data_3U53
# 
_entry.id   3U53 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3U53         
RCSB  RCSB068316   
WWPDB D_1000068316 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3U53 
_pdbx_database_status.recvd_initial_deposition_date   2011-10-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ge, H.H.'   1 
'Teng, M.K.' 2 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of wild-type and mutant human Ap4A hydrolase' 
_citation.journal_abbrev            Biochem.Biophys.Res.Commun. 
_citation.journal_volume            432 
_citation.page_first                16 
_citation.page_last                 21 
_citation.year                      2013 
_citation.journal_id_ASTM           BBRCA9 
_citation.country                   US 
_citation.journal_id_ISSN           0006-291X 
_citation.journal_id_CSD            0146 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23384440 
_citation.pdbx_database_id_DOI      10.1016/j.bbrc.2013.01.095 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ge, H.H.'   1 
primary 'Chen, X.F.' 2 
primary 'Yang, W.L.' 3 
primary 'Niu, L.W.'  4 
primary 'Teng, M.K.' 5 
# 
_cell.entry_id           3U53 
_cell.length_a           72.485 
_cell.length_b           72.485 
_cell.length_c           133.491 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3U53 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
;
17922.385 4   3.6.1.17 ? ? ? 
2 non-polymer syn 'SULFATE ION'                                       96.063    17  ?        ? ? ? 
3 non-polymer syn GLYCEROL                                            92.094    1   ?        ? ? ? 
4 water       nat water                                               18.015    148 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'asymmetrical diadenosine tetraphosphate hydrolase, Ap4A hydrolase, Ap4Aase, Nudix hydrolase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKREL
NYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEALEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKREL
NYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEALEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   LEU n 
1 4   ARG n 
1 5   ALA n 
1 6   CYS n 
1 7   GLY n 
1 8   LEU n 
1 9   ILE n 
1 10  ILE n 
1 11  PHE n 
1 12  ARG n 
1 13  ARG n 
1 14  CYS n 
1 15  LEU n 
1 16  ILE n 
1 17  PRO n 
1 18  LYS n 
1 19  VAL n 
1 20  ASP n 
1 21  ASN n 
1 22  ASN n 
1 23  ALA n 
1 24  ILE n 
1 25  GLU n 
1 26  PHE n 
1 27  LEU n 
1 28  LEU n 
1 29  LEU n 
1 30  GLN n 
1 31  ALA n 
1 32  SER n 
1 33  ASP n 
1 34  GLY n 
1 35  ILE n 
1 36  HIS n 
1 37  HIS n 
1 38  TRP n 
1 39  THR n 
1 40  PRO n 
1 41  PRO n 
1 42  LYS n 
1 43  GLY n 
1 44  HIS n 
1 45  VAL n 
1 46  GLU n 
1 47  PRO n 
1 48  GLY n 
1 49  GLU n 
1 50  ASP n 
1 51  ASP n 
1 52  LEU n 
1 53  GLU n 
1 54  THR n 
1 55  ALA n 
1 56  LEU n 
1 57  ARG n 
1 58  GLU n 
1 59  THR n 
1 60  GLN n 
1 61  GLU n 
1 62  GLU n 
1 63  ALA n 
1 64  GLY n 
1 65  ILE n 
1 66  GLU n 
1 67  ALA n 
1 68  GLY n 
1 69  GLN n 
1 70  LEU n 
1 71  THR n 
1 72  ILE n 
1 73  ILE n 
1 74  GLU n 
1 75  GLY n 
1 76  PHE n 
1 77  LYS n 
1 78  ARG n 
1 79  GLU n 
1 80  LEU n 
1 81  ASN n 
1 82  TYR n 
1 83  VAL n 
1 84  ALA n 
1 85  ARG n 
1 86  ASN n 
1 87  LYS n 
1 88  PRO n 
1 89  LYS n 
1 90  THR n 
1 91  VAL n 
1 92  ILE n 
1 93  TYR n 
1 94  TRP n 
1 95  LEU n 
1 96  ALA n 
1 97  GLU n 
1 98  VAL n 
1 99  LYS n 
1 100 ASP n 
1 101 TYR n 
1 102 ASP n 
1 103 VAL n 
1 104 GLU n 
1 105 ILE n 
1 106 ARG n 
1 107 LEU n 
1 108 SER n 
1 109 HIS n 
1 110 GLU n 
1 111 HIS n 
1 112 GLN n 
1 113 ALA n 
1 114 TYR n 
1 115 ARG n 
1 116 TRP n 
1 117 LEU n 
1 118 GLY n 
1 119 LEU n 
1 120 GLU n 
1 121 GLU n 
1 122 ALA n 
1 123 CYS n 
1 124 GLN n 
1 125 LEU n 
1 126 ALA n 
1 127 GLN n 
1 128 PHE n 
1 129 LYS n 
1 130 GLU n 
1 131 MET n 
1 132 LYS n 
1 133 ALA n 
1 134 ALA n 
1 135 LEU n 
1 136 GLN n 
1 137 GLU n 
1 138 GLY n 
1 139 HIS n 
1 140 GLN n 
1 141 PHE n 
1 142 LEU n 
1 143 CYS n 
1 144 SER n 
1 145 ILE n 
1 146 GLU n 
1 147 ALA n 
1 148 LEU n 
1 149 GLU n 
1 150 HIS n 
1 151 HIS n 
1 152 HIS n 
1 153 HIS n 
1 154 HIS n 
1 155 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 NUDT2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AP4A_HUMAN 
_struct_ref.pdbx_db_accession          P50583 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKREL
NYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3U53 A 1 ? 147 ? P50583 1 ? 147 ? 1 147 
2 1 3U53 B 1 ? 147 ? P50583 1 ? 147 ? 1 147 
3 1 3U53 C 1 ? 147 ? P50583 1 ? 147 ? 1 147 
4 1 3U53 D 1 ? 147 ? P50583 1 ? 147 ? 1 147 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3U53 LEU A 148 ? UNP P50583 ? ? 'EXPRESSION TAG' 148 1  
1 3U53 GLU A 149 ? UNP P50583 ? ? 'EXPRESSION TAG' 149 2  
1 3U53 HIS A 150 ? UNP P50583 ? ? 'EXPRESSION TAG' 150 3  
1 3U53 HIS A 151 ? UNP P50583 ? ? 'EXPRESSION TAG' 151 4  
1 3U53 HIS A 152 ? UNP P50583 ? ? 'EXPRESSION TAG' 152 5  
1 3U53 HIS A 153 ? UNP P50583 ? ? 'EXPRESSION TAG' 153 6  
1 3U53 HIS A 154 ? UNP P50583 ? ? 'EXPRESSION TAG' 154 7  
1 3U53 HIS A 155 ? UNP P50583 ? ? 'EXPRESSION TAG' 155 8  
2 3U53 LEU B 148 ? UNP P50583 ? ? 'EXPRESSION TAG' 148 9  
2 3U53 GLU B 149 ? UNP P50583 ? ? 'EXPRESSION TAG' 149 10 
2 3U53 HIS B 150 ? UNP P50583 ? ? 'EXPRESSION TAG' 150 11 
2 3U53 HIS B 151 ? UNP P50583 ? ? 'EXPRESSION TAG' 151 12 
2 3U53 HIS B 152 ? UNP P50583 ? ? 'EXPRESSION TAG' 152 13 
2 3U53 HIS B 153 ? UNP P50583 ? ? 'EXPRESSION TAG' 153 14 
2 3U53 HIS B 154 ? UNP P50583 ? ? 'EXPRESSION TAG' 154 15 
2 3U53 HIS B 155 ? UNP P50583 ? ? 'EXPRESSION TAG' 155 16 
3 3U53 LEU C 148 ? UNP P50583 ? ? 'EXPRESSION TAG' 148 17 
3 3U53 GLU C 149 ? UNP P50583 ? ? 'EXPRESSION TAG' 149 18 
3 3U53 HIS C 150 ? UNP P50583 ? ? 'EXPRESSION TAG' 150 19 
3 3U53 HIS C 151 ? UNP P50583 ? ? 'EXPRESSION TAG' 151 20 
3 3U53 HIS C 152 ? UNP P50583 ? ? 'EXPRESSION TAG' 152 21 
3 3U53 HIS C 153 ? UNP P50583 ? ? 'EXPRESSION TAG' 153 22 
3 3U53 HIS C 154 ? UNP P50583 ? ? 'EXPRESSION TAG' 154 23 
3 3U53 HIS C 155 ? UNP P50583 ? ? 'EXPRESSION TAG' 155 24 
4 3U53 LEU D 148 ? UNP P50583 ? ? 'EXPRESSION TAG' 148 25 
4 3U53 GLU D 149 ? UNP P50583 ? ? 'EXPRESSION TAG' 149 26 
4 3U53 HIS D 150 ? UNP P50583 ? ? 'EXPRESSION TAG' 150 27 
4 3U53 HIS D 151 ? UNP P50583 ? ? 'EXPRESSION TAG' 151 28 
4 3U53 HIS D 152 ? UNP P50583 ? ? 'EXPRESSION TAG' 152 29 
4 3U53 HIS D 153 ? UNP P50583 ? ? 'EXPRESSION TAG' 153 30 
4 3U53 HIS D 154 ? UNP P50583 ? ? 'EXPRESSION TAG' 154 31 
4 3U53 HIS D 155 ? UNP P50583 ? ? 'EXPRESSION TAG' 155 32 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3U53 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.71 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    
;0.1M Sodium citrate tribasic dihydrate, 1.2M Lithium sulfate, 0.2M Ammonium sulfate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2007-07-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'BSRF BEAMLINE 3W1A' 
_diffrn_source.pdbx_synchrotron_site       BSRF 
_diffrn_source.pdbx_synchrotron_beamline   3W1A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     3U53 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   2.6 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.705 
_reflns.number_obs                   17881 
_reflns.number_all                   18871 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.0983 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.705 
_reflns_shell.d_res_low                   2.775 
_reflns_shell.percent_possible_all        100 
_reflns_shell.Rmerge_I_obs                0.3756 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         2.5 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           1312 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3U53 
_refine.ls_number_reflns_obs                     17881 
_refine.ls_number_reflns_all                     18867 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.705 
_refine.ls_percent_reflns_obs                    99.99 
_refine.ls_R_factor_obs                          0.21654 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21297 
_refine.ls_R_factor_R_free                       0.28427 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  969 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.938 
_refine.correlation_coeff_Fo_to_Fc_free          0.883 
_refine.B_iso_mean                               55.676 
_refine.aniso_B[1][1]                            1.19 
_refine.aniso_B[2][2]                            1.19 
_refine.aniso_B[3][3]                            -2.39 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1KT9' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.405 
_refine.overall_SU_ML                            0.295 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             31.636 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4539 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         91 
_refine_hist.number_atoms_solvent             148 
_refine_hist.number_atoms_total               4778 
_refine_hist.d_res_high                       2.705 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.018  0.021  ? 4710 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.609  1.969  ? 6402 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.603  5.000  ? 576  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       37.045 24.629 ? 229  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       22.274 15.000 ? 772  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       22.947 15.000 ? 27   ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.108  0.200  ? 694  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.010  0.021  ? 3580 ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  4.110  1.500  ? 2870 ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 6.587  2.000  ? 4575 ? 'X-RAY DIFFRACTION' 
r_scbond_it                  4.312  3.000  ? 1840 ? 'X-RAY DIFFRACTION' 
r_scangle_it                 7.546  4.500  ? 1825 ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1086 0.48 0.50 'medium positional' 1 1 'X-RAY DIFFRACTION' ? ? ? 
1 B 1086 0.48 0.50 'medium positional' 1 2 'X-RAY DIFFRACTION' ? ? ? 
1 C 1086 0.54 0.50 'medium positional' 1 3 'X-RAY DIFFRACTION' ? ? ? 
1 D 1086 0.52 0.50 'medium positional' 1 4 'X-RAY DIFFRACTION' ? ? ? 
1 A 1086 4.37 2.00 'medium thermal'    1 5 'X-RAY DIFFRACTION' ? ? ? 
1 B 1086 5.12 2.00 'medium thermal'    1 6 'X-RAY DIFFRACTION' ? ? ? 
1 C 1086 5.01 2.00 'medium thermal'    1 7 'X-RAY DIFFRACTION' ? ? ? 
1 D 1086 4.34 2.00 'medium thermal'    1 8 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.705 
_refine_ls_shell.d_res_low                        2.775 
_refine_ls_shell.number_reflns_R_work             1312 
_refine_ls_shell.R_factor_R_work                  0.329 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.336 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             74 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
3 C 1 
4 D 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 4 A 147 1 4 ? ? ? ? ? ? ? ? 1 ? 
2 B 4 B 147 1 4 ? ? ? ? ? ? ? ? 1 ? 
3 C 4 C 147 1 4 ? ? ? ? ? ? ? ? 1 ? 
4 D 4 D 147 1 4 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3U53 
_struct.title                     'Crystal structure of human Ap4A hydrolase' 
_struct.pdbx_descriptor           
;Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] (E.C.3.6.1.17)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3U53 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            Hydrolase 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 2 ? 
N N N 2 ? 
O N N 2 ? 
P N N 2 ? 
Q N N 2 ? 
R N N 2 ? 
S N N 2 ? 
T N N 2 ? 
U N N 2 ? 
V N N 2 ? 
W N N 4 ? 
X N N 4 ? 
Y N N 4 ? 
Z N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 50  ? GLY A 64  ? ASP A 50  GLY A 64  1 ? 15 
HELX_P HELX_P2  2  GLU A 66  ? GLY A 68  ? GLU A 66  GLY A 68  5 ? 3  
HELX_P HELX_P3  3  GLY A 118 ? GLN A 127 ? GLY A 118 GLN A 127 1 ? 10 
HELX_P HELX_P4  4  PHE A 128 ? ALA A 147 ? PHE A 128 ALA A 147 1 ? 20 
HELX_P HELX_P5  5  ASP B 50  ? GLY B 64  ? ASP B 50  GLY B 64  1 ? 15 
HELX_P HELX_P6  6  GLU B 66  ? GLY B 68  ? GLU B 66  GLY B 68  5 ? 3  
HELX_P HELX_P7  7  GLY B 118 ? GLN B 127 ? GLY B 118 GLN B 127 1 ? 10 
HELX_P HELX_P8  8  PHE B 128 ? ALA B 147 ? PHE B 128 ALA B 147 1 ? 20 
HELX_P HELX_P9  9  ASP C 50  ? GLY C 64  ? ASP C 50  GLY C 64  1 ? 15 
HELX_P HELX_P10 10 GLU C 66  ? GLY C 68  ? GLU C 66  GLY C 68  5 ? 3  
HELX_P HELX_P11 11 GLY C 118 ? GLN C 127 ? GLY C 118 GLN C 127 1 ? 10 
HELX_P HELX_P12 12 PHE C 128 ? ALA C 147 ? PHE C 128 ALA C 147 1 ? 20 
HELX_P HELX_P13 13 ASP D 50  ? GLY D 64  ? ASP D 50  GLY D 64  1 ? 15 
HELX_P HELX_P14 14 GLU D 66  ? GLY D 68  ? GLU D 66  GLY D 68  5 ? 3  
HELX_P HELX_P15 15 GLY D 118 ? GLN D 127 ? GLY D 118 GLN D 127 1 ? 10 
HELX_P HELX_P16 16 PHE D 128 ? ALA D 147 ? PHE D 128 ALA D 147 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 5 ? 
D ? 4 ? 
E ? 4 ? 
F ? 5 ? 
G ? 3 ? 
H ? 4 ? 
I ? 5 ? 
J ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? parallel      
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 38  ? THR A 39  ? TRP A 38  THR A 39  
A 2 ILE A 24  ? ALA A 31  ? ILE A 24  ALA A 31  
A 3 ALA A 5   ? ARG A 13  ? ALA A 5   ARG A 13  
A 4 LYS A 87  ? VAL A 98  ? LYS A 87  VAL A 98  
A 5 LEU A 70  ? ALA A 84  ? LEU A 70  ALA A 84  
B 1 LYS A 42  ? HIS A 44  ? LYS A 42  HIS A 44  
B 2 ALA A 5   ? ARG A 13  ? ALA A 5   ARG A 13  
B 3 ILE A 24  ? ALA A 31  ? ILE A 24  ALA A 31  
B 4 HIS A 111 ? LEU A 117 ? HIS A 111 LEU A 117 
C 1 TRP B 38  ? THR B 39  ? TRP B 38  THR B 39  
C 2 ILE B 24  ? ALA B 31  ? ILE B 24  ALA B 31  
C 3 ALA B 5   ? ARG B 13  ? ALA B 5   ARG B 13  
C 4 LYS B 87  ? VAL B 98  ? LYS B 87  VAL B 98  
C 5 LEU B 70  ? ALA B 84  ? LEU B 70  ALA B 84  
D 1 LYS B 42  ? HIS B 44  ? LYS B 42  HIS B 44  
D 2 ALA B 5   ? ARG B 13  ? ALA B 5   ARG B 13  
D 3 ILE B 24  ? ALA B 31  ? ILE B 24  ALA B 31  
D 4 HIS B 111 ? LEU B 117 ? HIS B 111 LEU B 117 
E 1 TRP C 38  ? THR C 39  ? TRP C 38  THR C 39  
E 2 ILE C 24  ? ALA C 31  ? ILE C 24  ALA C 31  
E 3 ALA C 5   ? ARG C 13  ? ALA C 5   ARG C 13  
E 4 LYS C 42  ? HIS C 44  ? LYS C 42  HIS C 44  
F 1 LEU C 70  ? ILE C 72  ? LEU C 70  ILE C 72  
F 2 LYS C 87  ? VAL C 98  ? LYS C 87  VAL C 98  
F 3 ALA C 5   ? ARG C 13  ? ALA C 5   ARG C 13  
F 4 ILE C 24  ? ALA C 31  ? ILE C 24  ALA C 31  
F 5 HIS C 111 ? LEU C 117 ? HIS C 111 LEU C 117 
G 1 LEU C 70  ? ILE C 72  ? LEU C 70  ILE C 72  
G 2 LYS C 87  ? VAL C 98  ? LYS C 87  VAL C 98  
G 3 ARG C 78  ? ALA C 84  ? ARG C 78  ALA C 84  
H 1 TRP D 38  ? THR D 39  ? TRP D 38  THR D 39  
H 2 ILE D 24  ? ALA D 31  ? ILE D 24  ALA D 31  
H 3 ALA D 5   ? ARG D 13  ? ALA D 5   ARG D 13  
H 4 LYS D 42  ? HIS D 44  ? LYS D 42  HIS D 44  
I 1 LEU D 70  ? ILE D 72  ? LEU D 70  ILE D 72  
I 2 LYS D 87  ? VAL D 98  ? LYS D 87  VAL D 98  
I 3 ALA D 5   ? ARG D 13  ? ALA D 5   ARG D 13  
I 4 ILE D 24  ? ALA D 31  ? ILE D 24  ALA D 31  
I 5 HIS D 111 ? LEU D 117 ? HIS D 111 LEU D 117 
J 1 LEU D 70  ? ILE D 72  ? LEU D 70  ILE D 72  
J 2 LYS D 87  ? VAL D 98  ? LYS D 87  VAL D 98  
J 3 ARG D 78  ? ALA D 84  ? ARG D 78  ALA D 84  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 39 ? O THR A 39 N LEU A 29  ? N LEU A 29  
A 2 3 O GLU A 25 ? O GLU A 25 N ARG A 12  ? N ARG A 12  
A 3 4 N ILE A 9  ? N ILE A 9  O TRP A 94  ? O TRP A 94  
A 4 5 O LYS A 89 ? O LYS A 89 N TYR A 82  ? N TYR A 82  
B 1 2 O GLY A 43 ? O GLY A 43 N CYS A 6   ? N CYS A 6   
B 2 3 N ARG A 12 ? N ARG A 12 O GLU A 25  ? O GLU A 25  
B 3 4 N PHE A 26 ? N PHE A 26 O LEU A 117 ? O LEU A 117 
C 1 2 O THR B 39 ? O THR B 39 N LEU B 29  ? N LEU B 29  
C 2 3 O GLU B 25 ? O GLU B 25 N ARG B 12  ? N ARG B 12  
C 3 4 N GLY B 7  ? N GLY B 7  O ILE B 92  ? O ILE B 92  
C 4 5 O LYS B 89 ? O LYS B 89 N TYR B 82  ? N TYR B 82  
D 1 2 O GLY B 43 ? O GLY B 43 N CYS B 6   ? N CYS B 6   
D 2 3 N ARG B 12 ? N ARG B 12 O GLU B 25  ? O GLU B 25  
D 3 4 N PHE B 26 ? N PHE B 26 O LEU B 117 ? O LEU B 117 
E 1 2 O THR C 39 ? O THR C 39 N LEU C 29  ? N LEU C 29  
E 2 3 O GLU C 25 ? O GLU C 25 N ARG C 12  ? N ARG C 12  
E 3 4 N CYS C 6  ? N CYS C 6  O GLY C 43  ? O GLY C 43  
F 1 2 N THR C 71 ? N THR C 71 O GLU C 97  ? O GLU C 97  
F 2 3 O TRP C 94 ? O TRP C 94 N ILE C 9   ? N ILE C 9   
F 3 4 N ARG C 12 ? N ARG C 12 O GLU C 25  ? O GLU C 25  
F 4 5 N PHE C 26 ? N PHE C 26 O LEU C 117 ? O LEU C 117 
G 1 2 N THR C 71 ? N THR C 71 O GLU C 97  ? O GLU C 97  
G 2 3 O LYS C 87 ? O LYS C 87 N ALA C 84  ? N ALA C 84  
H 1 2 O THR D 39 ? O THR D 39 N LEU D 29  ? N LEU D 29  
H 2 3 O GLU D 25 ? O GLU D 25 N ARG D 12  ? N ARG D 12  
H 3 4 N CYS D 6  ? N CYS D 6  O GLY D 43  ? O GLY D 43  
I 1 2 N THR D 71 ? N THR D 71 O GLU D 97  ? O GLU D 97  
I 2 3 O TRP D 94 ? O TRP D 94 N ILE D 9   ? N ILE D 9   
I 3 4 N ARG D 12 ? N ARG D 12 O GLU D 25  ? O GLU D 25  
I 4 5 N PHE D 26 ? N PHE D 26 O LEU D 117 ? O LEU D 117 
J 1 2 N THR D 71 ? N THR D 71 O GLU D 97  ? O GLU D 97  
J 2 3 O LYS D 87 ? O LYS D 87 N ALA D 84  ? N ALA D 84  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 156' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 157' 
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SO4 A 158' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL A 159' 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 B 156' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 B 157' 
AC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 B 158' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 159' 
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 C 156' 
BC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 C 157' 
BC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 C 158' 
BC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 C 159' 
BC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 C 160' 
BC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 D 156' 
BC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 D 157' 
BC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 D 158' 
BC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 D 159' 
BC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 D 160' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASN A 22  ? ASN A 22  . ? 1_555 ? 
