LEU A 1 314 ? 12.395   -40.867 -18.469 1.00 38.60  ? 353  LEU A CA  1 
ATOM   2356  C C   . LEU A 1 314 ? 13.163   -41.966 -19.215 1.00 38.76  ? 353  LEU A C   1 
ATOM   2357  O O   . LEU A 1 314 ? 13.132   -43.119 -18.812 1.00 41.84  ? 353  LEU A O   1 
ATOM   2358  C CB  . LEU A 1 314 ? 11.086   -40.573 -19.206 1.00 29.73  ? 353  LEU A CB  1 
ATOM   2359  C CG  . LEU A 1 314 ? 10.034   -39.791 -18.421 1.00 39.03  ? 353  LEU A CG  1 
ATOM   2360  C CD1 . LEU A 1 314 ? 8.874    -39.360 -19.323 1.00 34.22  ? 353  LEU A CD1 1 
ATOM   2361  C CD2 . LEU A 1 314 ? 9.544    -40.641 -17.262 1.00 36.18  ? 353  LEU A CD2 1 
ATOM   2362  N N   . ASN A 1 315 ? 13.842   -41.609 -20.301 1.00 34.38  ? 354  ASN A N   1 
ATOM   2363  C CA  . ASN A 1 315 ? 14.477   -42.611 -21.164 1.00 43.53  ? 354  ASN A CA  1 
ATOM   2364  C C   . ASN A 1 315 ? 15.845   -43.076 -20.680 1.00 42.88  ? 354  ASN A C   1 
ATOM   2365  O O   . ASN A 1 315 ? 16.229   -44.233 -20.877 1.00 43.65  ? 354  ASN A O   1 
ATOM   2366  C CB  . ASN A 1 315 ? 14.597   -42.096 -22.604 1.00 37.84  ? 354  ASN A CB  1 
ATOM   2367  C CG  . ASN A 1 315 ? 13.253   -41.866 -23.250 1.00 44.30  ? 354  ASN A CG  1 
ATOM   2368  O OD1 . ASN A 1 315 ? 12.228   -42.312 -22.742 1.00 47.13  ? 354  ASN A OD1 1 
ATOM   2369  N ND2 . ASN A 1 315 ? 13.246   -41.166 -24.380 1.00 56.77  ? 354  ASN A ND2 1 
ATOM   2370  N N   . GLU A 1 316 ? 16.575   -42.172 -20.041 1.00 37.85  ? 355  GLU A N   1 
ATOM   2371  C CA  . GLU A 1 316 ? 17.957   -42.439 -19.675 1.00 33.98  ? 355  GLU A CA  1 
ATOM   2372  C C   . GLU A 1 316 ? 18.215   -42.465 -18.171 1.00 42.01  ? 355  GLU A C   1 
ATOM   2373  O O   . GLU A 1 316 ? 19.326   -42.786 -17.744 1.00 41.49  ? 355  GLU A O   1 
ATOM   2374  C CB  . GLU A 1 316 ? 18.883   -41.424 -20.355 1.00 34.93  ? 355  GLU A CB  1 
ATOM   2375  C CG  . GLU A 1 316 ? 18.718   -41.364 -21.880 1.00 37.96  ? 355  GLU A CG  1 
ATOM   2376  C CD  . GLU A 1 316 ? 19.709   -40.416 -22.548 1.00 46.73  ? 355  GLU A CD  1 
ATOM   2377  O OE1 . GLU A 1 316 ? 20.817   -40.217 -21.998 1.00 56.41  ? 355  GLU A OE1 1 
ATOM   2378  O OE2 . GLU A 1 316 ? 19.378   -39.863 -23.618 1.00 47.56  ? 355  GLU A OE2 1 
ATOM   2379  N N   . TYR A 1 317 ? 17.208   -42.131 -17.362 1.00 33.81  ? 356  TYR A N   1 
ATOM   2380  C CA  . TYR A 1 317 ? 17.387   -42.160 -15.908 1.00 31.12  ? 356  TYR A CA  1 
ATOM   2381  C C   . TYR A 1 317 ? 18.561   -41.276 -15.461 1.00 31.69  ? 356  TYR A C   1 
ATOM   2382  O O   . TYR A 1 317 ? 19.189   -41.523 -14.429 1.00 39.79  ? 356  TYR A O   1 
ATOM   2383  C CB  . TYR A 1 317 ? 17.575   -43.608 -15.417 1.00 37.82  ? 356  TYR A CB  1 
ATOM   2384  C CG  . TYR A 1 317 ? 16.369   -44.492 -15.670 1.00 42.04  ? 356  TYR A CG  1 
ATOM   2385  C CD1 . TYR A 1 317 ? 15.550   -44.912 -14.625 1.00 46.76  ? 356  TYR A CD1 1 
ATOM   2386  C CD2 . TYR A 1 317 ? 16.032   -44.884 -16.961 1.00 43.84  ? 356  TYR A CD2 1 
ATOM   2387  C CE1 . TYR A 1 317 ? 14.433   -45.714 -14.865 1.00 54.53  ? 356  TYR A CE1 1 
ATOM   2388  C CE2 . TYR A 1 317 ? 14.920   -45.673 -17.212 1.00 45.11  ? 356  TYR A CE2 1 
ATOM   2389  C CZ  . TYR A 1 317 ? 14.125   -46.089 -16.167 1.00 58.51  ? 356  TYR A CZ  1 
ATOM   2390  O OH  . TYR A 1 317 ? 13.020   -46.879 -16.434 1.00 59.92  ? 356  TYR A OH  1 
ATOM   2391  N N   . LYS A 1 318 ? 18.850   -40.248 -16.258 1.00 34.80  ? 357  LYS A N   1 
ATOM   2392  C CA  . LYS A 1 318 ? 19.872   -39.256 -15.935 1.00 42.72  ? 357  LYS A CA  1 
ATOM   2393  C C   . LYS A 1 318 ? 19.246   -37.872 -15.966 1.00 38.95  ? 357  LYS A C   1 
ATOM   2394  O O   . LYS A 1 318 ? 18.327   -37.618 -16.736 1.00 36.53  ? 357  LYS A O   1 
ATOM   2395  C CB  . LYS A 1 318 ? 21.035   -39.312 -16.929 1.00 39.27  ? 357  LYS A CB  1 
ATOM   2396  C CG  . LYS A 1 318 ? 22.027   -40.431 -16.641 1.00 51.35  ? 357  LYS A CG  1 
ATOM   2397  C CD  . LYS A 1 318 ? 22.689   -40.207 -15.285 1.00 58.08  ? 357  LYS A CD  1 
ATOM   2398  C CE  . LYS A 1 318 ? 23.419   -41.448 -14.775 1.00 60.32  ? 357  LYS A CE  1 
ATOM   2399  N NZ  . LYS A 1 318 ? 24.142   -41.151 -13.492 1.00 55.00  ? 357  LYS A NZ  1 
ATOM   2400  N N   . ARG A 1 319 ? 19.751   -36.982 -15.119 1.00 40.83  ? 358  ARG A N   1 
ATOM   2401  C CA  . ARG A 1 319 ? 19.230   -35.625 -15.041 1.00 30.72  ? 358  ARG A CA  1 
ATOM   2402  C C   . ARG A 1 319 ? 20.174   -34.668 -15.756 1.00 37.98  ? 358  ARG A C   1 
ATOM   2403  O O   . ARG A 1 319 ? 21.329   -35.029 -16.027 1.00 33.12  ? 358  ARG A O   1 
ATOM   2404  C CB  . ARG A 1 319 ? 19.028   -35.248 -13.574 1.00 31.56  ? 358  ARG A CB  1 
ATOM   2405  C CG  . ARG A 1 319 ? 18.074   -36.215 -12.876 1.00 34.74  ? 358  ARG A CG  1 
ATOM   2406  C CD  . ARG A 1 319 ? 18.290   -36.260 -11.381 1.00 35.30  ? 358  ARG A CD  1 
ATOM   2407  N NE  . ARG A 1 319 ? 17.791   -35.063 -10.705 1.00 30.80  ? 358  ARG A NE  1 
ATOM   2408  C CZ  . ARG A 1 319 ? 17.746   -34.942 -9.381  1.00 34.83  ? 358  ARG A CZ  1 
ATOM   2409  N NH1 . ARG A 1 319 ? 18.162   -35.947 -8.610  1.00 25.46  ? 358  ARG A NH1 1 
ATOM   2410  N NH2 . ARG A 1 319 ? 17.284   -33.827 -8.829  1.00 28.22  ? 358  ARG A NH2 1 
ATOM   2411  N N   . CYS A 1 320 ? 19.686   -33.460 -16.064 1.00 28.33  ? 359  CYS A N   1 
ATOM   2412  C CA  . CYS A 1 320 ? 20.428   -32.507 -16.891 1.00 32.33  ? 359  CYS A CA  1 
ATOM   2413  C C   . CYS A 1 320 ? 21.778   -32.072 -16.324 1.00 31.30  ? 359  CYS A C   1 
ATOM   2414  O O   . CYS A 1 320 ? 22.553   -31.417 -17.014 1.00 33.31  ? 359  CYS A O   1 
ATOM   2415  C CB  . CYS A 1 320 ? 19.583   -31.265 -17.182 1.00 30.91  ? 359  CYS A CB  1 
ATOM   2416  S SG  . CYS A 1 320 ? 19.298   -30.239 -15.715 1.00 32.86  ? 359  CYS A SG  1 
ATOM   2417  N N   . ASP A 1 321 ? 22.057   -32.407 -15.069 1.00 34.93  ? 360  ASP A N   1 
ATOM   2418  C CA  . ASP A 1 321 ? 23.357   -32.080 -14.487 1.00 26.38  ? 360  ASP A CA  1 
ATOM   2419  C C   . ASP A 1 321 ? 24.173   -33.345 -14.272 1.00 32.40  ? 360  ASP A C   1 
ATOM   2420  O O   . ASP A 1 321 ? 25.198   -33.308 -13.618 1.00 30.65  ? 360  ASP A O   1 
ATOM   2421  C CB  . ASP A 1 321 ? 23.201   -31.354 -13.158 1.00 26.37  ? 360  ASP A CB  1 
ATOM   2422  C CG  . ASP A 1 321 ? 22.480   -32.196 -12.117 1.00 30.26  ? 360  ASP A CG  1 
ATOM   2423  O OD1 . ASP A 1 321 ? 21.917   -33.255 -12.489 1.00 26.82  ? 360  ASP A OD1 1 
ATOM   2424  O OD2 . ASP A 1 321 ? 22.460   -31.783 -10.934 1.00 24.98  ? 360  ASP A OD2 1 
ATOM   2425  N N   . GLY A 1 322 ? 23.698   -34.466 -14.806 1.00 31.87  ? 361  GLY A N   1 
ATOM   2426  C CA  . GLY A 1 322 ? 24.398   -35.732 -14.657 1.00 33.51  ? 361  GLY A CA  1 
ATOM   2427  C C   . GLY A 1 322 ? 24.040   -36.579 -13.442 1.00 39.61  ? 361  GLY A C   1 
ATOM   2428  O O   . GLY A 1 322 ? 24.514   -37.721 -13.320 1.00 37.16  ? 361  GLY A O   1 
ATOM   2429  N N   . ARG A 1 323 ? 23.218   -36.046 -12.536 1.00 28.92  ? 362  ARG A N   1 
ATOM   2430  C CA  . ARG A 1 323 ? 22.818   -36.820 -11.350 1.00 34.45  ? 362  ARG A CA  1 
ATOM   2431  C C   . ARG A 1 323 ? 21.936   -38.050 -11.628 1.00 31.03  ? 362  ARG A C   1 
ATOM   2432  O O   . ARG A 1 323 ? 21.204   -38.090 -12.615 1.00 28.87  ? 362  ARG A O   1 
ATOM   2433  C CB  . ARG A 1 323 ? 22.115   -35.925 -10.323 1.00 31.87  ? 362  ARG A CB  1 
ATOM   2434  C CG  . ARG A 1 323 ? 23.061   -35.202 -9.382  1.00 26.90  ? 362  ARG A CG  1 
ATOM   2435  C CD  . ARG A 1 323 ? 22.276   -34.465 -8.298  1.00 34.60  ? 362  ARG A CD  1 
ATOM   2436  N NE  . ARG A 1 323 ? 21.438   -33.381 -8.821  1.00 26.85  ? 362  ARG A NE  1 
ATOM   2437  C CZ  . ARG A 1 323 ? 20.438   -32.828 -8.143  1.00 25.43  ? 362  ARG A CZ  1 
ATOM   2438  N NH1 . ARG A 1 323 ? 20.145   -33.271 -6.928  1.00 23.00  ? 362  ARG A NH1 1 
ATOM   2439  N NH2 . ARG A 1 323 ? 19.729   -31.839 -8.678  1.00 25.64  ? 362  ARG A NH2 1 
ATOM   2440  N N   . ASP A 1 324 ? 22.046   -39.037 -10.733 1.00 27.01  ? 363  ASP A N   1 
ATOM   2441  C CA  . ASP A 1 324 ? 21.100   -40.139 -10.572 1.00 43.25  ? 363  ASP A CA  1 
ATOM   2442  C C   . ASP A 1 324 ? 19.765   -39.577 -10.103 1.00 30.90  ? 363  ASP A C   1 
ATOM   2443  O O   . ASP A 1 324 ? 19.704   -38.469 -9.584  1.00 32.06  ? 363  ASP A O   1 
ATOM   2444  C CB  . ASP A 1 324 ? 21.588   -41.103 -9.473  1.00 32.00  ? 363  ASP A CB  1 
ATOM   2445  C CG  . ASP A 1 324 ? 22.564   -42.120 -9.983  1.00 50.40  ? 363  ASP A CG  1 
ATOM   2446  O OD1 . ASP A 1 324 ? 22.906   -43.041 -9.213  1.00 68.24  ? 363  ASP A OD1 1 
ATOM   2447  O OD2 . ASP A 1 324 ? 22.982   -42.014 -11.154 1.00 62.29  ? 363  ASP A OD2 1 
ATOM   2448  N N   . LEU A 1 325 ? 18.714   -40.367 -10.254 1.00 26.46  ? 364  LEU A N   1 
ATOM   2449  C CA  . LEU A 1 325 ? 17.396   -40.003 -9.737  1.00 34.11  ? 364  LEU A CA  1 
ATOM   2450  C C   . LEU A 1 325 ? 17.452   -39.679 -8.251  1.00 36.19  ? 364  LEU A C   1 
ATOM   2451  O O   . LEU A 1 325 ? 16.727   -38.799 -7.777  1.00 31.61  ? 364  LEU A O   1 
ATOM   2452  C CB  . LEU A 1 325 ? 16.392   -41.135 -9.973  1.00 34.60  ? 364  LEU A CB  1 
ATOM   2453  C CG  . LEU A 1 325 ? 16.133   -41.473 -11.439 1.00 32.63  ? 364  LEU A CG  1 
ATOM   2454  C CD1 . LEU A 1 325 ? 14.930   -42.400 -11.582 1.00 40.02  ? 364  LEU A CD1 1 
ATOM   2455  C CD2 . LEU A 1 325 ? 15.950   -40.211 -12.255 1.00 30.44  ? 364  LEU A CD2 1 
ATOM   2456  N N   . THR A 1 326 ? 18.325   -40.366 -7.516  1.00 32.74  ? 365  THR A N   1 
ATOM   2457  C CA  . THR A 1 326 ? 18.324   -40.248 -6.056  1.00 29.17  ? 365  THR A CA  1 
ATOM   2458  C C   . THR A 1 326 ? 19.459   -39.420 -5.452  1.00 24.77  ? 365  THR A C   1 
ATOM   2459  O O   . THR A 1 326 ? 19.529   -39.251 -4.233  1.00 31.59  ? 365  THR A O   1 
ATOM   2460  C CB  . THR A 1 326 ? 18.319   -41.639 -5.372  1.00 37.90  ? 365  THR A CB  1 
ATOM   2461  O OG1 . THR A 1 326 ? 19.567   -42.307 -5.622  1.00 37.80  ? 365  THR A OG1 1 
ATOM   2462  C CG2 . THR A 1 326 ? 17.139   -42.487 -5.870  1.00 31.48  ? 365  THR A CG2 1 
ATOM   2463  N N   . SER A 1 327 ? 20.350   -38.898 -6.281  1.00 26.56  ? 366  SER A N   1 
ATOM   2464  C CA  . SER A 1 327 ? 21.499   -38.167 -5.747  1.00 31.36  ? 366  SER A CA  1 
ATOM   2465  C C   . SER A 1 327 ? 21.173   -36.769 -5.222  1.00 26.24  ? 366  SER A C   1 
ATOM   2466  O O   . SER A 1 327 ? 20.518   -35.994 -5.894  1.00 30.60  ? 366  SER A O   1 
ATOM   2467  C CB  . SER A 1 327 ? 22.601   -38.045 -6.801  1.00 29.42  ? 366  SER A CB  1 
ATOM   2468  O OG  . SER A 1 327 ? 23.105   -39.310 -7.130  1.00 36.34  ? 366  SER A OG  1 
ATOM   2469  N N   . LEU A 1 328 ? 21.679   -36.467 -4.030  1.00 25.26  ? 367  LEU A N   1 
ATOM   2470  C CA  . LEU A 1 328 ? 21.714   -35.120 -3.478  1.00 29.07  ? 367  LEU A CA  1 
ATOM   2471  C C   . LEU A 1 328 ? 22.752   -34.305 -4.214  1.00 31.90  ? 367  LEU A C   1 
ATOM   2472  O O   . LEU A 1 328 ? 23.752   -34.854 -4.672  1.00 31.83  ? 367  LEU A O   1 
ATOM   2473  C CB  . LEU A 1 328 ? 22.209   -35.176 -2.039  1.00 30.17  ? 367  LEU A CB  1 
ATOM   2474  C CG  . LEU A 1 328 ? 21.335   -35.484 -0.844  1.00 39.79  ? 367  LEU A CG  1 
ATOM   2475  C CD1 . LEU A 1 328 ? 22.246   -35.409 0.376   1.00 30.10  ? 367  LEU A CD1 1 
ATOM   2476  C CD2 . LEU A 1 328 ? 20.225   -34.449 -0.766  1.00 25.97  ? 367  LEU A CD2 1 
ATOM   2477  N N   . ARG A 1 329 ? 22.559   -32.992 -4.283  1.00 32.06  ? 368  ARG A N   1 
ATOM   2478  C CA  . ARG A 1 329 ? 23.643   -32.111 -4.704  1.00 26.47  ? 368  ARG A CA  1 
ATOM   2479  C C   . ARG A 1 329 ? 24.660   -31.982 -3.579  1.00 30.78  ? 368  ARG A C   1 
ATOM   2480  O O   . ARG A 1 329 ? 24.383   -32.282 -2.417  1.00 27.22  ? 368  ARG A O   1 
ATOM   2481  C CB  . ARG A 1 329 ? 23.114   -30.735 -5.118  1.00 26.64  ? 368  ARG A CB  1 
ATOM   2482  C CG  . ARG A 1 329 ? 22.384   -30.735 -6.454  1.00 28.68  ? 368  ARG A CG  1 
ATOM   2483  C CD  . ARG A 1 329 ? 21.687   -29.389 -6.717  1.00 30.42  ? 368  ARG A CD  1 
ATOM   2484  N NE  . ARG A 1 329 ? 20.576   -29.144 -5.798  1.00 26.17  ? 368  ARG A NE  1 
ATOM   2485  C CZ  . ARG A 1 329 ? 19.756   -28.091 -5.862  1.00 29.68  ? 368  ARG A CZ  1 
ATOM   2486  N NH1 . ARG A 1 329 ? 19.919   -27.161 -6.801  1.00 26.12  ? 368  ARG A NH1 1 
ATOM   2487  N NH2 . ARG A 1 329 ? 18.773   -27.969 -4.983  1.00 25.54  ? 368  ARG A NH2 1 
ATOM   2488  N N   . ASN A 1 330 ? 25.855   -31.537 -3.928  1.00 29.19  ? 369  ASN A N   1 
ATOM   2489  C CA  . ASN A 1 330 ? 26.879   -31.320 -2.941  1.00 26.40  ? 369  ASN A CA  1 
ATOM   2490  C C   . ASN A 1 330 ? 26.409   -30.347 -1.862  1.00 30.61  ? 369  ASN A C   1 
ATOM   2491  O O   . ASN A 1 330 ? 25.854   -29.292 -2.173  1.00 25.29  ? 369  ASN A O   1 
ATOM   2492  C CB  . ASN A 1 330 ? 28.135   -30.784 -3.630  1.00 29.52  ? 369  ASN A CB  1 
ATOM   2493  C CG  . ASN A 1 330 ? 29.320   -30.831 -2.740  1.00 36.55  ? 369  ASN A CG  1 
ATOM   2494  O OD1 . ASN A 1 330 ? 29.802   -31.912 -2.385  1.00 30.23  ? 369  ASN A OD1 1 
ATOM   2495  N ND2 . ASN A 1 330 ? 29.796   -29.663 -2.335  1.00 36.30  ? 369  ASN A ND2 1 
ATOM   2496  N N   . VAL A 1 331 ? 26.603   -30.698 -0.594  1.00 28.18  ? 370  VAL A N   1 
ATOM   2497  C CA  . VAL A 1 331 ? 26.308   -29.741 0.465   1.00 31.01  ? 370  VAL A CA  1 
ATOM   2498  C C   . VAL A 1 331 ? 27.468   -29.381 1.376   1.00 33.35  ? 370  VAL A C   1 
ATOM   2499  O O   . VAL A 1 331 ? 28.331   -30.203 1.691   1.00 32.96  ? 370  VAL A O   1 
ATOM   2500  C CB  . VAL A 1 331 ? 25.000   -30.040 1.301   1.00 33.72  ? 370  VAL A CB  1 
ATOM   2501  C CG1 . VAL A 1 331 ? 24.223   -31.229 0.772   1.00 32.74  ? 370  VAL A CG1 1 
ATOM   2502  C CG2 . VAL A 1 331 ? 25.299   -30.120 2.793   1.00 24.09  ? 370  VAL A CG2 1 
ATOM   2503  N N   . SER A 1 332 ? 27.494   -28.114 1.768   1.00 30.10  ? 371  SER A N   1 
ATOM   2504  C CA  . SER A 1 332 ? 28.475   -27.654 2.729   1.00 28.69  ? 371  SER A CA  1 
ATOM   2505  C C   . SER A 1 332 ? 27.801   -26.649 3.647   1.00 33.48  ? 371  SER A C   1 
ATOM   2506  O O   . SER A 1 332 ? 26.841   -25.981 3.244   1.00 31.48  ? 371  SER A O   1 
ATOM   2507  C CB  . SER A 1 332 ? 29.672   -27.029 2.021   1.00 35.50  ? 371  SER A CB  1 
ATOM   2508  O OG  . SER A 1 332 ? 29.301   -25.861 1.314   1.00 39.63  ? 371  SER A OG  1 
ATOM   2509  N N   . CYS A 1 333 ? 28.277   -26.565 4.885   1.00 28.44  ? 372  CYS A N   1 
ATOM   2510  C CA  . CYS A 1 333 ? 27.735   -25.598 5.838   1.00 27.57  ? 372  CYS A CA  1 
ATOM   2511  C C   . CYS A 1 333 ? 28.760   -25.067 6.824   1.00 32.35  ? 372  CYS A C   1 
ATOM   2512  O O   . CYS A 1 333 ? 29.849   -25.621 6.976   1.00 36.61  ? 372  CYS A O   1 
ATOM   2513  C CB  . CYS A 1 333 ? 26.552   -26.179 6.611   1.00 35.44  ? 372  CYS A CB  1 
ATOM   2514  S SG  . CYS A 1 333 ? 26.401   -27.957 6.553   1.00 37.06  ? 372  CYS A SG  1 
ATOM   2515  N N   . GLU A 1 334 ? 28.388   -23.990 7.500   1.00 26.94  ? 373  GLU A N   1 
ATOM   2516  C CA  . GLU A 1 334 ? 29.244   -23.362 8.487   1.00 31.52  ? 373  GLU A CA  1 
ATOM   2517  C C   . GLU A 1 334 ? 28.360   -22.740 9.553   1.00 32.00  ? 373  GLU A C   1 
ATOM   2518  O O   . GLU A 1 334 ? 27.237   -22.298 9.267   1.00 29.32  ? 373  GLU A O   1 
ATOM   2519  C CB  . GLU A 1 334 ? 30.102   -22.261 7.842   1.00 36.80  ? 373  GLU A CB  1 
ATOM   2520  C CG  . GLU A 1 334 ? 30.470   -22.493 6.372   1.00 51.21  ? 373  GLU A CG  1 
ATOM   2521  C CD  . GLU A 1 334 ? 30.760   -21.184 5.612   1.00 67.98  ? 373  GLU A CD  1 
ATOM   2522  O OE1 . GLU A 1 334 ? 30.527   -21.125 4.378   1.00 57.98  ? 373  GLU A OE1 1 
ATOM   2523  O OE2 . GLU A 1 334 ? 31.221   -20.210 6.251   1.00 67.62  ? 373  GLU A OE2 1 
ATOM   2524  N N   . VAL A 1 335 ? 28.858   -22.713 10.784  1.00 27.52  ? 374  VAL A N   1 
ATOM   2525  C CA  . VAL A 1 335 ? 28.205   -21.947 11.837  1.00 26.55  ? 374  VAL A CA  1 
ATOM   2526  C C   . VAL A 1 335 ? 29.172   -20.890 12.340  1.00 28.51  ? 374  VAL A C   1 
ATOM   2527  O O   . VAL A 1 335 ? 30.346   -20.895 11.960  1.00 23.57  ? 374  VAL A O   1 
ATOM   2528  C CB  . VAL A 1 335 ? 27.752   -22.843 13.003  1.00 26.52  ? 374  VAL A CB  1 
ATOM   2529  C CG1 . VAL A 1 335 ? 26.738   -23.854 12.504  1.00 27.07  ? 374  VAL A CG1 1 
ATOM   2530  C CG2 . VAL A 1 335 ? 28.958   -23.544 13.646  1.00 28.24  ? 374  VAL A CG2 1 
ATOM   2531  N N   . ASP A 1 336 ? 28.664   -19.967 13.159  1.00 28.05  ? 375  ASP A N   1 
ATOM   2532  C CA  . ASP A 1 336 ? 29.510   -19.003 13.858  1.00 35.08  ? 375  ASP A CA  1 
ATOM   2533  C C   . ASP A 1 336 ? 30.189   -18.036 12.878  1.00 36.56  ? 375  ASP A C   1 
ATOM   2534  O O   . ASP A 1 336 ? 31.370   -17.722 13.009  1.00 36.01  ? 375  ASP A O   1 
ATOM   2535  C CB  . ASP A 1 336 ? 30.550   -19.740 14.709  1.00 31.54  ? 375  ASP A CB  1 
ATOM   2536  C CG  . ASP A 1 336 ? 31.097   -18.883 15.841  1.00 45.97  ? 375  ASP A CG  1 
ATOM   2537  O OD1 . ASP A 1 336 ? 30.378   -17.974 16.321  1.00 39.71  ? 375  ASP A OD1 1 
ATOM   2538  O OD2 . ASP A 1 336 ? 32.249   -19.126 16.253  1.00 45.60  ? 375  ASP A OD2 1 
ATOM   2539  N N   . MET A 1 337 ? 29.407   -17.580 11.907  1.00 32.01  ? 376  MET A N   1 
ATOM   2540  C CA  . MET A 1 337 ? 29.854   -16.731 10.809  1.00 34.95  ? 376  MET A CA  1 
ATOM   2541  C C   . MET A 1 337 ? 30.324   -15.356 11.286  1.00 35.82  ? 376  MET A C   1 
ATOM   2542  O O   . MET A 1 337 ? 31.284   -14.798 10.764  1.00 42.45  ? 376  MET A O   1 
ATOM   2543  C CB  . MET A 1 337 ? 28.690   -16.545 9.837   1.00 37.24  ? 376  MET A CB  1 
ATOM   2544  C CG  . MET A 1 337 ? 27.931   -17.833 9.516   1.00 38.32  ? 376  MET A CG  1 
ATOM   2545  S SD  . MET A 1 337 ? 28.989   -18.987 8.638   1.00 57.26  ? 376  MET A SD  1 
ATOM   2546  C CE  . MET A 1 337 ? 29.467   -17.964 7.237   1.00 38.31  ? 376  MET A CE  1 
ATOM   2547  N N   . PHE A 1 338 ? 29.626   -14.812 12.276  1.00 38.08  ? 377  PHE A N   1 
ATOM   2548  C CA  . PHE A 1 338 ? 29.901   -13.471 12.767  1.00 34.68  ? 377  PHE A CA  1 
ATOM   2549  C C   . PHE A 1 338 ? 29.834   -13.450 14.275  1.00 30.02  ? 377  PHE A C   1 
ATOM   2550  O O   . PHE A 1 338 ? 28.916   -13.987 14.872  1.00 33.24  ? 377  PHE A O   1 
ATOM   2551  C CB  . PHE A 1 338 ? 28.907   -12.465 12.165  1.00 34.31  ? 377  PHE A CB  1 
ATOM   2552  C CG  . PHE A 1 338 ? 28.899   -12.463 10.662  1.00 36.31  ? 377  PHE A CG  1 
ATOM   2553  C CD1 . PHE A 1 338 ? 27.993   -13.237 9.962   1.00 33.02  ? 377  PHE A CD1 1 
ATOM   2554  C CD2 . PHE A 1 338 ? 29.824   -11.711 9.950   1.00 38.41  ? 377  PHE A CD2 1 
ATOM   2555  C CE1 . PHE A 1 338 ? 28.001   -13.259 8.578   1.00 39.07  ? 377  PHE A CE1 1 
ATOM   2556  C CE2 . PHE A 1 338 ? 29.833   -11.730 8.568   1.00 33.42  ? 377  PHE A CE2 1 
ATOM   2557  C CZ  . PHE A 1 338 ? 28.918   -12.509 7.882   1.00 28.57  ? 377  PHE A CZ  1 
ATOM   2558  N N   . LYS A 1 339 ? 30.808   -12.787 14.879  1.00 33.92  ? 378  LYS A N   1 
ATOM   2559  C CA  . LYS A 1 339 ? 30.950   -12.716 16.325  1.00 32.61  ? 378  LYS A CA  1 
ATOM   2560  C C   . LYS A 1 339 ? 29.763   -12.158 17.128  1.00 40.37  ? 378  LYS A C   1 
ATOM   2561  O O   . LYS A 1 339 ? 29.471   -12.682 18.200  1.00 37.05  ? 378  LYS A O   1 
ATOM   2562  C CB  . LYS A 1 339 ? 32.232   -11.937 16.662  1.00 44.56  ? 378  LYS A CB  1 
ATOM   2563  C CG  . LYS A 1 339 ? 32.470   -11.702 18.142  1.00 53.25  ? 378  LYS A CG  1 
ATOM   2564  C CD  . LYS A 1 339 ? 33.938   -11.370 18.422  1.00 66.63  ? 378  LYS A CD  1 
ATOM   2565  C CE  . LYS A 1 339 ? 34.179   -11.072 19.905  1.00 70.05  ? 378  LYS A CE  1 
ATOM   2566  N NZ  . LYS A 1 339 ? 34.372   -9.609  20.184  1.00 66.42  ? 378  LYS A NZ  1 
ATOM   2567  N N   . THR A 1 340 ? 29.094   -11.096 16.666  1.00 31.75  ? 379  THR A N   1 
ATOM   2568  C CA  . THR A 1 340 ? 28.047   -10.496 17.502  1.00 31.47  ? 379  THR A CA  1 
ATOM   2569  C C   . THR A 1 340 ? 26.704   -11.222 17.452  1.00 28.87  ? 379  THR A C   1 
ATOM   2570  O O   . THR A 1 340 ? 25.833   -10.949 18.257  1.00 35.90  ? 379  THR A O   1 
ATOM   2571  C CB  . THR A 1 340 ? 27.759   -9.003  17.182  1.00 37.74  ? 379  THR A CB  1 
ATOM   2572  O OG1 . THR A 1 340 ? 27.377   -8.866  15.808  1.00 39.02  ? 379  THR A OG1 1 
ATOM   2573  C CG2 . THR A 1 340 ? 28.942   -8.141  17.485  1.00 31.93  ? 379  THR A CG2 1 
ATOM   2574  N N   . LEU A 1 341 ? 26.536   -12.133 16.503  1.00 29.73  ? 380  LEU A N   1 
ATOM   2575  C CA  . LEU A 1 341 ? 25.265   -12.829 16.334  1.00 29.99  ? 380  LEU A CA  1 
ATOM   2576  C C   . LEU A 1 341 ? 25.078   -13.927 17.387  1.00 41.10  ? 380  LEU A C   1 
ATOM   2577  O O   . LEU A 1 341 ? 26.012   -14.673 17.706  1.00 34.82  ? 380  LEU A O   1 
ATOM   2578  C CB  . LEU A 1 341 ? 25.183   -13.423 14.930  1.00 28.20  ? 380  LEU A CB  1 
ATOM   2579  C CG  . LEU A 1 341 ? 24.479   -12.707 13.769  1.00 37.64  ? 380  LEU A CG  1 
ATOM   2580  C CD1 . LEU A 1 341 ? 24.221   -11.238 14.018  1.00 30.62  ? 380  LEU A CD1 1 
ATOM   2581  C CD2 . LEU A 1 341 ? 25.236   -12.928 12.464  1.00 29.59  ? 380  LEU A CD2 1 
ATOM   2582  N N   . HIS A 1 342 ? 23.873   -14.020 17.936  1.00 29.92  ? 381  HIS A N   1 
ATOM   2583  C CA  . HIS A 1 342 ? 23.614   -14.978 18.998  1.00 27.60  ? 381  HIS A CA  1 
ATOM   2584  C C   . HIS A 1 342 ? 23.844   -16.388 18.480  1.00 36.24  ? 381  HIS A C   1 
ATOM   2585  O O   . HIS A 1 342 ? 24.367   -17.241 19.187  1.00 29.81  ? 381  HIS A O   1 
ATOM   2586  C CB  . HIS A 1 342 ? 22.198   -14.811 19.522  1.00 29.68  ? 381  HIS A CB  1 
ATOM   2587  C CG  . HIS A 1 342 ? 21.995   -13.549 20.299  1.00 37.52  ? 381  HIS A CG  1 
ATOM   2588  N ND1 . HIS A 1 342 ? 20.764   -12.934 20.414  1.00 33.30  ? 381  HIS A ND1 1 
ATOM   2589  C CD2 . HIS A 1 342 ? 22.863   -12.792 21.009  1.00 31.21  ? 381  HIS A CD2 1 
ATOM   2590  C CE1 . HIS A 1 342 ? 20.887   -11.854 21.162  1.00 38.80  ? 381  HIS A CE1 1 
ATOM   2591  N NE2 . HIS A 1 342 ? 22.150   -11.745 21.537  1.00 35.47  ? 381  HIS A NE2 1 
ATOM   2592  N N   . GLY A 1 343 ? 23.460   -16.616 17.230  1.00 25.84  ? 382  GLY A N   1 
ATOM   2593  C CA  . GLY A 1 343 ? 23.804   -17.843 16.539  1.00 27.09  ? 382  GLY A CA  1 
ATOM   2594  C C   . GLY A 1 343 ? 23.723   -17.555 15.058  1.00 28.98  ? 382  GLY A C   1 
ATOM   2595  O O   . GLY A 1 343 ? 22.984   -16.650 14.650  1.00 26.94  ? 382  GLY A O   1 
ATOM   2596  N N   . SER A 1 344 ? 24.465   -18.305 14.246  1.00 27.07  ? 383  SER A N   1 
ATOM   2597  C CA  . SER A 1 344 ? 24.351   -18.158 12.798  1.00 27.54  ? 383  SER A CA  1 
ATOM   2598  C C   . SER A 1 344 ? 24.885   -19.355 12.035  1.00 26.93  ? 383  SER A C   1 
ATOM   2599  O O   . SER A 1 344 ? 25.695   -20.136 12.546  1.00 28.03  ? 383  SER A O   1 
ATOM   2600  C CB  . SER A 1 344 ? 25.099   -16.912 12.324  1.00 25.69  ? 383  SER A CB  1 
ATOM   2601  O OG  . SER A 1 344 ? 26.504   -17.084 12.468  1.00 31.54  ? 383  SER A OG  1 
ATOM   2602  N N   . ALA A 1 345 ? 24.459   -19.460 10.783  1.00 23.93  ? 384  ALA A N   1 
ATOM   2603  C CA  . ALA A 1 345 ? 24.910   -20.525 9.927   1.00 25.01  ? 384  ALA A CA  1 
ATOM   2604  C C   . ALA A 1 345 ? 24.708   -20.196 8.455   1.00 27.56  ? 384  ALA A C   1 
ATOM   2605  O O   . ALA A 1 345 ? 23.776   -19.466 8.081   1.00 28.82  ? 384  ALA A O   1 
ATOM   2606  C CB  . ALA A 1 345 ? 24.165   -21.839 10.283  1.00 25.54  ? 384  ALA A CB  1 
ATOM   2607  N N   . LEU A 1 346 ? 25.572   -20.768 7.617   1.00 27.56  ? 385  LEU A N   1 
ATOM   2608  C CA  . LEU A 1 346 ? 25.399   -20.696 6.175   1.00 25.51  ? 385  LEU A CA  1 
ATOM   2609  C C   . LEU A 1 346 ? 25.211   -22.115 5.670   1.00 29.37  ? 385  LEU A C   1 
ATOM   2610  O O   . LEU A 1 346 ? 26.020   -22.990 5.960   1.00 30.54  ? 385  LEU A O   1 
ATOM   2611  C CB  . LEU A 1 346 ? 26.623   -20.058 5.504   1.00 29.79  ? 385  LEU A CB  1 
ATOM   2612  C CG  . LEU A 1 346 ? 26.414   -19.577 4.062   1.00 35.88  ? 385  LEU A CG  1 
ATOM   2613  C CD1 . LEU A 1 346 ? 25.562   -18.302 4.045   1.00 24.83  ? 385  LEU A CD1 1 
ATOM   2614  C CD2 . LEU A 1 346 ? 27.740   -19.331 3.356   1.00 31.33  ? 385  LEU A CD2 1 
ATOM   2615  N N   . PHE A 1 347 ? 24.133   -22.348 4.933   1.00 23.90  ? 386  PHE A N   1 
ATOM   2616  C CA  . PHE A 1 347 ? 23.855   -23.668 4.394   1.00 24.27  ? 386  PHE A CA  1 
ATOM   2617  C C   . PHE A 1 347 ? 23.807   -23.566 2.885   1.00 26.38  ? 386  PHE A C   1 
ATOM   2618  O O   . PHE A 1 347 ? 23.053   -22.763 2.329   1.00 27.30  ? 386  PHE A O   1 
ATOM   2619  C CB  . PHE A 1 347 ? 22.532   -24.228 4.948   1.00 24.11  ? 386  PHE A CB  1 
ATOM   2620  C CG  . PHE A 1 347 ? 22.238   -25.629 4.508   1.00 27.80  ? 386  PHE A CG  1 
ATOM   2621  C CD1 . PHE A 1 347 ? 22.770   -26.709 5.199   1.00 26.92  ? 386  PHE A CD1 1 
ATOM   2622  C CD2 . PHE A 1 347 ? 21.464   -25.872 3.376   1.00 23.24  ? 386  PHE A CD2 1 
ATOM   2623  C CE1 . PHE A 1 347 ? 22.523   -28.014 4.790   1.00 18.39  ? 386  PHE A CE1 1 
ATOM   2624  C CE2 . PHE A 1 347 ? 21.209   -27.176 2.957   1.00 29.39  ? 386  PHE A CE2 1 
ATOM   2625  C CZ  . PHE A 1 347 ? 21.735   -28.256 3.676   1.00 21.02  ? 386  PHE A CZ  1 
ATOM   2626  N N   . GLN A 1 348 ? 24.619   -24.393 2.240   1.00 27.84  ? 387  GLN A N   1 
ATOM   2627  C CA  . GLN A 1 348 ? 24.760   -24.410 0.798   1.00 27.40  ? 387  GLN A CA  1 
ATOM   2628  C C   . GLN A 1 348 ? 24.414   -25.783 0.247   1.00 29.17  ? 387  GLN A C   1 
ATOM   2629  O O   . GLN A 1 348 ? 25.003   -26.795 0.639   1.00 29.04  ? 387  GLN A O   1 
ATOM   2630  C CB  . GLN A 1 348 ? 26.209   -24.069 0.416   1.00 28.76  ? 387  GLN A CB  1 
ATOM   2631  C CG  . GLN A 1 348 ? 26.446   -23.914 -1.094  1.00 33.87  ? 387  GLN A CG  1 
ATOM   2632  C CD  . GLN A 1 348 ? 26.170   -22.495 -1.585  1.00 33.09  ? 387  GLN A CD  1 
ATOM   2633  O OE1 . GLN A 1 348 ? 26.455   -21.523 -0.884  1.00 30.02  ? 387  GLN A OE1 1 
ATOM   2634  N NE2 . GLN A 1 348 ? 25.614   -22.375 -2.793  1.00 25.13  ? 387  GLN A NE2 1 
ATOM   2635  N N   . ARG A 1 349 ? 23.446   -25.838 -0.657  1.00 28.98  ? 388  ARG A N   1 
ATOM   2636  C CA  . ARG A 1 349 ? 23.186   -27.085 -1.358  1.00 24.21  ? 388  ARG A CA  1 
ATOM   2637  C C   . ARG A 1 349 ? 23.126   -26.792 -2.855  1.00 29.33  ? 388  ARG A C   1 
ATOM   2638  O O   . ARG A 1 349 ? 22.233   -26.091 -3.335  1.00 24.52  ? 388  ARG A O   1 
ATOM   2639  C CB  . ARG A 1 349 ? 21.917   -27.776 -0.824  1.00 22.17  ? 388  ARG A CB  1 
ATOM   2640  C CG  . ARG A 1 349 ? 21.426   -28.934 -1.680  1.00 22.75  ? 388  ARG A CG  1 
ATOM   2641  C CD  . ARG A 1 349 ? 20.378   -29.802 -0.963  1.00 33.63  ? 388  ARG A CD  1 
ATOM   2642  N NE  . ARG A 1 349 ? 19.481   -29.026 -0.113  1.00 31.53  ? 388  ARG A NE  1 
ATOM   2643  C CZ  . ARG A 1 349 ? 18.629   -28.107 -0.557  1.00 30.37  ? 388  ARG A CZ  1 
ATOM   2644  N NH1 . ARG A 1 349 ? 18.554   -27.831 -1.851  1.00 28.82  ? 388  ARG A NH1 1 
ATOM   2645  N NH2 . ARG A 1 349 ? 17.867   -27.449 0.302   1.00 28.39  ? 388  ARG A NH2 1 
ATOM   2646  N N   . GLY A 1 350 ? 24.106   -27.301 -3.590  1.00 28.27  ? 389  GLY A N   1 
ATOM   2647  C CA  . GLY A 1 350 ? 24.291   -26.865 -4.961  1.00 30.71  ? 389  GLY A CA  1 
ATOM   2648  C C   . GLY A 1 350 ? 24.332   -25.342 -4.969  1.00 30.72  ? 389  GLY A C   1 
ATOM   2649  O O   . GLY A 1 350 ? 24.981   -24.727 -4.126  1.00 27.05  ? 389  GLY A O   1 
ATOM   2650  N N   . GLN A 1 351 ? 23.605   -24.725 -5.893  1.00 27.58  ? 390  GLN A N   1 
ATOM   2651  C CA  . GLN A 1 351 ? 23.667   -23.279 -6.015  1.00 28.61  ? 390  GLN A CA  1 
ATOM   2652  C C   . GLN A 1 351 ? 22.587   -22.611 -5.175  1.00 30.56  ? 390  GLN A C   1 
ATOM   2653  O O   . GLN A 1 351 ? 22.235   -21.459 -5.400  1.00 27.60  ? 390  GLN A O   1 
ATOM   2654  C CB  . GLN A 1 351 ? 23.596   -22.861 -7.485  1.00 28.51  ? 390  GLN A CB  1 
ATOM   2655  C CG  . GLN A 1 351 ? 24.822   -23.341 -8.274  1.00 33.67  ? 390  GLN A CG  1 
ATOM   2656  C CD  . GLN A 1 351 ? 24.854   -22.805 -9.690  1.00 34.17  ? 390  GLN A CD  1 
ATOM   2657  O OE1 . GLN A 1 351 ? 24.447   -23.483 -10.630 1.00 35.01  ? 390  GLN A OE1 1 
ATOM   2658  N NE2 . GLN A 1 351 ? 25.332   -21.578 -9.845  1.00 37.88  ? 390  GLN A NE2 1 
ATOM   2659  N N   . THR A 1 352 ? 22.064   -23.343 -4.198  1.00 25.44  ? 391  THR A N   1 
ATOM   2660  C CA  . THR A 1 352 ? 21.148   -22.747 -3.231  1.00 25.77  ? 391  THR A CA  1 
ATOM   2661  C C   . THR A 1 352 ? 21.890   -22.420 -1.929  1.00 26.42  ? 391  THR A C   1 
ATOM   2662  O O   . THR A 1 352 ? 22.522   -23.288 -1.322  1.00 27.25  ? 391  THR A O   1 
ATOM   2663  C CB  . THR A 1 352 ? 19.954   -23.656 -2.957  1.00 22.98  ? 391  THR A CB  1 
ATOM   2664  O OG1 . THR A 1 352 ? 19.151   -23.723 -4.135  1.00 24.39  ? 391  THR A OG1 1 
ATOM   2665  C CG2 . THR A 1 352 ? 19.117   -23.102 -1.829  1.00 26.85  ? 391  THR A CG2 1 
ATOM   2666  N N   . GLN A 1 353 ? 21.814   -21.158 -1.526  1.00 21.42  ? 392  GLN A N   1 
ATOM   2667  C CA  . GLN A 1 353 ? 22.557   -20.643 -0.381  1.00 21.91  ? 392  GLN A CA  1 
ATOM   2668  C C   . GLN A 1 353 ? 21.586   -19.902 0.519   1.00 27.52  ? 392  GLN A C   1 
ATOM   2669  O O   . GLN A 1 353 ? 20.890   -18.988 0.070   1.00 25.43  ? 392  GLN A O   1 
ATOM   2670  C CB  . GLN A 1 353 ? 23.656   -19.678 -0.863  1.00 26.83  ? 392  GLN A CB  1 
ATOM   2671  C CG  . GLN A 1 353 ? 24.497   -19.003 0.234   1.00 25.23  ? 392  GLN A CG  1 
ATOM   2672  C CD  . GLN A 1 353 ? 25.592   -18.071 -0.344  1.00 33.57  ? 392  GLN A CD  1 
ATOM   2673  O OE1 . GLN A 1 353 ? 25.402   -16.860 -0.437  1.00 25.32  ? 392  GLN A OE1 1 
ATOM   2674  N NE2 . GLN A 1 353 ? 26.734   -18.645 -0.725  1.00 27.26  ? 392  GLN A NE2 1 
ATOM   2675  N N   . VAL A 1 354 ? 21.500   -20.301 1.782   1.00 25.60  ? 393  VAL A N   1 
ATOM   2676  C CA  . VAL A 1 354 ? 20.753   -19.482 2.728   1.00 25.58  ? 393  VAL A CA  1 
ATOM   2677  C C   . VAL A 1 354 ? 21.534   -19.224 4.002   1.00 27.59  ? 393  VAL A C   1 
ATOM   2678  O O   . VAL A 1 354 ? 22.286   -20.072 4.483   1.00 25.87  ? 393  VAL A O   1 
ATOM   2679  C CB  . VAL A 1 354 ? 19.295   -19.984 3.033   1.00 31.28  ? 393  VAL A CB  1 
ATOM   2680  C CG1 . VAL A 1 354 ? 18.769   -20.893 1.942   1.00 23.78  ? 393  VAL A CG1 1 
ATOM   2681  C CG2 . VAL A 1 354 ? 19.199   -20.622 4.371   1.00 34.03  ? 393  VAL A CG2 1 
ATOM   2682  N N   . LEU A 1 355 ? 21.369   -18.015 4.503   1.00 23.03  ? 394  LEU A N   1 
ATOM   2683  C CA  . LEU A 1 355 ? 22.049   -17.546 5.695   1.00 27.79  ? 394  LEU A CA  1 
ATOM   2684  C C   . LEU A 1 355 ? 20.993   -17.506 6.764   1.00 31.71  ? 394  LEU A C   1 
ATOM   2685  O O   . LEU A 1 355 ? 19.920   -16.933 6.560   1.00 27.00  ? 394  LEU A O   1 
ATOM   2686  C CB  . LEU A 1 355 ? 22.615   -16.134 5.481   1.00 21.87  ? 394  LEU A CB  1 
ATOM   2687  C CG  . LEU A 1 355 ? 23.137   -15.442 6.746   1.00 26.41  ? 394  LEU A CG  1 
ATOM   2688  C CD1 . LEU A 1 355 ? 24.462   -16.064 7.149   1.00 27.00  ? 394  LEU A CD1 1 
ATOM   2689  C CD2 . LEU A 1 355 ? 23.297   -13.940 6.497   1.00 34.62  ? 394  LEU A CD2 1 
ATOM   2690  N N   . CYS A 1 356 ? 21.287   -18.130 7.897   1.00 28.26  ? 395  CYS A N   1 
ATOM   2691  C CA  . CYS A 1 356 ? 20.324   -18.206 8.982   1.00 28.47  ? 395  CYS A CA  1 
ATOM   2692  C C   . CYS A 1 356 ? 20.910   -17.571 10.219  1.00 29.59  ? 395  CYS A C   1 
ATOM   2693  O O   . CYS A 1 356 ? 22.104   -17.736 10.530  1.00 32.15  ? 395  CYS A O   1 
ATOM   2694  C CB  . CYS A 1 356 ? 19.934   -19.665 9.263   1.00 26.65  ? 395  CYS A CB  1 
ATOM   2695  S SG  . CYS A 1 356 ? 18.931   -20.398 7.970   1.00 30.41  ? 395  CYS A SG  1 
ATOM   2696  N N   . THR A 1 357 ? 20.092   -16.815 10.929  1.00 26.63  ? 396  THR A N   1 
ATOM   2697  C CA  . THR A 1 357 ? 20.598   -16.216 12.147  1.00 30.86  ? 396  THR A CA  1 
ATOM   2698  C C   . THR A 1 357 ? 19.623   -16.487 13.260  1.00 23.63  ? 396  THR A C   1 
ATOM   2699  O O   . THR A 1 357 ? 18.411   -16.522 13.026  1.00 27.45  ? 396  THR A O   1 
ATOM   2700  C CB  . THR A 1 357 ? 20.833   -14.682 12.006  1.00 29.49  ? 396  THR A CB  1 
ATOM   2701  O OG1 . THR A 1 357 ? 19.604   -13.985 12.204  1.00 48.87  ? 396  THR A OG1 1 
ATOM   2702  C CG2 . THR A 1 357 ? 21.381   -14.342 10.651  1.00 26.14  ? 396  THR A CG2 1 
ATOM   2703  N N   . VAL A 1 358 ? 20.131   -16.709 14.466  1.00 25.78  ? 397  VAL A N   1 
ATOM   2704  C CA  . VAL A 1 358 ? 19.225   -16.655 15.601  1.00 27.95  ? 397  VAL A CA  1 
ATOM   2705  C C   . VAL A 1 358 ? 19.502   -15.485 16.512  1.00 28.24  ? 397  VAL A C   1 
ATOM   2706  O O   . VAL A 1 358 ? 20.648   -15.078 16.730  1.00 27.44  ? 397  VAL A O   1 
ATOM   2707  C CB  . VAL A 1 358 ? 19.000   -18.002 16.385  1.00 38.72  ? 397  VAL A CB  1 
ATOM   2708  C CG1 . VAL A 1 358 ? 19.771   -19.152 15.791  1.00 26.53  ? 397  VAL A CG1 1 
ATOM   2709  C CG2 . VAL A 1 358 ? 19.231   -17.834 17.904  1.00 26.75  ? 397  VAL A CG2 1 
ATOM   2710  N N   . THR A 1 359 ? 18.411   -14.928 17.014  1.00 24.83  ? 398  THR A N   1 
ATOM   2711  C CA  . THR A 1 359 ? 18.482   -13.781 17.883  1.00 29.59  ? 398  THR A CA  1 
ATOM   2712  C C   . THR A 1 359 ? 17.545   -14.037 19.043  1.00 30.78  ? 398  THR A C   1 
ATOM   2713  O O   . THR A 1 359 ? 16.367   -14.387 18.856  1.00 26.18  ? 398  THR A O   1 
ATOM   2714  C CB  . THR A 1 359 ? 18.081   -12.496 17.126  1.00 30.89  ? 398  THR A CB  1 
ATOM   2715  O OG1 . THR A 1 359 ? 18.848   -12.408 15.915  1.00 38.38  ? 398  THR A OG1 1 
ATOM   2716  C CG2 . THR A 1 359 ? 18.335   -11.246 17.985  1.00 30.88  ? 398  THR A CG2 1 
ATOM   2717  N N   . PHE A 1 360 ? 18.086   -13.895 20.245  1.00 30.05  ? 399  PHE A N   1 
ATOM   2718  C CA  . PHE A 1 360 ? 17.292   -14.013 21.460  1.00 28.57  ? 399  PHE A CA  1 
ATOM   2719  C C   . PHE A 1 360 ? 16.714   -12.647 21.780  1.00 27.52  ? 399  PHE A C   1 
ATOM   2720  O O   . PHE A 1 360 ? 17.425   -11.648 21.796  1.00 34.89  ? 399  PHE A O   1 
ATOM   2721  C CB  . PHE A 1 360 ? 18.148   -14.518 22.627  1.00 29.80  ? 399  PHE A CB  1 
ATOM   2722  C CG  . PHE A 1 360 ? 18.770   -15.874 22.386  1.00 28.32  ? 399  PHE A CG  1 
ATOM   2723  C CD1 . PHE A 1 360 ? 18.001   -16.938 21.952  1.00 27.98  ? 399  PHE A CD1 1 
ATOM   2724  C CD2 . PHE A 1 360 ? 20.129   -16.068 22.575  1.00 31.67  ? 399  PHE A CD2 1 
ATOM   2725  C CE1 . PHE A 1 360 ? 18.573   -18.181 21.727  1.00 34.22  ? 399  PHE A CE1 1 
ATOM   2726  C CE2 . PHE A 1 360 ? 20.710   -17.302 22.351  1.00 29.02  ? 399  PHE A CE2 1 
ATOM   2727  C CZ  . PHE A 1 360 ? 19.934   -18.361 21.929  1.00 30.27  ? 399  PHE A CZ  1 
ATOM   2728  N N   . ASP A 1 361 ? 15.413   -12.620 22.026  1.00 31.95  ? 400  ASP A N   1 
ATOM   2729  C CA  . ASP A 1 361 ? 14.692   -11.400 22.331  1.00 32.90  ? 400  ASP A CA  1 
ATOM   2730  C C   . ASP A 1 361 ? 13.997   -11.636 23.660  1.00 33.50  ? 400  ASP A C   1 
ATOM   2731  O O   . ASP A 1 361 ? 13.965   -12.772 24.169  1.00 31.50  ? 400  ASP A O   1 
ATOM   2732  C CB  . ASP A 1 361 ? 13.652   -11.131 21.237  1.00 34.47  ? 400  ASP A CB  1 
ATOM   2733  C CG  . ASP A 1 361 ? 13.319   -9.659  21.085  1.00 42.43  ? 400  ASP A CG  1 
ATOM   2734  O OD1 . ASP A 1 361 ? 13.644   -8.861  21.994  1.00 39.63  ? 400  ASP A OD1 1 
ATOM   2735  O OD2 . ASP A 1 361 ? 12.715   -9.307  20.046  1.00 43.39  ? 400  ASP A OD2 1 
ATOM   2736  N N   . SER A 1 362 ? 13.438   -10.573 24.227  1.00 30.61  ? 401  SER A N   1 
ATOM   2737  C CA  . SER A 1 362 ? 12.734   -10.693 25.501  1.00 34.01  ? 401  SER A CA  1 
ATOM   2738  C C   . SER A 1 362 ? 11.492   -11.562 25.351  1.00 34.88  ? 401  SER A C   1 
ATOM   2739  O O   . SER A 1 362 ? 10.877   -11.612 24.281  1.00 33.99  ? 401  SER A O   1 
ATOM   2740  C CB  . SER A 1 362 ? 12.325   -9.308  26.022  1.00 34.94  ? 401  SER A CB  1 
ATOM   2741  O OG  . SER A 1 362 ? 11.345   -8.722  25.185  1.00 36.29  ? 401  SER A OG  1 
ATOM   2742  N N   . LEU A 1 363 ? 11.113   -12.233 26.431  1.00 35.51  ? 402  LEU A N   1 
ATOM   2743  C CA  . LEU A 1 363 ? 9.836    -12.929 26.465  1.00 37.79  ? 402  LEU A CA  1 
ATOM   2744  C C   . LEU A 1 363 ? 8.703    -11.941 26.177  1.00 38.19  ? 402  LEU A C   1 
ATOM   2745  O O   . LEU A 1 363 ? 7.729    -12.277 25.509  1.00 37.80  ? 402  LEU A O   1 
ATOM   2746  C CB  . LEU A 1 363 ? 9.627    -13.594 27.821  1.00 36.04  ? 402  LEU A CB  1 
ATOM   2747  C CG  . LEU A 1 363 ? 10.015   -15.060 28.000  1.00 44.95  ? 402  LEU A CG  1 
ATOM   2748  C CD1 . LEU A 1 363 ? 10.280   -15.753 26.668  1.00 34.34  ? 402  LEU A CD1 1 
ATOM   2749  C CD2 . LEU A 1 363 ? 11.213   -15.151 28.898  1.00 46.68  ? 402  LEU A CD2 1 
ATOM   2750  N N   . GLU A 1 364 ? 8.850    -10.717 26.680  1.00 38.73  ? 403  GLU A N   1 
ATOM   2751  C CA  . GLU A 1 364 ? 7.860    -9.659  26.482  1.00 40.15  ? 403  GLU A CA  1 
ATOM   2752  C C   . GLU A 1 364 ? 7.602    -9.340  25.012  1.00 40.59  ? 403  GLU A C   1 
ATOM   2753  O O   . GLU A 1 364 ? 6.506    -8.925  24.650  1.00 44.42  ? 403  GLU A O   1 
ATOM   2754  C CB  . GLU A 1 364 ? 8.284    -8.371  27.199  1.00 46.03  ? 403  GLU A CB  1 
ATOM   2755  C CG  . GLU A 1 364 ? 8.283    -8.454  28.715  1.00 43.52  ? 403  GLU A CG  1 
ATOM   2756  C CD  . GLU A 1 364 ? 9.654    -8.760  29.295  1.00 47.73  ? 403  GLU A CD  1 
ATOM   2757  O OE1 . GLU A 1 364 ? 10.510   -9.304  28.565  1.00 50.50  ? 403  GLU A OE1 1 
ATOM   2758  O OE2 . GLU A 1 364 ? 9.880    -8.442  30.482  1.00 50.19  ? 403  GLU A OE2 1 
ATOM   2759  N N   . SER A 1 365 ? 8.613    -9.521  24.172  1.00 41.64  ? 404  SER A N   1 
ATOM   2760  C CA  . SER A 1 365 ? 8.511    -9.150  22.759  1.00 40.22  ? 404  SER A CA  1 
ATOM   2761  C C   . SER A 1 365 ? 7.588    -10.078 21.970  1.00 35.97  ? 404  SER A C   1 
ATOM   2762  O O   . SER A 1 365 ? 7.207    -9.767  20.841  1.00 44.14  ? 404  SER A O   1 
ATOM   2763  C CB  . SER A 1 365 ? 9.898    -9.141  22.103  1.00 41.67  ? 404  SER A CB  1 
ATOM   2764  O OG  . SER A 1 365 ? 10.362   -10.471 21.912  1.00 30.83  ? 404  SER A OG  1 
ATOM   2765  N N   . GLY A 1 366 ? 7.259    -11.233 22.541  1.00 34.07  ? 405  GLY A N   1 
ATOM   2766  C CA  . GLY A 1 366 ? 6.276    -12.111 21.930  1.00 42.83  ? 405  GLY A CA  1 
ATOM   2767  C C   . GLY A 1 366 ? 4.844    -11.591 22.071  1.00 53.27  ? 405  GLY A C   1 
ATOM   2768  O O   . GLY A 1 366 ? 3.886    -12.246 21.636  1.00 44.84  ? 405  GLY A O   1 
ATOM   2769  N N   . ILE A 1 367 ? 4.695    -10.412 22.684  1.00 46.49  ? 406  ILE A N   1 
ATOM   2770  C CA  . ILE A 1 367 ? 3.377    -9.798  22.879  1.00 55.62  ? 406  ILE A CA  1 
ATOM   2771  C C   . ILE A 1 367 ? 3.379    -8.305  22.538  1.00 58.67  ? 406  ILE A C   1 
ATOM   2772  O O   . ILE A 1 367 ? 4.285    -7.568  22.936  1.00 55.76  ? 406  ILE A O   1 
ATOM   2773  C CB  . ILE A 1 367 ? 2.882    -9.967  24.335  1.00 51.56  ? 406  ILE A CB  1 
ATOM   2774  C CG1 . ILE A 1 367 ? 2.882    -11.440 24.736  1.00 47.11  ? 406  ILE A CG1 1 
ATOM   2775  C CG2 . ILE A 1 367 ? 1.486    -9.376  24.503  1.00 59.67  ? 406  ILE A CG2 1 
ATOM   2776  C CD1 . ILE A 1 367 ? 2.397    -11.674 26.148  1.00 49.45  ? 406  ILE A CD1 1 
ATOM   2777  N N   . LYS A 1 368 ? 2.359    -7.859  21.808  1.00 56.76  ? 407  LYS A N   1 
ATOM   2778  C CA  . LYS A 1 368 ? 2.222    -6.442  21.470  1.00 50.09  ? 407  LYS A CA  1 
ATOM   2779  C C   . LYS A 1 368 ? 1.447    -5.699  22.560  1.00 56.60  ? 407  LYS A C   1 
ATOM   2780  O O   . LYS A 1 368 ? 0.719    -6.317  23.343  1.00 61.36  ? 407  LYS A O   1 
ATOM   2781  C CB  . LYS A 1 368 ? 1.528    -6.275  20.118  1.00 57.47  ? 407  LYS A CB  1 
ATOM   2782  C CG  . LYS A 1 368 ? 1.329    -7.582  19.366  1.00 66.65  ? 407  LYS A CG  1 
ATOM   2783  C CD  . LYS A 1 368 ? 1.894    -7.511  17.959  1.00 69.69  ? 407  LYS A CD  1 
ATOM   2784  C CE  . LYS A 1 368 ? 3.378    -7.202  17.981  1.00 63.28  ? 407  LYS A CE  1 
ATOM   2785  N NZ  . LYS A 1 368 ? 3.943    -7.193  16.608  1.00 69.72  ? 407  LYS A NZ  1 
ATOM   2786  N N   . SER A 1 369 ? 1.606    -4.380  22.618  1.00 52.82  ? 408  SER A N   1 
ATOM   2787  C CA  . SER A 1 369 ? 0.952    -3.591  23.660  1.00 56.30  ? 408  SER A CA  1 
ATOM   2788  C C   . SER A 1 369 ? -0.559   -3.580  23.463  1.00 60.69  ? 408  SER A C   1 
ATOM   2789  O O   . SER A 1 369 ? -1.324   -3.471  24.426  1.00 57.60  ? 408  SER A O   1 
ATOM   2790  C CB  . SER A 1 369 ? 1.482    -2.158  23.680  1.00 71.22  ? 408  SER A CB  1 
ATOM   2791  O OG  . SER A 1 369 ? 0.903    -1.431  24.752  1.00 78.64  ? 408  SER A OG  1 
ATOM   2792  N N   . ASP A 1 370 ? -0.975   -3.702  22.206  1.00 55.40  ? 409  ASP A N   1 
ATOM   2793  C CA  . ASP A 1 370 ? -2.390   -3.722  21.861  1.00 62.72  ? 409  ASP A CA  1 
ATOM   2794  C C   . ASP A 1 370 ? -2.957   -5.140  21.905  1.00 56.50  ? 409  ASP A C   1 
ATOM   2795  O O   . ASP A 1 370 ? -2.531   -6.018  21.148  1.00 43.22  ? 409  ASP A O   1 
ATOM   2796  C CB  . ASP A 1 370 ? -2.608   -3.119  20.474  1.00 60.50  ? 409  ASP A CB  1 
ATOM   2797  C CG  . ASP A 1 370 ? -4.057   -2.761  20.223  1.00 70.32  ? 409  ASP A CG  1 
ATOM   2798  O OD1 . ASP A 1 370 ? -4.876   -3.688  20.025  1.00 72.03  ? 409  ASP A OD1 1 
ATOM   2799  O OD2 . ASP A 1 370 ? -4.376   -1.551  20.229  1.00 64.51  ? 409  ASP A OD2 1 
ATOM   2800  N N   . GLN A 1 371 ? -3.927   -5.347  22.791  1.00 55.97  ? 410  GLN A N   1 
ATOM   2801  C CA  . GLN A 1 371 ? -4.543   -6.656  22.974  1.00 54.79  ? 410  GLN A CA  1 
ATOM   2802  C C   . GLN A 1 371 ? -5.068   -7.274  21.675  1.00 53.47  ? 410  GLN A C   1 
ATOM   2803  O O   . GLN A 1 371 ? -4.805   -8.445  21.381  1.00 48.05  ? 410  GLN A O   1 
ATOM   2804  C CB  . GLN A 1 371 ? -5.681   -6.570  23.993  1.00 53.58  ? 410  GLN A CB  1 
ATOM   2805  C CG  . GLN A 1 371 ? -6.444   -7.878  24.152  1.00 49.94  ? 410  GLN A CG  1 
ATOM   2806  C CD  . GLN A 1 371 ? -7.674   -7.741  25.030  1.00 56.90  ? 410  GLN A CD  1 
ATOM   2807  O OE1 . GLN A 1 371 ? -7.933   -6.677  25.599  1.00 52.24  ? 410  GLN A OE1 1 
ATOM   2808  N NE2 . GLN A 1 371 ? -8.445   -8.821  25.140  1.00 57.63  ? 410  GLN A NE2 1 
ATOM   2809  N N   . VAL A 1 372 ? -5.816   -6.493  20.903  1.00 48.34  ? 411  VAL A N   1 
ATOM   2810  C CA  . VAL A 1 372 ? -6.473   -7.029  19.714  1.00 53.87  ? 411  VAL A CA  1 
ATOM   2811  C C   . VAL A 1 372 ? -5.467   -7.380  18.620  1.00 51.18  ? 411  VAL A C   1 
ATOM   2812  O O   . VAL A 1 372 ? -5.635   -8.365  17.911  1.00 45.42  ? 411  VAL A O   1 
ATOM   2813  C CB  . VAL A 1 372 ? -7.543   -6.071  19.152  1.00 58.89  ? 411  VAL A CB  1 
ATOM   2814  C CG1 . VAL A 1 372 ? -8.153   -6.657  17.876  1.00 51.12  ? 411  VAL A CG1 1 
ATOM   2815  C CG2 . VAL A 1 372 ? -8.620   -5.806  20.198  1.00 47.12  ? 411  VAL A CG2 1 
ATOM   2816  N N   . ILE A 1 373 ? -4.421   -6.574  18.485  1.00 48.62  ? 412  ILE A N   1 
ATOM   2817  C CA  . ILE A 1 373 ? -3.366   -6.883  17.525  1.00 52.57  ? 412  ILE A CA  1 
ATOM   2818  C C   . ILE A 1 373 ? -2.622   -8.165  17.936  1.00 53.33  ? 412  ILE A C   1 
ATOM   2819  O O   . ILE A 1 373 ? -2.293   -9.013  17.094  1.00 50.61  ? 412  ILE A O   1 
ATOM   2820  C CB  . ILE A 1 373 ? -2.386   -5.698  17.356  1.00 58.65  ? 412  ILE A CB  1 
ATOM   2821  C CG1 . ILE A 1 373 ? -3.162   -4.406  17.072  1.00 54.17  ? 412  ILE A CG1 1 
ATOM   2822  C CG2 . ILE A 1 373 ? -1.381   -5.982  16.238  1.00 52.12  ? 412  ILE A CG2 1 
ATOM   2823  C CD1 . ILE A 1 373 ? -2.286   -3.163  16.991  1.00 61.76  ? 412  ILE A CD1 1 
ATOM   2824  N N   . THR A 1 374 ? -2.378   -8.304  19.235  1.00 52.12  ? 413  THR A N   1 
ATOM   2825  C CA  . THR A 1 374 ? -1.761   -9.507  19.793  1.00 54.14  ? 413  THR A CA  1 
ATOM   2826  C C   . THR A 1 374 ? -2.574   -10.753 19.435  1.00 57.41  ? 413  THR A C   1 
ATOM   2827  O O   . THR A 1 374 ? -2.017   -11.766 18.999  1.00 47.77  ? 413  THR A O   1 
ATOM   2828  C CB  . THR A 1 374 ? -1.608   -9.394  21.339  1.00 52.99  ? 413  THR A CB  1 
ATOM   2829  O OG1 . THR A 1 374 ? -0.562   -8.457  21.657  1.00 52.04  ? 413  THR A OG1 1 
ATOM   2830  C CG2 . THR A 1 374 ? -1.276   -10.740 21.955  1.00 49.46  ? 413  THR A CG2 1 
ATOM   2831  N N   . ALA A 1 375 ? -3.893   -10.665 19.605  1.00 42.88  ? 414  ALA A N   1 
ATOM   2832  C CA  . ALA A 1 375 ? -4.775   -11.798 19.363  1.00 50.07  ? 414  ALA A CA  1 
ATOM   2833  C C   . ALA A 1 375 ? -4.682   -12.278 17.916  1.00 50.19  ? 414  ALA A C   1 
ATOM   2834  O O   . ALA A 1 375 ? -4.793   -13.470 17.635  1.00 55.67  ? 414  ALA A O   1 
ATOM   2835  C CB  . ALA A 1 375 ? -6.224   -11.435 19.723  1.00 53.31  ? 414  ALA A CB  1 
ATOM   2836  N N   . ILE A 1 376 ? -4.459   -11.345 17.000  1.00 43.64  ? 415  ILE A N   1 
ATOM   2837  C CA  . ILE A 1 376 ? -4.464   -11.670 15.580  1.00 51.24  ? 415  ILE A CA  1 
ATOM   2838  C C   . ILE A 1 376 ? -3.533   -12.841 15.219  1.00 56.95  ? 415  ILE A C   1 
ATOM   2839  O O   . ILE A 1 376 ? -3.999   -13.897 14.776  1.00 53.13  ? 415  ILE A O   1 
ATOM   2840  C CB  . ILE A 1 376 ? -4.191   -10.425 14.721  1.00 48.01  ? 415  ILE A CB  1 
ATOM   2841  C CG1 . ILE A 1 376 ? -5.333   -9.417  14.897  1.00 48.98  ? 415  ILE A CG1 1 
ATOM   2842  C CG2 . ILE A 1 376 ? -4.028   -10.804 13.258  1.00 58.93  ? 415  ILE A CG2 1 
ATOM   2843  C CD1 . ILE A 1 376 ? -5.156   -8.117  14.110  1.00 51.60  ? 415  ILE A CD1 1 
ATOM   2844  N N   . ASN A 1 377 ? -2.228   -12.671 15.407  1.00 54.39  ? 416  ASN A N   1 
ATOM   2845  C CA  . ASN A 1 377 ? -1.310   -13.792 15.176  1.00 62.31  ? 416  ASN A CA  1 
ATOM   2846  C C   . ASN A 1 377 ? -1.078   -14.626 16.432  1.00 64.78  ? 416  ASN A C   1 
ATOM   2847  O O   . ASN A 1 377 ? -0.516   -15.723 16.367  1.00 64.30  ? 416  ASN A O   1 
ATOM   2848  C CB  . ASN A 1 377 ? 0.023    -13.328 14.580  1.00 63.10  ? 416  ASN A CB  1 
ATOM   2849  C CG  . ASN A 1 377 ? -0.085   -12.983 13.102  1.00 60.77  ? 416  ASN A CG  1 
ATOM   2850  O OD1 . ASN A 1 377 ? -1.033   -13.387 12.422  1.00 50.39  ? 416  ASN A OD1 1 
ATOM   2851  N ND2 . ASN A 1 377 ? 0.896    -12.240 12.595  1.00 57.15  ? 416  ASN A ND2 1 
ATOM   2852  N N   . GLY A 1 378 ? -1.525   -14.106 17.572  1.00 64.64  ? 417  GLY A N   1 
ATOM   2853  C CA  . GLY A 1 378 ? -1.406   -14.820 18.830  1.00 59.78  ? 417  GLY A CA  1 
ATOM   2854  C C   . GLY A 1 378 ? 0.012    -14.823 19.374  1.00 53.69  ? 417  GLY A C   1 
ATOM   2855  O O   . GLY A 1 378 ? 0.896    -14.138 18.865  1.00 39.88  ? 417  GLY A O   1 
ATOM   2856  N N   . ILE A 1 379 ? 0.229    -15.601 20.423  1.00 55.37  ? 418  ILE A N   1 
ATOM   2857  C CA  . ILE A 1 379 ? 1.547    -15.697 21.023  1.00 52.86  ? 418  ILE A CA  1 
ATOM   2858  C C   . ILE A 1 379 ? 2.165    -17.023 20.618  1.00 43.54  ? 418  ILE A C   1 
ATOM   2859  O O   . ILE A 1 379 ? 1.576    -18.077 20.843  1.00 53.55  ? 418  ILE A O   1 
ATOM   2860  C CB  . ILE A 1 379 ? 1.456    -15.597 22.555  1.00 53.38  ? 418  ILE A CB  1 
ATOM   2861  C CG1 . ILE A 1 379 ? 0.679    -14.334 22.942  1.00 58.19  ? 418  ILE A CG1 1 
ATOM   2862  C CG2 . ILE A 1 379 ? 2.850    -15.607 23.180  1.00 52.73  ? 418  ILE A CG2 1 
ATOM   2863  C CD1 . ILE A 1 379 ? 0.627    -14.064 24.436  1.00 52.96  ? 418  ILE A CD1 1 
ATOM   2864  N N   . LYS A 1 380 ? 3.339    -16.966 19.999  1.00 35.39  ? 419  LYS A N   1 
ATOM   2865  C CA  . LYS A 1 380 ? 3.990    -18.169 19.479  1.00 36.79  ? 419  LYS A CA  1 
ATOM   2866  C C   . LYS A 1 380 ? 4.295    -19.161 20.593  1.00 37.68  ? 419  LYS A C   1 
ATOM   2867  O O   . LYS A 1 380 ? 4.950    -18.816 21.574  1.00 32.73  ? 419  LYS A O   1 
ATOM   2868  C CB  . LYS A 1 380 ? 5.265    -17.800 18.717  1.00 38.31  ? 419  LYS A CB  1 
ATOM   2869  C CG  . LYS A 1 380 ? 5.016    -17.343 17.279  1.00 48.36  ? 419  LYS A CG  1 
ATOM   2870  C CD  . LYS A 1 380 ? 4.599    -18.519 16.391  1.00 42.31  ? 419  LYS A CD  1 
ATOM   2871  C CE  . LYS A 1 380 ? 4.297    -18.067 14.961  1.00 51.78  ? 419  LYS A CE  1 
ATOM   2872  N NZ  . LYS A 1 380 ? 5.360    -17.147 14.434  1.00 64.36  ? 419  LYS A NZ  1 
ATOM   2873  N N   . ASP A 1 381 ? 3.791    -20.383 20.464  1.00 31.89  ? 420  ASP A N   1 
ATOM   2874  C CA  . ASP A 1 381 ? 4.129    -21.393 21.446  1.00 38.77  ? 420  ASP A CA  1 
ATOM   2875  C C   . ASP A 1 381 ? 5.642    -21.612 21.452  1.00 41.26  ? 420  ASP A C   1 
ATOM   2876  O O   . ASP A 1 381 ? 6.306    -21.461 20.415  1.00 34.05  ? 420  ASP A O   1 
ATOM   2877  C CB  . ASP A 1 381 ? 3.401    -22.705 21.186  1.00 39.47  ? 420  ASP A CB  1 
ATOM   2878  C CG  . ASP A 1 381 ? 3.627    -23.699 22.293  1.00 43.95  ? 420  ASP A CG  1 
ATOM   2879  O OD1 . ASP A 1 381 ? 3.530    -23.299 23.477  1.00 40.26  ? 420  ASP A OD1 1 
ATOM   2880  O OD2 . ASP A 1 381 ? 3.946    -24.864 21.986  1.00 40.10  ? 420  ASP A OD2 1 
ATOM   2881  N N   . LYS A 1 382 ? 6.168    -21.948 22.629  1.00 33.23  ? 421  LYS A N   1 
ATOM   2882  C CA  . LYS A 1 382 ? 7.610    -22.046 22.882  1.00 35.88  ? 421  LYS A CA  1 
ATOM   2883  C C   . LYS A 1 382 ? 8.321    -20.719 22.612  1.00 35.61  ? 421  LYS A C   1 
ATOM   2884  O O   . LYS A 1 382 ? 9.553    -20.647 22.624  1.00 33.65  ? 421  LYS A O   1 
ATOM   2885  C CB  . LYS A 1 382 ? 8.248    -23.169 22.062  1.00 30.21  ? 421  LYS A CB  1 
ATOM   2886  C CG  . LYS A 1 382 ? 7.646    -24.562 22.316  1.00 33.90  ? 421  LYS A CG  1 
ATOM   2887  C CD  . LYS A 1 382 ? 8.457    -25.644 21.596  1.00 29.37  ? 421  LYS A CD  1 
ATOM   2888  C CE  . LYS A 1 382 ? 7.811    -27.023 21.684  1.00 32.01  ? 421  LYS A CE  1 
ATOM   2889  N NZ  . LYS A 1 382 ? 8.575    -27.992 20.845  1.00 27.61  ? 421  LYS A NZ  1 
ATOM   2890  N N   . ASN A 1 383 ? 7.546    -19.668 22.376  1.00 31.95  ? 422  ASN A N   1 
ATOM   2891  C CA  . ASN A 1 383 ? 8.132    -18.362 22.080  1.00 34.97  ? 422  ASN A CA  1 
ATOM   2892  C C   . ASN A 1 383 ? 9.234    -18.520 21.054  1.00 28.91  ? 422  ASN A C   1 
ATOM   2893  O O   . ASN A 1 383 ? 10.369   -18.119 21.279  1.00 31.98  ? 422  ASN A O   1 
ATOM   2894  C CB  . ASN A 1 383 ? 8.665    -17.694 23.348  1.00 35.07  ? 422  ASN A CB  1 
ATOM   2895  C CG  . ASN A 1 383 ? 7.561    -17.409 24.358  1.00 43.18  ? 422  ASN A CG  1 
ATOM   2896  O OD1 . ASN A 1 383 ? 6.677    -16.577 24.116  1.00 38.90  ? 422  ASN A OD1 1 
ATOM   2897  N ND2 . ASN A 1 383 ? 7.598    -18.107 25.490  1.00 37.80  ? 422  ASN A ND2 1 
ATOM   2898  N N   . PHE A 1 384 ? 8.858    -19.127 19.934  1.00 23.83  ? 423  PHE A N   1 
ATOM   2899  C CA  . PHE A 1 384 ? 9.752    -19.488 18.848  1.00 29.45  ? 423  PHE A CA  1 
ATOM   2900  C C   . PHE A 1 384 ? 9.124    -19.083 17.521  1.00 23.70  ? 423  PHE A C   1 
ATOM   2901  O O   . PHE A 1 384 ? 7.944    -19.362 17.260  1.00 27.38  ? 423  PHE A O   1 
ATOM   2902  C CB  . PHE A 1 384 ? 9.994    -21.009 18.831  1.00 24.79  ? 423  PHE A CB  1 
ATOM   2903  C CG  . PHE A 1 384 ? 10.692   -21.484 17.588  1.00 27.40  ? 423  PHE A CG  1 
ATOM   2904  C CD1 . PHE A 1 384 ? 12.026   -21.171 17.369  1.00 24.20  ? 423  PHE A CD1 1 
ATOM   2905  C CD2 . PHE A 1 384 ? 10.011   -22.216 16.627  1.00 26.56  ? 423  PHE A CD2 1 
ATOM   2906  C CE1 . PHE A 1 384 ? 12.674   -21.593 16.214  1.00 28.13  ? 423  PHE A CE1 1 
ATOM   2907  C CE2 . PHE A 1 384 ? 10.653   -22.643 15.473  1.00 23.72  ? 423  PHE A CE2 1 
ATOM   2908  C CZ  . PHE A 1 384 ? 11.980   -22.336 15.267  1.00 26.20  ? 423  PHE A CZ  1 
ATOM   2909  N N   . MET A 1 385 ? 9.904    -18.433 16.674  1.00 26.89  ? 424  MET A N   1 
ATOM   2910  C CA  . MET A 1 385 ? 9.404    -18.087 15.356  1.00 28.47  ? 424  MET A CA  1 
ATOM   2911  C C   . MET A 1 385 ? 10.521   -17.998 14.344  1.00 28.09  ? 424  MET A C   1 
ATOM   2912  O O   . MET A 1 385 ? 11.675   -17.780 14.699  1.00 29.01  ? 424  MET A O   1 
ATOM   2913  C CB  . MET A 1 385 ? 8.646    -16.759 15.394  1.00 31.33  ? 424  MET A CB  1 
ATOM   2914  C CG  . MET A 1 385 ? 9.507    -15.577 15.743  1.00 37.21  ? 424  MET A CG  1 
ATOM   2915  S SD  . MET A 1 385 ? 8.503    -14.079 15.751  1.00 81.11  ? 424  MET A SD  1 
ATOM   2916  C CE  . MET A 1 385 ? 8.220    -13.859 13.991  1.00 66.18  ? 424  MET A CE  1 
ATOM   2917  N N   . LEU A 1 386 ? 10.163   -18.159 13.078  1.00 29.48  ? 425  LEU A N   1 
ATOM   2918  C CA  . LEU A 1 386 ? 11.127   -18.068 11.997  1.00 27.71  ? 425  LEU A CA  1 
ATOM   2919  C C   . LEU A 1 386 ? 10.589   -17.117 10.934  1.00 31.77  ? 425  LEU A C   1 
ATOM   2920  O O   . LEU A 1 386 ? 9.424    -17.198 10.545  1.00 29.02  ? 425  LEU A O   1 
ATOM   2921  C CB  . LEU A 1 386 ? 11.396   -19.445 11.403  1.00 24.79  ? 425  LEU A CB  1 
ATOM   2922  C CG  . LEU A 1 386 ? 12.539   -19.588 10.394  1.00 26.23  ? 425  LEU A CG  1 
ATOM   2923  C CD1 . LEU A 1 386 ? 13.088   -21.026 10.429  1.00 26.81  ? 425  LEU A CD1 1 
ATOM   2924  C CD2 . LEU A 1 386 ? 12.063   -19.206 8.994   1.00 21.68  ? 425  LEU A CD2 1 
ATOM   2925  N N   . HIS A 1 387 ? 11.450   -16.208 10.495  1.00 28.54  ? 426  HIS A N   1 
ATOM   2926  C CA  . HIS A 1 387 ? 11.127   -15.238 9.463   1.00 29.65  ? 426  HIS A CA  1 
ATOM   2927  C C   . HIS A 1 387 ? 12.017   -15.514 8.252   1.00 31.03  ? 426  HIS A C   1 
ATOM   2928  O O   . HIS A 1 387 ? 13.235   -15.542 8.366   1.00 27.78  ? 426  HIS A O   1 
ATOM   2929  C CB  . HIS A 1 387 ? 11.351   -13.820 10.000  1.00 26.46  ? 426  HIS A CB  1 
ATOM   2930  C CG  . HIS A 1 387 ? 11.297   -12.755 8.948   1.00 38.18  ? 426  HIS A CG  1 
ATOM   2931  N ND1 . HIS A 1 387 ? 10.114   -12.316 8.392   1.00 38.19  ? 426  HIS A ND1 1 
ATOM   2932  C CD2 . HIS A 1 387 ? 12.284   -12.042 8.351   1.00 35.94  ? 426  HIS A CD2 1 
ATOM   2933  C CE1 . HIS A 1 387 ? 10.375   -11.382 7.492   1.00 33.38  ? 426  HIS A CE1 1 
ATOM   2934  N NE2 . HIS A 1 387 ? 11.681   -11.197 7.448   1.00 34.70  ? 426  HIS A NE2 1 
ATOM   2935  N N   . TYR A 1 388 ? 11.396   -15.711 7.094   1.00 31.07  ? 427  TYR A N   1 
ATOM   2936  C CA  . TYR A 1 388 ? 12.103   -16.076 5.869   1.00 23.97  ? 427  TYR A CA  1 
ATOM   2937  C C   . TYR A 1 388 ? 12.043   -14.935 4.845   1.00 31.68  ? 427  TYR A C   1 
ATOM   2938  O O   . TYR A 1 388 ? 11.005   -14.308 4.666   1.00 27.10  ? 427  TYR A O   1 
ATOM   2939  C CB  . TYR A 1 388 ? 11.455   -17.343 5.318   1.00 21.31  ? 427  TYR A CB  1 
ATOM   2940  C CG  . TYR A 1 388 ? 11.723   -17.730 3.874   1.00 28.20  ? 427  TYR A CG  1 
ATOM   2941  C CD1 . TYR A 1 388 ? 11.073   -17.088 2.827   1.00 28.71  ? 427  TYR A CD1 1 
ATOM   2942  C CD2 . TYR A 1 388 ? 12.550   -18.802 3.565   1.00 26.18  ? 427  TYR A CD2 1 
ATOM   2943  C CE1 . TYR A 1 388 ? 11.275   -17.480 1.512   1.00 27.20  ? 427  TYR A CE1 1 
ATOM   2944  C CE2 . TYR A 1 388 ? 12.758   -19.198 2.261   1.00 22.77  ? 427  TYR A CE2 1 
ATOM   2945  C CZ  . TYR A 1 388 ? 12.117   -18.535 1.233   1.00 31.82  ? 427  TYR A CZ  1 
ATOM   2946  O OH  . TYR A 1 388 ? 12.310   -18.928 -0.083  1.00 30.09  ? 427  TYR A OH  1 
ATOM   2947  N N   . GLU A 1 389 ? 13.161   -14.650 4.191   1.00 29.98  ? 428  GLU A N   1 
ATOM   2948  C CA  . GLU A 1 389 ? 13.155   -13.697 3.095   1.00 28.32  ? 428  GLU A CA  1 
ATOM   2949  C C   . GLU A 1 389 ? 13.822   -14.280 1.870   1.00 29.96  ? 428  GLU A C   1 
ATOM   2950  O O   . GLU A 1 389 ? 14.805   -15.012 1.966   1.00 26.99  ? 428  GLU A O   1 
ATOM   2951  C CB  . GLU A 1 389 ? 13.830   -12.380 3.486   1.00 27.90  ? 428  GLU A CB  1 
ATOM   2952  C CG  . GLU A 1 389 ? 13.115   -11.633 4.599   1.00 29.18  ? 428  GLU A CG  1 
ATOM   2953  C CD  . GLU A 1 389 ? 13.723   -10.250 4.871   1.00 51.91  ? 428  GLU A CD  1 
ATOM   2954  O OE1 . GLU A 1 389 ? 14.571   -9.774  4.071   1.00 44.16  ? 428  GLU A OE1 1 
ATOM   2955  O OE2 . GLU A 1 389 ? 13.356   -9.645  5.901   1.00 46.27  ? 428  GLU A OE2 1 
ATOM   2956  N N   . PHE A 1 390 ? 13.261   -13.947 0.715   1.00 27.72  ? 429  PHE A N   1 
ATOM   2957  C CA  . PHE A 1 390 ? 13.795   -14.359 -0.574  1.00 31.66  ? 429  PHE A CA  1 
ATOM   2958  C C   . PHE A 1 390 ? 14.039   -13.072 -1.392  1.00 34.89  ? 429  PHE A C   1 
ATOM   2959  O O   . PHE A 1 390 ? 13.232   -12.703 -2.244  1.00 27.81  ? 429  PHE A O   1 
ATOM   2960  C CB  . PHE A 1 390 ? 12.764   -15.266 -1.253  1.00 28.72  ? 429  PHE A CB  1 
ATOM   2961  C CG  . PHE A 1 390 ? 13.298   -16.064 -2.409  1.00 38.10  ? 429  PHE A CG  1 
ATOM   2962  C CD1 . PHE A 1 390 ? 14.181   -15.515 -3.314  1.00 43.01  ? 429  PHE A CD1 1 
ATOM   2963  C CD2 . PHE A 1 390 ? 12.896   -17.376 -2.594  1.00 44.89  ? 429  PHE A CD2 1 
ATOM   2964  C CE1 . PHE A 1 390 ? 14.649   -16.261 -4.379  1.00 43.82  ? 429  PHE A CE1 1 
ATOM   2965  C CE2 . PHE A 1 390 ? 13.365   -18.115 -3.651  1.00 37.73  ? 429  PHE A CE2 1 
ATOM   2966  C CZ  . PHE A 1 390 ? 14.235   -17.559 -4.543  1.00 34.85  ? 429  PHE A CZ  1 
ATOM   2967  N N   . PRO A 1 391 ? 15.145   -12.365 -1.113  1.00 27.84  ? 430  PRO A N   1 
ATOM   2968  C CA  . PRO A 1 391 ? 15.387   -11.100 -1.815  1.00 29.86  ? 430  PRO A CA  1 
ATOM   2969  C C   . PRO A 1 391 ? 15.669   -11.331 -3.300  1.00 30.34  ? 430  PRO A C   1 
ATOM   2970  O O   . PRO A 1 391 ? 16.095   -12.419 -3.686  1.00 29.54  ? 430  PRO A O   1 
ATOM   2971  C CB  . PRO A 1 391 ? 16.623   -10.531 -1.108  1.00 30.08  ? 430  PRO A CB  1 
ATOM   2972  C CG  . PRO A 1 391 ? 17.312   -11.734 -0.516  1.00 32.27  ? 430  PRO A CG  1 
ATOM   2973  C CD  . PRO A 1 391 ? 16.213   -12.695 -0.157  1.00 30.80  ? 430  PRO A CD  1 
ATOM   2974  N N   . PRO A 1 392 ? 15.430   -10.309 -4.131  1.00 34.91  ? 431  PRO A N   1 
ATOM   2975  C CA  . PRO A 1 392 ? 15.545   -10.446 -5.593  1.00 33.10  ? 431  PRO A CA  1 
ATOM   2976  C C   . PRO A 1 392 ? 16.951   -10.786 -6.109  1.00 31.92  ? 431  PRO A C   1 
ATOM   2977  O O   . PRO A 1 392 ? 17.064   -11.423 -7.157  1.00 28.15  ? 431  PRO A O   1 
ATOM   2978  C CB  . PRO A 1 392 ? 15.097   -9.066  -6.117  1.00 32.78  ? 431  PRO A CB  1 
ATOM   2979  C CG  . PRO A 1 392 ? 15.131   -8.155  -4.934  1.00 32.72  ? 431  PRO A CG  1 
ATOM   2980  C CD  . PRO A 1 392 ? 14.850   -9.013  -3.736  1.00 28.20  ? 431  PRO A CD  1 
ATOM   2981  N N   . TYR A 1 393 ? 17.998   -10.367 -5.402  1.00 27.45  ? 432  TYR A N   1 
ATOM   2982  C CA  . TYR A 1 393 ? 19.351   -10.647 -5.866  1.00 29.23  ? 432  TYR A CA  1 
ATOM   2983  C C   . TYR A 1 393 ? 19.687   -12.134 -5.825  1.00 28.01  ? 432  TYR A C   1 
ATOM   2984  O O   . TYR A 1 393 ? 20.677   -12.555 -6.410  1.00 26.17  ? 432  TYR A O   1 
ATOM   2985  C CB  . TYR A 1 393 ? 20.400   -9.844  -5.083  1.00 23.18  ? 432  TYR A CB  1 
ATOM   2986  C CG  . TYR A 1 393 ? 20.369   -10.024 -3.576  1.00 24.61  ? 432  TYR A CG  1 
ATOM   2987  C CD1 . TYR A 1 393 ? 20.903   -11.157 -2.979  1.00 27.64  ? 432  TYR A CD1 1 
ATOM   2988  C CD2 . TYR A 1 393 ? 19.848   -9.040  -2.751  1.00 27.06  ? 432  TYR A CD2 1 
ATOM   2989  C CE1 . TYR A 1 393 ? 20.887   -11.316 -1.606  1.00 25.43  ? 432  TYR A CE1 1 
ATOM   2990  C CE2 . TYR A 1 393 ? 19.836   -9.187  -1.370  1.00 26.94  ? 432  TYR A CE2 1 
ATOM   2991  C CZ  . TYR A 1 393 ? 20.363   -10.330 -0.808  1.00 25.62  ? 432  TYR A CZ  1 
ATOM   2992  O OH  . TYR A 1 393 ? 20.363   -10.494 0.557   1.00 25.10  ? 432  TYR A OH  1 
ATOM   2993  N N   . ALA A 1 394 ? 18.868   -12.922 -5.135  1.00 26.65  ? 433  ALA A N   1 
ATOM   2994  C CA  . ALA A 1 394 ? 19.096   -14.369 -5.063  1.00 29.36  ? 433  ALA A CA  1 
ATOM   2995  C C   . ALA A 1 394 ? 18.958   -15.044 -6.430  1.00 27.37  ? 433  ALA A C   1 
ATOM   2996  O O   . ALA A 1 394 ? 19.488   -16.128 -6.654  1.00 30.51  ? 433  ALA A O   1 
ATOM   2997  C CB  . ALA A 1 394 ? 18.163   -15.020 -4.042  1.00 25.32  ? 433  ALA A CB  1 
ATOM   2998  N N   . THR A 1 395 ? 18.250   -14.392 -7.339  1.00 28.28  ? 434  THR A N   1 
ATOM   2999  C CA  . THR A 1 395 ? 18.084   -14.898 -8.695  1.00 27.10  ? 434  THR A CA  1 
ATOM   3000  C C   . THR A 1 395 ? 18.593   -13.870 -9.708  1.00 30.06  ? 434  THR A C   1 
ATOM   3001  O O   . THR A 1 395 ? 18.192   -13.877 -10.869 1.00 27.11  ? 434  THR A O   1 
ATOM   3002  C CB  . THR A 1 395 ? 16.587   -15.223 -9.004  1.00 32.07  ? 434  THR A CB  1 
ATOM   3003  O OG1 . THR A 1 395 ? 15.769   -14.081 -8.719  1.00 34.39  ? 434  THR A OG1 1 
ATOM   3004  C CG2 . THR A 1 395 ? 16.103   -16.389 -8.158  1.00 37.59  ? 434  THR A CG2 1 
ATOM   3005  N N   . ASN A 1 396 ? 19.485   -12.990 -9.261  1.00 31.84  ? 435  ASN A N   1 
ATOM   3006  C CA  . ASN A 1 396 ? 19.924   -11.853 -10.074 1.00 30.16  ? 435  ASN A CA  1 
ATOM   3007  C C   . ASN A 1 396 ? 18.742   -11.082 -10.680 1.00 29.65  ? 435  ASN A C   1 
ATOM   3008  O O   . ASN A 1 396 ? 18.714   -10.777 -11.872 1.00 30.02  ? 435  ASN A O   1 
ATOM   3009  C CB  . ASN A 1 396 ? 20.883   -12.309 -11.174 1.00 38.87  ? 435  ASN A CB  1 
ATOM   3010  C CG  . ASN A 1 396 ? 21.724   -11.169 -11.722 1.00 35.70  ? 435  ASN A CG  1 
ATOM   3011  O OD1 . ASN A 1 396 ? 21.999   -10.201 -11.016 1.00 30.53  ? 435  ASN A OD1 1 
ATOM   3012  N ND2 . ASN A 1 396 ? 22.141   -11.284 -12.981 1.00 31.54  ? 435  ASN A ND2 1 
ATOM   3013  N N   . GLU A 1 397 ? 17.748   -10.782 -9.858  1.00 30.22  ? 436  GLU A N   1 
ATOM   3014  C CA  . GLU A 1 397 ? 16.617   -10.009 -10.349 1.00 29.78  ? 436  GLU A CA  1 
ATOM   3015  C C   . GLU A 1 397 ? 16.405   -8.758  -9.538  1.00 27.31  ? 436  GLU A C   1 
ATOM   3016  O O   . GLU A 1 397 ? 17.067   -8.528  -8.525  1.00 28.61  ? 436  GLU A O   1 
ATOM   3017  C CB  . GLU A 1 397 ? 15.346   -10.847 -10.381 1.00 24.91  ? 436  GLU A CB  1 
ATOM   3018  C CG  . GLU A 1 397 ? 15.273   -11.714 -11.629 1.00 35.61  ? 436  GLU A CG  1 
ATOM   3019  C CD  . GLU A 1 397 ? 14.196   -12.781 -11.545 1.00 55.96  ? 436  GLU A CD  1 
ATOM   3020  O OE1 . GLU A 1 397 ? 13.742   -13.081 -10.421 1.00 60.13  ? 436  GLU A OE1 1 
ATOM   3021  O OE2 . GLU A 1 397 ? 13.803   -13.324 -12.602 1.00 73.02  ? 436  GLU A OE2 1 
ATOM   3022  N N   . ILE A 1 398 ? 15.470   -7.950  -10.009 1.00 30.00  ? 437  ILE A N   1 
ATOM   3023  C CA  . ILE A 1 398 ? 15.097   -6.728  -9.340  1.00 27.93  ? 437  ILE A CA  1 
ATOM   3024  C C   . ILE A 1 398 ? 13.666   -6.920  -8.859  1.00 35.72  ? 437  ILE A C   1 
ATOM   3025  O O   . ILE A 1 398 ? 12.841   -7.510  -9.552  1.00 35.72  ? 437  ILE A O   1 
ATOM   3026  C CB  . ILE A 1 398 ? 15.209   -5.545  -10.320 1.00 36.23  ? 437  ILE A CB  1 
ATOM   3027  C CG1 . ILE A 1 398 ? 16.692   -5.296  -10.642 1.00 34.01  ? 437  ILE A CG1 1 
ATOM   3028  C CG2 . ILE A 1 398 ? 14.513   -4.298  -9.761  1.00 37.97  ? 437  ILE A CG2 1 
ATOM   3029  C CD1 . ILE A 1 398 ? 16.960   -4.091  -11.538 1.00 37.13  ? 437  ILE A CD1 1 
ATOM   3030  N N   . GLY A 1 399 ? 13.366   -6.458  -7.657  1.00 34.09  ? 438  GLY A N   1 
ATOM   3031  C CA  . GLY A 1 399 ? 12.023   -6.646  -7.160  1.00 40.59  ? 438  GLY A CA  1 
ATOM   3032  C C   . GLY A 1 399 ? 11.691   -5.738  -6.007  1.00 45.84  ? 438  GLY A C   1 
ATOM   3033  O O   . GLY A 1 399 ? 12.575   -5.079  -5.440  1.00 42.15  ? 438  GLY A O   1 
ATOM   3034  N N   . LYS A 1 400 ? 10.405   -5.707  -5.665  1.00 51.94  ? 439  LYS A N   1 
ATOM   3035  C CA  . LYS A 1 400 ? 9.929    -4.987  -4.494  1.00 55.18  ? 439  LYS A CA  1 
ATOM   3036  C C   . LYS A 1 400 ? 10.457   -5.672  -3.245  1.00 53.49  ? 439  LYS A C   1 
ATOM   3037  O O   . LYS A 1 400 ? 10.545   -6.900  -3.183  1.00 52.54  ? 439  LYS A O   1 
ATOM   3038  C CB  . LYS A 1 400 ? 8.397    -4.945  -4.465  1.00 63.63  ? 439  LYS A CB  1 
ATOM   3039  C CG  . LYS A 1 400 ? 7.796    -3.653  -5.002  1.00 75.11  ? 439  LYS A CG  1 
ATOM   3040  C CD  . LYS A 1 400 ? 8.377    -2.437  -4.284  1.00 75.14  ? 439  LYS A CD  1 
ATOM   3041  C CE  . LYS A 1 400 ? 7.653    -1.149  -4.670  1.00 83.48  ? 439  LYS A CE  1 
ATOM   3042  N NZ  . LYS A 1 400 ? 8.268    0.051   -4.026  1.00 78.68  ? 439  LYS A NZ  1 
ATOM   3043  N N   . VAL A 1 401 ? 10.808   -4.877  -2.246  1.00 46.65  ? 440  VAL A N   1 
ATOM   3044  C CA  . VAL A 1 401 ? 11.406   -5.421  -1.043  1.00 57.77  ? 440  VAL A CA  1 
ATOM   3045  C C   . VAL A 1 401 ? 10.608   -4.972  0.186   1.00 59.77  ? 440  VAL A C   1 
ATOM   3046  O O   . VAL A 1 401 ? 10.937   -5.305  1.327   1.00 64.89  ? 440  VAL A O   1 
ATOM   3047  C CB  . VAL A 1 401 ? 12.913   -5.048  -0.966  1.00 62.60  ? 440  VAL A CB  1 
ATOM   3048  C CG1 . VAL A 1 401 ? 13.160   -3.911  0.020   1.00 68.13  ? 440  VAL A CG1 1 
ATOM   3049  C CG2 . VAL A 1 401 ? 13.749   -6.275  -0.634  1.00 53.64  ? 440  VAL A CG2 1 
ATOM   3050  N N   . THR A 1 402 ? 9.529    -4.239  -0.072  1.00 61.84  ? 441  THR A N   1 
ATOM   3051  C CA  . THR A 1 402 ? 8.627    -3.787  0.982   1.00 67.96  ? 441  THR A CA  1 
ATOM   3052  C C   . THR A 1 402 ? 7.263    -4.465  0.879   1.00 61.00  ? 441  THR A C   1 
ATOM   3053  O O   . THR A 1 402 ? 6.885    -4.974  -0.179  1.00 55.98  ? 441  THR A O   1 
ATOM   3054  C CB  . THR A 1 402 ? 8.389    -2.269  0.904   1.00 61.41  ? 441  THR A CB  1 
ATOM   3055  O OG1 . THR A 1 402 ? 7.684    -1.834  2.073   1.00 74.35  ? 441  THR A OG1 1 
ATOM   3056  C CG2 . THR A 1 402 ? 7.566    -1.929  -0.334  1.00 48.21  ? 441  THR A CG2 1 
ATOM   3057  N N   . GLY A 1 403 ? 6.526    -4.457  1.985   1.00 68.47  ? 442  GLY A N   1 
ATOM   3058  C CA  . GLY A 1 403 ? 5.145    -4.904  1.984   1.00 68.81  ? 442  GLY A CA  1 
ATOM   3059  C C   . GLY A 1 403 ? 4.967    -6.394  2.197   1.00 64.48  ? 442  GLY A C   1 
ATOM   3060  O O   . GLY A 1 403 ? 5.937    -7.151  2.281   1.00 64.15  ? 442  GLY A O   1 
ATOM   3061  N N   . LEU A 1 404 ? 3.710    -6.810  2.287   1.00 58.33  ? 443  LEU A N   1 
ATOM   3062  C CA  . LEU A 1 404 ? 3.372    -8.204  2.516   1.00 50.13  ? 443  LEU A CA  1 
ATOM   3063  C C   . LEU A 1 404 ? 3.788    -9.073  1.333   1.00 54.81  ? 443  LEU A C   1 
ATOM   3064  O O   . LEU A 1 404 ? 3.426    -8.794  0.188   1.00 60.05  ? 443  LEU A O   1 
ATOM   3065  C CB  . LEU A 1 404 ? 1.871    -8.337  2.771   1.00 57.53  ? 443  LEU A CB  1 
ATOM   3066  C CG  . LEU A 1 404 ? 1.299    -9.753  2.838   1.00 63.97  ? 443  LEU A CG  1 
ATOM   3067  C CD1 . LEU A 1 404 ? 2.148    -10.647 3.740   1.00 57.12  ? 443  LEU A CD1 1 
ATOM   3068  C CD2 . LEU A 1 404 ? -0.150   -9.707  3.308   1.00 66.74  ? 443  LEU A CD2 1 
ATOM   3069  N N   . ASN A 1 405 ? 4.561    -10.117 1.620   1.00 49.77  ? 444  ASN A N   1 
ATOM   3070  C CA  . ASN A 1 405 ? 4.949    -11.104 0.613   1.00 41.80  ? 444  ASN A CA  1 
ATOM   3071  C C   . ASN A 1 405 ? 4.411    -12.484 1.012   1.00 40.17  ? 444  ASN A C   1 
ATOM   3072  O O   . ASN A 1 405 ? 4.904    -13.105 1.952   1.00 38.21  ? 444  ASN A O   1 
ATOM   3073  C CB  . ASN A 1 405 ? 6.473    -11.117 0.448   1.00 44.01  ? 444  ASN A CB  1 
ATOM   3074  C CG  . ASN A 1 405 ? 6.935    -11.974 -0.717  1.00 43.77  ? 444  ASN A CG  1 
ATOM   3075  O OD1 . ASN A 1 405 ? 6.550    -13.141 -0.852  1.00 37.81  ? 444  ASN A OD1 1 
ATOM   3076  N ND2 . ASN A 1 405 ? 7.768    -11.396 -1.569  1.00 47.28  ? 444  ASN A ND2 1 
ATOM   3077  N N   . ARG A 1 406 ? 3.384    -12.949 0.309   1.00 35.58  ? 445  ARG A N   1 
ATOM   3078  C CA  . ARG A 1 406 ? 2.691    -14.172 0.704   1.00 35.49  ? 445  ARG A CA  1 
ATOM   3079  C C   . ARG A 1 406 ? 3.578    -15.431 0.620   1.00 34.73  ? 445  ARG A C   1 
ATOM   3080  O O   . ARG A 1 406 ? 3.487    -16.325 1.462   1.00 33.49  ? 445  ARG A O   1 
ATOM   3081  C CB  . ARG A 1 406 ? 1.405    -14.348 -0.111  1.00 38.43  ? 445  ARG A CB  1 
ATOM   3082  C CG  . ARG A 1 406 ? 0.325    -13.277 0.158   1.00 46.83  ? 445  ARG A CG  1 
ATOM   3083  C CD  . ARG A 1 406 ? -0.956   -13.549 -0.654  1.00 53.11  ? 445  ARG A CD  1 
ATOM   3084  N NE  . ARG A 1 406 ? -2.164   -13.539 0.176   1.00 54.53  ? 445  ARG A NE  1 
ATOM   3085  C CZ  . ARG A 1 406 ? -3.341   -14.058 -0.186  1.00 65.93  ? 445  ARG A CZ  1 
ATOM   3086  N NH1 . ARG A 1 406 ? -3.493   -14.641 -1.373  1.00 58.80  ? 445  ARG A NH1 1 
ATOM   3087  N NH2 . ARG A 1 406 ? -4.377   -14.002 0.648   1.00 49.52  ? 445  ARG A NH2 1 
ATOM   3088  N N   . ARG A 1 407 ? 4.423    -15.502 -0.401  1.00 30.04  ? 446  ARG A N   1 
ATOM   3089  C CA  . ARG A 1 407 ? 5.303    -16.649 -0.574  1.00 33.97  ? 446  ARG A CA  1 
ATOM   3090  C C   . ARG A 1 407 ? 6.350    -16.731 0.538   1.00 32.39  ? 446  ARG A C   1 
ATOM   3091  O O   . ARG A 1 407 ? 6.651    -17.815 1.049   1.00 32.96  ? 446  ARG A O   1 
ATOM   3092  C CB  . ARG A 1 407 ? 5.973    -16.609 -1.946  1.00 35.58  ? 446  ARG A CB  1 
ATOM   3093  C CG  . ARG A 1 407 ? 6.939    -17.767 -2.195  1.00 40.20  ? 446  ARG A CG  1 
ATOM   3094  C CD  . ARG A 1 407 ? 7.099    -18.030 -3.692  1.00 48.45  ? 446  ARG A CD  1 
ATOM   3095  N NE  . ARG A 1 407 ? 8.447    -17.766 -4.206  1.00 64.09  ? 446  ARG A NE  1 
ATOM   3096  C CZ  . ARG A 1 407 ? 9.090    -16.601 -4.115  1.00 61.32  ? 446  ARG A CZ  1 
ATOM   3097  N NH1 . ARG A 1 407 ? 8.535    -15.567 -3.496  1.00 58.56  ? 446  ARG A NH1 1 
ATOM   3098  N NH2 . ARG A 1 407 ? 10.306   -16.473 -4.636  1.00 53.38  ? 446  ARG A NH2 1 
ATOM   3099  N N   . GLU A 1 408 ? 6.913    -15.582 0.903   1.00 27.60  ? 447  GLU A N   1 
ATOM   3100  C CA  . GLU A 1 408 ? 7.877    -15.531 1.989   1.00 32.42  ? 447  GLU A CA  1 
ATOM   3101  C C   . GLU A 1 408 ? 7.235    -15.967 3.303   1.00 37.60  ? 447  GLU A C   1 
ATOM   3102  O O   . GLU A 1 408 ? 7.868    -16.627 4.120   1.00 25.46  ? 447  GLU A O   1 
ATOM   3103  C CB  . GLU A 1 408 ? 8.479    -14.123 2.124   1.00 24.39  ? 447  GLU A CB  1 
ATOM   3104  C CG  . GLU A 1 408 ? 9.453    -13.782 0.994   1.00 30.21  ? 447  GLU A CG  1 
ATOM   3105  C CD  . GLU A 1 408 ? 10.120   -12.436 1.184   1.00 35.76  ? 447  GLU A CD  1 
ATOM   3106  O OE1 . GLU A 1 408 ? 9.590    -11.614 1.964   1.00 40.54  ? 447  GLU A OE1 1 
ATOM   3107  O OE2 . GLU A 1 408 ? 11.173   -12.203 0.558   1.00 29.09  ? 447  GLU A OE2 1 
ATOM   3108  N N   . LEU A 1 409 ? 5.978    -15.579 3.507   1.00 29.84  ? 448  LEU A N   1 
ATOM   3109  C CA  . LEU A 1 409 ? 5.275    -15.953 4.725   1.00 33.52  ? 448  LEU A CA  1 
ATOM   3110  C C   . LEU A 1 409 ? 5.038    -17.466 4.767   1.00 22.80  ? 448  LEU A C   1 
ATOM   3111  O O   . LEU A 1 409 ? 5.268    -18.113 5.787   1.00 25.63  ? 448  LEU A O   1 
ATOM   3112  C CB  . LEU A 1 409 ? 3.953    -15.190 4.833   1.00 30.35  ? 448  LEU A CB  1 
ATOM   3113  C CG  . LEU A 1 409 ? 3.326    -15.122 6.231   1.00 39.39  ? 448  LEU A CG  1 
ATOM   3114  C CD1 . LEU A 1 409 ? 2.364    -13.938 6.307   1.00 57.35  ? 448  LEU A CD1 1 
ATOM   3115  C CD2 . LEU A 1 409 ? 2.620    -16.422 6.632   1.00 36.56  ? 448  LEU A CD2 1 
ATOM   3116  N N   . GLY A 1 410 ? 4.599    -18.019 3.645   1.00 26.47  ? 449  GLY A N   1 
ATOM   3117  C CA  . GLY A 1 410 ? 4.362    -19.448 3.538   1.00 25.54  ? 449  GLY A CA  1 
ATOM   3118  C C   . GLY A 1 410 ? 5.628    -20.267 3.755   1.00 31.14  ? 449  GLY A C   1 
ATOM   3119  O O   . GLY A 1 410 ? 5.603    -21.285 4.449   1.00 24.79  ? 449  GLY A O   1 
ATOM   3120  N N   . HIS A 1 411 ? 6.733    -19.826 3.157   1.00 23.83  ? 450  HIS A N   1 
ATOM   3121  C CA  . HIS A 1 411 ? 7.992    -20.551 3.254   1.00 25.70  ? 450  HIS A CA  1 
ATOM   3122  C C   . HIS A 1 411 ? 8.544    -20.471 4.668   1.00 29.36  ? 450  HIS A C   1 
ATOM   3123  O O   . HIS A 1 411 ? 9.055    -21.458 5.203   1.00 31.36  ? 450  HIS A O   1 
ATOM   3124  C CB  . HIS A 1 411 ? 9.010    -20.011 2.250   1.00 24.53  ? 450  HIS A CB  1 
ATOM   3125  C CG  . HIS A 1 411 ? 8.683    -20.348 0.825   1.00 21.36  ? 450  HIS A CG  1 
ATOM   3126  N ND1 . HIS A 1 411 ? 9.542    -20.075 -0.218  1.00 31.34  ? 450  HIS A ND1 1 
ATOM   3127  C CD2 . HIS A 1 411 ? 7.594    -20.931 0.280   1.00 23.82  ? 450  HIS A CD2 1 
ATOM   3128  C CE1 . HIS A 1 411 ? 8.990    -20.477 -1.352  1.00 27.47  ? 450  HIS A CE1 1 
ATOM   3129  N NE2 . HIS A 1 411 ? 7.815    -21.005 -1.080  1.00 28.20  ? 450  HIS A NE2 1 
ATOM   3130  N N   . GLY A 1 412 ? 8.449    -19.293 5.269   1.00 22.28  ? 451  GLY A N   1 
ATOM   3131  C CA  . GLY A 1 412 ? 8.872    -19.127 6.643   1.00 27.25  ? 451  GLY A CA  1 
ATOM   3132  C C   . GLY A 1 412 ? 8.104    -20.049 7.575   1.00 27.99  ? 451  GLY A C   1 
ATOM   3133  O O   . GLY A 1 412 ? 8.690    -20.707 8.443   1.00 24.69  ? 451  GLY A O   1 
ATOM   3134  N N   . ALA A 1 413 ? 6.786    -20.095 7.393   1.00 24.04  ? 452  ALA A N   1 
ATOM   3135  C CA  . ALA A 1 413 ? 5.932    -20.933 8.219   1.00 26.79  ? 452  ALA A CA  1 
ATOM   3136  C C   . ALA A 1 413 ? 6.301    -22.410 8.044   1.00 25.63  ? 452  ALA A C   1 
ATOM   3137  O O   . ALA A 1 413 ? 6.281    -23.169 9.002   1.00 27.51  ? 452  ALA A O   1 
ATOM   3138  C CB  . ALA A 1 413 ? 4.454    -20.701 7.890   1.00 23.09  ? 452  ALA A CB  1 
ATOM   3139  N N   . LEU A 1 414 ? 6.619    -22.808 6.817   1.00 23.70  ? 453  LEU A N   1 
ATOM   3140  C CA  . LEU A 1 414 ? 7.048    -24.177 6.550   1.00 26.60  ? 453  LEU A CA  1 
ATOM   3141  C C   . LEU A 1 414 ? 8.341    -24.530 7.316   1.00 29.16  ? 453  LEU A C   1 
ATOM   3142  O O   . LEU A 1 414 ? 8.403    -25.533 8.045   1.00 25.70  ? 453  LEU A O   1 
ATOM   3143  C CB  . LEU A 1 414 ? 7.225    -24.406 5.051   1.00 23.25  ? 453  LEU A CB  1 
ATOM   3144  C CG  . LEU A 1 414 ? 7.739    -25.801 4.653   1.00 28.04  ? 453  LEU A CG  1 
ATOM   3145  C CD1 . LEU A 1 414 ? 6.810    -26.920 5.128   1.00 27.25  ? 453  LEU A CD1 1 
ATOM   3146  C CD2 . LEU A 1 414 ? 7.927    -25.879 3.154   1.00 20.07  ? 453  LEU A CD2 1 
ATOM   3147  N N   . ALA A 1 415 ? 9.363    -23.690 7.182   1.00 26.75  ? 454  ALA A N   1 
ATOM   3148  C CA  . ALA A 1 415 ? 10.612   -23.951 7.892   1.00 28.67  ? 454  ALA A CA  1 
ATOM   3149  C C   . ALA A 1 415 ? 10.429   -23.842 9.410   1.00 25.12  ? 454  ALA A C   1 
ATOM   3150  O O   . ALA A 1 415 ? 11.034   -24.591 10.174  1.00 23.69  ? 454  ALA A O   1 
ATOM   3151  C CB  . ALA A 1 415 ? 11.737   -23.049 7.389   1.00 23.49  ? 454  ALA A CB  1 
ATOM   3152  N N   . GLU A 1 416 ? 9.571    -22.926 9.845   1.00 23.20  ? 455  GLU A N   1 
ATOM   3153  C CA  . GLU A 1 416 ? 9.266    -22.802 11.261  1.00 23.28  ? 455  GLU A CA  1 
ATOM   3154  C C   . GLU A 1 416 ? 8.708    -24.113 11.833  1.00 28.37  ? 455  GLU A C   1 
ATOM   3155  O O   . GLU A 1 416 ? 9.188    -24.606 12.847  1.00 24.75  ? 455  GLU A O   1 
ATOM   3156  C CB  . GLU A 1 416 ? 8.277    -21.652 11.515  1.00 27.80  ? 455  GLU A CB  1 
ATOM   3157  C CG  . GLU A 1 416 ? 7.993    -21.387 13.002  1.00 23.67  ? 455  GLU A CG  1 
ATOM   3158  C CD  . GLU A 1 416 ? 7.025    -20.228 13.222  1.00 29.89  ? 455  GLU A CD  1 
ATOM   3159  O OE1 . GLU A 1 416 ? 5.847    -20.495 13.524  1.00 32.48  ? 455  GLU A OE1 1 
ATOM   3160  O OE2 . GLU A 1 416 ? 7.435    -19.054 13.089  1.00 26.69  ? 455  GLU A OE2 1 
ATOM   3161  N N   . LYS A 1 417 ? 7.687    -24.666 11.193  1.00 22.30  ? 456  LYS A N   1 
ATOM   3162  C CA  . LYS A 1 417 ? 7.071    -25.892 11.691  1.00 27.62  ? 456  LYS A CA  1 
ATOM   3163  C C   . LYS A 1 417 ? 8.008    -27.080 11.561  1.00 24.36  ? 456  LYS A C   1 
ATOM   3164  O O   . LYS A 1 417 ? 7.923    -28.027 12.339  1.00 26.21  ? 456  LYS A O   1 
ATOM   3165  C CB  . LYS A 1 417 ? 5.762    -26.199 10.957  1.00 27.53  ? 456  LYS A CB  1 
ATOM   3166  C CG  . LYS A 1 417 ? 4.594    -25.360 11.435  1.00 45.54  ? 456  LYS A CG  1 
ATOM   3167  C CD  . LYS A 1 417 ? 4.389    -25.442 12.960  1.00 50.03  ? 456  LYS A CD  1 
ATOM   3168  C CE  . LYS A 1 417 ? 3.190    -24.595 13.388  1.00 53.06  ? 456  LYS A CE  1 
ATOM   3169  N NZ  . LYS A 1 417 ? 3.091    -24.427 14.866  1.00 58.18  ? 456  LYS A NZ  1 
ATOM   3170  N N   . ALA A 1 418 ? 8.897    -27.044 10.573  1.00 27.76  ? 457  ALA A N   1 
ATOM   3171  C CA  . ALA A 1 418 ? 9.893    -28.102 10.451  1.00 23.21  ? 457  ALA A CA  1 
ATOM   3172  C C   . ALA A 1 418 ? 10.727   -28.142 11.721  1.00 25.61  ? 457  ALA A C   1 
ATOM   3173  O O   . ALA A 1 418 ? 11.095   -29.213 12.194  1.00 28.38  ? 457  ALA A O   1 
ATOM   3174  C CB  . ALA A 1 418 ? 10.776   -27.878 9.237   1.00 19.40  ? 457  ALA A CB  1 
ATOM   3175  N N   . LEU A 1 419 ? 11.013   -26.968 12.280  1.00 25.20  ? 458  LEU A N   1 
ATOM   3176  C CA  . LEU A 1 419 ? 11.913   -26.864 13.431  1.00 22.89  ? 458  LEU A CA  1 
ATOM   3177  C C   . LEU A 1 419 ? 11.173   -26.942 14.768  1.00 23.18  ? 458  LEU A C   1 
ATOM   3178  O O   . LEU A 1 419 ? 11.704   -27.398 15.781  1.00 22.09  ? 458  LEU A O   1 
ATOM   3179  C CB  . LEU A 1 419 ? 12.705   -25.550 13.352  1.00 21.21  ? 458  LEU A CB  1 
ATOM   3180  C CG  . LEU A 1 419 ? 13.773   -25.492 12.252  1.00 23.26  ? 458  LEU A CG  1 
ATOM   3181  C CD1 . LEU A 1 419 ? 14.228   -24.053 11.979  1.00 23.02  ? 458  LEU A CD1 1 
ATOM   3182  C CD2 . LEU A 1 419 ? 14.963   -26.363 12.634  1.00 22.00  ? 458  LEU A CD2 1 
ATOM   3183  N N   . TYR A 1 420 ? 9.925    -26.504 14.758  1.00 26.65  ? 459  TYR A N   1 
ATOM   3184  C CA  . TYR A 1 420 ? 9.191    -26.315 16.001  1.00 31.35  ? 459  TYR A CA  1 
ATOM   3185  C C   . TYR A 1 420 ? 9.228    -27.515 16.989  1.00 26.13  ? 459  TYR A C   1 
ATOM   3186  O O   . TYR A 1 420 ? 9.409    -27.312 18.181  1.00 24.06  ? 459  TYR A O   1 
ATOM   3187  C CB  . TYR A 1 420 ? 7.763    -25.828 15.704  1.00 28.07  ? 459  TYR A CB  1 
ATOM   3188  C CG  . TYR A 1 420 ? 6.848    -25.952 16.880  1.00 28.30  ? 459  TYR A CG  1 
ATOM   3189  C CD1 . TYR A 1 420 ? 6.721    -24.926 17.809  1.00 27.95  ? 459  TYR A CD1 1 
ATOM   3190  C CD2 . TYR A 1 420 ? 6.129    -27.126 17.085  1.00 34.71  ? 459  TYR A CD2 1 
ATOM   3191  C CE1 . TYR A 1 420 ? 5.873    -25.066 18.912  1.00 36.74  ? 459  TYR A CE1 1 
ATOM   3192  C CE2 . TYR A 1 420 ? 5.288    -27.276 18.169  1.00 40.67  ? 459  TYR A CE2 1 
ATOM   3193  C CZ  . TYR A 1 420 ? 5.158    -26.253 19.076  1.00 33.81  ? 459  TYR A CZ  1 
ATOM   3194  O OH  . TYR A 1 420 ? 4.310    -26.451 20.137  1.00 38.85  ? 459  TYR A OH  1 
ATOM   3195  N N   . PRO A 1 421 ? 9.078    -28.760 16.498  1.00 24.41  ? 460  PRO A N   1 
ATOM   3196  C CA  . PRO A 1 421 ? 9.064    -29.898 17.436  1.00 29.04  ? 460  PRO A CA  1 
ATOM   3197  C C   . PRO A 1 421 ? 10.360   -30.146 18.213  1.00 27.22  ? 460  PRO A C   1 
ATOM   3198  O O   . PRO A 1 421 ? 10.292   -30.752 19.273  1.00 28.55  ? 460  PRO A O   1 
ATOM   3199  C CB  . PRO A 1 421 ? 8.745    -31.105 16.538  1.00 24.98  ? 460  PRO A CB  1 
ATOM   3200  C CG  . PRO A 1 421 ? 8.029    -30.511 15.368  1.00 27.17  ? 460  PRO A CG  1 
ATOM   3201  C CD  . PRO A 1 421 ? 8.683    -29.171 15.141  1.00 25.07  ? 460  PRO A CD  1 
ATOM   3202  N N   . VAL A 1 422 ? 11.504   -29.682 17.727  1.00 24.77  ? 461  VAL A N   1 
ATOM   3203  C CA  . VAL A 1 422 ? 12.753   -29.956 18.428  1.00 21.81  ? 461  VAL A CA  1 
ATOM   3204  C C   . VAL A 1 422 ? 13.111   -28.843 19.405  1.00 29.50  ? 461  VAL A C   1 
ATOM   3205  O O   . VAL A 1 422 ? 14.039   -28.991 20.212  1.00 23.86  ? 461  VAL A O   1 
ATOM   3206  C CB  . VAL A 1 422 ? 13.944   -30.250 17.460  1.00 26.31  ? 461  VAL A CB  1 
ATOM   3207  C CG1 . VAL A 1 422 ? 13.641   -31.489 16.598  1.00 25.18  ? 461  VAL A CG1 1 
ATOM   3208  C CG2 . VAL A 1 422 ? 14.307   -29.033 16.591  1.00 21.28  ? 461  VAL A CG2 1 
ATOM   3209  N N   . ILE A 1 423 ? 12.374   -27.733 19.343  1.00 24.67  ? 462  ILE A N   1 
ATOM   3210  C CA  . ILE A 1 423 ? 12.620   -26.621 20.260  1.00 21.44  ? 462  ILE A CA  1 
ATOM   3211  C C   . ILE A 1 423 ? 12.221   -26.990 21.703  1.00 24.29  ? 462  ILE A C   1 
ATOM   3212  O O   . ILE A 1 423 ? 11.179   -27.579 21.925  1.00 26.50  ? 462  ILE A O   1 
ATOM   3213  C CB  . ILE A 1 423 ? 11.855   -25.348 19.818  1.00 29.03  ? 462  ILE A CB  1 
ATOM   3214  C CG1 . ILE A 1 423 ? 12.184   -24.981 18.360  1.00 23.77  ? 462  ILE A CG1 1 
ATOM   3215  C CG2 . ILE A 1 423 ? 12.147   -24.198 20.759  1.00 20.68  ? 462  ILE A CG2 1 
ATOM   3216  C CD1 . ILE A 1 423 ? 13.675   -24.727 18.114  1.00 24.30  ? 462  ILE A CD1 1 
ATOM   3217  N N   . PRO A 1 424 ? 13.063   -26.650 22.690  1.00 28.50  ? 463  PRO A N   1 
ATOM   3218  C CA  . PRO A 1 424 ? 12.716   -26.922 24.090  1.00 29.07  ? 463  PRO A CA  1 
ATOM   3219  C C   . PRO A 1 424 ? 11.628   -25.989 24.605  1.00 34.00  ? 463  PRO A C   1 
ATOM   3220  O O   . PRO A 1 424 ? 11.568   -24.825 24.219  1.00 30.47  ? 463  PRO A O   1 
ATOM   3221  C CB  . PRO A 1 424 ? 14.017   -26.607 24.833  1.00 33.22  ? 463  PRO A CB  1 
ATOM   3222  C CG  . PRO A 1 424 ? 14.686   -25.558 23.960  1.00 30.68  ? 463  PRO A CG  1 
ATOM   3223  C CD  . PRO A 1 424 ? 14.414   -26.075 22.561  1.00 21.95  ? 463  PRO A CD  1 
ATOM   3224  N N   . ARG A 1 425 ? 10.780   -26.499 25.485  1.00 35.31  ? 464  ARG A N   1 
ATOM   3225  C CA  . ARG A 1 425 ? 9.832    -25.647 26.194  1.00 40.19  ? 464  ARG A CA  1 
ATOM   3226  C C   . ARG A 1 425 ? 10.538   -24.825 27.258  1.00 38.18  ? 464  ARG A C   1 
ATOM   3227  O O   . ARG A 1 425 ? 11.596   -25.212 27.756  1.00 36.71  ? 464  ARG A O   1 
ATOM   3228  C CB  . ARG A 1 425 ? 8.770    -26.490 26.882  1.00 43.45  ? 464  ARG A CB  1 
ATOM   3229  C CG  . ARG A 1 425 ? 8.208    -27.586 26.038  1.00 45.56  ? 464  ARG A CG  1 
ATOM   3230  C CD  . ARG A 1 425 ? 6.743    -27.778 26.381  1.00 60.66  ? 464  ARG A CD  1 
ATOM   3231  N NE  . ARG A 1 425 ? 5.910    -27.615 25.194  1.00 68.88  ? 464  ARG A NE  1 
ATOM   3232  C CZ  . ARG A 1 425 ? 5.177    -26.540 24.928  1.00 50.39  ? 464  ARG A CZ  1 
ATOM   3233  N NH1 . ARG A 1 425 ? 5.138    -25.519 25.776  1.00 46.17  ? 464  ARG A NH1 1 
ATOM   3234  N NH2 . ARG A 1 425 ? 4.462    -26.500 23.814  1.00 55.89  ? 464  ARG A NH2 1 
ATOM   3235  N N   . ASP A 1 426 ? 9.941    -23.692 27.614  1.00 37.45  ? 465  ASP A N   1 
ATOM   3236  C CA  . ASP A 1 426 ? 10.390   -22.921 28.767  1.00 38.45  ? 465  ASP A CA  1 
ATOM   3237  C C   . ASP A 1 426 ? 11.799   -22.352 28.618  1.00 39.84  ? 465  ASP A C   1 
ATOM   3238  O O   . ASP A 1 426 ? 12.502   -22.131 29.606  1.00 41.35  ? 465  ASP A O   1 
ATOM   3239  C CB  . ASP A 1 426 ? 10.300   -23.781 30.036  1.00 44.68  ? 465  ASP A CB  1 
ATOM   3240  C CG  . ASP A 1 426 ? 8.904    -24.363 30.250  1.00 54.56  ? 465  ASP A CG  1 
ATOM   3241  O OD1 . ASP A 1 426 ? 8.807    -25.510 30.733  1.00 63.56  ? 465  ASP A OD1 1 
ATOM   3242  O OD2 . ASP A 1 426 ? 7.906    -23.679 29.935  1.00 55.99  ? 465  ASP A OD2 1 
ATOM   3243  N N   . PHE A 1 427 ? 12.218   -22.106 27.384  1.00 43.11  ? 466  PHE A N   1 
ATOM   3244  C CA  . PHE A 1 427 ? 13.451   -21.361 27.173  1.00 33.31  ? 466  PHE A CA  1 
ATOM   3245  C C   . PHE A 1 427 ? 13.236   -19.956 27.748  1.00 37.64  ? 466  PHE A C   1 
ATOM   3246  O O   . PHE A 1 427 ? 12.124   -19.431 27.696  1.00 30.97  ? 466  PHE A O   1 
ATOM   3247  C CB  . PHE A 1 427 ? 13.772   -21.293 25.684  1.00 31.61  ? 466  PHE A CB  1 
ATOM   3248  C CG  . PHE A 1 427 ? 15.197   -20.966 25.391  1.00 36.41  ? 466  PHE A CG  1 
ATOM   3249  C CD1 . PHE A 1 427 ? 16.194   -21.900 25.627  1.00 30.78  ? 466  PHE A CD1 1 
ATOM   3250  C CD2 . PHE A 1 427 ? 15.548   -19.728 24.877  1.00 35.15  ? 466  PHE A CD2 1 
ATOM   3251  C CE1 . PHE A 1 427 ? 17.517   -21.603 25.367  1.00 35.35  ? 466  PHE A CE1 1 
ATOM   3252  C CE2 . PHE A 1 427 ? 16.866   -19.433 24.614  1.00 32.44  ? 466  PHE A CE2 1 
ATOM   3253  C CZ  . PHE A 1 427 ? 17.851   -20.370 24.852  1.00 35.40  ? 466  PHE A CZ  1 
ATOM   3254  N N   . PRO A 1 428 ? 14.293   -19.356 28.320  1.00 40.04  ? 467  PRO A N   1 
ATOM   3255  C CA  . PRO A 1 428 ? 14.175   -18.061 29.009  1.00 40.18  ? 467  PRO A CA  1 
ATOM   3256  C C   . PRO A 1 428 ? 14.026   -16.850 28.092  1.00 44.43  ? 467  PRO A C   1 
ATOM   3257  O O   . PRO A 1 428 ? 13.769   -15.766 28.592  1.00 38.57  ? 467  PRO A O   1 
ATOM   3258  C CB  . PRO A 1 428 ? 15.490   -17.960 29.786  1.00 37.45  ? 467  PRO A CB  1 
ATOM   3259  C CG  . PRO A 1 428 ? 16.453   -18.809 29.004  1.00 43.30  ? 467  PRO A CG  1 
ATOM   3260  C CD  . PRO A 1 428 ? 15.626   -19.957 28.502  1.00 34.65  ? 467  PRO A CD  1 
ATOM   3261  N N   . PHE A 1 429 ? 14.205   -17.018 26.787  1.00 37.92  ? 468  PHE A N   1 
ATOM   3262  C CA  . PHE A 1 429 ? 14.058   -15.900 25.864  1.00 32.80  ? 468  PHE A CA  1 
ATOM   3263  C C   . PHE A 1 429 ? 13.183   -16.281 24.689  1.00 36.67  ? 468  PHE A C   1 
ATOM   3264  O O   . PHE A 1 429 ? 12.988   -17.463 24.398  1.00 31.82  ? 468  PHE A O   1 
ATOM   3265  C CB  . PHE A 1 429 ? 15.420   -15.459 25.312  1.00 32.94  ? 468  PHE A CB  1 
ATOM   3266  C CG  . PHE A 1 429 ? 16.467   -15.297 26.352  1.00 38.38  ? 468  PHE A CG  1 
ATOM   3267  C CD1 . PHE A 1 429 ? 16.229   -14.535 27.480  1.00 40.92  ? 468  PHE A CD1 1 
ATOM   3268  C CD2 . PHE A 1 429 ? 17.689   -15.926 26.218  1.00 38.58  ? 468  PHE A CD2 1 
ATOM   3269  C CE1 . PHE A 1 429 ? 17.197   -14.396 28.454  1.00 42.81  ? 468  PHE A CE1 1 
ATOM   3270  C CE2 . PHE A 1 429 ? 18.668   -15.786 27.190  1.00 46.34  ? 468  PHE A CE2 1 
ATOM   3271  C CZ  . PHE A 1 429 ? 18.420   -15.022 28.310  1.00 43.59  ? 468  PHE A CZ  1 
ATOM   3272  N N   . THR A 1 430 ? 12.669   -15.276 23.992  1.00 32.09  ? 469  THR A N   1 
ATOM   3273  C CA  . THR A 1 430 ? 12.058   -15.545 22.704  1.00 29.76  ? 469  THR A CA  1 
ATOM   3274  C C   . THR A 1 430 ? 13.184   -15.936 21.750  1.00 31.37  ? 469  THR A C   1 
ATOM   3275  O O   . THR A 1 430 ? 14.267   -15.347 21.789  1.00 28.30  ? 469  THR A O   1 
ATOM   3276  C CB  . THR A 1 430 ? 11.303   -14.329 22.175  1.00 26.06  ? 469  THR A CB  1 
ATOM   3277  O OG1 . THR A 1 430 ? 10.143   -14.121 22.986  1.00 36.85  ? 469  THR A OG1 1 
ATOM   3278  C CG2 . THR A 1 430 ? 10.872   -14.562 20.749  1.00 26.90  ? 469  THR A CG2 1 
ATOM   3279  N N   . ILE A 1 431 ? 12.944   -16.955 20.932  1.00 33.17  ? 470  ILE A N   1 
ATOM   3280  C CA  . ILE A 1 431 ? 13.926   -17.410 19.952  1.00 33.27  ? 470  ILE A CA  1 
ATOM   3281  C C   . ILE A 1 431 ? 13.444   -17.013 18.559  1.00 31.50  ? 470  ILE A C   1 
ATOM   3282  O O   . ILE A 1 431 ? 12.417   -17.501 18.088  1.00 25.54  ? 470  ILE A O   1 
ATOM   3283  C CB  . ILE A 1 431 ? 14.113   -18.954 20.021  1.00 32.70  ? 470  ILE A CB  1 
ATOM   3284  C CG1 . ILE A 1 431 ? 14.590   -19.386 21.413  1.00 28.21  ? 470  ILE A CG1 1 
ATOM   3285  C CG2 . ILE A 1 431 ? 15.050   -19.456 18.931  1.00 21.80  ? 470  ILE A CG2 1 
ATOM   3286  C CD1 . ILE A 1 431 ? 14.248   -20.839 21.735  1.00 26.45  ? 470  ILE A CD1 1 
ATOM   3287  N N   . ARG A 1 432 ? 14.176   -16.115 17.908  1.00 28.74  ? 471  ARG A N   1 
ATOM   3288  C CA  . ARG A 1 432 ? 13.844   -15.731 16.545  1.00 27.44  ? 471  ARG A CA  1 
ATOM   3289  C C   . ARG A 1 432 ? 14.881   -16.235 15.542  1.00 26.61  ? 471  ARG A C   1 
ATOM   3290  O O   . ARG A 1 432 ? 16.063   -15.884 15.609  1.00 31.54  ? 471  ARG A O   1 
ATOM   3291  C CB  . ARG A 1 432 ? 13.740   -14.209 16.413  1.00 27.45  ? 471  ARG A CB  1 
ATOM   3292  C CG  . ARG A 1 432 ? 12.751   -13.568 17.363  1.00 33.88  ? 471  ARG A CG  1 
ATOM   3293  C CD  . ARG A 1 432 ? 12.651   -12.058 17.149  1.00 35.09  ? 471  ARG A CD  1 
ATOM   3294  N NE  . ARG A 1 432 ? 11.856   -11.457 18.212  1.00 35.61  ? 471  ARG A NE  1 
ATOM   3295  C CZ  . ARG A 1 432 ? 10.536   -11.514 18.244  1.00 34.27  ? 471  ARG A CZ  1 
ATOM   3296  N NH1 . ARG A 1 432 ? 9.898    -12.113 17.253  1.00 32.71  ? 471  ARG A NH1 1 
ATOM   3297  N NH2 . ARG A 1 432 ? 9.859    -10.968 19.246  1.00 38.92  ? 471  ARG A NH2 1 
ATOM   3298  N N   . VAL A 1 433 ? 14.421   -17.022 14.585  1.00 25.29  ? 472  VAL A N   1 
ATOM   3299  C CA  . VAL A 1 433 ? 15.282   -17.448 13.496  1.00 26.93  ? 472  VAL A CA  1 
ATOM   3300  C C   . VAL A 1 433 ? 14.976   -16.613 12.264  1.00 27.85  ? 472  VAL A C   1 
ATOM   3301  O O   . VAL A 1 433 ? 13.814   -16.374 11.928  1.00 27.01  ? 472  VAL A O   1 
ATOM   3302  C CB  . VAL A 1 433 ? 15.095   -18.952 13.172  1.00 30.03  ? 472  VAL A CB  1 
ATOM   3303  C CG1 . VAL A 1 433 ? 15.977   -19.365 11.983  1.00 19.27  ? 472  VAL A CG1 1 
ATOM   3304  C CG2 . VAL A 1 433 ? 15.392   -19.804 14.401  1.00 23.26  ? 472  VAL A CG2 1 
ATOM   3305  N N   . THR A 1 434 ? 16.028   -16.160 11.599  1.00 25.94  ? 473  THR A N   1 
ATOM   3306  C CA  . THR A 1 434 ? 15.886   -15.442 10.349  1.00 27.70  ? 473  THR A CA  1 
ATOM   3307  C C   . THR A 1 434 ? 16.548   -16.288 9.270   1.00 28.79  ? 473  THR A C   1 
ATOM   3308  O O   . THR A 1 434 ? 17.692   -16.704 9.428   1.00 28.80  ? 473  THR A O   1 
ATOM   3309  C CB  . THR A 1 434 ? 16.589   -14.058 10.445  1.00 28.22  ? 473  THR A CB  1 
ATOM   3310  O OG1 . THR A 1 434 ? 15.949   -13.273 11.462  1.00 30.62  ? 473  THR A OG1 1 
ATOM   3311  C CG2 . THR A 1 434 ? 16.546   -13.324 9.106   1.00 30.86  ? 473  THR A CG2 1 
ATOM   3312  N N   . SER A 1 435 ? 15.835   -16.567 8.184   1.00 22.54  ? 474  SER A N   1 
ATOM   3313  C CA  . SER A 1 435 ? 16.444   -17.292 7.082   1.00 26.85  ? 474  SER A CA  1 
ATOM   3314  C C   . SER A 1 435 ? 16.387   -16.426 5.846   1.00 26.10  ? 474  SER A C   1 
ATOM   3315  O O   . SER A 1 435 ? 15.326   -15.936 5.479   1.00 26.82  ? 474  SER A O   1 
ATOM   3316  C CB  . SER A 1 435 ? 15.732   -18.622 6.836   1.00 33.12  ? 474  SER A CB  1 
ATOM   3317  O OG  . SER A 1 435 ? 15.687   -19.400 8.031   1.00 41.02  ? 474  SER A OG  1 
ATOM   3318  N N   . GLU A 1 436 ? 17.532   -16.237 5.206   1.00 24.72  ? 475  GLU A N   1 
ATOM   3319  C CA  . GLU A 1 436 ? 17.614   -15.332 4.071   1.00 24.89  ? 475  GLU A CA  1 
ATOM   3320  C C   . GLU A 1 436 ? 18.224   -16.052 2.891   1.00 23.12  ? 475  GLU A C   1 
ATOM   3321  O O   . GLU A 1 436 ? 19.348   -16.544 2.975   1.00 27.28  ? 475  GLU A O   1 
ATOM   3322  C CB  . GLU A 1 436 ? 18.436   -14.097 4.455   1.00 28.50  ? 475  GLU A CB  1 
ATOM   3323  C CG  . GLU A 1 436 ? 17.707   -13.213 5.455   1.00 34.34  ? 475  GLU A CG  1 
ATOM   3324  C CD  . GLU A 1 436 ? 18.535   -12.039 5.950   1.00 35.33  ? 475  GLU A CD  1 
ATOM   3325  O OE1 . GLU A 1 436 ? 18.130   -10.890 5.686   1.00 47.10  ? 475  GLU A OE1 1 
ATOM   3326  O OE2 . GLU A 1 436 ? 19.571   -12.256 6.620   1.00 35.32  ? 475  GLU A OE2 1 
ATOM   3327  N N   . VAL A 1 437 ? 17.495   -16.155 1.789   1.00 24.24  ? 476  VAL A N   1 
ATOM   3328  C CA  . VAL A 1 437 ? 18.078   -16.871 0.659   1.00 26.24  ? 476  VAL A CA  1 
ATOM   3329  C C   . VAL A 1 437 ? 18.902   -15.963 -0.260  1.00 25.02  ? 476  VAL A C   1 
ATOM   3330  O O   . VAL A 1 437 ? 18.391   -15.054 -0.911  1.00 25.15  ? 476  VAL A O   1 
ATOM   3331  C CB  . VAL A 1 437 ? 17.095   -17.850 -0.076  1.00 30.07  ? 476  VAL A CB  1 
ATOM   3332  C CG1 . VAL A 1 437 ? 15.636   -17.696 0.380   1.00 25.53  ? 476  VAL A CG1 1 
ATOM   3333  C CG2 . VAL A 1 437 ? 17.262   -17.812 -1.561  1.00 26.18  ? 476  VAL A CG2 1 
ATOM   3334  N N   . LEU A 1 438 ? 20.196   -16.246 -0.273  1.00 28.33  ? 477  LEU A N   1 
ATOM   3335  C CA  . LEU A 1 438 ? 21.199   -15.398 -0.889  1.00 30.50  ? 477  LEU A CA  1 
ATOM   3336  C C   . LEU A 1 438 ? 21.473   -15.824 -2.322  1.00 32.60  ? 477  LEU A C   1 
ATOM   3337  O O   . LEU A 1 438 ? 21.826   -14.998 -3.163  1.00 28.90  ? 477  LEU A O   1 
ATOM   3338  C CB  . LEU A 1 438 ? 22.481   -15.468 -0.069  1.00 24.70  ? 477  LEU A CB  1 
ATOM   3339  C CG  . LEU A 1 438 ? 22.618   -14.455 1.063   1.00 38.30  ? 477  LEU A CG  1 
ATOM   3340  C CD1 . LEU A 1 438 ? 21.271   -14.080 1.685   1.00 30.56  ? 477  LEU A CD1 1 
ATOM   3341  C CD2 . LEU A 1 438 ? 23.651   -14.902 2.103   1.00 30.51  ? 477  LEU A CD2 1 
ATOM   3342  N N   . GLU A 1 439 ? 21.327   -17.121 -2.581  1.00 25.50  ? 478  GLU A N   1 
ATOM   3343  C CA  . GLU A 1 439 ? 21.471   -17.685 -3.910  1.00 24.79  ? 478  GLU A CA  1 
ATOM   3344  C C   . GLU A 1 439 ? 20.405   -18.758 -4.004  1.00 29.22  ? 478  GLU A C   1 
ATOM   3345  O O   . GLU A 1 439 ? 20.170   -19.498 -3.044  1.00 27.06  ? 478  GLU A O   1 
ATOM   3346  C CB  . GLU A 1 439 ? 22.866   -18.305 -4.112  1.00 22.37  ? 478  GLU A CB  1 
ATOM   3347  C CG  . GLU A 1 439 ? 24.010   -17.377 -3.774  1.00 22.99  ? 478  GLU A CG  1 
ATOM   3348  C CD  . GLU A 1 439 ? 25.392   -18.047 -3.786  1.00 30.57  ? 478  GLU A CD  1 
ATOM   3349  O OE1 . GLU A 1 439 ? 25.500   -19.305 -3.835  1.00 26.25  ? 478  GLU A OE1 1 
ATOM   3350  O OE2 . GLU A 1 439 ? 26.386   -17.294 -3.722  1.00 28.29  ? 478  GLU A OE2 1 
ATOM   3351  N N   . SER A 1 440 ? 19.754   -18.834 -5.156  1.00 26.31  ? 479  SER A N   1 
ATOM   3352  C CA  . SER A 1 440 ? 18.581   -19.675 -5.306  1.00 27.09  ? 479  SER A CA  1 
ATOM   3353  C C   . SER A 1 440 ? 18.681   -20.628 -6.487  1.00 27.72  ? 479  SER A C   1 
ATOM   3354  O O   . SER A 1 440 ? 18.843   -20.198 -7.628  1.00 24.43  ? 479  SER A O   1 
ATOM   3355  C CB  . SER A 1 440 ? 17.348   -18.790 -5.479  1.00 30.94  ? 479  SER A CB  1 
ATOM   3356  O OG  . SER A 1 440 ? 16.245   -19.551 -5.932  1.00 35.12  ? 479  SER A OG  1 
ATOM   3357  N N   . ASN A 1 441 ? 18.559   -21.922 -6.209  1.00 26.06  ? 480  ASN A N   1 
ATOM   3358  C CA  . ASN A 1 441 ? 18.553   -22.934 -7.257  1.00 23.72  ? 480  ASN A CA  1 
ATOM   3359  C C   . ASN A 1 441 ? 17.713   -24.156 -6.896  1.00 28.10  ? 480  ASN A C   1 
ATOM   3360  O O   . ASN A 1 441 ? 17.933   -25.246 -7.422  1.00 25.39  ? 480  ASN A O   1 
ATOM   3361  C CB  . ASN A 1 441 ? 19.978   -23.361 -7.613  1.00 24.67  ? 480  ASN A CB  1 
ATOM   3362  C CG  . ASN A 1 441 ? 20.055   -24.069 -8.952  1.00 32.46  ? 480  ASN A CG  1 
ATOM   3363  O OD1 . ASN A 1 441 ? 19.221   -23.851 -9.830  1.00 29.89  ? 480  ASN A OD1 1 
ATOM   3364  N ND2 . ASN A 1 441 ? 21.057   -24.925 -9.112  1.00 27.07  ? 480  ASN A ND2 1 
ATOM   3365  N N   . GLY A 1 442 ? 16.749   -23.970 -6.000  1.00 27.40  ? 481  GLY A N   1 
ATOM   3366  C CA  . GLY A 1 442 ? 15.848   -25.045 -5.626  1.00 22.39  ? 481  GLY A CA  1 
ATOM   3367  C C   . GLY A 1 442 ? 15.792   -25.345 -4.140  1.00 29.38  ? 481  GLY A C   1 
ATOM   3368  O O   . GLY A 1 442 ? 16.818   -25.559 -3.497  1.00 23.76  ? 481  GLY A O   1 
ATOM   3369  N N   . SER A 1 443 ? 14.576   -25.366 -3.602  1.00 25.09  ? 482  SER A N   1 
ATOM   3370  C CA  . SER A 1 443 ? 14.342   -25.701 -2.201  1.00 30.82  ? 482  SER A CA  1 
ATOM   3371  C C   . SER A 1 443 ? 15.077   -24.786 -1.226  1.00 31.69  ? 482  SER A C   1 
ATOM   3372  O O   . SER A 1 443 ? 15.992   -25.218 -0.523  1.00 24.44  ? 482  SER A O   1 
ATOM   3373  C CB  . SER A 1 443 ? 14.711   -27.160 -1.929  1.00 41.76  ? 482  SER A CB  1 
ATOM   3374  O OG  . SER A 1 443 ? 13.862   -27.719 -0.943  1.00 40.47  ? 482  SER A OG  1 
ATOM   3375  N N   . SER A 1 444 ? 14.663   -23.526 -1.177  1.00 21.54  ? 483  SER A N   1 
ATOM   3376  C CA  . SER A 1 444 ? 15.244   -22.567 -0.247  1.00 25.76  ? 483  SER A CA  1 
ATOM   3377  C C   . SER A 1 444 ? 14.658   -22.754 1.148   1.00 20.06  ? 483  SER A C   1 
ATOM   3378  O O   . SER A 1 444 ? 15.336   -22.544 2.151   1.00 24.30  ? 483  SER A O   1 
ATOM   3379  C CB  . SER A 1 444 ? 15.007   -21.136 -0.733  1.00 21.77  ? 483  SER A CB  1 
ATOM   3380  O OG  . SER A 1 444 ? 13.667   -20.955 -1.152  1.00 25.30  ? 483  SER A OG  1 
ATOM   3381  N N   . SER A 1 445 ? 13.391   -23.153 1.202   1.00 20.89  ? 484  SER A N   1 
ATOM   3382  C CA  . SER A 1 445 ? 12.700   -23.370 2.477   1.00 24.93  ? 484  SER A CA  1 
ATOM   3383  C C   . SER A 1 445 ? 13.297   -24.582 3.224   1.00 21.87  ? 484  SER A C   1 
ATOM   3384  O O   . SER A 1 445 ? 13.507   -24.539 4.437   1.00 26.52  ? 484  SER A O   1 
ATOM   3385  C CB  . SER A 1 445 ? 11.187   -23.538 2.272   1.00 21.93  ? 484  SER A CB  1 
ATOM   3386  O OG  . SER A 1 445 ? 10.892   -24.823 1.741   1.00 33.16  ? 484  SER A OG  1 
ATOM   3387  N N   . MET A 1 446 ? 13.594   -25.650 2.494   1.00 25.52  ? 485  MET A N   1 
ATOM   3388  C CA  . MET A 1 446 ? 14.258   -26.799 3.102   1.00 23.93  ? 485  MET A CA  1 
ATOM   3389  C C   . MET A 1 446 ? 15.694   -26.455 3.567   1.00 25.80  ? 485  MET A C   1 
ATOM   3390  O O   . MET A 1 446 ? 16.147   -26.912 4.623   1.00 23.82  ? 485  MET A O   1 
ATOM   3391  C CB  . MET A 1 446 ? 14.235   -27.997 2.151   1.00 24.36  ? 485  MET A CB  1 
ATOM   3392  C CG  . MET A 1 446 ? 12.813   -28.512 1.782   1.00 21.78  ? 485  MET A CG  1 
ATOM   3393  S SD  . MET A 1 446 ? 11.856   -29.054 3.235   1.00 25.66  ? 485  MET A SD  1 
ATOM   3394  C CE  . MET A 1 446 ? 11.009   -27.527 3.685   1.00 27.34  ? 485  MET A CE  1 
ATOM   3395  N N   . ALA A 1 447 ? 16.402   -25.633 2.798   1.00 23.33  ? 486  ALA A N   1 
ATOM   3396  C CA  . ALA A 1 447 ? 17.706   -25.125 3.251   1.00 24.83  ? 486  ALA A CA  1 
ATOM   3397  C C   . ALA A 1 447 ? 17.567   -24.243 4.501   1.00 28.40  ? 486  ALA A C   1 
ATOM   3398  O O   . ALA A 1 447 ? 18.443   -24.248 5.371   1.00 22.55  ? 486  ALA A O   1 
ATOM   3399  C CB  . ALA A 1 447 ? 18.415   -24.355 2.129   1.00 23.68  ? 486  ALA A CB  1 