2  AC1 5 ALA A 23  ? ALA A 23  . ? 1_555 ? 
3  AC1 5 ILE A 24  ? ILE A 24  . ? 1_555 ? 
4  AC1 5 HIS A 139 ? HIS A 139 . ? 1_555 ? 
5  AC1 5 HOH W .   ? HOH A 175 . ? 1_555 ? 
6  AC2 4 HIS A 37  ? HIS A 37  . ? 1_555 ? 
7  AC2 4 LYS A 42  ? LYS A 42  . ? 1_555 ? 
8  AC2 4 TYR A 82  ? TYR A 82  . ? 1_555 ? 
9  AC2 4 ALA A 84  ? ALA A 84  . ? 1_555 ? 
10 AC3 1 HIS A 109 ? HIS A 109 . ? 1_555 ? 
11 AC4 5 ARG A 12  ? ARG A 12  . ? 1_555 ? 
12 AC4 5 ARG A 13  ? ARG A 13  . ? 1_555 ? 
13 AC4 5 VAL A 98  ? VAL A 98  . ? 1_555 ? 
14 AC4 5 LYS A 99  ? LYS A 99  . ? 1_555 ? 
15 AC4 5 TYR A 101 ? TYR A 101 . ? 1_555 ? 
16 AC5 6 ASN B 22  ? ASN B 22  . ? 1_555 ? 
17 AC5 6 ALA B 23  ? ALA B 23  . ? 1_555 ? 
18 AC5 6 ILE B 24  ? ILE B 24  . ? 1_555 ? 
19 AC5 6 HIS B 139 ? HIS B 139 . ? 1_555 ? 
20 AC5 6 HOH X .   ? HOH B 174 . ? 1_555 ? 
21 AC5 6 HOH X .   ? HOH B 190 . ? 1_555 ? 
22 AC6 5 LEU B 70  ? LEU B 70  . ? 1_555 ? 
23 AC6 5 THR B 71  ? THR B 71  . ? 1_555 ? 
24 AC6 5 ILE B 72  ? ILE B 72  . ? 1_555 ? 
25 AC6 5 LEU C 70  ? LEU C 70  . ? 1_555 ? 
26 AC6 5 ILE C 72  ? ILE C 72  . ? 1_555 ? 
27 AC7 3 HIS B 44  ? HIS B 44  . ? 1_555 ? 
28 AC7 3 GLU B 58  ? GLU B 58  . ? 1_555 ? 
29 AC7 3 GLU B 110 ? GLU B 110 . ? 1_555 ? 
30 AC8 4 HIS B 37  ? HIS B 37  . ? 1_555 ? 
31 AC8 4 LYS B 42  ? LYS B 42  . ? 1_555 ? 
32 AC8 4 TYR B 82  ? TYR B 82  . ? 1_555 ? 
33 AC8 4 ALA B 84  ? ALA B 84  . ? 1_555 ? 
34 AC9 4 ARG A 12  ? ARG A 12  . ? 4_665 ? 
35 AC9 4 TYR C 114 ? TYR C 114 . ? 1_555 ? 
36 AC9 4 TRP C 116 ? TRP C 116 . ? 1_555 ? 
37 AC9 4 HOH Y .   ? HOH C 173 . ? 1_555 ? 
38 BC1 5 ASN C 22  ? ASN C 22  . ? 1_555 ? 
39 BC1 5 ALA C 23  ? ALA C 23  . ? 1_555 ? 
40 BC1 5 ILE C 24  ? ILE C 24  . ? 1_555 ? 
41 BC1 5 HIS C 139 ? HIS C 139 . ? 1_555 ? 
42 BC1 5 HOH Y .   ? HOH C 176 . ? 1_555 ? 
43 BC2 5 ASP C 100 ? ASP C 100 . ? 1_555 ? 
44 BC2 5 TYR C 101 ? TYR C 101 . ? 1_555 ? 
45 BC2 5 ASP C 102 ? ASP C 102 . ? 1_555 ? 
46 BC2 5 SO4 Q .   ? SO4 C 160 . ? 1_555 ? 
47 BC2 5 HOH Y .   ? HOH C 178 . ? 1_555 ? 
48 BC3 3 HIS C 37  ? HIS C 37  . ? 1_555 ? 
49 BC3 3 TYR C 82  ? TYR C 82  . ? 1_555 ? 
50 BC3 3 ALA C 84  ? ALA C 84  . ? 1_555 ? 
51 BC4 6 ARG C 12  ? ARG C 12  . ? 1_555 ? 
52 BC4 6 ARG C 13  ? ARG C 13  . ? 1_555 ? 
53 BC4 6 GLU C 97  ? GLU C 97  . ? 1_555 ? 
54 BC4 6 VAL C 98  ? VAL C 98  . ? 1_555 ? 
55 BC4 6 LYS C 99  ? LYS C 99  . ? 1_555 ? 
56 BC4 6 SO4 O .   ? SO4 C 158 . ? 1_555 ? 
57 BC5 6 ARG B 12  ? ARG B 12  . ? 1_455 ? 
58 BC5 6 TRP B 116 ? TRP B 116 . ? 1_455 ? 
59 BC5 6 TYR D 114 ? TYR D 114 . ? 1_555 ? 
60 BC5 6 TRP D 116 ? TRP D 116 . ? 1_555 ? 
61 BC5 6 HOH Z .   ? HOH D 177 . ? 1_555 ? 
62 BC5 6 HOH Z .   ? HOH D 182 . ? 1_555 ? 
63 BC6 4 ASN D 22  ? ASN D 22  . ? 1_555 ? 
64 BC6 4 ALA D 23  ? ALA D 23  . ? 1_555 ? 
65 BC6 4 ILE D 24  ? ILE D 24  . ? 1_555 ? 
66 BC6 4 HIS D 139 ? HIS D 139 . ? 1_555 ? 
67 BC7 6 LEU A 70  ? LEU A 70  . ? 4_555 ? 
68 BC7 6 THR A 71  ? THR A 71  . ? 4_555 ? 
69 BC7 6 ILE A 72  ? ILE A 72  . ? 4_555 ? 
70 BC7 6 LEU D 70  ? LEU D 70  . ? 1_555 ? 
71 BC7 6 THR D 71  ? THR D 71  . ? 1_555 ? 
72 BC7 6 ILE D 72  ? ILE D 72  . ? 1_555 ? 
73 BC8 4 ARG B 115 ? ARG B 115 . ? 1_455 ? 
74 BC8 4 ASP D 100 ? ASP D 100 . ? 1_555 ? 
75 BC8 4 TYR D 101 ? TYR D 101 . ? 1_555 ? 
76 BC8 4 ASP D 102 ? ASP D 102 . ? 1_555 ? 
77 BC9 3 LYS D 42  ? LYS D 42  . ? 1_555 ? 
78 BC9 3 TYR D 82  ? TYR D 82  . ? 1_555 ? 
79 BC9 3 ALA D 84  ? ALA D 84  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3U53 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3U53 
_atom_sites.fract_transf_matrix[1][1]   0.013796 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013796 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007491 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 4   ? 11.473  11.174  -23.794 1.00 52.10  ? 4   ARG A N   1 
ATOM   2    C CA  . ARG A 1 4   ? 10.334  10.354  -23.315 1.00 50.80  ? 4   ARG A CA  1 
ATOM   3    C C   . ARG A 1 4   ? 10.475  8.928   -23.823 1.00 49.73  ? 4   ARG A C   1 
ATOM   4    O O   . ARG A 1 4   ? 10.556  8.689   -25.027 1.00 50.91  ? 4   ARG A O   1 
ATOM   5    C CB  . ARG A 1 4   ? 9.004   10.950  -23.783 1.00 52.12  ? 4   ARG A CB  1 
ATOM   6    C CG  . ARG A 1 4   ? 7.743   10.199  -23.309 1.00 55.88  ? 4   ARG A CG  1 
ATOM   7    C CD  . ARG A 1 4   ? 6.533   10.654  -24.116 1.00 61.55  ? 4   ARG A CD  1 
ATOM   8    N NE  . ARG A 1 4   ? 5.251   10.519  -23.424 1.00 67.55  ? 4   ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 4   ? 5.034   10.815  -22.144 1.00 71.66  ? 4   ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 4   ? 6.013   11.272  -21.380 1.00 72.52  ? 4   ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 4   ? 3.824   10.666  -21.620 1.00 74.32  ? 4   ARG A NH2 1 
ATOM   12   N N   . ALA A 1 5   ? 10.487  7.986   -22.889 1.00 45.70  ? 5   ALA A N   1 
ATOM   13   C CA  . ALA A 1 5   ? 10.668  6.601   -23.200 1.00 42.57  ? 5   ALA A CA  1 
ATOM   14   C C   . ALA A 1 5   ? 9.569   5.793   -22.531 1.00 40.07  ? 5   ALA A C   1 
ATOM   15   O O   . ALA A 1 5   ? 9.052   6.184   -21.520 1.00 38.63  ? 5   ALA A O   1 
ATOM   16   C CB  . ALA A 1 5   ? 12.036  6.169   -22.729 1.00 42.78  ? 5   ALA A CB  1 
ATOM   17   N N   . CYS A 1 6   ? 9.223   4.650   -23.096 1.00 39.64  ? 6   CYS A N   1 
ATOM   18   C CA  . CYS A 1 6   ? 8.236   3.765   -22.497 1.00 38.29  ? 6   CYS A CA  1 
ATOM   19   C C   . CYS A 1 6   ? 8.733   2.343   -22.482 1.00 38.55  ? 6   CYS A C   1 
ATOM   20   O O   . CYS A 1 6   ? 9.547   1.950   -23.305 1.00 41.43  ? 6   CYS A O   1 
ATOM   21   C CB  . CYS A 1 6   ? 6.926   3.830   -23.249 1.00 39.73  ? 6   CYS A CB  1 
ATOM   22   S SG  . CYS A 1 6   ? 6.109   5.394   -23.144 1.00 38.32  ? 6   CYS A SG  1 
ATOM   23   N N   . GLY A 1 7   ? 8.250   1.551   -21.536 1.00 37.00  ? 7   GLY A N   1 
ATOM   24   C CA  . GLY A 1 7   ? 8.714   0.178   -21.451 1.00 35.10  ? 7   GLY A CA  1 
ATOM   25   C C   . GLY A 1 7   ? 7.785   -0.751  -20.722 1.00 34.08  ? 7   GLY A C   1 
ATOM   26   O O   . GLY A 1 7   ? 6.704   -0.382  -20.330 1.00 35.00  ? 7   GLY A O   1 
ATOM   27   N N   . LEU A 1 8   ? 8.222   -1.980  -20.526 1.00 32.13  ? 8   LEU A N   1 
ATOM   28   C CA  . LEU A 1 8   ? 7.432   -2.923  -19.775 1.00 30.46  ? 8   LEU A CA  1 
ATOM   29   C C   . LEU A 1 8   ? 8.257   -3.603  -18.725 1.00 28.42  ? 8   LEU A C   1 
ATOM   30   O O   . LEU A 1 8   ? 9.346   -4.120  -18.987 1.00 26.97  ? 8   LEU A O   1 
ATOM   31   C CB  . LEU A 1 8   ? 6.764   -3.972  -20.676 1.00 31.08  ? 8   LEU A CB  1 
ATOM   32   C CG  . LEU A 1 8   ? 5.762   -3.423  -21.679 1.00 34.44  ? 8   LEU A CG  1 
ATOM   33   C CD1 . LEU A 1 8   ? 5.359   -4.545  -22.607 1.00 37.82  ? 8   LEU A CD1 1 
ATOM   34   C CD2 . LEU A 1 8   ? 4.554   -2.767  -21.034 1.00 30.43  ? 8   LEU A CD2 1 
ATOM   35   N N   . ILE A 1 9   ? 7.702   -3.619  -17.521 1.00 27.49  ? 9   ILE A N   1 
ATOM   36   C CA  . ILE A 1 9   ? 8.269   -4.415  -16.477 1.00 26.78  ? 9   ILE A CA  1 
ATOM   37   C C   . ILE A 1 9   ? 7.783   -5.814  -16.773 1.00 27.98  ? 9   ILE A C   1 
ATOM   38   O O   . ILE A 1 9   ? 6.625   -6.145  -16.546 1.00 28.75  ? 9   ILE A O   1 
ATOM   39   C CB  . ILE A 1 9   ? 7.794   -3.959  -15.136 1.00 27.76  ? 9   ILE A CB  1 
ATOM   40   C CG1 . ILE A 1 9   ? 8.284   -2.542  -14.869 1.00 28.71  ? 9   ILE A CG1 1 
ATOM   41   C CG2 . ILE A 1 9   ? 8.335   -4.830  -14.030 1.00 25.61  ? 9   ILE A CG2 1 
ATOM   42   C CD1 . ILE A 1 9   ? 7.673   -1.931  -13.623 1.00 28.68  ? 9   ILE A CD1 1 
ATOM   43   N N   . ILE A 1 10  ? 8.670   -6.615  -17.359 1.00 27.66  ? 10  ILE A N   1 
ATOM   44   C CA  . ILE A 1 10  ? 8.329   -7.964  -17.721 1.00 27.64  ? 10  ILE A CA  1 
ATOM   45   C C   . ILE A 1 10  ? 8.507   -8.845  -16.491 1.00 28.38  ? 10  ILE A C   1 
ATOM   46   O O   . ILE A 1 10  ? 9.443   -8.675  -15.730 1.00 28.25  ? 10  ILE A O   1 
ATOM   47   C CB  . ILE A 1 10  ? 9.215   -8.413  -18.870 1.00 27.63  ? 10  ILE A CB  1 
ATOM   48   C CG1 . ILE A 1 10  ? 8.887   -7.596  -20.108 1.00 29.75  ? 10  ILE A CG1 1 
ATOM   49   C CG2 . ILE A 1 10  ? 8.973   -9.823  -19.219 1.00 28.21  ? 10  ILE A CG2 1 
ATOM   50   C CD1 . ILE A 1 10  ? 7.654   -8.057  -20.851 1.00 30.99  ? 10  ILE A CD1 1 
ATOM   51   N N   . PHE A 1 11  ? 7.586   -9.762  -16.283 1.00 29.89  ? 11  PHE A N   1 
ATOM   52   C CA  . PHE A 1 11  ? 7.710   -10.689 -15.211 1.00 32.83  ? 11  PHE A CA  1 
ATOM   53   C C   . PHE A 1 11  ? 7.169   -12.040 -15.627 1.00 35.52  ? 11  PHE A C   1 
ATOM   54   O O   . PHE A 1 11  ? 6.380   -12.157 -16.572 1.00 37.25  ? 11  PHE A O   1 
ATOM   55   C CB  . PHE A 1 11  ? 6.961   -10.185 -13.994 1.00 33.78  ? 11  PHE A CB  1 
ATOM   56   C CG  . PHE A 1 11  ? 5.473   -10.315 -14.099 1.00 37.65  ? 11  PHE A CG  1 
ATOM   57   C CD1 . PHE A 1 11  ? 4.840   -11.497 -13.746 1.00 37.54  ? 11  PHE A CD1 1 
ATOM   58   C CD2 . PHE A 1 11  ? 4.701   -9.242  -14.522 1.00 39.43  ? 11  PHE A CD2 1 
ATOM   59   C CE1 . PHE A 1 11  ? 3.485   -11.606 -13.817 1.00 42.36  ? 11  PHE A CE1 1 
ATOM   60   C CE2 . PHE A 1 11  ? 3.334   -9.362  -14.598 1.00 43.84  ? 11  PHE A CE2 1 
ATOM   61   C CZ  . PHE A 1 11  ? 2.728   -10.538 -14.244 1.00 45.15  ? 11  PHE A CZ  1 
ATOM   62   N N   . ARG A 1 12  ? 7.597   -13.072 -14.917 1.00 36.79  ? 12  ARG A N   1 
ATOM   63   C CA  . ARG A 1 12  ? 7.058   -14.385 -15.157 1.00 39.26  ? 12  ARG A CA  1 
ATOM   64   C C   . ARG A 1 12  ? 6.640   -15.030 -13.865 1.00 41.28  ? 12  ARG A C   1 
ATOM   65   O O   . ARG A 1 12  ? 7.065   -14.629 -12.777 1.00 40.80  ? 12  ARG A O   1 
ATOM   66   C CB  . ARG A 1 12  ? 8.051   -15.261 -15.896 1.00 38.57  ? 12  ARG A CB  1 
ATOM   67   C CG  . ARG A 1 12  ? 9.152   -15.792 -15.044 1.00 38.27  ? 12  ARG A CG  1 
ATOM   68   C CD  . ARG A 1 12  ? 10.093  -16.558 -15.865 1.00 37.09  ? 12  ARG A CD  1 
ATOM   69   N NE  . ARG A 1 12  ? 11.306  -16.805 -15.126 1.00 37.12  ? 12  ARG A NE  1 
ATOM   70   C CZ  . ARG A 1 12  ? 12.329  -17.523 -15.577 1.00 37.05  ? 12  ARG A CZ  1 
ATOM   71   N NH1 . ARG A 1 12  ? 12.311  -18.070 -16.769 1.00 33.68  ? 12  ARG A NH1 1 
ATOM   72   N NH2 . ARG A 1 12  ? 13.374  -17.705 -14.818 1.00 39.37  ? 12  ARG A NH2 1 
ATOM   73   N N   . ARG A 1 13  ? 5.788   -16.029 -13.998 1.00 44.51  ? 13  ARG A N   1 
ATOM   74   C CA  . ARG A 1 13  ? 5.244   -16.678 -12.844 1.00 48.43  ? 13  ARG A CA  1 
ATOM   75   C C   . ARG A 1 13  ? 5.907   -18.023 -12.670 1.00 49.15  ? 13  ARG A C   1 
ATOM   76   O O   . ARG A 1 13  ? 6.037   -18.798 -13.609 1.00 48.79  ? 13  ARG A O   1 
ATOM   77   C CB  . ARG A 1 13  ? 3.758   -16.856 -13.023 1.00 51.83  ? 13  ARG A CB  1 
ATOM   78   C CG  . ARG A 1 13  ? 2.964   -15.622 -12.877 1.00 54.31  ? 13  ARG A CG  1 
ATOM   79   C CD  . ARG A 1 13  ? 1.505   -15.969 -12.797 1.00 62.18  ? 13  ARG A CD  1 
ATOM   80   N NE  . ARG A 1 13  ? 0.692   -14.764 -12.703 1.00 70.75  ? 13  ARG A NE  1 
ATOM   81   C CZ  . ARG A 1 13  ? 0.473   -14.083 -11.579 1.00 73.40  ? 13  ARG A CZ  1 
ATOM   82   N NH1 . ARG A 1 13  ? 0.999   -14.496 -10.429 1.00 74.10  ? 13  ARG A NH1 1 
ATOM   83   N NH2 . ARG A 1 13  ? -0.273  -12.987 -11.609 1.00 76.07  ? 13  ARG A NH2 1 
ATOM   84   N N   . CYS A 1 14  ? 6.353   -18.286 -11.456 1.00 51.80  ? 14  CYS A N   1 
ATOM   85   C CA  . CYS A 1 14  ? 7.047   -19.515 -11.140 1.00 53.54  ? 14  CYS A CA  1 
ATOM   86   C C   . CYS A 1 14  ? 6.182   -20.356 -10.229 1.00 57.19  ? 14  CYS A C   1 
ATOM   87   O O   . CYS A 1 14  ? 6.038   -20.049 -9.065  1.00 60.31  ? 14  CYS A O   1 
ATOM   88   C CB  . CYS A 1 14  ? 8.360   -19.183 -10.463 1.00 52.84  ? 14  CYS A CB  1 
ATOM   89   S SG  . CYS A 1 14  ? 9.416   -18.136 -11.410 1.00 50.76  ? 14  CYS A SG  1 
ATOM   90   N N   . LEU A 1 15  ? 5.628   -21.378 -10.656 1.00 60.83  ? 15  LEU A N   1 
ATOM   91   C CA  . LEU A 1 15  ? 4.568   -22.117 -9.975  1.00 66.81  ? 15  LEU A CA  1 
ATOM   92   C C   . LEU A 1 15  ? 4.971   -23.525 -9.535  1.00 72.53  ? 15  LEU A C   1 
ATOM   93   O O   . LEU A 1 15  ? 5.011   -24.460 -10.327 1.00 73.61  ? 15  LEU A O   1 
ATOM   94   C CB  . LEU A 1 15  ? 3.331   -22.154 -10.869 1.00 67.47  ? 15  LEU A CB  1 
ATOM   95   C CG  . LEU A 1 15  ? 2.820   -20.783 -11.344 1.00 67.92  ? 15  LEU A CG  1 
ATOM   96   C CD1 . LEU A 1 15  ? 1.990   -20.915 -12.596 1.00 69.32  ? 15  LEU A CD1 1 
ATOM   97   C CD2 . LEU A 1 15  ? 2.047   -20.016 -10.272 1.00 68.76  ? 15  LEU A CD2 1 
ATOM   98   N N   . ILE A 1 16  ? 5.242   -23.676 -8.248  1.00 79.73  ? 16  ILE A N   1 
ATOM   99   C CA  . ILE A 1 16  ? 5.881   -24.880 -7.773  1.00 83.91  ? 16  ILE A CA  1 
ATOM   100  C C   . ILE A 1 16  ? 5.799   -25.086 -6.245  1.00 92.96  ? 16  ILE A C   1 
ATOM   101  O O   . ILE A 1 16  ? 5.583   -24.145 -5.479  1.00 90.93  ? 16  ILE A O   1 
ATOM   102  C CB  . ILE A 1 16  ? 7.353   -24.819 -8.168  1.00 79.51  ? 16  ILE A CB  1 
ATOM   103  C CG1 . ILE A 1 16  ? 7.844   -26.165 -8.752  1.00 74.12  ? 16  ILE A CG1 1 
ATOM   104  C CG2 . ILE A 1 16  ? 8.151   -24.265 -6.992  1.00 79.08  ? 16  ILE A CG2 1 
ATOM   105  C CD1 . ILE A 1 16  ? 7.977   -26.194 -10.281 1.00 64.17  ? 16  ILE A CD1 1 
ATOM   106  N N   . PRO A 1 17  ? 5.976   -26.330 -5.810  1.00 125.80 ? 17  PRO A N   1 
ATOM   107  C CA  . PRO A 1 17  ? 5.883   -26.659 -4.382  1.00 134.93 ? 17  PRO A CA  1 
ATOM   108  C C   . PRO A 1 17  ? 7.177   -26.423 -3.602  1.00 137.89 ? 17  PRO A C   1 
ATOM   109  O O   . PRO A 1 17  ? 7.818   -27.375 -3.156  1.00 139.13 ? 17  PRO A O   1 
ATOM   110  C CB  . PRO A 1 17  ? 5.546   -28.152 -4.394  0.61 139.18 ? 17  PRO A CB  1 
ATOM   111  C CG  . PRO A 1 17  ? 4.831   -28.360 -5.682  1.00 136.56 ? 17  PRO A CG  1 
ATOM   112  C CD  . PRO A 1 17  ? 5.472   -27.420 -6.664  0.22 128.29 ? 17  PRO A CD  1 
ATOM   113  N N   . LYS A 1 18  ? 7.546   -25.157 -3.434  1.00 138.14 ? 18  LYS A N   1 
ATOM   114  C CA  . LYS A 1 18  ? 8.727   -24.796 -2.656  1.00 137.67 ? 18  LYS A CA  1 
ATOM   115  C C   . LYS A 1 18  ? 10.010  -24.849 -3.480  1.00 132.27 ? 18  LYS A C   1 
ATOM   116  O O   . LYS A 1 18  ? 11.083  -24.484 -2.998  1.00 133.74 ? 18  LYS A O   1 
ATOM   117  C CB  . LYS A 1 18  ? 8.887   -25.738 -1.460  1.00 144.51 ? 18  LYS A CB  1 
ATOM   118  N N   . VAL A 1 19  ? 9.895   -25.306 -4.722  1.00 123.33 ? 19  VAL A N   1 
ATOM   119  C CA  . VAL A 1 19  ? 11.040  -25.378 -5.621  1.00 112.50 ? 19  VAL A CA  1 
ATOM   120  C C   . VAL A 1 19  ? 11.521  -23.973 -5.954  1.00 101.34 ? 19  VAL A C   1 
ATOM   121  O O   . VAL A 1 19  ? 12.720  -23.706 -6.043  1.00 96.32  ? 19  VAL A O   1 
ATOM   122  C CB  . VAL A 1 19  ? 10.691  -26.118 -6.924  1.00 113.20 ? 19  VAL A CB  1 
ATOM   123  C CG1 . VAL A 1 19  ? 11.863  -26.071 -7.891  1.00 114.23 ? 19  VAL A CG1 1 
ATOM   124  C CG2 . VAL A 1 19  ? 10.292  -27.556 -6.627  1.00 115.18 ? 19  VAL A CG2 1 
ATOM   125  N N   . ASP A 1 20  ? 10.553  -23.086 -6.145  1.00 94.83  ? 20  ASP A N   1 
ATOM   126  C CA  . ASP A 1 20  ? 10.789  -21.710 -6.527  1.00 88.70  ? 20  ASP A CA  1 
ATOM   127  C C   . ASP A 1 20  ? 10.703  -20.823 -5.311  1.00 90.16  ? 20  ASP A C   1 
ATOM   128  O O   . ASP A 1 20  ? 9.662   -20.717 -4.683  1.00 94.09  ? 20  ASP A O   1 
ATOM   129  C CB  . ASP A 1 20  ? 9.814   -21.238 -7.599  1.00 85.36  ? 20  ASP A CB  1 
ATOM   130  C CG  . ASP A 1 20  ? 9.859   -22.070 -8.837  1.00 83.26  ? 20  ASP A CG  1 
ATOM   131  O OD1 . ASP A 1 20  ? 10.938  -22.221 -9.427  1.00 79.13  ? 20  ASP A OD1 1 
ATOM   132  O OD2 . ASP A 1 20  ? 8.802   -22.553 -9.243  1.00 84.05  ? 20  ASP A OD2 1 
ATOM   133  N N   . ASN A 1 21  ? 11.828  -20.185 -4.998  1.00 87.55  ? 21  ASN A N   1 
ATOM   134  C CA  . ASN A 1 21  ? 11.898  -19.212 -3.922  1.00 89.73  ? 21  ASN A CA  1 
ATOM   135  C C   . ASN A 1 21  ? 10.797  -18.184 -4.099  1.00 85.38  ? 21  ASN A C   1 
ATOM   136  O O   . ASN A 1 21  ? 10.075  -17.868 -3.154  1.00 89.01  ? 21  ASN A O   1 
ATOM   137  C CB  . ASN A 1 21  ? 13.265  -18.528 -3.901  1.00 94.49  ? 21  ASN A CB  1 
ATOM   138  C CG  . ASN A 1 21  ? 13.807  -18.351 -2.497  1.00 109.16 ? 21  ASN A CG  1 
ATOM   139  O OD1 . ASN A 1 21  ? 13.380  -17.461 -1.761  1.00 119.70 ? 21  ASN A OD1 1 
ATOM   140  N ND2 . ASN A 1 21  ? 14.754  -19.201 -2.116  1.00 118.59 ? 21  ASN A ND2 1 
ATOM   141  N N   . ASN A 1 22  ? 10.658  -17.669 -5.318  1.00 78.71  ? 22  ASN A N   1 
ATOM   142  C CA  . ASN A 1 22  ? 9.527   -16.767 -5.610  1.00 70.27  ? 22  ASN A CA  1 
ATOM   143  C C   . ASN A 1 22  ? 8.523   -17.224 -6.698  1.00 66.28  ? 22  ASN A C   1 
ATOM   144  O O   . ASN A 1 22  ? 8.863   -18.024 -7.570  1.00 65.29  ? 22  ASN A O   1 
ATOM   145  C CB  . ASN A 1 22  ? 10.041  -15.362 -5.939  1.00 68.06  ? 22  ASN A CB  1 
ATOM   146  C CG  . ASN A 1 22  ? 11.522  -15.203 -5.655  1.00 68.50  ? 22  ASN A CG  1 
ATOM   147  O OD1 . ASN A 1 22  ? 12.315  -16.110 -5.907  1.00 70.96  ? 22  ASN A OD1 1 
ATOM   148  N ND2 . ASN A 1 22  ? 11.902  -14.046 -5.127  1.00 71.16  ? 22  ASN A ND2 1 
ATOM   149  N N   . ALA A 1 23  ? 7.295   -16.697 -6.632  1.00 63.68  ? 23  ALA A N   1 
ATOM   150  C CA  . ALA A 1 23  ? 6.251   -16.931 -7.625  1.00 60.13  ? 23  ALA A CA  1 
ATOM   151  C C   . ALA A 1 23  ? 6.311   -15.911 -8.779  1.00 55.40  ? 23  ALA A C   1 
ATOM   152  O O   . ALA A 1 23  ? 5.752   -16.126 -9.853  1.00 55.05  ? 23  ALA A O   1 
ATOM   153  C CB  . ALA A 1 23  ? 4.890   -16.928 -6.978  1.00 62.09  ? 23  ALA A CB  1 
ATOM   154  N N   . ILE A 1 24  ? 6.999   -14.804 -8.545  1.00 51.41  ? 24  ILE A N   1 
ATOM   155  C CA  . ILE A 1 24  ? 7.142   -13.783 -9.558  1.00 47.65  ? 24  ILE A CA  1 
ATOM   156  C C   . ILE A 1 24  ? 8.602   -13.448 -9.805  1.00 45.10  ? 24  ILE A C   1 
ATOM   157  O O   . ILE A 1 24  ? 9.341   -13.198 -8.866  1.00 45.91  ? 24  ILE A O   1 
ATOM   158  C CB  . ILE A 1 24  ? 6.303   -12.494 -9.198  1.00 51.19  ? 24  ILE A CB  1 
ATOM   159  C CG1 . ILE A 1 24  ? 4.815   -12.722 -9.508  1.00 47.92  ? 24  ILE A CG1 1 
ATOM   160  C CG2 . ILE A 1 24  ? 6.851   -11.242 -9.918  1.00 45.08  ? 24  ILE A CG2 1 
ATOM   161  C CD1 . ILE A 1 24  ? 3.897   -11.985 -8.629  1.00 47.82  ? 24  ILE A CD1 1 
ATOM   162  N N   . GLU A 1 25  ? 9.007   -13.445 -11.068 1.00 41.40  ? 25  GLU A N   1 
ATOM   163  C CA  . GLU A 1 25  ? 10.362  -13.040 -11.428 1.00 39.59  ? 25  GLU A CA  1 
ATOM   164  C C   . GLU A 1 25  ? 10.352  -11.965 -12.509 1.00 37.52  ? 25  GLU A C   1 
ATOM   165  O O   . GLU A 1 25  ? 9.590   -12.047 -13.470 1.00 36.48  ? 25  GLU A O   1 
ATOM   166  C CB  . GLU A 1 25  ? 11.203  -14.231 -11.886 1.00 38.94  ? 25  GLU A CB  1 
ATOM   167  C CG  . GLU A 1 25  ? 11.645  -15.187 -10.787 1.00 43.29  ? 25  GLU A CG  1 
ATOM   168  C CD  . GLU A 1 25  ? 12.289  -16.456 -11.333 1.00 48.10  ? 25  GLU A CD  1 
ATOM   169  O OE1 . GLU A 1 25  ? 12.898  -17.209 -10.562 1.00 52.95  ? 25  GLU A OE1 1 
ATOM   170  O OE2 . GLU A 1 25  ? 12.213  -16.715 -12.543 1.00 48.86  ? 25  GLU A OE2 1 
ATOM   171  N N   . PHE A 1 26  ? 11.223  -10.975 -12.351 1.00 36.41  ? 26  PHE A N   1 
ATOM   172  C CA  . PHE A 1 26  ? 11.313  -9.855  -13.258 1.00 35.62  ? 26  PHE A CA  1 
ATOM   173  C C   . PHE A 1 26  ? 12.456  -9.981  -14.236 1.00 35.16  ? 26  PHE A C   1 
ATOM   174  O O   . PHE A 1 26  ? 13.480  -10.530 -13.899 1.00 36.30  ? 26  PHE A O   1 
ATOM   175  C CB  . PHE A 1 26  ? 11.494  -8.585  -12.456 1.00 36.82  ? 26  PHE A CB  1 
ATOM   176  C CG  . PHE A 1 26  ? 10.387  -8.336  -11.508 1.00 38.61  ? 26  PHE A CG  1 
ATOM   177  C CD1 . PHE A 1 26  ? 9.181   -7.851  -11.952 1.00 39.13  ? 26  PHE A CD1 1 
ATOM   178  C CD2 . PHE A 1 26  ? 10.535  -8.633  -10.178 1.00 41.37  ? 26  PHE A CD2 1 
ATOM   179  C CE1 . PHE A 1 26  ? 8.159   -7.661  -11.085 1.00 40.34  ? 26  PHE A CE1 1 
ATOM   180  C CE2 . PHE A 1 26  ? 9.509   -8.457  -9.312  1.00 42.58  ? 26  PHE A CE2 1 
ATOM   181  C CZ  . PHE A 1 26  ? 8.323   -7.963  -9.762  1.00 42.71  ? 26  PHE A CZ  1 
ATOM   182  N N   . LEU A 1 27  ? 12.293  -9.451  -15.444 1.00 34.16  ? 27  LEU A N   1 