ATOM   3400  N N   . SER A 1 448 ? 16.467   -23.488 4.582   1.00 24.94  ? 487  SER A N   1 
ATOM   3401  C CA  . SER A 1 448 ? 16.170   -22.686 5.773   1.00 29.63  ? 487  SER A CA  1 
ATOM   3402  C C   . SER A 1 448 ? 15.984   -23.545 7.027   1.00 24.16  ? 487  SER A C   1 
ATOM   3403  O O   . SER A 1 448 ? 16.447   -23.172 8.095   1.00 25.61  ? 487  SER A O   1 
ATOM   3404  C CB  . SER A 1 448 ? 14.941   -21.786 5.555   1.00 23.13  ? 487  SER A CB  1 
ATOM   3405  O OG  . SER A 1 448 ? 15.166   -20.878 4.484   1.00 27.87  ? 487  SER A OG  1 
ATOM   3406  N N   . ALA A 1 449 ? 15.307   -24.686 6.898   1.00 23.19  ? 488  ALA A N   1 
ATOM   3407  C CA  . ALA A 1 449 ? 15.162   -25.613 8.024   1.00 24.70  ? 488  ALA A CA  1 
ATOM   3408  C C   . ALA A 1 449 ? 16.531   -26.146 8.476   1.00 26.19  ? 488  ALA A C   1 
ATOM   3409  O O   . ALA A 1 449 ? 16.852   -26.169 9.675   1.00 26.74  ? 488  ALA A O   1 
ATOM   3410  C CB  . ALA A 1 449 ? 14.214   -26.779 7.652   1.00 20.17  ? 488  ALA A CB  1 
ATOM   3411  N N   . CYS A 1 450 ? 17.337   -26.560 7.506   1.00 25.02  ? 489  CYS A N   1 
ATOM   3412  C CA  . CYS A 1 450 ? 18.694   -27.041 7.773   1.00 24.04  ? 489  CYS A CA  1 
ATOM   3413  C C   . CYS A 1 450 ? 19.561   -25.958 8.419   1.00 26.31  ? 489  CYS A C   1 
ATOM   3414  O O   . CYS A 1 450 ? 20.142   -26.171 9.482   1.00 26.14  ? 489  CYS A O   1 
ATOM   3415  C CB  . CYS A 1 450 ? 19.352   -27.496 6.473   1.00 23.58  ? 489  CYS A CB  1 
ATOM   3416  S SG  . CYS A 1 450 ? 18.635   -28.961 5.749   1.00 27.95  ? 489  CYS A SG  1 
ATOM   3417  N N   . GLY A 1 451 ? 19.653   -24.803 7.763   1.00 26.98  ? 490  GLY A N   1 
ATOM   3418  C CA  . GLY A 1 451 ? 20.340   -23.653 8.326   1.00 21.54  ? 490  GLY A CA  1 
ATOM   3419  C C   . GLY A 1 451 ? 19.846   -23.259 9.713   1.00 29.13  ? 490  GLY A C   1 
ATOM   3420  O O   . GLY A 1 451 ? 20.650   -22.948 10.602  1.00 25.09  ? 490  GLY A O   1 
ATOM   3421  N N   . GLY A 1 452 ? 18.525   -23.261 9.904   1.00 22.90  ? 491  GLY A N   1 
ATOM   3422  C CA  . GLY A 1 452 ? 17.951   -22.985 11.215  1.00 24.82  ? 491  GLY A CA  1 
ATOM   3423  C C   . GLY A 1 452 ? 18.414   -23.963 12.296  1.00 27.44  ? 491  GLY A C   1 
ATOM   3424  O O   . GLY A 1 452 ? 18.783   -23.567 13.403  1.00 27.81  ? 491  GLY A O   1 
ATOM   3425  N N   . SER A 1 453 ? 18.408   -25.248 11.967  1.00 26.87  ? 492  SER A N   1 
ATOM   3426  C CA  . SER A 1 453 ? 18.904   -26.268 12.887  1.00 27.72  ? 492  SER A CA  1 
ATOM   3427  C C   . SER A 1 453 ? 20.354   -25.987 13.303  1.00 22.72  ? 492  SER A C   1 
ATOM   3428  O O   . SER A 1 453 ? 20.673   -26.024 14.481  1.00 24.55  ? 492  SER A O   1 
ATOM   3429  C CB  . SER A 1 453 ? 18.785   -27.658 12.259  1.00 21.32  ? 492  SER A CB  1 
ATOM   3430  O OG  . SER A 1 453 ? 19.259   -28.658 13.141  1.00 28.30  ? 492  SER A OG  1 
ATOM   3431  N N   . LEU A 1 454 ? 21.222   -25.707 12.333  1.00 26.80  ? 493  LEU A N   1 
ATOM   3432  C CA  . LEU A 1 454 ? 22.631   -25.417 12.610  1.00 28.23  ? 493  LEU A CA  1 
ATOM   3433  C C   . LEU A 1 454 ? 22.798   -24.171 13.484  1.00 28.39  ? 493  LEU A C   1 
ATOM   3434  O O   . LEU A 1 454 ? 23.514   -24.193 14.496  1.00 25.14  ? 493  LEU A O   1 
ATOM   3435  C CB  . LEU A 1 454 ? 23.405   -25.226 11.299  1.00 24.52  ? 493  LEU A CB  1 
ATOM   3436  C CG  . LEU A 1 454 ? 23.469   -26.439 10.356  1.00 29.82  ? 493  LEU A CG  1 
ATOM   3437  C CD1 . LEU A 1 454 ? 23.998   -26.037 8.987   1.00 29.81  ? 493  LEU A CD1 1 
ATOM   3438  C CD2 . LEU A 1 454 ? 24.322   -27.550 10.927  1.00 23.49  ? 493  LEU A CD2 1 
ATOM   3439  N N   . ALA A 1 455 ? 22.152   -23.076 13.081  1.00 25.24  ? 494  ALA A N   1 
ATOM   3440  C CA  . ALA A 1 455 ? 22.232   -21.829 13.845  1.00 23.89  ? 494  ALA A CA  1 
ATOM   3441  C C   . ALA A 1 455 ? 21.664   -21.993 15.263  1.00 28.15  ? 494  ALA A C   1 
ATOM   3442  O O   . ALA A 1 455 ? 22.167   -21.391 16.215  1.00 25.45  ? 494  ALA A O   1 
ATOM   3443  C CB  . ALA A 1 455 ? 21.516   -20.686 13.107  1.00 24.28  ? 494  ALA A CB  1 
ATOM   3444  N N   . LEU A 1 456 ? 20.615   -22.802 15.407  1.00 24.92  ? 495  LEU A N   1 
ATOM   3445  C CA  . LEU A 1 456 ? 20.018   -22.978 16.728  1.00 25.93  ? 495  LEU A CA  1 
ATOM   3446  C C   . LEU A 1 456 ? 21.023   -23.650 17.669  1.00 24.94  ? 495  LEU A C   1 
ATOM   3447  O O   . LEU A 1 456 ? 21.205   -23.203 18.806  1.00 23.09  ? 495  LEU A O   1 
ATOM   3448  C CB  . LEU A 1 456 ? 18.700   -23.751 16.662  1.00 22.81  ? 495  LEU A CB  1 
ATOM   3449  C CG  . LEU A 1 456 ? 17.463   -22.962 16.205  1.00 29.51  ? 495  LEU A CG  1 
ATOM   3450  C CD1 . LEU A 1 456 ? 16.379   -23.918 15.726  1.00 26.55  ? 495  LEU A CD1 1 
ATOM   3451  C CD2 . LEU A 1 456 ? 16.941   -22.059 17.317  1.00 25.43  ? 495  LEU A CD2 1 
ATOM   3452  N N   . MET A 1 457 ? 21.671   -24.713 17.188  1.00 23.97  ? 496  MET A N   1 
ATOM   3453  C CA  . MET A 1 457 ? 22.751   -25.351 17.947  1.00 27.74  ? 496  MET A CA  1 
ATOM   3454  C C   . MET A 1 457 ? 23.891   -24.364 18.190  1.00 25.17  ? 496  MET A C   1 
ATOM   3455  O O   . MET A 1 457 ? 24.368   -24.221 19.311  1.00 25.47  ? 496  MET A O   1 
ATOM   3456  C CB  . MET A 1 457 ? 23.269   -26.612 17.244  1.00 26.01  ? 496  MET A CB  1 
ATOM   3457  C CG  . MET A 1 457 ? 22.290   -27.789 17.256  1.00 21.30  ? 496  MET A CG  1 
ATOM   3458  S SD  . MET A 1 457 ? 23.012   -29.300 16.542  1.00 30.93  ? 496  MET A SD  1 
ATOM   3459  C CE  . MET A 1 457 ? 21.788   -30.507 17.043  1.00 30.38  ? 496  MET A CE  1 
ATOM   3460  N N   . ASP A 1 458 ? 24.312   -23.656 17.148  1.00 27.55  ? 497  ASP A N   1 
ATOM   3461  C CA  . ASP A 1 458 ? 25.339   -22.619 17.339  1.00 21.85  ? 497  ASP A CA  1 
ATOM   3462  C C   . ASP A 1 458 ? 25.006   -21.683 18.503  1.00 26.53  ? 497  ASP A C   1 
ATOM   3463  O O   . ASP A 1 458 ? 25.892   -21.295 19.273  1.00 22.90  ? 497  ASP A O   1 
ATOM   3464  C CB  . ASP A 1 458 ? 25.515   -21.797 16.065  1.00 22.66  ? 497  ASP A CB  1 
ATOM   3465  C CG  . ASP A 1 458 ? 26.660   -20.784 16.170  1.00 31.81  ? 497  ASP A CG  1 
ATOM   3466  O OD1 . ASP A 1 458 ? 27.758   -21.126 16.655  1.00 27.30  ? 497  ASP A OD1 1 
ATOM   3467  O OD2 . ASP A 1 458 ? 26.457   -19.639 15.751  1.00 29.20  ? 497  ASP A OD2 1 
ATOM   3468  N N   . SER A 1 459 ? 23.728   -21.316 18.626  1.00 25.85  ? 498  SER A N   1 
ATOM   3469  C CA  . SER A 1 459 ? 23.314   -20.297 19.589  1.00 27.76  ? 498  SER A CA  1 
ATOM   3470  C C   . SER A 1 459 ? 23.203   -20.881 20.990  1.00 27.23  ? 498  SER A C   1 
ATOM   3471  O O   . SER A 1 459 ? 23.021   -20.148 21.961  1.00 28.80  ? 498  SER A O   1 
ATOM   3472  C CB  . SER A 1 459 ? 21.960   -19.698 19.193  1.00 25.00  ? 498  SER A CB  1 
ATOM   3473  O OG  . SER A 1 459 ? 20.911   -20.627 19.422  1.00 27.73  ? 498  SER A OG  1 
ATOM   3474  N N   . GLY A 1 460 ? 23.299   -22.201 21.092  1.00 25.67  ? 499  GLY A N   1 
ATOM   3475  C CA  . GLY A 1 460 ? 23.194   -22.856 22.381  1.00 27.25  ? 499  GLY A CA  1 
ATOM   3476  C C   . GLY A 1 460 ? 21.771   -23.137 22.841  1.00 25.96  ? 499  GLY A C   1 
ATOM   3477  O O   . GLY A 1 460 ? 21.538   -23.338 24.029  1.00 28.28  ? 499  GLY A O   1 
ATOM   3478  N N   . VAL A 1 461 ? 20.814   -23.148 21.915  1.00 23.93  ? 500  VAL A N   1 
ATOM   3479  C CA  . VAL A 1 461 ? 19.476   -23.663 22.243  1.00 26.45  ? 500  VAL A CA  1 
ATOM   3480  C C   . VAL A 1 461 ? 19.545   -25.180 22.266  1.00 30.59  ? 500  VAL A C   1 
ATOM   3481  O O   . VAL A 1 461 ? 19.935   -25.804 21.276  1.00 24.89  ? 500  VAL A O   1 
ATOM   3482  C CB  . VAL A 1 461 ? 18.401   -23.274 21.212  1.00 26.30  ? 500  VAL A CB  1 
ATOM   3483  C CG1 . VAL A 1 461 ? 17.073   -23.994 21.528  1.00 29.32  ? 500  VAL A CG1 1 
ATOM   3484  C CG2 . VAL A 1 461 ? 18.205   -21.767 21.195  1.00 26.73  ? 500  VAL A CG2 1 
ATOM   3485  N N   . PRO A 1 462 ? 19.172   -25.789 23.396  1.00 32.28  ? 501  PRO A N   1 
ATOM   3486  C CA  . PRO A 1 462 ? 19.322   -27.242 23.433  1.00 29.94  ? 501  PRO A CA  1 
ATOM   3487  C C   . PRO A 1 462 ? 18.189   -27.914 22.669  1.00 28.38  ? 501  PRO A C   1 
ATOM   3488  O O   . PRO A 1 462 ? 17.287   -28.430 23.309  1.00 29.30  ? 501  PRO A O   1 
ATOM   3489  C CB  . PRO A 1 462 ? 19.217   -27.557 24.930  1.00 33.78  ? 501  PRO A CB  1 
ATOM   3490  C CG  . PRO A 1 462 ? 18.322   -26.493 25.472  1.00 35.81  ? 501  PRO A CG  1 
ATOM   3491  C CD  . PRO A 1 462 ? 18.634   -25.247 24.658  1.00 31.14  ? 501  PRO A CD  1 
ATOM   3492  N N   . ILE A 1 463 ? 18.217   -27.893 21.336  1.00 28.72  ? 502  ILE A N   1 
ATOM   3493  C CA  . ILE A 1 463 ? 17.193   -28.590 20.561  1.00 28.98  ? 502  ILE A CA  1 
ATOM   3494  C C   . ILE A 1 463 ? 17.370   -30.096 20.716  1.00 31.79  ? 502  ILE A C   1 
ATOM   3495  O O   . ILE A 1 463 ? 18.480   -30.575 20.918  1.00 28.74  ? 502  ILE A O   1 
ATOM   3496  C CB  . ILE A 1 463 ? 17.215   -28.211 19.074  1.00 28.48  ? 502  ILE A CB  1 
ATOM   3497  C CG1 . ILE A 1 463 ? 18.521   -28.652 18.414  1.00 28.67  ? 502  ILE A CG1 1 
ATOM   3498  C CG2 . ILE A 1 463 ? 16.986   -26.690 18.885  1.00 24.85  ? 502  ILE A CG2 1 
ATOM   3499  C CD1 . ILE A 1 463 ? 18.519   -28.413 16.917  1.00 28.33  ? 502  ILE A CD1 1 
ATOM   3500  N N   . SER A 1 464 ? 16.273   -30.838 20.631  1.00 27.30  ? 503  SER A N   1 
ATOM   3501  C CA  . SER A 1 464 ? 16.294   -32.265 20.951  1.00 34.17  ? 503  SER A CA  1 
ATOM   3502  C C   . SER A 1 464 ? 17.022   -33.074 19.885  1.00 33.67  ? 503  SER A C   1 
ATOM   3503  O O   . SER A 1 464 ? 17.572   -34.133 20.163  1.00 32.77  ? 503  SER A O   1 
ATOM   3504  C CB  . SER A 1 464 ? 14.868   -32.787 21.125  1.00 32.00  ? 503  SER A CB  1 
ATOM   3505  O OG  . SER A 1 464 ? 14.110   -32.575 19.943  1.00 34.75  ? 503  SER A OG  1 
ATOM   3506  N N   . SER A 1 465 ? 17.037   -32.568 18.661  1.00 28.38  ? 504  SER A N   1 
ATOM   3507  C CA  . SER A 1 465 ? 17.683   -33.272 17.568  1.00 24.69  ? 504  SER A CA  1 
ATOM   3508  C C   . SER A 1 465 ? 17.841   -32.318 16.385  1.00 30.21  ? 504  SER A C   1 
ATOM   3509  O O   . SER A 1 465 ? 17.141   -31.296 16.309  1.00 27.34  ? 504  SER A O   1 
ATOM   3510  C CB  . SER A 1 465 ? 16.838   -34.504 17.175  1.00 29.52  ? 504  SER A CB  1 
ATOM   3511  O OG  . SER A 1 465 ? 17.540   -35.362 16.293  1.00 38.06  ? 504  SER A OG  1 
ATOM   3512  N N   . ALA A 1 466 ? 18.778   -32.622 15.489  1.00 24.13  ? 505  ALA A N   1 
ATOM   3513  C CA  . ALA A 1 466 ? 18.986   -31.809 14.291  1.00 23.72  ? 505  ALA A CA  1 
ATOM   3514  C C   . ALA A 1 466 ? 17.827   -32.021 13.309  1.00 26.23  ? 505  ALA A C   1 
ATOM   3515  O O   . ALA A 1 466 ? 17.173   -33.079 13.298  1.00 23.00  ? 505  ALA A O   1 
ATOM   3516  C CB  . ALA A 1 466 ? 20.326   -32.155 13.619  1.00 16.93  ? 505  ALA A CB  1 
ATOM   3517  N N   . VAL A 1 467 ? 17.581   -31.024 12.473  1.00 25.76  ? 506  VAL A N   1 
ATOM   3518  C CA  . VAL A 1 467 ? 16.509   -31.129 11.496  1.00 20.93  ? 506  VAL A CA  1 
ATOM   3519  C C   . VAL A 1 467 ? 17.030   -30.799 10.106  1.00 19.97  ? 506  VAL A C   1 
ATOM   3520  O O   . VAL A 1 467 ? 17.829   -29.867 9.936   1.00 26.04  ? 506  VAL A O   1 
ATOM   3521  C CB  . VAL A 1 467 ? 15.329   -30.176 11.851  1.00 24.88  ? 506  VAL A CB  1 
ATOM   3522  C CG1 . VAL A 1 467 ? 14.337   -30.063 10.680  1.00 18.50  ? 506  VAL A CG1 1 
ATOM   3523  C CG2 . VAL A 1 467 ? 14.638   -30.638 13.136  1.00 21.29  ? 506  VAL A CG2 1 
ATOM   3524  N N   . ALA A 1 468 ? 16.573   -31.566 9.121   1.00 19.71  ? 507  ALA A N   1 
ATOM   3525  C CA  . ALA A 1 468 ? 16.885   -31.290 7.732   1.00 25.50  ? 507  ALA A CA  1 
ATOM   3526  C C   . ALA A 1 468 ? 15.652   -31.542 6.882   1.00 22.42  ? 507  ALA A C   1 
ATOM   3527  O O   . ALA A 1 468 ? 14.770   -32.306 7.265   1.00 22.31  ? 507  ALA A O   1 
ATOM   3528  C CB  . ALA A 1 468 ? 18.056   -32.160 7.245   1.00 22.67  ? 507  ALA A CB  1 
ATOM   3529  N N   . GLY A 1 469 ? 15.600   -30.898 5.723   1.00 25.92  ? 508  GLY A N   1 
ATOM   3530  C CA  . GLY A 1 469 ? 14.530   -31.138 4.774   1.00 22.83  ? 508  GLY A CA  1 
ATOM   3531  C C   . GLY A 1 469 ? 15.086   -31.176 3.366   1.00 27.03  ? 508  GLY A C   1 
ATOM   3532  O O   . GLY A 1 469 ? 16.254   -30.838 3.134   1.00 21.49  ? 508  GLY A O   1 
ATOM   3533  N N   . VAL A 1 470 ? 14.255   -31.578 2.416   1.00 21.74  ? 509  VAL A N   1 
ATOM   3534  C CA  . VAL A 1 470 ? 14.708   -31.684 1.043   1.00 24.42  ? 509  VAL A CA  1 
ATOM   3535  C C   . VAL A 1 470 ? 13.474   -31.679 0.168   1.00 24.38  ? 509  VAL A C   1 
ATOM   3536  O O   . VAL A 1 470 ? 12.385   -32.005 0.636   1.00 28.12  ? 509  VAL A O   1 
ATOM   3537  C CB  . VAL A 1 470 ? 15.491   -33.012 0.840   1.00 28.74  ? 509  VAL A CB  1 
ATOM   3538  C CG1 . VAL A 1 470 ? 14.582   -34.219 1.105   1.00 24.22  ? 509  VAL A CG1 1 
ATOM   3539  C CG2 . VAL A 1 470 ? 16.092   -33.088 -0.556  1.00 21.58  ? 509  VAL A CG2 1 
ATOM   3540  N N   . ALA A 1 471 ? 13.626   -31.312 -1.096  1.00 20.57  ? 510  ALA A N   1 
ATOM   3541  C CA  . ALA A 1 471 ? 12.507   -31.365 -2.029  1.00 26.04  ? 510  ALA A CA  1 
ATOM   3542  C C   . ALA A 1 471 ? 12.617   -32.545 -2.997  1.00 29.36  ? 510  ALA A C   1 
ATOM   3543  O O   . ALA A 1 471 ? 13.666   -32.783 -3.593  1.00 25.40  ? 510  ALA A O   1 
ATOM   3544  C CB  . ALA A 1 471 ? 12.393   -30.064 -2.813  1.00 23.44  ? 510  ALA A CB  1 
ATOM   3545  N N   . ILE A 1 472 ? 11.509   -33.251 -3.176  1.00 25.88  ? 511  ILE A N   1 
ATOM   3546  C CA  . ILE A 1 472 ? 11.421   -34.314 -4.168  1.00 26.18  ? 511  ILE A CA  1 
ATOM   3547  C C   . ILE A 1 472 ? 10.603   -33.829 -5.353  1.00 26.63  ? 511  ILE A C   1 
ATOM   3548  O O   . ILE A 1 472 ? 9.567    -33.198 -5.184  1.00 30.39  ? 511  ILE A O   1 
ATOM   3549  C CB  . ILE A 1 472 ? 10.731   -35.565 -3.577  1.00 23.43  ? 511  ILE A CB  1 
ATOM   3550  C CG1 . ILE A 1 472 ? 11.462   -36.039 -2.325  1.00 25.46  ? 511  ILE A CG1 1 
ATOM   3551  C CG2 . ILE A 1 472 ? 10.591   -36.672 -4.637  1.00 22.02  ? 511  ILE A CG2 1 
ATOM   3552  C CD1 . ILE A 1 472 ? 12.958   -36.358 -2.533  1.00 30.05  ? 511  ILE A CD1 1 
ATOM   3553  N N   . GLY A 1 473 ? 11.072   -34.120 -6.559  1.00 23.82  ? 512  GLY A N   1 
ATOM   3554  C CA  . GLY A 1 473 ? 10.366   -33.734 -7.762  1.00 19.89  ? 512  GLY A CA  1 
ATOM   3555  C C   . GLY A 1 473 ? 9.871    -34.957 -8.502  1.00 26.55  ? 512  GLY A C   1 
ATOM   3556  O O   . GLY A 1 473 ? 10.103   -36.094 -8.070  1.00 29.28  ? 512  GLY A O   1 
ATOM   3557  N N   . LEU A 1 474 ? 9.215    -34.730 -9.630  1.00 30.38  ? 513  LEU A N   1 
ATOM   3558  C CA  . LEU A 1 474 ? 8.512    -35.803 -10.309 1.00 31.52  ? 513  LEU A CA  1 
ATOM   3559  C C   . LEU A 1 474 ? 8.402    -35.541 -11.795 1.00 28.37  ? 513  LEU A C   1 
ATOM   3560  O O   . LEU A 1 474 ? 8.079    -34.429 -12.218 1.00 25.68  ? 513  LEU A O   1 
ATOM   3561  C CB  . LEU A 1 474 ? 7.103    -35.954 -9.725  1.00 26.21  ? 513  LEU A CB  1 
ATOM   3562  C CG  . LEU A 1 474 ? 6.206    -37.006 -10.385 1.00 27.24  ? 513  LEU A CG  1 
ATOM   3563  C CD1 . LEU A 1 474 ? 6.737    -38.413 -10.091 1.00 23.55  ? 513  LEU A CD1 1 
ATOM   3564  C CD2 . LEU A 1 474 ? 4.769    -36.851 -9.888  1.00 26.93  ? 513  LEU A CD2 1 
ATOM   3565  N N   . VAL A 1 475 ? 8.672    -36.572 -12.587 1.00 25.38  ? 514  VAL A N   1 
ATOM   3566  C CA  . VAL A 1 475 ? 8.452    -36.486 -14.019 1.00 27.34  ? 514  VAL A CA  1 
ATOM   3567  C C   . VAL A 1 475 ? 7.628    -37.694 -14.412 1.00 30.43  ? 514  VAL A C   1 
ATOM   3568  O O   . VAL A 1 475 ? 7.965    -38.822 -14.052 1.00 29.84  ? 514  VAL A O   1 
ATOM   3569  C CB  . VAL A 1 475 ? 9.771    -36.449 -14.837 1.00 32.84  ? 514  VAL A CB  1 
ATOM   3570  C CG1 . VAL A 1 475 ? 9.471    -36.563 -16.323 1.00 28.92  ? 514  VAL A CG1 1 
ATOM   3571  C CG2 . VAL A 1 475 ? 10.537   -35.176 -14.561 1.00 24.48  ? 514  VAL A CG2 1 
ATOM   3572  N N   . THR A 1 476 ? 6.535    -37.454 -15.130 1.00 31.64  ? 515  THR A N   1 
ATOM   3573  C CA  . THR A 1 476 ? 5.653    -38.542 -15.550 1.00 32.80  ? 515  THR A CA  1 
ATOM   3574  C C   . THR A 1 476 ? 5.472    -38.565 -17.060 1.00 36.41  ? 515  THR A C   1 
ATOM   3575  O O   . THR A 1 476 ? 5.631    -37.548 -17.757 1.00 28.16  ? 515  THR A O   1 
ATOM   3576  C CB  . THR A 1 476 ? 4.229    -38.411 -14.951 1.00 31.20  ? 515  THR A CB  1 
ATOM   3577  O OG1 . THR A 1 476 ? 3.663    -37.157 -15.346 1.00 31.66  ? 515  THR A OG1 1 
ATOM   3578  C CG2 . THR A 1 476 ? 4.241    -38.514 -13.435 1.00 25.38  ? 515  THR A CG2 1 
ATOM   3579  N N   . LYS A 1 477 ? 5.136    -39.751 -17.543 1.00 33.88  ? 516  LYS A N   1 
ATOM   3580  C CA  . LYS A 1 477 ? 4.635    -39.950 -18.885 1.00 42.70  ? 516  LYS A CA  1 
ATOM   3581  C C   . LYS A 1 477 ? 3.187    -40.401 -18.709 1.00 38.51  ? 516  LYS A C   1 
ATOM   3582  O O   . LYS A 1 477 ? 2.909    -41.350 -17.985 1.00 38.72  ? 516  LYS A O   1 
ATOM   3583  C CB  . LYS A 1 477 ? 5.455    -41.042 -19.573 1.00 49.04  ? 516  LYS A CB  1 
ATOM   3584  C CG  . LYS A 1 477 ? 4.984    -41.413 -20.965 1.00 56.51  ? 516  LYS A CG  1 
ATOM   3585  C CD  . LYS A 1 477 ? 5.964    -42.376 -21.618 1.00 72.24  ? 516  LYS A CD  1 
ATOM   3586  C CE  . LYS A 1 477 ? 5.598    -42.640 -23.070 1.00 79.71  ? 516  LYS A CE  1 
ATOM   3587  N NZ  . LYS A 1 477 ? 5.523    -41.371 -23.852 1.00 76.65  ? 516  LYS A NZ  1 
ATOM   3588  N N   . THR A 1 478 ? 2.251    -39.705 -19.328 1.00 40.66  ? 517  THR A N   1 
ATOM   3589  C CA  . THR A 1 478 ? 0.867    -40.134 -19.226 1.00 45.30  ? 517  THR A CA  1 
ATOM   3590  C C   . THR A 1 478 ? 0.299    -40.312 -20.619 1.00 53.76  ? 517  THR A C   1 
ATOM   3591  O O   . THR A 1 478 ? 0.689    -39.597 -21.543 1.00 47.53  ? 517  THR A O   1 
ATOM   3592  C CB  . THR A 1 478 ? 0.017    -39.148 -18.402 1.00 43.68  ? 517  THR A CB  1 
ATOM   3593  O OG1 . THR A 1 478 ? 0.229    -37.815 -18.876 1.00 46.85  ? 517  THR A OG1 1 
ATOM   3594  C CG2 . THR A 1 478 ? 0.409    -39.208 -16.934 1.00 42.34  ? 517  THR A CG2 1 
ATOM   3595  N N   . ASP A 1 479 ? -0.600   -41.282 -20.778 1.00 65.30  ? 518  ASP A N   1 
ATOM   3596  C CA  . ASP A 1 479 ? -1.230   -41.518 -22.074 1.00 70.04  ? 518  ASP A CA  1 
ATOM   3597  C C   . ASP A 1 479 ? -2.054   -40.289 -22.442 1.00 74.20  ? 518  ASP A C   1 
ATOM   3598  O O   . ASP A 1 479 ? -2.549   -39.586 -21.563 1.00 67.01  ? 518  ASP A O   1 
ATOM   3599  C CB  . ASP A 1 479 ? -2.118   -42.763 -22.043 1.00 64.54  ? 518  ASP A CB  1 
ATOM   3600  C CG  . ASP A 1 479 ? -3.401   -42.541 -21.262 1.00 77.79  ? 518  ASP A CG  1 
ATOM   3601  O OD1 . ASP A 1 479 ? -3.320   -42.007 -20.137 1.00 77.52  ? 518  ASP A OD1 1 
ATOM   3602  O OD2 . ASP A 1 479 ? -4.490   -42.883 -21.771 1.00 72.72  ? 518  ASP A OD2 1 
ATOM   3603  N N   . PRO A 1 480 ? -2.193   -40.016 -23.747 1.00 80.80  ? 519  PRO A N   1 
ATOM   3604  C CA  . PRO A 1 480 ? -2.950   -38.837 -24.183 1.00 77.36  ? 519  PRO A CA  1 
ATOM   3605  C C   . PRO A 1 480 ? -4.457   -39.086 -24.097 1.00 80.68  ? 519  PRO A C   1 
ATOM   3606  O O   . PRO A 1 480 ? -5.246   -38.148 -24.195 1.00 81.80  ? 519  PRO A O   1 
ATOM   3607  C CB  . PRO A 1 480 ? -2.510   -38.668 -25.637 1.00 85.47  ? 519  PRO A CB  1 
ATOM   3608  C CG  . PRO A 1 480 ? -2.192   -40.068 -26.087 1.00 84.49  ? 519  PRO A CG  1 
ATOM   3609  C CD  . PRO A 1 480 ? -1.649   -40.788 -24.880 1.00 75.69  ? 519  PRO A CD  1 
ATOM   3610  N N   . GLU A 1 481 ? -4.835   -40.348 -23.908 1.00 84.07  ? 520  GLU A N   1 
ATOM   3611  C CA  . GLU A 1 481 ? -6.234   -40.743 -23.766 1.00 83.13  ? 520  GLU A CA  1 
ATOM   3612  C C   . GLU A 1 481 ? -6.804   -40.235 -22.440 1.00 82.74  ? 520  GLU A C   1 
ATOM   3613  O O   . GLU A 1 481 ? -7.545   -39.248 -22.409 1.00 75.73  ? 520  GLU A O   1 
ATOM   3614  C CB  . GLU A 1 481 ? -6.348   -42.270 -23.834 1.00 87.27  ? 520  GLU A CB  1 
ATOM   3615  C CG  . GLU A 1 481 ? -7.530   -42.792 -24.634 1.00 88.04  ? 520  GLU A CG  1 
ATOM   3616  C CD  . GLU A 1 481 ? -7.319   -42.681 -26.130 1.00 95.00  ? 520  GLU A CD  1 
ATOM   3617  O OE1 . GLU A 1 481 ? -6.710   -41.683 -26.581 1.00 89.93  ? 520  GLU A OE1 1 
ATOM   3618  O OE2 . GLU A 1 481 ? -7.758   -43.601 -26.854 1.00 92.05  ? 520  GLU A OE2 1 
ATOM   3619  N N   . LYS A 1 482 ? -6.465   -40.929 -21.352 1.00 82.85  ? 521  LYS A N   1 
ATOM   3620  C CA  . LYS A 1 482 ? -6.771   -40.477 -19.994 1.00 74.74  ? 521  LYS A CA  1 
ATOM   3621  C C   . LYS A 1 482 ? -5.522   -39.793 -19.441 1.00 78.91  ? 521  LYS A C   1 
ATOM   3622  O O   . LYS A 1 482 ? -4.471   -39.798 -20.083 1.00 74.74  ? 521  LYS A O   1 
ATOM   3623  C CB  . LYS A 1 482 ? -7.188   -41.668 -19.114 1.00 76.07  ? 521  LYS A CB  1 
ATOM   3624  C CG  . LYS A 1 482 ? -7.212   -41.424 -17.588 1.00 79.12  ? 521  LYS A CG  1 
ATOM   3625  C CD  . LYS A 1 482 ? -8.341   -40.493 -17.122 1.00 79.41  ? 521  LYS A CD  1 
ATOM   3626  C CE  . LYS A 1 482 ? -8.738   -40.744 -15.649 1.00 61.72  ? 521  LYS A CE  1 
ATOM   3627  N NZ  . LYS A 1 482 ? -7.633   -40.558 -14.653 1.00 60.37  ? 521  LYS A NZ  1 
ATOM   3628  N N   . GLY A 1 483 ? -5.626   -39.185 -18.268 1.00 71.85  ? 522  GLY A N   1 
ATOM   3629  C CA  . GLY A 1 483 ? -4.459   -38.578 -17.659 1.00 70.59  ? 522  GLY A CA  1 
ATOM   3630  C C   . GLY A 1 483 ? -3.615   -39.602 -16.923 1.00 63.98  ? 522  GLY A C   1 
ATOM   3631  O O   . GLY A 1 483 ? -2.761   -39.236 -16.116 1.00 57.12  ? 522  GLY A O   1 
ATOM   3632  N N   . GLU A 1 484 ? -3.844   -40.883 -17.206 1.00 57.07  ? 523  GLU A N   1 
ATOM   3633  C CA  . GLU A 1 484 ? -3.225   -41.959 -16.430 1.00 54.80  ? 523  GLU A CA  1 
ATOM   3634  C C   . GLU A 1 484 ? -1.710   -42.113 -16.611 1.00 50.25  ? 523  GLU A C   1 
ATOM   3635  O O   . GLU A 1 484 ? -1.184   -42.132 -17.729 1.00 43.63  ? 523  GLU A O   1 
ATOM   3636  C CB  . GLU A 1 484 ? -3.942   -43.288 -16.666 1.00 52.83  ? 523  GLU A CB  1 
ATOM   3637  C CG  . GLU A 1 484 ? -5.240   -43.415 -15.883 1.00 65.83  ? 523  GLU A CG  1 
ATOM   3638  C CD  . GLU A 1 484 ? -5.959   -44.731 -16.139 1.00 71.01  ? 523  GLU A CD  1 
ATOM   3639  O OE1 . GLU A 1 484 ? -5.275   -45.753 -16.369 1.00 70.41  ? 523  GLU A OE1 1 
ATOM   3640  O OE2 . GLU A 1 484 ? -7.209   -44.740 -16.112 1.00 69.17  ? 523  GLU A OE2 1 
ATOM   3641  N N   . ILE A 1 485 ? -1.024   -42.237 -15.481 1.00 46.61  ? 524  ILE A N   1 
ATOM   3642  C CA  . ILE A 1 485 ? 0.429    -42.284 -15.455 1.00 48.51  ? 524  ILE A CA  1 
ATOM   3643  C C   . ILE A 1 485 ? 0.940    -43.653 -15.888 1.00 43.22  ? 524  ILE A C   1 
ATOM   3644  O O   . ILE A 1 485 ? 0.696    -44.660 -15.218 1.00 44.06  ? 524  ILE A O   1 
ATOM   3645  C CB  . ILE A 1 485 ? 0.953    -41.954 -14.051 1.00 39.01  ? 524  ILE A CB  1 
ATOM   3646  C CG1 . ILE A 1 485 ? 0.466    -40.569 -13.624 1.00 37.32  ? 524  ILE A CG1 1 
ATOM   3647  C CG2 . ILE A 1 485 ? 2.469    -42.024 -14.024 1.00 44.94  ? 524  ILE A CG2 1 
ATOM   3648  C CD1 . ILE A 1 485 ? 0.921    -40.180 -12.247 1.00 35.24  ? 524  ILE A CD1 1 
ATOM   3649  N N   . GLU A 1 486 ? 1.632    -43.700 -17.018 1.00 38.21  ? 525  GLU A N   1 
ATOM   3650  C CA  . GLU A 1 486 ? 2.176    -44.974 -17.477 1.00 51.23  ? 525  GLU A CA  1 
ATOM   3651  C C   . GLU A 1 486 ? 3.617    -45.215 -17.028 1.00 46.60  ? 525  GLU A C   1 
ATOM   3652  O O   . GLU A 1 486 ? 4.110    -46.339 -17.094 1.00 49.28  ? 525  GLU A O   1 
ATOM   3653  C CB  . GLU A 1 486 ? 2.032    -45.129 -18.990 1.00 46.51  ? 525  GLU A CB  1 
ATOM   3654  C CG  . GLU A 1 486 ? 2.424    -43.922 -19.805 1.00 57.67  ? 525  GLU A CG  1 
ATOM   3655  C CD  . GLU A 1 486 ? 2.015    -44.059 -21.266 1.00 67.45  ? 525  GLU A CD  1 
ATOM   3656  O OE1 . GLU A 1 486 ? 0.860    -44.468 -21.525 1.00 62.08  ? 525  GLU A OE1 1 
ATOM   3657  O OE2 . GLU A 1 486 ? 2.849    -43.767 -22.155 1.00 76.39  ? 525  GLU A OE2 1 
ATOM   3658  N N   . ASP A 1 487 ? 4.280    -44.166 -16.554 1.00 39.95  ? 526  ASP A N   1 
ATOM   3659  C CA  . ASP A 1 487 ? 5.657    -44.288 -16.081 1.00 36.76  ? 526  ASP A CA  1 
ATOM   3660  C C   . ASP A 1 487 ? 6.069    -42.992 -15.370 1.00 38.07  ? 526  ASP A C   1 
ATOM   3661  O O   . ASP A 1 487 ? 5.499    -41.928 -15.628 1.00 35.69  ? 526  ASP A O   1 
ATOM   3662  C CB  . ASP A 1 487 ? 6.589    -44.590 -17.262 1.00 38.58  ? 526  ASP A CB  1 
ATOM   3663  C CG  . ASP A 1 487 ? 7.922    -45.203 -16.830 1.00 41.16  ? 526  ASP A CG  1 
ATOM   3664  O OD1 . ASP A 1 487 ? 8.065    -45.608 -15.652 1.00 46.38  ? 526  ASP A OD1 1 
ATOM   3665  O OD2 . ASP A 1 487 ? 8.831    -45.283 -17.677 1.00 46.43  ? 526  ASP A OD2 1 
ATOM   3666  N N   . TYR A 1 488 ? 7.049    -43.074 -14.476 1.00 33.42  ? 527  TYR A N   1 
ATOM   3667  C CA  . TYR A 1 488 ? 7.415    -41.904 -13.690 1.00 32.71  ? 527  TYR A CA  1 
ATOM   3668  C C   . TYR A 1 488 ? 8.751    -42.041 -12.982 1.00 32.62  ? 527  TYR A C   1 
ATOM   3669  O O   . TYR A 1 488 ? 9.151    -43.136 -12.580 1.00 30.42  ? 527  TYR A O   1 
ATOM   3670  C CB  . TYR A 1 488 ? 6.338    -41.617 -12.643 1.00 25.04  ? 527  TYR A CB  1 
ATOM   3671  C CG  . TYR A 1 488 ? 6.244    -42.671 -11.549 1.00 28.14  ? 527  TYR A CG  1 
ATOM   3672  C CD1 . TYR A 1 488 ? 6.986    -42.554 -10.389 1.00 28.23  ? 527  TYR A CD1 1 
ATOM   3673  C CD2 . TYR A 1 488 ? 5.412    -43.785 -11.684 1.00 33.62  ? 527  TYR A CD2 1 
ATOM   3674  C CE1 . TYR A 1 488 ? 6.905    -43.506 -9.383  1.00 28.82  ? 527  TYR A CE1 1 
ATOM   3675  C CE2 . TYR A 1 488 ? 5.323    -44.749 -10.680 1.00 30.78  ? 527  TYR A CE2 1 
ATOM   3676  C CZ  . TYR A 1 488 ? 6.072    -44.599 -9.534  1.00 36.84  ? 527  TYR A CZ  1 
ATOM   3677  O OH  . TYR A 1 488 ? 6.002    -45.538 -8.527  1.00 36.16  ? 527  TYR A OH  1 
ATOM   3678  N N   . ARG A 1 489 ? 9.409    -40.903 -12.787 1.00 32.91  ? 528  ARG A N   1 
ATOM   3679  C CA  . ARG A 1 489 ? 10.661   -40.858 -12.049 1.00 32.90  ? 528  ARG A CA  1 
ATOM   3680  C C   . ARG A 1 489 ? 10.562   -39.846 -10.920 1.00 27.92  ? 528  ARG A C   1 
ATOM   3681  O O   . ARG A 1 489 ? 10.252   -38.688 -11.156 1.00 30.62  ? 528  ARG A O   1 
ATOM   3682  C CB  . ARG A 1 489 ? 11.799   -40.425 -12.976 1.00 32.36  ? 528  ARG A CB  1 
ATOM   3683  C CG  . ARG A 1 489 ? 11.801   -41.090 -14.350 1.00 33.93  ? 528  ARG A CG  1 
ATOM   3684  C CD  . ARG A 1 489 ? 12.635   -42.379 -14.382 1.00 41.60  ? 528  ARG A CD  1 
ATOM   3685  N NE  . ARG A 1 489 ? 12.459   -43.031 -15.676 1.00 39.20  ? 528  ARG A NE  1 
ATOM   3686  C CZ  . ARG A 1 489 ? 11.581   -44.002 -15.902 1.00 40.10  ? 528  ARG A CZ  1 
ATOM   3687  N NH1 . ARG A 1 489 ? 10.832   -44.469 -14.906 1.00 35.02  ? 528  ARG A NH1 1 
ATOM   3688  N NH2 . ARG A 1 489 ? 11.465   -44.513 -17.119 1.00 39.28  ? 528  ARG A NH2 1 
ATOM   3689  N N   . LEU A 1 490 ? 10.862   -40.280 -9.705  1.00 24.92  ? 529  LEU A N   1 
ATOM   3690  C CA  . LEU A 1 490 ? 11.024   -39.376 -8.578  1.00 29.18  ? 529  LEU A CA  1 
ATOM   3691  C C   . LEU A 1 490 ? 12.466   -38.842 -8.506  1.00 32.02  ? 529  LEU A C   1 
ATOM   3692  O O   . LEU A 1 490 ? 13.434   -39.598 -8.653  1.00 28.54  ? 529  LEU A O   1 
ATOM   3693  C CB  . LEU A 1 490 ? 10.633   -40.087 -7.286  1.00 26.00  ? 529  LEU A CB  1 
ATOM   3694  C CG  . LEU A 1 490 ? 9.127    -40.360 -7.167  1.00 28.62  ? 529  LEU A CG  1 
ATOM   3695  C CD1 . LEU A 1 490 ? 8.830    -41.437 -6.135  1.00 25.61  ? 529  LEU A CD1 1 
ATOM   3696  C CD2 . LEU A 1 490 ? 8.367    -39.064 -6.841  1.00 22.25  ? 529  LEU A CD2 1 
ATOM   3697  N N   . LEU A 1 491 ? 12.597   -37.536 -8.286  1.00 23.93  ? 530  LEU A N   1 
ATOM   3698  C CA  . LEU A 1 491 ? 13.897   -36.863 -8.291  1.00 23.68  ? 530  LEU A CA  1 
ATOM   3699  C C   . LEU A 1 491 ? 14.266   -36.342 -6.919  1.00 27.44  ? 530  LEU A C   1 
ATOM   3700  O O   . LEU A 1 491 ? 13.530   -35.540 -6.342  1.00 26.40  ? 530  LEU A O   1 
ATOM   3701  C CB  . LEU A 1 491 ? 13.858   -35.665 -9.248  1.00 33.72  ? 530  LEU A CB  1 
ATOM   3702  C CG  . LEU A 1 491 ? 14.094   -35.855 -10.752 1.00 41.50  ? 530  LEU A CG  1 
ATOM   3703  C CD1 . LEU A 1 491 ? 14.018   -37.318 -11.172 1.00 28.40  ? 530  LEU A CD1 1 
ATOM   3704  C CD2 . LEU A 1 491 ? 13.152   -34.988 -11.588 1.00 29.49  ? 530  LEU A CD2 1 
ATOM   3705  N N   . THR A 1 492 ? 15.425   -36.751 -6.409  1.00 25.46  ? 531  THR A N   1 
ATOM   3706  C CA  . THR A 1 492 ? 15.885   -36.254 -5.122  1.00 26.15  ? 531  THR A CA  1 
ATOM   3707  C C   . THR A 1 492 ? 16.552   -34.874 -5.239  1.00 28.84  ? 531  THR A C   1 
ATOM   3708  O O   . THR A 1 492 ? 17.429   -34.678 -6.077  1.00 26.09  ? 531  THR A O   1 
ATOM   3709  C CB  . THR A 1 492 ? 16.858   -37.244 -4.464  1.00 28.56  ? 531  THR A CB  1 
ATOM   3710  O OG1 . THR A 1 492 ? 16.147   -38.428 -4.101  1.00 29.80  ? 531  THR A OG1 1 
ATOM   3711  C CG2 . THR A 1 492 ? 17.475   -36.640 -3.213  1.00 28.21  ? 531  THR A CG2 1 
ATOM   3712  N N   . ASP A 1 493 ? 16.115   -33.922 -4.407  1.00 25.45  ? 532  ASP A N   1 
ATOM   3713  C CA  . ASP A 1 493 ? 16.751   -32.602 -4.317  1.00 25.31  ? 532  ASP A CA  1 
ATOM   3714  C C   . ASP A 1 493 ? 16.793   -31.869 -5.665  1.00 28.01  ? 532  ASP A C   1 
ATOM   3715  O O   . ASP A 1 493 ? 17.852   -31.760 -6.283  1.00 27.83  ? 532  ASP A O   1 
ATOM   3716  C CB  . ASP A 1 493 ? 18.154   -32.747 -3.721  1.00 26.02  ? 532  ASP A CB  1 
ATOM   3717  C CG  . ASP A 1 493 ? 18.904   -31.420 -3.614  1.00 36.51  ? 532  ASP A CG  1 
ATOM   3718  O OD1 . ASP A 1 493 ? 18.272   -30.368 -3.326  1.00 28.36  ? 532  ASP A OD1 1 
ATOM   3719  O OD2 . ASP A 1 493 ? 20.146   -31.451 -3.798  1.00 28.41  ? 532  ASP A OD2 1 
ATOM   3720  N N   . ILE A 1 494 ? 15.646   -31.348 -6.098  1.00 26.15  ? 533  ILE A N   1 
ATOM   3721  C CA  . ILE A 1 494 ? 15.487   -30.865 -7.472  1.00 26.96  ? 533  ILE A CA  1 
ATOM   3722  C C   . ILE A 1 494 ? 16.037   -29.471 -7.732  1.00 27.64  ? 533  ILE A C   1 
ATOM   3723  O O   . ILE A 1 494 ? 15.917   -28.576 -6.900  1.00 28.11  ? 533  ILE A O   1 
ATOM   3724  C CB  . ILE A 1 494 ? 14.007   -30.845 -7.937  1.00 24.31  ? 533  ILE A CB  1 
ATOM   3725  C CG1 . ILE A 1 494 ? 13.100   -30.241 -6.859  1.00 24.63  ? 533  ILE A CG1 1 
ATOM   3726  C CG2 . ILE A 1 494 ? 13.531   -32.249 -8.357  1.00 24.10  ? 533  ILE A CG2 1 
ATOM   3727  C CD1 . ILE A 1 494 ? 11.669   -30.120 -7.311  1.00 23.85  ? 533  ILE A CD1 1 
ATOM   3728  N N   . LEU A 1 495 ? 16.626   -29.303 -8.911  1.00 24.31  ? 534  LEU A N   1 
ATOM   3729  C CA  . LEU A 1 495 ? 16.998   -27.989 -9.433  1.00 26.37  ? 534  LEU A CA  1 
ATOM   3730  C C   . LEU A 1 495 ? 15.747   -27.165 -9.675  1.00 28.06  ? 534  LEU A C   1 
ATOM   3731  O O   . LEU A 1 495 ? 14.662   -27.723 -9.846  1.00 27.87  ? 534  LEU A O   1 
ATOM   3732  C CB  . LEU A 1 495 ? 17.671   -28.155 -10.794 1.00 32.49  ? 534  LEU A CB  1 
ATOM   3733  C CG  . LEU A 1 495 ? 19.175   -28.394 -10.987 1.00 41.71  ? 534  LEU A CG  1 
ATOM   3734  C CD1 . LEU A 1 495 ? 19.906   -28.792 -9.722  1.00 29.32  ? 534  LEU A CD1 1 
ATOM   3735  C CD2 . LEU A 1 495 ? 19.391   -29.402 -12.103 1.00 27.58  ? 534  LEU A CD2 1 
ATOM   3736  N N   . GLY A 1 496 ? 15.914   -25.846 -9.747  1.00 26.09  ? 535  GLY A N   1 
ATOM   3737  C CA  . GLY A 1 496 ? 14.859   -24.961 -10.208 1.00 26.26  ? 535  GLY A CA  1 
ATOM   3738  C C   . GLY A 1 496 ? 14.221   -25.485 -11.488 1.00 34.41  ? 535  GLY A C   1 
ATOM   3739  O O   . GLY A 1 496 ? 12.998   -25.646 -11.570 1.00 24.59  ? 535  GLY A O   1 
ATOM   3740  N N   . ILE A 1 497 ? 15.049   -25.772 -12.489 1.00 28.41  ? 536  ILE A N   1 
ATOM   3741  C CA  . ILE A 1 497 ? 14.534   -26.231 -13.774 1.00 29.52  ? 536  ILE A CA  1 
ATOM   3742  C C   . ILE A 1 497 ? 13.735   -27.535 -13.680 1.00 33.03  ? 536  ILE A C   1 
ATOM   3743  O O   . ILE A 1 497 ? 12.807   -27.750 -14.466 1.00 31.86  ? 536  ILE A O   1 
ATOM   3744  C CB  . ILE A 1 497 ? 15.635   -26.353 -14.849 1.00 35.27  ? 536  ILE A CB  1 
ATOM   3745  C CG1 . ILE A 1 497 ? 15.002   -26.571 -16.224 1.00 29.48  ? 536  ILE A CG1 1 
ATOM   3746  C CG2 . ILE A 1 497 ? 16.645   -27.476 -14.497 1.00 22.68  ? 536  ILE A CG2 1 
ATOM   3747  C CD1 . ILE A 1 497 ? 15.976   -26.344 -17.387 1.00 28.92  ? 536  ILE A CD1 1 
ATOM   3748  N N   . GLU A 1 498 ? 14.080   -28.395 -12.722 1.00 27.95  ? 537  GLU A N   1 
ATOM   3749  C CA  . GLU A 1 498 ? 13.339   -29.640 -12.538 1.00 25.81  ? 537  GLU A CA  1 
ATOM   3750  C C   . GLU A 1 498 ? 11.988   -29.397 -11.864 1.00 33.80  ? 537  GLU A C   1 
ATOM   3751  O O   . GLU A 1 498 ? 11.064   -30.188 -12.012 1.00 26.89  ? 537  GLU A O   1 
ATOM   3752  C CB  . GLU A 1 498 ? 14.160   -30.659 -11.742 1.00 24.38  ? 537  GLU A CB  1 
ATOM   3753  C CG  . GLU A 1 498 ? 15.392   -31.166 -12.501 1.00 30.33  ? 537  GLU A CG  1 
ATOM   3754  C CD  . GLU A 1 498 ? 16.290   -32.034 -11.638 1.00 28.88  ? 537  GLU A CD  1 
ATOM   3755  O OE1 . GLU A 1 498 ? 16.450   -31.711 -10.443 1.00 25.34  ? 537  GLU A OE1 1 
ATOM   3756  O OE2 . GLU A 1 498 ? 16.823   -33.043 -12.151 1.00 29.97  ? 537  GLU A OE2 1 
ATOM   3757  N N   . ASP A 1 499 ? 11.890   -28.305 -11.110 1.00 35.50  ? 538  ASP A N   1 
ATOM   3758  C CA  . ASP A 1 499 ? 10.619   -27.875 -10.542 1.00 29.21  ? 538  ASP A CA  1 
ATOM   3759  C C   . ASP A 1 499 ? 9.736    -27.341 -11.673 1.00 31.05  ? 538  ASP A C   1 
ATOM   3760  O O   . ASP A 1 499 ? 8.664    -27.880 -11.924 1.00 27.23  ? 538  ASP A O   1 
ATOM   3761  C CB  . ASP A 1 499 ? 10.850   -26.806 -9.457  1.00 32.30  ? 538  ASP A CB  1 
ATOM   3762  C CG  . ASP A 1 499 ? 9.621    -26.554 -8.595  1.00 34.83  ? 538  ASP A CG  1 
ATOM   3763  O OD1 . ASP A 1 499 ? 8.542    -27.108 -8.906  1.00 33.15  ? 538  ASP A OD1 1 
ATOM   3764  O OD2 . ASP A 1 499 ? 9.743    -25.788 -7.607  1.00 32.81  ? 538  ASP A OD2 1 
ATOM   3765  N N   . TYR A 1 500 ? 10.179   -26.318 -12.407 1.00 29.75  ? 539  TYR A N   1 
ATOM   3766  C CA  . TYR A 1 500 ? 9.262    -25.794 -13.418 1.00 35.35  ? 539  TYR A CA  1 
ATOM   3767  C C   . TYR A 1 500 ? 8.934    -26.707 -14.605 1.00 36.47  ? 539  TYR A C   1 
ATOM   3768  O O   . TYR A 1 500 ? 7.859    -26.600 -15.175 1.00 29.58  ? 539  TYR A O   1 
ATOM   3769  C CB  . TYR A 1 500 ? 9.548    -24.352 -13.846 1.00 46.67  ? 539  TYR A CB  1 
ATOM   3770  C CG  . TYR A 1 500 ? 10.880   -24.056 -14.474 1.00 39.33  ? 539  TYR A CG  1 
ATOM   3771  C CD1 . TYR A 1 500 ? 11.880   -23.419 -13.735 1.00 42.27  ? 539  TYR A CD1 1 
ATOM   3772  C CD2 . TYR A 1 500 ? 11.124   -24.331 -15.817 1.00 40.70  ? 539  TYR A CD2 1 
ATOM   3773  C CE1 . TYR A 1 500 ? 13.103   -23.096 -14.299 1.00 32.94  ? 539  TYR A CE1 1 
ATOM   3774  C CE2 . TYR A 1 500 ? 12.362   -24.008 -16.402 1.00 39.97  ? 539  TYR A CE2 1 
ATOM   3775  C CZ  . TYR A 1 500 ? 13.342   -23.390 -15.629 1.00 40.95  ? 539  TYR A CZ  1 
ATOM   3776  O OH  . TYR A 1 500 ? 14.568   -23.064 -16.163 1.00 39.51  ? 539  TYR A OH  1 
ATOM   3777  N N   . ASN A 1 501 ? 9.835    -27.613 -14.957 1.00 30.70  ? 540  ASN A N   1 
ATOM   3778  C CA  . ASN A 1 501 ? 9.538    -28.580 -16.003 1.00 31.73  ? 540  ASN A CA  1 
ATOM   3779  C C   . ASN A 1 501 ? 8.975    -29.872 -15.406 1.00 29.59  ? 540  ASN A C   1 
ATOM   3780  O O   . ASN A 1 501 ? 8.644    -30.809 -16.125 1.00 32.26  ? 540  ASN A O   1 
ATOM   3781  C CB  . ASN A 1 501 ? 10.791   -28.873 -16.843 1.00 31.68  ? 540  ASN A CB  1 
ATOM   3782  C CG  . ASN A 1 501 ? 11.074   -27.787 -17.865 1.00 34.97  ? 540  ASN A CG  1 
ATOM   3783  O OD1 . ASN A 1 501 ? 10.160   -27.097 -18.313 1.00 33.76  ? 540  ASN A OD1 1 
ATOM   3784  N ND2 . ASN A 1 501 ? 12.341   -27.639 -18.251 1.00 34.64  ? 540  ASN A ND2 1 
ATOM   3785  N N   . GLY A 1 502 ? 8.871    -29.897 -14.083 1.00 28.23  ? 541  GLY A N   1 
ATOM   3786  C CA  . GLY A 1 502 ? 8.435    -31.069 -13.346 1.00 31.59  ? 541  GLY A CA  1 
ATOM   3787  C C   . GLY A 1 502 ? 6.979    -31.060 -12.913 1.00 31.87  ? 541  GLY A C   1 
ATOM   3788  O O   . GLY A 1 502 ? 6.220    -30.146 -13.234 1.00 27.51  ? 541  GLY A O   1 
ATOM   3789  N N   . ASP A 1 503 ? 6.589    -32.093 -12.175 1.00 25.31  ? 542  ASP A N   1 
ATOM   3790  C CA  . ASP A 1 503 ? 5.184    -32.293 -11.856 1.00 31.36  ? 542  ASP A CA  1 
ATOM   3791  C C   . ASP A 1 503 ? 4.852    -31.984 -10.403 1.00 30.69  ? 542  ASP A C   1 
ATOM   3792  O O   . ASP A 1 503 ? 3.681    -31.964 -10.035 1.00 29.48  ? 542  ASP A O   1 
ATOM   3793  C CB  . ASP A 1 503 ? 4.759    -33.726 -12.171 1.00 23.20  ? 542  ASP A CB  1 
ATOM   3794  C CG  . ASP A 1 503 ? 4.733    -34.009 -13.655 1.00 29.53  ? 542  ASP A CG  1 
ATOM   3795  O OD1 . ASP A 1 503 ? 4.533    -33.059 -14.432 1.00 28.31  ? 542  ASP A OD1 1 
ATOM   3796  O OD2 . ASP A 1 503 ? 4.903    -35.182 -14.037 1.00 34.42  ? 542  ASP A OD2 1 
ATOM   3797  N N   . MET A 1 504 ? 5.872    -31.782 -9.577  1.00 27.31  ? 543  MET A N   1 
ATOM   3798  C CA  . MET A 1 504 ? 5.632    -31.429 -8.183  1.00 26.70  ? 543  MET A CA  1 
ATOM   3799  C C   . MET A 1 504 ? 6.874    -30.860 -7.478  1.00 31.34  ? 543  MET A C   1 
ATOM   3800  O O   . MET A 1 504 ? 8.025    -31.050 -7.913  1.00 27.79  ? 543  MET A O   1 
ATOM   3801  C CB  . MET A 1 504 ? 5.081    -32.635 -7.397  1.00 31.24  ? 543  MET A CB  1 
ATOM   3802  C CG  . MET A 1 504 ? 6.151    -33.605 -6.900  1.00 27.16  ? 543  MET A CG  1 
ATOM   3803  S SD  . MET A 1 504 ? 5.508    -35.134 -6.137  1.00 28.85  ? 543  MET A SD  1 
ATOM   3804  C CE  . MET A 1 504 ? 7.066    -35.855 -5.567  1.00 24.27  ? 543  MET A CE  1 
ATOM   3805  N N   . ASP A 1 505 ? 6.616    -30.150 -6.386  1.00 25.89  ? 544  ASP A N   1 
ATOM   3806  C CA  . ASP A 1 505 ? 7.653    -29.706 -5.469  1.00 29.04  ? 544  ASP A CA  1 
ATOM   3807  C C   . ASP A 1 505 ? 7.224    -30.212 -4.101  1.00 28.92  ? 544  ASP A C   1 
ATOM   3808  O O   . ASP A 1 505 ? 6.408    -29.584 -3.416  1.00 28.31  ? 544  ASP A O   1 
ATOM   3809  C CB  . ASP A 1 505 ? 7.800    -28.180 -5.489  1.00 26.53  ? 544  ASP A CB  1 
ATOM   3810  C CG  . ASP A 1 505 ? 9.044    -27.705 -4.757  1.00 32.19  ? 544  ASP A CG  1 
ATOM   3811  O OD1 . ASP A 1 505 ? 9.911    -28.554 -4.447  1.00 27.44  ? 544  ASP A OD1 1 
ATOM   3812  O OD2 . ASP A 1 505 ? 9.172    -26.486 -4.504  1.00 29.89  ? 544  ASP A OD2 1 
ATOM   3813  N N   . PHE A 1 506 ? 7.752    -31.381 -3.735  1.00 24.88  ? 545  PHE A N   1 
ATOM   3814  C CA  . PHE A 1 506 ? 7.323    -32.128 -2.552  1.00 24.24  ? 545  PHE A CA  1 
ATOM   3815  C C   . PHE A 1 506 ? 8.376    -31.914 -1.465  1.00 29.42  ? 545  PHE A C   1 
ATOM   3816  O O   . PHE A 1 506 ? 9.395    -32.598 -1.416  1.00 26.30  ? 545  PHE A O   1 
ATOM   3817  C CB  . PHE A 1 506 ? 7.179    -33.614 -2.943  1.00 24.32  ? 545  PHE A CB  1 
ATOM   3818  C CG  . PHE A 1 506 ? 6.564    -34.520 -1.874  1.00 28.66  ? 545  PHE A CG  1 
ATOM   3819  C CD1 . PHE A 1 506 ? 7.323    -34.985 -0.806  1.00 30.26  ? 545  PHE A CD1 1 
ATOM   3820  C CD2 . PHE A 1 506 ? 5.257    -34.982 -2.003  1.00 21.77  ? 545  PHE A CD2 1 
ATOM   3821  C CE1 . PHE A 1 506 ? 6.773    -35.851 0.142   1.00 27.73  ? 545  PHE A CE1 1 
ATOM   3822  C CE2 . PHE A 1 506 ? 4.698    -35.848 -1.059  1.00 28.45  ? 545  PHE A CE2 1 
ATOM   3823  C CZ  . PHE A 1 506 ? 5.441    -36.275 0.013   1.00 24.38  ? 545  PHE A CZ  1 
ATOM   3824  N N   . LYS A 1 507 ? 8.119    -30.944 -0.600  1.00 26.56  ? 546  LYS A N   1 
ATOM   3825  C CA  . LYS A 1 507 ? 9.082    -30.509 0.392   1.00 22.48  ? 546  LYS A CA  1 
ATOM   3826  C C   . LYS A 1 507 ? 8.786    -31.151 1.742   1.00 29.94  ? 546  LYS A C   1 
ATOM   3827  O O   . LYS A 1 507 ? 7.712    -30.968 2.318   1.00 25.72  ? 546  LYS A O   1 
ATOM   3828  C CB  . LYS A 1 507 ? 9.070    -28.975 0.498   1.00 20.07  ? 546  LYS A CB  1 
ATOM   3829  C CG  . LYS A 1 507 ? 9.408    -28.281 -0.831  1.00 27.44  ? 546  LYS A CG  1 
ATOM   3830  C CD  . LYS A 1 507 ? 9.090    -26.765 -0.839  1.00 26.97  ? 546  LYS A CD  1 
ATOM   3831  C CE  . LYS A 1 507 ? 7.603    -26.504 -0.980  1.00 31.71  ? 546  LYS A CE  1 
ATOM   3832  N NZ  . LYS A 1 507 ? 7.270    -25.031 -1.094  1.00 31.26  ? 546  LYS A NZ  1 
ATOM   3833  N N   . ILE A 1 508 ? 9.740    -31.926 2.244   1.00 26.68  ? 547  ILE A N   1 
ATOM   3834  C CA  . ILE A 1 508 ? 9.515    -32.641 3.482   1.00 22.24  ? 547  ILE A CA  1 
ATOM   3835  C C   . ILE A 1 508 ? 10.743   -32.536 4.360   1.00 23.04  ? 547  ILE A C   1 
ATOM   3836  O O   . ILE A 1 508 ? 11.867   -32.507 3.871   1.00 27.27  ? 547  ILE A O   1 
ATOM   3837  C CB  . ILE A 1 508 ? 9.096    -34.099 3.211   1.00 28.46  ? 547  ILE A CB  1 
ATOM   3838  C CG1 . ILE A 1 508 ? 8.657    -34.782 4.506   1.00 35.12  ? 547  ILE A CG1 1 
ATOM   3839  C CG2 . ILE A 1 508 ? 10.225   -34.864 2.527   1.00 26.04  ? 547  ILE A CG2 1 
ATOM   3840  C CD1 . ILE A 1 508 ? 7.920    -36.090 4.275   1.00 30.88  ? 547  ILE A CD1 1 
ATOM   3841  N N   . ALA A 1 509 ? 10.514   -32.439 5.662   1.00 25.36  ? 548  ALA A N   1 
ATOM   3842  C CA  . ALA A 1 509 ? 11.582   -32.205 6.617   1.00 25.12  ? 548  ALA A CA  1 
ATOM   3843  C C   . ALA A 1 509 ? 11.330   -33.018 7.880   1.00 30.45  ? 548  ALA A C   1 
ATOM   3844  O O   . ALA A 1 509 ? 10.197   -33.463 8.122   1.00 29.05  ? 548  ALA A O   1 
ATOM   3845  C CB  . ALA A 1 509 ? 11.676   -30.704 6.954   1.00 22.70  ? 548  ALA A CB  1 
ATOM   3846  N N   . GLY A 1 510 ? 12.381   -33.209 8.674   1.00 23.05  ? 549  GLY A N   1 
ATOM   3847  C CA  . GLY A 1 510 ? 12.267   -33.892 9.954   1.00 23.59  ? 549  GLY A CA  1 
ATOM   3848  C C   . GLY A 1 510 ? 13.633   -34.193 10.560  1.00 24.54  ? 549  GLY A C   1 
ATOM   3849  O O   . GLY A 1 510 ? 14.622   -33.555 10.213  1.00 30.41  ? 549  GLY A O   1 
ATOM   3850  N N   . THR A 1 511 ? 13.672   -35.152 11.482  1.00 24.51  ? 550  THR A N   1 
ATOM   3851  C CA  . THR A 1 511 ? 14.882   -35.524 12.206  1.00 22.51  ? 550  THR A CA  1 
ATOM   3852  C C   . THR A 1 511 ? 15.342   -36.866 11.666  1.00 24.33  ? 550  THR A C   1 
ATOM   3853  O O   . THR A 1 511 ? 14.767   -37.388 10.715  1.00 28.87  ? 550  THR A O   1 
ATOM   3854  C CB  . THR A 1 511 ? 14.620   -35.692 13.726  1.00 25.02  ? 550  THR A CB  1 
ATOM   3855  O OG1 . THR A 1 511 ? 13.779   -36.842 13.950  1.00 23.48  ? 550  THR A OG1 1 
ATOM   3856  C CG2 . THR A 1 511 ? 13.957   -34.433 14.316  1.00 23.18  ? 550  THR A CG2 1 
ATOM   3857  N N   . ASN A 1 512 ? 16.369   -37.445 12.270  1.00 30.89  ? 551  ASN A N   1 
ATOM   3858  C CA  . ASN A 1 512 ? 16.784   -38.781 11.838  1.00 34.45  ? 551  ASN A CA  1 
ATOM   3859  C C   . ASN A 1 512 ? 15.717   -39.847 12.133  1.00 35.25  ? 551  ASN A C   1 
ATOM   3860  O O   . ASN A 1 512 ? 15.661   -40.872 11.457  1.00 38.95  ? 551  ASN A O   1 
ATOM   3861  C CB  . ASN A 1 512 ? 18.163   -39.169 12.411  1.00 31.19  ? 551  ASN A CB  1 
ATOM   3862  C CG  . ASN A 1 512 ? 18.179   -39.246 13.938  1.00 46.32  ? 551  ASN A CG  1 
ATOM   3863  O OD1 . ASN A 1 512 ? 17.290   -38.717 14.614  1.00 39.94  ? 551  ASN A OD1 1 
ATOM   3864  N ND2 . ASN A 1 512 ? 19.206   -39.902 14.488  1.00 46.62  ? 551  ASN A ND2 1 
ATOM   3865  N N   . LYS A 1 513 ? 14.852   -39.592 13.114  1.00 30.27  ? 552  LYS A N   1 
ATOM   3866  C CA  . LYS A 1 513 ? 13.844   -40.591 13.521  1.00 27.96  ? 552  LYS A CA  1 
ATOM   3867  C C   . LYS A 1 513 ? 12.406   -40.312 13.058  1.00 32.55  ? 552  LYS A C   1 
ATOM   3868  O O   . LYS A 1 513 ? 11.551   -41.205 13.094  1.00 33.20  ? 552  LYS A O   1 
ATOM   3869  C CB  . LYS A 1 513 ? 13.845   -40.755 15.042  1.00 31.07  ? 552  LYS A CB  1 
ATOM   3870  C CG  . LYS A 1 513 ? 15.174   -41.253 15.607  1.00 40.08  ? 552  LYS A CG  1 
ATOM   3871  C CD  . LYS A 1 513 ? 15.706   -42.422 14.768  1.00 55.60  ? 552  LYS A CD  1 
ATOM   3872  C CE  . LYS A 1 513 ? 16.958   -43.056 15.386  1.00 64.11  ? 552  LYS A CE  1 
ATOM   3873  N NZ  . LYS A 1 513 ? 17.575   -44.064 14.470  1.00 69.23  ? 552  LYS A NZ  1 
ATOM   3874  N N   . GLY A 1 514 ? 12.120   -39.090 12.628  1.00 29.69  ? 553  GLY A N   1 
ATOM   3875  C CA  . GLY A 1 514 ? 10.745   -38.771 12.286  1.00 31.01  ? 553  GLY A CA  1 
ATOM   3876  C C   . GLY A 1 514 ? 10.505   -37.580 11.385  1.00 26.74  ? 553  GLY A C   1 
ATOM   3877  O O   . GLY A 1 514 ? 11.440   -36.906 10.943  1.00 25.52  ? 553  GLY A O   1 
ATOM   3878  N N   . ILE A 1 515 ? 9.226    -37.319 11.137  1.00 26.18  ? 554  ILE A N   1 
ATOM   3879  C CA  . ILE A 1 515 ? 8.793    -36.289 10.209  1.00 25.38  ? 554  ILE A CA  1 
ATOM   3880  C C   . ILE A 1 515 ? 8.222    -35.108 10.981  1.00 28.16  ? 554  ILE A C   1 
ATOM   3881  O O   . ILE A 1 515 ? 7.422    -35.290 11.919  1.00 24.90  ? 554  ILE A O   1 
ATOM   3882  C CB  . ILE A 1 515 ? 7.730    -36.858 9.238   1.00 25.78  ? 554  ILE A CB  1 
ATOM   3883  C CG1 . ILE A 1 515 ? 8.321    -38.032 8.445   1.00 28.23  ? 554  ILE A CG1 1 
ATOM   3884  C CG2 . ILE A 1 515 ? 7.185    -35.755 8.302   1.00 24.65  ? 554  ILE A CG2 1 
ATOM   3885  C CD1 . ILE A 1 515 ? 7.315    -38.790 7.586   1.00 25.01  ? 554  ILE A CD1 1 
ATOM   3886  N N   . THR A 1 516 ? 8.633    -33.903 10.597  1.00 25.23  ? 555  THR A N   1 
ATOM   3887  C CA  . THR A 1 516 ? 8.139    -32.694 11.249  1.00 20.13  ? 555  THR A CA  1 
ATOM   3888  C C   . THR A 1 516 ? 7.296    -31.790 10.345  1.00 27.33  ? 555  THR A C   1 
ATOM   3889  O O   . THR A 1 516 ? 6.441    -31.062 10.836  1.00 28.74  ? 555  THR A O   1 
ATOM   3890  C CB  . THR A 1 516 ? 9.270    -31.845 11.878  1.00 22.93  ? 555  THR A CB  1 
ATOM   3891  O OG1 . THR A 1 516 ? 10.215   -31.470 10.867  1.00 25.42  ? 555  THR A OG1 1 
ATOM   3892  C CG2 . THR A 1 516 ? 9.973    -32.601 13.028  1.00 22.80  ? 555  THR A CG2 1 
ATOM   3893  N N   . ALA A 1 517 ? 7.532    -31.820 9.039   1.00 24.04  ? 556  ALA A N   1 
ATOM   3894  C CA  . ALA A 1 517 ? 6.789    -30.944 8.139   1.00 23.52  ? 556  ALA A CA  1 
ATOM   3895  C C   . ALA A 1 517 ? 6.739    -31.470 6.718   1.00 31.56  ? 556  ALA A C   1 
ATOM   3896  O O   . ALA A 1 517 ? 7.658    -32.169 6.243   1.00 26.77  ? 556  ALA A O   1 
ATOM   3897  C CB  . ALA A 1 517 ? 7.360    -29.501 8.164   1.00 23.50  ? 556  ALA A CB  1 
ATOM   3898  N N   . LEU A 1 518 ? 5.645    -31.128 6.046   1.00 23.45  ? 557  LEU A N   1 
ATOM   3899  C CA  . LEU A 1 518 ? 5.443    -31.518 4.663   1.00 26.01  ? 557  LEU A CA  1 
ATOM   3900  C C   . LEU A 1 518 ? 4.636    -30.456 3.952   1.00 27.19  ? 557  LEU A C   1 
ATOM   3901  O O   . LEU A 1 518 ? 3.664    -29.931 4.492   1.00 25.68  ? 557  LEU A O   1 
ATOM   3902  C CB  . LEU A 1 518 ? 4.705    -32.854 4.569   1.00 23.80  ? 557  LEU A CB  1 
ATOM   3903  C CG  . LEU A 1 518 ? 4.120    -33.158 3.191   1.00 26.51  ? 557  LEU A CG  1 
ATOM   3904  C CD1 . LEU A 1 518 ? 5.237    -33.333 2.136   1.00 30.67  ? 557  LEU A CD1 1 
ATOM   3905  C CD2 . LEU A 1 518 ? 3.256    -34.395 3.251   1.00 26.10  ? 557  LEU A CD2 1 
ATOM   3906  N N   . GLN A 1 519 ? 5.057    -30.140 2.737   1.00 28.06  ? 558  GLN A N   1 
ATOM   3907  C CA  . GLN A 1 519 ? 4.300    -29.273 1.856   1.00 26.25  ? 558  GLN A CA  1 
ATOM   3908  C C   . GLN A 1 519 ? 4.427    -29.813 0.439   1.00 27.41  ? 558  GLN A C   1 
ATOM   3909  O O   . GLN A 1 519 ? 5.447    -29.626 -0.212  1.00 27.74  ? 558  GLN A O   1 
ATOM   3910  C CB  . GLN A 1 519 ? 4.803    -27.837 1.935   1.00 25.39  ? 558  GLN A CB  1 
ATOM   3911  C CG  . GLN A 1 519 ? 4.088    -26.900 0.991   1.00 27.78  ? 558  GLN A CG  1 
ATOM   3912  C CD  . GLN A 1 519 ? 4.357    -25.439 1.327   1.00 34.51  ? 558  GLN A CD  1 
ATOM   3913  O OE1 . GLN A 1 519 ? 5.050    -24.740 0.586   1.00 33.88  ? 558  GLN A OE1 1 
ATOM   3914  N NE2 . GLN A 1 519 ? 3.825    -24.978 2.459   1.00 36.30  ? 558  GLN A NE2 1 
ATOM   3915  N N   . ALA A 1 520 ? 3.384    -30.501 -0.018  1.00 21.44  ? 559  ALA A N   1 
ATOM   3916  C CA  . ALA A 1 520 ? 3.386    -31.105 -1.332  1.00 25.70  ? 559  ALA A CA  1 
ATOM   3917  C C   . ALA A 1 520 ? 2.625    -30.203 -2.282  1.00 31.04  ? 559  ALA A C   1 
ATOM   3918  O O   . ALA A 1 520 ? 1.412    -30.047 -2.178  1.00 29.54  ? 559  ALA A O   1 
ATOM   3919  C CB  . ALA A 1 520 ? 2.754    -32.512 -1.289  1.00 31.51  ? 559  ALA A CB  1 
ATOM   3920  N N   . ASP A 1 521 ? 3.360    -29.585 -3.192  1.00 28.94  ? 560  ASP A N   1 
ATOM   3921  C CA  . ASP A 1 521 ? 2.761    -28.755 -4.211  1.00 28.59  ? 560  ASP A CA  1 
ATOM   3922  C C   . ASP A 1 521 ? 2.771    -29.592 -5.479  1.00 34.21  ? 560  ASP A C   1 
ATOM   3923  O O   . ASP A 1 521 ? 3.831    -29.831 -6.070  1.00 29.88  ? 560  ASP A O   1 
ATOM   3924  C CB  . ASP A 1 521 ? 3.572    -27.465 -4.381  1.00 45.83  ? 560  ASP A CB  1 
ATOM   3925  C CG  . ASP A 1 521 ? 2.972    -26.521 -5.412  1.00 57.40  ? 560  ASP A CG  1 
ATOM   3926  O OD1 . ASP A 1 521 ? 3.414    -26.557 -6.579  1.00 56.53  ? 560  ASP A OD1 1 
ATOM   3927  O OD2 . ASP A 1 521 ? 2.069    -25.732 -5.054  1.00 66.50  ? 560  ASP A OD2 1 
ATOM   3928  N N   . ILE A 1 522 ? 1.591    -30.060 -5.874  1.00 27.77  ? 561  ILE A N   1 
ATOM   3929  C CA  . ILE A 1 522 ? 1.477    -30.993 -6.975  1.00 26.48  ? 561  ILE A CA  1 
ATOM   3930  C C   . ILE A 1 522 ? 0.848    -30.291 -8.169  1.00 33.14  ? 561  ILE A C   1 
ATOM   3931  O O   . ILE A 1 522 ? -0.182   -29.626 -8.035  1.00 31.78  ? 561  ILE A O   1 
ATOM   3932  C CB  . ILE A 1 522 ? 0.670    -32.228 -6.552  1.00 26.71  ? 561  ILE A CB  1 
ATOM   3933  C CG1 . ILE A 1 522 ? 1.452    -33.015 -5.490  1.00 26.41  ? 561  ILE A CG1 1 
ATOM   3934  C CG2 . ILE A 1 522 ? 0.349    -33.102 -7.763  1.00 26.60  ? 561  ILE A CG2 1 
ATOM   3935  C CD1 . ILE A 1 522 ? 0.603    -33.957 -4.659  1.00 30.15  ? 561  ILE A CD1 1 
ATOM   3936  N N   . LYS A 1 523 ? 1.473    -30.423 -9.337  1.00 28.03  ? 562  LYS A N   1 
ATOM   3937  C CA  . LYS A 1 523 ? 1.052    -29.636 -10.497 1.00 32.39  ? 562  LYS A CA  1 
ATOM   3938  C C   . LYS A 1 523 ? 0.241    -30.439 -11.504 1.00 35.52  ? 562  LYS A C   1 
ATOM   3939  O O   . LYS A 1 523 ? -0.426   -29.867 -12.361 1.00 38.38  ? 562  LYS A O   1 
ATOM   3940  C CB  . LYS A 1 523 ? 2.255    -28.940 -11.154 1.00 34.33  ? 562  LYS A CB  1 
ATOM   3941  C CG  . LYS A 1 523 ? 3.058    -28.111 -10.150 1.00 35.79  ? 562  LYS A CG  1 
ATOM   3942  C CD  . LYS A 1 523 ? 3.917    -27.037 -10.818 1.00 51.26  ? 562  LYS A CD  1 
ATOM   3943  C CE  . LYS A 1 523 ? 5.175    -27.632 -11.455 1.00 48.56  ? 562  LYS A CE  1 
ATOM   3944  N NZ  . LYS A 1 523 ? 5.823    -26.650 -12.373 1.00 53.59  ? 562  LYS A NZ  1 
ATOM   3945  N N   . LEU A 1 524 ? 0.288    -31.760 -11.390 1.00 28.41  ? 563  LEU A N   1 
ATOM   3946  C CA  . LEU A 1 524 ? -0.636   -32.625 -12.123 1.00 30.75  ? 563  LEU A CA  1 
ATOM   3947  C C   . LEU A 1 524 ? -2.000   -32.586 -11.439 1.00 28.19  ? 563  LEU A C   1 
ATOM   3948  O O   . LEU A 1 524 ? -2.102   -32.204 -10.279 1.00 26.73  ? 563  LEU A O   1 
ATOM   3949  C CB  . LEU A 1 524 ? -0.128   -34.074 -12.137 1.00 27.25  ? 563  LEU A CB  1 
ATOM   3950  C CG  . LEU A 1 524 ? 1.170    -34.355 -12.884 1.00 33.95  ? 563  LEU A CG  1 
ATOM   3951  C CD1 . LEU A 1 524 ? 1.694    -35.749 -12.534 1.00 25.49  ? 563  LEU A CD1 1 
ATOM   3952  C CD2 . LEU A 1 524 ? 0.933    -34.199 -14.388 1.00 35.51  ? 563  LEU A CD2 1 
ATOM   3953  N N   . PRO A 1 525 ? -3.055   -32.986 -12.156 1.00 30.05  ? 564  PRO A N   1 
ATOM   3954  C CA  . PRO A 1 525 ? -4.390   -33.065 -11.551 1.00 36.46  ? 564  PRO A CA  1 
ATOM   3955  C C   . PRO A 1 525 ? -4.494   -34.243 -10.580 1.00 33.35  ? 564  PRO A C   1 
ATOM   3956  O O   . PRO A 1 525 ? -5.354   -35.101 -10.738 1.00 33.12  ? 564  PRO A O   1 
ATOM   3957  C CB  . PRO A 1 525 ? -5.322   -33.287 -12.756 1.00 36.03  ? 564  PRO A CB  1 
ATOM   3958  C CG  . PRO A 1 525 ? -4.498   -32.966 -13.973 1.00 42.05  ? 564  PRO A CG  1 
ATOM   3959  C CD  . PRO A 1 525 ? -3.080   -33.274 -13.599 1.00 38.41  ? 564  PRO A CD  1 
ATOM   3960  N N   . GLY A 1 526 ? -3.634   -34.267 -9.572  1.00 30.89  ? 565  GLY A N   1 
ATOM   3961  C CA  . GLY A 1 526 ? -3.601   -35.366 -8.631  1.00 27.76  ? 565  GLY A CA  1 
ATOM   3962  C C   . GLY A 1 526 ? -2.614   -36.455 -9.039  1.00 31.30  ? 565  GLY A C   1 
ATOM   3963  O O   . GLY A 1 526 ? -2.329   -36.649 -10.225 1.00 29.04  ? 565  GLY A O   1 
ATOM   3964  N N   . ILE A 1 527 ? -2.071   -37.151 -8.044  1.00 27.74  ? 566  ILE A N   1 
ATOM   3965  C CA  . ILE A 1 527 ? -1.178   -38.276 -8.291  1.00 28.45  ? 566  ILE A CA  1 
ATOM   3966  C C   . ILE A 1 527 ? -1.523   -39.415 -7.343  1.00 34.08  ? 566  ILE A C   1 
ATOM   3967  O O   . ILE A 1 527 ? -2.142   -39.192 -6.294  1.00 28.07  ? 566  ILE A O   1 
ATOM   3968  C CB  . ILE A 1 527 ? 0.303    -37.903 -8.079  1.00 26.25  ? 566  ILE A CB  1 
ATOM   3969  C CG1 . ILE A 1 527 ? 0.519    -37.417 -6.648  1.00 28.57  ? 566  ILE A CG1 1 
ATOM   3970  C CG2 . ILE A 1 527 ? 0.774    -36.868 -9.118  1.00 27.16  ? 566  ILE A CG2 1 
ATOM   3971  C CD1 . ILE A 1 527 ? 1.962    -37.049 -6.343  1.00 32.76  ? 566  ILE A CD1 1 
ATOM   3972  N N   . PRO A 1 528 ? -1.123   -40.646 -7.710  1.00 35.05  ? 567  PRO A N   1 
ATOM   3973  C CA  . PRO A 1 528 ? -1.461   -41.819 -6.901  1.00 26.67  ? 567  PRO A CA  1 
ATOM   3974  C C   . PRO A 1 528 ? -0.790   -41.819 -5.541  1.00 32.49  ? 567  PRO A C   1 
ATOM   3975  O O   . PRO A 1 528 ? 0.304    -41.255 -5.366  1.00 28.29  ? 567  PRO A O   1 
ATOM   3976  C CB  . PRO A 1 528 ? -0.972   -42.985 -7.762  1.00 32.60  ? 567  PRO A CB  1 
ATOM   3977  C CG  . PRO A 1 528 ? -1.081   -42.460 -9.170  1.00 34.54  ? 567  PRO A CG  1 
ATOM   3978  C CD  . PRO A 1 528 ? -0.639   -41.025 -9.050  1.00 26.49  ? 567  PRO A CD  1 
ATOM   3979  N N   . ILE A 1 529 ? -1.463   -42.447 -4.580  1.00 21.67  ? 568  ILE A N   1 
ATOM   3980  C CA  . ILE A 1 529 ? -0.940   -42.582 -3.232  1.00 23.49  ? 568  ILE A CA  1 
ATOM   3981  C C   . ILE A 1 529 ? 0.450    -43.229 -3.265  1.00 28.12  ? 568  ILE A C   1 
ATOM   3982  O O   . ILE A 1 529 ? 1.333    -42.867 -2.500  1.00 29.61  ? 568  ILE A O   1 
ATOM   3983  C CB  . ILE A 1 529 ? -1.866   -43.462 -2.369  1.00 31.02  ? 568  ILE A CB  1 
ATOM   3984  C CG1 . ILE A 1 529 ? -3.189   -42.751 -2.074  1.00 35.72  ? 568  ILE A CG1 1 
ATOM   3985  C CG2 . ILE A 1 529 ? -1.202   -43.841 -1.049  1.00 33.94  ? 568  ILE A CG2 1 
ATOM   3986  C CD1 . ILE A 1 529 ? -4.208   -43.639 -1.310  1.00 33.43  ? 568  ILE A CD1 1 
ATOM   3987  N N   . LYS A 1 530 ? 0.626    -44.203 -4.150  1.00 30.89  ? 569  LYS A N   1 
ATOM   3988  C CA  . LYS A 1 530 ? 1.871    -44.954 -4.225  1.00 33.12  ? 569  LYS A CA  1 
ATOM   3989  C C   . LYS A 1 530 ? 3.045    -44.015 -4.524  1.00 28.50  ? 569  LYS A C   1 
ATOM   3990  O O   . LYS A 1 530 ? 4.117    -44.122 -3.929  1.00 30.02  ? 569  LYS A O   1 
ATOM   3991  C CB  . LYS A 1 530 ? 1.757    -46.045 -5.291  1.00 32.65  ? 569  LYS A CB  1 
ATOM   3992  C CG  . LYS A 1 530 ? 3.060    -46.795 -5.580  1.00 44.79  ? 569  LYS A CG  1 
ATOM   3993  C CD  . LYS A 1 530 ? 2.888    -47.736 -6.772  1.00 50.24  ? 569  LYS A CD  1 
ATOM   3994  C CE  . LYS A 1 530 ? 4.063    -48.716 -6.911  1.00 64.97  ? 569  LYS A CE  1 
ATOM   3995  N NZ  . LYS A 1 530 ? 5.037    -48.328 -7.980  1.00 54.62  ? 569  LYS A NZ  1 
ATOM   3996  N N   . ILE A 1 531 ? 2.837    -43.086 -5.444  1.00 31.57  ? 570  ILE A N   1 
ATOM   3997  C CA  . ILE A 1 531 ? 3.879    -42.128 -5.758  1.00 29.11  ? 570  ILE A CA  1 
ATOM   3998  C C   . ILE A 1 531 ? 4.246    -41.261 -4.559  1.00 28.42  ? 570  ILE A C   1 
ATOM   3999  O O   . ILE A 1 531 ? 5.440    -41.052 -4.294  1.00 27.18  ? 570  ILE A O   1 
ATOM   4000  C CB  . ILE A 1 531 ? 3.547    -41.266 -6.981  1.00 33.97  ? 570  ILE A CB  1 
ATOM   4001  C CG1 . ILE A 1 531 ? 3.326    -42.161 -8.197  1.00 29.07  ? 570  ILE A CG1 1 
ATOM   4002  C CG2 . ILE A 1 531 ? 4.677    -40.264 -7.249  1.00 30.46  ? 570  ILE A CG2 1 
ATOM   4003  C CD1 . ILE A 1 531 ? 3.258    -41.402 -9.526  1.00 30.49  ? 570  ILE A CD1 1 
ATOM   4004  N N   . VAL A 1 532 ? 3.264    -40.766 -3.803  1.00 26.86  ? 571  VAL A N   1 
ATOM   4005  C CA  . VAL A 1 532 ? 3.674    -39.995 -2.627  1.00 25.75  ? 571  VAL A CA  1 
ATOM   4006  C C   . VAL A 1 532 ? 4.343    -40.821 -1.518  1.00 23.22  ? 571  VAL A C   1 
ATOM   4007  O O   . VAL A 1 532 ? 5.262    -40.326 -0.856  1.00 22.10  ? 571  VAL A O   1 
ATOM   4008  C CB  . VAL A 1 532 ? 2.620    -38.941 -2.077  1.00 36.77  ? 571  VAL A CB  1 
ATOM   4009  C CG1 . VAL A 1 532 ? 1.509    -38.664 -3.059  1.00 24.83  ? 571  VAL A CG1 1 
ATOM   4010  C CG2 . VAL A 1 532 ? 2.115    -39.299 -0.692  1.00 28.65  ? 571  VAL A CG2 1 
ATOM   4011  N N   . MET A 1 533 ? 3.905    -42.066 -1.317  1.00 25.10  ? 572  MET A N   1 
ATOM   4012  C CA  . MET A 1 533 ? 4.574    -42.962 -0.361  1.00 26.24  ? 572  MET A CA  1 
ATOM   4013  C C   . MET A 1 533 ? 6.053    -43.141 -0.725  1.00 25.22  ? 572  MET A C   1 
ATOM   4014  O O   . MET A 1 533 ? 6.937    -43.107 0.140   1.00 24.68  ? 572  MET A O   1 
ATOM   4015  C CB  . MET A 1 533 ? 3.905    -44.345 -0.331  1.00 33.28  ? 572  MET A CB  1 
ATOM   4016  C CG  . MET A 1 533 ? 2.421    -44.328 0.076   1.00 37.89  ? 572  MET A CG  1 
ATOM   4017  S SD  . MET A 1 533 ? 2.191    -43.775 1.769   1.00 39.24  ? 572  MET A SD  1 
ATOM   4018  C CE  . MET A 1 533 ? 1.545    -42.131 1.535   1.00 34.89  ? 572  MET A CE  1 
ATOM   4019  N N   . GLU A 1 534 ? 6.304    -43.358 -2.009  1.00 23.50  ? 573  GLU A N   1 
ATOM   4020  C CA  . GLU A 1 534 ? 7.670    -43.551 -2.490  1.00 29.63  ? 573  GLU A CA  1 
ATOM   4021  C C   . GLU A 1 534 ? 8.466    -42.252 -2.352  1.00 29.59  ? 573  GLU A C   1 
ATOM   4022  O O   . GLU A 1 534 ? 9.640    -42.273 -1.974  1.00 24.47  ? 573  GLU A O   1 
ATOM   4023  C CB  . GLU A 1 534 ? 7.652    -44.046 -3.937  1.00 19.94  ? 573  GLU A CB  1 
ATOM   4024  C CG  . GLU A 1 534 ? 7.233    -45.514 -4.030  1.00 33.23  ? 573  GLU A CG  1 
ATOM   4025  C CD  . GLU A 1 534 ? 6.977    -45.986 -5.451  1.00 37.91  ? 573  GLU A CD  1 
ATOM   4026  O OE1 . GLU A 1 534 ? 7.266    -45.241 -6.410  1.00 39.21  ? 573  GLU A OE1 1 
ATOM   4027  O OE2 . GLU A 1 534 ? 6.472    -47.113 -5.603  1.00 39.35  ? 573  GLU A OE2 1 
ATOM   4028  N N   . ALA A 1 535 ? 7.811    -41.122 -2.615  1.00 27.15  ? 574  ALA A N   1 
ATOM   4029  C CA  . ALA A 1 535 ? 8.476    -39.825 -2.474  1.00 24.35  ? 574  ALA A CA  1 
ATOM   4030  C C   . ALA A 1 535 ? 8.943    -39.646 -1.041  1.00 26.11  ? 574  ALA A C   1 
ATOM   4031  O O   . ALA A 1 535 ? 10.081   -39.237 -0.791  1.00 24.73  ? 574  ALA A O   1 
ATOM   4032  C CB  . ALA A 1 535 ? 7.553    -38.678 -2.896  1.00 21.10  ? 574  ALA A CB  1 
ATOM   4033  N N   . ILE A 1 536 ? 8.069    -39.985 -0.097  1.00 23.13  ? 575  ILE A N   1 
ATOM   4034  C CA  . ILE A 1 536 ? 8.387    -39.849 1.323   1.00 23.84  ? 575  ILE A CA  1 
ATOM   4035  C C   . ILE A 1 536 ? 9.569    -40.733 1.756   1.00 27.17  ? 575  ILE A C   1 
ATOM   4036  O O   . ILE A 1 536 ? 10.426   -40.313 2.530   1.00 27.23  ? 575  ILE A O   1 
ATOM   4037  C CB  . ILE A 1 536 ? 7.163    -40.176 2.190   1.00 25.67  ? 575  ILE A CB  1 
ATOM   4038  C CG1 . ILE A 1 536 ? 6.102    -39.078 2.035   1.00 27.33  ? 575  ILE A CG1 1 
ATOM   4039  C CG2 . ILE A 1 536 ? 7.567    -40.344 3.652   1.00 22.23  ? 575  ILE A CG2 1 
ATOM   4040  C CD1 . ILE A 1 536 ? 4.787    -39.395 2.713   1.00 23.07  ? 575  ILE A CD1 1 
ATOM   4041  N N   . GLN A 1 537 ? 9.598    -41.964 1.256   1.00 27.31  ? 576  GLN A N   1 
ATOM   4042  C CA  . GLN A 1 537 ? 10.661   -42.896 1.591   1.00 27.53  ? 576  GLN A CA  1 
ATOM   4043  C C   . GLN A 1 537 ? 11.980   -42.415 0.959   1.00 28.03  ? 576  GLN A C   1 
ATOM   4044  O O   . GLN A 1 537 ? 13.031   -42.436 1.593   1.00 25.25  ? 576  GLN A O   1 
ATOM   4045  C CB  . GLN A 1 537 ? 10.283   -44.309 1.119   1.00 29.78  ? 576  GLN A CB  1 
ATOM   4046  C CG  . GLN A 1 537 ? 11.406   -45.323 1.240   1.00 31.01  ? 576  GLN A CG  1 
ATOM   4047  C CD  . GLN A 1 537 ? 12.042   -45.321 2.612   1.00 43.91  ? 576  GLN A CD  1 
ATOM   4048  O OE1 . GLN A 1 537 ? 11.354   -45.238 3.636   1.00 37.74  ? 576  GLN A OE1 1 
ATOM   4049  N NE2 . GLN A 1 537 ? 13.370   -45.406 2.644   1.00 37.99  ? 576  GLN A NE2 1 
ATOM   4050  N N   . GLN A 1 538 ? 11.898   -41.944 -0.283  1.00 27.00  ? 577  GLN A N   1 
ATOM   4051  C CA  . GLN A 1 538 ? 13.079   -41.448 -0.981  1.00 30.39  ? 577  GLN A CA  1 
ATOM   4052  C C   . GLN A 1 538 ? 13.633   -40.196 -0.296  1.00 33.96  ? 577  GLN A C   1 
ATOM   4053  O O   . GLN A 1 538 ? 14.845   -40.011 -0.213  1.00 25.91  ? 577  GLN A O   1 
ATOM   4054  C CB  . GLN A 1 538 ? 12.763   -41.183 -2.458  1.00 30.56  ? 577  GLN A CB  1 
ATOM   4055  C CG  . GLN A 1 538 ? 13.960   -40.715 -3.295  1.00 28.84  ? 577  GLN A CG  1 
ATOM   4056  C CD  . GLN A 1 538 ? 13.692   -40.750 -4.792  1.00 31.66  ? 577  GLN A CD  1 
ATOM   4057  O OE1 . GLN A 1 538 ? 13.014   -41.654 -5.295  1.00 26.59  ? 577  GLN A OE1 1 
ATOM   4058  N NE2 . GLN A 1 538 ? 14.219   -39.756 -5.514  1.00 24.72  ? 577  GLN A NE2 1 
ATOM   4059  N N   . ALA A 1 539 ? 12.742   -39.354 0.229   1.00 27.90  ? 578  ALA A N   1 
ATOM   4060  C CA  . ALA A 1 539 ? 13.172   -38.133 0.911   1.00 30.03  ? 578  ALA A CA  1 
ATOM   4061  C C   . ALA A 1 539 ? 13.804   -38.467 2.253   1.00 27.66  ? 578  ALA A C   1 
ATOM   4062  O O   . ALA A 1 539 ? 14.706   -37.773 2.739   1.00 24.75  ? 578  ALA A O   1 
ATOM   4063  C CB  . ALA A 1 539 ? 11.998   -37.196 1.098   1.00 26.98  ? 578  ALA A CB  1 
ATOM   4064  N N   . SER A 1 540 ? 13.308   -39.536 2.861   1.00 23.54  ? 579  SER A N   1 
ATOM   4065  C CA  . SER A 1 540 ? 13.856   -39.997 4.121   1.00 28.96  ? 579  SER A CA  1 
ATOM   4066  C C   . SER A 1 540 ? 15.343   -40.348 3.978   1.00 24.69  ? 579  SER A C   1 
ATOM   4067  O O   . SER A 1 540 ? 16.149   -40.052 4.863   1.00 27.64  ? 579  SER A O   1 
ATOM   4068  C CB  . SER A 1 540 ? 13.076   -41.219 4.599   1.00 28.75  ? 579  SER A CB  1 
ATOM   4069  O OG  . SER A 1 540 ? 13.673   -41.786 5.735   1.00 46.32  ? 579  SER A OG  1 
ATOM   4070  N N   . VAL A 1 541 ? 15.697   -40.988 2.872   1.00 24.96  ? 580  VAL A N   1 
ATOM   4071  C CA  . VAL A 1 541 ? 17.101   -41.331 2.621   1.00 28.45  ? 580  VAL A CA  1 
ATOM   4072  C C   . VAL A 1 541 ? 17.930   -40.037 2.494   1.00 31.34  ? 580  VAL A C   1 
ATOM   4073  O O   . VAL A 1 541 ? 18.958   -39.876 3.150   1.00 32.82  ? 580  VAL A O   1 
ATOM   4074  C CB  . VAL A 1 541 ? 17.257   -42.237 1.345   1.00 25.62  ? 580  VAL A CB  1 
ATOM   4075  C CG1 . VAL A 1 541 ? 18.740   -42.519 1.004   1.00 22.82  ? 580  VAL A CG1 1 
ATOM   4076  C CG2 . VAL A 1 541 ? 16.503   -43.552 1.516   1.00 31.90  ? 580  VAL A CG2 1 
ATOM   4077  N N   . ALA A 1 542 ? 17.476   -39.109 1.655   1.00 28.78  ? 581  ALA A N   1 
ATOM   4078  C CA  . ALA A 1 542 ? 18.211   -37.850 1.449   1.00 25.98  ? 581  ALA A CA  1 
ATOM   4079  C C   . ALA A 1 542 ? 18.317   -37.009 2.723   1.00 27.61  ? 581  ALA A C   1 
ATOM   4080  O O   . ALA A 1 542 ? 19.362   -36.415 3.015   1.00 26.00  ? 581  ALA A O   1 
ATOM   4081  C CB  . ALA A 1 542 ? 17.563   -37.041 0.330   1.00 26.07  ? 581  ALA A CB  1 
ATOM   4082  N N   . LYS A 1 543 ? 17.228   -36.946 3.481   1.00 28.83  ? 582  LYS A N   1 
ATOM   4083  C CA  . LYS A 1 543 ? 17.257   -36.217 4.744   1.00 32.16  ? 582  LYS A CA  1 
ATOM   4084  C C   . LYS A 1 543 ? 18.402   -36.700 5.636   1.00 26.09  ? 582  LYS A C   1 
ATOM   4085  O O   . LYS A 1 543 ? 19.151   -35.902 6.184   1.00 27.16  ? 582  LYS A O   1 
ATOM   4086  C CB  . LYS A 1 543 ? 15.931   -36.378 5.492   1.00 23.16  ? 582  LYS A CB  1 
ATOM   4087  C CG  . LYS A 1 543 ? 15.950   -35.792 6.912   1.00 27.10  ? 582  LYS A CG  1 
ATOM   4088  C CD  . LYS A 1 543 ? 14.596   -36.003 7.614   1.00 31.21  ? 582  LYS A CD  1 
ATOM   4089  C CE  . LYS A 1 543 ? 14.174   -37.471 7.581   1.00 27.79  ? 582  LYS A CE  1 
ATOM   4090  N NZ  . LYS A 1 543 ? 13.105   -37.756 8.587   1.00 31.47  ? 582  LYS A NZ  1 
ATOM   4091  N N   . LYS A 1 544 ? 18.503   -38.013 5.801   1.00 24.40  ? 583  LYS A N   1 
ATOM   4092  C CA  . LYS A 1 544 ? 19.542   -38.601 6.633   1.00 27.74  ? 583  LYS A CA  1 
ATOM   4093  C C   . LYS A 1 544 ? 20.936   -38.300 6.092   1.00 23.31  ? 583  LYS A C   1 
ATOM   4094  O O   . LYS A 1 544 ? 21.836   -38.016 6.859   1.00 25.25  ? 583  LYS A O   1 
ATOM   4095  C CB  . LYS A 1 544 ? 19.331   -40.109 6.761   1.00 33.10  ? 583  LYS A CB  1 
ATOM   4096  C CG  . LYS A 1 544 ? 18.017   -40.456 7.463   1.00 39.68  ? 583  LYS A CG  1 
ATOM   4097  C CD  . LYS A 1 544 ? 17.756   -41.942 7.429   1.00 37.24  ? 583  LYS A CD  1 
ATOM   4098  C CE  . LYS A 1 544 ? 16.497   -42.298 8.210   1.00 42.94  ? 583  LYS A CE  1 
ATOM   4099  N NZ  . LYS A 1 544 ? 16.255   -43.775 8.184   1.00 52.97  ? 583  LYS A NZ  1 
ATOM   4100  N N   . GLU A 1 545 ? 21.099   -38.332 4.774   1.00 22.91  ? 584  GLU A N   1 
ATOM   4101  C CA  . GLU A 1 545 ? 22.350   -37.878 4.160   1.00 27.43  ? 584  GLU A CA  1 
ATOM   4102  C C   . GLU A 1 545 ? 22.672   -36.427 4.482   1.00 31.94  ? 584  GLU A C   1 
ATOM   4103  O O   . GLU A 1 545 ? 23.816   -36.096 4.793   1.00 23.27  ? 584  GLU A O   1 
ATOM   4104  C CB  . GLU A 1 545 ? 22.330   -38.105 2.648   1.00 30.02  ? 584  GLU A CB  1 
ATOM   4105  C CG  . GLU A 1 545 ? 22.403   -39.584 2.298   1.00 34.40  ? 584  GLU A CG  1 
ATOM   4106  C CD  . GLU A 1 545 ? 21.995   -39.882 0.867   1.00 40.37  ? 584  GLU A CD  1 
ATOM   4107  O OE1 . GLU A 1 545 ? 21.781   -38.923 0.106   1.00 45.26  ? 584  GLU A OE1 1 
ATOM   4108  O OE2 . GLU A 1 545 ? 21.884   -41.076 0.502   1.00 44.78  ? 584  GLU A OE2 1 
ATOM   4109  N N   . ILE A 1 546 ? 21.667   -35.554 4.427   1.00 25.79  ? 585  ILE A N   1 
ATOM   4110  C CA  . ILE A 1 546 ? 21.919   -34.164 4.765   1.00 25.86  ? 585  ILE A CA  1 
ATOM   4111  C C   . ILE A 1 546 ? 22.318   -34.053 6.226   1.00 25.74  ? 585  ILE A C   1 
ATOM   4112  O O   . ILE A 1 546 ? 23.247   -33.316 6.569   1.00 30.31  ? 585  ILE A O   1 
ATOM   4113  C CB  . ILE A 1 546 ? 20.705   -33.268 4.496   1.00 29.78  ? 585  ILE A CB  1 
ATOM   4114  C CG1 . ILE A 1 546 ? 20.321   -33.329 3.013   1.00 34.61  ? 585  ILE A CG1 1 
ATOM   4115  C CG2 . ILE A 1 546 ? 21.010   -31.830 4.939   1.00 22.47  ? 585  ILE A CG2 1 
ATOM   4116  C CD1 . ILE A 1 546 ? 18.965   -32.680 2.679   1.00 26.76  ? 585  ILE A CD1 1 
ATOM   4117  N N   . LEU A 1 547 ? 21.625   -34.792 7.088   1.00 23.10  ? 586  LEU A N   1 
ATOM   4118  C CA  . LEU A 1 547 ? 21.931   -34.766 8.518   1.00 27.38  ? 586  LEU A CA  1 
ATOM   4119  C C   . LEU A 1 547 ? 23.367   -35.229 8.802   1.00 27.23  ? 586  LEU A C   1 
ATOM   4120  O O   . LEU A 1 547 ? 24.040   -34.679 9.673   1.00 25.38  ? 586  LEU A O   1 
ATOM   4121  C CB  . LEU A 1 547 ? 20.935   -35.620 9.323   1.00 20.62  ? 586  LEU A CB  1 
ATOM   4122  C CG  . LEU A 1 547 ? 19.506   -35.055 9.423   1.00 27.20  ? 586  LEU A CG  1 
ATOM   4123  C CD1 . LEU A 1 547 ? 18.518   -36.125 9.879   1.00 20.10  ? 586  LEU A CD1 1 
ATOM   4124  C CD2 . LEU A 1 547 ? 19.451   -33.816 10.342  1.00 23.26  ? 586  LEU A CD2 1 
ATOM   4125  N N   . GLN A 1 548 ? 23.839   -36.245 8.087   1.00 27.32  ? 587  GLN A N   1 
ATOM   4126  C CA  . GLN A 1 548 ? 25.218   -36.702 8.331   1.00 35.25  ? 587  GLN A CA  1 
ATOM   4127  C C   . GLN A 1 548 ? 26.255   -35.624 7.998   1.00 21.09  ? 587  GLN A C   1 
ATOM   4128  O O   . GLN A 1 548 ? 27.188   -35.390 8.754   1.00 25.22  ? 587  GLN A O   1 
ATOM   4129  C CB  . GLN A 1 548 ? 25.520   -38.016 7.599   1.00 33.10  ? 587  GLN A CB  1 
ATOM   4130  C CG  . GLN A 1 548 ? 25.002   -39.236 8.375   1.00 40.95  ? 587  GLN A CG  1 
ATOM   4131  C CD  . GLN A 1 548 ? 25.273   -39.108 9.872   1.00 46.95  ? 587  GLN A CD  1 
ATOM   4132  O OE1 . GLN A 1 548 ? 26.413   -39.269 10.332  1.00 48.38  ? 587  GLN A OE1 1 
ATOM   4133  N NE2 . GLN A 1 548 ? 24.233   -38.778 10.637  1.00 52.07  ? 587  GLN A NE2 1 
ATOM   4134  N N   . ILE A 1 549 ? 26.078   -34.945 6.877   1.00 26.62  ? 588  ILE A N   1 
ATOM   4135  C CA  . ILE A 1 549 ? 27.002   -33.857 6.556   1.00 29.78  ? 588  ILE A CA  1 
ATOM   4136  C C   . ILE A 1 549 ? 26.829   -32.677 7.529   1.00 25.91  ? 588  ILE A C   1 
ATOM   4137  O O   . ILE A 1 549 ? 27.821   -32.099 7.962   1.00 26.34  ? 588  ILE A O   1 
ATOM   4138  C CB  . ILE A 1 549 ? 26.936   -33.441 5.061   1.00 30.22  ? 588  ILE A CB  1 
ATOM   4139  C CG1 . ILE A 1 549 ? 27.830   -32.223 4.795   1.00 32.09  ? 588  ILE A CG1 1 
ATOM   4140  C CG2 . ILE A 1 549 ? 25.522   -33.184 4.629   1.00 36.60  ? 588  ILE A CG2 1 
ATOM   4141  C CD1 . ILE A 1 549 ? 29.333   -32.513 4.986   1.00 40.91  ? 588  ILE A CD1 1 
ATOM   4142  N N   . MET A 1 550 ? 25.586   -32.355 7.918   1.00 27.15  ? 589  MET A N   1 
ATOM   4143  C CA  . MET A 1 550 ? 25.331   -31.277 8.899   1.00 24.71  ? 589  MET A CA  1 
ATOM   4144  C C   . MET A 1 550 ? 26.010   -31.575 10.222  1.00 30.38  ? 589  MET A C   1 
ATOM   4145  O O   . MET A 1 550 ? 26.570   -30.687 10.864  1.00 21.94  ? 589  MET A O   1 
ATOM   4146  C CB  . MET A 1 550 ? 23.826   -31.065 9.169   1.00 26.01  ? 589  MET A CB  1 
ATOM   4147  C CG  . MET A 1 550 ? 23.060   -30.369 8.054   1.00 25.96  ? 589  MET A CG  1 
ATOM   4148  S SD  . MET A 1 550 ? 21.271   -30.429 8.298   1.00 26.28  ? 589  MET A SD  1 
ATOM   4149  C CE  . MET A 1 550 ? 21.097   -29.547 9.848   1.00 18.85  ? 589  MET A CE  1 
ATOM   4150  N N   . ASN A 1 551 ? 25.951   -32.832 10.643  1.00 21.08  ? 590  ASN A N   1 
ATOM   4151  C CA  . ASN A 1 551 ? 26.477   -33.162 11.956  1.00 20.68  ? 590  ASN A CA  1 
ATOM   4152  C C   . ASN A 1 551 ? 28.010   -33.043 12.027  1.00 24.31  ? 590  ASN A C   1 
ATOM   4153  O O   . ASN A 1 551 ? 28.570   -32.949 13.114  1.00 25.57  ? 590  ASN A O   1 
ATOM   4154  C CB  . ASN A 1 551 ? 25.992   -34.544 12.417  1.00 28.89  ? 590  ASN A CB  1 
ATOM   4155  C CG  . ASN A 1 551 ? 24.556   -34.518 12.933  1.00 38.72  ? 590  ASN A CG  1 
ATOM   4156  O OD1 . ASN A 1 551 ? 24.096   -33.523 13.508  1.00 34.79  ? 590  ASN A OD1 1 
ATOM   4157  N ND2 . ASN A 1 551 ? 23.844   -35.622 12.737  1.00 38.83  ? 590  ASN A ND2 1 
ATOM   4158  N N   . LYS A 1 552 ? 28.668   -33.013 10.870  1.00 27.90  ? 591  LYS A N   1 
ATOM   4159  C CA  . LYS A 1 552 ? 30.114   -32.776 10.805  1.00 32.87  ? 591  LYS A CA  1 
ATOM   4160  C C   . LYS A 1 552 ? 30.532   -31.317 11.038  1.00 27.61  ? 591  LYS A C   1 
ATOM   4161  O O   . LYS A 1 552 ? 31.663   -31.059 11.451  1.00 27.35  ? 591  LYS A O   1 
ATOM   4162  C CB  . LYS A 1 552 ? 30.698   -33.313 9.492   1.00 27.97  ? 591  LYS A CB  1 
ATOM   4163  C CG  . LYS A 1 552 ? 30.674   -34.840 9.468   1.00 32.65  ? 591  LYS A CG  1 
ATOM   4164  C CD  . LYS A 1 552 ? 31.113   -35.393 8.128   1.00 38.26  ? 591  LYS A CD  1 
ATOM   4165  C CE  . LYS A 1 552 ? 31.284   -36.921 8.193   1.00 48.52  ? 591  LYS A CE  1 
ATOM   4166  N NZ  . LYS A 1 552 ? 30.080   -37.589 8.787   1.00 51.16  ? 591  LYS A NZ  1 
ATOM   4167  N N   . THR A 1 553 ? 29.639   -30.355 10.809  1.00 26.61  ? 592  THR A N   1 
ATOM   4168  C CA  . THR A 1 553 ? 30.001   -28.996 11.222  1.00 27.25  ? 592  THR A CA  1 
ATOM   4169  C C   . THR A 1 553 ? 29.570   -28.694 12.644  1.00 26.73  ? 592  THR A C   1 
ATOM   4170  O O   . THR A 1 553 ? 30.261   -27.982 13.362  1.00 32.74  ? 592  THR A O   1 
ATOM   4171  C CB  . THR A 1 553 ? 29.584   -27.867 10.243  1.00 32.38  ? 592  THR A CB  1 
ATOM   4172  O OG1 . THR A 1 553 ? 28.468   -27.126 10.756  1.00 42.66  ? 592  THR A OG1 1 
ATOM   4173  C CG2 . THR A 1 553 ? 29.275   -28.395 8.910   1.00 17.62  ? 592  THR A CG2 1 
ATOM   4174  N N   . ILE A 1 554 ? 28.432   -29.240 13.054  1.00 28.41  ? 593  ILE A N   1 
ATOM   4175  C CA  . ILE A 1 554 ? 28.009   -29.124 14.442  1.00 30.61  ? 593  ILE A CA  1 
ATOM   4176  C C   . ILE A 1 554 ? 27.000   -30.230 14.730  1.00 27.87  ? 593  ILE A C   1 
ATOM   4177  O O   . ILE A 1 554 ? 26.088   -30.453 13.945  1.00 27.98  ? 593  ILE A O   1 
ATOM   4178  C CB  . ILE A 1 554 ? 27.432   -27.721 14.744  1.00 27.51  ? 593  ILE A CB  1 
ATOM   4179  C CG1 . ILE A 1 554 ? 27.312   -27.486 16.251  1.00 24.81  ? 593  ILE A CG1 1 
ATOM   4180  C CG2 . ILE A 1 554 ? 26.090   -27.509 14.038  1.00 24.46  ? 593  ILE A CG2 1 
ATOM   4181  C CD1 . ILE A 1 554 ? 26.815   -26.044 16.590  1.00 26.91  ? 593  ILE A CD1 1 
ATOM   4182  N N   . SER A 1 555 ? 27.193   -30.959 15.827  1.00 27.65  ? 594  SER A N   1 
ATOM   4183  C CA  . SER A 1 555 ? 26.344   -32.118 16.096  1.00 30.03  ? 594  SER A CA  1 
ATOM   4184  C C   . SER A 1 555 ? 25.684   -32.055 17.462  1.00 30.03  ? 594  SER A C   1 
ATOM   4185  O O   . SER A 1 555 ? 24.886   -32.927 17.811  1.00 34.68  ? 594  SER A O   1 
ATOM   4186  C CB  . SER A 1 555 ? 27.118   -33.438 15.931  1.00 35.22  ? 594  SER A CB  1 
ATOM   4187  O OG  . SER A 1 555 ? 28.130   -33.553 16.911  1.00 31.03  ? 594  SER A OG  1 
ATOM   4188  N N   . LYS A 1 556 ? 26.009   -31.019 18.226  1.00 33.79  ? 595  LYS A N   1 
ATOM   4189  C CA  . LYS A 1 556 ? 25.283   -30.736 19.460  1.00 32.90  ? 595  LYS A CA  1 
ATOM   4190  C C   . LYS A 1 556 ? 25.258   -29.230 19.734  1.00 25.21  ? 595  LYS A C   1 
ATOM   4191  O O   . LYS A 1 556 ? 26.071   -28.485 19.190  1.00 28.98  ? 595  LYS A O   1 
ATOM   4192  C CB  . LYS A 1 556 ? 25.907   -31.482 20.640  1.00 31.41  ? 595  LYS A CB  1 
ATOM   4193  C CG  . LYS A 1 556 ? 27.334   -31.067 20.909  1.00 34.62  ? 595  LYS A CG  1 
ATOM   4194  C CD  . LYS A 1 556 ? 27.944   -31.926 22.016  1.00 50.17  ? 595  LYS A CD  1 
ATOM   4195  C CE  . LYS A 1 556 ? 29.388   -31.534 22.302  1.00 58.61  ? 595  LYS A CE  1 
ATOM   4196  N NZ  . LYS A 1 556 ? 29.488   -30.188 22.934  1.00 56.74  ? 595  LYS A NZ  1 
ATOM   4197  N N   . PRO A 1 557 ? 24.307   -28.781 20.571  1.00 24.10  ? 596  PRO A N   1 
ATOM   4198  C CA  . PRO A 1 557 ? 24.206   -27.366 20.921  1.00 32.08  ? 596  PRO A CA  1 
ATOM   4199  C C   . PRO A 1 557 ? 25.482   -26.922 21.622  1.00 31.74  ? 596  PRO A C   1 
ATOM   4200  O O   . PRO A 1 557 ? 26.066   -27.710 22.362  1.00 35.95  ? 596  PRO A O   1 
ATOM   4201  C CB  . PRO A 1 557 ? 23.042   -27.330 21.918  1.00 26.83  ? 596  PRO A CB  1 
ATOM   4202  C CG  . PRO A 1 557 ? 22.242   -28.548 21.627  1.00 35.09  ? 596  PRO A CG  1 
ATOM   4203  C CD  . PRO A 1 557 ? 23.251   -29.591 21.209  1.00 25.06  ? 596  PRO A CD  1 
ATOM   4204  N N   . ARG A 1 558 ? 25.924   -25.696 21.363  1.00 26.31  ? 597  ARG A N   1 
ATOM   4205  C CA  . ARG A 1 558 ? 26.949   -25.071 22.181  1.00 29.37  ? 597  ARG A CA  1 
ATOM   4206  C C   . ARG A 1 558 ? 26.509   -25.251 23.631  1.00 34.52  ? 597  ARG A C   1 
ATOM   4207  O O   . ARG A 1 558 ? 25.315   -25.113 23.941  1.00 29.32  ? 597  ARG A O   1 
ATOM   4208  C CB  . ARG A 1 558 ? 27.042   -23.583 21.838  1.00 26.90  ? 597  ARG A CB  1 
ATOM   4209  C CG  . ARG A 1 558 ? 28.268   -22.853 22.392  1.00 24.15  ? 597  ARG A CG  1 
ATOM   4210  C CD  . ARG A 1 558 ? 28.344   -21.419 21.788  1.00 32.04  ? 597  ARG A CD  1 
ATOM   4211  N NE  . ARG A 1 558 ? 28.369   -21.514 20.334  1.00 31.92  ? 597  ARG A NE  1 
ATOM   4212  C CZ  . ARG A 1 558 ? 29.453   -21.858 19.638  1.00 38.85  ? 597  ARG A CZ  1 
ATOM   4213  N NH1 . ARG A 1 558 ? 30.599   -22.082 20.269  1.00 31.73  ? 597  ARG A NH1 1 
ATOM   4214  N NH2 . ARG A 1 558 ? 29.406   -21.959 18.316  1.00 40.33  ? 597  ARG A NH2 1 
ATOM   4215  N N   . ALA A 1 559 ? 27.457   -25.552 24.514  1.00 25.06  ? 598  ALA A N   1 
ATOM   4216  C CA  . ALA A 1 559 ? 27.118   -25.964 25.877  1.00 30.16  ? 598  ALA A CA  1 
ATOM   4217  C C   . ALA A 1 559 ? 26.656   -24.792 26.738  1.00 35.54  ? 598  ALA A C   1 
ATOM   4218  O O   . ALA A 1 559 ? 26.140   -24.975 27.840  1.00 34.35  ? 598  ALA A O   1 
ATOM   4219  C CB  . ALA A 1 559 ? 28.294   -26.688 26.531  1.00 29.35  ? 598  ALA A CB  1 
ATOM   4220  N N   . SER A 1 560 ? 26.845   -23.584 26.231  1.00 31.99  ? 599  SER A N   1 
ATOM   4221  C CA  . SER A 1 560 ? 26.259   -22.410 26.856  1.00 29.35  ? 599  SER A CA  1 
ATOM   4222  C C   . SER A 1 560 ? 25.917   -21.479 25.717  1.00 33.09  ? 599  SER A C   1 
ATOM   4223  O O   . SER A 1 560 ? 26.278   -21.742 24.578  1.00 32.81  ? 599  SER A O   1 
ATOM   4224  C CB  . SER A 1 560 ? 27.252   -21.737 27.804  1.00 33.58  ? 599  SER A CB  1 
ATOM   4225  O OG  . SER A 1 560 ? 28.308   -21.123 27.081  1.00 39.25  ? 599  SER A OG  1 
ATOM   4226  N N   . ARG A 1 561 ? 25.211   -20.400 26.013  1.00 33.40  ? 600  ARG A N   1 
ATOM   4227  C CA  . ARG A 1 561 ? 24.986   -19.368 25.024  1.00 32.18  ? 600  ARG A CA  1 
ATOM   4228  C C   . ARG A 1 561 ? 26.267   -18.568 24.896  1.00 37.04  ? 600  ARG A C   1 
ATOM   4229  O O   . ARG A 1 561 ? 27.128   -18.624 25.778  1.00 34.78  ? 600  ARG A O   1 
ATOM   4230  C CB  . ARG A 1 561 ? 23.821   -18.476 25.449  1.00 28.77  ? 600  ARG A CB  1 
ATOM   4231  C CG  . ARG A 1 561 ? 22.492   -19.218 25.484  1.00 31.56  ? 600  ARG A CG  1 
ATOM   4232  C CD  . ARG A 1 561 ? 21.363   -18.286 25.845  1.00 35.99  ? 600  ARG A CD  1 
ATOM   4233  N NE  . ARG A 1 561 ? 21.427   -17.827 27.230  1.00 34.01  ? 600  ARG A NE  1 
ATOM   4234  C CZ  . ARG A 1 561 ? 20.864   -18.467 28.249  1.00 37.72  ? 600  ARG A CZ  1 
ATOM   4235  N NH1 . ARG A 1 561 ? 20.212   -19.612 28.042  1.00 33.34  ? 600  ARG A NH1 1 
ATOM   4236  N NH2 . ARG A 1 561 ? 20.961   -17.968 29.473  1.00 35.11  ? 600  ARG A NH2 1 
ATOM   4237  N N   . LYS A 1 562 ? 26.400   -17.823 23.807  1.00 32.99  ? 601  LYS A N   1 
ATOM   4238  C CA  . LYS A 1 562 ? 27.635   -17.092 23.555  1.00 36.03  ? 601  LYS A CA  1 
ATOM   4239  C C   . LYS A 1 562 ? 27.888   -15.970 24.563  1.00 38.25  ? 601  LYS A C   1 
ATOM   4240  O O   . LYS A 1 562 ? 26.992   -15.547 25.278  1.00 40.59  ? 601  LYS A O   1 
ATOM   4241  C CB  . LYS A 1 562 ? 27.671   -16.558 22.118  1.00 35.03  ? 601  LYS A CB  1 
ATOM   4242  C CG  . LYS A 1 562 ? 27.796   -17.662 21.068  1.00 36.20  ? 601  LYS A CG  1 
ATOM   4243  C CD  . LYS A 1 562 ? 27.972   -17.110 19.642  1.00 37.51  ? 601  LYS A CD  1 
ATOM   4244  C CE  . LYS A 1 562 ? 28.171   -18.254 18.650  1.00 41.95  ? 601  LYS A CE  1 
ATOM   4245  N NZ  . LYS A 1 562 ? 27.812   -17.889 17.249  1.00 44.87  ? 601  LYS A NZ  1 
ATOM   4246  N N   . GLU A 1 563 ? 29.136   -15.522 24.610  1.00 38.39  ? 602  GLU A N   1 
ATOM   4247  C CA  . GLU A 1 563 ? 29.594   -14.407 25.434  1.00 49.58  ? 602  GLU A CA  1 
ATOM   4248  C C   . GLU A 1 563 ? 28.671   -13.201 25.313  1.00 44.41  ? 602  GLU A C   1 
ATOM   4249  O O   . GLU A 1 563 ? 28.299   -12.559 26.295  1.00 48.68  ? 602  GLU A O   1 
ATOM   4250  C CB  . GLU A 1 563 ? 30.984   -14.006 24.923  1.00 46.75  ? 602  GLU A CB  1 
ATOM   4251  C CG  . GLU A 1 563 ? 31.842   -13.199 25.864  1.00 52.63  ? 602  GLU A CG  1 
ATOM   4252  C CD  . GLU A 1 563 ? 33.323   -13.498 25.657  1.00 54.71  ? 602  GLU A CD  1 
ATOM   4253  O OE1 . GLU A 1 563 ? 33.714   -13.895 24.530  1.00 54.22  ? 602  GLU A OE1 1 
ATOM   4254  O OE2 . GLU A 1 563 ? 34.091   -13.366 26.630  1.00 61.02  ? 602  GLU A OE2 1 
ATOM   4255  N N   . ASN A 1 564 ? 28.321   -12.904 24.075  1.00 41.51  ? 603  ASN A N   1 
ATOM   4256  C CA  . ASN A 1 564 ? 27.587   -11.700 23.714  1.00 61.12  ? 603  ASN A CA  1 
ATOM   4257  C C   . ASN A 1 564 ? 26.077   -11.790 23.980  1.00 50.32  ? 603  ASN A C   1 
ATOM   4258  O O   . ASN A 1 564 ? 25.325   -10.870 23.657  1.00 52.41  ? 603  ASN A O   1 
ATOM   4259  C CB  . ASN A 1 564 ? 27.838   -11.437 22.227  1.00 52.28  ? 603  ASN A CB  1 
ATOM   4260  C CG  . ASN A 1 564 ? 28.060   -12.739 21.432  1.00 67.46  ? 603  ASN A CG  1 
ATOM   4261  O OD1 . ASN A 1 564 ? 29.141   -13.350 21.493  1.00 60.14  ? 603  ASN A OD1 1 
ATOM   4262  N ND2 . ASN A 1 564 ? 27.034   -13.167 20.689  1.00 50.34  ? 603  ASN A ND2 1 
ATOM   4263  N N   . GLY A 1 565 ? 25.644   -12.900 24.571  1.00 41.73  ? 604  GLY A N   1 
ATOM   4264  C CA  . GLY A 1 565 ? 24.227   -13.213 24.683  1.00 42.66  ? 604  GLY A CA  1 
ATOM   4265  C C   . GLY A 1 565 ? 23.467   -12.365 25.683  1.00 33.22  ? 604  GLY A C   1 
ATOM   4266  O O   . GLY A 1 565 ? 24.061   -11.700 26.522  1.00 38.48  ? 604  GLY A O   1 
ATOM   4267  N N   . PRO A 1 566 ? 22.136   -12.391 25.602  1.00 35.86  ? 605  PRO A N   1 
ATOM   4268  C CA  . PRO A 1 566 ? 21.327   -11.560 26.493  1.00 35.92  ? 605  PRO A CA  1 
ATOM   4269  C C   . PRO A 1 566 ? 21.494   -11.982 27.939  1.00 40.63  ? 605  PRO A C   1 
ATOM   4270  O O   . PRO A 1 566 ? 21.925   -13.101 28.209  1.00 40.64  ? 605  PRO A O   1 
ATOM   4271  C CB  . PRO A 1 566 ? 19.893   -11.832 26.027  1.00 43.64  ? 605  PRO A CB  1 
ATOM   4272  C CG  . PRO A 1 566 ? 19.944   -13.151 25.371  1.00 41.36  ? 605  PRO A CG  1 
ATOM   4273  C CD  . PRO A 1 566 ? 21.311   -13.247 24.736  1.00 37.88  ? 605  PRO A CD  1 
ATOM   4274  N N   . VAL A 1 567 ? 21.165   -11.078 28.857  1.00 42.90  ? 606  VAL A N   1 
ATOM   4275  C CA  . VAL A 1 567 ? 21.201   -11.369 30.282  1.00 43.63  ? 606  VAL A CA  1 
ATOM   4276  C C   . VAL A 1 567 ? 19.971   -10.802 30.970  1.00 51.57  ? 606  VAL A C   1 
ATOM   4277  O O   . VAL A 1 567 ? 19.470   -9.738  30.599  1.00 49.81  ? 606  VAL A O   1 
ATOM   4278  C CB  . VAL A 1 567 ? 22.459   -10.786 30.951  1.00 43.44  ? 606  VAL A CB  1 
ATOM   4279  C CG1 . VAL A 1 567 ? 23.615   -11.767 30.847  1.00 51.21  ? 606  VAL A CG1 1 
ATOM   4280  C CG2 . VAL A 1 567 ? 22.823   -9.461  30.319  1.00 43.75  ? 606  VAL A CG2 1 
ATOM   4281  N N   . VAL A 1 568 ? 19.479   -11.525 31.968  1.00 49.89  ? 607  VAL A N   1 
ATOM   4282  C CA  . VAL A 1 568 ? 18.386   -11.041 32.791  1.00 49.07  ? 607  VAL A CA  1 
ATOM   4283  C C   . VAL A 1 568 ? 18.926   -10.739 34.182  1.00 61.78  ? 607  VAL A C   1 
ATOM   4284  O O   . VAL A 1 568 ? 19.754   -11.480 34.712  1.00 62.76  ? 607  VAL A O   1 
ATOM   4285  C CB  . VAL A 1 568 ? 17.239   -12.057 32.852  1.00 53.90  ? 607  VAL A CB  1 
ATOM   4286  C CG1 . VAL A 1 568 ? 16.066   -11.498 33.636  1.00 58.03  ? 607  VAL A CG1 1 
ATOM   4287  C CG2 . VAL A 1 568 ? 16.796   -12.406 31.447  1.00 50.10  ? 607  VAL A CG2 1 
ATOM   4288  N N   . GLU A 1 569 ? 18.473   -9.628  34.751  1.00 60.68  ? 608  GLU A N   1 
ATOM   4289  C CA  . GLU A 1 569 ? 18.940   -9.165  36.053  1.00 60.32  ? 608  GLU A CA  1 
ATOM   4290  C C   . GLU A 1 569 ? 17.757   -8.593  36.833  1.00 61.04  ? 608  GLU A C   1 
ATOM   4291  O O   . GLU A 1 569 ? 16.855   -7.991  36.255  1.00 53.32  ? 608  GLU A O   1 
ATOM   4292  C CB  . GLU A 1 569 ? 20.036   -8.105  35.874  1.00 57.75  ? 608  GLU A CB  1 
ATOM   4293  C CG  . GLU A 1 569 ? 20.601   -7.527  37.164  1.00 70.75  ? 608  GLU A CG  1 
ATOM   4294  C CD  . GLU A 1 569 ? 21.849   -6.674  36.937  1.00 79.85  ? 608  GLU A CD  1 
ATOM   4295  O OE1 . GLU A 1 569 ? 22.096   -5.749  37.745  1.00 73.10  ? 608  GLU A OE1 1 
ATOM   4296  O OE2 . GLU A 1 569 ? 22.585   -6.933  35.956  1.00 79.21  ? 608  GLU A OE2 1 
ATOM   4297  N N   . THR A 1 570 ? 17.759   -8.800  38.145  1.00 68.07  ? 609  THR A N   1 
ATOM   4298  C CA  . THR A 1 570 ? 16.687   -8.321  39.007  1.00 47.08  ? 609  THR A CA  1 
ATOM   4299  C C   . THR A 1 570 ? 17.160   -7.087  39.775  1.00 58.48  ? 609  THR A C   1 
ATOM   4300  O O   . THR A 1 570 ? 18.255   -7.088  40.334  1.00 64.54  ? 609  THR A O   1 
ATOM   4301  C CB  . THR A 1 570 ? 16.257   -9.419  39.993  1.00 57.18  ? 609  THR A CB  1 
ATOM   4302  O OG1 . THR A 1 570 ? 15.897   -10.602 39.267  1.00 66.57  ? 609  THR A OG1 1 
ATOM   4303  C CG2 . THR A 1 570 ? 15.081   -8.969  40.803  1.00 50.64  ? 609  THR A CG2 1 
ATOM   4304  N N   . VAL A 1 571 ? 16.339   -6.037  39.793  1.00 49.48  ? 610  VAL A N   1 
ATOM   4305  C CA  . VAL A 1 571 ? 16.710   -4.756  40.401  1.00 52.36  ? 610  VAL A CA  1 
ATOM   4306  C C   . VAL A 1 571 ? 15.729   -4.326  41.496  1.00 62.67  ? 610  VAL A C   1 
ATOM   4307  O O   . VAL A 1 571 ? 14.531   -4.185  41.242  1.00 56.68  ? 610  VAL A O   1 
ATOM   4308  C CB  . VAL A 1 571 ? 16.775   -3.641  39.339  1.00 57.44  ? 610  VAL A CB  1 
ATOM   4309  C CG1 . VAL A 1 571 ? 17.029   -2.292  39.987  1.00 55.39  ? 610  VAL A CG1 1 
ATOM   4310  C CG2 . VAL A 1 571 ? 17.850   -3.953  38.320  1.00 67.88  ? 610  VAL A CG2 1 
ATOM   4311  N N   . GLN A 1 572 ? 16.234   -4.113  42.709  1.00 55.27  ? 611  GLN A N   1 
ATOM   4312  C CA  . GLN A 1 572 ? 15.371   -3.732  43.827  1.00 50.23  ? 611  GLN A CA  1 
ATOM   4313  C C   . GLN A 1 572 ? 15.203   -2.219  43.928  1.00 52.67  ? 611  GLN A C   1 
ATOM   4314  O O   . GLN A 1 572 ? 16.172   -1.459  43.969  1.00 44.09  ? 611  GLN A O   1 
ATOM   4315  C CB  . GLN A 1 572 ? 15.884   -4.299  45.155  1.00 46.61  ? 611  GLN A CB  1 
ATOM   4316  C CG  . GLN A 1 572 ? 15.961   -5.811  45.205  1.00 54.09  ? 611  GLN A CG  1 
ATOM   4317  C CD  . GLN A 1 572 ? 14.597   -6.477  45.242  1.00 67.54  ? 611  GLN A CD  1 
ATOM   4318  O OE1 . GLN A 1 572 ? 14.353   -7.451  44.527  1.00 73.75  ? 611  GLN A OE1 1 
ATOM   4319  N NE2 . GLN A 1 572 ? 13.704   -5.966  46.087  1.00 66.99  ? 611  GLN A NE2 1 
ATOM   4320  N N   . VAL A 1 573 ? 13.953   -1.783  43.962  1.00 55.43  ? 612  VAL A N   1 
ATOM   4321  C CA  . VAL A 1 573 ? 13.660   -0.366  44.071  1.00 57.74  ? 612  VAL A CA  1 
ATOM   4322  C C   . VAL A 1 573 ? 12.715   -0.164  45.242  1.00 58.70  ? 612  VAL A C   1 
ATOM   4323  O O   . VAL A 1 573 ? 11.604   -0.692  45.242  1.00 63.34  ? 612  VAL A O   1 
ATOM   4324  C CB  . VAL A 1 573 ? 13.037   0.185   42.765  1.00 50.66  ? 612  VAL A CB  1 
ATOM   4325  C CG1 . VAL A 1 573 ? 12.868   1.694   42.846  1.00 54.48  ? 612  VAL A CG1 1 
ATOM   4326  C CG2 . VAL A 1 573 ? 13.907   -0.190  41.568  1.00 42.47  ? 612  VAL A CG2 1 
ATOM   4327  N N   . PRO A 1 574 ? 13.167   0.586   46.257  1.00 63.76  ? 613  PRO A N   1 
ATOM   4328  C CA  . PRO A 1 574 ? 12.360   0.873   47.447  1.00 64.87  ? 613  PRO A CA  1 
ATOM   4329  C C   . PRO A 1 574 ? 11.219   1.831   47.119  1.00 60.85  ? 613  PRO A C   1 
ATOM   4330  O O   . PRO A 1 574 ? 11.406   2.754   46.318  1.00 57.75  ? 613  PRO A O   1 
ATOM   4331  C CB  . PRO A 1 574 ? 13.364   1.552   48.384  1.00 66.88  ? 613  PRO A CB  1 
ATOM   4332  C CG  . PRO A 1 574 ? 14.329   2.218   47.466  1.00 67.97  ? 613  PRO A CG  1 
ATOM   4333  C CD  . PRO A 1 574 ? 14.465   1.285   46.287  1.00 64.83  ? 613  PRO A CD  1 
ATOM   4334  N N   . LEU A 1 575 ? 10.059   1.606   47.730  1.00 61.22  ? 614  LEU A N   1 
ATOM   4335  C CA  . LEU A 1 575 ? 8.893    2.460   47.521  1.00 61.44  ? 614  LEU A CA  1 
ATOM   4336  C C   . LEU A 1 575 ? 9.288    3.923   47.513  1.00 63.67  ? 614  LEU A C   1 
ATOM   4337  O O   . LEU A 1 575 ? 8.796    4.706   46.704  1.00 62.58  ? 614  LEU A O   1 
ATOM   4338  C CB  . LEU A 1 575 ? 7.849    2.226   48.608  1.00 69.41  ? 614  LEU A CB  1 
ATOM   4339  C CG  . LEU A 1 575 ? 7.083    0.907   48.554  1.00 68.11  ? 614  LEU A CG  1 
ATOM   4340  C CD1 . LEU A 1 575 ? 6.445    0.726   47.183  1.00 70.39  ? 614  LEU A CD1 1 
ATOM   4341  C CD2 . LEU A 1 575 ? 8.001    -0.251  48.880  1.00 72.51  ? 614  LEU A CD2 1 
ATOM   4342  N N   . SER A 1 576 ? 10.182   4.284   48.423  1.00 70.60  ? 615  SER A N   1 
ATOM   4343  C CA  . SER A 1 576 ? 10.677   5.650   48.518  1.00 72.79  ? 615  SER A CA  1 
ATOM   4344  C C   . SER A 1 576 ? 11.136   6.199   47.168  1.00 64.69  ? 615  SER A C   1 
ATOM   4345  O O   . SER A 1 576 ? 11.056   7.403   46.925  1.00 61.36  ? 615  SER A O   1 
ATOM   4346  C CB  . SER A 1 576 ? 11.830   5.727   49.522  1.00 73.05  ? 615  SER A CB  1 
ATOM   4347  O OG  . SER A 1 576 ? 12.477   6.987   49.452  1.00 78.13  ? 615  SER A OG  1 
ATOM   4348  N N   . LYS A 1 577 ? 11.612   5.317   46.293  1.00 68.86  ? 616  LYS A N   1 
ATOM   4349  C CA  . LYS A 1 577 ? 12.236   5.752   45.044  1.00 63.30  ? 616  LYS A CA  1 
ATOM   4350  C C   . LYS A 1 577 ? 11.475   5.341   43.781  1.00 57.32  ? 616  LYS A C   1 
ATOM   4351  O O   . LYS A 1 577 ? 11.845   5.740   42.680  1.00 52.11  ? 616  LYS A O   1 
ATOM   4352  C CB  . LYS A 1 577 ? 13.683   5.251   44.973  1.00 70.22  ? 616  LYS A CB  1 
ATOM   4353  C CG  . LYS A 1 577 ? 14.565   5.738   46.113  1.00 72.98  ? 616  LYS A CG  1 
ATOM   4354  C CD  . LYS A 1 577 ? 14.494   7.253   46.245  1.00 78.70  ? 616  LYS A CD  1 
ATOM   4355  C CE  . LYS A 1 577 ? 15.436   7.763   47.326  1.00 84.73  ? 616  LYS A CE  1 
ATOM   4356  N NZ  . LYS A 1 577 ? 16.860   7.444   47.011  1.00 92.10  ? 616  LYS A NZ  1 
ATOM   4357  N N   . ARG A 1 578 ? 10.419   4.549   43.942  1.00 56.44  ? 617  ARG A N   1 
ATOM   4358  C CA  . ARG A 1 578 ? 9.643    4.062   42.801  1.00 58.69  ? 617  ARG A CA  1 
ATOM   4359  C C   . ARG A 1 578 ? 9.173    5.197   41.889  1.00 60.13  ? 617  ARG A C   1 
ATOM   4360  O O   . ARG A 1 578 ? 9.424    5.179   40.685  1.00 58.20  ? 617  ARG A O   1 
ATOM   4361  C CB  . ARG A 1 578 ? 8.441    3.236   43.266  1.00 63.48  ? 617  ARG A CB  1 
ATOM   4362  C CG  . ARG A 1 578 ? 7.784    2.459   42.144  1.00 65.08  ? 617  ARG A CG  1 
ATOM   4363  C CD  . ARG A 1 578 ? 6.441    1.873   42.551  1.00 70.83  ? 617  ARG A CD  1 
ATOM   4364  N NE  . ARG A 1 578 ? 5.780    1.261   41.401  1.00 74.74  ? 617  ARG A NE  1 
ATOM   4365  C CZ  . ARG A 1 578 ? 5.078    1.937   40.493  1.00 77.30  ? 617  ARG A CZ  1 
ATOM   4366  N NH1 . ARG A 1 578 ? 4.936    3.255   40.604  1.00 75.22  ? 617  ARG A NH1 1 
ATOM   4367  N NH2 . ARG A 1 578 ? 4.514    1.298   39.473  1.00 65.00  ? 617  ARG A NH2 1 
ATOM   4368  N N   . ALA A 1 579 ? 8.493    6.181   42.469  1.00 57.10  ? 618  ALA A N   1 
ATOM   4369  C CA  . ALA A 1 579 ? 7.979    7.314   41.705  1.00 59.62  ? 618  ALA A CA  1 
ATOM   4370  C C   . ALA A 1 579 ? 9.055    7.973   40.847  1.00 48.64  ? 618  ALA A C   1 
ATOM   4371  O O   . ALA A 1 579 ? 8.794    8.357   39.708  1.00 52.79  ? 618  ALA A O   1 
ATOM   4372  C CB  . ALA A 1 579 ? 7.319    8.342   42.629  1.00 59.28  ? 618  ALA A CB  1 
ATOM   4373  N N   . LYS A 1 580 ? 10.265   8.099   41.381  1.00 51.91  ? 619  LYS A N   1 
ATOM   4374  C CA  . LYS A 1 580 ? 11.356   8.667   40.594  1.00 57.71  ? 619  LYS A CA  1 
ATOM   4375  C C   . LYS A 1 580 ? 11.907   7.659   39.575  1.00 57.27  ? 619  LYS A C   1 
ATOM   4376  O O   . LYS A 1 580 ? 12.255   8.020   38.447  1.00 48.38  ? 619  LYS A O   1 
ATOM   4377  C CB  . LYS A 1 580 ? 12.473   9.205   41.493  1.00 58.37  ? 619  LYS A CB  1 
ATOM   4378  C CG  . LYS A 1 580 ? 13.216   10.400  40.885  1.00 64.89  ? 619  LYS A CG  1 
ATOM   4379  C CD  . LYS A 1 580 ? 14.043   10.008  39.652  1.00 78.17  ? 619  LYS A CD  1 
ATOM   4380  C CE  . LYS A 1 580 ? 13.991   11.072  38.542  1.00 77.02  ? 619  LYS A CE  1 
ATOM   4381  N NZ  . LYS A 1 580 ? 12.727   11.013  37.727  1.00 67.45  ? 619  LYS A NZ  1 
ATOM   4382  N N   . PHE A 1 581 ? 11.969   6.394   39.972  1.00 55.64  ? 620  PHE A N   1 
ATOM   4383  C CA  . PHE A 1 581 ? 12.525   5.362   39.110  1.00 48.24  ? 620  PHE A CA  1 
ATOM   4384  C C   . PHE A 1 581 ? 11.708   5.253   37.831  1.00 52.19  ? 620  PHE A C   1 
ATOM   4385  O O   . PHE A 1 581 ? 12.240   5.373   36.730  1.00 49.54  ? 620  PHE A O   1 
ATOM   4386  C CB  . PHE A 1 581 ? 12.544   4.022   39.842  1.00 47.76  ? 620  PHE A CB  1 
ATOM   4387  C CG  . PHE A 1 581 ? 13.057   2.874   39.009  1.00 50.26  ? 620  PHE A CG  1 
ATOM   4388  C CD1 . PHE A 1 581 ? 14.373   2.845   38.577  1.00 54.10  ? 620  PHE A CD1 1 
ATOM   4389  C CD2 . PHE A 1 581 ? 12.230   1.812   38.683  1.00 51.94  ? 620  PHE A CD2 1 
ATOM   4390  C CE1 . PHE A 1 581 ? 14.846   1.783   37.824  1.00 60.14  ? 620  PHE A CE1 1 
ATOM   4391  C CE2 . PHE A 1 581 ? 12.701   0.744   37.930  1.00 48.06  ? 620  PHE A CE2 1 
ATOM   4392  C CZ  . PHE A 1 581 ? 14.008   0.732   37.503  1.00 51.53  ? 620  PHE A CZ  1 
ATOM   4393  N N   . VAL A 1 582 ? 10.405   5.047   37.990  1.00 44.82  ? 621  VAL A N   1 
ATOM   4394  C CA  . VAL A 1 582 ? 9.518    4.786   36.867  1.00 39.30  ? 621  VAL A CA  1 
ATOM   4395  C C   . VAL A 1 582 ? 9.135    6.061   36.103  1.00 41.50  ? 621  VAL A C   1 
ATOM   4396  O O   . VAL A 1 582 ? 8.911    6.025   34.894  1.00 41.97  ? 621  VAL A O   1 
ATOM   4397  C CB  . VAL A 1 582 ? 8.257    4.032   37.336  1.00 39.95  ? 621  VAL A CB  1 
ATOM   4398  C CG1 . VAL A 1 582 ? 7.376    3.671   36.165  1.00 55.87  ? 621  VAL A CG1 1 
ATOM   4399  C CG2 . VAL A 1 582 ? 8.646    2.771   38.088  1.00 48.02  ? 621  VAL A CG2 1 
ATOM   4400  N N   . GLY A 1 583 ? 9.077    7.191   36.797  1.00 44.39  ? 622  GLY A N   1 
ATOM   4401  C CA  . GLY A 1 583 ? 8.629    8.425   36.173  1.00 37.63  ? 622  GLY A CA  1 
ATOM   4402  C C   . GLY A 1 583 ? 7.121    8.441   35.953  1.00 39.46  ? 622  GLY A C   1 
ATOM   4403  O O   . GLY A 1 583 ? 6.447    7.424   36.133  1.00 37.36  ? 622  GLY A O   1 
ATOM   4404  N N   . PRO A 1 584 ? 6.576    9.601   35.566  1.00 40.40  ? 623  PRO A N   1 
ATOM   4405  C CA  . PRO A 1 584 ? 5.129    9.718   35.351  1.00 41.23  ? 623  PRO A CA  1 
ATOM   4406  C C   . PRO A 1 584 ? 4.634    8.786   34.248  1.00 40.17  ? 623  PRO A C   1 
ATOM   4407  O O   . PRO A 1 584 ? 5.154    8.817   33.136  1.00 40.50  ? 623  PRO A O   1 
ATOM   4408  C CB  . PRO A 1 584 ? 4.951    11.186  34.935  1.00 42.05  ? 623  PRO A CB  1 
ATOM   4409  C CG  . PRO A 1 584 ? 6.168    11.889  35.463  1.00 42.59  ? 623  PRO A CG  1 
ATOM   4410  C CD  . PRO A 1 584 ? 7.277    10.884  35.373  1.00 45.36  ? 623  PRO A CD  1 
ATOM   4411  N N   . GLY A 1 585 ? 3.631    7.973   34.568  1.00 42.59  ? 624  GLY A N   1 
ATOM   4412  C CA  . GLY A 1 585 ? 3.091    6.997   33.640  1.00 44.06  ? 624  GLY A CA  1 
ATOM   4413  C C   . GLY A 1 585 ? 4.135    6.042   33.089  1.00 47.94  ? 624  GLY A C   1 
ATOM   4414  O O   . GLY A 1 585 ? 3.955    5.474   32.015  1.00 47.79  ? 624  GLY A O   1 
ATOM   4415  N N   . GLY A 1 586 ? 5.236    5.874   33.815  1.00 42.30  ? 625  GLY A N   1 
ATOM   4416  C CA  . GLY A 1 586 ? 6.269    4.937   33.409  1.00 41.99  ? 625  GLY A CA  1 
ATOM   4417  C C   . GLY A 1 586 ? 7.198    5.479   32.342  1.00 42.08  ? 625  GLY A C   1 
ATOM   4418  O O   . GLY A 1 586 ? 7.880    4.719   31.663  1.00 43.57  ? 625  GLY A O   1 
ATOM   4419  N N   . TYR A 1 587 ? 7.232    6.800   32.204  1.00 39.95  ? 626  TYR A N   1 
ATOM   4420  C CA  . TYR A 1 587 ? 8.038    7.441   31.174  1.00 44.40  ? 626  TYR A CA  1 
ATOM   4421  C C   . TYR A 1 587 ? 9.522    7.057   31.210  1.00 39.43  ? 626  TYR A C   1 
ATOM   4422  O O   . TYR A 1 587 ? 10.122   6.774   30.170  1.00 37.03  ? 626  TYR A O   1 
ATOM   4423  C CB  . TYR A 1 587 ? 7.890    8.962   31.260  1.00 50.77  ? 626  TYR A CB  1 
ATOM   4424  C CG  . TYR A 1 587 ? 8.619    9.703   30.167  1.00 38.83  ? 626  TYR A CG  1 
ATOM   4425  C CD1 . TYR A 1 587 ? 8.030    9.898   28.921  1.00 40.89  ? 626  TYR A CD1 1 
ATOM   4426  C CD2 . TYR A 1 587 ? 9.893    10.205  30.379  1.00 40.41  ? 626  TYR A CD2 1 
ATOM   4427  C CE1 . TYR A 1 587 ? 8.694    10.577  27.912  1.00 41.38  ? 626  TYR A CE1 1 
ATOM   4428  C CE2 . TYR A 1 587 ? 10.568   10.882  29.379  1.00 54.71  ? 626  TYR A CE2 1 
ATOM   4429  C CZ  . TYR A 1 587 ? 9.966    11.067  28.148  1.00 43.10  ? 626  TYR A CZ  1 
ATOM   4430  O OH  . TYR A 1 587 ? 10.639   11.738  27.156  1.00 47.39  ? 626  TYR A OH  1 
ATOM   4431  N N   . ASN A 1 588 ? 10.113   7.056   32.398  1.00 41.66  ? 627  ASN A N   1 
ATOM   4432  C CA  . ASN A 1 588 ? 11.527   6.716   32.534  1.00 44.32  ? 627  ASN A CA  1 
ATOM   4433  C C   . ASN A 1 588 ? 11.864   5.338   31.987  1.00 39.15  ? 627  ASN A C   1 
ATOM   4434  O O   . ASN A 1 588 ? 12.860   5.175   31.294  1.00 40.75  ? 627  ASN A O   1 
ATOM   4435  C CB  . ASN A 1 588 ? 11.986   6.817   33.990  1.00 44.90  ? 627  ASN A CB  1 
ATOM   4436  C CG  . ASN A 1 588 ? 12.174   8.252   34.442  1.00 49.57  ? 627  ASN A CG  1 
ATOM   4437  O OD1 . ASN A 1 588 ? 12.288   9.160   33.620  1.00 54.81  ? 627  ASN A OD1 1 
ATOM   4438  N ND2 . ASN A 1 588 ? 12.217   8.462   35.754  1.00 50.60  ? 627  ASN A ND2 1 
ATOM   4439  N N   . LEU A 1 589 ? 11.029   4.351   32.296  1.00 42.00  ? 628  LEU A N   1 
ATOM   4440  C CA  . LEU A 1 589 ? 11.269   2.989   31.849  1.00 38.38  ? 628  LEU A CA  1 
ATOM   4441  C C   . LEU A 1 589 ? 11.157   2.907   30.335  1.00 47.40  ? 628  LEU A C   1 
ATOM   4442  O O   . LEU A 1 589 ? 11.910   2.181   29.686  1.00 47.55  ? 628  LEU A O   1 
ATOM   4443  C CB  . LEU A 1 589 ? 10.271   2.026   32.489  1.00 41.32  ? 628  LEU A CB  1 
ATOM   4444  C CG  . LEU A 1 589 ? 10.185   1.983   34.015  1.00 42.39  ? 628  LEU A CG  1 
ATOM   4445  C CD1 . LEU A 1 589 ? 9.088    1.021   34.447  1.00 43.52  ? 628  LEU A CD1 1 
ATOM   4446  C CD2 . LEU A 1 589 ? 11.513   1.603   34.639  1.00 51.13  ? 628  LEU A CD2 1 
ATOM   4447  N N   . LYS A 1 590 ? 10.202   3.640   29.776  1.00 43.04  ? 629  LYS A N   1 
ATOM   4448  C CA  . LYS A 1 590 ? 10.005   3.635   28.332  1.00 47.09  ? 629  LYS A CA  1 
ATOM   4449  C C   . LYS A 1 590 ? 11.214   4.252   27.651  1.00 40.13  ? 629  LYS A C   1 
ATOM   4450  O O   . LYS A 1 590 ? 11.751   3.699   26.693  1.00 43.01  ? 629  LYS A O   1 
ATOM   4451  C CB  . LYS A 1 590 ? 8.714    4.365   27.946  1.00 43.73  ? 629  LYS A CB  1 
ATOM   4452  C CG  . LYS A 1 590 ? 7.461    3.616   28.379  1.00 51.50  ? 629  LYS A CG  1 
ATOM   4453  C CD  . LYS A 1 590 ? 6.198    4.415   28.103  1.00 60.87  ? 629  LYS A CD  1 
ATOM   4454  C CE  . LYS A 1 590 ? 4.979    3.762   28.745  1.00 61.00  ? 629  LYS A CE  1 
ATOM   4455  N NZ  . LYS A 1 590 ? 3.930    4.773   29.066  1.00 58.90  ? 629  LYS A NZ  1 
ATOM   4456  N N   . LYS A 1 591 ? 11.655   5.390   28.166  1.00 36.47  ? 630  LYS A N   1 
ATOM   4457  C CA  . LYS A 1 591 ? 12.836   6.054   27.630  1.00 42.30  ? 630  LYS A CA  1 
ATOM   4458  C C   . LYS A 1 591 ? 14.079   5.163   27.747  1.00 49.08  ? 630  LYS A C   1 
ATOM   4459  O O   . LYS A 1 591 ? 14.938   5.136   26.859  1.00 39.00  ? 630  LYS A O   1 
ATOM   4460  C CB  . LYS A 1 591 ? 13.064   7.376   28.364  1.00 39.26  ? 630  LYS A CB  1 
ATOM   4461  C CG  . LYS A 1 591 ? 14.231   8.186   27.848  1.00 46.79  ? 630  LYS A CG  1 
ATOM   4462  C CD  . LYS A 1 591 ? 13.926   9.674   27.946  1.00 58.01  ? 630  LYS A CD  1 
ATOM   4463  C CE  . LYS A 1 591 ? 15.097   10.526  27.484  1.00 59.86  ? 630  LYS A CE  1 
ATOM   4464  N NZ  . LYS A 1 591 ? 14.868   11.968  27.787  1.00 65.16  ? 630  LYS A NZ  1 
ATOM   4465  N N   . LEU A 1 592 ? 14.175   4.440   28.855  1.00 43.10  ? 631  LEU A N   1 
ATOM   4466  C CA  . LEU A 1 592 ? 15.331   3.585   29.089  1.00 49.34  ? 631  LEU A CA  1 
ATOM   4467  C C   . LEU A 1 592 ? 15.386   2.505   28.027  1.00 41.13  ? 631  LEU A C   1 
ATOM   4468  O O   . LEU A 1 592 ? 16.447   2.210   27.472  1.00 41.17  ? 631  LEU A O   1 
ATOM   4469  C CB  . LEU A 1 592 ? 15.256   2.946   30.471  1.00 48.33  ? 631  LEU A CB  1 
ATOM   4470  C CG  . LEU A 1 592 ? 16.330   1.892   30.718  1.00 45.96  ? 631  LEU A CG  1 
ATOM   4471  C CD1 . LEU A 1 592 ? 17.700   2.530   30.615  1.00 44.67  ? 631  LEU A CD1 1 
ATOM   4472  C CD2 . LEU A 1 592 ? 16.120   1.255   32.070  1.00 43.98  ? 631  LEU A CD2 1 
ATOM   4473  N N   . GLN A 1 593 ? 14.225   1.926   27.744  1.00 38.82  ? 632  GLN A N   1 
ATOM   4474  C CA  . GLN A 1 593 ? 14.118   0.860   26.767  1.00 44.54  ? 632  GLN A CA  1 
ATOM   4475  C C   . GLN A 1 593 ? 14.459   1.347   25.362  1.00 53.98  ? 632  GLN A C   1 
ATOM   4476  O O   . GLN A 1 593 ? 15.219   0.695   24.648  1.00 49.15  ? 632  GLN A O   1 
ATOM   4477  C CB  . GLN A 1 593 ? 12.728   0.220   26.817  1.00 48.42  ? 632  GLN A CB  1 
ATOM   4478  C CG  . GLN A 1 593 ? 12.460   -0.514  28.139  1.00 52.58  ? 632  GLN A CG  1 
ATOM   4479  C CD  . GLN A 1 593 ? 11.035   -1.044  28.270  1.00 58.75  ? 632  GLN A CD  1 
ATOM   4480  O OE1 . GLN A 1 593 ? 10.712   -1.734  29.237  1.00 52.11  ? 632  GLN A OE1 1 
ATOM   4481  N NE2 . GLN A 1 593 ? 10.181   -0.718  27.302  1.00 51.52  ? 632  GLN A NE2 1 
ATOM   4482  N N   . ALA A 1 594 ? 13.913   2.496   24.970  1.00 44.12  ? 633  ALA A N   1 
ATOM   4483  C CA  . ALA A 1 594 ? 14.190   3.041   23.643  1.00 48.98  ? 633  ALA A CA  1 
ATOM   4484  C C   . ALA A 1 594 ? 15.671   3.357   23.460  1.00 45.08  ? 633  ALA A C   1 
ATOM   4485  O O   . ALA A 1 594 ? 16.209   3.227   22.364  1.00 50.62  ? 633  ALA A O   1 
ATOM   4486  C CB  . ALA A 1 594 ? 13.354   4.286   23.384  1.00 45.13  ? 633  ALA A CB  1 
ATOM   4487  N N   . GLU A 1 595 ? 16.330   3.767   24.536  1.00 44.02  ? 634  GLU A N   1 
ATOM   4488  C CA  . GLU A 1 595 ? 17.684   4.292   24.420  1.00 47.10  ? 634  GLU A CA  1 
ATOM   4489  C C   . GLU A 1 595 ? 18.790   3.256   24.592  1.00 60.83  ? 634  GLU A C   1 
ATOM   4490  O O   . GLU A 1 595 ? 19.910   3.463   24.117  1.00 55.11  ? 634  GLU A O   1 
ATOM   4491  C CB  . GLU A 1 595 ? 17.889   5.458   25.387  1.00 50.97  ? 634  GLU A CB  1 
ATOM   4492  C CG  . GLU A 1 595 ? 17.966   6.799   24.680  1.00 65.10  ? 634  GLU A CG  1 
ATOM   4493  C CD  . GLU A 1 595 ? 17.318   7.916   25.465  1.00 73.87  ? 634  GLU A CD  1 
ATOM   4494  O OE1 . GLU A 1 595 ? 17.322   7.838   26.717  1.00 63.37  ? 634  GLU A OE1 1 
ATOM   4495  O OE2 . GLU A 1 595 ? 16.805   8.866   24.825  1.00 61.06  ? 634  GLU A OE2 1 
ATOM   4496  N N   . THR A 1 596 ? 18.479   2.150   25.264  1.00 50.23  ? 635  THR A N   1 
ATOM   4497  C CA  . THR A 1 596 ? 19.480   1.122   25.534  1.00 46.79  ? 635  THR A CA  1 
ATOM   4498  C C   . THR A 1 596 ? 19.079   -0.216  24.922  1.00 46.54  ? 635  THR A C   1 
ATOM   4499  O O   . THR A 1 596 ? 19.890   -1.144  24.820  1.00 48.41  ? 635  THR A O   1 
ATOM   4500  C CB  . THR A 1 596 ? 19.676   0.909   27.040  1.00 47.30  ? 635  THR A CB  1 
ATOM   4501  O OG1 . THR A 1 596 ? 18.521   0.262   27.581  1.00 44.61  ? 635  THR A OG1 1 
ATOM   4502  C CG2 . THR A 1 596 ? 19.905   2.237   27.758  1.00 41.23  ? 635  THR A CG2 1 
ATOM   4503  N N   . GLY A 1 597 ? 17.820   -0.320  24.526  1.00 41.10  ? 636  GLY A N   1 
ATOM   4504  C CA  . GLY A 1 597 ? 17.313   -1.558  23.961  1.00 43.63  ? 636  GLY A CA  1 
ATOM   4505  C C   . GLY A 1 597 ? 17.099   -2.649  24.993  1.00 50.33  ? 636  GLY A C   1 
ATOM   4506  O O   . GLY A 1 597 ? 16.891   -3.811  24.637  1.00 55.01  ? 636  GLY A O   1 
ATOM   4507  N N   . VAL A 1 598 ? 17.160   -2.288  26.273  1.00 38.54  ? 637  VAL A N   1 
ATOM   4508  C CA  . VAL A 1 598 ? 16.771   -3.223  27.321  1.00 41.50  ? 637  VAL A CA  1 
ATOM   4509  C C   . VAL A 1 598 ? 15.256   -3.232  27.487  1.00 44.76  ? 637  VAL A C   1 
ATOM   4510  O O   . VAL A 1 598 ? 14.559   -2.350  26.982  1.00 50.36  ? 637  VAL A O   1 
ATOM   4511  C CB  . VAL A 1 598 ? 17.435   -2.896  28.675  1.00 48.45  ? 637  VAL A CB  1 
ATOM   4512  C CG1 . VAL A 1 598 ? 18.939   -2.745  28.508  1.00 44.64  ? 637  VAL A CG1 1 
ATOM   4513  C CG2 . VAL A 1 598 ? 16.825   -1.645  29.289  1.00 38.74  ? 637  VAL A CG2 1 
ATOM   4514  N N   . THR A 1 599 ? 14.752   -4.236  28.194  1.00 46.14  ? 638  THR A N   1 
ATOM   4515  C CA  . THR A 1 599 ? 13.326   -4.367  28.446  1.00 41.31  ? 638  THR A CA  1 
ATOM   4516  C C   . THR A 1 599 ? 13.110   -4.595  29.939  1.00 54.96  ? 638  THR A C   1 
ATOM   4517  O O   . THR A 1 599 ? 13.535   -5.619  30.495  1.00 39.84  ? 638  THR A O   1 
ATOM   4518  C CB  . THR A 1 599 ? 12.726   -5.534  27.651  1.00 43.61  ? 638  THR A CB  1 
ATOM   4519  O OG1 . THR A 1 599 ? 12.930   -5.314  26.250  1.00 55.13  ? 638  THR A OG1 1 
ATOM   4520  C CG2 . THR A 1 599 ? 11.232   -5.679  27.932  1.00 48.51  ? 638  THR A CG2 1 
ATOM   4521  N N   . ILE A 1 600 ? 12.468   -3.626  30.586  1.00 40.07  ? 639  ILE A N   1 
ATOM   4522  C CA  . ILE A 1 600 ? 12.198   -3.706  32.016  1.00 44.49  ? 639  ILE A CA  1 
ATOM   4523  C C   . ILE A 1 600 ? 10.727   -4.054  32.280  1.00 57.02  ? 639  ILE A C   1 
ATOM   4524  O O   . ILE A 1 600 ? 9.828    -3.546  31.595  1.00 49.73  ? 639  ILE A O   1 
ATOM   4525  C CB  . ILE A 1 600 ? 12.541   -2.381  32.720  1.00 50.10  ? 639  ILE A CB  1 
ATOM   4526  C CG1 . ILE A 1 600 ? 13.436   -2.628  33.928  1.00 51.11  ? 639  ILE A CG1 1 
ATOM   4527  C CG2 . ILE A 1 600 ? 11.286   -1.665  33.144  1.00 57.92  ? 639  ILE A CG2 1 
ATOM   4528  C CD1 . ILE A 1 600 ? 13.439   -1.492  34.911  1.00 51.26  ? 639  ILE A CD1 1 
ATOM   4529  N N   . SER A 1 601 ? 10.489   -4.927  33.261  1.00 43.60  ? 640  SER A N   1 
ATOM   4530  C CA  . SER A 1 601 ? 9.128    -5.281  33.666  1.00 42.93  ? 640  SER A CA  1 
ATOM   4531  C C   . SER A 1 601 ? 9.020    -5.408  35.182  1.00 48.96  ? 640  SER A C   1 
ATOM   4532  O O   . SER A 1 601 ? 9.799    -6.127  35.809  1.00 47.84  ? 640  SER A O   1 
ATOM   4533  C CB  . SER A 1 601 ? 8.691    -6.592  33.013  1.00 47.76  ? 640  SER A CB  1 
ATOM   4534  O OG  . SER A 1 601 ? 8.604    -6.454  31.608  1.00 52.94  ? 640  SER A OG  1 
ATOM   4535  N N   . GLN A 1 602 ? 8.051    -4.722  35.776  1.00 44.19  ? 641  GLN A N   1 
ATOM   4536  C CA  . GLN A 1 602 ? 7.925    -4.743  37.228  1.00 45.69  ? 641  GLN A CA  1 
ATOM   4537  C C   . GLN A 1 602 ? 7.390    -6.086  37.693  1.00 51.36  ? 641  GLN A C   1 
ATOM   4538  O O   . GLN A 1 602 ? 6.346    -6.540  37.219  1.00 49.61  ? 641  GLN A O   1 
ATOM   4539  C CB  . GLN A 1 602 ? 7.015    -3.621  37.718  1.00 48.30  ? 641  GLN A CB  1 
ATOM   4540  C CG  . GLN A 1 602 ? 6.800    -3.633  39.221  1.00 50.97  ? 641  GLN A CG  1 
ATOM   4541  C CD  . GLN A 1 602 ? 5.977    -2.450  39.711  1.00 61.85  ? 641  GLN A CD  1 
ATOM   4542  O OE1 . GLN A 1 602 ? 5.576    -1.586  38.928  1.00 48.54  ? 641  GLN A OE1 1 
ATOM   4543  N NE2 . GLN A 1 602 ? 5.730    -2.405  41.016  1.00 68.80  ? 641  GLN A NE2 1 
ATOM   4544  N N   . VAL A 1 603 ? 8.103    -6.713  38.628  1.00 43.65  ? 642  VAL A N   1 
ATOM   4545  C CA  . VAL A 1 603 ? 7.731    -8.036  39.128  1.00 41.67  ? 642  VAL A CA  1 
ATOM   4546  C C   . VAL A 1 603 ? 6.836    -7.970  40.361  1.00 58.29  ? 642  VAL A C   1 
ATOM   4547  O O   . VAL A 1 603 ? 5.906    -8.763  40.512  1.00 53.29  ? 642  VAL A O   1 
ATOM   4548  C CB  . VAL A 1 603 ? 8.966    -8.871  39.469  1.00 48.04  ? 642  VAL A CB  1 
ATOM   4549  C CG1 . VAL A 1 603 ? 8.553    -10.250 39.974  1.00 48.67  ? 642  VAL A CG1 1 
ATOM   4550  C CG2 . VAL A 1 603 ? 9.868    -8.984  38.251  1.00 43.41  ? 642  VAL A CG2 1 
ATOM   4551  N N   . ASP A 1 604 ? 7.132    -7.039  41.256  1.00 55.45  ? 643  ASP A N   1 
ATOM   4552  C CA  . ASP A 1 604 ? 6.259    -6.800  42.395  1.00 55.00  ? 643  ASP A CA  1 
ATOM   4553  C C   . ASP A 1 604 ? 6.395    -5.358  42.843  1.00 57.72  ? 643  ASP A C   1 
ATOM   4554  O O   . ASP A 1 604 ? 6.679    -4.477  42.033  1.00 59.74  ? 643  ASP A O   1 
ATOM   4555  C CB  . ASP A 1 604 ? 6.527    -7.793  43.537  1.00 57.55  ? 643  ASP A CB  1 
ATOM   4556  C CG  . ASP A 1 604 ? 7.959    -7.750  44.036  1.00 56.12  ? 643  ASP A CG  1 
ATOM   4557  O OD1 . ASP A 1 604 ? 8.531    -8.829  44.300  1.00 57.73  ? 643  ASP A OD1 1 
ATOM   4558  O OD2 . ASP A 1 604 ? 8.513    -6.642  44.176  1.00 63.63  ? 643  ASP A OD2 1 
ATOM   4559  N N   . GLU A 1 605 ? 6.195    -5.116  44.130  1.00 68.71  ? 644  GLU A N   1 
ATOM   4560  C CA  . GLU A 1 605 ? 6.214    -3.759  44.658  1.00 63.54  ? 644  GLU A CA  1 
ATOM   4561  C C   . GLU A 1 605 ? 7.594    -3.109  44.553  1.00 62.65  ? 644  GLU A C   1 
ATOM   4562  O O   . GLU A 1 605 ? 7.712    -1.928  44.208  1.00 59.49  ? 644  GLU A O   1 
ATOM   4563  C CB  . GLU A 1 605 ? 5.725    -3.763  46.107  1.00 74.94  ? 644  GLU A CB  1 
ATOM   4564  C CG  . GLU A 1 605 ? 4.421    -4.521  46.274  1.00 81.16  ? 644  GLU A CG  1 
ATOM   4565  C CD  . GLU A 1 605 ? 3.385    -4.092  45.247  1.00 87.89  ? 644  GLU A CD  1 
ATOM   4566  O OE1 . GLU A 1 605 ? 2.967    -4.940  44.419  1.00 75.66  ? 644  GLU A OE1 1 
ATOM   4567  O OE2 . GLU A 1 605 ? 2.998    -2.900  45.266  1.00 87.25  ? 644  GLU A OE2 1 
ATOM   4568  N N   . GLU A 1 606 ? 8.637    -3.883  44.834  1.00 60.67  ? 645  GLU A N   1 
ATOM   4569  C CA  . GLU A 1 606 ? 9.990    -3.335  44.871  1.00 66.97  ? 645  GLU A CA  1 
ATOM   4570  C C   . GLU A 1 606 ? 10.927   -3.942  43.825  1.00 66.29  ? 645  GLU A C   1 
ATOM   4571  O O   . GLU A 1 606 ? 12.078   -3.515  43.691  1.00 56.28  ? 645  GLU A O   1 
ATOM   4572  C CB  . GLU A 1 606 ? 10.586   -3.529  46.261  1.00 53.17  ? 645  GLU A CB  1 
ATOM   4573  C CG  . GLU A 1 606 ? 9.707    -3.014  47.377  1.00 65.30  ? 645  GLU A CG  1 
ATOM   4574  C CD  . GLU A 1 606 ? 10.459   -2.886  48.681  1.00 74.44  ? 645  GLU A CD  1 
ATOM   4575  O OE1 . GLU A 1 606 ? 11.034   -3.896  49.145  1.00 77.38  ? 645  GLU A OE1 1 
ATOM   4576  O OE2 . GLU A 1 606 ? 10.487   -1.766  49.230  1.00 65.49  ? 645  GLU A OE2 1 
ATOM   4577  N N   . THR A 1 607 ? 10.429   -4.927  43.082  1.00 65.77  ? 646  THR A N   1 
ATOM   4578  C CA  . THR A 1 607 ? 11.275   -5.706  42.184  1.00 56.17  ? 646  THR A CA  1 
ATOM   4579  C C   . THR A 1 607 ? 11.007   -5.462  40.699  1.00 56.62  ? 646  THR A C   1 
ATOM   4580  O O   . THR A 1 607 ? 9.874    -5.583  40.229  1.00 50.56  ? 646  THR A O   1 
ATOM   4581  C CB  . THR A 1 607 ? 11.126   -7.199  42.467  1.00 50.57  ? 646  THR A CB  1 
ATOM   4582  O OG1 . THR A 1 607 ? 11.262   -7.431  43.874  1.00 63.49  ? 646  THR A OG1 1 
ATOM   4583  C CG2 . THR A 1 607 ? 12.185   -7.979  41.721  1.00 46.72  ? 646  THR A CG2 1 
ATOM   4584  N N   . PHE A 1 608 ? 12.063   -5.129  39.965  1.00 45.38  ? 647  PHE A N   1 
ATOM   4585  C CA  . PHE A 1 608 ? 11.975   -4.983  38.519  1.00 42.71  ? 647  PHE A CA  1 
ATOM   4586  C C   . PHE A 1 608 ? 12.942   -5.935  37.822  1.00 53.12  ? 647  PHE A C   1 
ATOM   4587  O O   . PHE A 1 608 ? 14.124   -6.015  38.176  1.00 43.69  ? 647  PHE A O   1 
ATOM   4588  C CB  . PHE A 1 608 ? 12.278   -3.544  38.105  1.00 41.13  ? 647  PHE A CB  1 
ATOM   4589  C CG  . PHE A 1 608 ? 11.233   -2.551  38.530  1.00 47.77  ? 647  PHE A CG  1 
ATOM   4590  C CD1 . PHE A 1 608 ? 10.327   -2.042  37.610  1.00 44.15  ? 647  PHE A CD1 1 
ATOM   4591  C CD2 . PHE A 1 608 ? 11.165   -2.111  39.844  1.00 49.90  ? 647  PHE A CD2 1 
ATOM   4592  C CE1 . PHE A 1 608 ? 9.367    -1.109  37.992  1.00 48.20  ? 647  PHE A CE1 1 
ATOM   4593  C CE2 . PHE A 1 608 ? 10.205   -1.183  40.237  1.00 55.50  ? 647  PHE A CE2 1 
ATOM   4594  C CZ  . PHE A 1 608 ? 9.304    -0.682  39.307  1.00 48.37  ? 647  PHE A CZ  1 
ATOM   4595  N N   . SER A 1 609 ? 12.439   -6.662  36.829  1.00 40.60  ? 648  SER A N   1 
ATOM   4596  C CA  . SER A 1 609 ? 13.297   -7.539  36.041  1.00 44.73  ? 648  SER A CA  1 
ATOM   4597  C C   . SER A 1 609 ? 13.778   -6.803  34.802  1.00 47.03  ? 648  SER A C   1 
ATOM   4598  O O   . SER A 1 609 ? 12.998   -6.118  34.130  1.00 44.13  ? 648  SER A O   1 
ATOM   4599  C CB  . SER A 1 609 ? 12.557   -8.822  35.643  1.00 43.63  ? 648  SER A CB  1 
ATOM   4600  O OG  . SER A 1 609 ? 13.433   -9.728  34.991  1.00 58.88  ? 648  SER A OG  1 
ATOM   4601  N N   . VAL A 1 610 ? 15.066   -6.928  34.503  1.00 36.60  ? 649  VAL A N   1 
ATOM   4602  C CA  . VAL A 1 610 ? 15.622   -6.290  33.317  1.00 42.55  ? 649  VAL A CA  1 
ATOM   4603  C C   . VAL A 1 610 ? 16.146   -7.335  32.344  1.00 45.16  ? 649  VAL A C   1 
ATOM   4604  O O   . VAL A 1 610 ? 16.996   -8.145  32.691  1.00 43.70  ? 649  VAL A O   1 
ATOM   4605  C CB  . VAL A 1 610 ? 16.778   -5.335  33.661  1.00 41.90  ? 649  VAL A CB  1 
ATOM   4606  C CG1 . VAL A 1 610 ? 17.192   -4.535  32.432  1.00 49.31  ? 649  VAL A CG1 1 
ATOM   4607  C CG2 . VAL A 1 610 ? 16.383   -4.408  34.785  1.00 52.05  ? 649  VAL A CG2 1 
ATOM   4608  N N   . PHE A 1 611 ? 15.631   -7.315  31.124  1.00 41.21  ? 650  PHE A N   1 
ATOM   4609  C CA  . PHE A 1 611 ? 16.203   -8.099  30.045  1.00 38.62  ? 650  PHE A CA  1 
ATOM   4610  C C   . PHE A 1 611 ? 17.134   -7.179  29.278  1.00 45.35  ? 650  PHE A C   1 
ATOM   4611  O O   . PHE A 1 611 ? 16.741   -6.079  28.918  1.00 39.92  ? 650  PHE A O   1 
ATOM   4612  C CB  . PHE A 1 611 ? 15.109   -8.626  29.110  1.00 42.28  ? 650  PHE A CB  1 
ATOM   4613  C CG  . PHE A 1 611 ? 15.640   -9.226  27.835  1.00 47.34  ? 650  PHE A CG  1 
ATOM   4614  C CD1 . PHE A 1 611 ? 15.973   -10.565 27.772  1.00 40.32  ? 650  PHE A CD1 1 
ATOM   4615  C CD2 . PHE A 1 611 ? 15.819   -8.444  26.701  1.00 45.17  ? 650  PHE A CD2 1 
ATOM   4616  C CE1 . PHE A 1 611 ? 16.475   -11.116 26.603  1.00 48.42  ? 650  PHE A CE1 1 
ATOM   4617  C CE2 . PHE A 1 611 ? 16.317   -8.994  25.533  1.00 34.02  ? 650  PHE A CE2 1 
ATOM   4618  C CZ  . PHE A 1 611 ? 16.641   -10.328 25.486  1.00 33.05  ? 650  PHE A CZ  1 
ATOM   4619  N N   . ALA A 1 612 ? 18.371   -7.616  29.051  1.00 39.52  ? 651  ALA A N   1 
ATOM   4620  C CA  . ALA A 1 612 ? 19.301   -6.868  28.213  1.00 38.26  ? 651  ALA A CA  1 
ATOM   4621  C C   . ALA A 1 612 ? 19.776   -7.788  27.102  1.00 45.12  ? 651  ALA A C   1 
ATOM   4622  O O   . ALA A 1 612 ? 20.051   -8.960  27.349  1.00 40.03  ? 651  ALA A O   1 
ATOM   4623  C CB  . ALA A 1 612 ? 20.475   -6.348  29.032  1.00 37.47  ? 651  ALA A CB  1 
ATOM   4624  N N   . PRO A 1 613 ? 19.840   -7.270  25.864  1.00 49.61  ? 652  PRO A N   1 
ATOM   4625  C CA  . PRO A 1 613 ? 20.138   -8.082  24.672  1.00 52.34  ? 652  PRO A CA  1 
ATOM   4626  C C   . PRO A 1 613 ? 21.591   -8.538  24.638  1.00 43.06  ? 652  PRO A C   1 
ATOM   4627  O O   . PRO A 1 613 ? 21.939   -9.554  24.025  1.00 43.72  ? 652  PRO A O   1 
ATOM   4628  C CB  . PRO A 1 613 ? 19.873   -7.109  23.515  1.00 51.88  ? 652  PRO A CB  1 
ATOM   4629  C CG  . PRO A 1 613 ? 18.992   -6.060  24.088  1.00 50.06  ? 652  PRO A CG  1 
ATOM   4630  C CD  . PRO A 1 613 ? 19.455   -5.899  25.503  1.00 45.60  ? 652  PRO A CD  1 
ATOM   4631  N N   . THR A 1 614 ? 22.431   -7.759  25.300  1.00 41.91  ? 653  THR A N   1 
ATOM   4632  C CA  . THR A 1 614 ? 23.851   -8.032  25.379  1.00 50.84  ? 653  THR A CA  1 
ATOM   4633  C C   . THR A 1 614 ? 24.318   -7.491  26.716  1.00 45.39  ? 653  THR A C   1 
ATOM   4634  O O   . THR A 1 614 ? 23.588   -6.738  27.366  1.00 44.18  ? 653  THR A O   1 
ATOM   4635  C CB  . THR A 1 614 ? 24.630   -7.316  24.255  1.00 53.27  ? 653  THR A CB  1 
ATOM   4636  O OG1 . THR A 1 614 ? 24.581   -5.899  24.463  1.00 55.33  ? 653  THR A OG1 1 
ATOM   4637  C CG2 . THR A 1 614 ? 24.045   -7.654  22.881  1.00 56.52  ? 653  THR A CG2 1 
ATOM   4638  N N   . PRO A 1 615 ? 25.522   -7.891  27.144  1.00 48.71  ? 654  PRO A N   1 
ATOM   4639  C CA  . PRO A 1 615 ? 26.134   -7.344  28.359  1.00 51.63  ? 654  PRO A CA  1 
ATOM   4640  C C   . PRO A 1 615 ? 26.361   -5.831  28.238  1.00 49.38  ? 654  PRO A C   1 
ATOM   4641  O O   . PRO A 1 615 ? 26.263   -5.110  29.234  1.00 46.93  ? 654  PRO A O   1 
ATOM   4642  C CB  . PRO A 1 615 ? 27.468   -8.091  28.434  1.00 51.65  ? 654  PRO A CB  1 
ATOM   4643  C CG  . PRO A 1 615 ? 27.182   -9.404  27.754  1.00 51.97  ? 654  PRO A CG  1 
ATOM   4644  C CD  . PRO A 1 615 ? 26.294   -9.023  26.602  1.00 50.76  ? 654  PRO A CD  1 
ATOM   4645  N N   . SER A 1 616 ? 26.648   -5.362  27.025  1.00 48.96  ? 655  SER A N   1 
ATOM   4646  C CA  . SER A 1 616 ? 26.833   -3.932  26.781  1.00 55.48  ? 655  SER A CA  1 
ATOM   4647  C C   . SER A 1 616 ? 25.547   -3.154  27.069  1.00 57.00  ? 655  SER A C   1 
ATOM   4648  O O   . SER A 1 616 ? 25.568   -2.126  27.747  1.00 52.68  ? 655  SER A O   1 
ATOM   4649  C CB  . SER A 1 616 ? 27.296   -3.679  25.343  1.00 53.65  ? 655  SER A CB  1 
ATOM   4650  O OG  . SER A 1 616 ? 28.634   -4.108  25.156  1.00 59.14  ? 655  SER A OG  1 
ATOM   4651  N N   . ALA A 1 617 ? 24.428   -3.648  26.549  1.00 48.83  ? 656  ALA A N   1 
ATOM   4652  C CA  . ALA A 1 617 ? 23.139   -3.036  26.847  1.00 54.31  ? 656  ALA A CA  1 
ATOM   4653  C C   . ALA A 1 617 ? 22.900   -2.968  28.357  1.00 40.01  ? 656  ALA A C   1 
ATOM   4654  O O   . ALA A 1 617 ? 22.519   -1.929  28.875  1.00 47.30  ? 656  ALA A O   1 
ATOM   4655  C CB  . ALA A 1 617 ? 22.022   -3.796  26.160  1.00 46.98  ? 656  ALA A CB  1 
ATOM   4656  N N   . MET A 1 618 ? 23.139   -4.076  29.056  1.00 50.20  ? 657  MET A N   1 
ATOM   4657  C CA  . MET A 1 618 ? 22.868   -4.144  30.489  1.00 40.60  ? 657  MET A CA  1 
ATOM   4658  C C   . MET A 1 618 ? 23.701   -3.120  31.222  1.00 49.21  ? 657  MET A C   1 
ATOM   4659  O O   . MET A 1 618 ? 23.200   -2.414  32.096  1.00 48.26  ? 657  MET A O   1 
ATOM   4660  C CB  . MET A 1 618 ? 23.143   -5.542  31.038  1.00 41.97  ? 657  MET A CB  1 
ATOM   4661  C CG  . MET A 1 618 ? 22.843   -5.707  32.526  1.00 51.03  ? 657  MET A CG  1 
ATOM   4662  S SD  . MET A 1 618 ? 21.101   -5.521  32.990  1.00 51.97  ? 657  MET A SD  1 
ATOM   4663  C CE  . MET A 1 618 ? 20.450   -7.166  32.673  1.00 51.18  ? 657  MET A CE  1 
ATOM   4664  N N   . HIS A 1 619 ? 24.976   -3.035  30.853  1.00 58.13  ? 658  HIS A N   1 
ATOM   4665  C CA  . HIS A 1 619 ? 25.873   -2.039  31.429  1.00 61.95  ? 658  HIS A CA  1 
ATOM   4666  C C   . HIS A 1 619 ? 25.273   -0.632  31.305  1.00 57.74  ? 658  HIS A C   1 
ATOM   4667  O O   . HIS A 1 619 ? 25.081   0.052   32.310  1.00 52.95  ? 658  HIS A O   1 
ATOM   4668  C CB  . HIS A 1 619 ? 27.249   -2.114  30.764  1.00 64.69  ? 658  HIS A CB  1 
ATOM   4669  C CG  . HIS A 1 619 ? 28.350   -1.506  31.578  1.00 74.47  ? 658  HIS A CG  1 
ATOM   4670  N ND1 . HIS A 1 619 ? 28.110   -0.690  32.664  1.00 70.81  ? 658  HIS A ND1 1 
ATOM   4671  C CD2 . HIS A 1 619 ? 29.697   -1.599  31.468  1.00 79.42  ? 658  HIS A CD2 1 
ATOM   4672  C CE1 . HIS A 1 619 ? 29.261   -0.301  33.183  1.00 78.28  ? 658  HIS A CE1 1 
ATOM   4673  N NE2 . HIS A 1 619 ? 30.239   -0.839  32.476  1.00 88.38  ? 658  HIS A NE2 1 
ATOM   4674  N N   . GLU A 1 620 ? 24.959   -0.223  30.076  1.00 55.90  ? 659  GLU A N   1 
ATOM   4675  C CA  . GLU A 1 620 ? 24.288   1.055   29.813  1.00 58.73  ? 659  GLU A CA  1 
ATOM   4676  C C   . GLU A 1 620 ? 23.013   1.239   30.634  1.00 59.02  ? 659  GLU A C   1 
ATOM   4677  O O   . GLU A 1 620 ? 22.769   2.317   31.177  1.00 53.53  ? 659  GLU A O   1 
ATOM   4678  C CB  . GLU A 1 620 ? 23.940   1.188   28.332  1.00 51.90  ? 659  GLU A CB  1 
ATOM   4679  C CG  . GLU A 1 620 ? 25.138   1.126   27.406  1.00 61.93  ? 659  GLU A CG  1 
ATOM   4680  C CD  . GLU A 1 620 ? 24.751   1.297   25.949  1.00 64.74  ? 659  GLU A CD  1 
ATOM   4681  O OE1 . GLU A 1 620 ? 25.564   0.926   25.072  1.00 61.73  ? 659  GLU A OE1 1 
ATOM   4682  O OE2 . GLU A 1 620 ? 23.636   1.804   25.683  1.00 65.01  ? 659  GLU A OE2 1 
ATOM   4683  N N   . ALA A 1 621 ? 22.191   0.195   30.708  1.00 48.50  ? 660  ALA A N   1 
ATOM   4684  C CA  . ALA A 1 621 ? 20.992   0.256   31.540  1.00 55.66  ? 660  ALA A CA  1 
ATOM   4685  C C   . ALA A 1 621 ? 21.346   0.412   33.021  1.00 57.75  ? 660  ALA A C   1 
ATOM   4686  O O   . ALA A 1 621 ? 20.722   1.203   33.733  1.00 58.69  ? 660  ALA A O   1 
ATOM   4687  C CB  . ALA A 1 621 ? 20.109   -0.960  31.319  1.00 40.89  ? 660  ALA A CB  1 
ATOM   4688  N N   . ARG A 1 622 ? 22.346   -0.331  33.487  1.00 52.54  ? 661  ARG A N   1 
ATOM   4689  C CA  . ARG A 1 622 ? 22.779   -0.200  34.881  1.00 66.24  ? 661  ARG A CA  1 
ATOM   4690  C C   . ARG A 1 622 ? 23.255   1.220   35.208  1.00 71.68  ? 661  ARG A C   1 
ATOM   4691  O O   . ARG A 1 622 ? 23.188   1.661   36.360  1.00 68.48  ? 661  ARG A O   1 
ATOM   4692  C CB  . ARG A 1 622 ? 23.829   -1.256  35.259  1.00 65.28  ? 661  ARG A CB  1 
ATOM   4693  C CG  . ARG A 1 622 ? 23.238   -2.455  36.015  1.00 71.44  ? 661  ARG A CG  1 
ATOM   4694  C CD  . ARG A 1 622 ? 24.285   -3.520  36.343  1.00 68.83  ? 661  ARG A CD  1 
ATOM   4695  N NE  . ARG A 1 622 ? 24.905   -4.071  35.139  1.00 75.16  ? 661  ARG A NE  1 
ATOM   4696  C CZ  . ARG A 1 622 ? 26.124   -3.753  34.709  1.00 70.95  ? 661  ARG A CZ  1 
ATOM   4697  N NH1 . ARG A 1 622 ? 26.871   -2.894  35.390  1.00 71.74  ? 661  ARG A NH1 1 
ATOM   4698  N NH2 . ARG A 1 622 ? 26.600   -4.301  33.599  1.00 71.98  ? 661  ARG A NH2 1 
ATOM   4699  N N   . ASP A 1 623 ? 23.708   1.938   34.184  1.00 63.74  ? 662  ASP A N   1 
ATOM   4700  C CA  . ASP A 1 623 ? 24.174   3.309   34.363  1.00 70.21  ? 662  ASP A CA  1 
ATOM   4701  C C   . ASP A 1 623 ? 23.037   4.335   34.283  1.00 73.95  ? 662  ASP A C   1 
ATOM   4702  O O   . ASP A 1 623 ? 23.060   5.353   34.977  1.00 71.27  ? 662  ASP A O   1 
ATOM   4703  C CB  . ASP A 1 623 ? 25.268   3.646   33.343  1.00 66.82  ? 662  ASP A CB  1 
ATOM   4704  C CG  . ASP A 1 623 ? 26.596   2.961   33.653  1.00 71.92  ? 662  ASP A CG  1 
ATOM   4705  O OD1 . ASP A 1 623 ? 26.778   2.474   34.794  1.00 64.63  ? 662  ASP A OD1 1 
ATOM   4706  O OD2 . ASP A 1 623 ? 27.464   2.922   32.750  1.00 68.45  ? 662  ASP A OD2 1 
ATOM   4707  N N   . PHE A 1 624 ? 22.054   4.072   33.425  1.00 68.97  ? 663  PHE A N   1 
ATOM   4708  C CA  . PHE A 1 624 ? 20.880   4.933   33.318  1.00 65.39  ? 663  PHE A CA  1 
ATOM   4709  C C   . PHE A 1 624 ? 20.059   4.793   34.596  1.00 66.66  ? 663  PHE A C   1 
ATOM   4710  O O   . PHE A 1 624 ? 19.476   5.764   35.078  1.00 71.02  ? 663  PHE A O   1 
ATOM   4711  C CB  . PHE A 1 624 ? 20.058   4.557   32.074  1.00 66.79  ? 663  PHE A CB  1 
ATOM   4712  C CG  . PHE A 1 624 ? 18.811   5.398   31.859  1.00 76.68  ? 663  PHE A CG  1 
ATOM   4713  C CD1 . PHE A 1 624 ? 18.746   6.321   30.820  1.00 78.39  ? 663  PHE A CD1 1 
ATOM   4714  C CD2 . PHE A 1 624 ? 17.692   5.238   32.669  1.00 74.67  ? 663  PHE A CD2 1 
ATOM   4715  C CE1 . PHE A 1 624 ? 17.591   7.083   30.605  1.00 72.12  ? 663  PHE A CE1 1 
ATOM   4716  C CE2 . PHE A 1 624 ? 16.538   6.000   32.466  1.00 66.85  ? 663  PHE A CE2 1 
ATOM   4717  C CZ  . PHE A 1 624 ? 16.487   6.921   31.432  1.00 65.78  ? 663  PHE A CZ  1 
ATOM   4718  N N   . ILE A 1 625 ? 20.040   3.582   35.151  1.00 72.18  ? 664  ILE A N   1 
ATOM   4719  C CA  . ILE A 1 625 ? 19.297   3.290   36.377  1.00 66.98  ? 664  ILE A CA  1 
ATOM   4720  C C   . ILE A 1 625 ? 20.068   3.686   37.625  1.00 67.53  ? 664  ILE A C   1 
ATOM   4721  O O   . ILE A 1 625 ? 19.498   3.822   38.708  1.00 73.37  ? 664  ILE A O   1 
ATOM   4722  C CB  . ILE A 1 625 ? 18.954   1.790   36.488  1.00 71.14  ? 664  ILE A CB  1 
ATOM   4723  C CG1 . ILE A 1 625 ? 17.756   1.440   35.605  1.00 66.31  ? 664  ILE A CG1 1 
ATOM   4724  C CG2 . ILE A 1 625 ? 18.665   1.393   37.935  1.00 62.18  ? 664  ILE A CG2 1 
ATOM   4725  C CD1 . ILE A 1 625 ? 17.257   0.023   35.811  1.00 64.69  ? 664  ILE A CD1 1 
ATOM   4726  N N   . THR A 1 626 ? 21.373   3.867   37.478  1.00 79.27  ? 665  THR A N   1 
ATOM   4727  C CA  . THR A 1 626 ? 22.208   4.151   38.637  1.00 83.01  ? 665  THR A CA  1 
ATOM   4728  C C   . THR A 1 626 ? 22.161   5.627   39.058  1.00 82.27  ? 665  THR A C   1 
ATOM   4729  O O   . THR A 1 626 ? 22.899   6.048   39.949  1.00 86.04  ? 665  THR A O   1 
ATOM   4730  C CB  . THR A 1 626 ? 23.665   3.694   38.413  1.00 76.19  ? 665  THR A CB  1 
ATOM   4731  O OG1 . THR A 1 626 ? 24.275   3.395   39.675  1.00 86.59  ? 665  THR A OG1 1 
ATOM   4732  C CG2 . THR A 1 626 ? 24.467   4.767   37.686  1.00 77.24  ? 665  THR A CG2 1 
ATOM   4733  N N   . GLU A 1 627 ? 21.282   6.403   38.426  1.00 80.56  ? 666  GLU A N   1 
ATOM   4734  C CA  . GLU A 1 627 ? 21.095   7.805   38.794  1.00 74.93  ? 666  GLU A CA  1 
ATOM   4735  C C   . GLU A 1 627 ? 20.886   7.949   40.301  1.00 80.58  ? 666  GLU A C   1 
ATOM   4736  O O   . GLU A 1 627 ? 20.600   6.972   41.000  1.00 80.56  ? 666  GLU A O   1 
ATOM   4737  C CB  . GLU A 1 627 ? 19.905   8.410   38.041  1.00 76.20  ? 666  GLU A CB  1 
ATOM   4738  C CG  . GLU A 1 627 ? 18.707   8.757   38.929  1.00 84.26  ? 666  GLU A CG  1 
ATOM   4739  C CD  . GLU A 1 627 ? 17.931   7.533   39.388  1.00 72.73  ? 666  GLU A CD  1 
ATOM   4740  O OE1 . GLU A 1 627 ? 17.735   6.619   38.564  1.00 69.00  ? 666  GLU A OE1 1 
ATOM   4741  O OE2 . GLU A 1 627 ? 17.517   7.483   40.568  1.00 62.90  ? 666  GLU A OE2 1 
ATOM   4742  N N   . GLY B 1 1   ? -49.350  -15.711 18.332  1.00 36.46  ? 40   GLY C N   1 
ATOM   4743  C CA  . GLY B 1 1   ? -48.197  -16.285 18.997  1.00 41.19  ? 40   GLY C CA  1 
ATOM   4744  C C   . GLY B 1 1   ? -46.903  -15.558 18.674  1.00 39.49  ? 40   GLY C C   1 
ATOM   4745  O O   . GLY B 1 1   ? -46.882  -14.628 17.866  1.00 39.96  ? 40   GLY C O   1 
ATOM   4746  N N   . SER B 1 2   ? -45.827  -15.993 19.321  1.00 42.37  ? 41   SER C N   1 
ATOM   4747  C CA  . SER B 1 2   ? -44.496  -15.428 19.120  1.00 44.06  ? 41   SER C CA  1 
ATOM   4748  C C   . SER B 1 2   ? -44.087  -15.460 17.650  1.00 44.65  ? 41   SER C C   1 
ATOM   4749  O O   . SER B 1 2   ? -44.153  -16.506 17.014  1.00 33.28  ? 41   SER C O   1 
ATOM   4750  C CB  . SER B 1 2   ? -43.476  -16.210 19.959  1.00 49.37  ? 41   SER C CB  1 
ATOM   4751  O OG  . SER B 1 2   ? -42.146  -15.845 19.635  1.00 47.53  ? 41   SER C OG  1 
ATOM   4752  N N   . HIS B 1 3   ? -43.673  -14.311 17.115  1.00 42.61  ? 42   HIS C N   1 
ATOM   4753  C CA  . HIS B 1 3   ? -43.131  -14.239 15.751  1.00 46.80  ? 42   HIS C CA  1 
ATOM   4754  C C   . HIS B 1 3   ? -41.593  -14.273 15.716  1.00 54.20  ? 42   HIS C C   1 
ATOM   4755  O O   . HIS B 1 3   ? -40.988  -14.037 14.665  1.00 48.73  ? 42   HIS C O   1 
ATOM   4756  C CB  . HIS B 1 3   ? -43.593  -12.954 15.052  1.00 40.39  ? 42   HIS C CB  1 
ATOM   4757  C CG  . HIS B 1 3   ? -44.912  -13.071 14.359  1.00 47.61  ? 42   HIS C CG  1 
ATOM   4758  N ND1 . HIS B 1 3   ? -45.064  -12.835 13.007  1.00 55.78  ? 42   HIS C ND1 1 
ATOM   4759  C CD2 . HIS B 1 3   ? -46.144  -13.395 14.826  1.00 53.47  ? 42   HIS C CD2 1 
ATOM   4760  C CE1 . HIS B 1 3   ? -46.332  -13.010 12.671  1.00 56.08  ? 42   HIS C CE1 1 
ATOM   4761  N NE2 . HIS B 1 3   ? -47.007  -13.351 13.756  1.00 59.74  ? 42   HIS C NE2 1 
ATOM   4762  N N   . MET B 1 4   ? -40.956  -14.549 16.849  1.00 37.54  ? 43   MET C N   1 
ATOM   4763  C CA  . MET B 1 4   ? -39.507  -14.405 16.924  1.00 46.20  ? 43   MET C CA  1 
ATOM   4764  C C   . MET B 1 4   ? -38.741  -15.723 16.883  1.00 35.91  ? 43   MET C C   1 
ATOM   4765  O O   . MET B 1 4   ? -38.794  -16.507 17.826  1.00 37.64  ? 43   MET C O   1 
ATOM   4766  C CB  . MET B 1 4   ? -39.107  -13.618 18.167  1.00 38.59  ? 43   MET C CB  1 
ATOM   4767  C CG  . MET B 1 4   ? -37.656  -13.179 18.124  1.00 43.54  ? 43   MET C CG  1 
ATOM   4768  S SD  . MET B 1 4   ? -37.063  -12.782 19.761  1.00 40.19  ? 43   MET C SD  1 
ATOM   4769  C CE  . MET B 1 4   ? -37.780  -14.124 20.699  1.00 33.14  ? 43   MET C CE  1 
ATOM   4770  N N   . ALA B 1 5   ? -38.014  -15.947 15.790  1.00 35.92  ? 44   ALA C N   1 
ATOM   4771  C CA  . ALA B 1 5   ? -37.253  -17.177 15.622  1.00 36.90  ? 44   ALA C CA  1 
ATOM   4772  C C   . ALA B 1 5   ? -36.319  -17.410 16.809  1.00 42.80  ? 44   ALA C C   1 
ATOM   4773  O O   . ALA B 1 5   ? -35.539  -16.535 17.171  1.00 40.84  ? 44   ALA C O   1 
ATOM   4774  C CB  . ALA B 1 5   ? -36.466  -17.145 14.313  1.00 35.64  ? 44   ALA C CB  1 
ATOM   4775  N N   . SER B 1 6   ? -36.413  -18.588 17.416  1.00 40.94  ? 45   SER C N   1 
ATOM   4776  C CA  . SER B 1 6   ? -35.563  -18.936 18.545  1.00 40.29  ? 45   SER C CA  1 
ATOM   4777  C C   . SER B 1 6   ? -35.290  -20.428 18.515  1.00 42.96  ? 45   SER C C   1 
ATOM   4778  O O   . SER B 1 6   ? -36.111  -21.204 18.023  1.00 38.65  ? 45   SER C O   1 
ATOM   4779  C CB  . SER B 1 6   ? -36.230  -18.532 19.859  1.00 34.09  ? 45   SER C CB  1 
ATOM   4780  O OG  . SER B 1 6   ? -36.727  -17.207 19.744  1.00 48.29  ? 45   SER C OG  1 
ATOM   4781  N N   . ALA B 1 7   ? -34.134  -20.830 19.031  1.00 37.40  ? 46   ALA C N   1 
ATOM   4782  C CA  . ALA B 1 7   ? -33.732  -22.226 18.961  1.00 32.21  ? 46   ALA C CA  1 
ATOM   4783  C C   . ALA B 1 7   ? -32.711  -22.587 20.032  1.00 37.09  ? 46   ALA C C   1 
ATOM   4784  O O   . ALA B 1 7   ? -31.796  -21.815 20.328  1.00 34.05  ? 46   ALA C O   1 
ATOM   4785  C CB  . ALA B 1 7   ? -33.183  -22.540 17.580  1.00 32.16  ? 46   ALA C CB  1 
ATOM   4786  N N   . VAL B 1 8   ? -32.890  -23.765 20.620  1.00 29.81  ? 47   VAL C N   1 
ATOM   4787  C CA  . VAL B 1 8   ? -31.924  -24.317 21.548  1.00 34.56  ? 47   VAL C CA  1 
ATOM   4788  C C   . VAL B 1 8   ? -31.727  -25.786 21.216  1.00 40.80  ? 47   VAL C C   1 
ATOM   4789  O O   . VAL B 1 8   ? -32.657  -26.470 20.750  1.00 36.19  ? 47   VAL C O   1 
ATOM   4790  C CB  . VAL B 1 8   ? -32.349  -24.155 23.034  1.00 38.09  ? 47   VAL C CB  1 
ATOM   4791  C CG1 . VAL B 1 8   ? -32.493  -22.685 23.387  1.00 40.73  ? 47   VAL C CG1 1 
ATOM   4792  C CG2 . VAL B 1 8   ? -33.647  -24.912 23.318  1.00 37.09  ? 47   VAL C CG2 1 
ATOM   4793  N N   . ALA B 1 9   ? -30.502  -26.256 21.422  1.00 27.76  ? 48   ALA C N   1 
ATOM   4794  C CA  . ALA B 1 9   ? -30.191  -27.666 21.284  1.00 32.24  ? 48   ALA C CA  1 
ATOM   4795  C C   . ALA B 1 9   ? -29.987  -28.242 22.667  1.00 35.78  ? 48   ALA C C   1 
ATOM   4796  O O   . ALA B 1 9   ? -29.354  -27.622 23.521  1.00 36.28  ? 48   ALA C O   1 
ATOM   4797  C CB  . ALA B 1 9   ? -28.940  -27.859 20.433  1.00 36.66  ? 48   ALA C CB  1 
ATOM   4798  N N   . VAL B 1 10  ? -30.533  -29.427 22.895  1.00 30.95  ? 49   VAL C N   1 
ATOM   4799  C CA  . VAL B 1 10  ? -30.361  -30.093 24.173  1.00 32.38  ? 49   VAL C CA  1 
ATOM   4800  C C   . VAL B 1 10  ? -29.619  -31.398 23.921  1.00 41.74  ? 49   VAL C C   1 
ATOM   4801  O O   . VAL B 1 10  ? -30.014  -32.181 23.063  1.00 40.81  ? 49   VAL C O   1 
ATOM   4802  C CB  . VAL B 1 10  ? -31.710  -30.362 24.864  1.00 31.65  ? 49   VAL C CB  1 
ATOM   4803  C CG1 . VAL B 1 10  ? -31.531  -31.210 26.125  1.00 32.32  ? 49   VAL C CG1 1 
ATOM   4804  C CG2 . VAL B 1 10  ? -32.413  -29.044 25.195  1.00 34.65  ? 49   VAL C CG2 1 
ATOM   4805  N N   . ASP B 1 11  ? -28.533  -31.619 24.651  1.00 40.22  ? 50   ASP C N   1 
ATOM   4806  C CA  . ASP B 1 11  ? -27.762  -32.854 24.493  1.00 50.40  ? 50   ASP C CA  1 
ATOM   4807  C C   . ASP B 1 11  ? -28.232  -33.944 25.440  1.00 44.36  ? 50   ASP C C   1 
ATOM   4808  O O   . ASP B 1 11  ? -28.203  -33.777 26.658  1.00 55.10  ? 50   ASP C O   1 
ATOM   4809  C CB  . ASP B 1 11  ? -26.266  -32.605 24.679  1.00 56.64  ? 50   ASP C CB  1 
ATOM   4810  C CG  . ASP B 1 11  ? -25.533  -32.496 23.362  1.00 68.79  ? 50   ASP C CG  1 
ATOM   4811  O OD1 . ASP B 1 11  ? -25.474  -31.372 22.816  1.00 61.67  ? 50   ASP C OD1 1 
ATOM   4812  O OD2 . ASP B 1 11  ? -25.036  -33.538 22.869  1.00 71.15  ? 50   ASP C OD2 1 
ATOM   4813  N N   . LEU B 1 12  ? -28.665  -35.057 24.861  1.00 37.61  ? 51   LEU C N   1 
ATOM   4814  C CA  . LEU B 1 12  ? -29.191  -36.183 25.612  1.00 45.33  ? 51   LEU C CA  1 
ATOM   4815  C C   . LEU B 1 12  ? -28.363  -37.396 25.237  1.00 44.42  ? 51   LEU C C   1 
ATOM   4816  O O   . LEU B 1 12  ? -28.707  -38.119 24.301  1.00 46.95  ? 51   LEU C O   1 
ATOM   4817  C CB  . LEU B 1 12  ? -30.652  -36.443 25.232  1.00 39.52  ? 51   LEU C CB  1 
ATOM   4818  C CG  . LEU B 1 12  ? -31.632  -35.281 25.385  1.00 40.45  ? 51   LEU C CG  1 
ATOM   4819  C CD1 . LEU B 1 12  ? -32.974  -35.641 24.760  1.00 41.52  ? 51   LEU C CD1 1 
ATOM   4820  C CD2 . LEU B 1 12  ? -31.771  -34.941 26.863  1.00 44.19  ? 51   LEU C CD2 1 
ATOM   4821  N N   . GLY B 1 13  ? -27.265  -37.609 25.952  1.00 55.04  ? 52   GLY C N   1 
ATOM   4822  C CA  . GLY B 1 13  ? -26.340  -38.663 25.586  1.00 62.51  ? 52   GLY C CA  1 
ATOM   4823  C C   . GLY B 1 13  ? -25.827  -38.493 24.165  1.00 58.73  ? 52   GLY C C   1 
ATOM   4824  O O   . GLY B 1 13  ? -25.094  -37.547 23.870  1.00 60.13  ? 52   GLY C O   1 
ATOM   4825  N N   . ASN B 1 14  ? -26.249  -39.392 23.279  1.00 71.64  ? 53   ASN C N   1 
ATOM   4826  C CA  . ASN B 1 14  ? -25.686  -39.500 21.927  1.00 71.96  ? 53   ASN C CA  1 
ATOM   4827  C C   . ASN B 1 14  ? -26.364  -38.694 20.807  1.00 69.23  ? 53   ASN C C   1 
ATOM   4828  O O   . ASN B 1 14  ? -25.792  -38.532 19.724  1.00 60.90  ? 53   ASN C O   1 
ATOM   4829  C CB  . ASN B 1 14  ? -25.611  -40.975 21.519  1.00 72.35  ? 53   ASN C CB  1 
ATOM   4830  C CG  . ASN B 1 14  ? -26.893  -41.732 21.832  1.00 81.31  ? 53   ASN C CG  1 
ATOM   4831  O OD1 . ASN B 1 14  ? -27.919  -41.130 22.162  1.00 73.69  ? 53   ASN C OD1 1 
ATOM   4832  N ND2 . ASN B 1 14  ? -26.839  -43.062 21.733  1.00 80.62  ? 53   ASN C ND2 1 
ATOM   4833  N N   . ARG B 1 15  ? -27.580  -38.209 21.050  1.00 66.78  ? 54   ARG C N   1 
ATOM   4834  C CA  . ARG B 1 15  ? -28.301  -37.429 20.042  1.00 63.75  ? 54   ARG C CA  1 
ATOM   4835  C C   . ARG B 1 15  ? -28.821  -36.129 20.651  1.00 51.67  ? 54   ARG C C   1 
ATOM   4836  O O   . ARG B 1 15  ? -29.163  -36.083 21.831  1.00 51.88  ? 54   ARG C O   1 
ATOM   4837  C CB  . ARG B 1 15  ? -29.449  -38.248 19.425  1.00 62.23  ? 54   ARG C CB  1 
ATOM   4838  C CG  . ARG B 1 15  ? -29.044  -39.094 18.208  1.00 70.65  ? 54   ARG C CG  1 
ATOM   4839  C CD  . ARG B 1 15  ? -30.115  -40.130 17.818  1.00 61.87  ? 54   ARG C CD  1 
ATOM   4840  N NE  . ARG B 1 15  ? -29.926  -41.418 18.496  1.00 71.64  ? 54   ARG C NE  1 
ATOM   4841  C CZ  . ARG B 1 15  ? -30.497  -41.760 19.654  1.00 69.87  ? 54   ARG C CZ  1 
ATOM   4842  N NH1 . ARG B 1 15  ? -31.301  -40.905 20.279  1.00 61.44  ? 54   ARG C NH1 1 
ATOM   4843  N NH2 . ARG B 1 15  ? -30.258  -42.958 20.195  1.00 56.27  ? 54   ARG C NH2 1 
ATOM   4844  N N   . LYS B 1 16  ? -28.860  -35.064 19.861  1.00 42.66  ? 55   LYS C N   1 
ATOM   4845  C CA  . LYS B 1 16  ? -29.338  -33.803 20.400  1.00 47.19  ? 55   LYS C CA  1 
ATOM   4846  C C   . LYS B 1 16  ? -30.762  -33.477 19.970  1.00 44.88  ? 55   LYS C C   1 
ATOM   4847  O O   . LYS B 1 16  ? -31.206  -33.835 18.877  1.00 37.49  ? 55   LYS C O   1 
ATOM   4848  C CB  . LYS B 1 16  ? -28.381  -32.653 20.092  1.00 54.70  ? 55   LYS C CB  1 
ATOM   4849  C CG  . LYS B 1 16  ? -28.366  -32.191 18.661  1.00 51.65  ? 55   LYS C CG  1 
ATOM   4850  C CD  . LYS B 1 16  ? -27.317  -31.108 18.502  1.00 64.75  ? 55   LYS C CD  1 
ATOM   4851  C CE  . LYS B 1 16  ? -26.027  -31.499 19.225  1.00 62.67  ? 55   LYS C CE  1 
ATOM   4852  N NZ  . LYS B 1 16  ? -25.133  -30.325 19.475  1.00 66.84  ? 55   LYS C NZ  1 
ATOM   4853  N N   . LEU B 1 17  ? -31.474  -32.805 20.863  1.00 36.72  ? 56   LEU C N   1 
ATOM   4854  C CA  . LEU B 1 17  ? -32.854  -32.429 20.627  1.00 38.02  ? 56   LEU C CA  1 
ATOM   4855  C C   . LEU B 1 17  ? -32.820  -30.980 20.183  1.00 34.02  ? 56   LEU C C   1 
ATOM   4856  O O   . LEU B 1 17  ? -32.360  -30.126 20.933  1.00 38.66  ? 56   LEU C O   1 
ATOM   4857  C CB  . LEU B 1 17  ? -33.625  -32.519 21.942  1.00 34.84  ? 56   LEU C CB  1 
ATOM   4858  C CG  . LEU B 1 17  ? -34.910  -33.307 22.127  1.00 43.57  ? 56   LEU C CG  1 
ATOM   4859  C CD1 . LEU B 1 17  ? -35.640  -32.749 23.343  1.00 32.64  ? 56   LEU C CD1 1 
ATOM   4860  C CD2 . LEU B 1 17  ? -35.776  -33.224 20.896  1.00 35.18  ? 56   LEU C CD2 1 
ATOM   4861  N N   . GLU B 1 18  ? -33.283  -30.691 18.973  1.00 32.05  ? 57   GLU C N   1 
ATOM   4862  C CA  . GLU B 1 18  ? -33.339  -29.305 18.516  1.00 31.61  ? 57   GLU C CA  1 
ATOM   4863  C C   . GLU B 1 18  ? -34.753  -28.744 18.641  1.00 35.24  ? 57   GLU C C   1 
ATOM   4864  O O   . GLU B 1 18  ? -35.676  -29.176 17.949  1.00 34.99  ? 57   GLU C O   1 
ATOM   4865  C CB  . GLU B 1 18  ? -32.854  -29.168 17.081  1.00 31.19  ? 57   GLU C CB  1 
ATOM   4866  C CG  . GLU B 1 18  ? -31.411  -28.698 16.960  1.00 57.98  ? 57   GLU C CG  1 
ATOM   4867  C CD  . GLU B 1 18  ? -30.553  -29.714 16.244  1.00 64.95  ? 57   GLU C CD  1 
ATOM   4868  O OE1 . GLU B 1 18  ? -29.315  -29.528 16.195  1.00 77.17  ? 57   GLU C OE1 1 
ATOM   4869  O OE2 . GLU B 1 18  ? -31.127  -30.703 15.733  1.00 55.68  ? 57   GLU C OE2 1 
ATOM   4870  N N   . ILE B 1 19  ? -34.907  -27.786 19.536  1.00 27.80  ? 58   ILE C N   1 
ATOM   4871  C CA  . ILE B 1 19  ? -36.195  -27.170 19.807  1.00 30.45  ? 58   ILE C CA  1 
ATOM   4872  C C   . ILE B 1 19  ? -36.177  -25.743 19.293  1.00 35.01  ? 58   ILE C C   1 
ATOM   4873  O O   . ILE B 1 19  ? -35.224  -25.009 19.546  1.00 32.42  ? 58   ILE C O   1 
ATOM   4874  C CB  . ILE B 1 19  ? -36.482  -27.183 21.314  1.00 31.38  ? 58   ILE C CB  1 
ATOM   4875  C CG1 . ILE B 1 19  ? -36.478  -28.629 21.827  1.00 32.41  ? 58   ILE C CG1 1 
ATOM   4876  C CG2 . ILE B 1 19  ? -37.796  -26.479 21.615  1.00 28.09  ? 58   ILE C CG2 1 
ATOM   4877  C CD1 . ILE B 1 19  ? -36.240  -28.753 23.309  1.00 39.08  ? 58   ILE C CD1 1 
ATOM   4878  N N   . SER B 1 20  ? -37.216  -25.349 18.557  1.00 28.11  ? 59   SER C N   1 
ATOM   4879  C CA  . SER B 1 20  ? -37.291  -23.980 18.042  1.00 25.90  ? 59   SER C CA  1 
ATOM   4880  C C   . SER B 1 20  ? -38.733  -23.479 17.929  1.00 30.01  ? 59   SER C C   1 
ATOM   4881  O O   . SER B 1 20  ? -39.677  -24.251 18.089  1.00 28.41  ? 59   SER C O   1 
ATOM   4882  C CB  . SER B 1 20  ? -36.604  -23.876 16.682  1.00 31.94  ? 59   SER C CB  1 
ATOM   4883  O OG  . SER B 1 20  ? -37.236  -24.697 15.715  1.00 29.77  ? 59   SER C OG  1 
ATOM   4884  N N   . SER B 1 21  ? -38.886  -22.191 17.637  1.00 26.04  ? 60   SER C N   1 
ATOM   4885  C CA  . SER B 1 21  ? -40.197  -21.573 17.501  1.00 27.69  ? 60   SER C CA  1 
ATOM   4886  C C   . SER B 1 21  ? -40.089  -20.270 16.732  1.00 30.57  ? 60   SER C C   1 
ATOM   4887  O O   . SER B 1 21  ? -38.999  -19.750 16.527  1.00 26.82  ? 60   SER C O   1 
ATOM   4888  C CB  . SER B 1 21  ? -40.798  -21.269 18.878  1.00 27.45  ? 60   SER C CB  1 
ATOM   4889  O OG  . SER B 1 21  ? -42.184  -20.956 18.755  1.00 32.16  ? 60   SER C OG  1 
ATOM   4890  N N   . GLY B 1 22  ? -41.231  -19.725 16.331  1.00 27.84  ? 61   GLY C N   1 
ATOM   4891  C CA  . GLY B 1 22  ? -41.257  -18.365 15.819  1.00 30.90  ? 61   GLY C CA  1 
ATOM   4892  C C   . GLY B 1 22  ? -41.199  -18.207 14.313  1.00 28.99  ? 61   GLY C C   1 
ATOM   4893  O O   . GLY B 1 22  ? -41.135  -17.087 13.819  1.00 28.88  ? 61   GLY C O   1 
ATOM   4894  N N   . LYS B 1 23  ? -41.209  -19.312 13.574  1.00 26.60  ? 62   LYS C N   1 
ATOM   4895  C CA  . LYS B 1 23  ? -41.217  -19.224 12.115  1.00 30.37  ? 62   LYS C CA  1 
ATOM   4896  C C   . LYS B 1 23  ? -42.520  -19.761 11.533  1.00 27.57  ? 62   LYS C C   1 
ATOM   4897  O O   . LYS B 1 23  ? -43.089  -19.196 10.598  1.00 28.06  ? 62   LYS C O   1 
ATOM   4898  C CB  . LYS B 1 23  ? -40.025  -19.987 11.511  1.00 37.31  ? 62   LYS C CB  1 
ATOM   4899  C CG  . LYS B 1 23  ? -38.670  -19.313 11.764  1.00 48.30  ? 62   LYS C CG  1 
ATOM   4900  C CD  . LYS B 1 23  ? -37.488  -20.154 11.279  1.00 54.42  ? 62   LYS C CD  1 
ATOM   4901  C CE  . LYS B 1 23  ? -36.177  -19.392 11.463  1.00 60.47  ? 62   LYS C CE  1 
ATOM   4902  N NZ  . LYS B 1 23  ? -34.965  -20.248 11.256  1.00 78.62  ? 62   LYS C NZ  1 
ATOM   4903  N N   . LEU B 1 24  ? -42.992  -20.855 12.105  1.00 29.07  ? 63   LEU C N   1 
ATOM   4904  C CA  . LEU B 1 24  ? -44.104  -21.584 11.528  1.00 28.25  ? 63   LEU C CA  1 
ATOM   4905  C C   . LEU B 1 24  ? -45.377  -21.416 12.355  1.00 28.15  ? 63   LEU C C   1 
ATOM   4906  O O   . LEU B 1 24  ? -45.316  -21.380 13.581  1.00 29.22  ? 63   LEU C O   1 
ATOM   4907  C CB  . LEU B 1 24  ? -43.727  -23.061 11.450  1.00 29.20  ? 63   LEU C CB  1 
ATOM   4908  C CG  . LEU B 1 24  ? -43.283  -23.649 10.107  1.00 37.14  ? 63   LEU C CG  1 
ATOM   4909  C CD1 . LEU B 1 24  ? -42.624  -22.662 9.181   1.00 28.83  ? 63   LEU C CD1 1 
ATOM   4910  C CD2 . LEU B 1 24  ? -42.411  -24.884 10.314  1.00 33.52  ? 63   LEU C CD2 1 
ATOM   4911  N N   . ALA B 1 25  ? -46.526  -21.342 11.681  1.00 22.68  ? 64   ALA C N   1 
ATOM   4912  C CA  . ALA B 1 25  ? -47.829  -21.279 12.349  1.00 25.75  ? 64   ALA C CA  1 
ATOM   4913  C C   . ALA B 1 25  ? -47.845  -20.271 13.487  1.00 24.41  ? 64   ALA C C   1 
ATOM   4914  O O   . ALA B 1 25  ? -48.184  -20.602 14.623  1.00 25.79  ? 64   ALA C O   1 
ATOM   4915  C CB  . ALA B 1 25  ? -48.249  -22.659 12.854  1.00 25.01  ? 64   ALA C CB  1 
ATOM   4916  N N   . ARG B 1 26  ? -47.492  -19.036 13.159  1.00 23.00  ? 65   ARG C N   1 
ATOM   4917  C CA  . ARG B 1 26  ? -47.326  -17.977 14.145  1.00 29.63  ? 65   ARG C CA  1 
ATOM   4918  C C   . ARG B 1 26  ? -48.635  -17.373 14.685  1.00 33.89  ? 65   ARG C C   1 
ATOM   4919  O O   . ARG B 1 26  ? -48.598  -16.600 15.639  1.00 27.37  ? 65   ARG C O   1 
ATOM   4920  C CB  . ARG B 1 26  ? -46.411  -16.884 13.580  1.00 28.33  ? 65   ARG C CB  1 
ATOM   4921  C CG  . ARG B 1 26  ? -44.944  -17.315 13.473  1.00 28.02  ? 65   ARG C CG  1 
ATOM   4922  C CD  . ARG B 1 26  ? -44.136  -16.383 12.584  1.00 26.51  ? 65   ARG C CD  1 
ATOM   4923  N NE  . ARG B 1 26  ? -44.615  -16.452 11.212  1.00 31.99  ? 65   ARG C NE  1 
ATOM   4924  C CZ  . ARG B 1 26  ? -44.188  -15.677 10.224  1.00 33.18  ? 65   ARG C CZ  1 
ATOM   4925  N NH1 . ARG B 1 26  ? -43.262  -14.755 10.452  1.00 40.15  ? 65   ARG C NH1 1 
ATOM   4926  N NH2 . ARG B 1 26  ? -44.687  -15.830 9.005   1.00 25.84  ? 65   ARG C NH2 1 
ATOM   4927  N N   . PHE B 1 27  ? -49.781  -17.717 14.086  1.00 23.41  ? 66   PHE C N   1 
ATOM   4928  C CA  . PHE B 1 27  ? -51.067  -17.248 14.616  1.00 24.70  ? 66   PHE C CA  1 
ATOM   4929  C C   . PHE B 1 27  ? -51.490  -18.010 15.870  1.00 27.64  ? 66   PHE C C   1 
ATOM   4930  O O   . PHE B 1 27  ? -52.155  -17.458 16.733  1.00 29.90  ? 66   PHE C O   1 
ATOM   4931  C CB  . PHE B 1 27  ? -52.182  -17.308 13.562  1.00 22.95  ? 66   PHE C CB  1 
ATOM   4932  C CG  . PHE B 1 27  ? -52.137  -16.185 12.560  1.00 25.77  ? 66   PHE C CG  1 
ATOM   4933  C CD1 . PHE B 1 27  ? -52.214  -16.451 11.203  1.00 20.63  ? 66   PHE C CD1 1 
ATOM   4934  C CD2 . PHE B 1 27  ? -52.036  -14.858 12.976  1.00 31.10  ? 66   PHE C CD2 1 
ATOM   4935  C CE1 . PHE B 1 27  ? -52.184  -15.416 10.268  1.00 25.10  ? 66   PHE C CE1 1 
ATOM   4936  C CE2 . PHE B 1 27  ? -52.008  -13.810 12.044  1.00 28.81  ? 66   PHE C CE2 1 
ATOM   4937  C CZ  . PHE B 1 27  ? -52.082  -14.092 10.690  1.00 27.67  ? 66   PHE C CZ  1 
ATOM   4938  N N   . ALA B 1 28  ? -51.093  -19.273 15.980  1.00 25.86  ? 67   ALA C N   1 
ATOM   4939  C CA  . ALA B 1 28  ? -51.442  -20.069 17.159  1.00 26.25  ? 67   ALA C CA  1 
ATOM   4940  C C   . ALA B 1 28  ? -50.939  -19.413 18.453  1.00 29.26  ? 67   ALA C C   1 
ATOM   4941  O O   . ALA B 1 28  ? -49.895  -18.772 18.456  1.00 26.23  ? 67   ALA C O   1 
ATOM   4942  C CB  . ALA B 1 28  ? -50.893  -21.492 17.032  1.00 22.02  ? 67   ALA C CB  1 
ATOM   4943  N N   . ASP B 1 29  ? -51.691  -19.560 19.540  1.00 25.40  ? 68   ASP C N   1 
ATOM   4944  C CA  . ASP B 1 29  ? -51.264  -19.003 20.820  1.00 30.20  ? 68   ASP C CA  1 
ATOM   4945  C C   . ASP B 1 29  ? -49.837  -19.458 21.110  1.00 27.39  ? 68   ASP C C   1 
ATOM   4946  O O   . ASP B 1 29  ? -49.006  -18.690 21.596  1.00 28.00  ? 68   ASP C O   1 
ATOM   4947  C CB  . ASP B 1 29  ? -52.211  -19.443 21.935  1.00 28.27  ? 68   ASP C CB  1 
ATOM   4948  C CG  . ASP B 1 29  ? -53.587  -18.793 21.824  1.00 29.54  ? 68   ASP C CG  1 
ATOM   4949  O OD1 . ASP B 1 29  ? -53.674  -17.655 21.318  1.00 29.20  ? 68   ASP C OD1 1 
ATOM   4950  O OD2 . ASP B 1 29  ? -54.575  -19.426 22.244  1.00 29.67  ? 68   ASP C OD2 1 
ATOM   4951  N N   . GLY B 1 30  ? -49.550  -20.716 20.786  1.00 28.82  ? 69   GLY C N   1 
ATOM   4952  C CA  . GLY B 1 30  ? -48.193  -21.206 20.880  1.00 27.85  ? 69   GLY C CA  1 
ATOM   4953  C C   . GLY B 1 30  ? -47.879  -22.258 19.835  1.00 30.84  ? 69   GLY C C   1 
ATOM   4954  O O   . GLY B 1 30  ? -48.767  -22.987 19.354  1.00 27.58  ? 69   GLY C O   1 
ATOM   4955  N N   . SER B 1 31  ? -46.600  -22.348 19.496  1.00 22.52  ? 70   SER C N   1 
ATOM   4956  C CA  . SER B 1 31  ? -46.160  -23.265 18.459  1.00 26.33  ? 70   SER C CA  1 
ATOM   4957  C C   . SER B 1 31  ? -44.713  -23.657 18.739  1.00 25.72  ? 70   SER C C   1 
ATOM   4958  O O   . SER B 1 31  ? -43.943  -22.861 19.275  1.00 26.37  ? 70   SER C O   1 
ATOM   4959  C CB  . SER B 1 31  ? -46.283  -22.583 17.087  1.00 26.02  ? 70   SER C CB  1 
ATOM   4960  O OG  . SER B 1 31  ? -45.837  -23.414 16.028  1.00 32.74  ? 70   SER C OG  1 
ATOM   4961  N N   . ALA B 1 32  ? -44.344  -24.879 18.388  1.00 28.26  ? 71   ALA C N   1 
ATOM   4962  C CA  . ALA B 1 32  ? -42.955  -25.314 18.525  1.00 31.23  ? 71   ALA C CA  1 
ATOM   4963  C C   . ALA B 1 32  ? -42.616  -26.324 17.455  1.00 31.52  ? 71   ALA C C   1 
ATOM   4964  O O   . ALA B 1 32  ? -43.499  -27.013 16.947  1.00 31.34  ? 71   ALA C O   1 
ATOM   4965  C CB  . ALA B 1 32  ? -42.723  -25.932 19.886  1.00 29.56  ? 71   ALA C CB  1 
ATOM   4966  N N   . VAL B 1 33  ? -41.334  -26.399 17.117  1.00 29.86  ? 72   VAL C N   1 
ATOM   4967  C CA  . VAL B 1 33  ? -40.815  -27.431 16.235  1.00 23.05  ? 72   VAL C CA  1 
ATOM   4968  C C   . VAL B 1 33  ? -39.735  -28.185 16.976  1.00 26.73  ? 72   VAL C C   1 
ATOM   4969  O O   . VAL B 1 33  ? -38.769  -27.584 17.475  1.00 30.33  ? 72   VAL C O   1 
ATOM   4970  C CB  . VAL B 1 33  ? -40.211  -26.839 14.967  1.00 25.47  ? 72   VAL C CB  1 
ATOM   4971  C CG1 . VAL B 1 33  ? -39.550  -27.937 14.141  1.00 31.26  ? 72   VAL C CG1 1 
ATOM   4972  C CG2 . VAL B 1 33  ? -41.286  -26.117 14.162  1.00 31.41  ? 72   VAL C CG2 1 
ATOM   4973  N N   . VAL B 1 34  ? -39.892  -29.498 17.064  1.00 26.48  ? 73   VAL C N   1 
ATOM   4974  C CA  . VAL B 1 34  ? -38.901  -30.311 17.736  1.00 22.41  ? 73   VAL C CA  1 
ATOM   4975  C C   . VAL B 1 34  ? -38.306  -31.326 16.775  1.00 32.98  ? 73   VAL C C   1 
ATOM   4976  O O   . VAL B 1 34  ? -39.033  -32.067 16.108  1.00 30.86  ? 73   VAL C O   1 
ATOM   4977  C CB  . VAL B 1 34  ? -39.483  -31.056 18.934  1.00 25.71  ? 73   VAL C CB  1 
ATOM   4978  C CG1 . VAL B 1 34  ? -38.394  -31.905 19.584  1.00 23.85  ? 73   VAL C CG1 1 
ATOM   4979  C CG2 . VAL B 1 34  ? -40.062  -30.088 19.934  1.00 25.83  ? 73   VAL C CG2 1 
ATOM   4980  N N   . GLN B 1 35  ? -36.978  -31.378 16.730  1.00 30.72  ? 74   GLN C N   1 
ATOM   4981  C CA  . GLN B 1 35  ? -36.283  -32.195 15.745  1.00 27.43  ? 74   GLN C CA  1 
ATOM   4982  C C   . GLN B 1 35  ? -35.186  -33.048 16.375  1.00 33.06  ? 74   GLN C C   1 
ATOM   4983  O O   . GLN B 1 35  ? -34.439  -32.595 17.244  1.00 31.88  ? 74   GLN C O   1 
ATOM   4984  C CB  . GLN B 1 35  ? -35.725  -31.321 14.612  1.00 28.27  ? 74   GLN C CB  1 
ATOM   4985  C CG  . GLN B 1 35  ? -34.921  -32.093 13.571  1.00 38.21  ? 74   GLN C CG  1 
ATOM   4986  C CD  . GLN B 1 35  ? -34.561  -31.259 12.346  1.00 42.78  ? 74   GLN C CD  1 
ATOM   4987  O OE1 . GLN B 1 35  ? -35.081  -30.155 12.146  1.00 40.50  ? 74   GLN C OE1 1 
ATOM   4988  N NE2 . GLN B 1 35  ? -33.663  -31.789 11.518  1.00 42.49  ? 74   GLN C NE2 1 
ATOM   4989  N N   . SER B 1 36  ? -35.121  -34.300 15.938  1.00 28.18  ? 75   SER C N   1 
ATOM   4990  C CA  . SER B 1 36  ? -34.029  -35.200 16.295  1.00 32.96  ? 75   SER C CA  1 
ATOM   4991  C C   . SER B 1 36  ? -33.634  -35.962 15.036  1.00 32.90  ? 75   SER C C   1 
ATOM   4992  O O   . SER B 1 36  ? -34.481  -36.587 14.391  1.00 28.43  ? 75   SER C O   1 
ATOM   4993  C CB  . SER B 1 36  ? -34.476  -36.170 17.385  1.00 34.47  ? 75   SER C CB  1 
ATOM   4994  O OG  . SER B 1 36  ? -33.533  -37.210 17.563  1.00 54.44  ? 75   SER C OG  1 
ATOM   4995  N N   . GLY B 1 37  ? -32.359  -35.895 14.672  1.00 32.68  ? 76   GLY C N   1 
ATOM   4996  C CA  . GLY B 1 37  ? -31.917  -36.433 13.394  1.00 31.81  ? 76   GLY C CA  1 
ATOM   4997  C C   . GLY B 1 37  ? -32.627  -35.697 12.270  1.00 32.97  ? 76   GLY C C   1 
ATOM   4998  O O   . GLY B 1 37  ? -32.626  -34.463 12.234  1.00 29.01  ? 76   GLY C O   1 
ATOM   4999  N N   . ASP B 1 38  ? -33.263  -36.433 11.364  1.00 30.98  ? 77   ASP C N   1 
ATOM   5000  C CA  . ASP B 1 38  ? -34.050  -35.773 10.317  1.00 32.72  ? 77   ASP C CA  1 
ATOM   5001  C C   . ASP B 1 38  ? -35.559  -35.971 10.491  1.00 30.25  ? 77   ASP C C   1 
ATOM   5002  O O   . ASP B 1 38  ? -36.324  -35.904 9.528   1.00 30.81  ? 77   ASP C O   1 
ATOM   5003  C CB  . ASP B 1 38  ? -33.578  -36.184 8.928   1.00 28.05  ? 77   ASP C CB  1 
ATOM   5004  C CG  . ASP B 1 38  ? -32.148  -35.732 8.650   1.00 38.06  ? 77   ASP C CG  1 
ATOM   5005  O OD1 . ASP B 1 38  ? -31.861  -34.533 8.834   1.00 39.11  ? 77   ASP C OD1 1 
ATOM   5006  O OD2 . ASP B 1 38  ? -31.313  -36.575 8.270   1.00 42.58  ? 77   ASP C OD2 1 
ATOM   5007  N N   . THR B 1 39  ? -35.975  -36.216 11.727  1.00 33.60  ? 78   THR C N   1 
ATOM   5008  C CA  . THR B 1 39  ? -37.402  -36.228 12.061  1.00 30.83  ? 78   THR C CA  1 
ATOM   5009  C C   . THR B 1 39  ? -37.742  -34.927 12.750  1.00 30.83  ? 78   THR C C   1 
ATOM   5010  O O   . THR B 1 39  ? -37.047  -34.511 13.676  1.00 31.15  ? 78   THR C O   1 
ATOM   5011  C CB  . THR B 1 39  ? -37.778  -37.383 12.984  1.00 31.29  ? 78   THR C CB  1 
ATOM   5012  O OG1 . THR B 1 39  ? -37.605  -38.613 12.279  1.00 29.88  ? 78   THR C OG1 1 
ATOM   5013  C CG2 . THR B 1 39  ? -39.246  -37.260 13.434  1.00 28.66  ? 78   THR C CG2 1 
ATOM   5014  N N   . ALA B 1 40  ? -38.796  -34.271 12.281  1.00 33.71  ? 79   ALA C N   1 
ATOM   5015  C CA  . ALA B 1 40  ? -39.172  -32.963 12.812  1.00 33.68  ? 79   ALA C CA  1 
ATOM   5016  C C   . ALA B 1 40  ? -40.670  -32.889 12.997  1.00 34.76  ? 79   ALA C C   1 
ATOM   5017  O O   . ALA B 1 40  ? -41.440  -33.181 12.071  1.00 25.03  ? 79   ALA C O   1 
ATOM   5018  C CB  . ALA B 1 40  ? -38.703  -31.840 11.889  1.00 22.43  ? 79   ALA C CB  1 
ATOM   5019  N N   . VAL B 1 41  ? -41.073  -32.455 14.186  1.00 28.37  ? 80   VAL C N   1 
ATOM   5020  C CA  . VAL B 1 41  ? -42.482  -32.408 14.539  1.00 28.68  ? 80   VAL C CA  1 
ATOM   5021  C C   . VAL B 1 41  ? -42.870  -30.991 14.939  1.00 31.60  ? 80   VAL C C   1 
ATOM   5022  O O   . VAL B 1 41  ? -42.176  -30.345 15.740  1.00 27.30  ? 80   VAL C O   1 
ATOM   5023  C CB  . VAL B 1 41  ? -42.782  -33.381 15.690  1.00 29.47  ? 80   VAL C CB  1 
ATOM   5024  C CG1 . VAL B 1 41  ? -44.226  -33.259 16.142  1.00 27.89  ? 80   VAL C CG1 1 
ATOM   5025  C CG2 . VAL B 1 41  ? -42.458  -34.825 15.266  1.00 30.20  ? 80   VAL C CG2 1 
ATOM   5026  N N   . MET B 1 42  ? -43.960  -30.495 14.361  1.00 25.22  ? 81   MET C N   1 
ATOM   5027  C CA  . MET B 1 42  ? -44.501  -29.217 14.798  1.00 28.10  ? 81   MET C CA  1 
ATOM   5028  C C   . MET B 1 42  ? -45.726  -29.441 15.677  1.00 29.73  ? 81   MET C C   1 
ATOM   5029  O O   . MET B 1 42  ? -46.615  -30.238 15.339  1.00 28.95  ? 81   MET C O   1 
ATOM   5030  C CB  . MET B 1 42  ? -44.845  -28.298 13.617  1.00 26.99  ? 81   MET C CB  1 
ATOM   5031  C CG  . MET B 1 42  ? -45.325  -26.922 14.069  1.00 29.19  ? 81   MET C CG  1 
ATOM   5032  S SD  . MET B 1 42  ? -45.837  -25.843 12.722  1.00 31.71  ? 81   MET C SD  1 
ATOM   5033  C CE  . MET B 1 42  ? -47.328  -26.659 12.148  1.00 27.87  ? 81   MET C CE  1 
ATOM   5034  N N   . VAL B 1 43  ? -45.752  -28.750 16.812  1.00 24.81  ? 82   VAL C N   1 
ATOM   5035  C CA  . VAL B 1 43  ? -46.894  -28.796 17.718  1.00 25.16  ? 82   VAL C CA  1 
ATOM   5036  C C   . VAL B 1 43  ? -47.443  -27.395 17.976  1.00 27.49  ? 82   VAL C C   1 
ATOM   5037  O O   . VAL B 1 43  ? -46.681  -26.447 18.154  1.00 27.31  ? 82   VAL C O   1 
ATOM   5038  C CB  . VAL B 1 43  ? -46.527  -29.449 19.057  1.00 32.74  ? 82   VAL C CB  1 
ATOM   5039  C CG1 . VAL B 1 43  ? -47.746  -29.453 19.997  1.00 26.43  ? 82   VAL C CG1 1 
ATOM   5040  C CG2 . VAL B 1 43  ? -45.991  -30.862 18.827  1.00 27.27  ? 82   VAL C CG2 1 
ATOM   5041  N N   . THR B 1 44  ? -48.766  -27.268 17.968  1.00 28.09  ? 83   THR C N   1 
ATOM   5042  C CA  . THR B 1 44  ? -49.421  -25.984 18.201  1.00 25.91  ? 83   THR C CA  1 
ATOM   5043  C C   . THR B 1 44  ? -50.319  -26.109 19.422  1.00 27.77  ? 83   THR C C   1 
ATOM   5044  O O   . THR B 1 44  ? -50.807  -27.196 19.738  1.00 33.13  ? 83   THR C O   1 
ATOM   5045  C CB  . THR B 1 44  ? -50.300  -25.559 16.995  1.00 26.06  ? 83   THR C CB  1 
ATOM   5046  O OG1 . THR B 1 44  ? -51.283  -26.574 16.736  1.00 24.70  ? 83   THR C OG1 1 
ATOM   5047  C CG2 . THR B 1 44  ? -49.457  -25.367 15.754  1.00 22.11  ? 83   THR C CG2 1 
ATOM   5048  N N   . ALA B 1 45  ? -50.527  -24.996 20.111  1.00 27.70  ? 84   ALA C N   1 
ATOM   5049  C CA  . ALA B 1 45  ? -51.448  -24.949 21.230  1.00 25.26  ? 84   ALA C CA  1 
ATOM   5050  C C   . ALA B 1 45  ? -52.376  -23.752 21.023  1.00 32.12  ? 84   ALA C C   1 
ATOM   5051  O O   . ALA B 1 45  ? -51.907  -22.644 20.744  1.00 25.23  ? 84   ALA C O   1 
ATOM   5052  C CB  . ALA B 1 45  ? -50.677  -24.820 22.549  1.00 23.01  ? 84   ALA C CB  1 
ATOM   5053  N N   . VAL B 1 46  ? -53.685  -23.982 21.154  1.00 25.97  ? 85   VAL C N   1 
ATOM   5054  C CA  . VAL B 1 46  ? -54.696  -22.925 21.015  1.00 28.83  ? 85   VAL C CA  1 
ATOM   5055  C C   . VAL B 1 46  ? -55.683  -22.990 22.174  1.00 29.41  ? 85   VAL C C   1 
ATOM   5056  O O   . VAL B 1 46  ? -56.178  -24.063 22.504  1.00 28.34  ? 85   VAL C O   1 
ATOM   5057  C CB  . VAL B 1 46  ? -55.503  -23.081 19.710  1.00 25.89  ? 85   VAL C CB  1 
ATOM   5058  C CG1 . VAL B 1 46  ? -56.604  -22.015 19.623  1.00 32.17  ? 85   VAL C CG1 1 
ATOM   5059  C CG2 . VAL B 1 46  ? -54.585  -23.001 18.496  1.00 23.24  ? 85   VAL C CG2 1 
ATOM   5060  N N   . SER B 1 47  ? -55.966  -21.850 22.798  1.00 25.47  ? 86   SER C N   1 
ATOM   5061  C CA  . SER B 1 47  ? -56.871  -21.842 23.939  1.00 26.55  ? 86   SER C CA  1 
ATOM   5062  C C   . SER B 1 47  ? -57.789  -20.626 23.870  1.00 32.41  ? 86   SER C C   1 
ATOM   5063  O O   . SER B 1 47  ? -57.318  -19.488 23.941  1.00 31.07  ? 86   SER C O   1 
ATOM   5064  C CB  . SER B 1 47  ? -56.085  -21.824 25.258  1.00 25.84  ? 86   SER C CB  1 
ATOM   5065  O OG  . SER B 1 47  ? -56.951  -22.050 26.364  1.00 27.82  ? 86   SER C OG  1 
ATOM   5066  N N   . LYS B 1 48  ? -59.092  -20.868 23.734  1.00 31.71  ? 87   LYS C N   1 
ATOM   5067  C CA  . LYS B 1 48  ? -60.052  -19.773 23.589  1.00 37.19  ? 87   LYS C CA  1 
ATOM   5068  C C   . LYS B 1 48  ? -60.054  -18.873 24.830  1.00 30.49  ? 87   LYS C C   1 
ATOM   5069  O O   . LYS B 1 48  ? -59.668  -19.303 25.917  1.00 29.13  ? 87   LYS C O   1 
ATOM   5070  C CB  . LYS B 1 48  ? -61.465  -20.313 23.314  1.00 36.81  ? 87   LYS C CB  1 
ATOM   5071  C CG  . LYS B 1 48  ? -61.617  -21.065 21.983  1.00 38.91  ? 87   LYS C CG  1 
ATOM   5072  C CD  . LYS B 1 48  ? -60.991  -20.292 20.812  1.00 52.82  ? 87   LYS C CD  1 
ATOM   5073  C CE  . LYS B 1 48  ? -61.966  -20.106 19.633  1.00 62.52  ? 87   LYS C CE  1 
ATOM   5074  N NZ  . LYS B 1 48  ? -62.187  -21.345 18.791  1.00 55.36  ? 87   LYS C NZ  1 
ATOM   5075  N N   . THR B 1 49  ? -60.478  -17.624 24.660  1.00 28.01  ? 88   THR C N   1 
ATOM   5076  C CA  . THR B 1 49  ? -60.507  -16.674 25.768  1.00 35.95  ? 88   THR C CA  1 
ATOM   5077  C C   . THR B 1 49  ? -61.894  -16.601 26.407  1.00 35.60  ? 88   THR C C   1 
ATOM   5078  O O   . THR B 1 49  ? -62.040  -16.191 27.551  1.00 34.37  ? 88   THR C O   1 
ATOM   5079  C CB  . THR B 1 49  ? -60.062  -15.271 25.328  1.00 35.50  ? 88   THR C CB  1 
ATOM   5080  O OG1 . THR B 1 49  ? -60.834  -14.863 24.196  1.00 33.12  ? 88   THR C OG1 1 
ATOM   5081  C CG2 . THR B 1 49  ? -58.575  -15.277 24.932  1.00 35.06  ? 88   THR C CG2 1 
ATOM   5082  N N   . LYS B 1 50  ? -62.908  -17.011 25.663  1.00 31.70  ? 89   LYS C N   1 
ATOM   5083  C CA  . LYS B 1 50  ? -64.257  -17.083 26.206  1.00 44.71  ? 89   LYS C CA  1 
ATOM   5084  C C   . LYS B 1 50  ? -64.473  -18.414 26.903  1.00 39.40  ? 89   LYS C C   1 
ATOM   5085  O O   . LYS B 1 50  ? -64.146  -19.466 26.354  1.00 37.87  ? 89   LYS C O   1 
ATOM   5086  C CB  . LYS B 1 50  ? -65.301  -16.860 25.107  1.00 42.07  ? 89   LYS C CB  1 
ATOM   5087  C CG  . LYS B 1 50  ? -65.278  -15.426 24.556  1.00 63.25  ? 89   LYS C CG  1 
ATOM   5088  C CD  . LYS B 1 50  ? -65.318  -14.390 25.690  1.00 56.43  ? 89   LYS C CD  1 
ATOM   5089  C CE  . LYS B 1 50  ? -64.502  -13.129 25.357  1.00 75.04  ? 89   LYS C CE  1 
ATOM   5090  N NZ  . LYS B 1 50  ? -63.010  -13.357 25.274  1.00 50.26  ? 89   LYS C NZ  1 
ATOM   5091  N N   . PRO B 1 51  ? -65.020  -18.369 28.122  1.00 35.45  ? 90   PRO C N   1 
ATOM   5092  C CA  . PRO B 1 51  ? -65.211  -19.571 28.939  1.00 34.49  ? 90   PRO C CA  1 
ATOM   5093  C C   . PRO B 1 51  ? -66.082  -20.577 28.203  1.00 41.17  ? 90   PRO C C   1 
ATOM   5094  O O   . PRO B 1 51  ? -66.875  -20.187 27.347  1.00 39.78  ? 90   PRO C O   1 
ATOM   5095  C CB  . PRO B 1 51  ? -65.937  -19.037 30.179  1.00 39.73  ? 90   PRO C CB  1 
ATOM   5096  C CG  . PRO B 1 51  ? -65.566  -17.582 30.233  1.00 40.91  ? 90   PRO C CG  1 
ATOM   5097  C CD  . PRO B 1 51  ? -65.515  -17.157 28.793  1.00 35.33  ? 90   PRO C CD  1 
ATOM   5098  N N   . SER B 1 52  ? -65.921  -21.855 28.522  1.00 37.17  ? 91   SER C N   1 
ATOM   5099  C CA  . SER B 1 52  ? -66.713  -22.902 27.901  1.00 45.27  ? 91   SER C CA  1 
ATOM   5100  C C   . SER B 1 52  ? -68.066  -23.063 28.607  1.00 56.19  ? 91   SER C C   1 
ATOM   5101  O O   . SER B 1 52  ? -68.143  -22.985 29.835  1.00 47.90  ? 91   SER C O   1 
ATOM   5102  C CB  . SER B 1 52  ? -65.945  -24.227 27.930  1.00 47.64  ? 91   SER C CB  1 
ATOM   5103  O OG  . SER B 1 52  ? -66.700  -25.263 27.323  1.00 57.90  ? 91   SER C OG  1 
ATOM   5104  N N   . PRO B 1 53  ? -69.140  -23.276 27.825  1.00 54.18  ? 92   PRO C N   1 
ATOM   5105  C CA  . PRO B 1 53  ? -70.470  -23.586 28.372  1.00 64.57  ? 92   PRO C CA  1 
ATOM   5106  C C   . PRO B 1 53  ? -70.426  -24.878 29.189  1.00 61.86  ? 92   PRO C C   1 
ATOM   5107  O O   . PRO B 1 53  ? -71.156  -25.046 30.172  1.00 65.73  ? 92   PRO C O   1 
ATOM   5108  C CB  . PRO B 1 53  ? -71.325  -23.787 27.115  1.00 63.87  ? 92   PRO C CB  1 
ATOM   5109  C CG  . PRO B 1 53  ? -70.620  -23.018 26.049  1.00 68.38  ? 92   PRO C CG  1 
ATOM   5110  C CD  . PRO B 1 53  ? -69.159  -23.176 26.356  1.00 59.88  ? 92   PRO C CD  1 
ATOM   5111  N N   . SER B 1 54  ? -69.561  -25.790 28.771  1.00 55.66  ? 93   SER C N   1 
ATOM   5112  C CA  . SER B 1 54  ? -69.306  -26.996 29.538  1.00 63.11  ? 93   SER C CA  1 
ATOM   5113  C C   . SER B 1 54  ? -68.507  -26.594 30.765  1.00 64.25  ? 93   SER C C   1 
ATOM   5114  O O   . SER B 1 54  ? -67.403  -26.061 30.650  1.00 67.83  ? 93   SER C O   1 
ATOM   5115  C CB  . SER B 1 54  ? -68.499  -27.983 28.701  1.00 66.95  ? 93   SER C CB  1 
ATOM   5116  O OG  . SER B 1 54  ? -68.782  -27.830 27.320  1.00 74.27  ? 93   SER C OG  1 
ATOM   5117  N N   . GLN B 1 55  ? -69.056  -26.844 31.943  1.00 67.00  ? 94   GLN C N   1 
ATOM   5118  C CA  . GLN B 1 55  ? -68.399  -26.403 33.167  1.00 68.34  ? 94   GLN C CA  1 
ATOM   5119  C C   . GLN B 1 55  ? -67.219  -27.294 33.552  1.00 54.19  ? 94   GLN C C   1 
ATOM   5120  O O   . GLN B 1 55  ? -67.227  -27.933 34.605  1.00 51.51  ? 94   GLN C O   1 
ATOM   5121  C CB  . GLN B 1 55  ? -69.414  -26.301 34.306  1.00 67.07  ? 94   GLN C CB  1 
ATOM   5122  C CG  . GLN B 1 55  ? -70.551  -25.339 33.992  1.00 72.94  ? 94   GLN C CG  1 
ATOM   5123  C CD  . GLN B 1 55  ? -70.064  -23.916 33.738  1.00 80.58  ? 94   GLN C CD  1 
ATOM   5124  O OE1 . GLN B 1 55  ? -69.139  -23.436 34.401  1.00 80.97  ? 94   GLN C OE1 1 
ATOM   5125  N NE2 . GLN B 1 55  ? -70.679  -23.240 32.768  1.00 57.30  ? 94   GLN C NE2 1 
ATOM   5126  N N   . PHE B 1 56  ? -66.205  -27.326 32.691  1.00 47.18  ? 95   PHE C N   1 
ATOM   5127  C CA  . PHE B 1 56  ? -64.975  -28.065 32.974  1.00 47.33  ? 95   PHE C CA  1 
ATOM   5128  C C   . PHE B 1 56  ? -63.915  -27.672 31.949  1.00 43.13  ? 95   PHE C C   1 
ATOM   5129  O O   . PHE B 1 56  ? -64.205  -26.920 31.014  1.00 40.33  ? 95   PHE C O   1 
ATOM   5130  C CB  . PHE B 1 56  ? -65.229  -29.569 32.914  1.00 48.20  ? 95   PHE C CB  1 
ATOM   5131  C CG  . PHE B 1 56  ? -65.324  -30.102 31.519  1.00 58.49  ? 95   PHE C CG  1 
ATOM   5132  C CD1 . PHE B 1 56  ? -64.367  -30.979 31.032  1.00 53.76  ? 95   PHE C CD1 1 
ATOM   5133  C CD2 . PHE B 1 56  ? -66.351  -29.703 30.680  1.00 59.32  ? 95   PHE C CD2 1 
ATOM   5134  C CE1 . PHE B 1 56  ? -64.447  -31.466 29.744  1.00 49.58  ? 95   PHE C CE1 1 
ATOM   5135  C CE2 . PHE B 1 56  ? -66.434  -30.186 29.387  1.00 64.77  ? 95   PHE C CE2 1 
ATOM   5136  C CZ  . PHE B 1 56  ? -65.478  -31.067 28.919  1.00 59.33  ? 95   PHE C CZ  1 
ATOM   5137  N N   . MET B 1 57  ? -62.693  -28.174 32.116  1.00 35.22  ? 96   MET C N   1 
ATOM   5138  C CA  . MET B 1 57  ? -61.638  -27.878 31.147  1.00 41.42  ? 96   MET C CA  1 
ATOM   5139  C C   . MET B 1 57  ? -61.688  -28.835 29.971  1.00 34.81  ? 96   MET C C   1 
ATOM   5140  O O   . MET B 1 57  ? -61.332  -30.005 30.107  1.00 40.06  ? 96   MET C O   1 
ATOM   5141  C CB  . MET B 1 57  ? -60.239  -27.927 31.768  1.00 32.33  ? 96   MET C CB  1 
ATOM   5142  C CG  . MET B 1 57  ? -59.161  -27.502 30.762  1.00 39.10  ? 96   MET C CG  1 
ATOM   5143  S SD  . MET B 1 57  ? -57.474  -27.760 31.348  1.00 38.71  ? 96   MET C SD  1 
ATOM   5144  C CE  . MET B 1 57  ? -57.744  -27.607 33.120  1.00 52.53  ? 96   MET C CE  1 
ATOM   5145  N N   . PRO B 1 58  ? -62.112  -28.331 28.805  1.00 32.05  ? 97   PRO C N   1 
ATOM   5146  C CA  . PRO B 1 58  ? -62.141  -29.124 27.583  1.00 38.17  ? 97   PRO C CA  1 
ATOM   5147  C C   . PRO B 1 58  ? -60.768  -29.036 26.929  1.00 32.30  ? 97   PRO C C   1 
ATOM   5148  O O   . PRO B 1 58  ? -60.425  -28.011 26.348  1.00 30.35  ? 97   PRO C O   1 
ATOM   5149  C CB  . PRO B 1 58  ? -63.190  -28.399 26.724  1.00 39.28  ? 97   PRO C CB  1 
ATOM   5150  C CG  . PRO B 1 58  ? -63.452  -27.062 27.421  1.00 35.24  ? 97   PRO C CG  1 
ATOM   5151  C CD  . PRO B 1 58  ? -62.433  -26.925 28.520  1.00 27.36  ? 97   PRO C CD  1 
ATOM   5152  N N   . LEU B 1 59  ? -59.979  -30.091 27.065  1.00 35.03  ? 98   LEU C N   1 
ATOM   5153  C CA  . LEU B 1 59  ? -58.660  -30.137 26.449  1.00 36.97  ? 98   LEU C CA  1 
ATOM   5154  C C   . LEU B 1 59  ? -58.621  -31.339 25.530  1.00 29.87  ? 98   LEU C C   1 
ATOM   5155  O O   . LEU B 1 59  ? -59.044  -32.421 25.913  1.00 28.74  ? 98   LEU C O   1 
ATOM   5156  C CB  . LEU B 1 59  ? -57.564  -30.259 27.511  1.00 29.95  ? 98   LEU C CB  1 
ATOM   5157  C CG  . LEU B 1 59  ? -56.217  -30.790 27.006  1.00 29.77  ? 98   LEU C CG  1 
ATOM   5158  C CD1 . LEU B 1 59  ? -55.516  -29.733 26.165  1.00 22.11  ? 98   LEU C CD1 1 
ATOM   5159  C CD2 . LEU B 1 59  ? -55.318  -31.255 28.159  1.00 28.41  ? 98   LEU C CD2 1 
ATOM   5160  N N   . VAL B 1 60  ? -58.128  -31.145 24.313  1.00 31.05  ? 99   VAL C N   1 
ATOM   5161  C CA  . VAL B 1 60  ? -57.977  -32.251 23.382  1.00 30.68  ? 99   VAL C CA  1 
ATOM   5162  C C   . VAL B 1 60  ? -56.611  -32.207 22.683  1.00 30.01  ? 99   VAL C C   1 
ATOM   5163  O O   . VAL B 1 60  ? -56.156  -31.147 22.242  1.00 29.45  ? 99   VAL C O   1 
ATOM   5164  C CB  . VAL B 1 60  ? -59.127  -32.273 22.346  1.00 36.70  ? 99   VAL C CB  1 
ATOM   5165  C CG1 . VAL B 1 60  ? -59.116  -31.003 21.515  1.00 31.49  ? 99   VAL C CG1 1 
ATOM   5166  C CG2 . VAL B 1 60  ? -59.015  -33.500 21.454  1.00 36.48  ? 99   VAL C CG2 1 
ATOM   5167  N N   . VAL B 1 61  ? -55.949  -33.357 22.615  1.00 26.02  ? 100  VAL C N   1 
ATOM   5168  C CA  . VAL B 1 61  ? -54.696  -33.488 21.876  1.00 29.35  ? 100  VAL C CA  1 
ATOM   5169  C C   . VAL B 1 61  ? -54.960  -34.328 20.631  1.00 29.62  ? 100  VAL C C   1 
ATOM   5170  O O   . VAL B 1 61  ? -55.519  -35.416 20.724  1.00 32.42  ? 100  VAL C O   1 
ATOM   5171  C CB  . VAL B 1 61  ? -53.600  -34.202 22.716  1.00 30.93  ? 100  VAL C CB  1 
ATOM   5172  C CG1 . VAL B 1 61  ? -52.300  -34.349 21.900  1.00 29.24  ? 100  VAL C CG1 1 
ATOM   5173  C CG2 . VAL B 1 61  ? -53.342  -33.452 24.019  1.00 26.65  ? 100  VAL C CG2 1 
ATOM   5174  N N   . ASP B 1 62  ? -54.578  -33.818 19.468  1.00 28.62  ? 101  ASP C N   1 
ATOM   5175  C CA  . ASP B 1 62  ? -54.679  -34.592 18.243  1.00 23.61  ? 101  ASP C CA  1 
ATOM   5176  C C   . ASP B 1 62  ? -53.295  -34.772 17.599  1.00 33.97  ? 101  ASP C C   1 
ATOM   5177  O O   . ASP B 1 62  ? -52.773  -33.880 16.935  1.00 29.01  ? 101  ASP C O   1 
ATOM   5178  C CB  . ASP B 1 62  ? -55.670  -33.966 17.261  1.00 32.62  ? 101  ASP C CB  1 
ATOM   5179  C CG  . ASP B 1 62  ? -57.114  -33.969 17.790  1.00 38.81  ? 101  ASP C CG  1 
ATOM   5180  O OD1 . ASP B 1 62  ? -57.640  -32.882 18.097  1.00 42.39  ? 101  ASP C OD1 1 
ATOM   5181  O OD2 . ASP B 1 62  ? -57.720  -35.055 17.908  1.00 41.62  ? 101  ASP C OD2 1 
ATOM   5182  N N   . TYR B 1 63  ? -52.707  -35.940 17.814  1.00 30.39  ? 102  TYR C N   1 
ATOM   5183  C CA  . TYR B 1 63  ? -51.454  -36.289 17.167  1.00 28.63  ? 102  TYR C CA  1 
ATOM   5184  C C   . TYR B 1 63  ? -51.787  -37.038 15.891  1.00 27.95  ? 102  TYR C C   1 
ATOM   5185  O O   . TYR B 1 63  ? -52.538  -38.000 15.902  1.00 30.96  ? 102  TYR C O   1 
ATOM   5186  C CB  . TYR B 1 63  ? -50.604  -37.138 18.106  1.00 25.01  ? 102  TYR C CB  1 
ATOM   5187  C CG  . TYR B 1 63  ? -49.364  -37.743 17.486  1.00 28.31  ? 102  TYR C CG  1 
ATOM   5188  C CD1 . TYR B 1 63  ? -48.125  -37.137 17.639  1.00 25.47  ? 102  TYR C CD1 1 
ATOM   5189  C CD2 . TYR B 1 63  ? -49.427  -38.937 16.777  1.00 28.44  ? 102  TYR C CD2 1 
ATOM   5190  C CE1 . TYR B 1 63  ? -46.967  -37.699 17.077  1.00 33.76  ? 102  TYR C CE1 1 
ATOM   5191  C CE2 . TYR B 1 63  ? -48.275  -39.508 16.210  1.00 36.58  ? 102  TYR C CE2 1 
ATOM   5192  C CZ  . TYR B 1 63  ? -47.054  -38.882 16.369  1.00 30.36  ? 102  TYR C CZ  1 
ATOM   5193  O OH  . TYR B 1 63  ? -45.918  -39.430 15.822  1.00 36.18  ? 102  TYR C OH  1 
ATOM   5194  N N   . ARG B 1 64  ? -51.230  -36.584 14.783  1.00 34.07  ? 103  ARG C N   1 
ATOM   5195  C CA  . ARG B 1 64  ? -51.557  -37.158 13.487  1.00 37.59  ? 103  ARG C CA  1 
ATOM   5196  C C   . ARG B 1 64  ? -50.298  -37.414 12.670  1.00 38.43  ? 103  ARG C C   1 
ATOM   5197  O O   . ARG B 1 64  ? -49.342  -36.633 12.726  1.00 32.74  ? 103  ARG C O   1 
ATOM   5198  C CB  . ARG B 1 64  ? -52.526  -36.223 12.745  1.00 42.48  ? 103  ARG C CB  1 
ATOM   5199  C CG  . ARG B 1 64  ? -53.938  -36.264 13.349  1.00 48.62  ? 103  ARG C CG  1 
ATOM   5200  C CD  . ARG B 1 64  ? -54.772  -35.058 12.975  1.00 56.07  ? 103  ARG C CD  1 
ATOM   5201  N NE  . ARG B 1 64  ? -54.893  -34.920 11.529  1.00 65.47  ? 103  ARG C NE  1 
ATOM   5202  C CZ  . ARG B 1 64  ? -54.669  -33.789 10.866  1.00 70.94  ? 103  ARG C CZ  1 
ATOM   5203  N NH1 . ARG B 1 64  ? -54.320  -32.684 11.528  1.00 53.84  ? 103  ARG C NH1 1 
ATOM   5204  N NH2 . ARG B 1 64  ? -54.794  -33.766 9.543   1.00 65.68  ? 103  ARG C NH2 1 
ATOM   5205  N N   . GLN B 1 65  ? -50.282  -38.511 11.922  1.00 33.58  ? 104  GLN C N   1 
ATOM   5206  C CA  . GLN B 1 65  ? -49.158  -38.770 11.024  1.00 36.98  ? 104  GLN C CA  1 
ATOM   5207  C C   . GLN B 1 65  ? -49.622  -38.679 9.568   1.00 36.37  ? 104  GLN C C   1 
ATOM   5208  O O   . GLN B 1 65  ? -50.814  -38.776 9.285   1.00 42.43  ? 104  GLN C O   1 
ATOM   5209  C CB  . GLN B 1 65  ? -48.513  -40.120 11.346  1.00 40.54  ? 104  GLN C CB  1 
ATOM   5210  C CG  . GLN B 1 65  ? -49.491  -41.261 11.372  1.00 47.51  ? 104  GLN C CG  1 
ATOM   5211  C CD  . GLN B 1 65  ? -48.890  -42.536 11.933  1.00 63.05  ? 104  GLN C CD  1 
ATOM   5212  O OE1 . GLN B 1 65  ? -47.897  -42.504 12.673  1.00 53.75  ? 104  GLN C OE1 1 
ATOM   5213  N NE2 . GLN B 1 65  ? -49.497  -43.673 11.590  1.00 58.23  ? 104  GLN C NE2 1 
ATOM   5214  N N   . LYS B 1 66  ? -48.690  -38.456 8.649   1.00 40.87  ? 105  LYS C N   1 
ATOM   5215  C CA  . LYS B 1 66  ? -49.037  -38.307 7.236   1.00 43.64  ? 105  LYS C CA  1 
ATOM   5216  C C   . LYS B 1 66  ? -48.761  -39.590 6.446   1.00 47.25  ? 105  LYS C C   1 
ATOM   5217  O O   . LYS B 1 66  ? -49.077  -39.681 5.254   1.00 39.12  ? 105  LYS C O   1 
ATOM   5218  C CB  . LYS B 1 66  ? -48.268  -37.132 6.619   1.00 36.53  ? 105  LYS C CB  1 
ATOM   5219  C CG  . LYS B 1 66  ? -48.619  -35.783 7.215   1.00 42.45  ? 105  LYS C CG  1 
ATOM   5220  C CD  . LYS B 1 66  ? -47.617  -34.734 6.757   1.00 38.00  ? 105  LYS C CD  1 
ATOM   5221  C CE  . LYS B 1 66  ? -47.728  -33.453 7.565   1.00 32.56  ? 105  LYS C CE  1 
ATOM   5222  N NZ  . LYS B 1 66  ? -46.685  -32.475 7.118   1.00 25.54  ? 105  LYS C NZ  1 
ATOM   5223  N N   . ALA B 1 67  ? -48.176  -40.574 7.126   1.00 43.74  ? 106  ALA C N   1 
ATOM   5224  C CA  . ALA B 1 67  ? -47.809  -41.841 6.510   1.00 41.04  ? 106  ALA C CA  1 
ATOM   5225  C C   . ALA B 1 67  ? -47.646  -42.934 7.569   1.00 50.58  ? 106  ALA C C   1 
ATOM   5226  O O   . ALA B 1 67  ? -47.413  -42.641 8.742   1.00 44.71  ? 106  ALA C O   1 
ATOM   5227  C CB  . ALA B 1 67  ? -46.518  -41.680 5.712   1.00 49.90  ? 106  ALA C CB  1 
ATOM   5228  N N   . ALA B 1 68  ? -47.776  -44.195 7.160   1.00 44.42  ? 107  ALA C N   1 
ATOM   5229  C CA  . ALA B 1 68  ? -47.501  -45.305 8.068   1.00 47.28  ? 107  ALA C CA  1 
ATOM   5230  C C   . ALA B 1 68  ? -46.157  -45.973 7.743   1.00 50.09  ? 107  ALA C C   1 
ATOM   5231  O O   . ALA B 1 68  ? -45.465  -45.582 6.795   1.00 44.82  ? 107  ALA C O   1 
ATOM   5232  C CB  . ALA B 1 68  ? -48.643  -46.326 8.038   1.00 55.48  ? 107  ALA C CB  1 
ATOM   5233  N N   . ALA B 1 69  ? -45.796  -46.973 8.544   1.00 51.52  ? 108  ALA C N   1 
ATOM   5234  C CA  . ALA B 1 69  ? -44.546  -47.725 8.370   1.00 57.70  ? 108  ALA C CA  1 
ATOM   5235  C C   . ALA B 1 69  ? -43.300  -46.837 8.384   1.00 64.19  ? 108  ALA C C   1 
ATOM   5236  O O   . ALA B 1 69  ? -42.560  -46.763 7.393   1.00 52.71  ? 108  ALA C O   1 
ATOM   5237  C CB  . ALA B 1 69  ? -44.591  -48.571 7.098   1.00 56.89  ? 108  ALA C CB  1 
ATOM   5238  N N   . ALA B 1 70  ? -43.075  -46.171 9.514   1.00 54.95  ? 109  ALA C N   1 
ATOM   5239  C CA  . ALA B 1 70  ? -41.896  -45.330 9.689   1.00 61.05  ? 109  ALA C CA  1 
ATOM   5240  C C   . ALA B 1 70  ? -41.766  -44.291 8.575   1.00 54.94  ? 109  ALA C C   1 
ATOM   5241  O O   . ALA B 1 70  ? -40.669  -44.045 8.069   1.00 49.18  ? 109  ALA C O   1 
ATOM   5242  C CB  . ALA B 1 70  ? -40.639  -46.192 9.770   1.00 55.08  ? 109  ALA C CB  1 
ATOM   5243  N N   . GLY B 1 71  ? -42.895  -43.696 8.192   1.00 51.88  ? 110  GLY C N   1 
ATOM   5244  C CA  . GLY B 1 71  ? -42.914  -42.600 7.234   1.00 44.32  ? 110  GLY C CA  1 
ATOM   5245  C C   . GLY B 1 71  ? -42.777  -43.003 5.776   1.00 52.25  ? 110  GLY C C   1 
ATOM   5246  O O   . GLY B 1 71  ? -42.427  -42.182 4.930   1.00 55.36  ? 110  GLY C O   1 
ATOM   5247  N N   . ARG B 1 72  ? -43.077  -44.263 5.478   1.00 59.80  ? 111  ARG C N   1 
ATOM   5248  C CA  . ARG B 1 72  ? -42.852  -44.812 4.143   1.00 58.60  ? 111  ARG C CA  1 
ATOM   5249  C C   . ARG B 1 72  ? -44.119  -44.980 3.310   1.00 53.02  ? 111  ARG C C   1 
ATOM   5250  O O   . ARG B 1 72  ? -44.074  -44.899 2.079   1.00 50.53  ? 111  ARG C O   1 
ATOM   5251  C CB  . ARG B 1 72  ? -42.123  -46.150 4.250   1.00 50.15  ? 111  ARG C CB  1 
ATOM   5252  C CG  . ARG B 1 72  ? -40.715  -46.001 4.788   1.00 58.71  ? 111  ARG C CG  1 
ATOM   5253  C CD  . ARG B 1 72  ? -40.166  -47.316 5.294   1.00 61.10  ? 111  ARG C CD  1 
ATOM   5254  N NE  . ARG B 1 72  ? -38.740  -47.208 5.587   1.00 72.66  ? 111  ARG C NE  1 
ATOM   5255  C CZ  . ARG B 1 72  ? -38.001  -48.194 6.082   1.00 73.12  ? 111  ARG C CZ  1 
ATOM   5256  N NH1 . ARG B 1 72  ? -38.552  -49.371 6.349   1.00 68.14  ? 111  ARG C NH1 1 
ATOM   5257  N NH2 . ARG B 1 72  ? -36.709  -47.999 6.311   1.00 74.16  ? 111  ARG C NH2 1 
ATOM   5258  N N   . ILE B 1 73  ? -45.247  -45.230 3.966   1.00 36.01  ? 112  ILE C N   1 
ATOM   5259  C CA  . ILE B 1 73  ? -46.484  -45.418 3.220   1.00 43.72  ? 112  ILE C CA  1 
ATOM   5260  C C   . ILE B 1 73  ? -47.395  -44.217 3.409   1.00 46.56  ? 112  ILE C C   1 
ATOM   5261  O O   . ILE B 1 73  ? -47.962  -44.029 4.486   1.00 43.47  ? 112  ILE C O   1 
ATOM   5262  C CB  . ILE B 1 73  ? -47.225  -46.706 3.638   1.00 43.56  ? 112  ILE C CB  1 
ATOM   5263  C CG1 . ILE B 1 73  ? -46.306  -47.931 3.484   1.00 49.06  ? 112  ILE C CG1 1 
ATOM   5264  C CG2 . ILE B 1 73  ? -48.525  -46.855 2.845   1.00 41.94  ? 112  ILE C CG2 1 
ATOM   5265  C CD1 . ILE B 1 73  ? -46.044  -48.367 2.034   1.00 43.53  ? 112  ILE C CD1 1 
ATOM   5266  N N   . PRO B 1 74  ? -47.519  -43.383 2.365   1.00 47.29  ? 113  PRO C N   1 
ATOM   5267  C CA  . PRO B 1 74  ? -48.435  -42.241 2.440   1.00 47.61  ? 113  PRO C CA  1 
ATOM   5268  C C   . PRO B 1 74  ? -49.873  -42.667 2.761   1.00 52.76  ? 113  PRO C C   1 
ATOM   5269  O O   . PRO B 1 74  ? -50.407  -43.630 2.187   1.00 44.63  ? 113  PRO C O   1 
ATOM   5270  C CB  . PRO B 1 74  ? -48.329  -41.619 1.044   1.00 42.09  ? 113  PRO C CB  1 
ATOM   5271  C CG  . PRO B 1 74  ? -46.951  -41.958 0.601   1.00 34.21  ? 113  PRO C CG  1 
ATOM   5272  C CD  . PRO B 1 74  ? -46.705  -43.352 1.136   1.00 39.63  ? 113  PRO C CD  1 
ATOM   5273  N N   . THR B 1 75  ? -50.489  -41.941 3.691   1.00 48.44  ? 114  THR C N   1 
ATOM   5274  C CA  . THR B 1 75  ? -51.811  -42.288 4.190   1.00 46.82  ? 114  THR C CA  1 
ATOM   5275  C C   . THR B 1 75  ? -52.664  -41.051 4.464   1.00 58.65  ? 114  THR C C   1 
ATOM   5276  O O   . THR B 1 75  ? -53.837  -41.176 4.833   1.00 43.25  ? 114  THR C O   1 
ATOM   5277  C CB  . THR B 1 75  ? -51.719  -43.119 5.494   1.00 52.82  ? 114  THR C CB  1 
ATOM   5278  O OG1 . THR B 1 75  ? -51.005  -42.372 6.493   1.00 45.04  ? 114  THR C OG1 1 
ATOM   5279  C CG2 . THR B 1 75  ? -51.018  -44.459 5.243   1.00 41.11  ? 114  THR C CG2 1 
ATOM   5280  N N   . ASN B 1 76  ? -52.079  -39.864 4.282   1.00 51.88  ? 115  ASN C N   1 
ATOM   5281  C CA  . ASN B 1 76  ? -52.762  -38.611 4.617   1.00 47.51  ? 115  ASN C CA  1 
ATOM   5282  C C   . ASN B 1 76  ? -53.908  -38.224 3.681   1.00 49.20  ? 115  ASN C C   1 
ATOM   5283  O O   . ASN B 1 76  ? -54.807  -37.475 4.067   1.00 56.98  ? 115  ASN C O   1 
ATOM   5284  C CB  . ASN B 1 76  ? -51.763  -37.449 4.804   1.00 48.56  ? 115  ASN C CB  1 
ATOM   5285  C CG  . ASN B 1 76  ? -51.189  -36.929 3.487   1.00 50.93  ? 115  ASN C CG  1 
ATOM   5286  O OD1 . ASN B 1 76  ? -51.196  -37.624 2.465   1.00 54.18  ? 115  ASN C OD1 1 
ATOM   5287  N ND2 . ASN B 1 76  ? -50.679  -35.696 3.512   1.00 43.96  ? 115  ASN C ND2 1 
ATOM   5288  N N   . TYR B 1 77  ? -53.884  -38.744 2.459   1.00 50.35  ? 116  TYR C N   1 
ATOM   5289  C CA  . TYR B 1 77  ? -54.971  -38.515 1.509   1.00 50.45  ? 116  TYR C CA  1 
ATOM   5290  C C   . TYR B 1 77  ? -56.210  -39.356 1.848   1.00 57.24  ? 116  TYR C C   1 
ATOM   5291  O O   . TYR B 1 77  ? -57.278  -39.179 1.247   1.00 49.48  ? 116  TYR C O   1 
ATOM   5292  C CB  . TYR B 1 77  ? -54.503  -38.817 0.077   1.00 55.51  ? 116  TYR C CB  1 
ATOM   5293  C CG  . TYR B 1 77  ? -54.033  -40.245 -0.137  1.00 49.32  ? 116  TYR C CG  1 
ATOM   5294  C CD1 . TYR B 1 77  ? -54.889  -41.211 -0.655  1.00 44.17  ? 116  TYR C CD1 1 
ATOM   5295  C CD2 . TYR B 1 77  ? -52.730  -40.626 0.182   1.00 53.68  ? 116  TYR C CD2 1 
ATOM   5296  C CE1 . TYR B 1 77  ? -54.459  -42.518 -0.855  1.00 43.79  ? 116  TYR C CE1 1 
ATOM   5297  C CE2 . TYR B 1 77  ? -52.291  -41.932 -0.008  1.00 52.78  ? 116  TYR C CE2 1 
ATOM   5298  C CZ  . TYR B 1 77  ? -53.166  -42.876 -0.528  1.00 48.89  ? 116  TYR C CZ  1 
ATOM   5299  O OH  . TYR B 1 77  ? -52.742  -44.174 -0.719  1.00 40.23  ? 116  TYR C OH  1 
ATOM   5300  N N   . LEU B 1 78  ? -56.058  -40.256 2.819   1.00 52.95  ? 117  LEU C N   1 
ATOM   5301  C CA  . LEU B 1 78  ? -57.087  -41.238 3.173   1.00 62.85  ? 117  LEU C CA  1 
ATOM   5302  C C   . LEU B 1 78  ? -58.003  -40.779 4.308   1.00 72.45  ? 117  LEU C C   1 
ATOM   5303  O O   . LEU B 1 78  ? -57.795  -41.165 5.462   1.00 78.96  ? 117  LEU C O   1 
ATOM   5304  C CB  . LEU B 1 78  ? -56.419  -42.551 3.592   1.00 63.24  ? 117  LEU C CB  1 
ATOM   5305  C CG  . LEU B 1 78  ? -56.657  -43.823 2.782   1.00 68.45  ? 117  LEU C CG  1 
ATOM   5306  C CD1 . LEU B 1 78  ? -56.323  -43.607 1.318   1.00 59.72  ? 117  LEU C CD1 1 
ATOM   5307  C CD2 . LEU B 1 78  ? -55.835  -44.967 3.359   1.00 67.27  ? 117  LEU C CD2 1 
ATOM   5308  N N   . ARG B 1 79  ? -59.013  -39.972 3.981   1.00 76.10  ? 118  ARG C N   1 
ATOM   5309  C CA  . ARG B 1 79  ? -60.043  -39.558 4.946   1.00 81.19  ? 118  ARG C CA  1 
ATOM   5310  C C   . ARG B 1 79  ? -59.537  -39.432 6.389   1.00 87.93  ? 118  ARG C C   1 
ATOM   5311  O O   . ARG B 1 79  ? -59.649  -40.365 7.192   1.00 88.91  ? 118  ARG C O   1 
ATOM   5312  C CB  . ARG B 1 79  ? -61.251  -40.503 4.886   1.00 79.33  ? 118  ARG C CB  1 
ATOM   5313  C CG  . ARG B 1 79  ? -62.174  -40.407 6.094   1.00 89.74  ? 118  ARG C CG  1 
ATOM   5314  C CD  . ARG B 1 79  ? -63.630  -40.645 5.729   1.00 93.74  ? 118  ARG C CD  1 
ATOM   5315  N NE  . ARG B 1 79  ? -63.865  -41.966 5.151   1.00 103.49 ? 118  ARG C NE  1 
ATOM   5316  C CZ  . ARG B 1 79  ? -65.072  -42.447 4.864   1.00 103.60 ? 118  ARG C CZ  1 
ATOM   5317  N NH1 . ARG B 1 79  ? -66.153  -41.716 5.107   1.00 93.25  ? 118  ARG C NH1 1 
ATOM   5318  N NH2 . ARG B 1 79  ? -65.202  -43.659 4.337   1.00 91.81  ? 118  ARG C NH2 1 
ATOM   5319  N N   . GLY B 1 83  ? -60.084  -43.149 8.973   1.00 65.59  ? 122  GLY C N   1 
ATOM   5320  C CA  . GLY B 1 83  ? -60.046  -42.601 10.319  1.00 72.42  ? 122  GLY C CA  1 
ATOM   5321  C C   . GLY B 1 83  ? -58.638  -42.499 10.883  1.00 80.97  ? 122  GLY C C   1 
ATOM   5322  O O   . GLY B 1 83  ? -57.674  -42.292 10.136  1.00 77.50  ? 122  GLY C O   1 
ATOM   5323  N N   . THR B 1 84  ? -58.511  -42.645 12.202  1.00 65.75  ? 123  THR C N   1 
ATOM   5324  C CA  . THR B 1 84  ? -57.204  -42.525 12.852  1.00 59.08  ? 123  THR C CA  1 
ATOM   5325  C C   . THR B 1 84  ? -56.694  -43.841 13.439  1.00 54.15  ? 123  THR C C   1 
ATOM   5326  O O   . THR B 1 84  ? -57.437  -44.600 14.073  1.00 48.83  ? 123  THR C O   1 
ATOM   5327  C CB  . THR B 1 84  ? -57.185  -41.423 13.933  1.00 58.50  ? 123  THR C CB  1 
ATOM   5328  O OG1 . THR B 1 84  ? -58.531  -41.036 14.245  1.00 75.12  ? 123  THR C OG1 1 
ATOM   5329  C CG2 . THR B 1 84  ? -56.387  -40.191 13.448  1.00 57.95  ? 123  THR C CG2 1 
ATOM   5330  N N   . SER B 1 85  ? -55.409  -44.089 13.217  1.00 44.34  ? 124  SER C N   1 
ATOM   5331  C CA  . SER B 1 85  ? -54.753  -45.315 13.635  1.00 44.47  ? 124  SER C CA  1 
ATOM   5332  C C   . SER B 1 85  ? -54.606  -45.415 15.148  1.00 45.27  ? 124  SER C C   1 
ATOM   5333  O O   . SER B 1 85  ? -54.729  -44.421 15.866  1.00 38.69  ? 124  SER C O   1 
ATOM   5334  C CB  . SER B 1 85  ? -53.373  -45.394 12.996  1.00 46.94  ? 124  SER C CB  1 
ATOM   5335  O OG  . SER B 1 85  ? -52.527  -44.409 13.546  1.00 43.74  ? 124  SER C OG  1 
ATOM   5336  N N   . ASP B 1 86  ? -54.319  -46.627 15.618  1.00 41.95  ? 125  ASP C N   1 
ATOM   5337  C CA  . ASP B 1 86  ? -54.094  -46.877 17.038  1.00 49.23  ? 125  ASP C CA  1 
ATOM   5338  C C   . ASP B 1 86  ? -52.888  -46.096 17.552  1.00 41.07  ? 125  ASP C C   1 
ATOM   5339  O O   . ASP B 1 86  ? -52.896  -45.590 18.675  1.00 38.20  ? 125  ASP C O   1 
ATOM   5340  C CB  . ASP B 1 86  ? -53.899  -48.375 17.306  1.00 44.14  ? 125  ASP C CB  1 
ATOM   5341  C CG  . ASP B 1 86  ? -55.144  -49.195 16.999  1.00 51.36  ? 125  ASP C CG  1 
ATOM   5342  O OD1 . ASP B 1 86  ? -56.200  -48.602 16.679  1.00 50.19  ? 125  ASP C OD1 1 
ATOM   5343  O OD2 . ASP B 1 86  ? -55.068  -50.441 17.091  1.00 64.20  ? 125  ASP C OD2 1 
ATOM   5344  N N   . LYS B 1 87  ? -51.850  -46.000 16.731  1.00 36.26  ? 126  LYS C N   1 
ATOM   5345  C CA  . LYS B 1 87  ? -50.657  -45.256 17.129  1.00 40.73  ? 126  LYS C CA  1 
ATOM   5346  C C   . LYS B 1 87  ? -50.976  -43.779 17.385  1.00 36.99  ? 126  LYS C C   1 
ATOM   5347  O O   . LYS B 1 87  ? -50.489  -43.181 18.349  1.00 38.06  ? 126  LYS C O   1 
ATOM   5348  C CB  . LYS B 1 87  ? -49.566  -45.376 16.069  1.00 43.41  ? 126  LYS C CB  1 
ATOM   5349  C CG  . LYS B 1 87  ? -48.456  -44.333 16.195  1.00 38.24  ? 126  LYS C CG  1 
ATOM   5350  C CD  . LYS B 1 87  ? -47.511  -44.667 17.328  1.00 46.97  ? 126  LYS C CD  1 
ATOM   5351  C CE  . LYS B 1 87  ? -46.282  -43.770 17.285  1.00 51.39  ? 126  LYS C CE  1 
ATOM   5352  N NZ  . LYS B 1 87  ? -45.232  -44.246 18.224  1.00 55.72  ? 126  LYS C NZ  1 
ATOM   5353  N N   . GLU B 1 88  ? -51.782  -43.190 16.511  1.00 38.15  ? 127  GLU C N   1 
ATOM   5354  C CA  . GLU B 1 88  ? -52.174  -41.794 16.670  1.00 33.94  ? 127  GLU C CA  1 
ATOM   5355  C C   . GLU B 1 88  ? -53.005  -41.569 17.937  1.00 34.28  ? 127  GLU C C   1 
ATOM   5356  O O   . GLU B 1 88  ? -52.793  -40.600 18.667  1.00 30.16  ? 127  GLU C O   1 
ATOM   5357  C CB  . GLU B 1 88  ? -52.935  -41.317 15.438  1.00 30.94  ? 127  GLU C CB  1 
ATOM   5358  C CG  . GLU B 1 88  ? -52.057  -41.170 14.199  1.00 37.11  ? 127  GLU C CG  1 
ATOM   5359  C CD  . GLU B 1 88  ? -52.865  -41.000 12.918  1.00 45.62  ? 127  GLU C CD  1 
ATOM   5360  O OE1 . GLU B 1 88  ? -53.765  -41.829 12.678  1.00 44.34  ? 127  GLU C OE1 1 
ATOM   5361  O OE2 . GLU B 1 88  ? -52.608  -40.043 12.156  1.00 37.24  ? 127  GLU C OE2 1 
ATOM   5362  N N   . ILE B 1 89  ? -53.948  -42.465 18.194  1.00 31.99  ? 128  ILE C N   1 
ATOM   5363  C CA  . ILE B 1 89  ? -54.770  -42.367 19.393  1.00 30.64  ? 128  ILE C CA  1 
ATOM   5364  C C   . ILE B 1 89  ? -53.907  -42.518 20.635  1.00 30.12  ? 128  ILE C C   1 
ATOM   5365  O O   . ILE B 1 89  ? -53.987  -41.713 21.562  1.00 31.19  ? 128  ILE C O   1 
ATOM   5366  C CB  . ILE B 1 89  ? -55.899  -43.435 19.430  1.00 43.19  ? 128  ILE C CB  1 
ATOM   5367  C CG1 . ILE B 1 89  ? -57.163  -42.919 18.738  1.00 49.85  ? 128  ILE C CG1 1 
ATOM   5368  C CG2 . ILE B 1 89  ? -56.263  -43.792 20.867  1.00 33.93  ? 128  ILE C CG2 1 
ATOM   5369  C CD1 . ILE B 1 89  ? -57.028  -42.748 17.260  1.00 54.64  ? 128  ILE C CD1 1 
ATOM   5370  N N   . LEU B 1 90  ? -53.075  -43.551 20.652  1.00 29.47  ? 129  LEU C N   1 
ATOM   5371  C CA  . LEU B 1 90  ? -52.234  -43.809 21.810  1.00 30.55  ? 129  LEU C CA  1 
ATOM   5372  C C   . LEU B 1 90  ? -51.264  -42.653 22.068  1.00 27.41  ? 129  LEU C C   1 
ATOM   5373  O O   . LEU B 1 90  ? -51.024  -42.278 23.214  1.00 31.16  ? 129  LEU C O   1 
ATOM   5374  C CB  . LEU B 1 90  ? -51.449  -45.105 21.625  1.00 31.82  ? 129  LEU C CB  1 
ATOM   5375  C CG  . LEU B 1 90  ? -52.247  -46.409 21.594  1.00 38.47  ? 129  LEU C CG  1 
ATOM   5376  C CD1 . LEU B 1 90  ? -51.270  -47.609 21.506  1.00 33.30  ? 129  LEU C CD1 1 
ATOM   5377  C CD2 . LEU B 1 90  ? -53.143  -46.527 22.815  1.00 29.15  ? 129  LEU C CD2 1 
ATOM   5378  N N   . THR B 1 91  ? -50.689  -42.098 21.011  1.00 30.27  ? 130  THR C N   1 
ATOM   5379  C CA  . THR B 1 91  ? -49.736  -40.995 21.188  1.00 28.27  ? 130  THR C CA  1 
ATOM   5380  C C   . THR B 1 91  ? -50.433  -39.722 21.702  1.00 30.11  ? 130  THR C C   1 
ATOM   5381  O O   . THR B 1 91  ? -49.923  -39.048 22.611  1.00 29.40  ? 130  THR C O   1 
ATOM   5382  C CB  . THR B 1 91  ? -48.953  -40.700 19.903  1.00 30.15  ? 130  THR C CB  1 
ATOM   5383  O OG1 . THR B 1 91  ? -48.272  -41.890 19.491  1.00 30.61  ? 130  THR C OG1 1 
ATOM   5384  C CG2 . THR B 1 91  ? -47.924  -39.597 20.146  1.00 30.98  ? 130  THR C CG2 1 
ATOM   5385  N N   . SER B 1 92  ? -51.591  -39.404 21.123  1.00 28.41  ? 131  SER C N   1 
ATOM   5386  C CA  . SER B 1 92  ? -52.423  -38.304 21.607  1.00 30.51  ? 131  SER C CA  1 
ATOM   5387  C C   . SER B 1 92  ? -52.624  -38.436 23.106  1.00 27.62  ? 131  SER C C   1 
ATOM   5388  O O   . SER B 1 92  ? -52.470  -37.478 23.852  1.00 29.98  ? 131  SER C O   1 
ATOM   5389  C CB  . SER B 1 92  ? -53.803  -38.335 20.950  1.00 25.99  ? 131  SER C CB  1 
ATOM   5390  O OG  . SER B 1 92  ? -53.736  -38.110 19.557  1.00 32.73  ? 131  SER C OG  1 
ATOM   5391  N N   . ARG B 1 93  ? -52.979  -39.643 23.535  1.00 25.85  ? 132  ARG C N   1 
ATOM   5392  C CA  . ARG B 1 93  ? -53.272  -39.887 24.937  1.00 24.24  ? 132  ARG C CA  1 
ATOM   5393  C C   . ARG B 1 93  ? -52.039  -39.712 25.826  1.00 29.81  ? 132  ARG C C   1 
ATOM   5394  O O   . ARG B 1 93  ? -52.139  -39.188 26.927  1.00 27.20  ? 132  ARG C O   1 
ATOM   5395  C CB  . ARG B 1 93  ? -53.919  -41.269 25.126  1.00 31.77  ? 132  ARG C CB  1 
ATOM   5396  C CG  . ARG B 1 93  ? -55.381  -41.319 24.636  1.00 30.76  ? 132  ARG C CG  1 
ATOM   5397  C CD  . ARG B 1 93  ? -55.970  -42.740 24.680  1.00 36.84  ? 132  ARG C CD  1 
ATOM   5398  N NE  . ARG B 1 93  ? -56.112  -43.275 26.038  1.00 33.68  ? 132  ARG C NE  1 
ATOM   5399  C CZ  . ARG B 1 93  ? -57.127  -42.987 26.852  1.00 34.33  ? 132  ARG C CZ  1 
ATOM   5400  N NH1 . ARG B 1 93  ? -58.085  -42.161 26.449  1.00 36.71  ? 132  ARG C NH1 1 
ATOM   5401  N NH2 . ARG B 1 93  ? -57.189  -43.524 28.064  1.00 36.18  ? 132  ARG C NH2 1 
ATOM   5402  N N   . ILE B 1 94  ? -50.878  -40.154 25.348  1.00 28.66  ? 133  ILE C N   1 
ATOM   5403  C CA  . ILE B 1 94  ? -49.656  -39.998 26.121  1.00 33.24  ? 133  ILE C CA  1 
ATOM   5404  C C   . ILE B 1 94  ? -49.325  -38.521 26.239  1.00 24.04  ? 133  ILE C C   1 
ATOM   5405  O O   . ILE B 1 94  ? -48.925  -38.045 27.301  1.00 29.26  ? 133  ILE C O   1 
ATOM   5406  C CB  . ILE B 1 94  ? -48.470  -40.776 25.492  1.00 24.31  ? 133  ILE C CB  1 
ATOM   5407  C CG1 . ILE B 1 94  ? -48.768  -42.281 25.529  1.00 42.91  ? 133  ILE C CG1 1 
ATOM   5408  C CG2 . ILE B 1 94  ? -47.202  -40.484 26.254  1.00 34.98  ? 133  ILE C CG2 1 
ATOM   5409  C CD1 . ILE B 1 94  ? -47.719  -43.156 24.843  1.00 49.66  ? 133  ILE C CD1 1 
ATOM   5410  N N   . ILE B 1 95  ? -49.494  -37.789 25.146  1.00 26.73  ? 134  ILE C N   1 
ATOM   5411  C CA  . ILE B 1 95  ? -49.220  -36.361 25.181  1.00 26.29  ? 134  ILE C CA  1 
ATOM   5412  C C   . ILE B 1 95  ? -50.189  -35.688 26.155  1.00 33.20  ? 134  ILE C C   1 
ATOM   5413  O O   . ILE B 1 95  ? -49.780  -34.870 26.990  1.00 27.42  ? 134  ILE C O   1 
ATOM   5414  C CB  . ILE B 1 95  ? -49.334  -35.727 23.788  1.00 31.30  ? 134  ILE C CB  1 
ATOM   5415  C CG1 . ILE B 1 95  ? -48.222  -36.258 22.876  1.00 29.07  ? 134  ILE C CG1 1 
ATOM   5416  C CG2 . ILE B 1 95  ? -49.257  -34.198 23.887  1.00 25.43  ? 134  ILE C CG2 1 
ATOM   5417  C CD1 . ILE B 1 95  ? -48.453  -35.964 21.398  1.00 25.94  ? 134  ILE C CD1 1 
ATOM   5418  N N   . ASP B 1 96  ? -51.468  -36.056 26.054  1.00 25.83  ? 135  ASP C N   1 
ATOM   5419  C CA  . ASP B 1 96  ? -52.500  -35.518 26.937  1.00 29.76  ? 135  ASP C CA  1 
ATOM   5420  C C   . ASP B 1 96  ? -52.125  -35.682 28.415  1.00 29.17  ? 135  ASP C C   1 
ATOM   5421  O O   . ASP B 1 96  ? -52.133  -34.716 29.189  1.00 25.93  ? 135  ASP C O   1 
ATOM   5422  C CB  . ASP B 1 96  ? -53.854  -36.193 26.660  1.00 30.01  ? 135  ASP C CB  1 
ATOM   5423  C CG  . ASP B 1 96  ? -54.976  -35.628 27.519  1.00 36.93  ? 135  ASP C CG  1 
ATOM   5424  O OD1 . ASP B 1 96  ? -54.895  -35.759 28.757  1.00 32.57  ? 135  ASP C OD1 1 
ATOM   5425  O OD2 . ASP B 1 96  ? -55.935  -35.048 26.958  1.00 34.63  ? 135  ASP C OD2 1 
ATOM   5426  N N   . ARG B 1 97  ? -51.806  -36.909 28.809  1.00 25.42  ? 136  ARG C N   1 
ATOM   5427  C CA  . ARG B 1 97  ? -51.458  -37.170 30.205  1.00 28.23  ? 136  ARG C CA  1 
ATOM   5428  C C   . ARG B 1 97  ? -50.202  -36.409 30.648  1.00 30.30  ? 136  ARG C C   1 
ATOM   5429  O O   . ARG B 1 97  ? -50.020  -36.166 31.838  1.00 26.73  ? 136  ARG C O   1 
ATOM   5430  C CB  . ARG B 1 97  ? -51.313  -38.679 30.474  1.00 32.45  ? 136  ARG C CB  1 
ATOM   5431  C CG  . ARG B 1 97  ? -52.653  -39.438 30.436  1.00 33.91  ? 136  ARG C CG  1 
ATOM   5432  C CD  . ARG B 1 97  ? -52.540  -40.855 30.975  1.00 44.25  ? 136  ARG C CD  1 
ATOM   5433  N NE  . ARG B 1 97  ? -51.707  -41.710 30.137  1.00 40.92  ? 136  ARG C NE  1 
ATOM   5434  C CZ  . ARG B 1 97  ? -52.165  -42.438 29.126  1.00 45.01  ? 136  ARG C CZ  1 
ATOM   5435  N NH1 . ARG B 1 97  ? -53.469  -42.441 28.832  1.00 43.52  ? 136  ARG C NH1 1 
ATOM   5436  N NH2 . ARG B 1 97  ? -51.317  -43.173 28.411  1.00 48.85  ? 136  ARG C NH2 1 
ATOM   5437  N N   . SER B 1 98  ? -49.352  -36.025 29.690  1.00 24.40  ? 137  SER C N   1 
ATOM   5438  C CA  . SER B 1 98  ? -48.106  -35.330 30.002  1.00 26.92  ? 137  SER C CA  1 
ATOM   5439  C C   . SER B 1 98  ? -48.316  -33.847 30.270  1.00 28.46  ? 137  SER C C   1 
ATOM   5440  O O   . SER B 1 98  ? -47.439  -33.197 30.843  1.00 30.26  ? 137  SER C O   1 
ATOM   5441  C CB  . SER B 1 98  ? -47.081  -35.485 28.867  1.00 24.38  ? 137  SER C CB  1 
ATOM   5442  O OG  . SER B 1 98  ? -46.729  -36.843 28.665  1.00 27.76  ? 137  SER C OG  1 
ATOM   5443  N N   . ILE B 1 99  ? -49.449  -33.300 29.825  1.00 28.24  ? 138  ILE C N   1 
ATOM   5444  C CA  . ILE B 1 99  ? -49.662  -31.852 29.908  1.00 26.90  ? 138  ILE C CA  1 
ATOM   5445  C C   . ILE B 1 99  ? -50.880  -31.475 30.740  1.00 29.81  ? 138  ILE C C   1 
ATOM   5446  O O   . ILE B 1 99  ? -50.909  -30.405 31.345  1.00 26.68  ? 138  ILE C O   1 
ATOM   5447  C CB  . ILE B 1 99  ? -49.791  -31.192 28.515  1.00 26.34  ? 138  ILE C CB  1 
ATOM   5448  C CG1 . ILE B 1 99  ? -51.079  -31.646 27.820  1.00 26.84  ? 138  ILE C CG1 1 
ATOM   5449  C CG2 . ILE B 1 99  ? -48.579  -31.497 27.671  1.00 28.08  ? 138  ILE C CG2 1 
ATOM   5450  C CD1 . ILE B 1 99  ? -51.225  -31.137 26.408  1.00 24.25  ? 138  ILE C CD1 1 
ATOM   5451  N N   . ARG B 1 100 ? -51.874  -32.361 30.771  1.00 27.08  ? 139  ARG C N   1 
ATOM   5452  C CA  . ARG B 1 100 ? -53.134  -32.091 31.467  1.00 30.56  ? 139  ARG C CA  1 
ATOM   5453  C C   . ARG B 1 100 ? -52.972  -31.615 32.911  1.00 28.83  ? 139  ARG C C   1 
ATOM   5454  O O   . ARG B 1 100 ? -53.634  -30.666 33.307  1.00 30.95  ? 139  ARG C O   1 
ATOM   5455  C CB  . ARG B 1 100 ? -54.089  -33.304 31.405  1.00 27.68  ? 139  ARG C CB  1 
ATOM   5456  C CG  . ARG B 1 100 ? -55.479  -33.081 32.044  1.00 31.80  ? 139  ARG C CG  1 
ATOM   5457  C CD  . ARG B 1 100 ? -56.443  -34.251 31.767  1.00 31.72  ? 139  ARG C CD  1 
ATOM   5458  N NE  . ARG B 1 100 ? -56.770  -34.339 30.341  1.00 33.85  ? 139  ARG C NE  1 
ATOM   5459  C CZ  . ARG B 1 100 ? -57.826  -33.762 29.772  1.00 31.59  ? 139  ARG C CZ  1 
ATOM   5460  N NH1 . ARG B 1 100 ? -58.680  -33.061 30.506  1.00 33.07  ? 139  ARG C NH1 1 
ATOM   5461  N NH2 . ARG B 1 100 ? -58.035  -33.886 28.466  1.00 32.76  ? 139  ARG C NH2 1 
ATOM   5462  N N   . PRO B 1 101 ? -52.116  -32.280 33.708  1.00 29.46  ? 140  PRO C N   1 
ATOM   5463  C CA  . PRO B 1 101 ? -52.061  -31.937 35.142  1.00 27.48  ? 140  PRO C CA  1 
ATOM   5464  C C   . PRO B 1 101 ? -51.426  -30.580 35.467  1.00 31.65  ? 140  PRO C C   1 
ATOM   5465  O O   . PRO B 1 101 ? -51.454  -30.178 36.631  1.00 31.95  ? 140  PRO C O   1 
ATOM   5466  C CB  . PRO B 1 101 ? -51.217  -33.068 35.756  1.00 32.51  ? 140  PRO C CB  1 
ATOM   5467  C CG  . PRO B 1 101 ? -51.166  -34.162 34.697  1.00 33.81  ? 140  PRO C CG  1 
ATOM   5468  C CD  . PRO B 1 101 ? -51.289  -33.458 33.384  1.00 35.72  ? 140  PRO C CD  1 
ATOM   5469  N N   . LEU B 1 102 ? -50.871  -29.885 34.477  1.00 29.95  ? 141  LEU C N   1 
ATOM   5470  C CA  . LEU B 1 102 ? -50.189  -28.613 34.737  1.00 28.50  ? 141  LEU C CA  1 
ATOM   5471  C C   . LEU B 1 102 ? -51.026  -27.367 34.427  1.00 31.03  ? 141  LEU C C   1 
ATOM   5472  O O   . LEU B 1 102 ? -50.566  -26.246 34.646  1.00 29.86  ? 141  LEU C O   1 
ATOM   5473  C CB  . LEU B 1 102 ? -48.856  -28.552 33.985  1.00 27.58  ? 141  LEU C CB  1 
ATOM   5474  C CG  . LEU B 1 102 ? -47.906  -29.697 34.352  1.00 35.77  ? 141  LEU C CG  1 
ATOM   5475  C CD1 . LEU B 1 102 ? -46.663  -29.562 33.548  1.00 44.31  ? 141  LEU C CD1 1 
ATOM   5476  C CD2 . LEU B 1 102 ? -47.563  -29.664 35.832  1.00 31.64  ? 141  LEU C CD2 1 
ATOM   5477  N N   . PHE B 1 103 ? -52.238  -27.564 33.904  1.00 30.00  ? 142  PHE C N   1 
ATOM   5478  C CA  . PHE B 1 103 ? -53.207  -26.474 33.768  1.00 31.56  ? 142  PHE C CA  1 
ATOM   5479  C C   . PHE B 1 103 ? -53.731  -26.101 35.151  1.00 31.10  ? 142  PHE C C   1 
ATOM   5480  O O   . PHE B 1 103 ? -53.868  -26.963 36.013  1.00 25.56  ? 142  PHE C O   1 
ATOM   5481  C CB  . PHE B 1 103 ? -54.382  -26.873 32.846  1.00 31.34  ? 142  PHE C CB  1 
ATOM   5482  C CG  . PHE B 1 103 ? -53.992  -26.994 31.404  1.00 26.38  ? 142  PHE C CG  1 
ATOM   5483  C CD1 . PHE B 1 103 ? -53.557  -28.211 30.889  1.00 26.11  ? 142  PHE C CD1 1 
ATOM   5484  C CD2 . PHE B 1 103 ? -54.016  -25.882 30.576  1.00 19.94  ? 142  PHE C CD2 1 
ATOM   5485  C CE1 . PHE B 1 103 ? -53.156  -28.315 29.568  1.00 25.43  ? 142  PHE C CE1 1 
ATOM   5486  C CE2 . PHE B 1 103 ? -53.614  -25.974 29.261  1.00 27.67  ? 142  PHE C CE2 1 
ATOM   5487  C CZ  . PHE B 1 103 ? -53.185  -27.196 28.751  1.00 20.85  ? 142  PHE C CZ  1 
ATOM   5488  N N   . PRO B 1 104 ? -54.025  -24.813 35.366  1.00 31.31  ? 143  PRO C N   1 