ATOM   183  C CA  . LEU A 1 27  ? 13.378  -9.418  -16.411 1.00 33.21  ? 27  LEU A CA  1 
ATOM   184  C C   . LEU A 1 27  ? 14.145  -8.105  -16.376 1.00 34.27  ? 27  LEU A C   1 
ATOM   185  O O   . LEU A 1 27  ? 13.566  -7.047  -16.565 1.00 34.97  ? 27  LEU A O   1 
ATOM   186  C CB  . LEU A 1 27  ? 12.818  -9.608  -17.808 1.00 32.38  ? 27  LEU A CB  1 
ATOM   187  C CG  . LEU A 1 27  ? 13.806  -9.725  -18.961 1.00 30.90  ? 27  LEU A CG  1 
ATOM   188  C CD1 . LEU A 1 27  ? 14.633  -10.982 -18.814 1.00 29.39  ? 27  LEU A CD1 1 
ATOM   189  C CD2 . LEU A 1 27  ? 13.054  -9.754  -20.240 1.00 28.50  ? 27  LEU A CD2 1 
ATOM   190  N N   . LEU A 1 28  ? 15.448  -8.174  -16.152 1.00 34.61  ? 28  LEU A N   1 
ATOM   191  C CA  . LEU A 1 28  ? 16.289  -6.993  -16.300 1.00 36.61  ? 28  LEU A CA  1 
ATOM   192  C C   . LEU A 1 28  ? 17.280  -7.246  -17.382 1.00 38.40  ? 28  LEU A C   1 
ATOM   193  O O   . LEU A 1 28  ? 17.770  -8.345  -17.519 1.00 38.68  ? 28  LEU A O   1 
ATOM   194  C CB  . LEU A 1 28  ? 17.036  -6.650  -15.030 1.00 36.25  ? 28  LEU A CB  1 
ATOM   195  C CG  . LEU A 1 28  ? 16.167  -6.291  -13.838 1.00 35.93  ? 28  LEU A CG  1 
ATOM   196  C CD1 . LEU A 1 28  ? 17.038  -5.966  -12.687 1.00 38.12  ? 28  LEU A CD1 1 
ATOM   197  C CD2 . LEU A 1 28  ? 15.298  -5.126  -14.129 1.00 35.97  ? 28  LEU A CD2 1 
ATOM   198  N N   . LEU A 1 29  ? 17.573  -6.214  -18.150 1.00 41.31  ? 29  LEU A N   1 
ATOM   199  C CA  . LEU A 1 29  ? 18.515  -6.312  -19.241 1.00 43.89  ? 29  LEU A CA  1 
ATOM   200  C C   . LEU A 1 29  ? 19.748  -5.494  -18.898 1.00 47.87  ? 29  LEU A C   1 
ATOM   201  O O   . LEU A 1 29  ? 19.631  -4.426  -18.341 1.00 48.60  ? 29  LEU A O   1 
ATOM   202  C CB  . LEU A 1 29  ? 17.855  -5.795  -20.518 1.00 43.45  ? 29  LEU A CB  1 
ATOM   203  C CG  . LEU A 1 29  ? 16.494  -6.396  -20.915 1.00 40.95  ? 29  LEU A CG  1 
ATOM   204  C CD1 . LEU A 1 29  ? 16.076  -5.882  -22.258 1.00 39.90  ? 29  LEU A CD1 1 
ATOM   205  C CD2 . LEU A 1 29  ? 16.505  -7.913  -20.934 1.00 37.49  ? 29  LEU A CD2 1 
ATOM   206  N N   . GLN A 1 30  ? 20.929  -6.016  -19.189 1.00 51.89  ? 30  GLN A N   1 
ATOM   207  C CA  . GLN A 1 30  ? 22.165  -5.298  -18.908 1.00 57.94  ? 30  GLN A CA  1 
ATOM   208  C C   . GLN A 1 30  ? 22.555  -4.434  -20.086 1.00 62.09  ? 30  GLN A C   1 
ATOM   209  O O   . GLN A 1 30  ? 22.631  -4.924  -21.197 1.00 62.22  ? 30  GLN A O   1 
ATOM   210  C CB  . GLN A 1 30  ? 23.289  -6.286  -18.610 1.00 58.07  ? 30  GLN A CB  1 
ATOM   211  C CG  . GLN A 1 30  ? 24.621  -5.640  -18.256 1.00 61.32  ? 30  GLN A CG  1 
ATOM   212  C CD  . GLN A 1 30  ? 25.636  -6.618  -17.729 1.00 61.51  ? 30  GLN A CD  1 
ATOM   213  O OE1 . GLN A 1 30  ? 25.774  -7.720  -18.230 1.00 60.87  ? 30  GLN A OE1 1 
ATOM   214  N NE2 . GLN A 1 30  ? 26.363  -6.204  -16.719 1.00 63.99  ? 30  GLN A NE2 1 
ATOM   215  N N   . ALA A 1 31  ? 22.816  -3.156  -19.850 1.00 67.79  ? 31  ALA A N   1 
ATOM   216  C CA  . ALA A 1 31  ? 23.323  -2.300  -20.909 1.00 74.01  ? 31  ALA A CA  1 
ATOM   217  C C   . ALA A 1 31  ? 24.732  -2.710  -21.372 1.00 81.46  ? 31  ALA A C   1 
ATOM   218  O O   . ALA A 1 31  ? 25.604  -3.047  -20.570 1.00 83.22  ? 31  ALA A O   1 
ATOM   219  C CB  . ALA A 1 31  ? 23.309  -0.874  -20.470 1.00 75.21  ? 31  ALA A CB  1 
ATOM   220  N N   . SER A 1 32  ? 24.948  -2.698  -22.681 1.00 88.80  ? 32  SER A N   1 
ATOM   221  C CA  . SER A 1 32  ? 26.278  -2.939  -23.227 1.00 94.50  ? 32  SER A CA  1 
ATOM   222  C C   . SER A 1 32  ? 27.182  -1.725  -23.054 1.00 102.08 ? 32  SER A C   1 
ATOM   223  O O   . SER A 1 32  ? 28.331  -1.851  -22.636 1.00 104.77 ? 32  SER A O   1 
ATOM   224  C CB  . SER A 1 32  ? 26.182  -3.305  -24.696 1.00 91.85  ? 32  SER A CB  1 
ATOM   225  O OG  . SER A 1 32  ? 25.863  -4.671  -24.823 1.00 89.36  ? 32  SER A OG  1 
ATOM   226  N N   . ASP A 1 33  ? 26.650  -0.555  -23.397 1.00 107.35 ? 33  ASP A N   1 
ATOM   227  C CA  . ASP A 1 33  ? 27.372  0.699   -23.243 1.00 114.87 ? 33  ASP A CA  1 
ATOM   228  C C   . ASP A 1 33  ? 27.233  1.185   -21.808 1.00 117.91 ? 33  ASP A C   1 
ATOM   229  O O   . ASP A 1 33  ? 26.127  1.453   -21.337 1.00 115.47 ? 33  ASP A O   1 
ATOM   230  C CB  . ASP A 1 33  ? 26.835  1.753   -24.213 1.00 39.82  ? 33  ASP A CB  1 
ATOM   231  N N   . GLY A 1 34  ? 28.359  1.289   -21.114 1.00 130.28 ? 34  GLY A N   1 
ATOM   232  C CA  . GLY A 1 34  ? 28.354  1.639   -19.708 1.00 133.42 ? 34  GLY A CA  1 
ATOM   233  C C   . GLY A 1 34  ? 28.577  0.394   -18.876 1.00 131.89 ? 34  GLY A C   1 
ATOM   234  O O   . GLY A 1 34  ? 29.138  0.456   -17.781 1.00 135.17 ? 34  GLY A O   1 
ATOM   235  N N   . ILE A 1 35  ? 28.139  -0.745  -19.404 1.00 134.65 ? 35  ILE A N   1 
ATOM   236  C CA  . ILE A 1 35  ? 28.360  -2.052  -18.725 1.00 129.35 ? 35  ILE A CA  1 
ATOM   237  C C   . ILE A 1 35  ? 27.802  -2.176  -17.285 1.00 122.51 ? 35  ILE A C   1 
ATOM   238  O O   . ILE A 1 35  ? 28.123  -3.128  -16.567 1.00 120.48 ? 35  ILE A O   1 
ATOM   239  C CB  . ILE A 1 35  ? 29.853  -2.565  -18.840 1.00 133.98 ? 35  ILE A CB  1 
ATOM   240  C CG1 . ILE A 1 35  ? 29.907  -4.098  -18.747 1.00 129.46 ? 35  ILE A CG1 1 
ATOM   241  C CG2 . ILE A 1 35  ? 30.790  -1.893  -17.813 1.00 140.72 ? 35  ILE A CG2 1 
ATOM   242  C CD1 . ILE A 1 35  ? 31.306  -4.669  -18.471 1.00 135.53 ? 35  ILE A CD1 1 
ATOM   243  N N   . HIS A 1 36  ? 26.954  -1.236  -16.871 1.00 119.13 ? 36  HIS A N   1 
ATOM   244  C CA  . HIS A 1 36  ? 26.527  -1.188  -15.463 1.00 113.48 ? 36  HIS A CA  1 
ATOM   245  C C   . HIS A 1 36  ? 25.016  -1.030  -15.231 1.00 103.20 ? 36  HIS A C   1 
ATOM   246  O O   . HIS A 1 36  ? 24.555  -1.081  -14.073 1.00 102.03 ? 36  HIS A O   1 
ATOM   247  C CB  . HIS A 1 36  ? 27.334  -0.122  -14.679 1.00 123.53 ? 36  HIS A CB  1 
ATOM   248  C CG  . HIS A 1 36  ? 26.992  -0.041  -13.217 0.01 125.16 ? 36  HIS A CG  1 
ATOM   249  N ND1 . HIS A 1 36  ? 27.175  -1.097  -12.343 0.01 122.38 ? 36  HIS A ND1 1 
ATOM   250  C CD2 . HIS A 1 36  ? 26.466  0.974   -12.481 0.01 131.09 ? 36  HIS A CD2 1 
ATOM   251  C CE1 . HIS A 1 36  ? 26.789  -0.736  -11.130 0.01 125.22 ? 36  HIS A CE1 1 
ATOM   252  N NE2 . HIS A 1 36  ? 26.353  0.516   -11.188 0.01 131.90 ? 36  HIS A NE2 1 
ATOM   253  N N   . HIS A 1 37  ? 24.271  -0.785  -16.303 1.00 94.11  ? 37  HIS A N   1 
ATOM   254  C CA  . HIS A 1 37  ? 22.857  -0.456  -16.187 1.00 82.52  ? 37  HIS A CA  1 
ATOM   255  C C   . HIS A 1 37  ? 21.954  -1.658  -16.415 1.00 71.36  ? 37  HIS A C   1 
ATOM   256  O O   . HIS A 1 37  ? 22.075  -2.360  -17.419 1.00 69.94  ? 37  HIS A O   1 
ATOM   257  C CB  . HIS A 1 37  ? 22.489  0.666   -17.161 1.00 53.68  ? 37  HIS A CB  1 
ATOM   258  C CG  . HIS A 1 37  ? 21.379  1.546   -16.678 1.00 53.10  ? 37  HIS A CG  1 
ATOM   259  N ND1 . HIS A 1 37  ? 21.432  2.921   -16.754 1.00 57.08  ? 37  HIS A ND1 1 
ATOM   260  C CD2 . HIS A 1 37  ? 20.185  1.247   -16.112 0.01 49.74  ? 37  HIS A CD2 1 
ATOM   261  C CE1 . HIS A 1 37  ? 20.320  3.431   -16.256 0.01 56.00  ? 37  HIS A CE1 1 
ATOM   262  N NE2 . HIS A 1 37  ? 19.547  2.436   -15.859 0.01 51.68  ? 37  HIS A NE2 1 
ATOM   263  N N   . TRP A 1 38  ? 21.042  -1.884  -15.476 1.00 70.19  ? 38  TRP A N   1 
ATOM   264  C CA  . TRP A 1 38  ? 20.063  -2.957  -15.610 1.00 60.73  ? 38  TRP A CA  1 
ATOM   265  C C   . TRP A 1 38  ? 18.636  -2.419  -15.544 1.00 56.85  ? 38  TRP A C   1 
ATOM   266  O O   . TRP A 1 38  ? 18.207  -1.888  -14.520 1.00 58.27  ? 38  TRP A O   1 
ATOM   267  C CB  . TRP A 1 38  ? 20.276  -4.014  -14.525 1.00 58.90  ? 38  TRP A CB  1 
ATOM   268  C CG  . TRP A 1 38  ? 21.573  -4.754  -14.653 1.00 57.12  ? 38  TRP A CG  1 
ATOM   269  C CD1 . TRP A 1 38  ? 22.817  -4.287  -14.344 1.00 59.34  ? 38  TRP A CD1 1 
ATOM   270  C CD2 . TRP A 1 38  ? 21.753  -6.094  -15.127 1.00 52.97  ? 38  TRP A CD2 1 
ATOM   271  N NE1 . TRP A 1 38  ? 23.761  -5.253  -14.594 1.00 57.71  ? 38  TRP A NE1 1 
ATOM   272  C CE2 . TRP A 1 38  ? 23.134  -6.372  -15.076 1.00 55.05  ? 38  TRP A CE2 1 
ATOM   273  C CE3 . TRP A 1 38  ? 20.882  -7.086  -15.588 1.00 49.16  ? 38  TRP A CE3 1 
ATOM   274  C CZ2 . TRP A 1 38  ? 23.663  -7.600  -15.469 1.00 53.08  ? 38  TRP A CZ2 1 
ATOM   275  C CZ3 . TRP A 1 38  ? 21.410  -8.304  -15.978 1.00 50.37  ? 38  TRP A CZ3 1 
ATOM   276  C CH2 . TRP A 1 38  ? 22.787  -8.550  -15.916 1.00 51.06  ? 38  TRP A CH2 1 
ATOM   277  N N   . THR A 1 39  ? 17.908  -2.564  -16.646 1.00 50.17  ? 39  THR A N   1 
ATOM   278  C CA  . THR A 1 39  ? 16.523  -2.110  -16.735 1.00 45.44  ? 39  THR A CA  1 
ATOM   279  C C   . THR A 1 39  ? 15.617  -3.117  -17.423 1.00 40.90  ? 39  THR A C   1 
ATOM   280  O O   . THR A 1 39  ? 16.080  -4.083  -18.021 1.00 39.31  ? 39  THR A O   1 
ATOM   281  C CB  . THR A 1 39  ? 16.367  -0.733  -17.440 1.00 46.85  ? 39  THR A CB  1 
ATOM   282  O OG1 . THR A 1 39  ? 16.661  -0.844  -18.835 1.00 43.61  ? 39  THR A OG1 1 
ATOM   283  C CG2 . THR A 1 39  ? 17.259  0.291   -16.811 1.00 49.36  ? 39  THR A CG2 1 
ATOM   284  N N   . PRO A 1 40  ? 14.310  -2.898  -17.316 1.00 38.15  ? 40  PRO A N   1 
ATOM   285  C CA  . PRO A 1 40  ? 13.407  -3.689  -18.108 1.00 35.56  ? 40  PRO A CA  1 
ATOM   286  C C   . PRO A 1 40  ? 13.475  -3.130  -19.521 1.00 33.52  ? 40  PRO A C   1 
ATOM   287  O O   . PRO A 1 40  ? 14.097  -2.109  -19.722 1.00 33.84  ? 40  PRO A O   1 
ATOM   288  C CB  . PRO A 1 40  ? 12.066  -3.438  -17.442 1.00 36.27  ? 40  PRO A CB  1 
ATOM   289  C CG  . PRO A 1 40  ? 12.406  -3.103  -16.076 1.00 38.74  ? 40  PRO A CG  1 
ATOM   290  C CD  . PRO A 1 40  ? 13.639  -2.301  -16.157 1.00 39.51  ? 40  PRO A CD  1 
ATOM   291  N N   . PRO A 1 41  ? 12.889  -3.799  -20.502 1.00 32.18  ? 41  PRO A N   1 
ATOM   292  C CA  . PRO A 1 41  ? 12.973  -3.220  -21.823 1.00 31.61  ? 41  PRO A CA  1 
ATOM   293  C C   . PRO A 1 41  ? 12.260  -1.863  -21.909 1.00 32.39  ? 41  PRO A C   1 
ATOM   294  O O   . PRO A 1 41  ? 11.128  -1.715  -21.465 1.00 29.30  ? 41  PRO A O   1 
ATOM   295  C CB  . PRO A 1 41  ? 12.253  -4.247  -22.693 1.00 32.23  ? 41  PRO A CB  1 
ATOM   296  C CG  . PRO A 1 41  ? 11.734  -5.291  -21.748 1.00 33.32  ? 41  PRO A CG  1 
ATOM   297  C CD  . PRO A 1 41  ? 12.475  -5.205  -20.526 1.00 31.98  ? 41  PRO A CD  1 
ATOM   298  N N   . LYS A 1 42  ? 12.937  -0.885  -22.504 1.00 34.56  ? 42  LYS A N   1 
ATOM   299  C CA  . LYS A 1 42  ? 12.331  0.403   -22.769 1.00 36.48  ? 42  LYS A CA  1 
ATOM   300  C C   . LYS A 1 42  ? 13.019  1.144   -23.932 1.00 38.69  ? 42  LYS A C   1 
ATOM   301  O O   . LYS A 1 42  ? 14.080  0.753   -24.388 1.00 40.40  ? 42  LYS A O   1 
ATOM   302  C CB  . LYS A 1 42  ? 12.323  1.221   -21.500 1.00 37.86  ? 42  LYS A CB  1 
ATOM   303  C CG  . LYS A 1 42  ? 13.532  2.035   -21.320 1.00 41.42  ? 42  LYS A CG  1 
ATOM   304  C CD  . LYS A 1 42  ? 14.075  1.891   -19.942 1.00 46.39  ? 42  LYS A CD  1 
ATOM   305  C CE  . LYS A 1 42  ? 15.337  2.711   -19.804 1.00 52.81  ? 42  LYS A CE  1 
ATOM   306  N NZ  . LYS A 1 42  ? 16.289  2.425   -20.913 1.00 55.57  ? 42  LYS A NZ  1 
ATOM   307  N N   . GLY A 1 43  ? 12.417  2.220   -24.383 1.00 40.25  ? 43  GLY A N   1 
ATOM   308  C CA  . GLY A 1 43  ? 12.955  2.999   -25.458 1.00 43.13  ? 43  GLY A CA  1 
ATOM   309  C C   . GLY A 1 43  ? 12.102  4.185   -25.750 1.00 45.62  ? 43  GLY A C   1 
ATOM   310  O O   . GLY A 1 43  ? 11.122  4.380   -25.124 1.00 42.77  ? 43  GLY A O   1 
ATOM   311  N N   . HIS A 1 44  ? 12.496  4.957   -26.734 1.00 50.86  ? 44  HIS A N   1 
ATOM   312  C CA  . HIS A 1 44  ? 11.900  6.229   -27.032 1.00 56.83  ? 44  HIS A CA  1 
ATOM   313  C C   . HIS A 1 44  ? 10.702  6.182   -27.905 1.00 52.37  ? 44  HIS A C   1 
ATOM   314  O O   . HIS A 1 44  ? 10.627  5.412   -28.801 1.00 51.48  ? 44  HIS A O   1 
ATOM   315  C CB  . HIS A 1 44  ? 12.920  7.113   -27.715 1.00 66.59  ? 44  HIS A CB  1 
ATOM   316  C CG  . HIS A 1 44  ? 13.963  7.638   -26.800 1.00 82.93  ? 44  HIS A CG  1 
ATOM   317  N ND1 . HIS A 1 44  ? 15.227  7.102   -26.734 1.00 93.15  ? 44  HIS A ND1 1 
ATOM   318  C CD2 . HIS A 1 44  ? 13.928  8.636   -25.896 1.00 94.33  ? 44  HIS A CD2 1 
ATOM   319  C CE1 . HIS A 1 44  ? 15.929  7.751   -25.831 1.00 100.83 ? 44  HIS A CE1 1 
ATOM   320  N NE2 . HIS A 1 44  ? 15.164  8.689   -25.309 1.00 101.90 ? 44  HIS A NE2 1 
ATOM   321  N N   . VAL A 1 45  ? 9.790   7.084   -27.635 1.00 51.55  ? 45  VAL A N   1 
ATOM   322  C CA  . VAL A 1 45  ? 8.592   7.282   -28.387 1.00 49.78  ? 45  VAL A CA  1 
ATOM   323  C C   . VAL A 1 45  ? 8.850   7.826   -29.768 1.00 52.23  ? 45  VAL A C   1 
ATOM   324  O O   . VAL A 1 45  ? 9.558   8.774   -29.929 1.00 58.03  ? 45  VAL A O   1 
ATOM   325  C CB  . VAL A 1 45  ? 7.726   8.265   -27.644 1.00 49.37  ? 45  VAL A CB  1 
ATOM   326  C CG1 . VAL A 1 45  ? 6.567   8.631   -28.430 1.00 46.91  ? 45  VAL A CG1 1 
ATOM   327  C CG2 . VAL A 1 45  ? 7.254   7.666   -26.433 1.00 47.88  ? 45  VAL A CG2 1 
ATOM   328  N N   . GLU A 1 46  ? 8.267   7.212   -30.771 1.00 52.18  ? 46  GLU A N   1 
ATOM   329  C CA  . GLU A 1 46  ? 8.340   7.714   -32.120 1.00 56.03  ? 46  GLU A CA  1 
ATOM   330  C C   . GLU A 1 46  ? 7.274   8.784   -32.305 1.00 56.28  ? 46  GLU A C   1 
ATOM   331  O O   . GLU A 1 46  ? 6.304   8.804   -31.578 1.00 53.87  ? 46  GLU A O   1 
ATOM   332  C CB  . GLU A 1 46  ? 8.133   6.597   -33.147 1.00 55.66  ? 46  GLU A CB  1 
ATOM   333  C CG  . GLU A 1 46  ? 9.251   5.598   -33.263 1.00 61.94  ? 46  GLU A CG  1 
ATOM   334  C CD  . GLU A 1 46  ? 10.510  6.153   -33.847 1.00 74.52  ? 46  GLU A CD  1 
ATOM   335  O OE1 . GLU A 1 46  ? 11.487  5.397   -33.906 1.00 83.62  ? 46  GLU A OE1 1 
ATOM   336  O OE2 . GLU A 1 46  ? 10.545  7.325   -34.247 1.00 76.15  ? 46  GLU A OE2 1 
ATOM   337  N N   . PRO A 1 47  ? 7.447   9.669   -33.299 1.00 67.06  ? 47  PRO A N   1 
ATOM   338  C CA  . PRO A 1 47  ? 6.507   10.742  -33.539 1.00 69.24  ? 47  PRO A CA  1 
ATOM   339  C C   . PRO A 1 47  ? 5.049   10.346  -33.547 1.00 69.35  ? 47  PRO A C   1 
ATOM   340  O O   . PRO A 1 47  ? 4.239   10.952  -32.869 1.00 72.80  ? 47  PRO A O   1 
ATOM   341  C CB  . PRO A 1 47  ? 6.940   11.235  -34.902 1.00 72.44  ? 47  PRO A CB  1 
ATOM   342  C CG  . PRO A 1 47  ? 8.411   11.109  -34.844 1.00 72.53  ? 47  PRO A CG  1 
ATOM   343  C CD  . PRO A 1 47  ? 8.719   9.932   -33.996 1.00 69.00  ? 47  PRO A CD  1 
ATOM   344  N N   . GLY A 1 48  ? 4.694   9.334   -34.296 1.00 68.70  ? 48  GLY A N   1 
ATOM   345  C CA  . GLY A 1 48  ? 3.306   8.939   -34.295 1.00 70.30  ? 48  GLY A CA  1 
ATOM   346  C C   . GLY A 1 48  ? 2.780   8.388   -32.989 1.00 65.90  ? 48  GLY A C   1 
ATOM   347  O O   . GLY A 1 48  ? 1.646   8.626   -32.621 1.00 67.36  ? 48  GLY A O   1 
ATOM   348  N N   . GLU A 1 49  ? 3.659   7.691   -32.280 1.00 60.76  ? 49  GLU A N   1 
ATOM   349  C CA  . GLU A 1 49  ? 3.336   6.642   -31.326 1.00 56.52  ? 49  GLU A CA  1 
ATOM   350  C C   . GLU A 1 49  ? 2.582   6.941   -30.046 1.00 53.79  ? 49  GLU A C   1 
ATOM   351  O O   . GLU A 1 49  ? 2.893   7.874   -29.322 1.00 53.63  ? 49  GLU A O   1 
ATOM   352  C CB  . GLU A 1 49  ? 4.623   5.961   -30.937 1.00 54.53  ? 49  GLU A CB  1 
ATOM   353  C CG  . GLU A 1 49  ? 4.570   4.515   -31.101 1.00 55.62  ? 49  GLU A CG  1 
ATOM   354  C CD  . GLU A 1 49  ? 5.922   3.928   -31.254 1.00 56.44  ? 49  GLU A CD  1 
ATOM   355  O OE1 . GLU A 1 49  ? 6.860   4.441   -30.645 1.00 56.23  ? 49  GLU A OE1 1 
ATOM   356  O OE2 . GLU A 1 49  ? 6.053   2.940   -31.983 1.00 59.81  ? 49  GLU A OE2 1 
ATOM   357  N N   . ASP A 1 50  ? 1.609   6.086   -29.772 1.00 51.21  ? 50  ASP A N   1 
ATOM   358  C CA  . ASP A 1 50  ? 0.967   5.992   -28.487 1.00 48.46  ? 50  ASP A CA  1 
ATOM   359  C C   . ASP A 1 50  ? 1.963   5.477   -27.432 1.00 45.62  ? 50  ASP A C   1 
ATOM   360  O O   . ASP A 1 50  ? 2.903   4.766   -27.756 1.00 45.81  ? 50  ASP A O   1 
ATOM   361  C CB  . ASP A 1 50  ? -0.156  5.006   -28.611 1.00 49.15  ? 50  ASP A CB  1 
ATOM   362  C CG  . ASP A 1 50  ? -0.902  4.870   -27.371 1.00 50.37  ? 50  ASP A CG  1 
ATOM   363  O OD1 . ASP A 1 50  ? -1.209  3.731   -27.013 1.00 49.18  ? 50  ASP A OD1 1 
ATOM   364  O OD2 . ASP A 1 50  ? -1.156  5.906   -26.733 1.00 54.49  ? 50  ASP A OD2 1 
ATOM   365  N N   . ASP A 1 51  ? 1.787   5.823   -26.170 1.00 42.36  ? 51  ASP A N   1 
ATOM   366  C CA  . ASP A 1 51  ? 2.780   5.419   -25.199 1.00 38.42  ? 51  ASP A CA  1 
ATOM   367  C C   . ASP A 1 51  ? 2.885   3.917   -25.018 1.00 37.33  ? 51  ASP A C   1 
ATOM   368  O O   . ASP A 1 51  ? 3.982   3.382   -25.028 1.00 35.75  ? 51  ASP A O   1 
ATOM   369  C CB  . ASP A 1 51  ? 2.537   6.112   -23.879 1.00 38.24  ? 51  ASP A CB  1 
ATOM   370  C CG  . ASP A 1 51  ? 3.265   7.417   -23.769 1.00 36.22  ? 51  ASP A CG  1 
ATOM   371  O OD1 . ASP A 1 51  ? 3.368   7.927   -22.674 1.00 38.87  ? 51  ASP A OD1 1 
ATOM   372  O OD2 . ASP A 1 51  ? 3.752   7.942   -24.753 1.00 35.94  ? 51  ASP A OD2 1 
ATOM   373  N N   . LEU A 1 52  ? 1.753   3.234   -24.872 1.00 37.32  ? 52  LEU A N   1 
ATOM   374  C CA  . LEU A 1 52  ? 1.750   1.778   -24.793 1.00 36.62  ? 52  LEU A CA  1 
ATOM   375  C C   . LEU A 1 52  ? 2.246   1.082   -26.069 1.00 37.93  ? 52  LEU A C   1 
ATOM   376  O O   . LEU A 1 52  ? 2.736   -0.034  -26.030 1.00 38.90  ? 52  LEU A O   1 
ATOM   377  C CB  . LEU A 1 52  ? 0.360   1.290   -24.441 1.00 37.58  ? 52  LEU A CB  1 
ATOM   378  C CG  . LEU A 1 52  ? 0.127   -0.093  -23.798 1.00 36.66  ? 52  LEU A CG  1 
ATOM   379  C CD1 . LEU A 1 52  ? 1.199   -0.548  -22.850 1.00 26.58  ? 52  LEU A CD1 1 
ATOM   380  C CD2 . LEU A 1 52  ? -1.178  0.000   -23.057 1.00 39.82  ? 52  LEU A CD2 1 
ATOM   381  N N   . GLU A 1 53  ? 2.087   1.739   -27.203 1.00 38.87  ? 53  GLU A N   1 
ATOM   382  C CA  . GLU A 1 53  ? 2.590   1.260   -28.453 1.00 38.49  ? 53  GLU A CA  1 
ATOM   383  C C   . GLU A 1 53  ? 4.106   1.169   -28.407 1.00 36.21  ? 53  GLU A C   1 
ATOM   384  O O   . GLU A 1 53  ? 4.662   0.234   -28.954 1.00 37.00  ? 53  GLU A O   1 
ATOM   385  C CB  . GLU A 1 53  ? 2.185   2.243   -29.530 1.00 40.76  ? 53  GLU A CB  1 
ATOM   386  C CG  . GLU A 1 53  ? 1.570   1.635   -30.744 1.00 44.54  ? 53  GLU A CG  1 
ATOM   387  C CD  . GLU A 1 53  ? 0.875   2.646   -31.610 1.00 48.34  ? 53  GLU A CD  1 
ATOM   388  O OE1 . GLU A 1 53  ? 0.423   2.265   -32.690 1.00 53.46  ? 53  GLU A OE1 1 
ATOM   389  O OE2 . GLU A 1 53  ? 0.788   3.821   -31.230 1.00 48.01  ? 53  GLU A OE2 1 
ATOM   390  N N   . THR A 1 54  ? 4.763   2.148   -27.784 1.00 33.05  ? 54  THR A N   1 
ATOM   391  C CA  . THR A 1 54  ? 6.214   2.165   -27.617 1.00 30.80  ? 54  THR A CA  1 
ATOM   392  C C   . THR A 1 54  ? 6.701   1.056   -26.688 1.00 28.87  ? 54  THR A C   1 
ATOM   393  O O   . THR A 1 54  ? 7.701   0.413   -26.938 1.00 27.93  ? 54  THR A O   1 
ATOM   394  C CB  . THR A 1 54  ? 6.667   3.502   -26.987 1.00 31.21  ? 54  THR A CB  1 
ATOM   395  O OG1 . THR A 1 54  ? 6.162   4.604   -27.736 1.00 32.65  ? 54  THR A OG1 1 
ATOM   396  C CG2 . THR A 1 54  ? 8.149   3.606   -26.899 1.00 29.89  ? 54  THR A CG2 1 
ATOM   397  N N   . ALA A 1 55  ? 5.996   0.879   -25.592 1.00 26.65  ? 55  ALA A N   1 
ATOM   398  C CA  . ALA A 1 55  ? 6.376   -0.109  -24.625 1.00 26.71  ? 55  ALA A CA  1 
ATOM   399  C C   . ALA A 1 55  ? 6.390   -1.477  -25.251 1.00 27.51  ? 55  ALA A C   1 
ATOM   400  O O   . ALA A 1 55  ? 7.310   -2.265  -25.003 1.00 26.84  ? 55  ALA A O   1 
ATOM   401  C CB  . ALA A 1 55  ? 5.432   -0.102  -23.448 1.00 26.16  ? 55  ALA A CB  1 
ATOM   402  N N   . LEU A 1 56  ? 5.365   -1.784  -26.035 1.00 28.09  ? 56  LEU A N   1 
ATOM   403  C CA  . LEU A 1 56  ? 5.338   -3.064  -26.733 1.00 28.79  ? 56  LEU A CA  1 
ATOM   404  C C   . LEU A 1 56  ? 6.380   -3.079  -27.792 1.00 29.74  ? 56  LEU A C   1 
ATOM   405  O O   . LEU A 1 56  ? 7.119   -4.004  -27.885 1.00 30.24  ? 56  LEU A O   1 
ATOM   406  C CB  . LEU A 1 56  ? 3.974   -3.337  -27.381 1.00 30.17  ? 56  LEU A CB  1 
ATOM   407  C CG  . LEU A 1 56  ? 2.828   -3.490  -26.402 1.00 30.25  ? 56  LEU A CG  1 