ATOM   5489  C CA  . PRO B 1 104 ? -54.519  -24.382 36.677  1.00 37.04  ? 143  PRO C CA  1 
ATOM   5490  C C   . PRO B 1 104 ? -55.939  -24.868 36.913  1.00 35.84  ? 143  PRO C C   1 
ATOM   5491  O O   . PRO B 1 104 ? -56.673  -25.091 35.955  1.00 30.43  ? 143  PRO C O   1 
ATOM   5492  C CB  . PRO B 1 104 ? -54.488  -22.851 36.579  1.00 42.43  ? 143  PRO C CB  1 
ATOM   5493  C CG  . PRO B 1 104 ? -54.561  -22.555 35.125  1.00 36.83  ? 143  PRO C CG  1 
ATOM   5494  C CD  . PRO B 1 104 ? -53.844  -23.683 34.438  1.00 32.85  ? 143  PRO C CD  1 
ATOM   5495  N N   . ALA B 1 105 ? -56.322  -25.040 38.170  1.00 29.05  ? 144  ALA C N   1 
ATOM   5496  C CA  . ALA B 1 105 ? -57.680  -25.463 38.467  1.00 39.30  ? 144  ALA C CA  1 
ATOM   5497  C C   . ALA B 1 105 ? -58.626  -24.388 37.958  1.00 34.21  ? 144  ALA C C   1 
ATOM   5498  O O   . ALA B 1 105 ? -58.292  -23.204 37.976  1.00 33.59  ? 144  ALA C O   1 
ATOM   5499  C CB  . ALA B 1 105 ? -57.868  -25.689 39.975  1.00 35.15  ? 144  ALA C CB  1 
ATOM   5500  N N   . GLY B 1 106 ? -59.787  -24.815 37.471  1.00 31.88  ? 145  GLY C N   1 
ATOM   5501  C CA  . GLY B 1 106 ? -60.822  -23.899 37.038  1.00 37.85  ? 145  GLY C CA  1 
ATOM   5502  C C   . GLY B 1 106 ? -60.581  -23.273 35.678  1.00 40.97  ? 145  GLY C C   1 
ATOM   5503  O O   . GLY B 1 106 ? -61.275  -22.319 35.302  1.00 33.50  ? 145  GLY C O   1 
ATOM   5504  N N   . TYR B 1 107 ? -59.604  -23.799 34.940  1.00 38.99  ? 146  TYR C N   1 
ATOM   5505  C CA  . TYR B 1 107 ? -59.300  -23.290 33.599  1.00 34.39  ? 146  TYR C CA  1 
ATOM   5506  C C   . TYR B 1 107 ? -60.265  -23.872 32.547  1.00 36.23  ? 146  TYR C C   1 
ATOM   5507  O O   . TYR B 1 107 ? -59.890  -24.718 31.726  1.00 31.64  ? 146  TYR C O   1 
ATOM   5508  C CB  . TYR B 1 107 ? -57.831  -23.551 33.215  1.00 31.83  ? 146  TYR C CB  1 
ATOM   5509  C CG  . TYR B 1 107 ? -57.424  -22.775 31.982  1.00 30.74  ? 146  TYR C CG  1 
ATOM   5510  C CD1 . TYR B 1 107 ? -57.186  -21.404 32.044  1.00 22.76  ? 146  TYR C CD1 1 
ATOM   5511  C CD2 . TYR B 1 107 ? -57.319  -23.398 30.756  1.00 30.23  ? 146  TYR C CD2 1 
ATOM   5512  C CE1 . TYR B 1 107 ? -56.845  -20.690 30.930  1.00 27.33  ? 146  TYR C CE1 1 
ATOM   5513  C CE2 . TYR B 1 107 ? -56.977  -22.686 29.630  1.00 28.40  ? 146  TYR C CE2 1 
ATOM   5514  C CZ  . TYR B 1 107 ? -56.744  -21.336 29.724  1.00 25.85  ? 146  TYR C CZ  1 
ATOM   5515  O OH  . TYR B 1 107 ? -56.404  -20.628 28.601  1.00 28.03  ? 146  TYR C OH  1 
ATOM   5516  N N   . PHE B 1 108 ? -61.509  -23.399 32.577  1.00 31.21  ? 147  PHE C N   1 
ATOM   5517  C CA  . PHE B 1 108 ? -62.563  -23.911 31.706  1.00 35.79  ? 147  PHE C CA  1 
ATOM   5518  C C   . PHE B 1 108 ? -62.574  -23.212 30.355  1.00 38.11  ? 147  PHE C C   1 
ATOM   5519  O O   . PHE B 1 108 ? -63.543  -22.536 30.003  1.00 32.94  ? 147  PHE C O   1 
ATOM   5520  C CB  . PHE B 1 108 ? -63.931  -23.753 32.375  1.00 38.85  ? 147  PHE C CB  1 
ATOM   5521  C CG  . PHE B 1 108 ? -64.089  -24.564 33.635  1.00 42.73  ? 147  PHE C CG  1 
ATOM   5522  C CD1 . PHE B 1 108 ? -63.046  -25.344 34.114  1.00 39.45  ? 147  PHE C CD1 1 
ATOM   5523  C CD2 . PHE B 1 108 ? -65.287  -24.566 34.327  1.00 45.49  ? 147  PHE C CD2 1 
ATOM   5524  C CE1 . PHE B 1 108 ? -63.187  -26.103 35.282  1.00 43.39  ? 147  PHE C CE1 1 
ATOM   5525  C CE2 . PHE B 1 108 ? -65.438  -25.321 35.486  1.00 46.95  ? 147  PHE C CE2 1 
ATOM   5526  C CZ  . PHE B 1 108 ? -64.385  -26.089 35.966  1.00 43.88  ? 147  PHE C CZ  1 
ATOM   5527  N N   . TYR B 1 109 ? -61.489  -23.374 29.604  1.00 32.03  ? 148  TYR C N   1 
ATOM   5528  C CA  . TYR B 1 109 ? -61.383  -22.786 28.281  1.00 29.23  ? 148  TYR C CA  1 
ATOM   5529  C C   . TYR B 1 109 ? -61.011  -23.846 27.262  1.00 35.94  ? 148  TYR C C   1 
ATOM   5530  O O   . TYR B 1 109 ? -60.057  -24.607 27.460  1.00 29.73  ? 148  TYR C O   1 
ATOM   5531  C CB  . TYR B 1 109 ? -60.378  -21.629 28.294  1.00 26.71  ? 148  TYR C CB  1 
ATOM   5532  C CG  . TYR B 1 109 ? -60.804  -20.572 29.273  1.00 34.86  ? 148  TYR C CG  1 
ATOM   5533  C CD1 . TYR B 1 109 ? -60.560  -20.725 30.628  1.00 29.68  ? 148  TYR C CD1 1 
ATOM   5534  C CD2 . TYR B 1 109 ? -61.502  -19.444 28.850  1.00 29.92  ? 148  TYR C CD2 1 
ATOM   5535  C CE1 . TYR B 1 109 ? -60.979  -19.779 31.534  1.00 30.83  ? 148  TYR C CE1 1 
ATOM   5536  C CE2 . TYR B 1 109 ? -61.914  -18.490 29.742  1.00 32.54  ? 148  TYR C CE2 1 
ATOM   5537  C CZ  . TYR B 1 109 ? -61.659  -18.664 31.083  1.00 33.91  ? 148  TYR C CZ  1 
ATOM   5538  O OH  . TYR B 1 109 ? -62.082  -17.712 31.971  1.00 38.20  ? 148  TYR C OH  1 
ATOM   5539  N N   . ASP B 1 110 ? -61.784  -23.890 26.181  1.00 29.99  ? 149  ASP C N   1 
ATOM   5540  C CA  . ASP B 1 110 ? -61.592  -24.865 25.120  1.00 32.80  ? 149  ASP C CA  1 
ATOM   5541  C C   . ASP B 1 110 ? -60.142  -24.772 24.641  1.00 32.41  ? 149  ASP C C   1 
ATOM   5542  O O   . ASP B 1 110 ? -59.684  -23.698 24.246  1.00 30.17  ? 149  ASP C O   1 
ATOM   5543  C CB  . ASP B 1 110 ? -62.578  -24.584 23.984  1.00 34.70  ? 149  ASP C CB  1 
ATOM   5544  C CG  . ASP B 1 110 ? -62.816  -25.787 23.094  1.00 54.05  ? 149  ASP C CG  1 
ATOM   5545  O OD1 . ASP B 1 110 ? -62.522  -26.935 23.514  1.00 48.67  ? 149  ASP C OD1 1 
ATOM   5546  O OD2 . ASP B 1 110 ? -63.307  -25.576 21.961  1.00 58.15  ? 149  ASP C OD2 1 
ATOM   5547  N N   . THR B 1 111 ? -59.421  -25.888 24.709  1.00 32.14  ? 150  THR C N   1 
ATOM   5548  C CA  . THR B 1 111 ? -57.983  -25.898 24.427  1.00 28.18  ? 150  THR C CA  1 
ATOM   5549  C C   . THR B 1 111 ? -57.595  -27.101 23.568  1.00 32.44  ? 150  THR C C   1 
ATOM   5550  O O   . THR B 1 111 ? -57.998  -28.233 23.841  1.00 27.20  ? 150  THR C O   1 
ATOM   5551  C CB  . THR B 1 111 ? -57.175  -25.938 25.722  1.00 29.01  ? 150  THR C CB  1 
ATOM   5552  O OG1 . THR B 1 111 ? -57.543  -24.825 26.544  1.00 26.47  ? 150  THR C OG1 1 
ATOM   5553  C CG2 . THR B 1 111 ? -55.669  -25.894 25.423  1.00 29.05  ? 150  THR C CG2 1 
ATOM   5554  N N   . GLN B 1 112 ? -56.819  -26.848 22.524  1.00 27.66  ? 151  GLN C N   1 
ATOM   5555  C CA  . GLN B 1 112 ? -56.494  -27.888 21.566  1.00 34.26  ? 151  GLN C CA  1 
ATOM   5556  C C   . GLN B 1 112 ? -55.014  -27.895 21.243  1.00 28.66  ? 151  GLN C C   1 
ATOM   5557  O O   . GLN B 1 112 ? -54.433  -26.873 20.894  1.00 24.06  ? 151  GLN C O   1 
ATOM   5558  C CB  . GLN B 1 112 ? -57.297  -27.717 20.273  1.00 27.91  ? 151  GLN C CB  1 
ATOM   5559  C CG  . GLN B 1 112 ? -56.957  -28.780 19.219  1.00 32.83  ? 151  GLN C CG  1 
ATOM   5560  C CD  . GLN B 1 112 ? -57.865  -28.721 17.997  1.00 34.61  ? 151  GLN C CD  1 
ATOM   5561  O OE1 . GLN B 1 112 ? -58.101  -27.653 17.419  1.00 31.12  ? 151  GLN C OE1 1 
ATOM   5562  N NE2 . GLN B 1 112 ? -58.391  -29.872 17.613  1.00 32.55  ? 151  GLN C NE2 1 
ATOM   5563  N N   . VAL B 1 113 ? -54.405  -29.060 21.365  1.00 31.19  ? 152  VAL C N   1 
ATOM   5564  C CA  . VAL B 1 113 ? -53.018  -29.223 20.961  1.00 27.64  ? 152  VAL C CA  1 
ATOM   5565  C C   . VAL B 1 113 ? -52.998  -30.105 19.718  1.00 27.16  ? 152  VAL C C   1 
ATOM   5566  O O   . VAL B 1 113 ? -53.528  -31.223 19.725  1.00 27.94  ? 152  VAL C O   1 
ATOM   5567  C CB  . VAL B 1 113 ? -52.180  -29.828 22.103  1.00 27.46  ? 152  VAL C CB  1 
ATOM   5568  C CG1 . VAL B 1 113 ? -50.781  -30.213 21.629  1.00 26.50  ? 152  VAL C CG1 1 
ATOM   5569  C CG2 . VAL B 1 113 ? -52.111  -28.859 23.263  1.00 22.31  ? 152  VAL C CG2 1 
ATOM   5570  N N   . LEU B 1 114 ? -52.423  -29.587 18.637  1.00 23.44  ? 153  LEU C N   1 
ATOM   5571  C CA  . LEU B 1 114 ? -52.307  -30.356 17.406  1.00 27.75  ? 153  LEU C CA  1 
ATOM   5572  C C   . LEU B 1 114 ? -50.850  -30.635 17.056  1.00 34.74  ? 153  LEU C C   1 
ATOM   5573  O O   . LEU B 1 114 ? -49.980  -29.802 17.299  1.00 25.10  ? 153  LEU C O   1 
ATOM   5574  C CB  . LEU B 1 114 ? -52.961  -29.616 16.254  1.00 23.51  ? 153  LEU C CB  1 
ATOM   5575  C CG  . LEU B 1 114 ? -54.451  -29.879 16.094  1.00 31.86  ? 153  LEU C CG  1 
ATOM   5576  C CD1 . LEU B 1 114 ? -55.111  -28.697 15.419  1.00 35.58  ? 153  LEU C CD1 1 
ATOM   5577  C CD2 . LEU B 1 114 ? -54.637  -31.138 15.281  1.00 46.78  ? 153  LEU C CD2 1 
ATOM   5578  N N   . CYS B 1 115 ? -50.598  -31.799 16.460  1.00 28.24  ? 154  CYS C N   1 
ATOM   5579  C CA  . CYS B 1 115 ? -49.238  -32.180 16.091  1.00 29.52  ? 154  CYS C CA  1 
ATOM   5580  C C   . CYS B 1 115 ? -49.111  -32.451 14.597  1.00 33.14  ? 154  CYS C C   1 
ATOM   5581  O O   . CYS B 1 115 ? -49.930  -33.167 14.010  1.00 35.63  ? 154  CYS C O   1 
ATOM   5582  C CB  . CYS B 1 115 ? -48.806  -33.424 16.860  1.00 24.32  ? 154  CYS C CB  1 
ATOM   5583  S SG  . CYS B 1 115 ? -49.066  -33.378 18.626  1.00 31.81  ? 154  CYS C SG  1 
ATOM   5584  N N   . ASN B 1 116 ? -48.069  -31.891 13.991  1.00 29.19  ? 155  ASN C N   1 
ATOM   5585  C CA  . ASN B 1 116 ? -47.849  -32.036 12.565  1.00 29.05  ? 155  ASN C CA  1 
ATOM   5586  C C   . ASN B 1 116 ? -46.457  -32.610 12.317  1.00 28.81  ? 155  ASN C C   1 
ATOM   5587  O O   . ASN B 1 116 ? -45.454  -32.006 12.692  1.00 29.48  ? 155  ASN C O   1 
ATOM   5588  C CB  . ASN B 1 116 ? -48.019  -30.677 11.884  1.00 34.25  ? 155  ASN C CB  1 
ATOM   5589  C CG  . ASN B 1 116 ? -47.883  -30.749 10.371  1.00 43.24  ? 155  ASN C CG  1 
ATOM   5590  O OD1 . ASN B 1 116 ? -46.971  -31.394 9.840   1.00 39.81  ? 155  ASN C OD1 1 
ATOM   5591  N ND2 . ASN B 1 116 ? -48.783  -30.068 9.668   1.00 37.14  ? 155  ASN C ND2 1 
ATOM   5592  N N   . LEU B 1 117 ? -46.400  -33.791 11.711  1.00 31.22  ? 156  LEU C N   1 
ATOM   5593  C CA  . LEU B 1 117 ? -45.121  -34.446 11.413  1.00 27.95  ? 156  LEU C CA  1 
ATOM   5594  C C   . LEU B 1 117 ? -44.562  -33.876 10.125  1.00 28.75  ? 156  LEU C C   1 
ATOM   5595  O O   . LEU B 1 117 ? -44.946  -34.294 9.039   1.00 30.77  ? 156  LEU C O   1 
ATOM   5596  C CB  . LEU B 1 117 ? -45.306  -35.953 11.298  1.00 28.63  ? 156  LEU C CB  1 
ATOM   5597  C CG  . LEU B 1 117 ? -45.070  -36.753 12.580  1.00 38.56  ? 156  LEU C CG  1 
ATOM   5598  C CD1 . LEU B 1 117 ? -45.844  -36.156 13.742  1.00 31.09  ? 156  LEU C CD1 1 
ATOM   5599  C CD2 . LEU B 1 117 ? -45.413  -38.240 12.373  1.00 34.67  ? 156  LEU C CD2 1 
ATOM   5600  N N   . LEU B 1 118 ? -43.684  -32.885 10.253  1.00 24.63  ? 157  LEU C N   1 
ATOM   5601  C CA  . LEU B 1 118 ? -43.120  -32.182 9.096   1.00 32.27  ? 157  LEU C CA  1 
ATOM   5602  C C   . LEU B 1 118 ? -42.273  -33.122 8.233   1.00 32.73  ? 157  LEU C C   1 
ATOM   5603  O O   . LEU B 1 118 ? -42.279  -33.034 7.002   1.00 33.13  ? 157  LEU C O   1 
ATOM   5604  C CB  . LEU B 1 118 ? -42.277  -30.974 9.547   1.00 31.66  ? 157  LEU C CB  1 
ATOM   5605  C CG  . LEU B 1 118 ? -42.943  -29.947 10.465  1.00 37.64  ? 157  LEU C CG  1 
ATOM   5606  C CD1 . LEU B 1 118 ? -41.909  -29.006 11.077  1.00 38.42  ? 157  LEU C CD1 1 
ATOM   5607  C CD2 . LEU B 1 118 ? -44.003  -29.154 9.721   1.00 31.91  ? 157  LEU C CD2 1 
ATOM   5608  N N   . ALA B 1 119 ? -41.546  -34.013 8.899   1.00 32.36  ? 158  ALA C N   1 
ATOM   5609  C CA  . ALA B 1 119 ? -40.699  -35.006 8.241   1.00 35.91  ? 158  ALA C CA  1 
ATOM   5610  C C   . ALA B 1 119 ? -40.380  -36.100 9.244   1.00 33.50  ? 158  ALA C C   1 
ATOM   5611  O O   . ALA B 1 119 ? -40.304  -35.841 10.443  1.00 30.10  ? 158  ALA C O   1 
ATOM   5612  C CB  . ALA B 1 119 ? -39.422  -34.366 7.727   1.00 30.82  ? 158  ALA C CB  1 
ATOM   5613  N N   . VAL B 1 120 ? -40.242  -37.330 8.768   1.00 29.44  ? 159  VAL C N   1 
ATOM   5614  C CA  . VAL B 1 120 ? -39.725  -38.402 9.615   1.00 38.40  ? 159  VAL C CA  1 
ATOM   5615  C C   . VAL B 1 120 ? -38.591  -39.102 8.872   1.00 39.73  ? 159  VAL C C   1 
ATOM   5616  O O   . VAL B 1 120 ? -38.570  -39.124 7.638   1.00 38.40  ? 159  VAL C O   1 
ATOM   5617  C CB  . VAL B 1 120 ? -40.804  -39.430 10.014  1.00 41.02  ? 159  VAL C CB  1 
ATOM   5618  C CG1 . VAL B 1 120 ? -42.122  -38.732 10.331  1.00 45.85  ? 159  VAL C CG1 1 
ATOM   5619  C CG2 . VAL B 1 120 ? -40.984  -40.453 8.916   1.00 48.82  ? 159  VAL C CG2 1 
ATOM   5620  N N   . ASP B 1 121 ? -37.641  -39.663 9.611   1.00 31.58  ? 160  ASP C N   1 
ATOM   5621  C CA  . ASP B 1 121 ? -36.483  -40.254 8.958   1.00 33.51  ? 160  ASP C CA  1 
ATOM   5622  C C   . ASP B 1 121 ? -36.467  -41.774 9.074   1.00 37.00  ? 160  ASP C C   1 
ATOM   5623  O O   . ASP B 1 121 ? -35.571  -42.422 8.567   1.00 38.24  ? 160  ASP C O   1 
ATOM   5624  C CB  . ASP B 1 121 ? -35.171  -39.625 9.454   1.00 34.65  ? 160  ASP C CB  1 
ATOM   5625  C CG  . ASP B 1 121 ? -34.948  -39.814 10.941  1.00 32.00  ? 160  ASP C CG  1 
ATOM   5626  O OD1 . ASP B 1 121 ? -34.014  -39.179 11.472  1.00 30.71  ? 160  ASP C OD1 1 
ATOM   5627  O OD2 . ASP B 1 121 ? -35.687  -40.602 11.578  1.00 36.04  ? 160  ASP C OD2 1 
ATOM   5628  N N   . GLY B 1 122 ? -37.480  -42.332 9.726   1.00 33.39  ? 161  GLY C N   1 
ATOM   5629  C CA  . GLY B 1 122 ? -37.576  -43.769 9.888   1.00 38.58  ? 161  GLY C CA  1 
ATOM   5630  C C   . GLY B 1 122 ? -36.569  -44.293 10.886  1.00 37.95  ? 161  GLY C C   1 
ATOM   5631  O O   . GLY B 1 122 ? -36.400  -45.502 11.037  1.00 40.96  ? 161  GLY C O   1 
ATOM   5632  N N   . VAL B 1 123 ? -35.903  -43.370 11.571  1.00 33.85  ? 162  VAL C N   1 
ATOM   5633  C CA  . VAL B 1 123 ? -34.890  -43.708 12.557  1.00 33.73  ? 162  VAL C CA  1 
ATOM   5634  C C   . VAL B 1 123 ? -35.242  -43.105 13.917  1.00 39.25  ? 162  VAL C C   1 
ATOM   5635  O O   . VAL B 1 123 ? -35.304  -43.810 14.924  1.00 34.87  ? 162  VAL C O   1 
ATOM   5636  C CB  . VAL B 1 123 ? -33.499  -43.204 12.100  1.00 37.49  ? 162  VAL C CB  1 
ATOM   5637  C CG1 . VAL B 1 123 ? -32.487  -43.220 13.255  1.00 33.05  ? 162  VAL C CG1 1 
ATOM   5638  C CG2 . VAL B 1 123 ? -33.008  -44.038 10.925  1.00 40.36  ? 162  VAL C CG2 1 
ATOM   5639  N N   . ASN B 1 124 ? -35.476  -41.794 13.937  1.00 33.55  ? 163  ASN C N   1 
ATOM   5640  C CA  . ASN B 1 124 ? -35.842  -41.104 15.167  1.00 32.18  ? 163  ASN C CA  1 
ATOM   5641  C C   . ASN B 1 124 ? -37.364  -40.996 15.312  1.00 28.23  ? 163  ASN C C   1 
ATOM   5642  O O   . ASN B 1 124 ? -38.025  -40.404 14.472  1.00 33.33  ? 163  ASN C O   1 
ATOM   5643  C CB  . ASN B 1 124 ? -35.166  -39.729 15.215  1.00 30.26  ? 163  ASN C CB  1 
ATOM   5644  C CG  . ASN B 1 124 ? -33.630  -39.830 15.224  1.00 39.77  ? 163  ASN C CG  1 
ATOM   5645  O OD1 . ASN B 1 124 ? -33.022  -39.973 16.277  1.00 39.63  ? 163  ASN C OD1 1 
ATOM   5646  N ND2 . ASN B 1 124 ? -33.014  -39.750 14.049  1.00 29.06  ? 163  ASN C ND2 1 
ATOM   5647  N N   . GLU B 1 125 ? -37.900  -41.589 16.374  1.00 30.71  ? 164  GLU C N   1 
ATOM   5648  C CA  . GLU B 1 125 ? -39.338  -41.636 16.647  1.00 34.15  ? 164  GLU C CA  1 
ATOM   5649  C C   . GLU B 1 125 ? -39.974  -40.255 16.862  1.00 35.32  ? 164  GLU C C   1 
ATOM   5650  O O   . GLU B 1 125 ? -39.485  -39.454 17.655  1.00 30.04  ? 164  GLU C O   1 
ATOM   5651  C CB  . GLU B 1 125 ? -39.604  -42.496 17.885  1.00 31.68  ? 164  GLU C CB  1 
ATOM   5652  C CG  . GLU B 1 125 ? -39.306  -43.974 17.717  1.00 41.83  ? 164  GLU C CG  1 
ATOM   5653  C CD  . GLU B 1 125 ? -40.255  -44.667 16.752  1.00 49.63  ? 164  GLU C CD  1 
ATOM   5654  O OE1 . GLU B 1 125 ? -41.455  -44.326 16.733  1.00 49.66  ? 164  GLU C OE1 1 
ATOM   5655  O OE2 . GLU B 1 125 ? -39.793  -45.551 16.000  1.00 62.55  ? 164  GLU C OE2 1 
ATOM   5656  N N   . PRO B 1 126 ? -41.077  -39.975 16.157  1.00 33.81  ? 165  PRO C N   1 
ATOM   5657  C CA  . PRO B 1 126 ? -41.675  -38.643 16.351  1.00 28.12  ? 165  PRO C CA  1 
ATOM   5658  C C   . PRO B 1 126 ? -42.511  -38.511 17.632  1.00 34.24  ? 165  PRO C C   1 
ATOM   5659  O O   . PRO B 1 126 ? -42.713  -37.382 18.088  1.00 27.03  ? 165  PRO C O   1 
ATOM   5660  C CB  . PRO B 1 126 ? -42.541  -38.449 15.101  1.00 26.73  ? 165  PRO C CB  1 
ATOM   5661  C CG  . PRO B 1 126 ? -42.752  -39.860 14.533  1.00 28.55  ? 165  PRO C CG  1 
ATOM   5662  C CD  . PRO B 1 126 ? -41.527  -40.635 14.918  1.00 30.11  ? 165  PRO C CD  1 
ATOM   5663  N N   . ASP B 1 127 ? -42.959  -39.615 18.231  1.00 29.24  ? 166  ASP C N   1 
ATOM   5664  C CA  . ASP B 1 127 ? -43.852  -39.469 19.389  1.00 27.90  ? 166  ASP C CA  1 
ATOM   5665  C C   . ASP B 1 127 ? -43.281  -38.629 20.533  1.00 32.06  ? 166  ASP C C   1 
ATOM   5666  O O   . ASP B 1 127 ? -43.937  -37.693 20.994  1.00 34.78  ? 166  ASP C O   1 
ATOM   5667  C CB  . ASP B 1 127 ? -44.450  -40.794 19.904  1.00 24.43  ? 166  ASP C CB  1 
ATOM   5668  C CG  . ASP B 1 127 ? -43.398  -41.867 20.192  1.00 39.35  ? 166  ASP C CG  1 
ATOM   5669  O OD1 . ASP B 1 127 ? -42.172  -41.576 20.160  1.00 27.68  ? 166  ASP C OD1 1 
ATOM   5670  O OD2 . ASP B 1 127 ? -43.821  -43.017 20.455  1.00 33.50  ? 166  ASP C OD2 1 
ATOM   5671  N N   . VAL B 1 128 ? -42.077  -38.939 20.993  1.00 29.94  ? 167  VAL C N   1 
ATOM   5672  C CA  . VAL B 1 128 ? -41.539  -38.179 22.110  1.00 24.92  ? 167  VAL C CA  1 
ATOM   5673  C C   . VAL B 1 128 ? -41.185  -36.758 21.714  1.00 25.27  ? 167  VAL C C   1 
ATOM   5674  O O   . VAL B 1 128 ? -41.269  -35.860 22.535  1.00 27.77  ? 167  VAL C O   1 
ATOM   5675  C CB  . VAL B 1 128 ? -40.389  -38.898 22.884  1.00 38.75  ? 167  VAL C CB  1 
ATOM   5676  C CG1 . VAL B 1 128 ? -40.189  -40.298 22.378  1.00 40.09  ? 167  VAL C CG1 1 
ATOM   5677  C CG2 . VAL B 1 128 ? -39.092  -38.075 22.869  1.00 30.11  ? 167  VAL C CG2 1 
ATOM   5678  N N   . LEU B 1 129 ? -40.829  -36.536 20.457  1.00 26.88  ? 168  LEU C N   1 
ATOM   5679  C CA  . LEU B 1 129 ? -40.663  -35.160 19.990  1.00 25.71  ? 168  LEU C CA  1 
ATOM   5680  C C   . LEU B 1 129 ? -41.973  -34.386 20.187  1.00 30.44  ? 168  LEU C C   1 
ATOM   5681  O O   . LEU B 1 129 ? -41.969  -33.225 20.611  1.00 27.91  ? 168  LEU C O   1 
ATOM   5682  C CB  . LEU B 1 129 ? -40.244  -35.124 18.517  1.00 25.42  ? 168  LEU C CB  1 
ATOM   5683  C CG  . LEU B 1 129 ? -38.757  -35.289 18.179  1.00 42.27  ? 168  LEU C CG  1 
ATOM   5684  C CD1 . LEU B 1 129 ? -37.991  -36.060 19.250  1.00 32.42  ? 168  LEU C CD1 1 
ATOM   5685  C CD2 . LEU B 1 129 ? -38.577  -35.904 16.799  1.00 25.71  ? 168  LEU C CD2 1 
ATOM   5686  N N   . ALA B 1 130 ? -43.090  -35.035 19.875  1.00 29.52  ? 169  ALA C N   1 
ATOM   5687  C CA  . ALA B 1 130 ? -44.396  -34.388 19.971  1.00 25.15  ? 169  ALA C CA  1 
ATOM   5688  C C   . ALA B 1 130 ? -44.717  -33.983 21.401  1.00 25.62  ? 169  ALA C C   1 
ATOM   5689  O O   . ALA B 1 130 ? -45.217  -32.885 21.654  1.00 26.80  ? 169  ALA C O   1 
ATOM   5690  C CB  . ALA B 1 130 ? -45.490  -35.298 19.417  1.00 32.92  ? 169  ALA C CB  1 
ATOM   5691  N N   . ILE B 1 131 ? -44.449  -34.878 22.342  1.00 28.98  ? 170  ILE C N   1 
ATOM   5692  C CA  . ILE B 1 131 ? -44.683  -34.549 23.743  1.00 28.71  ? 170  ILE C CA  1 
ATOM   5693  C C   . ILE B 1 131 ? -43.929  -33.289 24.121  1.00 30.36  ? 170  ILE C C   1 
ATOM   5694  O O   . ILE B 1 131 ? -44.501  -32.364 24.703  1.00 29.03  ? 170  ILE C O   1 
ATOM   5695  C CB  . ILE B 1 131 ? -44.247  -35.674 24.663  1.00 27.83  ? 170  ILE C CB  1 
ATOM   5696  C CG1 . ILE B 1 131 ? -44.956  -36.975 24.263  1.00 24.71  ? 170  ILE C CG1 1 
ATOM   5697  C CG2 . ILE B 1 131 ? -44.532  -35.307 26.125  1.00 22.97  ? 170  ILE C CG2 1 
ATOM   5698  C CD1 . ILE B 1 131 ? -44.604  -38.162 25.164  1.00 29.20  ? 170  ILE C CD1 1 
ATOM   5699  N N   . ASN B 1 132 ? -42.637  -33.260 23.796  1.00 24.86  ? 171  ASN C N   1 
ATOM   5700  C CA  . ASN B 1 132 ? -41.834  -32.082 24.052  1.00 28.87  ? 171  ASN C CA  1 
ATOM   5701  C C   . ASN B 1 132 ? -42.397  -30.862 23.315  1.00 28.88  ? 171  ASN C C   1 
ATOM   5702  O O   . ASN B 1 132 ? -42.429  -29.762 23.861  1.00 26.19  ? 171  ASN C O   1 
ATOM   5703  C CB  . ASN B 1 132 ? -40.363  -32.342 23.699  1.00 25.96  ? 171  ASN C CB  1 
ATOM   5704  C CG  . ASN B 1 132 ? -39.689  -33.301 24.687  1.00 28.68  ? 171  ASN C CG  1 
ATOM   5705  O OD1 . ASN B 1 132 ? -39.533  -32.976 25.860  1.00 23.12  ? 171  ASN C OD1 1 
ATOM   5706  N ND2 . ASN B 1 132 ? -39.296  -34.485 24.215  1.00 25.06  ? 171  ASN C ND2 1 
ATOM   5707  N N   . GLY B 1 133 ? -42.869  -31.067 22.086  1.00 25.62  ? 172  GLY C N   1 
ATOM   5708  C CA  . GLY B 1 133 ? -43.417  -29.980 21.295  1.00 27.75  ? 172  GLY C CA  1 
ATOM   5709  C C   . GLY B 1 133 ? -44.613  -29.356 21.997  1.00 26.56  ? 172  GLY C C   1 
ATOM   5710  O O   . GLY B 1 133 ? -44.760  -28.129 22.036  1.00 27.59  ? 172  GLY C O   1 
ATOM   5711  N N   . ALA B 1 134 ? -45.463  -30.198 22.576  1.00 19.63  ? 173  ALA C N   1 
ATOM   5712  C CA  . ALA B 1 134 ? -46.634  -29.696 23.294  1.00 26.96  ? 173  ALA C CA  1 
ATOM   5713  C C   . ALA B 1 134 ? -46.188  -28.836 24.473  1.00 24.88  ? 173  ALA C C   1 
ATOM   5714  O O   . ALA B 1 134 ? -46.704  -27.743 24.702  1.00 24.73  ? 173  ALA C O   1 
ATOM   5715  C CB  . ALA B 1 134 ? -47.527  -30.849 23.762  1.00 22.47  ? 173  ALA C CB  1 
ATOM   5716  N N   . SER B 1 135 ? -45.213  -29.341 25.213  1.00 26.08  ? 174  SER C N   1 
ATOM   5717  C CA  . SER B 1 135 ? -44.677  -28.611 26.349  1.00 30.07  ? 174  SER C CA  1 
ATOM   5718  C C   . SER B 1 135 ? -44.130  -27.237 25.957  1.00 23.53  ? 174  SER C C   1 
ATOM   5719  O O   . SER B 1 135 ? -44.422  -26.244 26.625  1.00 25.20  ? 174  SER C O   1 
ATOM   5720  C CB  . SER B 1 135 ? -43.592  -29.427 27.054  1.00 28.07  ? 174  SER C CB  1 
ATOM   5721  O OG  . SER B 1 135 ? -42.929  -28.628 28.012  1.00 25.08  ? 174  SER C OG  1 
ATOM   5722  N N   . VAL B 1 136 ? -43.342  -27.164 24.884  1.00 27.02  ? 175  VAL C N   1 
ATOM   5723  C CA  . VAL B 1 136 ? -42.768  -25.866 24.513  1.00 30.45  ? 175  VAL C CA  1 
ATOM   5724  C C   . VAL B 1 136 ? -43.800  -24.910 23.902  1.00 26.84  ? 175  VAL C C   1 
ATOM   5725  O O   . VAL B 1 136 ? -43.773  -23.726 24.201  1.00 22.21  ? 175  VAL C O   1 
ATOM   5726  C CB  . VAL B 1 136 ? -41.401  -25.926 23.719  1.00 38.15  ? 175  VAL C CB  1 
ATOM   5727  C CG1 . VAL B 1 136 ? -41.075  -27.301 23.243  1.00 34.79  ? 175  VAL C CG1 1 
ATOM   5728  C CG2 . VAL B 1 136 ? -41.339  -24.895 22.583  1.00 26.04  ? 175  VAL C CG2 1 
ATOM   5729  N N   . ALA B 1 137 ? -44.722  -25.431 23.091  1.00 21.45  ? 176  ALA C N   1 
ATOM   5730  C CA  . ALA B 1 137 ? -45.808  -24.609 22.540  1.00 26.45  ? 176  ALA C CA  1 
ATOM   5731  C C   . ALA B 1 137 ? -46.586  -23.944 23.680  1.00 24.97  ? 176  ALA C C   1 
ATOM   5732  O O   . ALA B 1 137 ? -46.839  -22.746 23.651  1.00 27.79  ? 176  ALA C O   1 
ATOM   5733  C CB  . ALA B 1 137 ? -46.753  -25.450 21.652  1.00 19.34  ? 176  ALA C CB  1 
ATOM   5734  N N   . LEU B 1 138 ? -46.940  -24.729 24.693  1.00 28.94  ? 177  LEU C N   1 
ATOM   5735  C CA  . LEU B 1 138 ? -47.667  -24.202 25.845  1.00 26.03  ? 177  LEU C CA  1 
ATOM   5736  C C   . LEU B 1 138 ? -46.784  -23.223 26.627  1.00 30.59  ? 177  LEU C C   1 
ATOM   5737  O O   . LEU B 1 138 ? -47.241  -22.143 27.024  1.00 25.97  ? 177  LEU C O   1 
ATOM   5738  C CB  . LEU B 1 138 ? -48.159  -25.342 26.756  1.00 24.59  ? 177  LEU C CB  1 
ATOM   5739  C CG  . LEU B 1 138 ? -49.442  -26.074 26.341  1.00 29.19  ? 177  LEU C CG  1 
ATOM   5740  C CD1 . LEU B 1 138 ? -49.660  -27.350 27.164  1.00 23.66  ? 177  LEU C CD1 1 
ATOM   5741  C CD2 . LEU B 1 138 ? -50.701  -25.166 26.406  1.00 23.88  ? 177  LEU C CD2 1 
ATOM   5742  N N   . SER B 1 139 ? -45.518  -23.592 26.816  1.00 25.48  ? 178  SER C N   1 
ATOM   5743  C CA  . SER B 1 139 ? -44.564  -22.755 27.558  1.00 24.73  ? 178  SER C CA  1 
ATOM   5744  C C   . SER B 1 139 ? -44.349  -21.388 26.918  1.00 24.77  ? 178  SER C C   1 
ATOM   5745  O O   . SER B 1 139 ? -44.200  -20.396 27.611  1.00 25.61  ? 178  SER C O   1 
ATOM   5746  C CB  . SER B 1 139 ? -43.210  -23.462 27.722  1.00 24.86  ? 178  SER C CB  1 
ATOM   5747  O OG  . SER B 1 139 ? -43.336  -24.642 28.503  1.00 24.23  ? 178  SER C OG  1 
ATOM   5748  N N   . LEU B 1 140 ? -44.325  -21.341 25.593  1.00 26.50  ? 179  LEU C N   1 
ATOM   5749  C CA  . LEU B 1 140 ? -44.098  -20.097 24.878  1.00 24.80  ? 179  LEU C CA  1 
ATOM   5750  C C   . LEU B 1 140 ? -45.402  -19.316 24.651  1.00 31.83  ? 179  LEU C C   1 
ATOM   5751  O O   . LEU B 1 140 ? -45.379  -18.146 24.271  1.00 31.51  ? 179  LEU C O   1 
ATOM   5752  C CB  . LEU B 1 140 ? -43.415  -20.388 23.539  1.00 28.75  ? 179  LEU C CB  1 
ATOM   5753  C CG  . LEU B 1 140 ? -42.038  -21.060 23.584  1.00 31.07  ? 179  LEU C CG  1 
ATOM   5754  C CD1 . LEU B 1 140 ? -41.501  -21.274 22.182  1.00 25.52  ? 179  LEU C CD1 1 
ATOM   5755  C CD2 . LEU B 1 140 ? -41.055  -20.228 24.415  1.00 26.48  ? 179  LEU C CD2 1 
ATOM   5756  N N   . SER B 1 141 ? -46.537  -19.970 24.875  1.00 26.96  ? 180  SER C N   1 
ATOM   5757  C CA  . SER B 1 141 ? -47.834  -19.357 24.621  1.00 24.22  ? 180  SER C CA  1 
ATOM   5758  C C   . SER B 1 141 ? -48.232  -18.476 25.787  1.00 27.80  ? 180  SER C C   1 
ATOM   5759  O O   . SER B 1 141 ? -47.590  -18.504 26.829  1.00 27.22  ? 180  SER C O   1 
ATOM   5760  C CB  . SER B 1 141 ? -48.898  -20.443 24.497  1.00 27.80  ? 180  SER C CB  1 
ATOM   5761  O OG  . SER B 1 141 ? -49.243  -20.906 25.788  1.00 24.73  ? 180  SER C OG  1 
ATOM   5762  N N   . ASP B 1 142 ? -49.322  -17.730 25.619  1.00 28.91  ? 181  ASP C N   1 
ATOM   5763  C CA  . ASP B 1 142 ? -49.907  -16.957 26.710  1.00 29.36  ? 181  ASP C CA  1 
ATOM   5764  C C   . ASP B 1 142 ? -50.900  -17.783 27.533  1.00 29.82  ? 181  ASP C C   1 
ATOM   5765  O O   . ASP B 1 142 ? -51.641  -17.229 28.349  1.00 30.33  ? 181  ASP C O   1 
ATOM   5766  C CB  . ASP B 1 142 ? -50.577  -15.684 26.174  1.00 29.52  ? 181  ASP C CB  1 
ATOM   5767  C CG  . ASP B 1 142 ? -51.901  -15.958 25.458  1.00 29.99  ? 181  ASP C CG  1 
ATOM   5768  O OD1 . ASP B 1 142 ? -52.558  -14.974 25.089  1.00 32.36  ? 181  ASP C OD1 1 
ATOM   5769  O OD2 . ASP B 1 142 ? -52.291  -17.135 25.264  1.00 31.37  ? 181  ASP C OD2 1 
ATOM   5770  N N   . ILE B 1 143 ? -50.903  -19.102 27.328  1.00 29.40  ? 182  ILE C N   1 
ATOM   5771  C CA  . ILE B 1 143 ? -51.811  -20.000 28.050  1.00 24.88  ? 182  ILE C CA  1 
ATOM   5772  C C   . ILE B 1 143 ? -51.265  -20.364 29.435  1.00 30.84  ? 182  ILE C C   1 
ATOM   5773  O O   . ILE B 1 143 ? -50.152  -20.868 29.554  1.00 28.54  ? 182  ILE C O   1 
ATOM   5774  C CB  . ILE B 1 143 ? -52.089  -21.309 27.247  1.00 24.93  ? 182  ILE C CB  1 
ATOM   5775  C CG1 . ILE B 1 143 ? -52.636  -20.996 25.851  1.00 26.06  ? 182  ILE C CG1 1 
ATOM   5776  C CG2 . ILE B 1 143 ? -53.076  -22.206 27.978  1.00 24.21  ? 182  ILE C CG2 1 
ATOM   5777  C CD1 . ILE B 1 143 ? -52.453  -22.149 24.861  1.00 27.37  ? 182  ILE C CD1 1 
ATOM   5778  N N   . PRO B 1 144 ? -52.054  -20.114 30.492  1.00 28.60  ? 183  PRO C N   1 
ATOM   5779  C CA  . PRO B 1 144 ? -51.628  -20.461 31.853  1.00 28.36  ? 183  PRO C CA  1 
ATOM   5780  C C   . PRO B 1 144 ? -51.335  -21.954 31.929  1.00 29.71  ? 183  PRO C C   1 
ATOM   5781  O O   . PRO B 1 144 ? -52.209  -22.753 31.614  1.00 27.07  ? 183  PRO C O   1 
ATOM   5782  C CB  . PRO B 1 144 ? -52.859  -20.132 32.703  1.00 32.55  ? 183  PRO C CB  1 
ATOM   5783  C CG  . PRO B 1 144 ? -53.665  -19.192 31.875  1.00 35.75  ? 183  PRO C CG  1 
ATOM   5784  C CD  . PRO B 1 144 ? -53.424  -19.578 30.456  1.00 30.05  ? 183  PRO C CD  1 
ATOM   5785  N N   . TRP B 1 145 ? -50.121  -22.318 32.322  1.00 28.31  ? 184  TRP C N   1 
ATOM   5786  C CA  . TRP B 1 145 ? -49.690  -23.713 32.312  1.00 27.43  ? 184  TRP C CA  1 
ATOM   5787  C C   . TRP B 1 145 ? -48.383  -23.795 33.098  1.00 28.82  ? 184  TRP C C   1 
ATOM   5788  O O   . TRP B 1 145 ? -47.409  -23.116 32.774  1.00 30.55  ? 184  TRP C O   1 
ATOM   5789  C CB  . TRP B 1 145 ? -49.490  -24.193 30.876  1.00 24.56  ? 184  TRP C CB  1 
ATOM   5790  C CG  . TRP B 1 145 ? -49.232  -25.674 30.746  1.00 28.76  ? 184  TRP C CG  1 
ATOM   5791  C CD1 . TRP B 1 145 ? -50.141  -26.673 30.922  1.00 26.67  ? 184  TRP C CD1 1 
ATOM   5792  C CD2 . TRP B 1 145 ? -47.997  -26.315 30.383  1.00 22.18  ? 184  TRP C CD2 1 
ATOM   5793  N NE1 . TRP B 1 145 ? -49.556  -27.892 30.703  1.00 29.94  ? 184  TRP C NE1 1 
ATOM   5794  C CE2 . TRP B 1 145 ? -48.238  -27.704 30.382  1.00 30.23  ? 184  TRP C CE2 1 
ATOM   5795  C CE3 . TRP B 1 145 ? -46.712  -25.852 30.077  1.00 25.21  ? 184  TRP C CE3 1 
ATOM   5796  C CZ2 . TRP B 1 145 ? -47.245  -28.637 30.076  1.00 25.97  ? 184  TRP C CZ2 1 
ATOM   5797  C CZ3 . TRP B 1 145 ? -45.718  -26.786 29.770  1.00 28.33  ? 184  TRP C CZ3 1 
ATOM   5798  C CH2 . TRP B 1 145 ? -45.996  -28.160 29.773  1.00 27.62  ? 184  TRP C CH2 1 
ATOM   5799  N N   . ASN B 1 146 ? -48.380  -24.601 34.151  1.00 32.20  ? 185  ASN C N   1 
ATOM   5800  C CA  . ASN B 1 146 ? -47.278  -24.594 35.103  1.00 33.92  ? 185  ASN C CA  1 
ATOM   5801  C C   . ASN B 1 146 ? -46.191  -25.625 34.766  1.00 29.70  ? 185  ASN C C   1 
ATOM   5802  O O   . ASN B 1 146 ? -45.996  -26.594 35.492  1.00 28.28  ? 185  ASN C O   1 
ATOM   5803  C CB  . ASN B 1 146 ? -47.815  -24.806 36.526  1.00 37.64  ? 185  ASN C CB  1 
ATOM   5804  C CG  . ASN B 1 146 ? -48.892  -23.776 36.914  1.00 48.51  ? 185  ASN C CG  1 
ATOM   5805  O OD1 . ASN B 1 146 ? -48.805  -22.593 36.560  1.00 53.12  ? 185  ASN C OD1 1 
ATOM   5806  N ND2 . ASN B 1 146 ? -49.911  -24.231 37.648  1.00 56.10  ? 185  ASN C ND2 1 
ATOM   5807  N N   . GLY B 1 147 ? -45.491  -25.410 33.657  1.00 28.49  ? 186  GLY C N   1 
ATOM   5808  C CA  . GLY B 1 147 ? -44.407  -26.300 33.254  1.00 31.77  ? 186  GLY C CA  1 
ATOM   5809  C C   . GLY B 1 147 ? -43.072  -25.608 33.465  1.00 30.53  ? 186  GLY C C   1 
ATOM   5810  O O   . GLY B 1 147 ? -42.935  -24.835 34.407  1.00 28.92  ? 186  GLY C O   1 
ATOM   5811  N N   . PRO B 1 148 ? -42.093  -25.852 32.578  1.00 27.35  ? 187  PRO C N   1 
ATOM   5812  C CA  . PRO B 1 148 ? -42.184  -26.740 31.413  1.00 26.69  ? 187  PRO C CA  1 
ATOM   5813  C C   . PRO B 1 148 ? -42.158  -28.222 31.792  1.00 30.32  ? 187  PRO C C   1 
ATOM   5814  O O   . PRO B 1 148 ? -41.783  -28.600 32.908  1.00 26.74  ? 187  PRO C O   1 
ATOM   5815  C CB  . PRO B 1 148 ? -40.906  -26.419 30.621  1.00 26.54  ? 187  PRO C CB  1 
ATOM   5816  C CG  . PRO B 1 148 ? -40.389  -25.112 31.182  1.00 34.78  ? 187  PRO C CG  1 
ATOM   5817  C CD  . PRO B 1 148 ? -40.814  -25.122 32.618  1.00 31.88  ? 187  PRO C CD  1 
ATOM   5818  N N   . VAL B 1 149 ? -42.546  -29.059 30.841  1.00 23.36  ? 188  VAL C N   1 
ATOM   5819  C CA  . VAL B 1 149 ? -42.346  -30.495 30.974  1.00 24.03  ? 188  VAL C CA  1 
ATOM   5820  C C   . VAL B 1 149 ? -41.255  -30.897 29.993  1.00 26.93  ? 188  VAL C C   1 
ATOM   5821  O O   . VAL B 1 149 ? -41.074  -30.251 28.957  1.00 23.17  ? 188  VAL C O   1 
ATOM   5822  C CB  . VAL B 1 149 ? -43.644  -31.281 30.640  1.00 28.98  ? 188  VAL C CB  1 
ATOM   5823  C CG1 . VAL B 1 149 ? -43.344  -32.760 30.367  1.00 33.58  ? 188  VAL C CG1 1 
ATOM   5824  C CG2 . VAL B 1 149 ? -44.654  -31.139 31.758  1.00 27.59  ? 188  VAL C CG2 1 
ATOM   5825  N N   . GLY B 1 150 ? -40.516  -31.953 30.323  1.00 28.92  ? 189  GLY C N   1 
ATOM   5826  C CA  . GLY B 1 150 ? -39.604  -32.570 29.376  1.00 26.67  ? 189  GLY C CA  1 
ATOM   5827  C C   . GLY B 1 150 ? -39.895  -34.060 29.288  1.00 28.98  ? 189  GLY C C   1 
ATOM   5828  O O   . GLY B 1 150 ? -40.313  -34.681 30.277  1.00 22.90  ? 189  GLY C O   1 
ATOM   5829  N N   . ALA B 1 151 ? -39.682  -34.652 28.116  1.00 29.23  ? 190  ALA C N   1 
ATOM   5830  C CA  . ALA B 1 151 ? -39.973  -36.081 27.971  1.00 26.32  ? 190  ALA C CA  1 
ATOM   5831  C C   . ALA B 1 151 ? -38.907  -36.836 27.199  1.00 26.00  ? 190  ALA C C   1 
ATOM   5832  O O   . ALA B 1 151 ? -38.343  -36.319 26.238  1.00 25.86  ? 190  ALA C O   1 
ATOM   5833  C CB  . ALA B 1 151 ? -41.355  -36.293 27.323  1.00 23.79  ? 190  ALA C CB  1 
ATOM   5834  N N   . VAL B 1 152 ? -38.644  -38.068 27.630  1.00 30.16  ? 191  VAL C N   1 
ATOM   5835  C CA  . VAL B 1 152 ? -37.761  -38.967 26.902  1.00 29.57  ? 191  VAL C CA  1 
ATOM   5836  C C   . VAL B 1 152 ? -38.289  -40.393 26.941  1.00 27.85  ? 191  VAL C C   1 
ATOM   5837  O O   . VAL B 1 152 ? -39.092  -40.760 27.807  1.00 31.63  ? 191  VAL C O   1 
ATOM   5838  C CB  . VAL B 1 152 ? -36.334  -39.001 27.505  1.00 32.05  ? 191  VAL C CB  1 
ATOM   5839  C CG1 . VAL B 1 152 ? -35.658  -37.654 27.386  1.00 25.57  ? 191  VAL C CG1 1 
ATOM   5840  C CG2 . VAL B 1 152 ? -36.389  -39.461 28.957  1.00 24.95  ? 191  VAL C CG2 1 
ATOM   5841  N N   . ARG B 1 153 ? -37.817  -41.202 26.004  1.00 29.46  ? 192  ARG C N   1 
ATOM   5842  C CA  . ARG B 1 153 ? -38.001  -42.639 26.102  1.00 28.42  ? 192  ARG C CA  1 
ATOM   5843  C C   . ARG B 1 153 ? -36.717  -43.244 26.656  1.00 37.80  ? 192  ARG C C   1 
ATOM   5844  O O   . ARG B 1 153 ? -35.617  -42.763 26.369  1.00 35.39  ? 192  ARG C O   1 
ATOM   5845  C CB  . ARG B 1 153 ? -38.317  -43.236 24.731  1.00 25.85  ? 192  ARG C CB  1 
ATOM   5846  C CG  . ARG B 1 153 ? -38.387  -44.772 24.709  1.00 32.17  ? 192  ARG C CG  1 
ATOM   5847  C CD  . ARG B 1 153 ? -38.924  -45.299 23.365  1.00 26.07  ? 192  ARG C CD  1 
ATOM   5848  N NE  . ARG B 1 153 ? -40.375  -45.152 23.265  1.00 35.20  ? 192  ARG C NE  1 
ATOM   5849  C CZ  . ARG B 1 153 ? -41.002  -44.307 22.453  1.00 39.23  ? 192  ARG C CZ  1 
ATOM   5850  N NH1 . ARG B 1 153 ? -40.316  -43.503 21.647  1.00 31.81  ? 192  ARG C NH1 1 
ATOM   5851  N NH2 . ARG B 1 153 ? -42.324  -44.268 22.448  1.00 39.78  ? 192  ARG C NH2 1 
ATOM   5852  N N   . ILE B 1 154 ? -36.852  -44.285 27.464  1.00 33.05  ? 193  ILE C N   1 
ATOM   5853  C CA  . ILE B 1 154 ? -35.692  -45.057 27.882  1.00 34.82  ? 193  ILE C CA  1 
ATOM   5854  C C   . ILE B 1 154 ? -35.872  -46.498 27.425  1.00 37.99  ? 193  ILE C C   1 
ATOM   5855  O O   . ILE B 1 154 ? -36.946  -47.086 27.590  1.00 29.17  ? 193  ILE C O   1 
ATOM   5856  C CB  . ILE B 1 154 ? -35.486  -45.056 29.418  1.00 35.33  ? 193  ILE C CB  1 
ATOM   5857  C CG1 . ILE B 1 154 ? -35.244  -43.642 29.954  1.00 29.09  ? 193  ILE C CG1 1 
ATOM   5858  C CG2 . ILE B 1 154 ? -34.323  -45.959 29.787  1.00 33.85  ? 193  ILE C CG2 1 
ATOM   5859  C CD1 . ILE B 1 154 ? -34.103  -42.909 29.300  1.00 35.60  ? 193  ILE C CD1 1 
ATOM   5860  N N   . GLY B 1 155 ? -34.825  -47.051 26.823  1.00 34.16  ? 194  GLY C N   1 
ATOM   5861  C CA  . GLY B 1 155 ? -34.819  -48.452 26.460  1.00 36.24  ? 194  GLY C CA  1 
ATOM   5862  C C   . GLY B 1 155 ? -33.644  -49.139 27.124  1.00 38.10  ? 194  GLY C C   1 
ATOM   5863  O O   . GLY B 1 155 ? -32.728  -48.483 27.625  1.00 35.18  ? 194  GLY C O   1 
ATOM   5864  N N   . ILE B 1 156 ? -33.674  -50.465 27.144  1.00 44.48  ? 195  ILE C N   1 
ATOM   5865  C CA  . ILE B 1 156 ? -32.536  -51.236 27.630  1.00 40.34  ? 195  ILE C CA  1 
ATOM   5866  C C   . ILE B 1 156 ? -32.063  -52.185 26.530  1.00 44.13  ? 195  ILE C C   1 
ATOM   5867  O O   . ILE B 1 156 ? -32.775  -53.111 26.135  1.00 35.20  ? 195  ILE C O   1 
ATOM   5868  C CB  . ILE B 1 156 ? -32.864  -52.004 28.927  1.00 36.52  ? 195  ILE C CB  1 
ATOM   5869  C CG1 . ILE B 1 156 ? -33.418  -51.051 29.984  1.00 31.75  ? 195  ILE C CG1 1 
ATOM   5870  C CG2 . ILE B 1 156 ? -31.616  -52.704 29.467  1.00 47.66  ? 195  ILE C CG2 1 
ATOM   5871  C CD1 . ILE B 1 156 ? -33.926  -51.748 31.231  1.00 34.87  ? 195  ILE C CD1 1 
ATOM   5872  N N   . ILE B 1 157 ? -30.872  -51.919 26.009  1.00 40.73  ? 196  ILE C N   1 
ATOM   5873  C CA  . ILE B 1 157 ? -30.307  -52.751 24.963  1.00 51.30  ? 196  ILE C CA  1 
ATOM   5874  C C   . ILE B 1 157 ? -29.023  -53.386 25.494  1.00 53.86  ? 196  ILE C C   1 
ATOM   5875  O O   . ILE B 1 157 ? -28.049  -52.692 25.776  1.00 46.14  ? 196  ILE C O   1 
ATOM   5876  C CB  . ILE B 1 157 ? -30.029  -51.947 23.672  1.00 45.76  ? 196  ILE C CB  1 
ATOM   5877  C CG1 . ILE B 1 157 ? -31.330  -51.372 23.095  1.00 43.33  ? 196  ILE C CG1 1 
ATOM   5878  C CG2 . ILE B 1 157 ? -29.359  -52.828 22.632  1.00 45.52  ? 196  ILE C CG2 1 
ATOM   5879  C CD1 . ILE B 1 157 ? -31.884  -50.179 23.859  1.00 44.69  ? 196  ILE C CD1 1 
ATOM   5880  N N   . ASP B 1 158 ? -29.044  -54.706 25.653  1.00 52.11  ? 197  ASP C N   1 
ATOM   5881  C CA  . ASP B 1 158 ? -27.898  -55.434 26.180  1.00 53.91  ? 197  ASP C CA  1 
ATOM   5882  C C   . ASP B 1 158 ? -27.546  -54.911 27.558  1.00 61.02  ? 197  ASP C C   1 
ATOM   5883  O O   . ASP B 1 158 ? -26.375  -54.772 27.895  1.00 57.11  ? 197  ASP C O   1 
ATOM   5884  C CB  . ASP B 1 158 ? -26.691  -55.285 25.255  1.00 54.56  ? 197  ASP C CB  1 
ATOM   5885  C CG  . ASP B 1 158 ? -26.975  -55.760 23.849  1.00 66.57  ? 197  ASP C CG  1 
ATOM   5886  O OD1 . ASP B 1 158 ? -27.645  -56.806 23.698  1.00 66.72  ? 197  ASP C OD1 1 
ATOM   5887  O OD2 . ASP B 1 158 ? -26.536  -55.080 22.894  1.00 75.15  ? 197  ASP C OD2 1 
ATOM   5888  N N   . GLY B 1 159 ? -28.568  -54.597 28.345  1.00 60.35  ? 198  GLY C N   1 
ATOM   5889  C CA  . GLY B 1 159 ? -28.363  -54.135 29.703  1.00 55.84  ? 198  GLY C CA  1 
ATOM   5890  C C   . GLY B 1 159 ? -27.875  -52.702 29.845  1.00 51.85  ? 198  GLY C C   1 
ATOM   5891  O O   . GLY B 1 159 ? -27.605  -52.257 30.958  1.00 62.89  ? 198  GLY C O   1 
ATOM   5892  N N   . GLU B 1 160 ? -27.752  -51.980 28.735  1.00 45.94  ? 199  GLU C N   1 
ATOM   5893  C CA  . GLU B 1 160 ? -27.371  -50.564 28.789  1.00 50.07  ? 199  GLU C CA  1 
ATOM   5894  C C   . GLU B 1 160 ? -28.602  -49.655 28.658  1.00 48.11  ? 199  GLU C C   1 
ATOM   5895  O O   . GLU B 1 160 ? -29.478  -49.897 27.832  1.00 41.62  ? 199  GLU C O   1 
ATOM   5896  C CB  . GLU B 1 160 ? -26.343  -50.232 27.694  1.00 53.85  ? 199  GLU C CB  1 
ATOM   5897  C CG  . GLU B 1 160 ? -26.916  -50.194 26.277  1.00 67.81  ? 199  GLU C CG  1 
ATOM   5898  C CD  . GLU B 1 160 ? -25.908  -50.588 25.194  1.00 79.91  ? 199  GLU C CD  1 
ATOM   5899  O OE1 . GLU B 1 160 ? -26.338  -50.813 24.034  1.00 60.96  ? 199  GLU C OE1 1 
ATOM   5900  O OE2 . GLU B 1 160 ? -24.695  -50.671 25.506  1.00 84.24  ? 199  GLU C OE2 1 
ATOM   5901  N N   . TYR B 1 161 ? -28.670  -48.609 29.473  1.00 46.73  ? 200  TYR C N   1 
ATOM   5902  C CA  . TYR B 1 161 ? -29.802  -47.692 29.417  1.00 43.81  ? 200  TYR C CA  1 
ATOM   5903  C C   . TYR B 1 161 ? -29.615  -46.672 28.301  1.00 46.50  ? 200  TYR C C   1 
ATOM   5904  O O   . TYR B 1 161 ? -28.677  -45.877 28.320  1.00 48.64  ? 200  TYR C O   1 
ATOM   5905  C CB  . TYR B 1 161 ? -30.033  -47.030 30.782  1.00 38.92  ? 200  TYR C CB  1 
ATOM   5906  C CG  . TYR B 1 161 ? -30.344  -48.057 31.847  1.00 39.21  ? 200  TYR C CG  1 
ATOM   5907  C CD1 . TYR B 1 161 ? -31.660  -48.408 32.145  1.00 35.35  ? 200  TYR C CD1 1 
ATOM   5908  C CD2 . TYR B 1 161 ? -29.318  -48.718 32.520  1.00 48.07  ? 200  TYR C CD2 1 
ATOM   5909  C CE1 . TYR B 1 161 ? -31.947  -49.365 33.105  1.00 42.36  ? 200  TYR C CE1 1 
ATOM   5910  C CE2 . TYR B 1 161 ? -29.595  -49.679 33.481  1.00 46.01  ? 200  TYR C CE2 1 
ATOM   5911  C CZ  . TYR B 1 161 ? -30.908  -50.003 33.764  1.00 46.04  ? 200  TYR C CZ  1 
ATOM   5912  O OH  . TYR B 1 161 ? -31.178  -50.955 34.722  1.00 41.16  ? 200  TYR C OH  1 
ATOM   5913  N N   . VAL B 1 162 ? -30.513  -46.730 27.322  1.00 35.36  ? 201  VAL C N   1 
ATOM   5914  C CA  . VAL B 1 162 ? -30.454  -45.898 26.129  1.00 34.11  ? 201  VAL C CA  1 
ATOM   5915  C C   . VAL B 1 162 ? -31.578  -44.845 26.124  1.00 38.60  ? 201  VAL C C   1 
ATOM   5916  O O   . VAL B 1 162 ? -32.764  -45.179 26.218  1.00 34.28  ? 201  VAL C O   1 
ATOM   5917  C CB  . VAL B 1 162 ? -30.543  -46.768 24.849  1.00 33.34  ? 201  VAL C CB  1 
ATOM   5918  C CG1 . VAL B 1 162 ? -30.494  -45.912 23.614  1.00 35.48  ? 201  VAL C CG1 1 
ATOM   5919  C CG2 . VAL B 1 162 ? -29.407  -47.803 24.822  1.00 45.16  ? 201  VAL C CG2 1 
ATOM   5920  N N   . VAL B 1 163 ? -31.197  -43.576 26.020  1.00 33.38  ? 202  VAL C N   1 
ATOM   5921  C CA  . VAL B 1 163 ? -32.156  -42.479 25.973  1.00 35.07  ? 202  VAL C CA  1 
ATOM   5922  C C   . VAL B 1 163 ? -32.633  -42.273 24.535  1.00 38.99  ? 202  VAL C C   1 
ATOM   5923  O O   . VAL B 1 163 ? -31.826  -42.244 23.610  1.00 37.16  ? 202  VAL C O   1 
ATOM   5924  C CB  . VAL B 1 163 ? -31.540  -41.161 26.534  1.00 37.93  ? 202  VAL C CB  1 
ATOM   5925  C CG1 . VAL B 1 163 ? -30.302  -40.779 25.763  1.00 37.57  ? 202  VAL C CG1 1 
ATOM   5926  C CG2 . VAL B 1 163 ? -32.559  -40.014 26.512  1.00 38.98  ? 202  VAL C CG2 1 
ATOM   5927  N N   . ASN B 1 164 ? -33.947  -42.139 24.354  1.00 35.05  ? 203  ASN C N   1 
ATOM   5928  C CA  . ASN B 1 164 ? -34.552  -41.983 23.027  1.00 35.04  ? 203  ASN C CA  1 
ATOM   5929  C C   . ASN B 1 164 ? -33.965  -42.913 21.971  1.00 34.53  ? 203  ASN C C   1 
ATOM   5930  O O   . ASN B 1 164 ? -33.410  -42.454 20.976  1.00 33.04  ? 203  ASN C O   1 
ATOM   5931  C CB  . ASN B 1 164 ? -34.452  -40.534 22.539  1.00 37.84  ? 203  ASN C CB  1 
ATOM   5932  C CG  . ASN B 1 164 ? -35.162  -39.557 23.456  1.00 42.07  ? 203  ASN C CG  1 
ATOM   5933  O OD1 . ASN B 1 164 ? -36.114  -39.907 24.163  1.00 30.38  ? 203  ASN C OD1 1 
ATOM   5934  N ND2 . ASN B 1 164 ? -34.696  -38.321 23.451  1.00 41.87  ? 203  ASN C ND2 1 
ATOM   5935  N N   . PRO B 1 165 ? -34.099  -44.228 22.181  1.00 37.98  ? 204  PRO C N   1 
ATOM   5936  C CA  . PRO B 1 165 ? -33.608  -45.235 21.231  1.00 37.97  ? 204  PRO C CA  1 
ATOM   5937  C C   . PRO B 1 165 ? -34.184  -45.049 19.830  1.00 41.46  ? 204  PRO C C   1 
ATOM   5938  O O   . PRO B 1 165 ? -35.375  -44.761 19.701  1.00 38.46  ? 204  PRO C O   1 
ATOM   5939  C CB  . PRO B 1 165 ? -34.138  -46.547 21.818  1.00 37.42  ? 204  PRO C CB  1 
ATOM   5940  C CG  . PRO B 1 165 ? -35.320  -46.116 22.712  1.00 33.95  ? 204  PRO C CG  1 
ATOM   5941  C CD  . PRO B 1 165 ? -34.828  -44.842 23.305  1.00 33.54  ? 204  PRO C CD  1 
ATOM   5942  N N   . THR B 1 166 ? -33.352  -45.226 18.804  1.00 36.76  ? 205  THR C N   1 
ATOM   5943  C CA  . THR B 1 166 ? -33.807  -45.241 17.418  1.00 36.37  ? 205  THR C CA  1 
ATOM   5944  C C   . THR B 1 166 ? -34.821  -46.369 17.223  1.00 39.67  ? 205  THR C C   1 
ATOM   5945  O O   . THR B 1 166 ? -35.079  -47.140 18.148  1.00 37.38  ? 205  THR C O   1 
ATOM   5946  C CB  . THR B 1 166 ? -32.631  -45.533 16.464  1.00 40.62  ? 205  THR C CB  1 
ATOM   5947  O OG1 . THR B 1 166 ? -32.173  -46.867 16.693  1.00 32.83  ? 205  THR C OG1 1 
ATOM   5948  C CG2 . THR B 1 166 ? -31.462  -44.554 16.686  1.00 35.41  ? 205  THR C CG2 1 
ATOM   5949  N N   . ARG B 1 167 ? -35.374  -46.486 16.017  1.00 39.06  ? 206  ARG C N   1 
ATOM   5950  C CA  . ARG B 1 167 ? -36.269  -47.601 15.703  1.00 42.71  ? 206  ARG C CA  1 
ATOM   5951  C C   . ARG B 1 167 ? -35.552  -48.942 15.840  1.00 45.06  ? 206  ARG C C   1 
ATOM   5952  O O   . ARG B 1 167 ? -36.081  -49.859 16.465  1.00 38.11  ? 206  ARG C O   1 
ATOM   5953  C CB  . ARG B 1 167 ? -36.838  -47.500 14.284  1.00 47.04  ? 206  ARG C CB  1 
ATOM   5954  C CG  . ARG B 1 167 ? -37.788  -46.354 14.035  1.00 53.81  ? 206  ARG C CG  1 
ATOM   5955  C CD  . ARG B 1 167 ? -38.665  -46.659 12.818  1.00 63.76  ? 206  ARG C CD  1 
ATOM   5956  N NE  . ARG B 1 167 ? -39.648  -47.705 13.097  1.00 71.43  ? 206  ARG C NE  1 
ATOM   5957  C CZ  . ARG B 1 167 ? -39.897  -48.745 12.305  1.00 72.61  ? 206  ARG C CZ  1 
ATOM   5958  N NH1 . ARG B 1 167 ? -39.232  -48.900 11.165  1.00 70.88  ? 206  ARG C NH1 1 
ATOM   5959  N NH2 . ARG B 1 167 ? -40.817  -49.633 12.658  1.00 63.29  ? 206  ARG C NH2 1 
ATOM   5960  N N   . LYS B 1 168 ? -34.359  -49.060 15.249  1.00 42.88  ? 207  LYS C N   1 
ATOM   5961  C CA  . LYS B 1 168 ? -33.594  -50.315 15.327  1.00 45.86  ? 207  LYS C CA  1 
ATOM   5962  C C   . LYS B 1 168 ? -33.317  -50.674 16.776  1.00 44.82  ? 207  LYS C C   1 
ATOM   5963  O O   . LYS B 1 168 ? -33.545  -51.807 17.203  1.00 38.82  ? 207  LYS C O   1 
ATOM   5964  C CB  . LYS B 1 168 ? -32.258  -50.238 14.581  1.00 42.35  ? 207  LYS C CB  1 
ATOM   5965  C CG  . LYS B 1 168 ? -32.321  -49.694 13.170  1.00 51.38  ? 207  LYS C CG  1 
ATOM   5966  C CD  . LYS B 1 168 ? -33.055  -50.611 12.202  1.00 67.18  ? 207  LYS C CD  1 
ATOM   5967  C CE  . LYS B 1 168 ? -32.557  -50.363 10.773  1.00 77.84  ? 207  LYS C CE  1 
ATOM   5968  N NZ  . LYS B 1 168 ? -33.486  -50.860 9.719   1.00 75.96  ? 207  LYS C NZ  1 
ATOM   5969  N N   . GLU B 1 169 ? -32.817  -49.703 17.534  1.00 42.83  ? 208  GLU C N   1 
ATOM   5970  C CA  . GLU B 1 169 ? -32.531  -49.944 18.936  1.00 39.59  ? 208  GLU C CA  1 
ATOM   5971  C C   . GLU B 1 169 ? -33.763  -50.444 19.680  1.00 38.10  ? 208  GLU C C   1 
ATOM   5972  O O   . GLU B 1 169 ? -33.670  -51.382 20.465  1.00 42.32  ? 208  GLU C O   1 
ATOM   5973  C CB  . GLU B 1 169 ? -31.959  -48.693 19.598  1.00 42.72  ? 208  GLU C CB  1 
ATOM   5974  C CG  . GLU B 1 169 ? -30.557  -48.353 19.132  1.00 42.23  ? 208  GLU C CG  1 
ATOM   5975  C CD  . GLU B 1 169 ? -30.073  -47.022 19.667  1.00 53.05  ? 208  GLU C CD  1 
ATOM   5976  O OE1 . GLU B 1 169 ? -30.920  -46.136 19.936  1.00 43.52  ? 208  GLU C OE1 1 
ATOM   5977  O OE2 . GLU B 1 169 ? -28.843  -46.861 19.827  1.00 57.32  ? 208  GLU C OE2 1 
ATOM   5978  N N   . MET B 1 170 ? -34.919  -49.832 19.420  1.00 40.56  ? 209  MET C N   1 
ATOM   5979  C CA  . MET B 1 170 ? -36.155  -50.218 20.104  1.00 40.16  ? 209  MET C CA  1 
ATOM   5980  C C   . MET B 1 170 ? -36.538  -51.675 19.835  1.00 40.30  ? 209  MET C C   1 
ATOM   5981  O O   . MET B 1 170 ? -37.128  -52.343 20.685  1.00 33.17  ? 209  MET C O   1 
ATOM   5982  C CB  . MET B 1 170 ? -37.315  -49.291 19.710  1.00 34.24  ? 209  MET C CB  1 
ATOM   5983  C CG  . MET B 1 170 ? -37.342  -47.956 20.445  1.00 38.33  ? 209  MET C CG  1 
ATOM   5984  S SD  . MET B 1 170 ? -38.649  -46.842 19.857  1.00 42.14  ? 209  MET C SD  1 
ATOM   5985  C CE  . MET B 1 170 ? -40.104  -47.852 20.111  1.00 37.87  ? 209  MET C CE  1 
ATOM   5986  N N   . SER B 1 171 ? -36.215  -52.161 18.642  1.00 39.59  ? 210  SER C N   1 
ATOM   5987  C CA  . SER B 1 171 ? -36.544  -53.536 18.288  1.00 50.11  ? 210  SER C CA  1 
ATOM   5988  C C   . SER B 1 171 ? -35.673  -54.519 19.068  1.00 47.16  ? 210  SER C C   1 
ATOM   5989  O O   . SER B 1 171 ? -35.998  -55.700 19.157  1.00 45.90  ? 210  SER C O   1 
ATOM   5990  C CB  . SER B 1 171 ? -36.406  -53.774 16.779  1.00 44.54  ? 210  SER C CB  1 
ATOM   5991  O OG  . SER B 1 171 ? -35.043  -53.782 16.377  1.00 52.42  ? 210  SER C OG  1 
ATOM   5992  N N   . SER B 1 172 ? -34.572  -54.028 19.635  1.00 45.14  ? 211  SER C N   1 
ATOM   5993  C CA  . SER B 1 172 ? -33.704  -54.862 20.466  1.00 38.10  ? 211  SER C CA  1 
ATOM   5994  C C   . SER B 1 172 ? -33.887  -54.593 21.950  1.00 43.99  ? 211  SER C C   1 
ATOM   5995  O O   . SER B 1 172 ? -33.239  -55.232 22.776  1.00 48.96  ? 211  SER C O   1 
ATOM   5996  C CB  . SER B 1 172 ? -32.229  -54.643 20.119  1.00 44.97  ? 211  SER C CB  1 
ATOM   5997  O OG  . SER B 1 172 ? -32.073  -53.872 18.942  1.00 68.88  ? 211  SER C OG  1 
ATOM   5998  N N   . SER B 1 173 ? -34.749  -53.639 22.300  1.00 37.72  ? 212  SER C N   1 
ATOM   5999  C CA  . SER B 1 173 ? -34.876  -53.229 23.698  1.00 34.48  ? 212  SER C CA  1 
ATOM   6000  C C   . SER B 1 173 ? -35.785  -54.138 24.524  1.00 34.11  ? 212  SER C C   1 
ATOM   6001  O O   . SER B 1 173 ? -36.788  -54.638 24.034  1.00 32.21  ? 212  SER C O   1 
ATOM   6002  C CB  . SER B 1 173 ? -35.372  -51.783 23.803  1.00 36.55  ? 212  SER C CB  1 
ATOM   6003  O OG  . SER B 1 173 ? -35.451  -51.405 25.163  1.00 30.66  ? 212  SER C OG  1 
ATOM   6004  N N   . THR B 1 174 ? -35.435  -54.338 25.789  1.00 34.26  ? 213  THR C N   1 
ATOM   6005  C CA  . THR B 1 174 ? -36.316  -55.051 26.707  1.00 33.91  ? 213  THR C CA  1 
ATOM   6006  C C   . THR B 1 174 ? -37.247  -54.082 27.438  1.00 36.09  ? 213  THR C C   1 
ATOM   6007  O O   . THR B 1 174 ? -38.040  -54.495 28.273  1.00 33.94  ? 213  THR C O   1 
ATOM   6008  C CB  . THR B 1 174 ? -35.532  -55.839 27.776  1.00 35.65  ? 213  THR C CB  1 
ATOM   6009  O OG1 . THR B 1 174 ? -34.734  -54.928 28.544  1.00 36.27  ? 213  THR C OG1 1 
ATOM   6010  C CG2 . THR B 1 174 ? -34.628  -56.902 27.131  1.00 38.97  ? 213  THR C CG2 1 
ATOM   6011  N N   . LEU B 1 175 ? -37.130  -52.792 27.142  1.00 34.79  ? 214  LEU C N   1 
ATOM   6012  C CA  . LEU B 1 175 ? -37.976  -51.800 27.789  1.00 35.00  ? 214  LEU C CA  1 
ATOM   6013  C C   . LEU B 1 175 ? -38.399  -50.735 26.795  1.00 34.10  ? 214  LEU C C   1 
ATOM   6014  O O   . LEU B 1 175 ? -37.602  -50.276 25.978  1.00 30.00  ? 214  LEU C O   1 
ATOM   6015  C CB  . LEU B 1 175 ? -37.236  -51.142 28.960  1.00 31.26  ? 214  LEU C CB  1 
ATOM   6016  C CG  . LEU B 1 175 ? -37.995  -50.077 29.753  1.00 31.15  ? 214  LEU C CG  1 
ATOM   6017  C CD1 . LEU B 1 175 ? -39.202  -50.688 30.427  1.00 30.65  ? 214  LEU C CD1 1 
ATOM   6018  C CD2 . LEU B 1 175 ? -37.096  -49.432 30.781  1.00 31.40  ? 214  LEU C CD2 1 
ATOM   6019  N N   . ASN B 1 176 ? -39.664  -50.353 26.859  1.00 34.51  ? 215  ASN C N   1 
ATOM   6020  C CA  . ASN B 1 176 ? -40.135  -49.171 26.158  1.00 30.02  ? 215  ASN C CA  1 
ATOM   6021  C C   . ASN B 1 176 ? -40.824  -48.283 27.189  1.00 33.76  ? 215  ASN C C   1 
ATOM   6022  O O   . ASN B 1 176 ? -42.019  -48.440 27.452  1.00 32.43  ? 215  ASN C O   1 
ATOM   6023  C CB  . ASN B 1 176 ? -41.105  -49.543 25.036  1.00 35.33  ? 215  ASN C CB  1 
ATOM   6024  C CG  . ASN B 1 176 ? -41.616  -48.318 24.269  1.00 37.89  ? 215  ASN C CG  1 
ATOM   6025  O OD1 . ASN B 1 176 ? -41.489  -47.181 24.722  1.00 31.32  ? 215  ASN C OD1 1 
ATOM   6026  N ND2 . ASN B 1 176 ? -42.188  -48.554 23.104  1.00 34.03  ? 215  ASN C ND2 1 
ATOM   6027  N N   . LEU B 1 177 ? -40.048  -47.390 27.799  1.00 26.48  ? 216  LEU C N   1 
ATOM   6028  C CA  . LEU B 1 177 ? -40.542  -46.516 28.859  1.00 33.39  ? 216  LEU C CA  1 
ATOM   6029  C C   . LEU B 1 177 ? -40.475  -45.060 28.409  1.00 35.57  ? 216  LEU C C   1 
ATOM   6030  O O   . LEU B 1 177 ? -39.419  -44.586 27.968  1.00 26.90  ? 216  LEU C O   1 
ATOM   6031  C CB  . LEU B 1 177 ? -39.720  -46.696 30.142  1.00 28.99  ? 216  LEU C CB  1 
ATOM   6032  C CG  . LEU B 1 177 ? -39.876  -45.629 31.242  1.00 33.93  ? 216  LEU C CG  1 
ATOM   6033  C CD1 . LEU B 1 177 ? -41.125  -45.859 32.086  1.00 29.78  ? 216  LEU C CD1 1 
ATOM   6034  C CD2 . LEU B 1 177 ? -38.650  -45.581 32.140  1.00 32.30  ? 216  LEU C CD2 1 
ATOM   6035  N N   . VAL B 1 178 ? -41.607  -44.369 28.495  1.00 30.80  ? 217  VAL C N   1 
ATOM   6036  C CA  . VAL B 1 178 ? -41.646  -42.929 28.258  1.00 28.01  ? 217  VAL C CA  1 
ATOM   6037  C C   . VAL B 1 178 ? -41.868  -42.220 29.588  1.00 32.31  ? 217  VAL C C   1 
ATOM   6038  O O   . VAL B 1 178 ? -42.811  -42.541 30.319  1.00 31.99  ? 217  VAL C O   1 
ATOM   6039  C CB  . VAL B 1 178 ? -42.782  -42.520 27.302  1.00 27.49  ? 217  VAL C CB  1 
ATOM   6040  C CG1 . VAL B 1 178 ? -42.855  -40.997 27.199  1.00 31.97  ? 217  VAL C CG1 1 
ATOM   6041  C CG2 . VAL B 1 178 ? -42.586  -43.126 25.928  1.00 27.86  ? 217  VAL C CG2 1 
ATOM   6042  N N   . VAL B 1 179 ? -41.004  -41.263 29.909  1.00 28.95  ? 218  VAL C N   1 
ATOM   6043  C CA  . VAL B 1 179 ? -41.218  -40.458 31.112  1.00 33.35  ? 218  VAL C CA  1 
ATOM   6044  C C   . VAL B 1 179 ? -41.307  -38.968 30.811  1.00 27.24  ? 218  VAL C C   1 
ATOM   6045  O O   . VAL B 1 179 ? -40.536  -38.422 30.017  1.00 28.03  ? 218  VAL C O   1 
ATOM   6046  C CB  . VAL B 1 179 ? -40.169  -40.713 32.238  1.00 41.34  ? 218  VAL C CB  1 
ATOM   6047  C CG1 . VAL B 1 179 ? -39.226  -41.826 31.873  1.00 38.85  ? 218  VAL C CG1 1 
ATOM   6048  C CG2 . VAL B 1 179 ? -39.409  -39.447 32.577  1.00 37.30  ? 218  VAL C CG2 1 
ATOM   6049  N N   . ALA B 1 180 ? -42.276  -38.327 31.444  1.00 28.48  ? 219  ALA C N   1 
ATOM   6050  C CA  . ALA B 1 180 ? -42.463  -36.899 31.318  1.00 28.87  ? 219  ALA C CA  1 
ATOM   6051  C C   . ALA B 1 180 ? -42.233  -36.316 32.702  1.00 33.43  ? 219  ALA C C   1 
ATOM   6052  O O   . ALA B 1 180 ? -42.893  -36.720 33.662  1.00 27.10  ? 219  ALA C O   1 
ATOM   6053  C CB  . ALA B 1 180 ? -43.893  -36.590 30.825  1.00 24.69  ? 219  ALA C CB  1 
ATOM   6054  N N   . GLY B 1 181 ? -41.297  -35.377 32.802  1.00 26.82  ? 220  GLY C N   1 
ATOM   6055  C CA  . GLY B 1 181 ? -40.979  -34.764 34.072  1.00 29.14  ? 220  GLY C CA  1 
ATOM   6056  C C   . GLY B 1 181 ? -41.272  -33.275 34.095  1.00 30.87  ? 220  GLY C C   1 
ATOM   6057  O O   . GLY B 1 181 ? -41.241  -32.605 33.064  1.00 32.28  ? 220  GLY C O   1 
ATOM   6058  N N   . ALA B 1 182 ? -41.576  -32.769 35.284  1.00 34.26  ? 221  ALA C N   1 
ATOM   6059  C CA  . ALA B 1 182 ? -41.720  -31.338 35.514  1.00 36.07  ? 221  ALA C CA  1 
ATOM   6060  C C   . ALA B 1 182 ? -40.519  -30.878 36.352  1.00 35.28  ? 221  ALA C C   1 
ATOM   6061  O O   . ALA B 1 182 ? -39.708  -31.707 36.768  1.00 30.73  ? 221  ALA C O   1 
ATOM   6062  C CB  . ALA B 1 182 ? -43.031  -31.051 36.224  1.00 28.43  ? 221  ALA C CB  1 
ATOM   6063  N N   . PRO B 1 183 ? -40.386  -29.559 36.587  1.00 35.77  ? 222  PRO C N   1 
ATOM   6064  C CA  . PRO B 1 183 ? -39.201  -29.082 37.315  1.00 32.70  ? 222  PRO C CA  1 
ATOM   6065  C C   . PRO B 1 183 ? -39.050  -29.718 38.707  1.00 33.38  ? 222  PRO C C   1 
ATOM   6066  O O   . PRO B 1 183 ? -40.012  -30.236 39.275  1.00 33.68  ? 222  PRO C O   1 
ATOM   6067  C CB  . PRO B 1 183 ? -39.443  -27.567 37.429  1.00 30.61  ? 222  PRO C CB  1 
ATOM   6068  C CG  . PRO B 1 183 ? -40.301  -27.240 36.260  1.00 32.77  ? 222  PRO C CG  1 
ATOM   6069  C CD  . PRO B 1 183 ? -41.249  -28.444 36.162  1.00 29.99  ? 222  PRO C CD  1 
ATOM   6070  N N   . LYS B 1 184 ? -37.841  -29.671 39.244  1.00 35.63  ? 223  LYS C N   1 
ATOM   6071  C CA  . LYS B 1 184 ? -37.540  -30.314 40.521  1.00 37.78  ? 223  LYS C CA  1 
ATOM   6072  C C   . LYS B 1 184 ? -37.719  -31.827 40.450  1.00 34.18  ? 223  LYS C C   1 
ATOM   6073  O O   . LYS B 1 184 ? -38.017  -32.461 41.459  1.00 35.58  ? 223  LYS C O   1 
ATOM   6074  C CB  . LYS B 1 184 ? -38.405  -29.749 41.651  1.00 36.34  ? 223  LYS C CB  1 
ATOM   6075  C CG  . LYS B 1 184 ? -38.032  -28.355 42.124  1.00 49.49  ? 223  LYS C CG  1 
ATOM   6076  C CD  . LYS B 1 184 ? -38.763  -28.033 43.421  1.00 52.59  ? 223  LYS C CD  1 
ATOM   6077  C CE  . LYS B 1 184 ? -38.249  -26.751 44.062  1.00 78.35  ? 223  LYS C CE  1 
ATOM   6078  N NZ  . LYS B 1 184 ? -38.455  -25.556 43.197  1.00 73.34  ? 223  LYS C NZ  1 
ATOM   6079  N N   . SER B 1 185 ? -37.540  -32.398 39.264  1.00 28.69  ? 224  SER C N   1 
ATOM   6080  C CA  . SER B 1 185 ? -37.559  -33.853 39.106  1.00 35.57  ? 224  SER C CA  1 
ATOM   6081  C C   . SER B 1 185 ? -38.883  -34.491 39.527  1.00 37.81  ? 224  SER C C   1 
ATOM   6082  O O   . SER B 1 185 ? -38.900  -35.612 40.052  1.00 34.60  ? 224  SER C O   1 
ATOM   6083  C CB  . SER B 1 185 ? -36.420  -34.494 39.905  1.00 33.89  ? 224  SER C CB  1 
ATOM   6084  O OG  . SER B 1 185 ? -35.163  -33.988 39.506  1.00 34.03  ? 224  SER C OG  1 
ATOM   6085  N N   . GLN B 1 186 ? -39.985  -33.783 39.302  1.00 33.48  ? 225  GLN C N   1 
ATOM   6086  C CA  . GLN B 1 186 ? -41.302  -34.350 39.566  1.00 33.60  ? 225  GLN C CA  1 
ATOM   6087  C C   . GLN B 1 186 ? -41.786  -35.157 38.358  1.00 31.91  ? 225  GLN C C   1 
ATOM   6088  O O   . GLN B 1 186 ? -41.647  -34.729 37.215  1.00 36.38  ? 225  GLN C O   1 
ATOM   6089  C CB  . GLN B 1 186 ? -42.304  -33.254 39.906  1.00 31.21  ? 225  GLN C CB  1 
ATOM   6090  C CG  . GLN B 1 186 ? -41.903  -32.417 41.106  1.00 41.34  ? 225  GLN C CG  1 
ATOM   6091  C CD  . GLN B 1 186 ? -41.693  -33.267 42.337  1.00 38.36  ? 225  GLN C CD  1 
ATOM   6092  O OE1 . GLN B 1 186 ? -42.659  -33.709 42.966  1.00 34.37  ? 225  GLN C OE1 1 
ATOM   6093  N NE2 . GLN B 1 186 ? -40.428  -33.512 42.685  1.00 31.78  ? 225  GLN C NE2 1 
ATOM   6094  N N   . ILE B 1 187 ? -42.343  -36.330 38.620  1.00 29.65  ? 226  ILE C N   1 
ATOM   6095  C CA  . ILE B 1 187 ? -42.849  -37.187 37.557  1.00 30.56  ? 226  ILE C CA  1 
ATOM   6096  C C   . ILE B 1 187 ? -44.299  -36.837 37.226  1.00 31.53  ? 226  ILE C C   1 
ATOM   6097  O O   . ILE B 1 187 ? -45.162  -36.847 38.101  1.00 25.44  ? 226  ILE C O   1 
ATOM   6098  C CB  . ILE B 1 187 ? -42.736  -38.676 37.957  1.00 30.72  ? 226  ILE C CB  1 
ATOM   6099  C CG1 . ILE B 1 187 ? -41.258  -39.072 38.058  1.00 33.01  ? 226  ILE C CG1 1 
ATOM   6100  C CG2 . ILE B 1 187 ? -43.480  -39.572 36.950  1.00 28.75  ? 226  ILE C CG2 1 
ATOM   6101  C CD1 . ILE B 1 187 ? -41.020  -40.446 38.689  1.00 34.31  ? 226  ILE C CD1 1 
ATOM   6102  N N   . VAL B 1 188 ? -44.558  -36.512 35.965  1.00 31.95  ? 227  VAL C N   1 
ATOM   6103  C CA  . VAL B 1 188 ? -45.908  -36.139 35.545  1.00 30.59  ? 227  VAL C CA  1 
ATOM   6104  C C   . VAL B 1 188 ? -46.655  -37.294 34.875  1.00 29.32  ? 227  VAL C C   1 
ATOM   6105  O O   . VAL B 1 188 ? -47.876  -37.432 35.023  1.00 29.91  ? 227  VAL C O   1 
ATOM   6106  C CB  . VAL B 1 188 ? -45.882  -34.913 34.606  1.00 33.65  ? 227  VAL C CB  1 
ATOM   6107  C CG1 . VAL B 1 188 ? -47.267  -34.605 34.089  1.00 37.10  ? 227  VAL C CG1 1 
ATOM   6108  C CG2 . VAL B 1 188 ? -45.321  -33.708 35.347  1.00 36.67  ? 227  VAL C CG2 1 
ATOM   6109  N N   . MET B 1 189 ? -45.907  -38.122 34.149  1.00 29.01  ? 228  MET C N   1 
ATOM   6110  C CA  . MET B 1 189 ? -46.483  -39.192 33.340  1.00 35.12  ? 228  MET C CA  1 
ATOM   6111  C C   . MET B 1 189 ? -45.458  -40.312 33.179  1.00 36.09  ? 228  MET C C   1 
ATOM   6112  O O   . MET B 1 189 ? -44.296  -40.050 32.872  1.00 31.79  ? 228  MET C O   1 
ATOM   6113  C CB  . MET B 1 189 ? -46.887  -38.641 31.959  1.00 28.16  ? 228  MET C CB  1 
ATOM   6114  C CG  . MET B 1 189 ? -47.639  -39.617 31.043  1.00 29.00  ? 228  MET C CG  1 
ATOM   6115  S SD  . MET B 1 189 ? -46.676  -40.992 30.347  1.00 30.83  ? 228  MET C SD  1 
ATOM   6116  C CE  . MET B 1 189 ? -45.412  -40.129 29.424  1.00 28.49  ? 228  MET C CE  1 
ATOM   6117  N N   . LEU B 1 190 ? -45.881  -41.552 33.417  1.00 36.03  ? 229  LEU C N   1 
ATOM   6118  C CA  . LEU B 1 190 ? -45.063  -42.722 33.082  1.00 39.51  ? 229  LEU C CA  1 
ATOM   6119  C C   . LEU B 1 190 ? -45.890  -43.679 32.237  1.00 34.52  ? 229  LEU C C   1 
ATOM   6120  O O   . LEU B 1 190 ? -47.007  -44.029 32.604  1.00 33.66  ? 229  LEU C O   1 
ATOM   6121  C CB  . LEU B 1 190 ? -44.558  -43.464 34.332  1.00 31.79  ? 229  LEU C CB  1 
ATOM   6122  C CG  . LEU B 1 190 ? -43.580  -42.760 35.278  1.00 33.05  ? 229  LEU C CG  1 
ATOM   6123  C CD1 . LEU B 1 190 ? -43.312  -43.639 36.486  1.00 33.09  ? 229  LEU C CD1 1 
ATOM   6124  C CD2 . LEU B 1 190 ? -42.268  -42.403 34.567  1.00 40.01  ? 229  LEU C CD2 1 
ATOM   6125  N N   . GLU B 1 191 ? -45.334  -44.080 31.101  1.00 33.31  ? 230  GLU C N   1 
ATOM   6126  C CA  . GLU B 1 191 ? -45.952  -45.077 30.239  1.00 35.18  ? 230  GLU C CA  1 
ATOM   6127  C C   . GLU B 1 191 ? -44.880  -46.109 29.886  1.00 31.60  ? 230  GLU C C   1 
ATOM   6128  O O   . GLU B 1 191 ? -43.839  -45.756 29.339  1.00 32.66  ? 230  GLU C O   1 
ATOM   6129  C CB  . GLU B 1 191 ? -46.495  -44.411 28.967  1.00 28.82  ? 230  GLU C CB  1 
ATOM   6130  C CG  . GLU B 1 191 ? -47.392  -45.299 28.105  1.00 34.13  ? 230  GLU C CG  1 
ATOM   6131  C CD  . GLU B 1 191 ? -48.701  -45.636 28.792  1.00 38.04  ? 230  GLU C CD  1 
ATOM   6132  O OE1 . GLU B 1 191 ? -49.129  -44.856 29.668  1.00 42.86  ? 230  GLU C OE1 1 
ATOM   6133  O OE2 . GLU B 1 191 ? -49.299  -46.681 28.466  1.00 39.25  ? 230  GLU C OE2 1 
ATOM   6134  N N   . ALA B 1 192 ? -45.120  -47.382 30.196  1.00 31.09  ? 231  ALA C N   1 
ATOM   6135  C CA  . ALA B 1 192 ? -44.135  -48.403 29.846  1.00 32.91  ? 231  ALA C CA  1 
ATOM   6136  C C   . ALA B 1 192 ? -44.697  -49.733 29.379  1.00 37.27  ? 231  ALA C C   1 
ATOM   6137  O O   . ALA B 1 192 ? -45.736  -50.205 29.851  1.00 33.37  ? 231  ALA C O   1 
ATOM   6138  C CB  . ALA B 1 192 ? -43.142  -48.636 30.999  1.00 25.85  ? 231  ALA C CB  1 
ATOM   6139  N N   . SER B 1 193 ? -43.958  -50.319 28.446  1.00 32.65  ? 232  SER C N   1 
ATOM   6140  C CA  . SER B 1 193 ? -44.049  -51.720 28.099  1.00 37.50  ? 232  SER C CA  1 
ATOM   6141  C C   . SER B 1 193 ? -42.693  -52.312 28.468  1.00 37.53  ? 232  SER C C   1 
ATOM   6142  O O   . SER B 1 193 ? -41.678  -51.628 28.360  1.00 30.39  ? 232  SER C O   1 
ATOM   6143  C CB  . SER B 1 193 ? -44.237  -51.855 26.590  1.00 34.35  ? 232  SER C CB  1 
ATOM   6144  O OG  . SER B 1 193 ? -44.799  -53.108 26.275  1.00 53.22  ? 232  SER C OG  1 
ATOM   6145  N N   . ALA B 1 194 ? -42.655  -53.574 28.885  1.00 35.90  ? 233  ALA C N   1 
ATOM   6146  C CA  . ALA B 1 194 ? -41.366  -54.210 29.177  1.00 30.57  ? 233  ALA C CA  1 
ATOM   6147  C C   . ALA B 1 194 ? -41.412  -55.737 29.047  1.00 38.21  ? 233  ALA C C   1 
ATOM   6148  O O   . ALA B 1 194 ? -42.444  -56.365 29.306  1.00 32.67  ? 233  ALA C O   1 
ATOM   6149  C CB  . ALA B 1 194 ? -40.881  -53.809 30.561  1.00 27.30  ? 233  ALA C CB  1 
ATOM   6150  N N   . GLU B 1 195 ? -40.283  -56.321 28.645  1.00 37.15  ? 234  GLU C N   1 
ATOM   6151  C CA  . GLU B 1 195 ? -40.155  -57.768 28.522  1.00 37.90  ? 234  GLU C CA  1 
ATOM   6152  C C   . GLU B 1 195 ? -39.975  -58.443 29.879  1.00 40.97  ? 234  GLU C C   1 
ATOM   6153  O O   . GLU B 1 195 ? -38.973  -59.122 30.113  1.00 37.48  ? 234  GLU C O   1 
ATOM   6154  C CB  . GLU B 1 195 ? -38.969  -58.125 27.624  1.00 36.98  ? 234  GLU C CB  1 
ATOM   6155  C CG  . GLU B 1 195 ? -39.206  -57.843 26.152  1.00 42.88  ? 234  GLU C CG  1 
ATOM   6156  C CD  . GLU B 1 195 ? -40.317  -58.712 25.562  1.00 51.83  ? 234  GLU C CD  1 
ATOM   6157  O OE1 . GLU B 1 195 ? -40.126  -59.946 25.439  1.00 49.12  ? 234  GLU C OE1 1 
ATOM   6158  O OE2 . GLU B 1 195 ? -41.385  -58.157 25.228  1.00 46.17  ? 234  GLU C OE2 1 
ATOM   6159  N N   . ASN B 1 196 ? -40.941  -58.245 30.766  1.00 29.31  ? 235  ASN C N   1 
ATOM   6160  C CA  . ASN B 1 196 ? -40.937  -58.905 32.058  1.00 33.03  ? 235  ASN C CA  1 
ATOM   6161  C C   . ASN B 1 196 ? -39.625  -58.649 32.799  1.00 42.67  ? 235  ASN C C   1 
ATOM   6162  O O   . ASN B 1 196 ? -38.995  -59.583 33.298  1.00 40.15  ? 235  ASN C O   1 
ATOM   6163  C CB  . ASN B 1 196 ? -41.140  -60.407 31.840  1.00 46.00  ? 235  ASN C CB  1 
ATOM   6164  C CG  . ASN B 1 196 ? -41.441  -61.146 33.116  1.00 45.78  ? 235  ASN C CG  1 
ATOM   6165  O OD1 . ASN B 1 196 ? -42.006  -60.583 34.055  1.00 43.39  ? 235  ASN C OD1 1 
ATOM   6166  N ND2 . ASN B 1 196 ? -41.073  -62.423 33.159  1.00 43.89  ? 235  ASN C ND2 1 
ATOM   6167  N N   . ILE B 1 197 ? -39.206  -57.386 32.867  1.00 35.92  ? 236  ILE C N   1 
ATOM   6168  C CA  . ILE B 1 197 ? -37.917  -57.072 33.463  1.00 30.84  ? 236  ILE C CA  1 
ATOM   6169  C C   . ILE B 1 197 ? -37.968  -56.902 34.975  1.00 38.21  ? 236  ILE C C   1 
ATOM   6170  O O   . ILE B 1 197 ? -39.040  -56.773 35.568  1.00 38.31  ? 236  ILE C O   1 
ATOM   6171  C CB  . ILE B 1 197 ? -37.241  -55.827 32.810  1.00 37.31  ? 236  ILE C CB  1 
ATOM   6172  C CG1 . ILE B 1 197 ? -38.016  -54.539 33.127  1.00 38.43  ? 236  ILE C CG1 1 
ATOM   6173  C CG2 . ILE B 1 197 ? -37.077  -56.030 31.308  1.00 35.77  ? 236  ILE C CG2 1 
ATOM   6174  C CD1 . ILE B 1 197 ? -37.276  -53.277 32.719  1.00 29.98  ? 236  ILE C CD1 1 
ATOM   6175  N N   . LEU B 1 198 ? -36.783  -56.896 35.585  1.00 39.33  ? 237  LEU C N   1 
ATOM   6176  C CA  . LEU B 1 198 ? -36.642  -56.763 37.029  1.00 35.54  ? 237  LEU C CA  1 
ATOM   6177  C C   . LEU B 1 198 ? -37.046  -55.386 37.515  1.00 35.37  ? 237  LEU C C   1 
ATOM   6178  O O   . LEU B 1 198 ? -36.791  -54.379 36.857  1.00 40.32  ? 237  LEU C O   1 
ATOM   6179  C CB  . LEU B 1 198 ? -35.195  -57.034 37.454  1.00 43.41  ? 237  LEU C CB  1 
ATOM   6180  C CG  . LEU B 1 198 ? -34.632  -58.429 37.169  1.00 53.75  ? 237  LEU C CG  1 
ATOM   6181  C CD1 . LEU B 1 198 ? -33.150  -58.487 37.528  1.00 55.27  ? 237  LEU C CD1 1 
ATOM   6182  C CD2 . LEU B 1 198 ? -35.426  -59.514 37.911  1.00 43.57  ? 237  LEU C CD2 1 
ATOM   6183  N N   . GLN B 1 199 ? -37.652  -55.353 38.691  1.00 34.70  ? 238  GLN C N   1 
ATOM   6184  C CA  . GLN B 1 199 ? -38.087  -54.114 39.297  1.00 37.61  ? 238  GLN C CA  1 
ATOM   6185  C C   . GLN B 1 199 ? -36.953  -53.094 39.414  1.00 47.22  ? 238  GLN C C   1 
ATOM   6186  O O   . GLN B 1 199 ? -37.130  -51.913 39.085  1.00 34.96  ? 238  GLN C O   1 
ATOM   6187  C CB  . GLN B 1 199 ? -38.692  -54.403 40.666  1.00 36.82  ? 238  GLN C CB  1 
ATOM   6188  C CG  . GLN B 1 199 ? -39.017  -53.174 41.471  1.00 41.52  ? 238  GLN C CG  1 
ATOM   6189  C CD  . GLN B 1 199 ? -39.766  -53.513 42.742  1.00 46.33  ? 238  GLN C CD  1 
ATOM   6190  O OE1 . GLN B 1 199 ? -39.520  -52.928 43.801  1.00 47.88  ? 238  GLN C OE1 1 
ATOM   6191  N NE2 . GLN B 1 199 ? -40.683  -54.471 42.647  1.00 38.30  ? 238  GLN C NE2 1 
ATOM   6192  N N   . GLN B 1 200 ? -35.791  -53.553 39.874  1.00 40.43  ? 239  GLN C N   1 
ATOM   6193  C CA  . GLN B 1 200 ? -34.653  -52.664 40.096  1.00 48.24  ? 239  GLN C CA  1 
ATOM   6194  C C   . GLN B 1 200 ? -34.185  -52.017 38.796  1.00 42.04  ? 239  GLN C C   1 
ATOM   6195  O O   . GLN B 1 200 ? -33.836  -50.836 38.774  1.00 38.85  ? 239  GLN C O   1 
ATOM   6196  C CB  . GLN B 1 200 ? -33.493  -53.412 40.774  1.00 53.72  ? 239  GLN C CB  1 
ATOM   6197  C CG  . GLN B 1 200 ? -33.759  -53.775 42.237  1.00 69.98  ? 239  GLN C CG  1 
ATOM   6198  C CD  . GLN B 1 200 ? -32.543  -54.384 42.927  1.00 82.44  ? 239  GLN C CD  1 
ATOM   6199  O OE1 . GLN B 1 200 ? -32.067  -55.458 42.546  1.00 81.34  ? 239  GLN C OE1 1 
ATOM   6200  N NE2 . GLN B 1 200 ? -32.037  -53.698 43.949  1.00 71.68  ? 239  GLN C NE2 1 
ATOM   6201  N N   . ASP B 1 201 ? -34.171  -52.803 37.723  1.00 35.67  ? 240  ASP C N   1 
ATOM   6202  C CA  . ASP B 1 201 ? -33.845  -52.300 36.392  1.00 36.15  ? 240  ASP C CA  1 
ATOM   6203  C C   . ASP B 1 201 ? -34.901  -51.294 35.959  1.00 41.73  ? 240  ASP C C   1 
ATOM   6204  O O   . ASP B 1 201 ? -34.581  -50.227 35.416  1.00 32.30  ? 240  ASP C O   1 
ATOM   6205  C CB  . ASP B 1 201 ? -33.832  -53.447 35.382  1.00 33.72  ? 240  ASP C CB  1 
ATOM   6206  C CG  . ASP B 1 201 ? -32.684  -54.427 35.620  1.00 53.04  ? 240  ASP C CG  1 
ATOM   6207  O OD1 . ASP B 1 201 ? -31.918  -54.229 36.590  1.00 44.06  ? 240  ASP C OD1 1 
ATOM   6208  O OD2 . ASP B 1 201 ? -32.555  -55.394 34.833  1.00 38.40  ? 240  ASP C OD2 1 
ATOM   6209  N N   . PHE B 1 202 ? -36.164  -51.655 36.187  1.00 34.79  ? 241  PHE C N   1 
ATOM   6210  C CA  . PHE B 1 202 ? -37.270  -50.810 35.770  1.00 38.44  ? 241  PHE C CA  1 
ATOM   6211  C C   . PHE B 1 202 ? -37.137  -49.472 36.475  1.00 32.48  ? 241  PHE C C   1 
ATOM   6212  O O   . PHE B 1 202 ? -37.217  -48.416 35.850  1.00 38.96  ? 241  PHE C O   1 
ATOM   6213  C CB  . PHE B 1 202 ? -38.609  -51.464 36.101  1.00 36.38  ? 241  PHE C CB  1 
ATOM   6214  C CG  . PHE B 1 202 ? -39.791  -50.791 35.446  1.00 35.49  ? 241  PHE C CG  1 
ATOM   6215  C CD1 . PHE B 1 202 ? -40.475  -49.775 36.097  1.00 39.60  ? 241  PHE C CD1 1 
ATOM   6216  C CD2 . PHE B 1 202 ? -40.220  -51.183 34.187  1.00 35.82  ? 241  PHE C CD2 1 
ATOM   6217  C CE1 . PHE B 1 202 ? -41.571  -49.150 35.503  1.00 40.32  ? 241  PHE C CE1 1 
ATOM   6218  C CE2 . PHE B 1 202 ? -41.312  -50.564 33.580  1.00 39.90  ? 241  PHE C CE2 1 
ATOM   6219  C CZ  . PHE B 1 202 ? -41.984  -49.541 34.242  1.00 35.95  ? 241  PHE C CZ  1 
ATOM   6220  N N   . CYS B 1 203 ? -36.911  -49.532 37.783  1.00 38.16  ? 242  CYS C N   1 
ATOM   6221  C CA  . CYS B 1 203 ? -36.796  -48.332 38.593  1.00 35.41  ? 242  CYS C CA  1 
ATOM   6222  C C   . CYS B 1 203 ? -35.601  -47.473 38.189  1.00 34.95  ? 242  CYS C C   1 
ATOM   6223  O O   . CYS B 1 203 ? -35.703  -46.249 38.124  1.00 33.26  ? 242  CYS C O   1 
ATOM   6224  C CB  . CYS B 1 203 ? -36.745  -48.685 40.080  1.00 33.67  ? 242  CYS C CB  1 
ATOM   6225  S SG  . CYS B 1 203 ? -38.330  -49.354 40.704  1.00 39.03  ? 242  CYS C SG  1 
ATOM   6226  N N   . HIS B 1 204 ? -34.467  -48.107 37.915  1.00 37.51  ? 243  HIS C N   1 
ATOM   6227  C CA  . HIS B 1 204 ? -33.292  -47.354 37.499  1.00 35.03  ? 243  HIS C CA  1 
ATOM   6228  C C   . HIS B 1 204 ? -33.589  -46.604 36.204  1.00 34.70  ? 243  HIS C C   1 
ATOM   6229  O O   . HIS B 1 204 ? -33.199  -45.458 36.051  1.00 33.77  ? 243  HIS C O   1 
ATOM   6230  C CB  . HIS B 1 204 ? -32.077  -48.262 37.319  1.00 32.45  ? 243  HIS C CB  1 
ATOM   6231  C CG  . HIS B 1 204 ? -30.801  -47.515 37.097  1.00 36.16  ? 243  HIS C CG  1 
ATOM   6232  N ND1 . HIS B 1 204 ? -30.233  -47.366 35.852  1.00 42.75  ? 243  HIS C ND1 1 
ATOM   6233  C CD2 . HIS B 1 204 ? -29.999  -46.846 37.960  1.00 34.50  ? 243  HIS C CD2 1 
ATOM   6234  C CE1 . HIS B 1 204 ? -29.132  -46.642 35.957  1.00 35.99  ? 243  HIS C CE1 1 
ATOM   6235  N NE2 . HIS B 1 204 ? -28.964  -46.319 37.225  1.00 34.87  ? 243  HIS C NE2 1 
ATOM   6236  N N   . ALA B 1 205 ? -34.290  -47.256 35.280  1.00 34.59  ? 244  ALA C N   1 
ATOM   6237  C CA  . ALA B 1 205 ? -34.646  -46.624 34.012  1.00 29.95  ? 244  ALA C CA  1 
ATOM   6238  C C   . ALA B 1 205 ? -35.451  -45.350 34.248  1.00 30.88  ? 244  ALA C C   1 
ATOM   6239  O O   . ALA B 1 205 ? -35.217  -44.344 33.582  1.00 30.55  ? 244  ALA C O   1 
ATOM   6240  C CB  . ALA B 1 205 ? -35.414  -47.572 33.142  1.00 27.38  ? 244  ALA C CB  1 
ATOM   6241  N N   . ILE B 1 206 ? -36.380  -45.397 35.205  1.00 27.06  ? 245  ILE C N   1 
ATOM   6242  C CA  . ILE B 1 206 ? -37.192  -44.229 35.543  1.00 30.32  ? 245  ILE C CA  1 
ATOM   6243  C C   . ILE B 1 206 ? -36.314  -43.094 36.065  1.00 35.00  ? 245  ILE C C   1 
ATOM   6244  O O   . ILE B 1 206 ? -36.519  -41.929 35.724  1.00 30.54  ? 245  ILE C O   1 
ATOM   6245  C CB  . ILE B 1 206 ? -38.257  -44.558 36.609  1.00 31.96  ? 245  ILE C CB  1 
ATOM   6246  C CG1 . ILE B 1 206 ? -39.349  -45.464 36.033  1.00 26.62  ? 245  ILE C CG1 1 
ATOM   6247  C CG2 . ILE B 1 206 ? -38.872  -43.282 37.170  1.00 35.32  ? 245  ILE C CG2 1 
ATOM   6248  C CD1 . ILE B 1 206 ? -40.190  -46.107 37.102  1.00 24.99  ? 245  ILE C CD1 1 
ATOM   6249  N N   . LYS B 1 207 ? -35.345  -43.445 36.906  1.00 31.48  ? 246  LYS C N   1 
ATOM   6250  C CA  . LYS B 1 207 ? -34.446  -42.462 37.501  1.00 32.55  ? 246  LYS C CA  1 
ATOM   6251  C C   . LYS B 1 207 ? -33.599  -41.736 36.451  1.00 36.18  ? 246  LYS C C   1 
ATOM   6252  O O   . LYS B 1 207 ? -33.458  -40.512 36.496  1.00 38.27  ? 246  LYS C O   1 
ATOM   6253  C CB  . LYS B 1 207 ? -33.554  -43.123 38.556  1.00 37.81  ? 246  LYS C CB  1 
ATOM   6254  C CG  . LYS B 1 207 ? -34.295  -43.556 39.822  1.00 41.58  ? 246  LYS C CG  1 
ATOM   6255  C CD  . LYS B 1 207 ? -33.387  -44.353 40.769  1.00 56.02  ? 246  LYS C CD  1 
ATOM   6256  C CE  . LYS B 1 207 ? -34.109  -44.781 42.061  1.00 67.13  ? 246  LYS C CE  1 
ATOM   6257  N NZ  . LYS B 1 207 ? -34.397  -43.647 43.007  1.00 54.52  ? 246  LYS C NZ  1 
ATOM   6258  N N   . VAL B 1 208 ? -33.036  -42.487 35.509  1.00 30.85  ? 247  VAL C N   1 
ATOM   6259  C CA  . VAL B 1 208 ? -32.252  -41.883 34.435  1.00 33.32  ? 247  VAL C CA  1 
ATOM   6260  C C   . VAL B 1 208 ? -33.143  -41.088 33.477  1.00 33.65  ? 247  VAL C C   1 
ATOM   6261  O O   . VAL B 1 208 ? -32.718  -40.075 32.914  1.00 30.03  ? 247  VAL C O   1 
ATOM   6262  C CB  . VAL B 1 208 ? -31.420  -42.937 33.655  1.00 39.22  ? 247  VAL C CB  1 
ATOM   6263  C CG1 . VAL B 1 208 ? -32.019  -44.306 33.802  1.00 43.25  ? 247  VAL C CG1 1 
ATOM   6264  C CG2 . VAL B 1 208 ? -31.319  -42.573 32.193  1.00 40.12  ? 247  VAL C CG2 1 
ATOM   6265  N N   . GLY B 1 209 ? -34.378  -41.552 33.293  1.00 31.87  ? 248  GLY C N   1 
ATOM   6266  C CA  . GLY B 1 209 ? -35.317  -40.844 32.438  1.00 35.29  ? 248  GLY C CA  1 
ATOM   6267  C C   . GLY B 1 209 ? -35.591  -39.450 32.978  1.00 27.80  ? 248  GLY C C   1 
ATOM   6268  O O   . GLY B 1 209 ? -35.487  -38.453 32.256  1.00 29.87  ? 248  GLY C O   1 
ATOM   6269  N N   . VAL B 1 210 ? -35.935  -39.391 34.260  1.00 31.99  ? 249  VAL C N   1 
ATOM   6270  C CA  . VAL B 1 210 ? -36.223  -38.124 34.927  1.00 33.38  ? 249  VAL C CA  1 
ATOM   6271  C C   . VAL B 1 210 ? -35.034  -37.187 34.823  1.00 31.72  ? 249  VAL C C   1 
ATOM   6272  O O   . VAL B 1 210 ? -35.196  -35.998 34.543  1.00 34.93  ? 249  VAL C O   1 
ATOM   6273  C CB  . VAL B 1 210 ? -36.573  -38.333 36.403  1.00 30.80  ? 249  VAL C CB  1 
ATOM   6274  C CG1 . VAL B 1 210 ? -36.617  -37.005 37.138  1.00 35.45  ? 249  VAL C CG1 1 
ATOM   6275  C CG2 . VAL B 1 210 ? -37.901  -39.049 36.526  1.00 27.31  ? 249  VAL C CG2 1 
ATOM   6276  N N   . LYS B 1 211 ? -33.841  -37.725 35.053  1.00 32.08  ? 250  LYS C N   1 
ATOM   6277  C CA  . LYS B 1 211 ? -32.619  -36.933 34.942  1.00 37.95  ? 250  LYS C CA  1 
ATOM   6278  C C   . LYS B 1 211 ? -32.561  -36.220 33.597  1.00 33.51  ? 250  LYS C C   1 
ATOM   6279  O O   . LYS B 1 211 ? -32.309  -35.016 33.536  1.00 32.24  ? 250  LYS C O   1 
ATOM   6280  C CB  . LYS B 1 211 ? -31.379  -37.813 35.155  1.00 37.00  ? 250  LYS C CB  1 
ATOM   6281  C CG  . LYS B 1 211 ? -30.238  -37.601 34.143  1.00 62.11  ? 250  LYS C CG  1 
ATOM   6282  C CD  . LYS B 1 211 ? -29.521  -38.941 33.834  1.00 60.32  ? 250  LYS C CD  1 
ATOM   6283  C CE  . LYS B 1 211 ? -28.504  -38.837 32.694  1.00 56.08  ? 250  LYS C CE  1 
ATOM   6284  N NZ  . LYS B 1 211 ? -27.175  -38.295 33.113  1.00 68.45  ? 250  LYS C NZ  1 
ATOM   6285  N N   . TYR B 1 212 ? -32.812  -36.957 32.518  1.00 30.63  ? 251  TYR C N   1 
ATOM   6286  C CA  . TYR B 1 212 ? -32.778  -36.357 31.188  1.00 34.14  ? 251  TYR C CA  1 
ATOM   6287  C C   . TYR B 1 212 ? -33.876  -35.287 30.970  1.00 34.95  ? 251  TYR C C   1 
ATOM   6288  O O   . TYR B 1 212 ? -33.642  -34.291 30.290  1.00 29.93  ? 251  TYR C O   1 
ATOM   6289  C CB  . TYR B 1 212 ? -32.857  -37.439 30.109  1.00 35.88  ? 251  TYR C CB  1 
ATOM   6290  C CG  . TYR B 1 212 ? -31.586  -38.249 29.922  1.00 36.07  ? 251  TYR C CG  1 
ATOM   6291  C CD1 . TYR B 1 212 ? -30.422  -37.655 29.458  1.00 39.51  ? 251  TYR C CD1 1 
ATOM   6292  C CD2 . TYR B 1 212 ? -31.564  -39.612 30.178  1.00 39.85  ? 251  TYR C CD2 1 
ATOM   6293  C CE1 . TYR B 1 212 ? -29.255  -38.397 29.274  1.00 43.38  ? 251  TYR C CE1 1 
ATOM   6294  C CE2 . TYR B 1 212 ? -30.408  -40.358 30.000  1.00 47.39  ? 251  TYR C CE2 1 
ATOM   6295  C CZ  . TYR B 1 212 ? -29.259  -39.748 29.546  1.00 44.00  ? 251  TYR C CZ  1 
ATOM   6296  O OH  . TYR B 1 212 ? -28.116  -40.499 29.370  1.00 58.09  ? 251  TYR C OH  1 
ATOM   6297  N N   . THR B 1 213 ? -35.063  -35.488 31.548  1.00 27.95  ? 252  THR C N   1 
ATOM   6298  C CA  . THR B 1 213 ? -36.136  -34.508 31.387  1.00 33.62  ? 252  THR C CA  1 
ATOM   6299  C C   . THR B 1 213 ? -35.734  -33.148 31.946  1.00 36.18  ? 252  THR C C   1 
ATOM   6300  O O   . THR B 1 213 ? -36.097  -32.120 31.379  1.00 33.76  ? 252  THR C O   1 
ATOM   6301  C CB  . THR B 1 213 ? -37.476  -34.939 32.029  1.00 25.53  ? 252  THR C CB  1 
ATOM   6302  O OG1 . THR B 1 213 ? -37.320  -35.082 33.444  1.00 27.17  ? 252  THR C OG1 1 
ATOM   6303  C CG2 . THR B 1 213 ? -37.983  -36.239 31.413  1.00 27.47  ? 252  THR C CG2 1 
ATOM   6304  N N   . GLN B 1 214 ? -34.985  -33.151 33.049  1.00 31.21  ? 253  GLN C N   1 
ATOM   6305  C CA  . GLN B 1 214 ? -34.499  -31.910 33.652  1.00 32.29  ? 253  GLN C CA  1 
ATOM   6306  C C   . GLN B 1 214 ? -33.604  -31.147 32.686  1.00 32.05  ? 253  GLN C C   1 
ATOM   6307  O O   . GLN B 1 214 ? -33.596  -29.915 32.670  1.00 32.41  ? 253  GLN C O   1 
ATOM   6308  C CB  . GLN B 1 214 ? -33.734  -32.196 34.944  1.00 29.32  ? 253  GLN C CB  1 
ATOM   6309  C CG  . GLN B 1 214 ? -34.536  -32.949 35.986  1.00 29.49  ? 253  GLN C CG  1 
ATOM   6310  C CD  . GLN B 1 214 ? -35.913  -32.347 36.215  1.00 32.40  ? 253  GLN C CD  1 
ATOM   6311  O OE1 . GLN B 1 214 ? -36.070  -31.405 36.993  1.00 35.08  ? 253  GLN C OE1 1 
ATOM   6312  N NE2 . GLN B 1 214 ? -36.924  -32.896 35.542  1.00 30.07  ? 253  GLN C NE2 1 
ATOM   6313  N N   . GLN B 1 215 ? -32.838  -31.878 31.884  1.00 30.35  ? 254  GLN C N   1 
ATOM   6314  C CA  . GLN B 1 215 ? -32.006  -31.235 30.875  1.00 34.60  ? 254  GLN C CA  1 
ATOM   6315  C C   . GLN B 1 215 ? -32.874  -30.551 29.809  1.00 32.34  ? 254  GLN C C   1 
ATOM   6316  O O   . GLN B 1 215 ? -32.605  -29.419 29.399  1.00 29.95  ? 254  GLN C O   1 
ATOM   6317  C CB  . GLN B 1 215 ? -31.038  -32.253 30.256  1.00 34.18  ? 254  GLN C CB  1 
ATOM   6318  C CG  . GLN B 1 215 ? -29.914  -32.663 31.213  1.00 36.62  ? 254  GLN C CG  1 
ATOM   6319  C CD  . GLN B 1 215 ? -29.093  -33.834 30.706  1.00 60.36  ? 254  GLN C CD  1 
ATOM   6320  O OE1 . GLN B 1 215 ? -28.977  -34.052 29.497  1.00 55.93  ? 254  GLN C OE1 1 
ATOM   6321  N NE2 . GLN B 1 215 ? -28.518  -34.600 31.634  1.00 67.25  ? 254  GLN C NE2 1 
ATOM   6322  N N   . ILE B 1 216 ? -33.927  -31.237 29.377  1.00 33.62  ? 255  ILE C N   1 
ATOM   6323  C CA  . ILE B 1 216 ? -34.862  -30.651 28.420  1.00 32.93  ? 255  ILE C CA  1 
ATOM   6324  C C   . ILE B 1 216 ? -35.550  -29.407 29.001  1.00 25.78  ? 255  ILE C C   1 
ATOM   6325  O O   . ILE B 1 216 ? -35.601  -28.361 28.361  1.00 30.09  ? 255  ILE C O   1 
ATOM   6326  C CB  . ILE B 1 216 ? -35.898  -31.688 27.935  1.00 30.92  ? 255  ILE C CB  1 
ATOM   6327  C CG1 . ILE B 1 216 ? -35.179  -32.845 27.231  1.00 29.44  ? 255  ILE C CG1 1 
ATOM   6328  C CG2 . ILE B 1 216 ? -36.928  -31.040 26.997  1.00 23.69  ? 255  ILE C CG2 1 
ATOM   6329  C CD1 . ILE B 1 216 ? -36.130  -33.954 26.735  1.00 28.38  ? 255  ILE C CD1 1 
ATOM   6330  N N   . ILE B 1 217 ? -36.056  -29.514 30.221  1.00 24.31  ? 256  ILE C N   1 
ATOM   6331  C CA  . ILE B 1 217 ? -36.679  -28.367 30.874  1.00 30.22  ? 256  ILE C CA  1 
ATOM   6332  C C   . ILE B 1 217 ? -35.756  -27.141 30.867  1.00 30.71  ? 256  ILE C C   1 
ATOM   6333  O O   . ILE B 1 217 ? -36.181  -26.037 30.542  1.00 32.03  ? 256  ILE C O   1 
ATOM   6334  C CB  . ILE B 1 217 ? -37.114  -28.715 32.313  1.00 31.73  ? 256  ILE C CB  1 
ATOM   6335  C CG1 . ILE B 1 217 ? -38.287  -29.700 32.273  1.00 29.06  ? 256  ILE C CG1 1 
ATOM   6336  C CG2 . ILE B 1 217 ? -37.491  -27.446 33.094  1.00 23.16  ? 256  ILE C CG2 1 
ATOM   6337  C CD1 . ILE B 1 217 ? -38.711  -30.238 33.621  1.00 24.49  ? 256  ILE C CD1 1 
ATOM   6338  N N   . GLN B 1 218 ? -34.492  -27.342 31.220  1.00 31.80  ? 257  GLN C N   1 
ATOM   6339  C CA  . GLN B 1 218 ? -33.534  -26.246 31.212  1.00 37.54  ? 257  GLN C CA  1 
ATOM   6340  C C   . GLN B 1 218 ? -33.507  -25.569 29.846  1.00 34.88  ? 257  GLN C C   1 
ATOM   6341  O O   . GLN B 1 218 ? -33.575  -24.337 29.751  1.00 31.64  ? 257  GLN C O   1 
ATOM   6342  C CB  . GLN B 1 218 ? -32.131  -26.731 31.611  1.00 35.47  ? 257  GLN C CB  1 
ATOM   6343  C CG  . GLN B 1 218 ? -31.067  -25.664 31.442  1.00 45.81  ? 257  GLN C CG  1 
ATOM   6344  C CD  . GLN B 1 218 ? -29.814  -25.951 32.253  1.00 66.86  ? 257  GLN C CD  1 
ATOM   6345  O OE1 . GLN B 1 218 ? -29.592  -27.078 32.700  1.00 61.48  ? 257  GLN C OE1 1 
ATOM   6346  N NE2 . GLN B 1 218 ? -28.994  -24.924 32.456  1.00 74.94  ? 257  GLN C NE2 1 
ATOM   6347  N N   . GLY B 1 219 ? -33.426  -26.375 28.790  1.00 30.02  ? 258  GLY C N   1 
ATOM   6348  C CA  . GLY B 1 219 ? -33.465  -25.842 27.438  1.00 31.72  ? 258  GLY C CA  1 
ATOM   6349  C C   . GLY B 1 219 ? -34.730  -25.055 27.130  1.00 31.41  ? 258  GLY C C   1 
ATOM   6350  O O   . GLY B 1 219 ? -34.676  -24.008 26.496  1.00 31.01  ? 258  GLY C O   1 
ATOM   6351  N N   . ILE B 1 220 ? -35.876  -25.560 27.573  1.00 27.23  ? 259  ILE C N   1 
ATOM   6352  C CA  . ILE B 1 220 ? -37.145  -24.902 27.290  1.00 27.36  ? 259  ILE C CA  1 
ATOM   6353  C C   . ILE B 1 220 ? -37.226  -23.585 28.044  1.00 29.98  ? 259  ILE C C   1 
ATOM   6354  O O   . ILE B 1 220 ? -37.735  -22.589 27.525  1.00 26.01  ? 259  ILE C O   1 
ATOM   6355  C CB  . ILE B 1 220 ? -38.349  -25.782 27.688  1.00 25.32  ? 259  ILE C CB  1 
ATOM   6356  C CG1 . ILE B 1 220 ? -38.410  -27.026 26.795  1.00 21.94  ? 259  ILE C CG1 1 
ATOM   6357  C CG2 . ILE B 1 220 ? -39.656  -24.971 27.613  1.00 23.66  ? 259  ILE C CG2 1 
ATOM   6358  C CD1 . ILE B 1 220 ? -39.460  -28.025 27.234  1.00 27.99  ? 259  ILE C CD1 1 
ATOM   6359  N N   . GLN B 1 221 ? -36.714  -23.597 29.271  1.00 26.28  ? 260  GLN C N   1 
ATOM   6360  C CA  . GLN B 1 221 ? -36.658  -22.411 30.106  1.00 27.56  ? 260  GLN C CA  1 
ATOM   6361  C C   . GLN B 1 221 ? -35.832  -21.298 29.464  1.00 33.76  ? 260  GLN C C   1 
ATOM   6362  O O   . GLN B 1 221 ? -36.137  -20.123 29.640  1.00 32.40  ? 260  GLN C O   1 
ATOM   6363  C CB  . GLN B 1 221 ? -36.123  -22.761 31.498  1.00 31.99  ? 260  GLN C CB  1 
ATOM   6364  C CG  . GLN B 1 221 ? -37.210  -23.267 32.451  1.00 32.95  ? 260  GLN C CG  1 
ATOM   6365  C CD  . GLN B 1 221 ? -36.638  -23.856 33.741  1.00 55.39  ? 260  GLN C CD  1 
ATOM   6366  O OE1 . GLN B 1 221 ? -35.467  -24.250 33.792  1.00 41.14  ? 260  GLN C OE1 1 
ATOM   6367  N NE2 . GLN B 1 221 ? -37.464  -23.914 34.790  1.00 52.22  ? 260  GLN C NE2 1 
ATOM   6368  N N   . GLN B 1 222 ? -34.805  -21.677 28.702  1.00 29.72  ? 261  GLN C N   1 
ATOM   6369  C CA  . GLN B 1 222 ? -33.996  -20.712 27.957  1.00 28.75  ? 261  GLN C CA  1 
ATOM   6370  C C   . GLN B 1 222 ? -34.830  -20.059 26.853  1.00 31.13  ? 261  GLN C C   1 
ATOM   6371  O O   . GLN B 1 222 ? -34.792  -18.839 26.657  1.00 30.48  ? 261  GLN C O   1 
ATOM   6372  C CB  . GLN B 1 222 ? -32.764  -21.404 27.358  1.00 25.28  ? 261  GLN C CB  1 
ATOM   6373  C CG  . GLN B 1 222 ? -31.898  -20.513 26.465  1.00 36.11  ? 261  GLN C CG  1 
ATOM   6374  C CD  . GLN B 1 222 ? -31.194  -19.405 27.241  1.00 39.69  ? 261  GLN C CD  1 
ATOM   6375  O OE1 . GLN B 1 222 ? -31.006  -19.499 28.460  1.00 40.10  ? 261  GLN C OE1 1 
ATOM   6376  N NE2 . GLN B 1 222 ? -30.807  -18.348 26.537  1.00 37.00  ? 261  GLN C NE2 1 
ATOM   6377  N N   . LEU B 1 223 ? -35.578  -20.888 26.129  1.00 26.25  ? 262  LEU C N   1 
ATOM   6378  C CA  . LEU B 1 223 ? -36.462  -20.433 25.064  1.00 32.25  ? 262  LEU C CA  1 
ATOM   6379  C C   . LEU B 1 223 ? -37.518  -19.468 25.625  1.00 32.10  ? 262  LEU C C   1 
ATOM   6380  O O   . LEU B 1 223 ? -37.848  -18.440 25.021  1.00 27.84  ? 262  LEU C O   1 
ATOM   6381  C CB  . LEU B 1 223 ? -37.154  -21.652 24.445  1.00 38.21  ? 262  LEU C CB  1 
ATOM   6382  C CG  . LEU B 1 223 ? -37.058  -22.054 22.968  1.00 44.78  ? 262  LEU C CG  1 
ATOM   6383  C CD1 . LEU B 1 223 ? -35.771  -21.664 22.272  1.00 26.12  ? 262  LEU C CD1 1 
ATOM   6384  C CD2 . LEU B 1 223 ? -37.300  -23.548 22.849  1.00 38.23  ? 262  LEU C CD2 1 
ATOM   6385  N N   . VAL B 1 224 ? -38.044  -19.806 26.792  1.00 23.40  ? 263  VAL C N   1 
ATOM   6386  C CA  . VAL B 1 224 ? -39.015  -18.945 27.454  1.00 33.35  ? 263  VAL C CA  1 
ATOM   6387  C C   . VAL B 1 224 ? -38.385  -17.604 27.813  1.00 33.20  ? 263  VAL C C   1 
ATOM   6388  O O   . VAL B 1 224 ? -38.987  -16.547 27.612  1.00 28.60  ? 263  VAL C O   1 
ATOM   6389  C CB  . VAL B 1 224 ? -39.580  -19.632 28.713  1.00 29.07  ? 263  VAL C CB  1 
ATOM   6390  C CG1 . VAL B 1 224 ? -40.242  -18.618 29.660  1.00 29.94  ? 263  VAL C CG1 1 
ATOM   6391  C CG2 . VAL B 1 224 ? -40.546  -20.728 28.294  1.00 25.86  ? 263  VAL C CG2 1 
ATOM   6392  N N   . LYS B 1 225 ? -37.161  -17.651 28.333  1.00 32.17  ? 264  LYS C N   1 
ATOM   6393  C CA  . LYS B 1 225 ? -36.480  -16.436 28.757  1.00 27.32  ? 264  LYS C CA  1 
ATOM   6394  C C   . LYS B 1 225 ? -36.252  -15.491 27.570  1.00 35.71  ? 264  LYS C C   1 
ATOM   6395  O O   . LYS B 1 225 ? -36.517  -14.286 27.655  1.00 34.54  ? 264  LYS C O   1 
ATOM   6396  C CB  . LYS B 1 225 ? -35.158  -16.768 29.456  1.00 32.51  ? 264  LYS C CB  1 
ATOM   6397  C CG  . LYS B 1 225 ? -34.356  -15.527 29.869  1.00 41.71  ? 264  LYS C CG  1 
ATOM   6398  C CD  . LYS B 1 225 ? -33.068  -15.875 30.616  1.00 40.32  ? 264  LYS C CD  1 
ATOM   6399  C CE  . LYS B 1 225 ? -32.140  -16.731 29.769  1.00 41.65  ? 264  LYS C CE  1 
ATOM   6400  N NZ  . LYS B 1 225 ? -30.760  -16.819 30.345  1.00 56.69  ? 264  LYS C NZ  1 
ATOM   6401  N N   . GLU B 1 226 ? -35.796  -16.045 26.452  1.00 30.59  ? 265  GLU C N   1 
ATOM   6402  C CA  . GLU B 1 226 ? -35.534  -15.241 25.265  1.00 29.40  ? 265  GLU C CA  1 
ATOM   6403  C C   . GLU B 1 226 ? -36.812  -14.691 24.658  1.00 35.59  ? 265  GLU C C   1 
ATOM   6404  O O   . GLU B 1 226 ? -36.851  -13.539 24.206  1.00 37.99  ? 265  GLU C O   1 
ATOM   6405  C CB  . GLU B 1 226 ? -34.771  -16.060 24.217  1.00 30.63  ? 265  GLU C CB  1 
ATOM   6406  C CG  . GLU B 1 226 ? -33.350  -16.379 24.637  1.00 35.28  ? 265  GLU C CG  1 
ATOM   6407  C CD  . GLU B 1 226 ? -32.595  -17.237 23.623  1.00 37.00  ? 265  GLU C CD  1 
ATOM   6408  O OE1 . GLU B 1 226 ? -32.981  -17.289 22.432  1.00 38.75  ? 265  GLU C OE1 1 
ATOM   6409  O OE2 . GLU B 1 226 ? -31.604  -17.858 24.033  1.00 37.46  ? 265  GLU C OE2 1 
ATOM   6410  N N   . THR B 1 227 ? -37.862  -15.509 24.661  1.00 29.38  ? 266  THR C N   1 
ATOM   6411  C CA  . THR B 1 227 ? -39.102  -15.142 23.996  1.00 27.94  ? 266  THR C CA  1 
ATOM   6412  C C   . THR B 1 227 ? -39.801  -14.002 24.721  1.00 31.57  ? 266  THR C C   1 
ATOM   6413  O O   . THR B 1 227 ? -40.411  -13.148 24.088  1.00 34.11  ? 266  THR C O   1 
ATOM   6414  C CB  . THR B 1 227 ? -40.067  -16.358 23.857  1.00 29.08  ? 266  THR C CB  1 
ATOM   6415  O OG1 . THR B 1 227 ? -39.458  -17.348 23.022  1.00 36.71  ? 266  THR C OG1 1 
ATOM   6416  C CG2 . THR B 1 227 ? -41.384  -15.938 23.221  1.00 37.15  ? 266  THR C CG2 1 
ATOM   6417  N N   . GLY B 1 228 ? -39.708  -13.992 26.047  1.00 29.17  ? 267  GLY C N   1 
ATOM   6418  C CA  . GLY B 1 228 ? -40.394  -12.990 26.842  1.00 31.92  ? 267  GLY C CA  1 
ATOM   6419  C C   . GLY B 1 228 ? -41.901  -13.226 26.854  1.00 39.40  ? 267  GLY C C   1 
ATOM   6420  O O   . GLY B 1 228 ? -42.657  -12.534 26.171  1.00 36.94  ? 267  GLY C O   1 
ATOM   6421  N N   . VAL B 1 229 ? -42.323  -14.211 27.640  1.00 30.20  ? 268  VAL C N   1 
ATOM   6422  C CA  . VAL B 1 229 ? -43.702  -14.678 27.657  1.00 30.70  ? 268  VAL C CA  1 
ATOM   6423  C C   . VAL B 1 229 ? -44.514  -13.942 28.719  1.00 29.58  ? 268  VAL C C   1 
ATOM   6424  O O   . VAL B 1 229 ? -44.113  -13.864 29.882  1.00 30.60  ? 268  VAL C O   1 
ATOM   6425  C CB  . VAL B 1 229 ? -43.761  -16.199 27.963  1.00 32.31  ? 268  VAL C CB  1 
ATOM   6426  C CG1 . VAL B 1 229 ? -45.206  -16.691 28.031  1.00 29.34  ? 268  VAL C CG1 1 
ATOM   6427  C CG2 . VAL B 1 229 ? -42.955  -17.002 26.927  1.00 29.40  ? 268  VAL C CG2 1 
ATOM   6428  N N   . THR B 1 230 ? -45.649  -13.399 28.308  1.00 26.32  ? 269  THR C N   1 
ATOM   6429  C CA  . THR B 1 230 ? -46.635  -12.863 29.242  1.00 28.21  ? 269  THR C CA  1 
ATOM   6430  C C   . THR B 1 230 ? -47.901  -13.723 29.175  1.00 34.63  ? 269  THR C C   1 
ATOM   6431  O O   . THR B 1 230 ? -48.587  -13.763 28.153  1.00 31.86  ? 269  THR C O   1 
ATOM   6432  C CB  . THR B 1 230 ? -46.967  -11.396 28.915  1.00 33.21  ? 269  THR C CB  1 
ATOM   6433  O OG1 . THR B 1 230 ? -45.781  -10.595 29.059  1.00 40.07  ? 269  THR C OG1 1 
ATOM   6434  C CG2 . THR B 1 230 ? -48.047  -10.870 29.848  1.00 37.95  ? 269  THR C CG2 1 
ATOM   6435  N N   . LYS B 1 231 ? -48.193  -14.448 30.246  1.00 23.74  ? 270  LYS C N   1 
ATOM   6436  C CA  . LYS B 1 231 ? -49.414  -15.242 30.272  1.00 28.83  ? 270  LYS C CA  1 
ATOM   6437  C C   . LYS B 1 231 ? -50.654  -14.339 30.270  1.00 33.66  ? 270  LYS C C   1 
ATOM   6438  O O   . LYS B 1 231 ? -50.633  -13.244 30.830  1.00 33.92  ? 270  LYS C O   1 
ATOM   6439  C CB  . LYS B 1 231 ? -49.425  -16.161 31.494  1.00 26.03  ? 270  LYS C CB  1 
ATOM   6440  C CG  . LYS B 1 231 ? -48.339  -17.229 31.485  1.00 29.54  ? 270  LYS C CG  1 
ATOM   6441  C CD  . LYS B 1 231 ? -48.424  -18.107 30.224  1.00 27.47  ? 270  LYS C CD  1 
ATOM   6442  C CE  . LYS B 1 231 ? -47.467  -19.306 30.324  1.00 26.87  ? 270  LYS C CE  1 
ATOM   6443  N NZ  . LYS B 1 231 ? -47.558  -20.195 29.136  1.00 27.62  ? 270  LYS C NZ  1 
ATOM   6444  N N   . ARG B 1 232 ? -51.725  -14.796 29.632  1.00 30.81  ? 271  ARG C N   1 
ATOM   6445  C CA  . ARG B 1 232 ? -52.990  -14.068 29.650  1.00 34.88  ? 271  ARG C CA  1 
ATOM   6446  C C   . ARG B 1 232 ? -53.526  -14.022 31.079  1.00 36.10  ? 271  ARG C C   1 
ATOM   6447  O O   . ARG B 1 232 ? -53.134  -14.831 31.917  1.00 30.91  ? 271  ARG C O   1 
ATOM   6448  C CB  . ARG B 1 232 ? -54.027  -14.784 28.783  1.00 29.64  ? 271  ARG C CB  1 
ATOM   6449  C CG  . ARG B 1 232 ? -54.558  -16.068 29.444  1.00 31.13  ? 271  ARG C CG  1 
ATOM   6450  C CD  . ARG B 1 232 ? -55.557  -16.801 28.564  1.00 30.88  ? 271  ARG C CD  1 
ATOM   6451  N NE  . ARG B 1 232 ? -54.980  -17.179 27.276  1.00 33.57  ? 271  ARG C NE  1 
ATOM   6452  C CZ  . ARG B 1 232 ? -55.637  -17.838 26.323  1.00 33.10  ? 271  ARG C CZ  1 
ATOM   6453  N NH1 . ARG B 1 232 ? -56.906  -18.193 26.509  1.00 27.78  ? 271  ARG C NH1 1 
ATOM   6454  N NH2 . ARG B 1 232 ? -55.025  -18.135 25.182  1.00 26.82  ? 271  ARG C NH2 1 
ATOM   6455  N N   . THR B 1 233 ? -54.422  -13.079 31.353  1.00 32.14  ? 272  THR C N   1 
ATOM   6456  C CA  . THR B 1 233 ? -55.273  -13.171 32.540  1.00 32.05  ? 272  THR C CA  1 
ATOM   6457  C C   . THR B 1 233 ? -56.625  -13.738 32.122  1.00 34.16  ? 272  THR C C   1 
ATOM   6458  O O   . THR B 1 233 ? -57.376  -13.078 31.402  1.00 33.84  ? 272  THR C O   1 
ATOM   6459  C CB  . THR B 1 233 ? -55.524  -11.799 33.178  1.00 42.77  ? 272  THR C CB  1 
ATOM   6460  O OG1 . THR B 1 233 ? -54.273  -11.152 33.435  1.00 40.69  ? 272  THR C OG1 1 
ATOM   6461  C CG2 . THR B 1 233 ? -56.311  -11.955 34.494  1.00 40.81  ? 272  THR C CG2 1 
ATOM   6462  N N   . PRO B 1 234 ? -56.942  -14.968 32.559  1.00 32.22  ? 273  PRO C N   1 
ATOM   6463  C CA  . PRO B 1 234 ? -58.221  -15.535 32.132  1.00 30.52  ? 273  PRO C CA  1 
ATOM   6464  C C   . PRO B 1 234 ? -59.372  -14.638 32.575  1.00 40.20  ? 273  PRO C C   1 
ATOM   6465  O O   . PRO B 1 234 ? -59.285  -14.001 33.620  1.00 33.98  ? 273  PRO C O   1 
ATOM   6466  C CB  . PRO B 1 234 ? -58.279  -16.875 32.875  1.00 33.75  ? 273  PRO C CB  1 
ATOM   6467  C CG  . PRO B 1 234 ? -56.823  -17.216 33.158  1.00 36.23  ? 273  PRO C CG  1 
ATOM   6468  C CD  . PRO B 1 234 ? -56.184  -15.881 33.435  1.00 27.24  ? 273  PRO C CD  1 
ATOM   6469  N N   . GLN B 1 235 ? -60.433  -14.584 31.781  1.00 38.02  ? 274  GLN C N   1 
ATOM   6470  C CA  . GLN B 1 235 ? -61.611  -13.829 32.167  1.00 40.20  ? 274  GLN C CA  1 
ATOM   6471  C C   . GLN B 1 235 ? -62.011  -14.242 33.587  1.00 45.10  ? 274  GLN C C   1 
ATOM   6472  O O   . GLN B 1 235 ? -62.276  -13.397 34.437  1.00 43.79  ? 274  GLN C O   1 
ATOM   6473  C CB  . GLN B 1 235 ? -62.739  -14.091 31.171  1.00 45.61  ? 274  GLN C CB  1 
ATOM   6474  C CG  . GLN B 1 235 ? -64.107  -13.626 31.616  1.00 48.99  ? 274  GLN C CG  1 
ATOM   6475  C CD  . GLN B 1 235 ? -65.178  -13.928 30.579  1.00 60.06  ? 274  GLN C CD  1 
ATOM   6476  O OE1 . GLN B 1 235 ? -64.889  -14.069 29.385  1.00 56.23  ? 274  GLN C OE1 1 
ATOM   6477  N NE2 . GLN B 1 235 ? -66.423  -14.036 31.032  1.00 55.80  ? 274  GLN C NE2 1 
ATOM   6478  N N   . LYS B 1 236 ? -62.028  -15.546 33.842  1.00 39.99  ? 275  LYS C N   1 
ATOM   6479  C CA  . LYS B 1 236 ? -62.277  -16.066 35.188  1.00 38.36  ? 275  LYS C CA  1 
ATOM   6480  C C   . LYS B 1 236 ? -61.777  -17.504 35.336  1.00 41.08  ? 275  LYS C C   1 
ATOM   6481  O O   . LYS B 1 236 ? -61.936  -18.324 34.427  1.00 33.52  ? 275  LYS C O   1 
ATOM   6482  C CB  . LYS B 1 236 ? -63.774  -16.015 35.522  1.00 46.74  ? 275  LYS C CB  1 
ATOM   6483  C CG  . LYS B 1 236 ? -64.148  -16.746 36.816  1.00 49.44  ? 275  LYS C CG  1 
ATOM   6484  C CD  . LYS B 1 236 ? -65.615  -16.556 37.174  1.00 57.92  ? 275  LYS C CD  1 
ATOM   6485  C CE  . LYS B 1 236 ? -65.897  -17.007 38.605  1.00 55.35  ? 275  LYS C CE  1 
ATOM   6486  N NZ  . LYS B 1 236 ? -64.950  -16.384 39.584  1.00 53.08  ? 275  LYS C NZ  1 
ATOM   6487  N N   . LEU B 1 237 ? -61.169  -17.800 36.479  1.00 37.23  ? 276  LEU C N   1 
ATOM   6488  C CA  . LEU B 1 237 ? -60.866  -19.176 36.848  1.00 41.70  ? 276  LEU C CA  1 
ATOM   6489  C C   . LEU B 1 237 ? -62.018  -19.718 37.680  1.00 38.82  ? 276  LEU C C   1 
ATOM   6490  O O   . LEU B 1 237 ? -62.369  -19.161 38.715  1.00 41.20  ? 276  LEU C O   1 
ATOM   6491  C CB  . LEU B 1 237 ? -59.555  -19.258 37.630  1.00 42.63  ? 276  LEU C CB  1 
ATOM   6492  C CG  . LEU B 1 237 ? -58.310  -18.927 36.805  1.00 38.90  ? 276  LEU C CG  1 
ATOM   6493  C CD1 . LEU B 1 237 ? -57.083  -18.880 37.687  1.00 45.66  ? 276  LEU C CD1 1 
ATOM   6494  C CD2 . LEU B 1 237 ? -58.140  -19.950 35.692  1.00 31.76  ? 276  LEU C CD2 1 
ATOM   6495  N N   . PHE B 1 238 ? -62.605  -20.813 37.226  1.00 34.89  ? 277  PHE C N   1 
ATOM   6496  C CA  . PHE B 1 238 ? -63.854  -21.273 37.810  1.00 40.15  ? 277  PHE C CA  1 
ATOM   6497  C C   . PHE B 1 238 ? -63.673  -22.149 39.042  1.00 34.31  ? 277  PHE C C   1 
ATOM   6498  O O   . PHE B 1 238 ? -64.226  -23.246 39.120  1.00 40.65  ? 277  PHE C O   1 
ATOM   6499  C CB  . PHE B 1 238 ? -64.692  -21.979 36.752  1.00 39.90  ? 277  PHE C CB  1 
ATOM   6500  C CG  . PHE B 1 238 ? -65.218  -21.058 35.702  1.00 48.09  ? 277  PHE C CG  1 
ATOM   6501  C CD1 . PHE B 1 238 ? -66.460  -20.451 35.852  1.00 52.12  ? 277  PHE C CD1 1 
ATOM   6502  C CD2 . PHE B 1 238 ? -64.467  -20.781 34.570  1.00 39.11  ? 277  PHE C CD2 1 
ATOM   6503  C CE1 . PHE B 1 238 ? -66.947  -19.586 34.887  1.00 52.17  ? 277  PHE C CE1 1 
ATOM   6504  C CE2 . PHE B 1 238 ? -64.947  -19.923 33.600  1.00 43.74  ? 277  PHE C CE2 1 
ATOM   6505  C CZ  . PHE B 1 238 ? -66.191  -19.320 33.759  1.00 55.19  ? 277  PHE C CZ  1 
ATOM   6506  N N   . THR B 1 239 ? -62.885  -21.665 39.994  1.00 38.42  ? 278  THR C N   1 
ATOM   6507  C CA  . THR B 1 239 ? -62.803  -22.298 41.301  1.00 44.55  ? 278  THR C CA  1 
ATOM   6508  C C   . THR B 1 239 ? -63.845  -21.638 42.214  1.00 39.66  ? 278  THR C C   1 
ATOM   6509  O O   . THR B 1 239 ? -63.970  -20.418 42.224  1.00 43.79  ? 278  THR C O   1 
ATOM   6510  C CB  . THR B 1 239 ? -61.403  -22.146 41.902  1.00 38.84  ? 278  THR C CB  1 
ATOM   6511  O OG1 . THR B 1 239 ? -61.110  -20.760 42.066  1.00 45.95  ? 278  THR C OG1 1 
ATOM   6512  C CG2 . THR B 1 239 ? -60.359  -22.760 40.983  1.00 42.31  ? 278  THR C CG2 1 
ATOM   6513  N N   . PRO B 1 240 ? -64.607  -22.446 42.970  1.00 41.06  ? 279  PRO C N   1 
ATOM   6514  C CA  . PRO B 1 240 ? -65.685  -21.912 43.819  1.00 41.96  ? 279  PRO C CA  1 
ATOM   6515  C C   . PRO B 1 240 ? -65.182  -20.929 44.878  1.00 35.45  ? 279  PRO C C   1 
ATOM   6516  O O   . PRO B 1 240 ? -64.111  -21.129 45.445  1.00 38.49  ? 279  PRO C O   1 
ATOM   6517  C CB  . PRO B 1 240 ? -66.265  -23.164 44.488  1.00 32.54  ? 279  PRO C CB  1 
ATOM   6518  C CG  . PRO B 1 240 ? -65.179  -24.193 44.395  1.00 41.44  ? 279  PRO C CG  1 
ATOM   6519  C CD  . PRO B 1 240 ? -64.477  -23.908 43.093  1.00 38.42  ? 279  PRO C CD  1 
ATOM   6520  N N   . SER B 1 241 ? -65.950  -19.877 45.132  1.00 39.70  ? 280  SER C N   1 
ATOM   6521  C CA  . SER B 1 241 ? -65.536  -18.859 46.087  1.00 48.02  ? 280  SER C CA  1 
ATOM   6522  C C   . SER B 1 241 ? -65.280  -19.499 47.441  1.00 42.33  ? 280  SER C C   1 
ATOM   6523  O O   . SER B 1 241 ? -65.981  -20.426 47.833  1.00 35.89  ? 280  SER C O   1 
ATOM   6524  C CB  . SER B 1 241 ? -66.606  -17.783 46.229  1.00 47.82  ? 280  SER C CB  1 
ATOM   6525  O OG  . SER B 1 241 ? -67.671  -18.277 47.014  1.00 40.16  ? 280  SER C OG  1 
ATOM   6526  N N   . PRO B 1 242 ? -64.252  -19.014 48.151  1.00 43.36  ? 281  PRO C N   1 
ATOM   6527  C CA  . PRO B 1 242 ? -63.947  -19.520 49.493  1.00 43.89  ? 281  PRO C CA  1 
ATOM   6528  C C   . PRO B 1 242 ? -65.183  -19.420 50.383  1.00 44.99  ? 281  PRO C C   1 
ATOM   6529  O O   . PRO B 1 242 ? -65.426  -20.279 51.241  1.00 38.61  ? 281  PRO C O   1 
ATOM   6530  C CB  . PRO B 1 242 ? -62.867  -18.559 49.991  1.00 42.52  ? 281  PRO C CB  1 
ATOM   6531  C CG  . PRO B 1 242 ? -62.212  -18.051 48.748  1.00 50.31  ? 281  PRO C CG  1 
ATOM   6532  C CD  . PRO B 1 242 ? -63.280  -18.009 47.689  1.00 40.90  ? 281  PRO C CD  1 
ATOM   6533  N N   . GLU B 1 243 ? -65.968  -18.375 50.163  1.00 36.25  ? 282  GLU C N   1 
ATOM   6534  C CA  . GLU B 1 243 ? -67.135  -18.135 50.995  1.00 41.76  ? 282  GLU C CA  1 
ATOM   6535  C C   . GLU B 1 243 ? -68.171  -19.254 50.873  1.00 42.25  ? 282  GLU C C   1 
ATOM   6536  O O   . GLU B 1 243 ? -68.743  -19.692 51.870  1.00 35.14  ? 282  GLU C O   1 
ATOM   6537  C CB  . GLU B 1 243 ? -67.762  -16.782 50.671  1.00 45.86  ? 282  GLU C CB  1 
ATOM   6538  C CG  . GLU B 1 243 ? -68.665  -16.252 51.766  1.00 60.11  ? 282  GLU C CG  1 
ATOM   6539  C CD  . GLU B 1 243 ? -69.532  -15.091 51.302  1.00 76.23  ? 282  GLU C CD  1 
ATOM   6540  O OE1 . GLU B 1 243 ? -69.584  -14.838 50.077  1.00 76.54  ? 282  GLU C OE1 1 
ATOM   6541  O OE2 . GLU B 1 243 ? -70.165  -14.436 52.160  1.00 79.19  ? 282  GLU C OE2 1 
ATOM   6542  N N   . ILE B 1 244 ? -68.429  -19.735 49.663  1.00 38.09  ? 283  ILE C N   1 
ATOM   6543  C CA  . ILE B 1 244 ? -69.437  -20.779 49.571  1.00 41.97  ? 283  ILE C CA  1 
ATOM   6544  C C   . ILE B 1 244 ? -68.860  -22.184 49.818  1.00 39.26  ? 283  ILE C C   1 
ATOM   6545  O O   . ILE B 1 244 ? -69.579  -23.080 50.259  1.00 35.78  ? 283  ILE C O   1 
ATOM   6546  C CB  . ILE B 1 244 ? -70.326  -20.678 48.289  1.00 43.86  ? 283  ILE C CB  1 
ATOM   6547  C CG1 . ILE B 1 244 ? -70.130  -21.884 47.386  1.00 35.53  ? 283  ILE C CG1 1 
ATOM   6548  C CG2 . ILE B 1 244 ? -70.163  -19.332 47.578  1.00 45.55  ? 283  ILE C CG2 1 
ATOM   6549  C CD1 . ILE B 1 244 ? -71.262  -22.880 47.536  1.00 50.75  ? 283  ILE C CD1 1 
ATOM   6550  N N   . VAL B 1 245 ? -67.563  -22.371 49.578  1.00 33.09  ? 284  VAL C N   1 
ATOM   6551  C CA  . VAL B 1 245 ? -66.931  -23.618 50.000  1.00 33.27  ? 284  VAL C CA  1 
ATOM   6552  C C   . VAL B 1 245 ? -67.006  -23.760 51.524  1.00 29.61  ? 284  VAL C C   1 
ATOM   6553  O O   . VAL B 1 245 ? -67.328  -24.826 52.031  1.00 30.51  ? 284  VAL C O   1 
ATOM   6554  C CB  . VAL B 1 245 ? -65.469  -23.749 49.528  1.00 37.87  ? 284  VAL C CB  1 
ATOM   6555  C CG1 . VAL B 1 245 ? -64.766  -24.887 50.277  1.00 39.31  ? 284  VAL C CG1 1 
ATOM   6556  C CG2 . VAL B 1 245 ? -65.421  -24.001 48.012  1.00 43.62  ? 284  VAL C CG2 1 
ATOM   6557  N N   . LYS B 1 246 ? -66.731  -22.679 52.251  1.00 31.43  ? 285  LYS C N   1 
ATOM   6558  C CA  . LYS B 1 246 ? -66.826  -22.726 53.715  1.00 40.99  ? 285  LYS C CA  1 
ATOM   6559  C C   . LYS B 1 246 ? -68.230  -23.089 54.202  1.00 35.77  ? 285  LYS C C   1 
ATOM   6560  O O   . LYS B 1 246 ? -68.402  -23.966 55.046  1.00 36.51  ? 285  LYS C O   1 
ATOM   6561  C CB  . LYS B 1 246 ? -66.413  -21.399 54.342  1.00 37.42  ? 285  LYS C CB  1 
ATOM   6562  C CG  . LYS B 1 246 ? -66.601  -21.373 55.854  1.00 33.36  ? 285  LYS C CG  1 
ATOM   6563  C CD  . LYS B 1 246 ? -66.141  -20.040 56.419  1.00 49.25  ? 285  LYS C CD  1 
ATOM   6564  C CE  . LYS B 1 246 ? -65.928  -20.119 57.921  1.00 59.82  ? 285  LYS C CE  1 
ATOM   6565  N NZ  . LYS B 1 246 ? -64.861  -21.111 58.288  1.00 64.48  ? 285  LYS C NZ  1 
ATOM   6566  N N   . TYR B 1 247 ? -69.232  -22.393 53.684  1.00 33.65  ? 286  TYR C N   1 
ATOM   6567  C CA  . TYR B 1 247 ? -70.601  -22.660 54.083  1.00 35.70  ? 286  TYR C CA  1 
ATOM   6568  C C   . TYR B 1 247 ? -70.964  -24.123 53.752  1.00 40.36  ? 286  TYR C C   1 
ATOM   6569  O O   . TYR B 1 247 ? -71.562  -24.829 54.571  1.00 36.77  ? 286  TYR C O   1 
ATOM   6570  C CB  . TYR B 1 247 ? -71.557  -21.644 53.445  1.00 37.72  ? 286  TYR C CB  1 
ATOM   6571  C CG  . TYR B 1 247 ? -72.947  -21.653 54.043  1.00 49.90  ? 286  TYR C CG  1 
ATOM   6572  C CD1 . TYR B 1 247 ? -73.245  -20.908 55.183  1.00 48.55  ? 286  TYR C CD1 1 
ATOM   6573  C CD2 . TYR B 1 247 ? -73.963  -22.408 53.469  1.00 43.20  ? 286  TYR C CD2 1 
ATOM   6574  C CE1 . TYR B 1 247 ? -74.523  -20.922 55.731  1.00 54.17  ? 286  TYR C CE1 1 
ATOM   6575  C CE2 . TYR B 1 247 ? -75.238  -22.430 54.008  1.00 40.57  ? 286  TYR C CE2 1 
ATOM   6576  C CZ  . TYR B 1 247 ? -75.514  -21.689 55.135  1.00 57.13  ? 286  TYR C CZ  1 
ATOM   6577  O OH  . TYR B 1 247 ? -76.790  -21.718 55.658  1.00 59.64  ? 286  TYR C OH  1 
ATOM   6578  N N   . THR B 1 248 ? -70.558  -24.587 52.573  1.00 36.31  ? 287  THR C N   1 
ATOM   6579  C CA  . THR B 1 248 ? -70.771  -25.982 52.177  1.00 32.73  ? 287  THR C CA  1 
ATOM   6580  C C   . THR B 1 248 ? -70.092  -26.936 53.160  1.00 38.29  ? 287  THR C C   1 
ATOM   6581  O O   . THR B 1 248 ? -70.709  -27.887 53.636  1.00 31.47  ? 287  THR C O   1 
ATOM   6582  C CB  . THR B 1 248 ? -70.243  -26.244 50.745  1.00 38.17  ? 287  THR C CB  1 
ATOM   6583  O OG1 . THR B 1 248 ? -70.790  -25.268 49.844  1.00 31.54  ? 287  THR C OG1 1 
ATOM   6584  C CG2 . THR B 1 248 ? -70.621  -27.644 50.267  1.00 30.26  ? 287  THR C CG2 1 
ATOM   6585  N N   . HIS B 1 249 ? -68.820  -26.661 53.458  1.00 33.94  ? 288  HIS C N   1 
ATOM   6586  C CA  . HIS B 1 249 ? -68.036  -27.433 54.424  1.00 38.41  ? 288  HIS C CA  1 
ATOM   6587  C C   . HIS B 1 249 ? -68.752  -27.530 55.777  1.00 32.46  ? 288  HIS C C   1 
ATOM   6588  O O   . HIS B 1 249 ? -68.938  -28.613 56.315  1.00 32.25  ? 288  HIS C O   1 
ATOM   6589  C CB  . HIS B 1 249 ? -66.654  -26.789 54.595  1.00 33.65  ? 288  HIS C CB  1 
ATOM   6590  C CG  . HIS B 1 249 ? -65.678  -27.610 55.388  1.00 37.18  ? 288  HIS C CG  1 
ATOM   6591  N ND1 . HIS B 1 249 ? -65.418  -28.936 55.115  1.00 38.62  ? 288  HIS C ND1 1 
ATOM   6592  C CD2 . HIS B 1 249 ? -64.870  -27.282 56.423  1.00 38.02  ? 288  HIS C CD2 1 
ATOM   6593  C CE1 . HIS B 1 249 ? -64.512  -29.392 55.958  1.00 36.61  ? 288  HIS C CE1 1 
ATOM   6594  N NE2 . HIS B 1 249 ? -64.160  -28.406 56.764  1.00 37.39  ? 288  HIS C NE2 1 
ATOM   6595  N N   . LYS B 1 250 ? -69.164  -26.389 56.315  1.00 29.87  ? 289  LYS C N   1 
ATOM   6596  C CA  . LYS B 1 250 ? -69.869  -26.368 57.595  1.00 37.60  ? 289  LYS C CA  1 
ATOM   6597  C C   . LYS B 1 250 ? -71.159  -27.192 57.534  1.00 36.25  ? 289  LYS C C   1 
ATOM   6598  O O   . LYS B 1 250 ? -71.493  -27.937 58.460  1.00 36.80  ? 289  LYS C O   1 
ATOM   6599  C CB  . LYS B 1 250 ? -70.172  -24.920 58.015  1.00 36.24  ? 289  LYS C CB  1 
ATOM   6600  C CG  . LYS B 1 250 ? -68.914  -24.057 58.198  1.00 40.83  ? 289  LYS C CG  1 
ATOM   6601  C CD  . LYS B 1 250 ? -69.246  -22.561 58.297  1.00 42.72  ? 289  LYS C CD  1 
ATOM   6602  C CE  . LYS B 1 250 ? -70.247  -22.265 59.413  1.00 45.30  ? 289  LYS C CE  1 
ATOM   6603  N NZ  . LYS B 1 250 ? -69.786  -22.803 60.725  1.00 43.81  ? 289  LYS C NZ  1 
ATOM   6604  N N   . LEU B 1 251 ? -71.881  -27.065 56.430  1.00 34.71  ? 290  LEU C N   1 
ATOM   6605  C CA  . LEU B 1 251 ? -73.172  -27.720 56.306  1.00 34.90  ? 290  LEU C CA  1 
ATOM   6606  C C   . LEU B 1 251 ? -73.048  -29.240 56.180  1.00 36.17  ? 290  LEU C C   1 
ATOM   6607  O O   . LEU B 1 251 ? -73.821  -29.979 56.781  1.00 31.19  ? 290  LEU C O   1 
ATOM   6608  C CB  . LEU B 1 251 ? -73.914  -27.146 55.102  1.00 38.14  ? 290  LEU C CB  1 
ATOM   6609  C CG  . LEU B 1 251 ? -75.435  -27.011 55.141  1.00 57.62  ? 290  LEU C CG  1 
ATOM   6610  C CD1 . LEU B 1 251 ? -75.946  -26.699 56.544  1.00 54.86  ? 290  LEU C CD1 1 
ATOM   6611  C CD2 . LEU B 1 251 ? -75.852  -25.929 54.154  1.00 46.09  ? 290  LEU C CD2 1 
ATOM   6612  N N   . ALA B 1 252 ? -72.060  -29.708 55.424  1.00 36.46  ? 291  ALA C N   1 
ATOM   6613  C CA  . ALA B 1 252 ? -72.056  -31.106 54.973  1.00 38.59  ? 291  ALA C CA  1 
ATOM   6614  C C   . ALA B 1 252 ? -70.985  -32.029 55.558  1.00 34.17  ? 291  ALA C C   1 
ATOM   6615  O O   . ALA B 1 252 ? -71.117  -33.254 55.465  1.00 32.52  ? 291  ALA C O   1 
ATOM   6616  C CB  . ALA B 1 252 ? -72.002  -31.162 53.438  1.00 38.16  ? 291  ALA C CB  1 
ATOM   6617  N N   . MET B 1 253 ? -69.923  -31.464 56.133  1.00 33.58  ? 292  MET C N   1 
ATOM   6618  C CA  . MET B 1 253 ? -68.779  -32.293 56.527  1.00 32.40  ? 292  MET C CA  1 
ATOM   6619  C C   . MET B 1 253 ? -69.141  -33.456 57.456  1.00 32.60  ? 292  MET C C   1 
ATOM   6620  O O   . MET B 1 253 ? -68.648  -34.579 57.297  1.00 30.50  ? 292  MET C O   1 
ATOM   6621  C CB  . MET B 1 253 ? -67.642  -31.453 57.118  1.00 31.35  ? 292  MET C CB  1 
ATOM   6622  C CG  . MET B 1 253 ? -67.900  -30.864 58.495  1.00 28.15  ? 292  MET C CG  1 
ATOM   6623  S SD  . MET B 1 253 ? -66.482  -29.882 59.035  1.00 37.52  ? 292  MET C SD  1 
ATOM   6624  C CE  . MET B 1 253 ? -66.968  -29.463 60.713  1.00 31.19  ? 292  MET C CE  1 
ATOM   6625  N N   . GLU B 1 254 ? -70.010  -33.199 58.423  1.00 36.86  ? 293  GLU C N   1 
ATOM   6626  C CA  . GLU B 1 254 ? -70.404  -34.263 59.336  1.00 37.02  ? 293  GLU C CA  1 
ATOM   6627  C C   . GLU B 1 254 ? -71.066  -35.437 58.613  1.00 34.17  ? 293  GLU C C   1 
ATOM   6628  O O   . GLU B 1 254 ? -70.674  -36.583 58.811  1.00 32.06  ? 293  GLU C O   1 
ATOM   6629  C CB  . GLU B 1 254 ? -71.297  -33.718 60.447  1.00 33.04  ? 293  GLU C CB  1 
ATOM   6630  C CG  . GLU B 1 254 ? -70.540  -32.819 61.434  1.00 38.80  ? 293  GLU C CG  1 
ATOM   6631  C CD  . GLU B 1 254 ? -71.411  -32.344 62.591  1.00 46.39  ? 293  GLU C CD  1 
ATOM   6632  O OE1 . GLU B 1 254 ? -72.597  -32.753 62.661  1.00 45.99  ? 293  GLU C OE1 1 
ATOM   6633  O OE2 . GLU B 1 254 ? -70.910  -31.562 63.430  1.00 41.27  ? 293  GLU C OE2 1 
ATOM   6634  N N   . ARG B 1 255 ? -72.071  -35.157 57.786  1.00 37.25  ? 294  ARG C N   1 
ATOM   6635  C CA  . ARG B 1 255 ? -72.776  -36.229 57.074  1.00 38.61  ? 294  ARG C CA  1 
ATOM   6636  C C   . ARG B 1 255 ? -71.842  -36.952 56.107  1.00 31.56  ? 294  ARG C C   1 
ATOM   6637  O O   . ARG B 1 255 ? -71.907  -38.166 55.972  1.00 35.46  ? 294  ARG C O   1 
ATOM   6638  C CB  . ARG B 1 255 ? -74.015  -35.693 56.341  1.00 29.92  ? 294  ARG C CB  1 
ATOM   6639  C CG  . ARG B 1 255 ? -75.219  -35.482 57.252  1.00 36.31  ? 294  ARG C CG  1 
ATOM   6640  C CD  . ARG B 1 255 ? -75.878  -34.111 57.043  1.00 52.55  ? 294  ARG C CD  1 
ATOM   6641  N NE  . ARG B 1 255 ? -76.816  -34.027 55.917  1.00 59.78  ? 294  ARG C NE  1 
ATOM   6642  C CZ  . ARG B 1 255 ? -77.600  -35.016 55.484  1.00 51.94  ? 294  ARG C CZ  1 
ATOM   6643  N NH1 . ARG B 1 255 ? -77.577  -36.207 56.069  1.00 69.16  ? 294  ARG C NH1 1 
ATOM   6644  N NH2 . ARG B 1 255 ? -78.420  -34.811 54.458  1.00 46.89  ? 294  ARG C NH2 1 
ATOM   6645  N N   . LEU B 1 256 ? -70.956  -36.204 55.455  1.00 28.94  ? 295  LEU C N   1 
ATOM   6646  C CA  . LEU B 1 256 ? -70.022  -36.807 54.514  1.00 32.52  ? 295  LEU C CA  1 
ATOM   6647  C C   . LEU B 1 256 ? -69.061  -37.708 55.275  1.00 34.99  ? 295  LEU C C   1 
ATOM   6648  O O   . LEU B 1 256 ? -68.794  -38.839 54.856  1.00 31.24  ? 295  LEU C O   1 
ATOM   6649  C CB  . LEU B 1 256 ? -69.251  -35.740 53.727  1.00 28.49  ? 295  LEU C CB  1 
ATOM   6650  C CG  . LEU B 1 256 ? -70.024  -34.998 52.637  1.00 37.21  ? 295  LEU C CG  1 
ATOM   6651  C CD1 . LEU B 1 256 ? -69.218  -33.815 52.110  1.00 33.44  ? 295  LEU C CD1 1 
ATOM   6652  C CD2 . LEU B 1 256 ? -70.388  -35.957 51.519  1.00 32.85  ? 295  LEU C CD2 1 
ATOM   6653  N N   . TYR B 1 257 ? -68.554  -37.213 56.405  1.00 36.56  ? 296  TYR C N   1 
ATOM   6654  C CA  . TYR B 1 257 ? -67.645  -38.008 57.230  1.00 34.96  ? 296  TYR C CA  1 
ATOM   6655  C C   . TYR B 1 257 ? -68.340  -39.313 57.618  1.00 37.51  ? 296  TYR C C   1 
ATOM   6656  O O   . TYR B 1 257 ? -67.752  -40.390 57.530  1.00 34.16  ? 296  TYR C O   1 
ATOM   6657  C CB  . TYR B 1 257 ? -67.183  -37.250 58.486  1.00 33.38  ? 296  TYR C CB  1 
ATOM   6658  C CG  . TYR B 1 257 ? -66.288  -38.088 59.381  1.00 32.85  ? 296  TYR C CG  1 
ATOM   6659  C CD1 . TYR B 1 257 ? -64.908  -37.941 59.352  1.00 42.00  ? 296  TYR C CD1 1 
ATOM   6660  C CD2 . TYR B 1 257 ? -66.827  -39.054 60.226  1.00 38.04  ? 296  TYR C CD2 1 
ATOM   6661  C CE1 . TYR B 1 257 ? -64.085  -38.727 60.154  1.00 37.26  ? 296  TYR C CE1 1 
ATOM   6662  C CE2 . TYR B 1 257 ? -66.020  -39.837 61.031  1.00 38.66  ? 296  TYR C CE2 1 
ATOM   6663  C CZ  . TYR B 1 257 ? -64.650  -39.668 60.992  1.00 41.90  ? 296  TYR C CZ  1 
ATOM   6664  O OH  . TYR B 1 257 ? -63.846  -40.448 61.793  1.00 42.32  ? 296  TYR C OH  1 
ATOM   6665  N N   . ALA B 1 258 ? -69.597  -39.212 58.037  1.00 32.79  ? 297  ALA C N   1 
ATOM   6666  C CA  . ALA B 1 258 ? -70.354  -40.401 58.402  1.00 40.55  ? 297  ALA C CA  1 
ATOM   6667  C C   . ALA B 1 258 ? -70.405  -41.394 57.234  1.00 39.41  ? 297  ALA C C   1 
ATOM   6668  O O   . ALA B 1 258 ? -70.150  -42.585 57.409  1.00 34.97  ? 297  ALA C O   1 
ATOM   6669  C CB  . ALA B 1 258 ? -71.761  -40.029 58.871  1.00 38.34  ? 297  ALA C CB  1 
ATOM   6670  N N   . VAL B 1 259 ? -70.712  -40.903 56.038  1.00 35.17  ? 298  VAL C N   1 
ATOM   6671  C CA  . VAL B 1 259 ? -70.779  -41.797 54.888  1.00 35.48  ? 298  VAL C CA  1 
ATOM   6672  C C   . VAL B 1 259 ? -69.435  -42.471 54.616  1.00 32.67  ? 298  VAL C C   1 
ATOM   6673  O O   . VAL B 1 259 ? -69.373  -43.689 54.407  1.00 31.91  ? 298  VAL C O   1 
ATOM   6674  C CB  . VAL B 1 259 ? -71.315  -41.092 53.626  1.00 41.33  ? 298  VAL C CB  1 
ATOM   6675  C CG1 . VAL B 1 259 ? -71.061  -41.942 52.399  1.00 39.41  ? 298  VAL C CG1 1 
ATOM   6676  C CG2 . VAL B 1 259 ? -72.809  -40.814 53.779  1.00 30.70  ? 298  VAL C CG2 1 
ATOM   6677  N N   . PHE B 1 260 ? -68.357  -41.696 54.673  1.00 31.82  ? 299  PHE C N   1 
ATOM   6678  C CA  . PHE B 1 260 ? -67.054  -42.217 54.294  1.00 32.01  ? 299  PHE C CA  1 
ATOM   6679  C C   . PHE B 1 260 ? -66.409  -43.095 55.372  1.00 37.07  ? 299  PHE C C   1 
ATOM   6680  O O   . PHE B 1 260 ? -65.416  -43.763 55.111  1.00 36.65  ? 299  PHE C O   1 
ATOM   6681  C CB  . PHE B 1 260 ? -66.128  -41.090 53.837  1.00 36.14  ? 299  PHE C CB  1 
ATOM   6682  C CG  . PHE B 1 260 ? -66.596  -40.398 52.577  1.00 39.96  ? 299  PHE C CG  1 
ATOM   6683  C CD1 . PHE B 1 260 ? -67.287  -41.100 51.605  1.00 33.82  ? 299  PHE C CD1 1 
ATOM   6684  C CD2 . PHE B 1 260 ? -66.345  -39.048 52.369  1.00 31.55  ? 299  PHE C CD2 1 
ATOM   6685  C CE1 . PHE B 1 260 ? -67.727  -40.473 50.447  1.00 29.86  ? 299  PHE C CE1 1 
ATOM   6686  C CE2 . PHE B 1 260 ? -66.774  -38.416 51.210  1.00 42.95  ? 299  PHE C CE2 1 
ATOM   6687  C CZ  . PHE B 1 260 ? -67.465  -39.131 50.246  1.00 33.12  ? 299  PHE C CZ  1 
ATOM   6688  N N   . THR B 1 261 ? -66.987  -43.112 56.569  1.00 39.18  ? 300  THR C N   1 
ATOM   6689  C CA  . THR B 1 261 ? -66.539  -44.033 57.616  1.00 35.36  ? 300  THR C CA  1 
ATOM   6690  C C   . THR B 1 261 ? -67.578  -45.137 57.868  1.00 41.51  ? 300  THR C C   1 
ATOM   6691  O O   . THR B 1 261 ? -67.490  -45.890 58.845  1.00 39.66  ? 300  THR C O   1 
ATOM   6692  C CB  . THR B 1 261 ? -66.269  -43.302 58.929  1.00 40.65  ? 300  THR C CB  1 
ATOM   6693  O OG1 . THR B 1 261 ? -67.430  -42.533 59.281  1.00 38.25  ? 300  THR C OG1 1 
ATOM   6694  C CG2 . THR B 1 261 ? -65.041  -42.373 58.791  1.00 36.71  ? 300  THR C CG2 1 
ATOM   6695  N N   . ASP B 1 262 ? -68.566  -45.224 56.984  1.00 40.47  ? 301  ASP C N   1 
ATOM   6696  C CA  . ASP B 1 262 ? -69.544  -46.308 57.052  1.00 43.39  ? 301  ASP C CA  1 
ATOM   6697  C C   . ASP B 1 262 ? -69.077  -47.442 56.154  1.00 41.88  ? 301  ASP C C   1 
ATOM   6698  O O   . ASP B 1 262 ? -69.341  -47.446 54.950  1.00 46.26  ? 301  ASP C O   1 
ATOM   6699  C CB  . ASP B 1 262 ? -70.932  -45.824 56.624  1.00 38.26  ? 301  ASP C CB  1 
ATOM   6700  C CG  . ASP B 1 262 ? -71.984  -46.929 56.682  1.00 42.05  ? 301  ASP C CG  1 
ATOM   6701  O OD1 . ASP B 1 262 ? -71.617  -48.108 56.855  1.00 42.95  ? 301  ASP C OD1 1 
ATOM   6702  O OD2 . ASP B 1 262 ? -73.185  -46.611 56.548  1.00 45.35  ? 301  ASP C OD2 1 
ATOM   6703  N N   . TYR B 1 263 ? -68.396  -48.410 56.757  1.00 46.16  ? 302  TYR C N   1 
ATOM   6704  C CA  . TYR B 1 263 ? -67.760  -49.499 56.023  1.00 48.44  ? 302  TYR C CA  1 
ATOM   6705  C C   . TYR B 1 263 ? -68.731  -50.551 55.469  1.00 54.50  ? 302  TYR C C   1 
ATOM   6706  O O   . TYR B 1 263 ? -68.301  -51.549 54.886  1.00 64.95  ? 302  TYR C O   1 
ATOM   6707  C CB  . TYR B 1 263 ? -66.692  -50.154 56.905  1.00 49.85  ? 302  TYR C CB  1 
ATOM   6708  C CG  . TYR B 1 263 ? -65.775  -49.142 57.567  1.00 51.19  ? 302  TYR C CG  1 
ATOM   6709  C CD1 . TYR B 1 263 ? -65.313  -49.334 58.865  1.00 50.67  ? 302  TYR C CD1 1 
ATOM   6710  C CD2 . TYR B 1 263 ? -65.375  -47.989 56.891  1.00 47.90  ? 302  TYR C CD2 1 
ATOM   6711  C CE1 . TYR B 1 263 ? -64.481  -48.414 59.473  1.00 57.74  ? 302  TYR C CE1 1 
ATOM   6712  C CE2 . TYR B 1 263 ? -64.539  -47.058 57.492  1.00 50.93  ? 302  TYR C CE2 1 
ATOM   6713  C CZ  . TYR B 1 263 ? -64.097  -47.277 58.784  1.00 62.66  ? 302  TYR C CZ  1 
ATOM   6714  O OH  . TYR B 1 263 ? -63.271  -46.357 59.386  1.00 55.48  ? 302  TYR C OH  1 
ATOM   6715  N N   . GLU B 1 264 ? -70.032  -50.326 55.630  1.00 49.10  ? 303  GLU C N   1 
ATOM   6716  C CA  . GLU B 1 264 ? -71.027  -51.280 55.139  1.00 60.78  ? 303  GLU C CA  1 
ATOM   6717  C C   . GLU B 1 264 ? -71.545  -50.911 53.751  1.00 58.46  ? 303  GLU C C   1 
ATOM   6718  O O   . GLU B 1 264 ? -72.321  -51.659 53.149  1.00 54.57  ? 303  GLU C O   1 
ATOM   6719  C CB  . GLU B 1 264 ? -72.202  -51.405 56.114  1.00 56.73  ? 303  GLU C CB  1 
ATOM   6720  C CG  . GLU B 1 264 ? -71.801  -51.714 57.551  1.00 72.99  ? 303  GLU C CG  1 
ATOM   6721  C CD  . GLU B 1 264 ? -71.119  -53.067 57.704  1.00 87.18  ? 303  GLU C CD  1 
ATOM   6722  O OE1 . GLU B 1 264 ? -71.620  -53.893 58.503  1.00 89.58  ? 303  GLU C OE1 1 
ATOM   6723  O OE2 . GLU B 1 264 ? -70.078  -53.302 57.042  1.00 75.83  ? 303  GLU C OE2 1 
ATOM   6724  N N   . HIS B 1 265 ? -71.122  -49.753 53.254  1.00 47.21  ? 304  HIS C N   1 
ATOM   6725  C CA  . HIS B 1 265 ? -71.508  -49.306 51.922  1.00 47.81  ? 304  HIS C CA  1 
ATOM   6726  C C   . HIS B 1 265 ? -70.861  -50.126 50.811  1.00 40.37  ? 304  HIS C C   1 
ATOM   6727  O O   . HIS B 1 265 ? -69.719  -50.575 50.942  1.00 44.87  ? 304  HIS C O   1 
ATOM   6728  C CB  . HIS B 1 265 ? -71.134  -47.836 51.720  1.00 40.48  ? 304  HIS C CB  1 
ATOM   6729  C CG  . HIS B 1 265 ? -72.153  -46.873 52.237  1.00 42.61  ? 304  HIS C CG  1 
ATOM   6730  N ND1 . HIS B 1 265 ? -73.497  -46.983 51.946  1.00 39.71  ? 304  HIS C ND1 1 
ATOM   6731  C CD2 . HIS B 1 265 ? -72.027  -45.769 53.011  1.00 46.21  ? 304  HIS C CD2 1 
ATOM   6732  C CE1 . HIS B 1 265 ? -74.153  -45.993 52.523  1.00 47.10  ? 304  HIS C CE1 1 
ATOM   6733  N NE2 . HIS B 1 265 ? -73.281  -45.237 53.173  1.00 44.68  ? 304  HIS C NE2 1 
ATOM   6734  N N   . ASP B 1 266 ? -71.605  -50.317 49.721  1.00 41.13  ? 305  ASP C N   1 
ATOM   6735  C CA  . ASP B 1 266 ? -71.025  -50.756 48.455  1.00 44.75  ? 305  ASP C CA  1 
ATOM   6736  C C   . ASP B 1 266 ? -70.989  -49.534 47.542  1.00 41.01  ? 305  ASP C C   1 
ATOM   6737  O O   . ASP B 1 266 ? -71.407  -48.443 47.945  1.00 37.31  ? 305  ASP C O   1 
ATOM   6738  C CB  . ASP B 1 266 ? -71.852  -51.875 47.812  1.00 45.13  ? 305  ASP C CB  1 
ATOM   6739  C CG  . ASP B 1 266 ? -73.024  -51.342 47.007  1.00 45.80  ? 305  ASP C CG  1 
ATOM   6740  O OD1 . ASP B 1 266 ? -73.977  -50.836 47.634  1.00 44.51  ? 305  ASP C OD1 1 
ATOM   6741  O OD2 . ASP B 1 266 ? -72.986  -51.417 45.750  1.00 43.90  ? 305  ASP C OD2 1 
ATOM   6742  N N   . LYS B 1 267 ? -70.504  -49.710 46.316  1.00 38.38  ? 306  LYS C N   1 
ATOM   6743  C CA  . LYS B 1 267 ? -70.344  -48.577 45.409  1.00 40.28  ? 306  LYS C CA  1 
ATOM   6744  C C   . LYS B 1 267 ? -71.600  -47.729 45.317  1.00 42.09  ? 306  LYS C C   1 
ATOM   6745  O O   . LYS B 1 267 ? -71.547  -46.512 45.489  1.00 46.79  ? 306  LYS C O   1 
ATOM   6746  C CB  . LYS B 1 267 ? -69.949  -49.028 44.001  1.00 33.19  ? 306  LYS C CB  1 
ATOM   6747  C CG  . LYS B 1 267 ? -69.748  -47.846 43.042  1.00 39.01  ? 306  LYS C CG  1 
ATOM   6748  C CD  . LYS B 1 267 ? -69.624  -48.274 41.583  1.00 41.07  ? 306  LYS C CD  1 
ATOM   6749  C CE  . LYS B 1 267 ? -69.532  -47.055 40.660  1.00 45.63  ? 306  LYS C CE  1 
ATOM   6750  N NZ  . LYS B 1 267 ? -69.448  -47.452 39.220  1.00 44.27  ? 306  LYS C NZ  1 
ATOM   6751  N N   . VAL B 1 268 ? -72.729  -48.376 45.042  1.00 41.24  ? 307  VAL C N   1 
ATOM   6752  C CA  . VAL B 1 268 ? -73.970  -47.655 44.792  1.00 40.59  ? 307  VAL C CA  1 
ATOM   6753  C C   . VAL B 1 268 ? -74.581  -47.006 46.043  1.00 38.25  ? 307  VAL C C   1 
ATOM   6754  O O   . VAL B 1 268 ? -74.941  -45.830 46.015  1.00 34.75  ? 307  VAL C O   1 
ATOM   6755  C CB  . VAL B 1 268 ? -74.995  -48.537 44.060  1.00 49.06  ? 307  VAL C CB  1 
ATOM   6756  C CG1 . VAL B 1 268 ? -76.342  -47.815 43.943  1.00 40.13  ? 307  VAL C CG1 1 
ATOM   6757  C CG2 . VAL B 1 268 ? -74.449  -48.920 42.682  1.00 38.24  ? 307  VAL C CG2 1 
ATOM   6758  N N   . SER B 1 269 ? -74.686  -47.756 47.137  1.00 46.11  ? 308  SER C N   1 
ATOM   6759  C CA  . SER B 1 269 ? -75.241  -47.180 48.361  1.00 38.86  ? 308  SER C CA  1 
ATOM   6760  C C   . SER B 1 269 ? -74.438  -45.947 48.787  1.00 41.11  ? 308  SER C C   1 
ATOM   6761  O O   . SER B 1 269 ? -75.019  -44.954 49.227  1.00 36.51  ? 308  SER C O   1 
ATOM   6762  C CB  . SER B 1 269 ? -75.355  -48.217 49.497  1.00 39.50  ? 308  SER C CB  1 
ATOM   6763  O OG  . SER B 1 269 ? -74.095  -48.730 49.922  1.00 43.83  ? 308  SER C OG  1 
ATOM   6764  N N   . ARG B 1 270 ? -73.115  -45.995 48.618  1.00 38.93  ? 309  ARG C N   1 
ATOM   6765  C CA  . ARG B 1 270 ? -72.260  -44.863 49.000  1.00 36.53  ? 309  ARG C CA  1 
ATOM   6766  C C   . ARG B 1 270 ? -72.488  -43.650 48.111  1.00 36.40  ? 309  ARG C C   1 
ATOM   6767  O O   . ARG B 1 270 ? -72.579  -42.520 48.603  1.00 32.23  ? 309  ARG C O   1 
ATOM   6768  C CB  . ARG B 1 270 ? -70.776  -45.239 48.993  1.00 36.69  ? 309  ARG C CB  1 
ATOM   6769  C CG  . ARG B 1 270 ? -69.890  -44.209 49.702  1.00 34.39  ? 309  ARG C CG  1 
ATOM   6770  C CD  . ARG B 1 270 ? -68.517  -44.796 50.005  1.00 37.50  ? 309  ARG C CD  1 
ATOM   6771  N NE  . ARG B 1 270 ? -68.069  -45.549 48.862  1.00 48.12  ? 309  ARG C NE  1 
ATOM   6772  C CZ  . ARG B 1 270 ? -67.700  -46.822 48.887  1.00 48.82  ? 309  ARG C CZ  1 
ATOM   6773  N NH1 . ARG B 1 270 ? -67.675  -47.514 50.024  1.00 44.47  ? 309  ARG C NH1 1 
ATOM   6774  N NH2 . ARG B 1 270 ? -67.338  -47.392 47.754  1.00 46.39  ? 309  ARG C NH2 1 
ATOM   6775  N N   . ASP B 1 271 ? -72.577  -43.880 46.803  1.00 38.40  ? 310  ASP C N   1 
ATOM   6776  C CA  . ASP B 1 271 ? -72.864  -42.792 45.870  1.00 42.49  ? 310  ASP C CA  1 
ATOM   6777  C C   . ASP B 1 271 ? -74.266  -42.201 46.095  1.00 35.16  ? 310  ASP C C   1 
ATOM   6778  O O   . ASP B 1 271 ? -74.472  -40.998 45.957  1.00 37.36  ? 310  ASP C O   1 
ATOM   6779  C CB  . ASP B 1 271 ? -72.702  -43.259 44.415  1.00 44.24  ? 310  ASP C CB  1 
ATOM   6780  C CG  . ASP B 1 271 ? -71.247  -43.493 44.031  1.00 41.78  ? 310  ASP C CG  1 
ATOM   6781  O OD1 . ASP B 1 271 ? -70.351  -42.921 44.694  1.00 42.94  ? 310  ASP C OD1 1 
ATOM   6782  O OD2 . ASP B 1 271 ? -71.002  -44.240 43.060  1.00 45.62  ? 310  ASP C OD2 1 
ATOM   6783  N N   . GLU B 1 272 ? -75.228  -43.045 46.440  1.00 37.95  ? 311  GLU C N   1 
ATOM   6784  C CA  . GLU B 1 272 ? -76.570  -42.545 46.731  1.00 39.38  ? 311  GLU C CA  1 
ATOM   6785  C C   . GLU B 1 272 ? -76.587  -41.718 48.014  1.00 38.64  ? 311  GLU C C   1 
ATOM   6786  O O   . GLU B 1 272 ? -77.154  -40.629 48.049  1.00 43.45  ? 311  GLU C O   1 
ATOM   6787  C CB  . GLU B 1 272 ? -77.574  -43.694 46.773  1.00 40.31  ? 311  GLU C CB  1 
ATOM   6788  C CG  . GLU B 1 272 ? -78.045  -44.072 45.371  1.00 55.06  ? 311  GLU C CG  1 
ATOM   6789  C CD  . GLU B 1 272 ? -78.673  -45.448 45.275  1.00 67.57  ? 311  GLU C CD  1 
ATOM   6790  O OE1 . GLU B 1 272 ? -78.900  -45.894 44.125  1.00 57.96  ? 311  GLU C OE1 1 
ATOM   6791  O OE2 . GLU B 1 272 ? -78.937  -46.079 46.329  1.00 63.08  ? 311  GLU C OE2 1 
ATOM   6792  N N   . ALA B 1 273 ? -75.931  -42.224 49.052  1.00 34.87  ? 312  ALA C N   1 
ATOM   6793  C CA  . ALA B 1 273 ? -75.811  -41.497 50.310  1.00 37.46  ? 312  ALA C CA  1 
ATOM   6794  C C   . ALA B 1 273 ? -75.119  -40.137 50.098  1.00 35.70  ? 312  ALA C C   1 
ATOM   6795  O O   . ALA B 1 273 ? -75.577  -39.112 50.591  1.00 39.17  ? 312  ALA C O   1 
ATOM   6796  C CB  . ALA B 1 273 ? -75.059  -42.345 51.333  1.00 34.15  ? 312  ALA C CB  1 
ATOM   6797  N N   . VAL B 1 274 ? -74.029  -40.123 49.339  1.00 35.26  ? 313  VAL C N   1 
ATOM   6798  C CA  . VAL B 1 274 ? -73.370  -38.865 49.031  1.00 32.54  ? 313  VAL C CA  1 
ATOM   6799  C C   . VAL B 1 274 ? -74.316  -37.931 48.277  1.00 38.60  ? 313  VAL C C   1 
ATOM   6800  O O   . VAL B 1 274 ? -74.406  -36.737 48.583  1.00 37.09  ? 313  VAL C O   1 
ATOM   6801  C CB  . VAL B 1 274 ? -72.075  -39.072 48.225  1.00 32.82  ? 313  VAL C CB  1 
ATOM   6802  C CG1 . VAL B 1 274 ? -71.579  -37.748 47.660  1.00 34.77  ? 313  VAL C CG1 1 
ATOM   6803  C CG2 . VAL B 1 274 ? -71.005  -39.691 49.094  1.00 37.22  ? 313  VAL C CG2 1 
ATOM   6804  N N   . ASN B 1 275 ? -75.026  -38.479 47.296  1.00 40.33  ? 314  ASN C N   1 
ATOM   6805  C CA  . ASN B 1 275 ? -75.932  -37.678 46.475  1.00 37.00  ? 314  ASN C CA  1 
ATOM   6806  C C   . ASN B 1 275 ? -77.090  -37.086 47.277  1.00 36.55  ? 314  ASN C C   1 
ATOM   6807  O O   . ASN B 1 275 ? -77.495  -35.953 47.038  1.00 38.71  ? 314  ASN C O   1 
ATOM   6808  C CB  . ASN B 1 275 ? -76.472  -38.492 45.294  1.00 39.70  ? 314  ASN C CB  1 
ATOM   6809  C CG  . ASN B 1 275 ? -77.195  -37.626 44.278  1.00 53.65  ? 314  ASN C CG  1 
ATOM   6810  O OD1 . ASN B 1 275 ? -76.567  -36.991 43.433  1.00 56.46  ? 314  ASN C OD1 1 
ATOM   6811  N ND2 . ASN B 1 275 ? -78.517  -37.585 44.369  1.00 47.76  ? 314  ASN C ND2 1 
ATOM   6812  N N   . LYS B 1 276 ? -77.631  -37.856 48.218  1.00 35.07  ? 315  LYS C N   1 
ATOM   6813  C CA  . LYS B 1 276 ? -78.652  -37.336 49.127  1.00 35.85  ? 315  LYS C CA  1 
ATOM   6814  C C   . LYS B 1 276 ? -78.151  -36.076 49.858  1.00 37.91  ? 315  LYS C C   1 
ATOM   6815  O O   . LYS B 1 276 ? -78.829  -35.049 49.899  1.00 38.60  ? 315  LYS C O   1 
ATOM   6816  C CB  . LYS B 1 276 ? -79.066  -38.412 50.134  1.00 39.84  ? 315  LYS C CB  1 
ATOM   6817  C CG  . LYS B 1 276 ? -80.126  -37.956 51.121  1.00 49.95  ? 315  LYS C CG  1 
ATOM   6818  C CD  . LYS B 1 276 ? -81.232  -37.208 50.388  1.00 57.37  ? 315  LYS C CD  1 
ATOM   6819  C CE  . LYS B 1 276 ? -82.357  -36.788 51.319  1.00 72.83  ? 315  LYS C CE  1 
ATOM   6820  N NZ  . LYS B 1 276 ? -83.397  -35.999 50.586  1.00 77.02  ? 315  LYS C NZ  1 
ATOM   6821  N N   . ILE B 1 277 ? -76.953  -36.159 50.430  1.00 39.21  ? 316  ILE C N   1 
ATOM   6822  C CA  . ILE B 1 277 ? -76.368  -35.013 51.115  1.00 40.06  ? 316  ILE C CA  1 
ATOM   6823  C C   . ILE B 1 277 ? -76.225  -33.851 50.146  1.00 37.97  ? 316  ILE C C   1 
ATOM   6824  O O   . ILE B 1 277 ? -76.466  -32.699 50.504  1.00 39.44  ? 316  ILE C O   1 
ATOM   6825  C CB  . ILE B 1 277 ? -74.985  -35.345 51.710  1.00 39.20  ? 316  ILE C CB  1 
ATOM   6826  C CG1 . ILE B 1 277 ? -75.083  -36.558 52.632  1.00 38.95  ? 316  ILE C CG1 1 
ATOM   6827  C CG2 . ILE B 1 277 ? -74.411  -34.132 52.460  1.00 34.18  ? 316  ILE C CG2 1 
ATOM   6828  C CD1 . ILE B 1 277 ? -73.737  -37.137 53.032  1.00 40.77  ? 316  ILE C CD1 1 
ATOM   6829  N N   . ARG B 1 278 ? -75.841  -34.166 48.911  1.00 38.34  ? 317  ARG C N   1 
ATOM   6830  C CA  . ARG B 1 278 ? -75.644  -33.151 47.881  1.00 45.05  ? 317  ARG C CA  1 
ATOM   6831  C C   . ARG B 1 278 ? -76.935  -32.404 47.605  1.00 44.38  ? 317  ARG C C   1 
ATOM   6832  O O   . ARG B 1 278 ? -76.958  -31.174 47.515  1.00 45.40  ? 317  ARG C O   1 
ATOM   6833  C CB  . ARG B 1 278 ? -75.158  -33.779 46.573  1.00 44.12  ? 317  ARG C CB  1 
ATOM   6834  C CG  . ARG B 1 278 ? -74.930  -32.740 45.476  1.00 42.95  ? 317  ARG C CG  1 
ATOM   6835  C CD  . ARG B 1 278 ? -74.911  -33.388 44.116  1.00 35.67  ? 317  ARG C CD  1 
ATOM   6836  N NE  . ARG B 1 278 ? -74.313  -34.717 44.193  1.00 56.09  ? 317  ARG C NE  1 
ATOM   6837  C CZ  . ARG B 1 278 ? -73.022  -34.967 44.011  1.00 55.06  ? 317  ARG C CZ  1 
ATOM   6838  N NH1 . ARG B 1 278 ? -72.193  -33.971 43.730  1.00 58.75  ? 317  ARG C NH1 1 
ATOM   6839  N NH2 . ARG B 1 278 ? -72.561  -36.211 44.110  1.00 50.10  ? 317  ARG C NH2 1 
ATOM   6840  N N   . LEU B 1 279 ? -78.010  -33.163 47.466  1.00 39.93  ? 318  LEU C N   1 
ATOM   6841  C CA  . LEU B 1 279 ? -79.293  -32.575 47.138  1.00 51.98  ? 318  LEU C CA  1 
ATOM   6842  C C   . LEU B 1 279 ? -79.829  -31.760 48.306  1.00 49.42  ? 318  LEU C C   1 
ATOM   6843  O O   . LEU B 1 279 ? -80.301  -30.649 48.105  1.00 51.22  ? 318  LEU C O   1 
ATOM   6844  C CB  . LEU B 1 279 ? -80.289  -33.647 46.677  1.00 44.03  ? 318  LEU C CB  1 
ATOM   6845  C CG  . LEU B 1 279 ? -80.007  -34.214 45.277  1.00 51.01  ? 318  LEU C CG  1 
ATOM   6846  C CD1 . LEU B 1 279 ? -80.863  -35.442 44.978  1.00 54.33  ? 318  LEU C CD1 1 
ATOM   6847  C CD2 . LEU B 1 279 ? -80.198  -33.153 44.203  1.00 53.46  ? 318  LEU C CD2 1 
ATOM   6848  N N   . ASP B 1 280 ? -79.734  -32.298 49.521  1.00 55.85  ? 319  ASP C N   1 
ATOM   6849  C CA  . ASP B 1 280 ? -80.189  -31.580 50.716  1.00 51.44  ? 319  ASP C CA  1 
ATOM   6850  C C   . ASP B 1 280 ? -79.401  -30.292 50.955  1.00 51.08  ? 319  ASP C C   1 
ATOM   6851  O O   . ASP B 1 280 ? -79.899  -29.365 51.586  1.00 63.66  ? 319  ASP C O   1 
ATOM   6852  C CB  . ASP B 1 280 ? -80.082  -32.455 51.975  1.00 55.03  ? 319  ASP C CB  1 
ATOM   6853  C CG  . ASP B 1 280 ? -81.111  -33.584 52.016  1.00 61.94  ? 319  ASP C CG  1 
ATOM   6854  O OD1 . ASP B 1 280 ? -82.198  -33.450 51.407  1.00 66.15  ? 319  ASP C OD1 1 
ATOM   6855  O OD2 . ASP B 1 280 ? -80.832  -34.608 52.681  1.00 58.14  ? 319  ASP C OD2 1 
ATOM   6856  N N   . THR B 1 281 ? -78.166  -30.242 50.466  1.00 51.90  ? 320  THR C N   1 
ATOM   6857  C CA  . THR B 1 281 ? -77.275  -29.127 50.778  1.00 45.36  ? 320  THR C CA  1 
ATOM   6858  C C   . THR B 1 281 ? -77.156  -28.111 49.637  1.00 62.81  ? 320  THR C C   1 
ATOM   6859  O O   . THR B 1 281 ? -77.057  -26.901 49.883  1.00 41.14  ? 320  THR C O   1 
ATOM   6860  C CB  . THR B 1 281 ? -75.867  -29.605 51.214  1.00 45.80  ? 320  THR C CB  1 
ATOM   6861  O OG1 . THR B 1 281 ? -75.302  -30.441 50.201  1.00 58.86  ? 320  THR C OG1 1 
ATOM   6862  C CG2 . THR B 1 281 ? -75.940  -30.392 52.517  1.00 49.68  ? 320  THR C CG2 1 
ATOM   6863  N N   . GLU B 1 282 ? -77.162  -28.596 48.395  1.00 56.74  ? 321  GLU C N   1 
ATOM   6864  C CA  . GLU B 1 282 ? -77.198  -27.693 47.246  1.00 54.51  ? 321  GLU C CA  1 
ATOM   6865  C C   . GLU B 1 282 ? -78.476  -26.847 47.283  1.00 49.75  ? 321  GLU C C   1 
ATOM   6866  O O   . GLU B 1 282 ? -78.473  -25.679 46.884  1.00 52.51  ? 321  GLU C O   1 
ATOM   6867  C CB  . GLU B 1 282 ? -77.048  -28.454 45.920  1.00 49.60  ? 321  GLU C CB  1 
ATOM   6868  C CG  . GLU B 1 282 ? -75.604  -28.860 45.621  1.00 52.41  ? 321  GLU C CG  1 
ATOM   6869  C CD  . GLU B 1 282 ? -75.453  -29.686 44.349  1.00 60.83  ? 321  GLU C CD  1 
ATOM   6870  O OE1 . GLU B 1 282 ? -76.461  -29.882 43.631  1.00 57.25  ? 321  GLU C OE1 1 
ATOM   6871  O OE2 . GLU B 1 282 ? -74.316  -30.147 44.076  1.00 51.89  ? 321  GLU C OE2 1 
ATOM   6872  N N   . GLU B 1 283 ? -79.555  -27.423 47.802  1.00 51.54  ? 322  GLU C N   1 
ATOM   6873  C CA  . GLU B 1 283 ? -80.785  -26.657 48.007  1.00 56.38  ? 322  GLU C CA  1 
ATOM   6874  C C   . GLU B 1 283 ? -80.558  -25.469 48.941  1.00 54.45  ? 322  GLU C C   1 
ATOM   6875  O O   . GLU B 1 283 ? -80.996  -24.354 48.659  1.00 58.79  ? 322  GLU C O   1 
ATOM   6876  C CB  . GLU B 1 283 ? -81.903  -27.551 48.553  1.00 63.49  ? 322  GLU C CB  1 
ATOM   6877  C CG  . GLU B 1 283 ? -83.024  -26.795 49.283  1.00 76.53  ? 322  GLU C CG  1 
ATOM   6878  C CD  . GLU B 1 283 ? -83.884  -25.936 48.359  1.00 86.83  ? 322  GLU C CD  1 
ATOM   6879  O OE1 . GLU B 1 283 ? -83.673  -25.977 47.126  1.00 85.24  ? 322  GLU C OE1 1 
ATOM   6880  O OE2 . GLU B 1 283 ? -84.778  -25.219 48.868  1.00 84.31  ? 322  GLU C OE2 1 
ATOM   6881  N N   . GLN B 1 284 ? -79.873  -25.711 50.054  1.00 59.28  ? 323  GLN C N   1 
ATOM   6882  C CA  . GLN B 1 284 ? -79.614  -24.656 51.035  1.00 57.19  ? 323  GLN C CA  1 
ATOM   6883  C C   . GLN B 1 284 ? -78.608  -23.616 50.538  1.00 46.92  ? 323  GLN C C   1 
ATOM   6884  O O   . GLN B 1 284 ? -78.767  -22.424 50.801  1.00 47.44  ? 323  GLN C O   1 
ATOM   6885  C CB  . GLN B 1 284 ? -79.162  -25.252 52.370  1.00 45.06  ? 323  GLN C CB  1 
ATOM   6886  C CG  . GLN B 1 284 ? -80.135  -26.284 52.936  1.00 53.63  ? 323  GLN C CG  1 
ATOM   6887  C CD  . GLN B 1 284 ? -79.720  -26.785 54.306  1.00 58.43  ? 323  GLN C CD  1 
ATOM   6888  O OE1 . GLN B 1 284 ? -79.786  -26.052 55.295  1.00 53.98  ? 323  GLN C OE1 1 
ATOM   6889  N NE2 . GLN B 1 284 ? -79.280  -28.039 54.370  1.00 64.13  ? 323  GLN C NE2 1 
ATOM   6890  N N   . LEU B 1 285 ? -77.574  -24.060 49.828  1.00 42.90  ? 324  LEU C N   1 
ATOM   6891  C CA  . LEU B 1 285 ? -76.634  -23.127 49.216  1.00 44.80  ? 324  LEU C CA  1 
ATOM   6892  C C   . LEU B 1 285 ? -77.371  -22.157 48.292  1.00 49.26  ? 324  LEU C C   1 
ATOM   6893  O O   . LEU B 1 285 ? -77.030  -20.975 48.230  1.00 44.77  ? 324  LEU C O   1 
ATOM   6894  C CB  . LEU B 1 285 ? -75.521  -23.861 48.455  1.00 47.30  ? 324  LEU C CB  1 
ATOM   6895  C CG  . LEU B 1 285 ? -74.303  -24.384 49.240  1.00 47.00  ? 324  LEU C CG  1 
ATOM   6896  C CD1 . LEU B 1 285 ? -73.643  -23.283 50.043  1.00 37.90  ? 324  LEU C CD1 1 
ATOM   6897  C CD2 . LEU B 1 285 ? -74.682  -25.516 50.164  1.00 48.38  ? 324  LEU C CD2 1 
ATOM   6898  N N   . LYS B 1 286 ? -78.387  -22.658 47.590  1.00 53.42  ? 325  LYS C N   1 
ATOM   6899  C CA  . LYS B 1 286 ? -79.167  -21.835 46.662  1.00 56.76  ? 325  LYS C CA  1 
ATOM   6900  C C   . LYS B 1 286 ? -79.969  -20.755 47.384  1.00 58.29  ? 325  LYS C C   1 
ATOM   6901  O O   . LYS B 1 286 ? -80.082  -19.628 46.899  1.00 57.35  ? 325  LYS C O   1 
ATOM   6902  C CB  . LYS B 1 286 ? -80.100  -22.694 45.796  1.00 56.11  ? 325  LYS C CB  1 
ATOM   6903  C CG  . LYS B 1 286 ? -79.538  -23.073 44.425  1.00 56.62  ? 325  LYS C CG  1 
ATOM   6904  C CD  . LYS B 1 286 ? -80.595  -23.765 43.560  1.00 68.09  ? 325  LYS C CD  1 
ATOM   6905  C CE  . LYS B 1 286 ? -81.805  -22.857 43.330  1.00 79.66  ? 325  LYS C CE  1 
ATOM   6906  N NZ  . LYS B 1 286 ? -82.899  -23.515 42.545  1.00 81.18  ? 325  LYS C NZ  1 
ATOM   6907  N N   . GLU B 1 287 ? -80.530  -21.106 48.538  1.00 57.83  ? 326  GLU C N   1 
ATOM   6908  C CA  . GLU B 1 287 ? -81.244  -20.138 49.363  1.00 57.22  ? 326  GLU C CA  1 
ATOM   6909  C C   . GLU B 1 287 ? -80.263  -19.127 49.947  1.00 60.73  ? 326  GLU C C   1 
ATOM   6910  O O   . GLU B 1 287 ? -80.559  -17.935 50.044  1.00 64.20  ? 326  GLU C O   1 
ATOM   6911  C CB  . GLU B 1 287 ? -82.006  -20.840 50.495  1.00 62.71  ? 326  GLU C CB  1 
ATOM   6912  C CG  . GLU B 1 287 ? -83.064  -21.841 50.028  1.00 79.25  ? 326  GLU C CG  1 
ATOM   6913  C CD  . GLU B 1 287 ? -83.756  -22.561 51.185  1.00 90.36  ? 326  GLU C CD  1 
ATOM   6914  O OE1 . GLU B 1 287 ? -84.637  -21.947 51.831  1.00 80.41  ? 326  GLU C OE1 1 
ATOM   6915  O OE2 . GLU B 1 287 ? -83.420  -23.741 51.448  1.00 83.61  ? 326  GLU C OE2 1 
ATOM   6916  N N   . LYS B 1 288 ? -79.086  -19.611 50.331  1.00 55.47  ? 327  LYS C N   1 
ATOM   6917  C CA  . LYS B 1 288 ? -78.079  -18.759 50.956  1.00 52.29  ? 327  LYS C CA  1 
ATOM   6918  C C   . LYS B 1 288 ? -77.367  -17.839 49.959  1.00 48.72  ? 327  LYS C C   1 
ATOM   6919  O O   . LYS B 1 288 ? -77.066  -16.691 50.283  1.00 52.19  ? 327  LYS C O   1 
ATOM   6920  C CB  . LYS B 1 288 ? -77.061  -19.613 51.719  1.00 53.94  ? 327  LYS C CB  1 
ATOM   6921  C CG  . LYS B 1 288 ? -75.892  -18.834 52.310  1.00 53.19  ? 327  LYS C CG  1 
ATOM   6922  C CD  . LYS B 1 288 ? -76.379  -17.775 53.288  1.00 62.94  ? 327  LYS C CD  1 
ATOM   6923  C CE  . LYS B 1 288 ? -75.230  -17.123 54.034  1.00 58.75  ? 327  LYS C CE  1 
ATOM   6924  N NZ  . LYS B 1 288 ? -75.745  -16.346 55.194  1.00 60.65  ? 327  LYS C NZ  1 
ATOM   6925  N N   . PHE B 1 289 ? -77.095  -18.338 48.754  1.00 47.27  ? 328  PHE C N   1 
ATOM   6926  C CA  . PHE B 1 289 ? -76.380  -17.544 47.750  1.00 50.10  ? 328  PHE C CA  1 
ATOM   6927  C C   . PHE B 1 289 ? -77.139  -17.473 46.424  1.00 54.07  ? 328  PHE C C   1 
ATOM   6928  O O   . PHE B 1 289 ? -76.682  -18.009 45.415  1.00 50.41  ? 328  PHE C O   1 
ATOM   6929  C CB  . PHE B 1 289 ? -74.988  -18.125 47.502  1.00 50.70  ? 328  PHE C CB  1 
ATOM   6930  C CG  . PHE B 1 289 ? -74.164  -18.305 48.751  1.00 51.70  ? 328  PHE C CG  1 
ATOM   6931  C CD1 . PHE B 1 289 ? -73.447  -17.246 49.286  1.00 47.93  ? 328  PHE C CD1 1 
ATOM   6932  C CD2 . PHE B 1 289 ? -74.091  -19.543 49.375  1.00 42.75  ? 328  PHE C CD2 1 
ATOM   6933  C CE1 . PHE B 1 289 ? -72.684  -17.412 50.432  1.00 49.07  ? 328  PHE C CE1 1 
ATOM   6934  C CE2 . PHE B 1 289 ? -73.326  -19.723 50.517  1.00 40.27  ? 328  PHE C CE2 1 
ATOM   6935  C CZ  . PHE B 1 289 ? -72.622  -18.653 51.049  1.00 49.97  ? 328  PHE C CZ  1 
ATOM   6936  N N   . PRO B 1 290 ? -78.304  -16.803 46.421  1.00 63.85  ? 329  PRO C N   1 
ATOM   6937  C CA  . PRO B 1 290 ? -79.198  -16.797 45.252  1.00 65.66  ? 329  PRO C CA  1 
ATOM   6938  C C   . PRO B 1 290 ? -78.594  -16.153 43.996  1.00 59.23  ? 329  PRO C C   1 
ATOM   6939  O O   . PRO B 1 290 ? -79.071  -16.416 42.889  1.00 63.40  ? 329  PRO C O   1 
ATOM   6940  C CB  . PRO B 1 290 ? -80.420  -16.012 45.743  1.00 65.14  ? 329  PRO C CB  1 
ATOM   6941  C CG  . PRO B 1 290 ? -79.921  -15.199 46.886  1.00 73.80  ? 329  PRO C CG  1 
ATOM   6942  C CD  . PRO B 1 290 ? -78.854  -16.025 47.543  1.00 63.96  ? 329  PRO C CD  1 
ATOM   6943  N N   . GLU B 1 291 ? -77.563  -15.331 44.161  1.00 59.50  ? 330  GLU C N   1 
ATOM   6944  C CA  . GLU B 1 291 ? -76.876  -14.750 43.011  1.00 62.65  ? 330  GLU C CA  1 
ATOM   6945  C C   . GLU B 1 291 ? -75.753  -15.656 42.499  1.00 66.42  ? 330  GLU C C   1 
ATOM   6946  O O   . GLU B 1 291 ? -75.207  -15.434 41.417  1.00 67.02  ? 330  GLU C O   1 
ATOM   6947  C CB  . GLU B 1 291 ? -76.344  -13.349 43.331  1.00 73.21  ? 330  GLU C CB  1 
ATOM   6948  C CG  . GLU B 1 291 ? -77.356  -12.234 43.068  1.00 82.15  ? 330  GLU C CG  1 
ATOM   6949  C CD  . GLU B 1 291 ? -77.953  -12.307 41.666  1.00 85.81  ? 330  GLU C CD  1 
ATOM   6950  O OE1 . GLU B 1 291 ? -77.177  -12.442 40.690  1.00 80.94  ? 330  GLU C OE1 1 
ATOM   6951  O OE2 . GLU B 1 291 ? -79.200  -12.250 41.542  1.00 78.35  ? 330  GLU C OE2 1 
ATOM   6952  N N   . ALA B 1 292 ? -75.419  -16.682 43.274  1.00 62.57  ? 331  ALA C N   1 
ATOM   6953  C CA  . ALA B 1 292 ? -74.364  -17.609 42.889  1.00 65.06  ? 331  ALA C CA  1 
ATOM   6954  C C   . ALA B 1 292 ? -74.813  -18.516 41.750  1.00 60.13  ? 331  ALA C C   1 
ATOM   6955  O O   . ALA B 1 292 ? -75.962  -18.946 41.703  1.00 58.77  ? 331  ALA C O   1 
ATOM   6956  C CB  . ALA B 1 292 ? -73.918  -18.441 44.088  1.00 60.69  ? 331  ALA C CB  1 
ATOM   6957  N N   . ASP B 1 293 ? -73.895  -18.804 40.835  1.00 57.42  ? 332  ASP C N   1 
ATOM   6958  C CA  . ASP B 1 293 ? -74.166  -19.711 39.725  1.00 49.93  ? 332  ASP C CA  1 
ATOM   6959  C C   . ASP B 1 293 ? -74.284  -21.152 40.226  1.00 57.59  ? 332  ASP C C   1 
ATOM   6960  O O   . ASP B 1 293 ? -73.406  -21.638 40.939  1.00 59.07  ? 332  ASP C O   1 
ATOM   6961  C CB  . ASP B 1 293 ? -73.056  -19.590 38.675  1.00 56.67  ? 332  ASP C CB  1 
ATOM   6962  C CG  . ASP B 1 293 ? -73.313  -20.442 37.443  1.00 63.66  ? 332  ASP C CG  1 
ATOM   6963  O OD1 . ASP B 1 293 ? -73.927  -21.524 37.564  1.00 68.07  ? 332  ASP C OD1 1 
ATOM   6964  O OD2 . ASP B 1 293 ? -72.892  -20.030 36.344  1.00 73.54  ? 332  ASP C OD2 1 
ATOM   6965  N N   . PRO B 1 294 ? -75.376  -21.840 39.854  1.00 59.61  ? 333  PRO C N   1 
ATOM   6966  C CA  . PRO B 1 294 ? -75.631  -23.220 40.278  1.00 48.17  ? 333  PRO C CA  1 
ATOM   6967  C C   . PRO B 1 294 ? -74.477  -24.175 40.006  1.00 52.05  ? 333  PRO C C   1 
ATOM   6968  O O   . PRO B 1 294 ? -74.350  -25.188 40.699  1.00 47.64  ? 333  PRO C O   1 
ATOM   6969  C CB  . PRO B 1 294 ? -76.861  -23.625 39.452  1.00 61.85  ? 333  PRO C CB  1 
ATOM   6970  C CG  . PRO B 1 294 ? -77.043  -22.544 38.427  1.00 54.16  ? 333  PRO C CG  1 
ATOM   6971  C CD  . PRO B 1 294 ? -76.483  -21.314 39.042  1.00 59.22  ? 333  PRO C CD  1 
ATOM   6972  N N   . TYR B 1 295 ? -73.655  -23.871 39.006  1.00 53.12  ? 334  TYR C N   1 
ATOM   6973  C CA  . TYR B 1 295 ? -72.478  -24.689 38.726  1.00 57.26  ? 334  TYR C CA  1 
ATOM   6974  C C   . TYR B 1 295 ? -71.404  -24.515 39.794  1.00 45.74  ? 334  TYR C C   1 
ATOM   6975  O O   . TYR B 1 295 ? -70.674  -25.453 40.121  1.00 42.14  ? 334  TYR C O   1 
ATOM   6976  C CB  . TYR B 1 295 ? -71.903  -24.353 37.352  1.00 61.00  ? 334  TYR C CB  1 
ATOM   6977  C CG  . TYR B 1 295 ? -72.745  -24.876 36.216  1.00 73.25  ? 334  TYR C CG  1 
ATOM   6978  C CD1 . TYR B 1 295 ? -72.846  -26.243 35.975  1.00 67.68  ? 334  TYR C CD1 1 
ATOM   6979  C CD2 . TYR B 1 295 ? -73.438  -24.008 35.382  1.00 73.94  ? 334  TYR C CD2 1 
ATOM   6980  C CE1 . TYR B 1 295 ? -73.616  -26.727 34.937  1.00 74.61  ? 334  TYR C CE1 1 
ATOM   6981  C CE2 . TYR B 1 295 ? -74.207  -24.484 34.341  1.00 76.35  ? 334  TYR C CE2 1 
ATOM   6982  C CZ  . TYR B 1 295 ? -74.292  -25.844 34.123  1.00 79.99  ? 334  TYR C CZ  1 
ATOM   6983  O OH  . TYR B 1 295 ? -75.062  -26.325 33.087  1.00 95.29  ? 334  TYR C OH  1 
ATOM   6984  N N   . GLU B 1 296 ? -71.310  -23.306 40.330  1.00 42.67  ? 335  GLU C N   1 
ATOM   6985  C CA  . GLU B 1 296 ? -70.340  -23.018 41.371  1.00 45.09  ? 335  GLU C CA  1 
ATOM   6986  C C   . GLU B 1 296 ? -70.709  -23.784 42.627  1.00 42.67  ? 335  GLU C C   1 
ATOM   6987  O O   . GLU B 1 296 ? -69.849  -24.297 43.333  1.00 36.96  ? 335  GLU C O   1 
ATOM   6988  C CB  . GLU B 1 296 ? -70.293  -21.522 41.664  1.00 37.50  ? 335  GLU C CB  1 
ATOM   6989  C CG  . GLU B 1 296 ? -69.268  -21.167 42.707  1.00 46.84  ? 335  GLU C CG  1 
ATOM   6990  C CD  . GLU B 1 296 ? -69.052  -19.681 42.826  1.00 40.94  ? 335  GLU C CD  1 
ATOM   6991  O OE1 . GLU B 1 296 ? -69.737  -18.926 42.108  1.00 52.62  ? 335  GLU C OE1 1 
ATOM   6992  O OE2 . GLU B 1 296 ? -68.199  -19.271 43.641  1.00 47.44  ? 335  GLU C OE2 1 
ATOM   6993  N N   . ILE B 1 297 ? -72.005  -23.864 42.891  1.00 44.69  ? 336  ILE C N   1 
ATOM   6994  C CA  . ILE B 1 297 ? -72.517  -24.582 44.045  1.00 41.76  ? 336  ILE C CA  1 
ATOM   6995  C C   . ILE B 1 297 ? -72.248  -26.076 43.920  1.00 39.35  ? 336  ILE C C   1 
ATOM   6996  O O   . ILE B 1 297 ? -71.903  -26.737 44.886  1.00 39.99  ? 336  ILE C O   1 
ATOM   6997  C CB  . ILE B 1 297 ? -74.021  -24.315 44.205  1.00 37.93  ? 336  ILE C CB  1 
ATOM   6998  C CG1 . ILE B 1 297 ? -74.221  -22.927 44.823  1.00 42.65  ? 336  ILE C CG1 1 
ATOM   6999  C CG2 . ILE B 1 297 ? -74.689  -25.410 45.036  1.00 42.26  ? 336  ILE C CG2 1 
ATOM   7000  C CD1 . ILE B 1 297 ? -75.649  -22.396 44.741  1.00 52.36  ? 336  ILE C CD1 1 
ATOM   7001  N N   . ILE B 1 298 ? -72.396  -26.604 42.717  1.00 36.11  ? 337  ILE C N   1 
ATOM   7002  C CA  . ILE B 1 298 ? -72.098  -28.005 42.478  1.00 39.82  ? 337  ILE C CA  1 
ATOM   7003  C C   . ILE B 1 298 ? -70.611  -28.268 42.662  1.00 34.97  ? 337  ILE C C   1 
ATOM   7004  O O   . ILE B 1 298 ? -70.220  -29.254 43.285  1.00 41.03  ? 337  ILE C O   1 
ATOM   7005  C CB  . ILE B 1 298 ? -72.534  -28.429 41.070  1.00 41.57  ? 337  ILE C CB  1 
ATOM   7006  C CG1 . ILE B 1 298 ? -74.065  -28.486 41.001  1.00 46.76  ? 337  ILE C CG1 1 
ATOM   7007  C CG2 . ILE B 1 298 ? -71.930  -29.775 40.710  1.00 37.87  ? 337  ILE C CG2 1 
ATOM   7008  C CD1 . ILE B 1 298 ? -74.618  -28.424 39.602  1.00 44.52  ? 337  ILE C CD1 1 
ATOM   7009  N N   . GLU B 1 299 ? -69.783  -27.379 42.124  1.00 34.56  ? 338  GLU C N   1 
ATOM   7010  C CA  . GLU B 1 299 ? -68.336  -27.539 42.229  1.00 39.63  ? 338  GLU C CA  1 
ATOM   7011  C C   . GLU B 1 299 ? -67.931  -27.417 43.688  1.00 37.91  ? 338  GLU C C   1 
ATOM   7012  O O   . GLU B 1 299 ? -67.065  -28.141 44.166  1.00 36.69  ? 338  GLU C O   1 
ATOM   7013  C CB  . GLU B 1 299 ? -67.606  -26.490 41.392  1.00 39.52  ? 338  GLU C CB  1 
ATOM   7014  C CG  . GLU B 1 299 ? -66.121  -26.767 41.218  1.00 48.16  ? 338  GLU C CG  1 
ATOM   7015  C CD  . GLU B 1 299 ? -65.863  -28.011 40.382  1.00 71.41  ? 338  GLU C CD  1 
ATOM   7016  O OE1 . GLU B 1 299 ? -65.975  -27.918 39.135  1.00 65.73  ? 338  GLU C OE1 1 
ATOM   7017  O OE2 . GLU B 1 299 ? -65.560  -29.078 40.971  1.00 59.02  ? 338  GLU C OE2 1 
ATOM   7018  N N   . SER B 1 300 ? -68.581  -26.492 44.388  1.00 41.01  ? 339  SER C N   1 
ATOM   7019  C CA  . SER B 1 300 ? -68.389  -26.319 45.821  1.00 41.33  ? 339  SER C CA  1 
ATOM   7020  C C   . SER B 1 300 ? -68.638  -27.632 46.580  1.00 39.35  ? 339  SER C C   1 
ATOM   7021  O O   . SER B 1 300 ? -67.835  -28.042 47.419  1.00 32.10  ? 339  SER C O   1 
ATOM   7022  C CB  . SER B 1 300 ? -69.306  -25.206 46.331  1.00 39.74  ? 339  SER C CB  1 
ATOM   7023  O OG  . SER B 1 300 ? -69.147  -24.988 47.720  1.00 44.10  ? 339  SER C OG  1 
ATOM   7024  N N   . PHE B 1 301 ? -69.737  -28.310 46.277  1.00 32.90  ? 340  PHE C N   1 
ATOM   7025  C CA  . PHE B 1 301 ? -69.997  -29.578 46.952  1.00 34.93  ? 340  PHE C CA  1 
ATOM   7026  C C   . PHE B 1 301 ? -68.933  -30.647 46.669  1.00 35.91  ? 340  PHE C C   1 
ATOM   7027  O O   . PHE B 1 301 ? -68.503  -31.356 47.581  1.00 33.37  ? 340  PHE C O   1 
ATOM   7028  C CB  . PHE B 1 301 ? -71.396  -30.118 46.653  1.00 31.93  ? 340  PHE C CB  1 
ATOM   7029  C CG  . PHE B 1 301 ? -71.737  -31.330 47.457  1.00 39.28  ? 340  PHE C CG  1 
ATOM   7030  C CD1 . PHE B 1 301 ? -71.467  -32.599 46.973  1.00 36.84  ? 340  PHE C CD1 1 
ATOM   7031  C CD2 . PHE B 1 301 ? -72.285  -31.202 48.729  1.00 38.75  ? 340  PHE C CD2 1 
ATOM   7032  C CE1 . PHE B 1 301 ? -71.762  -33.718 47.733  1.00 39.02  ? 340  PHE C CE1 1 
ATOM   7033  C CE2 . PHE B 1 301 ? -72.583  -32.317 49.492  1.00 36.77  ? 340  PHE C CE2 1 
ATOM   7034  C CZ  . PHE B 1 301 ? -72.327  -33.573 48.995  1.00 35.80  ? 340  PHE C CZ  1 
ATOM   7035  N N   . ASN B 1 302 ? -68.503  -30.772 45.416  1.00 38.94  ? 341  ASN C N   1 
ATOM   7036  C CA  . ASN B 1 302 ? -67.498  -31.783 45.083  1.00 33.28  ? 341  ASN C CA  1 
ATOM   7037  C C   . ASN B 1 302 ? -66.154  -31.503 45.758  1.00 35.08  ? 341  ASN C C   1 
ATOM   7038  O O   . ASN B 1 302 ? -65.471  -32.419 46.181  1.00 34.94  ? 341  ASN C O   1 
ATOM   7039  C CB  . ASN B 1 302 ? -67.298  -31.899 43.571  1.00 41.94  ? 341  ASN C CB  1 
ATOM   7040  C CG  . ASN B 1 302 ? -68.570  -32.272 42.840  1.00 41.94  ? 341  ASN C CG  1 
ATOM   7041  O OD1 . ASN B 1 302 ? -69.374  -33.067 43.330  1.00 45.91  ? 341  ASN C OD1 1 
ATOM   7042  N ND2 . ASN B 1 302 ? -68.758  -31.696 41.657  1.00 48.08  ? 341  ASN C ND2 1 
ATOM   7043  N N   . VAL B 1 303 ? -65.776  -30.232 45.852  1.00 32.48  ? 342  VAL C N   1 
ATOM   7044  C CA  . VAL B 1 303 ? -64.544  -29.873 46.541  1.00 33.32  ? 342  VAL C CA  1 
ATOM   7045  C C   . VAL B 1 303 ? -64.605  -30.308 48.005  1.00 33.09  ? 342  VAL C C   1 
ATOM   7046  O O   . VAL B 1 303 ? -63.660  -30.894 48.545  1.00 34.22  ? 342  VAL C O   1 
ATOM   7047  C CB  . VAL B 1 303 ? -64.275  -28.359 46.435  1.00 32.32  ? 342  VAL C CB  1 
ATOM   7048  C CG1 . VAL B 1 303 ? -63.187  -27.929 47.408  1.00 40.90  ? 342  VAL C CG1 1 
ATOM   7049  C CG2 . VAL B 1 303 ? -63.896  -28.003 44.998  1.00 38.93  ? 342  VAL C CG2 1 
ATOM   7050  N N   . VAL B 1 304 ? -65.736  -30.041 48.641  1.00 32.76  ? 343  VAL C N   1 
ATOM   7051  C CA  . VAL B 1 304 ? -65.924  -30.395 50.043  1.00 27.86  ? 343  VAL C CA  1 
ATOM   7052  C C   . VAL B 1 304 ? -65.921  -31.916 50.253  1.00 30.88  ? 343  VAL C C   1 
ATOM   7053  O O   . VAL B 1 304 ? -65.201  -32.433 51.113  1.00 34.50  ? 343  VAL C O   1 
ATOM   7054  C CB  . VAL B 1 304 ? -67.221  -29.748 50.592  1.00 30.08  ? 343  VAL C CB  1 
ATOM   7055  C CG1 . VAL B 1 304 ? -67.677  -30.417 51.878  1.00 32.40  ? 343  VAL C CG1 1 
ATOM   7056  C CG2 . VAL B 1 304 ? -67.001  -28.263 50.810  1.00 30.72  ? 343  VAL C CG2 1 
ATOM   7057  N N   . ALA B 1 305 ? -66.726  -32.631 49.466  1.00 30.40  ? 344  ALA C N   1 
ATOM   7058  C CA  . ALA B 1 305 ? -66.740  -34.088 49.518  1.00 28.88  ? 344  ALA C CA  1 
ATOM   7059  C C   . ALA B 1 305 ? -65.317  -34.633 49.354  1.00 33.14  ? 344  ALA C C   1 
ATOM   7060  O O   . ALA B 1 305 ? -64.852  -35.446 50.142  1.00 34.17  ? 344  ALA C O   1 
ATOM   7061  C CB  . ALA B 1 305 ? -67.667  -34.660 48.433  1.00 35.05  ? 344  ALA C CB  1 
ATOM   7062  N N   . LYS B 1 306 ? -64.624  -34.177 48.323  1.00 29.35  ? 345  LYS C N   1 
ATOM   7063  C CA  . LYS B 1 306 ? -63.265  -34.641 48.084  1.00 35.70  ? 345  LYS C CA  1 
ATOM   7064  C C   . LYS B 1 306 ? -62.339  -34.372 49.289  1.00 30.64  ? 345  LYS C C   1 
ATOM   7065  O O   . LYS B 1 306 ? -61.586  -35.258 49.708  1.00 34.34  ? 345  LYS C O   1 
ATOM   7066  C CB  . LYS B 1 306 ? -62.718  -34.016 46.793  1.00 34.17  ? 345  LYS C CB  1 
ATOM   7067  C CG  . LYS B 1 306 ? -61.247  -34.295 46.537  1.00 29.86  ? 345  LYS C CG  1 
ATOM   7068  C CD  . LYS B 1 306 ? -60.754  -33.551 45.294  1.00 31.71  ? 345  LYS C CD  1 
ATOM   7069  C CE  . LYS B 1 306 ? -59.231  -33.568 45.224  1.00 38.65  ? 345  LYS C CE  1 
ATOM   7070  N NZ  . LYS B 1 306 ? -58.710  -33.095 43.918  1.00 45.32  ? 345  LYS C NZ  1 
ATOM   7071  N N   . GLU B 1 307 ? -62.401  -33.160 49.845  1.00 30.87  ? 346  GLU C N   1 
ATOM   7072  C CA  . GLU B 1 307 ? -61.564  -32.807 50.998  1.00 33.38  ? 346  GLU C CA  1 
ATOM   7073  C C   . GLU B 1 307 ? -61.862  -33.693 52.215  1.00 34.35  ? 346  GLU C C   1 
ATOM   7074  O O   . GLU B 1 307 ? -60.950  -34.194 52.873  1.00 31.86  ? 346  GLU C O   1 
ATOM   7075  C CB  . GLU B 1 307 ? -61.697  -31.316 51.361  1.00 31.05  ? 346  GLU C CB  1 
ATOM   7076  C CG  . GLU B 1 307 ? -60.852  -30.872 52.575  1.00 30.07  ? 346  GLU C CG  1 
ATOM   7077  C CD  . GLU B 1 307 ? -61.600  -31.025 53.906  1.00 41.83  ? 346  GLU C CD  1 
ATOM   7078  O OE1 . GLU B 1 307 ? -62.841  -30.893 53.901  1.00 32.26  ? 346  GLU C OE1 1 
ATOM   7079  O OE2 . GLU B 1 307 ? -60.957  -31.281 54.953  1.00 36.50  ? 346  GLU C OE2 1 
ATOM   7080  N N   . VAL B 1 308 ? -63.141  -33.888 52.505  1.00 28.13  ? 347  VAL C N   1 
ATOM   7081  C CA  . VAL B 1 308 ? -63.534  -34.713 53.632  1.00 31.66  ? 347  VAL C CA  1 
ATOM   7082  C C   . VAL B 1 308 ? -63.079  -36.149 53.422  1.00 38.14  ? 347  VAL C C   1 
ATOM   7083  O O   . VAL B 1 308 ? -62.565  -36.794 54.334  1.00 38.42  ? 347  VAL C O   1 
ATOM   7084  C CB  . VAL B 1 308 ? -65.061  -34.661 53.857  1.00 31.08  ? 347  VAL C CB  1 
ATOM   7085  C CG1 . VAL B 1 308 ? -65.487  -35.758 54.807  1.00 29.42  ? 347  VAL C CG1 1 
ATOM   7086  C CG2 . VAL B 1 308 ? -65.464  -33.279 54.370  1.00 31.58  ? 347  VAL C CG2 1 
ATOM   7087  N N   . PHE B 1 309 ? -63.248  -36.634 52.199  1.00 35.68  ? 348  PHE C N   1 
ATOM   7088  C CA  . PHE B 1 309 ? -62.839  -37.986 51.835  1.00 34.37  ? 348  PHE C CA  1 
ATOM   7089  C C   . PHE B 1 309 ? -61.333  -38.202 52.049  1.00 34.34  ? 348  PHE C C   1 
ATOM   7090  O O   . PHE B 1 309 ? -60.918  -39.160 52.705  1.00 30.46  ? 348  PHE C O   1 
ATOM   7091  C CB  . PHE B 1 309 ? -63.232  -38.251 50.376  1.00 34.70  ? 348  PHE C CB  1 
ATOM   7092  C CG  . PHE B 1 309 ? -62.928  -39.638 49.901  1.00 37.47  ? 348  PHE C CG  1 
ATOM   7093  C CD1 . PHE B 1 309 ? -63.871  -40.642 50.015  1.00 37.18  ? 348  PHE C CD1 1 
ATOM   7094  C CD2 . PHE B 1 309 ? -61.702  -39.937 49.329  1.00 23.41  ? 348  PHE C CD2 1 
ATOM   7095  C CE1 . PHE B 1 309 ? -63.594  -41.919 49.575  1.00 30.47  ? 348  PHE C CE1 1 
ATOM   7096  C CE2 . PHE B 1 309 ? -61.424  -41.210 48.878  1.00 33.34  ? 348  PHE C CE2 1 
ATOM   7097  C CZ  . PHE B 1 309 ? -62.365  -42.205 49.005  1.00 33.96  ? 348  PHE C CZ  1 
ATOM   7098  N N   . ARG B 1 310 ? -60.519  -37.309 51.495  1.00 29.98  ? 349  ARG C N   1 
ATOM   7099  C CA  . ARG B 1 310 ? -59.062  -37.462 51.557  1.00 32.61  ? 349  ARG C CA  1 
ATOM   7100  C C   . ARG B 1 310 ? -58.542  -37.335 52.984  1.00 35.01  ? 349  ARG C C   1 
ATOM   7101  O O   . ARG B 1 310 ? -57.649  -38.075 53.394  1.00 33.16  ? 349  ARG C O   1 
ATOM   7102  C CB  . ARG B 1 310 ? -58.366  -36.425 50.669  1.00 33.93  ? 349  ARG C CB  1 
ATOM   7103  C CG  . ARG B 1 310 ? -58.716  -36.534 49.191  1.00 36.64  ? 349  ARG C CG  1 
ATOM   7104  C CD  . ARG B 1 310 ? -58.370  -35.256 48.437  1.00 31.11  ? 349  ARG C CD  1 
ATOM   7105  N NE  . ARG B 1 310 ? -56.939  -34.974 48.423  1.00 28.65  ? 349  ARG C NE  1 
ATOM   7106  C CZ  . ARG B 1 310 ? -56.098  -35.383 47.477  1.00 35.12  ? 349  ARG C CZ  1 
ATOM   7107  N NH1 . ARG B 1 310 ? -56.533  -36.111 46.450  1.00 31.54  ? 349  ARG C NH1 1 
ATOM   7108  N NH2 . ARG B 1 310 ? -54.815  -35.061 47.554  1.00 35.96  ? 349  ARG C NH2 1 
ATOM   7109  N N   . SER B 1 311 ? -59.101  -36.385 53.727  1.00 26.81  ? 350  SER C N   1 
ATOM   7110  C CA  . SER B 1 311 ? -58.688  -36.128 55.101  1.00 31.55  ? 350  SER C CA  1 
ATOM   7111  C C   . SER B 1 311 ? -58.826  -37.357 56.007  1.00 34.88  ? 350  SER C C   1 
ATOM   7112  O O   . SER B 1 311 ? -58.004  -37.570 56.901  1.00 37.86  ? 350  SER C O   1 
ATOM   7113  C CB  . SER B 1 311 ? -59.453  -34.927 55.678  1.00 37.79  ? 350  SER C CB  1 
ATOM   7114  O OG  . SER B 1 311 ? -59.129  -33.734 54.970  1.00 40.76  ? 350  SER C OG  1 
ATOM   7115  N N   . ILE B 1 312 ? -59.847  -38.171 55.776  1.00 36.20  ? 351  ILE C N   1 
ATOM   7116  C CA  . ILE B 1 312 ? -60.020  -39.399 56.558  1.00 33.08  ? 351  ILE C CA  1 
ATOM   7117  C C   . ILE B 1 312 ? -58.881  -40.395 56.285  1.00 39.48  ? 351  ILE C C   1 
ATOM   7118  O O   . ILE B 1 312 ? -58.261  -40.933 57.207  1.00 32.65  ? 351  ILE C O   1 
ATOM   7119  C CB  . ILE B 1 312 ? -61.389  -40.054 56.271  1.00 36.29  ? 351  ILE C CB  1 
ATOM   7120  C CG1 . ILE B 1 312 ? -62.516  -39.120 56.731  1.00 38.84  ? 351  ILE C CG1 1 
ATOM   7121  C CG2 . ILE B 1 312 ? -61.490  -41.413 56.956  1.00 31.20  ? 351  ILE C CG2 1 
ATOM   7122  C CD1 . ILE B 1 312 ? -63.887  -39.472 56.187  1.00 30.47  ? 351  ILE C CD1 1 
ATOM   7123  N N   . VAL B 1 313 ? -58.592  -40.633 55.013  1.00 36.91  ? 352  VAL C N   1 
ATOM   7124  C CA  . VAL B 1 313 ? -57.495  -41.527 54.665  1.00 37.60  ? 352  VAL C CA  1 
ATOM   7125  C C   . VAL B 1 313 ? -56.197  -41.100 55.362  1.00 38.41  ? 352  VAL C C   1 
ATOM   7126  O O   . VAL B 1 313 ? -55.445  -41.930 55.879  1.00 35.98  ? 352  VAL C O   1 
ATOM   7127  C CB  . VAL B 1 313 ? -57.263  -41.558 53.142  1.00 36.27  ? 352  VAL C CB  1 
ATOM   7128  C CG1 . VAL B 1 313 ? -56.063  -42.447 52.812  1.00 47.68  ? 352  VAL C CG1 1 
ATOM   7129  C CG2 . VAL B 1 313 ? -58.502  -42.066 52.432  1.00 43.26  ? 352  VAL C CG2 1 
ATOM   7130  N N   . LEU B 1 314 ? -55.946  -39.796 55.371  1.00 41.24  ? 353  LEU C N   1 
ATOM   7131  C CA  . LEU B 1 314 ? -54.705  -39.249 55.900  1.00 40.02  ? 353  LEU C CA  1 
ATOM   7132  C C   . LEU B 1 314 ? -54.643  -39.291 57.429  1.00 39.23  ? 353  LEU C C   1 
ATOM   7133  O O   . LEU B 1 314 ? -53.591  -39.590 57.998  1.00 39.89  ? 353  LEU C O   1 
ATOM   7134  C CB  . LEU B 1 314 ? -54.525  -37.803 55.429  1.00 41.06  ? 353  LEU C CB  1 
ATOM   7135  C CG  . LEU B 1 314 ? -54.155  -37.491 53.976  1.00 45.45  ? 353  LEU C CG  1 
ATOM   7136  C CD1 . LEU B 1 314 ? -54.646  -36.096 53.610  1.00 33.87  ? 353  LEU C CD1 1 
ATOM   7137  C CD2 . LEU B 1 314 ? -52.658  -37.594 53.757  1.00 35.18  ? 353  LEU C CD2 1 
ATOM   7138  N N   . ASN B 1 315 ? -55.757  -38.956 58.081  1.00 38.08  ? 354  ASN C N   1 
ATOM   7139  C CA  . ASN B 1 315 ? -55.814  -38.902 59.544  1.00 38.98  ? 354  ASN C CA  1 
ATOM   7140  C C   . ASN B 1 315 ? -55.934  -40.291 60.176  1.00 40.11  ? 354  ASN C C   1 
ATOM   7141  O O   . ASN B 1 315 ? -55.402  -40.539 61.256  1.00 41.85  ? 354  ASN C O   1 
ATOM   7142  C CB  . ASN B 1 315 ? -56.992  -38.044 60.029  1.00 29.68  ? 354  ASN C CB  1 
ATOM   7143  C CG  . ASN B 1 315 ? -56.869  -36.574 59.636  1.00 45.12  ? 354  ASN C CG  1 
ATOM   7144  O OD1 . ASN B 1 315 ? -55.772  -36.048 59.464  1.00 43.00  ? 354  ASN C OD1 1 
ATOM   7145  N ND2 . ASN B 1 315 ? -58.013  -35.903 59.508  1.00 40.65  ? 354  ASN C ND2 1 
ATOM   7146  N N   . GLU B 1 316 ? -56.632  -41.197 59.499  1.00 41.09  ? 355  GLU C N   1 
ATOM   7147  C CA  . GLU B 1 316 ? -57.000  -42.465 60.116  1.00 35.95  ? 355  GLU C CA  1 
ATOM   7148  C C   . GLU B 1 316 ? -56.362  -43.670 59.444  1.00 42.63  ? 355  GLU C C   1 
ATOM   7149  O O   . GLU B 1 316 ? -56.477  -44.792 59.935  1.00 46.05  ? 355  GLU C O   1 
ATOM   7150  C CB  . GLU B 1 316 ? -58.523  -42.601 60.155  1.00 36.38  ? 355  GLU C CB  1 
ATOM   7151  C CG  . GLU B 1 316 ? -59.206  -41.385 60.782  1.00 37.95  ? 355  GLU C CG  1 
ATOM   7152  C CD  . GLU B 1 316 ? -60.724  -41.516 60.859  1.00 47.05  ? 355  GLU C CD  1 
ATOM   7153  O OE1 . GLU B 1 316 ? -61.264  -42.561 60.432  1.00 50.43  ? 355  GLU C OE1 1 
ATOM   7154  O OE2 . GLU B 1 316 ? -61.380  -40.571 61.353  1.00 40.53  ? 355  GLU C OE2 1 
ATOM   7155  N N   . TYR B 1 317 ? -55.686  -43.441 58.325  1.00 42.41  ? 356  TYR C N   1 
ATOM   7156  C CA  . TYR B 1 317 ? -55.006  -44.531 57.632  1.00 47.19  ? 356  TYR C CA  1 
ATOM   7157  C C   . TYR B 1 317 ? -56.001  -45.656 57.390  1.00 49.24  ? 356  TYR C C   1 
ATOM   7158  O O   . TYR B 1 317 ? -55.635  -46.828 57.374  1.00 43.91  ? 356  TYR C O   1 
ATOM   7159  C CB  . TYR B 1 317 ? -53.825  -45.056 58.462  1.00 39.85  ? 356  TYR C CB  1 
ATOM   7160  C CG  . TYR B 1 317 ? -52.708  -44.050 58.686  1.00 48.11  ? 356  TYR C CG  1 
ATOM   7161  C CD1 . TYR B 1 317 ? -51.489  -44.188 58.033  1.00 51.41  ? 356  TYR C CD1 1 
ATOM   7162  C CD2 . TYR B 1 317 ? -52.869  -42.969 59.549  1.00 44.69  ? 356  TYR C CD2 1 
ATOM   7163  C CE1 . TYR B 1 317 ? -50.467  -43.280 58.223  1.00 52.11  ? 356  TYR C CE1 1 
ATOM   7164  C CE2 . TYR B 1 317 ? -51.843  -42.051 59.749  1.00 41.66  ? 356  TYR C CE2 1 
ATOM   7165  C CZ  . TYR B 1 317 ? -50.643  -42.217 59.079  1.00 47.39  ? 356  TYR C CZ  1 
ATOM   7166  O OH  . TYR B 1 317 ? -49.602  -41.327 59.254  1.00 55.82  ? 356  TYR C OH  1 
ATOM   7167  N N   . LYS B 1 318 ? -57.270  -45.299 57.221  1.00 42.78  ? 357  LYS C N   1 
ATOM   7168  C CA  . LYS B 1 318 ? -58.297  -46.303 56.960  1.00 38.50  ? 357  LYS C CA  1 
ATOM   7169  C C   . LYS B 1 318 ? -59.254  -45.818 55.866  1.00 49.94  ? 357  LYS C C   1 
ATOM   7170  O O   . LYS B 1 318 ? -59.634  -44.641 55.817  1.00 46.92  ? 357  LYS C O   1 
ATOM   7171  C CB  . LYS B 1 318 ? -59.044  -46.666 58.243  1.00 48.93  ? 357  LYS C CB  1 
ATOM   7172  C CG  . LYS B 1 318 ? -59.857  -47.954 58.149  1.00 53.95  ? 357  LYS C CG  1 
ATOM   7173  C CD  . LYS B 1 318 ? -60.486  -48.298 59.491  1.00 51.16  ? 357  LYS C CD  1 
ATOM   7174  C CE  . LYS B 1 318 ? -61.372  -49.526 59.394  1.00 60.85  ? 357  LYS C CE  1 
ATOM   7175  N NZ  . LYS B 1 318 ? -62.136  -49.742 60.657  1.00 69.69  ? 357  LYS C NZ  1 
ATOM   7176  N N   . ARG B 1 319 ? -59.633  -46.736 54.986  1.00 40.30  ? 358  ARG C N   1 
ATOM   7177  C CA  . ARG B 1 319 ? -60.320  -46.376 53.756  1.00 42.72  ? 358  ARG C CA  1 
ATOM   7178  C C   . ARG B 1 319 ? -61.838  -46.473 53.903  1.00 39.09  ? 358  ARG C C   1 
ATOM   7179  O O   . ARG B 1 319 ? -62.335  -46.957 54.914  1.00 41.15  ? 358  ARG C O   1 
ATOM   7180  C CB  . ARG B 1 319 ? -59.759  -47.218 52.603  1.00 32.77  ? 358  ARG C CB  1 
ATOM   7181  C CG  . ARG B 1 319 ? -58.276  -46.868 52.326  1.00 36.07  ? 358  ARG C CG  1 
ATOM   7182  C CD  . ARG B 1 319 ? -57.493  -48.013 51.683  1.00 32.28  ? 358  ARG C CD  1 
ATOM   7183  N NE  . ARG B 1 319 ? -57.896  -48.211 50.299  1.00 37.27  ? 358  ARG C NE  1 
ATOM   7184  C CZ  . ARG B 1 319 ? -57.419  -49.160 49.503  1.00 30.45  ? 358  ARG C CZ  1 
ATOM   7185  N NH1 . ARG B 1 319 ? -56.512  -50.023 49.948  1.00 30.05  ? 358  ARG C NH1 1 
ATOM   7186  N NH2 . ARG B 1 319 ? -57.851  -49.239 48.255  1.00 33.28  ? 358  ARG C NH2 1 
ATOM   7187  N N   . CYS B 1 320 ? -62.574  -45.997 52.906  1.00 39.66  ? 359  CYS C N   1 
ATOM   7188  C CA  . CYS B 1 320 ? -64.022  -45.852 53.049  1.00 35.65  ? 359  CYS C CA  1 
ATOM   7189  C C   . CYS B 1 320 ? -64.782  -47.178 53.020  1.00 37.56  ? 359  CYS C C   1 
ATOM   7190  O O   . CYS B 1 320 ? -65.978  -47.217 53.310  1.00 40.03  ? 359  CYS C O   1 
ATOM   7191  C CB  . CYS B 1 320 ? -64.582  -44.877 52.005  1.00 37.59  ? 359  CYS C CB  1 
ATOM   7192  S SG  . CYS B 1 320 ? -64.638  -45.532 50.319  1.00 35.58  ? 359  CYS C SG  1 
ATOM   7193  N N   . ASP B 1 321 ? -64.097  -48.260 52.666  1.00 37.69  ? 360  ASP C N   1 
ATOM   7194  C CA  . ASP B 1 321 ? -64.690  -49.592 52.772  1.00 37.04  ? 360  ASP C CA  1 
ATOM   7195  C C   . ASP B 1 321 ? -64.066  -50.355 53.939  1.00 39.01  ? 360  ASP C C   1 
ATOM   7196  O O   . ASP B 1 321 ? -64.243  -51.570 54.062  1.00 43.93  ? 360  ASP C O   1 
ATOM   7197  C CB  . ASP B 1 321 ? -64.506  -50.385 51.473  1.00 36.34  ? 360  ASP C CB  1 
ATOM   7198  C CG  . ASP B 1 321 ? -63.038  -50.613 51.133  1.00 40.70  ? 360  ASP C CG  1 
ATOM   7199  O OD1 . ASP B 1 321 ? -62.175  -50.017 51.807  1.00 38.72  ? 360  ASP C OD1 1 
ATOM   7200  O OD2 . ASP B 1 321 ? -62.743  -51.360 50.179  1.00 43.81  ? 360  ASP C OD2 1 
ATOM   7201  N N   . GLY B 1 322 ? -63.321  -49.641 54.782  1.00 36.66  ? 361  GLY C N   1 
ATOM   7202  C CA  . GLY B 1 322 ? -62.675  -50.252 55.931  1.00 44.30  ? 361  GLY C CA  1 
ATOM   7203  C C   . GLY B 1 322 ? -61.307  -50.884 55.691  1.00 43.99  ? 361  GLY C C   1 
ATOM   7204  O O   . GLY B 1 322 ? -60.678  -51.358 56.636  1.00 40.09  ? 361  GLY C O   1 
ATOM   7205  N N   . ARG B 1 323 ? -60.835  -50.899 54.446  1.00 39.88  ? 362  ARG C N   1 
ATOM   7206  C CA  . ARG B 1 323 ? -59.516  -51.471 54.150  1.00 38.39  ? 362  ARG C CA  1 
ATOM   7207  C C   . ARG B 1 323 ? -58.386  -50.611 54.717  1.00 39.43  ? 362  ARG C C   1 
ATOM   7208  O O   . ARG B 1 323 ? -58.531  -49.400 54.875  1.00 44.88  ? 362  ARG C O   1 
ATOM   7209  C CB  . ARG B 1 323 ? -59.302  -51.636 52.637  1.00 37.50  ? 362  ARG C CB  1 
ATOM   7210  C CG  . ARG B 1 323 ? -59.839  -52.931 52.029  1.00 38.16  ? 362  ARG C CG  1 
ATOM   7211  C CD  . ARG B 1 323 ? -59.443  -53.049 50.551  1.00 40.29  ? 362  ARG C CD  1 
ATOM   7212  N NE  . ARG B 1 323 ? -60.047  -52.010 49.706  1.00 39.48  ? 362  ARG C NE  1 
ATOM   7213  C CZ  . ARG B 1 323 ? -59.623  -51.701 48.483  1.00 37.89  ? 362  ARG C CZ  1 
ATOM   7214  N NH1 . ARG B 1 323 ? -58.586  -52.345 47.950  1.00 33.74  ? 362  ARG C NH1 1 
ATOM   7215  N NH2 . ARG B 1 323 ? -60.240  -50.756 47.785  1.00 42.02  ? 362  ARG C NH2 1 
ATOM   7216  N N   . ASP B 1 324 ? -57.257  -51.230 55.029  1.00 44.21  ? 363  ASP C N   1 
ATOM   7217  C CA  . ASP B 1 324 ? -56.070  -50.435 55.309  1.00 40.07  ? 363  ASP C CA  1 
ATOM   7218  C C   . ASP B 1 324 ? -55.407  -50.082 53.977  1.00 38.36  ? 363  ASP C C   1 
ATOM   7219  O O   . ASP B 1 324 ? -55.939  -50.385 52.905  1.00 35.01  ? 363  ASP C O   1 
ATOM   7220  C CB  . ASP B 1 324 ? -55.104  -51.149 56.258  1.00 35.57  ? 363  ASP C CB  1 
ATOM   7221  C CG  . ASP B 1 324 ? -54.645  -52.488 55.732  1.00 43.09  ? 363  ASP C CG  1 
ATOM   7222  O OD1 . ASP B 1 324 ? -54.267  -53.349 56.555  1.00 52.99  ? 363  ASP C OD1 1 
ATOM   7223  O OD2 . ASP B 1 324 ? -54.667  -52.690 54.501  1.00 47.80  ? 363  ASP C OD2 1 
ATOM   7224  N N   . LEU B 1 325 ? -54.254  -49.439 54.042  1.00 38.12  ? 364  LEU C N   1 
ATOM   7225  C CA  . LEU B 1 325 ? -53.639  -48.875 52.852  1.00 34.97  ? 364  LEU C CA  1 
ATOM   7226  C C   . LEU B 1 325 ? -53.178  -49.923 51.829  1.00 37.29  ? 364  LEU C C   1 
ATOM   7227  O O   . LEU B 1 325 ? -53.151  -49.655 50.627  1.00 35.80  ? 364  LEU C O   1 
ATOM   7228  C CB  . LEU B 1 325 ? -52.467  -47.983 53.266  1.00 31.70  ? 364  LEU C CB  1 
ATOM   7229  C CG  . LEU B 1 325 ? -52.818  -46.844 54.222  1.00 35.48  ? 364  LEU C CG  1 
ATOM   7230  C CD1 . LEU B 1 325 ? -51.598  -45.930 54.413  1.00 44.82  ? 364  LEU C CD1 1 
ATOM   7231  C CD2 . LEU B 1 325 ? -54.010  -46.048 53.684  1.00 37.41  ? 364  LEU C CD2 1 
ATOM   7232  N N   . THR B 1 326 ? -52.824  -51.113 52.301  1.00 34.47  ? 365  THR C N   1 
ATOM   7233  C CA  . THR B 1 326 ? -52.196  -52.111 51.434  1.00 35.27  ? 365  THR C CA  1 
ATOM   7234  C C   . THR B 1 326 ? -53.089  -53.289 51.032  1.00 35.32  ? 365  THR C C   1 
ATOM   7235  O O   . THR B 1 326 ? -52.670  -54.150 50.249  1.00 37.18  ? 365  THR C O   1 
ATOM   7236  C CB  . THR B 1 326 ? -50.930  -52.692 52.086  1.00 40.04  ? 365  THR C CB  1 
ATOM   7237  O OG1 . THR B 1 326 ? -51.292  -53.333 53.315  1.00 42.89  ? 365  THR C OG1 1 
ATOM   7238  C CG2 . THR B 1 326 ? -49.887  -51.583 52.353  1.00 36.86  ? 365  THR C CG2 1 
ATOM   7239  N N   . SER B 1 327 ? -54.305  -53.341 51.561  1.00 31.56  ? 366  SER C N   1 
ATOM   7240  C CA  . SER B 1 327 ? -55.153  -54.512 51.350  1.00 34.86  ? 366  SER C CA  1 
ATOM   7241  C C   . SER B 1 327 ? -55.820  -54.557 49.976  1.00 40.78  ? 366  SER C C   1 
ATOM   7242  O O   . SER B 1 327 ? -56.296  -53.541 49.465  1.00 35.83  ? 366  SER C O   1 
ATOM   7243  C CB  . SER B 1 327 ? -56.227  -54.611 52.437  1.00 41.23  ? 366  SER C CB  1 
ATOM   7244  O OG  . SER B 1 327 ? -55.703  -55.186 53.625  1.00 47.44  ? 366  SER C OG  1 
ATOM   7245  N N   . LEU B 1 328 ? -55.851  -55.756 49.401  1.00 34.65  ? 367  LEU C N   1 
ATOM   7246  C CA  . LEU B 1 328 ? -56.627  -56.038 48.200  1.00 41.50  ? 367  LEU C CA  1 
ATOM   7247  C C   . LEU B 1 328 ? -58.112  -56.176 48.514  1.00 37.64  ? 367  LEU C C   1 
ATOM   7248  O O   . LEU B 1 328 ? -58.491  -56.533 49.627  1.00 35.37  ? 367  LEU C O   1 
ATOM   7249  C CB  . LEU B 1 328 ? -56.156  -57.346 47.564  1.00 32.80  ? 367  LEU C CB  1 
ATOM   7250  C CG  . LEU B 1 328 ? -54.969  -57.283 46.615  1.00 36.19  ? 367  LEU C CG  1 
ATOM   7251  C CD1 . LEU B 1 328 ? -54.575  -58.695 46.223  1.00 38.41  ? 367  LEU C CD1 1 
ATOM   7252  C CD2 . LEU B 1 328 ? -55.302  -56.444 45.389  1.00 38.15  ? 367  LEU C CD2 1 
ATOM   7253  N N   . ARG B 1 329 ? -58.952  -55.896 47.522  1.00 31.66  ? 368  ARG C N   1 
ATOM   7254  C CA  . ARG B 1 329 ? -60.354  -56.275 47.595  1.00 35.25  ? 368  ARG C CA  1 
ATOM   7255  C C   . ARG B 1 329 ? -60.451  -57.794 47.428  1.00 31.05  ? 368  ARG C C   1 
ATOM   7256  O O   . ARG B 1 329 ? -59.476  -58.437 47.049  1.00 37.73  ? 368  ARG C O   1 
ATOM   7257  C CB  . ARG B 1 329 ? -61.153  -55.574 46.491  1.00 32.61  ? 368  ARG C CB  1 
ATOM   7258  C CG  . ARG B 1 329 ? -61.537  -54.139 46.809  1.00 43.05  ? 368  ARG C CG  1 
ATOM   7259  C CD  . ARG B 1 329 ? -62.176  -53.449 45.608  1.00 38.47  ? 368  ARG C CD  1 
ATOM   7260  N NE  . ARG B 1 329 ? -61.197  -53.146 44.565  1.00 32.31  ? 368  ARG C NE  1 
ATOM   7261  C CZ  . ARG B 1 329 ? -61.483  -52.431 43.479  1.00 37.01  ? 368  ARG C CZ  1 
ATOM   7262  N NH1 . ARG B 1 329 ? -62.713  -51.956 43.307  1.00 31.67  ? 368  ARG C NH1 1 
ATOM   7263  N NH2 . ARG B 1 329 ? -60.546  -52.178 42.573  1.00 29.64  ? 368  ARG C NH2 1 
ATOM   7264  N N   . ASN B 1 330 ? -61.622  -58.357 47.704  1.00 34.50  ? 369  ASN C N   1 
ATOM   7265  C CA  . ASN B 1 330 ? -61.879  -59.773 47.432  1.00 38.73  ? 369  ASN C CA  1 
ATOM   7266  C C   . ASN B 1 330 ? -61.661  -60.106 45.961  1.00 40.50  ? 369  ASN C C   1 
ATOM   7267  O O   . ASN B 1 330 ? -62.337  -59.546 45.096  1.00 41.00  ? 369  ASN C O   1 
ATOM   7268  C CB  . ASN B 1 330 ? -63.333  -60.139 47.773  1.00 43.30  ? 369  ASN C CB  1 
ATOM   7269  C CG  . ASN B 1 330 ? -63.657  -59.999 49.253  1.00 53.64  ? 369  ASN C CG  1 
ATOM   7270  O OD1 . ASN B 1 330 ? -64.640  -59.349 49.621  1.00 66.25  ? 369  ASN C OD1 1 
ATOM   7271  N ND2 . ASN B 1 330 ? -62.846  -60.623 50.106  1.00 49.70  ? 369  ASN C ND2 1 
ATOM   7272  N N   . VAL B 1 331 ? -60.740  -61.018 45.659  1.00 37.10  ? 370  VAL C N   1 
ATOM   7273  C CA  . VAL B 1 331 ? -60.647  -61.499 44.284  1.00 38.66  ? 370  VAL C CA  1 
ATOM   7274  C C   . VAL B 1 331 ? -61.018  -62.975 44.145  1.00 47.96  ? 370  VAL C C   1 
ATOM   7275  O O   . VAL B 1 331 ? -60.638  -63.813 44.962  1.00 45.63  ? 370  VAL C O   1 
ATOM   7276  C CB  . VAL B 1 331 ? -59.294  -61.172 43.576  1.00 43.65  ? 370  VAL C CB  1 
ATOM   7277  C CG1 . VAL B 1 331 ? -58.420  -60.270 44.426  1.00 46.75  ? 370  VAL C CG1 1 
ATOM   7278  C CG2 . VAL B 1 331 ? -58.570  -62.443 43.160  1.00 37.71  ? 370  VAL C CG2 1 
ATOM   7279  N N   . SER B 1 332 ? -61.808  -63.262 43.118  1.00 40.25  ? 371  SER C N   1 
ATOM   7280  C CA  . SER B 1 332 ? -62.176  -64.622 42.770  1.00 41.61  ? 371  SER C CA  1 
ATOM   7281  C C   . SER B 1 332 ? -62.151  -64.715 41.257  1.00 43.91  ? 371  SER C C   1 
ATOM   7282  O O   . SER B 1 332 ? -62.219  -63.699 40.565  1.00 39.17  ? 371  SER C O   1 
ATOM   7283  C CB  . SER B 1 332 ? -63.567  -64.977 43.313  1.00 36.13  ? 371  SER C CB  1 
ATOM   7284  O OG  . SER B 1 332 ? -64.543  -64.028 42.908  1.00 45.46  ? 371  SER C OG  1 
ATOM   7285  N N   . CYS B 1 333 ? -62.029  -65.925 40.736  1.00 39.01  ? 372  CYS C N   1 
ATOM   7286  C CA  . CYS B 1 333 ? -62.052  -66.092 39.297  1.00 38.59  ? 372  CYS C CA  1 
ATOM   7287  C C   . CYS B 1 333 ? -62.455  -67.486 38.884  1.00 42.59  ? 372  CYS C C   1 
ATOM   7288  O O   . CYS B 1 333 ? -62.457  -68.418 39.692  1.00 40.86  ? 372  CYS C O   1 
ATOM   7289  C CB  . CYS B 1 333 ? -60.700  -65.738 38.686  1.00 50.58  ? 372  CYS C CB  1 
ATOM   7290  S SG  . CYS B 1 333 ? -59.283  -66.233 39.661  1.00 53.94  ? 372  CYS C SG  1 
ATOM   7291  N N   . GLU B 1 334 ? -62.807  -67.620 37.614  1.00 38.57  ? 373  GLU C N   1 
ATOM   7292  C CA  . GLU B 1 334 ? -63.085  -68.930 37.058  1.00 42.35  ? 373  GLU C CA  1 
ATOM   7293  C C   . GLU B 1 334 ? -62.735  -68.954 35.587  1.00 41.58  ? 373  GLU C C   1 
ATOM   7294  O O   . GLU B 1 334 ? -62.583  -67.904 34.953  1.00 37.87  ? 373  GLU C O   1 
ATOM   7295  C CB  . GLU B 1 334 ? -64.553  -69.302 37.263  1.00 39.22  ? 373  GLU C CB  1 
ATOM   7296  C CG  . GLU B 1 334 ? -65.531  -68.265 36.753  1.00 45.87  ? 373  GLU C CG  1 
ATOM   7297  C CD  . GLU B 1 334 ? -66.973  -68.658 37.026  1.00 62.68  ? 373  GLU C CD  1 
ATOM   7298  O OE1 . GLU B 1 334 ? -67.892  -67.891 36.660  1.00 63.56  ? 373  GLU C OE1 1 
ATOM   7299  O OE2 . GLU B 1 334 ? -67.187  -69.743 37.610  1.00 74.09  ? 373  GLU C OE2 1 
ATOM   7300  N N   . VAL B 1 335 ? -62.604  -70.162 35.052  1.00 36.71  ? 374  VAL C N   1 
ATOM   7301  C CA  . VAL B 1 335 ? -62.335  -70.363 33.643  1.00 37.96  ? 374  VAL C CA  1 
ATOM   7302  C C   . VAL B 1 335 ? -63.374  -71.316 33.041  1.00 35.87  ? 374  VAL C C   1 
ATOM   7303  O O   . VAL B 1 335 ? -64.283  -71.771 33.738  1.00 38.55  ? 374  VAL C O   1 
ATOM   7304  C CB  . VAL B 1 335 ? -60.910  -70.897 33.424  1.00 36.66  ? 374  VAL C CB  1 
ATOM   7305  C CG1 . VAL B 1 335 ? -59.877  -69.870 33.917  1.00 37.81  ? 374  VAL C CG1 1 
ATOM   7306  C CG2 . VAL B 1 335 ? -60.723  -72.230 34.141  1.00 38.26  ? 374  VAL C CG2 1 
ATOM   7307  N N   . ASP B 1 336 ? -63.260  -71.563 31.739  1.00 40.69  ? 375  ASP C N   1 
ATOM   7308  C CA  . ASP B 1 336 ? -64.006  -72.631 31.075  1.00 41.99  ? 375  ASP C CA  1 
ATOM   7309  C C   . ASP B 1 336 ? -65.516  -72.585 31.325  1.00 50.48  ? 375  ASP C C   1 
ATOM   7310  O O   . ASP B 1 336 ? -66.133  -73.618 31.574  1.00 53.57  ? 375  ASP C O   1 
ATOM   7311  C CB  . ASP B 1 336 ? -63.444  -73.992 31.520  1.00 40.88  ? 375  ASP C CB  1 
ATOM   7312  C CG  . ASP B 1 336 ? -64.111  -75.169 30.815  1.00 56.69  ? 375  ASP C CG  1 
ATOM   7313  O OD1 . ASP B 1 336 ? -64.205  -75.157 29.569  1.00 46.63  ? 375  ASP C OD1 1 
ATOM   7314  O OD2 . ASP B 1 336 ? -64.553  -76.104 31.517  1.00 53.29  ? 375  ASP C OD2 1 
ATOM   7315  N N   . MET B 1 337 ? -66.122  -71.404 31.245  1.00 47.26  ? 376  MET C N   1 
ATOM   7316  C CA  . MET B 1 337 ? -67.553  -71.296 31.529  1.00 48.43  ? 376  MET C CA  1 
ATOM   7317  C C   . MET B 1 337 ? -68.471  -71.562 30.336  1.00 50.38  ? 376  MET C C   1 
ATOM   7318  O O   . MET B 1 337 ? -69.692  -71.655 30.504  1.00 53.59  ? 376  MET C O   1 
ATOM   7319  C CB  . MET B 1 337 ? -67.892  -69.946 32.166  1.00 55.41  ? 376  MET C CB  1 
ATOM   7320  C CG  . MET B 1 337 ? -67.359  -68.746 31.415  1.00 66.83  ? 376  MET C CG  1 
ATOM   7321  S SD  . MET B 1 337 ? -66.501  -67.645 32.557  1.00 71.29  ? 376  MET C SD  1 
ATOM   7322  C CE  . MET B 1 337 ? -65.393  -68.829 33.309  1.00 35.99  ? 376  MET C CE  1 
ATOM   7323  N N   . PHE B 1 338 ? -67.903  -71.673 29.140  1.00 43.40  ? 377  PHE C N   1 
ATOM   7324  C CA  . PHE B 1 338 ? -68.710  -71.984 27.958  1.00 44.32  ? 377  PHE C CA  1 
ATOM   7325  C C   . PHE B 1 338 ? -68.025  -72.992 27.044  1.00 41.21  ? 377  PHE C C   1 
ATOM   7326  O O   . PHE B 1 338 ? -66.852  -72.839 26.699  1.00 41.96  ? 377  PHE C O   1 
ATOM   7327  C CB  . PHE B 1 338 ? -69.079  -70.718 27.181  1.00 46.95  ? 377  PHE C CB  1 
ATOM   7328  C CG  . PHE B 1 338 ? -69.903  -69.753 27.971  1.00 47.78  ? 377  PHE C CG  1 
ATOM   7329  C CD1 . PHE B 1 338 ? -69.310  -68.673 28.602  1.00 49.70  ? 377  PHE C CD1 1 
ATOM   7330  C CD2 . PHE B 1 338 ? -71.270  -69.939 28.103  1.00 48.57  ? 377  PHE C CD2 1 
ATOM   7331  C CE1 . PHE B 1 338 ? -70.073  -67.788 29.342  1.00 52.20  ? 377  PHE C CE1 1 
ATOM   7332  C CE2 . PHE B 1 338 ? -72.035  -69.063 28.843  1.00 43.80  ? 377  PHE C CE2 1 
ATOM   7333  C CZ  . PHE B 1 338 ? -71.437  -67.983 29.461  1.00 50.49  ? 377  PHE C CZ  1 
ATOM   7334  N N   . LYS B 1 339 ? -68.781  -74.018 26.663  1.00 38.62  ? 378  LYS C N   1 
ATOM   7335  C CA  . LYS B 1 339 ? -68.289  -75.122 25.851  1.00 39.05  ? 378  LYS C CA  1 
ATOM   7336  C C   . LYS B 1 339 ? -67.731  -74.660 24.509  1.00 42.29  ? 378  LYS C C   1 
ATOM   7337  O O   . LYS B 1 339 ? -66.658  -75.099 24.095  1.00 46.93  ? 378  LYS C O   1 
ATOM   7338  C CB  . LYS B 1 339 ? -69.418  -76.140 25.639  1.00 53.22  ? 378  LYS C CB  1 
ATOM   7339  C CG  . LYS B 1 339 ? -68.973  -77.518 25.163  1.00 63.96  ? 378  LYS C CG  1 
ATOM   7340  C CD  . LYS B 1 339 ? -70.173  -78.461 25.016  1.00 67.15  ? 378  LYS C CD  1 
ATOM   7341  C CE  . LYS B 1 339 ? -70.955  -78.581 26.326  1.00 75.62  ? 378  LYS C CE  1 
ATOM   7342  N NZ  . LYS B 1 339 ? -72.270  -79.287 26.158  1.00 79.36  ? 378  LYS C NZ  1 
ATOM   7343  N N   . THR B 1 340 ? -68.449  -73.757 23.846  1.00 43.12  ? 379  THR C N   1 
ATOM   7344  C CA  . THR B 1 340 ? -68.100  -73.322 22.490  1.00 41.77  ? 379  THR C CA  1 
ATOM   7345  C C   . THR B 1 340 ? -66.836  -72.460 22.382  1.00 46.59  ? 379  THR C C   1 
ATOM   7346  O O   . THR B 1 340 ? -66.162  -72.461 21.350  1.00 46.80  ? 379  THR C O   1 
ATOM   7347  C CB  . THR B 1 340 ? -69.262  -72.550 21.835  1.00 48.17  ? 379  THR C CB  1 
ATOM   7348  O OG1 . THR B 1 340 ? -70.231  -73.480 21.343  1.00 60.15  ? 379  THR C OG1 1 
ATOM   7349  C CG2 . THR B 1 340 ? -68.753  -71.721 20.673  1.00 50.21  ? 379  THR C CG2 1 
ATOM   7350  N N   . LEU B 1 341 ? -66.508  -71.722 23.435  1.00 41.48  ? 380  LEU C N   1 
ATOM   7351  C CA  . LEU B 1 341 ? -65.370  -70.806 23.365  1.00 38.86  ? 380  LEU C CA  1 
ATOM   7352  C C   . LEU B 1 341 ? -64.011  -71.518 23.353  1.00 41.86  ? 380  LEU C C   1 
ATOM   7353  O O   . LEU B 1 341 ? -63.801  -72.501 24.058  1.00 48.92  ? 380  LEU C O   1 
ATOM   7354  C CB  . LEU B 1 341 ? -65.436  -69.772 24.496  1.00 35.72  ? 380  LEU C CB  1 
ATOM   7355  C CG  . LEU B 1 341 ? -66.745  -68.965 24.571  1.00 40.11  ? 380  LEU C CG  1 
ATOM   7356  C CD1 . LEU B 1 341 ? -66.702  -67.925 25.687  1.00 39.16  ? 380  LEU C CD1 1 
ATOM   7357  C CD2 . LEU B 1 341 ? -67.054  -68.302 23.243  1.00 33.87  ? 380  LEU C CD2 1 
ATOM   7358  N N   . HIS B 1 342 ? -63.087  -71.017 22.541  1.00 36.72  ? 381  HIS C N   1 
ATOM   7359  C CA  . HIS B 1 342 ? -61.731  -71.546 22.530  1.00 43.22  ? 381  HIS C CA  1 
ATOM   7360  C C   . HIS B 1 342 ? -61.083  -71.412 23.909  1.00 44.21  ? 381  HIS C C   1 
ATOM   7361  O O   . HIS B 1 342 ? -60.220  -72.204 24.274  1.00 41.23  ? 381  HIS C O   1 
ATOM   7362  C CB  . HIS B 1 342 ? -60.893  -70.837 21.477  1.00 36.23  ? 381  HIS C CB  1 
ATOM   7363  C CG  . HIS B 1 342 ? -61.344  -71.097 20.077  1.00 40.11  ? 381  HIS C CG  1 
ATOM   7364  N ND1 . HIS B 1 342 ? -60.994  -70.284 19.021  1.00 41.45  ? 381  HIS C ND1 1 
ATOM   7365  C CD2 . HIS B 1 342 ? -62.115  -72.079 19.555  1.00 45.46  ? 381  HIS C CD2 1 
ATOM   7366  C CE1 . HIS B 1 342 ? -61.529  -70.754 17.908  1.00 44.42  ? 381  HIS C CE1 1 
ATOM   7367  N NE2 . HIS B 1 342 ? -62.219  -71.843 18.207  1.00 44.32  ? 381  HIS C NE2 1 
ATOM   7368  N N   . GLY B 1 343 ? -61.516  -70.415 24.674  1.00 36.13  ? 382  GLY C N   1 
ATOM   7369  C CA  . GLY B 1 343 ? -61.020  -70.199 26.025  1.00 36.16  ? 382  GLY C CA  1 
ATOM   7370  C C   . GLY B 1 343 ? -61.763  -69.050 26.682  1.00 37.67  ? 382  GLY C C   1 
ATOM   7371  O O   . GLY B 1 343 ? -62.255  -68.161 25.988  1.00 38.62  ? 382  GLY C O   1 
ATOM   7372  N N   . SER B 1 344 ? -61.859  -69.053 28.008  1.00 34.69  ? 383  SER C N   1 
ATOM   7373  C CA  . SER B 1 344 ? -62.657  -68.031 28.680  1.00 37.58  ? 383  SER C CA  1 
ATOM   7374  C C   . SER B 1 344 ? -62.393  -67.962 30.181  1.00 39.72  ? 383  SER C C   1 
ATOM   7375  O O   . SER B 1 344 ? -62.037  -68.958 30.808  1.00 41.64  ? 383  SER C O   1 
ATOM   7376  C CB  . SER B 1 344 ? -64.145  -68.265 28.424  1.00 41.84  ? 383  SER C CB  1 
ATOM   7377  O OG  . SER B 1 344 ? -64.641  -69.317 29.239  1.00 38.15  ? 383  SER C OG  1 
ATOM   7378  N N   . ALA B 1 345 ? -62.581  -66.776 30.747  1.00 38.77  ? 384  ALA C N   1 
ATOM   7379  C CA  . ALA B 1 345 ? -62.368  -66.549 32.167  1.00 34.84  ? 384  ALA C CA  1 
ATOM   7380  C C   . ALA B 1 345 ? -63.197  -65.379 32.653  1.00 39.95  ? 384  ALA C C   1 
ATOM   7381  O O   . ALA B 1 345 ? -63.457  -64.434 31.907  1.00 41.24  ? 384  ALA C O   1 
ATOM   7382  C CB  . ALA B 1 345 ? -60.895  -66.291 32.454  1.00 31.87  ? 384  ALA C CB  1 
ATOM   7383  N N   . LEU B 1 346 ? -63.608  -65.455 33.911  1.00 38.69  ? 385  LEU C N   1 
ATOM   7384  C CA  . LEU B 1 346 ? -64.287  -64.356 34.573  1.00 39.78  ? 385  LEU C CA  1 
ATOM   7385  C C   . LEU B 1 346 ? -63.399  -63.936 35.734  1.00 40.81  ? 385  LEU C C   1 
ATOM   7386  O O   . LEU B 1 346 ? -63.048  -64.750 36.583  1.00 37.48  ? 385  LEU C O   1 
ATOM   7387  C CB  . LEU B 1 346 ? -65.661  -64.796 35.081  1.00 35.76  ? 385  LEU C CB  1 
ATOM   7388  C CG  . LEU B 1 346 ? -66.655  -63.738 35.580  1.00 39.39  ? 385  LEU C CG  1 
ATOM   7389  C CD1 . LEU B 1 346 ? -67.060  -62.777 34.468  1.00 36.15  ? 385  LEU C CD1 1 
ATOM   7390  C CD2 . LEU B 1 346 ? -67.894  -64.407 36.156  1.00 34.71  ? 385  LEU C CD2 1 
ATOM   7391  N N   . PHE B 1 347 ? -63.011  -62.670 35.760  1.00 35.14  ? 386  PHE C N   1 
ATOM   7392  C CA  . PHE B 1 347 ? -62.168  -62.187 36.841  1.00 38.10  ? 386  PHE C CA  1 
ATOM   7393  C C   . PHE B 1 347 ? -62.906  -61.135 37.647  1.00 36.34  ? 386  PHE C C   1 
ATOM   7394  O O   . PHE B 1 347 ? -63.430  -60.179 37.088  1.00 37.95  ? 386  PHE C O   1 
ATOM   7395  C CB  . PHE B 1 347 ? -60.849  -61.631 36.301  1.00 36.17  ? 386  PHE C CB  1 
ATOM   7396  C CG  . PHE B 1 347 ? -59.880  -61.229 37.382  1.00 45.47  ? 386  PHE C CG  1 
ATOM   7397  C CD1 . PHE B 1 347 ? -59.012  -62.163 37.938  1.00 38.92  ? 386  PHE C CD1 1 
ATOM   7398  C CD2 . PHE B 1 347 ? -59.855  -59.926 37.857  1.00 35.69  ? 386  PHE C CD2 1 
ATOM   7399  C CE1 . PHE B 1 347 ? -58.127  -61.806 38.939  1.00 33.69  ? 386  PHE C CE1 1 
ATOM   7400  C CE2 . PHE B 1 347 ? -58.976  -59.554 38.855  1.00 39.25  ? 386  PHE C CE2 1 
ATOM   7401  C CZ  . PHE B 1 347 ? -58.105  -60.496 39.402  1.00 40.48  ? 386  PHE C CZ  1 
ATOM   7402  N N   . GLN B 1 348 ? -62.948  -61.324 38.961  1.00 35.77  ? 387  GLN C N   1 
ATOM   7403  C CA  . GLN B 1 348 ? -63.711  -60.450 39.846  1.00 36.12  ? 387  GLN C CA  1 
ATOM   7404  C C   . GLN B 1 348 ? -62.840  -59.931 40.981  1.00 41.21  ? 387  GLN C C   1 
ATOM   7405  O O   . GLN B 1 348 ? -62.256  -60.707 41.732  1.00 35.92  ? 387  GLN C O   1 
ATOM   7406  C CB  . GLN B 1 348 ? -64.902  -61.201 40.443  1.00 36.77  ? 387  GLN C CB  1 
ATOM   7407  C CG  . GLN B 1 348 ? -65.840  -60.328 41.269  1.00 36.83  ? 387  GLN C CG  1 
ATOM   7408  C CD  . GLN B 1 348 ? -66.965  -59.740 40.426  1.00 43.24  ? 387  GLN C CD  1 
ATOM   7409  O OE1 . GLN B 1 348 ? -67.426  -60.370 39.473  1.00 46.77  ? 387  GLN C OE1 1 
ATOM   7410  N NE2 . GLN B 1 348 ? -67.404  -58.529 40.765  1.00 38.04  ? 387  GLN C NE2 1 
ATOM   7411  N N   . ARG B 1 349 ? -62.759  -58.611 41.093  1.00 35.32  ? 388  ARG C N   1 
ATOM   7412  C CA  . ARG B 1 349 ? -62.015  -57.962 42.160  1.00 36.47  ? 388  ARG C CA  1 
ATOM   7413  C C   . ARG B 1 349 ? -62.924  -56.878 42.710  1.00 34.92  ? 388  ARG C C   1 
ATOM   7414  O O   . ARG B 1 349 ? -63.192  -55.885 42.038  1.00 37.27  ? 388  ARG C O   1 
ATOM   7415  C CB  . ARG B 1 349 ? -60.702  -57.376 41.626  1.00 35.92  ? 388  ARG C CB  1 
ATOM   7416  C CG  . ARG B 1 349 ? -59.921  -56.556 42.647  1.00 40.51  ? 388  ARG C CG  1 
ATOM   7417  C CD  . ARG B 1 349 ? -58.421  -56.466 42.339  1.00 38.95  ? 388  ARG C CD  1 
ATOM   7418  N NE  . ARG B 1 349 ? -58.090  -56.249 40.929  1.00 40.12  ? 388  ARG C NE  1 
ATOM   7419  C CZ  . ARG B 1 349 ? -58.606  -55.292 40.159  1.00 46.17  ? 388  ARG C CZ  1 
ATOM   7420  N NH1 . ARG B 1 349 ? -59.496  -54.438 40.649  1.00 36.92  ? 388  ARG C NH1 1 
ATOM   7421  N NH2 . ARG B 1 349 ? -58.236  -55.194 38.887  1.00 36.57  ? 388  ARG C NH2 1 
ATOM   7422  N N   . GLY B 1 350 ? -63.436  -57.093 43.917  1.00 39.43  ? 389  GLY C N   1 
ATOM   7423  C CA  . GLY B 1 350 ? -64.479  -56.236 44.451  1.00 36.17  ? 389  GLY C CA  1 
ATOM   7424  C C   . GLY B 1 350 ? -65.672  -56.216 43.511  1.00 37.87  ? 389  GLY C C   1 
ATOM   7425  O O   . GLY B 1 350 ? -66.119  -57.259 43.038  1.00 39.68  ? 389  GLY C O   1 
ATOM   7426  N N   . GLN B 1 351 ? -66.188  -55.028 43.226  1.00 33.58  ? 390  GLN C N   1 
ATOM   7427  C CA  . GLN B 1 351 ? -67.328  -54.892 42.320  1.00 36.55  ? 390  GLN C CA  1 
ATOM   7428  C C   . GLN B 1 351 ? -66.903  -54.612 40.874  1.00 33.82  ? 390  GLN C C   1 
ATOM   7429  O O   . GLN B 1 351 ? -67.672  -54.083 40.071  1.00 34.71  ? 390  GLN C O   1 
ATOM   7430  C CB  . GLN B 1 351 ? -68.277  -53.813 42.829  1.00 36.30  ? 390  GLN C CB  1 
ATOM   7431  C CG  . GLN B 1 351 ? -68.746  -54.069 44.248  1.00 34.00  ? 390  GLN C CG  1 
ATOM   7432  C CD  . GLN B 1 351 ? -69.799  -53.079 44.703  1.00 43.76  ? 390  GLN C CD  1 
ATOM   7433  O OE1 . GLN B 1 351 ? -69.486  -52.072 45.336  1.00 42.13  ? 390  GLN C OE1 1 
ATOM   7434  N NE2 . GLN B 1 351 ? -71.058  -53.362 44.381  1.00 41.49  ? 390  GLN C NE2 1 
ATOM   7435  N N   . THR B 1 352 ? -65.662  -54.957 40.556  1.00 30.48  ? 391  THR C N   1 
ATOM   7436  C CA  . THR B 1 352 ? -65.187  -54.904 39.184  1.00 33.72  ? 391  THR C CA  1 
ATOM   7437  C C   . THR B 1 352 ? -65.220  -56.313 38.582  1.00 37.61  ? 391  THR C C   1 
ATOM   7438  O O   . THR B 1 352 ? -64.596  -57.239 39.115  1.00 35.05  ? 391  THR C O   1 
ATOM   7439  C CB  . THR B 1 352 ? -63.764  -54.314 39.111  1.00 32.66  ? 391  THR C CB  1 
ATOM   7440  O OG1 . THR B 1 352 ? -63.812  -52.916 39.436  1.00 34.80  ? 391  THR C OG1 1 
ATOM   7441  C CG2 . THR B 1 352 ? -63.185  -54.494 37.711  1.00 36.60  ? 391  THR C CG2 1 
ATOM   7442  N N   . GLN B 1 353 ? -65.959  -56.468 37.485  1.00 36.73  ? 392  GLN C N   1 
ATOM   7443  C CA  . GLN B 1 353 ? -66.127  -57.769 36.823  1.00 35.90  ? 392  GLN C CA  1 
ATOM   7444  C C   . GLN B 1 353 ? -65.744  -57.726 35.339  1.00 34.11  ? 392  GLN C C   1 
ATOM   7445  O O   . GLN B 1 353 ? -66.354  -57.018 34.550  1.00 32.77  ? 392  GLN C O   1 
ATOM   7446  C CB  . GLN B 1 353 ? -67.584  -58.238 36.952  1.00 38.29  ? 392  GLN C CB  1 
ATOM   7447  C CG  . GLN B 1 353 ? -67.889  -59.600 36.317  1.00 36.37  ? 392  GLN C CG  1 
ATOM   7448  C CD  . GLN B 1 353 ? -69.361  -59.972 36.442  1.00 37.08  ? 392  GLN C CD  1 
ATOM   7449  O OE1 . GLN B 1 353 ? -70.201  -59.497 35.683  1.00 33.39  ? 392  GLN C OE1 1 
ATOM   7450  N NE2 . GLN B 1 353 ? -69.677  -60.807 37.421  1.00 37.57  ? 392  GLN C NE2 1 
ATOM   7451  N N   . VAL B 1 354 ? -64.744  -58.498 34.953  1.00 33.41  ? 393  VAL C N   1 
ATOM   7452  C CA  . VAL B 1 354 ? -64.350  -58.552 33.550  1.00 32.96  ? 393  VAL C CA  1 
ATOM   7453  C C   . VAL B 1 354 ? -64.442  -59.974 32.990  1.00 38.43  ? 393  VAL C C   1 
ATOM   7454  O O   . VAL B 1 354 ? -63.910  -60.924 33.574  1.00 36.51  ? 393  VAL C O   1 
ATOM   7455  C CB  . VAL B 1 354 ? -62.931  -58.006 33.343  1.00 29.87  ? 393  VAL C CB  1 
ATOM   7456  C CG1 . VAL B 1 354 ? -62.559  -58.076 31.886  1.00 32.10  ? 393  VAL C CG1 1 
ATOM   7457  C CG2 . VAL B 1 354 ? -62.845  -56.574 33.844  1.00 31.96  ? 393  VAL C CG2 1 
ATOM   7458  N N   . LEU B 1 355 ? -65.137  -60.110 31.866  1.00 36.06  ? 394  LEU C N   1 
ATOM   7459  C CA  . LEU B 1 355 ? -65.214  -61.381 31.152  1.00 38.44  ? 394  LEU C CA  1 
ATOM   7460  C C   . LEU B 1 355 ? -64.198  -61.405 30.010  1.00 39.63  ? 394  LEU C C   1 
ATOM   7461  O O   . LEU B 1 355 ? -64.210  -60.531 29.142  1.00 36.36  ? 394  LEU C O   1 
ATOM   7462  C CB  . LEU B 1 355 ? -66.623  -61.594 30.587  1.00 36.28  ? 394  LEU C CB  1 
ATOM   7463  C CG  . LEU B 1 355 ? -66.702  -62.728 29.562  1.00 44.50  ? 394  LEU C CG  1 
ATOM   7464  C CD1 . LEU B 1 355 ? -66.801  -64.093 30.272  1.00 33.42  ? 394  LEU C CD1 1 
ATOM   7465  C CD2 . LEU B 1 355 ? -67.860  -62.506 28.594  1.00 42.98  ? 394  LEU C CD2 1 
ATOM   7466  N N   . CYS B 1 356 ? -63.315  -62.399 30.012  1.00 31.53  ? 395  CYS C N   1 
ATOM   7467  C CA  . CYS B 1 356 ? -62.328  -62.529 28.951  1.00 31.64  ? 395  CYS C CA  1 
ATOM   7468  C C   . CYS B 1 356 ? -62.561  -63.769 28.099  1.00 44.49  ? 395  CYS C C   1 
ATOM   7469  O O   . CYS B 1 356 ? -62.819  -64.861 28.620  1.00 38.01  ? 395  CYS C O   1 
ATOM   7470  C CB  . CYS B 1 356 ? -60.905  -62.533 29.519  1.00 29.78  ? 395  CYS C CB  1 
ATOM   7471  S SG  . CYS B 1 356 ? -60.475  -60.954 30.300  1.00 41.48  ? 395  CYS C SG  1 
ATOM   7472  N N   . THR B 1 357 ? -62.460  -63.580 26.788  1.00 41.27  ? 396  THR C N   1 
ATOM   7473  C CA  . THR B 1 357 ? -62.658  -64.649 25.825  1.00 36.28  ? 396  THR C CA  1 
ATOM   7474  C C   . THR B 1 357 ? -61.417  -64.768 24.959  1.00 38.69  ? 396  THR C C   1 
ATOM   7475  O O   . THR B 1 357 ? -60.895  -63.756 24.478  1.00 33.95  ? 396  THR C O   1 
ATOM   7476  C CB  . THR B 1 357 ? -63.837  -64.335 24.889  1.00 33.75  ? 396  THR C CB  1 
ATOM   7477  O OG1 . THR B 1 357 ? -65.069  -64.328 25.631  1.00 38.00  ? 396  THR C OG1 1 
ATOM   7478  C CG2 . THR B 1 357 ? -63.913  -65.372 23.765  1.00 37.50  ? 396  THR C CG2 1 
ATOM   7479  N N   . VAL B 1 358 ? -60.933  -65.994 24.771  1.00 35.02  ? 397  VAL C N   1 
ATOM   7480  C CA  . VAL B 1 358 ? -59.895  -66.233 23.782  1.00 27.73  ? 397  VAL C CA  1 
ATOM   7481  C C   . VAL B 1 358 ? -60.512  -66.788 22.510  1.00 38.16  ? 397  VAL C C   1 
ATOM   7482  O O   . VAL B 1 358 ? -61.326  -67.711 22.553  1.00 40.52  ? 397  VAL C O   1 
ATOM   7483  C CB  . VAL B 1 358 ? -58.806  -67.196 24.268  1.00 38.68  ? 397  VAL C CB  1 
ATOM   7484  C CG1 . VAL B 1 358 ? -57.841  -67.498 23.118  1.00 35.60  ? 397  VAL C CG1 1 
ATOM   7485  C CG2 . VAL B 1 358 ? -58.049  -66.600 25.462  1.00 36.10  ? 397  VAL C CG2 1 
ATOM   7486  N N   . THR B 1 359 ? -60.131  -66.208 21.378  1.00 40.66  ? 398  THR C N   1 
ATOM   7487  C CA  . THR B 1 359 ? -60.582  -66.697 20.081  1.00 37.83  ? 398  THR C CA  1 
ATOM   7488  C C   . THR B 1 359 ? -59.404  -66.851 19.152  1.00 41.10  ? 398  THR C C   1 
ATOM   7489  O O   . THR B 1 359 ? -58.615  -65.919 18.960  1.00 36.95  ? 398  THR C O   1 
ATOM   7490  C CB  . THR B 1 359 ? -61.619  -65.762 19.432  1.00 36.68  ? 398  THR C CB  1 
ATOM   7491  O OG1 . THR B 1 359 ? -62.699  -65.552 20.346  1.00 35.30  ? 398  THR C OG1 1 
ATOM   7492  C CG2 . THR B 1 359 ? -62.167  -66.383 18.142  1.00 41.33  ? 398  THR C CG2 1 
ATOM   7493  N N   . PHE B 1 360 ? -59.277  -68.047 18.592  1.00 43.97  ? 399  PHE C N   1 
ATOM   7494  C CA  . PHE B 1 360 ? -58.216  -68.330 17.645  1.00 39.98  ? 399  PHE C CA  1 
ATOM   7495  C C   . PHE B 1 360 ? -58.698  -67.973 16.256  1.00 40.28  ? 399  PHE C C   1 
ATOM   7496  O O   . PHE B 1 360 ? -59.850  -68.223 15.907  1.00 39.76  ? 399  PHE C O   1 
ATOM   7497  C CB  . PHE B 1 360 ? -57.808  -69.803 17.726  1.00 37.22  ? 399  PHE C CB  1 
ATOM   7498  C CG  . PHE B 1 360 ? -57.123  -70.158 19.002  1.00 39.65  ? 399  PHE C CG  1 
ATOM   7499  C CD1 . PHE B 1 360 ? -56.076  -69.379 19.482  1.00 37.92  ? 399  PHE C CD1 1 
ATOM   7500  C CD2 . PHE B 1 360 ? -57.536  -71.251 19.744  1.00 38.93  ? 399  PHE C CD2 1 
ATOM   7501  C CE1 . PHE B 1 360 ? -55.446  -69.697 20.667  1.00 33.59  ? 399  PHE C CE1 1 
ATOM   7502  C CE2 . PHE B 1 360 ? -56.913  -71.576 20.930  1.00 37.50  ? 399  PHE C CE2 1 
ATOM   7503  C CZ  . PHE B 1 360 ? -55.863  -70.795 21.393  1.00 40.67  ? 399  PHE C CZ  1 
ATOM   7504  N N   . ASP B 1 361 ? -57.813  -67.379 15.468  1.00 38.97  ? 400  ASP C N   1 
ATOM   7505  C CA  . ASP B 1 361 ? -58.173  -66.899 14.140  1.00 37.79  ? 400  ASP C CA  1 
ATOM   7506  C C   . ASP B 1 361 ? -57.086  -67.310 13.158  1.00 38.96  ? 400  ASP C C   1 
ATOM   7507  O O   . ASP B 1 361 ? -55.995  -67.703 13.566  1.00 39.54  ? 400  ASP C O   1 
ATOM   7508  C CB  . ASP B 1 361 ? -58.289  -65.373 14.155  1.00 40.54  ? 400  ASP C CB  1 
ATOM   7509  C CG  . ASP B 1 361 ? -59.332  -64.850 13.176  1.00 50.07  ? 400  ASP C CG  1 
ATOM   7510  O OD1 . ASP B 1 361 ? -59.779  -65.630 12.302  1.00 42.92  ? 400  ASP C OD1 1 
ATOM   7511  O OD2 . ASP B 1 361 ? -59.699  -63.652 13.285  1.00 38.62  ? 400  ASP C OD2 1 
ATOM   7512  N N   . SER B 1 362 ? -57.382  -67.209 11.869  1.00 37.96  ? 401  SER C N   1 
ATOM   7513  C CA  . SER B 1 362 ? -56.394  -67.487 10.839  1.00 37.25  ? 401  SER C CA  1 
ATOM   7514  C C   . SER B 1 362 ? -55.204  -66.546 10.964  1.00 46.93  ? 401  SER C C   1 
ATOM   7515  O O   . SER B 1 362 ? -55.351  -65.389 11.371  1.00 41.55  ? 401  SER C O   1 
ATOM   7516  C CB  . SER B 1 362 ? -57.020  -67.302 9.461   1.00 43.64  ? 401  SER C CB  1 
ATOM   7517  O OG  . SER B 1 362 ? -57.335  -65.933 9.255   1.00 45.15  ? 401  SER C OG  1 
ATOM   7518  N N   . LEU B 1 363 ? -54.027  -67.047 10.604  1.00 46.35  ? 402  LEU C N   1 
ATOM   7519  C CA  . LEU B 1 363 ? -52.851  -66.206 10.465  1.00 40.51  ? 402  LEU C CA  1 
ATOM   7520  C C   . LEU B 1 363 ? -53.160  -65.068 9.492   1.00 45.88  ? 402  LEU C C   1 
ATOM   7521  O O   . LEU B 1 363 ? -52.718  -63.933 9.687   1.00 43.59  ? 402  LEU C O   1 
ATOM   7522  C CB  . LEU B 1 363 ? -51.671  -67.033 9.944   1.00 37.82  ? 402  LEU C CB  1 
ATOM   7523  C CG  . LEU B 1 363 ? -50.646  -67.580 10.949  1.00 51.20  ? 402  LEU C CG  1 
ATOM   7524  C CD1 . LEU B 1 363 ? -51.192  -67.628 12.361  1.00 47.79  ? 402  LEU C CD1 1 
ATOM   7525  C CD2 . LEU B 1 363 ? -50.162  -68.954 10.516  1.00 46.63  ? 402  LEU C CD2 1 
ATOM   7526  N N   . GLU B 1 364 ? -53.932  -65.380 8.453   1.00 44.54  ? 403  GLU C N   1 
ATOM   7527  C CA  . GLU B 1 364 ? -54.256  -64.411 7.406   1.00 51.66  ? 403  GLU C CA  1 
ATOM   7528  C C   . GLU B 1 364 ? -55.037  -63.226 7.945   1.00 53.24  ? 403  GLU C C   1 
ATOM   7529  O O   . GLU B 1 364 ? -54.938  -62.118 7.415   1.00 51.54  ? 403  GLU C O   1 
ATOM   7530  C CB  . GLU B 1 364 ? -55.070  -65.057 6.286   1.00 46.77  ? 403  GLU C CB  1 
ATOM   7531  C CG  . GLU B 1 364 ? -54.331  -66.118 5.496   1.00 54.34  ? 403  GLU C CG  1 
ATOM   7532  C CD  . GLU B 1 364 ? -54.619  -67.527 5.990   1.00 62.29  ? 403  GLU C CD  1 
ATOM   7533  O OE1 . GLU B 1 364 ? -54.781  -67.719 7.220   1.00 51.99  ? 403  GLU C OE1 1 
ATOM   7534  O OE2 . GLU B 1 364 ? -54.690  -68.444 5.138   1.00 62.40  ? 403  GLU C OE2 1 
ATOM   7535  N N   . SER B 1 365 ? -55.829  -63.463 8.982   1.00 41.98  ? 404  SER C N   1 
ATOM   7536  C CA  . SER B 1 365 ? -56.658  -62.401 9.540   1.00 48.86  ? 404  SER C CA  1 
ATOM   7537  C C   . SER B 1 365 ? -55.795  -61.318 10.189  1.00 49.00  ? 404  SER C C   1 
ATOM   7538  O O   . SER B 1 365 ? -56.285  -60.230 10.498  1.00 49.40  ? 404  SER C O   1 
ATOM   7539  C CB  . SER B 1 365 ? -57.690  -62.955 10.531  1.00 41.15  ? 404  SER C CB  1 
ATOM   7540  O OG  . SER B 1 365 ? -57.080  -63.386 11.734  1.00 39.18  ? 404  SER C OG  1 
ATOM   7541  N N   . GLY B 1 366 ? -54.511  -61.612 10.384  1.00 39.29  ? 405  GLY C N   1 
ATOM   7542  C CA  . GLY B 1 366 ? -53.580  -60.622 10.898  1.00 53.85  ? 405  GLY C CA  1 
ATOM   7543  C C   . GLY B 1 366 ? -53.234  -59.545 9.877   1.00 63.17  ? 405  GLY C C   1 
ATOM   7544  O O   . GLY B 1 366 ? -52.681  -58.500 10.222  1.00 61.01  ? 405  GLY C O   1 
ATOM   7545  N N   . ILE B 1 367 ? -53.559  -59.805 8.614   1.00 56.89  ? 406  ILE C N   1 
ATOM   7546  C CA  . ILE B 1 367 ? -53.261  -58.881 7.527   1.00 58.27  ? 406  ILE C CA  1 
ATOM   7547  C C   . ILE B 1 367 ? -54.534  -58.535 6.765   1.00 63.75  ? 406  ILE C C   1 
ATOM   7548  O O   . ILE B 1 367 ? -55.318  -59.419 6.417   1.00 62.26  ? 406  ILE C O   1 
ATOM   7549  C CB  . ILE B 1 367 ? -52.254  -59.484 6.523   1.00 63.64  ? 406  ILE C CB  1 
ATOM   7550  C CG1 . ILE B 1 367 ? -50.937  -59.833 7.214   1.00 58.38  ? 406  ILE C CG1 1 
ATOM   7551  C CG2 . ILE B 1 367 ? -52.015  -58.525 5.363   1.00 62.67  ? 406  ILE C CG2 1 
ATOM   7552  C CD1 . ILE B 1 367 ? -49.869  -60.354 6.262   1.00 61.34  ? 406  ILE C CD1 1 
ATOM   7553  N N   . LYS B 1 368 ? -54.733  -57.250 6.494   1.00 60.48  ? 407  LYS C N   1 
ATOM   7554  C CA  . LYS B 1 368 ? -55.947  -56.797 5.828   1.00 61.99  ? 407  LYS C CA  1 
ATOM   7555  C C   . LYS B 1 368 ? -55.795  -56.897 4.314   1.00 68.31  ? 407  LYS C C   1 
ATOM   7556  O O   . LYS B 1 368 ? -54.694  -57.128 3.806   1.00 68.68  ? 407  LYS C O   1 
ATOM   7557  C CB  . LYS B 1 368 ? -56.298  -55.373 6.268   1.00 66.17  ? 407  LYS C CB  1 
ATOM   7558  C CG  . LYS B 1 368 ? -56.289  -55.205 7.787   1.00 66.20  ? 407  LYS C CG  1 
ATOM   7559  C CD  . LYS B 1 368 ? -56.616  -53.781 8.209   1.00 72.45  ? 407  LYS C CD  1 
ATOM   7560  C CE  . LYS B 1 368 ? -58.111  -53.503 8.145   1.00 71.88  ? 407  LYS C CE  1 
ATOM   7561  N NZ  . LYS B 1 368 ? -58.848  -54.146 9.263   1.00 74.65  ? 407  LYS C NZ  1 
ATOM   7562  N N   . SER B 1 369 ? -56.904  -56.740 3.597   1.00 75.48  ? 408  SER C N   1 
ATOM   7563  C CA  . SER B 1 369 ? -56.912  -56.940 2.149   1.00 76.78  ? 408  SER C CA  1 
ATOM   7564  C C   . SER B 1 369 ? -56.188  -55.817 1.411   1.00 77.77  ? 408  SER C C   1 
ATOM   7565  O O   . SER B 1 369 ? -55.498  -56.049 0.414   1.00 71.32  ? 408  SER C O   1 
ATOM   7566  C CB  . SER B 1 369 ? -58.348  -57.063 1.635   1.00 77.02  ? 408  SER C CB  1 
ATOM   7567  O OG  . SER B 1 369 ? -58.367  -57.264 0.232   1.00 82.23  ? 408  SER C OG  1 
ATOM   7568  N N   . ASP B 1 370 ? -56.354  -54.599 1.912   1.00 71.53  ? 409  ASP C N   1 
ATOM   7569  C CA  . ASP B 1 370 ? -55.749  -53.430 1.294   1.00 72.70  ? 409  ASP C CA  1 
ATOM   7570  C C   . ASP B 1 370 ? -54.328  -53.237 1.819   1.00 63.70  ? 409  ASP C C   1 
ATOM   7571  O O   . ASP B 1 370 ? -54.109  -53.098 3.021   1.00 58.50  ? 409  ASP C O   1 
ATOM   7572  C CB  . ASP B 1 370 ? -56.611  -52.189 1.558   1.00 74.62  ? 409  ASP C CB  1 
ATOM   7573  C CG  . ASP B 1 370 ? -56.153  -50.975 0.768   1.00 74.64  ? 409  ASP C CG  1 
ATOM   7574  O OD1 . ASP B 1 370 ? -55.331  -50.201 1.303   1.00 74.21  ? 409  ASP C OD1 1 
ATOM   7575  O OD2 . ASP B 1 370 ? -56.614  -50.794 -0.382  1.00 78.67  ? 409  ASP C OD2 1 
ATOM   7576  N N   . GLN B 1 371 ? -53.368  -53.253 0.904   1.00 63.34  ? 410  GLN C N   1 
ATOM   7577  C CA  . GLN B 1 371 ? -51.964  -53.037 1.232   1.00 66.62  ? 410  GLN C CA  1 