ATOM   408  C CD1 . LEU A 1 56  ? 1.517   -3.188  -27.027 1.00 30.87  ? 56  LEU A CD1 1 
ATOM   409  C CD2 . LEU A 1 56  ? 2.884   -4.890  -25.861 1.00 25.81  ? 56  LEU A CD2 1 
ATOM   410  N N   . ARG A 1 57  ? 6.443   -2.067  -28.626 1.00 31.51  ? 57  ARG A N   1 
ATOM   411  C CA  . ARG A 1 57  ? 7.390   -2.155  -29.706 1.00 35.00  ? 57  ARG A CA  1 
ATOM   412  C C   . ARG A 1 57  ? 8.791   -2.315  -29.129 1.00 34.95  ? 57  ARG A C   1 
ATOM   413  O O   . ARG A 1 57  ? 9.591   -3.138  -29.572 1.00 35.64  ? 57  ARG A O   1 
ATOM   414  C CB  . ARG A 1 57  ? 7.339   -0.897  -30.571 1.00 36.53  ? 57  ARG A CB  1 
ATOM   415  C CG  . ARG A 1 57  ? 8.144   -0.994  -31.847 1.00 39.13  ? 57  ARG A CG  1 
ATOM   416  C CD  . ARG A 1 57  ? 8.375   0.337   -32.464 1.00 42.08  ? 57  ARG A CD  1 
ATOM   417  N NE  . ARG A 1 57  ? 9.532   0.972   -31.868 1.00 43.89  ? 57  ARG A NE  1 
ATOM   418  C CZ  . ARG A 1 57  ? 9.483   2.057   -31.127 1.00 44.51  ? 57  ARG A CZ  1 
ATOM   419  N NH1 . ARG A 1 57  ? 8.341   2.656   -30.885 1.00 46.73  ? 57  ARG A NH1 1 
ATOM   420  N NH2 . ARG A 1 57  ? 10.584  2.545   -30.630 1.00 48.20  ? 57  ARG A NH2 1 
ATOM   421  N N   . GLU A 1 58  ? 9.079   -1.501  -28.130 1.00 34.36  ? 58  GLU A N   1 
ATOM   422  C CA  . GLU A 1 58  ? 10.394  -1.413  -27.577 1.00 33.93  ? 58  GLU A CA  1 
ATOM   423  C C   . GLU A 1 58  ? 10.782  -2.706  -26.849 1.00 33.03  ? 58  GLU A C   1 
ATOM   424  O O   . GLU A 1 58  ? 11.949  -3.085  -26.843 1.00 33.17  ? 58  GLU A O   1 
ATOM   425  C CB  . GLU A 1 58  ? 10.430  -0.196  -26.698 1.00 34.06  ? 58  GLU A CB  1 
ATOM   426  C CG  . GLU A 1 58  ? 11.742  0.470   -26.618 1.00 38.17  ? 58  GLU A CG  1 
ATOM   427  C CD  . GLU A 1 58  ? 12.197  1.072   -27.886 1.00 40.94  ? 58  GLU A CD  1 
ATOM   428  O OE1 . GLU A 1 58  ? 11.464  1.899   -28.418 1.00 43.20  ? 58  GLU A OE1 1 
ATOM   429  O OE2 . GLU A 1 58  ? 13.308  0.747   -28.321 1.00 43.35  ? 58  GLU A OE2 1 
ATOM   430  N N   . THR A 1 59  ? 9.802   -3.399  -26.275 1.00 31.75  ? 59  THR A N   1 
ATOM   431  C CA  . THR A 1 59  ? 10.018  -4.732  -25.702 1.00 30.84  ? 59  THR A CA  1 
ATOM   432  C C   . THR A 1 59  ? 10.406  -5.789  -26.729 1.00 32.62  ? 59  THR A C   1 
ATOM   433  O O   . THR A 1 59  ? 11.265  -6.602  -26.473 1.00 32.84  ? 59  THR A O   1 
ATOM   434  C CB  . THR A 1 59  ? 8.792   -5.206  -24.919 1.00 30.34  ? 59  THR A CB  1 
ATOM   435  O OG1 . THR A 1 59  ? 8.534   -4.307  -23.831 1.00 28.32  ? 59  THR A OG1 1 
ATOM   436  C CG2 . THR A 1 59  ? 9.032   -6.539  -24.345 1.00 29.73  ? 59  THR A CG2 1 
ATOM   437  N N   . GLN A 1 60  ? 9.776   -5.792  -27.894 1.00 34.99  ? 60  GLN A N   1 
ATOM   438  C CA  . GLN A 1 60  ? 10.213  -6.677  -28.955 1.00 37.79  ? 60  GLN A CA  1 
ATOM   439  C C   . GLN A 1 60  ? 11.628  -6.307  -29.459 1.00 37.87  ? 60  GLN A C   1 
ATOM   440  O O   . GLN A 1 60  ? 12.449  -7.170  -29.701 1.00 37.93  ? 60  GLN A O   1 
ATOM   441  C CB  . GLN A 1 60  ? 9.147   -6.787  -30.059 1.00 39.56  ? 60  GLN A CB  1 
ATOM   442  C CG  . GLN A 1 60  ? 9.419   -6.131  -31.422 1.00 48.47  ? 60  GLN A CG  1 
ATOM   443  C CD  . GLN A 1 60  ? 10.651  -6.676  -32.144 1.00 57.36  ? 60  GLN A CD  1 
ATOM   444  O OE1 . GLN A 1 60  ? 10.939  -7.874  -32.111 1.00 60.41  ? 60  GLN A OE1 1 
ATOM   445  N NE2 . GLN A 1 60  ? 11.395  -5.784  -32.780 1.00 61.48  ? 60  GLN A NE2 1 
ATOM   446  N N   . GLU A 1 61  ? 11.919  -5.021  -29.583 1.00 37.80  ? 61  GLU A N   1 
ATOM   447  C CA  . GLU A 1 61  ? 13.238  -4.605  -30.050 1.00 39.89  ? 61  GLU A CA  1 
ATOM   448  C C   . GLU A 1 61  ? 14.361  -4.942  -29.061 1.00 38.75  ? 61  GLU A C   1 
ATOM   449  O O   . GLU A 1 61  ? 15.384  -5.512  -29.390 1.00 39.31  ? 61  GLU A O   1 
ATOM   450  C CB  . GLU A 1 61  ? 13.217  -3.112  -30.387 1.00 39.13  ? 61  GLU A CB  1 
ATOM   451  C CG  . GLU A 1 61  ? 12.884  -2.873  -31.807 1.00 47.51  ? 61  GLU A CG  1 
ATOM   452  C CD  . GLU A 1 61  ? 12.492  -1.447  -32.146 1.00 55.78  ? 61  GLU A CD  1 
ATOM   453  O OE1 . GLU A 1 61  ? 11.492  -1.285  -32.863 1.00 61.67  ? 61  GLU A OE1 1 
ATOM   454  O OE2 . GLU A 1 61  ? 13.180  -0.494  -31.748 1.00 57.95  ? 61  GLU A OE2 1 
ATOM   455  N N   . GLU A 1 62  ? 14.135  -4.554  -27.826 1.00 37.66  ? 62  GLU A N   1 
ATOM   456  C CA  . GLU A 1 62  ? 15.098  -4.691  -26.794 1.00 36.99  ? 62  GLU A CA  1 
ATOM   457  C C   . GLU A 1 62  ? 15.261  -6.115  -26.288 1.00 36.15  ? 62  GLU A C   1 
ATOM   458  O O   . GLU A 1 62  ? 16.370  -6.541  -26.028 1.00 35.89  ? 62  GLU A O   1 
ATOM   459  C CB  . GLU A 1 62  ? 14.664  -3.783  -25.689 1.00 36.61  ? 62  GLU A CB  1 
ATOM   460  C CG  . GLU A 1 62  ? 15.691  -2.798  -25.310 1.00 41.66  ? 62  GLU A CG  1 
ATOM   461  C CD  . GLU A 1 62  ? 16.113  -1.952  -26.445 1.00 46.99  ? 62  GLU A CD  1 
ATOM   462  O OE1 . GLU A 1 62  ? 15.241  -1.423  -27.137 1.00 52.91  ? 62  GLU A OE1 1 
ATOM   463  O OE2 . GLU A 1 62  ? 17.319  -1.799  -26.638 1.00 48.51  ? 62  GLU A OE2 1 
ATOM   464  N N   . ALA A 1 63  ? 14.156  -6.842  -26.146 1.00 35.04  ? 63  ALA A N   1 
ATOM   465  C CA  . ALA A 1 63  ? 14.169  -8.184  -25.558 1.00 34.90  ? 63  ALA A CA  1 
ATOM   466  C C   . ALA A 1 63  ? 13.715  -9.318  -26.451 1.00 35.94  ? 63  ALA A C   1 
ATOM   467  O O   . ALA A 1 63  ? 13.766  -10.476 -26.048 1.00 36.84  ? 63  ALA A O   1 
ATOM   468  C CB  . ALA A 1 63  ? 13.361  -8.220  -24.267 1.00 32.95  ? 63  ALA A CB  1 
ATOM   469  N N   . GLY A 1 64  ? 13.253  -9.011  -27.652 1.00 36.86  ? 64  GLY A N   1 
ATOM   470  C CA  . GLY A 1 64  ? 12.854  -10.084 -28.556 1.00 37.93  ? 64  GLY A CA  1 
ATOM   471  C C   . GLY A 1 64  ? 11.501  -10.715 -28.275 1.00 37.94  ? 64  GLY A C   1 
ATOM   472  O O   . GLY A 1 64  ? 11.145  -11.687 -28.911 1.00 38.58  ? 64  GLY A O   1 
ATOM   473  N N   . ILE A 1 65  ? 10.743  -10.137 -27.349 1.00 36.79  ? 65  ILE A N   1 
ATOM   474  C CA  . ILE A 1 65  ? 9.441   -10.646 -26.969 1.00 36.86  ? 65  ILE A CA  1 
ATOM   475  C C   . ILE A 1 65  ? 8.308   -9.967  -27.692 1.00 39.82  ? 65  ILE A C   1 
ATOM   476  O O   . ILE A 1 65  ? 8.076   -8.788  -27.546 1.00 37.89  ? 65  ILE A O   1 
ATOM   477  C CB  . ILE A 1 65  ? 9.181   -10.471 -25.487 1.00 34.50  ? 65  ILE A CB  1 
ATOM   478  C CG1 . ILE A 1 65  ? 10.300  -11.112 -24.707 1.00 30.28  ? 65  ILE A CG1 1 
ATOM   479  C CG2 . ILE A 1 65  ? 7.855   -11.103 -25.114 1.00 33.20  ? 65  ILE A CG2 1 
ATOM   480  C CD1 . ILE A 1 65  ? 10.287  -10.797 -23.247 1.00 23.78  ? 65  ILE A CD1 1 
ATOM   481  N N   . GLU A 1 66  ? 7.585   -10.774 -28.448 1.00 45.66  ? 66  GLU A N   1 
ATOM   482  C CA  . GLU A 1 66  ? 6.466   -10.350 -29.269 1.00 49.40  ? 66  GLU A CA  1 
ATOM   483  C C   . GLU A 1 66  ? 5.187   -10.293 -28.495 1.00 48.49  ? 66  GLU A C   1 
ATOM   484  O O   . GLU A 1 66  ? 5.071   -10.913 -27.473 1.00 46.87  ? 66  GLU A O   1 
ATOM   485  C CB  . GLU A 1 66  ? 6.324   -11.300 -30.444 1.00 55.36  ? 66  GLU A CB  1 
ATOM   486  C CG  . GLU A 1 66  ? 6.544   -10.622 -31.764 1.00 69.21  ? 66  GLU A CG  1 
ATOM   487  C CD  . GLU A 1 66  ? 7.814   -11.044 -32.436 1.00 82.10  ? 66  GLU A CD  1 
ATOM   488  O OE1 . GLU A 1 66  ? 8.464   -10.178 -33.056 1.00 85.04  ? 66  GLU A OE1 1 
ATOM   489  O OE2 . GLU A 1 66  ? 8.154   -12.241 -32.364 1.00 87.94  ? 66  GLU A OE2 1 
ATOM   490  N N   . ALA A 1 67  ? 4.214   -9.561  -29.012 1.00 50.08  ? 67  ALA A N   1 
ATOM   491  C CA  . ALA A 1 67  ? 2.949   -9.324  -28.307 1.00 51.53  ? 67  ALA A CA  1 
ATOM   492  C C   . ALA A 1 67  ? 2.156   -10.596 -28.003 1.00 54.32  ? 67  ALA A C   1 
ATOM   493  O O   . ALA A 1 67  ? 1.473   -10.676 -26.991 1.00 53.92  ? 67  ALA A O   1 
ATOM   494  C CB  . ALA A 1 67  ? 2.111   -8.328  -29.050 1.00 52.51  ? 67  ALA A CB  1 
ATOM   495  N N   . GLY A 1 68  ? 2.270   -11.587 -28.884 1.00 56.70  ? 68  GLY A N   1 
ATOM   496  C CA  . GLY A 1 68  ? 1.714   -12.909 -28.655 1.00 59.10  ? 68  GLY A CA  1 
ATOM   497  C C   . GLY A 1 68  ? 2.279   -13.593 -27.421 1.00 56.76  ? 68  GLY A C   1 
ATOM   498  O O   . GLY A 1 68  ? 1.609   -14.421 -26.817 1.00 58.78  ? 68  GLY A O   1 
ATOM   499  N N   . GLN A 1 69  ? 3.510   -13.237 -27.051 1.00 53.03  ? 69  GLN A N   1 
ATOM   500  C CA  . GLN A 1 69  ? 4.222   -13.848 -25.933 1.00 50.54  ? 69  GLN A CA  1 
ATOM   501  C C   . GLN A 1 69  ? 4.022   -13.075 -24.633 1.00 48.24  ? 69  GLN A C   1 
ATOM   502  O O   . GLN A 1 69  ? 4.600   -13.394 -23.606 1.00 46.44  ? 69  GLN A O   1 
ATOM   503  C CB  . GLN A 1 69  ? 5.703   -13.960 -26.268 1.00 49.22  ? 69  GLN A CB  1 
ATOM   504  C CG  . GLN A 1 69  ? 5.990   -14.682 -27.582 1.00 51.67  ? 69  GLN A CG  1 
ATOM   505  C CD  . GLN A 1 69  ? 7.377   -14.385 -28.202 1.00 52.55  ? 69  GLN A CD  1 
ATOM   506  O OE1 . GLN A 1 69  ? 7.698   -14.920 -29.246 1.00 56.24  ? 69  GLN A OE1 1 
ATOM   507  N NE2 . GLN A 1 69  ? 8.174   -13.543 -27.570 1.00 45.31  ? 69  GLN A NE2 1 
ATOM   508  N N   . LEU A 1 70  ? 3.158   -12.070 -24.705 1.00 47.93  ? 70  LEU A N   1 
ATOM   509  C CA  . LEU A 1 70  ? 2.962   -11.089 -23.652 1.00 45.66  ? 70  LEU A CA  1 
ATOM   510  C C   . LEU A 1 70  ? 1.522   -10.878 -23.321 1.00 47.12  ? 70  LEU A C   1 
ATOM   511  O O   . LEU A 1 70  ? 0.679   -10.879 -24.203 1.00 51.11  ? 70  LEU A O   1 
ATOM   512  C CB  . LEU A 1 70  ? 3.400   -9.733  -24.167 1.00 43.85  ? 70  LEU A CB  1 
ATOM   513  C CG  . LEU A 1 70  ? 4.847   -9.394  -24.098 1.00 40.95  ? 70  LEU A CG  1 
ATOM   514  C CD1 . LEU A 1 70  ? 4.940   -7.957  -24.433 1.00 38.47  ? 70  LEU A CD1 1 
ATOM   515  C CD2 . LEU A 1 70  ? 5.261   -9.637  -22.692 1.00 42.15  ? 70  LEU A CD2 1 
ATOM   516  N N   . THR A 1 71  ? 1.248   -10.607 -22.056 1.00 45.97  ? 71  THR A N   1 
ATOM   517  C CA  . THR A 1 71  ? -0.050  -10.077 -21.676 1.00 46.85  ? 71  THR A CA  1 
ATOM   518  C C   . THR A 1 71  ? 0.102   -8.889  -20.738 1.00 44.60  ? 71  THR A C   1 
ATOM   519  O O   . THR A 1 71  ? 0.727   -8.977  -19.692 1.00 42.61  ? 71  THR A O   1 
ATOM   520  C CB  . THR A 1 71  ? -0.945  -11.171 -21.094 1.00 49.37  ? 71  THR A CB  1 
ATOM   521  O OG1 . THR A 1 71  ? -1.740  -11.704 -22.148 1.00 53.30  ? 71  THR A OG1 1 
ATOM   522  C CG2 . THR A 1 71  ? -1.864  -10.624 -20.054 1.00 49.24  ? 71  THR A CG2 1 
ATOM   523  N N   . ILE A 1 72  ? -0.467  -7.771  -21.147 1.00 44.70  ? 72  ILE A N   1 
ATOM   524  C CA  . ILE A 1 72  ? -0.483  -6.570  -20.342 1.00 43.99  ? 72  ILE A CA  1 
ATOM   525  C C   . ILE A 1 72  ? -1.462  -6.667  -19.169 1.00 46.22  ? 72  ILE A C   1 
ATOM   526  O O   . ILE A 1 72  ? -2.648  -6.913  -19.357 1.00 50.33  ? 72  ILE A O   1 
ATOM   527  C CB  . ILE A 1 72  ? -0.878  -5.378  -21.204 1.00 44.16  ? 72  ILE A CB  1 
ATOM   528  C CG1 . ILE A 1 72  ? 0.147   -5.207  -22.315 1.00 42.20  ? 72  ILE A CG1 1 
ATOM   529  C CG2 . ILE A 1 72  ? -0.967  -4.087  -20.378 1.00 43.03  ? 72  ILE A CG2 1 
ATOM   530  C CD1 . ILE A 1 72  ? 1.101   -4.120  -22.069 1.00 39.02  ? 72  ILE A CD1 1 
ATOM   531  N N   . ILE A 1 73  ? -0.957  -6.460  -17.962 1.00 44.54  ? 73  ILE A N   1 
ATOM   532  C CA  . ILE A 1 73  ? -1.812  -6.446  -16.818 1.00 46.29  ? 73  ILE A CA  1 
ATOM   533  C C   . ILE A 1 73  ? -2.435  -5.072  -16.758 1.00 48.45  ? 73  ILE A C   1 
ATOM   534  O O   . ILE A 1 73  ? -1.738  -4.100  -16.546 1.00 47.61  ? 73  ILE A O   1 
ATOM   535  C CB  . ILE A 1 73  ? -1.018  -6.727  -15.559 1.00 44.48  ? 73  ILE A CB  1 
ATOM   536  C CG1 . ILE A 1 73  ? -0.250  -8.029  -15.720 1.00 41.82  ? 73  ILE A CG1 1 
ATOM   537  C CG2 . ILE A 1 73  ? -1.909  -6.778  -14.339 1.00 44.26  ? 73  ILE A CG2 1 
ATOM   538  C CD1 . ILE A 1 73  ? -1.052  -9.087  -16.342 1.00 37.76  ? 73  ILE A CD1 1 
ATOM   539  N N   . GLU A 1 74  ? -3.739  -4.982  -16.976 1.00 52.37  ? 74  GLU A N   1 
ATOM   540  C CA  . GLU A 1 74  ? -4.408  -3.695  -16.911 1.00 54.97  ? 74  GLU A CA  1 
ATOM   541  C C   . GLU A 1 74  ? -4.449  -3.174  -15.502 1.00 53.99  ? 74  GLU A C   1 
ATOM   542  O O   . GLU A 1 74  ? -4.465  -3.934  -14.557 1.00 54.98  ? 74  GLU A O   1 
ATOM   543  C CB  . GLU A 1 74  ? -5.829  -3.758  -17.480 1.00 61.94  ? 74  GLU A CB  1 
ATOM   544  C CG  . GLU A 1 74  ? -5.939  -4.342  -18.884 1.00 70.01  ? 74  GLU A CG  1 
ATOM   545  C CD  . GLU A 1 74  ? -5.073  -3.623  -19.918 1.00 76.44  ? 74  GLU A CD  1 
ATOM   546  O OE1 . GLU A 1 74  ? -4.530  -4.319  -20.803 1.00 77.94  ? 74  GLU A OE1 1 
ATOM   547  O OE2 . GLU A 1 74  ? -4.930  -2.379  -19.855 1.00 78.35  ? 74  GLU A OE2 1 
ATOM   548  N N   . GLY A 1 75  ? -4.451  -1.858  -15.381 1.00 52.70  ? 75  GLY A N   1 
ATOM   549  C CA  . GLY A 1 75  ? -4.573  -1.204  -14.095 1.00 52.43  ? 75  GLY A CA  1 
ATOM   550  C C   . GLY A 1 75  ? -3.305  -0.735  -13.427 1.00 49.96  ? 75  GLY A C   1 
ATOM   551  O O   . GLY A 1 75  ? -3.360  -0.183  -12.329 1.00 52.60  ? 75  GLY A O   1 
ATOM   552  N N   . PHE A 1 76  ? -2.166  -0.940  -14.071 1.00 44.07  ? 76  PHE A N   1 
ATOM   553  C CA  . PHE A 1 76  ? -0.919  -0.478  -13.513 1.00 39.95  ? 76  PHE A CA  1 
ATOM   554  C C   . PHE A 1 76  ? -0.085  0.260   -14.537 1.00 37.87  ? 76  PHE A C   1 
ATOM   555  O O   . PHE A 1 76  ? 0.017   -0.129  -15.692 1.00 37.07  ? 76  PHE A O   1 
ATOM   556  C CB  . PHE A 1 76  ? -0.139  -1.635  -12.927 1.00 38.93  ? 76  PHE A CB  1 
ATOM   557  C CG  . PHE A 1 76  ? 1.181   -1.235  -12.365 1.00 35.82  ? 76  PHE A CG  1 
ATOM   558  C CD1 . PHE A 1 76  ? 1.287   -0.850  -11.041 1.00 34.36  ? 76  PHE A CD1 1 
ATOM   559  C CD2 . PHE A 1 76  ? 2.318   -1.242  -13.168 1.00 29.84  ? 76  PHE A CD2 1 
ATOM   560  C CE1 . PHE A 1 76  ? 2.514   -0.482  -10.525 1.00 35.98  ? 76  PHE A CE1 1 
ATOM   561  C CE2 . PHE A 1 76  ? 3.525   -0.848  -12.677 1.00 28.93  ? 76  PHE A CE2 1 
ATOM   562  C CZ  . PHE A 1 76  ? 3.642   -0.467  -11.354 1.00 32.15  ? 76  PHE A CZ  1 
ATOM   563  N N   . LYS A 1 77  ? 0.521   1.334   -14.080 1.00 37.24  ? 77  LYS A N   1 
ATOM   564  C CA  . LYS A 1 77  ? 1.386   2.171   -14.889 1.00 36.13  ? 77  LYS A CA  1 
ATOM   565  C C   . LYS A 1 77  ? 2.257   2.966   -13.902 1.00 36.33  ? 77  LYS A C   1 
ATOM   566  O O   . LYS A 1 77  ? 1.834   3.296   -12.799 1.00 36.37  ? 77  LYS A O   1 
ATOM   567  C CB  . LYS A 1 77  ? 0.519   3.130   -15.710 1.00 37.22  ? 77  LYS A CB  1 
ATOM   568  C CG  . LYS A 1 77  ? 1.236   4.048   -16.640 1.00 37.23  ? 77  LYS A CG  1 
ATOM   569  C CD  . LYS A 1 77  ? 0.284   5.101   -17.112 1.00 41.99  ? 77  LYS A CD  1 
ATOM   570  C CE  . LYS A 1 77  ? -1.110  4.507   -17.239 1.00 46.56  ? 77  LYS A CE  1 
ATOM   571  N NZ  . LYS A 1 77  ? -2.134  5.413   -17.888 1.00 50.66  ? 77  LYS A NZ  1 
ATOM   572  N N   . ARG A 1 78  ? 3.477   3.268   -14.297 1.00 35.82  ? 78  ARG A N   1 
ATOM   573  C CA  . ARG A 1 78  ? 4.366   4.002   -13.434 1.00 37.63  ? 78  ARG A CA  1 
ATOM   574  C C   . ARG A 1 78  ? 5.267   4.931   -14.228 1.00 38.00  ? 78  ARG A C   1 
ATOM   575  O O   . ARG A 1 78  ? 6.032   4.484   -15.068 1.00 37.30  ? 78  ARG A O   1 
ATOM   576  C CB  . ARG A 1 78  ? 5.228   3.006   -12.700 1.00 37.87  ? 78  ARG A CB  1 
ATOM   577  C CG  . ARG A 1 78  ? 6.205   3.644   -11.804 1.00 41.43  ? 78  ARG A CG  1 
ATOM   578  C CD  . ARG A 1 78  ? 5.734   3.530   -10.412 1.00 45.63  ? 78  ARG A CD  1 
ATOM   579  N NE  . ARG A 1 78  ? 5.746   4.833   -9.758  1.00 50.90  ? 78  ARG A NE  1 
ATOM   580  C CZ  . ARG A 1 78  ? 6.806   5.410   -9.169  1.00 49.47  ? 78  ARG A CZ  1 
ATOM   581  N NH1 . ARG A 1 78  ? 7.990   4.810   -9.147  1.00 47.69  ? 78  ARG A NH1 1 
ATOM   582  N NH2 . ARG A 1 78  ? 6.667   6.603   -8.589  1.00 50.38  ? 78  ARG A NH2 1 
ATOM   583  N N   . GLU A 1 79  ? 5.184   6.221   -13.968 1.00 40.43  ? 79  GLU A N   1 
ATOM   584  C CA  . GLU A 1 79  ? 6.031   7.178   -14.642 1.00 42.31  ? 79  GLU A CA  1 
ATOM   585  C C   . GLU A 1 79  ? 7.216   7.497   -13.772 1.00 44.80  ? 79  GLU A C   1 
ATOM   586  O O   . GLU A 1 79  ? 7.069   7.932   -12.648 1.00 47.38  ? 79  GLU A O   1 
ATOM   587  C CB  . GLU A 1 79  ? 5.266   8.450   -14.928 1.00 43.27  ? 79  GLU A CB  1 
ATOM   588  C CG  . GLU A 1 79  ? 6.126   9.579   -15.441 1.00 46.69  ? 79  GLU A CG  1 
ATOM   589  C CD  . GLU A 1 79  ? 5.325   10.716  -16.024 1.00 51.70  ? 79  GLU A CD  1 
ATOM   590  O OE1 . GLU A 1 79  ? 4.318   10.459  -16.700 1.00 54.44  ? 79  GLU A OE1 1 
ATOM   591  O OE2 . GLU A 1 79  ? 5.699   11.875  -15.815 1.00 55.67  ? 79  GLU A OE2 1 
ATOM   592  N N   . LEU A 1 80  ? 8.400   7.271   -14.302 1.00 46.01  ? 80  LEU A N   1 
ATOM   593  C CA  . LEU A 1 80  ? 9.621   7.520   -13.594 1.00 48.57  ? 80  LEU A CA  1 
ATOM   594  C C   . LEU A 1 80  ? 10.168  8.823   -14.051 1.00 52.79  ? 80  LEU A C   1 
ATOM   595  O O   . LEU A 1 80  ? 10.290  9.038   -15.240 1.00 51.43  ? 80  LEU A O   1 
ATOM   596  C CB  . LEU A 1 80  ? 10.627  6.443   -13.943 1.00 46.62  ? 80  LEU A CB  1 
ATOM   597  C CG  . LEU A 1 80  ? 10.884  5.416   -12.867 1.00 43.75  ? 80  LEU A CG  1 
ATOM   598  C CD1 . LEU A 1 80  ? 9.590   4.765   -12.489 1.00 43.62  ? 80  LEU A CD1 1 
ATOM   599  C CD2 . LEU A 1 80  ? 11.821  4.427   -13.382 1.00 39.27  ? 80  LEU A CD2 1 
ATOM   600  N N   . ASN A 1 81  ? 10.512  9.696   -13.110 1.00 59.36  ? 81  ASN A N   1 
ATOM   601  C CA  . ASN A 1 81  ? 11.123  10.967  -13.467 1.00 65.28  ? 81  ASN A CA  1 
ATOM   602  C C   . ASN A 1 81  ? 12.466  11.138  -12.813 1.00 70.56  ? 81  ASN A C   1 
ATOM   603  O O   . ASN A 1 81  ? 12.542  11.255  -11.608 1.00 74.87  ? 81  ASN A O   1 
ATOM   604  C CB  . ASN A 1 81  ? 10.215  12.088  -13.049 1.00 66.52  ? 81  ASN A CB  1 
ATOM   605  C CG  . ASN A 1 81  ? 9.262   12.478  -14.125 1.00 67.09  ? 81  ASN A CG  1 
ATOM   606  O OD1 . ASN A 1 81  ? 9.638   13.134  -15.081 1.00 71.41  ? 81  ASN A OD1 1 
ATOM   607  N ND2 . ASN A 1 81  ? 8.007   12.097  -13.971 1.00 69.21  ? 81  ASN A ND2 1 
ATOM   608  N N   . TYR A 1 82  ? 13.529  11.149  -13.607 1.00 75.99  ? 82  TYR A N   1 
ATOM   609  C CA  . TYR A 1 82  ? 14.875  11.221  -13.061 1.00 82.40  ? 82  TYR A CA  1 
ATOM   610  C C   . TYR A 1 82  ? 15.912  11.847  -13.992 1.00 87.19  ? 82  TYR A C   1 
ATOM   611  O O   . TYR A 1 82  ? 15.571  12.430  -15.024 1.00 86.79  ? 82  TYR A O   1 
ATOM   612  C CB  . TYR A 1 82  ? 15.336  9.838   -12.614 1.00 81.01  ? 82  TYR A CB  1 
ATOM   613  C CG  . TYR A 1 82  ? 15.471  8.849   -13.737 1.00 78.62  ? 82  TYR A CG  1 
ATOM   614  C CD1 . TYR A 1 82  ? 16.637  8.778   -14.493 1.00 79.84  ? 82  TYR A CD1 1 
ATOM   615  C CD2 . TYR A 1 82  ? 14.436  7.974   -14.048 1.00 76.51  ? 82  TYR A CD2 1 
ATOM   616  C CE1 . TYR A 1 82  ? 16.761  7.865   -15.541 1.00 76.92  ? 82  TYR A CE1 1 
ATOM   617  C CE2 . TYR A 1 82  ? 14.556  7.057   -15.082 1.00 72.05  ? 82  TYR A CE2 1 
ATOM   618  C CZ  . TYR A 1 82  ? 15.718  7.011   -15.823 1.00 72.70  ? 82  TYR A CZ  1 
ATOM   619  O OH  . TYR A 1 82  ? 15.843  6.114   -16.851 1.00 70.85  ? 82  TYR A OH  1 
ATOM   620  N N   . VAL A 1 83  ? 17.183  11.727  -13.599 1.00 94.59  ? 83  VAL A N   1 
ATOM   621  C CA  . VAL A 1 83  ? 18.315  12.382  -14.271 1.00 101.07 ? 83  VAL A CA  1 
ATOM   622  C C   . VAL A 1 83  ? 19.377  11.363  -14.644 1.00 102.98 ? 83  VAL A C   1 
ATOM   623  O O   . VAL A 1 83  ? 19.954  10.733  -13.764 1.00 103.32 ? 83  VAL A O   1 
ATOM   624  C CB  . VAL A 1 83  ? 18.995  13.428  -13.352 1.00 106.16 ? 83  VAL A CB  1 
ATOM   625  C CG1 . VAL A 1 83  ? 19.936  14.298  -14.166 1.00 113.49 ? 83  VAL A CG1 1 
ATOM   626  C CG2 . VAL A 1 83  ? 17.965  14.292  -12.613 1.00 106.11 ? 83  VAL A CG2 1 
ATOM   627  N N   . ALA A 1 84  ? 19.610  11.183  -15.941 1.00 105.95 ? 84  ALA A N   1 
ATOM   628  C CA  . ALA A 1 84  ? 20.611  10.230  -16.410 1.00 109.68 ? 84  ALA A CA  1 
ATOM   629  C C   . ALA A 1 84  ? 21.642  10.882  -17.329 1.00 115.64 ? 84  ALA A C   1 
ATOM   630  O O   . ALA A 1 84  ? 21.286  11.575  -18.283 1.00 115.01 ? 84  ALA A O   1 
ATOM   631  C CB  . ALA A 1 84  ? 19.938  9.059   -17.112 1.00 105.51 ? 84  ALA A CB  1 
ATOM   632  N N   . ARG A 1 85  ? 22.919  10.652  -17.041 1.00 123.26 ? 85  ARG A N   1 