ATOM   7578  C C   . GLN B 1 371 ? -51.761  -51.795 2.112   1.00 66.82  ? 410  GLN C C   1 
ATOM   7579  O O   . GLN B 1 371 ? -51.069  -51.854 3.133   1.00 59.91  ? 410  GLN C O   1 
ATOM   7580  C CB  . GLN B 1 371 ? -51.145  -52.943 -0.067  1.00 71.33  ? 410  GLN C CB  1 
ATOM   7581  C CG  . GLN B 1 371 ? -50.027  -51.904 -0.079  1.00 69.21  ? 410  GLN C CG  1 
ATOM   7582  C CD  . GLN B 1 371 ? -48.749  -52.406 0.561   1.00 71.84  ? 410  GLN C CD  1 
ATOM   7583  O OE1 . GLN B 1 371 ? -48.783  -53.217 1.490   1.00 73.43  ? 410  GLN C OE1 1 
ATOM   7584  N NE2 . GLN B 1 371 ? -47.610  -51.931 0.061   1.00 59.86  ? 410  GLN C NE2 1 
ATOM   7585  N N   . VAL B 1 372 ? -52.375  -50.680 1.726   1.00 59.39  ? 411  VAL C N   1 
ATOM   7586  C CA  . VAL B 1 372 ? -52.207  -49.423 2.457   1.00 64.25  ? 411  VAL C CA  1 
ATOM   7587  C C   . VAL B 1 372 ? -52.875  -49.484 3.831   1.00 61.97  ? 411  VAL C C   1 
ATOM   7588  O O   . VAL B 1 372 ? -52.275  -49.118 4.841   1.00 50.79  ? 411  VAL C O   1 
ATOM   7589  C CB  . VAL B 1 372 ? -52.794  -48.224 1.684   1.00 55.12  ? 411  VAL C CB  1 
ATOM   7590  C CG1 . VAL B 1 372 ? -52.521  -46.935 2.443   1.00 54.98  ? 411  VAL C CG1 1 
ATOM   7591  C CG2 . VAL B 1 372 ? -52.216  -48.159 0.278   1.00 58.85  ? 411  VAL C CG2 1 
ATOM   7592  N N   . ILE B 1 373 ? -54.122  -49.946 3.852   1.00 52.40  ? 412  ILE C N   1 
ATOM   7593  C CA  . ILE B 1 373 ? -54.871  -50.083 5.095   1.00 55.87  ? 412  ILE C CA  1 
ATOM   7594  C C   . ILE B 1 373 ? -54.139  -51.007 6.070   1.00 51.45  ? 412  ILE C C   1 
ATOM   7595  O O   . ILE B 1 373 ? -54.135  -50.773 7.278   1.00 52.33  ? 412  ILE C O   1 
ATOM   7596  C CB  . ILE B 1 373 ? -56.316  -50.579 4.836   1.00 67.29  ? 412  ILE C CB  1 
ATOM   7597  C CG1 . ILE B 1 373 ? -57.250  -49.399 4.542   1.00 67.55  ? 412  ILE C CG1 1 
ATOM   7598  C CG2 . ILE B 1 373 ? -56.842  -51.331 6.031   1.00 68.14  ? 412  ILE C CG2 1 
ATOM   7599  C CD1 . ILE B 1 373 ? -56.835  -48.548 3.358   1.00 65.51  ? 412  ILE C CD1 1 
ATOM   7600  N N   . THR B 1 374 ? -53.494  -52.042 5.543   1.00 57.58  ? 413  THR C N   1 
ATOM   7601  C CA  . THR B 1 374 ? -52.710  -52.945 6.380   1.00 47.48  ? 413  THR C CA  1 
ATOM   7602  C C   . THR B 1 374 ? -51.551  -52.229 7.078   1.00 59.51  ? 413  THR C C   1 
ATOM   7603  O O   . THR B 1 374 ? -51.358  -52.377 8.289   1.00 57.94  ? 413  THR C O   1 
ATOM   7604  C CB  . THR B 1 374 ? -52.159  -54.146 5.579   1.00 62.87  ? 413  THR C CB  1 
ATOM   7605  O OG1 . THR B 1 374 ? -53.237  -55.010 5.198   1.00 53.23  ? 413  THR C OG1 1 
ATOM   7606  C CG2 . THR B 1 374 ? -51.167  -54.932 6.421   1.00 57.23  ? 413  THR C CG2 1 
ATOM   7607  N N   . ALA B 1 375 ? -50.779  -51.455 6.319   1.00 55.41  ? 414  ALA C N   1 
ATOM   7608  C CA  . ALA B 1 375 ? -49.613  -50.772 6.877   1.00 52.80  ? 414  ALA C CA  1 
ATOM   7609  C C   . ALA B 1 375 ? -49.995  -49.816 8.010   1.00 64.76  ? 414  ALA C C   1 
ATOM   7610  O O   . ALA B 1 375 ? -49.238  -49.653 8.971   1.00 59.06  ? 414  ALA C O   1 
ATOM   7611  C CB  . ALA B 1 375 ? -48.847  -50.033 5.789   1.00 54.93  ? 414  ALA C CB  1 
ATOM   7612  N N   . ILE B 1 376 ? -51.170  -49.195 7.895   1.00 53.65  ? 415  ILE C N   1 
ATOM   7613  C CA  . ILE B 1 376 ? -51.617  -48.202 8.872   1.00 61.52  ? 415  ILE C CA  1 
ATOM   7614  C C   . ILE B 1 376 ? -51.509  -48.721 10.301  1.00 63.68  ? 415  ILE C C   1 
ATOM   7615  O O   . ILE B 1 376 ? -50.883  -48.080 11.148  1.00 62.14  ? 415  ILE C O   1 
ATOM   7616  C CB  . ILE B 1 376 ? -53.057  -47.732 8.606   1.00 58.80  ? 415  ILE C CB  1 
ATOM   7617  C CG1 . ILE B 1 376 ? -53.106  -46.863 7.346   1.00 57.71  ? 415  ILE C CG1 1 
ATOM   7618  C CG2 . ILE B 1 376 ? -53.592  -46.956 9.803   1.00 61.32  ? 415  ILE C CG2 1 
ATOM   7619  C CD1 . ILE B 1 376 ? -54.510  -46.484 6.914   1.00 59.47  ? 415  ILE C CD1 1 
ATOM   7620  N N   . ASN B 1 377 ? -52.113  -49.881 10.560  1.00 60.39  ? 416  ASN C N   1 
ATOM   7621  C CA  . ASN B 1 377 ? -52.025  -50.512 11.877  1.00 61.39  ? 416  ASN C CA  1 
ATOM   7622  C C   . ASN B 1 377 ? -50.961  -51.610 11.974  1.00 61.20  ? 416  ASN C C   1 
ATOM   7623  O O   . ASN B 1 377 ? -50.663  -52.095 13.064  1.00 60.22  ? 416  ASN C O   1 
ATOM   7624  C CB  . ASN B 1 377 ? -53.388  -51.049 12.328  1.00 64.23  ? 416  ASN C CB  1 
ATOM   7625  C CG  . ASN B 1 377 ? -54.204  -50.010 13.092  1.00 71.90  ? 416  ASN C CG  1 
ATOM   7626  O OD1 . ASN B 1 377 ? -53.656  -49.053 13.646  1.00 63.34  ? 416  ASN C OD1 1 
ATOM   7627  N ND2 . ASN B 1 377 ? -55.520  -50.201 13.131  1.00 68.89  ? 416  ASN C ND2 1 
ATOM   7628  N N   . GLY B 1 378 ? -50.391  -51.995 10.836  1.00 58.70  ? 417  GLY C N   1 
ATOM   7629  C CA  . GLY B 1 378 ? -49.324  -52.983 10.815  1.00 66.14  ? 417  GLY C CA  1 
ATOM   7630  C C   . GLY B 1 378 ? -49.778  -54.383 11.195  1.00 52.34  ? 417  GLY C C   1 
ATOM   7631  O O   . GLY B 1 378 ? -50.970  -54.625 11.374  1.00 47.53  ? 417  GLY C O   1 
ATOM   7632  N N   . ILE B 1 379 ? -48.823  -55.304 11.305  1.00 50.98  ? 418  ILE C N   1 
ATOM   7633  C CA  . ILE B 1 379 ? -49.116  -56.676 11.701  1.00 58.92  ? 418  ILE C CA  1 
ATOM   7634  C C   . ILE B 1 379 ? -48.773  -56.860 13.170  1.00 57.02  ? 418  ILE C C   1 
ATOM   7635  O O   . ILE B 1 379 ? -47.663  -56.533 13.594  1.00 61.83  ? 418  ILE C O   1 
ATOM   7636  C CB  . ILE B 1 379 ? -48.285  -57.694 10.890  1.00 65.49  ? 418  ILE C CB  1 
ATOM   7637  C CG1 . ILE B 1 379 ? -48.234  -57.303 9.414   1.00 56.60  ? 418  ILE C CG1 1 
ATOM   7638  C CG2 . ILE B 1 379 ? -48.841  -59.111 11.071  1.00 60.80  ? 418  ILE C CG2 1 
ATOM   7639  C CD1 . ILE B 1 379 ? -49.579  -57.306 8.743   1.00 65.89  ? 418  ILE C CD1 1 
ATOM   7640  N N   . LYS B 1 380 ? -49.717  -57.380 13.947  1.00 43.57  ? 419  LYS C N   1 
ATOM   7641  C CA  . LYS B 1 380 ? -49.466  -57.631 15.362  1.00 44.28  ? 419  LYS C CA  1 
ATOM   7642  C C   . LYS B 1 380 ? -48.358  -58.670 15.515  1.00 50.01  ? 419  LYS C C   1 
ATOM   7643  O O   . LYS B 1 380 ? -48.453  -59.777 14.977  1.00 50.31  ? 419  LYS C O   1 
ATOM   7644  C CB  . LYS B 1 380 ? -50.743  -58.088 16.070  1.00 46.65  ? 419  LYS C CB  1 
ATOM   7645  C CG  . LYS B 1 380 ? -51.763  -56.965 16.336  1.00 49.03  ? 419  LYS C CG  1 
ATOM   7646  C CD  . LYS B 1 380 ? -51.263  -56.005 17.420  1.00 46.57  ? 419  LYS C CD  1 
ATOM   7647  C CE  . LYS B 1 380 ? -52.303  -54.952 17.783  1.00 44.53  ? 419  LYS C CE  1 
ATOM   7648  N NZ  . LYS B 1 380 ? -51.723  -53.943 18.721  1.00 45.81  ? 419  LYS C NZ  1 
ATOM   7649  N N   . ASP B 1 381 ? -47.292  -58.303 16.221  1.00 45.38  ? 420  ASP C N   1 
ATOM   7650  C CA  . ASP B 1 381 ? -46.205  -59.241 16.449  1.00 49.38  ? 420  ASP C CA  1 
ATOM   7651  C C   . ASP B 1 381 ? -46.672  -60.394 17.326  1.00 50.37  ? 420  ASP C C   1 
ATOM   7652  O O   . ASP B 1 381 ? -47.455  -60.199 18.260  1.00 40.26  ? 420  ASP C O   1 
ATOM   7653  C CB  . ASP B 1 381 ? -45.002  -58.563 17.093  1.00 49.42  ? 420  ASP C CB  1 
ATOM   7654  C CG  . ASP B 1 381 ? -43.827  -59.509 17.223  1.00 57.12  ? 420  ASP C CG  1 
ATOM   7655  O OD1 . ASP B 1 381 ? -43.552  -60.226 16.237  1.00 52.86  ? 420  ASP C OD1 1 
ATOM   7656  O OD2 . ASP B 1 381 ? -43.201  -59.559 18.305  1.00 52.21  ? 420  ASP C OD2 1 
ATOM   7657  N N   . LYS B 1 382 ? -46.179  -61.592 17.027  1.00 44.88  ? 421  LYS C N   1 
ATOM   7658  C CA  . LYS B 1 382 ? -46.658  -62.801 17.686  1.00 41.37  ? 421  LYS C CA  1 
ATOM   7659  C C   . LYS B 1 382 ? -48.125  -63.046 17.332  1.00 43.41  ? 421  LYS C C   1 
ATOM   7660  O O   . LYS B 1 382 ? -48.778  -63.895 17.944  1.00 37.10  ? 421  LYS C O   1 
ATOM   7661  C CB  . LYS B 1 382 ? -46.523  -62.709 19.213  1.00 42.36  ? 421  LYS C CB  1 
ATOM   7662  C CG  . LYS B 1 382 ? -45.163  -62.255 19.752  1.00 41.68  ? 421  LYS C CG  1 
ATOM   7663  C CD  . LYS B 1 382 ? -45.068  -62.603 21.236  1.00 43.78  ? 421  LYS C CD  1 
ATOM   7664  C CE  . LYS B 1 382 ? -43.779  -62.112 21.890  1.00 41.04  ? 421  LYS C CE  1 
ATOM   7665  N NZ  . LYS B 1 382 ? -43.758  -62.459 23.348  1.00 38.35  ? 421  LYS C NZ  1 
ATOM   7666  N N   . ASN B 1 383 ? -48.637  -62.300 16.353  1.00 40.52  ? 422  ASN C N   1 
ATOM   7667  C CA  . ASN B 1 383 ? -50.046  -62.394 15.970  1.00 40.11  ? 422  ASN C CA  1 
ATOM   7668  C C   . ASN B 1 383 ? -50.936  -62.482 17.201  1.00 38.52  ? 422  ASN C C   1 
ATOM   7669  O O   . ASN B 1 383 ? -51.766  -63.390 17.327  1.00 43.01  ? 422  ASN C O   1 
ATOM   7670  C CB  . ASN B 1 383 ? -50.285  -63.594 15.051  1.00 41.98  ? 422  ASN C CB  1 
ATOM   7671  C CG  . ASN B 1 383 ? -49.420  -63.552 13.803  1.00 48.64  ? 422  ASN C CG  1 
ATOM   7672  O OD1 . ASN B 1 383 ? -48.524  -64.383 13.628  1.00 50.46  ? 422  ASN C OD1 1 
ATOM   7673  N ND2 . ASN B 1 383 ? -49.687  -62.589 12.926  1.00 42.24  ? 422  ASN C ND2 1 
ATOM   7674  N N   . PHE B 1 384 ? -50.731  -61.540 18.115  1.00 34.78  ? 423  PHE C N   1 
ATOM   7675  C CA  . PHE B 1 384 ? -51.480  -61.466 19.359  1.00 31.59  ? 423  PHE C CA  1 
ATOM   7676  C C   . PHE B 1 384 ? -52.170  -60.104 19.498  1.00 32.09  ? 423  PHE C C   1 
ATOM   7677  O O   . PHE B 1 384 ? -51.552  -59.069 19.287  1.00 34.29  ? 423  PHE C O   1 
ATOM   7678  C CB  . PHE B 1 384 ? -50.540  -61.699 20.537  1.00 34.34  ? 423  PHE C CB  1 
ATOM   7679  C CG  . PHE B 1 384 ? -51.163  -61.416 21.868  1.00 33.10  ? 423  PHE C CG  1 
ATOM   7680  C CD1 . PHE B 1 384 ? -52.129  -62.263 22.389  1.00 33.70  ? 423  PHE C CD1 1 
ATOM   7681  C CD2 . PHE B 1 384 ? -50.788  -60.299 22.602  1.00 30.43  ? 423  PHE C CD2 1 
ATOM   7682  C CE1 . PHE B 1 384 ? -52.710  -61.999 23.623  1.00 37.32  ? 423  PHE C CE1 1 
ATOM   7683  C CE2 . PHE B 1 384 ? -51.367  -60.032 23.834  1.00 30.74  ? 423  PHE C CE2 1 
ATOM   7684  C CZ  . PHE B 1 384 ? -52.327  -60.884 24.344  1.00 32.13  ? 423  PHE C CZ  1 
ATOM   7685  N N   . MET B 1 385 ? -53.447  -60.100 19.869  1.00 29.58  ? 424  MET C N   1 
ATOM   7686  C CA  . MET B 1 385 ? -54.185  -58.853 19.946  1.00 34.36  ? 424  MET C CA  1 
ATOM   7687  C C   . MET B 1 385 ? -55.259  -58.956 21.018  1.00 40.16  ? 424  MET C C   1 
ATOM   7688  O O   . MET B 1 385 ? -55.890  -60.006 21.174  1.00 38.72  ? 424  MET C O   1 
ATOM   7689  C CB  . MET B 1 385 ? -54.778  -58.520 18.572  1.00 38.78  ? 424  MET C CB  1 
ATOM   7690  C CG  . MET B 1 385 ? -56.073  -57.745 18.598  1.00 58.82  ? 424  MET C CG  1 
ATOM   7691  S SD  . MET B 1 385 ? -57.478  -58.769 18.116  1.00 71.65  ? 424  MET C SD  1 
ATOM   7692  C CE  . MET B 1 385 ? -58.375  -58.885 19.658  1.00 53.25  ? 424  MET C CE  1 
ATOM   7693  N N   . LEU B 1 386 ? -55.432  -57.881 21.783  1.00 33.98  ? 425  LEU C N   1 
ATOM   7694  C CA  . LEU B 1 386 ? -56.481  -57.823 22.796  1.00 32.34  ? 425  LEU C CA  1 
ATOM   7695  C C   . LEU B 1 386 ? -57.397  -56.631 22.530  1.00 36.19  ? 425  LEU C C   1 
ATOM   7696  O O   . LEU B 1 386 ? -56.937  -55.524 22.227  1.00 34.15  ? 425  LEU C O   1 
ATOM   7697  C CB  . LEU B 1 386 ? -55.888  -57.765 24.204  1.00 24.29  ? 425  LEU C CB  1 
ATOM   7698  C CG  . LEU B 1 386 ? -56.856  -57.843 25.392  1.00 28.43  ? 425  LEU C CG  1 
ATOM   7699  C CD1 . LEU B 1 386 ? -56.169  -58.477 26.602  1.00 28.24  ? 425  LEU C CD1 1 
ATOM   7700  C CD2 . LEU B 1 386 ? -57.417  -56.457 25.743  1.00 27.05  ? 425  LEU C CD2 1 
ATOM   7701  N N   . HIS B 1 387 ? -58.695  -56.875 22.627  1.00 30.67  ? 426  HIS C N   1 
ATOM   7702  C CA  . HIS B 1 387 ? -59.701  -55.858 22.356  1.00 31.09  ? 426  HIS C CA  1 
ATOM   7703  C C   . HIS B 1 387 ? -60.507  -55.680 23.631  1.00 30.99  ? 426  HIS C C   1 
ATOM   7704  O O   . HIS B 1 387 ? -60.948  -56.653 24.233  1.00 36.02  ? 426  HIS C O   1 
ATOM   7705  C CB  . HIS B 1 387 ? -60.596  -56.304 21.192  1.00 38.30  ? 426  HIS C CB  1 
ATOM   7706  C CG  . HIS B 1 387 ? -61.799  -55.437 20.974  1.00 38.81  ? 426  HIS C CG  1 
ATOM   7707  N ND1 . HIS B 1 387 ? -61.737  -54.225 20.318  1.00 40.37  ? 426  HIS C ND1 1 
ATOM   7708  C CD2 . HIS B 1 387 ? -63.099  -55.619 21.306  1.00 39.55  ? 426  HIS C CD2 1 
ATOM   7709  C CE1 . HIS B 1 387 ? -62.945  -53.693 20.266  1.00 36.50  ? 426  HIS C CE1 1 
ATOM   7710  N NE2 . HIS B 1 387 ? -63.790  -54.518 20.856  1.00 39.16  ? 426  HIS C NE2 1 
ATOM   7711  N N   . TYR B 1 388 ? -60.689  -54.437 24.054  1.00 30.73  ? 427  TYR C N   1 
ATOM   7712  C CA  . TYR B 1 388 ? -61.312  -54.174 25.339  1.00 29.24  ? 427  TYR C CA  1 
ATOM   7713  C C   . TYR B 1 388 ? -62.573  -53.374 25.101  1.00 37.59  ? 427  TYR C C   1 
ATOM   7714  O O   . TYR B 1 388 ? -62.614  -52.498 24.244  1.00 30.24  ? 427  TYR C O   1 
ATOM   7715  C CB  . TYR B 1 388 ? -60.307  -53.440 26.226  1.00 24.75  ? 427  TYR C CB  1 
ATOM   7716  C CG  . TYR B 1 388 ? -60.812  -52.671 27.430  1.00 27.86  ? 427  TYR C CG  1 
ATOM   7717  C CD1 . TYR B 1 388 ? -61.462  -51.447 27.287  1.00 33.77  ? 427  TYR C CD1 1 
ATOM   7718  C CD2 . TYR B 1 388 ? -60.542  -53.118 28.718  1.00 31.34  ? 427  TYR C CD2 1 
ATOM   7719  C CE1 . TYR B 1 388 ? -61.878  -50.716 28.403  1.00 32.05  ? 427  TYR C CE1 1 
ATOM   7720  C CE2 . TYR B 1 388 ? -60.951  -52.403 29.831  1.00 27.25  ? 427  TYR C CE2 1 
ATOM   7721  C CZ  . TYR B 1 388 ? -61.613  -51.197 29.668  1.00 34.61  ? 427  TYR C CZ  1 
ATOM   7722  O OH  . TYR B 1 388 ? -62.009  -50.479 30.779  1.00 32.57  ? 427  TYR C OH  1 
ATOM   7723  N N   . GLU B 1 389 ? -63.619  -53.710 25.836  1.00 24.86  ? 428  GLU C N   1 
ATOM   7724  C CA  . GLU B 1 389 ? -64.844  -52.964 25.743  1.00 25.05  ? 428  GLU C CA  1 
ATOM   7725  C C   . GLU B 1 389 ? -65.363  -52.684 27.137  1.00 32.88  ? 428  GLU C C   1 
ATOM   7726  O O   . GLU B 1 389 ? -65.263  -53.523 28.041  1.00 29.87  ? 428  GLU C O   1 
ATOM   7727  C CB  . GLU B 1 389 ? -65.890  -53.715 24.915  1.00 31.01  ? 428  GLU C CB  1 
ATOM   7728  C CG  . GLU B 1 389 ? -65.553  -53.807 23.438  1.00 33.88  ? 428  GLU C CG  1 
ATOM   7729  C CD  . GLU B 1 389 ? -66.700  -54.340 22.609  1.00 47.48  ? 428  GLU C CD  1 
ATOM   7730  O OE1 . GLU B 1 389 ? -66.516  -54.502 21.384  1.00 57.49  ? 428  GLU C OE1 1 
ATOM   7731  O OE2 . GLU B 1 389 ? -67.782  -54.597 23.180  1.00 48.82  ? 428  GLU C OE2 1 
ATOM   7732  N N   . PHE B 1 390 ? -65.909  -51.486 27.293  1.00 29.35  ? 429  PHE C N   1 
ATOM   7733  C CA  . PHE B 1 390 ? -66.438  -51.016 28.560  1.00 33.82  ? 429  PHE C CA  1 
ATOM   7734  C C   . PHE B 1 390 ? -67.873  -50.578 28.293  1.00 36.65  ? 429  PHE C C   1 
ATOM   7735  O O   . PHE B 1 390 ? -68.135  -49.394 28.097  1.00 33.32  ? 429  PHE C O   1 
ATOM   7736  C CB  . PHE B 1 390 ? -65.593  -49.830 29.046  1.00 36.67  ? 429  PHE C CB  1 
ATOM   7737  C CG  . PHE B 1 390 ? -65.846  -49.428 30.477  1.00 33.95  ? 429  PHE C CG  1 
ATOM   7738  C CD1 . PHE B 1 390 ? -67.127  -49.402 30.997  1.00 43.92  ? 429  PHE C CD1 1 
ATOM   7739  C CD2 . PHE B 1 390 ? -64.794  -49.064 31.295  1.00 42.25  ? 429  PHE C CD2 1 
ATOM   7740  C CE1 . PHE B 1 390 ? -67.352  -49.021 32.306  1.00 50.17  ? 429  PHE C CE1 1 
ATOM   7741  C CE2 . PHE B 1 390 ? -65.016  -48.683 32.609  1.00 49.08  ? 429  PHE C CE2 1 
ATOM   7742  C CZ  . PHE B 1 390 ? -66.294  -48.662 33.112  1.00 47.04  ? 429  PHE C CZ  1 
ATOM   7743  N N   . PRO B 1 391 ? -68.806  -51.540 28.249  1.00 31.46  ? 430  PRO C N   1 
ATOM   7744  C CA  . PRO B 1 391 ? -70.205  -51.219 27.939  1.00 31.58  ? 430  PRO C CA  1 
ATOM   7745  C C   . PRO B 1 391 ? -70.879  -50.394 29.021  1.00 32.97  ? 430  PRO C C   1 
ATOM   7746  O O   . PRO B 1 391 ? -70.487  -50.476 30.186  1.00 34.73  ? 430  PRO C O   1 
ATOM   7747  C CB  . PRO B 1 391 ? -70.875  -52.598 27.846  1.00 34.73  ? 430  PRO C CB  1 
ATOM   7748  C CG  . PRO B 1 391 ? -69.986  -53.506 28.599  1.00 41.61  ? 430  PRO C CG  1 
ATOM   7749  C CD  . PRO B 1 391 ? -68.591  -52.988 28.383  1.00 38.14  ? 430  PRO C CD  1 
ATOM   7750  N N   . PRO B 1 392 ? -71.911  -49.623 28.640  1.00 34.14  ? 431  PRO C N   1 
ATOM   7751  C CA  . PRO B 1 392 ? -72.652  -48.713 29.522  1.00 37.41  ? 431  PRO C CA  1 
ATOM   7752  C C   . PRO B 1 392 ? -73.204  -49.376 30.783  1.00 34.84  ? 431  PRO C C   1 
ATOM   7753  O O   . PRO B 1 392 ? -73.222  -48.743 31.841  1.00 29.17  ? 431  PRO C O   1 
ATOM   7754  C CB  . PRO B 1 392 ? -73.820  -48.254 28.639  1.00 45.23  ? 431  PRO C CB  1 
ATOM   7755  C CG  . PRO B 1 392 ? -73.323  -48.389 27.251  1.00 37.98  ? 431  PRO C CG  1 
ATOM   7756  C CD  . PRO B 1 392 ? -72.386  -49.554 27.246  1.00 30.35  ? 431  PRO C CD  1 
ATOM   7757  N N   . TYR B 1 393 ? -73.661  -50.619 30.665  1.00 34.03  ? 432  TYR C N   1 
ATOM   7758  C CA  . TYR B 1 393 ? -74.374  -51.285 31.755  1.00 32.94  ? 432  TYR C CA  1 
ATOM   7759  C C   . TYR B 1 393 ? -73.444  -51.653 32.911  1.00 31.29  ? 432  TYR C C   1 
ATOM   7760  O O   . TYR B 1 393 ? -73.905  -51.990 34.001  1.00 33.83  ? 432  TYR C O   1 
ATOM   7761  C CB  . TYR B 1 393 ? -75.134  -52.529 31.250  1.00 30.62  ? 432  TYR C CB  1 
ATOM   7762  C CG  . TYR B 1 393 ? -74.273  -53.527 30.493  1.00 30.70  ? 432  TYR C CG  1 
ATOM   7763  C CD1 . TYR B 1 393 ? -73.377  -54.348 31.162  1.00 33.32  ? 432  TYR C CD1 1 
ATOM   7764  C CD2 . TYR B 1 393 ? -74.367  -53.651 29.117  1.00 36.52  ? 432  TYR C CD2 1 
ATOM   7765  C CE1 . TYR B 1 393 ? -72.594  -55.248 30.487  1.00 31.25  ? 432  TYR C CE1 1 
ATOM   7766  C CE2 . TYR B 1 393 ? -73.592  -54.566 28.425  1.00 30.32  ? 432  TYR C CE2 1 
ATOM   7767  C CZ  . TYR B 1 393 ? -72.706  -55.360 29.119  1.00 33.24  ? 432  TYR C CZ  1 
ATOM   7768  O OH  . TYR B 1 393 ? -71.920  -56.258 28.440  1.00 33.19  ? 432  TYR C OH  1 
ATOM   7769  N N   . ALA B 1 394 ? -72.137  -51.578 32.669  1.00 35.29  ? 433  ALA C N   1 
ATOM   7770  C CA  . ALA B 1 394 ? -71.133  -51.838 33.708  1.00 35.14  ? 433  ALA C CA  1 
ATOM   7771  C C   . ALA B 1 394 ? -71.206  -50.827 34.859  1.00 37.51  ? 433  ALA C C   1 
ATOM   7772  O O   . ALA B 1 394 ? -70.707  -51.085 35.960  1.00 33.43  ? 433  ALA C O   1 
ATOM   7773  C CB  . ALA B 1 394 ? -69.747  -51.844 33.106  1.00 35.19  ? 433  ALA C CB  1 
ATOM   7774  N N   . THR B 1 395 ? -71.814  -49.672 34.593  1.00 37.46  ? 434  THR C N   1 
ATOM   7775  C CA  . THR B 1 395 ? -72.036  -48.669 35.626  1.00 33.32  ? 434  THR C CA  1 
ATOM   7776  C C   . THR B 1 395 ? -73.501  -48.276 35.670  1.00 34.06  ? 434  THR C C   1 
ATOM   7777  O O   . THR B 1 395 ? -73.853  -47.212 36.192  1.00 39.02  ? 434  THR C O   1 
ATOM   7778  C CB  . THR B 1 395 ? -71.182  -47.395 35.404  1.00 40.31  ? 434  THR C CB  1 
ATOM   7779  O OG1 . THR B 1 395 ? -71.451  -46.839 34.111  1.00 36.28  ? 434  THR C OG1 1 
ATOM   7780  C CG2 . THR B 1 395 ? -69.700  -47.709 35.515  1.00 38.83  ? 434  THR C CG2 1 
ATOM   7781  N N   . ASN B 1 396 ? -74.361  -49.132 35.122  1.00 32.48  ? 435  ASN C N   1 
ATOM   7782  C CA  . ASN B 1 396 ? -75.795  -48.831 35.055  1.00 33.53  ? 435  ASN C CA  1 
ATOM   7783  C C   . ASN B 1 396 ? -76.060  -47.476 34.403  1.00 35.94  ? 435  ASN C C   1 
ATOM   7784  O O   . ASN B 1 396 ? -76.885  -46.691 34.866  1.00 36.89  ? 435  ASN C O   1 
ATOM   7785  C CB  . ASN B 1 396 ? -76.443  -48.881 36.450  1.00 37.57  ? 435  ASN C CB  1 
ATOM   7786  C CG  . ASN B 1 396 ? -77.974  -48.966 36.386  1.00 40.87  ? 435  ASN C CG  1 
ATOM   7787  O OD1 . ASN B 1 396 ? -78.531  -49.521 35.443  1.00 37.33  ? 435  ASN C OD1 1 
ATOM   7788  N ND2 . ASN B 1 396 ? -78.649  -48.405 37.391  1.00 31.53  ? 435  ASN C ND2 1 
ATOM   7789  N N   . GLU B 1 397 ? -75.340  -47.202 33.328  1.00 35.36  ? 436  GLU C N   1 
ATOM   7790  C CA  . GLU B 1 397 ? -75.565  -45.985 32.571  1.00 32.84  ? 436  GLU C CA  1 
ATOM   7791  C C   . GLU B 1 397 ? -76.076  -46.345 31.187  1.00 39.26  ? 436  GLU C C   1 
ATOM   7792  O O   . GLU B 1 397 ? -76.121  -47.517 30.805  1.00 35.63  ? 436  GLU C O   1 
ATOM   7793  C CB  . GLU B 1 397 ? -74.274  -45.152 32.468  1.00 32.37  ? 436  GLU C CB  1 
ATOM   7794  C CG  . GLU B 1 397 ? -73.781  -44.587 33.809  1.00 35.58  ? 436  GLU C CG  1 
ATOM   7795  C CD  . GLU B 1 397 ? -72.403  -43.940 33.708  1.00 51.83  ? 436  GLU C CD  1 
ATOM   7796  O OE1 . GLU B 1 397 ? -72.249  -42.984 32.917  1.00 67.10  ? 436  GLU C OE1 1 
ATOM   7797  O OE2 . GLU B 1 397 ? -71.466  -44.388 34.407  1.00 61.86  ? 436  GLU C OE2 1 
ATOM   7798  N N   . ILE B 1 398 ? -76.480  -45.321 30.452  1.00 38.97  ? 437  ILE C N   1 
ATOM   7799  C CA  . ILE B 1 398 ? -76.873  -45.460 29.069  1.00 37.69  ? 437  ILE C CA  1 
ATOM   7800  C C   . ILE B 1 398 ? -75.836  -44.749 28.222  1.00 42.31  ? 437  ILE C C   1 
ATOM   7801  O O   . ILE B 1 398 ? -75.385  -43.656 28.563  1.00 45.19  ? 437  ILE C O   1 
ATOM   7802  C CB  . ILE B 1 398 ? -78.256  -44.853 28.846  1.00 37.25  ? 437  ILE C CB  1 
ATOM   7803  C CG1 . ILE B 1 398 ? -79.310  -45.789 29.450  1.00 43.13  ? 437  ILE C CG1 1 
ATOM   7804  C CG2 . ILE B 1 398 ? -78.501  -44.603 27.366  1.00 36.97  ? 437  ILE C CG2 1 
ATOM   7805  C CD1 . ILE B 1 398 ? -80.680  -45.182 29.580  1.00 40.85  ? 437  ILE C CD1 1 
ATOM   7806  N N   . GLY B 1 399 ? -75.433  -45.370 27.126  1.00 34.82  ? 438  GLY C N   1 
ATOM   7807  C CA  . GLY B 1 399 ? -74.365  -44.796 26.337  1.00 45.17  ? 438  GLY C CA  1 
ATOM   7808  C C   . GLY B 1 399 ? -74.349  -45.265 24.907  1.00 51.65  ? 438  GLY C C   1 
ATOM   7809  O O   . GLY B 1 399 ? -74.976  -46.267 24.562  1.00 52.75  ? 438  GLY C O   1 
ATOM   7810  N N   . LYS B 1 400 ? -73.622  -44.530 24.072  1.00 59.25  ? 439  LYS C N   1 
ATOM   7811  C CA  . LYS B 1 400 ? -73.392  -44.950 22.701  1.00 65.35  ? 439  LYS C CA  1 
ATOM   7812  C C   . LYS B 1 400 ? -72.466  -46.160 22.674  1.00 66.17  ? 439  LYS C C   1 
ATOM   7813  O O   . LYS B 1 400 ? -71.446  -46.201 23.363  1.00 62.61  ? 439  LYS C O   1 
ATOM   7814  C CB  . LYS B 1 400 ? -72.827  -43.800 21.862  1.00 70.97  ? 439  LYS C CB  1 
ATOM   7815  C CG  . LYS B 1 400 ? -73.899  -42.834 21.350  1.00 84.93  ? 439  LYS C CG  1 
ATOM   7816  C CD  . LYS B 1 400 ? -73.744  -42.569 19.852  1.00 88.65  ? 439  LYS C CD  1 
ATOM   7817  C CE  . LYS B 1 400 ? -75.063  -42.756 19.096  1.00 86.08  ? 439  LYS C CE  1 
ATOM   7818  N NZ  . LYS B 1 400 ? -76.082  -41.706 19.407  1.00 78.58  ? 439  LYS C NZ  1 
ATOM   7819  N N   . VAL B 1 401 ? -72.840  -47.155 21.882  1.00 66.84  ? 440  VAL C N   1 
ATOM   7820  C CA  . VAL B 1 401 ? -72.077  -48.391 21.819  1.00 70.25  ? 440  VAL C CA  1 
ATOM   7821  C C   . VAL B 1 401 ? -71.473  -48.535 20.418  1.00 66.63  ? 440  VAL C C   1 
ATOM   7822  O O   . VAL B 1 401 ? -71.056  -49.614 19.998  1.00 73.96  ? 440  VAL C O   1 
ATOM   7823  C CB  . VAL B 1 401 ? -72.954  -49.598 22.243  1.00 63.52  ? 440  VAL C CB  1 
ATOM   7824  C CG1 . VAL B 1 401 ? -73.460  -50.371 21.033  1.00 67.78  ? 440  VAL C CG1 1 
ATOM   7825  C CG2 . VAL B 1 401 ? -72.198  -50.493 23.208  1.00 52.12  ? 440  VAL C CG2 1 
ATOM   7826  N N   . THR B 1 402 ? -71.411  -47.408 19.717  1.00 76.13  ? 441  THR C N   1 
ATOM   7827  C CA  . THR B 1 402 ? -70.830  -47.337 18.382  1.00 80.73  ? 441  THR C CA  1 
ATOM   7828  C C   . THR B 1 402 ? -69.502  -46.566 18.440  1.00 74.39  ? 441  THR C C   1 
ATOM   7829  O O   . THR B 1 402 ? -69.439  -45.468 18.998  1.00 73.45  ? 441  THR C O   1 
ATOM   7830  C CB  . THR B 1 402 ? -71.829  -46.686 17.382  1.00 77.90  ? 441  THR C CB  1 
ATOM   7831  O OG1 . THR B 1 402 ? -71.521  -47.094 16.044  1.00 85.45  ? 441  THR C OG1 1 
ATOM   7832  C CG2 . THR B 1 402 ? -71.815  -45.159 17.485  1.00 77.83  ? 441  THR C CG2 1 
ATOM   7833  N N   . GLY B 1 403 ? -68.440  -47.160 17.889  1.00 79.76  ? 442  GLY C N   1 
ATOM   7834  C CA  . GLY B 1 403 ? -67.098  -46.588 17.953  1.00 76.25  ? 442  GLY C CA  1 
ATOM   7835  C C   . GLY B 1 403 ? -66.992  -45.221 17.297  1.00 84.26  ? 442  GLY C C   1 
ATOM   7836  O O   . GLY B 1 403 ? -67.975  -44.721 16.745  1.00 96.29  ? 442  GLY C O   1 
ATOM   7837  N N   . LEU B 1 404 ? -65.811  -44.607 17.344  1.00 69.50  ? 443  LEU C N   1 
ATOM   7838  C CA  . LEU B 1 404 ? -64.630  -45.192 17.968  1.00 68.70  ? 443  LEU C CA  1 
ATOM   7839  C C   . LEU B 1 404 ? -64.387  -44.602 19.352  1.00 55.41  ? 443  LEU C C   1 
ATOM   7840  O O   . LEU B 1 404 ? -64.538  -43.401 19.570  1.00 59.30  ? 443  LEU C O   1 
ATOM   7841  C CB  . LEU B 1 404 ? -63.396  -44.995 17.078  1.00 72.21  ? 443  LEU C CB  1 
ATOM   7842  C CG  . LEU B 1 404 ? -62.140  -44.329 17.656  1.00 64.96  ? 443  LEU C CG  1 
ATOM   7843  C CD1 . LEU B 1 404 ? -60.895  -44.815 16.918  1.00 62.88  ? 443  LEU C CD1 1 
ATOM   7844  C CD2 . LEU B 1 404 ? -62.240  -42.798 17.623  1.00 65.74  ? 443  LEU C CD2 1 
ATOM   7845  N N   . ASN B 1 405 ? -64.001  -45.463 20.281  1.00 52.69  ? 444  ASN C N   1 
ATOM   7846  C CA  . ASN B 1 405 ? -63.847  -45.079 21.671  1.00 38.88  ? 444  ASN C CA  1 
ATOM   7847  C C   . ASN B 1 405 ? -62.368  -45.058 22.056  1.00 44.05  ? 444  ASN C C   1 
ATOM   7848  O O   . ASN B 1 405 ? -61.724  -46.104 22.124  1.00 40.67  ? 444  ASN C O   1 
ATOM   7849  C CB  . ASN B 1 405 ? -64.630  -46.062 22.534  1.00 50.42  ? 444  ASN C CB  1 
ATOM   7850  C CG  . ASN B 1 405 ? -64.629  -45.689 23.993  1.00 54.89  ? 444  ASN C CG  1 
ATOM   7851  O OD1 . ASN B 1 405 ? -63.582  -45.379 24.568  1.00 49.03  ? 444  ASN C OD1 1 
ATOM   7852  N ND2 . ASN B 1 405 ? -65.808  -45.720 24.610  1.00 59.52  ? 444  ASN C ND2 1 
ATOM   7853  N N   . ARG B 1 406 ? -61.823  -43.870 22.293  1.00 30.81  ? 445  ARG C N   1 
ATOM   7854  C CA  . ARG B 1 406 ? -60.377  -43.732 22.497  1.00 36.01  ? 445  ARG C CA  1 
ATOM   7855  C C   . ARG B 1 406 ? -59.914  -44.390 23.791  1.00 32.34  ? 445  ARG C C   1 
ATOM   7856  O O   . ARG B 1 406 ? -58.833  -44.991 23.847  1.00 31.00  ? 445  ARG C O   1 
ATOM   7857  C CB  . ARG B 1 406 ? -59.961  -42.253 22.481  1.00 39.06  ? 445  ARG C CB  1 
ATOM   7858  C CG  . ARG B 1 406 ? -60.053  -41.620 21.095  1.00 50.62  ? 445  ARG C CG  1 
ATOM   7859  C CD  . ARG B 1 406 ? -59.680  -40.139 21.081  1.00 58.03  ? 445  ARG C CD  1 
ATOM   7860  N NE  . ARG B 1 406 ? -59.536  -39.668 19.705  1.00 62.66  ? 445  ARG C NE  1 
ATOM   7861  C CZ  . ARG B 1 406 ? -60.554  -39.446 18.877  1.00 72.87  ? 445  ARG C CZ  1 
ATOM   7862  N NH1 . ARG B 1 406 ? -61.808  -39.634 19.283  1.00 64.39  ? 445  ARG C NH1 1 
ATOM   7863  N NH2 . ARG B 1 406 ? -60.321  -39.026 17.639  1.00 72.48  ? 445  ARG C NH2 1 
ATOM   7864  N N   . ARG B 1 407 ? -60.732  -44.259 24.830  1.00 26.31  ? 446  ARG C N   1 
ATOM   7865  C CA  . ARG B 1 407 ? -60.410  -44.818 26.129  1.00 34.95  ? 446  ARG C CA  1 
ATOM   7866  C C   . ARG B 1 407 ? -60.371  -46.340 26.051  1.00 32.82  ? 446  ARG C C   1 
ATOM   7867  O O   . ARG B 1 407 ? -59.497  -46.983 26.637  1.00 32.24  ? 446  ARG C O   1 
ATOM   7868  C CB  . ARG B 1 407 ? -61.444  -44.375 27.153  1.00 37.63  ? 446  ARG C CB  1 
ATOM   7869  C CG  . ARG B 1 407 ? -61.253  -44.972 28.527  1.00 42.30  ? 446  ARG C CG  1 
ATOM   7870  C CD  . ARG B 1 407 ? -62.134  -44.245 29.512  1.00 51.44  ? 446  ARG C CD  1 
ATOM   7871  N NE  . ARG B 1 407 ? -61.870  -44.652 30.884  1.00 59.81  ? 446  ARG C NE  1 
ATOM   7872  C CZ  . ARG B 1 407 ? -62.071  -43.870 31.940  1.00 69.42  ? 446  ARG C CZ  1 
ATOM   7873  N NH1 . ARG B 1 407 ? -62.531  -42.633 31.777  1.00 71.16  ? 446  ARG C NH1 1 
ATOM   7874  N NH2 . ARG B 1 407 ? -61.805  -44.323 33.156  1.00 59.38  ? 446  ARG C NH2 1 
ATOM   7875  N N   . GLU B 1 408 ? -61.320  -46.904 25.312  1.00 29.72  ? 447  GLU C N   1 
ATOM   7876  C CA  . GLU B 1 408 ? -61.415  -48.344 25.166  1.00 30.93  ? 447  GLU C CA  1 
ATOM   7877  C C   . GLU B 1 408 ? -60.202  -48.873 24.417  1.00 33.28  ? 447  GLU C C   1 
ATOM   7878  O O   . GLU B 1 408 ? -59.687  -49.947 24.732  1.00 32.19  ? 447  GLU C O   1 
ATOM   7879  C CB  . GLU B 1 408 ? -62.713  -48.735 24.449  1.00 31.44  ? 447  GLU C CB  1 
ATOM   7880  C CG  . GLU B 1 408 ? -63.902  -48.898 25.384  1.00 33.36  ? 447  GLU C CG  1 
ATOM   7881  C CD  . GLU B 1 408 ? -65.168  -49.311 24.650  1.00 36.36  ? 447  GLU C CD  1 
ATOM   7882  O OE1 . GLU B 1 408 ? -65.202  -49.220 23.405  1.00 38.90  ? 447  GLU C OE1 1 
ATOM   7883  O OE2 . GLU B 1 408 ? -66.128  -49.736 25.317  1.00 34.75  ? 447  GLU C OE2 1 
ATOM   7884  N N   . LEU B 1 409 ? -59.752  -48.114 23.421  1.00 27.19  ? 448  LEU C N   1 
ATOM   7885  C CA  . LEU B 1 409 ? -58.562  -48.483 22.661  1.00 30.66  ? 448  LEU C CA  1 
ATOM   7886  C C   . LEU B 1 409 ? -57.319  -48.429 23.559  1.00 33.99  ? 448  LEU C C   1 
ATOM   7887  O O   . LEU B 1 409 ? -56.477  -49.330 23.538  1.00 30.87  ? 448  LEU C O   1 
ATOM   7888  C CB  . LEU B 1 409 ? -58.397  -47.556 21.454  1.00 35.19  ? 448  LEU C CB  1 
ATOM   7889  C CG  . LEU B 1 409 ? -57.466  -48.040 20.337  1.00 46.07  ? 448  LEU C CG  1 
ATOM   7890  C CD1 . LEU B 1 409 ? -57.820  -47.385 19.004  1.00 51.01  ? 448  LEU C CD1 1 
ATOM   7891  C CD2 . LEU B 1 409 ? -55.998  -47.790 20.675  1.00 44.55  ? 448  LEU C CD2 1 
ATOM   7892  N N   . GLY B 1 410 ? -57.218  -47.376 24.360  1.00 29.39  ? 449  GLY C N   1 
ATOM   7893  C CA  . GLY B 1 410 ? -56.083  -47.209 25.250  1.00 29.49  ? 449  GLY C CA  1 
ATOM   7894  C C   . GLY B 1 410 ? -56.032  -48.302 26.303  1.00 28.22  ? 449  GLY C C   1 
ATOM   7895  O O   . GLY B 1 410 ? -54.970  -48.833 26.615  1.00 30.14  ? 449  GLY C O   1 
ATOM   7896  N N   . HIS B 1 411 ? -57.185  -48.637 26.859  1.00 25.97  ? 450  HIS C N   1 
ATOM   7897  C CA  . HIS B 1 411 ? -57.243  -49.662 27.892  1.00 36.12  ? 450  HIS C CA  1 
ATOM   7898  C C   . HIS B 1 411 ? -56.914  -51.036 27.318  1.00 35.56  ? 450  HIS C C   1 
ATOM   7899  O O   . HIS B 1 411 ? -56.233  -51.821 27.952  1.00 32.03  ? 450  HIS C O   1 
ATOM   7900  C CB  . HIS B 1 411 ? -58.601  -49.650 28.588  1.00 25.59  ? 450  HIS C CB  1 
ATOM   7901  C CG  . HIS B 1 411 ? -58.803  -48.459 29.469  1.00 29.18  ? 450  HIS C CG  1 
ATOM   7902  N ND1 . HIS B 1 411 ? -59.854  -48.349 30.350  1.00 37.19  ? 450  HIS C ND1 1 
ATOM   7903  C CD2 . HIS B 1 411 ? -58.076  -47.322 29.605  1.00 30.73  ? 450  HIS C CD2 1 
ATOM   7904  C CE1 . HIS B 1 411 ? -59.771  -47.194 30.991  1.00 32.72  ? 450  HIS C CE1 1 
ATOM   7905  N NE2 . HIS B 1 411 ? -58.701  -46.554 30.559  1.00 33.91  ? 450  HIS C NE2 1 
ATOM   7906  N N   . GLY B 1 412 ? -57.388  -51.302 26.105  1.00 33.10  ? 451  GLY C N   1 
ATOM   7907  C CA  . GLY B 1 412 ? -57.077  -52.536 25.407  1.00 31.08  ? 451  GLY C CA  1 
ATOM   7908  C C   . GLY B 1 412 ? -55.596  -52.650 25.139  1.00 31.61  ? 451  GLY C C   1 
ATOM   7909  O O   . GLY B 1 412 ? -55.005  -53.701 25.380  1.00 31.98  ? 451  GLY C O   1 
ATOM   7910  N N   . ALA B 1 413 ? -54.991  -51.564 24.659  1.00 28.08  ? 452  ALA C N   1 
ATOM   7911  C CA  . ALA B 1 413 ? -53.556  -51.539 24.404  1.00 36.77  ? 452  ALA C CA  1 
ATOM   7912  C C   . ALA B 1 413 ? -52.763  -51.859 25.665  1.00 32.93  ? 452  ALA C C   1 
ATOM   7913  O O   . ALA B 1 413 ? -51.741  -52.554 25.608  1.00 34.18  ? 452  ALA C O   1 
ATOM   7914  C CB  . ALA B 1 413 ? -53.123  -50.181 23.848  1.00 32.06  ? 452  ALA C CB  1 
ATOM   7915  N N   . LEU B 1 414 ? -53.229  -51.340 26.798  1.00 26.48  ? 453  LEU C N   1 
ATOM   7916  C CA  . LEU B 1 414 ? -52.521  -51.514 28.061  1.00 30.84  ? 453  LEU C CA  1 
ATOM   7917  C C   . LEU B 1 414 ? -52.550  -52.974 28.516  1.00 27.37  ? 453  LEU C C   1 
ATOM   7918  O O   . LEU B 1 414 ? -51.522  -53.533 28.892  1.00 31.00  ? 453  LEU C O   1 
ATOM   7919  C CB  . LEU B 1 414 ? -53.091  -50.599 29.142  1.00 30.40  ? 453  LEU C CB  1 
ATOM   7920  C CG  . LEU B 1 414 ? -52.579  -50.818 30.564  1.00 25.97  ? 453  LEU C CG  1 
ATOM   7921  C CD1 . LEU B 1 414 ? -51.056  -50.651 30.618  1.00 31.76  ? 453  LEU C CD1 1 
ATOM   7922  C CD2 . LEU B 1 414 ? -53.265  -49.847 31.516  1.00 26.56  ? 453  LEU C CD2 1 
ATOM   7923  N N   . ALA B 1 415 ? -53.720  -53.589 28.474  1.00 29.14  ? 454  ALA C N   1 
ATOM   7924  C CA  . ALA B 1 415 ? -53.835  -54.996 28.851  1.00 31.64  ? 454  ALA C CA  1 
ATOM   7925  C C   . ALA B 1 415 ? -53.063  -55.885 27.861  1.00 32.07  ? 454  ALA C C   1 
ATOM   7926  O O   . ALA B 1 415 ? -52.415  -56.864 28.245  1.00 33.34  ? 454  ALA C O   1 
ATOM   7927  C CB  . ALA B 1 415 ? -55.302  -55.404 28.941  1.00 28.08  ? 454  ALA C CB  1 
ATOM   7928  N N   . GLU B 1 416 ? -53.117  -55.521 26.585  1.00 30.92  ? 455  GLU C N   1 
ATOM   7929  C CA  . GLU B 1 416 ? -52.383  -56.244 25.547  1.00 35.35  ? 455  GLU C CA  1 
ATOM   7930  C C   . GLU B 1 416 ? -50.871  -56.258 25.779  1.00 37.79  ? 455  GLU C C   1 
ATOM   7931  O O   . GLU B 1 416 ? -50.225  -57.303 25.685  1.00 29.61  ? 455  GLU C O   1 
ATOM   7932  C CB  . GLU B 1 416 ? -52.693  -55.656 24.168  1.00 30.19  ? 455  GLU C CB  1 
ATOM   7933  C CG  . GLU B 1 416 ? -51.957  -56.325 23.042  1.00 29.22  ? 455  GLU C CG  1 
ATOM   7934  C CD  . GLU B 1 416 ? -52.305  -55.729 21.689  1.00 37.94  ? 455  GLU C CD  1 
ATOM   7935  O OE1 . GLU B 1 416 ? -51.389  -55.168 21.059  1.00 33.02  ? 455  GLU C OE1 1 
ATOM   7936  O OE2 . GLU B 1 416 ? -53.482  -55.823 21.252  1.00 31.98  ? 455  GLU C OE2 1 
ATOM   7937  N N   . LYS B 1 417 ? -50.296  -55.097 26.062  1.00 32.24  ? 456  LYS C N   1 
ATOM   7938  C CA  . LYS B 1 417 ? -48.862  -55.040 26.295  1.00 32.63  ? 456  LYS C CA  1 
ATOM   7939  C C   . LYS B 1 417 ? -48.509  -55.647 27.653  1.00 37.75  ? 456  LYS C C   1 
ATOM   7940  O O   . LYS B 1 417 ? -47.360  -55.996 27.888  1.00 36.81  ? 456  LYS C O   1 
ATOM   7941  C CB  . LYS B 1 417 ? -48.325  -53.611 26.163  1.00 32.71  ? 456  LYS C CB  1 
ATOM   7942  C CG  . LYS B 1 417 ? -48.866  -52.663 27.208  1.00 38.62  ? 456  LYS C CG  1 
ATOM   7943  C CD  . LYS B 1 417 ? -48.878  -51.217 26.706  1.00 40.96  ? 456  LYS C CD  1 
ATOM   7944  C CE  . LYS B 1 417 ? -47.897  -50.360 27.504  1.00 48.15  ? 456  LYS C CE  1 
ATOM   7945  N NZ  . LYS B 1 417 ? -48.221  -48.903 27.450  1.00 42.95  ? 456  LYS C NZ  1 
ATOM   7946  N N   . ALA B 1 418 ? -49.491  -55.785 28.541  1.00 32.72  ? 457  ALA C N   1 
ATOM   7947  C CA  . ALA B 1 418 ? -49.238  -56.463 29.810  1.00 34.00  ? 457  ALA C CA  1 
ATOM   7948  C C   . ALA B 1 418 ? -49.028  -57.958 29.578  1.00 37.03  ? 457  ALA C C   1 
ATOM   7949  O O   . ALA B 1 418 ? -48.246  -58.599 30.277  1.00 34.13  ? 457  ALA C O   1 
ATOM   7950  C CB  . ALA B 1 418 ? -50.375  -56.239 30.789  1.00 22.66  ? 457  ALA C CB  1 
ATOM   7951  N N   . LEU B 1 419 ? -49.730  -58.503 28.591  1.00 33.43  ? 458  LEU C N   1 
ATOM   7952  C CA  . LEU B 1 419 ? -49.690  -59.939 28.313  1.00 35.80  ? 458  LEU C CA  1 
ATOM   7953  C C   . LEU B 1 419 ? -48.657  -60.304 27.245  1.00 33.22  ? 458  LEU C C   1 
ATOM   7954  O O   . LEU B 1 419 ? -48.049  -61.371 27.286  1.00 35.44  ? 458  LEU C O   1 
ATOM   7955  C CB  . LEU B 1 419 ? -51.084  -60.419 27.893  1.00 31.68  ? 458  LEU C CB  1 
ATOM   7956  C CG  . LEU B 1 419 ? -52.177  -60.333 28.964  1.00 31.28  ? 458  LEU C CG  1 
ATOM   7957  C CD1 . LEU B 1 419 ? -53.597  -60.445 28.368  1.00 33.27  ? 458  LEU C CD1 1 
ATOM   7958  C CD2 . LEU B 1 419 ? -51.956  -61.377 30.044  1.00 37.96  ? 458  LEU C CD2 1 
ATOM   7959  N N   . TYR B 1 420 ? -48.453  -59.397 26.299  1.00 31.05  ? 459  TYR C N   1 
ATOM   7960  C CA  . TYR B 1 420 ? -47.574  -59.622 25.158  1.00 34.87  ? 459  TYR C CA  1 
ATOM   7961  C C   . TYR B 1 420 ? -46.269  -60.406 25.425  1.00 40.16  ? 459  TYR C C   1 
ATOM   7962  O O   . TYR B 1 420 ? -45.898  -61.270 24.636  1.00 34.81  ? 459  TYR C O   1 
ATOM   7963  C CB  . TYR B 1 420 ? -47.242  -58.288 24.500  1.00 30.45  ? 459  TYR C CB  1 
ATOM   7964  C CG  . TYR B 1 420 ? -46.152  -58.370 23.462  1.00 32.28  ? 459  TYR C CG  1 
ATOM   7965  C CD1 . TYR B 1 420 ? -46.447  -58.672 22.140  1.00 33.38  ? 459  TYR C CD1 1 
ATOM   7966  C CD2 . TYR B 1 420 ? -44.823  -58.132 23.802  1.00 42.94  ? 459  TYR C CD2 1 
ATOM   7967  C CE1 . TYR B 1 420 ? -45.450  -58.734 21.184  1.00 40.41  ? 459  TYR C CE1 1 
ATOM   7968  C CE2 . TYR B 1 420 ? -43.813  -58.195 22.850  1.00 43.94  ? 459  TYR C CE2 1 
ATOM   7969  C CZ  . TYR B 1 420 ? -44.135  -58.496 21.544  1.00 43.22  ? 459  TYR C CZ  1 
ATOM   7970  O OH  . TYR B 1 420 ? -43.143  -58.559 20.598  1.00 48.00  ? 459  TYR C OH  1 
ATOM   7971  N N   . PRO B 1 421 ? -45.558  -60.084 26.514  1.00 35.83  ? 460  PRO C N   1 
ATOM   7972  C CA  . PRO B 1 421 ? -44.253  -60.722 26.741  1.00 36.73  ? 460  PRO C CA  1 
ATOM   7973  C C   . PRO B 1 421 ? -44.322  -62.220 27.021  1.00 38.22  ? 460  PRO C C   1 
ATOM   7974  O O   . PRO B 1 421 ? -43.363  -62.921 26.699  1.00 42.46  ? 460  PRO C O   1 
ATOM   7975  C CB  . PRO B 1 421 ? -43.712  -59.990 27.974  1.00 35.42  ? 460  PRO C CB  1 
ATOM   7976  C CG  . PRO B 1 421 ? -44.466  -58.656 27.980  1.00 38.62  ? 460  PRO C CG  1 
ATOM   7977  C CD  . PRO B 1 421 ? -45.833  -59.023 27.499  1.00 32.18  ? 460  PRO C CD  1 
ATOM   7978  N N   . VAL B 1 422 ? -45.409  -62.703 27.612  1.00 39.39  ? 461  VAL C N   1 
ATOM   7979  C CA  . VAL B 1 422 ? -45.476  -64.117 27.971  1.00 39.08  ? 461  VAL C CA  1 
ATOM   7980  C C   . VAL B 1 422 ? -46.109  -64.947 26.878  1.00 40.70  ? 461  VAL C C   1 
ATOM   7981  O O   . VAL B 1 422 ? -46.180  -66.168 26.983  1.00 38.42  ? 461  VAL C O   1 
ATOM   7982  C CB  . VAL B 1 422 ? -46.244  -64.350 29.262  1.00 36.75  ? 461  VAL C CB  1 
ATOM   7983  C CG1 . VAL B 1 422 ? -45.542  -63.629 30.424  1.00 31.42  ? 461  VAL C CG1 1 
ATOM   7984  C CG2 . VAL B 1 422 ? -47.693  -63.911 29.101  1.00 38.68  ? 461  VAL C CG2 1 
ATOM   7985  N N   . ILE B 1 423 ? -46.572  -64.274 25.830  1.00 39.06  ? 462  ILE C N   1 
ATOM   7986  C CA  . ILE B 1 423 ? -47.170  -64.953 24.689  1.00 40.10  ? 462  ILE C CA  1 
ATOM   7987  C C   . ILE B 1 423 ? -46.090  -65.657 23.870  1.00 39.20  ? 462  ILE C C   1 
ATOM   7988  O O   . ILE B 1 423 ? -45.065  -65.052 23.538  1.00 38.90  ? 462  ILE C O   1 
ATOM   7989  C CB  . ILE B 1 423 ? -47.915  -63.965 23.790  1.00 41.69  ? 462  ILE C CB  1 
ATOM   7990  C CG1 . ILE B 1 423 ? -49.034  -63.262 24.579  1.00 37.62  ? 462  ILE C CG1 1 
ATOM   7991  C CG2 . ILE B 1 423 ? -48.473  -64.683 22.593  1.00 35.92  ? 462  ILE C CG2 1 
ATOM   7992  C CD1 . ILE B 1 423 ? -50.164  -64.193 25.005  1.00 32.70  ? 462  ILE C CD1 1 
ATOM   7993  N N   . PRO B 1 424 ? -46.316  -66.939 23.535  1.00 41.31  ? 463  PRO C N   1 
ATOM   7994  C CA  . PRO B 1 424 ? -45.294  -67.667 22.784  1.00 45.71  ? 463  PRO C CA  1 
ATOM   7995  C C   . PRO B 1 424 ? -45.204  -67.165 21.353  1.00 44.81  ? 463  PRO C C   1 
ATOM   7996  O O   . PRO B 1 424 ? -46.204  -66.740 20.776  1.00 44.50  ? 463  PRO C O   1 
ATOM   7997  C CB  . PRO B 1 424 ? -45.806  -69.112 22.812  1.00 46.46  ? 463  PRO C CB  1 
ATOM   7998  C CG  . PRO B 1 424 ? -47.276  -68.980 22.908  1.00 44.36  ? 463  PRO C CG  1 
ATOM   7999  C CD  . PRO B 1 424 ? -47.516  -67.762 23.770  1.00 40.32  ? 463  PRO C CD  1 
ATOM   8000  N N   . ARG B 1 425 ? -44.001  -67.204 20.795  1.00 46.95  ? 464  ARG C N   1 
ATOM   8001  C CA  . ARG B 1 425 ? -43.797  -66.850 19.402  1.00 49.58  ? 464  ARG C CA  1 
ATOM   8002  C C   . ARG B 1 425 ? -44.053  -68.069 18.505  1.00 53.95  ? 464  ARG C C   1 
ATOM   8003  O O   . ARG B 1 425 ? -43.903  -69.216 18.937  1.00 53.51  ? 464  ARG C O   1 
ATOM   8004  C CB  . ARG B 1 425 ? -42.382  -66.304 19.201  1.00 50.01  ? 464  ARG C CB  1 
ATOM   8005  C CG  . ARG B 1 425 ? -42.171  -65.615 17.872  1.00 56.34  ? 464  ARG C CG  1 
ATOM   8006  C CD  . ARG B 1 425 ? -40.808  -64.945 17.814  1.00 62.04  ? 464  ARG C CD  1 
ATOM   8007  N NE  . ARG B 1 425 ? -40.717  -63.794 18.709  1.00 64.12  ? 464  ARG C NE  1 
ATOM   8008  C CZ  . ARG B 1 425 ? -41.156  -62.573 18.408  1.00 59.72  ? 464  ARG C CZ  1 
ATOM   8009  N NH1 . ARG B 1 425 ? -41.732  -62.344 17.235  1.00 52.98  ? 464  ARG C NH1 1 
ATOM   8010  N NH2 . ARG B 1 425 ? -41.019  -61.578 19.276  1.00 46.41  ? 464  ARG C NH2 1 
ATOM   8011  N N   . ASP B 1 426 ? -44.461  -67.808 17.266  1.00 53.16  ? 465  ASP C N   1 
ATOM   8012  C CA  . ASP B 1 426 ? -44.719  -68.857 16.271  1.00 59.65  ? 465  ASP C CA  1 
ATOM   8013  C C   . ASP B 1 426 ? -45.919  -69.753 16.567  1.00 49.03  ? 465  ASP C C   1 
ATOM   8014  O O   . ASP B 1 426 ? -45.956  -70.906 16.143  1.00 53.65  ? 465  ASP C O   1 
ATOM   8015  C CB  . ASP B 1 426 ? -43.471  -69.715 16.031  1.00 63.23  ? 465  ASP C CB  1 
ATOM   8016  C CG  . ASP B 1 426 ? -42.369  -68.952 15.327  1.00 65.76  ? 465  ASP C CG  1 
ATOM   8017  O OD1 . ASP B 1 426 ? -41.181  -69.231 15.607  1.00 72.19  ? 465  ASP C OD1 1 
ATOM   8018  O OD2 . ASP B 1 426 ? -42.693  -68.067 14.504  1.00 68.37  ? 465  ASP C OD2 1 
ATOM   8019  N N   . PHE B 1 427 ? -46.903  -69.225 17.281  1.00 50.28  ? 466  PHE C N   1 
ATOM   8020  C CA  . PHE B 1 427 ? -48.157  -69.943 17.470  1.00 46.09  ? 466  PHE C CA  1 
ATOM   8021  C C   . PHE B 1 427 ? -48.836  -70.091 16.113  1.00 43.29  ? 466  PHE C C   1 
ATOM   8022  O O   . PHE B 1 427 ? -48.770  -69.185 15.287  1.00 47.70  ? 466  PHE C O   1 
ATOM   8023  C CB  . PHE B 1 427 ? -49.059  -69.177 18.427  1.00 44.10  ? 466  PHE C CB  1 
ATOM   8024  C CG  . PHE B 1 427 ? -50.130  -70.012 19.047  1.00 44.26  ? 466  PHE C CG  1 
ATOM   8025  C CD1 . PHE B 1 427 ? -49.811  -70.968 19.998  1.00 37.82  ? 466  PHE C CD1 1 
ATOM   8026  C CD2 . PHE B 1 427 ? -51.458  -69.835 18.690  1.00 38.74  ? 466  PHE C CD2 1 
ATOM   8027  C CE1 . PHE B 1 427 ? -50.791  -71.732 20.577  1.00 36.13  ? 466  PHE C CE1 1 
ATOM   8028  C CE2 . PHE B 1 427 ? -52.440  -70.595 19.263  1.00 36.25  ? 466  PHE C CE2 1 
ATOM   8029  C CZ  . PHE B 1 427 ? -52.111  -71.547 20.209  1.00 44.12  ? 466  PHE C CZ  1 
ATOM   8030  N N   . PRO B 1 428 ? -49.490  -71.237 15.872  1.00 42.44  ? 467  PRO C N   1 
ATOM   8031  C CA  . PRO B 1 428 ? -50.056  -71.496 14.543  1.00 47.43  ? 467  PRO C CA  1 
ATOM   8032  C C   . PRO B 1 428 ? -51.255  -70.610 14.191  1.00 47.60  ? 467  PRO C C   1 
ATOM   8033  O O   . PRO B 1 428 ? -51.575  -70.491 13.008  1.00 49.18  ? 467  PRO C O   1 
ATOM   8034  C CB  . PRO B 1 428 ? -50.489  -72.969 14.623  1.00 47.59  ? 467  PRO C CB  1 
ATOM   8035  C CG  . PRO B 1 428 ? -50.690  -73.235 16.078  1.00 45.28  ? 467  PRO C CG  1 
ATOM   8036  C CD  . PRO B 1 428 ? -49.694  -72.367 16.798  1.00 45.90  ? 467  PRO C CD  1 
ATOM   8037  N N   . PHE B 1 429 ? -51.900  -70.005 15.187  1.00 44.78  ? 468  PHE C N   1 
ATOM   8038  C CA  . PHE B 1 429 ? -53.095  -69.190 14.943  1.00 42.65  ? 468  PHE C CA  1 
ATOM   8039  C C   . PHE B 1 429 ? -52.974  -67.783 15.503  1.00 42.47  ? 468  PHE C C   1 
ATOM   8040  O O   . PHE B 1 429 ? -52.293  -67.554 16.501  1.00 42.80  ? 468  PHE C O   1 
ATOM   8041  C CB  . PHE B 1 429 ? -54.316  -69.851 15.570  1.00 42.32  ? 468  PHE C CB  1 
ATOM   8042  C CG  . PHE B 1 429 ? -54.394  -71.326 15.319  1.00 45.73  ? 468  PHE C CG  1 
ATOM   8043  C CD1 . PHE B 1 429 ? -54.033  -71.851 14.090  1.00 49.68  ? 468  PHE C CD1 1 
ATOM   8044  C CD2 . PHE B 1 429 ? -54.812  -72.189 16.315  1.00 50.19  ? 468  PHE C CD2 1 
ATOM   8045  C CE1 . PHE B 1 429 ? -54.096  -73.214 13.854  1.00 46.75  ? 468  PHE C CE1 1 
ATOM   8046  C CE2 . PHE B 1 429 ? -54.880  -73.551 16.085  1.00 57.19  ? 468  PHE C CE2 1 
ATOM   8047  C CZ  . PHE B 1 429 ? -54.520  -74.061 14.849  1.00 46.50  ? 468  PHE C CZ  1 
ATOM   8048  N N   . THR B 1 430 ? -53.647  -66.835 14.867  1.00 41.34  ? 469  THR C N   1 
ATOM   8049  C CA  . THR B 1 430 ? -53.781  -65.518 15.467  1.00 39.07  ? 469  THR C CA  1 
ATOM   8050  C C   . THR B 1 430 ? -54.509  -65.691 16.788  1.00 38.08  ? 469  THR C C   1 
ATOM   8051  O O   . THR B 1 430 ? -55.541  -66.346 16.845  1.00 34.32  ? 469  THR C O   1 
ATOM   8052  C CB  . THR B 1 430 ? -54.586  -64.569 14.578  1.00 36.66  ? 469  THR C CB  1 
ATOM   8053  O OG1 . THR B 1 430 ? -53.798  -64.228 13.436  1.00 37.41  ? 469  THR C OG1 1 
ATOM   8054  C CG2 . THR B 1 430 ? -54.945  -63.301 15.342  1.00 38.29  ? 469  THR C CG2 1 
ATOM   8055  N N   . ILE B 1 431 ? -53.954  -65.126 17.853  1.00 37.60  ? 470  ILE C N   1 
ATOM   8056  C CA  . ILE B 1 431 ? -54.591  -65.185 19.164  1.00 38.92  ? 470  ILE C CA  1 
ATOM   8057  C C   . ILE B 1 431 ? -55.317  -63.876 19.465  1.00 41.51  ? 470  ILE C C   1 
ATOM   8058  O O   . ILE B 1 431 ? -54.689  -62.815 19.525  1.00 33.64  ? 470  ILE C O   1 
ATOM   8059  C CB  . ILE B 1 431 ? -53.554  -65.431 20.270  1.00 32.93  ? 470  ILE C CB  1 
ATOM   8060  C CG1 . ILE B 1 431 ? -52.742  -66.692 19.961  1.00 28.77  ? 470  ILE C CG1 1 
ATOM   8061  C CG2 . ILE B 1 431 ? -54.242  -65.504 21.630  1.00 31.56  ? 470  ILE C CG2 1 
ATOM   8062  C CD1 . ILE B 1 431 ? -51.392  -66.767 20.709  1.00 35.43  ? 470  ILE C CD1 1 
ATOM   8063  N N   . ARG B 1 432 ? -56.634  -63.954 19.642  1.00 36.34  ? 471  ARG C N   1 
ATOM   8064  C CA  . ARG B 1 432 ? -57.432  -62.782 19.993  1.00 41.43  ? 471  ARG C CA  1 
ATOM   8065  C C   . ARG B 1 432 ? -58.054  -62.948 21.373  1.00 38.81  ? 471  ARG C C   1 
ATOM   8066  O O   . ARG B 1 432 ? -58.816  -63.889 21.614  1.00 36.74  ? 471  ARG C O   1 
ATOM   8067  C CB  . ARG B 1 432 ? -58.540  -62.530 18.961  1.00 32.99  ? 471  ARG C CB  1 
ATOM   8068  C CG  . ARG B 1 432 ? -58.055  -62.451 17.523  1.00 43.74  ? 471  ARG C CG  1 
ATOM   8069  C CD  . ARG B 1 432 ? -59.179  -62.056 16.560  1.00 46.36  ? 471  ARG C CD  1 
ATOM   8070  N NE  . ARG B 1 432 ? -58.703  -61.941 15.182  1.00 42.42  ? 471  ARG C NE  1 
ATOM   8071  C CZ  . ARG B 1 432 ? -57.953  -60.939 14.738  1.00 45.35  ? 471  ARG C CZ  1 
ATOM   8072  N NH1 . ARG B 1 432 ? -57.592  -59.960 15.564  1.00 42.44  ? 471  ARG C NH1 1 
ATOM   8073  N NH2 . ARG B 1 432 ? -57.563  -60.912 13.470  1.00 43.49  ? 471  ARG C NH2 1 
ATOM   8074  N N   . VAL B 1 433 ? -57.721  -62.039 22.281  1.00 33.37  ? 472  VAL C N   1 
ATOM   8075  C CA  . VAL B 1 433 ? -58.386  -61.984 23.579  1.00 32.68  ? 472  VAL C CA  1 
ATOM   8076  C C   . VAL B 1 433 ? -59.371  -60.832 23.503  1.00 36.69  ? 472  VAL C C   1 
ATOM   8077  O O   . VAL B 1 433 ? -59.002  -59.747 23.057  1.00 37.11  ? 472  VAL C O   1 
ATOM   8078  C CB  . VAL B 1 433 ? -57.394  -61.684 24.738  1.00 31.53  ? 472  VAL C CB  1 
ATOM   8079  C CG1 . VAL B 1 433 ? -58.147  -61.448 26.043  1.00 30.24  ? 472  VAL C CG1 1 
ATOM   8080  C CG2 . VAL B 1 433 ? -56.375  -62.812 24.907  1.00 31.69  ? 472  VAL C CG2 1 
ATOM   8081  N N   . THR B 1 434 ? -60.616  -61.049 23.912  1.00 35.05  ? 473  THR C N   1 
ATOM   8082  C CA  . THR B 1 434 ? -61.502  -59.911 24.114  1.00 37.00  ? 473  THR C CA  1 
ATOM   8083  C C   . THR B 1 434 ? -61.828  -59.784 25.593  1.00 33.80  ? 473  THR C C   1 
ATOM   8084  O O   . THR B 1 434 ? -62.075  -60.784 26.273  1.00 34.70  ? 473  THR C O   1 
ATOM   8085  C CB  . THR B 1 434 ? -62.773  -59.895 23.194  1.00 42.49  ? 473  THR C CB  1 
ATOM   8086  O OG1 . THR B 1 434 ? -63.942  -60.303 23.914  1.00 47.43  ? 473  THR C OG1 1 
ATOM   8087  C CG2 . THR B 1 434 ? -62.588  -60.751 21.985  1.00 25.62  ? 473  THR C CG2 1 
ATOM   8088  N N   . SER B 1 435 ? -61.761  -58.552 26.092  1.00 33.96  ? 474  SER C N   1 
ATOM   8089  C CA  . SER B 1 435 ? -62.022  -58.273 27.494  1.00 31.88  ? 474  SER C CA  1 
ATOM   8090  C C   . SER B 1 435 ? -63.203  -57.335 27.575  1.00 30.19  ? 474  SER C C   1 
ATOM   8091  O O   . SER B 1 435 ? -63.195  -56.260 26.978  1.00 32.37  ? 474  SER C O   1 
ATOM   8092  C CB  . SER B 1 435 ? -60.806  -57.628 28.160  1.00 29.21  ? 474  SER C CB  1 
ATOM   8093  O OG  . SER B 1 435 ? -59.655  -58.441 28.043  1.00 37.50  ? 474  SER C OG  1 
ATOM   8094  N N   . GLU B 1 436 ? -64.230  -57.738 28.304  1.00 28.96  ? 475  GLU C N   1 
ATOM   8095  C CA  . GLU B 1 436 ? -65.411  -56.909 28.402  1.00 29.12  ? 475  GLU C CA  1 
ATOM   8096  C C   . GLU B 1 436 ? -65.706  -56.690 29.855  1.00 33.05  ? 475  GLU C C   1 
ATOM   8097  O O   . GLU B 1 436 ? -65.826  -57.647 30.619  1.00 31.93  ? 475  GLU C O   1 
ATOM   8098  C CB  . GLU B 1 436 ? -66.586  -57.580 27.710  1.00 32.82  ? 475  GLU C CB  1 
ATOM   8099  C CG  . GLU B 1 436 ? -66.304  -57.910 26.257  1.00 40.07  ? 475  GLU C CG  1 
ATOM   8100  C CD  . GLU B 1 436 ? -67.390  -58.775 25.640  1.00 42.90  ? 475  GLU C CD  1 
ATOM   8101  O OE1 . GLU B 1 436 ? -68.358  -58.233 25.060  1.00 49.64  ? 475  GLU C OE1 1 
ATOM   8102  O OE2 . GLU B 1 436 ? -67.270  -60.005 25.741  1.00 39.73  ? 475  GLU C OE2 1 
ATOM   8103  N N   . VAL B 1 437 ? -65.806  -55.425 30.245  1.00 30.80  ? 476  VAL C N   1 
ATOM   8104  C CA  . VAL B 1 437 ? -66.097  -55.112 31.633  1.00 34.10  ? 476  VAL C CA  1 
ATOM   8105  C C   . VAL B 1 437 ? -67.606  -55.040 31.878  1.00 33.70  ? 476  VAL C C   1 
ATOM   8106  O O   . VAL B 1 437 ? -68.321  -54.233 31.291  1.00 32.18  ? 476  VAL C O   1 
ATOM   8107  C CB  . VAL B 1 437 ? -65.297  -53.879 32.160  1.00 42.16  ? 476  VAL C CB  1 
ATOM   8108  C CG1 . VAL B 1 437 ? -64.694  -53.065 31.010  1.00 33.29  ? 476  VAL C CG1 1 
ATOM   8109  C CG2 . VAL B 1 437 ? -66.131  -53.040 33.074  1.00 35.73  ? 476  VAL C CG2 1 
ATOM   8110  N N   . LEU B 1 438 ? -68.077  -55.928 32.740  1.00 31.12  ? 477  LEU C N   1 
ATOM   8111  C CA  . LEU B 1 438 ? -69.503  -56.126 32.934  1.00 37.43  ? 477  LEU C CA  1 
ATOM   8112  C C   . LEU B 1 438 ? -69.993  -55.412 34.188  1.00 36.86  ? 477  LEU C C   1 
ATOM   8113  O O   . LEU B 1 438 ? -71.178  -55.114 34.319  1.00 35.16  ? 477  LEU C O   1 
ATOM   8114  C CB  . LEU B 1 438 ? -69.807  -57.625 33.022  1.00 36.96  ? 477  LEU C CB  1 
ATOM   8115  C CG  . LEU B 1 438 ? -69.245  -58.526 31.919  1.00 41.07  ? 477  LEU C CG  1 
ATOM   8116  C CD1 . LEU B 1 438 ? -69.836  -59.928 32.057  1.00 35.09  ? 477  LEU C CD1 1 
ATOM   8117  C CD2 . LEU B 1 438 ? -69.535  -57.952 30.539  1.00 29.39  ? 477  LEU C CD2 1 
ATOM   8118  N N   . GLU B 1 439 ? -69.062  -55.161 35.105  1.00 36.29  ? 478  GLU C N   1 
ATOM   8119  C CA  . GLU B 1 439 ? -69.313  -54.411 36.332  1.00 34.03  ? 478  GLU C CA  1 
ATOM   8120  C C   . GLU B 1 439 ? -68.063  -53.565 36.567  1.00 34.71  ? 478  GLU C C   1 
ATOM   8121  O O   . GLU B 1 439 ? -66.953  -54.052 36.384  1.00 32.60  ? 478  GLU C O   1 
ATOM   8122  C CB  . GLU B 1 439 ? -69.529  -55.365 37.508  1.00 30.37  ? 478  GLU C CB  1 
ATOM   8123  C CG  . GLU B 1 439 ? -70.691  -56.337 37.293  1.00 37.30  ? 478  GLU C CG  1 
ATOM   8124  C CD  . GLU B 1 439 ? -70.836  -57.379 38.403  1.00 42.96  ? 478  GLU C CD  1 
ATOM   8125  O OE1 . GLU B 1 439 ? -69.931  -57.492 39.266  1.00 38.97  ? 478  GLU C OE1 1 
ATOM   8126  O OE2 . GLU B 1 439 ? -71.862  -58.090 38.402  1.00 33.05  ? 478  GLU C OE2 1 
ATOM   8127  N N   . SER B 1 440 ? -68.227  -52.295 36.926  1.00 34.80  ? 479  SER C N   1 
ATOM   8128  C CA  . SER B 1 440 ? -67.051  -51.472 37.193  1.00 40.39  ? 479  SER C CA  1 
ATOM   8129  C C   . SER B 1 440 ? -67.077  -50.743 38.536  1.00 31.06  ? 479  SER C C   1 
ATOM   8130  O O   . SER B 1 440 ? -67.828  -49.787 38.721  1.00 32.92  ? 479  SER C O   1 
ATOM   8131  C CB  . SER B 1 440 ? -66.849  -50.460 36.062  1.00 40.14  ? 479  SER C CB  1 
ATOM   8132  O OG  . SER B 1 440 ? -65.751  -49.607 36.329  1.00 44.18  ? 479  SER C OG  1 
ATOM   8133  N N   . ASN B 1 441 ? -66.205  -51.214 39.422  1.00 36.32  ? 480  ASN C N   1 
ATOM   8134  C CA  . ASN B 1 441 ? -65.923  -50.597 40.699  1.00 33.69  ? 480  ASN C CA  1 
ATOM   8135  C C   . ASN B 1 441 ? -64.539  -49.961 40.547  1.00 36.37  ? 480  ASN C C   1 
ATOM   8136  O O   . ASN B 1 441 ? -63.966  -49.445 41.505  1.00 34.53  ? 480  ASN C O   1 
ATOM   8137  C CB  . ASN B 1 441 ? -65.924  -51.632 41.821  1.00 32.67  ? 480  ASN C CB  1 
ATOM   8138  C CG  . ASN B 1 441 ? -65.924  -50.998 43.198  1.00 38.70  ? 480  ASN C CG  1 
ATOM   8139  O OD1 . ASN B 1 441 ? -66.081  -49.785 43.335  1.00 35.37  ? 480  ASN C OD1 1 
ATOM   8140  N ND2 . ASN B 1 441 ? -65.751  -51.819 44.228  1.00 37.71  ? 480  ASN C ND2 1 
ATOM   8141  N N   . GLY B 1 442 ? -64.014  -50.017 39.321  1.00 34.48  ? 481  GLY C N   1 
ATOM   8142  C CA  . GLY B 1 442 ? -62.707  -49.469 38.985  1.00 32.00  ? 481  GLY C CA  1 
ATOM   8143  C C   . GLY B 1 442 ? -61.657  -50.481 38.538  1.00 36.16  ? 481  GLY C C   1 
ATOM   8144  O O   . GLY B 1 442 ? -61.839  -51.689 38.689  1.00 34.68  ? 481  GLY C O   1 
ATOM   8145  N N   . SER B 1 443 ? -60.549  -49.976 37.996  1.00 32.66  ? 482  SER C N   1 
ATOM   8146  C CA  . SER B 1 443 ? -59.431  -50.809 37.528  1.00 35.44  ? 482  SER C CA  1 
ATOM   8147  C C   . SER B 1 443 ? -59.753  -51.886 36.479  1.00 38.21  ? 482  SER C C   1 
ATOM   8148  O O   . SER B 1 443 ? -59.299  -53.024 36.600  1.00 32.41  ? 482  SER C O   1 
ATOM   8149  C CB  . SER B 1 443 ? -58.711  -51.447 38.719  1.00 34.32  ? 482  SER C CB  1 
ATOM   8150  O OG  . SER B 1 443 ? -57.525  -52.100 38.302  1.00 35.54  ? 482  SER C OG  1 
ATOM   8151  N N   . SER B 1 444 ? -60.534  -51.533 35.462  1.00 28.30  ? 483  SER C N   1 
ATOM   8152  C CA  . SER B 1 444 ? -60.919  -52.486 34.415  1.00 28.13  ? 483  SER C CA  1 
ATOM   8153  C C   . SER B 1 444 ? -59.775  -53.075 33.566  1.00 28.97  ? 483  SER C C   1 
ATOM   8154  O O   . SER B 1 444 ? -59.767  -54.276 33.298  1.00 34.60  ? 483  SER C O   1 
ATOM   8155  C CB  . SER B 1 444 ? -61.973  -51.860 33.498  1.00 31.40  ? 483  SER C CB  1 
ATOM   8156  O OG  . SER B 1 444 ? -61.494  -50.661 32.917  1.00 28.73  ? 483  SER C OG  1 
ATOM   8157  N N   . SER B 1 445 ? -58.816  -52.249 33.150  1.00 26.24  ? 484  SER C N   1 
ATOM   8158  C CA  . SER B 1 445 ? -57.691  -52.730 32.359  1.00 34.02  ? 484  SER C CA  1 
ATOM   8159  C C   . SER B 1 445 ? -56.865  -53.795 33.065  1.00 31.89  ? 484  SER C C   1 
ATOM   8160  O O   . SER B 1 445 ? -56.431  -54.763 32.443  1.00 28.53  ? 484  SER C O   1 
ATOM   8161  C CB  . SER B 1 445 ? -56.791  -51.562 31.946  1.00 30.55  ? 484  SER C CB  1 
ATOM   8162  O OG  . SER B 1 445 ? -56.227  -50.929 33.079  1.00 36.75  ? 484  SER C OG  1 
ATOM   8163  N N   . MET B 1 446 ? -56.641  -53.614 34.361  1.00 29.63  ? 485  MET C N   1 
ATOM   8164  C CA  . MET B 1 446 ? -55.825  -54.563 35.107  1.00 31.71  ? 485  MET C CA  1 
ATOM   8165  C C   . MET B 1 446 ? -56.531  -55.900 35.282  1.00 34.41  ? 485  MET C C   1 
ATOM   8166  O O   . MET B 1 446 ? -55.894  -56.950 35.186  1.00 33.98  ? 485  MET C O   1 
ATOM   8167  C CB  . MET B 1 446 ? -55.417  -53.980 36.463  1.00 33.02  ? 485  MET C CB  1 
ATOM   8168  C CG  . MET B 1 446 ? -54.516  -52.765 36.352  1.00 30.77  ? 485  MET C CG  1 
ATOM   8169  S SD  . MET B 1 446 ? -52.948  -53.083 35.535  1.00 33.53  ? 485  MET C SD  1 
ATOM   8170  C CE  . MET B 1 446 ? -53.308  -52.632 33.823  1.00 23.31  ? 485  MET C CE  1 
ATOM   8171  N N   . ALA B 1 447 ? -57.838  -55.863 35.545  1.00 30.39  ? 486  ALA C N   1 
ATOM   8172  C CA  . ALA B 1 447 ? -58.638  -57.086 35.600  1.00 32.58  ? 486  ALA C CA  1 
ATOM   8173  C C   . ALA B 1 447 ? -58.621  -57.820 34.242  1.00 37.55  ? 486  ALA C C   1 
ATOM   8174  O O   . ALA B 1 447 ? -58.672  -59.058 34.186  1.00 32.05  ? 486  ALA C O   1 
ATOM   8175  C CB  . ALA B 1 447 ? -60.073  -56.774 36.041  1.00 30.18  ? 486  ALA C CB  1 
ATOM   8176  N N   . SER B 1 448 ? -58.529  -57.048 33.159  1.00 33.73  ? 487  SER C N   1 
ATOM   8177  C CA  . SER B 1 448 ? -58.463  -57.601 31.805  1.00 32.64  ? 487  SER C CA  1 
ATOM   8178  C C   . SER B 1 448 ? -57.161  -58.365 31.591  1.00 39.27  ? 487  SER C C   1 
ATOM   8179  O O   . SER B 1 448 ? -57.149  -59.428 30.972  1.00 36.08  ? 487  SER C O   1 
ATOM   8180  C CB  . SER B 1 448 ? -58.587  -56.499 30.740  1.00 30.67  ? 487  SER C CB  1 
ATOM   8181  O OG  . SER B 1 448 ? -59.815  -55.788 30.859  1.00 31.12  ? 487  SER C OG  1 
ATOM   8182  N N   . ALA B 1 449 ? -56.059  -57.821 32.085  1.00 29.76  ? 488  ALA C N   1 
ATOM   8183  C CA  . ALA B 1 449 ? -54.787  -58.531 31.990  1.00 33.29  ? 488  ALA C CA  1 
ATOM   8184  C C   . ALA B 1 449 ? -54.833  -59.857 32.766  1.00 32.00  ? 488  ALA C C   1 
ATOM   8185  O O   . ALA B 1 449 ? -54.349  -60.886 32.282  1.00 34.88  ? 488  ALA C O   1 
ATOM   8186  C CB  . ALA B 1 449 ? -53.653  -57.660 32.481  1.00 28.15  ? 488  ALA C CB  1 
ATOM   8187  N N   . CYS B 1 450 ? -55.423  -59.819 33.959  1.00 28.23  ? 489  CYS C N   1 
ATOM   8188  C CA  . CYS B 1 450 ? -55.610  -60.998 34.801  1.00 39.31  ? 489  CYS C CA  1 
ATOM   8189  C C   . CYS B 1 450 ? -56.514  -62.044 34.128  1.00 44.44  ? 489  CYS C C   1 
ATOM   8190  O O   . CYS B 1 450 ? -56.114  -63.196 33.926  1.00 38.76  ? 489  CYS C O   1 
ATOM   8191  C CB  . CYS B 1 450 ? -56.205  -60.597 36.156  1.00 33.47  ? 489  CYS C CB  1 
ATOM   8192  S SG  . CYS B 1 450 ? -55.129  -59.615 37.249  1.00 37.84  ? 489  CYS C SG  1 
ATOM   8193  N N   . GLY B 1 451 ? -57.734  -61.636 33.799  1.00 35.04  ? 490  GLY C N   1 
ATOM   8194  C CA  . GLY B 1 451 ? -58.656  -62.494 33.080  1.00 32.68  ? 490  GLY C CA  1 
ATOM   8195  C C   . GLY B 1 451 ? -58.066  -63.020 31.784  1.00 36.77  ? 490  GLY C C   1 
ATOM   8196  O O   . GLY B 1 451 ? -58.234  -64.193 31.451  1.00 39.51  ? 490  GLY C O   1 
ATOM   8197  N N   . GLY B 1 452 ? -57.378  -62.151 31.048  1.00 29.43  ? 491  GLY C N   1 
ATOM   8198  C CA  . GLY B 1 452 ? -56.698  -62.542 29.828  1.00 30.67  ? 491  GLY C CA  1 
ATOM   8199  C C   . GLY B 1 452 ? -55.673  -63.638 30.103  1.00 38.82  ? 491  GLY C C   1 
ATOM   8200  O O   . GLY B 1 452 ? -55.555  -64.591 29.340  1.00 32.22  ? 491  GLY C O   1 
ATOM   8201  N N   . SER B 1 453 ? -54.935  -63.509 31.202  1.00 31.48  ? 492  SER C N   1 
ATOM   8202  C CA  . SER B 1 453 ? -53.984  -64.550 31.595  1.00 37.66  ? 492  SER C CA  1 
ATOM   8203  C C   . SER B 1 453 ? -54.700  -65.892 31.773  1.00 38.43  ? 492  SER C C   1 
ATOM   8204  O O   . SER B 1 453 ? -54.324  -66.890 31.161  1.00 35.31  ? 492  SER C O   1 
ATOM   8205  C CB  . SER B 1 453 ? -53.266  -64.161 32.886  1.00 39.13  ? 492  SER C CB  1 
ATOM   8206  O OG  . SER B 1 453 ? -52.116  -64.955 33.101  1.00 30.48  ? 492  SER C OG  1 
ATOM   8207  N N   . LEU B 1 454 ? -55.729  -65.890 32.615  1.00 29.52  ? 493  LEU C N   1 
ATOM   8208  C CA  . LEU B 1 454 ? -56.545  -67.064 32.877  1.00 36.83  ? 493  LEU C CA  1 
ATOM   8209  C C   . LEU B 1 454 ? -57.087  -67.684 31.598  1.00 42.92  ? 493  LEU C C   1 
ATOM   8210  O O   . LEU B 1 454 ? -56.917  -68.883 31.366  1.00 33.14  ? 493  LEU C O   1 
ATOM   8211  C CB  . LEU B 1 454 ? -57.710  -66.711 33.803  1.00 28.71  ? 493  LEU C CB  1 
ATOM   8212  C CG  . LEU B 1 454 ? -57.300  -66.261 35.203  1.00 35.30  ? 493  LEU C CG  1 
ATOM   8213  C CD1 . LEU B 1 454 ? -58.499  -65.722 35.970  1.00 36.45  ? 493  LEU C CD1 1 
ATOM   8214  C CD2 . LEU B 1 454 ? -56.648  -67.412 35.951  1.00 36.46  ? 493  LEU C CD2 1 
ATOM   8215  N N   . ALA B 1 455 ? -57.732  -66.869 30.769  1.00 33.61  ? 494  ALA C N   1 
ATOM   8216  C CA  . ALA B 1 455 ? -58.380  -67.387 29.567  1.00 35.51  ? 494  ALA C CA  1 
ATOM   8217  C C   . ALA B 1 455 ? -57.370  -67.969 28.595  1.00 39.46  ? 494  ALA C C   1 
ATOM   8218  O O   . ALA B 1 455 ? -57.661  -68.946 27.897  1.00 41.00  ? 494  ALA C O   1 
ATOM   8219  C CB  . ALA B 1 455 ? -59.227  -66.314 28.886  1.00 35.60  ? 494  ALA C CB  1 
ATOM   8220  N N   . LEU B 1 456 ? -56.182  -67.376 28.546  1.00 35.88  ? 495  LEU C N   1 
ATOM   8221  C CA  . LEU B 1 456 ? -55.137  -67.900 27.677  1.00 35.58  ? 495  LEU C CA  1 
ATOM   8222  C C   . LEU B 1 456 ? -54.732  -69.312 28.107  1.00 38.79  ? 495  LEU C C   1 
ATOM   8223  O O   . LEU B 1 456 ? -54.682  -70.227 27.285  1.00 38.43  ? 495  LEU C O   1 
ATOM   8224  C CB  . LEU B 1 456 ? -53.922  -66.965 27.640  1.00 36.39  ? 495  LEU C CB  1 
ATOM   8225  C CG  . LEU B 1 456 ? -54.053  -65.714 26.764  1.00 36.08  ? 495  LEU C CG  1 
ATOM   8226  C CD1 . LEU B 1 456 ? -52.955  -64.710 27.105  1.00 32.63  ? 495  LEU C CD1 1 
ATOM   8227  C CD2 . LEU B 1 456 ? -54.039  -66.064 25.275  1.00 33.09  ? 495  LEU C CD2 1 
ATOM   8228  N N   . MET B 1 457 ? -54.452  -69.489 29.395  1.00 38.31  ? 496  MET C N   1 
ATOM   8229  C CA  . MET B 1 457 ? -54.107  -70.811 29.902  1.00 43.37  ? 496  MET C CA  1 
ATOM   8230  C C   . MET B 1 457 ? -55.232  -71.792 29.614  1.00 44.77  ? 496  MET C C   1 
ATOM   8231  O O   . MET B 1 457 ? -54.989  -72.913 29.168  1.00 37.54  ? 496  MET C O   1 
ATOM   8232  C CB  . MET B 1 457 ? -53.822  -70.771 31.400  1.00 36.98  ? 496  MET C CB  1 
ATOM   8233  C CG  . MET B 1 457 ? -52.500  -70.122 31.743  1.00 32.48  ? 496  MET C CG  1 
ATOM   8234  S SD  . MET B 1 457 ? -52.160  -70.207 33.505  1.00 42.64  ? 496  MET C SD  1 
ATOM   8235  C CE  . MET B 1 457 ? -50.534  -69.462 33.570  1.00 30.85  ? 496  MET C CE  1 
ATOM   8236  N N   . ASP B 1 458 ? -56.463  -71.356 29.859  1.00 39.54  ? 497  ASP C N   1 
ATOM   8237  C CA  . ASP B 1 458 ? -57.617  -72.208 29.648  1.00 36.90  ? 497  ASP C CA  1 
ATOM   8238  C C   . ASP B 1 458 ? -57.665  -72.665 28.204  1.00 42.11  ? 497  ASP C C   1 
ATOM   8239  O O   . ASP B 1 458 ? -58.045  -73.799 27.919  1.00 44.23  ? 497  ASP C O   1 
ATOM   8240  C CB  . ASP B 1 458 ? -58.909  -71.466 29.994  1.00 36.72  ? 497  ASP C CB  1 
ATOM   8241  C CG  . ASP B 1 458 ? -60.163  -72.276 29.653  1.00 44.48  ? 497  ASP C CG  1 
ATOM   8242  O OD1 . ASP B 1 458 ? -60.269  -73.424 30.117  1.00 40.07  ? 497  ASP C OD1 1 
ATOM   8243  O OD2 . ASP B 1 458 ? -61.043  -71.769 28.921  1.00 44.92  ? 497  ASP C OD2 1 
ATOM   8244  N N   . SER B 1 459 ? -57.291  -71.775 27.291  1.00 35.94  ? 498  SER C N   1 
ATOM   8245  C CA  . SER B 1 459 ? -57.405  -72.062 25.866  1.00 36.40  ? 498  SER C CA  1 
ATOM   8246  C C   . SER B 1 459 ? -56.239  -72.920 25.380  1.00 36.81  ? 498  SER C C   1 
ATOM   8247  O O   . SER B 1 459 ? -56.229  -73.373 24.241  1.00 42.16  ? 498  SER C O   1 
ATOM   8248  C CB  . SER B 1 459 ? -57.432  -70.764 25.067  1.00 34.28  ? 498  SER C CB  1 
ATOM   8249  O OG  . SER B 1 459 ? -56.120  -70.237 24.961  1.00 31.93  ? 498  SER C OG  1 
ATOM   8250  N N   . GLY B 1 460 ? -55.249  -73.109 26.242  1.00 36.33  ? 499  GLY C N   1 
ATOM   8251  C CA  . GLY B 1 460 ? -54.105  -73.938 25.921  1.00 37.07  ? 499  GLY C CA  1 
ATOM   8252  C C   . GLY B 1 460 ? -52.963  -73.239 25.216  1.00 45.90  ? 499  GLY C C   1 
ATOM   8253  O O   . GLY B 1 460 ? -52.130  -73.902 24.601  1.00 43.96  ? 499  GLY C O   1 
ATOM   8254  N N   . VAL B 1 461 ? -52.914  -71.907 25.287  1.00 37.53  ? 500  VAL C N   1 
ATOM   8255  C CA  . VAL B 1 461 ? -51.754  -71.184 24.782  1.00 28.72  ? 500  VAL C CA  1 
ATOM   8256  C C   . VAL B 1 461 ? -50.629  -71.361 25.785  1.00 37.44  ? 500  VAL C C   1 
ATOM   8257  O O   . VAL B 1 461 ? -50.805  -71.072 26.970  1.00 38.03  ? 500  VAL C O   1 
ATOM   8258  C CB  . VAL B 1 461 ? -52.030  -69.667 24.599  1.00 35.35  ? 500  VAL C CB  1 
ATOM   8259  C CG1 . VAL B 1 461 ? -50.750  -68.941 24.217  1.00 35.16  ? 500  VAL C CG1 1 
ATOM   8260  C CG2 . VAL B 1 461 ? -53.122  -69.436 23.554  1.00 32.04  ? 500  VAL C CG2 1 
ATOM   8261  N N   . PRO B 1 462 ? -49.468  -71.856 25.325  1.00 38.04  ? 501  PRO C N   1 
ATOM   8262  C CA  . PRO B 1 462 ? -48.401  -72.077 26.303  1.00 37.66  ? 501  PRO C CA  1 
ATOM   8263  C C   . PRO B 1 462 ? -47.671  -70.781 26.690  1.00 44.38  ? 501  PRO C C   1 
ATOM   8264  O O   . PRO B 1 462 ? -46.517  -70.573 26.315  1.00 41.34  ? 501  PRO C O   1 
ATOM   8265  C CB  . PRO B 1 462 ? -47.466  -73.068 25.592  1.00 40.88  ? 501  PRO C CB  1 
ATOM   8266  C CG  . PRO B 1 462 ? -47.726  -72.872 24.132  1.00 45.61  ? 501  PRO C CG  1 
ATOM   8267  C CD  . PRO B 1 462 ? -49.159  -72.430 24.000  1.00 37.56  ? 501  PRO C CD  1 
ATOM   8268  N N   . ILE B 1 463 ? -48.351  -69.907 27.427  1.00 41.25  ? 502  ILE C N   1 
ATOM   8269  C CA  . ILE B 1 463 ? -47.728  -68.668 27.859  1.00 37.44  ? 502  ILE C CA  1 
ATOM   8270  C C   . ILE B 1 463 ? -46.672  -69.017 28.907  1.00 40.40  ? 502  ILE C C   1 
ATOM   8271  O O   . ILE B 1 463 ? -46.814  -70.004 29.624  1.00 41.95  ? 502  ILE C O   1 
ATOM   8272  C CB  . ILE B 1 463 ? -48.759  -67.649 28.418  1.00 43.29  ? 502  ILE C CB  1 
ATOM   8273  C CG1 . ILE B 1 463 ? -49.392  -68.151 29.714  1.00 36.07  ? 502  ILE C CG1 1 
ATOM   8274  C CG2 . ILE B 1 463 ? -49.843  -67.329 27.384  1.00 41.85  ? 502  ILE C CG2 1 
ATOM   8275  C CD1 . ILE B 1 463 ? -50.336  -67.128 30.373  1.00 35.15  ? 502  ILE C CD1 1 
ATOM   8276  N N   . SER B 1 464 ? -45.617  -68.216 28.996  1.00 38.95  ? 503  SER C N   1 
ATOM   8277  C CA  . SER B 1 464 ? -44.477  -68.563 29.844  1.00 43.23  ? 503  SER C CA  1 
ATOM   8278  C C   . SER B 1 464 ? -44.722  -68.324 31.336  1.00 44.81  ? 503  SER C C   1 
ATOM   8279  O O   . SER B 1 464 ? -44.027  -68.882 32.177  1.00 50.35  ? 503  SER C O   1 
ATOM   8280  C CB  . SER B 1 464 ? -43.220  -67.821 29.375  1.00 52.91  ? 503  SER C CB  1 
ATOM   8281  O OG  . SER B 1 464 ? -43.452  -66.422 29.297  1.00 45.51  ? 503  SER C OG  1 
ATOM   8282  N N   . SER B 1 465 ? -45.703  -67.492 31.668  1.00 39.60  ? 504  SER C N   1 
ATOM   8283  C CA  . SER B 1 465 ? -46.006  -67.184 33.066  1.00 44.20  ? 504  SER C CA  1 
ATOM   8284  C C   . SER B 1 465 ? -47.374  -66.547 33.166  1.00 36.75  ? 504  SER C C   1 
ATOM   8285  O O   . SER B 1 465 ? -47.866  -65.961 32.203  1.00 39.46  ? 504  SER C O   1 
ATOM   8286  C CB  . SER B 1 465 ? -44.986  -66.202 33.668  1.00 35.95  ? 504  SER C CB  1 
ATOM   8287  O OG  . SER B 1 465 ? -43.664  -66.694 33.586  1.00 59.04  ? 504  SER C OG  1 
ATOM   8288  N N   . ALA B 1 466 ? -47.973  -66.652 34.343  1.00 32.72  ? 505  ALA C N   1 
ATOM   8289  C CA  . ALA B 1 466 ? -49.226  -65.979 34.639  1.00 37.40  ? 505  ALA C CA  1 
ATOM   8290  C C   . ALA B 1 466 ? -48.924  -64.489 34.805  1.00 39.90  ? 505  ALA C C   1 
ATOM   8291  O O   . ALA B 1 466 ? -47.826  -64.120 35.229  1.00 37.38  ? 505  ALA C O   1 
ATOM   8292  C CB  . ALA B 1 466 ? -49.816  -66.539 35.911  1.00 32.86  ? 505  ALA C CB  1 
ATOM   8293  N N   . VAL B 1 467 ? -49.873  -63.630 34.452  1.00 39.74  ? 506  VAL C N   1 
ATOM   8294  C CA  . VAL B 1 467 ? -49.692  -62.202 34.705  1.00 35.20  ? 506  VAL C CA  1 
ATOM   8295  C C   . VAL B 1 467 ? -50.881  -61.562 35.425  1.00 41.02  ? 506  VAL C C   1 
ATOM   8296  O O   . VAL B 1 467 ? -52.048  -61.943 35.228  1.00 31.08  ? 506  VAL C O   1 
ATOM   8297  C CB  . VAL B 1 467 ? -49.216  -61.403 33.447  1.00 38.40  ? 506  VAL C CB  1 
ATOM   8298  C CG1 . VAL B 1 467 ? -49.254  -62.262 32.206  1.00 44.21  ? 506  VAL C CG1 1 
ATOM   8299  C CG2 . VAL B 1 467 ? -50.004  -60.109 33.267  1.00 31.06  ? 506  VAL C CG2 1 
ATOM   8300  N N   . ALA B 1 468 ? -50.551  -60.624 36.307  1.00 32.59  ? 507  ALA C N   1 
ATOM   8301  C CA  . ALA B 1 468 ? -51.543  -59.910 37.087  1.00 32.65  ? 507  ALA C CA  1 
ATOM   8302  C C   . ALA B 1 468 ? -51.241  -58.407 37.103  1.00 31.15  ? 507  ALA C C   1 
ATOM   8303  O O   . ALA B 1 468 ? -50.075  -57.986 37.011  1.00 29.70  ? 507  ALA C O   1 
ATOM   8304  C CB  . ALA B 1 468 ? -51.587  -60.454 38.485  1.00 32.59  ? 507  ALA C CB  1 
ATOM   8305  N N   . GLY B 1 469 ? -52.294  -57.601 37.204  1.00 32.46  ? 508  GLY C N   1 
ATOM   8306  C CA  . GLY B 1 469 ? -52.125  -56.161 37.276  1.00 29.82  ? 508  GLY C CA  1 
ATOM   8307  C C   . GLY B 1 469 ? -52.899  -55.608 38.453  1.00 34.77  ? 508  GLY C C   1 
ATOM   8308  O O   . GLY B 1 469 ? -53.822  -56.244 38.963  1.00 32.18  ? 508  GLY C O   1 
ATOM   8309  N N   . VAL B 1 470 ? -52.528  -54.415 38.890  1.00 35.71  ? 509  VAL C N   1 
ATOM   8310  C CA  . VAL B 1 470 ? -53.266  -53.749 39.943  1.00 28.46  ? 509  VAL C CA  1 
ATOM   8311  C C   . VAL B 1 470 ? -53.061  -52.245 39.792  1.00 27.55  ? 509  VAL C C   1 
ATOM   8312  O O   . VAL B 1 470 ? -52.087  -51.811 39.185  1.00 30.41  ? 509  VAL C O   1 
ATOM   8313  C CB  . VAL B 1 470 ? -52.797  -54.240 41.337  1.00 28.35  ? 509  VAL C CB  1 
ATOM   8314  C CG1 . VAL B 1 470 ? -51.346  -53.835 41.594  1.00 31.68  ? 509  VAL C CG1 1 
ATOM   8315  C CG2 . VAL B 1 470 ? -53.716  -53.725 42.434  1.00 25.35  ? 509  VAL C CG2 1 
ATOM   8316  N N   . ALA B 1 471 ? -53.992  -51.453 40.316  1.00 28.56  ? 510  ALA C N   1 
ATOM   8317  C CA  . ALA B 1 471 ? -53.828  -50.004 40.318  1.00 35.72  ? 510  ALA C CA  1 
ATOM   8318  C C   . ALA B 1 471 ? -53.556  -49.496 41.725  1.00 32.66  ? 510  ALA C C   1 
ATOM   8319  O O   . ALA B 1 471 ? -54.236  -49.865 42.681  1.00 32.19  ? 510  ALA C O   1 
ATOM   8320  C CB  . ALA B 1 471 ? -55.065  -49.299 39.728  1.00 30.25  ? 510  ALA C CB  1 
ATOM   8321  N N   . ILE B 1 472 ? -52.568  -48.632 41.852  1.00 32.97  ? 511  ILE C N   1 
ATOM   8322  C CA  . ILE B 1 472 ? -52.353  -47.982 43.130  1.00 31.97  ? 511  ILE C CA  1 
ATOM   8323  C C   . ILE B 1 472 ? -52.745  -46.510 43.046  1.00 30.53  ? 511  ILE C C   1 
ATOM   8324  O O   . ILE B 1 472 ? -52.489  -45.840 42.041  1.00 26.72  ? 511  ILE C O   1 
ATOM   8325  C CB  . ILE B 1 472 ? -50.917  -48.214 43.619  1.00 36.11  ? 511  ILE C CB  1 
ATOM   8326  C CG1 . ILE B 1 472 ? -50.823  -49.648 44.161  1.00 38.63  ? 511  ILE C CG1 1 
ATOM   8327  C CG2 . ILE B 1 472 ? -50.540  -47.249 44.733  1.00 28.81  ? 511  ILE C CG2 1 
ATOM   8328  C CD1 . ILE B 1 472 ? -49.632  -50.318 43.748  1.00 40.76  ? 511  ILE C CD1 1 
ATOM   8329  N N   . GLY B 1 473 ? -53.408  -46.034 44.090  1.00 30.86  ? 512  GLY C N   1 
ATOM   8330  C CA  . GLY B 1 473 ? -53.824  -44.649 44.166  1.00 29.93  ? 512  GLY C CA  1 
ATOM   8331  C C   . GLY B 1 473 ? -52.985  -43.896 45.180  1.00 36.33  ? 512  GLY C C   1 
ATOM   8332  O O   . GLY B 1 473 ? -52.077  -44.452 45.801  1.00 29.49  ? 512  GLY C O   1 
ATOM   8333  N N   . LEU B 1 474 ? -53.298  -42.621 45.352  1.00 40.99  ? 513  LEU C N   1 
ATOM   8334  C CA  . LEU B 1 474 ? -52.487  -41.746 46.188  1.00 31.83  ? 513  LEU C CA  1 
ATOM   8335  C C   . LEU B 1 474 ? -53.359  -40.639 46.744  1.00 31.78  ? 513  LEU C C   1 
ATOM   8336  O O   . LEU B 1 474 ? -54.190  -40.067 46.026  1.00 32.22  ? 513  LEU C O   1 
ATOM   8337  C CB  . LEU B 1 474 ? -51.367  -41.127 45.356  1.00 27.02  ? 513  LEU C CB  1 
ATOM   8338  C CG  . LEU B 1 474 ? -50.539  -40.016 46.016  1.00 31.40  ? 513  LEU C CG  1 
ATOM   8339  C CD1 . LEU B 1 474 ? -49.551  -40.619 47.031  1.00 29.25  ? 513  LEU C CD1 1 
ATOM   8340  C CD2 . LEU B 1 474 ? -49.791  -39.222 44.954  1.00 31.59  ? 513  LEU C CD2 1 
ATOM   8341  N N   . VAL B 1 475 ? -53.180  -40.348 48.025  1.00 31.14  ? 514  VAL C N   1 
ATOM   8342  C CA  . VAL B 1 475 ? -53.777  -39.167 48.622  1.00 33.80  ? 514  VAL C CA  1 
ATOM   8343  C C   . VAL B 1 475 ? -52.679  -38.339 49.289  1.00 35.33  ? 514  VAL C C   1 
ATOM   8344  O O   . VAL B 1 475 ? -51.955  -38.845 50.141  1.00 35.37  ? 514  VAL C O   1 
ATOM   8345  C CB  . VAL B 1 475 ? -54.863  -39.525 49.661  1.00 36.38  ? 514  VAL C CB  1 
ATOM   8346  C CG1 . VAL B 1 475 ? -55.251  -38.282 50.457  1.00 32.95  ? 514  VAL C CG1 1 
ATOM   8347  C CG2 . VAL B 1 475 ? -56.086  -40.132 48.971  1.00 33.43  ? 514  VAL C CG2 1 
ATOM   8348  N N   . THR B 1 476 ? -52.552  -37.076 48.894  1.00 33.83  ? 515  THR C N   1 
ATOM   8349  C CA  . THR B 1 476 ? -51.523  -36.202 49.455  1.00 37.83  ? 515  THR C CA  1 
ATOM   8350  C C   . THR B 1 476 ? -52.111  -35.054 50.264  1.00 38.44  ? 515  THR C C   1 
ATOM   8351  O O   . THR B 1 476 ? -53.242  -34.624 50.033  1.00 35.89  ? 515  THR C O   1 
ATOM   8352  C CB  . THR B 1 476 ? -50.644  -35.562 48.361  1.00 40.16  ? 515  THR C CB  1 
ATOM   8353  O OG1 . THR B 1 476 ? -51.477  -34.824 47.460  1.00 33.65  ? 515  THR C OG1 1 
ATOM   8354  C CG2 . THR B 1 476 ? -49.845  -36.616 47.591  1.00 30.47  ? 515  THR C CG2 1 
ATOM   8355  N N   . LYS B 1 477 ? -51.327  -34.576 51.222  1.00 38.15  ? 516  LYS C N   1 
ATOM   8356  C CA  . LYS B 1 477 ? -51.561  -33.291 51.857  1.00 40.24  ? 516  LYS C CA  1 
ATOM   8357  C C   . LYS B 1 477 ? -50.458  -32.327 51.389  1.00 38.51  ? 516  LYS C C   1 
ATOM   8358  O O   . LYS B 1 477 ? -49.277  -32.618 51.538  1.00 39.25  ? 516  LYS C O   1 
ATOM   8359  C CB  . LYS B 1 477 ? -51.556  -33.464 53.378  1.00 40.94  ? 516  LYS C CB  1 
ATOM   8360  C CG  . LYS B 1 477 ? -51.258  -32.208 54.179  1.00 51.62  ? 516  LYS C CG  1 
ATOM   8361  C CD  . LYS B 1 477 ? -52.521  -31.455 54.551  1.00 64.01  ? 516  LYS C CD  1 
ATOM   8362  C CE  . LYS B 1 477 ? -52.216  -30.363 55.574  1.00 72.15  ? 516  LYS C CE  1 
ATOM   8363  N NZ  . LYS B 1 477 ? -53.462  -29.755 56.126  1.00 75.65  ? 516  LYS C NZ  1 
ATOM   8364  N N   . THR B 1 478 ? -50.847  -31.199 50.800  1.00 47.02  ? 517  THR C N   1 
ATOM   8365  C CA  . THR B 1 478 ? -49.885  -30.198 50.328  1.00 53.44  ? 517  THR C CA  1 
ATOM   8366  C C   . THR B 1 478 ? -50.097  -28.826 50.991  1.00 61.58  ? 517  THR C C   1 
ATOM   8367  O O   . THR B 1 478 ? -50.821  -28.712 51.980  1.00 65.28  ? 517  THR C O   1 
ATOM   8368  C CB  . THR B 1 478 ? -49.951  -30.020 48.796  1.00 49.68  ? 517  THR C CB  1 
ATOM   8369  O OG1 . THR B 1 478 ? -51.224  -29.480 48.434  1.00 56.14  ? 517  THR C OG1 1 
ATOM   8370  C CG2 . THR B 1 478 ? -49.748  -31.341 48.082  1.00 44.40  ? 517  THR C CG2 1 
ATOM   8371  N N   . ASP B 1 479 ? -49.476  -27.788 50.428  1.00 65.35  ? 518  ASP C N   1 
ATOM   8372  C CA  . ASP B 1 479 ? -49.515  -26.437 51.010  1.00 75.01  ? 518  ASP C CA  1 
ATOM   8373  C C   . ASP B 1 479 ? -50.685  -25.584 50.532  1.00 70.79  ? 518  ASP C C   1 
ATOM   8374  O O   . ASP B 1 479 ? -50.578  -24.355 50.483  1.00 71.12  ? 518  ASP C O   1 
ATOM   8375  C CB  . ASP B 1 479 ? -48.219  -25.687 50.712  1.00 72.74  ? 518  ASP C CB  1 
ATOM   8376  C CG  . ASP B 1 479 ? -46.998  -26.484 51.076  1.00 77.04  ? 518  ASP C CG  1 
ATOM   8377  O OD1 . ASP B 1 479 ? -47.040  -27.180 52.114  1.00 73.75  ? 518  ASP C OD1 1 
ATOM   8378  O OD2 . ASP B 1 479 ? -46.006  -26.425 50.320  1.00 78.83  ? 518  ASP C OD2 1 
ATOM   8379  N N   . GLY B 1 483 ? -46.412  -25.659 47.025  1.00 62.85  ? 522  GLY C N   1 
ATOM   8380  C CA  . GLY B 1 483 ? -47.334  -26.766 46.828  1.00 73.30  ? 522  GLY C CA  1 
ATOM   8381  C C   . GLY B 1 483 ? -46.674  -28.107 47.096  1.00 71.80  ? 522  GLY C C   1 
ATOM   8382  O O   . GLY B 1 483 ? -47.015  -29.131 46.493  1.00 59.76  ? 522  GLY C O   1 
ATOM   8383  N N   . GLU B 1 484 ? -45.719  -28.093 48.018  1.00 66.63  ? 523  GLU C N   1 
ATOM   8384  C CA  . GLU B 1 484 ? -44.929  -29.274 48.327  1.00 55.90  ? 523  GLU C CA  1 
ATOM   8385  C C   . GLU B 1 484 ? -45.692  -30.291 49.177  1.00 45.84  ? 523  GLU C C   1 
ATOM   8386  O O   . GLU B 1 484 ? -46.495  -29.933 50.036  1.00 44.76  ? 523  GLU C O   1 
ATOM   8387  C CB  . GLU B 1 484 ? -43.629  -28.864 49.016  1.00 53.64  ? 523  GLU C CB  1 
ATOM   8388  C CG  . GLU B 1 484 ? -42.794  -27.885 48.195  1.00 71.03  ? 523  GLU C CG  1 
ATOM   8389  C CD  . GLU B 1 484 ? -41.340  -27.838 48.632  1.00 89.56  ? 523  GLU C CD  1 
ATOM   8390  O OE1 . GLU B 1 484 ? -41.048  -28.232 49.784  1.00 86.44  ? 523  GLU C OE1 1 
ATOM   8391  O OE2 . GLU B 1 484 ? -40.488  -27.416 47.816  1.00 97.97  ? 523  GLU C OE2 1 
ATOM   8392  N N   . ILE B 1 485 ? -45.418  -31.565 48.933  1.00 39.16  ? 524  ILE C N   1 
ATOM   8393  C CA  . ILE B 1 485 ? -46.111  -32.648 49.622  1.00 48.12  ? 524  ILE C CA  1 
ATOM   8394  C C   . ILE B 1 485 ? -45.635  -32.804 51.065  1.00 51.89  ? 524  ILE C C   1 
ATOM   8395  O O   . ILE B 1 485 ? -44.452  -33.066 51.318  1.00 43.58  ? 524  ILE C O   1 
ATOM   8396  C CB  . ILE B 1 485 ? -45.953  -33.971 48.851  1.00 39.06  ? 524  ILE C CB  1 
ATOM   8397  C CG1 . ILE B 1 485 ? -46.627  -33.843 47.480  1.00 43.50  ? 524  ILE C CG1 1 
ATOM   8398  C CG2 . ILE B 1 485 ? -46.516  -35.125 49.656  1.00 35.49  ? 524  ILE C CG2 1 
ATOM   8399  C CD1 . ILE B 1 485 ? -46.565  -35.087 46.626  1.00 46.48  ? 524  ILE C CD1 1 
ATOM   8400  N N   . GLU B 1 486 ? -46.562  -32.628 52.005  1.00 42.27  ? 525  GLU C N   1 
ATOM   8401  C CA  . GLU B 1 486 ? -46.249  -32.695 53.428  1.00 44.21  ? 525  GLU C CA  1 
ATOM   8402  C C   . GLU B 1 486 ? -46.423  -34.109 53.955  1.00 50.11  ? 525  GLU C C   1 
ATOM   8403  O O   . GLU B 1 486 ? -45.666  -34.560 54.814  1.00 49.16  ? 525  GLU C O   1 
ATOM   8404  C CB  . GLU B 1 486 ? -47.146  -31.742 54.222  1.00 44.83  ? 525  GLU C CB  1 
ATOM   8405  C CG  . GLU B 1 486 ? -46.881  -30.266 53.955  1.00 60.37  ? 525  GLU C CG  1 
ATOM   8406  C CD  . GLU B 1 486 ? -47.854  -29.353 54.679  1.00 65.52  ? 525  GLU C CD  1 
ATOM   8407  O OE1 . GLU B 1 486 ? -47.936  -28.160 54.316  1.00 78.96  ? 525  GLU C OE1 1 
ATOM   8408  O OE2 . GLU B 1 486 ? -48.539  -29.829 55.610  1.00 66.85  ? 525  GLU C OE2 1 
ATOM   8409  N N   . ASP B 1 487 ? -47.430  -34.804 53.438  1.00 43.69  ? 526  ASP C N   1 
ATOM   8410  C CA  . ASP B 1 487 ? -47.721  -36.169 53.856  1.00 41.43  ? 526  ASP C CA  1 
ATOM   8411  C C   . ASP B 1 487 ? -48.437  -36.866 52.704  1.00 41.56  ? 526  ASP C C   1 
ATOM   8412  O O   . ASP B 1 487 ? -48.940  -36.204 51.799  1.00 39.62  ? 526  ASP C O   1 
ATOM   8413  C CB  . ASP B 1 487 ? -48.601  -36.161 55.105  1.00 42.64  ? 526  ASP C CB  1 
ATOM   8414  C CG  . ASP B 1 487 ? -48.568  -37.479 55.863  1.00 46.04  ? 526  ASP C CG  1 
ATOM   8415  O OD1 . ASP B 1 487 ? -47.968  -38.467 55.375  1.00 44.00  ? 526  ASP C OD1 1 
ATOM   8416  O OD2 . ASP B 1 487 ? -49.167  -37.525 56.958  1.00 58.44  ? 526  ASP C OD2 1 
ATOM   8417  N N   . TYR B 1 488 ? -48.470  -38.194 52.719  1.00 38.88  ? 527  TYR C N   1 
ATOM   8418  C CA  . TYR B 1 488 ? -49.169  -38.929 51.670  1.00 35.00  ? 527  TYR C CA  1 
ATOM   8419  C C   . TYR B 1 488 ? -49.459  -40.361 52.081  1.00 37.95  ? 527  TYR C C   1 
ATOM   8420  O O   . TYR B 1 488 ? -48.764  -40.927 52.923  1.00 37.53  ? 527  TYR C O   1 
ATOM   8421  C CB  . TYR B 1 488 ? -48.361  -38.922 50.372  1.00 30.13  ? 527  TYR C CB  1 
ATOM   8422  C CG  . TYR B 1 488 ? -47.019  -39.617 50.471  1.00 34.43  ? 527  TYR C CG  1 
ATOM   8423  C CD1 . TYR B 1 488 ? -46.911  -40.988 50.274  1.00 38.36  ? 527  TYR C CD1 1 
ATOM   8424  C CD2 . TYR B 1 488 ? -45.860  -38.901 50.750  1.00 35.45  ? 527  TYR C CD2 1 
ATOM   8425  C CE1 . TYR B 1 488 ? -45.694  -41.634 50.357  1.00 39.89  ? 527  TYR C CE1 1 
ATOM   8426  C CE2 . TYR B 1 488 ? -44.625  -39.536 50.829  1.00 40.13  ? 527  TYR C CE2 1 
ATOM   8427  C CZ  . TYR B 1 488 ? -44.552  -40.903 50.635  1.00 46.92  ? 527  TYR C CZ  1 
ATOM   8428  O OH  . TYR B 1 488 ? -43.339  -41.544 50.716  1.00 42.85  ? 527  TYR C OH  1 
ATOM   8429  N N   . ARG B 1 489 ? -50.493  -40.937 51.472  1.00 36.26  ? 528  ARG C N   1 
ATOM   8430  C CA  . ARG B 1 489 ? -50.841  -42.337 51.661  1.00 31.10  ? 528  ARG C CA  1 
ATOM   8431  C C   . ARG B 1 489 ? -50.946  -43.022 50.302  1.00 37.12  ? 528  ARG C C   1 
ATOM   8432  O O   . ARG B 1 489 ? -51.672  -42.544 49.419  1.00 37.24  ? 528  ARG C O   1 
ATOM   8433  C CB  . ARG B 1 489 ? -52.191  -42.444 52.367  1.00 35.40  ? 528  ARG C CB  1 
ATOM   8434  C CG  . ARG B 1 489 ? -52.343  -41.532 53.555  1.00 33.61  ? 528  ARG C CG  1 
ATOM   8435  C CD  . ARG B 1 489 ? -51.893  -42.212 54.851  1.00 38.99  ? 528  ARG C CD  1 
ATOM   8436  N NE  . ARG B 1 489 ? -51.941  -41.248 55.942  1.00 42.67  ? 528  ARG C NE  1 
ATOM   8437  C CZ  . ARG B 1 489 ? -50.931  -40.444 56.252  1.00 42.95  ? 528  ARG C CZ  1 
ATOM   8438  N NH1 . ARG B 1 489 ? -49.793  -40.525 55.570  1.00 28.43  ? 528  ARG C NH1 1 
ATOM   8439  N NH2 . ARG B 1 489 ? -51.056  -39.569 57.241  1.00 40.70  ? 528  ARG C NH2 1 
ATOM   8440  N N   . LEU B 1 490 ? -50.227  -44.131 50.139  1.00 32.21  ? 529  LEU C N   1 
ATOM   8441  C CA  . LEU B 1 490 ? -50.343  -44.974 48.949  1.00 37.46  ? 529  LEU C CA  1 
ATOM   8442  C C   . LEU B 1 490 ? -51.398  -46.065 49.169  1.00 39.26  ? 529  LEU C C   1 
ATOM   8443  O O   . LEU B 1 490 ? -51.442  -46.701 50.220  1.00 35.51  ? 529  LEU C O   1 
ATOM   8444  C CB  . LEU B 1 490 ? -48.989  -45.593 48.568  1.00 30.90  ? 529  LEU C CB  1 
ATOM   8445  C CG  . LEU B 1 490 ? -48.028  -44.660 47.828  1.00 37.14  ? 529  LEU C CG  1 
ATOM   8446  C CD1 . LEU B 1 490 ? -46.600  -45.208 47.833  1.00 33.31  ? 529  LEU C CD1 1 
ATOM   8447  C CD2 . LEU B 1 490 ? -48.516  -44.419 46.399  1.00 31.23  ? 529  LEU C CD2 1 
ATOM   8448  N N   . LEU B 1 491 ? -52.239  -46.276 48.159  1.00 37.14  ? 530  LEU C N   1 
ATOM   8449  C CA  . LEU B 1 491 ? -53.435  -47.094 48.292  1.00 32.35  ? 530  LEU C CA  1 
ATOM   8450  C C   . LEU B 1 491 ? -53.409  -48.252 47.306  1.00 31.15  ? 530  LEU C C   1 
ATOM   8451  O O   . LEU B 1 491 ? -53.296  -48.037 46.095  1.00 34.45  ? 530  LEU C O   1 
ATOM   8452  C CB  . LEU B 1 491 ? -54.663  -46.230 47.999  1.00 36.31  ? 530  LEU C CB  1 
ATOM   8453  C CG  . LEU B 1 491 ? -55.371  -45.539 49.165  1.00 45.98  ? 530  LEU C CG  1 
ATOM   8454  C CD1 . LEU B 1 491 ? -54.396  -44.744 50.017  1.00 40.08  ? 530  LEU C CD1 1 
ATOM   8455  C CD2 . LEU B 1 491 ? -56.496  -44.644 48.640  1.00 44.62  ? 530  LEU C CD2 1 
ATOM   8456  N N   . THR B 1 492 ? -53.516  -49.483 47.790  1.00 31.63  ? 531  THR C N   1 
ATOM   8457  C CA  . THR B 1 492 ? -53.547  -50.587 46.839  1.00 28.60  ? 531  THR C CA  1 
ATOM   8458  C C   . THR B 1 492 ? -54.962  -50.942 46.410  1.00 31.05  ? 531  THR C C   1 
ATOM   8459  O O   . THR B 1 492 ? -55.873  -51.022 47.237  1.00 30.36  ? 531  THR C O   1 
ATOM   8460  C CB  . THR B 1 492 ? -52.792  -51.845 47.309  1.00 35.64  ? 531  THR C CB  1 
ATOM   8461  O OG1 . THR B 1 492 ? -53.697  -52.763 47.928  1.00 49.86  ? 531  THR C OG1 1 
ATOM   8462  C CG2 . THR B 1 492 ? -51.692  -51.489 48.255  1.00 28.65  ? 531  THR C CG2 1 
ATOM   8463  N N   . ASP B 1 493 ? -55.125  -51.141 45.103  1.00 29.89  ? 532  ASP C N   1 
ATOM   8464  C CA  . ASP B 1 493 ? -56.371  -51.630 44.528  1.00 36.36  ? 532  ASP C CA  1 
ATOM   8465  C C   . ASP B 1 493 ? -57.511  -50.645 44.782  1.00 34.63  ? 532  ASP C C   1 
ATOM   8466  O O   . ASP B 1 493 ? -58.425  -50.917 45.559  1.00 34.39  ? 532  ASP C O   1 
ATOM   8467  C CB  . ASP B 1 493 ? -56.697  -53.014 45.094  1.00 33.71  ? 532  ASP C CB  1 
ATOM   8468  C CG  . ASP B 1 493 ? -57.895  -53.654 44.423  1.00 34.90  ? 532  ASP C CG  1 
ATOM   8469  O OD1 . ASP B 1 493 ? -58.126  -53.406 43.221  1.00 35.87  ? 532  ASP C OD1 1 
ATOM   8470  O OD2 . ASP B 1 493 ? -58.607  -54.415 45.101  1.00 36.87  ? 532  ASP C OD2 1 
ATOM   8471  N N   . ILE B 1 494 ? -57.455  -49.495 44.119  1.00 32.60  ? 533  ILE C N   1 
ATOM   8472  C CA  . ILE B 1 494 ? -58.379  -48.411 44.439  1.00 29.38  ? 533  ILE C CA  1 
ATOM   8473  C C   . ILE B 1 494 ? -59.773  -48.558 43.849  1.00 33.83  ? 533  ILE C C   1 
ATOM   8474  O O   . ILE B 1 494 ? -59.946  -49.013 42.720  1.00 32.17  ? 533  ILE C O   1 
ATOM   8475  C CB  . ILE B 1 494 ? -57.817  -47.025 44.052  1.00 36.84  ? 533  ILE C CB  1 
ATOM   8476  C CG1 . ILE B 1 494 ? -57.335  -47.010 42.595  1.00 32.00  ? 533  ILE C CG1 1 
ATOM   8477  C CG2 . ILE B 1 494 ? -56.691  -46.621 45.012  1.00 39.00  ? 533  ILE C CG2 1 
ATOM   8478  C CD1 . ILE B 1 494 ? -56.733  -45.664 42.167  1.00 29.68  ? 533  ILE C CD1 1 
ATOM   8479  N N   . LEU B 1 495 ? -60.756  -48.170 44.654  1.00 29.94  ? 534  LEU C N   1 
ATOM   8480  C CA  . LEU B 1 495 ? -62.133  -47.966 44.221  1.00 36.50  ? 534  LEU C CA  1 
ATOM   8481  C C   . LEU B 1 495 ? -62.196  -46.847 43.203  1.00 39.03  ? 534  LEU C C   1 
ATOM   8482  O O   . LEU B 1 495 ? -61.255  -46.060 43.075  1.00 32.32  ? 534  LEU C O   1 
ATOM   8483  C CB  . LEU B 1 495 ? -62.994  -47.518 45.407  1.00 30.75  ? 534  LEU C CB  1 
ATOM   8484  C CG  . LEU B 1 495 ? -63.650  -48.505 46.373  1.00 44.65  ? 534  LEU C CG  1 
ATOM   8485  C CD1 . LEU B 1 495 ? -63.059  -49.896 46.281  1.00 32.94  ? 534  LEU C CD1 1 
ATOM   8486  C CD2 . LEU B 1 495 ? -63.621  -47.958 47.806  1.00 28.15  ? 534  LEU C CD2 1 
ATOM   8487  N N   . GLY B 1 496 ? -63.326  -46.760 42.504  1.00 32.82  ? 535  GLY C N   1 
ATOM   8488  C CA  . GLY B 1 496 ? -63.597  -45.627 41.646  1.00 37.28  ? 535  GLY C CA  1 
ATOM   8489  C C   . GLY B 1 496 ? -63.401  -44.336 42.416  1.00 37.49  ? 535  GLY C C   1 
ATOM   8490  O O   . GLY B 1 496 ? -62.667  -43.443 41.977  1.00 33.96  ? 535  GLY C O   1 
ATOM   8491  N N   . ILE B 1 497 ? -64.029  -44.254 43.586  1.00 30.95  ? 536  ILE C N   1 
ATOM   8492  C CA  . ILE B 1 497 ? -64.039  -43.017 44.364  1.00 33.56  ? 536  ILE C CA  1 
ATOM   8493  C C   . ILE B 1 497 ? -62.635  -42.595 44.818  1.00 33.73  ? 536  ILE C C   1 
ATOM   8494  O O   . ILE B 1 497 ? -62.339  -41.404 44.929  1.00 33.32  ? 536  ILE C O   1 
ATOM   8495  C CB  . ILE B 1 497 ? -65.025  -43.105 45.564  1.00 36.32  ? 536  ILE C CB  1 
ATOM   8496  C CG1 . ILE B 1 497 ? -65.292  -41.714 46.154  1.00 35.67  ? 536  ILE C CG1 1 
ATOM   8497  C CG2 . ILE B 1 497 ? -64.513  -44.068 46.620  1.00 33.27  ? 536  ILE C CG2 1 
ATOM   8498  C CD1 . ILE B 1 497 ? -66.426  -41.684 47.186  1.00 31.31  ? 536  ILE C CD1 1 
ATOM   8499  N N   . GLU B 1 498 ? -61.759  -43.567 45.042  1.00 27.84  ? 537  GLU C N   1 
ATOM   8500  C CA  . GLU B 1 498 ? -60.399  -43.246 45.459  1.00 33.51  ? 537  GLU C CA  1 
ATOM   8501  C C   . GLU B 1 498 ? -59.591  -42.743 44.271  1.00 33.61  ? 537  GLU C C   1 
ATOM   8502  O O   . GLU B 1 498 ? -58.596  -42.048 44.436  1.00 32.94  ? 537  GLU C O   1 
ATOM   8503  C CB  . GLU B 1 498 ? -59.734  -44.447 46.123  1.00 34.38  ? 537  GLU C CB  1 
ATOM   8504  C CG  . GLU B 1 498 ? -60.423  -44.848 47.421  1.00 33.06  ? 537  GLU C CG  1 
ATOM   8505  C CD  . GLU B 1 498 ? -59.861  -46.120 48.013  1.00 31.37  ? 537  GLU C CD  1 
ATOM   8506  O OE1 . GLU B 1 498 ? -59.548  -47.051 47.245  1.00 31.96  ? 537  GLU C OE1 1 
ATOM   8507  O OE2 . GLU B 1 498 ? -59.733  -46.185 49.249  1.00 32.72  ? 537  GLU C OE2 1 
ATOM   8508  N N   . ASP B 1 499 ? -60.049  -43.077 43.071  1.00 31.86  ? 538  ASP C N   1 
ATOM   8509  C CA  . ASP B 1 499 ? -59.425  -42.569 41.861  1.00 29.24  ? 538  ASP C CA  1 
ATOM   8510  C C   . ASP B 1 499 ? -59.855  -41.110 41.639  1.00 35.29  ? 538  ASP C C   1 
ATOM   8511  O O   . ASP B 1 499 ? -59.009  -40.218 41.568  1.00 31.17  ? 538  ASP C O   1 
ATOM   8512  C CB  . ASP B 1 499 ? -59.801  -43.444 40.667  1.00 29.15  ? 538  ASP C CB  1 
ATOM   8513  C CG  . ASP B 1 499 ? -58.981  -43.141 39.428  1.00 34.52  ? 538  ASP C CG  1 
ATOM   8514  O OD1 . ASP B 1 499 ? -58.182  -42.187 39.446  1.00 36.65  ? 538  ASP C OD1 1 
ATOM   8515  O OD2 . ASP B 1 499 ? -59.142  -43.865 38.425  1.00 41.85  ? 538  ASP C OD2 1 
ATOM   8516  N N   . TYR B 1 500 ? -61.158  -40.844 41.566  1.00 31.59  ? 539  TYR C N   1 
ATOM   8517  C CA  . TYR B 1 500 ? -61.563  -39.477 41.235  1.00 32.71  ? 539  TYR C CA  1 
ATOM   8518  C C   . TYR B 1 500 ? -61.365  -38.460 42.363  1.00 33.31  ? 539  TYR C C   1 
ATOM   8519  O O   . TYR B 1 500 ? -61.175  -37.285 42.089  1.00 30.93  ? 539  TYR C O   1 
ATOM   8520  C CB  . TYR B 1 500 ? -62.940  -39.375 40.553  1.00 42.09  ? 539  TYR C CB  1 
ATOM   8521  C CG  . TYR B 1 500 ? -64.125  -39.798 41.369  1.00 34.03  ? 539  TYR C CG  1 
ATOM   8522  C CD1 . TYR B 1 500 ? -64.673  -38.952 42.322  1.00 36.33  ? 539  TYR C CD1 1 
ATOM   8523  C CD2 . TYR B 1 500 ? -64.725  -41.039 41.160  1.00 47.54  ? 539  TYR C CD2 1 
ATOM   8524  C CE1 . TYR B 1 500 ? -65.777  -39.343 43.072  1.00 45.44  ? 539  TYR C CE1 1 
ATOM   8525  C CE2 . TYR B 1 500 ? -65.828  -41.441 41.898  1.00 40.12  ? 539  TYR C CE2 1 
ATOM   8526  C CZ  . TYR B 1 500 ? -66.347  -40.589 42.854  1.00 45.52  ? 539  TYR C CZ  1 
ATOM   8527  O OH  . TYR B 1 500 ? -67.439  -40.983 43.591  1.00 47.61  ? 539  TYR C OH  1 
ATOM   8528  N N   . ASN B 1 501 ? -61.371  -38.910 43.617  1.00 34.55  ? 540  ASN C N   1 
ATOM   8529  C CA  . ASN B 1 501 ? -60.974  -38.034 44.722  1.00 35.69  ? 540  ASN C CA  1 
ATOM   8530  C C   . ASN B 1 501 ? -59.489  -38.110 45.066  1.00 34.46  ? 540  ASN C C   1 
ATOM   8531  O O   . ASN B 1 501 ? -59.044  -37.429 45.983  1.00 32.30  ? 540  ASN C O   1 
ATOM   8532  C CB  . ASN B 1 501 ? -61.783  -38.313 45.988  1.00 33.83  ? 540  ASN C CB  1 
ATOM   8533  C CG  . ASN B 1 501 ? -63.191  -37.776 45.904  1.00 38.92  ? 540  ASN C CG  1 
ATOM   8534  O OD1 . ASN B 1 501 ? -63.464  -36.807 45.189  1.00 34.96  ? 540  ASN C OD1 1 
ATOM   8535  N ND2 . ASN B 1 501 ? -64.098  -38.402 46.635  1.00 32.82  ? 540  ASN C ND2 1 
ATOM   8536  N N   . GLY B 1 502 ? -58.735  -38.932 44.338  1.00 33.75  ? 541  GLY C N   1 
ATOM   8537  C CA  . GLY B 1 502 ? -57.323  -39.143 44.626  1.00 27.91  ? 541  GLY C CA  1 
ATOM   8538  C C   . GLY B 1 502 ? -56.383  -38.470 43.639  1.00 37.96  ? 541  GLY C C   1 
ATOM   8539  O O   . GLY B 1 502 ? -56.816  -37.663 42.811  1.00 36.04  ? 541  GLY C O   1 
ATOM   8540  N N   . ASP B 1 503 ? -55.097  -38.823 43.706  1.00 28.09  ? 542  ASP C N   1 
ATOM   8541  C CA  . ASP B 1 503 ? -54.065  -38.091 42.978  1.00 32.62  ? 542  ASP C CA  1 
ATOM   8542  C C   . ASP B 1 503 ? -53.470  -38.832 41.782  1.00 32.57  ? 542  ASP C C   1 
ATOM   8543  O O   . ASP B 1 503 ? -52.725  -38.239 41.006  1.00 33.44  ? 542  ASP C O   1 
ATOM   8544  C CB  . ASP B 1 503 ? -52.934  -37.685 43.927  1.00 27.86  ? 542  ASP C CB  1 
ATOM   8545  C CG  . ASP B 1 503 ? -53.390  -36.720 44.992  1.00 35.96  ? 542  ASP C CG  1 
ATOM   8546  O OD1 . ASP B 1 503 ? -54.270  -35.887 44.700  1.00 35.68  ? 542  ASP C OD1 1 
ATOM   8547  O OD2 . ASP B 1 503 ? -52.871  -36.793 46.121  1.00 36.36  ? 542  ASP C OD2 1 
ATOM   8548  N N   . MET B 1 504 ? -53.765  -40.123 41.647  1.00 27.67  ? 543  MET C N   1 
ATOM   8549  C CA  . MET B 1 504 ? -53.243  -40.881 40.515  1.00 29.40  ? 543  MET C CA  1 
ATOM   8550  C C   . MET B 1 504 ? -53.947  -42.222 40.325  1.00 29.73  ? 543  MET C C   1 
ATOM   8551  O O   . MET B 1 504 ? -54.552  -42.757 41.250  1.00 28.99  ? 543  MET C O   1 
ATOM   8552  C CB  . MET B 1 504 ? -51.740  -41.122 40.686  1.00 28.96  ? 543  MET C CB  1 
ATOM   8553  C CG  . MET B 1 504 ? -51.397  -42.235 41.692  1.00 29.79  ? 543  MET C CG  1 
ATOM   8554  S SD  . MET B 1 504 ? -49.613  -42.413 41.874  1.00 30.81  ? 543  MET C SD  1 
ATOM   8555  C CE  . MET B 1 504 ? -49.540  -43.880 42.925  1.00 27.57  ? 543  MET C CE  1 
ATOM   8556  N N   . ASP B 1 505 ? -53.850  -42.754 39.112  1.00 27.61  ? 544  ASP C N   1 
ATOM   8557  C CA  . ASP B 1 505 ? -54.301  -44.105 38.806  1.00 32.49  ? 544  ASP C CA  1 
ATOM   8558  C C   . ASP B 1 505 ? -53.078  -44.799 38.231  1.00 30.74  ? 544  ASP C C   1 
ATOM   8559  O O   . ASP B 1 505 ? -52.765  -44.667 37.048  1.00 35.53  ? 544  ASP C O   1 
ATOM   8560  C CB  . ASP B 1 505 ? -55.468  -44.079 37.805  1.00 33.89  ? 544  ASP C CB  1 
ATOM   8561  C CG  . ASP B 1 505 ? -56.160  -45.429 37.670  1.00 37.79  ? 544  ASP C CG  1 
ATOM   8562  O OD1 . ASP B 1 505 ? -55.901  -46.313 38.514  1.00 38.02  ? 544  ASP C OD1 1 
ATOM   8563  O OD2 . ASP B 1 505 ? -56.974  -45.604 36.729  1.00 31.82  ? 544  ASP C OD2 1 
ATOM   8564  N N   . PHE B 1 506 ? -52.356  -45.497 39.094  1.00 28.26  ? 545  PHE C N   1 
ATOM   8565  C CA  . PHE B 1 506 ? -51.026  -45.990 38.760  1.00 26.54  ? 545  PHE C CA  1 
ATOM   8566  C C   . PHE B 1 506 ? -51.216  -47.475 38.463  1.00 34.57  ? 545  PHE C C   1 
ATOM   8567  O O   . PHE B 1 506 ? -51.300  -48.295 39.375  1.00 27.88  ? 545  PHE C O   1 
ATOM   8568  C CB  . PHE B 1 506 ? -50.107  -45.751 39.962  1.00 31.58  ? 545  PHE C CB  1 
ATOM   8569  C CG  . PHE B 1 506 ? -48.644  -46.034 39.713  1.00 30.74  ? 545  PHE C CG  1 
ATOM   8570  C CD1 . PHE B 1 506 ? -48.135  -47.317 39.850  1.00 28.21  ? 545  PHE C CD1 1 
ATOM   8571  C CD2 . PHE B 1 506 ? -47.769  -45.007 39.402  1.00 33.42  ? 545  PHE C CD2 1 
ATOM   8572  C CE1 . PHE B 1 506 ? -46.781  -47.572 39.645  1.00 31.48  ? 545  PHE C CE1 1 
ATOM   8573  C CE2 . PHE B 1 506 ? -46.413  -45.251 39.200  1.00 33.99  ? 545  PHE C CE2 1 
ATOM   8574  C CZ  . PHE B 1 506 ? -45.919  -46.535 39.323  1.00 28.72  ? 545  PHE C CZ  1 
ATOM   8575  N N   . LYS B 1 507 ? -51.338  -47.803 37.178  1.00 29.22  ? 546  LYS C N   1 
ATOM   8576  C CA  . LYS B 1 507 ? -51.708  -49.148 36.751  1.00 31.06  ? 546  LYS C CA  1 
ATOM   8577  C C   . LYS B 1 507 ? -50.476  -49.900 36.294  1.00 28.25  ? 546  LYS C C   1 
ATOM   8578  O O   . LYS B 1 507 ? -49.821  -49.522 35.327  1.00 31.28  ? 546  LYS C O   1 
ATOM   8579  C CB  . LYS B 1 507 ? -52.776  -49.100 35.650  1.00 28.33  ? 546  LYS C CB  1 
ATOM   8580  C CG  . LYS B 1 507 ? -54.056  -48.377 36.098  1.00 35.20  ? 546  LYS C CG  1 
ATOM   8581  C CD  . LYS B 1 507 ? -55.026  -48.117 34.955  1.00 31.66  ? 546  LYS C CD  1 
ATOM   8582  C CE  . LYS B 1 507 ? -54.594  -46.919 34.140  1.00 34.46  ? 546  LYS C CE  1 
ATOM   8583  N NZ  . LYS B 1 507 ? -55.569  -46.592 33.052  1.00 38.11  ? 546  LYS C NZ  1 
ATOM   8584  N N   . ILE B 1 508 ? -50.151  -50.958 37.019  1.00 30.55  ? 547  ILE C N   1 
ATOM   8585  C CA  . ILE B 1 508 ? -48.948  -51.699 36.727  1.00 24.12  ? 547  ILE C CA  1 
ATOM   8586  C C   . ILE B 1 508 ? -49.211  -53.179 36.777  1.00 26.04  ? 547  ILE C C   1 
ATOM   8587  O O   . ILE B 1 508 ? -49.904  -53.668 37.659  1.00 27.95  ? 547  ILE C O   1 
ATOM   8588  C CB  . ILE B 1 508 ? -47.794  -51.316 37.667  1.00 34.29  ? 547  ILE C CB  1 
ATOM   8589  C CG1 . ILE B 1 508 ? -46.475  -51.916 37.156  1.00 31.28  ? 547  ILE C CG1 1 
ATOM   8590  C CG2 . ILE B 1 508 ? -48.084  -51.755 39.087  1.00 30.61  ? 547  ILE C CG2 1 
ATOM   8591  C CD1 . ILE B 1 508 ? -45.236  -51.292 37.789  1.00 40.73  ? 547  ILE C CD1 1 
ATOM   8592  N N   . ALA B 1 509 ? -48.663  -53.875 35.789  1.00 32.62  ? 548  ALA C N   1 
ATOM   8593  C CA  . ALA B 1 509 ? -48.825  -55.307 35.652  1.00 33.05  ? 548  ALA C CA  1 
ATOM   8594  C C   . ALA B 1 509 ? -47.481  -56.000 35.400  1.00 31.29  ? 548  ALA C C   1 
ATOM   8595  O O   . ALA B 1 509 ? -46.499  -55.374 34.991  1.00 29.40  ? 548  ALA C O   1 
ATOM   8596  C CB  . ALA B 1 509 ? -49.782  -55.607 34.518  1.00 28.78  ? 548  ALA C CB  1 
ATOM   8597  N N   . GLY B 1 510 ? -47.462  -57.310 35.623  1.00 33.44  ? 549  GLY C N   1 
ATOM   8598  C CA  . GLY B 1 510 ? -46.290  -58.119 35.353  1.00 29.90  ? 549  GLY C CA  1 
ATOM   8599  C C   . GLY B 1 510 ? -46.501  -59.561 35.791  1.00 38.53  ? 549  GLY C C   1 
ATOM   8600  O O   . GLY B 1 510 ? -47.633  -60.010 36.009  1.00 33.78  ? 549  GLY C O   1 
ATOM   8601  N N   . THR B 1 511 ? -45.394  -60.283 35.919  1.00 37.52  ? 550  THR C N   1 
ATOM   8602  C CA  . THR B 1 511 ? -45.404  -61.665 36.366  1.00 40.10  ? 550  THR C CA  1 
ATOM   8603  C C   . THR B 1 511 ? -44.910  -61.717 37.802  1.00 41.82  ? 550  THR C C   1 
ATOM   8604  O O   . THR B 1 511 ? -44.658  -60.680 38.414  1.00 34.02  ? 550  THR C O   1 
ATOM   8605  C CB  . THR B 1 511 ? -44.464  -62.513 35.512  1.00 39.09  ? 550  THR C CB  1 
ATOM   8606  O OG1 . THR B 1 511 ? -43.121  -62.051 35.690  1.00 36.18  ? 550  THR C OG1 1 
ATOM   8607  C CG2 . THR B 1 511 ? -44.835  -62.398 34.040  1.00 39.85  ? 550  THR C CG2 1 
ATOM   8608  N N   . ASN B 1 512 ? -44.756  -62.924 38.337  1.00 40.21  ? 551  ASN C N   1 
ATOM   8609  C CA  . ASN B 1 512 ? -44.261  -63.080 39.701  1.00 42.74  ? 551  ASN C CA  1 
ATOM   8610  C C   . ASN B 1 512 ? -42.906  -62.393 39.927  1.00 41.83  ? 551  ASN C C   1 
ATOM   8611  O O   . ASN B 1 512 ? -42.641  -61.853 41.004  1.00 45.94  ? 551  ASN C O   1 
ATOM   8612  C CB  . ASN B 1 512 ? -44.164  -64.562 40.077  1.00 50.68  ? 551  ASN C CB  1 
ATOM   8613  C CG  . ASN B 1 512 ? -43.907  -64.764 41.557  1.00 62.49  ? 551  ASN C CG  1 
ATOM   8614  O OD1 . ASN B 1 512 ? -44.635  -64.236 42.402  1.00 63.63  ? 551  ASN C OD1 1 
ATOM   8615  N ND2 . ASN B 1 512 ? -42.851  -65.507 41.881  1.00 62.84  ? 551  ASN C ND2 1 
ATOM   8616  N N   . LYS B 1 513 ? -42.063  -62.389 38.901  1.00 31.86  ? 552  LYS C N   1 
ATOM   8617  C CA  . LYS B 1 513 ? -40.708  -61.860 39.041  1.00 47.64  ? 552  LYS C CA  1 
ATOM   8618  C C   . LYS B 1 513 ? -40.398  -60.630 38.188  1.00 42.33  ? 552  LYS C C   1 
ATOM   8619  O O   . LYS B 1 513 ? -39.274  -60.123 38.227  1.00 43.16  ? 552  LYS C O   1 
ATOM   8620  C CB  . LYS B 1 513 ? -39.692  -62.949 38.687  1.00 56.66  ? 552  LYS C CB  1 
ATOM   8621  C CG  . LYS B 1 513 ? -39.763  -63.374 37.225  1.00 57.55  ? 552  LYS C CG  1 
ATOM   8622  C CD  . LYS B 1 513 ? -38.380  -63.538 36.609  1.00 58.67  ? 552  LYS C CD  1 