ATOM   633  C CA  . ARG A 1 85  ? 24.000  11.193  -17.859 1.00 131.75 ? 85  ARG A CA  1 
ATOM   634  C C   . ARG A 1 85  ? 23.905  12.710  -17.984 1.00 135.11 ? 85  ARG A C   1 
ATOM   635  O O   . ARG A 1 85  ? 24.150  13.269  -19.054 1.00 137.33 ? 85  ARG A O   1 
ATOM   636  C CB  . ARG A 1 85  ? 23.994  10.550  -19.247 1.00 133.05 ? 85  ARG A CB  1 
ATOM   637  N N   . ASN A 1 86  ? 23.547  13.372  -16.889 1.00 135.94 ? 86  ASN A N   1 
ATOM   638  C CA  . ASN A 1 86  ? 23.406  14.822  -16.887 1.00 139.06 ? 86  ASN A CA  1 
ATOM   639  C C   . ASN A 1 86  ? 22.288  15.265  -17.823 1.00 132.75 ? 86  ASN A C   1 
ATOM   640  O O   . ASN A 1 86  ? 22.312  16.371  -18.362 1.00 135.60 ? 86  ASN A O   1 
ATOM   641  C CB  . ASN A 1 86  ? 24.723  15.491  -17.285 1.00 148.60 ? 86  ASN A CB  1 
ATOM   642  C CG  . ASN A 1 86  ? 25.650  15.700  -16.103 1.00 158.92 ? 86  ASN A CG  1 
ATOM   643  O OD1 . ASN A 1 86  ? 25.224  16.140  -15.035 1.00 164.58 ? 86  ASN A OD1 1 
ATOM   644  N ND2 . ASN A 1 86  ? 26.926  15.385  -16.289 1.00 167.32 ? 86  ASN A ND2 1 
ATOM   645  N N   . LYS A 1 87  ? 21.307  14.387  -18.007 1.00 123.59 ? 87  LYS A N   1 
ATOM   646  C CA  . LYS A 1 87  ? 20.161  14.667  -18.863 1.00 113.60 ? 87  LYS A CA  1 
ATOM   647  C C   . LYS A 1 87  ? 18.881  14.274  -18.138 1.00 103.74 ? 87  LYS A C   1 
ATOM   648  O O   . LYS A 1 87  ? 18.883  13.352  -17.322 1.00 102.03 ? 87  LYS A O   1 
ATOM   649  C CB  . LYS A 1 87  ? 20.283  13.915  -20.177 1.00 111.91 ? 87  LYS A CB  1 
ATOM   650  N N   . PRO A 1 88  ? 17.789  14.972  -18.430 1.00 97.89  ? 88  PRO A N   1 
ATOM   651  C CA  . PRO A 1 88  ? 16.506  14.673  -17.765 1.00 91.21  ? 88  PRO A CA  1 
ATOM   652  C C   . PRO A 1 88  ? 15.662  13.591  -18.454 1.00 83.07  ? 88  PRO A C   1 
ATOM   653  O O   . PRO A 1 88  ? 15.386  13.684  -19.654 1.00 81.77  ? 88  PRO A O   1 
ATOM   654  C CB  . PRO A 1 88  ? 15.778  16.025  -17.784 1.00 92.58  ? 88  PRO A CB  1 
ATOM   655  C CG  . PRO A 1 88  ? 16.321  16.721  -18.957 1.00 96.31  ? 88  PRO A CG  1 
ATOM   656  C CD  . PRO A 1 88  ? 17.747  16.274  -19.131 1.00 99.85  ? 88  PRO A CD  1 
ATOM   657  N N   . LYS A 1 89  ? 15.239  12.596  -17.672 1.00 76.02  ? 89  LYS A N   1 
ATOM   658  C CA  . LYS A 1 89  ? 14.574  11.406  -18.191 1.00 67.96  ? 89  LYS A CA  1 
ATOM   659  C C   . LYS A 1 89  ? 13.132  11.184  -17.724 1.00 63.17  ? 89  LYS A C   1 
ATOM   660  O O   . LYS A 1 89  ? 12.807  11.387  -16.563 1.00 65.72  ? 89  LYS A O   1 
ATOM   661  C CB  . LYS A 1 89  ? 15.418  10.171  -17.858 1.00 67.12  ? 89  LYS A CB  1 
ATOM   662  C CG  . LYS A 1 89  ? 16.490  9.843   -18.889 1.00 68.24  ? 89  LYS A CG  1 
ATOM   663  N N   . THR A 1 90  ? 12.284  10.749  -18.646 1.00 55.11  ? 90  THR A N   1 
ATOM   664  C CA  . THR A 1 90  ? 10.948  10.310  -18.303 1.00 49.87  ? 90  THR A CA  1 
ATOM   665  C C   . THR A 1 90  ? 10.635  8.939   -18.909 1.00 45.22  ? 90  THR A C   1 
ATOM   666  O O   . THR A 1 90  ? 10.683  8.759   -20.119 1.00 44.96  ? 90  THR A O   1 
ATOM   667  C CB  . THR A 1 90  ? 9.900   11.316  -18.774 1.00 50.28  ? 90  THR A CB  1 
ATOM   668  O OG1 . THR A 1 90  ? 10.145  12.581  -18.160 1.00 53.42  ? 90  THR A OG1 1 
ATOM   669  C CG2 . THR A 1 90  ? 8.521   10.855  -18.413 1.00 47.46  ? 90  THR A CG2 1 
ATOM   670  N N   . VAL A 1 91  ? 10.297  7.971   -18.079 1.00 40.82  ? 91  VAL A N   1 
ATOM   671  C CA  . VAL A 1 91  ? 10.010  6.658   -18.609 1.00 36.13  ? 91  VAL A CA  1 
ATOM   672  C C   . VAL A 1 91  ? 8.690   6.192   -18.072 1.00 34.53  ? 91  VAL A C   1 
ATOM   673  O O   . VAL A 1 91  ? 8.424   6.363   -16.901 1.00 34.23  ? 91  VAL A O   1 
ATOM   674  C CB  . VAL A 1 91  ? 11.134  5.647   -18.261 1.00 36.17  ? 91  VAL A CB  1 
ATOM   675  C CG1 . VAL A 1 91  ? 11.000  4.374   -19.097 1.00 30.40  ? 91  VAL A CG1 1 
ATOM   676  C CG2 . VAL A 1 91  ? 12.498  6.296   -18.490 1.00 34.44  ? 91  VAL A CG2 1 
ATOM   677  N N   . ILE A 1 92  ? 7.863   5.601   -18.922 1.00 32.05  ? 92  ILE A N   1 
ATOM   678  C CA  . ILE A 1 92  ? 6.612   5.083   -18.433 1.00 32.23  ? 92  ILE A CA  1 
ATOM   679  C C   . ILE A 1 92  ? 6.657   3.611   -18.530 1.00 31.14  ? 92  ILE A C   1 
ATOM   680  O O   . ILE A 1 92  ? 7.071   3.104   -19.558 1.00 32.18  ? 92  ILE A O   1 
ATOM   681  C CB  . ILE A 1 92  ? 5.465   5.507   -19.277 1.00 32.79  ? 92  ILE A CB  1 
ATOM   682  C CG1 . ILE A 1 92  ? 5.571   6.980   -19.559 1.00 35.15  ? 92  ILE A CG1 1 
ATOM   683  C CG2 . ILE A 1 92  ? 4.194   5.311   -18.506 1.00 33.26  ? 92  ILE A CG2 1 
ATOM   684  C CD1 . ILE A 1 92  ? 5.249   7.771   -18.356 1.00 39.45  ? 92  ILE A CD1 1 
ATOM   685  N N   . TYR A 1 93  ? 6.208   2.920   -17.480 1.00 30.17  ? 93  TYR A N   1 
ATOM   686  C CA  . TYR A 1 93  ? 6.203   1.475   -17.494 1.00 27.96  ? 93  TYR A CA  1 
ATOM   687  C C   . TYR A 1 93  ? 4.827   0.923   -17.187 1.00 27.96  ? 93  TYR A C   1 
ATOM   688  O O   . TYR A 1 93  ? 4.124   1.450   -16.333 1.00 29.18  ? 93  TYR A O   1 
ATOM   689  C CB  . TYR A 1 93  ? 7.156   0.949   -16.433 1.00 28.07  ? 93  TYR A CB  1 
ATOM   690  C CG  . TYR A 1 93  ? 8.610   0.965   -16.763 1.00 25.97  ? 93  TYR A CG  1 
ATOM   691  C CD1 . TYR A 1 93  ? 9.147   0.068   -17.665 1.00 25.53  ? 93  TYR A CD1 1 
ATOM   692  C CD2 . TYR A 1 93  ? 9.470   1.828   -16.106 1.00 27.46  ? 93  TYR A CD2 1 
ATOM   693  C CE1 . TYR A 1 93  ? 10.490  0.066   -17.942 1.00 22.87  ? 93  TYR A CE1 1 
ATOM   694  C CE2 . TYR A 1 93  ? 10.812  1.838   -16.369 1.00 27.12  ? 93  TYR A CE2 1 
ATOM   695  C CZ  . TYR A 1 93  ? 11.307  0.960   -17.289 1.00 27.27  ? 93  TYR A CZ  1 
ATOM   696  O OH  . TYR A 1 93  ? 12.632  1.005   -17.541 1.00 29.97  ? 93  TYR A OH  1 
ATOM   697  N N   . TRP A 1 94  ? 4.495   -0.180  -17.861 1.00 26.45  ? 94  TRP A N   1 
ATOM   698  C CA  . TRP A 1 94  ? 3.337   -1.041  -17.573 1.00 25.93  ? 94  TRP A CA  1 
ATOM   699  C C   . TRP A 1 94  ? 3.878   -2.413  -17.184 1.00 25.15  ? 94  TRP A C   1 
ATOM   700  O O   . TRP A 1 94  ? 5.059   -2.654  -17.358 1.00 25.66  ? 94  TRP A O   1 
ATOM   701  C CB  . TRP A 1 94  ? 2.469   -1.220  -18.799 1.00 25.60  ? 94  TRP A CB  1 
ATOM   702  C CG  . TRP A 1 94  ? 1.559   -0.145  -19.094 1.00 26.34  ? 94  TRP A CG  1 
ATOM   703  C CD1 . TRP A 1 94  ? 0.234   -0.099  -18.807 1.00 28.06  ? 94  TRP A CD1 1 
ATOM   704  C CD2 . TRP A 1 94  ? 1.861   1.051   -19.809 1.00 28.84  ? 94  TRP A CD2 1 
ATOM   705  N NE1 . TRP A 1 94  ? -0.312  1.078   -19.261 1.00 29.15  ? 94  TRP A NE1 1 
ATOM   706  C CE2 . TRP A 1 94  ? 0.672   1.800   -19.884 1.00 29.07  ? 94  TRP A CE2 1 
ATOM   707  C CE3 . TRP A 1 94  ? 3.033   1.575   -20.383 1.00 29.29  ? 94  TRP A CE3 1 
ATOM   708  C CZ2 . TRP A 1 94  ? 0.616   3.025   -20.509 1.00 29.63  ? 94  TRP A CZ2 1 
ATOM   709  C CZ3 . TRP A 1 94  ? 2.973   2.804   -20.996 1.00 29.74  ? 94  TRP A CZ3 1 
ATOM   710  C CH2 . TRP A 1 94  ? 1.772   3.511   -21.063 1.00 29.67  ? 94  TRP A CH2 1 
ATOM   711  N N   . LEU A 1 95  ? 3.033   -3.295  -16.665 1.00 24.78  ? 95  LEU A N   1 
ATOM   712  C CA  . LEU A 1 95  ? 3.475   -4.573  -16.192 1.00 24.45  ? 95  LEU A CA  1 
ATOM   713  C C   . LEU A 1 95  ? 3.020   -5.545  -17.205 1.00 26.20  ? 95  LEU A C   1 
ATOM   714  O O   . LEU A 1 95  ? 1.862   -5.500  -17.611 1.00 32.44  ? 95  LEU A O   1 
ATOM   715  C CB  . LEU A 1 95  ? 2.735   -4.952  -14.944 1.00 25.94  ? 95  LEU A CB  1 
ATOM   716  C CG  . LEU A 1 95  ? 3.401   -4.887  -13.599 1.00 28.83  ? 95  LEU A CG  1 
ATOM   717  C CD1 . LEU A 1 95  ? 2.293   -5.182  -12.648 1.00 34.29  ? 95  LEU A CD1 1 
ATOM   718  C CD2 . LEU A 1 95  ? 4.443   -5.941  -13.461 1.00 30.57  ? 95  LEU A CD2 1 
ATOM   719  N N   . ALA A 1 96  ? 3.868   -6.463  -17.612 1.00 24.10  ? 96  ALA A N   1 
ATOM   720  C CA  . ALA A 1 96  ? 3.395   -7.416  -18.578 1.00 25.82  ? 96  ALA A CA  1 
ATOM   721  C C   . ALA A 1 96  ? 3.880   -8.764  -18.160 1.00 27.15  ? 96  ALA A C   1 
ATOM   722  O O   . ALA A 1 96  ? 4.913   -8.885  -17.522 1.00 27.15  ? 96  ALA A O   1 
ATOM   723  C CB  . ALA A 1 96  ? 3.888   -7.055  -19.986 1.00 23.94  ? 96  ALA A CB  1 
ATOM   724  N N   . GLU A 1 97  ? 3.122   -9.781  -18.501 1.00 30.16  ? 97  GLU A N   1 
ATOM   725  C CA  . GLU A 1 97  ? 3.421   -11.104 -18.032 1.00 32.94  ? 97  GLU A CA  1 
ATOM   726  C C   . GLU A 1 97  ? 3.772   -11.929 -19.218 1.00 33.49  ? 97  GLU A C   1 
ATOM   727  O O   . GLU A 1 97  ? 3.180   -11.770 -20.269 1.00 36.02  ? 97  GLU A O   1 
ATOM   728  C CB  . GLU A 1 97  ? 2.204   -11.701 -17.366 1.00 35.53  ? 97  GLU A CB  1 
ATOM   729  C CG  . GLU A 1 97  ? 2.454   -13.026 -16.747 1.00 39.81  ? 97  GLU A CG  1 
ATOM   730  C CD  . GLU A 1 97  ? 1.212   -13.603 -16.140 1.00 48.11  ? 97  GLU A CD  1 
ATOM   731  O OE1 . GLU A 1 97  ? 1.253   -14.765 -15.680 1.00 51.75  ? 97  GLU A OE1 1 
ATOM   732  O OE2 . GLU A 1 97  ? 0.187   -12.890 -16.136 1.00 51.37  ? 97  GLU A OE2 1 
ATOM   733  N N   . VAL A 1 98  ? 4.750   -12.799 -19.068 1.00 33.37  ? 98  VAL A N   1 
ATOM   734  C CA  . VAL A 1 98  ? 5.092   -13.667 -20.172 1.00 34.16  ? 98  VAL A CA  1 
ATOM   735  C C   . VAL A 1 98  ? 4.304   -14.952 -20.098 1.00 38.09  ? 98  VAL A C   1 
ATOM   736  O O   . VAL A 1 98  ? 4.208   -15.603 -19.068 1.00 39.46  ? 98  VAL A O   1 
ATOM   737  C CB  . VAL A 1 98  ? 6.590   -13.971 -20.252 1.00 32.27  ? 98  VAL A CB  1 
ATOM   738  C CG1 . VAL A 1 98  ? 7.364   -12.740 -20.702 1.00 26.30  ? 98  VAL A CG1 1 
ATOM   739  C CG2 . VAL A 1 98  ? 7.092   -14.507 -18.925 1.00 31.42  ? 98  VAL A CG2 1 
ATOM   740  N N   . LYS A 1 99  ? 3.743   -15.337 -21.239 1.00 41.42  ? 99  LYS A N   1 
ATOM   741  C CA  . LYS A 1 99  ? 2.941   -16.551 -21.332 1.00 46.64  ? 99  LYS A CA  1 
ATOM   742  C C   . LYS A 1 99  ? 3.755   -17.819 -21.074 1.00 47.84  ? 99  LYS A C   1 
ATOM   743  O O   . LYS A 1 99  ? 3.255   -18.772 -20.478 1.00 50.05  ? 99  LYS A O   1 
ATOM   744  C CB  . LYS A 1 99  ? 2.259   -16.637 -22.700 1.00 48.68  ? 99  LYS A CB  1 
ATOM   745  C CG  . LYS A 1 99  ? 1.744   -18.023 -23.051 1.00 55.47  ? 99  LYS A CG  1 
ATOM   746  C CD  . LYS A 1 99  ? 1.369   -18.117 -24.521 1.00 63.15  ? 99  LYS A CD  1 
ATOM   747  C CE  . LYS A 1 99  ? 0.236   -19.107 -24.740 0.00 61.42  ? 99  LYS A CE  1 
ATOM   748  N NZ  . LYS A 1 99  ? -0.200  -19.146 -26.163 0.86 72.09  ? 99  LYS A NZ  1 
ATOM   749  N N   . ASP A 1 100 ? 5.006   -17.831 -21.527 1.00 47.49  ? 100 ASP A N   1 
ATOM   750  C CA  . ASP A 1 100 ? 5.837   -18.997 -21.385 1.00 48.51  ? 100 ASP A CA  1 
ATOM   751  C C   . ASP A 1 100 ? 7.060   -18.682 -20.567 1.00 45.84  ? 100 ASP A C   1 
ATOM   752  O O   . ASP A 1 100 ? 7.736   -17.691 -20.787 1.00 43.25  ? 100 ASP A O   1 
ATOM   753  C CB  . ASP A 1 100 ? 6.246   -19.519 -22.757 1.00 50.64  ? 100 ASP A CB  1 
ATOM   754  C CG  . ASP A 1 100 ? 5.071   -20.093 -23.537 1.00 60.28  ? 100 ASP A CG  1 
ATOM   755  O OD1 . ASP A 1 100 ? 4.982   -19.864 -24.746 1.00 69.27  ? 100 ASP A OD1 1 
ATOM   756  O OD2 . ASP A 1 100 ? 4.225   -20.782 -22.948 1.00 67.49  ? 100 ASP A OD2 1 
ATOM   757  N N   . TYR A 1 101 ? 7.333   -19.554 -19.610 1.00 47.55  ? 101 TYR A N   1 
ATOM   758  C CA  . TYR A 1 101 ? 8.464   -19.427 -18.720 1.00 45.10  ? 101 TYR A CA  1 
ATOM   759  C C   . TYR A 1 101 ? 9.758   -19.341 -19.519 1.00 42.98  ? 101 TYR A C   1 
ATOM   760  O O   . TYR A 1 101 ? 10.689  -18.657 -19.135 1.00 43.78  ? 101 TYR A O   1 
ATOM   761  C CB  . TYR A 1 101 ? 8.472   -20.643 -17.805 1.00 45.23  ? 101 TYR A CB  1 
ATOM   762  C CG  . TYR A 1 101 ? 9.544   -20.682 -16.762 1.00 43.99  ? 101 TYR A CG  1 
ATOM   763  C CD1 . TYR A 1 101 ? 9.330   -20.136 -15.512 1.00 43.83  ? 101 TYR A CD1 1 
ATOM   764  C CD2 . TYR A 1 101 ? 10.742  -21.322 -17.001 1.00 44.42  ? 101 TYR A CD2 1 
ATOM   765  C CE1 . TYR A 1 101 ? 10.280  -20.196 -14.540 1.00 44.58  ? 101 TYR A CE1 1 
ATOM   766  C CE2 . TYR A 1 101 ? 11.703  -21.392 -16.032 1.00 46.20  ? 101 TYR A CE2 1 
ATOM   767  C CZ  . TYR A 1 101 ? 11.467  -20.822 -14.802 1.00 47.20  ? 101 TYR A CZ  1 
ATOM   768  O OH  . TYR A 1 101 ? 12.423  -20.871 -13.836 1.00 49.23  ? 101 TYR A OH  1 
ATOM   769  N N   . ASP A 1 102 ? 9.793   -20.032 -20.643 1.00 42.95  ? 102 ASP A N   1 
ATOM   770  C CA  . ASP A 1 102 ? 11.022  -20.265 -21.354 1.00 42.65  ? 102 ASP A CA  1 
ATOM   771  C C   . ASP A 1 102 ? 11.091  -19.482 -22.634 1.00 40.57  ? 102 ASP A C   1 
ATOM   772  O O   . ASP A 1 102 ? 11.804  -19.851 -23.558 1.00 41.98  ? 102 ASP A O   1 
ATOM   773  C CB  . ASP A 1 102 ? 11.180  -21.761 -21.629 1.00 47.64  ? 102 ASP A CB  1 
ATOM   774  C CG  . ASP A 1 102 ? 10.185  -22.278 -22.622 1.00 53.44  ? 102 ASP A CG  1 
ATOM   775  O OD1 . ASP A 1 102 ? 10.466  -23.310 -23.225 1.00 59.68  ? 102 ASP A OD1 1 
ATOM   776  O OD2 . ASP A 1 102 ? 9.130   -21.664 -22.820 1.00 58.05  ? 102 ASP A OD2 1 
ATOM   777  N N   . VAL A 1 103 ? 10.356  -18.383 -22.664 1.00 35.05  ? 103 VAL A N   1 
ATOM   778  C CA  . VAL A 1 103 ? 10.226  -17.553 -23.835 1.00 31.11  ? 103 VAL A CA  1 
ATOM   779  C C   . VAL A 1 103 ? 11.615  -17.139 -24.201 1.00 31.08  ? 103 VAL A C   1 
ATOM   780  O O   . VAL A 1 103 ? 12.420  -16.862 -23.325 1.00 30.05  ? 103 VAL A O   1 
ATOM   781  C CB  . VAL A 1 103 ? 9.352   -16.301 -23.528 1.00 28.76  ? 103 VAL A CB  1 
ATOM   782  C CG1 . VAL A 1 103 ? 9.796   -15.617 -22.251 1.00 24.24  ? 103 VAL A CG1 1 
ATOM   783  C CG2 . VAL A 1 103 ? 9.370   -15.313 -24.675 1.00 24.76  ? 103 VAL A CG2 1 
ATOM   784  N N   . GLU A 1 104 ? 11.908  -17.140 -25.488 1.00 31.83  ? 104 GLU A N   1 
ATOM   785  C CA  . GLU A 1 104 ? 13.215  -16.768 -25.945 1.00 33.82  ? 104 GLU A CA  1 
ATOM   786  C C   . GLU A 1 104 ? 13.412  -15.261 -25.841 1.00 32.42  ? 104 GLU A C   1 
ATOM   787  O O   . GLU A 1 104 ? 12.656  -14.477 -26.409 1.00 32.21  ? 104 GLU A O   1 
ATOM   788  C CB  . GLU A 1 104 ? 13.435  -17.233 -27.377 1.00 35.89  ? 104 GLU A CB  1 
ATOM   789  C CG  . GLU A 1 104 ? 14.900  -17.192 -27.802 1.00 43.15  ? 104 GLU A CG  1 
ATOM   790  C CD  . GLU A 1 104 ? 15.134  -17.227 -29.323 1.00 47.56  ? 104 GLU A CD  1 
ATOM   791  O OE1 . GLU A 1 104 ? 16.141  -16.664 -29.766 1.00 47.74  ? 104 GLU A OE1 1 
ATOM   792  O OE2 . GLU A 1 104 ? 14.335  -17.808 -30.073 1.00 50.97  ? 104 GLU A OE2 1 
ATOM   793  N N   . ILE A 1 105 ? 14.440  -14.873 -25.098 1.00 31.61  ? 105 ILE A N   1 
ATOM   794  C CA  . ILE A 1 105 ? 14.850  -13.494 -24.963 1.00 30.18  ? 105 ILE A CA  1 
ATOM   795  C C   . ILE A 1 105 ? 15.870  -13.211 -26.028 1.00 32.14  ? 105 ILE A C   1 
ATOM   796  O O   . ILE A 1 105 ? 16.894  -13.882 -26.090 1.00 33.90  ? 105 ILE A O   1 
ATOM   797  C CB  . ILE A 1 105 ? 15.577  -13.301 -23.649 1.00 29.44  ? 105 ILE A CB  1 
ATOM   798  C CG1 . ILE A 1 105 ? 14.651  -13.596 -22.476 1.00 27.60  ? 105 ILE A CG1 1 
ATOM   799  C CG2 . ILE A 1 105 ? 16.143  -11.913 -23.570 1.00 27.37  ? 105 ILE A CG2 1 
ATOM   800  C CD1 . ILE A 1 105 ? 13.340  -12.874 -22.581 1.00 24.36  ? 105 ILE A CD1 1 
ATOM   801  N N   . ARG A 1 106 ? 15.620  -12.233 -26.875 1.00 32.77  ? 106 ARG A N   1 
ATOM   802  C CA  . ARG A 1 106 ? 16.591  -11.974 -27.911 1.00 35.85  ? 106 ARG A CA  1 
ATOM   803  C C   . ARG A 1 106 ? 17.085  -10.558 -27.781 1.00 37.34  ? 106 ARG A C   1 
ATOM   804  O O   . ARG A 1 106 ? 16.357  -9.627  -28.091 1.00 39.88  ? 106 ARG A O   1 
ATOM   805  C CB  . ARG A 1 106 ? 16.016  -12.250 -29.307 1.00 36.67  ? 106 ARG A CB  1 
ATOM   806  N N   . LEU A 1 107 ? 18.320  -10.394 -27.314 1.00 39.16  ? 107 LEU A N   1 
ATOM   807  C CA  . LEU A 1 107 ? 18.875  -9.066  -27.145 1.00 40.60  ? 107 LEU A CA  1 
ATOM   808  C C   . LEU A 1 107 ? 19.365  -8.415  -28.433 1.00 44.83  ? 107 LEU A C   1 
ATOM   809  O O   . LEU A 1 107 ? 19.750  -9.076  -29.397 1.00 46.28  ? 107 LEU A O   1 
ATOM   810  C CB  . LEU A 1 107 ? 19.978  -9.062  -26.102 1.00 39.24  ? 107 LEU A CB  1 
ATOM   811  C CG  . LEU A 1 107 ? 19.624  -9.758  -24.803 1.00 35.44  ? 107 LEU A CG  1 
ATOM   812  C CD1 . LEU A 1 107 ? 20.875  -9.897  -24.020 1.00 35.61  ? 107 LEU A CD1 1 
ATOM   813  C CD2 . LEU A 1 107 ? 18.596  -9.003  -24.008 1.00 30.82  ? 107 LEU A CD2 1 
ATOM   814  N N   . SER A 1 108 ? 19.347  -7.090  -28.422 1.00 48.13  ? 108 SER A N   1 
ATOM   815  C CA  . SER A 1 108 ? 19.968  -6.291  -29.458 1.00 52.23  ? 108 SER A CA  1 
ATOM   816  C C   . SER A 1 108 ? 21.335  -5.846  -28.948 1.00 54.24  ? 108 SER A C   1 
ATOM   817  O O   . SER A 1 108 ? 21.726  -6.203  -27.841 1.00 53.27  ? 108 SER A O   1 
ATOM   818  C CB  . SER A 1 108 ? 19.075  -5.115  -29.834 1.00 52.70  ? 108 SER A CB  1 
ATOM   819  O OG  . SER A 1 108 ? 19.180  -4.072  -28.908 1.00 53.31  ? 108 SER A OG  1 
ATOM   820  N N   . HIS A 1 109 ? 22.061  -5.085  -29.764 1.00 57.64  ? 109 HIS A N   1 
ATOM   821  C CA  . HIS A 1 109 ? 23.409  -4.626  -29.429 1.00 59.55  ? 109 HIS A CA  1 
ATOM   822  C C   . HIS A 1 109 ? 23.395  -3.812  -28.145 1.00 59.09  ? 109 HIS A C   1 
ATOM   823  O O   . HIS A 1 109 ? 24.388  -3.757  -27.446 1.00 59.62  ? 109 HIS A O   1 
ATOM   824  C CB  . HIS A 1 109 ? 24.041  -3.831  -30.592 1.00 62.41  ? 109 HIS A CB  1 
ATOM   825  C CG  . HIS A 1 109 ? 23.398  -2.497  -30.842 0.07 65.66  ? 109 HIS A CG  1 
ATOM   826  N ND1 . HIS A 1 109 ? 22.307  -2.336  -31.671 0.87 67.45  ? 109 HIS A ND1 1 
ATOM   827  C CD2 . HIS A 1 109 ? 23.698  -1.261  -30.373 1.00 68.11  ? 109 HIS A CD2 1 
ATOM   828  C CE1 . HIS A 1 109 ? 21.953  -1.064  -31.690 0.86 70.03  ? 109 HIS A CE1 1 
ATOM   829  N NE2 . HIS A 1 109 ? 22.781  -0.390  -30.909 0.84 69.65  ? 109 HIS A NE2 1 
ATOM   830  N N   . GLU A 1 110 ? 22.264  -3.196  -27.826 1.00 59.18  ? 110 GLU A N   1 
ATOM   831  C CA  . GLU A 1 110 ? 22.189  -2.344  -26.640 1.00 61.20  ? 110 GLU A CA  1 
ATOM   832  C C   . GLU A 1 110 ? 22.481  -3.073  -25.334 1.00 57.55  ? 110 GLU A C   1 
ATOM   833  O O   . GLU A 1 110 ? 22.928  -2.448  -24.372 1.00 57.80  ? 110 GLU A O   1 
ATOM   834  C CB  . GLU A 1 110 ? 20.860  -1.597  -26.556 1.00 63.35  ? 110 GLU A CB  1 
ATOM   835  C CG  . GLU A 1 110 ? 20.742  -0.410  -27.513 1.00 72.03  ? 110 GLU A CG  1 
ATOM   836  C CD  . GLU A 1 110 ? 19.411  0.335   -27.411 1.00 76.85  ? 110 GLU A CD  1 
ATOM   837  O OE1 . GLU A 1 110 ? 18.879  0.514   -26.299 1.00 78.54  ? 110 GLU A OE1 1 
ATOM   838  O OE2 . GLU A 1 110 ? 18.892  0.755   -28.457 1.00 76.69  ? 110 GLU A OE2 1 
ATOM   839  N N   . HIS A 1 111 ? 22.254  -4.386  -25.310 1.00 53.21  ? 111 HIS A N   1 
ATOM   840  C CA  . HIS A 1 111 ? 22.389  -5.175  -24.088 1.00 50.63  ? 111 HIS A CA  1 
ATOM   841  C C   . HIS A 1 111 ? 23.213  -6.410  -24.296 1.00 51.44  ? 111 HIS A C   1 
ATOM   842  O O   . HIS A 1 111 ? 23.250  -6.961  -25.380 1.00 54.19  ? 111 HIS A O   1 
ATOM   843  C CB  . HIS A 1 111 ? 21.020  -5.533  -23.511 1.00 47.91  ? 111 HIS A CB  1 
ATOM   844  C CG  . HIS A 1 111 ? 20.161  -4.339  -23.248 1.00 44.18  ? 111 HIS A CG  1 
ATOM   845  N ND1 . HIS A 1 111 ? 19.234  -3.885  -24.154 1.00 41.34  ? 111 HIS A ND1 1 
ATOM   846  C CD2 . HIS A 1 111 ? 20.130  -3.476  -22.209 1.00 41.17  ? 111 HIS A CD2 1 
ATOM   847  C CE1 . HIS A 1 111 ? 18.661  -2.799  -23.678 1.00 41.88  ? 111 HIS A CE1 1 
ATOM   848  N NE2 . HIS A 1 111 ? 19.188  -2.530  -22.501 1.00 41.73  ? 111 HIS A NE2 1 
ATOM   849  N N   . GLN A 1 112 ? 23.890  -6.842  -23.249 1.00 51.67  ? 112 GLN A N   1 
ATOM   850  C CA  . GLN A 1 112 ? 24.823  -7.938  -23.386 1.00 52.42  ? 112 GLN A CA  1 
ATOM   851  C C   . GLN A 1 112 ? 24.403  -9.184  -22.617 1.00 49.95  ? 112 GLN A C   1 
ATOM   852  O O   . GLN A 1 112 ? 24.889  -10.264 -22.891 1.00 51.18  ? 112 GLN A O   1 
ATOM   853  C CB  . GLN A 1 112 ? 26.206  -7.476  -22.966 1.00 55.95  ? 112 GLN A CB  1 
ATOM   854  C CG  . GLN A 1 112 ? 26.198  -6.502  -21.792 1.00 61.82  ? 112 GLN A CG  1 
ATOM   855  C CD  . GLN A 1 112 ? 27.566  -6.327  -21.151 1.00 69.33  ? 112 GLN A CD  1 
ATOM   856  O OE1 . GLN A 1 112 ? 27.764  -6.694  -20.004 1.00 72.29  ? 112 GLN A OE1 1 
ATOM   857  N NE2 . GLN A 1 112 ? 28.508  -5.768  -21.891 1.00 73.34  ? 112 GLN A NE2 1 