ATOM   8623  C CE  . LYS B 1 513 ? -38.473  -63.733 35.099  1.00 63.37  ? 552  LYS C CE  1 
ATOM   8624  N NZ  . LYS B 1 513 ? -39.092  -65.046 34.712  1.00 68.71  ? 552  LYS C NZ  1 
ATOM   8625  N N   . GLY B 1 514 ? -41.368  -60.159 37.406  1.00 36.77  ? 553  GLY C N   1 
ATOM   8626  C CA  . GLY B 1 514 ? -41.089  -59.107 36.439  1.00 34.51  ? 553  GLY C CA  1 
ATOM   8627  C C   . GLY B 1 514 ? -42.220  -58.125 36.151  1.00 34.79  ? 553  GLY C C   1 
ATOM   8628  O O   . GLY B 1 514 ? -43.390  -58.373 36.465  1.00 34.72  ? 553  GLY C O   1 
ATOM   8629  N N   . ILE B 1 515 ? -41.855  -56.997 35.548  1.00 32.24  ? 554  ILE C N   1 
ATOM   8630  C CA  . ILE B 1 515 ? -42.821  -55.972 35.157  1.00 34.83  ? 554  ILE C CA  1 
ATOM   8631  C C   . ILE B 1 515 ? -43.047  -56.041 33.645  1.00 29.73  ? 554  ILE C C   1 
ATOM   8632  O O   . ILE B 1 515 ? -42.087  -56.149 32.875  1.00 30.47  ? 554  ILE C O   1 
ATOM   8633  C CB  . ILE B 1 515 ? -42.321  -54.558 35.574  1.00 34.09  ? 554  ILE C CB  1 
ATOM   8634  C CG1 . ILE B 1 515 ? -42.110  -54.493 37.089  1.00 35.15  ? 554  ILE C CG1 1 
ATOM   8635  C CG2 . ILE B 1 515 ? -43.297  -53.461 35.137  1.00 26.22  ? 554  ILE C CG2 1 
ATOM   8636  C CD1 . ILE B 1 515 ? -41.578  -53.124 37.579  1.00 33.38  ? 554  ILE C CD1 1 
ATOM   8637  N N   . THR B 1 516 ? -44.308  -55.990 33.217  1.00 31.22  ? 555  THR C N   1 
ATOM   8638  C CA  . THR B 1 516 ? -44.617  -56.021 31.783  1.00 30.49  ? 555  THR C CA  1 
ATOM   8639  C C   . THR B 1 516 ? -45.246  -54.737 31.224  1.00 32.68  ? 555  THR C C   1 
ATOM   8640  O O   . THR B 1 516 ? -45.074  -54.418 30.045  1.00 32.73  ? 555  THR C O   1 
ATOM   8641  C CB  . THR B 1 516 ? -45.509  -57.225 31.421  1.00 29.97  ? 555  THR C CB  1 
ATOM   8642  O OG1 . THR B 1 516 ? -46.645  -57.248 32.283  1.00 32.67  ? 555  THR C OG1 1 
ATOM   8643  C CG2 . THR B 1 516 ? -44.727  -58.543 31.595  1.00 31.65  ? 555  THR C CG2 1 
ATOM   8644  N N   . ALA B 1 517 ? -45.991  -54.022 32.061  1.00 34.37  ? 556  ALA C N   1 
ATOM   8645  C CA  . ALA B 1 517 ? -46.653  -52.796 31.636  1.00 29.56  ? 556  ALA C CA  1 
ATOM   8646  C C   . ALA B 1 517 ? -46.863  -51.833 32.800  1.00 35.23  ? 556  ALA C C   1 
ATOM   8647  O O   . ALA B 1 517 ? -47.115  -52.245 33.946  1.00 33.55  ? 556  ALA C O   1 
ATOM   8648  C CB  . ALA B 1 517 ? -47.993  -53.104 30.951  1.00 33.19  ? 556  ALA C CB  1 
ATOM   8649  N N   . LEU B 1 518 ? -46.742  -50.547 32.491  1.00 28.08  ? 557  LEU C N   1 
ATOM   8650  C CA  . LEU B 1 518 ? -47.027  -49.490 33.443  1.00 29.31  ? 557  LEU C CA  1 
ATOM   8651  C C   . LEU B 1 518 ? -47.753  -48.345 32.738  1.00 34.19  ? 557  LEU C C   1 
ATOM   8652  O O   . LEU B 1 518 ? -47.322  -47.884 31.671  1.00 29.12  ? 557  LEU C O   1 
ATOM   8653  C CB  . LEU B 1 518 ? -45.730  -48.966 34.068  1.00 30.46  ? 557  LEU C CB  1 
ATOM   8654  C CG  . LEU B 1 518 ? -45.863  -47.693 34.900  1.00 35.94  ? 557  LEU C CG  1 
ATOM   8655  C CD1 . LEU B 1 518 ? -46.867  -47.906 36.020  1.00 36.39  ? 557  LEU C CD1 1 
ATOM   8656  C CD2 . LEU B 1 518 ? -44.495  -47.270 35.452  1.00 39.01  ? 557  LEU C CD2 1 
ATOM   8657  N N   . GLN B 1 519 ? -48.857  -47.900 33.326  1.00 34.42  ? 558  GLN C N   1 
ATOM   8658  C CA  . GLN B 1 519 ? -49.482  -46.648 32.906  1.00 35.55  ? 558  GLN C CA  1 
ATOM   8659  C C   . GLN B 1 519 ? -49.826  -45.833 34.142  1.00 35.51  ? 558  GLN C C   1 
ATOM   8660  O O   . GLN B 1 519 ? -50.742  -46.174 34.889  1.00 27.68  ? 558  GLN C O   1 
ATOM   8661  C CB  . GLN B 1 519 ? -50.727  -46.905 32.069  1.00 31.52  ? 558  GLN C CB  1 
ATOM   8662  C CG  . GLN B 1 519 ? -51.540  -45.662 31.749  1.00 38.13  ? 558  GLN C CG  1 
ATOM   8663  C CD  . GLN B 1 519 ? -52.566  -45.931 30.661  1.00 45.70  ? 558  GLN C CD  1 
ATOM   8664  O OE1 . GLN B 1 519 ? -53.767  -45.705 30.846  1.00 41.57  ? 558  GLN C OE1 1 
ATOM   8665  N NE2 . GLN B 1 519 ? -52.095  -46.437 29.517  1.00 34.27  ? 558  GLN C NE2 1 
ATOM   8666  N N   . ALA B 1 520 ? -49.061  -44.767 34.360  1.00 28.82  ? 559  ALA C N   1 
ATOM   8667  C CA  . ALA B 1 520 ? -49.256  -43.921 35.525  1.00 30.53  ? 559  ALA C CA  1 
ATOM   8668  C C   . ALA B 1 520 ? -49.979  -42.655 35.104  1.00 36.03  ? 559  ALA C C   1 
ATOM   8669  O O   . ALA B 1 520 ? -49.415  -41.793 34.418  1.00 36.81  ? 559  ALA C O   1 
ATOM   8670  C CB  . ALA B 1 520 ? -47.917  -43.590 36.189  1.00 27.29  ? 559  ALA C CB  1 
ATOM   8671  N N   . ASP B 1 521 ? -51.245  -42.572 35.486  1.00 31.81  ? 560  ASP C N   1 
ATOM   8672  C CA  . ASP B 1 521 ? -52.048  -41.388 35.230  1.00 33.91  ? 560  ASP C CA  1 
ATOM   8673  C C   . ASP B 1 521 ? -51.997  -40.526 36.477  1.00 29.04  ? 560  ASP C C   1 
ATOM   8674  O O   . ASP B 1 521 ? -52.651  -40.818 37.471  1.00 30.37  ? 560  ASP C O   1 
ATOM   8675  C CB  . ASP B 1 521 ? -53.502  -41.760 34.926  1.00 39.78  ? 560  ASP C CB  1 
ATOM   8676  C CG  . ASP B 1 521 ? -53.625  -42.815 33.834  1.00 56.43  ? 560  ASP C CG  1 
ATOM   8677  O OD1 . ASP B 1 521 ? -53.633  -42.450 32.641  1.00 65.53  ? 560  ASP C OD1 1 
ATOM   8678  O OD2 . ASP B 1 521 ? -53.730  -44.019 34.165  1.00 62.63  ? 560  ASP C OD2 1 
ATOM   8679  N N   . ILE B 1 522 ? -51.227  -39.457 36.422  1.00 29.36  ? 561  ILE C N   1 
ATOM   8680  C CA  . ILE B 1 522 ? -50.972  -38.677 37.618  1.00 32.09  ? 561  ILE C CA  1 
ATOM   8681  C C   . ILE B 1 522 ? -51.676  -37.344 37.498  1.00 35.23  ? 561  ILE C C   1 
ATOM   8682  O O   . ILE B 1 522 ? -51.475  -36.629 36.519  1.00 33.29  ? 561  ILE C O   1 
ATOM   8683  C CB  . ILE B 1 522 ? -49.461  -38.482 37.830  1.00 27.52  ? 561  ILE C CB  1 
ATOM   8684  C CG1 . ILE B 1 522 ? -48.815  -39.837 38.187  1.00 37.44  ? 561  ILE C CG1 1 
ATOM   8685  C CG2 . ILE B 1 522 ? -49.213  -37.454 38.923  1.00 28.86  ? 561  ILE C CG2 1 
ATOM   8686  C CD1 . ILE B 1 522 ? -47.293  -39.887 38.006  1.00 33.58  ? 561  ILE C CD1 1 
ATOM   8687  N N   . LYS B 1 523 ? -52.498  -37.020 38.495  1.00 33.33  ? 562  LYS C N   1 
ATOM   8688  C CA  . LYS B 1 523 ? -53.364  -35.839 38.444  1.00 36.84  ? 562  LYS C CA  1 
ATOM   8689  C C   . LYS B 1 523 ? -52.781  -34.613 39.154  1.00 33.05  ? 562  LYS C C   1 
ATOM   8690  O O   . LYS B 1 523 ? -53.115  -33.481 38.818  1.00 35.85  ? 562  LYS C O   1 
ATOM   8691  C CB  . LYS B 1 523 ? -54.768  -36.164 38.977  1.00 34.71  ? 562  LYS C CB  1 
ATOM   8692  C CG  . LYS B 1 523 ? -55.653  -36.882 37.966  1.00 38.36  ? 562  LYS C CG  1 
ATOM   8693  C CD  . LYS B 1 523 ? -55.826  -38.362 38.276  1.00 57.95  ? 562  LYS C CD  1 
ATOM   8694  C CE  . LYS B 1 523 ? -56.727  -38.587 39.495  1.00 59.33  ? 562  LYS C CE  1 
ATOM   8695  N NZ  . LYS B 1 523 ? -57.983  -37.759 39.458  1.00 58.33  ? 562  LYS C NZ  1 
ATOM   8696  N N   . LEU B 1 524 ? -51.912  -34.840 40.131  1.00 40.48  ? 563  LEU C N   1 
ATOM   8697  C CA  . LEU B 1 524 ? -51.099  -33.761 40.687  1.00 32.72  ? 563  LEU C CA  1 
ATOM   8698  C C   . LEU B 1 524 ? -50.143  -33.250 39.623  1.00 34.88  ? 563  LEU C C   1 
ATOM   8699  O O   . LEU B 1 524 ? -49.812  -33.974 38.689  1.00 35.92  ? 563  LEU C O   1 
ATOM   8700  C CB  . LEU B 1 524 ? -50.286  -34.254 41.890  1.00 35.28  ? 563  LEU C CB  1 
ATOM   8701  C CG  . LEU B 1 524 ? -51.086  -34.562 43.150  1.00 37.41  ? 563  LEU C CG  1 
ATOM   8702  C CD1 . LEU B 1 524 ? -50.202  -35.200 44.233  1.00 36.07  ? 563  LEU C CD1 1 
ATOM   8703  C CD2 . LEU B 1 524 ? -51.747  -33.281 43.642  1.00 32.35  ? 563  LEU C CD2 1 
ATOM   8704  N N   . PRO B 1 525 ? -49.684  -32.001 39.766  1.00 30.22  ? 564  PRO C N   1 
ATOM   8705  C CA  . PRO B 1 525 ? -48.655  -31.481 38.861  1.00 33.88  ? 564  PRO C CA  1 
ATOM   8706  C C   . PRO B 1 525 ? -47.293  -32.114 39.141  1.00 37.99  ? 564  PRO C C   1 
ATOM   8707  O O   . PRO B 1 525 ? -46.344  -31.419 39.501  1.00 36.44  ? 564  PRO C O   1 
ATOM   8708  C CB  . PRO B 1 525 ? -48.641  -29.975 39.166  1.00 35.83  ? 564  PRO C CB  1 
ATOM   8709  C CG  . PRO B 1 525 ? -49.175  -29.857 40.557  1.00 43.88  ? 564  PRO C CG  1 
ATOM   8710  C CD  . PRO B 1 525 ? -50.147  -30.997 40.741  1.00 36.45  ? 564  PRO C CD  1 
ATOM   8711  N N   . GLY B 1 526 ? -47.204  -33.430 38.973  1.00 30.71  ? 565  GLY C N   1 
ATOM   8712  C CA  . GLY B 1 526 ? -45.961  -34.144 39.180  1.00 31.15  ? 565  GLY C CA  1 
ATOM   8713  C C   . GLY B 1 526 ? -45.827  -34.620 40.613  1.00 38.73  ? 565  GLY C C   1 
ATOM   8714  O O   . GLY B 1 526 ? -46.258  -33.939 41.546  1.00 33.74  ? 565  GLY C O   1 
ATOM   8715  N N   . ILE B 1 527 ? -45.254  -35.808 40.787  1.00 32.07  ? 566  ILE C N   1 
ATOM   8716  C CA  . ILE B 1 527 ? -44.961  -36.322 42.115  1.00 30.73  ? 566  ILE C CA  1 
ATOM   8717  C C   . ILE B 1 527 ? -43.491  -36.736 42.204  1.00 33.13  ? 566  ILE C C   1 
ATOM   8718  O O   . ILE B 1 527 ? -42.836  -36.951 41.178  1.00 32.07  ? 566  ILE C O   1 
ATOM   8719  C CB  . ILE B 1 527 ? -45.857  -37.520 42.467  1.00 41.57  ? 566  ILE C CB  1 
ATOM   8720  C CG1 . ILE B 1 527 ? -45.650  -38.652 41.455  1.00 30.62  ? 566  ILE C CG1 1 
ATOM   8721  C CG2 . ILE B 1 527 ? -47.327  -37.087 42.554  1.00 35.29  ? 566  ILE C CG2 1 
ATOM   8722  C CD1 . ILE B 1 527 ? -46.509  -39.892 41.720  1.00 36.43  ? 566  ILE C CD1 1 
ATOM   8723  N N   . PRO B 1 528 ? -42.962  -36.842 43.432  1.00 28.67  ? 567  PRO C N   1 
ATOM   8724  C CA  . PRO B 1 528 ? -41.536  -37.165 43.572  1.00 35.49  ? 567  PRO C CA  1 
ATOM   8725  C C   . PRO B 1 528 ? -41.257  -38.629 43.230  1.00 33.04  ? 567  PRO C C   1 
ATOM   8726  O O   . PRO B 1 528 ? -42.107  -39.507 43.410  1.00 24.18  ? 567  PRO C O   1 
ATOM   8727  C CB  . PRO B 1 528 ? -41.249  -36.911 45.058  1.00 33.19  ? 567  PRO C CB  1 
ATOM   8728  C CG  . PRO B 1 528 ? -42.440  -36.130 45.572  1.00 37.97  ? 567  PRO C CG  1 
ATOM   8729  C CD  . PRO B 1 528 ? -43.602  -36.569 44.725  1.00 32.00  ? 567  PRO C CD  1 
ATOM   8730  N N   . ILE B 1 529 ? -40.056  -38.879 42.734  1.00 32.42  ? 568  ILE C N   1 
ATOM   8731  C CA  . ILE B 1 529 ? -39.674  -40.211 42.309  1.00 33.71  ? 568  ILE C CA  1 
ATOM   8732  C C   . ILE B 1 529 ? -39.788  -41.237 43.448  1.00 32.14  ? 568  ILE C C   1 
ATOM   8733  O O   . ILE B 1 529 ? -40.181  -42.377 43.225  1.00 38.60  ? 568  ILE C O   1 
ATOM   8734  C CB  . ILE B 1 529 ? -38.291  -40.178 41.615  1.00 36.88  ? 568  ILE C CB  1 
ATOM   8735  C CG1 . ILE B 1 529 ? -37.469  -41.417 41.954  1.00 49.16  ? 568  ILE C CG1 1 
ATOM   8736  C CG2 . ILE B 1 529 ? -37.552  -38.905 41.965  1.00 54.86  ? 568  ILE C CG2 1 
ATOM   8737  C CD1 . ILE B 1 529 ? -37.832  -42.609 41.113  1.00 42.52  ? 568  ILE C CD1 1 
ATOM   8738  N N   . LYS B 1 530 ? -39.481  -40.820 44.672  1.00 33.67  ? 569  LYS C N   1 
ATOM   8739  C CA  . LYS B 1 530 ? -39.635  -41.691 45.837  1.00 40.40  ? 569  LYS C CA  1 
ATOM   8740  C C   . LYS B 1 530 ? -41.040  -42.305 45.946  1.00 37.66  ? 569  LYS C C   1 
ATOM   8741  O O   . LYS B 1 530 ? -41.192  -43.476 46.280  1.00 38.51  ? 569  LYS C O   1 
ATOM   8742  C CB  . LYS B 1 530 ? -39.315  -40.914 47.118  1.00 41.51  ? 569  LYS C CB  1 
ATOM   8743  C CG  . LYS B 1 530 ? -39.640  -41.658 48.408  1.00 46.12  ? 569  LYS C CG  1 
ATOM   8744  C CD  . LYS B 1 530 ? -39.476  -40.733 49.606  1.00 54.31  ? 569  LYS C CD  1 
ATOM   8745  C CE  . LYS B 1 530 ? -39.802  -41.424 50.923  1.00 54.18  ? 569  LYS C CE  1 
ATOM   8746  N NZ  . LYS B 1 530 ? -38.752  -42.404 51.306  1.00 71.77  ? 569  LYS C NZ  1 
ATOM   8747  N N   . ILE B 1 531 ? -42.069  -41.512 45.681  1.00 35.98  ? 570  ILE C N   1 
ATOM   8748  C CA  . ILE B 1 531 ? -43.438  -42.010 45.782  1.00 28.69  ? 570  ILE C CA  1 
ATOM   8749  C C   . ILE B 1 531 ? -43.711  -43.023 44.682  1.00 30.39  ? 570  ILE C C   1 
ATOM   8750  O O   . ILE B 1 531 ? -44.379  -44.026 44.900  1.00 33.87  ? 570  ILE C O   1 
ATOM   8751  C CB  . ILE B 1 531 ? -44.466  -40.864 45.722  1.00 33.00  ? 570  ILE C CB  1 
ATOM   8752  C CG1 . ILE B 1 531 ? -44.285  -39.955 46.937  1.00 32.79  ? 570  ILE C CG1 1 
ATOM   8753  C CG2 . ILE B 1 531 ? -45.906  -41.409 45.660  1.00 27.63  ? 570  ILE C CG2 1 
ATOM   8754  C CD1 . ILE B 1 531 ? -45.330  -38.872 47.029  1.00 35.01  ? 570  ILE C CD1 1 
ATOM   8755  N N   . VAL B 1 532 ? -43.180  -42.761 43.498  1.00 32.69  ? 571  VAL C N   1 
ATOM   8756  C CA  . VAL B 1 532 ? -43.277  -43.719 42.410  1.00 30.41  ? 571  VAL C CA  1 
ATOM   8757  C C   . VAL B 1 532 ? -42.600  -45.038 42.806  1.00 37.00  ? 571  VAL C C   1 
ATOM   8758  O O   . VAL B 1 532 ? -43.189  -46.119 42.669  1.00 35.11  ? 571  VAL C O   1 
ATOM   8759  C CB  . VAL B 1 532 ? -42.692  -43.135 41.100  1.00 31.71  ? 571  VAL C CB  1 
ATOM   8760  C CG1 . VAL B 1 532 ? -42.530  -44.213 40.040  1.00 31.73  ? 571  VAL C CG1 1 
ATOM   8761  C CG2 . VAL B 1 532 ? -43.587  -41.995 40.586  1.00 32.82  ? 571  VAL C CG2 1 
ATOM   8762  N N   . MET B 1 533 ? -41.376  -44.951 43.323  1.00 35.42  ? 572  MET C N   1 
ATOM   8763  C CA  . MET B 1 533 ? -40.645  -46.150 43.721  1.00 40.77  ? 572  MET C CA  1 
ATOM   8764  C C   . MET B 1 533 ? -41.446  -46.954 44.732  1.00 33.17  ? 572  MET C C   1 
ATOM   8765  O O   . MET B 1 533 ? -41.550  -48.187 44.626  1.00 37.25  ? 572  MET C O   1 
ATOM   8766  C CB  . MET B 1 533 ? -39.280  -45.789 44.316  1.00 39.51  ? 572  MET C CB  1 
ATOM   8767  C CG  . MET B 1 533 ? -38.373  -45.002 43.395  1.00 44.64  ? 572  MET C CG  1 
ATOM   8768  S SD  . MET B 1 533 ? -37.878  -45.901 41.918  1.00 47.06  ? 572  MET C SD  1 
ATOM   8769  C CE  . MET B 1 533 ? -39.293  -45.702 40.850  1.00 42.82  ? 572  MET C CE  1 
ATOM   8770  N N   . GLU B 1 534 ? -42.012  -46.253 45.713  1.00 35.03  ? 573  GLU C N   1 
ATOM   8771  C CA  . GLU B 1 534 ? -42.845  -46.893 46.733  1.00 33.86  ? 573  GLU C CA  1 
ATOM   8772  C C   . GLU B 1 534 ? -44.119  -47.515 46.161  1.00 32.96  ? 573  GLU C C   1 
ATOM   8773  O O   . GLU B 1 534 ? -44.553  -48.570 46.630  1.00 30.92  ? 573  GLU C O   1 
ATOM   8774  C CB  . GLU B 1 534 ? -43.164  -45.928 47.885  1.00 36.85  ? 573  GLU C CB  1 
ATOM   8775  C CG  . GLU B 1 534 ? -41.906  -45.460 48.632  1.00 42.20  ? 573  GLU C CG  1 
ATOM   8776  C CD  . GLU B 1 534 ? -42.172  -44.414 49.706  1.00 46.69  ? 573  GLU C CD  1 
ATOM   8777  O OE1 . GLU B 1 534 ? -43.340  -44.004 49.901  1.00 38.57  ? 573  GLU C OE1 1 
ATOM   8778  O OE2 . GLU B 1 534 ? -41.194  -43.998 50.361  1.00 57.52  ? 573  GLU C OE2 1 
ATOM   8779  N N   . ALA B 1 535 ? -44.705  -46.890 45.140  1.00 29.37  ? 574  ALA C N   1 
ATOM   8780  C CA  . ALA B 1 535 ? -45.919  -47.443 44.529  1.00 30.79  ? 574  ALA C CA  1 
ATOM   8781  C C   . ALA B 1 535 ? -45.619  -48.745 43.771  1.00 28.75  ? 574  ALA C C   1 
ATOM   8782  O O   . ALA B 1 535 ? -46.410  -49.685 43.757  1.00 35.15  ? 574  ALA C O   1 
ATOM   8783  C CB  . ALA B 1 535 ? -46.577  -46.406 43.603  1.00 35.57  ? 574  ALA C CB  1 
ATOM   8784  N N   . ILE B 1 536 ? -44.456  -48.792 43.143  1.00 34.56  ? 575  ILE C N   1 
ATOM   8785  C CA  . ILE B 1 536 ? -44.047  -49.958 42.383  1.00 31.76  ? 575  ILE C CA  1 
ATOM   8786  C C   . ILE B 1 536 ? -43.834  -51.172 43.295  1.00 34.32  ? 575  ILE C C   1 
ATOM   8787  O O   . ILE B 1 536 ? -44.365  -52.247 43.023  1.00 35.55  ? 575  ILE C O   1 
ATOM   8788  C CB  . ILE B 1 536 ? -42.800  -49.639 41.549  1.00 32.90  ? 575  ILE C CB  1 
ATOM   8789  C CG1 . ILE B 1 536 ? -43.180  -48.659 40.429  1.00 30.82  ? 575  ILE C CG1 1 
ATOM   8790  C CG2 . ILE B 1 536 ? -42.162  -50.921 40.990  1.00 34.47  ? 575  ILE C CG2 1 
ATOM   8791  C CD1 . ILE B 1 536 ? -41.994  -48.065 39.682  1.00 29.93  ? 575  ILE C CD1 1 
ATOM   8792  N N   . GLN B 1 537 ? -43.076  -50.994 44.379  1.00 35.01  ? 576  GLN C N   1 
ATOM   8793  C CA  . GLN B 1 537 ? -42.906  -52.051 45.378  1.00 36.26  ? 576  GLN C CA  1 
ATOM   8794  C C   . GLN B 1 537 ? -44.256  -52.476 45.975  1.00 40.51  ? 576  GLN C C   1 
ATOM   8795  O O   . GLN B 1 537 ? -44.563  -53.668 46.061  1.00 32.25  ? 576  GLN C O   1 
ATOM   8796  C CB  . GLN B 1 537 ? -41.956  -51.608 46.495  1.00 35.42  ? 576  GLN C CB  1 
ATOM   8797  C CG  . GLN B 1 537 ? -40.737  -52.506 46.666  1.00 58.66  ? 576  GLN C CG  1 
ATOM   8798  C CD  . GLN B 1 537 ? -41.082  -53.985 46.647  1.00 52.22  ? 576  GLN C CD  1 
ATOM   8799  O OE1 . GLN B 1 537 ? -40.816  -54.685 45.664  1.00 57.03  ? 576  GLN C OE1 1 
ATOM   8800  N NE2 . GLN B 1 537 ? -41.670  -54.472 47.737  1.00 44.28  ? 576  GLN C NE2 1 
ATOM   8801  N N   . GLN B 1 538 ? -45.058  -51.497 46.386  1.00 37.24  ? 577  GLN C N   1 
ATOM   8802  C CA  . GLN B 1 538 ? -46.372  -51.791 46.957  1.00 36.10  ? 577  GLN C CA  1 
ATOM   8803  C C   . GLN B 1 538 ? -47.251  -52.563 45.968  1.00 35.85  ? 577  GLN C C   1 
ATOM   8804  O O   . GLN B 1 538 ? -47.973  -53.476 46.358  1.00 36.56  ? 577  GLN C O   1 
ATOM   8805  C CB  . GLN B 1 538 ? -47.068  -50.516 47.457  1.00 33.18  ? 577  GLN C CB  1 
ATOM   8806  C CG  . GLN B 1 538 ? -48.351  -50.757 48.284  1.00 33.51  ? 577  GLN C CG  1 
ATOM   8807  C CD  . GLN B 1 538 ? -48.874  -49.477 48.947  1.00 35.63  ? 577  GLN C CD  1 
ATOM   8808  O OE1 . GLN B 1 538 ? -48.097  -48.591 49.300  1.00 37.60  ? 577  GLN C OE1 1 
ATOM   8809  N NE2 . GLN B 1 538 ? -50.192  -49.374 49.104  1.00 30.23  ? 577  GLN C NE2 1 
ATOM   8810  N N   . ALA B 1 539 ? -47.176  -52.223 44.687  1.00 34.18  ? 578  ALA C N   1 
ATOM   8811  C CA  . ALA B 1 539 ? -47.914  -52.985 43.682  1.00 36.70  ? 578  ALA C CA  1 
ATOM   8812  C C   . ALA B 1 539 ? -47.401  -54.418 43.543  1.00 35.98  ? 578  ALA C C   1 
ATOM   8813  O O   . ALA B 1 539 ? -48.187  -55.350 43.321  1.00 31.03  ? 578  ALA C O   1 
ATOM   8814  C CB  . ALA B 1 539 ? -47.864  -52.287 42.327  1.00 32.68  ? 578  ALA C CB  1 
ATOM   8815  N N   . SER B 1 540 ? -46.085  -54.594 43.631  1.00 32.37  ? 579  SER C N   1 
ATOM   8816  C CA  . SER B 1 540 ? -45.511  -55.921 43.416  1.00 37.05  ? 579  SER C CA  1 
ATOM   8817  C C   . SER B 1 540 ? -46.028  -56.884 44.479  1.00 37.72  ? 579  SER C C   1 
ATOM   8818  O O   . SER B 1 540 ? -46.284  -58.050 44.191  1.00 39.89  ? 579  SER C O   1 
ATOM   8819  C CB  . SER B 1 540 ? -43.970  -55.897 43.395  1.00 41.38  ? 579  SER C CB  1 
ATOM   8820  O OG  . SER B 1 540 ? -43.430  -55.836 44.707  1.00 44.35  ? 579  SER C OG  1 
ATOM   8821  N N   . VAL B 1 541 ? -46.199  -56.384 45.700  1.00 37.81  ? 580  VAL C N   1 
ATOM   8822  C CA  . VAL B 1 541 ? -46.770  -57.189 46.778  1.00 35.87  ? 580  VAL C CA  1 
ATOM   8823  C C   . VAL B 1 541 ? -48.204  -57.624 46.439  1.00 41.86  ? 580  VAL C C   1 
ATOM   8824  O O   . VAL B 1 541 ? -48.559  -58.789 46.623  1.00 34.85  ? 580  VAL C O   1 
ATOM   8825  C CB  . VAL B 1 541 ? -46.720  -56.460 48.153  1.00 33.78  ? 580  VAL C CB  1 
ATOM   8826  C CG1 . VAL B 1 541 ? -47.543  -57.212 49.195  1.00 39.61  ? 580  VAL C CG1 1 
ATOM   8827  C CG2 . VAL B 1 541 ? -45.280  -56.319 48.634  1.00 37.75  ? 580  VAL C CG2 1 
ATOM   8828  N N   . ALA B 1 542 ? -49.017  -56.695 45.934  1.00 37.97  ? 581  ALA C N   1 
ATOM   8829  C CA  . ALA B 1 542 ? -50.401  -57.002 45.572  1.00 38.34  ? 581  ALA C CA  1 
ATOM   8830  C C   . ALA B 1 542 ? -50.493  -57.899 44.335  1.00 33.75  ? 581  ALA C C   1 
ATOM   8831  O O   . ALA B 1 542 ? -51.360  -58.766 44.247  1.00 35.34  ? 581  ALA C O   1 
ATOM   8832  C CB  . ALA B 1 542 ? -51.197  -55.713 45.352  1.00 31.34  ? 581  ALA C CB  1 
ATOM   8833  N N   . LYS B 1 543 ? -49.601  -57.671 43.378  1.00 34.61  ? 582  LYS C N   1 
ATOM   8834  C CA  . LYS B 1 543 ? -49.531  -58.496 42.176  1.00 34.07  ? 582  LYS C CA  1 
ATOM   8835  C C   . LYS B 1 543 ? -49.312  -59.952 42.573  1.00 36.92  ? 582  LYS C C   1 
ATOM   8836  O O   . LYS B 1 543 ? -49.910  -60.866 41.999  1.00 33.10  ? 582  LYS C O   1 
ATOM   8837  C CB  . LYS B 1 543 ? -48.390  -58.018 41.259  1.00 34.24  ? 582  LYS C CB  1 
ATOM   8838  C CG  . LYS B 1 543 ? -48.113  -58.924 40.056  1.00 38.67  ? 582  LYS C CG  1 
ATOM   8839  C CD  . LYS B 1 543 ? -47.006  -58.378 39.146  1.00 35.37  ? 582  LYS C CD  1 
ATOM   8840  C CE  . LYS B 1 543 ? -45.694  -58.192 39.894  1.00 38.52  ? 582  LYS C CE  1 
ATOM   8841  N NZ  . LYS B 1 543 ? -44.550  -57.978 38.963  1.00 37.04  ? 582  LYS C NZ  1 
ATOM   8842  N N   . LYS B 1 544 ? -48.454  -60.164 43.565  1.00 35.27  ? 583  LYS C N   1 
ATOM   8843  C CA  . LYS B 1 544 ? -48.154  -61.524 44.003  1.00 37.57  ? 583  LYS C CA  1 
ATOM   8844  C C   . LYS B 1 544 ? -49.335  -62.158 44.727  1.00 36.29  ? 583  LYS C C   1 
ATOM   8845  O O   . LYS B 1 544 ? -49.615  -63.335 44.544  1.00 37.58  ? 583  LYS C O   1 
ATOM   8846  C CB  . LYS B 1 544 ? -46.882  -61.568 44.851  1.00 33.95  ? 583  LYS C CB  1 
ATOM   8847  C CG  . LYS B 1 544 ? -45.652  -61.178 44.050  1.00 41.39  ? 583  LYS C CG  1 
ATOM   8848  C CD  . LYS B 1 544 ? -44.366  -61.435 44.811  1.00 47.05  ? 583  LYS C CD  1 
ATOM   8849  C CE  . LYS B 1 544 ? -43.200  -60.765 44.111  1.00 50.81  ? 583  LYS C CE  1 
ATOM   8850  N NZ  . LYS B 1 544 ? -41.885  -61.232 44.648  1.00 69.50  ? 583  LYS C NZ  1 
ATOM   8851  N N   . GLU B 1 545 ? -50.044  -61.376 45.531  1.00 34.45  ? 584  GLU C N   1 
ATOM   8852  C CA  . GLU B 1 545 ? -51.247  -61.896 46.169  1.00 40.14  ? 584  GLU C CA  1 
ATOM   8853  C C   . GLU B 1 545 ? -52.306  -62.298 45.142  1.00 39.38  ? 584  GLU C C   1 
ATOM   8854  O O   . GLU B 1 545 ? -52.966  -63.322 45.294  1.00 42.76  ? 584  GLU C O   1 
ATOM   8855  C CB  . GLU B 1 545 ? -51.805  -60.892 47.183  1.00 42.35  ? 584  GLU C CB  1 
ATOM   8856  C CG  . GLU B 1 545 ? -50.885  -60.703 48.393  1.00 47.95  ? 584  GLU C CG  1 
ATOM   8857  C CD  . GLU B 1 545 ? -51.304  -59.553 49.295  1.00 55.25  ? 584  GLU C CD  1 
ATOM   8858  O OE1 . GLU B 1 545 ? -52.478  -59.118 49.218  1.00 57.82  ? 584  GLU C OE1 1 
ATOM   8859  O OE2 . GLU B 1 545 ? -50.450  -59.089 50.081  1.00 54.71  ? 584  GLU C OE2 1 
ATOM   8860  N N   . ILE B 1 546 ? -52.456  -61.504 44.088  1.00 37.36  ? 585  ILE C N   1 
ATOM   8861  C CA  . ILE B 1 546 ? -53.476  -61.786 43.082  1.00 39.02  ? 585  ILE C CA  1 
ATOM   8862  C C   . ILE B 1 546 ? -53.148  -63.064 42.332  1.00 36.16  ? 585  ILE C C   1 
ATOM   8863  O O   . ILE B 1 546 ? -54.013  -63.914 42.127  1.00 34.35  ? 585  ILE C O   1 
ATOM   8864  C CB  . ILE B 1 546 ? -53.604  -60.650 42.052  1.00 35.33  ? 585  ILE C CB  1 
ATOM   8865  C CG1 . ILE B 1 546 ? -54.063  -59.360 42.733  1.00 36.74  ? 585  ILE C CG1 1 
ATOM   8866  C CG2 . ILE B 1 546 ? -54.567  -61.057 40.948  1.00 33.66  ? 585  ILE C CG2 1 
ATOM   8867  C CD1 . ILE B 1 546 ? -53.908  -58.154 41.870  1.00 36.16  ? 585  ILE C CD1 1 
ATOM   8868  N N   . LEU B 1 547 ? -51.891  -63.178 41.918  1.00 33.54  ? 586  LEU C N   1 
ATOM   8869  C CA  . LEU B 1 547 ? -51.413  -64.344 41.188  1.00 39.56  ? 586  LEU C CA  1 
ATOM   8870  C C   . LEU B 1 547 ? -51.630  -65.608 42.014  1.00 43.14  ? 586  LEU C C   1 
ATOM   8871  O O   . LEU B 1 547 ? -52.018  -66.642 41.477  1.00 37.80  ? 586  LEU C O   1 
ATOM   8872  C CB  . LEU B 1 547 ? -49.929  -64.194 40.827  1.00 40.81  ? 586  LEU C CB  1 
ATOM   8873  C CG  . LEU B 1 547 ? -49.581  -63.231 39.687  1.00 48.56  ? 586  LEU C CG  1 
ATOM   8874  C CD1 . LEU B 1 547 ? -48.073  -62.958 39.599  1.00 35.28  ? 586  LEU C CD1 1 
ATOM   8875  C CD2 . LEU B 1 547 ? -50.115  -63.765 38.366  1.00 38.98  ? 586  LEU C CD2 1 
ATOM   8876  N N   . GLN B 1 548 ? -51.385  -65.513 43.318  1.00 43.99  ? 587  GLN C N   1 
ATOM   8877  C CA  . GLN B 1 548 ? -51.636  -66.630 44.227  1.00 49.62  ? 587  GLN C CA  1 
ATOM   8878  C C   . GLN B 1 548 ? -53.069  -67.110 44.122  1.00 46.90  ? 587  GLN C C   1 
ATOM   8879  O O   . GLN B 1 548 ? -53.324  -68.314 44.056  1.00 47.25  ? 587  GLN C O   1 
ATOM   8880  C CB  . GLN B 1 548 ? -51.349  -66.244 45.678  1.00 47.89  ? 587  GLN C CB  1 
ATOM   8881  C CG  . GLN B 1 548 ? -49.943  -66.585 46.138  1.00 64.78  ? 587  GLN C CG  1 
ATOM   8882  C CD  . GLN B 1 548 ? -49.890  -66.912 47.620  1.00 83.65  ? 587  GLN C CD  1 
ATOM   8883  O OE1 . GLN B 1 548 ? -50.928  -67.064 48.273  1.00 72.11  ? 587  GLN C OE1 1 
ATOM   8884  N NE2 . GLN B 1 548 ? -48.678  -67.029 48.158  1.00 72.08  ? 587  GLN C NE2 1 
ATOM   8885  N N   . ILE B 1 549 ? -54.011  -66.172 44.126  1.00 45.60  ? 588  ILE C N   1 
ATOM   8886  C CA  . ILE B 1 549 ? -55.414  -66.545 43.991  1.00 40.88  ? 588  ILE C CA  1 
ATOM   8887  C C   . ILE B 1 549 ? -55.667  -67.114 42.598  1.00 45.49  ? 588  ILE C C   1 
ATOM   8888  O O   . ILE B 1 549 ? -56.261  -68.184 42.448  1.00 39.52  ? 588  ILE C O   1 
ATOM   8889  C CB  . ILE B 1 549 ? -56.347  -65.362 44.256  1.00 45.27  ? 588  ILE C CB  1 
ATOM   8890  C CG1 . ILE B 1 549 ? -56.208  -64.915 45.711  1.00 49.71  ? 588  ILE C CG1 1 
ATOM   8891  C CG2 . ILE B 1 549 ? -57.785  -65.757 43.946  1.00 43.35  ? 588  ILE C CG2 1 
ATOM   8892  C CD1 . ILE B 1 549 ? -56.569  -63.469 45.956  1.00 48.26  ? 588  ILE C CD1 1 
ATOM   8893  N N   . MET B 1 550 ? -55.186  -66.404 41.583  1.00 44.72  ? 589  MET C N   1 
ATOM   8894  C CA  . MET B 1 550 ? -55.332  -66.842 40.199  1.00 44.78  ? 589  MET C CA  1 
ATOM   8895  C C   . MET B 1 550 ? -54.857  -68.277 40.011  1.00 43.76  ? 589  MET C C   1 
ATOM   8896  O O   . MET B 1 550 ? -55.547  -69.090 39.397  1.00 41.10  ? 589  MET C O   1 
ATOM   8897  C CB  . MET B 1 550 ? -54.569  -65.909 39.247  1.00 41.56  ? 589  MET C CB  1 
ATOM   8898  C CG  . MET B 1 550 ? -55.217  -64.525 39.069  1.00 37.15  ? 589  MET C CG  1 
ATOM   8899  S SD  . MET B 1 550 ? -54.248  -63.413 38.042  1.00 38.29  ? 589  MET C SD  1 
ATOM   8900  C CE  . MET B 1 550 ? -54.093  -64.354 36.535  1.00 36.96  ? 589  MET C CE  1 
ATOM   8901  N N   . ASN B 1 551 ? -53.676  -68.577 40.539  1.00 41.23  ? 590  ASN C N   1 
ATOM   8902  C CA  . ASN B 1 551 ? -53.058  -69.890 40.359  1.00 40.71  ? 590  ASN C CA  1 
ATOM   8903  C C   . ASN B 1 551 ? -53.873  -71.018 40.994  1.00 43.00  ? 590  ASN C C   1 
ATOM   8904  O O   . ASN B 1 551 ? -53.741  -72.180 40.618  1.00 46.13  ? 590  ASN C O   1 
ATOM   8905  C CB  . ASN B 1 551 ? -51.622  -69.887 40.889  1.00 36.02  ? 590  ASN C CB  1 
ATOM   8906  C CG  . ASN B 1 551 ? -50.641  -69.261 39.915  1.00 43.84  ? 590  ASN C CG  1 
ATOM   8907  O OD1 . ASN B 1 551 ? -50.845  -69.301 38.700  1.00 41.33  ? 590  ASN C OD1 1 
ATOM   8908  N ND2 . ASN B 1 551 ? -49.560  -68.691 40.442  1.00 43.29  ? 590  ASN C ND2 1 
ATOM   8909  N N   . LYS B 1 552 ? -54.720  -70.672 41.957  1.00 46.16  ? 591  LYS C N   1 
ATOM   8910  C CA  . LYS B 1 552 ? -55.633  -71.647 42.532  1.00 46.62  ? 591  LYS C CA  1 
ATOM   8911  C C   . LYS B 1 552 ? -56.687  -72.081 41.513  1.00 51.92  ? 591  LYS C C   1 
ATOM   8912  O O   . LYS B 1 552 ? -57.209  -73.191 41.594  1.00 47.51  ? 591  LYS C O   1 
ATOM   8913  C CB  . LYS B 1 552 ? -56.307  -71.091 43.788  1.00 46.64  ? 591  LYS C CB  1 
ATOM   8914  C CG  . LYS B 1 552 ? -55.398  -71.014 45.015  1.00 52.85  ? 591  LYS C CG  1 
ATOM   8915  C CD  . LYS B 1 552 ? -56.198  -70.717 46.288  1.00 64.25  ? 591  LYS C CD  1 
ATOM   8916  C CE  . LYS B 1 552 ? -55.284  -70.434 47.488  1.00 71.94  ? 591  LYS C CE  1 
ATOM   8917  N NZ  . LYS B 1 552 ? -56.055  -70.146 48.738  1.00 63.09  ? 591  LYS C NZ  1 
ATOM   8918  N N   . THR B 1 553 ? -57.003  -71.212 40.554  1.00 49.97  ? 592  THR C N   1 
ATOM   8919  C CA  . THR B 1 553 ? -58.042  -71.525 39.567  1.00 42.29  ? 592  THR C CA  1 
ATOM   8920  C C   . THR B 1 553 ? -57.460  -72.245 38.354  1.00 41.13  ? 592  THR C C   1 
ATOM   8921  O O   . THR B 1 553 ? -58.061  -73.166 37.812  1.00 45.45  ? 592  THR C O   1 
ATOM   8922  C CB  . THR B 1 553 ? -58.830  -70.265 39.148  1.00 43.92  ? 592  THR C CB  1 
ATOM   8923  O OG1 . THR B 1 553 ? -59.634  -69.833 40.249  1.00 44.34  ? 592  THR C OG1 1 
ATOM   8924  C CG2 . THR B 1 553 ? -59.745  -70.555 37.962  1.00 41.84  ? 592  THR C CG2 1 
ATOM   8925  N N   . ILE B 1 554 ? -56.278  -71.815 37.942  1.00 38.34  ? 593  ILE C N   1 
ATOM   8926  C CA  . ILE B 1 554 ? -55.516  -72.494 36.910  1.00 41.12  ? 593  ILE C CA  1 
ATOM   8927  C C   . ILE B 1 554 ? -54.091  -71.981 37.033  1.00 45.23  ? 593  ILE C C   1 
ATOM   8928  O O   . ILE B 1 554 ? -53.882  -70.792 37.258  1.00 44.30  ? 593  ILE C O   1 
ATOM   8929  C CB  . ILE B 1 554 ? -56.093  -72.236 35.499  1.00 44.59  ? 593  ILE C CB  1 
ATOM   8930  C CG1 . ILE B 1 554 ? -55.343  -73.070 34.455  1.00 45.60  ? 593  ILE C CG1 1 
ATOM   8931  C CG2 . ILE B 1 554 ? -56.049  -70.742 35.154  1.00 41.33  ? 593  ILE C CG2 1 
ATOM   8932  C CD1 . ILE B 1 554 ? -56.099  -73.272 33.127  1.00 39.26  ? 593  ILE C CD1 1 
ATOM   8933  N N   . SER B 1 555 ? -53.109  -72.873 36.929  1.00 37.78  ? 594  SER C N   1 
ATOM   8934  C CA  . SER B 1 555 ? -51.728  -72.483 37.157  1.00 39.77  ? 594  SER C CA  1 
ATOM   8935  C C   . SER B 1 555 ? -50.870  -72.780 35.939  1.00 38.37  ? 594  SER C C   1 
ATOM   8936  O O   . SER B 1 555 ? -49.768  -72.255 35.805  1.00 44.33  ? 594  SER C O   1 
ATOM   8937  C CB  . SER B 1 555 ? -51.159  -73.172 38.404  1.00 44.70  ? 594  SER C CB  1 
ATOM   8938  O OG  . SER B 1 555 ? -51.115  -74.586 38.235  1.00 56.61  ? 594  SER C OG  1 
ATOM   8939  N N   . LYS B 1 556 ? -51.390  -73.615 35.046  1.00 42.30  ? 595  LYS C N   1 
ATOM   8940  C CA  . LYS B 1 556 ? -50.683  -73.963 33.817  1.00 47.48  ? 595  LYS C CA  1 
ATOM   8941  C C   . LYS B 1 556 ? -51.658  -74.030 32.649  1.00 44.85  ? 595  LYS C C   1 
ATOM   8942  O O   . LYS B 1 556 ? -52.862  -74.240 32.844  1.00 42.67  ? 595  LYS C O   1 
ATOM   8943  C CB  . LYS B 1 556 ? -49.931  -75.300 33.957  1.00 55.03  ? 595  LYS C CB  1 
ATOM   8944  C CG  . LYS B 1 556 ? -48.505  -75.162 34.486  1.00 56.80  ? 595  LYS C CG  1 
ATOM   8945  C CD  . LYS B 1 556 ? -47.746  -76.494 34.454  1.00 74.12  ? 595  LYS C CD  1 
ATOM   8946  C CE  . LYS B 1 556 ? -47.289  -76.863 33.037  1.00 83.10  ? 595  LYS C CE  1 
ATOM   8947  N NZ  . LYS B 1 556 ? -46.396  -78.072 33.006  1.00 79.48  ? 595  LYS C NZ  1 
ATOM   8948  N N   . PRO B 1 557 ? -51.141  -73.844 31.430  1.00 45.17  ? 596  PRO C N   1 
ATOM   8949  C CA  . PRO B 1 557 ? -51.999  -73.920 30.245  1.00 42.69  ? 596  PRO C CA  1 
ATOM   8950  C C   . PRO B 1 557 ? -52.519  -75.333 30.064  1.00 49.89  ? 596  PRO C C   1 
ATOM   8951  O O   . PRO B 1 557 ? -51.782  -76.285 30.329  1.00 48.27  ? 596  PRO C O   1 
ATOM   8952  C CB  . PRO B 1 557 ? -51.050  -73.559 29.101  1.00 37.24  ? 596  PRO C CB  1 
ATOM   8953  C CG  . PRO B 1 557 ? -49.912  -72.800 29.763  1.00 43.37  ? 596  PRO C CG  1 
ATOM   8954  C CD  . PRO B 1 557 ? -49.757  -73.471 31.092  1.00 48.77  ? 596  PRO C CD  1 
ATOM   8955  N N   . ARG B 1 558 ? -53.776  -75.452 29.645  1.00 53.51  ? 597  ARG C N   1 
ATOM   8956  C CA  . ARG B 1 558 ? -54.371  -76.730 29.283  1.00 45.80  ? 597  ARG C CA  1 
ATOM   8957  C C   . ARG B 1 558 ? -53.367  -77.486 28.413  1.00 51.92  ? 597  ARG C C   1 
ATOM   8958  O O   . ARG B 1 558 ? -52.684  -76.878 27.579  1.00 47.36  ? 597  ARG C O   1 
ATOM   8959  C CB  . ARG B 1 558 ? -55.682  -76.490 28.526  1.00 43.07  ? 597  ARG C CB  1 
ATOM   8960  C CG  . ARG B 1 558 ? -56.698  -77.629 28.633  1.00 61.08  ? 597  ARG C CG  1 
ATOM   8961  C CD  . ARG B 1 558 ? -57.846  -77.500 27.615  1.00 57.82  ? 597  ARG C CD  1 
ATOM   8962  N NE  . ARG B 1 558 ? -58.868  -76.530 28.010  1.00 52.38  ? 597  ARG C NE  1 
ATOM   8963  C CZ  . ARG B 1 558 ? -60.079  -76.849 28.469  1.00 61.75  ? 597  ARG C CZ  1 
ATOM   8964  N NH1 . ARG B 1 558 ? -60.437  -78.124 28.591  1.00 52.54  ? 597  ARG C NH1 1 
ATOM   8965  N NH2 . ARG B 1 558 ? -60.942  -75.892 28.802  1.00 58.59  ? 597  ARG C NH2 1 
ATOM   8966  N N   . ALA B 1 559 ? -53.257  -78.798 28.611  1.00 50.74  ? 598  ALA C N   1 
ATOM   8967  C CA  . ALA B 1 559 ? -52.231  -79.585 27.918  1.00 48.49  ? 598  ALA C CA  1 
ATOM   8968  C C   . ALA B 1 559 ? -52.362  -79.492 26.402  1.00 49.99  ? 598  ALA C C   1 
ATOM   8969  O O   . ALA B 1 559 ? -51.360  -79.473 25.680  1.00 54.00  ? 598  ALA C O   1 
ATOM   8970  C CB  . ALA B 1 559 ? -52.263  -81.044 28.372  1.00 49.51  ? 598  ALA C CB  1 
ATOM   8971  N N   . SER B 1 560 ? -53.599  -79.449 25.924  1.00 39.38  ? 599  SER C N   1 
ATOM   8972  C CA  . SER B 1 560 ? -53.855  -79.207 24.509  1.00 47.80  ? 599  SER C CA  1 
ATOM   8973  C C   . SER B 1 560 ? -55.001  -78.215 24.358  1.00 53.41  ? 599  SER C C   1 
ATOM   8974  O O   . SER B 1 560 ? -55.716  -77.933 25.324  1.00 49.47  ? 599  SER C O   1 
ATOM   8975  C CB  . SER B 1 560 ? -54.226  -80.511 23.802  1.00 61.89  ? 599  SER C CB  1 
ATOM   8976  O OG  . SER B 1 560 ? -55.529  -80.932 24.183  1.00 62.51  ? 599  SER C OG  1 
ATOM   8977  N N   . ARG B 1 561 ? -55.184  -77.695 23.146  1.00 51.67  ? 600  ARG C N   1 
ATOM   8978  C CA  . ARG B 1 561 ? -56.327  -76.833 22.863  1.00 55.99  ? 600  ARG C CA  1 
ATOM   8979  C C   . ARG B 1 561 ? -57.617  -77.632 22.992  1.00 53.91  ? 600  ARG C C   1 
ATOM   8980  O O   . ARG B 1 561 ? -57.585  -78.859 23.073  1.00 52.71  ? 600  ARG C O   1 
ATOM   8981  C CB  . ARG B 1 561 ? -56.215  -76.229 21.467  1.00 42.36  ? 600  ARG C CB  1 
ATOM   8982  C CG  . ARG B 1 561 ? -55.001  -75.360 21.301  1.00 43.70  ? 600  ARG C CG  1 
ATOM   8983  C CD  . ARG B 1 561 ? -54.989  -74.707 19.947  1.00 46.23  ? 600  ARG C CD  1 
ATOM   8984  N NE  . ARG B 1 561 ? -54.810  -75.690 18.887  1.00 50.95  ? 600  ARG C NE  1 
ATOM   8985  C CZ  . ARG B 1 561 ? -53.626  -76.140 18.489  1.00 50.23  ? 600  ARG C CZ  1 
ATOM   8986  N NH1 . ARG B 1 561 ? -52.519  -75.696 19.072  1.00 47.05  ? 600  ARG C NH1 1 
ATOM   8987  N NH2 . ARG B 1 561 ? -53.550  -77.033 17.512  1.00 58.22  ? 600  ARG C NH2 1 
ATOM   8988  N N   . LYS B 1 562 ? -58.750  -76.942 23.017  1.00 48.90  ? 601  LYS C N   1 
ATOM   8989  C CA  . LYS B 1 562 ? -60.030  -77.621 23.165  1.00 56.12  ? 601  LYS C CA  1 
ATOM   8990  C C   . LYS B 1 562 ? -60.307  -78.509 21.959  1.00 55.02  ? 601  LYS C C   1 
ATOM   8991  O O   . LYS B 1 562 ? -59.919  -78.185 20.838  1.00 53.87  ? 601  LYS C O   1 
ATOM   8992  C CB  . LYS B 1 562 ? -61.171  -76.621 23.341  1.00 57.28  ? 601  LYS C CB  1 
ATOM   8993  C CG  . LYS B 1 562 ? -61.344  -76.072 24.750  1.00 57.16  ? 601  LYS C CG  1 
ATOM   8994  C CD  . LYS B 1 562 ? -62.646  -75.300 24.815  1.00 50.60  ? 601  LYS C CD  1 
ATOM   8995  C CE  . LYS B 1 562 ? -62.938  -74.740 26.193  1.00 62.65  ? 601  LYS C CE  1 
ATOM   8996  N NZ  . LYS B 1 562 ? -64.326  -74.171 26.230  1.00 47.37  ? 601  LYS C NZ  1 
ATOM   8997  N N   . GLU B 1 563 ? -60.983  -79.628 22.193  1.00 60.18  ? 602  GLU C N   1 
ATOM   8998  C CA  . GLU B 1 563 ? -61.296  -80.562 21.118  1.00 63.81  ? 602  GLU C CA  1 
ATOM   8999  C C   . GLU B 1 563 ? -62.137  -79.889 20.035  1.00 65.32  ? 602  GLU C C   1 
ATOM   9000  O O   . GLU B 1 563 ? -62.000  -80.196 18.850  1.00 63.99  ? 602  GLU C O   1 
ATOM   9001  C CB  . GLU B 1 563 ? -62.018  -81.795 21.657  1.00 59.78  ? 602  GLU C CB  1 
ATOM   9002  C CG  . GLU B 1 563 ? -62.251  -82.867 20.604  1.00 79.65  ? 602  GLU C CG  1 
ATOM   9003  C CD  . GLU B 1 563 ? -63.367  -83.824 20.978  1.00 87.61  ? 602  GLU C CD  1 
ATOM   9004  O OE1 . GLU B 1 563 ? -63.270  -85.014 20.610  1.00 91.55  ? 602  GLU C OE1 1 
ATOM   9005  O OE2 . GLU B 1 563 ? -64.343  -83.385 21.631  1.00 81.07  ? 602  GLU C OE2 1 
ATOM   9006  N N   . ASN B 1 564 ? -63.004  -78.970 20.453  1.00 59.41  ? 603  ASN C N   1 
ATOM   9007  C CA  . ASN B 1 564 ? -63.812  -78.185 19.524  1.00 66.25  ? 603  ASN C CA  1 
ATOM   9008  C C   . ASN B 1 564 ? -63.072  -76.944 19.012  1.00 65.16  ? 603  ASN C C   1 
ATOM   9009  O O   . ASN B 1 564 ? -63.694  -75.972 18.569  1.00 59.67  ? 603  ASN C O   1 
ATOM   9010  C CB  . ASN B 1 564 ? -65.123  -77.763 20.193  1.00 67.91  ? 603  ASN C CB  1 
ATOM   9011  C CG  . ASN B 1 564 ? -64.896  -76.925 21.440  1.00 61.41  ? 603  ASN C CG  1 
ATOM   9012  O OD1 . ASN B 1 564 ? -63.952  -76.133 21.510  1.00 69.85  ? 603  ASN C OD1 1 
ATOM   9013  N ND2 . ASN B 1 564 ? -65.754  -77.103 22.435  1.00 58.81  ? 603  ASN C ND2 1 
ATOM   9014  N N   . GLY B 1 565 ? -61.743  -76.981 19.086  1.00 59.32  ? 604  GLY C N   1 
ATOM   9015  C CA  . GLY B 1 565 ? -60.921  -75.867 18.650  1.00 63.02  ? 604  GLY C CA  1 
ATOM   9016  C C   . GLY B 1 565 ? -60.736  -75.836 17.145  1.00 59.69  ? 604  GLY C C   1 
ATOM   9017  O O   . GLY B 1 565 ? -61.398  -76.574 16.416  1.00 58.34  ? 604  GLY C O   1 
ATOM   9018  N N   . PRO B 1 566 ? -59.829  -74.978 16.664  1.00 55.38  ? 605  PRO C N   1 
ATOM   9019  C CA  . PRO B 1 566 ? -59.621  -74.840 15.220  1.00 50.81  ? 605  PRO C CA  1 
ATOM   9020  C C   . PRO B 1 566 ? -58.685  -75.916 14.673  1.00 49.02  ? 605  PRO C C   1 
ATOM   9021  O O   . PRO B 1 566 ? -57.849  -76.442 15.410  1.00 57.79  ? 605  PRO C O   1 
ATOM   9022  C CB  . PRO B 1 566 ? -58.987  -73.454 15.100  1.00 54.09  ? 605  PRO C CB  1 
ATOM   9023  C CG  . PRO B 1 566 ? -58.236  -73.297 16.375  1.00 55.94  ? 605  PRO C CG  1 
ATOM   9024  C CD  . PRO B 1 566 ? -59.014  -74.027 17.437  1.00 49.27  ? 605  PRO C CD  1 
ATOM   9025  N N   . VAL B 1 567 ? -58.841  -76.237 13.392  1.00 48.29  ? 606  VAL C N   1 
ATOM   9026  C CA  . VAL B 1 567 ? -58.043  -77.269 12.744  1.00 51.74  ? 606  VAL C CA  1 
ATOM   9027  C C   . VAL B 1 567 ? -57.570  -76.786 11.387  1.00 53.01  ? 606  VAL C C   1 
ATOM   9028  O O   . VAL B 1 567 ? -58.258  -76.019 10.710  1.00 49.19  ? 606  VAL C O   1 
ATOM   9029  C CB  . VAL B 1 567 ? -58.842  -78.569 12.527  1.00 53.76  ? 606  VAL C CB  1 
ATOM   9030  C CG1 . VAL B 1 567 ? -59.396  -79.090 13.845  1.00 60.07  ? 606  VAL C CG1 1 
ATOM   9031  C CG2 . VAL B 1 567 ? -59.958  -78.336 11.536  1.00 48.77  ? 606  VAL C CG2 1 
ATOM   9032  N N   . VAL B 1 568 ? -56.386  -77.237 10.995  1.00 46.08  ? 607  VAL C N   1 
ATOM   9033  C CA  . VAL B 1 568 ? -55.834  -76.873 9.702   1.00 54.78  ? 607  VAL C CA  1 
ATOM   9034  C C   . VAL B 1 568 ? -55.610  -78.125 8.861   1.00 68.93  ? 607  VAL C C   1 
ATOM   9035  O O   . VAL B 1 568 ? -54.905  -79.046 9.281   1.00 74.14  ? 607  VAL C O   1 
ATOM   9036  C CB  . VAL B 1 568 ? -54.515  -76.100 9.850   1.00 53.25  ? 607  VAL C CB  1 
ATOM   9037  C CG1 . VAL B 1 568 ? -54.007  -75.654 8.486   1.00 60.19  ? 607  VAL C CG1 1 
ATOM   9038  C CG2 . VAL B 1 568 ? -54.717  -74.897 10.759  1.00 56.70  ? 607  VAL C CG2 1 
ATOM   9039  N N   . GLU B 1 569 ? -56.222  -78.163 7.680   1.00 64.55  ? 608  GLU C N   1 
ATOM   9040  C CA  . GLU B 1 569 ? -56.053  -79.293 6.771   1.00 64.84  ? 608  GLU C CA  1 
ATOM   9041  C C   . GLU B 1 569 ? -55.519  -78.831 5.423   1.00 60.27  ? 608  GLU C C   1 
ATOM   9042  O O   . GLU B 1 569 ? -55.785  -77.713 4.992   1.00 52.74  ? 608  GLU C O   1 
ATOM   9043  C CB  . GLU B 1 569 ? -57.375  -80.041 6.578   1.00 59.61  ? 608  GLU C CB  1 
ATOM   9044  C CG  . GLU B 1 569 ? -57.956  -80.614 7.863   1.00 69.13  ? 608  GLU C CG  1 
ATOM   9045  C CD  . GLU B 1 569 ? -59.241  -81.394 7.637   1.00 80.93  ? 608  GLU C CD  1 
ATOM   9046  O OE1 . GLU B 1 569 ? -59.719  -81.453 6.478   1.00 73.70  ? 608  GLU C OE1 1 
ATOM   9047  O OE2 . GLU B 1 569 ? -59.770  -81.952 8.624   1.00 81.84  ? 608  GLU C OE2 1 
ATOM   9048  N N   . THR B 1 570 ? -54.763  -79.701 4.763   1.00 61.47  ? 609  THR C N   1 
ATOM   9049  C CA  . THR B 1 570 ? -54.278  -79.435 3.417   1.00 53.12  ? 609  THR C CA  1 
ATOM   9050  C C   . THR B 1 570 ? -55.093  -80.205 2.388   1.00 60.95  ? 609  THR C C   1 
ATOM   9051  O O   . THR B 1 570 ? -55.290  -81.415 2.510   1.00 69.75  ? 609  THR C O   1 
ATOM   9052  C CB  . THR B 1 570 ? -52.808  -79.826 3.263   1.00 59.95  ? 609  THR C CB  1 
ATOM   9053  O OG1 . THR B 1 570 ? -51.995  -78.941 4.042   1.00 60.47  ? 609  THR C OG1 1 
ATOM   9054  C CG2 . THR B 1 570 ? -52.392  -79.741 1.804   1.00 61.00  ? 609  THR C CG2 1 
ATOM   9055  N N   . VAL B 1 571 ? -55.565  -79.494 1.373   1.00 62.13  ? 610  VAL C N   1 
ATOM   9056  C CA  . VAL B 1 571 ? -56.329  -80.101 0.299   1.00 59.26  ? 610  VAL C CA  1 
ATOM   9057  C C   . VAL B 1 571 ? -55.524  -80.087 -0.989  1.00 64.22  ? 610  VAL C C   1 
ATOM   9058  O O   . VAL B 1 571 ? -55.107  -79.028 -1.455  1.00 61.76  ? 610  VAL C O   1 
ATOM   9059  C CB  . VAL B 1 571 ? -57.639  -79.345 0.061   1.00 63.63  ? 610  VAL C CB  1 
ATOM   9060  C CG1 . VAL B 1 571 ? -58.378  -79.923 -1.139  1.00 65.58  ? 610  VAL C CG1 1 
ATOM   9061  C CG2 . VAL B 1 571 ? -58.503  -79.398 1.305   1.00 67.93  ? 610  VAL C CG2 1 
ATOM   9062  N N   . GLN B 1 572 ? -55.301  -81.266 -1.561  1.00 60.59  ? 611  GLN C N   1 
ATOM   9063  C CA  . GLN B 1 572 ? -54.606  -81.369 -2.834  1.00 60.56  ? 611  GLN C CA  1 
ATOM   9064  C C   . GLN B 1 572 ? -55.592  -81.145 -3.975  1.00 61.13  ? 611  GLN C C   1 
ATOM   9065  O O   . GLN B 1 572 ? -56.715  -81.642 -3.934  1.00 67.67  ? 611  GLN C O   1 
ATOM   9066  C CB  . GLN B 1 572 ? -53.924  -82.732 -2.959  1.00 69.75  ? 611  GLN C CB  1 
ATOM   9067  C CG  . GLN B 1 572 ? -52.756  -82.919 -2.002  1.00 68.74  ? 611  GLN C CG  1 
ATOM   9068  C CD  . GLN B 1 572 ? -51.623  -81.941 -2.271  1.00 77.16  ? 611  GLN C CD  1 
ATOM   9069  O OE1 . GLN B 1 572 ? -51.398  -81.538 -3.415  1.00 78.05  ? 611  GLN C OE1 1 
ATOM   9070  N NE2 . GLN B 1 572 ? -50.907  -81.548 -1.216  1.00 65.03  ? 611  GLN C NE2 1 
ATOM   9071  N N   . VAL B 1 573 ? -55.180  -80.376 -4.980  1.00 60.22  ? 612  VAL C N   1 
ATOM   9072  C CA  . VAL B 1 573 ? -56.038  -80.100 -6.131  1.00 64.94  ? 612  VAL C CA  1 
ATOM   9073  C C   . VAL B 1 573 ? -55.237  -80.103 -7.428  1.00 72.53  ? 612  VAL C C   1 
ATOM   9074  O O   . VAL B 1 573 ? -54.392  -79.232 -7.641  1.00 74.37  ? 612  VAL C O   1 
ATOM   9075  C CB  . VAL B 1 573 ? -56.758  -78.741 -6.011  1.00 64.56  ? 612  VAL C CB  1 
ATOM   9076  C CG1 . VAL B 1 573 ? -57.698  -78.542 -7.192  1.00 61.16  ? 612  VAL C CG1 1 
ATOM   9077  C CG2 . VAL B 1 573 ? -57.515  -78.646 -4.696  1.00 59.93  ? 612  VAL C CG2 1 
ATOM   9078  N N   . PRO B 1 574 ? -55.508  -81.082 -8.305  1.00 71.64  ? 613  PRO C N   1 
ATOM   9079  C CA  . PRO B 1 574 ? -54.761  -81.232 -9.562  1.00 78.05  ? 613  PRO C CA  1 
ATOM   9080  C C   . PRO B 1 574 ? -55.086  -80.153 -10.598 1.00 78.02  ? 613  PRO C C   1 
ATOM   9081  O O   . PRO B 1 574 ? -56.237  -79.723 -10.713 1.00 77.58  ? 613  PRO C O   1 
ATOM   9082  C CB  . PRO B 1 574 ? -55.202  -82.609 -10.066 1.00 77.07  ? 613  PRO C CB  1 
ATOM   9083  C CG  . PRO B 1 574 ? -56.557  -82.815 -9.466  1.00 74.88  ? 613  PRO C CG  1 
ATOM   9084  C CD  . PRO B 1 574 ? -56.520  -82.139 -8.125  1.00 72.21  ? 613  PRO C CD  1 
ATOM   9085  N N   . LEU B 1 575 ? -54.064  -79.725 -11.337 1.00 77.85  ? 614  LEU C N   1 
ATOM   9086  C CA  . LEU B 1 575 ? -54.226  -78.755 -12.417 1.00 75.95  ? 614  LEU C CA  1 
ATOM   9087  C C   . LEU B 1 575 ? -55.518  -79.008 -13.178 1.00 74.52  ? 614  LEU C C   1 
ATOM   9088  O O   . LEU B 1 575 ? -56.191  -78.078 -13.619 1.00 70.12  ? 614  LEU C O   1 
ATOM   9089  C CB  . LEU B 1 575 ? -53.048  -78.851 -13.389 1.00 71.13  ? 614  LEU C CB  1 
ATOM   9090  C CG  . LEU B 1 575 ? -51.709  -78.198 -13.027 1.00 76.39  ? 614  LEU C CG  1 
ATOM   9091  C CD1 . LEU B 1 575 ? -51.645  -76.761 -13.528 1.00 70.14  ? 614  LEU C CD1 1 
ATOM   9092  C CD2 . LEU B 1 575 ? -51.441  -78.264 -11.534 1.00 80.74  ? 614  LEU C CD2 1 
ATOM   9093  N N   . SER B 1 576 ? -55.851  -80.284 -13.324 1.00 76.64  ? 615  SER C N   1 
ATOM   9094  C CA  . SER B 1 576 ? -57.005  -80.712 -14.101 1.00 78.87  ? 615  SER C CA  1 
ATOM   9095  C C   . SER B 1 576 ? -58.312  -80.162 -13.543 1.00 68.16  ? 615  SER C C   1 
ATOM   9096  O O   . SER B 1 576 ? -59.252  -79.912 -14.290 1.00 69.36  ? 615  SER C O   1 
ATOM   9097  C CB  . SER B 1 576 ? -57.062  -82.240 -14.132 1.00 78.96  ? 615  SER C CB  1 
ATOM   9098  O OG  . SER B 1 576 ? -55.756  -82.789 -14.220 1.00 83.46  ? 615  SER C OG  1 
ATOM   9099  N N   . LYS B 1 577 ? -58.367  -79.981 -12.227 1.00 69.85  ? 616  LYS C N   1 
ATOM   9100  C CA  . LYS B 1 577 ? -59.597  -79.542 -11.575 1.00 73.23  ? 616  LYS C CA  1 
ATOM   9101  C C   . LYS B 1 577 ? -59.473  -78.129 -11.009 1.00 65.45  ? 616  LYS C C   1 
ATOM   9102  O O   . LYS B 1 577 ? -60.441  -77.576 -10.489 1.00 53.03  ? 616  LYS C O   1 
ATOM   9103  C CB  . LYS B 1 577 ? -59.987  -80.517 -10.461 1.00 71.94  ? 616  LYS C CB  1 
ATOM   9104  C CG  . LYS B 1 577 ? -59.496  -81.937 -10.685 1.00 79.71  ? 616  LYS C CG  1 
ATOM   9105  C CD  . LYS B 1 577 ? -60.535  -82.963 -10.263 1.00 81.94  ? 616  LYS C CD  1 
ATOM   9106  C CE  . LYS B 1 577 ? -61.772  -82.880 -11.147 1.00 78.52  ? 616  LYS C CE  1 
ATOM   9107  N NZ  . LYS B 1 577 ? -62.740  -83.986 -10.885 1.00 72.68  ? 616  LYS C NZ  1 
ATOM   9108  N N   . ARG B 1 578 ? -58.281  -77.554 -11.123 1.00 61.44  ? 617  ARG C N   1 
ATOM   9109  C CA  . ARG B 1 578 ? -57.989  -76.243 -10.551 1.00 65.03  ? 617  ARG C CA  1 
ATOM   9110  C C   . ARG B 1 578 ? -58.974  -75.168 -11.020 1.00 66.08  ? 617  ARG C C   1 
ATOM   9111  O O   . ARG B 1 578 ? -59.661  -74.543 -10.208 1.00 62.87  ? 617  ARG C O   1 
ATOM   9112  C CB  . ARG B 1 578 ? -56.557  -75.831 -10.890 1.00 67.09  ? 617  ARG C CB  1 
ATOM   9113  C CG  . ARG B 1 578 ? -55.984  -74.779 -9.965  1.00 70.28  ? 617  ARG C CG  1 
ATOM   9114  C CD  . ARG B 1 578 ? -55.509  -73.570 -10.741 1.00 67.19  ? 617  ARG C CD  1 
ATOM   9115  N NE  . ARG B 1 578 ? -54.828  -72.615 -9.876  1.00 75.09  ? 617  ARG C NE  1 
ATOM   9116  C CZ  . ARG B 1 578 ? -53.507  -72.481 -9.811  1.00 80.40  ? 617  ARG C CZ  1 
ATOM   9117  N NH1 . ARG B 1 578 ? -52.721  -73.236 -10.569 1.00 75.49  ? 617  ARG C NH1 1 
ATOM   9118  N NH2 . ARG B 1 578 ? -52.973  -71.584 -8.995  1.00 79.47  ? 617  ARG C NH2 1 
ATOM   9119  N N   . ALA B 1 579 ? -59.041  -74.960 -12.331 1.00 63.05  ? 618  ALA C N   1 
ATOM   9120  C CA  . ALA B 1 579 ? -59.960  -73.980 -12.901 1.00 64.88  ? 618  ALA C CA  1 
ATOM   9121  C C   . ALA B 1 579 ? -61.343  -74.047 -12.254 1.00 64.46  ? 618  ALA C C   1 
ATOM   9122  O O   . ALA B 1 579 ? -61.910  -73.020 -11.872 1.00 64.49  ? 618  ALA C O   1 
ATOM   9123  C CB  . ALA B 1 579 ? -60.068  -74.169 -14.410 1.00 60.01  ? 618  ALA C CB  1 
ATOM   9124  N N   . LYS B 1 580 ? -61.875  -75.260 -12.129 1.00 54.37  ? 619  LYS C N   1 
ATOM   9125  C CA  . LYS B 1 580 ? -63.214  -75.470 -11.587 1.00 59.99  ? 619  LYS C CA  1 
ATOM   9126  C C   . LYS B 1 580 ? -63.251  -75.274 -10.071 1.00 58.74  ? 619  LYS C C   1 
ATOM   9127  O O   . LYS B 1 580 ? -64.224  -74.746 -9.524  1.00 56.15  ? 619  LYS C O   1 
ATOM   9128  C CB  . LYS B 1 580 ? -63.721  -76.876 -11.935 1.00 72.90  ? 619  LYS C CB  1 
ATOM   9129  C CG  . LYS B 1 580 ? -65.244  -76.980 -12.054 1.00 74.59  ? 619  LYS C CG  1 
ATOM   9130  C CD  . LYS B 1 580 ? -65.782  -78.367 -11.695 1.00 73.70  ? 619  LYS C CD  1 
ATOM   9131  C CE  . LYS B 1 580 ? -65.100  -79.482 -12.485 1.00 86.07  ? 619  LYS C CE  1 
ATOM   9132  N NZ  . LYS B 1 580 ? -63.769  -79.872 -11.925 1.00 76.36  ? 619  LYS C NZ  1 
ATOM   9133  N N   . PHE B 1 581 ? -62.195  -75.717 -9.396  1.00 56.36  ? 620  PHE C N   1 
ATOM   9134  C CA  . PHE B 1 581 ? -62.100  -75.571 -7.950  1.00 57.65  ? 620  PHE C CA  1 
ATOM   9135  C C   . PHE B 1 581 ? -62.165  -74.100 -7.539  1.00 53.69  ? 620  PHE C C   1 
ATOM   9136  O O   . PHE B 1 581 ? -63.056  -73.696 -6.796  1.00 53.86  ? 620  PHE C O   1 
ATOM   9137  C CB  . PHE B 1 581 ? -60.817  -76.224 -7.430  1.00 51.60  ? 620  PHE C CB  1 
ATOM   9138  C CG  . PHE B 1 581 ? -60.570  -76.002 -5.964  1.00 55.70  ? 620  PHE C CG  1 
ATOM   9139  C CD1 . PHE B 1 581 ? -61.425  -76.535 -5.015  1.00 58.02  ? 620  PHE C CD1 1 
ATOM   9140  C CD2 . PHE B 1 581 ? -59.475  -75.269 -5.537  1.00 53.57  ? 620  PHE C CD2 1 
ATOM   9141  C CE1 . PHE B 1 581 ? -61.196  -76.331 -3.667  1.00 61.98  ? 620  PHE C CE1 1 
ATOM   9142  C CE2 . PHE B 1 581 ? -59.240  -75.062 -4.193  1.00 52.88  ? 620  PHE C CE2 1 
ATOM   9143  C CZ  . PHE B 1 581 ? -60.099  -75.593 -3.256  1.00 57.16  ? 620  PHE C CZ  1 
ATOM   9144  N N   . VAL B 1 582 ? -61.238  -73.295 -8.044  1.00 50.70  ? 621  VAL C N   1 
ATOM   9145  C CA  . VAL B 1 582 ? -61.187  -71.888 -7.660  1.00 56.12  ? 621  VAL C CA  1 
ATOM   9146  C C   . VAL B 1 582 ? -62.343  -71.051 -8.227  1.00 52.15  ? 621  VAL C C   1 
ATOM   9147  O O   . VAL B 1 582 ? -62.830  -70.141 -7.559  1.00 52.86  ? 621  VAL C O   1 
ATOM   9148  C CB  . VAL B 1 582 ? -59.828  -71.232 -8.023  1.00 52.52  ? 621  VAL C CB  1 
ATOM   9149  C CG1 . VAL B 1 582 ? -58.675  -72.046 -7.453  1.00 52.65  ? 621  VAL C CG1 1 
ATOM   9150  C CG2 . VAL B 1 582 ? -59.684  -71.079 -9.527  1.00 57.52  ? 621  VAL C CG2 1 
ATOM   9151  N N   . GLY B 1 583 ? -62.789  -71.362 -9.443  1.00 53.23  ? 622  GLY C N   1 
ATOM   9152  C CA  . GLY B 1 583 ? -63.785  -70.544 -10.124 1.00 48.50  ? 622  GLY C CA  1 
ATOM   9153  C C   . GLY B 1 583 ? -63.146  -69.307 -10.740 1.00 56.39  ? 622  GLY C C   1 
ATOM   9154  O O   . GLY B 1 583 ? -61.993  -68.994 -10.443 1.00 44.80  ? 622  GLY C O   1 
ATOM   9155  N N   . PRO B 1 584 ? -63.881  -68.598 -11.612 1.00 55.69  ? 623  PRO C N   1 
ATOM   9156  C CA  . PRO B 1 584 ? -63.349  -67.375 -12.225 1.00 52.91  ? 623  PRO C CA  1 
ATOM   9157  C C   . PRO B 1 584 ? -62.976  -66.321 -11.187 1.00 53.81  ? 623  PRO C C   1 
ATOM   9158  O O   . PRO B 1 584 ? -63.754  -66.050 -10.274 1.00 51.17  ? 623  PRO C O   1 
ATOM   9159  C CB  . PRO B 1 584 ? -64.504  -66.882 -13.104 1.00 55.53  ? 623  PRO C CB  1 
ATOM   9160  C CG  . PRO B 1 584 ? -65.711  -67.634 -12.637 1.00 58.04  ? 623  PRO C CG  1 
ATOM   9161  C CD  . PRO B 1 584 ? -65.216  -68.940 -12.133 1.00 57.25  ? 623  PRO C CD  1 
ATOM   9162  N N   . GLY B 1 585 ? -61.784  -65.748 -11.328 1.00 52.13  ? 624  GLY C N   1 
ATOM   9163  C CA  . GLY B 1 585 ? -61.287  -64.756 -10.389 1.00 57.82  ? 624  GLY C CA  1 
ATOM   9164  C C   . GLY B 1 585 ? -61.097  -65.289 -8.979  1.00 57.53  ? 624  GLY C C   1 
ATOM   9165  O O   . GLY B 1 585 ? -60.779  -64.534 -8.059  1.00 53.07  ? 624  GLY C O   1 
ATOM   9166  N N   . GLY B 1 586 ? -61.291  -66.594 -8.808  1.00 56.68  ? 625  GLY C N   1 
ATOM   9167  C CA  . GLY B 1 586 ? -61.191  -67.216 -7.500  1.00 50.99  ? 625  GLY C CA  1 
ATOM   9168  C C   . GLY B 1 586 ? -62.488  -67.104 -6.721  1.00 45.92  ? 625  GLY C C   1 
ATOM   9169  O O   . GLY B 1 586 ? -62.507  -67.260 -5.500  1.00 49.24  ? 625  GLY C O   1 
ATOM   9170  N N   . TYR B 1 587 ? -63.573  -66.828 -7.437  1.00 47.73  ? 626  TYR C N   1 
ATOM   9171  C CA  . TYR B 1 587 ? -64.893  -66.652 -6.837  1.00 53.01  ? 626  TYR C CA  1 
ATOM   9172  C C   . TYR B 1 587 ? -65.249  -67.748 -5.828  1.00 54.45  ? 626  TYR C C   1 
ATOM   9173  O O   . TYR B 1 587 ? -65.630  -67.451 -4.696  1.00 50.52  ? 626  TYR C O   1 
ATOM   9174  C CB  . TYR B 1 587 ? -65.946  -66.599 -7.939  1.00 49.89  ? 626  TYR C CB  1 
ATOM   9175  C CG  . TYR B 1 587 ? -67.356  -66.321 -7.467  1.00 56.35  ? 626  TYR C CG  1 
ATOM   9176  C CD1 . TYR B 1 587 ? -68.172  -67.347 -7.008  1.00 58.51  ? 626  TYR C CD1 1 
ATOM   9177  C CD2 . TYR B 1 587 ? -67.881  -65.035 -7.509  1.00 59.80  ? 626  TYR C CD2 1 
ATOM   9178  C CE1 . TYR B 1 587 ? -69.463  -67.100 -6.587  1.00 58.40  ? 626  TYR C CE1 1 
ATOM   9179  C CE2 . TYR B 1 587 ? -69.174  -64.776 -7.092  1.00 62.79  ? 626  TYR C CE2 1 
ATOM   9180  C CZ  . TYR B 1 587 ? -69.962  -65.813 -6.631  1.00 61.22  ? 626  TYR C CZ  1 
ATOM   9181  O OH  . TYR B 1 587 ? -71.254  -65.561 -6.216  1.00 57.24  ? 626  TYR C OH  1 
ATOM   9182  N N   . ASN B 1 588 ? -65.128  -69.007 -6.246  1.00 47.57  ? 627  ASN C N   1 
ATOM   9183  C CA  . ASN B 1 588 ? -65.496  -70.142 -5.406  1.00 43.90  ? 627  ASN C CA  1 
ATOM   9184  C C   . ASN B 1 588 ? -64.817  -70.116 -4.047  1.00 44.33  ? 627  ASN C C   1 
ATOM   9185  O O   . ASN B 1 588 ? -65.437  -70.439 -3.037  1.00 42.48  ? 627  ASN C O   1 
ATOM   9186  C CB  . ASN B 1 588 ? -65.176  -71.466 -6.105  1.00 46.76  ? 627  ASN C CB  1 
ATOM   9187  C CG  . ASN B 1 588 ? -66.151  -71.789 -7.212  1.00 56.31  ? 627  ASN C CG  1 
ATOM   9188  O OD1 . ASN B 1 588 ? -67.114  -71.052 -7.441  1.00 61.82  ? 627  ASN C OD1 1 
ATOM   9189  N ND2 . ASN B 1 588 ? -65.906  -72.893 -7.915  1.00 52.44  ? 627  ASN C ND2 1 
ATOM   9190  N N   . LEU B 1 589 ? -63.545  -69.734 -4.025  1.00 41.55  ? 628  LEU C N   1 
ATOM   9191  C CA  . LEU B 1 589 ? -62.809  -69.673 -2.766  1.00 49.49  ? 628  LEU C CA  1 
ATOM   9192  C C   . LEU B 1 589 ? -63.412  -68.610 -1.865  1.00 48.29  ? 628  LEU C C   1 
ATOM   9193  O O   . LEU B 1 589 ? -63.532  -68.811 -0.657  1.00 50.21  ? 628  LEU C O   1 
ATOM   9194  C CB  . LEU B 1 589 ? -61.322  -69.376 -2.992  1.00 50.21  ? 628  LEU C CB  1 
ATOM   9195  C CG  . LEU B 1 589 ? -60.481  -70.367 -3.798  1.00 60.66  ? 628  LEU C CG  1 
ATOM   9196  C CD1 . LEU B 1 589 ? -59.053  -69.856 -3.909  1.00 59.66  ? 628  LEU C CD1 1 
ATOM   9197  C CD2 . LEU B 1 589 ? -60.510  -71.763 -3.180  1.00 55.97  ? 628  LEU C CD2 1 
ATOM   9198  N N   . LYS B 1 590 ? -63.790  -67.479 -2.456  1.00 49.90  ? 629  LYS C N   1 
ATOM   9199  C CA  . LYS B 1 590 ? -64.376  -66.375 -1.691  1.00 54.36  ? 629  LYS C CA  1 
ATOM   9200  C C   . LYS B 1 590 ? -65.712  -66.790 -1.091  1.00 51.36  ? 629  LYS C C   1 
ATOM   9201  O O   . LYS B 1 590 ? -65.954  -66.603 0.099   1.00 49.20  ? 629  LYS C O   1 
ATOM   9202  C CB  . LYS B 1 590 ? -64.581  -65.140 -2.572  1.00 49.07  ? 629  LYS C CB  1 
ATOM   9203  C CG  . LYS B 1 590 ? -63.354  -64.711 -3.351  1.00 49.83  ? 629  LYS C CG  1 
ATOM   9204  C CD  . LYS B 1 590 ? -62.353  -63.992 -2.478  1.00 58.74  ? 629  LYS C CD  1 
ATOM   9205  C CE  . LYS B 1 590 ? -61.170  -63.505 -3.311  1.00 65.80  ? 629  LYS C CE  1 
ATOM   9206  N NZ  . LYS B 1 590 ? -61.612  -62.782 -4.542  1.00 59.79  ? 629  LYS C NZ  1 
ATOM   9207  N N   . LYS B 1 591 ? -66.579  -67.350 -1.929  1.00 52.01  ? 630  LYS C N   1 
ATOM   9208  C CA  . LYS B 1 591 ? -67.885  -67.818 -1.478  1.00 50.25  ? 630  LYS C CA  1 
ATOM   9209  C C   . LYS B 1 591 ? -67.738  -68.906 -0.413  1.00 51.85  ? 630  LYS C C   1 
ATOM   9210  O O   . LYS B 1 591 ? -68.497  -68.939 0.553   1.00 55.98  ? 630  LYS C O   1 
ATOM   9211  C CB  . LYS B 1 591 ? -68.712  -68.325 -2.665  1.00 53.34  ? 630  LYS C CB  1 
ATOM   9212  C CG  . LYS B 1 591 ? -70.164  -68.652 -2.325  1.00 67.58  ? 630  LYS C CG  1 
ATOM   9213  C CD  . LYS B 1 591 ? -70.994  -68.930 -3.575  1.00 63.03  ? 630  LYS C CD  1 
ATOM   9214  C CE  . LYS B 1 591 ? -72.426  -69.288 -3.212  1.00 67.62  ? 630  LYS C CE  1 
ATOM   9215  N NZ  . LYS B 1 591 ? -73.298  -69.492 -4.401  1.00 71.50  ? 630  LYS C NZ  1 
ATOM   9216  N N   . LEU B 1 592 ? -66.753  -69.786 -0.587  1.00 49.84  ? 631  LEU C N   1 
ATOM   9217  C CA  . LEU B 1 592 ? -66.505  -70.857 0.378   1.00 50.63  ? 631  LEU C CA  1 
ATOM   9218  C C   . LEU B 1 592 ? -66.230  -70.313 1.781   1.00 53.49  ? 631  LEU C C   1 
ATOM   9219  O O   . LEU B 1 592 ? -66.836  -70.757 2.763   1.00 49.62  ? 631  LEU C O   1 
ATOM   9220  C CB  . LEU B 1 592 ? -65.346  -71.749 -0.081  1.00 47.02  ? 631  LEU C CB  1 
ATOM   9221  C CG  . LEU B 1 592 ? -64.643  -72.566 1.009   1.00 50.47  ? 631  LEU C CG  1 
ATOM   9222  C CD1 . LEU B 1 592 ? -65.588  -73.584 1.633   1.00 53.89  ? 631  LEU C CD1 1 
ATOM   9223  C CD2 . LEU B 1 592 ? -63.382  -73.247 0.474   1.00 46.41  ? 631  LEU C CD2 1 
ATOM   9224  N N   . GLN B 1 593 ? -65.312  -69.356 1.864   1.00 43.75  ? 632  GLN C N   1 
ATOM   9225  C CA  . GLN B 1 593 ? -64.965  -68.718 3.132   1.00 48.78  ? 632  GLN C CA  1 
ATOM   9226  C C   . GLN B 1 593 ? -66.164  -67.998 3.753   1.00 54.91  ? 632  GLN C C   1 
ATOM   9227  O O   . GLN B 1 593 ? -66.373  -68.051 4.969   1.00 51.43  ? 632  GLN C O   1 
ATOM   9228  C CB  . GLN B 1 593 ? -63.810  -67.739 2.925   1.00 41.66  ? 632  GLN C CB  1 
ATOM   9229  C CG  . GLN B 1 593 ? -62.603  -68.379 2.264   1.00 51.06  ? 632  GLN C CG  1 
ATOM   9230  C CD  . GLN B 1 593 ? -61.415  -67.438 2.131   1.00 47.48  ? 632  GLN C CD  1 
ATOM   9231  O OE1 . GLN B 1 593 ? -60.279  -67.835 2.383   1.00 43.81  ? 632  GLN C OE1 1 
ATOM   9232  N NE2 . GLN B 1 593 ? -61.670  -66.190 1.724   1.00 48.75  ? 632  GLN C NE2 1 
ATOM   9233  N N   . ALA B 1 594 ? -66.954  -67.341 2.909   1.00 48.84  ? 633  ALA C N   1 
ATOM   9234  C CA  . ALA B 1 594 ? -68.114  -66.584 3.367   1.00 54.08  ? 633  ALA C CA  1 
ATOM   9235  C C   . ALA B 1 594 ? -69.228  -67.482 3.914   1.00 57.10  ? 633  ALA C C   1 
ATOM   9236  O O   . ALA B 1 594 ? -69.928  -67.109 4.856   1.00 52.84  ? 633  ALA C O   1 
ATOM   9237  C CB  . ALA B 1 594 ? -68.647  -65.715 2.241   1.00 45.85  ? 633  ALA C CB  1 
ATOM   9238  N N   . GLU B 1 595 ? -69.391  -68.659 3.318   1.00 49.62  ? 634  GLU C N   1 
ATOM   9239  C CA  . GLU B 1 595 ? -70.488  -69.542 3.696   1.00 53.83  ? 634  GLU C CA  1 
ATOM   9240  C C   . GLU B 1 595 ? -70.156  -70.436 4.886   1.00 54.21  ? 634  GLU C C   1 
ATOM   9241  O O   . GLU B 1 595 ? -71.023  -70.724 5.714   1.00 58.94  ? 634  GLU C O   1 
ATOM   9242  C CB  . GLU B 1 595 ? -70.937  -70.392 2.505   1.00 57.09  ? 634  GLU C CB  1 
ATOM   9243  C CG  . GLU B 1 595 ? -71.625  -69.595 1.403   1.00 67.81  ? 634  GLU C CG  1 
ATOM   9244  C CD  . GLU B 1 595 ? -72.325  -70.481 0.380   1.00 82.68  ? 634  GLU C CD  1 
ATOM   9245  O OE1 . GLU B 1 595 ? -72.209  -71.724 0.479   1.00 86.49  ? 634  GLU C OE1 1 
ATOM   9246  O OE2 . GLU B 1 595 ? -72.998  -69.932 -0.521  1.00 76.67  ? 634  GLU C OE2 1 
ATOM   9247  N N   . THR B 1 596 ? -68.906  -70.880 4.969   1.00 45.28  ? 635  THR C N   1 
ATOM   9248  C CA  . THR B 1 596 ? -68.517  -71.798 6.028   1.00 45.18  ? 635  THR C CA  1 
ATOM   9249  C C   . THR B 1 596 ? -67.683  -71.118 7.105   1.00 48.25  ? 635  THR C C   1 
ATOM   9250  O O   . THR B 1 596 ? -67.560  -71.631 8.219   1.00 57.35  ? 635  THR C O   1 
ATOM   9251  C CB  . THR B 1 596 ? -67.738  -73.005 5.473   1.00 52.86  ? 635  THR C CB  1 
ATOM   9252  O OG1 . THR B 1 596 ? -66.436  -72.586 5.039   1.00 52.55  ? 635  THR C OG1 1 
ATOM   9253  C CG2 . THR B 1 596 ? -68.491  -73.631 4.314   1.00 45.59  ? 635  THR C CG2 1 
ATOM   9254  N N   . GLY B 1 597 ? -67.109  -69.968 6.776   1.00 45.62  ? 636  GLY C N   1 
ATOM   9255  C CA  . GLY B 1 597 ? -66.305  -69.235 7.737   1.00 47.68  ? 636  GLY C CA  1 
ATOM   9256  C C   . GLY B 1 597 ? -64.917  -69.828 7.908   1.00 55.11  ? 636  GLY C C   1 
ATOM   9257  O O   . GLY B 1 597 ? -64.273  -69.660 8.951   1.00 47.28  ? 636  GLY C O   1 
ATOM   9258  N N   . VAL B 1 598 ? -64.455  -70.545 6.889   1.00 42.08  ? 637  VAL C N   1 
ATOM   9259  C CA  . VAL B 1 598 ? -63.084  -71.026 6.886   1.00 44.05  ? 637  VAL C CA  1 
ATOM   9260  C C   . VAL B 1 598 ? -62.230  -70.037 6.119   1.00 43.77  ? 637  VAL C C   1 
ATOM   9261  O O   . VAL B 1 598 ? -62.746  -69.203 5.382   1.00 47.16  ? 637  VAL C O   1 
ATOM   9262  C CB  . VAL B 1 598 ? -62.951  -72.408 6.216   1.00 43.09  ? 637  VAL C CB  1 
ATOM   9263  C CG1 . VAL B 1 598 ? -63.870  -73.414 6.895   1.00 47.18  ? 637  VAL C CG1 1 
ATOM   9264  C CG2 . VAL B 1 598 ? -63.261  -72.310 4.732   1.00 33.23  ? 637  VAL C CG2 1 
ATOM   9265  N N   . THR B 1 599 ? -60.921  -70.132 6.294   1.00 41.80  ? 638  THR C N   1 
ATOM   9266  C CA  . THR B 1 599 ? -60.011  -69.327 5.512   1.00 41.25  ? 638  THR C CA  1 
ATOM   9267  C C   . THR B 1 599 ? -59.118  -70.265 4.723   1.00 47.67  ? 638  THR C C   1 
ATOM   9268  O O   . THR B 1 599 ? -58.495  -71.169 5.288   1.00 46.27  ? 638  THR C O   1 
ATOM   9269  C CB  . THR B 1 599 ? -59.135  -68.414 6.396   1.00 48.68  ? 638  THR C CB  1 
ATOM   9270  O OG1 . THR B 1 599 ? -59.964  -67.615 7.250   1.00 42.94  ? 638  THR C OG1 1 
ATOM   9271  C CG2 . THR B 1 599 ? -58.272  -67.510 5.527   1.00 45.99  ? 638  THR C CG2 1 
ATOM   9272  N N   . ILE B 1 600 ? -59.058  -70.051 3.416   1.00 39.38  ? 639  ILE C N   1 
ATOM   9273  C CA  . ILE B 1 600 ? -58.274  -70.916 2.550   1.00 49.96  ? 639  ILE C CA  1 
ATOM   9274  C C   . ILE B 1 600 ? -57.173  -70.131 1.832   1.00 52.61  ? 639  ILE C C   1 
ATOM   9275  O O   . ILE B 1 600 ? -57.418  -69.055 1.283   1.00 52.90  ? 639  ILE C O   1 
ATOM   9276  C CB  . ILE B 1 600 ? -59.181  -71.666 1.548   1.00 44.77  ? 639  ILE C CB  1 
ATOM   9277  C CG1 . ILE B 1 600 ? -58.364  -72.631 0.691   1.00 46.68  ? 639  ILE C CG1 1 
ATOM   9278  C CG2 . ILE B 1 600 ? -59.970  -70.691 0.685   1.00 44.75  ? 639  ILE C CG2 1 
ATOM   9279  C CD1 . ILE B 1 600 ? -59.220  -73.544 -0.169  1.00 55.93  ? 639  ILE C CD1 1 
ATOM   9280  N N   . SER B 1 601 ? -55.953  -70.663 1.868   1.00 45.10  ? 640  SER C N   1 
ATOM   9281  C CA  . SER B 1 601 ? -54.820  -70.021 1.212   1.00 45.37  ? 640  SER C CA  1 
ATOM   9282  C C   . SER B 1 601 ? -54.079  -70.973 0.282   1.00 54.50  ? 640  SER C C   1 
ATOM   9283  O O   . SER B 1 601 ? -53.708  -72.080 0.669   1.00 51.13  ? 640  SER C O   1 
ATOM   9284  C CB  . SER B 1 601 ? -53.855  -69.441 2.242   1.00 53.69  ? 640  SER C CB  1 
ATOM   9285  O OG  . SER B 1 601 ? -54.323  -68.197 2.732   1.00 66.83  ? 640  SER C OG  1 
ATOM   9286  N N   . GLN B 1 602 ? -53.862  -70.527 -0.947  1.00 50.77  ? 641  GLN C N   1 
ATOM   9287  C CA  . GLN B 1 602 ? -53.174  -71.333 -1.936  1.00 54.03  ? 641  GLN C CA  1 
ATOM   9288  C C   . GLN B 1 602 ? -51.699  -71.445 -1.589  1.00 59.21  ? 641  GLN C C   1 
ATOM   9289  O O   . GLN B 1 602 ? -51.003  -70.437 -1.443  1.00 50.32  ? 641  GLN C O   1 
ATOM   9290  C CB  . GLN B 1 602 ? -53.341  -70.723 -3.326  1.00 58.14  ? 641  GLN C CB  1 
ATOM   9291  C CG  . GLN B 1 602 ? -52.666  -71.501 -4.441  1.00 53.13  ? 641  GLN C CG  1 
ATOM   9292  C CD  . GLN B 1 602 ? -52.985  -70.933 -5.808  1.00 61.12  ? 641  GLN C CD  1 
ATOM   9293  O OE1 . GLN B 1 602 ? -52.087  -70.664 -6.604  1.00 73.49  ? 641  GLN C OE1 1 
ATOM   9294  N NE2 . GLN B 1 602 ? -54.271  -70.748 -6.088  1.00 60.27  ? 641  GLN C NE2 1 
ATOM   9295  N N   . VAL B 1 603 ? -51.232  -72.680 -1.455  1.00 50.34  ? 642  VAL C N   1 
ATOM   9296  C CA  . VAL B 1 603 ? -49.826  -72.952 -1.183  1.00 60.59  ? 642  VAL C CA  1 
ATOM   9297  C C   . VAL B 1 603 ? -48.994  -73.087 -2.468  1.00 61.98  ? 642  VAL C C   1 
ATOM   9298  O O   . VAL B 1 603 ? -47.938  -72.465 -2.577  1.00 64.38  ? 642  VAL C O   1 
ATOM   9299  C CB  . VAL B 1 603 ? -49.664  -74.201 -0.300  1.00 59.20  ? 642  VAL C CB  1 
ATOM   9300  C CG1 . VAL B 1 603 ? -48.195  -74.524 -0.091  1.00 57.52  ? 642  VAL C CG1 1 
ATOM   9301  C CG2 . VAL B 1 603 ? -50.369  -73.988 1.031   1.00 55.25  ? 642  VAL C CG2 1 
ATOM   9302  N N   . ASP B 1 604 ? -49.464  -73.882 -3.436  1.00 64.80  ? 643  ASP C N   1 
ATOM   9303  C CA  . ASP B 1 604 ? -48.715  -74.079 -4.687  1.00 65.98  ? 643  ASP C CA  1 
ATOM   9304  C C   . ASP B 1 604 ? -49.446  -74.826 -5.816  1.00 76.55  ? 643  ASP C C   1 
ATOM   9305  O O   . ASP B 1 604 ? -49.123  -75.977 -6.130  1.00 74.40  ? 643  ASP C O   1 
ATOM   9306  C CB  . ASP B 1 604 ? -47.359  -74.752 -4.411  1.00 67.37  ? 643  ASP C CB  1 
ATOM   9307  C CG  . ASP B 1 604 ? -47.500  -76.109 -3.732  1.00 74.66  ? 643  ASP C CG  1 
ATOM   9308  O OD1 . ASP B 1 604 ? -46.622  -76.465 -2.915  1.00 73.47  ? 643  ASP C OD1 1 
ATOM   9309  O OD2 . ASP B 1 604 ? -48.485  -76.823 -4.012  1.00 69.40  ? 643  ASP C OD2 1 
ATOM   9310  N N   . GLU B 1 605 ? -50.418  -74.166 -6.438  1.00 72.95  ? 644  GLU C N   1 
ATOM   9311  C CA  . GLU B 1 605 ? -51.050  -74.695 -7.653  1.00 79.86  ? 644  GLU C CA  1 
ATOM   9312  C C   . GLU B 1 605 ? -51.771  -76.031 -7.474  1.00 72.96  ? 644  GLU C C   1 
ATOM   9313  O O   . GLU B 1 605 ? -52.830  -76.264 -8.065  1.00 73.25  ? 644  GLU C O   1 
ATOM   9314  C CB  . GLU B 1 605 ? -50.020  -74.822 -8.774  1.00 76.65  ? 644  GLU C CB  1 
ATOM   9315  C CG  . GLU B 1 605 ? -49.468  -73.493 -9.245  1.00 85.52  ? 644  GLU C CG  1 
ATOM   9316  C CD  . GLU B 1 605 ? -48.033  -73.604 -9.701  1.00 94.31  ? 644  GLU C CD  1 
ATOM   9317  O OE1 . GLU B 1 605 ? -47.465  -74.714 -9.597  1.00 87.63  ? 644  GLU C OE1 1 
ATOM   9318  O OE2 . GLU B 1 605 ? -47.475  -72.581 -10.156 1.00 96.11  ? 644  GLU C OE2 1 
ATOM   9319  N N   . GLU B 1 606 ? -51.193  -76.914 -6.672  1.00 64.71  ? 645  GLU C N   1 
ATOM   9320  C CA  . GLU B 1 606 ? -51.830  -78.195 -6.410  1.00 72.65  ? 645  GLU C CA  1 
ATOM   9321  C C   . GLU B 1 606 ? -52.204  -78.337 -4.935  1.00 65.51  ? 645  GLU C C   1 
ATOM   9322  O O   . GLU B 1 606 ? -52.934  -79.251 -4.553  1.00 68.89  ? 645  GLU C O   1 
ATOM   9323  C CB  . GLU B 1 606 ? -50.918  -79.339 -6.855  1.00 70.45  ? 645  GLU C CB  1 
ATOM   9324  C CG  . GLU B 1 606 ? -50.424  -79.201 -8.290  1.00 72.43  ? 645  GLU C CG  1 
ATOM   9325  C CD  . GLU B 1 606 ? -50.629  -80.466 -9.110  1.00 86.61  ? 645  GLU C CD  1 
ATOM   9326  O OE1 . GLU B 1 606 ? -49.698  -81.301 -9.162  1.00 88.36  ? 645  GLU C OE1 1 
ATOM   9327  O OE2 . GLU B 1 606 ? -51.720  -80.625 -9.702  1.00 80.94  ? 645  GLU C OE2 1 
ATOM   9328  N N   . THR B 1 607 ? -51.713  -77.411 -4.118  1.00 62.17  ? 646  THR C N   1 
ATOM   9329  C CA  . THR B 1 607 ? -51.896  -77.470 -2.674  1.00 60.15  ? 646  THR C CA  1 
ATOM   9330  C C   . THR B 1 607 ? -52.610  -76.236 -2.116  1.00 67.73  ? 646  THR C C   1 
ATOM   9331  O O   . THR B 1 607 ? -52.189  -75.100 -2.351  1.00 59.00  ? 646  THR C O   1 
ATOM   9332  C CB  . THR B 1 607 ? -50.536  -77.597 -1.966  1.00 63.57  ? 646  THR C CB  1 
ATOM   9333  O OG1 . THR B 1 607 ? -49.759  -78.618 -2.605  1.00 75.84  ? 646  THR C OG1 1 
ATOM   9334  C CG2 . THR B 1 607 ? -50.722  -77.940 -0.499  1.00 63.45  ? 646  THR C CG2 1 
ATOM   9335  N N   . PHE B 1 608 ? -53.689  -76.466 -1.373  1.00 57.47  ? 647  PHE C N   1 
ATOM   9336  C CA  . PHE B 1 608 ? -54.379  -75.392 -0.667  1.00 60.90  ? 647  PHE C CA  1 
ATOM   9337  C C   . PHE B 1 608 ? -54.419  -75.707 0.822   1.00 58.47  ? 647  PHE C C   1 
ATOM   9338  O O   . PHE B 1 608 ? -54.560  -76.865 1.211   1.00 60.10  ? 647  PHE C O   1 
ATOM   9339  C CB  . PHE B 1 608 ? -55.806  -75.223 -1.192  1.00 59.57  ? 647  PHE C CB  1 
ATOM   9340  C CG  . PHE B 1 608 ? -55.885  -74.658 -2.586  1.00 62.89  ? 647  PHE C CG  1 
ATOM   9341  C CD1 . PHE B 1 608 ? -56.093  -73.305 -2.789  1.00 53.96  ? 647  PHE C CD1 1 
ATOM   9342  C CD2 . PHE B 1 608 ? -55.765  -75.481 -3.693  1.00 60.02  ? 647  PHE C CD2 1 
ATOM   9343  C CE1 . PHE B 1 608 ? -56.173  -72.783 -4.065  1.00 57.36  ? 647  PHE C CE1 1 
ATOM   9344  C CE2 . PHE B 1 608 ? -55.844  -74.963 -4.975  1.00 60.12  ? 647  PHE C CE2 1 
ATOM   9345  C CZ  . PHE B 1 608 ? -56.046  -73.614 -5.161  1.00 66.46  ? 647  PHE C CZ  1 
ATOM   9346  N N   . SER B 1 609 ? -54.285  -74.682 1.658   1.00 59.57  ? 648  SER C N   1 
ATOM   9347  C CA  . SER B 1 609 ? -54.438  -74.863 3.099   1.00 47.01  ? 648  SER C CA  1 
ATOM   9348  C C   . SER B 1 609 ? -55.758  -74.275 3.555   1.00 46.10  ? 648  SER C C   1 
ATOM   9349  O O   . SER B 1 609 ? -56.205  -73.244 3.043   1.00 48.16  ? 648  SER C O   1 
ATOM   9350  C CB  . SER B 1 609 ? -53.283  -74.226 3.875   1.00 52.12  ? 648  SER C CB  1 
ATOM   9351  O OG  . SER B 1 609 ? -53.430  -74.456 5.270   1.00 57.24  ? 648  SER C OG  1 
ATOM   9352  N N   . VAL B 1 610 ? -56.379  -74.938 4.518   1.00 45.85  ? 649  VAL C N   1 
ATOM   9353  C CA  . VAL B 1 610 ? -57.666  -74.502 5.029   1.00 48.86  ? 649  VAL C CA  1 
ATOM   9354  C C   . VAL B 1 610 ? -57.599  -74.344 6.533   1.00 55.19  ? 649  VAL C C   1 
ATOM   9355  O O   . VAL B 1 610 ? -57.298  -75.298 7.255   1.00 44.95  ? 649  VAL C O   1 
ATOM   9356  C CB  . VAL B 1 610 ? -58.792  -75.496 4.690   1.00 53.75  ? 649  VAL C CB  1 
ATOM   9357  C CG1 . VAL B 1 610 ? -60.098  -75.042 5.328   1.00 45.42  ? 649  VAL C CG1 1 
ATOM   9358  C CG2 . VAL B 1 610 ? -58.948  -75.634 3.183   1.00 47.52  ? 649  VAL C CG2 1 
ATOM   9359  N N   . PHE B 1 611 ? -57.851  -73.124 6.998   1.00 48.63  ? 650  PHE C N   1 
ATOM   9360  C CA  . PHE B 1 611 ? -58.013  -72.875 8.418   1.00 43.37  ? 650  PHE C CA  1 
ATOM   9361  C C   . PHE B 1 611 ? -59.506  -72.871 8.713   1.00 39.61  ? 650  PHE C C   1 
ATOM   9362  O O   . PHE B 1 611 ? -60.276  -72.214 8.024   1.00 44.66  ? 650  PHE C O   1 
ATOM   9363  C CB  . PHE B 1 611 ? -57.377  -71.537 8.828   1.00 49.65  ? 650  PHE C CB  1 
ATOM   9364  C CG  . PHE B 1 611 ? -57.676  -71.140 10.245  1.00 42.09  ? 650  PHE C CG  1 
ATOM   9365  C CD1 . PHE B 1 611 ? -56.819  -71.503 11.275  1.00 45.16  ? 650  PHE C CD1 1 
ATOM   9366  C CD2 . PHE B 1 611 ? -58.831  -70.428 10.551  1.00 45.50  ? 650  PHE C CD2 1 
ATOM   9367  C CE1 . PHE B 1 611 ? -57.095  -71.158 12.590  1.00 46.54  ? 650  PHE C CE1 1 
ATOM   9368  C CE2 . PHE B 1 611 ? -59.124  -70.074 11.863  1.00 44.24  ? 650  PHE C CE2 1 
ATOM   9369  C CZ  . PHE B 1 611 ? -58.252  -70.439 12.887  1.00 50.12  ? 650  PHE C CZ  1 
ATOM   9370  N N   . ALA B 1 612 ? -59.910  -73.634 9.721   1.00 35.76  ? 651  ALA C N   1 
ATOM   9371  C CA  . ALA B 1 612 ? -61.293  -73.668 10.157  1.00 40.40  ? 651  ALA C CA  1 
ATOM   9372  C C   . ALA B 1 612 ? -61.317  -73.442 11.659  1.00 39.99  ? 651  ALA C C   1 
ATOM   9373  O O   . ALA B 1 612 ? -60.575  -74.087 12.398  1.00 51.40  ? 651  ALA C O   1 
ATOM   9374  C CB  . ALA B 1 612 ? -61.944  -75.015 9.800   1.00 45.95  ? 651  ALA C CB  1 
ATOM   9375  N N   . PRO B 1 613 ? -62.164  -72.512 12.114  1.00 45.40  ? 652  PRO C N   1 
ATOM   9376  C CA  . PRO B 1 613 ? -62.225  -72.094 13.521  1.00 48.28  ? 652  PRO C CA  1 
ATOM   9377  C C   . PRO B 1 613 ? -62.709  -73.229 14.416  1.00 57.43  ? 652  PRO C C   1 
ATOM   9378  O O   . PRO B 1 613 ? -62.387  -73.260 15.606  1.00 56.95  ? 652  PRO C O   1 
ATOM   9379  C CB  . PRO B 1 613 ? -63.261  -70.961 13.504  1.00 51.52  ? 652  PRO C CB  1 
ATOM   9380  C CG  . PRO B 1 613 ? -63.362  -70.537 12.056  1.00 52.34  ? 652  PRO C CG  1 
ATOM   9381  C CD  . PRO B 1 613 ? -63.132  -71.787 11.276  1.00 47.09  ? 652  PRO C CD  1 
ATOM   9382  N N   . THR B 1 614 ? -63.476  -74.147 13.832  1.00 50.41  ? 653  THR C N   1 
ATOM   9383  C CA  . THR B 1 614 ? -64.026  -75.293 14.549  1.00 56.95  ? 653  THR C CA  1 
ATOM   9384  C C   . THR B 1 614 ? -64.012  -76.545 13.671  1.00 55.71  ? 653  THR C C   1 
ATOM   9385  O O   . THR B 1 614 ? -63.862  -76.451 12.451  1.00 46.29  ? 653  THR C O   1 
ATOM   9386  C CB  . THR B 1 614 ? -65.482  -75.036 14.963  1.00 54.40  ? 653  THR C CB  1 
ATOM   9387  O OG1 . THR B 1 614 ? -66.299  -74.934 13.787  1.00 55.09  ? 653  THR C OG1 1 
ATOM   9388  C CG2 . THR B 1 614 ? -65.590  -73.749 15.781  1.00 57.48  ? 653  THR C CG2 1 
ATOM   9389  N N   . PRO B 1 615 ? -64.159  -77.726 14.294  1.00 57.27  ? 654  PRO C N   1 
ATOM   9390  C CA  . PRO B 1 615 ? -64.310  -78.965 13.521  1.00 59.27  ? 654  PRO C CA  1 
ATOM   9391  C C   . PRO B 1 615 ? -65.550  -78.921 12.630  1.00 50.30  ? 654  PRO C C   1 
ATOM   9392  O O   . PRO B 1 615 ? -65.491  -79.376 11.490  1.00 55.13  ? 654  PRO C O   1 
ATOM   9393  C CB  . PRO B 1 615 ? -64.472  -80.038 14.604  1.00 55.07  ? 654  PRO C CB  1 
ATOM   9394  C CG  . PRO B 1 615 ? -63.788  -79.468 15.799  1.00 65.97  ? 654  PRO C CG  1 
ATOM   9395  C CD  . PRO B 1 615 ? -64.056  -77.987 15.741  1.00 53.05  ? 654  PRO C CD  1 
ATOM   9396  N N   . SER B 1 616 ? -66.652  -78.375 13.136  1.00 44.60  ? 655  SER C N   1 
ATOM   9397  C CA  . SER B 1 616 ? -67.867  -78.269 12.337  1.00 46.39  ? 655  SER C CA  1 
ATOM   9398  C C   . SER B 1 616 ? -67.619  -77.441 11.083  1.00 58.75  ? 655  SER C C   1 
ATOM   9399  O O   . SER B 1 616 ? -68.061  -77.798 9.986   1.00 53.01  ? 655  SER C O   1 
ATOM   9400  C CB  . SER B 1 616 ? -69.005  -77.656 13.152  1.00 51.06  ? 655  SER C CB  1 
ATOM   9401  O OG  . SER B 1 616 ? -69.315  -78.458 14.277  1.00 57.29  ? 655  SER C OG  1 
ATOM   9402  N N   . ALA B 1 617 ? -66.905  -76.331 11.246  1.00 56.48  ? 656  ALA C N   1 
ATOM   9403  C CA  . ALA B 1 617 ? -66.626  -75.452 10.118  1.00 56.01  ? 656  ALA C CA  1 
ATOM   9404  C C   . ALA B 1 617 ? -65.836  -76.208 9.051   1.00 50.16  ? 656  ALA C C   1 
ATOM   9405  O O   . ALA B 1 617 ? -66.130  -76.102 7.864   1.00 47.45  ? 656  ALA C O   1 
ATOM   9406  C CB  . ALA B 1 617 ? -65.872  -74.190 10.577  1.00 48.97  ? 656  ALA C CB  1 
ATOM   9407  N N   . MET B 1 618 ? -64.839  -76.977 9.480   1.00 39.23  ? 657  MET C N   1 
ATOM   9408  C CA  . MET B 1 618 ? -64.012  -77.721 8.543   1.00 46.13  ? 657  MET C CA  1 
ATOM   9409  C C   . MET B 1 618 ? -64.858  -78.700 7.742   1.00 47.47  ? 657  MET C C   1 
ATOM   9410  O O   . MET B 1 618 ? -64.622  -78.904 6.554   1.00 51.03  ? 657  MET C O   1 
ATOM   9411  C CB  . MET B 1 618 ? -62.898  -78.468 9.276   1.00 42.36  ? 657  MET C CB  1 
ATOM   9412  C CG  . MET B 1 618 ? -61.992  -79.248 8.353   1.00 53.02  ? 657  MET C CG  1 
ATOM   9413  S SD  . MET B 1 618 ? -61.095  -78.206 7.191   1.00 53.22  ? 657  MET C SD  1 
ATOM   9414  C CE  . MET B 1 618 ? -59.790  -77.566 8.241   1.00 59.96  ? 657  MET C CE  1 
ATOM   9415  N N   . HIS B 1 619 ? -65.848  -79.294 8.398   1.00 48.76  ? 658  HIS C N   1 
ATOM   9416  C CA  . HIS B 1 619 ? -66.695  -80.298 7.758   1.00 56.04  ? 658  HIS C CA  1 
ATOM   9417  C C   . HIS B 1 619 ? -67.547  -79.699 6.645   1.00 57.88  ? 658  HIS C C   1 
ATOM   9418  O O   . HIS B 1 619 ? -67.595  -80.242 5.541   1.00 53.79  ? 658  HIS C O   1 
ATOM   9419  C CB  . HIS B 1 619 ? -67.569  -81.021 8.792   1.00 55.47  ? 658  HIS C CB  1 
ATOM   9420  C CG  . HIS B 1 619 ? -66.793  -81.900 9.727   1.00 75.01  ? 658  HIS C CG  1 
ATOM   9421  N ND1 . HIS B 1 619 ? -65.600  -82.492 9.374   1.00 76.99  ? 658  HIS C ND1 1 
ATOM   9422  C CD2 . HIS B 1 619 ? -67.038  -82.280 11.005  1.00 77.53  ? 658  HIS C CD2 1 
ATOM   9423  C CE1 . HIS B 1 619 ? -65.143  -83.202 10.391  1.00 75.42  ? 658  HIS C CE1 1 
ATOM   9424  N NE2 . HIS B 1 619 ? -65.996  -83.089 11.394  1.00 77.14  ? 658  HIS C NE2 1 
ATOM   9425  N N   . GLU B 1 620 ? -68.208  -78.580 6.932   1.00 52.24  ? 659  GLU C N   1 
ATOM   9426  C CA  . GLU B 1 620 ? -69.013  -77.895 5.925   1.00 55.10  ? 659  GLU C CA  1 
ATOM   9427  C C   . GLU B 1 620 ? -68.152  -77.458 4.748   1.00 54.42  ? 659  GLU C C   1 
ATOM   9428  O O   . GLU B 1 620 ? -68.628  -77.391 3.613   1.00 54.49  ? 659  GLU C O   1 
ATOM   9429  C CB  . GLU B 1 620 ? -69.685  -76.659 6.512   1.00 56.33  ? 659  GLU C CB  1 
ATOM   9430  C CG  . GLU B 1 620 ? -70.574  -76.908 7.699   1.00 53.98  ? 659  GLU C CG  1 
ATOM   9431  C CD  . GLU B 1 620 ? -71.122  -75.609 8.253   1.00 64.34  ? 659  GLU C CD  1 
ATOM   9432  O OE1 . GLU B 1 620 ? -71.533  -75.587 9.431   1.00 66.09  ? 659  GLU C OE1 1 
ATOM   9433  O OE2 . GLU B 1 620 ? -71.133  -74.605 7.506   1.00 60.37  ? 659  GLU C OE2 1 
ATOM   9434  N N   . ALA B 1 621 ? -66.891  -77.138 5.028   1.00 52.01  ? 660  ALA C N   1 
ATOM   9435  C CA  . ALA B 1 621 ? -65.961  -76.719 3.982   1.00 55.37  ? 660  ALA C CA  1 
ATOM   9436  C C   . ALA B 1 621 ? -65.504  -77.915 3.147   1.00 53.29  ? 660  ALA C C   1 
ATOM   9437  O O   . ALA B 1 621 ? -65.368  -77.812 1.926   1.00 47.65  ? 660  ALA C O   1 
ATOM   9438  C CB  . ALA B 1 621 ? -64.768  -75.991 4.584   1.00 41.87  ? 660  ALA C CB  1 
ATOM   9439  N N   . ARG B 1 622 ? -65.266  -79.049 3.806   1.00 53.53  ? 661  ARG C N   1 
ATOM   9440  C CA  . ARG B 1 622 ? -64.926  -80.276 3.085   1.00 54.47  ? 661  ARG C CA  1 
ATOM   9441  C C   . ARG B 1 622 ? -66.056  -80.637 2.127   1.00 50.03  ? 661  ARG C C   1 
ATOM   9442  O O   . ARG B 1 622 ? -65.822  -80.963 0.961   1.00 49.30  ? 661  ARG C O   1 
ATOM   9443  C CB  . ARG B 1 622 ? -64.636  -81.439 4.045   1.00 44.27  ? 661  ARG C CB  1 
ATOM   9444  C CG  . ARG B 1 622 ? -63.281  -81.358 4.737   1.00 67.55  ? 661  ARG C CG  1 
ATOM   9445  C CD  . ARG B 1 622 ? -62.696  -82.750 4.961   1.00 81.17  ? 661  ARG C CD  1 
ATOM   9446  N NE  . ARG B 1 622 ? -61.967  -82.851 6.222   1.00 83.71  ? 661  ARG C NE  1 
ATOM   9447  C CZ  . ARG B 1 622 ? -62.515  -83.246 7.369   1.00 84.88  ? 661  ARG C CZ  1 
ATOM   9448  N NH1 . ARG B 1 622 ? -63.802  -83.575 7.414   1.00 75.83  ? 661  ARG C NH1 1 
ATOM   9449  N NH2 . ARG B 1 622 ? -61.778  -83.314 8.472   1.00 78.07  ? 661  ARG C NH2 1 
ATOM   9450  N N   . ASP B 1 623 ? -67.285  -80.560 2.625   1.00 50.81  ? 662  ASP C N   1 
ATOM   9451  C CA  . ASP B 1 623 ? -68.460  -80.775 1.795   1.00 52.14  ? 662  ASP C CA  1 
ATOM   9452  C C   . ASP B 1 623 ? -68.499  -79.815 0.612   1.00 57.78  ? 662  ASP C C   1 
ATOM   9453  O O   . ASP B 1 623 ? -68.539  -80.250 -0.539  1.00 62.17  ? 662  ASP C O   1 
ATOM   9454  C CB  . ASP B 1 623 ? -69.740  -80.654 2.629   1.00 56.06  ? 662  ASP C CB  1 
ATOM   9455  C CG  . ASP B 1 623 ? -69.954  -81.852 3.548   1.00 69.63  ? 662  ASP C CG  1 
ATOM   9456  O OD1 . ASP B 1 623 ? -69.019  -82.674 3.695   1.00 67.05  ? 662  ASP C OD1 1 
ATOM   9457  O OD2 . ASP B 1 623 ? -71.056  -81.967 4.128   1.00 71.55  ? 662  ASP C OD2 1 
ATOM   9458  N N   . PHE B 1 624 ? -68.490  -78.513 0.902   1.00 60.92  ? 663  PHE C N   1 
ATOM   9459  C CA  . PHE B 1 624 ? -68.557  -77.478 -0.131  1.00 43.23  ? 663  PHE C CA  1 
ATOM   9460  C C   . PHE B 1 624 ? -67.525  -77.756 -1.215  1.00 44.72  ? 663  PHE C C   1 
ATOM   9461  O O   . PHE B 1 624 ? -67.817  -77.641 -2.403  1.00 59.71  ? 663  PHE C O   1 
ATOM   9462  C CB  . PHE B 1 624 ? -68.331  -76.094 0.494   1.00 59.26  ? 663  PHE C CB  1 
ATOM   9463  C CG  . PHE B 1 624 ? -68.347  -74.946 -0.498  1.00 52.79  ? 663  PHE C CG  1 
ATOM   9464  C CD1 . PHE B 1 624 ? -69.394  -74.032 -0.506  1.00 54.08  ? 663  PHE C CD1 1 
ATOM   9465  C CD2 . PHE B 1 624 ? -67.305  -74.773 -1.405  1.00 50.71  ? 663  PHE C CD2 1 
ATOM   9466  C CE1 . PHE B 1 624 ? -69.407  -72.970 -1.406  1.00 61.87  ? 663  PHE C CE1 1 
ATOM   9467  C CE2 . PHE B 1 624 ? -67.310  -73.716 -2.309  1.00 54.61  ? 663  PHE C CE2 1 
ATOM   9468  C CZ  . PHE B 1 624 ? -68.362  -72.812 -2.312  1.00 57.29  ? 663  PHE C CZ  1 
ATOM   9469  N N   . ILE B 1 625 ? -66.324  -78.134 -0.792  1.00 49.50  ? 664  ILE C N   1 
ATOM   9470  C CA  . ILE B 1 625 ? -65.214  -78.420 -1.700  1.00 57.38  ? 664  ILE C CA  1 
ATOM   9471  C C   . ILE B 1 625 ? -65.455  -79.635 -2.597  1.00 62.67  ? 664  ILE C C   1 
ATOM   9472  O O   . ILE B 1 625 ? -65.386  -79.525 -3.822  1.00 58.55  ? 664  ILE C O   1 
ATOM   9473  C CB  . ILE B 1 625 ? -63.898  -78.632 -0.927  1.00 58.38  ? 664  ILE C CB  1 
ATOM   9474  C CG1 . ILE B 1 625 ? -63.296  -77.288 -0.509  1.00 48.84  ? 664  ILE C CG1 1 
ATOM   9475  C CG2 . ILE B 1 625 ? -62.899  -79.401 -1.779  1.00 64.23  ? 664  ILE C CG2 1 
ATOM   9476  C CD1 . ILE B 1 625 ? -62.048  -77.428 0.348   1.00 47.50  ? 664  ILE C CD1 1 
ATOM   9477  N N   . THR B 1 626 ? -65.718  -80.790 -1.986  1.00 60.72  ? 665  THR C N   1 
ATOM   9478  C CA  . THR B 1 626 ? -66.019  -82.006 -2.741  1.00 65.40  ? 665  THR C CA  1 
ATOM   9479  C C   . THR B 1 626 ? -67.084  -81.718 -3.799  1.00 66.63  ? 665  THR C C   1 
ATOM   9480  O O   . THR B 1 626 ? -66.987  -82.185 -4.936  1.00 62.78  ? 665  THR C O   1 
ATOM   9481  C CB  . THR B 1 626 ? -66.520  -83.158 -1.827  1.00 62.62  ? 665  THR C CB  1 
ATOM   9482  O OG1 . THR B 1 626 ? -65.582  -83.395 -0.770  1.00 65.48  ? 665  THR C OG1 1 
ATOM   9483  C CG2 . THR B 1 626 ? -66.689  -84.436 -2.631  1.00 58.53  ? 665  THR C CG2 1 
ATOM   9484  N N   . GLU B 1 627 ? -68.088  -80.934 -3.409  1.00 64.85  ? 666  GLU C N   1 
ATOM   9485  C CA  . GLU B 1 627 ? -69.211  -80.586 -4.277  1.00 64.84  ? 666  GLU C CA  1 
ATOM   9486  C C   . GLU B 1 627 ? -68.789  -79.866 -5.567  1.00 76.70  ? 666  GLU C C   1 
ATOM   9487  O O   . GLU B 1 627 ? -69.034  -80.366 -6.667  1.00 75.80  ? 666  GLU C O   1 
ATOM   9488  C CB  . GLU B 1 627 ? -70.226  -79.737 -3.504  1.00 63.46  ? 666  GLU C CB  1 
ATOM   9489  C CG  . GLU B 1 627 ? -71.681  -80.060 -3.819  1.00 88.24  ? 666  GLU C CG  1 
ATOM   9490  C CD  . GLU B 1 627 ? -72.287  -79.126 -4.852  1.00 95.37  ? 666  GLU C CD  1 
ATOM   9491  O OE1 . GLU B 1 627 ? -71.847  -77.957 -4.930  1.00 98.59  ? 666  GLU C OE1 1 
ATOM   9492  O OE2 . GLU B 1 627 ? -73.205  -79.557 -5.584  1.00 92.65  ? 666  GLU C OE2 1 
ATOM   9493  N N   . ILE B 1 628 ? -68.163  -78.697 -5.434  1.00 74.55  ? 667  ILE C N   1 
ATOM   9494  C CA  . ILE B 1 628 ? -67.735  -77.925 -6.603  1.00 64.91  ? 667  ILE C CA  1 
ATOM   9495  C C   . ILE B 1 628 ? -66.705  -78.681 -7.439  1.00 72.64  ? 667  ILE C C   1 
ATOM   9496  O O   . ILE B 1 628 ? -66.434  -78.313 -8.583  1.00 71.67  ? 667  ILE C O   1 
ATOM   9497  C CB  . ILE B 1 628 ? -67.135  -76.560 -6.213  1.00 71.87  ? 667  ILE C CB  1 
ATOM   9498  C CG1 . ILE B 1 628 ? -65.899  -76.760 -5.327  1.00 55.48  ? 667  ILE C CG1 1 
ATOM   9499  C CG2 . ILE B 1 628 ? -68.192  -75.683 -5.541  1.00 71.52  ? 667  ILE C CG2 1 
ATOM   9500  C CD1 . ILE B 1 628 ? -64.982  -75.560 -5.250  1.00 71.34  ? 667  ILE C CD1 1 
ATOM   9501  N N   . CYS B 1 629 ? -66.119  -79.726 -6.861  1.00 66.41  ? 668  CYS C N   1 
ATOM   9502  C CA  . CYS B 1 629 ? -65.232  -80.604 -7.616  1.00 77.29  ? 668  CYS C CA  1 
ATOM   9503  C C   . CYS B 1 629 ? -65.999  -81.782 -8.215  1.00 73.27  ? 668  CYS C C   1 
ATOM   9504  O O   . CYS B 1 629 ? -66.479  -81.711 -9.349  1.00 70.64  ? 668  CYS C O   1 
ATOM   9505  C CB  . CYS B 1 629 ? -64.082  -81.102 -6.738  1.00 81.27  ? 668  CYS C CB  1 
ATOM   9506  S SG  . CYS B 1 629 ? -62.782  -79.874 -6.457  1.00 86.32  ? 668  CYS C SG  1 
ATOM   9507  N N   . MET C 1 4   ? -101.020 -31.528 -13.010 1.00 64.63  ? 43   MET B N   1 
ATOM   9508  C CA  . MET C 1 4   ? -100.445 -30.186 -13.023 1.00 58.61  ? 43   MET B CA  1 
ATOM   9509  C C   . MET C 1 4   ? -99.018  -30.182 -13.585 1.00 54.26  ? 43   MET B C   1 
ATOM   9510  O O   . MET C 1 4   ? -98.264  -29.219 -13.401 1.00 45.66  ? 43   MET B O   1 
ATOM   9511  C CB  . MET C 1 4   ? -100.473 -29.571 -11.622 1.00 52.67  ? 43   MET B CB  1 
ATOM   9512  C CG  . MET C 1 4   ? -99.424  -30.116 -10.666 1.00 55.30  ? 43   MET B CG  1 
ATOM   9513  S SD  . MET C 1 4   ? -99.188  -28.973 -9.289  1.00 87.44  ? 43   MET B SD  1 
ATOM   9514  C CE  . MET C 1 4   ? -99.446  -27.394 -10.116 1.00 59.49  ? 43   MET B CE  1 
ATOM   9515  N N   . ALA C 1 5   ? -98.660  -31.263 -14.273 1.00 43.06  ? 44   ALA B N   1 
ATOM   9516  C CA  . ALA C 1 5   ? -97.399  -31.333 -15.000 1.00 50.48  ? 44   ALA B CA  1 
ATOM   9517  C C   . ALA C 1 5   ? -97.212  -30.115 -15.901 1.00 45.39  ? 44   ALA B C   1 
ATOM   9518  O O   . ALA C 1 5   ? -98.144  -29.693 -16.589 1.00 40.95  ? 44   ALA B O   1 
ATOM   9519  C CB  . ALA C 1 5   ? -97.332  -32.621 -15.825 1.00 50.35  ? 44   ALA B CB  1 
ATOM   9520  N N   . SER C 1 6   ? -96.004  -29.559 -15.881 1.00 34.83  ? 45   SER B N   1 
ATOM   9521  C CA  . SER C 1 6   ? -95.617  -28.452 -16.751 1.00 39.02  ? 45   SER B CA  1 
ATOM   9522  C C   . SER C 1 6   ? -94.225  -28.720 -17.332 1.00 40.24  ? 45   SER B C   1 
ATOM   9523  O O   . SER C 1 6   ? -93.477  -29.526 -16.790 1.00 42.47  ? 45   SER B O   1 
ATOM   9524  C CB  . SER C 1 6   ? -95.602  -27.154 -15.959 1.00 40.85  ? 45   SER B CB  1 
ATOM   9525  O OG  . SER C 1 6   ? -94.654  -27.245 -14.906 1.00 47.55  ? 45   SER B OG  1 
ATOM   9526  N N   . ALA C 1 7   ? -93.881  -28.049 -18.430 1.00 36.04  ? 46   ALA B N   1 
ATOM   9527  C CA  . ALA C 1 7   ? -92.641  -28.332 -19.141 1.00 36.42  ? 46   ALA B CA  1 
ATOM   9528  C C   . ALA C 1 7   ? -92.277  -27.210 -20.107 1.00 41.59  ? 46   ALA B C   1 
ATOM   9529  O O   . ALA C 1 7   ? -93.152  -26.568 -20.687 1.00 38.08  ? 46   ALA B O   1 
ATOM   9530  C CB  . ALA C 1 7   ? -92.747  -29.669 -19.905 1.00 35.76  ? 46   ALA B CB  1 
ATOM   9531  N N   . VAL C 1 8   ? -90.977  -26.983 -20.268 1.00 30.61  ? 47   VAL B N   1 
ATOM   9532  C CA  . VAL C 1 8   ? -90.456  -26.100 -21.302 1.00 34.75  ? 47   VAL B CA  1 
ATOM   9533  C C   . VAL C 1 8   ? -89.213  -26.758 -21.871 1.00 36.17  ? 47   VAL B C   1 
ATOM   9534  O O   . VAL C 1 8   ? -88.411  -27.336 -21.133 1.00 35.97  ? 47   VAL B O   1 
ATOM   9535  C CB  . VAL C 1 8   ? -90.040  -24.719 -20.742 1.00 35.61  ? 47   VAL B CB  1 
ATOM   9536  C CG1 . VAL C 1 8   ? -89.774  -23.740 -21.880 1.00 40.67  ? 47   VAL B CG1 1 
ATOM   9537  C CG2 . VAL C 1 8   ? -91.104  -24.162 -19.816 1.00 48.86  ? 47   VAL B CG2 1 
ATOM   9538  N N   . ALA C 1 9   ? -89.042  -26.689 -23.180 1.00 36.97  ? 48   ALA B N   1 
ATOM   9539  C CA  . ALA C 1 9   ? -87.796  -27.150 -23.765 1.00 43.34  ? 48   ALA B CA  1 
ATOM   9540  C C   . ALA C 1 9   ? -86.932  -25.937 -24.042 1.00 36.86  ? 48   ALA B C   1 
ATOM   9541  O O   . ALA C 1 9   ? -87.432  -24.907 -24.489 1.00 35.92  ? 48   ALA B O   1 
ATOM   9542  C CB  . ALA C 1 9   ? -88.056  -27.921 -25.037 1.00 39.53  ? 48   ALA B CB  1 
ATOM   9543  N N   . VAL C 1 10  ? -85.641  -26.023 -23.754 1.00 36.49  ? 49   VAL B N   1 
ATOM   9544  C CA  . VAL C 1 10  ? -84.768  -24.961 -24.242 1.00 31.96  ? 49   VAL B CA  1 
ATOM   9545  C C   . VAL C 1 10  ? -83.739  -25.458 -25.233 1.00 33.66  ? 49   VAL B C   1 
ATOM   9546  O O   . VAL C 1 10  ? -83.074  -26.480 -25.032 1.00 33.30  ? 49   VAL B O   1 
ATOM   9547  C CB  . VAL C 1 10  ? -84.174  -24.015 -23.143 1.00 39.66  ? 49   VAL B CB  1 
ATOM   9548  C CG1 . VAL C 1 10  ? -84.631  -24.413 -21.748 1.00 40.11  ? 49   VAL B CG1 1 
ATOM   9549  C CG2 . VAL C 1 10  ? -82.653  -23.902 -23.266 1.00 33.95  ? 49   VAL B CG2 1 
ATOM   9550  N N   . ASP C 1 11  ? -83.680  -24.736 -26.343 1.00 34.45  ? 50   ASP B N   1 
ATOM   9551  C CA  . ASP C 1 11  ? -82.814  -25.080 -27.438 1.00 40.09  ? 50   ASP B CA  1 
ATOM   9552  C C   . ASP C 1 11  ? -81.496  -24.381 -27.183 1.00 45.61  ? 50   ASP B C   1 
ATOM   9553  O O   . ASP C 1 11  ? -81.444  -23.151 -27.095 1.00 35.45  ? 50   ASP B O   1 
ATOM   9554  C CB  . ASP C 1 11  ? -83.429  -24.606 -28.752 1.00 53.69  ? 50   ASP B CB  1 
ATOM   9555  C CG  . ASP C 1 11  ? -82.632  -25.048 -29.962 1.00 55.06  ? 50   ASP B CG  1 
ATOM   9556  O OD1 . ASP C 1 11  ? -82.378  -24.200 -30.845 1.00 67.37  ? 50   ASP B OD1 1 
ATOM   9557  O OD2 . ASP C 1 11  ? -82.269  -26.240 -30.035 1.00 61.71  ? 50   ASP B OD2 1 
ATOM   9558  N N   . LEU C 1 12  ? -80.448  -25.181 -27.023 1.00 35.98  ? 51   LEU B N   1 
ATOM   9559  C CA  . LEU C 1 12  ? -79.095  -24.676 -26.839 1.00 39.12  ? 51   LEU B CA  1 
ATOM   9560  C C   . LEU C 1 12  ? -78.255  -25.031 -28.059 1.00 40.18  ? 51   LEU B C   1 
ATOM   9561  O O   . LEU C 1 12  ? -77.056  -25.257 -27.950 1.00 39.17  ? 51   LEU B O   1 
ATOM   9562  C CB  . LEU C 1 12  ? -78.467  -25.296 -25.592 1.00 34.24  ? 51   LEU B CB  1 
ATOM   9563  C CG  . LEU C 1 12  ? -78.496  -24.563 -24.252 1.00 35.51  ? 51   LEU B CG  1 
ATOM   9564  C CD1 . LEU C 1 12  ? -79.535  -23.441 -24.184 1.00 41.38  ? 51   LEU B CD1 1 
ATOM   9565  C CD2 . LEU C 1 12  ? -78.633  -25.546 -23.080 1.00 35.08  ? 51   LEU B CD2 1 
ATOM   9566  N N   . GLY C 1 13  ? -78.890  -25.090 -29.226 1.00 45.93  ? 52   GLY B N   1 
ATOM   9567  C CA  . GLY C 1 13  ? -78.182  -25.410 -30.455 1.00 45.77  ? 52   GLY B CA  1 
ATOM   9568  C C   . GLY C 1 13  ? -78.110  -26.906 -30.688 1.00 40.67  ? 52   GLY B C   1 
ATOM   9569  O O   . GLY C 1 13  ? -79.091  -27.518 -31.110 1.00 47.61  ? 52   GLY B O   1 
ATOM   9570  N N   . ASN C 1 14  ? -76.958  -27.506 -30.408 1.00 37.07  ? 53   ASN B N   1 
ATOM   9571  C CA  . ASN C 1 14  ? -76.825  -28.962 -30.530 1.00 46.05  ? 53   ASN B CA  1 
ATOM   9572  C C   . ASN C 1 14  ? -77.320  -29.724 -29.296 1.00 45.48  ? 53   ASN B C   1 
ATOM   9573  O O   . ASN C 1 14  ? -77.234  -30.953 -29.234 1.00 53.93  ? 53   ASN B O   1 
ATOM   9574  C CB  . ASN C 1 14  ? -75.379  -29.361 -30.814 1.00 38.71  ? 53   ASN B CB  1 
ATOM   9575  C CG  . ASN C 1 14  ? -74.874  -28.824 -32.139 1.00 56.16  ? 53   ASN B CG  1 
ATOM   9576  O OD1 . ASN C 1 14  ? -75.658  -28.443 -33.017 1.00 45.83  ? 53   ASN B OD1 1 
ATOM   9577  N ND2 . ASN C 1 14  ? -73.550  -28.794 -32.294 1.00 45.62  ? 53   ASN B ND2 1 
ATOM   9578  N N   . ARG C 1 15  ? -77.826  -28.989 -28.314 1.00 42.79  ? 54   ARG B N   1 
ATOM   9579  C CA  . ARG C 1 15  ? -78.304  -29.590 -27.076 1.00 37.90  ? 54   ARG B CA  1 
ATOM   9580  C C   . ARG C 1 15  ? -79.701  -29.076 -26.794 1.00 36.07  ? 54   ARG B C   1 
ATOM   9581  O O   . ARG C 1 15  ? -80.026  -27.933 -27.114 1.00 35.83  ? 54   ARG B O   1 
ATOM   9582  C CB  . ARG C 1 15  ? -77.387  -29.209 -25.912 1.00 40.98  ? 54   ARG B CB  1 
ATOM   9583  C CG  . ARG C 1 15  ? -75.924  -29.527 -26.125 1.00 35.50  ? 54   ARG B CG  1 
ATOM   9584  C CD  . ARG C 1 15  ? -75.629  -31.014 -25.904 1.00 37.93  ? 54   ARG B CD  1 
ATOM   9585  N NE  . ARG C 1 15  ? -74.190  -31.222 -25.875 1.00 34.60  ? 54   ARG B NE  1 
ATOM   9586  C CZ  . ARG C 1 15  ? -73.447  -31.501 -26.941 1.00 38.64  ? 54   ARG B CZ  1 
ATOM   9587  N NH1 . ARG C 1 15  ? -74.011  -31.644 -28.133 1.00 30.25  ? 54   ARG B NH1 1 
ATOM   9588  N NH2 . ARG C 1 15  ? -72.130  -31.638 -26.814 1.00 32.90  ? 54   ARG B NH2 1 
ATOM   9589  N N   . LYS C 1 16  ? -80.529  -29.919 -26.195 1.00 35.98  ? 55   LYS B N   1 
ATOM   9590  C CA  . LYS C 1 16  ? -81.865  -29.502 -25.812 1.00 35.34  ? 55   LYS B CA  1 
ATOM   9591  C C   . LYS C 1 16  ? -82.006  -29.723 -24.319 1.00 36.75  ? 55   LYS B C   1 
ATOM   9592  O O   . LYS C 1 16  ? -81.614  -30.759 -23.790 1.00 39.42  ? 55   LYS B O   1 
ATOM   9593  C CB  . LYS C 1 16  ? -82.923  -30.302 -26.572 1.00 35.40  ? 55   LYS B CB  1 
ATOM   9594  C CG  . LYS C 1 16  ? -82.613  -30.512 -28.048 1.00 50.07  ? 55   LYS B CG  1 
ATOM   9595  C CD  . LYS C 1 16  ? -82.864  -29.259 -28.886 1.00 66.37  ? 55   LYS B CD  1 
ATOM   9596  C CE  . LYS C 1 16  ? -82.543  -29.522 -30.359 1.00 67.00  ? 55   LYS B CE  1 
ATOM   9597  N NZ  . LYS C 1 16  ? -82.619  -28.299 -31.202 1.00 60.70  ? 55   LYS B NZ  1 
ATOM   9598  N N   . LEU C 1 17  ? -82.552  -28.744 -23.625 1.00 33.14  ? 56   LEU B N   1 
ATOM   9599  C CA  . LEU C 1 17  ? -82.767  -28.913 -22.204 1.00 35.04  ? 56   LEU B CA  1 
ATOM   9600  C C   . LEU C 1 17  ? -84.260  -29.047 -21.986 1.00 35.90  ? 56   LEU B C   1 
ATOM   9601  O O   . LEU C 1 17  ? -85.018  -28.134 -22.326 1.00 36.56  ? 56   LEU B O   1 
ATOM   9602  C CB  . LEU C 1 17  ? -82.233  -27.693 -21.464 1.00 37.17  ? 56   LEU B CB  1 
ATOM   9603  C CG  . LEU C 1 17  ? -81.329  -27.915 -20.265 1.00 50.32  ? 56   LEU B CG  1 
ATOM   9604  C CD1 . LEU C 1 17  ? -80.140  -28.786 -20.637 1.00 42.40  ? 56   LEU B CD1 1 
ATOM   9605  C CD2 . LEU C 1 17  ? -80.870  -26.552 -19.757 1.00 47.03  ? 56   LEU B CD2 1 
ATOM   9606  N N   . GLU C 1 18  ? -84.683  -30.187 -21.445 1.00 31.48  ? 57   GLU B N   1 
ATOM   9607  C CA  . GLU C 1 18  ? -86.091  -30.413 -21.172 1.00 35.47  ? 57   GLU B CA  1 
ATOM   9608  C C   . GLU C 1 18  ? -86.328  -30.230 -19.693 1.00 33.40  ? 57   GLU B C   1 
ATOM   9609  O O   . GLU C 1 18  ? -85.870  -31.026 -18.874 1.00 34.49  ? 57   GLU B O   1 
ATOM   9610  C CB  . GLU C 1 18  ? -86.545  -31.813 -21.605 1.00 39.55  ? 57   GLU B CB  1 
ATOM   9611  C CG  . GLU C 1 18  ? -85.472  -32.658 -22.282 1.00 58.91  ? 57   GLU B CG  1 
ATOM   9612  C CD  . GLU C 1 18  ? -85.140  -32.184 -23.691 1.00 69.10  ? 57   GLU B CD  1 
ATOM   9613  O OE1 . GLU C 1 18  ? -84.032  -32.516 -24.191 1.00 55.17  ? 57   GLU B OE1 1 
ATOM   9614  O OE2 . GLU C 1 18  ? -85.990  -31.485 -24.300 1.00 63.31  ? 57   GLU B OE2 1 
ATOM   9615  N N   . ILE C 1 19  ? -87.036  -29.162 -19.359 1.00 29.01  ? 58   ILE B N   1 
ATOM   9616  C CA  . ILE C 1 19  ? -87.279  -28.816 -17.971 1.00 32.14  ? 58   ILE B CA  1 
ATOM   9617  C C   . ILE C 1 19  ? -88.742  -29.054 -17.617 1.00 34.51  ? 58   ILE B C   1 
ATOM   9618  O O   . ILE C 1 19  ? -89.634  -28.647 -18.357 1.00 34.55  ? 58   ILE B O   1 
ATOM   9619  C CB  . ILE C 1 19  ? -86.889  -27.351 -17.722 1.00 27.48  ? 58   ILE B CB  1 
ATOM   9620  C CG1 . ILE C 1 19  ? -85.388  -27.168 -17.995 1.00 28.99  ? 58   ILE B CG1 1 
ATOM   9621  C CG2 . ILE C 1 19  ? -87.260  -26.926 -16.304 1.00 26.94  ? 58   ILE B CG2 1 
ATOM   9622  C CD1 . ILE C 1 19  ? -84.957  -25.714 -18.146 1.00 34.67  ? 58   ILE B CD1 1 
ATOM   9623  N N   . SER C 1 20  ? -88.992  -29.720 -16.494 1.00 28.17  ? 59   SER B N   1 
ATOM   9624  C CA  . SER C 1 20  ? -90.364  -30.040 -16.117 1.00 28.21  ? 59   SER B CA  1 
ATOM   9625  C C   . SER C 1 20  ? -90.582  -30.069 -14.609 1.00 36.05  ? 59   SER B C   1 
ATOM   9626  O O   . SER C 1 20  ? -89.633  -30.069 -13.818 1.00 28.53  ? 59   SER B O   1 
ATOM   9627  C CB  . SER C 1 20  ? -90.799  -31.369 -16.746 1.00 31.76  ? 59   SER B CB  1 
ATOM   9628  O OG  . SER C 1 20  ? -89.982  -32.440 -16.298 1.00 29.62  ? 59   SER B OG  1 
ATOM   9629  N N   . SER C 1 21  ? -91.852  -30.094 -14.225 1.00 25.47  ? 60   SER B N   1 
ATOM   9630  C CA  . SER C 1 21  ? -92.243  -30.163 -12.831 1.00 31.13  ? 60   SER B CA  1 
ATOM   9631  C C   . SER C 1 21  ? -93.689  -30.654 -12.784 1.00 33.95  ? 60   SER B C   1 
ATOM   9632  O O   . SER C 1 21  ? -94.385  -30.656 -13.801 1.00 34.71  ? 60   SER B O   1 
ATOM   9633  C CB  . SER C 1 21  ? -92.120  -28.775 -12.189 1.00 22.79  ? 60   SER B CB  1 
ATOM   9634  O OG  . SER C 1 21  ? -92.407  -28.797 -10.803 1.00 30.02  ? 60   SER B OG  1 
ATOM   9635  N N   . GLY C 1 22  ? -94.133  -31.082 -11.612 1.00 31.84  ? 61   GLY B N   1 
ATOM   9636  C CA  . GLY C 1 22  ? -95.528  -31.407 -11.414 1.00 34.71  ? 61   GLY B CA  1 
ATOM   9637  C C   . GLY C 1 22  ? -95.880  -32.884 -11.353 1.00 36.30  ? 61   GLY B C   1 
ATOM   9638  O O   . GLY C 1 22  ? -97.040  -33.212 -11.136 1.00 37.47  ? 61   GLY B O   1 
ATOM   9639  N N   . LYS C 1 23  ? -94.898  -33.766 -11.535 1.00 29.76  ? 62   LYS B N   1 
ATOM   9640  C CA  . LYS C 1 23  ? -95.132  -35.212 -11.486 1.00 37.57  ? 62   LYS B CA  1 
ATOM   9641  C C   . LYS C 1 23  ? -94.518  -35.885 -10.261 1.00 36.96  ? 62   LYS B C   1 
ATOM   9642  O O   . LYS C 1 23  ? -95.138  -36.747 -9.627  1.00 31.47  ? 62   LYS B O   1 
ATOM   9643  C CB  . LYS C 1 23  ? -94.566  -35.891 -12.738 1.00 40.14  ? 62   LYS B CB  1 
ATOM   9644  C CG  . LYS C 1 23  ? -95.403  -35.705 -13.983 1.00 53.77  ? 62   LYS B CG  1 
ATOM   9645  C CD  . LYS C 1 23  ? -94.722  -36.286 -15.224 1.00 57.94  ? 62   LYS B CD  1 
ATOM   9646  C CE  . LYS C 1 23  ? -95.514  -35.916 -16.475 1.00 59.28  ? 62   LYS B CE  1 
ATOM   9647  N NZ  . LYS C 1 23  ? -94.728  -36.076 -17.731 1.00 68.02  ? 62   LYS B NZ  1 
ATOM   9648  N N   . LEU C 1 24  ? -93.290  -35.494 -9.938  1.00 30.73  ? 63   LEU B N   1 
ATOM   9649  C CA  . LEU C 1 24  ? -92.497  -36.202 -8.938  1.00 25.63  ? 63   LEU B CA  1 
ATOM   9650  C C   . LEU C 1 24  ? -92.279  -35.371 -7.660  1.00 31.32  ? 63   LEU B C   1 
ATOM   9651  O O   . LEU C 1 24  ? -92.144  -34.141 -7.716  1.00 30.78  ? 63   LEU B O   1 
ATOM   9652  C CB  . LEU C 1 24  ? -91.150  -36.587 -9.562  1.00 24.50  ? 63   LEU B CB  1 
ATOM   9653  C CG  . LEU C 1 24  ? -90.898  -37.927 -10.250 1.00 39.07  ? 63   LEU B CG  1 
ATOM   9654  C CD1 . LEU C 1 24  ? -92.148  -38.547 -10.867 1.00 38.23  ? 63   LEU B CD1 1 
ATOM   9655  C CD2 . LEU C 1 24  ? -89.742  -37.827 -11.260 1.00 23.77  ? 63   LEU B CD2 1 
ATOM   9656  N N   . ALA C 1 25  ? -92.254  -36.051 -6.514  1.00 28.48  ? 64   ALA B N   1 
ATOM   9657  C CA  . ALA C 1 25  ? -91.898  -35.434 -5.247  1.00 33.03  ? 64   ALA B CA  1 
ATOM   9658  C C   . ALA C 1 25  ? -92.711  -34.164 -5.003  1.00 37.02  ? 64   ALA B C   1 
ATOM   9659  O O   . ALA C 1 25  ? -92.150  -33.097 -4.728  1.00 28.68  ? 64   ALA B O   1 
ATOM   9660  C CB  . ALA C 1 25  ? -90.380  -35.124 -5.217  1.00 29.45  ? 64   ALA B CB  1 
ATOM   9661  N N   . ARG C 1 26  ? -94.032  -34.290 -5.087  1.00 30.38  ? 65   ARG B N   1 
ATOM   9662  C CA  . ARG C 1 26  ? -94.921  -33.131 -5.088  1.00 25.92  ? 65   ARG B CA  1 
ATOM   9663  C C   . ARG C 1 26  ? -95.195  -32.512 -3.708  1.00 28.46  ? 65   ARG B C   1 
ATOM   9664  O O   . ARG C 1 26  ? -95.849  -31.472 -3.612  1.00 28.18  ? 65   ARG B O   1 
ATOM   9665  C CB  . ARG C 1 26  ? -96.241  -33.480 -5.796  1.00 34.08  ? 65   ARG B CB  1 
ATOM   9666  C CG  . ARG C 1 26  ? -96.123  -33.579 -7.319  1.00 32.64  ? 65   ARG B CG  1 