ATOM   858  N N   . ALA A 1 113 ? 23.493  -9.028  -21.663 1.00 46.07  ? 113 ALA A N   1 
ATOM   859  C CA  . ALA A 1 113 ? 22.961  -10.146 -20.899 1.00 42.82  ? 113 ALA A CA  1 
ATOM   860  C C   . ALA A 1 113 ? 21.587  -9.808  -20.326 1.00 39.25  ? 113 ALA A C   1 
ATOM   861  O O   . ALA A 1 113 ? 21.219  -8.653  -20.208 1.00 38.26  ? 113 ALA A O   1 
ATOM   862  C CB  . ALA A 1 113 ? 23.915  -10.513 -19.787 1.00 44.32  ? 113 ALA A CB  1 
ATOM   863  N N   . TYR A 1 114 ? 20.844  -10.832 -19.943 1.00 36.28  ? 114 TYR A N   1 
ATOM   864  C CA  . TYR A 1 114 ? 19.636  -10.637 -19.207 1.00 32.56  ? 114 TYR A CA  1 
ATOM   865  C C   . TYR A 1 114 ? 19.642  -11.539 -17.975 1.00 34.14  ? 114 TYR A C   1 
ATOM   866  O O   . TYR A 1 114 ? 20.488  -12.437 -17.876 1.00 36.88  ? 114 TYR A O   1 
ATOM   867  C CB  . TYR A 1 114 ? 18.453  -10.903 -20.103 1.00 29.36  ? 114 TYR A CB  1 
ATOM   868  C CG  . TYR A 1 114 ? 18.167  -12.349 -20.364 1.00 29.40  ? 114 TYR A CG  1 
ATOM   869  C CD1 . TYR A 1 114 ? 18.627  -12.970 -21.520 1.00 26.72  ? 114 TYR A CD1 1 
ATOM   870  C CD2 . TYR A 1 114 ? 17.387  -13.099 -19.481 1.00 28.89  ? 114 TYR A CD2 1 
ATOM   871  C CE1 . TYR A 1 114 ? 18.363  -14.268 -21.775 1.00 26.79  ? 114 TYR A CE1 1 
ATOM   872  C CE2 . TYR A 1 114 ? 17.120  -14.421 -19.736 1.00 28.93  ? 114 TYR A CE2 1 
ATOM   873  C CZ  . TYR A 1 114 ? 17.612  -14.986 -20.891 1.00 30.80  ? 114 TYR A CZ  1 
ATOM   874  O OH  . TYR A 1 114 ? 17.360  -16.290 -21.189 1.00 36.58  ? 114 TYR A OH  1 
ATOM   875  N N   . ARG A 1 115 ? 18.736  -11.283 -17.028 1.00 32.63  ? 115 ARG A N   1 
ATOM   876  C CA  . ARG A 1 115 ? 18.582  -12.128 -15.853 1.00 34.45  ? 115 ARG A CA  1 
ATOM   877  C C   . ARG A 1 115 ? 17.113  -12.150 -15.479 1.00 32.69  ? 115 ARG A C   1 
ATOM   878  O O   . ARG A 1 115 ? 16.449  -11.149 -15.611 1.00 30.95  ? 115 ARG A O   1 
ATOM   879  C CB  . ARG A 1 115 ? 19.395  -11.571 -14.665 1.00 36.76  ? 115 ARG A CB  1 
ATOM   880  C CG  . ARG A 1 115 ? 20.922  -11.644 -14.776 1.00 41.16  ? 115 ARG A CG  1 
ATOM   881  C CD  . ARG A 1 115 ? 21.463  -12.841 -14.016 1.00 49.18  ? 115 ARG A CD  1 
ATOM   882  N NE  . ARG A 1 115 ? 22.789  -12.642 -13.422 1.00 56.20  ? 115 ARG A NE  1 
ATOM   883  C CZ  . ARG A 1 115 ? 23.085  -12.879 -12.138 1.00 63.21  ? 115 ARG A CZ  1 
ATOM   884  N NH1 . ARG A 1 115 ? 22.157  -13.307 -11.295 1.00 62.61  ? 115 ARG A NH1 1 
ATOM   885  N NH2 . ARG A 1 115 ? 24.318  -12.706 -11.686 1.00 67.52  ? 115 ARG A NH2 1 
ATOM   886  N N   . TRP A 1 116 ? 16.609  -13.284 -15.006 1.00 33.22  ? 116 TRP A N   1 
ATOM   887  C CA  . TRP A 1 116 ? 15.257  -13.377 -14.448 1.00 32.33  ? 116 TRP A CA  1 
ATOM   888  C C   . TRP A 1 116 ? 15.375  -13.349 -12.934 1.00 34.80  ? 116 TRP A C   1 
ATOM   889  O O   . TRP A 1 116 ? 16.057  -14.178 -12.365 1.00 37.36  ? 116 TRP A O   1 
ATOM   890  C CB  . TRP A 1 116 ? 14.608  -14.681 -14.849 1.00 31.70  ? 116 TRP A CB  1 
ATOM   891  C CG  . TRP A 1 116 ? 13.971  -14.659 -16.174 1.00 31.00  ? 116 TRP A CG  1 
ATOM   892  C CD1 . TRP A 1 116 ? 14.402  -15.291 -17.306 1.00 30.80  ? 116 TRP A CD1 1 
ATOM   893  C CD2 . TRP A 1 116 ? 12.758  -13.988 -16.528 1.00 28.19  ? 116 TRP A CD2 1 
ATOM   894  N NE1 . TRP A 1 116 ? 13.537  -15.038 -18.338 1.00 28.55  ? 116 TRP A NE1 1 
ATOM   895  C CE2 . TRP A 1 116 ? 12.521  -14.242 -17.886 1.00 27.39  ? 116 TRP A CE2 1 
ATOM   896  C CE3 . TRP A 1 116 ? 11.857  -13.192 -15.829 1.00 26.72  ? 116 TRP A CE3 1 
ATOM   897  C CZ2 . TRP A 1 116 ? 11.408  -13.735 -18.557 1.00 27.70  ? 116 TRP A CZ2 1 
ATOM   898  C CZ3 . TRP A 1 116 ? 10.760  -12.683 -16.490 1.00 27.58  ? 116 TRP A CZ3 1 
ATOM   899  C CH2 . TRP A 1 116 ? 10.535  -12.957 -17.840 1.00 25.65  ? 116 TRP A CH2 1 
ATOM   900  N N   . LEU A 1 117 ? 14.703  -12.416 -12.274 1.00 34.52  ? 117 LEU A N   1 
ATOM   901  C CA  . LEU A 1 117 ? 14.919  -12.235 -10.853 1.00 37.66  ? 117 LEU A CA  1 
ATOM   902  C C   . LEU A 1 117 ? 13.704  -12.055 -9.959  1.00 39.14  ? 117 LEU A C   1 
ATOM   903  O O   . LEU A 1 117 ? 12.705  -11.437 -10.337 1.00 37.95  ? 117 LEU A O   1 
ATOM   904  C CB  . LEU A 1 117 ? 15.804  -11.028 -10.647 1.00 37.37  ? 117 LEU A CB  1 
ATOM   905  C CG  . LEU A 1 117 ? 17.178  -11.047 -11.289 1.00 38.67  ? 117 LEU A CG  1 
ATOM   906  C CD1 . LEU A 1 117 ? 17.841  -9.739  -10.983 1.00 38.05  ? 117 LEU A CD1 1 
ATOM   907  C CD2 . LEU A 1 117 ? 18.003  -12.196 -10.759 1.00 40.45  ? 117 LEU A CD2 1 
ATOM   908  N N   . GLY A 1 118 ? 13.824  -12.574 -8.739  1.00 44.03  ? 118 GLY A N   1 
ATOM   909  C CA  . GLY A 1 118 ? 12.845  -12.348 -7.682  1.00 44.65  ? 118 GLY A CA  1 
ATOM   910  C C   . GLY A 1 118 ? 12.955  -10.906 -7.283  1.00 43.52  ? 118 GLY A C   1 
ATOM   911  O O   . GLY A 1 118 ? 13.980  -10.269 -7.534  1.00 43.08  ? 118 GLY A O   1 
ATOM   912  N N   . LEU A 1 119 ? 11.912  -10.385 -6.657  1.00 44.00  ? 119 LEU A N   1 
ATOM   913  C CA  . LEU A 1 119 ? 11.843  -8.959  -6.416  1.00 44.47  ? 119 LEU A CA  1 
ATOM   914  C C   . LEU A 1 119 ? 13.052  -8.381  -5.698  1.00 48.14  ? 119 LEU A C   1 
ATOM   915  O O   . LEU A 1 119 ? 13.576  -7.369  -6.100  1.00 48.20  ? 119 LEU A O   1 
ATOM   916  C CB  . LEU A 1 119 ? 10.546  -8.579  -5.707  1.00 43.90  ? 119 LEU A CB  1 
ATOM   917  C CG  . LEU A 1 119 ? 10.319  -7.137  -5.230  1.00 41.11  ? 119 LEU A CG  1 
ATOM   918  C CD1 . LEU A 1 119 ? 10.432  -6.138  -6.346  1.00 33.87  ? 119 LEU A CD1 1 
ATOM   919  C CD2 . LEU A 1 119 ? 8.961   -7.072  -4.635  1.00 39.00  ? 119 LEU A CD2 1 
ATOM   920  N N   . GLU A 1 120 ? 13.524  -9.020  -4.653  1.00 54.05  ? 120 GLU A N   1 
ATOM   921  C CA  . GLU A 1 120 ? 14.644  -8.439  -3.929  1.00 59.63  ? 120 GLU A CA  1 
ATOM   922  C C   . GLU A 1 120 ? 15.921  -8.306  -4.745  1.00 58.09  ? 120 GLU A C   1 
ATOM   923  O O   . GLU A 1 120 ? 16.554  -7.254  -4.728  1.00 58.28  ? 120 GLU A O   1 
ATOM   924  C CB  . GLU A 1 120 ? 14.930  -9.218  -2.657  1.00 65.06  ? 120 GLU A CB  1 
ATOM   925  C CG  . GLU A 1 120 ? 15.802  -8.470  -1.701  1.00 75.45  ? 120 GLU A CG  1 
ATOM   926  C CD  . GLU A 1 120 ? 16.183  -9.338  -0.569  1.00 95.79  ? 120 GLU A CD  1 
ATOM   927  O OE1 . GLU A 1 120 ? 16.056  -8.882  0.579   1.00 106.37 ? 120 GLU A OE1 1 
ATOM   928  O OE2 . GLU A 1 120 ? 16.580  -10.494 -0.822  1.00 102.45 ? 120 GLU A OE2 1 
ATOM   929  N N   . GLU A 1 121 ? 16.303  -9.366  -5.445  1.00 57.12  ? 121 GLU A N   1 
ATOM   930  C CA  . GLU A 1 121 ? 17.544  -9.345  -6.205  1.00 57.41  ? 121 GLU A CA  1 
ATOM   931  C C   . GLU A 1 121 ? 17.429  -8.341  -7.356  1.00 52.83  ? 121 GLU A C   1 
ATOM   932  O O   . GLU A 1 121 ? 18.381  -7.630  -7.671  1.00 52.40  ? 121 GLU A O   1 
ATOM   933  C CB  . GLU A 1 121 ? 17.920  -10.744 -6.700  1.00 60.25  ? 121 GLU A CB  1 
ATOM   934  C CG  . GLU A 1 121 ? 18.129  -11.786 -5.587  1.00 74.50  ? 121 GLU A CG  1 
ATOM   935  C CD  . GLU A 1 121 ? 16.827  -12.346 -4.976  1.00 85.06  ? 121 GLU A CD  1 
ATOM   936  O OE1 . GLU A 1 121 ? 15.753  -11.727 -5.136  1.00 84.76  ? 121 GLU A OE1 1 
ATOM   937  O OE2 . GLU A 1 121 ? 16.884  -13.408 -4.318  1.00 93.85  ? 121 GLU A OE2 1 
ATOM   938  N N   . ALA A 1 122 ? 16.244  -8.263  -7.953  1.00 49.17  ? 122 ALA A N   1 
ATOM   939  C CA  . ALA A 1 122 ? 15.976  -7.300  -9.015  1.00 45.80  ? 122 ALA A CA  1 
ATOM   940  C C   . ALA A 1 122 ? 16.213  -5.854  -8.590  1.00 46.02  ? 122 ALA A C   1 
ATOM   941  O O   . ALA A 1 122 ? 16.822  -5.092  -9.325  1.00 44.51  ? 122 ALA A O   1 
ATOM   942  C CB  . ALA A 1 122 ? 14.557  -7.460  -9.500  1.00 43.85  ? 122 ALA A CB  1 
ATOM   943  N N   . CYS A 1 123 ? 15.697  -5.479  -7.422  1.00 47.48  ? 123 CYS A N   1 
ATOM   944  C CA  . CYS A 1 123 ? 15.913  -4.156  -6.857  1.00 49.11  ? 123 CYS A CA  1 
ATOM   945  C C   . CYS A 1 123 ? 17.382  -3.930  -6.586  1.00 52.93  ? 123 CYS A C   1 
ATOM   946  O O   . CYS A 1 123 ? 17.911  -2.855  -6.840  1.00 52.42  ? 123 CYS A O   1 
ATOM   947  C CB  . CYS A 1 123 ? 15.117  -3.977  -5.570  1.00 50.41  ? 123 CYS A CB  1 
ATOM   948  S SG  . CYS A 1 123 ? 13.340  -4.048  -5.752  1.00 45.80  ? 123 CYS A SG  1 
ATOM   949  N N   . GLN A 1 124 ? 18.034  -4.962  -6.065  1.00 57.57  ? 124 GLN A N   1 
ATOM   950  C CA  . GLN A 1 124 ? 19.453  -4.916  -5.780  1.00 63.09  ? 124 GLN A CA  1 
ATOM   951  C C   . GLN A 1 124 ? 20.281  -4.671  -7.032  1.00 61.85  ? 124 GLN A C   1 
ATOM   952  O O   . GLN A 1 124 ? 21.261  -3.927  -6.987  1.00 64.79  ? 124 GLN A O   1 
ATOM   953  C CB  . GLN A 1 124 ? 19.905  -6.197  -5.076  1.00 71.16  ? 124 GLN A CB  1 
ATOM   954  C CG  . GLN A 1 124 ? 19.940  -6.126  -3.539  1.00 83.06  ? 124 GLN A CG  1 
ATOM   955  C CD  . GLN A 1 124 ? 21.235  -5.538  -2.992  1.00 92.40  ? 124 GLN A CD  1 
ATOM   956  O OE1 . GLN A 1 124 ? 21.344  -5.272  -1.797  1.00 99.82  ? 124 GLN A OE1 1 
ATOM   957  N NE2 . GLN A 1 124 ? 22.223  -5.335  -3.868  1.00 91.80  ? 124 GLN A NE2 1 
ATOM   958  N N   . LEU A 1 125 ? 19.891  -5.309  -8.137  1.00 59.20  ? 125 LEU A N   1 
ATOM   959  C CA  . LEU A 1 125 ? 20.550  -5.102  -9.432  1.00 57.95  ? 125 LEU A CA  1 
ATOM   960  C C   . LEU A 1 125 ? 20.210  -3.787  -10.117 1.00 56.85  ? 125 LEU A C   1 
ATOM   961  O O   . LEU A 1 125 ? 21.061  -3.160  -10.717 1.00 56.97  ? 125 LEU A O   1 
ATOM   962  C CB  . LEU A 1 125 ? 20.232  -6.230  -10.389 1.00 55.87  ? 125 LEU A CB  1 
ATOM   963  C CG  . LEU A 1 125 ? 21.327  -7.203  -10.746 1.00 56.73  ? 125 LEU A CG  1 
ATOM   964  C CD1 . LEU A 1 125 ? 20.961  -7.823  -12.044 1.00 53.65  ? 125 LEU A CD1 1 
ATOM   965  C CD2 . LEU A 1 125 ? 22.609  -6.464  -10.887 1.00 61.72  ? 125 LEU A CD2 1 
ATOM   966  N N   . ALA A 1 126 ? 18.954  -3.378  -10.060 1.00 56.17  ? 126 ALA A N   1 
ATOM   967  C CA  . ALA A 1 126 ? 18.575  -2.141  -10.690 1.00 56.54  ? 126 ALA A CA  1 
ATOM   968  C C   . ALA A 1 126 ? 19.289  -0.955  -10.046 1.00 60.42  ? 126 ALA A C   1 
ATOM   969  O O   . ALA A 1 126 ? 19.665  -0.016  -10.732 1.00 60.21  ? 126 ALA A O   1 
ATOM   970  C CB  . ALA A 1 126 ? 17.107  -1.975  -10.628 1.00 54.71  ? 126 ALA A CB  1 
ATOM   971  N N   . GLN A 1 127 ? 19.468  -1.013  -8.725  1.00 65.36  ? 127 GLN A N   1 
ATOM   972  C CA  . GLN A 1 127 ? 20.250  -0.024  -7.959  1.00 70.06  ? 127 GLN A CA  1 
ATOM   973  C C   . GLN A 1 127 ? 19.572  1.336   -7.747  1.00 72.31  ? 127 GLN A C   1 
ATOM   974  O O   . GLN A 1 127 ? 19.423  1.775   -6.606  1.00 74.24  ? 127 GLN A O   1 
ATOM   975  C CB  . GLN A 1 127 ? 21.679  0.142   -8.517  1.00 70.79  ? 127 GLN A CB  1 
ATOM   976  N N   . PHE A 1 128 ? 19.172  1.985   -8.842  1.00 70.94  ? 128 PHE A N   1 
ATOM   977  C CA  . PHE A 1 128 ? 18.536  3.310   -8.813  1.00 68.78  ? 128 PHE A CA  1 
ATOM   978  C C   . PHE A 1 128 ? 17.208  3.285   -8.061  1.00 64.49  ? 128 PHE A C   1 
ATOM   979  O O   . PHE A 1 128 ? 16.435  2.351   -8.204  1.00 62.87  ? 128 PHE A O   1 
ATOM   980  C CB  . PHE A 1 128 ? 18.358  3.821   -10.243 1.00 67.31  ? 128 PHE A CB  1 
ATOM   981  C CG  . PHE A 1 128 ? 17.586  5.087   -10.345 1.00 72.33  ? 128 PHE A CG  1 
ATOM   982  C CD1 . PHE A 1 128 ? 17.653  6.047   -9.324  1.00 80.94  ? 128 PHE A CD1 1 
ATOM   983  C CD2 . PHE A 1 128 ? 16.801  5.335   -11.464 1.00 72.67  ? 128 PHE A CD2 1 
ATOM   984  C CE1 . PHE A 1 128 ? 16.939  7.231   -9.402  1.00 82.88  ? 128 PHE A CE1 1 
ATOM   985  C CE2 . PHE A 1 128 ? 16.090  6.511   -11.562 1.00 77.16  ? 128 PHE A CE2 1 
ATOM   986  C CZ  . PHE A 1 128 ? 16.159  7.469   -10.521 1.00 82.00  ? 128 PHE A CZ  1 
ATOM   987  N N   . LYS A 1 129 ? 16.961  4.303   -7.250  1.00 64.68  ? 129 LYS A N   1 
ATOM   988  C CA  . LYS A 1 129 ? 15.816  4.296   -6.348  1.00 63.93  ? 129 LYS A CA  1 
ATOM   989  C C   . LYS A 1 129 ? 14.487  4.283   -7.068  1.00 58.98  ? 129 LYS A C   1 
ATOM   990  O O   . LYS A 1 129 ? 13.587  3.567   -6.672  1.00 57.76  ? 129 LYS A O   1 
ATOM   991  C CB  . LYS A 1 129 ? 15.871  5.438   -5.313  1.00 68.25  ? 129 LYS A CB  1 
ATOM   992  C CG  . LYS A 1 129 ? 16.329  6.781   -5.857  1.00 76.67  ? 129 LYS A CG  1 
ATOM   993  C CD  . LYS A 1 129 ? 16.077  7.911   -4.861  1.00 87.69  ? 129 LYS A CD  1 
ATOM   994  C CE  . LYS A 1 129 ? 16.191  9.295   -5.521  1.00 93.70  ? 129 LYS A CE  1 
ATOM   995  N NZ  . LYS A 1 129 ? 17.512  9.949   -5.268  1.00 99.67  ? 129 LYS A NZ  1 
ATOM   996  N N   . GLU A 1 130 ? 14.364  5.053   -8.131  1.00 55.49  ? 130 GLU A N   1 
ATOM   997  C CA  . GLU A 1 130 ? 13.103  5.104   -8.825  1.00 52.33  ? 130 GLU A CA  1 
ATOM   998  C C   . GLU A 1 130 ? 12.727  3.787   -9.501  1.00 47.53  ? 130 GLU A C   1 
ATOM   999  O O   . GLU A 1 130 ? 11.559  3.410   -9.542  1.00 45.25  ? 130 GLU A O   1 
ATOM   1000 C CB  . GLU A 1 130 ? 13.089  6.253   -9.804  1.00 53.35  ? 130 GLU A CB  1 
ATOM   1001 C CG  . GLU A 1 130 ? 12.189  7.348   -9.357  1.00 64.44  ? 130 GLU A CG  1 
ATOM   1002 C CD  . GLU A 1 130 ? 12.809  8.708   -9.467  1.00 79.58  ? 130 GLU A CD  1 
ATOM   1003 O OE1 . GLU A 1 130 ? 14.058  8.822   -9.454  1.00 86.37  ? 130 GLU A OE1 1 
ATOM   1004 O OE2 . GLU A 1 130 ? 12.028  9.675   -9.547  1.00 84.37  ? 130 GLU A OE2 1 
ATOM   1005 N N   . MET A 1 131 ? 13.715  3.081   -10.021 1.00 44.49  ? 131 MET A N   1 
ATOM   1006 C CA  . MET A 1 131 ? 13.435  1.806   -10.622 1.00 40.85  ? 131 MET A CA  1 
ATOM   1007 C C   . MET A 1 131 ? 13.046  0.815   -9.543  1.00 40.72  ? 131 MET A C   1 
ATOM   1008 O O   . MET A 1 131 ? 12.172  -0.025  -9.750  1.00 38.97  ? 131 MET A O   1 
ATOM   1009 C CB  . MET A 1 131 ? 14.630  1.302   -11.434 1.00 40.79  ? 131 MET A CB  1 
ATOM   1010 C CG  . MET A 1 131 ? 14.391  0.006   -12.226 1.00 37.95  ? 131 MET A CG  1 
ATOM   1011 S SD  . MET A 1 131 ? 13.014  0.104   -13.377 1.00 35.06  ? 131 MET A SD  1 
ATOM   1012 C CE  . MET A 1 131 ? 13.551  1.416   -14.438 1.00 34.50  ? 131 MET A CE  1 
ATOM   1013 N N   . LYS A 1 132 ? 13.702  0.897   -8.391  1.00 41.77  ? 132 LYS A N   1 
ATOM   1014 C CA  . LYS A 1 132 ? 13.436  -0.066  -7.333  1.00 43.03  ? 132 LYS A CA  1 
ATOM   1015 C C   . LYS A 1 132 ? 12.026  0.140   -6.837  1.00 40.27  ? 132 LYS A C   1 
ATOM   1016 O O   . LYS A 1 132 ? 11.261  -0.792  -6.611  1.00 39.41  ? 132 LYS A O   1 
ATOM   1017 C CB  . LYS A 1 132 ? 14.399  0.132   -6.176  1.00 49.53  ? 132 LYS A CB  1 
ATOM   1018 C CG  . LYS A 1 132 ? 15.830  -0.254  -6.445  1.00 56.89  ? 132 LYS A CG  1 
ATOM   1019 C CD  . LYS A 1 132 ? 16.740  0.206   -5.304  1.00 67.73  ? 132 LYS A CD  1 
ATOM   1020 C CE  . LYS A 1 132 ? 16.706  -0.759  -4.136  1.00 72.43  ? 132 LYS A CE  1 
ATOM   1021 N NZ  . LYS A 1 132 ? 17.902  -0.621  -3.269  1.00 80.20  ? 132 LYS A NZ  1 
ATOM   1022 N N   . ALA A 1 133 ? 11.692  1.404   -6.693  1.00 38.27  ? 133 ALA A N   1 
ATOM   1023 C CA  . ALA A 1 133 ? 10.400  1.795   -6.208  1.00 36.24  ? 133 ALA A CA  1 
ATOM   1024 C C   . ALA A 1 133 ? 9.345   1.274   -7.129  1.00 32.49  ? 133 ALA A C   1 
ATOM   1025 O O   . ALA A 1 133 ? 8.312   0.827   -6.675  1.00 33.28  ? 133 ALA A O   1 
ATOM   1026 C CB  . ALA A 1 133 ? 10.314  3.280   -6.132  1.00 36.76  ? 133 ALA A CB  1 
ATOM   1027 N N   . ALA A 1 134 ? 9.607   1.344   -8.428  1.00 28.28  ? 134 ALA A N   1 
ATOM   1028 C CA  . ALA A 1 134 ? 8.619   0.945   -9.424  1.00 25.03  ? 134 ALA A CA  1 
ATOM   1029 C C   . ALA A 1 134 ? 8.403   -0.560  -9.467  1.00 24.15  ? 134 ALA A C   1 
ATOM   1030 O O   . ALA A 1 134 ? 7.288   -1.016  -9.669  1.00 23.23  ? 134 ALA A O   1 
ATOM   1031 C CB  . ALA A 1 134 ? 8.999   1.461   -10.782 1.00 21.89  ? 134 ALA A CB  1 
ATOM   1032 N N   . LEU A 1 135 ? 9.472   -1.327  -9.287  1.00 24.17  ? 135 LEU A N   1 
ATOM   1033 C CA  . LEU A 1 135 ? 9.368   -2.770  -9.322  1.00 24.45  ? 135 LEU A CA  1 
ATOM   1034 C C   . LEU A 1 135 ? 8.635   -3.245  -8.085  1.00 27.90  ? 135 LEU A C   1 
ATOM   1035 O O   . LEU A 1 135 ? 7.789   -4.134  -8.158  1.00 28.60  ? 135 LEU A O   1 
ATOM   1036 C CB  . LEU A 1 135 ? 10.762  -3.397  -9.357  1.00 24.75  ? 135 LEU A CB  1 
ATOM   1037 C CG  . LEU A 1 135 ? 11.753  -3.009  -10.459 1.00 21.73  ? 135 LEU A CG  1 
ATOM   1038 C CD1 . LEU A 1 135 ? 13.106  -3.394  -10.052 1.00 22.47  ? 135 LEU A CD1 1 
ATOM   1039 C CD2 . LEU A 1 135 ? 11.434  -3.706  -11.730 1.00 15.92  ? 135 LEU A CD2 1 
ATOM   1040 N N   . GLN A 1 136 ? 8.975   -2.648  -6.946  1.00 30.62  ? 136 GLN A N   1 
ATOM   1041 C CA  . GLN A 1 136 ? 8.297   -2.942  -5.717  1.00 34.32  ? 136 GLN A CA  1 
ATOM   1042 C C   . GLN A 1 136 ? 6.828   -2.648  -5.818  1.00 34.41  ? 136 GLN A C   1 
ATOM   1043 O O   . GLN A 1 136 ? 6.040   -3.458  -5.347  1.00 36.57  ? 136 GLN A O   1 
ATOM   1044 C CB  . GLN A 1 136 ? 8.880   -2.148  -4.568  1.00 36.68  ? 136 GLN A CB  1 
ATOM   1045 C CG  . GLN A 1 136 ? 10.174  -2.651  -4.085  1.00 42.85  ? 136 GLN A CG  1 
ATOM   1046 C CD  . GLN A 1 136 ? 10.854  -1.665  -3.201  1.00 52.92  ? 136 GLN A CD  1 
ATOM   1047 O OE1 . GLN A 1 136 ? 10.267  -0.672  -2.803  1.00 58.66  ? 136 GLN A OE1 1 
ATOM   1048 N NE2 . GLN A 1 136 ? 12.100  -1.919  -2.890  1.00 56.15  ? 136 GLN A NE2 1 
ATOM   1049 N N   . GLU A 1 137 ? 6.444   -1.498  -6.383  1.00 33.35  ? 137 GLU A N   1 
ATOM   1050 C CA  . GLU A 1 137 ? 5.022   -1.203  -6.429  1.00 34.32  ? 137 GLU A CA  1 
ATOM   1051 C C   . GLU A 1 137 ? 4.349   -2.086  -7.449  1.00 33.71  ? 137 GLU A C   1 
ATOM   1052 O O   . GLU A 1 137 ? 3.190   -2.463  -7.269  1.00 33.92  ? 137 GLU A O   1 
ATOM   1053 C CB  . GLU A 1 137 ? 4.628   0.287   -6.505  1.00 34.37  ? 137 GLU A CB  1 
ATOM   1054 C CG  . GLU A 1 137 ? 5.478   1.216   -7.307  1.00 35.09  ? 137 GLU A CG  1 
ATOM   1055 C CD  . GLU A 1 137 ? 5.782   2.526   -6.594  1.00 37.83  ? 137 GLU A CD  1 
ATOM   1056 O OE1 . GLU A 1 137 ? 6.040   3.515   -7.273  1.00 36.56  ? 137 GLU A OE1 1 
ATOM   1057 O OE2 . GLU A 1 137 ? 5.816   2.566   -5.360  1.00 41.73  ? 137 GLU A OE2 1 
ATOM   1058 N N   . GLY A 1 138 ? 5.107   -2.481  -8.478  1.00 32.53  ? 138 GLY A N   1 
ATOM   1059 C CA  . GLY A 1 138 ? 4.609   -3.413  -9.485  1.00 31.12  ? 138 GLY A CA  1 
ATOM   1060 C C   . GLY A 1 138 ? 4.199   -4.729  -8.850  1.00 33.55  ? 138 GLY A C   1 
ATOM   1061 O O   . GLY A 1 138 ? 3.128   -5.274  -9.107  1.00 32.53  ? 138 GLY A O   1 
ATOM   1062 N N   . HIS A 1 139 ? 5.075   -5.225  -7.997  1.00 35.77  ? 139 HIS A N   1 
ATOM   1063 C CA  . HIS A 1 139 ? 4.893   -6.508  -7.384  1.00 39.54  ? 139 HIS A CA  1 
ATOM   1064 C C   . HIS A 1 139 ? 3.689   -6.462  -6.469  1.00 42.52  ? 139 HIS A C   1 
ATOM   1065 O O   . HIS A 1 139 ? 2.782   -7.293  -6.537  1.00 43.64  ? 139 HIS A O   1 
ATOM   1066 C CB  . HIS A 1 139 ? 6.138   -6.813  -6.569  1.00 41.55  ? 139 HIS A CB  1 
ATOM   1067 C CG  . HIS A 1 139 ? 6.167   -8.194  -6.012  1.00 45.08  ? 139 HIS A CG  1 
ATOM   1068 N ND1 . HIS A 1 139 ? 6.026   -8.452  -4.672  1.00 50.97  ? 139 HIS A ND1 1 
ATOM   1069 C CD2 . HIS A 1 139 ? 6.326   -9.393  -6.611  1.00 46.60  ? 139 HIS A CD2 1 
ATOM   1070 C CE1 . HIS A 1 139 ? 6.108   -9.752  -4.467  1.00 53.56  ? 139 HIS A CE1 1 
ATOM   1071 N NE2 . HIS A 1 139 ? 6.284   -10.347 -5.629  1.00 50.40  ? 139 HIS A NE2 1 
ATOM   1072 N N   . GLN A 1 140 ? 3.707   -5.459  -5.610  1.00 44.60  ? 140 GLN A N   1 
ATOM   1073 C CA  . GLN A 1 140 ? 2.629   -5.168  -4.702  1.00 47.81  ? 140 GLN A CA  1 
ATOM   1074 C C   . GLN A 1 140 ? 1.315   -5.067  -5.448  1.00 45.83  ? 140 GLN A C   1 
ATOM   1075 O O   . GLN A 1 140 ? 0.317   -5.613  -5.015  1.00 48.35  ? 140 GLN A O   1 
ATOM   1076 C CB  . GLN A 1 140 ? 2.959   -3.878  -3.995  1.00 51.94  ? 140 GLN A CB  1 
ATOM   1077 C CG  . GLN A 1 140 ? 1.856   -3.229  -3.230  1.00 61.60  ? 140 GLN A CG  1 
ATOM   1078 C CD  . GLN A 1 140 ? 2.375   -2.061  -2.429  1.00 71.53  ? 140 GLN A CD  1 
ATOM   1079 O OE1 . GLN A 1 140 ? 3.495   -1.583  -2.645  1.00 72.78  ? 140 GLN A OE1 1 
ATOM   1080 N NE2 . GLN A 1 140 ? 1.578   -1.606  -1.485  1.00 78.66  ? 140 GLN A NE2 1 
ATOM   1081 N N   . PHE A 1 141 ? 1.304   -4.403  -6.589  1.00 42.53  ? 141 PHE A N   1 
ATOM   1082 C CA  . PHE A 1 141 ? 0.098   -4.422  -7.357  1.00 41.82  ? 141 PHE A CA  1 
ATOM   1083 C C   . PHE A 1 141 ? -0.322  -5.844  -7.663  1.00 42.56  ? 141 PHE A C   1 
ATOM   1084 O O   . PHE A 1 141 ? -1.467  -6.200  -7.460  1.00 43.78  ? 141 PHE A O   1 
ATOM   1085 C CB  . PHE A 1 141 ? 0.282   -3.668  -8.651  1.00 39.79  ? 141 PHE A CB  1 
ATOM   1086 C CG  . PHE A 1 141 ? -0.877  -3.792  -9.594  1.00 37.80  ? 141 PHE A CG  1 
ATOM   1087 C CD1 . PHE A 1 141 ? -0.827  -4.671  -10.646 1.00 36.59  ? 141 PHE A CD1 1 
ATOM   1088 C CD2 . PHE A 1 141 ? -1.998  -3.016  -9.435  1.00 38.21  ? 141 PHE A CD2 1 
ATOM   1089 C CE1 . PHE A 1 141 ? -1.873  -4.774  -11.505 1.00 39.69  ? 141 PHE A CE1 1 
ATOM   1090 C CE2 . PHE A 1 141 ? -3.041  -3.105  -10.302 1.00 41.24  ? 141 PHE A CE2 1 
ATOM   1091 C CZ  . PHE A 1 141 ? -2.991  -3.979  -11.335 1.00 40.74  ? 141 PHE A CZ  1 
ATOM   1092 N N   . LEU A 1 142 ? 0.608   -6.653  -8.164  1.00 42.47  ? 142 LEU A N   1 
ATOM   1093 C CA  . LEU A 1 142 ? 0.306   -8.051  -8.536  1.00 43.89  ? 142 LEU A CA  1 
ATOM   1094 C C   . LEU A 1 142 ? -0.270  -8.934  -7.410  1.00 49.04  ? 142 LEU A C   1 
ATOM   1095 O O   . LEU A 1 142 ? -1.174  -9.737  -7.634  1.00 49.68  ? 142 LEU A O   1 
ATOM   1096 C CB  . LEU A 1 142 ? 1.524   -8.728  -9.156  1.00 41.03  ? 142 LEU A CB  1 
ATOM   1097 C CG  . LEU A 1 142 ? 1.858   -8.256  -10.562 1.00 35.46  ? 142 LEU A CG  1 
ATOM   1098 C CD1 . LEU A 1 142 ? 3.167   -8.825  -11.020 1.00 29.87  ? 142 LEU A CD1 1 
ATOM   1099 C CD2 . LEU A 1 142 ? 0.752   -8.582  -11.530 1.00 33.58  ? 142 LEU A CD2 1 
ATOM   1100 N N   . CYS A 1 143 ? 0.257   -8.783  -6.207  1.00 52.18  ? 143 CYS A N   1 
ATOM   1101 C CA  . CYS A 1 143 ? -0.298  -9.503  -5.076  1.00 59.59  ? 143 CYS A CA  1 
ATOM   1102 C C   . CYS A 1 143 ? -1.759  -9.139  -4.778  1.00 61.24  ? 143 CYS A C   1 
ATOM   1103 O O   . CYS A 1 143 ? -2.572  -10.016 -4.476  1.00 65.28  ? 143 CYS A O   1 
ATOM   1104 C CB  . CYS A 1 143 ? 0.579   -9.313  -3.846  1.00 60.03  ? 143 CYS A CB  1 
ATOM   1105 S SG  . CYS A 1 143 ? 2.199   -9.900  -4.129  1.00 66.32  ? 143 CYS A SG  1 
ATOM   1106 N N   . SER A 1 144 ? -2.092  -7.861  -4.872  1.00 61.11  ? 144 SER A N   1 
ATOM   1107 C CA  . SER A 1 144 ? -3.463  -7.455  -4.651  1.00 64.62  ? 144 SER A CA  1 
ATOM   1108 C C   . SER A 1 144 ? -4.404  -8.030  -5.695  1.00 65.04  ? 144 SER A C   1 
ATOM   1109 O O   . SER A 1 144 ? -5.395  -8.634  -5.359  1.00 68.02  ? 144 SER A O   1 
ATOM   1110 C CB  . SER A 1 144 ? -3.586  -5.934  -4.580  1.00 63.83  ? 144 SER A CB  1 
ATOM   1111 O OG  . SER A 1 144 ? -3.598  -5.367  -5.874  1.00 64.48  ? 144 SER A OG  1 
ATOM   1112 N N   . ILE A 1 145 ? -4.097  -7.860  -6.969  1.00 63.88  ? 145 ILE A N   1 
ATOM   1113 C CA  . ILE A 1 145 ? -4.961  -8.432  -7.985  1.00 65.07  ? 145 ILE A CA  1 
ATOM   1114 C C   . ILE A 1 145 ? -5.224  -9.900  -7.690  1.00 68.52  ? 145 ILE A C   1 
ATOM   1115 O O   . ILE A 1 145 ? -6.330  -10.374 -7.883  1.00 70.54  ? 145 ILE A O   1 
ATOM   1116 C CB  . ILE A 1 145 ? -4.374  -8.281  -9.376  1.00 61.94  ? 145 ILE A CB  1 
ATOM   1117 C CG1 . ILE A 1 145 ? -4.302  -6.810  -9.727  1.00 59.89  ? 145 ILE A CG1 1 
ATOM   1118 C CG2 . ILE A 1 145 ? -5.234  -8.974  -10.379 1.00 62.25  ? 145 ILE A CG2 1 
ATOM   1119 C CD1 . ILE A 1 145 ? -5.433  -6.010  -9.163  1.00 60.60  ? 145 ILE A CD1 1 
ATOM   1120 N N   . GLU A 1 146 ? -4.214  -10.605 -7.193  1.00 70.57  ? 146 GLU A N   1 
ATOM   1121 C CA  . GLU A 1 146 ? -4.344  -12.036 -6.942  1.00 76.92  ? 146 GLU A CA  1 
ATOM   1122 C C   . GLU A 1 146 ? -5.452  -12.289 -5.931  1.00 84.01  ? 146 GLU A C   1 
ATOM   1123 O O   . GLU A 1 146 ? -6.235  -13.228 -6.076  1.00 87.90  ? 146 GLU A O   1 
ATOM   1124 C CB  . GLU A 1 146 ? -3.023  -12.615 -6.433  1.00 78.97  ? 146 GLU A CB  1 
ATOM   1125 C CG  . GLU A 1 146 ? -2.231  -13.372 -7.486  0.97 79.55  ? 146 GLU A CG  1 
ATOM   1126 C CD  . GLU A 1 146 ? -0.828  -13.715 -7.024  0.00 83.73  ? 146 GLU A CD  1 
ATOM   1127 O OE1 . GLU A 1 146 ? 0.139   -13.257 -7.668  1.00 67.87  ? 146 GLU A OE1 1 
ATOM   1128 O OE2 . GLU A 1 146 ? -0.692  -14.442 -6.018  0.96 87.16  ? 146 GLU A OE2 1 
ATOM   1129 N N   . ALA A 1 147 ? -5.521  -11.441 -4.913  1.00 86.07  ? 147 ALA A N   1 
ATOM   1130 C CA  . ALA A 1 147 ? -6.573  -11.534 -3.920  1.00 91.66  ? 147 ALA A CA  1 
ATOM   1131 C C   . ALA A 1 147 ? -7.699  -10.555 -4.266  1.00 95.11  ? 147 ALA A C   1 
ATOM   1132 O O   . ALA A 1 147 ? -8.532  -10.801 -5.140  1.00 96.91  ? 147 ALA A O   1 
ATOM   1133 C CB  . ALA A 1 147 ? -6.002  -11.244 -2.580  1.00 91.23  ? 147 ALA A CB  1 
ATOM   1134 N N   . ARG B 1 4   ? 25.011  24.587  7.555   1.00 54.13  ? 4   ARG B N   1 
ATOM   1135 C CA  . ARG B 1 4   ? 25.792  25.707  6.969   1.00 53.31  ? 4   ARG B CA  1 
ATOM   1136 C C   . ARG B 1 4   ? 27.250  25.716  7.452   1.00 49.63  ? 4   ARG B C   1 
ATOM   1137 O O   . ARG B 1 4   ? 27.519  25.681  8.653   1.00 48.15  ? 4   ARG B O   1 
ATOM   1138 C CB  . ARG B 1 4   ? 25.109  27.025  7.304   1.00 56.05  ? 4   ARG B CB  1 
ATOM   1139 C CG  . ARG B 1 4   ? 26.067  28.118  7.652   1.00 60.18  ? 4   ARG B CG  1 
ATOM   1140 C CD  . ARG B 1 4   ? 26.217  29.105  6.574   1.00 63.11  ? 4   ARG B CD  1 
ATOM   1141 N NE  . ARG B 1 4   ? 25.665  30.374  6.994   1.00 68.32  ? 4   ARG B NE  1 
ATOM   1142 C CZ  . ARG B 1 4   ? 25.352  31.352  6.152   1.00 75.75  ? 4   ARG B CZ  1 
ATOM   1143 N NH1 . ARG B 1 4   ? 25.531  31.201  4.846   1.00 74.49  ? 4   ARG B NH1 1 
ATOM   1144 N NH2 . ARG B 1 4   ? 24.851  32.487  6.613   1.00 81.98  ? 4   ARG B NH2 1 
ATOM   1145 N N   . ALA B 1 5   ? 28.184  25.779  6.504   1.00 45.33  ? 5   ALA B N   1 
ATOM   1146 C CA  . ALA B 1 5   ? 29.599  25.637  6.803   1.00 40.34  ? 5   ALA B CA  1 
ATOM   1147 C C   . ALA B 1 5   ? 30.434  26.707  6.123   1.00 37.77  ? 5   ALA B C   1 
ATOM   1148 O O   . ALA B 1 5   ? 30.086  27.179  5.073   1.00 37.72  ? 5   ALA B O   1 
ATOM   1149 C CB  . ALA B 1 5   ? 30.056  24.245  6.391   1.00 39.55  ? 5   ALA B CB  1 
ATOM   1150 N N   . CYS B 1 6   ? 31.559  27.054  6.721   1.00 35.52  ? 6   CYS B N   1 
ATOM   1151 C CA  . CYS B 1 6   ? 32.503  28.001  6.127   1.00 34.75  ? 6   CYS B CA  1 
ATOM   1152 C C   . CYS B 1 6   ? 33.940  27.496  6.090   1.00 33.71  ? 6   CYS B C   1 
ATOM   1153 O O   . CYS B 1 6   ? 34.354  26.712  6.935   1.00 33.50  ? 6   CYS B O   1 
ATOM   1154 C CB  . CYS B 1 6   ? 32.456  29.312  6.859   1.00 34.41  ? 6   CYS B CB  1 
ATOM   1155 S SG  . CYS B 1 6   ? 30.867  30.098  6.764   1.00 38.44  ? 6   CYS B SG  1 
ATOM   1156 N N   . GLY B 1 7   ? 34.724  27.945  5.113   1.00 32.68  ? 7   GLY B N   1 
ATOM   1157 C CA  . GLY B 1 7   ? 36.090  27.468  5.028   1.00 30.20  ? 7   GLY B CA  1 
ATOM   1158 C C   . GLY B 1 7   ? 37.021  28.421  4.344   1.00 29.82  ? 7   GLY B C   1 
ATOM   1159 O O   . GLY B 1 7   ? 36.654  29.540  4.053   1.00 31.48  ? 7   GLY B O   1 
ATOM   1160 N N   . LEU B 1 8   ? 38.236  27.976  4.071   1.00 27.12  ? 8   LEU B N   1 
ATOM   1161 C CA  . LEU B 1 8   ? 39.153  28.806  3.349   1.00 26.37  ? 8   LEU B CA  1 
ATOM   1162 C C   . LEU B 1 8   ? 39.829  28.033  2.254   1.00 25.65  ? 8   LEU B C   1 
ATOM   1163 O O   . LEU B 1 8   ? 40.359  26.952  2.479   1.00 26.00  ? 8   LEU B O   1 
ATOM   1164 C CB  . LEU B 1 8   ? 40.211  29.390  4.287   1.00 25.64  ? 8   LEU B CB  1 
ATOM   1165 C CG  . LEU B 1 8   ? 39.698  30.439  5.253   1.00 27.88  ? 8   LEU B CG  1 
ATOM   1166 C CD1 . LEU B 1 8   ? 40.836  30.801  6.174   1.00 29.59  ? 8   LEU B CD1 1 
ATOM   1167 C CD2 . LEU B 1 8   ? 39.153  31.669  4.546   1.00 25.35  ? 8   LEU B CD2 1 
ATOM   1168 N N   . ILE B 1 9   ? 39.846  28.598  1.058   1.00 25.22  ? 9   ILE B N   1 
ATOM   1169 C CA  . ILE B 1 9   ? 40.629  27.997  0.016   1.00 24.34  ? 9   ILE B CA  1 
ATOM   1170 C C   . ILE B 1 9   ? 42.029  28.459  0.291   1.00 24.54  ? 9   ILE B C   1 
ATOM   1171 O O   . ILE B 1 9   ? 42.371  29.584  0.000   1.00 25.15  ? 9   ILE B O   1 
ATOM   1172 C CB  . ILE B 1 9   ? 40.188  28.464  -1.344  1.00 25.13  ? 9   ILE B CB  1 
ATOM   1173 C CG1 . ILE B 1 9   ? 38.858  27.816  -1.693  1.00 26.64  ? 9   ILE B CG1 1 
ATOM   1174 C CG2 . ILE B 1 9   ? 41.189  28.084  -2.420  1.00 22.45  ? 9   ILE B CG2 1 
ATOM   1175 C CD1 . ILE B 1 9   ? 38.120  28.533  -2.825  1.00 26.02  ? 9   ILE B CD1 1 
ATOM   1176 N N   . ILE B 1 10  ? 42.828  27.591  0.893   1.00 23.80  ? 10  ILE B N   1 
ATOM   1177 C CA  . ILE B 1 10  ? 44.180  27.937  1.235   1.00 23.42  ? 10  ILE B CA  1 
ATOM   1178 C C   . ILE B 1 10  ? 45.078  27.741  0.024   1.00 25.07  ? 10  ILE B C   1 
ATOM   1179 O O   . ILE B 1 10  ? 44.940  26.783  -0.728  1.00 24.61  ? 10  ILE B O   1 
ATOM   1180 C CB  . ILE B 1 10  ? 44.643  27.070  2.400   1.00 23.30  ? 10  ILE B CB  1 
ATOM   1181 C CG1 . ILE B 1 10  ? 43.795  27.344  3.634   1.00 24.12  ? 10  ILE B CG1 1 
ATOM   1182 C CG2 . ILE B 1 10  ? 46.039  27.342  2.761   1.00 23.30  ? 10  ILE B CG2 1 
ATOM   1183 C CD1 . ILE B 1 10  ? 44.129  28.619  4.302   1.00 25.98  ? 10  ILE B CD1 1 
ATOM   1184 N N   . PHE B 1 11  ? 46.001  28.667  -0.159  1.00 26.88  ? 11  PHE B N   1 
ATOM   1185 C CA  . PHE B 1 11  ? 46.955  28.575  -1.221  1.00 30.11  ? 11  PHE B CA  1 
ATOM   1186 C C   . PHE B 1 11  ? 48.293  29.150  -0.806  1.00 32.40  ? 11  PHE B C   1 
ATOM   1187 O O   . PHE B 1 11  ? 48.388  29.954  0.124   1.00 33.19  ? 11  PHE B O   1 
ATOM   1188 C CB  . PHE B 1 11  ? 46.452  29.335  -2.447  1.00 31.15  ? 11  PHE B CB  1 
ATOM   1189 C CG  . PHE B 1 11  ? 46.590  30.837  -2.336  1.00 33.64  ? 11  PHE B CG  1 
ATOM   1190 C CD1 . PHE B 1 11  ? 47.759  31.462  -2.728  1.00 30.76  ? 11  PHE B CD1 1 
ATOM   1191 C CD2 . PHE B 1 11  ? 45.529  31.617  -1.837  1.00 33.98  ? 11  PHE B CD2 1 
ATOM   1192 C CE1 . PHE B 1 11  ? 47.877  32.824  -2.637  1.00 36.55  ? 11  PHE B CE1 1 
ATOM   1193 C CE2 . PHE B 1 11  ? 45.651  32.995  -1.743  1.00 36.68  ? 11  PHE B CE2 1 
ATOM   1194 C CZ  . PHE B 1 11  ? 46.823  33.600  -2.144  1.00 37.87  ? 11  PHE B CZ  1 
ATOM   1195 N N   . ARG B 1 12  ? 49.328  28.739  -1.514  1.00 34.07  ? 12  ARG B N   1 
ATOM   1196 C CA  . ARG B 1 12  ? 50.622  29.304  -1.307  1.00 37.06  ? 12  ARG B CA  1 
ATOM   1197 C C   . ARG B 1 12  ? 51.267  29.652  -2.641  1.00 39.79  ? 12  ARG B C   1 
ATOM   1198 O O   . ARG B 1 12  ? 50.900  29.120  -3.699  1.00 39.23  ? 12  ARG B O   1 
ATOM   1199 C CB  . ARG B 1 12  ? 51.483  28.332  -0.553  1.00 36.85  ? 12  ARG B CB  1 
ATOM   1200 C CG  . ARG B 1 12  ? 51.835  27.131  -1.340  1.00 37.28  ? 12  ARG B CG  1 
ATOM   1201 C CD  . ARG B 1 12  ? 52.709  26.258  -0.550  1.00 36.91  ? 12  ARG B CD  1 
ATOM   1202 N NE  . ARG B 1 12  ? 53.021  25.080  -1.320  1.00 38.56  ? 12  ARG B NE  1 
ATOM   1203 C CZ  . ARG B 1 12  ? 53.656  24.014  -0.850  1.00 37.75  ? 12  ARG B CZ  1 
ATOM   1204 N NH1 . ARG B 1 12  ? 54.044  23.959  0.401   1.00 33.55  ? 12  ARG B NH1 1 
ATOM   1205 N NH2 . ARG B 1 12  ? 53.897  23.000  -1.646  1.00 39.89  ? 12  ARG B NH2 1 
ATOM   1206 N N   . ARG B 1 13  ? 52.229  30.559  -2.588  1.00 42.98  ? 13  ARG B N   1 
ATOM   1207 C CA  . ARG B 1 13  ? 52.899  30.951  -3.802  1.00 46.47  ? 13  ARG B CA  1 
ATOM   1208 C C   . ARG B 1 13  ? 54.272  30.328  -3.865  1.00 48.36  ? 13  ARG B C   1 
ATOM   1209 O O   . ARG B 1 13  ? 55.022  30.309  -2.906  1.00 48.21  ? 13  ARG B O   1 
ATOM   1210 C CB  . ARG B 1 13  ? 53.025  32.456  -3.893  1.00 48.81  ? 13  ARG B CB  1 
ATOM   1211 C CG  . ARG B 1 13  ? 51.821  33.250  -3.491  1.00 49.91  ? 13  ARG B CG  1 
ATOM   1212 C CD  . ARG B 1 13  ? 52.203  34.688  -3.475  1.00 55.32  ? 13  ARG B CD  1 
ATOM   1213 N NE  . ARG B 1 13  ? 51.040  35.565  -3.444  1.00 62.79  ? 13  ARG B NE  1 
ATOM   1214 C CZ  . ARG B 1 13  ? 50.340  35.946  -4.518  1.00 64.35  ? 13  ARG B CZ  1 
ATOM   1215 N NH1 . ARG B 1 13  ? 50.670  35.513  -5.730  1.00 64.46  ? 13  ARG B NH1 1 
ATOM   1216 N NH2 . ARG B 1 13  ? 49.298  36.756  -4.377  1.00 64.72  ? 13  ARG B NH2 1 
ATOM   1217 N N   . CYS B 1 14  ? 54.587  29.804  -5.023  1.00 51.49  ? 14  CYS B N   1 
ATOM   1218 C CA  . CYS B 1 14  ? 55.845  29.158  -5.251  1.00 55.14  ? 14  CYS B CA  1 
ATOM   1219 C C   . CYS B 1 14  ? 56.669  30.056  -6.143  1.00 59.16  ? 14  CYS B C   1 
ATOM   1220 O O   . CYS B 1 14  ? 56.401  30.157  -7.325  1.00 61.01  ? 14  CYS B O   1 
ATOM   1221 C CB  . CYS B 1 14  ? 55.569  27.847  -5.934  1.00 54.51  ? 14  CYS B CB  1 
ATOM   1222 S SG  . CYS B 1 14  ? 54.291  26.919  -5.119  1.00 51.96  ? 14  CYS B SG  1 
ATOM   1223 N N   . LEU B 1 15  ? 57.665  30.718  -5.568  1.00 63.68  ? 15  LEU B N   1 
ATOM   1224 C CA  . LEU B 1 15  ? 58.373  31.805  -6.239  1.00 69.24  ? 15  LEU B CA  1 
ATOM   1225 C C   . LEU B 1 15  ? 59.774  31.433  -6.726  1.00 76.87  ? 15  LEU B C   1 
ATOM   1226 O O   . LEU B 1 15  ? 60.730  31.383  -5.961  1.00 79.50  ? 15  LEU B O   1 
ATOM   1227 C CB  . LEU B 1 15  ? 58.419  33.018  -5.312  1.00 68.93  ? 15  LEU B CB  1 
ATOM   1228 C CG  . LEU B 1 15  ? 57.055  33.498  -4.788  1.00 67.42  ? 15  LEU B CG  1 
ATOM   1229 C CD1 . LEU B 1 15  ? 57.210  34.296  -3.517  1.00 68.05  ? 15  LEU B CD1 1 
ATOM   1230 C CD2 . LEU B 1 15  ? 56.250  34.290  -5.817  1.00 66.06  ? 15  LEU B CD2 1 
ATOM   1231 N N   . ILE B 1 16  ? 59.894  31.199  -8.024  1.00 83.74  ? 16  ILE B N   1 
ATOM   1232 C CA  . ILE B 1 16  ? 61.092  30.588  -8.548  1.00 89.80  ? 16  ILE B CA  1 
ATOM   1233 C C   . ILE B 1 16  ? 61.256  30.715  -10.078 1.00 97.69  ? 16  ILE B C   1 
ATOM   1234 O O   . ILE B 1 16  ? 60.293  30.939  -10.813 1.00 93.21  ? 16  ILE B O   1 
ATOM   1235 C CB  . ILE B 1 16  ? 61.060  29.106  -8.192  1.00 86.70  ? 16  ILE B CB  1 
ATOM   1236 C CG1 . ILE B 1 16  ? 62.427  28.616  -7.657  1.00 83.90  ? 16  ILE B CG1 1 
ATOM   1237 C CG2 . ILE B 1 16  ? 60.484  28.333  -9.374  1.00 84.99  ? 16  ILE B CG2 1 
ATOM   1238 C CD1 . ILE B 1 16  ? 62.498  28.442  -6.134  1.00 74.63  ? 16  ILE B CD1 1 
ATOM   1239 N N   . PRO B 1 17  ? 62.491  30.565  -10.550 1.00 108.47 ? 17  PRO B N   1 
ATOM   1240 C CA  . PRO B 1 17  ? 62.781  30.701  -11.983 1.00 114.94 ? 17  PRO B CA  1 
ATOM   1241 C C   . PRO B 1 17  ? 62.540  29.426  -12.792 1.00 117.70 ? 17  PRO B C   1 
ATOM   1242 O O   . PRO B 1 17  ? 63.487  28.810  -13.280 1.00 117.80 ? 17  PRO B O   1 
ATOM   1243 C CB  . PRO B 1 17  ? 64.269  31.057  -12.001 0.61 117.60 ? 17  PRO B CB  1 
ATOM   1244 C CG  . PRO B 1 17  ? 64.502  31.739  -10.700 1.00 116.52 ? 17  PRO B CG  1 
ATOM   1245 C CD  . PRO B 1 17  ? 63.596  31.060  -9.711  0.22 111.07 ? 17  PRO B CD  1 
ATOM   1246 N N   . LYS B 1 18  ? 61.273  29.051  -12.931 1.00 119.04 ? 18  LYS B N   1 
ATOM   1247 C CA  . LYS B 1 18  ? 60.871  27.890  -13.720 1.00 118.52 ? 18  LYS B CA  1 
ATOM   1248 C C   . LYS B 1 18  ? 60.972  26.583  -12.939 1.00 115.46 ? 18  LYS B C   1 
ATOM   1249 O O   . LYS B 1 18  ? 60.584  25.524  -13.433 1.00 117.41 ? 18  LYS B O   1 
ATOM   1250 C CB  . LYS B 1 18  ? 61.706  27.800  -15.000 1.00 122.56 ? 18  LYS B CB  1 
ATOM   1251 N N   . VAL B 1 19  ? 61.486  26.665  -11.718 1.00 108.01 ? 19  VAL B N   1 
ATOM   1252 C CA  . VAL B 1 19  ? 61.595  25.497  -10.854 1.00 99.51  ? 19  VAL B CA  1 
ATOM   1253 C C   . VAL B 1 19  ? 60.206  24.988  -10.497 1.00 90.10  ? 19  VAL B C   1 
ATOM   1254 O O   . VAL B 1 19  ? 59.956  23.785  -10.434 1.00 86.47  ? 19  VAL B O   1 
ATOM   1255 C CB  . VAL B 1 19  ? 62.365  25.819  -9.560  1.00 101.33 ? 19  VAL B CB  1 
ATOM   1256 C CG1 . VAL B 1 19  ? 62.357  24.619  -8.626  1.00 101.62 ? 19  VAL B CG1 1 
ATOM   1257 C CG2 . VAL B 1 19  ? 63.791  26.241  -9.883  1.00 102.60 ? 19  VAL B CG2 1 
ATOM   1258 N N   . ASP B 1 20  ? 59.312  25.940  -10.256 1.00 83.52  ? 20  ASP B N   1 
ATOM   1259 C CA  . ASP B 1 20  ? 57.950  25.676  -9.844  1.00 78.80  ? 20  ASP B CA  1 
ATOM   1260 C C   . ASP B 1 20  ? 57.030  25.783  -11.034 1.00 79.12  ? 20  ASP B C   1 
ATOM   1261 O O   . ASP B 1 20  ? 56.895  26.839  -11.630 1.00 81.54  ? 20  ASP B O   1 
ATOM   1262 C CB  . ASP B 1 20  ? 57.495  26.615  -8.734  1.00 76.28  ? 20  ASP B CB  1 
ATOM   1263 C CG  . ASP B 1 20  ? 58.360  26.547  -7.520  1.00 75.25  ? 20  ASP B CG  1 
ATOM   1264 O OD1 . ASP B 1 20  ? 58.540  25.455  -6.964  1.00 72.50  ? 20  ASP B OD1 1 
ATOM   1265 O OD2 . ASP B 1 20  ? 58.841  27.599  -7.098  1.00 75.57  ? 20  ASP B OD2 1 
ATOM   1266 N N   . ASN B 1 21  ? 56.417  24.658  -11.374 1.00 77.28  ? 21  ASN B N   1 
ATOM   1267 C CA  . ASN B 1 21  ? 55.415  24.581  -12.395 1.00 78.69  ? 21  ASN B CA  1 
ATOM   1268 C C   . ASN B 1 21  ? 54.410  25.687  -12.162 1.00 74.25  ? 21  ASN B C   1 
ATOM   1269 O O   . ASN B 1 21  ? 54.205  26.537  -13.013 1.00 76.33  ? 21  ASN B O   1 
ATOM   1270 C CB  . ASN B 1 21  ? 54.714  23.241  -12.237 1.00 85.09  ? 21  ASN B CB  1 
ATOM   1271 C CG  . ASN B 1 21  ? 54.409  22.580  -13.540 1.00 98.86  ? 21  ASN B CG  1 
ATOM   1272 O OD1 . ASN B 1 21  ? 53.431  22.912  -14.201 1.00 108.69 ? 21  ASN B OD1 1 
ATOM   1273 N ND2 . ASN B 1 21  ? 55.227  21.605  -13.909 1.00 108.42 ? 21  ASN B ND2 1 
ATOM   1274 N N   . ASN B 1 22  ? 53.811  25.681  -10.973 1.00 69.17  ? 22  ASN B N   1 
ATOM   1275 C CA  . ASN B 1 22  ? 52.769  26.616  -10.577 1.00 60.84  ? 22  ASN B CA  1 
ATOM   1276 C C   . ASN B 1 22  ? 53.278  27.683  -9.627  1.00 57.31  ? 22  ASN B C   1 
ATOM   1277 O O   . ASN B 1 22  ? 54.092  27.408  -8.749  1.00 57.27  ? 22  ASN B O   1 
ATOM   1278 C CB  . ASN B 1 22  ? 51.662  25.838  -9.899  1.00 60.06  ? 22  ASN B CB  1 
ATOM   1279 C CG  . ASN B 1 22  ? 51.091  24.754  -10.771 1.00 60.87  ? 22  ASN B CG  1 
ATOM   1280 O OD1 . ASN B 1 22  ? 51.164  23.597  -10.451 1.00 61.97  ? 22  ASN B OD1 1 
ATOM   1281 N ND2 . ASN B 1 22  ? 50.491  25.134  -11.860 1.00 65.52  ? 22  ASN B ND2 1 
ATOM   1282 N N   . ALA B 1 23  ? 52.808  28.910  -9.795  1.00 53.99  ? 23  ALA B N   1 
ATOM   1283 C CA  . ALA B 1 23  ? 53.111  29.946  -8.808  1.00 50.61  ? 23  ALA B CA  1 
ATOM   1284 C C   . ALA B 1 23  ? 52.089  29.930  -7.665  1.00 47.08  ? 23  ALA B C   1 
ATOM   1285 O O   . ALA B 1 23  ? 52.309  30.520  -6.619  1.00 47.84  ? 23  ALA B O   1 
ATOM   1286 C CB  . ALA B 1 23  ? 53.191  31.312  -9.454  1.00 51.42  ? 23  ALA B CB  1 
ATOM   1287 N N   . ILE B 1 24  ? 50.981  29.236  -7.887  1.00 43.01  ? 24  ILE B N   1 
ATOM   1288 C CA  . ILE B 1 24  ? 49.952  29.071  -6.882  1.00 40.01  ? 24  ILE B CA  1 
ATOM   1289 C C   . ILE B 1 24  ? 49.736  27.589  -6.650  1.00 37.98  ? 24  ILE B C   1 
ATOM   1290 O O   . ILE B 1 24  ? 49.500  26.850  -7.592  1.00 38.00  ? 24  ILE B O   1 
ATOM   1291 C CB  . ILE B 1 24  ? 48.553  29.729  -7.306  1.00 40.83  ? 24  ILE B CB  1 
ATOM   1292 C CG1 . ILE B 1 24  ? 48.645  31.234  -7.662  1.00 40.53  ? 24  ILE B CG1 1 
ATOM   1293 C CG2 . ILE B 1 24  ? 47.493  29.497  -6.266  1.00 37.26  ? 24  ILE B CG2 1 
ATOM   1294 C CD1 . ILE B 1 24  ? 49.345  32.112  -6.669  1.00 40.42  ? 24  ILE B CD1 1 
ATOM   1295 N N   . GLU B 1 25  ? 49.792  27.170  -5.393  1.00 35.25  ? 25  GLU B N   1 
ATOM   1296 C CA  . GLU B 1 25  ? 49.385  25.818  -5.027  1.00 34.83  ? 25  GLU B CA  1 
ATOM   1297 C C   . GLU B 1 25  ? 48.270  25.863  -3.977  1.00 33.88  ? 25  GLU B C   1 
ATOM   1298 O O   . GLU B 1 25  ? 48.341  26.634  -3.020  1.00 33.21  ? 25  GLU B O   1 
ATOM   1299 C CB  . GLU B 1 25  ? 50.567  24.991  -4.528  1.00 34.58  ? 25  GLU B CB  1 
ATOM   1300 C CG  . GLU B 1 25  ? 51.475  24.494  -5.640  1.00 38.85  ? 25  GLU B CG  1 
ATOM   1301 C CD  . GLU B 1 25  ? 52.763  23.853  -5.130  1.00 44.28  ? 25  GLU B CD  1 
ATOM   1302 O OE1 . GLU B 1 25  ? 53.501  23.277  -5.946  1.00 47.85  ? 25  GLU B OE1 1 
ATOM   1303 O OE2 . GLU B 1 25  ? 53.044  23.908  -3.924  1.00 44.11  ? 25  GLU B OE2 1 
ATOM   1304 N N   . PHE B 1 26  ? 47.242  25.038  -4.155  1.00 33.13  ? 26  PHE B N   1 
ATOM   1305 C CA  . PHE B 1 26  ? 46.133  24.990  -3.235  1.00 32.53  ? 26  PHE B CA  1 
ATOM   1306 C C   . PHE B 1 26  ? 46.213  23.809  -2.307  1.00 33.34  ? 26  PHE B C   1 