ATOM   9667  C CD  . ARG C 1 26  ? -97.345  -34.258 -7.939  1.00 25.91  ? 65   ARG B CD  1 
ATOM   9668  N NE  . ARG C 1 26  ? -97.454  -35.619 -7.437  1.00 28.77  ? 65   ARG B NE  1 
ATOM   9669  C CZ  . ARG C 1 26  ? -98.332  -36.522 -7.860  1.00 39.58  ? 65   ARG B CZ  1 
ATOM   9670  N NH1 . ARG C 1 26  ? -99.204  -36.220 -8.817  1.00 31.23  ? 65   ARG B NH1 1 
ATOM   9671  N NH2 . ARG C 1 26  ? -98.331  -37.736 -7.325  1.00 35.61  ? 65   ARG B NH2 1 
ATOM   9672  N N   . PHE C 1 27  ? -94.716  -33.145 -2.641  1.00 28.56  ? 66   PHE B N   1 
ATOM   9673  C CA  . PHE C 1 27  ? -94.824  -32.527 -1.320  1.00 29.27  ? 66   PHE B CA  1 
ATOM   9674  C C   . PHE C 1 27  ? -93.760  -31.437 -1.102  1.00 30.94  ? 66   PHE B C   1 
ATOM   9675  O O   . PHE C 1 27  ? -93.950  -30.548 -0.281  1.00 31.67  ? 66   PHE B O   1 
ATOM   9676  C CB  . PHE C 1 27  ? -94.720  -33.564 -0.194  1.00 33.74  ? 66   PHE B CB  1 
ATOM   9677  C CG  . PHE C 1 27  ? -95.982  -34.363 0.035   1.00 35.49  ? 66   PHE B CG  1 
ATOM   9678  C CD1 . PHE C 1 27  ? -97.181  -33.733 0.341   1.00 36.80  ? 66   PHE B CD1 1 
ATOM   9679  C CD2 . PHE C 1 27  ? -95.958  -35.745 -0.027  1.00 26.74  ? 66   PHE B CD2 1 
ATOM   9680  C CE1 . PHE C 1 27  ? -98.337  -34.466 0.564   1.00 34.41  ? 66   PHE B CE1 1 
ATOM   9681  C CE2 . PHE C 1 27  ? -97.119  -36.485 0.198   1.00 33.16  ? 66   PHE B CE2 1 
ATOM   9682  C CZ  . PHE C 1 27  ? -98.304  -35.841 0.491   1.00 30.91  ? 66   PHE B CZ  1 
ATOM   9683  N N   . ALA C 1 28  ? -92.648  -31.498 -1.830  1.00 28.16  ? 67   ALA B N   1 
ATOM   9684  C CA  . ALA C 1 28  ? -91.567  -30.526 -1.610  1.00 29.94  ? 67   ALA B CA  1 
ATOM   9685  C C   . ALA C 1 28  ? -91.982  -29.085 -1.947  1.00 32.29  ? 67   ALA B C   1 
ATOM   9686  O O   . ALA C 1 28  ? -92.746  -28.852 -2.888  1.00 27.85  ? 67   ALA B O   1 
ATOM   9687  C CB  . ALA C 1 28  ? -90.319  -30.922 -2.391  1.00 25.68  ? 67   ALA B CB  1 
ATOM   9688  N N   . ASP C 1 29  ? -91.481  -28.114 -1.185  1.00 29.49  ? 68   ASP B N   1 
ATOM   9689  C CA  . ASP C 1 29  ? -91.739  -26.713 -1.527  1.00 27.84  ? 68   ASP B CA  1 
ATOM   9690  C C   . ASP C 1 29  ? -91.466  -26.475 -3.011  1.00 26.60  ? 68   ASP B C   1 
ATOM   9691  O O   . ASP C 1 29  ? -92.213  -25.778 -3.691  1.00 26.54  ? 68   ASP B O   1 
ATOM   9692  C CB  . ASP C 1 29  ? -90.896  -25.765 -0.675  1.00 24.60  ? 68   ASP B CB  1 
ATOM   9693  C CG  . ASP C 1 29  ? -91.323  -25.755 0.789   1.00 33.61  ? 68   ASP B CG  1 
ATOM   9694  O OD1 . ASP C 1 29  ? -90.434  -25.663 1.669   1.00 32.60  ? 68   ASP B OD1 1 
ATOM   9695  O OD2 . ASP C 1 29  ? -92.546  -25.838 1.061   1.00 31.32  ? 68   ASP B OD2 1 
ATOM   9696  N N   . GLY C 1 30  ? -90.391  -27.074 -3.511  1.00 28.33  ? 69   GLY B N   1 
ATOM   9697  C CA  . GLY C 1 30  ? -90.066  -26.987 -4.919  1.00 24.62  ? 69   GLY B CA  1 
ATOM   9698  C C   . GLY C 1 30  ? -89.473  -28.283 -5.434  1.00 29.92  ? 69   GLY B C   1 
ATOM   9699  O O   . GLY C 1 30  ? -88.823  -29.024 -4.696  1.00 25.69  ? 69   GLY B O   1 
ATOM   9700  N N   . SER C 1 31  ? -89.677  -28.536 -6.719  1.00 26.29  ? 70   SER B N   1 
ATOM   9701  C CA  . SER C 1 31  ? -89.215  -29.754 -7.356  1.00 26.94  ? 70   SER B CA  1 
ATOM   9702  C C   . SER C 1 31  ? -89.175  -29.545 -8.855  1.00 29.67  ? 70   SER B C   1 
ATOM   9703  O O   . SER C 1 31  ? -90.014  -28.847 -9.405  1.00 34.99  ? 70   SER B O   1 
ATOM   9704  C CB  . SER C 1 31  ? -90.170  -30.915 -7.038  1.00 35.55  ? 70   SER B CB  1 
ATOM   9705  O OG  . SER C 1 31  ? -89.739  -32.106 -7.679  1.00 36.80  ? 70   SER B OG  1 
ATOM   9706  N N   . ALA C 1 32  ? -88.219  -30.175 -9.517  1.00 21.52  ? 71   ALA B N   1 
ATOM   9707  C CA  . ALA C 1 32  ? -88.074  -30.031 -10.949 1.00 24.98  ? 71   ALA B CA  1 
ATOM   9708  C C   . ALA C 1 32  ? -87.243  -31.180 -11.460 1.00 27.68  ? 71   ALA B C   1 
ATOM   9709  O O   . ALA C 1 32  ? -86.466  -31.781 -10.716 1.00 27.26  ? 71   ALA B O   1 
ATOM   9710  C CB  . ALA C 1 32  ? -87.383  -28.704 -11.299 1.00 28.93  ? 71   ALA B CB  1 
ATOM   9711  N N   . VAL C 1 33  ? -87.410  -31.470 -12.741 1.00 29.51  ? 72   VAL B N   1 
ATOM   9712  C CA  . VAL C 1 33  ? -86.620  -32.474 -13.413 1.00 24.37  ? 72   VAL B CA  1 
ATOM   9713  C C   . VAL C 1 33  ? -85.997  -31.806 -14.626 1.00 27.60  ? 72   VAL B C   1 
ATOM   9714  O O   . VAL C 1 33  ? -86.679  -31.111 -15.375 1.00 28.00  ? 72   VAL B O   1 
ATOM   9715  C CB  . VAL C 1 33  ? -87.504  -33.655 -13.863 1.00 30.41  ? 72   VAL B CB  1 
ATOM   9716  C CG1 . VAL C 1 33  ? -86.698  -34.620 -14.722 1.00 33.80  ? 72   VAL B CG1 1 
ATOM   9717  C CG2 . VAL C 1 33  ? -88.099  -34.376 -12.644 1.00 25.51  ? 72   VAL B CG2 1 
ATOM   9718  N N   . VAL C 1 34  ? -84.698  -31.997 -14.804 1.00 26.16  ? 73   VAL B N   1 
ATOM   9719  C CA  . VAL C 1 34  ? -84.015  -31.450 -15.959 1.00 28.32  ? 73   VAL B CA  1 
ATOM   9720  C C   . VAL C 1 34  ? -83.364  -32.576 -16.719 1.00 24.25  ? 73   VAL B C   1 
ATOM   9721  O O   . VAL C 1 34  ? -82.600  -33.357 -16.159 1.00 30.85  ? 73   VAL B O   1 
ATOM   9722  C CB  . VAL C 1 34  ? -82.946  -30.421 -15.572 1.00 28.81  ? 73   VAL B CB  1 
ATOM   9723  C CG1 . VAL C 1 34  ? -82.263  -29.895 -16.819 1.00 25.98  ? 73   VAL B CG1 1 
ATOM   9724  C CG2 . VAL C 1 34  ? -83.580  -29.274 -14.787 1.00 32.18  ? 73   VAL B CG2 1 
ATOM   9725  N N   . GLN C 1 35  ? -83.654  -32.650 -18.007 1.00 27.46  ? 74   GLN B N   1 
ATOM   9726  C CA  . GLN C 1 35  ? -83.212  -33.777 -18.802 1.00 28.16  ? 74   GLN B CA  1 
ATOM   9727  C C   . GLN C 1 35  ? -82.517  -33.303 -20.065 1.00 31.30  ? 74   GLN B C   1 
ATOM   9728  O O   . GLN C 1 35  ? -82.919  -32.308 -20.677 1.00 31.39  ? 74   GLN B O   1 
ATOM   9729  C CB  . GLN C 1 35  ? -84.408  -34.694 -19.156 1.00 30.56  ? 74   GLN B CB  1 
ATOM   9730  C CG  . GLN C 1 35  ? -84.034  -35.814 -20.131 1.00 34.06  ? 74   GLN B CG  1 
ATOM   9731  C CD  . GLN C 1 35  ? -85.089  -36.920 -20.241 1.00 42.85  ? 74   GLN B CD  1 
ATOM   9732  O OE1 . GLN C 1 35  ? -86.211  -36.789 -19.742 1.00 36.35  ? 74   GLN B OE1 1 
ATOM   9733  N NE2 . GLN C 1 35  ? -84.718  -38.023 -20.892 1.00 36.01  ? 74   GLN B NE2 1 
ATOM   9734  N N   . SER C 1 36  ? -81.462  -34.016 -20.440 1.00 25.79  ? 75   SER B N   1 
ATOM   9735  C CA  . SER C 1 36  ? -80.767  -33.766 -21.692 1.00 33.05  ? 75   SER B CA  1 
ATOM   9736  C C   . SER C 1 36  ? -80.306  -35.115 -22.233 1.00 27.79  ? 75   SER B C   1 
ATOM   9737  O O   . SER C 1 36  ? -79.701  -35.889 -21.516 1.00 26.57  ? 75   SER B O   1 
ATOM   9738  C CB  . SER C 1 36  ? -79.575  -32.820 -21.476 1.00 26.66  ? 75   SER B CB  1 
ATOM   9739  O OG  . SER C 1 36  ? -79.025  -32.441 -22.717 1.00 33.56  ? 75   SER B OG  1 
ATOM   9740  N N   . GLY C 1 37  ? -80.599  -35.410 -23.493 1.00 34.91  ? 76   GLY B N   1 
ATOM   9741  C CA  . GLY C 1 37  ? -80.401  -36.763 -23.980 1.00 35.04  ? 76   GLY B CA  1 
ATOM   9742  C C   . GLY C 1 37  ? -81.180  -37.726 -23.089 1.00 27.64  ? 76   GLY B C   1 
ATOM   9743  O O   . GLY C 1 37  ? -82.357  -37.503 -22.798 1.00 30.39  ? 76   GLY B O   1 
ATOM   9744  N N   . ASP C 1 38  ? -80.520  -38.774 -22.620 1.00 28.34  ? 77   ASP B N   1 
ATOM   9745  C CA  . ASP C 1 38  ? -81.178  -39.735 -21.744 1.00 26.91  ? 77   ASP B CA  1 
ATOM   9746  C C   . ASP C 1 38  ? -80.733  -39.642 -20.277 1.00 37.40  ? 77   ASP B C   1 
ATOM   9747  O O   . ASP C 1 38  ? -80.904  -40.587 -19.489 1.00 34.03  ? 77   ASP B O   1 
ATOM   9748  C CB  . ASP C 1 38  ? -81.011  -41.141 -22.308 1.00 33.08  ? 77   ASP B CB  1 
ATOM   9749  C CG  . ASP C 1 38  ? -81.805  -41.341 -23.599 1.00 39.93  ? 77   ASP B CG  1 
ATOM   9750  O OD1 . ASP C 1 38  ? -82.997  -40.956 -23.631 1.00 37.73  ? 77   ASP B OD1 1 
ATOM   9751  O OD2 . ASP C 1 38  ? -81.232  -41.871 -24.579 1.00 43.81  ? 77   ASP B OD2 1 
ATOM   9752  N N   . THR C 1 39  ? -80.176  -38.489 -19.916 1.00 30.29  ? 78   THR B N   1 
ATOM   9753  C CA  . THR C 1 39  ? -79.854  -38.193 -18.529 1.00 27.43  ? 78   THR B CA  1 
ATOM   9754  C C   . THR C 1 39  ? -80.923  -37.263 -17.965 1.00 24.41  ? 78   THR B C   1 
ATOM   9755  O O   . THR C 1 39  ? -81.239  -36.233 -18.569 1.00 30.47  ? 78   THR B O   1 
ATOM   9756  C CB  . THR C 1 39  ? -78.458  -37.522 -18.395 1.00 27.39  ? 78   THR B CB  1 
ATOM   9757  O OG1 . THR C 1 39  ? -77.464  -38.366 -18.988 1.00 26.89  ? 78   THR B OG1 1 
ATOM   9758  C CG2 . THR C 1 39  ? -78.121  -37.311 -16.926 1.00 30.11  ? 78   THR B CG2 1 
ATOM   9759  N N   . ALA C 1 40  ? -81.486  -37.627 -16.820 1.00 24.85  ? 79   ALA B N   1 
ATOM   9760  C CA  . ALA C 1 40  ? -82.519  -36.807 -16.186 1.00 33.52  ? 79   ALA B CA  1 
ATOM   9761  C C   . ALA C 1 40  ? -82.229  -36.649 -14.706 1.00 28.87  ? 79   ALA B C   1 
ATOM   9762  O O   . ALA C 1 40  ? -81.984  -37.630 -14.010 1.00 29.96  ? 79   ALA B O   1 
ATOM   9763  C CB  . ALA C 1 40  ? -83.900  -37.417 -16.384 1.00 30.85  ? 79   ALA B CB  1 
ATOM   9764  N N   . VAL C 1 41  ? -82.259  -35.409 -14.232 1.00 26.28  ? 80   VAL B N   1 
ATOM   9765  C CA  . VAL C 1 41  ? -81.966  -35.121 -12.835 1.00 25.36  ? 80   VAL B CA  1 
ATOM   9766  C C   . VAL C 1 41  ? -83.168  -34.441 -12.205 1.00 26.72  ? 80   VAL B C   1 
ATOM   9767  O O   . VAL C 1 41  ? -83.725  -33.500 -12.771 1.00 25.42  ? 80   VAL B O   1 
ATOM   9768  C CB  . VAL C 1 41  ? -80.702  -34.211 -12.693 1.00 27.95  ? 80   VAL B CB  1 
ATOM   9769  C CG1 . VAL C 1 41  ? -80.442  -33.866 -11.239 1.00 23.60  ? 80   VAL B CG1 1 
ATOM   9770  C CG2 . VAL C 1 41  ? -79.481  -34.915 -13.284 1.00 25.36  ? 80   VAL B CG2 1 
ATOM   9771  N N   . MET C 1 42  ? -83.582  -34.940 -11.045 1.00 24.33  ? 81   MET B N   1 
ATOM   9772  C CA  . MET C 1 42  ? -84.634  -34.295 -10.265 1.00 26.98  ? 81   MET B CA  1 
ATOM   9773  C C   . MET C 1 42  ? -84.009  -33.522 -9.117  1.00 24.85  ? 81   MET B C   1 
ATOM   9774  O O   . MET C 1 42  ? -83.172  -34.060 -8.397  1.00 24.73  ? 81   MET B O   1 
ATOM   9775  C CB  . MET C 1 42  ? -85.589  -35.331 -9.658  1.00 23.35  ? 81   MET B CB  1 
ATOM   9776  C CG  . MET C 1 42  ? -86.769  -34.692 -8.899  1.00 28.80  ? 81   MET B CG  1 
ATOM   9777  S SD  . MET C 1 42  ? -87.894  -35.895 -8.131  1.00 33.19  ? 81   MET B SD  1 
ATOM   9778  C CE  . MET C 1 42  ? -86.948  -36.409 -6.708  1.00 31.36  ? 81   MET B CE  1 
ATOM   9779  N N   . VAL C 1 43  ? -84.456  -32.289 -8.907  1.00 24.88  ? 82   VAL B N   1 
ATOM   9780  C CA  . VAL C 1 43  ? -83.985  -31.518 -7.768  1.00 22.33  ? 82   VAL B CA  1 
ATOM   9781  C C   . VAL C 1 43  ? -85.149  -30.994 -6.952  1.00 27.68  ? 82   VAL B C   1 
ATOM   9782  O O   . VAL C 1 43  ? -86.116  -30.436 -7.492  1.00 28.27  ? 82   VAL B O   1 
ATOM   9783  C CB  . VAL C 1 43  ? -83.069  -30.337 -8.215  1.00 24.50  ? 82   VAL B CB  1 
ATOM   9784  C CG1 . VAL C 1 43  ? -82.552  -29.553 -6.997  1.00 24.36  ? 82   VAL B CG1 1 
ATOM   9785  C CG2 . VAL C 1 43  ? -81.896  -30.849 -9.063  1.00 19.01  ? 82   VAL B CG2 1 
ATOM   9786  N N   . THR C 1 44  ? -85.050  -31.158 -5.641  1.00 25.81  ? 83   THR B N   1 
ATOM   9787  C CA  . THR C 1 44  ? -86.058  -30.625 -4.734  1.00 24.96  ? 83   THR B CA  1 
ATOM   9788  C C   . THR C 1 44  ? -85.490  -29.526 -3.840  1.00 28.50  ? 83   THR B C   1 
ATOM   9789  O O   . THR C 1 44  ? -84.282  -29.484 -3.547  1.00 27.42  ? 83   THR B O   1 
ATOM   9790  C CB  . THR C 1 44  ? -86.585  -31.733 -3.806  1.00 24.99  ? 83   THR B CB  1 
ATOM   9791  O OG1 . THR C 1 44  ? -85.492  -32.260 -3.041  1.00 26.09  ? 83   THR B OG1 1 
ATOM   9792  C CG2 . THR C 1 44  ? -87.216  -32.870 -4.623  1.00 22.33  ? 83   THR B CG2 1 
ATOM   9793  N N   . ALA C 1 45  ? -86.371  -28.648 -3.383  1.00 25.32  ? 84   ALA B N   1 
ATOM   9794  C CA  . ALA C 1 45  ? -85.984  -27.632 -2.424  1.00 26.56  ? 84   ALA B CA  1 
ATOM   9795  C C   . ALA C 1 45  ? -87.018  -27.561 -1.310  1.00 26.87  ? 84   ALA B C   1 
ATOM   9796  O O   . ALA C 1 45  ? -88.232  -27.524 -1.563  1.00 35.55  ? 84   ALA B O   1 
ATOM   9797  C CB  . ALA C 1 45  ? -85.818  -26.289 -3.100  1.00 21.45  ? 84   ALA B CB  1 
ATOM   9798  N N   . VAL C 1 46  ? -86.520  -27.569 -0.078  1.00 26.86  ? 85   VAL B N   1 
ATOM   9799  C CA  . VAL C 1 46  ? -87.347  -27.454 1.119   1.00 27.38  ? 85   VAL B CA  1 
ATOM   9800  C C   . VAL C 1 46  ? -86.776  -26.349 2.002   1.00 28.81  ? 85   VAL B C   1 
ATOM   9801  O O   . VAL C 1 46  ? -85.552  -26.270 2.200   1.00 27.47  ? 85   VAL B O   1 
ATOM   9802  C CB  . VAL C 1 46  ? -87.350  -28.762 1.921   1.00 24.70  ? 85   VAL B CB  1 
ATOM   9803  C CG1 . VAL C 1 46  ? -88.237  -28.612 3.170   1.00 27.67  ? 85   VAL B CG1 1 
ATOM   9804  C CG2 . VAL C 1 46  ? -87.807  -29.932 1.041   1.00 24.43  ? 85   VAL B CG2 1 
ATOM   9805  N N   . SER C 1 47  ? -87.652  -25.497 2.529   1.00 24.38  ? 86   SER B N   1 
ATOM   9806  C CA  . SER C 1 47  ? -87.211  -24.387 3.358   1.00 26.88  ? 86   SER B CA  1 
ATOM   9807  C C   . SER C 1 47  ? -88.191  -24.191 4.518   1.00 31.51  ? 86   SER B C   1 
ATOM   9808  O O   . SER C 1 47  ? -89.372  -23.928 4.303   1.00 35.06  ? 86   SER B O   1 
ATOM   9809  C CB  . SER C 1 47  ? -87.094  -23.117 2.501   1.00 29.96  ? 86   SER B CB  1 
ATOM   9810  O OG  . SER C 1 47  ? -86.443  -22.055 3.182   1.00 26.85  ? 86   SER B OG  1 
ATOM   9811  N N   . LYS C 1 48  ? -87.692  -24.324 5.744   1.00 26.98  ? 87   LYS B N   1 
ATOM   9812  C CA  . LYS C 1 48  ? -88.526  -24.224 6.943   1.00 36.71  ? 87   LYS B CA  1 
ATOM   9813  C C   . LYS C 1 48  ? -89.208  -22.865 7.041   1.00 32.96  ? 87   LYS B C   1 
ATOM   9814  O O   . LYS C 1 48  ? -88.700  -21.871 6.521   1.00 27.17  ? 87   LYS B O   1 
ATOM   9815  C CB  . LYS C 1 48  ? -87.673  -24.456 8.191   1.00 35.46  ? 87   LYS B CB  1 
ATOM   9816  C CG  . LYS C 1 48  ? -87.716  -25.875 8.747   1.00 43.70  ? 87   LYS B CG  1 
ATOM   9817  C CD  . LYS C 1 48  ? -87.690  -26.929 7.654   1.00 47.39  ? 87   LYS B CD  1 
ATOM   9818  C CE  . LYS C 1 48  ? -88.138  -28.290 8.194   1.00 56.67  ? 87   LYS B CE  1 
ATOM   9819  N NZ  . LYS C 1 48  ? -89.598  -28.301 8.563   1.00 57.51  ? 87   LYS B NZ  1 
ATOM   9820  N N   . THR C 1 49  ? -90.350  -22.823 7.722   1.00 29.92  ? 88   THR B N   1 
ATOM   9821  C CA  . THR C 1 49  ? -91.080  -21.576 7.901   1.00 33.45  ? 88   THR B CA  1 
ATOM   9822  C C   . THR C 1 49  ? -90.689  -20.917 9.217   1.00 39.84  ? 88   THR B C   1 
ATOM   9823  O O   . THR C 1 49  ? -90.875  -19.711 9.399   1.00 33.12  ? 88   THR B O   1 
ATOM   9824  C CB  . THR C 1 49  ? -92.620  -21.777 7.833   1.00 36.76  ? 88   THR B CB  1 
ATOM   9825  O OG1 . THR C 1 49  ? -93.038  -22.701 8.846   1.00 35.86  ? 88   THR B OG1 1 
ATOM   9826  C CG2 . THR C 1 49  ? -93.031  -22.316 6.469   1.00 35.25  ? 88   THR B CG2 1 
ATOM   9827  N N   . LYS C 1 50  ? -90.141  -21.705 10.135  1.00 35.19  ? 89   LYS B N   1 
ATOM   9828  C CA  . LYS C 1 50  ? -89.678  -21.146 11.402  1.00 44.82  ? 89   LYS B CA  1 
ATOM   9829  C C   . LYS C 1 50  ? -88.206  -20.732 11.333  1.00 30.14  ? 89   LYS B C   1 
ATOM   9830  O O   . LYS C 1 50  ? -87.372  -21.456 10.789  1.00 37.12  ? 89   LYS B O   1 
ATOM   9831  C CB  . LYS C 1 50  ? -89.915  -22.119 12.565  1.00 45.58  ? 89   LYS B CB  1 
ATOM   9832  C CG  . LYS C 1 50  ? -91.369  -22.539 12.722  1.00 53.94  ? 89   LYS B CG  1 
ATOM   9833  C CD  . LYS C 1 50  ? -92.314  -21.369 12.493  1.00 65.83  ? 89   LYS B CD  1 
ATOM   9834  C CE  . LYS C 1 50  ? -93.767  -21.826 12.433  1.00 65.52  ? 89   LYS B CE  1 
ATOM   9835  N NZ  . LYS C 1 50  ? -94.691  -20.711 12.042  1.00 68.09  ? 89   LYS B NZ  1 
ATOM   9836  N N   . PRO C 1 51  ? -87.892  -19.556 11.889  1.00 34.39  ? 90   PRO B N   1 
ATOM   9837  C CA  . PRO C 1 51  ? -86.540  -18.997 11.839  1.00 40.64  ? 90   PRO B CA  1 
ATOM   9838  C C   . PRO C 1 51  ? -85.535  -19.964 12.427  1.00 40.06  ? 90   PRO B C   1 
ATOM   9839  O O   . PRO C 1 51  ? -85.851  -20.703 13.366  1.00 40.52  ? 90   PRO B O   1 
ATOM   9840  C CB  . PRO C 1 51  ? -86.644  -17.740 12.714  1.00 39.01  ? 90   PRO B CB  1 
ATOM   9841  C CG  . PRO C 1 51  ? -88.079  -17.363 12.646  1.00 42.45  ? 90   PRO B CG  1 
ATOM   9842  C CD  . PRO C 1 51  ? -88.838  -18.658 12.578  1.00 37.12  ? 90   PRO B CD  1 
ATOM   9843  N N   . SER C 1 52  ? -84.339  -19.973 11.855  1.00 40.12  ? 91   SER B N   1 
ATOM   9844  C CA  . SER C 1 52  ? -83.246  -20.752 12.407  1.00 52.14  ? 91   SER B CA  1 
ATOM   9845  C C   . SER C 1 52  ? -82.771  -20.118 13.714  1.00 56.07  ? 91   SER B C   1 
ATOM   9846  O O   . SER C 1 52  ? -82.613  -18.899 13.791  1.00 56.02  ? 91   SER B O   1 
ATOM   9847  C CB  . SER C 1 52  ? -82.087  -20.820 11.416  1.00 45.74  ? 91   SER B CB  1 
ATOM   9848  O OG  . SER C 1 52  ? -81.082  -21.700 11.888  1.00 48.58  ? 91   SER B OG  1 
ATOM   9849  N N   . PRO C 1 53  ? -82.572  -20.946 14.754  1.00 65.62  ? 92   PRO B N   1 
ATOM   9850  C CA  . PRO C 1 53  ? -81.923  -20.512 15.997  1.00 68.04  ? 92   PRO B CA  1 
ATOM   9851  C C   . PRO C 1 53  ? -80.490  -20.071 15.706  1.00 66.01  ? 92   PRO B C   1 
ATOM   9852  O O   . PRO C 1 53  ? -79.877  -19.345 16.490  1.00 68.93  ? 92   PRO B O   1 
ATOM   9853  C CB  . PRO C 1 53  ? -81.930  -21.784 16.851  1.00 69.57  ? 92   PRO B CB  1 
ATOM   9854  C CG  . PRO C 1 53  ? -83.107  -22.560 16.350  1.00 72.18  ? 92   PRO B CG  1 
ATOM   9855  C CD  . PRO C 1 53  ? -83.108  -22.316 14.864  1.00 64.61  ? 92   PRO B CD  1 
ATOM   9856  N N   . SER C 1 54  ? -79.968  -20.517 14.569  1.00 62.80  ? 93   SER B N   1 
ATOM   9857  C CA  . SER C 1 54  ? -78.690  -20.035 14.068  1.00 63.48  ? 93   SER B CA  1 
ATOM   9858  C C   . SER C 1 54  ? -78.877  -18.663 13.415  1.00 66.30  ? 93   SER B C   1 
ATOM   9859  O O   . SER C 1 54  ? -79.731  -18.487 12.545  1.00 66.56  ? 93   SER B O   1 
ATOM   9860  C CB  . SER C 1 54  ? -78.103  -21.035 13.065  1.00 58.87  ? 93   SER B CB  1 
ATOM   9861  O OG  . SER C 1 54  ? -77.761  -20.403 11.842  1.00 60.29  ? 93   SER B OG  1 
ATOM   9862  N N   . GLN C 1 55  ? -78.083  -17.685 13.834  1.00 72.29  ? 94   GLN B N   1 
ATOM   9863  C CA  . GLN C 1 55  ? -78.185  -16.350 13.249  1.00 70.25  ? 94   GLN B CA  1 
ATOM   9864  C C   . GLN C 1 55  ? -77.482  -16.253 11.895  1.00 64.63  ? 94   GLN B C   1 
ATOM   9865  O O   . GLN C 1 55  ? -76.556  -15.458 11.707  1.00 59.20  ? 94   GLN B O   1 
ATOM   9866  C CB  . GLN C 1 55  ? -77.681  -15.277 14.215  1.00 71.35  ? 94   GLN B CB  1 
ATOM   9867  C CG  . GLN C 1 55  ? -78.767  -14.281 14.602  1.00 68.84  ? 94   GLN B CG  1 
ATOM   9868  C CD  . GLN C 1 55  ? -80.014  -14.965 15.135  1.00 72.30  ? 94   GLN B CD  1 
ATOM   9869  O OE1 . GLN C 1 55  ? -79.956  -15.703 16.119  1.00 70.56  ? 94   GLN B OE1 1 
ATOM   9870  N NE2 . GLN C 1 55  ? -81.152  -14.726 14.481  1.00 69.65  ? 94   GLN B NE2 1 
ATOM   9871  N N   . PHE C 1 56  ? -77.928  -17.089 10.963  1.00 56.66  ? 95   PHE B N   1 
ATOM   9872  C CA  . PHE C 1 56  ? -77.524  -16.990 9.564   1.00 53.58  ? 95   PHE B CA  1 
ATOM   9873  C C   . PHE C 1 56  ? -78.442  -17.867 8.722   1.00 43.07  ? 95   PHE B C   1 
ATOM   9874  O O   . PHE C 1 56  ? -79.291  -18.577 9.259   1.00 52.45  ? 95   PHE B O   1 
ATOM   9875  C CB  . PHE C 1 56  ? -76.061  -17.390 9.368   1.00 54.44  ? 95   PHE B CB  1 
ATOM   9876  C CG  . PHE C 1 56  ? -75.746  -18.777 9.835   1.00 65.44  ? 95   PHE B CG  1 
ATOM   9877  C CD1 . PHE C 1 56  ? -76.095  -19.878 9.068   1.00 55.32  ? 95   PHE B CD1 1 
ATOM   9878  C CD2 . PHE C 1 56  ? -75.095  -18.981 11.041  1.00 65.97  ? 95   PHE B CD2 1 
ATOM   9879  C CE1 . PHE C 1 56  ? -75.807  -21.155 9.496   1.00 51.92  ? 95   PHE B CE1 1 
ATOM   9880  C CE2 . PHE C 1 56  ? -74.800  -20.256 11.475  1.00 68.47  ? 95   PHE B CE2 1 
ATOM   9881  C CZ  . PHE C 1 56  ? -75.159  -21.347 10.701  1.00 70.88  ? 95   PHE B CZ  1 
ATOM   9882  N N   . MET C 1 57  ? -78.287  -17.812 7.406   1.00 37.03  ? 96   MET B N   1 
ATOM   9883  C CA  . MET C 1 57  ? -79.054  -18.698 6.545   1.00 48.78  ? 96   MET B CA  1 
ATOM   9884  C C   . MET C 1 57  ? -78.390  -20.059 6.416   1.00 43.90  ? 96   MET B C   1 
ATOM   9885  O O   . MET C 1 57  ? -77.345  -20.180 5.772   1.00 39.11  ? 96   MET B O   1 
ATOM   9886  C CB  . MET C 1 57  ? -79.221  -18.111 5.154   1.00 50.63  ? 96   MET B CB  1 
ATOM   9887  C CG  . MET C 1 57  ? -79.962  -19.060 4.234   1.00 43.61  ? 96   MET B CG  1 
ATOM   9888  S SD  . MET C 1 57  ? -80.073  -18.416 2.572   1.00 37.59  ? 96   MET B SD  1 
ATOM   9889  C CE  . MET C 1 57  ? -78.348  -18.279 2.125   1.00 33.15  ? 96   MET B CE  1 
ATOM   9890  N N   . PRO C 1 58  ? -79.003  -21.090 7.018   1.00 39.64  ? 97   PRO B N   1 
ATOM   9891  C CA  . PRO C 1 58  ? -78.456  -22.430 6.856   1.00 35.31  ? 97   PRO B CA  1 
ATOM   9892  C C   . PRO C 1 58  ? -78.940  -23.015 5.546   1.00 32.01  ? 97   PRO B C   1 
ATOM   9893  O O   . PRO C 1 58  ? -80.095  -23.441 5.451   1.00 33.59  ? 97   PRO B O   1 
ATOM   9894  C CB  . PRO C 1 58  ? -79.044  -23.199 8.041   1.00 34.58  ? 97   PRO B CB  1 
ATOM   9895  C CG  . PRO C 1 58  ? -80.076  -22.256 8.692   1.00 35.73  ? 97   PRO B CG  1 
ATOM   9896  C CD  . PRO C 1 58  ? -80.276  -21.114 7.751   1.00 30.11  ? 97   PRO B CD  1 
ATOM   9897  N N   . LEU C 1 59  ? -78.062  -23.004 4.546   1.00 26.45  ? 98   LEU B N   1 
ATOM   9898  C CA  . LEU C 1 59  ? -78.328  -23.629 3.256   1.00 35.34  ? 98   LEU B CA  1 
ATOM   9899  C C   . LEU C 1 59  ? -77.388  -24.816 3.001   1.00 30.66  ? 98   LEU B C   1 
ATOM   9900  O O   . LEU C 1 59  ? -76.162  -24.685 3.070   1.00 25.29  ? 98   LEU B O   1 
ATOM   9901  C CB  . LEU C 1 59  ? -78.186  -22.606 2.125   1.00 28.94  ? 98   LEU B CB  1 
ATOM   9902  C CG  . LEU C 1 59  ? -78.169  -23.154 0.695   1.00 32.16  ? 98   LEU B CG  1 
ATOM   9903  C CD1 . LEU C 1 59  ? -79.554  -23.661 0.282   1.00 24.99  ? 98   LEU B CD1 1 
ATOM   9904  C CD2 . LEU C 1 59  ? -77.663  -22.094 -0.276  1.00 28.39  ? 98   LEU B CD2 1 
ATOM   9905  N N   . VAL C 1 60  ? -77.959  -25.978 2.705   1.00 31.03  ? 99   VAL B N   1 
ATOM   9906  C CA  . VAL C 1 60  ? -77.140  -27.136 2.339   1.00 31.01  ? 99   VAL B CA  1 
ATOM   9907  C C   . VAL C 1 60  ? -77.609  -27.724 1.014   1.00 29.97  ? 99   VAL B C   1 
ATOM   9908  O O   . VAL C 1 60  ? -78.799  -27.923 0.797   1.00 25.29  ? 99   VAL B O   1 
ATOM   9909  C CB  . VAL C 1 60  ? -77.158  -28.242 3.420   1.00 34.87  ? 99   VAL B CB  1 
ATOM   9910  C CG1 . VAL C 1 60  ? -78.532  -28.869 3.503   1.00 32.27  ? 99   VAL B CG1 1 
ATOM   9911  C CG2 . VAL C 1 60  ? -76.097  -29.330 3.115   1.00 29.39  ? 99   VAL B CG2 1 
ATOM   9912  N N   . VAL C 1 61  ? -76.657  -27.992 0.132   1.00 28.69  ? 100  VAL B N   1 
ATOM   9913  C CA  . VAL C 1 61  ? -76.934  -28.679 -1.114  1.00 24.63  ? 100  VAL B CA  1 
ATOM   9914  C C   . VAL C 1 61  ? -76.364  -30.092 -1.038  1.00 32.10  ? 100  VAL B C   1 
ATOM   9915  O O   . VAL C 1 61  ? -75.204  -30.299 -0.684  1.00 25.63  ? 100  VAL B O   1 
ATOM   9916  C CB  . VAL C 1 61  ? -76.308  -27.966 -2.325  1.00 28.48  ? 100  VAL B CB  1 
ATOM   9917  C CG1 . VAL C 1 61  ? -76.642  -28.719 -3.593  1.00 26.99  ? 100  VAL B CG1 1 
ATOM   9918  C CG2 . VAL C 1 61  ? -76.782  -26.499 -2.420  1.00 24.09  ? 100  VAL B CG2 1 
ATOM   9919  N N   . ASP C 1 62  ? -77.189  -31.070 -1.364  1.00 29.55  ? 101  ASP B N   1 
ATOM   9920  C CA  . ASP C 1 62  ? -76.725  -32.441 -1.381  1.00 29.02  ? 101  ASP B CA  1 
ATOM   9921  C C   . ASP C 1 62  ? -76.949  -33.053 -2.754  1.00 37.90  ? 101  ASP B C   1 
ATOM   9922  O O   . ASP C 1 62  ? -78.075  -33.379 -3.139  1.00 34.09  ? 101  ASP B O   1 
ATOM   9923  C CB  . ASP C 1 62  ? -77.399  -33.248 -0.267  1.00 27.79  ? 101  ASP B CB  1 
ATOM   9924  C CG  . ASP C 1 62  ? -76.910  -32.836 1.130   1.00 37.89  ? 101  ASP B CG  1 
ATOM   9925  O OD1 . ASP C 1 62  ? -77.695  -32.242 1.894   1.00 44.58  ? 101  ASP B OD1 1 
ATOM   9926  O OD2 . ASP C 1 62  ? -75.730  -33.079 1.465   1.00 43.13  ? 101  ASP B OD2 1 
ATOM   9927  N N   . TYR C 1 63  ? -75.866  -33.182 -3.504  1.00 28.62  ? 102  TYR B N   1 
ATOM   9928  C CA  . TYR C 1 63  ? -75.919  -33.852 -4.795  1.00 30.38  ? 102  TYR B CA  1 
ATOM   9929  C C   . TYR C 1 63  ? -75.389  -35.254 -4.604  1.00 35.68  ? 102  TYR B C   1 
ATOM   9930  O O   . TYR C 1 63  ? -74.326  -35.436 -4.024  1.00 36.97  ? 102  TYR B O   1 
ATOM   9931  C CB  . TYR C 1 63  ? -75.075  -33.101 -5.809  1.00 26.90  ? 102  TYR B CB  1 
ATOM   9932  C CG  . TYR C 1 63  ? -74.909  -33.772 -7.158  1.00 29.27  ? 102  TYR B CG  1 
ATOM   9933  C CD1 . TYR C 1 63  ? -75.728  -33.434 -8.229  1.00 24.94  ? 102  TYR B CD1 1 
ATOM   9934  C CD2 . TYR C 1 63  ? -73.888  -34.698 -7.378  1.00 27.11  ? 102  TYR B CD2 1 
ATOM   9935  C CE1 . TYR C 1 63  ? -75.552  -34.020 -9.481  1.00 30.41  ? 102  TYR B CE1 1 
ATOM   9936  C CE2 . TYR C 1 63  ? -73.702  -35.287 -8.621  1.00 29.40  ? 102  TYR B CE2 1 
ATOM   9937  C CZ  . TYR C 1 63  ? -74.541  -34.947 -9.665  1.00 31.50  ? 102  TYR B CZ  1 
ATOM   9938  O OH  . TYR C 1 63  ? -74.363  -35.519 -10.900 1.00 30.89  ? 102  TYR B OH  1 
ATOM   9939  N N   . ARG C 1 64  ? -76.135  -36.243 -5.081  1.00 31.04  ? 103  ARG B N   1 
ATOM   9940  C CA  . ARG C 1 64  ? -75.786  -37.638 -4.838  1.00 34.23  ? 103  ARG B CA  1 
ATOM   9941  C C   . ARG C 1 64  ? -75.908  -38.453 -6.110  1.00 37.35  ? 103  ARG B C   1 
ATOM   9942  O O   . ARG C 1 64  ? -76.832  -38.254 -6.897  1.00 37.35  ? 103  ARG B O   1 
ATOM   9943  C CB  . ARG C 1 64  ? -76.678  -38.237 -3.745  1.00 36.26  ? 103  ARG B CB  1 
ATOM   9944  C CG  . ARG C 1 64  ? -75.913  -38.620 -2.478  1.00 58.29  ? 103  ARG B CG  1 
ATOM   9945  C CD  . ARG C 1 64  ? -76.591  -38.090 -1.220  1.00 69.75  ? 103  ARG B CD  1 
ATOM   9946  N NE  . ARG C 1 64  ? -75.626  -37.688 -0.193  1.00 66.08  ? 103  ARG B NE  1 
ATOM   9947  C CZ  . ARG C 1 64  ? -75.133  -36.454 -0.070  1.00 74.78  ? 103  ARG B CZ  1 
ATOM   9948  N NH1 . ARG C 1 64  ? -75.508  -35.499 -0.916  1.00 67.40  ? 103  ARG B NH1 1 
ATOM   9949  N NH2 . ARG C 1 64  ? -74.267  -36.167 0.896   1.00 71.71  ? 103  ARG B NH2 1 
ATOM   9950  N N   . GLN C 1 65  ? -74.950  -39.352 -6.313  1.00 41.49  ? 104  GLN B N   1 
ATOM   9951  C CA  . GLN C 1 65  ? -74.954  -40.269 -7.443  1.00 41.93  ? 104  GLN B CA  1 
ATOM   9952  C C   . GLN C 1 65  ? -75.465  -41.622 -6.980  1.00 44.44  ? 104  GLN B C   1 
ATOM   9953  O O   . GLN C 1 65  ? -75.446  -41.921 -5.785  1.00 37.05  ? 104  GLN B O   1 
ATOM   9954  C CB  . GLN C 1 65  ? -73.533  -40.475 -7.962  1.00 47.99  ? 104  GLN B CB  1 
ATOM   9955  C CG  . GLN C 1 65  ? -72.845  -39.250 -8.505  1.00 52.74  ? 104  GLN B CG  1 
ATOM   9956  C CD  . GLN C 1 65  ? -71.423  -39.560 -8.940  1.00 50.83  ? 104  GLN B CD  1 
ATOM   9957  O OE1 . GLN C 1 65  ? -70.687  -40.278 -8.251  1.00 48.91  ? 104  GLN B OE1 1 
ATOM   9958  N NE2 . GLN C 1 65  ? -71.038  -39.044 -10.099 1.00 51.06  ? 104  GLN B NE2 1 
ATOM   9959  N N   . LYS C 1 66  ? -75.896  -42.448 -7.930  1.00 36.44  ? 105  LYS B N   1 
ATOM   9960  C CA  . LYS C 1 66  ? -76.268  -43.823 -7.633  1.00 39.18  ? 105  LYS B CA  1 
ATOM   9961  C C   . LYS C 1 66  ? -75.223  -44.786 -8.187  1.00 46.31  ? 105  LYS B C   1 
ATOM   9962  O O   . LYS C 1 66  ? -75.245  -45.978 -7.883  1.00 44.60  ? 105  LYS B O   1 
ATOM   9963  C CB  . LYS C 1 66  ? -77.653  -44.149 -8.209  1.00 41.32  ? 105  LYS B CB  1 
ATOM   9964  C CG  . LYS C 1 66  ? -78.778  -43.414 -7.511  1.00 34.53  ? 105  LYS B CG  1 
ATOM   9965  C CD  . LYS C 1 66  ? -80.102  -43.562 -8.255  1.00 37.37  ? 105  LYS B CD  1 
ATOM   9966  C CE  . LYS C 1 66  ? -81.103  -42.496 -7.796  1.00 38.23  ? 105  LYS B CE  1 
ATOM   9967  N NZ  . LYS C 1 66  ? -82.383  -42.568 -8.565  1.00 33.89  ? 105  LYS B NZ  1 
ATOM   9968  N N   . ALA C 1 67  ? -74.301  -44.257 -8.990  1.00 40.81  ? 106  ALA B N   1 
ATOM   9969  C CA  . ALA C 1 67  ? -73.279  -45.081 -9.629  1.00 46.17  ? 106  ALA B CA  1 
ATOM   9970  C C   . ALA C 1 67  ? -72.000  -44.299 -9.932  1.00 47.61  ? 106  ALA B C   1 
ATOM   9971  O O   . ALA C 1 67  ? -72.026  -43.075 -10.091 1.00 47.50  ? 106  ALA B O   1 
ATOM   9972  C CB  . ALA C 1 67  ? -73.827  -45.710 -10.911 1.00 45.50  ? 106  ALA B CB  1 
ATOM   9973  N N   . ALA C 1 68  ? -70.887  -45.025 -10.022 1.00 46.93  ? 107  ALA B N   1 
ATOM   9974  C CA  . ALA C 1 68  ? -69.602  -44.441 -10.389 1.00 49.79  ? 107  ALA B CA  1 
ATOM   9975  C C   . ALA C 1 68  ? -69.349  -44.636 -11.879 1.00 54.98  ? 107  ALA B C   1 
ATOM   9976  O O   . ALA C 1 68  ? -70.085  -45.371 -12.547 1.00 49.34  ? 107  ALA B O   1 
ATOM   9977  C CB  . ALA C 1 68  ? -68.476  -45.067 -9.562  1.00 50.15  ? 107  ALA B CB  1 
ATOM   9978  N N   . ALA C 1 69  ? -68.311  -43.972 -12.387 1.00 44.33  ? 108  ALA B N   1 
ATOM   9979  C CA  . ALA C 1 69  ? -67.914  -44.067 -13.794 1.00 52.88  ? 108  ALA B CA  1 
ATOM   9980  C C   . ALA C 1 69  ? -69.034  -43.661 -14.761 1.00 58.72  ? 108  ALA B C   1 
ATOM   9981  O O   . ALA C 1 69  ? -69.303  -44.346 -15.751 1.00 58.54  ? 108  ALA B O   1 
ATOM   9982  C CB  . ALA C 1 69  ? -67.392  -45.468 -14.114 1.00 51.05  ? 108  ALA B CB  1 
ATOM   9983  N N   . ALA C 1 70  ? -69.666  -42.527 -14.479 1.00 61.13  ? 109  ALA B N   1 
ATOM   9984  C CA  . ALA C 1 70  ? -70.825  -42.084 -15.243 1.00 62.28  ? 109  ALA B CA  1 
ATOM   9985  C C   . ALA C 1 70  ? -71.816  -43.232 -15.452 1.00 55.39  ? 109  ALA B C   1 
ATOM   9986  O O   . ALA C 1 70  ? -72.082  -43.647 -16.583 1.00 50.30  ? 109  ALA B O   1 
ATOM   9987  C CB  . ALA C 1 70  ? -70.401  -41.470 -16.579 1.00 57.56  ? 109  ALA B CB  1 
ATOM   9988  N N   . GLY C 1 71  ? -72.326  -43.758 -14.340 1.00 57.32  ? 110  GLY B N   1 
ATOM   9989  C CA  . GLY C 1 71  ? -73.476  -44.640 -14.358 1.00 59.44  ? 110  GLY B CA  1 
ATOM   9990  C C   . GLY C 1 71  ? -73.209  -46.101 -14.653 1.00 66.09  ? 110  GLY B C   1 
ATOM   9991  O O   . GLY C 1 71  ? -74.150  -46.894 -14.702 1.00 53.33  ? 110  GLY B O   1 
ATOM   9992  N N   . ARG C 1 72  ? -71.943  -46.464 -14.847 1.00 55.67  ? 111  ARG B N   1 
ATOM   9993  C CA  . ARG C 1 72  ? -71.589  -47.849 -15.150 1.00 53.04  ? 111  ARG B CA  1 
ATOM   9994  C C   . ARG C 1 72  ? -71.491  -48.702 -13.881 1.00 62.48  ? 111  ARG B C   1 
ATOM   9995  O O   . ARG C 1 72  ? -71.934  -49.856 -13.867 1.00 51.55  ? 111  ARG B O   1 
ATOM   9996  C CB  . ARG C 1 72  ? -70.272  -47.908 -15.927 1.00 56.53  ? 111  ARG B CB  1 
ATOM   9997  C CG  . ARG C 1 72  ? -70.095  -46.758 -16.900 1.00 66.08  ? 111  ARG B CG  1 
ATOM   9998  C CD  . ARG C 1 72  ? -70.641  -47.070 -18.283 1.00 70.60  ? 111  ARG B CD  1 
ATOM   9999  N NE  . ARG C 1 72  ? -69.595  -47.568 -19.176 1.00 81.71  ? 111  ARG B NE  1 
ATOM   10000 C CZ  . ARG C 1 72  ? -68.747  -46.790 -19.846 1.00 77.55  ? 111  ARG B CZ  1 
ATOM   10001 N NH1 . ARG C 1 72  ? -68.817  -45.469 -19.729 1.00 75.71  ? 111  ARG B NH1 1 
ATOM   10002 N NH2 . ARG C 1 72  ? -67.823  -47.332 -20.633 1.00 79.75  ? 111  ARG B NH2 1 
ATOM   10003 N N   . ILE C 1 73  ? -70.925  -48.134 -12.814 1.00 49.03  ? 112  ILE B N   1 
ATOM   10004 C CA  . ILE C 1 73  ? -70.697  -48.892 -11.582 1.00 47.73  ? 112  ILE B CA  1 
ATOM   10005 C C   . ILE C 1 73  ? -71.641  -48.525 -10.430 1.00 49.29  ? 112  ILE B C   1 
ATOM   10006 O O   . ILE C 1 73  ? -71.453  -47.506 -9.768  1.00 51.63  ? 112  ILE B O   1 
ATOM   10007 C CB  . ILE C 1 73  ? -69.230  -48.763 -11.101 1.00 46.07  ? 112  ILE B CB  1 
ATOM   10008 C CG1 . ILE C 1 73  ? -68.274  -49.215 -12.201 1.00 57.51  ? 112  ILE B CG1 1 
ATOM   10009 C CG2 . ILE C 1 73  ? -69.000  -49.596 -9.843  1.00 44.86  ? 112  ILE B CG2 1 
ATOM   10010 C CD1 . ILE C 1 73  ? -68.455  -50.677 -12.582 1.00 55.77  ? 112  ILE B CD1 1 
ATOM   10011 N N   . PRO C 1 74  ? -72.645  -49.378 -10.169 1.00 55.65  ? 113  PRO B N   1 
ATOM   10012 C CA  . PRO C 1 74  ? -73.575  -49.202 -9.044  1.00 53.05  ? 113  PRO B CA  1 
ATOM   10013 C C   . PRO C 1 74  ? -72.847  -49.024 -7.702  1.00 53.35  ? 113  PRO B C   1 
ATOM   10014 O O   . PRO C 1 74  ? -71.918  -49.772 -7.394  1.00 45.48  ? 113  PRO B O   1 
ATOM   10015 C CB  . PRO C 1 74  ? -74.367  -50.514 -9.041  1.00 52.58  ? 113  PRO B CB  1 
ATOM   10016 C CG  . PRO C 1 74  ? -74.290  -50.992 -10.454 1.00 48.90  ? 113  PRO B CG  1 
ATOM   10017 C CD  . PRO C 1 74  ? -72.933  -50.599 -10.942 1.00 52.30  ? 113  PRO B CD  1 
ATOM   10018 N N   . THR C 1 75  ? -73.280  -48.044 -6.914  1.00 48.01  ? 114  THR B N   1 
ATOM   10019 C CA  . THR C 1 75  ? -72.632  -47.739 -5.641  1.00 53.61  ? 114  THR B CA  1 
ATOM   10020 C C   . THR C 1 75  ? -73.619  -47.340 -4.556  1.00 52.73  ? 114  THR B C   1 
ATOM   10021 O O   . THR C 1 75  ? -73.245  -47.241 -3.384  1.00 52.18  ? 114  THR B O   1 
ATOM   10022 C CB  . THR C 1 75  ? -71.623  -46.578 -5.782  1.00 53.96  ? 114  THR B CB  1 
ATOM   10023 O OG1 . THR C 1 75  ? -72.296  -45.420 -6.299  1.00 45.40  ? 114  THR B OG1 1 
ATOM   10024 C CG2 . THR C 1 75  ? -70.474  -46.965 -6.707  1.00 44.93  ? 114  THR B CG2 1 
ATOM   10025 N N   . ASN C 1 76  ? -74.872  -47.101 -4.933  1.00 44.80  ? 115  ASN B N   1 
ATOM   10026 C CA  . ASN C 1 76  ? -75.838  -46.606 -3.962  1.00 52.62  ? 115  ASN B CA  1 
ATOM   10027 C C   . ASN C 1 76  ? -76.121  -47.601 -2.840  1.00 44.84  ? 115  ASN B C   1 
ATOM   10028 O O   . ASN C 1 76  ? -76.569  -47.212 -1.762  1.00 45.45  ? 115  ASN B O   1 
ATOM   10029 C CB  . ASN C 1 76  ? -77.128  -46.106 -4.629  1.00 52.29  ? 115  ASN B CB  1 
ATOM   10030 C CG  . ASN C 1 76  ? -77.951  -47.223 -5.253  1.00 48.55  ? 115  ASN B CG  1 
ATOM   10031 O OD1 . ASN C 1 76  ? -77.430  -48.286 -5.593  1.00 49.86  ? 115  ASN B OD1 1 
ATOM   10032 N ND2 . ASN C 1 76  ? -79.250  -46.972 -5.418  1.00 41.80  ? 115  ASN B ND2 1 
ATOM   10033 N N   . TYR C 1 77  ? -75.823  -48.876 -3.079  1.00 46.38  ? 116  TYR B N   1 
ATOM   10034 C CA  . TYR C 1 77  ? -76.007  -49.894 -2.045  1.00 49.65  ? 116  TYR B CA  1 
ATOM   10035 C C   . TYR C 1 77  ? -74.932  -49.848 -0.956  1.00 53.88  ? 116  TYR B C   1 
ATOM   10036 O O   . TYR C 1 77  ? -75.077  -50.485 0.090   1.00 56.82  ? 116  TYR B O   1 
ATOM   10037 C CB  . TYR C 1 77  ? -76.091  -51.298 -2.654  1.00 47.54  ? 116  TYR B CB  1 
ATOM   10038 C CG  . TYR C 1 77  ? -74.831  -51.746 -3.352  1.00 41.12  ? 116  TYR B CG  1 
ATOM   10039 C CD1 . TYR C 1 77  ? -73.882  -52.523 -2.690  1.00 45.32  ? 116  TYR B CD1 1 
ATOM   10040 C CD2 . TYR C 1 77  ? -74.585  -51.389 -4.669  1.00 46.62  ? 116  TYR B CD2 1 
ATOM   10041 C CE1 . TYR C 1 77  ? -72.721  -52.932 -3.327  1.00 43.61  ? 116  TYR B CE1 1 
ATOM   10042 C CE2 . TYR C 1 77  ? -73.428  -51.791 -5.313  1.00 52.47  ? 116  TYR B CE2 1 
ATOM   10043 C CZ  . TYR C 1 77  ? -72.501  -52.564 -4.638  1.00 48.28  ? 116  TYR B CZ  1 
ATOM   10044 O OH  . TYR C 1 77  ? -71.354  -52.966 -5.283  1.00 52.30  ? 116  TYR B OH  1 
ATOM   10045 N N   . LEU C 1 78  ? -73.859  -49.095 -1.197  1.00 58.87  ? 117  LEU B N   1 
ATOM   10046 C CA  . LEU C 1 78  ? -72.773  -48.970 -0.221  1.00 60.34  ? 117  LEU B CA  1 
ATOM   10047 C C   . LEU C 1 78  ? -73.062  -47.921 0.857   1.00 66.92  ? 117  LEU B C   1 
ATOM   10048 O O   . LEU C 1 78  ? -73.045  -46.714 0.600   1.00 66.98  ? 117  LEU B O   1 
ATOM   10049 C CB  . LEU C 1 78  ? -71.444  -48.666 -0.927  1.00 55.17  ? 117  LEU B CB  1 
ATOM   10050 C CG  . LEU C 1 78  ? -71.032  -49.695 -1.988  1.00 59.59  ? 117  LEU B CG  1 
ATOM   10051 C CD1 . LEU C 1 78  ? -69.809  -49.241 -2.773  1.00 62.15  ? 117  LEU B CD1 1 
ATOM   10052 C CD2 . LEU C 1 78  ? -70.795  -51.070 -1.363  1.00 58.57  ? 117  LEU B CD2 1 
ATOM   10053 N N   . GLY C 1 83  ? -72.900  -39.988 -0.113  1.00 56.50  ? 122  GLY B N   1 
ATOM   10054 C CA  . GLY C 1 83  ? -71.985  -41.024 -0.572  1.00 75.35  ? 122  GLY B CA  1 
ATOM   10055 C C   . GLY C 1 83  ? -70.804  -41.304 0.351   1.00 75.80  ? 122  GLY B C   1 
ATOM   10056 O O   . GLY C 1 83  ? -70.708  -42.386 0.939   1.00 73.29  ? 122  GLY B O   1 
ATOM   10057 N N   . THR C 1 84  ? -69.875  -40.352 0.436   1.00 70.75  ? 123  THR B N   1 
ATOM   10058 C CA  . THR C 1 84  ? -69.901  -39.181 -0.435  1.00 51.33  ? 123  THR B CA  1 
ATOM   10059 C C   . THR C 1 84  ? -68.588  -39.087 -1.209  1.00 58.22  ? 123  THR B C   1 
ATOM   10060 O O   . THR C 1 84  ? -67.517  -38.931 -0.620  1.00 51.49  ? 123  THR B O   1 
ATOM   10061 C CB  . THR C 1 84  ? -70.139  -37.885 0.345   1.00 62.35  ? 123  THR B CB  1 
ATOM   10062 O OG1 . THR C 1 84  ? -71.002  -38.143 1.460   1.00 77.74  ? 123  THR B OG1 1 
ATOM   10063 C CG2 . THR C 1 84  ? -70.778  -36.841 -0.557  1.00 50.80  ? 123  THR B CG2 1 
ATOM   10064 N N   . SER C 1 85  ? -68.679  -39.196 -2.532  1.00 50.36  ? 124  SER B N   1 
ATOM   10065 C CA  . SER C 1 85  ? -67.501  -39.196 -3.393  1.00 45.62  ? 124  SER B CA  1 
ATOM   10066 C C   . SER C 1 85  ? -67.006  -37.790 -3.673  1.00 43.48  ? 124  SER B C   1 
ATOM   10067 O O   . SER C 1 85  ? -67.718  -36.807 -3.444  1.00 36.74  ? 124  SER B O   1 
ATOM   10068 C CB  . SER C 1 85  ? -67.812  -39.881 -4.724  1.00 40.33  ? 124  SER B CB  1 
ATOM   10069 O OG  . SER C 1 85  ? -68.639  -39.061 -5.539  1.00 42.32  ? 124  SER B OG  1 
ATOM   10070 N N   . ASP C 1 86  ? -65.784  -37.705 -4.189  1.00 40.35  ? 125  ASP B N   1 
ATOM   10071 C CA  . ASP C 1 86  ? -65.221  -36.431 -4.593  1.00 37.42  ? 125  ASP B CA  1 
ATOM   10072 C C   . ASP C 1 86  ? -66.179  -35.722 -5.525  1.00 39.96  ? 125  ASP B C   1 
ATOM   10073 O O   . ASP C 1 86  ? -66.526  -34.562 -5.290  1.00 33.19  ? 125  ASP B O   1 
ATOM   10074 C CB  . ASP C 1 86  ? -63.863  -36.607 -5.276  1.00 41.43  ? 125  ASP B CB  1 
ATOM   10075 C CG  . ASP C 1 86  ? -62.715  -36.691 -4.281  1.00 51.86  ? 125  ASP B CG  1 
ATOM   10076 O OD1 . ASP C 1 86  ? -62.972  -36.960 -3.083  1.00 40.86  ? 125  ASP B OD1 1 
ATOM   10077 O OD2 . ASP C 1 86  ? -61.554  -36.486 -4.701  1.00 49.21  ? 125  ASP B OD2 1 
ATOM   10078 N N   . LYS C 1 87  ? -66.608  -36.427 -6.573  1.00 33.13  ? 126  LYS B N   1 
ATOM   10079 C CA  . LYS C 1 87  ? -67.535  -35.871 -7.559  1.00 37.69  ? 126  LYS B CA  1 
ATOM   10080 C C   . LYS C 1 87  ? -68.766  -35.258 -6.890  1.00 32.07  ? 126  LYS B C   1 
ATOM   10081 O O   . LYS C 1 87  ? -69.185  -34.145 -7.231  1.00 29.65  ? 126  LYS B O   1 
ATOM   10082 C CB  . LYS C 1 87  ? -67.970  -36.938 -8.570  1.00 40.49  ? 126  LYS B CB  1 
ATOM   10083 C CG  . LYS C 1 87  ? -69.035  -36.461 -9.576  1.00 40.46  ? 126  LYS B CG  1 
ATOM   10084 C CD  . LYS C 1 87  ? -68.457  -35.483 -10.598 1.00 40.19  ? 126  LYS B CD  1 
ATOM   10085 C CE  . LYS C 1 87  ? -69.549  -34.878 -11.485 1.00 43.87  ? 126  LYS B CE  1 
ATOM   10086 N NZ  . LYS C 1 87  ? -70.431  -35.905 -12.124 1.00 53.51  ? 126  LYS B NZ  1 
ATOM   10087 N N   . GLU C 1 88  ? -69.325  -35.987 -5.929  1.00 29.72  ? 127  GLU B N   1 
ATOM   10088 C CA  . GLU C 1 88  ? -70.530  -35.554 -5.237  1.00 32.79  ? 127  GLU B CA  1 
ATOM   10089 C C   . GLU C 1 88  ? -70.312  -34.302 -4.393  1.00 35.39  ? 127  GLU B C   1 
ATOM   10090 O O   . GLU C 1 88  ? -71.132  -33.381 -4.410  1.00 32.97  ? 127  GLU B O   1 
ATOM   10091 C CB  . GLU C 1 88  ? -71.087  -36.691 -4.381  1.00 31.65  ? 127  GLU B CB  1 
ATOM   10092 C CG  . GLU C 1 88  ? -71.773  -37.780 -5.218  1.00 38.32  ? 127  GLU B CG  1 
ATOM   10093 C CD  . GLU C 1 88  ? -72.025  -39.059 -4.433  1.00 39.38  ? 127  GLU B CD  1 
ATOM   10094 O OE1 . GLU C 1 88  ? -71.242  -39.352 -3.509  1.00 44.68  ? 127  GLU B OE1 1 
ATOM   10095 O OE2 . GLU C 1 88  ? -73.004  -39.773 -4.741  1.00 45.10  ? 127  GLU B OE2 1 
ATOM   10096 N N   . ILE C 1 89  ? -69.212  -34.276 -3.649  1.00 31.59  ? 128  ILE B N   1 
ATOM   10097 C CA  . ILE C 1 89  ? -68.895  -33.127 -2.817  1.00 30.83  ? 128  ILE B CA  1 
ATOM   10098 C C   . ILE C 1 89  ? -68.662  -31.874 -3.658  1.00 28.42  ? 128  ILE B C   1 
ATOM   10099 O O   . ILE C 1 89  ? -69.196  -30.805 -3.349  1.00 28.15  ? 128  ILE B O   1 
ATOM   10100 C CB  . ILE C 1 89  ? -67.681  -33.406 -1.911  1.00 29.97  ? 128  ILE B CB  1 
ATOM   10101 C CG1 . ILE C 1 89  ? -68.080  -34.392 -0.813  1.00 35.27  ? 128  ILE B CG1 1 
ATOM   10102 C CG2 . ILE C 1 89  ? -67.138  -32.103 -1.296  1.00 31.75  ? 128  ILE B CG2 1 
ATOM   10103 C CD1 . ILE C 1 89  ? -66.990  -35.393 -0.459  1.00 47.10  ? 128  ILE B CD1 1 
ATOM   10104 N N   . LEU C 1 90  ? -67.881  -32.012 -4.723  1.00 24.57  ? 129  LEU B N   1 
ATOM   10105 C CA  . LEU C 1 90  ? -67.564  -30.869 -5.575  1.00 33.18  ? 129  LEU B CA  1 
ATOM   10106 C C   . LEU C 1 90  ? -68.817  -30.367 -6.310  1.00 29.68  ? 129  LEU B C   1 
ATOM   10107 O O   . LEU C 1 90  ? -69.056  -29.172 -6.401  1.00 27.97  ? 129  LEU B O   1 
ATOM   10108 C CB  . LEU C 1 90  ? -66.442  -31.225 -6.553  1.00 26.41  ? 129  LEU B CB  1 
ATOM   10109 C CG  . LEU C 1 90  ? -65.114  -31.650 -5.897  1.00 27.57  ? 129  LEU B CG  1 
ATOM   10110 C CD1 . LEU C 1 90  ? -64.186  -32.280 -6.933  1.00 34.28  ? 129  LEU B CD1 1 
ATOM   10111 C CD2 . LEU C 1 90  ? -64.433  -30.460 -5.233  1.00 29.18  ? 129  LEU B CD2 1 
ATOM   10112 N N   . THR C 1 91  ? -69.639  -31.280 -6.809  1.00 27.23  ? 130  THR B N   1 
ATOM   10113 C CA  . THR C 1 91  ? -70.867  -30.853 -7.481  1.00 25.83  ? 130  THR B CA  1 
ATOM   10114 C C   . THR C 1 91  ? -71.827  -30.122 -6.536  1.00 26.05  ? 130  THR B C   1 
ATOM   10115 O O   . THR C 1 91  ? -72.414  -29.109 -6.897  1.00 29.63  ? 130  THR B O   1 
ATOM   10116 C CB  . THR C 1 91  ? -71.569  -32.030 -8.200  1.00 26.39  ? 130  THR B CB  1 
ATOM   10117 O OG1 . THR C 1 91  ? -70.654  -32.605 -9.139  1.00 28.67  ? 130  THR B OG1 1 
ATOM   10118 C CG2 . THR C 1 91  ? -72.807  -31.535 -8.950  1.00 23.26  ? 130  THR B CG2 1 
ATOM   10119 N N   . SER C 1 92  ? -71.977  -30.630 -5.320  1.00 23.96  ? 131  SER B N   1 
ATOM   10120 C CA  . SER C 1 92  ? -72.776  -29.943 -4.316  1.00 23.47  ? 131  SER B CA  1 
ATOM   10121 C C   . SER C 1 92  ? -72.274  -28.512 -4.102  1.00 28.46  ? 131  SER B C   1 
ATOM   10122 O O   . SER C 1 92  ? -73.067  -27.572 -3.989  1.00 22.76  ? 131  SER B O   1 
ATOM   10123 C CB  . SER C 1 92  ? -72.716  -30.687 -2.981  1.00 28.58  ? 131  SER B CB  1 
ATOM   10124 O OG  . SER C 1 92  ? -73.351  -31.946 -3.062  1.00 32.44  ? 131  SER B OG  1 
ATOM   10125 N N   . ARG C 1 93  ? -70.952  -28.345 -4.033  1.00 25.46  ? 132  ARG B N   1 
ATOM   10126 C CA  . ARG C 1 93  ? -70.387  -27.017 -3.797  1.00 28.28  ? 132  ARG B CA  1 
ATOM   10127 C C   . ARG C 1 93  ? -70.585  -26.075 -4.988  1.00 25.73  ? 132  ARG B C   1 
ATOM   10128 O O   . ARG C 1 93  ? -70.827  -24.881 -4.812  1.00 28.52  ? 132  ARG B O   1 
ATOM   10129 C CB  . ARG C 1 93  ? -68.900  -27.111 -3.401  1.00 25.17  ? 132  ARG B CB  1 
ATOM   10130 C CG  . ARG C 1 93  ? -68.697  -27.707 -2.003  1.00 25.70  ? 132  ARG B CG  1 
ATOM   10131 C CD  . ARG C 1 93  ? -67.209  -28.015 -1.734  1.00 30.45  ? 132  ARG B CD  1 
ATOM   10132 N NE  . ARG C 1 93  ? -66.381  -26.809 -1.826  1.00 31.21  ? 132  ARG B NE  1 
ATOM   10133 C CZ  . ARG C 1 93  ? -66.277  -25.897 -0.859  1.00 35.12  ? 132  ARG B CZ  1 
ATOM   10134 N NH1 . ARG C 1 93  ? -66.952  -26.049 0.270   1.00 28.66  ? 132  ARG B NH1 1 
ATOM   10135 N NH2 . ARG C 1 93  ? -65.486  -24.838 -1.017  1.00 35.00  ? 132  ARG B NH2 1 
ATOM   10136 N N   . ILE C 1 94  ? -70.471  -26.598 -6.204  1.00 23.33  ? 133  ILE B N   1 
ATOM   10137 C CA  . ILE C 1 94  ? -70.725  -25.748 -7.358  1.00 30.40  ? 133  ILE B CA  1 
ATOM   10138 C C   . ILE C 1 94  ? -72.193  -25.303 -7.428  1.00 25.71  ? 133  ILE B C   1 
ATOM   10139 O O   . ILE C 1 94  ? -72.497  -24.148 -7.765  1.00 27.62  ? 133  ILE B O   1 
ATOM   10140 C CB  . ILE C 1 94  ? -70.270  -26.405 -8.679  1.00 33.51  ? 133  ILE B CB  1 
ATOM   10141 C CG1 . ILE C 1 94  ? -70.339  -25.396 -9.821  1.00 32.45  ? 133  ILE B CG1 1 
ATOM   10142 C CG2 . ILE C 1 94  ? -71.115  -27.614 -9.026  1.00 36.96  ? 133  ILE B CG2 1 
ATOM   10143 C CD1 . ILE C 1 94  ? -69.758  -25.942 -11.116 1.00 45.00  ? 133  ILE B CD1 1 
ATOM   10144 N N   . ILE C 1 95  ? -73.103  -26.211 -7.095  1.00 23.36  ? 134  ILE B N   1 
ATOM   10145 C CA  . ILE C 1 95  ? -74.514  -25.857 -7.069  1.00 23.72  ? 134  ILE B CA  1 
ATOM   10146 C C   . ILE C 1 95  ? -74.770  -24.827 -5.980  1.00 27.26  ? 134  ILE B C   1 
ATOM   10147 O O   . ILE C 1 95  ? -75.512  -23.854 -6.182  1.00 23.57  ? 134  ILE B O   1 
ATOM   10148 C CB  . ILE C 1 95  ? -75.407  -27.075 -6.806  1.00 26.17  ? 134  ILE B CB  1 
ATOM   10149 C CG1 . ILE C 1 95  ? -75.242  -28.117 -7.923  1.00 21.57  ? 134  ILE B CG1 1 
ATOM   10150 C CG2 . ILE C 1 95  ? -76.879  -26.620 -6.639  1.00 23.92  ? 134  ILE B CG2 1 
ATOM   10151 C CD1 . ILE C 1 95  ? -75.827  -29.497 -7.568  1.00 24.09  ? 134  ILE B CD1 1 
ATOM   10152 N N   . ASP C 1 96  ? -74.172  -25.062 -4.816  1.00 24.32  ? 135  ASP B N   1 
ATOM   10153 C CA  . ASP C 1 96  ? -74.291  -24.133 -3.703  1.00 26.19  ? 135  ASP B CA  1 
ATOM   10154 C C   . ASP C 1 96  ? -73.869  -22.713 -4.124  1.00 29.10  ? 135  ASP B C   1 
ATOM   10155 O O   . ASP C 1 96  ? -74.599  -21.758 -3.889  1.00 25.17  ? 135  ASP B O   1 
ATOM   10156 C CB  . ASP C 1 96  ? -73.471  -24.620 -2.499  1.00 25.32  ? 135  ASP B CB  1 
ATOM   10157 C CG  . ASP C 1 96  ? -73.608  -23.708 -1.293  1.00 28.21  ? 135  ASP B CG  1 
ATOM   10158 O OD1 . ASP C 1 96  ? -73.185  -22.541 -1.387  1.00 30.96  ? 135  ASP B OD1 1 
ATOM   10159 O OD2 . ASP C 1 96  ? -74.129  -24.150 -0.249  1.00 27.15  ? 135  ASP B OD2 1 
ATOM   10160 N N   . ARG C 1 97  ? -72.707  -22.588 -4.761  1.00 27.69  ? 136  ARG B N   1 
ATOM   10161 C CA  . ARG C 1 97  ? -72.206  -21.281 -5.188  1.00 31.89  ? 136  ARG B CA  1 
ATOM   10162 C C   . ARG C 1 97  ? -73.119  -20.638 -6.222  1.00 33.63  ? 136  ARG B C   1 
ATOM   10163 O O   . ARG C 1 97  ? -73.181  -19.418 -6.330  1.00 28.20  ? 136  ARG B O   1 
ATOM   10164 C CB  . ARG C 1 97  ? -70.773  -21.372 -5.751  1.00 25.36  ? 136  ARG B CB  1 
ATOM   10165 C CG  . ARG C 1 97  ? -69.671  -21.351 -4.689  1.00 40.03  ? 136  ARG B CG  1 
ATOM   10166 C CD  . ARG C 1 97  ? -68.276  -21.036 -5.286  1.00 41.46  ? 136  ARG B CD  1 
ATOM   10167 N NE  . ARG C 1 97  ? -67.745  -22.141 -6.084  1.00 34.13  ? 136  ARG B NE  1 
ATOM   10168 C CZ  . ARG C 1 97  ? -67.271  -23.277 -5.572  1.00 48.76  ? 136  ARG B CZ  1 
ATOM   10169 N NH1 . ARG C 1 97  ? -67.241  -23.464 -4.251  1.00 42.40  ? 136  ARG B NH1 1 
ATOM   10170 N NH2 . ARG C 1 97  ? -66.825  -24.232 -6.379  1.00 45.26  ? 136  ARG B NH2 1 
ATOM   10171 N N   . SER C 1 98  ? -73.828  -21.469 -6.978  1.00 28.61  ? 137  SER B N   1 
ATOM   10172 C CA  . SER C 1 98  ? -74.686  -20.988 -8.060  1.00 23.86  ? 137  SER B CA  1 
ATOM   10173 C C   . SER C 1 98  ? -76.011  -20.386 -7.572  1.00 22.21  ? 137  SER B C   1 
ATOM   10174 O O   . SER C 1 98  ? -76.646  -19.619 -8.298  1.00 28.08  ? 137  SER B O   1 
ATOM   10175 C CB  . SER C 1 98  ? -74.968  -22.123 -9.055  1.00 22.18  ? 137  SER B CB  1 
ATOM   10176 O OG  . SER C 1 98  ? -73.788  -22.533 -9.718  1.00 23.71  ? 137  SER B OG  1 
ATOM   10177 N N   . ILE C 1 99  ? -76.421  -20.730 -6.353  1.00 20.70  ? 138  ILE B N   1 
ATOM   10178 C CA  . ILE C 1 99  ? -77.743  -20.337 -5.858  1.00 25.15  ? 138  ILE B CA  1 
ATOM   10179 C C   . ILE C 1 99  ? -77.694  -19.509 -4.577  1.00 23.06  ? 138  ILE B C   1 
ATOM   10180 O O   . ILE C 1 99  ? -78.578  -18.704 -4.331  1.00 21.11  ? 138  ILE B O   1 
ATOM   10181 C CB  . ILE C 1 99  ? -78.678  -21.564 -5.608  1.00 26.87  ? 138  ILE B CB  1 
ATOM   10182 C CG1 . ILE C 1 99  ? -78.173  -22.420 -4.433  1.00 23.80  ? 138  ILE B CG1 1 
ATOM   10183 C CG2 . ILE C 1 99  ? -78.839  -22.398 -6.878  1.00 23.25  ? 138  ILE B CG2 1 
ATOM   10184 C CD1 . ILE C 1 99  ? -79.026  -23.703 -4.181  1.00 21.48  ? 138  ILE B CD1 1 
ATOM   10185 N N   . ARG C 1 100 ? -76.661  -19.720 -3.768  1.00 26.28  ? 139  ARG B N   1 
ATOM   10186 C CA  . ARG C 1 100 ? -76.505  -19.014 -2.494  1.00 31.05  ? 139  ARG B CA  1 
ATOM   10187 C C   . ARG C 1 100 ? -76.673  -17.477 -2.580  1.00 27.30  ? 139  ARG B C   1 
ATOM   10188 O O   . ARG C 1 100 ? -77.386  -16.881 -1.767  1.00 26.00  ? 139  ARG B O   1 
ATOM   10189 C CB  . ARG C 1 100 ? -75.137  -19.363 -1.869  1.00 25.06  ? 139  ARG B CB  1 
ATOM   10190 C CG  . ARG C 1 100 ? -74.946  -18.845 -0.440  1.00 30.56  ? 139  ARG B CG  1 
ATOM   10191 C CD  . ARG C 1 100 ? -73.689  -19.452 0.210   1.00 30.54  ? 139  ARG B CD  1 
ATOM   10192 N NE  . ARG C 1 100 ? -73.894  -20.848 0.609   1.00 33.76  ? 139  ARG B NE  1 
ATOM   10193 C CZ  . ARG C 1 100 ? -74.420  -21.224 1.771   1.00 31.43  ? 139  ARG B CZ  1 
ATOM   10194 N NH1 . ARG C 1 100 ? -74.786  -20.309 2.650   1.00 26.46  ? 139  ARG B NH1 1 
ATOM   10195 N NH2 . ARG C 1 100 ? -74.574  -22.514 2.060   1.00 25.61  ? 139  ARG B NH2 1 
ATOM   10196 N N   . PRO C 1 101 ? -76.021  -16.833 -3.564  1.00 27.52  ? 140  PRO B N   1 
ATOM   10197 C CA  . PRO C 1 101 ? -76.034  -15.360 -3.603  1.00 30.21  ? 140  PRO B CA  1 
ATOM   10198 C C   . PRO C 1 101 ? -77.402  -14.752 -3.884  1.00 36.21  ? 140  PRO B C   1 
ATOM   10199 O O   . PRO C 1 101 ? -77.523  -13.537 -3.761  1.00 31.60  ? 140  PRO B O   1 
ATOM   10200 C CB  . PRO C 1 101 ? -75.099  -15.023 -4.776  1.00 28.44  ? 140  PRO B CB  1 
ATOM   10201 C CG  . PRO C 1 101 ? -74.288  -16.261 -5.008  1.00 27.11  ? 140  PRO B CG  1 
ATOM   10202 C CD  . PRO C 1 101 ? -75.207  -17.399 -4.651  1.00 28.24  ? 140  PRO B CD  1 
ATOM   10203 N N   . LEU C 1 102 ? -78.394  -15.549 -4.281  1.00 27.28  ? 141  LEU B N   1 
ATOM   10204 C CA  . LEU C 1 102 ? -79.681  -14.984 -4.713  1.00 23.65  ? 141  LEU B CA  1 
ATOM   10205 C C   . LEU C 1 102 ? -80.799  -15.088 -3.694  1.00 27.68  ? 141  LEU B C   1 
ATOM   10206 O O   . LEU C 1 102 ? -81.910  -14.661 -3.960  1.00 27.80  ? 141  LEU B O   1 
ATOM   10207 C CB  . LEU C 1 102 ? -80.142  -15.597 -6.030  1.00 26.32  ? 141  LEU B CB  1 
ATOM   10208 C CG  . LEU C 1 102 ? -79.115  -15.442 -7.147  1.00 34.49  ? 141  LEU B CG  1 
ATOM   10209 C CD1 . LEU C 1 102 ? -79.666  -16.067 -8.383  1.00 35.34  ? 141  LEU B CD1 1 
ATOM   10210 C CD2 . LEU C 1 102 ? -78.818  -13.962 -7.365  1.00 32.21  ? 141  LEU B CD2 1 
ATOM   10211 N N   . PHE C 1 103 ? -80.517  -15.671 -2.538  1.00 28.59  ? 142  PHE B N   1 
ATOM   10212 C CA  . PHE C 1 103 ? -81.446  -15.592 -1.420  1.00 30.14  ? 142  PHE B CA  1 
ATOM   10213 C C   . PHE C 1 103 ? -81.412  -14.178 -0.837  1.00 30.90  ? 142  PHE B C   1 
ATOM   10214 O O   . PHE C 1 103 ? -80.365  -13.537 -0.838  1.00 27.52  ? 142  PHE B O   1 
ATOM   10215 C CB  . PHE C 1 103 ? -81.068  -16.624 -0.355  1.00 26.14  ? 142  PHE B CB  1 
ATOM   10216 C CG  . PHE C 1 103 ? -81.362  -18.049 -0.762  1.00 28.17  ? 142  PHE B CG  1 
ATOM   10217 C CD1 . PHE C 1 103 ? -80.369  -18.844 -1.334  1.00 25.10  ? 142  PHE B CD1 1 
ATOM   10218 C CD2 . PHE C 1 103 ? -82.632  -18.587 -0.588  1.00 28.07  ? 142  PHE B CD2 1 
ATOM   10219 C CE1 . PHE C 1 103 ? -80.639  -20.171 -1.717  1.00 27.12  ? 142  PHE B CE1 1 
ATOM   10220 C CE2 . PHE C 1 103 ? -82.916  -19.924 -0.965  1.00 24.03  ? 142  PHE B CE2 1 
ATOM   10221 C CZ  . PHE C 1 103 ? -81.915  -20.707 -1.524  1.00 30.68  ? 142  PHE B CZ  1 
ATOM   10222 N N   . PRO C 1 104 ? -82.560  -13.678 -0.349  1.00 34.22  ? 143  PRO B N   1 
ATOM   10223 C CA  . PRO C 1 104 ? -82.566  -12.322 0.215   1.00 32.38  ? 143  PRO B CA  1 
ATOM   10224 C C   . PRO C 1 104 ? -81.759  -12.266 1.500   1.00 36.47  ? 143  PRO B C   1 
ATOM   10225 O O   . PRO C 1 104 ? -81.607  -13.287 2.177   1.00 32.41  ? 143  PRO B O   1 
ATOM   10226 C CB  . PRO C 1 104 ? -84.050  -12.070 0.528   1.00 32.93  ? 143  PRO B CB  1 
ATOM   10227 C CG  . PRO C 1 104 ? -84.649  -13.438 0.673   1.00 32.86  ? 143  PRO B CG  1 
ATOM   10228 C CD  . PRO C 1 104 ? -83.896  -14.303 -0.313  1.00 34.83  ? 143  PRO B CD  1 
ATOM   10229 N N   . ALA C 1 105 ? -81.242  -11.086 1.825   1.00 34.66  ? 144  ALA B N   1 
ATOM   10230 C CA  . ALA C 1 105 ? -80.510  -10.892 3.065   1.00 36.90  ? 144  ALA B CA  1 
ATOM   10231 C C   . ALA C 1 105 ? -81.446  -11.133 4.238   1.00 25.60  ? 144  ALA B C   1 
ATOM   10232 O O   . ALA C 1 105 ? -82.635  -10.835 4.163   1.00 32.58  ? 144  ALA B O   1 
ATOM   10233 C CB  . ALA C 1 105 ? -79.927  -9.479  3.125   1.00 35.39  ? 144  ALA B CB  1 
ATOM   10234 N N   . GLY C 1 106 ? -80.908  -11.691 5.315   1.00 31.29  ? 145  GLY B N   1 
ATOM   10235 C CA  . GLY C 1 106 ? -81.698  -11.978 6.500   1.00 31.05  ? 145  GLY B CA  1 
ATOM   10236 C C   . GLY C 1 106 ? -82.645  -13.167 6.382   1.00 40.00  ? 145  GLY B C   1 
ATOM   10237 O O   . GLY C 1 106 ? -83.556  -13.323 7.207   1.00 32.46  ? 145  GLY B O   1 
ATOM   10238 N N   . TYR C 1 107 ? -82.450  -14.013 5.371   1.00 29.71  ? 146  TYR B N   1 
ATOM   10239 C CA  . TYR C 1 107 ? -83.338  -15.163 5.207   1.00 34.50  ? 146  TYR B CA  1 
ATOM   10240 C C   . TYR C 1 107 ? -82.828  -16.351 6.026   1.00 34.83  ? 146  TYR B C   1 
ATOM   10241 O O   . TYR C 1 107 ? -82.232  -17.293 5.502   1.00 32.85  ? 146  TYR B O   1 
ATOM   10242 C CB  . TYR C 1 107 ? -83.538  -15.518 3.725   1.00 39.16  ? 146  TYR B CB  1 
ATOM   10243 C CG  . TYR C 1 107 ? -84.578  -16.601 3.510   1.00 37.86  ? 146  TYR B CG  1 
ATOM   10244 C CD1 . TYR C 1 107 ? -85.939  -16.303 3.528   1.00 27.41  ? 146  TYR B CD1 1 
ATOM   10245 C CD2 . TYR C 1 107 ? -84.196  -17.929 3.319   1.00 33.52  ? 146  TYR B CD2 1 
ATOM   10246 C CE1 . TYR C 1 107 ? -86.896  -17.302 3.340   1.00 30.97  ? 146  TYR B CE1 1 
ATOM   10247 C CE2 . TYR C 1 107 ? -85.138  -18.929 3.133   1.00 34.95  ? 146  TYR B CE2 1 
ATOM   10248 C CZ  . TYR C 1 107 ? -86.483  -18.616 3.150   1.00 29.54  ? 146  TYR B CZ  1 
ATOM   10249 O OH  . TYR C 1 107 ? -87.404  -19.623 2.966   1.00 29.80  ? 146  TYR B OH  1 
ATOM   10250 N N   . PHE C 1 108 ? -83.047  -16.287 7.333   1.00 32.07  ? 147  PHE B N   1 
ATOM   10251 C CA  . PHE C 1 108 ? -82.442  -17.257 8.234   1.00 36.53  ? 147  PHE B CA  1 
ATOM   10252 C C   . PHE C 1 108 ? -83.381  -18.437 8.434   1.00 34.81  ? 147  PHE B C   1 
ATOM   10253 O O   . PHE C 1 108 ? -83.936  -18.632 9.510   1.00 35.17  ? 147  PHE B O   1 
ATOM   10254 C CB  . PHE C 1 108 ? -82.074  -16.610 9.576   1.00 37.13  ? 147  PHE B CB  1 
ATOM   10255 C CG  . PHE C 1 108 ? -81.055  -15.498 9.462   1.00 39.47  ? 147  PHE B CG  1 
ATOM   10256 C CD1 . PHE C 1 108 ? -80.442  -15.216 8.250   1.00 38.28  ? 147  PHE B CD1 1 
ATOM   10257 C CD2 . PHE C 1 108 ? -80.715  -14.735 10.573  1.00 48.51  ? 147  PHE B CD2 1 
ATOM   10258 C CE1 . PHE C 1 108 ? -79.501  -14.197 8.149   1.00 52.34  ? 147  PHE B CE1 1 
ATOM   10259 C CE2 . PHE C 1 108 ? -79.776  -13.714 10.479  1.00 50.34  ? 147  PHE B CE2 1 
ATOM   10260 C CZ  . PHE C 1 108 ? -79.171  -13.443 9.269   1.00 45.70  ? 147  PHE B CZ  1 
ATOM   10261 N N   . TYR C 1 109 ? -83.553  -19.220 7.377   1.00 31.90  ? 148  TYR B N   1 
ATOM   10262 C CA  . TYR C 1 109 ? -84.453  -20.358 7.411   1.00 34.80  ? 148  TYR B CA  1 
ATOM   10263 C C   . TYR C 1 109 ? -83.758  -21.586 6.829   1.00 26.41  ? 148  TYR B C   1 
ATOM   10264 O O   . TYR C 1 109 ? -83.280  -21.566 5.694   1.00 25.28  ? 148  TYR B O   1 
ATOM   10265 C CB  . TYR C 1 109 ? -85.757  -20.029 6.668   1.00 31.25  ? 148  TYR B CB  1 
ATOM   10266 C CG  . TYR C 1 109 ? -86.454  -18.844 7.285   1.00 34.44  ? 148  TYR B CG  1 
ATOM   10267 C CD1 . TYR C 1 109 ? -87.406  -19.019 8.281   1.00 37.94  ? 148  TYR B CD1 1 
ATOM   10268 C CD2 . TYR C 1 109 ? -86.123  -17.544 6.916   1.00 34.73  ? 148  TYR B CD2 1 
ATOM   10269 C CE1 . TYR C 1 109 ? -88.028  -17.941 8.877   1.00 37.69  ? 148  TYR B CE1 1 
ATOM   10270 C CE2 . TYR C 1 109 ? -86.746  -16.450 7.512   1.00 33.34  ? 148  TYR B CE2 1 
ATOM   10271 C CZ  . TYR C 1 109 ? -87.699  -16.662 8.493   1.00 35.29  ? 148  TYR B CZ  1 
ATOM   10272 O OH  . TYR C 1 109 ? -88.330  -15.603 9.100   1.00 36.76  ? 148  TYR B OH  1 
ATOM   10273 N N   . ASP C 1 110 ? -83.699  -22.636 7.641   1.00 26.57  ? 149  ASP B N   1 
ATOM   10274 C CA  . ASP C 1 110 ? -83.095  -23.919 7.275   1.00 34.98  ? 149  ASP B CA  1 
ATOM   10275 C C   . ASP C 1 110 ? -83.610  -24.365 5.909   1.00 27.07  ? 149  ASP B C   1 
ATOM   10276 O O   . ASP C 1 110 ? -84.805  -24.556 5.721   1.00 30.52  ? 149  ASP B O   1 
ATOM   10277 C CB  . ASP C 1 110 ? -83.423  -24.957 8.352   1.00 35.16  ? 149  ASP B CB  1 
ATOM   10278 C CG  . ASP C 1 110 ? -82.441  -26.114 8.379   1.00 53.45  ? 149  ASP B CG  1 
ATOM   10279 O OD1 . ASP C 1 110 ? -81.271  -25.915 7.984   1.00 50.14  ? 149  ASP B OD1 1 
ATOM   10280 O OD2 . ASP C 1 110 ? -82.841  -27.229 8.804   1.00 56.99  ? 149  ASP B OD2 1 
ATOM   10281 N N   . THR C 1 111 ? -82.698  -24.506 4.956   1.00 27.73  ? 150  THR B N   1 
ATOM   10282 C CA  . THR C 1 111 ? -83.057  -24.746 3.565   1.00 26.66  ? 150  THR B CA  1 
ATOM   10283 C C   . THR C 1 111 ? -82.161  -25.836 2.979   1.00 30.03  ? 150  THR B C   1 
ATOM   10284 O O   . THR C 1 111 ? -80.936  -25.780 3.115   1.00 28.59  ? 150  THR B O   1 
ATOM   10285 C CB  . THR C 1 111 ? -82.888  -23.453 2.736   1.00 26.97  ? 150  THR B CB  1 
ATOM   10286 O OG1 . THR C 1 111 ? -83.661  -22.392 3.323   1.00 29.93  ? 150  THR B OG1 1 
ATOM   10287 C CG2 . THR C 1 111 ? -83.291  -23.670 1.277   1.00 21.13  ? 150  THR B CG2 1 
ATOM   10288 N N   . GLN C 1 112 ? -82.770  -26.824 2.330   1.00 26.29  ? 151  GLN B N   1 
ATOM   10289 C CA  . GLN C 1 112 ? -82.026  -27.951 1.766   1.00 30.56  ? 151  GLN B CA  1 
ATOM   10290 C C   . GLN C 1 112 ? -82.376  -28.203 0.298   1.00 32.63  ? 151  GLN B C   1 
ATOM   10291 O O   . GLN C 1 112 ? -83.540  -28.222 -0.085  1.00 28.64  ? 151  GLN B O   1 
ATOM   10292 C CB  . GLN C 1 112 ? -82.252  -29.214 2.599   1.00 27.47  ? 151  GLN B CB  1 
ATOM   10293 C CG  . GLN C 1 112 ? -81.588  -30.477 2.045   1.00 27.06  ? 151  GLN B CG  1 
ATOM   10294 C CD  . GLN C 1 112 ? -81.704  -31.659 3.006   1.00 32.88  ? 151  GLN B CD  1 
ATOM   10295 O OE1 . GLN C 1 112 ? -82.789  -31.974 3.495   1.00 30.88  ? 151  GLN B OE1 1 
ATOM   10296 N NE2 . GLN C 1 112 ? -80.577  -32.306 3.291   1.00 32.30  ? 151  GLN B NE2 1 
ATOM   10297 N N   . VAL C 1 113 ? -81.352  -28.368 -0.524  1.00 27.27  ? 152  VAL B N   1 
ATOM   10298 C CA  . VAL C 1 113 ? -81.539  -28.696 -1.923  1.00 21.15  ? 152  VAL B CA  1 
ATOM   10299 C C   . VAL C 1 113 ? -80.964  -30.089 -2.160  1.00 33.59  ? 152  VAL B C   1 
ATOM   10300 O O   . VAL C 1 113 ? -79.770  -30.316 -1.949  1.00 30.54  ? 152  VAL B O   1 
ATOM   10301 C CB  . VAL C 1 113 ? -80.854  -27.663 -2.839  1.00 26.76  ? 152  VAL B CB  1 
ATOM   10302 C CG1 . VAL C 1 113 ? -80.914  -28.106 -4.281  1.00 22.42  ? 152  VAL B CG1 1 
ATOM   10303 C CG2 . VAL C 1 113 ? -81.487  -26.262 -2.641  1.00 25.44  ? 152  VAL B CG2 1 
ATOM   10304 N N   . LEU C 1 114 ? -81.821  -31.027 -2.557  1.00 21.40  ? 153  LEU B N   1 
ATOM   10305 C CA  . LEU C 1 114 ? -81.393  -32.405 -2.795  1.00 21.65  ? 153  LEU B CA  1 
ATOM   10306 C C   . LEU C 1 114 ? -81.496  -32.749 -4.276  1.00 31.08  ? 153  LEU B C   1 
ATOM   10307 O O   . LEU C 1 114 ? -82.421  -32.312 -4.956  1.00 27.84  ? 153  LEU B O   1 
ATOM   10308 C CB  . LEU C 1 114 ? -82.217  -33.392 -1.958  1.00 28.32  ? 153  LEU B CB  1 
ATOM   10309 C CG  . LEU C 1 114 ? -82.118  -33.286 -0.431  1.00 37.17  ? 153  LEU B CG  1 
ATOM   10310 C CD1 . LEU C 1 114 ? -82.945  -34.360 0.257   1.00 37.51  ? 153  LEU B CD1 1 
ATOM   10311 C CD2 . LEU C 1 114 ? -80.686  -33.378 0.025   1.00 44.54  ? 153  LEU B CD2 1 
ATOM   10312 N N   . CYS C 1 115 ? -80.531  -33.519 -4.771  1.00 27.42  ? 154  CYS B N   1 
ATOM   10313 C CA  . CYS C 1 115 ? -80.489  -33.895 -6.180  1.00 33.08  ? 154  CYS B CA  1 
ATOM   10314 C C   . CYS C 1 115 ? -80.580  -35.414 -6.330  1.00 39.05  ? 154  CYS B C   1 
ATOM   10315 O O   . CYS C 1 115 ? -79.812  -36.149 -5.710  1.00 35.29  ? 154  CYS B O   1 
ATOM   10316 C CB  . CYS C 1 115 ? -79.188  -33.398 -6.827  1.00 31.53  ? 154  CYS B CB  1 
ATOM   10317 S SG  . CYS C 1 115 ? -78.920  -31.610 -6.690  1.00 30.78  ? 154  CYS B SG  1 
ATOM   10318 N N   . ASN C 1 116 ? -81.515  -35.872 -7.159  1.00 31.42  ? 155  ASN B N   1 
ATOM   10319 C CA  . ASN C 1 116 ? -81.680  -37.292 -7.446  1.00 32.67  ? 155  ASN B CA  1 
ATOM   10320 C C   . ASN C 1 116 ? -81.424  -37.573 -8.930  1.00 31.01  ? 155  ASN B C   1 
ATOM   10321 O O   . ASN C 1 116 ? -82.108  -37.036 -9.792  1.00 28.56  ? 155  ASN B O   1 
ATOM   10322 C CB  . ASN C 1 116 ? -83.084  -37.759 -7.042  1.00 34.87  ? 155  ASN B CB  1 
ATOM   10323 C CG  . ASN C 1 116 ? -83.288  -39.271 -7.228  1.00 37.23  ? 155  ASN B CG  1 
ATOM   10324 O OD1 . ASN C 1 116 ? -82.843  -39.862 -8.213  1.00 32.96  ? 155  ASN B OD1 1 
ATOM   10325 N ND2 . ASN C 1 116 ? -83.974  -39.891 -6.276  1.00 43.88  ? 155  ASN B ND2 1 
ATOM   10326 N N   . LEU C 1 117 ? -80.422  -38.398 -9.231  1.00 35.04  ? 156  LEU B N   1 
ATOM   10327 C CA  . LEU C 1 117 ? -80.141  -38.758 -10.614 1.00 28.14  ? 156  LEU B CA  1 
ATOM   10328 C C   . LEU C 1 117 ? -81.109  -39.864 -11.055 1.00 32.11  ? 156  LEU B C   1 
ATOM   10329 O O   . LEU C 1 117 ? -80.825  -41.040 -10.895 1.00 29.28  ? 156  LEU B O   1 
ATOM   10330 C CB  . LEU C 1 117 ? -78.689  -39.208 -10.772 1.00 30.19  ? 156  LEU B CB  1 
ATOM   10331 C CG  . LEU C 1 117 ? -77.626  -38.110 -10.943 1.00 36.93  ? 156  LEU B CG  1 
ATOM   10332 C CD1 . LEU C 1 117 ? -77.853  -36.956 -9.973  1.00 34.63  ? 156  LEU B CD1 1 
ATOM   10333 C CD2 . LEU C 1 117 ? -76.226  -38.676 -10.789 1.00 36.34  ? 156  LEU B CD2 1 
ATOM   10334 N N   . LEU C 1 118 ? -82.265  -39.476 -11.588 1.00 33.87  ? 157  LEU B N   1 
ATOM   10335 C CA  . LEU C 1 118 ? -83.261  -40.452 -12.017 1.00 34.96  ? 157  LEU B CA  1 
ATOM   10336 C C   . LEU C 1 118 ? -82.614  -41.413 -13.001 1.00 38.18  ? 157  LEU B C   1 
ATOM   10337 O O   . LEU C 1 118 ? -82.838  -42.618 -12.940 1.00 34.97  ? 157  LEU B O   1 
ATOM   10338 C CB  . LEU C 1 118 ? -84.471  -39.753 -12.647 1.00 28.66  ? 157  LEU B CB  1 
ATOM   10339 C CG  . LEU C 1 118 ? -85.194  -38.759 -11.732 1.00 35.52  ? 157  LEU B CG  1 
ATOM   10340 C CD1 . LEU C 1 118 ? -86.331  -38.058 -12.462 1.00 35.98  ? 157  LEU B CD1 1 
ATOM   10341 C CD2 . LEU C 1 118 ? -85.716  -39.425 -10.470 1.00 28.09  ? 157  LEU B CD2 1 
ATOM   10342 N N   . ALA C 1 119 ? -81.778  -40.878 -13.886 1.00 33.61  ? 158  ALA B N   1 
ATOM   10343 C CA  . ALA C 1 119 ? -81.107  -41.699 -14.888 1.00 36.01  ? 158  ALA B CA  1 
ATOM   10344 C C   . ALA C 1 119 ? -79.947  -40.955 -15.533 1.00 33.99  ? 158  ALA B C   1 
ATOM   10345 O O   . ALA C 1 119 ? -80.000  -39.748 -15.742 1.00 35.91  ? 158  ALA B O   1 
ATOM   10346 C CB  . ALA C 1 119 ? -82.104  -42.170 -15.966 1.00 32.96  ? 158  ALA B CB  1 
ATOM   10347 N N   . VAL C 1 120 ? -78.906  -41.699 -15.868 1.00 28.91  ? 159  VAL B N   1 
ATOM   10348 C CA  . VAL C 1 120 ? -77.717  -41.140 -16.478 1.00 31.40  ? 159  VAL B CA  1 
ATOM   10349 C C   . VAL C 1 120 ? -77.351  -42.031 -17.650 1.00 33.30  ? 159  VAL B C   1 
ATOM   10350 O O   . VAL C 1 120 ? -77.300  -43.249 -17.503 1.00 37.41  ? 159  VAL B O   1 
ATOM   10351 C CB  . VAL C 1 120 ? -76.555  -41.080 -15.459 1.00 36.41  ? 159  VAL B CB  1 
ATOM   10352 C CG1 . VAL C 1 120 ? -75.281  -40.577 -16.115 1.00 46.06  ? 159  VAL B CG1 1 
ATOM   10353 C CG2 . VAL C 1 120 ? -76.935  -40.188 -14.278 1.00 37.36  ? 159  VAL B CG2 1 
ATOM   10354 N N   . ASP C 1 121 ? -77.094  -41.427 -18.809 1.00 34.39  ? 160  ASP B N   1 
ATOM   10355 C CA  . ASP C 1 121 ? -76.822  -42.195 -20.022 1.00 33.83  ? 160  ASP B CA  1 
ATOM   10356 C C   . ASP C 1 121 ? -75.336  -42.384 -20.293 1.00 40.52  ? 160  ASP B C   1 
ATOM   10357 O O   . ASP C 1 121 ? -74.960  -43.024 -21.271 1.00 39.11  ? 160  ASP B O   1 
ATOM   10358 C CB  . ASP C 1 121 ? -77.504  -41.569 -21.249 1.00 28.76  ? 160  ASP B CB  1 
ATOM   10359 C CG  . ASP C 1 121 ? -77.027  -40.159 -21.533 1.00 32.05  ? 160  ASP B CG  1 
ATOM   10360 O OD1 . ASP C 1 121 ? -77.657  -39.489 -22.383 1.00 32.86  ? 160  ASP B OD1 1 
ATOM   10361 O OD2 . ASP C 1 121 ? -76.039  -39.707 -20.898 1.00 33.18  ? 160  ASP B OD2 1 
ATOM   10362 N N   . GLY C 1 122 ? -74.490  -41.830 -19.433 1.00 36.07  ? 161  GLY B N   1 
ATOM   10363 C CA  . GLY C 1 122 ? -73.055  -41.976 -19.610 1.00 31.89  ? 161  GLY B CA  1 
ATOM   10364 C C   . GLY C 1 122 ? -72.438  -41.101 -20.685 1.00 32.07  ? 161  GLY B C   1 
ATOM   10365 O O   . GLY C 1 122 ? -71.254  -41.234 -20.991 1.00 36.67  ? 161  GLY B O   1 
ATOM   10366 N N   . VAL C 1 123 ? -73.229  -40.215 -21.281 1.00 36.98  ? 162  VAL B N   1 
ATOM   10367 C CA  . VAL C 1 123 ? -72.664  -39.256 -22.226 1.00 35.78  ? 162  VAL B CA  1 
ATOM   10368 C C   . VAL C 1 123 ? -73.029  -37.813 -21.884 1.00 31.89  ? 162  VAL B C   1 
ATOM   10369 O O   . VAL C 1 123 ? -72.186  -36.935 -21.963 1.00 31.65  ? 162  VAL B O   1 
ATOM   10370 C CB  . VAL C 1 123 ? -72.977  -39.578 -23.721 1.00 42.61  ? 162  VAL B CB  1 
ATOM   10371 C CG1 . VAL C 1 123 ? -73.545  -40.994 -23.886 1.00 34.76  ? 162  VAL B CG1 1 
ATOM   10372 C CG2 . VAL C 1 123 ? -73.860  -38.515 -24.345 1.00 28.95  ? 162  VAL B CG2 1 
ATOM   10373 N N   . ASN C 1 124 ? -74.276  -37.580 -21.494 1.00 36.70  ? 163  ASN B N   1 
ATOM   10374 C CA  . ASN C 1 124 ? -74.708  -36.260 -21.051 1.00 29.90  ? 163  ASN B CA  1 
ATOM   10375 C C   . ASN C 1 124 ? -74.524  -36.117 -19.533 1.00 32.69  ? 163  ASN B C   1 
ATOM   10376 O O   . ASN C 1 124 ? -75.156  -36.838 -18.759 1.00 27.73  ? 163  ASN B O   1 
ATOM   10377 C CB  . ASN C 1 124 ? -76.170  -36.012 -21.453 1.00 37.31  ? 163  ASN B CB  1 
ATOM   10378 C CG  . ASN C 1 124 ? -76.354  -35.914 -22.963 1.00 36.17  ? 163  ASN B CG  1 
ATOM   10379 O OD1 . ASN C 1 124 ? -76.076  -34.876 -23.565 1.00 35.55  ? 163  ASN B OD1 1 
ATOM   10380 N ND2 . ASN C 1 124 ? -76.818  -37.002 -23.582 1.00 32.84  ? 163  ASN B ND2 1 
ATOM   10381 N N   . GLU C 1 125 ? -73.653  -35.189 -19.126 1.00 32.96  ? 164  GLU B N   1 
ATOM   10382 C CA  . GLU C 1 125 ? -73.280  -34.986 -17.717 1.00 32.48  ? 164  GLU B CA  1 
ATOM   10383 C C   . GLU C 1 125 ? -74.424  -34.443 -16.852 1.00 28.61  ? 164  GLU B C   1 
ATOM   10384 O O   . GLU C 1 125 ? -75.030  -33.430 -17.178 1.00 30.69  ? 164  GLU B O   1 
ATOM   10385 C CB  . GLU C 1 125 ? -72.081  -34.023 -17.632 1.00 28.31  ? 164  GLU B CB  1 
ATOM   10386 C CG  . GLU C 1 125 ? -70.766  -34.683 -17.270 1.00 46.28  ? 164  GLU B CG  1 
ATOM   10387 C CD  . GLU C 1 125 ? -70.757  -35.223 -15.848 1.00 55.38  ? 164  GLU B CD  1 
ATOM   10388 O OE1 . GLU C 1 125 ? -70.063  -36.243 -15.651 1.00 55.39  ? 164  GLU B OE1 1 
ATOM   10389 O OE2 . GLU C 1 125 ? -71.444  -34.649 -14.944 1.00 43.75  ? 164  GLU B OE2 1 
ATOM   10390 N N   . PRO C 1 126 ? -74.719  -35.115 -15.734 1.00 31.71  ? 165  PRO B N   1 
ATOM   10391 C CA  . PRO C 1 126 ? -75.809  -34.655 -14.872 1.00 29.22  ? 165  PRO B CA  1 
ATOM   10392 C C   . PRO C 1 126 ? -75.491  -33.389 -14.058 1.00 28.72  ? 165  PRO B C   1 
ATOM   10393 O O   . PRO C 1 126 ? -76.427  -32.715 -13.638 1.00 24.54  ? 165  PRO B O   1 
ATOM   10394 C CB  . PRO C 1 126 ? -76.028  -35.842 -13.925 1.00 24.66  ? 165  PRO B CB  1 
ATOM   10395 C CG  . PRO C 1 126 ? -74.701  -36.553 -13.907 1.00 29.27  ? 165  PRO B CG  1 
ATOM   10396 C CD  . PRO C 1 126 ? -74.162  -36.408 -15.296 1.00 32.75  ? 165  PRO B CD  1 
ATOM   10397 N N   . ASP C 1 127 ? -74.223  -33.066 -13.830 1.00 29.88  ? 166  ASP B N   1 
ATOM   10398 C CA  . ASP C 1 127 ? -73.922  -32.000 -12.870 1.00 24.29  ? 166  ASP B CA  1 
ATOM   10399 C C   . ASP C 1 127 ? -74.524  -30.647 -13.269 1.00 21.43  ? 166  ASP B C   1 
ATOM   10400 O O   . ASP C 1 127 ? -75.182  -30.003 -12.468 1.00 24.20  ? 166  ASP B O   1 
ATOM   10401 C CB  . ASP C 1 127 ? -72.425  -31.905 -12.534 1.00 21.72  ? 166  ASP B CB  1 
ATOM   10402 C CG  . ASP C 1 127 ? -71.545  -31.693 -13.757 1.00 27.67  ? 166  ASP B CG  1 
ATOM   10403 O OD1 . ASP C 1 127 ? -72.068  -31.461 -14.864 1.00 31.69  ? 166  ASP B OD1 1 
ATOM   10404 O OD2 . ASP C 1 127 ? -70.307  -31.759 -13.607 1.00 30.00  ? 166  ASP B OD2 1 
ATOM   10405 N N   . VAL C 1 128 ? -74.295  -30.222 -14.504 1.00 24.13  ? 167  VAL B N   1 
ATOM   10406 C CA  . VAL C 1 128 ? -74.908  -28.995 -14.998 1.00 29.85  ? 167  VAL B CA  1 
ATOM   10407 C C   . VAL C 1 128 ? -76.462  -29.046 -14.983 1.00 26.38  ? 167  VAL B C   1 
ATOM   10408 O O   . VAL C 1 128 ? -77.125  -28.029 -14.768 1.00 25.75  ? 167  VAL B O   1 
ATOM   10409 C CB  . VAL C 1 128 ? -74.375  -28.655 -16.414 1.00 31.53  ? 167  VAL B CB  1 
ATOM   10410 C CG1 . VAL C 1 128 ? -75.171  -27.507 -17.035 1.00 36.41  ? 167  VAL B CG1 1 
ATOM   10411 C CG2 . VAL C 1 128 ? -72.874  -28.324 -16.353 1.00 30.02  ? 167  VAL B CG2 1 
ATOM   10412 N N   . LEU C 1 129 ? -77.028  -30.226 -15.222 1.00 22.92  ? 168  LEU B N   1 
ATOM   10413 C CA  . LEU C 1 129 ? -78.476  -30.430 -15.150 1.00 28.52  ? 168  LEU B CA  1 
ATOM   10414 C C   . LEU C 1 129 ? -78.972  -30.168 -13.733 1.00 27.37  ? 168  LEU B C   1 
ATOM   10415 O O   . LEU C 1 129 ? -80.001  -29.518 -13.528 1.00 23.33  ? 168  LEU B O   1 
ATOM   10416 C CB  . LEU C 1 129 ? -78.831  -31.863 -15.572 1.00 22.91  ? 168  LEU B CB  1 
ATOM   10417 C CG  . LEU C 1 129 ? -79.020  -32.132 -17.074 1.00 31.23  ? 168  LEU B CG  1 
ATOM   10418 C CD1 . LEU C 1 129 ? -78.257  -31.176 -17.952 1.00 36.40  ? 168  LEU B CD1 1 
ATOM   10419 C CD2 . LEU C 1 129 ? -78.696  -33.573 -17.441 1.00 29.47  ? 168  LEU B CD2 1 
ATOM   10420 N N   . ALA C 1 130 ? -78.222  -30.659 -12.750 1.00 21.05  ? 169  ALA B N   1 
ATOM   10421 C CA  . ALA C 1 130 ? -78.574  -30.414 -11.355 1.00 21.03  ? 169  ALA B CA  1 
ATOM   10422 C C   . ALA C 1 130 ? -78.535  -28.922 -10.997 1.00 23.04  ? 169  ALA B C   1 
ATOM   10423 O O   . ALA C 1 130 ? -79.417  -28.433 -10.286 1.00 28.34  ? 169  ALA B O   1 
ATOM   10424 C CB  . ALA C 1 130 ? -77.673  -31.203 -10.437 1.00 21.77  ? 169  ALA B CB  1 
ATOM   10425 N N   . ILE C 1 131 ? -77.512  -28.197 -11.459 1.00 24.96  ? 170  ILE B N   1 
ATOM   10426 C CA  . ILE C 1 131 ? -77.464  -26.761 -11.173 1.00 22.12  ? 170  ILE B CA  1 
ATOM   10427 C C   . ILE C 1 131 ? -78.744  -26.087 -11.677 1.00 22.40  ? 170  ILE B C   1 
ATOM   10428 O O   . ILE C 1 131 ? -79.372  -25.295 -10.950 1.00 25.17  ? 170  ILE B O   1 
ATOM   10429 C CB  . ILE C 1 131 ? -76.267  -26.029 -11.818 1.00 20.22  ? 170  ILE B CB  1 
ATOM   10430 C CG1 . ILE C 1 131 ? -74.923  -26.636 -11.368 1.00 23.93  ? 170  ILE B CG1 1 
ATOM   10431 C CG2 . ILE C 1 131 ? -76.341  -24.540 -11.458 1.00 14.59  ? 170  ILE B CG2 1 
ATOM   10432 C CD1 . ILE C 1 131 ? -73.719  -26.072 -12.128 1.00 23.41  ? 170  ILE B CD1 1 
ATOM   10433 N N   . ASN C 1 132 ? -79.123  -26.378 -12.920 1.00 21.36  ? 171  ASN B N   1 
ATOM   10434 C CA  . ASN C 1 132 ? -80.389  -25.835 -13.458 1.00 23.31  ? 171  ASN B CA  1 
ATOM   10435 C C   . ASN C 1 132 ? -81.617  -26.316 -12.700 1.00 19.83  ? 171  ASN B C   1 
ATOM   10436 O O   . ASN C 1 132 ? -82.557  -25.548 -12.476 1.00 25.54  ? 171  ASN B O   1 
ATOM   10437 C CB  . ASN C 1 132 ? -80.525  -26.122 -14.943 1.00 20.33  ? 171  ASN B CB  1 
ATOM   10438 C CG  . ASN C 1 132 ? -79.508  -25.360 -15.756 1.00 24.45  ? 171  ASN B CG  1 
ATOM   10439 O OD1 . ASN C 1 132 ? -79.592  -24.141 -15.866 1.00 24.11  ? 171  ASN B OD1 1 
ATOM   10440 N ND2 . ASN C 1 132 ? -78.543  -26.068 -16.328 1.00 24.28  ? 171  ASN B ND2 1 
ATOM   10441 N N   . GLY C 1 133 ? -81.586  -27.578 -12.272 1.00 24.00  ? 172  GLY B N   1 
ATOM   10442 C CA  . GLY C 1 133 ? -82.661  -28.139 -11.469 1.00 25.12  ? 172  GLY B CA  1 
ATOM   10443 C C   . GLY C 1 133 ? -82.870  -27.408 -10.155 1.00 28.37  ? 172  GLY B C   1 
ATOM   10444 O O   . GLY C 1 133 ? -84.008  -27.133 -9.771  1.00 25.17  ? 172  GLY B O   1 
ATOM   10445 N N   . ALA C 1 134 ? -81.780  -27.097 -9.449  1.00 21.68  ? 173  ALA B N   1 
ATOM   10446 C CA  . ALA C 1 134 ? -81.883  -26.279 -8.243  1.00 22.36  ? 173  ALA B CA  1 
ATOM   10447 C C   . ALA C 1 134 ? -82.546  -24.954 -8.582  1.00 19.63  ? 173  ALA B C   1 
ATOM   10448 O O   . ALA C 1 134 ? -83.416  -24.474 -7.855  1.00 25.09  ? 173  ALA B O   1 
ATOM   10449 C CB  . ALA C 1 134 ? -80.491  -26.038 -7.592  1.00 20.95  ? 173  ALA B CB  1 
ATOM   10450 N N   . SER C 1 135 ? -82.153  -24.365 -9.699  1.00 21.91  ? 174  SER B N   1 
ATOM   10451 C CA  . SER C 1 135 ? -82.701  -23.061 -10.075 1.00 25.94  ? 174  SER B CA  1 
ATOM   10452 C C   . SER C 1 135 ? -84.208  -23.153 -10.359 1.00 25.05  ? 174  SER B C   1 
ATOM   10453 O O   . SER C 1 135 ? -84.984  -22.289 -9.959  1.00 26.87  ? 174  SER B O   1 
ATOM   10454 C CB  . SER C 1 135 ? -81.959  -22.497 -11.291 1.00 22.20  ? 174  SER B CB  1 
ATOM   10455 O OG  . SER C 1 135 ? -82.510  -21.256 -11.710 1.00 22.58  ? 174  SER B OG  1 
ATOM   10456 N N   . VAL C 1 136 ? -84.621  -24.198 -11.061 1.00 27.96  ? 175  VAL B N   1 
ATOM   10457 C CA  . VAL C 1 136 ? -86.036  -24.339 -11.403 1.00 25.05  ? 175  VAL B CA  1 
ATOM   10458 C C   . VAL C 1 136 ? -86.843  -24.632 -10.141 1.00 26.08  ? 175  VAL B C   1 
ATOM   10459 O O   . VAL C 1 136 ? -87.871  -23.999 -9.894  1.00 26.05  ? 175  VAL B O   1 
ATOM   10460 C CB  . VAL C 1 136 ? -86.254  -25.431 -12.469 1.00 27.36  ? 175  VAL B CB  1 
ATOM   10461 C CG1 . VAL C 1 136 ? -87.759  -25.588 -12.801 1.00 27.40  ? 175  VAL B CG1 1 
ATOM   10462 C CG2 . VAL C 1 136 ? -85.475  -25.069 -13.724 1.00 25.44  ? 175  VAL B CG2 1 
ATOM   10463 N N   . ALA C 1 137 ? -86.362  -25.572 -9.327  1.00 25.61  ? 176  ALA B N   1 
ATOM   10464 C CA  . ALA C 1 137 ? -87.059  -25.912 -8.090  1.00 27.92  ? 176  ALA B CA  1 
ATOM   10465 C C   . ALA C 1 137 ? -87.293  -24.671 -7.239  1.00 28.04  ? 176  ALA B C   1 
ATOM   10466 O O   . ALA C 1 137 ? -88.415  -24.411 -6.785  1.00 27.87  ? 176  ALA B O   1 
ATOM   10467 C CB  . ALA C 1 137 ? -86.290  -26.961 -7.290  1.00 22.55  ? 176  ALA B CB  1 
ATOM   10468 N N   . LEU C 1 138 ? -86.227  -23.917 -6.997  1.00 26.24  ? 177  LEU B N   1 
ATOM   10469 C CA  . LEU C 1 138 ? -86.344  -22.694 -6.219  1.00 25.56  ? 177  LEU B CA  1 
ATOM   10470 C C   . LEU C 1 138 ? -87.269  -21.677 -6.893  1.00 25.27  ? 177  LEU B C   1 
ATOM   10471 O O   . LEU C 1 138 ? -88.087  -21.034 -6.229  1.00 24.57  ? 177  LEU B O   1 
ATOM   10472 C CB  . LEU C 1 138 ? -84.959  -22.082 -5.954  1.00 24.20  ? 177  LEU B CB  1 
ATOM   10473 C CG  . LEU C 1 138 ? -84.131  -22.765 -4.862  1.00 23.45  ? 177  LEU B CG  1 
ATOM   10474 C CD1 . LEU C 1 138 ? -82.655  -22.351 -4.912  1.00 22.49  ? 177  LEU B CD1 1 
ATOM   10475 C CD2 . LEU C 1 138 ? -84.750  -22.470 -3.497  1.00 21.23  ? 177  LEU B CD2 1 
ATOM   10476 N N   . SER C 1 139 ? -87.132  -21.516 -8.203  1.00 25.04  ? 178  SER B N   1 
ATOM   10477 C CA  . SER C 1 139 ? -87.965  -20.542 -8.923  1.00 24.96  ? 178  SER B CA  1 
ATOM   10478 C C   . SER C 1 139 ? -89.464  -20.867 -8.837  1.00 28.60  ? 178  SER B C   1 
ATOM   10479 O O   . SER C 1 139 ? -90.290  -19.966 -8.684  1.00 31.62  ? 178  SER B O   1 
ATOM   10480 C CB  . SER C 1 139 ? -87.546  -20.459 -10.394 1.00 23.98  ? 178  SER B CB  1 
ATOM   10481 O OG  . SER C 1 139 ? -86.197  -20.029 -10.528 1.00 28.53  ? 178  SER B OG  1 
ATOM   10482 N N   . LEU C 1 140 ? -89.806  -22.151 -8.938  1.00 27.45  ? 179  LEU B N   1 
ATOM   10483 C CA  . LEU C 1 140 ? -91.204  -22.581 -8.946  1.00 28.97  ? 179  LEU B CA  1 
ATOM   10484 C C   . LEU C 1 140 ? -91.797  -22.569 -7.552  1.00 33.60  ? 179  LEU B C   1 
ATOM   10485 O O   . LEU C 1 140 ? -92.993  -22.346 -7.386  1.00 30.36  ? 179  LEU B O   1 
ATOM   10486 C CB  . LEU C 1 140 ? -91.345  -23.978 -9.545  1.00 25.60  ? 179  LEU B CB  1 
ATOM   10487 C CG  . LEU C 1 140 ? -90.971  -24.080 -11.026 1.00 31.56  ? 179  LEU B CG  1 
ATOM   10488 C CD1 . LEU C 1 140 ? -91.301  -25.457 -11.541 1.00 27.09  ? 179  LEU B CD1 1 
ATOM   10489 C CD2 . LEU C 1 140 ? -91.688  -23.017 -11.838 1.00 34.59  ? 179  LEU B CD2 1 
ATOM   10490 N N   . SER C 1 141 ? -90.949  -22.787 -6.549  1.00 24.79  ? 180  SER B N   1 
ATOM   10491 C CA  . SER C 1 141 ? -91.399  -22.889 -5.164  1.00 25.84  ? 180  SER B CA  1 
ATOM   10492 C C   . SER C 1 141 ? -91.839  -21.546 -4.602  1.00 25.61  ? 180  SER B C   1 
ATOM   10493 O O   . SER C 1 141 ? -91.686  -20.509 -5.256  1.00 26.72  ? 180  SER B O   1 
ATOM   10494 C CB  . SER C 1 141 ? -90.246  -23.390 -4.295  1.00 23.92  ? 180  SER B CB  1 
ATOM   10495 O OG  . SER C 1 141 ? -89.290  -22.344 -4.129  1.00 29.71  ? 180  SER B OG  1 
ATOM   10496 N N   . ASP C 1 142 ? -92.330  -21.572 -3.361  1.00 25.75  ? 181  ASP B N   1 
ATOM   10497 C CA  . ASP C 1 142 ? -92.679  -20.356 -2.621  1.00 31.07  ? 181  ASP B CA  1 
ATOM   10498 C C   . ASP C 1 142 ? -91.479  -19.768 -1.837  1.00 28.41  ? 181  ASP B C   1 
ATOM   10499 O O   . ASP C 1 142 ? -91.650  -18.879 -0.996  1.00 27.09  ? 181  ASP B O   1 
ATOM   10500 C CB  . ASP C 1 142 ? -93.839  -20.646 -1.653  1.00 26.31  ? 181  ASP B CB  1 
ATOM   10501 C CG  . ASP C 1 142 ? -93.404  -21.488 -0.452  1.00 32.04  ? 181  ASP B CG  1 
ATOM   10502 O OD1 . ASP C 1 142 ? -92.288  -22.051 -0.471  1.00 38.46  ? 181  ASP B OD1 1 
ATOM   10503 O OD2 . ASP C 1 142 ? -94.174  -21.603 0.516   1.00 35.48  ? 181  ASP B OD2 1 
ATOM   10504 N N   . ILE C 1 143 ? -90.275  -20.268 -2.107  1.00 25.73  ? 182  ILE B N   1 
ATOM   10505 C CA  . ILE C 1 143 ? -89.075  -19.799 -1.401  1.00 24.95  ? 182  ILE B CA  1 
ATOM   10506 C C   . ILE C 1 143 ? -88.495  -18.520 -2.033  1.00 21.35  ? 182  ILE B C   1 
ATOM   10507 O O   . ILE C 1 143 ? -88.186  -18.494 -3.219  1.00 27.08  ? 182  ILE B O   1 
ATOM   10508 C CB  . ILE C 1 143 ? -87.997  -20.924 -1.337  1.00 27.94  ? 182  ILE B CB  1 
ATOM   10509 C CG1 . ILE C 1 143 ? -88.604  -22.210 -0.747  1.00 29.85  ? 182  ILE B CG1 1 
ATOM   10510 C CG2 . ILE C 1 143 ? -86.756  -20.455 -0.547  1.00 25.02  ? 182  ILE B CG2 1 
ATOM   10511 C CD1 . ILE C 1 143 ? -87.815  -23.509 -1.048  1.00 23.90  ? 182  ILE B CD1 1 
ATOM   10512 N N   . PRO C 1 144 ? -88.376  -17.442 -1.248  1.00 25.63  ? 183  PRO B N   1 
ATOM   10513 C CA  . PRO C 1 144 ? -87.825  -16.192 -1.788  1.00 29.37  ? 183  PRO B CA  1 
ATOM   10514 C C   . PRO C 1 144 ? -86.430  -16.461 -2.319  1.00 29.59  ? 183  PRO B C   1 
ATOM   10515 O O   . PRO C 1 144 ? -85.598  -17.006 -1.592  1.00 32.40  ? 183  PRO B O   1 
ATOM   10516 C CB  . PRO C 1 144 ? -87.739  -15.283 -0.562  1.00 25.48  ? 183  PRO B CB  1 
ATOM   10517 C CG  . PRO C 1 144 ? -88.720  -15.875 0.420   1.00 28.50  ? 183  PRO B CG  1 
ATOM   10518 C CD  . PRO C 1 144 ? -88.693  -17.344 0.187   1.00 31.27  ? 183  PRO B CD  1 
ATOM   10519 N N   . TRP C 1 145 ? -86.197  -16.105 -3.573  1.00 24.61  ? 184  TRP B N   1 
ATOM   10520 C CA  . TRP C 1 145 ? -84.956  -16.415 -4.262  1.00 28.17  ? 184  TRP B CA  1 
ATOM   10521 C C   . TRP C 1 145 ? -84.959  -15.604 -5.528  1.00 31.00  ? 184  TRP B C   1 
ATOM   10522 O O   . TRP C 1 145 ? -85.833  -15.767 -6.377  1.00 33.59  ? 184  TRP B O   1 
ATOM   10523 C CB  . TRP C 1 145 ? -84.875  -17.895 -4.619  1.00 23.54  ? 184  TRP B CB  1 
ATOM   10524 C CG  . TRP C 1 145 ? -83.525  -18.314 -5.140  1.00 24.77  ? 184  TRP B CG  1 
ATOM   10525 C CD1 . TRP C 1 145 ? -82.349  -18.351 -4.432  1.00 23.05  ? 184  TRP B CD1 1 
ATOM   10526 C CD2 . TRP C 1 145 ? -83.207  -18.760 -6.464  1.00 22.30  ? 184  TRP B CD2 1 
ATOM   10527 N NE1 . TRP C 1 145 ? -81.329  -18.799 -5.235  1.00 26.90  ? 184  TRP B NE1 1 
ATOM   10528 C CE2 . TRP C 1 145 ? -81.827  -19.054 -6.488  1.00 23.72  ? 184  TRP B CE2 1 
ATOM   10529 C CE3 . TRP C 1 145 ? -83.951  -18.940 -7.634  1.00 25.54  ? 184  TRP B CE3 1 
ATOM   10530 C CZ2 . TRP C 1 145 ? -81.178  -19.514 -7.632  1.00 21.36  ? 184  TRP B CZ2 1 
ATOM   10531 C CZ3 . TRP C 1 145 ? -83.303  -19.397 -8.768  1.00 22.24  ? 184  TRP B CZ3 1 
ATOM   10532 C CH2 . TRP C 1 145 ? -81.929  -19.676 -8.759  1.00 23.05  ? 184  TRP B CH2 1 
ATOM   10533 N N   . ASN C 1 146 ? -83.983  -14.720 -5.657  1.00 32.33  ? 185  ASN B N   1 
ATOM   10534 C CA  . ASN C 1 146 ? -84.022  -13.721 -6.709  1.00 32.13  ? 185  ASN B CA  1 
ATOM   10535 C C   . ASN C 1 146 ? -83.353  -14.178 -7.991  1.00 38.21  ? 185  ASN B C   1 
ATOM   10536 O O   . ASN C 1 146 ? -82.337  -13.629 -8.406  1.00 30.16  ? 185  ASN B O   1 
ATOM   10537 C CB  . ASN C 1 146 ? -83.436  -12.408 -6.200  1.00 34.30  ? 185  ASN B CB  1 
ATOM   10538 C CG  . ASN C 1 146 ? -84.206  -11.864 -5.007  1.00 46.48  ? 185  ASN B CG  1 
ATOM   10539 O OD1 . ASN C 1 146 ? -85.441  -11.988 -4.936  1.00 48.63  ? 185  ASN B OD1 1 
ATOM   10540 N ND2 . ASN C 1 146 ? -83.486  -11.277 -4.052  1.00 44.52  ? 185  ASN B ND2 1 
ATOM   10541 N N   . GLY C 1 147 ? -83.944  -15.192 -8.618  1.00 33.16  ? 186  GLY B N   1 
ATOM   10542 C CA  . GLY C 1 147 ? -83.387  -15.762 -9.827  1.00 30.14  ? 186  GLY B CA  1 
ATOM   10543 C C   . GLY C 1 147 ? -84.163  -15.362 -11.066 1.00 36.35  ? 186  GLY B C   1 
ATOM   10544 O O   . GLY C 1 147 ? -84.724  -14.280 -11.139 1.00 32.50  ? 186  GLY B O   1 
ATOM   10545 N N   . PRO C 1 148 ? -84.195  -16.245 -12.064 1.00 32.99  ? 187  PRO B N   1 
ATOM   10546 C CA  . PRO C 1 148 ? -83.572  -17.566 -12.020 1.00 25.38  ? 187  PRO B CA  1 
ATOM   10547 C C   . PRO C 1 148 ? -82.106  -17.518 -12.444 1.00 31.55  ? 187  PRO B C   1 
ATOM   10548 O O   . PRO C 1 148 ? -81.644  -16.507 -12.974 1.00 29.77  ? 187  PRO B O   1 
ATOM   10549 C CB  . PRO C 1 148 ? -84.360  -18.358 -13.081 1.00 27.01  ? 187  PRO B CB  1 
ATOM   10550 C CG  . PRO C 1 148 ? -85.318  -17.349 -13.739 1.00 36.37  ? 187  PRO B CG  1 
ATOM   10551 C CD  . PRO C 1 148 ? -84.850  -15.990 -13.354 1.00 32.74  ? 187  PRO B CD  1 
ATOM   10552 N N   . VAL C 1 149 ? -81.384  -18.611 -12.222 1.00 25.48  ? 188  VAL B N   1 
ATOM   10553 C CA  . VAL C 1 149 ? -80.104  -18.786 -12.892 1.00 26.80  ? 188  VAL B CA  1 
ATOM   10554 C C   . VAL C 1 149 ? -80.143  -19.919 -13.923 1.00 24.64  ? 188  VAL B C   1 
ATOM   10555 O O   . VAL C 1 149 ? -80.943  -20.862 -13.826 1.00 26.26  ? 188  VAL B O   1 
ATOM   10556 C CB  . VAL C 1 149 ? -78.894  -18.944 -11.919 1.00 35.05  ? 188  VAL B CB  1 
ATOM   10557 C CG1 . VAL C 1 149 ? -79.219  -18.447 -10.516 1.00 27.10  ? 188  VAL B CG1 1 
ATOM   10558 C CG2 . VAL C 1 149 ? -78.356  -20.356 -11.927 1.00 33.23  ? 188  VAL B CG2 1 
ATOM   10559 N N   . GLY C 1 150 ? -79.310  -19.777 -14.941 1.00 28.10  ? 189  GLY B N   1 
ATOM   10560 C CA  . GLY C 1 150 ? -79.099  -20.823 -15.919 1.00 27.00  ? 189  GLY B CA  1 
ATOM   10561 C C   . GLY C 1 150 ? -77.627  -21.176 -15.870 1.00 33.65  ? 189  GLY B C   1 
ATOM   10562 O O   . GLY C 1 150 ? -76.777  -20.311 -15.609 1.00 29.84  ? 189  GLY B O   1 
ATOM   10563 N N   . ALA C 1 151 ? -77.312  -22.443 -16.092 1.00 26.65  ? 190  ALA B N   1 
ATOM   10564 C CA  . ALA C 1 151 ? -75.913  -22.853 -16.101 1.00 26.72  ? 190  ALA B CA  1 
ATOM   10565 C C   . ALA C 1 151 ? -75.585  -23.741 -17.293 1.00 28.31  ? 190  ALA B C   1 
ATOM   10566 O O   . ALA C 1 151 ? -76.414  -24.552 -17.709 1.00 24.69  ? 190  ALA B O   1 
ATOM   10567 C CB  . ALA C 1 151 ? -75.572  -23.561 -14.806 1.00 24.48  ? 190  ALA B CB  1 
ATOM   10568 N N   . VAL C 1 152 ? -74.377  -23.576 -17.834 1.00 24.90  ? 191  VAL B N   1 
ATOM   10569 C CA  . VAL C 1 152 ? -73.825  -24.483 -18.837 1.00 27.40  ? 191  VAL B CA  1 
ATOM   10570 C C   . VAL C 1 152 ? -72.338  -24.761 -18.588 1.00 35.28  ? 191  VAL B C   1 
ATOM   10571 O O   . VAL C 1 152 ? -71.659  -24.021 -17.867 1.00 31.37  ? 191  VAL B O   1 
ATOM   10572 C CB  . VAL C 1 152 ? -73.951  -23.916 -20.272 1.00 29.09  ? 191  VAL B CB  1 
ATOM   10573 C CG1 . VAL C 1 152 ? -75.416  -23.618 -20.613 1.00 28.35  ? 191  VAL B CG1 1 
ATOM   10574 C CG2 . VAL C 1 152 ? -73.073  -22.660 -20.434 1.00 23.95  ? 191  VAL B CG2 1 
ATOM   10575 N N   . ARG C 1 153 ? -71.840  -25.832 -19.194 1.00 25.26  ? 192  ARG B N   1 
ATOM   10576 C CA  . ARG C 1 153 ? -70.413  -26.081 -19.254 1.00 27.28  ? 192  ARG B CA  1 
ATOM   10577 C C   . ARG C 1 153 ? -69.999  -25.681 -20.657 1.00 29.24  ? 192  ARG B C   1 
ATOM   10578 O O   . ARG C 1 153 ? -70.775  -25.858 -21.603 1.00 26.51  ? 192  ARG B O   1 
ATOM   10579 C CB  . ARG C 1 153 ? -70.098  -27.564 -18.994 1.00 24.10  ? 192  ARG B CB  1 
ATOM   10580 C CG  . ARG C 1 153 ? -68.634  -27.944 -19.251 1.00 26.33  ? 192  ARG B CG  1 
ATOM   10581 C CD  . ARG C 1 153 ? -68.307  -29.336 -18.742 1.00 25.82  ? 192  ARG B CD  1 
ATOM   10582 N NE  . ARG C 1 153 ? -68.255  -29.415 -17.282 1.00 26.31  ? 192  ARG B NE  1 
ATOM   10583 C CZ  . ARG C 1 153 ? -69.140  -30.042 -16.513 1.00 28.02  ? 192  ARG B CZ  1 
ATOM   10584 N NH1 . ARG C 1 153 ? -70.189  -30.682 -17.044 1.00 25.26  ? 192  ARG B NH1 1 
ATOM   10585 N NH2 . ARG C 1 153 ? -68.964  -30.044 -15.201 1.00 24.05  ? 192  ARG B NH2 1 
ATOM   10586 N N   . ILE C 1 154 ? -68.814  -25.092 -20.780 1.00 23.11  ? 193  ILE B N   1 
ATOM   10587 C CA  . ILE C 1 154 ? -68.229  -24.796 -22.075 1.00 25.55  ? 193  ILE B CA  1 
ATOM   10588 C C   . ILE C 1 154 ? -66.909  -25.567 -22.194 1.00 30.36  ? 193  ILE B C   1 
ATOM   10589 O O   . ILE C 1 154 ? -66.016  -25.437 -21.346 1.00 24.71  ? 193  ILE B O   1 
ATOM   10590 C CB  . ILE C 1 154 ? -67.947  -23.282 -22.268 1.00 25.75  ? 193  ILE B CB  1 
ATOM   10591 C CG1 . ILE C 1 154 ? -69.228  -22.458 -22.170 1.00 26.32  ? 193  ILE B CG1 1 
ATOM   10592 C CG2 . ILE C 1 154 ? -67.235  -23.027 -23.607 1.00 26.22  ? 193  ILE B CG2 1 
ATOM   10593 C CD1 . ILE C 1 154 ? -70.219  -22.741 -23.288 1.00 32.45  ? 193  ILE B CD1 1 
ATOM   10594 N N   . GLY C 1 155 ? -66.796  -26.384 -23.235 1.00 25.12  ? 194  GLY B N   1 
ATOM   10595 C CA  . GLY C 1 155 ? -65.547  -27.050 -23.544 1.00 24.40  ? 194  GLY B CA  1 
ATOM   10596 C C   . GLY C 1 155 ? -64.981  -26.492 -24.830 1.00 27.58  ? 194  GLY B C   1 
ATOM   10597 O O   . GLY C 1 155 ? -65.579  -25.639 -25.473 1.00 29.72  ? 194  GLY B O   1 
ATOM   10598 N N   . ILE C 1 156 ? -63.811  -26.974 -25.203 1.00 28.36  ? 195  ILE B N   1 
ATOM   10599 C CA  . ILE C 1 156 ? -63.206  -26.591 -26.460 1.00 31.13  ? 195  ILE B CA  1 
ATOM   10600 C C   . ILE C 1 156 ? -62.817  -27.886 -27.139 1.00 35.11  ? 195  ILE B C   1 
ATOM   10601 O O   . ILE C 1 156 ? -61.988  -28.637 -26.628 1.00 35.29  ? 195  ILE B O   1 
ATOM   10602 C CB  . ILE C 1 156 ? -61.959  -25.714 -26.239 1.00 32.27  ? 195  ILE B CB  1 
ATOM   10603 C CG1 . ILE C 1 156 ? -62.380  -24.334 -25.732 1.00 32.34  ? 195  ILE B CG1 1 
ATOM   10604 C CG2 . ILE C 1 156 ? -61.149  -25.589 -27.515 1.00 35.26  ? 195  ILE B CG2 1 
ATOM   10605 C CD1 . ILE C 1 156 ? -61.205  -23.359 -25.487 1.00 28.57  ? 195  ILE B CD1 1 
ATOM   10606 N N   . ILE C 1 157 ? -63.446  -28.166 -28.272 1.00 31.34  ? 196  ILE B N   1 
ATOM   10607 C CA  . ILE C 1 157 ? -63.170  -29.396 -29.004 1.00 36.59  ? 196  ILE B CA  1 
ATOM   10608 C C   . ILE C 1 157 ? -62.902  -29.090 -30.464 1.00 36.56  ? 196  ILE B C   1 
ATOM   10609 O O   . ILE C 1 157 ? -63.699  -28.411 -31.119 1.00 29.90  ? 196  ILE B O   1 
ATOM   10610 C CB  . ILE C 1 157 ? -64.344  -30.404 -28.914 1.00 37.05  ? 196  ILE B CB  1 
ATOM   10611 C CG1 . ILE C 1 157 ? -64.416  -31.010 -27.513 1.00 37.44  ? 196  ILE B CG1 1 
ATOM   10612 C CG2 . ILE C 1 157 ? -64.171  -31.502 -29.961 1.00 44.58  ? 196  ILE B CG2 1 
ATOM   10613 C CD1 . ILE C 1 157 ? -65.207  -30.162 -26.535 1.00 35.84  ? 196  ILE B CD1 1 
ATOM   10614 N N   . ASP C 1 158 ? -61.775  -29.589 -30.963 1.00 35.65  ? 197  ASP B N   1 
ATOM   10615 C CA  . ASP C 1 158 ? -61.368  -29.340 -32.333 1.00 35.18  ? 197  ASP B CA  1 
ATOM   10616 C C   . ASP C 1 158 ? -61.497  -27.847 -32.652 1.00 34.77  ? 197  ASP B C   1 
ATOM   10617 O O   . ASP C 1 158 ? -61.942  -27.463 -33.733 1.00 37.16  ? 197  ASP B O   1 
ATOM   10618 C CB  . ASP C 1 158 ? -62.219  -30.186 -33.289 1.00 39.11  ? 197  ASP B CB  1 
ATOM   10619 C CG  . ASP C 1 158 ? -61.553  -30.409 -34.633 1.00 42.46  ? 197  ASP B CG  1 
ATOM   10620 O OD1 . ASP C 1 158 ? -60.349  -30.109 -34.752 1.00 47.94  ? 197  ASP B OD1 1 
ATOM   10621 O OD2 . ASP C 1 158 ? -62.232  -30.904 -35.566 1.00 33.71  ? 197  ASP B OD2 1 
ATOM   10622 N N   . GLY C 1 159 ? -61.121  -27.005 -31.697 1.00 33.77  ? 198  GLY B N   1 
ATOM   10623 C CA  . GLY C 1 159 ? -61.074  -25.573 -31.942 1.00 30.75  ? 198  GLY B CA  1 
ATOM   10624 C C   . GLY C 1 159 ? -62.405  -24.845 -31.838 1.00 36.87  ? 198  GLY B C   1 
ATOM   10625 O O   . GLY C 1 159 ? -62.487  -23.662 -32.158 1.00 38.26  ? 198  GLY B O   1 
ATOM   10626 N N   . GLU C 1 160 ? -63.447  -25.539 -31.389 1.00 29.97  ? 199  GLU B N   1 
ATOM   10627 C CA  . GLU C 1 160 ? -64.755  -24.920 -31.255 1.00 33.25  ? 199  GLU B CA  1 
ATOM   10628 C C   . GLU C 1 160 ? -65.163  -24.855 -29.794 1.00 30.55  ? 199  GLU B C   1 
ATOM   10629 O O   . GLU C 1 160 ? -64.845  -25.748 -29.023 1.00 34.00  ? 199  GLU B O   1 
ATOM   10630 C CB  . GLU C 1 160 ? -65.820  -25.698 -32.040 1.00 33.93  ? 199  GLU B CB  1 
ATOM   10631 C CG  . GLU C 1 160 ? -65.473  -25.970 -33.500 1.00 38.93  ? 199  GLU B CG  1 
ATOM   10632 C CD  . GLU C 1 160 ? -65.383  -24.704 -34.360 1.00 43.83  ? 199  GLU B CD  1 
ATOM   10633 O OE1 . GLU C 1 160 ? -65.518  -23.579 -33.828 1.00 41.53  ? 199  GLU B OE1 1 
ATOM   10634 O OE2 . GLU C 1 160 ? -65.174  -24.835 -35.583 1.00 41.97  ? 199  GLU B OE2 1 
ATOM   10635 N N   . TYR C 1 161 ? -65.877  -23.799 -29.423 1.00 35.44  ? 200  TYR B N   1 
ATOM   10636 C CA  . TYR C 1 161 ? -66.496  -23.743 -28.107 1.00 29.83  ? 200  TYR B CA  1 
ATOM   10637 C C   . TYR C 1 161 ? -67.742  -24.612 -28.124 1.00 36.55  ? 200  TYR B C   1 
ATOM   10638 O O   . TYR C 1 161 ? -68.627  -24.413 -28.951 1.00 33.72  ? 200  TYR B O   1 
ATOM   10639 C CB  . TYR C 1 161 ? -66.819  -22.294 -27.741 1.00 26.67  ? 200  TYR B CB  1 
ATOM   10640 C CG  . TYR C 1 161 ? -65.567  -21.470 -27.669 1.00 29.13  ? 200  TYR B CG  1 
ATOM   10641 C CD1 . TYR C 1 161 ? -64.757  -21.511 -26.547 1.00 34.53  ? 200  TYR B CD1 1 
ATOM   10642 C CD2 . TYR C 1 161 ? -65.157  -20.706 -28.754 1.00 42.38  ? 200  TYR B CD2 1 
ATOM   10643 C CE1 . TYR C 1 161 ? -63.588  -20.777 -26.485 1.00 39.74  ? 200  TYR B CE1 1 
ATOM   10644 C CE2 . TYR C 1 161 ? -63.986  -19.970 -28.709 1.00 48.51  ? 200  TYR B CE2 1 
ATOM   10645 C CZ  . TYR C 1 161 ? -63.208  -20.006 -27.568 1.00 43.30  ? 200  TYR B CZ  1 
ATOM   10646 O OH  . TYR C 1 161 ? -62.046  -19.282 -27.519 1.00 44.06  ? 200  TYR B OH  1 
ATOM   10647 N N   . VAL C 1 162 ? -67.788  -25.606 -27.244 1.00 30.17  ? 201  VAL B N   1 
ATOM   10648 C CA  . VAL C 1 162 ? -68.896  -26.547 -27.218 1.00 28.17  ? 201  VAL B CA  1 
ATOM   10649 C C   . VAL C 1 162 ? -69.688  -26.333 -25.941 1.00 33.67  ? 201  VAL B C   1 
ATOM   10650 O O   . VAL C 1 162 ? -69.126  -26.362 -24.854 1.00 30.27  ? 201  VAL B O   1 
ATOM   10651 C CB  . VAL C 1 162 ? -68.403  -28.020 -27.237 1.00 34.53  ? 201  VAL B CB  1 
ATOM   10652 C CG1 . VAL C 1 162 ? -69.565  -28.976 -27.019 1.00 34.63  ? 201  VAL B CG1 1 
ATOM   10653 C CG2 . VAL C 1 162 ? -67.673  -28.336 -28.536 1.00 33.50  ? 201  VAL B CG2 1 
ATOM   10654 N N   . VAL C 1 163 ? -70.991  -26.118 -26.065 1.00 31.44  ? 202  VAL B N   1 
ATOM   10655 C CA  . VAL C 1 163 ? -71.824  -25.974 -24.882 1.00 21.96  ? 202  VAL B CA  1 
ATOM   10656 C C   . VAL C 1 163 ? -72.248  -27.367 -24.421 1.00 31.86  ? 202  VAL B C   1 
ATOM   10657 O O   . VAL C 1 163 ? -72.622  -28.220 -25.229 1.00 37.30  ? 202  VAL B O   1 
ATOM   10658 C CB  . VAL C 1 163 ? -73.013  -24.991 -25.130 1.00 30.11  ? 202  VAL B CB  1 
ATOM   10659 C CG1 . VAL C 1 163 ? -73.830  -25.434 -26.313 1.00 51.40  ? 202  VAL B CG1 1 
ATOM   10660 C CG2 . VAL C 1 163 ? -73.904  -24.851 -23.879 1.00 25.19  ? 202  VAL B CG2 1 
ATOM   10661 N N   . ASN C 1 164 ? -72.146  -27.599 -23.117 1.00 30.92  ? 203  ASN B N   1 
ATOM   10662 C CA  . ASN C 1 164 ? -72.433  -28.896 -22.519 1.00 28.47  ? 203  ASN B CA  1 
ATOM   10663 C C   . ASN C 1 164 ? -71.757  -30.067 -23.231 1.00 41.70  ? 203  ASN B C   1 
ATOM   10664 O O   . ASN C 1 164 ? -72.423  -30.981 -23.712 1.00 30.98  ? 203  ASN B O   1 
ATOM   10665 C CB  . ASN C 1 164 ? -73.942  -29.136 -22.401 1.00 30.41  ? 203  ASN B CB  1 
ATOM   10666 C CG  . ASN C 1 164 ? -74.602  -28.158 -21.458 1.00 43.21  ? 203  ASN B CG  1 
ATOM   10667 O OD1 . ASN C 1 164 ? -73.920  -27.495 -20.671 1.00 28.02  ? 203  ASN B OD1 1 
ATOM   10668 N ND2 . ASN C 1 164 ? -75.930  -28.055 -21.527 1.00 38.04  ? 203  ASN B ND2 1 
ATOM   10669 N N   . PRO C 1 165 ? -70.422  -30.055 -23.272 1.00 35.51  ? 204  PRO B N   1 
ATOM   10670 C CA  . PRO C 1 165 ? -69.731  -31.184 -23.908 1.00 31.72  ? 204  PRO B CA  1 
ATOM   10671 C C   . PRO C 1 165 ? -70.114  -32.536 -23.301 1.00 34.13  ? 204  PRO B C   1 
ATOM   10672 O O   . PRO C 1 165 ? -70.337  -32.665 -22.087 1.00 28.51  ? 204  PRO B O   1 
ATOM   10673 C CB  . PRO C 1 165 ? -68.248  -30.892 -23.645 1.00 31.14  ? 204  PRO B CB  1 
ATOM   10674 C CG  . PRO C 1 165 ? -68.248  -29.900 -22.457 1.00 30.80  ? 204  PRO B CG  1 
ATOM   10675 C CD  . PRO C 1 165 ? -69.491  -29.081 -22.675 1.00 27.06  ? 204  PRO B CD  1 
ATOM   10676 N N   . THR C 1 166 ? -70.181  -33.546 -24.159 1.00 26.47  ? 205  THR B N   1 
ATOM   10677 C CA  . THR C 1 166 ? -70.369  -34.915 -23.699 1.00 29.40  ? 205  THR B CA  1 
ATOM   10678 C C   . THR C 1 166 ? -69.164  -35.398 -22.887 1.00 36.16  ? 205  THR B C   1 
ATOM   10679 O O   . THR C 1 166 ? -68.102  -34.757 -22.848 1.00 31.91  ? 205  THR B O   1 
ATOM   10680 C CB  . THR C 1 166 ? -70.566  -35.878 -24.880 1.00 33.70  ? 205  THR B CB  1 
ATOM   10681 O OG1 . THR C 1 166 ? -69.336  -35.992 -25.603 1.00 29.23  ? 205  THR B OG1 1 
ATOM   10682 C CG2 . THR C 1 166 ? -71.679  -35.373 -25.819 1.00 27.57  ? 205  THR B CG2 1 
ATOM   10683 N N   . ARG C 1 167 ? -69.339  -36.548 -22.255 1.00 31.76  ? 206  ARG B N   1 
ATOM   10684 C CA  . ARG C 1 167 ? -68.313  -37.131 -21.409 1.00 32.82  ? 206  ARG B CA  1 
ATOM   10685 C C   . ARG C 1 167 ? -67.049  -37.393 -22.210 1.00 38.28  ? 206  ARG B C   1 
ATOM   10686 O O   . ARG C 1 167 ? -65.946  -37.085 -21.754 1.00 36.18  ? 206  ARG B O   1 
ATOM   10687 C CB  . ARG C 1 167 ? -68.835  -38.411 -20.768 1.00 35.92  ? 206  ARG B CB  1 
ATOM   10688 C CG  . ARG C 1 167 ? -67.872  -39.044 -19.797 1.00 46.52  ? 206  ARG B CG  1 
ATOM   10689 C CD  . ARG C 1 167 ? -68.489  -40.269 -19.131 1.00 52.34  ? 206  ARG B CD  1 
ATOM   10690 N NE  . ARG C 1 167 ? -67.665  -40.737 -18.021 1.00 58.70  ? 206  ARG B NE  1 
ATOM   10691 C CZ  . ARG C 1 167 ? -66.699  -41.642 -18.138 1.00 66.54  ? 206  ARG B CZ  1 
ATOM   10692 N NH1 . ARG C 1 167 ? -66.440  -42.191 -19.323 1.00 54.92  ? 206  ARG B NH1 1 
ATOM   10693 N NH2 . ARG C 1 167 ? -65.999  -42.001 -17.067 1.00 64.96  ? 206  ARG B NH2 1 
ATOM   10694 N N   . LYS C 1 168 ? -67.219  -37.931 -23.416 1.00 32.38  ? 207  LYS B N   1 
ATOM   10695 C CA  . LYS C 1 168 ? -66.101  -38.175 -24.323 1.00 41.95  ? 207  LYS B CA  1 
ATOM   10696 C C   . LYS C 1 168 ? -65.432  -36.870 -24.741 1.00 34.42  ? 207  LYS B C   1 
ATOM   10697 O O   . LYS C 1 168 ? -64.209  -36.777 -24.784 1.00 37.73  ? 207  LYS B O   1 
ATOM   10698 C CB  . LYS C 1 168 ? -66.571  -38.924 -25.576 1.00 46.70  ? 207  LYS B CB  1 
ATOM   10699 C CG  . LYS C 1 168 ? -66.316  -40.424 -25.588 1.00 57.77  ? 207  LYS B CG  1 
ATOM   10700 C CD  . LYS C 1 168 ? -66.810  -41.010 -26.913 1.00 71.96  ? 207  LYS B CD  1 
ATOM   10701 C CE  . LYS C 1 168 ? -66.248  -42.403 -27.201 1.00 82.87  ? 207  LYS B CE  1 
ATOM   10702 N NZ  . LYS C 1 168 ? -66.656  -42.887 -28.566 1.00 71.09  ? 207  LYS B NZ  1 
ATOM   10703 N N   . GLU C 1 169 ? -66.233  -35.869 -25.078 1.00 32.95  ? 208  GLU B N   1 
ATOM   10704 C CA  . GLU C 1 169 ? -65.678  -34.560 -25.423 1.00 32.66  ? 208  GLU B CA  1 
ATOM   10705 C C   . GLU C 1 169 ? -64.841  -33.995 -24.268 1.00 32.73  ? 208  GLU B C   1 
ATOM   10706 O O   . GLU C 1 169 ? -63.715  -33.554 -24.467 1.00 31.03  ? 208  GLU B O   1 
ATOM   10707 C CB  . GLU C 1 169 ? -66.787  -33.590 -25.836 1.00 35.65  ? 208  GLU B CB  1 
ATOM   10708 C CG  . GLU C 1 169 ? -67.275  -33.814 -27.272 1.00 40.70  ? 208  GLU B CG  1 
ATOM   10709 C CD  . GLU C 1 169 ? -68.444  -32.926 -27.636 1.00 38.34  ? 208  GLU B CD  1 
ATOM   10710 O OE1 . GLU C 1 169 ? -68.562  -32.543 -28.820 1.00 36.85  ? 208  GLU B OE1 1 
ATOM   10711 O OE2 . GLU C 1 169 ? -69.249  -32.616 -26.732 1.00 31.31  ?