ATOM   1307 O O   . PHE B 1 26  ? 46.591  22.733  -2.726  1.00 36.10  ? 26  PHE B O   1 
ATOM   1308 C CB  . PHE B 1 26  ? 44.848  24.852  -4.010  1.00 33.50  ? 26  PHE B CB  1 
ATOM   1309 C CG  . PHE B 1 26  ? 44.586  25.983  -4.916  1.00 34.72  ? 26  PHE B CG  1 
ATOM   1310 C CD1 . PHE B 1 26  ? 44.119  27.179  -4.418  1.00 35.25  ? 26  PHE B CD1 1 
ATOM   1311 C CD2 . PHE B 1 26  ? 44.847  25.871  -6.263  1.00 36.07  ? 26  PHE B CD2 1 
ATOM   1312 C CE1 . PHE B 1 26  ? 43.914  28.237  -5.243  1.00 35.58  ? 26  PHE B CE1 1 
ATOM   1313 C CE2 . PHE B 1 26  ? 44.649  26.915  -7.083  1.00 36.54  ? 26  PHE B CE2 1 
ATOM   1314 C CZ  . PHE B 1 26  ? 44.162  28.101  -6.576  1.00 37.89  ? 26  PHE B CZ  1 
ATOM   1315 N N   . LEU B 1 27  ? 45.813  23.979  -1.052  1.00 32.73  ? 27  LEU B N   1 
ATOM   1316 C CA  . LEU B 1 27  ? 45.784  22.861  -0.121  1.00 32.32  ? 27  LEU B CA  1 
ATOM   1317 C C   . LEU B 1 27  ? 44.463  22.135  -0.140  1.00 33.00  ? 27  LEU B C   1 
ATOM   1318 O O   . LEU B 1 27  ? 43.433  22.741  0.072   1.00 33.13  ? 27  LEU B O   1 
ATOM   1319 C CB  . LEU B 1 27  ? 46.032  23.366  1.295   1.00 31.70  ? 27  LEU B CB  1 
ATOM   1320 C CG  . LEU B 1 27  ? 46.080  22.361  2.457   1.00 30.37  ? 27  LEU B CG  1 
ATOM   1321 C CD1 . LEU B 1 27  ? 47.339  21.441  2.410   1.00 28.38  ? 27  LEU B CD1 1 
ATOM   1322 C CD2 . LEU B 1 27  ? 46.037  23.148  3.735   1.00 24.39  ? 27  LEU B CD2 1 
ATOM   1323 N N   . LEU B 1 28  ? 44.494  20.836  -0.382  1.00 34.28  ? 28  LEU B N   1 
ATOM   1324 C CA  . LEU B 1 28  ? 43.302  19.996  -0.222  1.00 35.92  ? 28  LEU B CA  1 
ATOM   1325 C C   . LEU B 1 28  ? 43.532  18.984  0.883   1.00 38.04  ? 28  LEU B C   1 
ATOM   1326 O O   . LEU B 1 28  ? 44.633  18.490  1.040   1.00 38.97  ? 28  LEU B O   1 
ATOM   1327 C CB  . LEU B 1 28  ? 42.991  19.248  -1.494  1.00 36.37  ? 28  LEU B CB  1 
ATOM   1328 C CG  . LEU B 1 28  ? 42.539  20.031  -2.713  1.00 35.03  ? 28  LEU B CG  1 
ATOM   1329 C CD1 . LEU B 1 28  ? 42.164  19.057  -3.793  1.00 36.99  ? 28  LEU B CD1 1 
ATOM   1330 C CD2 . LEU B 1 28  ? 41.373  20.876  -2.406  1.00 33.09  ? 28  LEU B CD2 1 
ATOM   1331 N N   . LEU B 1 29  ? 42.498  18.686  1.653   1.00 39.74  ? 29  LEU B N   1 
ATOM   1332 C CA  . LEU B 1 29  ? 42.629  17.766  2.763   1.00 42.47  ? 29  LEU B CA  1 
ATOM   1333 C C   . LEU B 1 29  ? 41.836  16.524  2.466   1.00 46.70  ? 29  LEU B C   1 
ATOM   1334 O O   . LEU B 1 29  ? 40.766  16.615  1.922   1.00 46.54  ? 29  LEU B O   1 
ATOM   1335 C CB  . LEU B 1 29  ? 42.104  18.409  4.034   1.00 40.67  ? 29  LEU B CB  1 
ATOM   1336 C CG  . LEU B 1 29  ? 42.674  19.772  4.452   1.00 38.58  ? 29  LEU B CG  1 
ATOM   1337 C CD1 . LEU B 1 29  ? 42.053  20.166  5.764   1.00 37.08  ? 29  LEU B CD1 1 
ATOM   1338 C CD2 . LEU B 1 29  ? 44.171  19.752  4.581   1.00 36.04  ? 29  LEU B CD2 1 
ATOM   1339 N N   . GLN B 1 30  ? 42.367  15.355  2.794   1.00 52.18  ? 30  GLN B N   1 
ATOM   1340 C CA  . GLN B 1 30  ? 41.658  14.099  2.497   1.00 58.58  ? 30  GLN B CA  1 
ATOM   1341 C C   . GLN B 1 30  ? 40.735  13.686  3.622   1.00 61.52  ? 30  GLN B C   1 
ATOM   1342 O O   . GLN B 1 30  ? 41.173  13.565  4.755   1.00 62.03  ? 30  GLN B O   1 
ATOM   1343 C CB  . GLN B 1 30  ? 42.637  12.962  2.213   1.00 60.41  ? 30  GLN B CB  1 
ATOM   1344 C CG  . GLN B 1 30  ? 41.961  11.696  1.739   1.00 64.84  ? 30  GLN B CG  1 
ATOM   1345 C CD  . GLN B 1 30  ? 42.924  10.641  1.261   1.00 68.57  ? 30  GLN B CD  1 
ATOM   1346 O OE1 . GLN B 1 30  ? 43.967  10.404  1.854   1.00 71.32  ? 30  GLN B OE1 1 
ATOM   1347 N NE2 . GLN B 1 30  ? 42.562  9.986   0.189   1.00 71.45  ? 30  GLN B NE2 1 
ATOM   1348 N N   . ALA B 1 31  ? 39.465  13.455  3.302   1.00 66.21  ? 31  ALA B N   1 
ATOM   1349 C CA  . ALA B 1 31  ? 38.516  12.950  4.285   1.00 71.08  ? 31  ALA B CA  1 
ATOM   1350 C C   . ALA B 1 31  ? 38.946  11.586  4.818   1.00 77.16  ? 31  ALA B C   1 
ATOM   1351 O O   . ALA B 1 31  ? 39.377  10.720  4.061   1.00 81.17  ? 31  ALA B O   1 
ATOM   1352 C CB  . ALA B 1 31  ? 37.152  12.865  3.689   1.00 71.08  ? 31  ALA B CB  1 
ATOM   1353 N N   . SER B 1 32  ? 38.868  11.430  6.133   1.00 82.33  ? 32  SER B N   1 
ATOM   1354 C CA  . SER B 1 32  ? 39.145  10.164  6.800   1.00 88.87  ? 32  SER B CA  1 
ATOM   1355 C C   . SER B 1 32  ? 38.085  9.107   6.510   1.00 95.32  ? 32  SER B C   1 
ATOM   1356 O O   . SER B 1 32  ? 38.400  7.939   6.326   1.00 100.12 ? 32  SER B O   1 
ATOM   1357 C CB  . SER B 1 32  ? 39.296  10.362  8.298   1.00 86.64  ? 32  SER B CB  1 
ATOM   1358 O OG  . SER B 1 32  ? 40.647  10.233  8.672   1.00 87.61  ? 32  SER B OG  1 
ATOM   1359 N N   . ASP B 1 33  ? 36.825  9.533   6.483   1.00 106.63 ? 33  ASP B N   1 
ATOM   1360 C CA  . ASP B 1 33  ? 35.708  8.633   6.248   1.00 116.47 ? 33  ASP B CA  1 
ATOM   1361 C C   . ASP B 1 33  ? 35.067  8.855   4.894   1.00 117.26 ? 33  ASP B C   1 
ATOM   1362 O O   . ASP B 1 33  ? 34.647  9.952   4.562   1.00 112.48 ? 33  ASP B O   1 
ATOM   1363 C CB  . ASP B 1 33  ? 34.660  8.793   7.351   1.00 32.39  ? 33  ASP B CB  1 
ATOM   1364 N N   . GLY B 1 34  ? 34.989  7.771   4.138   1.00 152.19 ? 34  GLY B N   1 
ATOM   1365 C CA  . GLY B 1 34  ? 34.465  7.716   2.787   1.00 161.01 ? 34  GLY B CA  1 
ATOM   1366 C C   . GLY B 1 34  ? 35.727  7.588   1.972   1.00 164.37 ? 34  GLY B C   1 
ATOM   1367 O O   . GLY B 1 34  ? 35.770  6.944   0.924   1.00 174.13 ? 34  GLY B O   1 
ATOM   1368 N N   . ILE B 1 35  ? 36.769  8.223   2.495   1.00 157.65 ? 35  ILE B N   1 
ATOM   1369 C CA  . ILE B 1 35  ? 38.136  8.111   2.012   1.00 157.15 ? 35  ILE B CA  1 
ATOM   1370 C C   . ILE B 1 35  ? 38.418  8.737   0.643   1.00 155.75 ? 35  ILE B C   1 
ATOM   1371 O O   . ILE B 1 35  ? 39.545  8.692   0.155   1.00 157.69 ? 35  ILE B O   1 
ATOM   1372 C CB  . ILE B 1 35  ? 38.587  6.637   2.024   1.00 165.34 ? 35  ILE B CB  1 
ATOM   1373 C CG1 . ILE B 1 35  ? 40.100  6.543   2.170   1.00 164.98 ? 35  ILE B CG1 1 
ATOM   1374 C CG2 . ILE B 1 35  ? 38.088  5.917   0.784   1.00 178.42 ? 35  ILE B CG2 1 
ATOM   1375 C CD1 . ILE B 1 35  ? 40.711  5.510   1.271   1.00 161.15 ? 35  ILE B CD1 1 
ATOM   1376 N N   . HIS B 1 36  ? 37.408  9.327   0.022   1.00 152.60 ? 36  HIS B N   1 
ATOM   1377 C CA  . HIS B 1 36  ? 37.610  9.924   -1.291  1.00 150.38 ? 36  HIS B CA  1 
ATOM   1378 C C   . HIS B 1 36  ? 37.267  11.391  -1.318  1.00 135.54 ? 36  HIS B C   1 
ATOM   1379 O O   . HIS B 1 36  ? 37.198  11.996  -2.381  1.00 135.65 ? 36  HIS B O   1 
ATOM   1380 C CB  . HIS B 1 36  ? 36.776  9.215   -2.357  1.00 165.57 ? 36  HIS B CB  1 
ATOM   1381 C CG  . HIS B 1 36  ? 36.309  10.127  -3.449  0.01 168.08 ? 36  HIS B CG  1 
ATOM   1382 N ND1 . HIS B 1 36  ? 36.845  10.107  -4.718  0.01 172.57 ? 36  HIS B ND1 1 
ATOM   1383 C CD2 . HIS B 1 36  ? 35.370  11.104  -3.453  0.01 168.72 ? 36  HIS B CD2 1 
ATOM   1384 C CE1 . HIS B 1 36  ? 36.251  11.023  -5.460  0.01 173.38 ? 36  HIS B CE1 1 
ATOM   1385 N NE2 . HIS B 1 36  ? 35.352  11.642  -4.716  0.01 172.63 ? 36  HIS B NE2 1 
ATOM   1386 N N   . HIS B 1 37  ? 37.028  11.963  -0.156  1.00 121.39 ? 37  HIS B N   1 
ATOM   1387 C CA  . HIS B 1 37  ? 36.634  13.349  -0.109  1.00 106.54 ? 37  HIS B CA  1 
ATOM   1388 C C   . HIS B 1 37  ? 37.860  14.215  0.073   1.00 91.28  ? 37  HIS B C   1 
ATOM   1389 O O   . HIS B 1 37  ? 38.575  14.075  1.051   1.00 87.75  ? 37  HIS B O   1 
ATOM   1390 C CB  . HIS B 1 37  ? 35.669  13.538  1.056   1.00 76.00  ? 37  HIS B CB  1 
ATOM   1391 C CG  . HIS B 1 37  ? 34.286  13.919  0.649   1.00 76.63  ? 37  HIS B CG  1 
ATOM   1392 N ND1 . HIS B 1 37  ? 33.181  13.159  0.960   1.00 83.08  ? 37  HIS B ND1 1 
ATOM   1393 C CD2 . HIS B 1 37  ? 33.823  14.996  -0.031  0.01 73.33  ? 37  HIS B CD2 1 
ATOM   1394 C CE1 . HIS B 1 37  ? 32.098  13.745  0.482   0.01 83.42  ? 37  HIS B CE1 1 
ATOM   1395 N NE2 . HIS B 1 37  ? 32.460  14.863  -0.121  0.01 77.99  ? 37  HIS B NE2 1 
ATOM   1396 N N   . TRP B 1 38  ? 38.098  15.108  -0.878  1.00 86.42  ? 38  TRP B N   1 
ATOM   1397 C CA  . TRP B 1 38  ? 39.226  16.019  -0.799  1.00 70.96  ? 38  TRP B CA  1 
ATOM   1398 C C   . TRP B 1 38  ? 38.672  17.418  -0.744  1.00 62.14  ? 38  TRP B C   1 
ATOM   1399 O O   . TRP B 1 38  ? 37.896  17.810  -1.599  1.00 64.20  ? 38  TRP B O   1 
ATOM   1400 C CB  . TRP B 1 38  ? 40.133  15.871  -2.006  1.00 69.24  ? 38  TRP B CB  1 
ATOM   1401 C CG  . TRP B 1 38  ? 40.987  14.666  -1.958  1.00 74.37  ? 38  TRP B CG  1 
ATOM   1402 C CD1 . TRP B 1 38  ? 40.690  13.444  -2.450  1.00 86.14  ? 38  TRP B CD1 1 
ATOM   1403 C CD2 . TRP B 1 38  ? 42.291  14.566  -1.394  1.00 68.71  ? 38  TRP B CD2 1 
ATOM   1404 N NE1 . TRP B 1 38  ? 41.720  12.583  -2.230  1.00 89.09  ? 38  TRP B NE1 1 
ATOM   1405 C CE2 . TRP B 1 38  ? 42.721  13.249  -1.579  1.00 80.03  ? 38  TRP B CE2 1 
ATOM   1406 C CE3 . TRP B 1 38  ? 43.136  15.464  -0.750  1.00 56.34  ? 38  TRP B CE3 1 
ATOM   1407 C CZ2 . TRP B 1 38  ? 43.956  12.804  -1.144  1.00 79.27  ? 38  TRP B CZ2 1 
ATOM   1408 C CZ3 . TRP B 1 38  ? 44.357  15.021  -0.315  1.00 57.59  ? 38  TRP B CZ3 1 
ATOM   1409 C CH2 . TRP B 1 38  ? 44.759  13.704  -0.515  1.00 67.93  ? 38  TRP B CH2 1 
ATOM   1410 N N   . THR B 1 39  ? 39.067  18.182  0.260   1.00 51.58  ? 39  THR B N   1 
ATOM   1411 C CA  . THR B 1 39  ? 38.497  19.501  0.394   1.00 45.01  ? 39  THR B CA  1 
ATOM   1412 C C   . THR B 1 39  ? 39.406  20.480  1.110   1.00 40.21  ? 39  THR B C   1 
ATOM   1413 O O   . THR B 1 39  ? 40.342  20.081  1.776   1.00 39.97  ? 39  THR B O   1 
ATOM   1414 C CB  . THR B 1 39  ? 37.197  19.397  1.191   1.00 45.85  ? 39  THR B CB  1 
ATOM   1415 O OG1 . THR B 1 39  ? 36.083  19.542  0.313   1.00 49.38  ? 39  THR B OG1 1 
ATOM   1416 C CG2 . THR B 1 39  ? 37.135  20.454  2.252   1.00 40.96  ? 39  THR B CG2 1 
ATOM   1417 N N   . PRO B 1 40  ? 39.124  21.767  0.951   1.00 35.92  ? 40  PRO B N   1 
ATOM   1418 C CA  . PRO B 1 40  ? 39.832  22.825  1.659   1.00 31.91  ? 40  PRO B CA  1 
ATOM   1419 C C   . PRO B 1 40  ? 39.291  22.782  3.068   1.00 29.87  ? 40  PRO B C   1 
ATOM   1420 O O   . PRO B 1 40  ? 38.247  22.202  3.250   1.00 31.02  ? 40  PRO B O   1 
ATOM   1421 C CB  . PRO B 1 40  ? 39.367  24.075  0.946   1.00 30.35  ? 40  PRO B CB  1 
ATOM   1422 C CG  . PRO B 1 40  ? 39.048  23.637  -0.382  1.00 32.55  ? 40  PRO B CG  1 
ATOM   1423 C CD  . PRO B 1 40  ? 38.512  22.270  -0.280  1.00 35.36  ? 40  PRO B CD  1 
ATOM   1424 N N   . PRO B 1 41  ? 39.964  23.339  4.053   1.00 28.23  ? 41  PRO B N   1 
ATOM   1425 C CA  . PRO B 1 41  ? 39.441  23.216  5.398   1.00 27.92  ? 41  PRO B CA  1 
ATOM   1426 C C   . PRO B 1 41  ? 38.119  23.927  5.553   1.00 29.31  ? 41  PRO B C   1 
ATOM   1427 O O   . PRO B 1 41  ? 37.957  25.050  5.100   1.00 27.50  ? 41  PRO B O   1 
ATOM   1428 C CB  . PRO B 1 41  ? 40.476  23.937  6.219   1.00 27.65  ? 41  PRO B CB  1 
ATOM   1429 C CG  . PRO B 1 41  ? 41.697  23.916  5.366   1.00 27.95  ? 41  PRO B CG  1 
ATOM   1430 C CD  . PRO B 1 41  ? 41.249  24.038  4.006   1.00 26.91  ? 41  PRO B CD  1 
ATOM   1431 N N   . LYS B 1 42  ? 37.165  23.271  6.200   1.00 32.20  ? 42  LYS B N   1 
ATOM   1432 C CA  . LYS B 1 42  ? 35.896  23.910  6.451   1.00 33.43  ? 42  LYS B CA  1 
ATOM   1433 C C   . LYS B 1 42  ? 35.083  23.182  7.521   1.00 35.73  ? 42  LYS B C   1 
ATOM   1434 O O   . LYS B 1 42  ? 35.403  22.063  7.893   1.00 37.12  ? 42  LYS B O   1 
ATOM   1435 C CB  . LYS B 1 42  ? 35.136  24.051  5.153   1.00 33.95  ? 42  LYS B CB  1 
ATOM   1436 C CG  . LYS B 1 42  ? 34.128  22.998  4.937   1.00 37.43  ? 42  LYS B CG  1 
ATOM   1437 C CD  . LYS B 1 42  ? 34.533  22.123  3.837   1.00 40.63  ? 42  LYS B CD  1 
ATOM   1438 C CE  . LYS B 1 42  ? 33.372  21.284  3.431   1.00 47.97  ? 42  LYS B CE  1 
ATOM   1439 N NZ  . LYS B 1 42  ? 33.729  19.836  3.430   1.00 53.02  ? 42  LYS B NZ  1 
ATOM   1440 N N   . GLY B 1 43  ? 34.054  23.844  8.040   1.00 36.99  ? 43  GLY B N   1 
ATOM   1441 C CA  . GLY B 1 43  ? 33.254  23.312  9.109   1.00 39.57  ? 43  GLY B CA  1 
ATOM   1442 C C   . GLY B 1 43  ? 32.019  24.137  9.338   1.00 42.42  ? 43  GLY B C   1 
ATOM   1443 O O   . GLY B 1 43  ? 31.841  25.183  8.738   1.00 40.25  ? 43  GLY B O   1 
ATOM   1444 N N   . HIS B 1 44  ? 31.177  23.655  10.247  1.00 47.10  ? 44  HIS B N   1 
ATOM   1445 C CA  . HIS B 1 44  ? 29.867  24.235  10.528  1.00 51.25  ? 44  HIS B CA  1 
ATOM   1446 C C   . HIS B 1 44  ? 29.940  25.496  11.335  1.00 49.12  ? 44  HIS B C   1 
ATOM   1447 O O   . HIS B 1 44  ? 30.735  25.623  12.246  1.00 48.65  ? 44  HIS B O   1 
ATOM   1448 C CB  . HIS B 1 44  ? 28.951  23.212  11.228  1.00 59.10  ? 44  HIS B CB  1 
ATOM   1449 C CG  . HIS B 1 44  ? 28.655  22.000  10.398  1.00 72.98  ? 44  HIS B CG  1 
ATOM   1450 N ND1 . HIS B 1 44  ? 29.138  20.746  10.708  1.00 82.58  ? 44  HIS B ND1 1 
ATOM   1451 C CD2 . HIS B 1 44  ? 27.960  21.858  9.243   1.00 81.71  ? 44  HIS B CD2 1 
ATOM   1452 C CE1 . HIS B 1 44  ? 28.745  19.883  9.789   1.00 87.40  ? 44  HIS B CE1 1 
ATOM   1453 N NE2 . HIS B 1 44  ? 28.029  20.532  8.887   1.00 87.16  ? 44  HIS B NE2 1 
ATOM   1454 N N   . VAL B 1 45  ? 29.063  26.416  10.991  1.00 48.92  ? 45  VAL B N   1 
ATOM   1455 C CA  . VAL B 1 45  ? 28.865  27.651  11.719  1.00 49.23  ? 45  VAL B CA  1 
ATOM   1456 C C   . VAL B 1 45  ? 28.307  27.414  13.111  1.00 52.33  ? 45  VAL B C   1 
ATOM   1457 O O   . VAL B 1 45  ? 27.349  26.682  13.271  1.00 56.59  ? 45  VAL B O   1 
ATOM   1458 C CB  . VAL B 1 45  ? 27.914  28.552  10.925  1.00 48.61  ? 45  VAL B CB  1 
ATOM   1459 C CG1 . VAL B 1 45  ? 27.454  29.735  11.738  1.00 48.46  ? 45  VAL B CG1 1 
ATOM   1460 C CG2 . VAL B 1 45  ? 28.620  29.036  9.729   1.00 45.08  ? 45  VAL B CG2 1 
ATOM   1461 N N   . GLU B 1 46  ? 28.917  28.043  14.104  1.00 53.86  ? 46  GLU B N   1 
ATOM   1462 C CA  . GLU B 1 46  ? 28.500  27.968  15.481  1.00 58.47  ? 46  GLU B CA  1 
ATOM   1463 C C   . GLU B 1 46  ? 27.457  29.052  15.760  1.00 61.02  ? 46  GLU B C   1 
ATOM   1464 O O   . GLU B 1 46  ? 27.484  30.087  15.123  1.00 60.03  ? 46  GLU B O   1 
ATOM   1465 C CB  . GLU B 1 46  ? 29.730  28.179  16.354  1.00 59.14  ? 46  GLU B CB  1 
ATOM   1466 C CG  . GLU B 1 46  ? 29.697  27.488  17.678  1.00 67.78  ? 46  GLU B CG  1 
ATOM   1467 C CD  . GLU B 1 46  ? 29.783  26.008  17.551  1.00 74.80  ? 46  GLU B CD  1 
ATOM   1468 O OE1 . GLU B 1 46  ? 30.899  25.515  17.343  1.00 76.68  ? 46  GLU B OE1 1 
ATOM   1469 O OE2 . GLU B 1 46  ? 28.741  25.342  17.673  1.00 77.06  ? 46  GLU B OE2 1 
ATOM   1470 N N   . PRO B 1 47  ? 26.530  28.820  16.713  1.00 65.18  ? 47  PRO B N   1 
ATOM   1471 C CA  . PRO B 1 47  ? 25.454  29.747  17.008  1.00 67.48  ? 47  PRO B CA  1 
ATOM   1472 C C   . PRO B 1 47  ? 25.828  31.214  17.053  1.00 69.11  ? 47  PRO B C   1 
ATOM   1473 O O   . PRO B 1 47  ? 25.142  32.027  16.457  1.00 73.27  ? 47  PRO B O   1 
ATOM   1474 C CB  . PRO B 1 47  ? 24.991  29.268  18.369  1.00 70.27  ? 47  PRO B CB  1 
ATOM   1475 C CG  . PRO B 1 47  ? 25.116  27.824  18.275  1.00 69.90  ? 47  PRO B CG  1 
ATOM   1476 C CD  . PRO B 1 47  ? 26.228  27.515  17.330  1.00 67.41  ? 47  PRO B CD  1 
ATOM   1477 N N   . GLY B 1 48  ? 26.896  31.571  17.731  1.00 68.58  ? 48  GLY B N   1 
ATOM   1478 C CA  . GLY B 1 48  ? 27.307  32.962  17.707  1.00 69.16  ? 48  GLY B CA  1 
ATOM   1479 C C   . GLY B 1 48  ? 27.898  33.495  16.410  1.00 65.48  ? 48  GLY B C   1 
ATOM   1480 O O   . GLY B 1 48  ? 27.671  34.641  16.055  1.00 66.94  ? 48  GLY B O   1 
ATOM   1481 N N   . GLU B 1 49  ? 28.619  32.626  15.696  1.00 58.90  ? 49  GLU B N   1 
ATOM   1482 C CA  . GLU B 1 49  ? 29.649  32.973  14.724  1.00 54.01  ? 49  GLU B CA  1 
ATOM   1483 C C   . GLU B 1 49  ? 29.370  33.747  13.452  1.00 51.33  ? 49  GLU B C   1 
ATOM   1484 O O   . GLU B 1 49  ? 28.466  33.437  12.691  1.00 52.41  ? 49  GLU B O   1 
ATOM   1485 C CB  . GLU B 1 49  ? 30.378  31.719  14.327  1.00 52.14  ? 49  GLU B CB  1 
ATOM   1486 C CG  . GLU B 1 49  ? 31.536  31.469  15.184  1.00 53.89  ? 49  GLU B CG  1 
ATOM   1487 C CD  . GLU B 1 49  ? 32.315  30.284  14.761  1.00 53.73  ? 49  GLU B CD  1 
ATOM   1488 O OE1 . GLU B 1 49  ? 31.803  29.468  13.972  1.00 52.95  ? 49  GLU B OE1 1 
ATOM   1489 O OE2 . GLU B 1 49  ? 33.458  30.168  15.219  1.00 55.18  ? 49  GLU B OE2 1 
ATOM   1490 N N   . ASP B 1 50  ? 30.226  34.726  13.219  1.00 48.32  ? 50  ASP B N   1 
ATOM   1491 C CA  . ASP B 1 50  ? 30.370  35.354  11.938  1.00 45.55  ? 50  ASP B CA  1 
ATOM   1492 C C   . ASP B 1 50  ? 30.904  34.335  10.919  1.00 42.88  ? 50  ASP B C   1 
ATOM   1493 O O   . ASP B 1 50  ? 31.670  33.430  11.263  1.00 41.64  ? 50  ASP B O   1 
ATOM   1494 C CB  . ASP B 1 50  ? 31.371  36.465  12.058  1.00 45.84  ? 50  ASP B CB  1 
ATOM   1495 C CG  . ASP B 1 50  ? 31.474  37.245  10.833  1.00 46.35  ? 50  ASP B CG  1 
ATOM   1496 O OD1 . ASP B 1 50  ? 32.380  36.976  10.052  1.00 45.53  ? 50  ASP B OD1 1 
ATOM   1497 O OD2 . ASP B 1 50  ? 30.633  38.121  10.626  1.00 50.36  ? 50  ASP B OD2 1 
ATOM   1498 N N   . ASP B 1 51  ? 30.511  34.468  9.662   1.00 40.24  ? 51  ASP B N   1 
ATOM   1499 C CA  . ASP B 1 51  ? 30.888  33.458  8.704   1.00 37.51  ? 51  ASP B CA  1 
ATOM   1500 C C   . ASP B 1 51  ? 32.409  33.362  8.490   1.00 36.15  ? 51  ASP B C   1 
ATOM   1501 O O   . ASP B 1 51  ? 32.953  32.268  8.418   1.00 34.32  ? 51  ASP B O   1 
ATOM   1502 C CB  . ASP B 1 51  ? 30.098  33.625  7.408   1.00 37.39  ? 51  ASP B CB  1 
ATOM   1503 C CG  . ASP B 1 51  ? 28.752  32.937  7.457   1.00 36.97  ? 51  ASP B CG  1 
ATOM   1504 O OD1 . ASP B 1 51  ? 28.119  32.812  6.426   1.00 39.92  ? 51  ASP B OD1 1 
ATOM   1505 O OD2 . ASP B 1 51  ? 28.304  32.523  8.519   1.00 38.51  ? 51  ASP B OD2 1 
ATOM   1506 N N   . LEU B 1 52  ? 33.079  34.511  8.413   1.00 35.71  ? 52  LEU B N   1 
ATOM   1507 C CA  . LEU B 1 52  ? 34.518  34.550  8.340   1.00 34.97  ? 52  LEU B CA  1 
ATOM   1508 C C   . LEU B 1 52  ? 35.176  34.038  9.632   1.00 36.17  ? 52  LEU B C   1 
ATOM   1509 O O   . LEU B 1 52  ? 36.280  33.535  9.626   1.00 37.57  ? 52  LEU B O   1 
ATOM   1510 C CB  . LEU B 1 52  ? 34.965  35.970  8.035   1.00 35.92  ? 52  LEU B CB  1 
ATOM   1511 C CG  . LEU B 1 52  ? 36.341  36.218  7.389   1.00 34.80  ? 52  LEU B CG  1 
ATOM   1512 C CD1 . LEU B 1 52  ? 36.705  35.150  6.418   1.00 25.82  ? 52  LEU B CD1 1 
ATOM   1513 C CD2 . LEU B 1 52  ? 36.338  37.550  6.675   1.00 37.36  ? 52  LEU B CD2 1 
ATOM   1514 N N   . GLU B 1 53  ? 34.497  34.184  10.753  1.00 36.99  ? 53  GLU B N   1 
ATOM   1515 C CA  . GLU B 1 53  ? 34.984  33.661  12.000  1.00 36.61  ? 53  GLU B CA  1 
ATOM   1516 C C   . GLU B 1 53  ? 35.039  32.146  12.012  1.00 34.63  ? 53  GLU B C   1 
ATOM   1517 O O   . GLU B 1 53  ? 35.967  31.589  12.584  1.00 34.78  ? 53  GLU B O   1 
ATOM   1518 C CB  . GLU B 1 53  ? 34.043  34.102  13.089  1.00 39.39  ? 53  GLU B CB  1 
ATOM   1519 C CG  . GLU B 1 53  ? 34.695  34.685  14.299  1.00 41.98  ? 53  GLU B CG  1 
ATOM   1520 C CD  . GLU B 1 53  ? 33.703  35.370  15.194  1.00 45.93  ? 53  GLU B CD  1 
ATOM   1521 O OE1 . GLU B 1 53  ? 34.118  35.839  16.250  1.00 51.07  ? 53  GLU B OE1 1 
ATOM   1522 O OE2 . GLU B 1 53  ? 32.510  35.441  14.867  1.00 46.40  ? 53  GLU B OE2 1 
ATOM   1523 N N   . THR B 1 54  ? 34.032  31.497  11.421  1.00 31.96  ? 54  THR B N   1 
ATOM   1524 C CA  . THR B 1 54  ? 34.010  30.046  11.232  1.00 30.46  ? 54  THR B CA  1 
ATOM   1525 C C   . THR B 1 54  ? 35.120  29.581  10.284  1.00 29.09  ? 54  THR B C   1 
ATOM   1526 O O   . THR B 1 54  ? 35.772  28.566  10.516  1.00 28.50  ? 54  THR B O   1 
ATOM   1527 C CB  . THR B 1 54  ? 32.668  29.573  10.605  1.00 31.11  ? 54  THR B CB  1 
ATOM   1528 O OG1 . THR B 1 54  ? 31.552  30.112  11.319  1.00 34.28  ? 54  THR B OG1 1 
ATOM   1529 C CG2 . THR B 1 54  ? 32.558  28.095  10.598  1.00 29.39  ? 54  THR B CG2 1 
ATOM   1530 N N   . ALA B 1 55  ? 35.304  30.322  9.201   1.00 27.04  ? 55  ALA B N   1 
ATOM   1531 C CA  . ALA B 1 55  ? 36.256  29.936  8.204   1.00 26.37  ? 55  ALA B CA  1 
ATOM   1532 C C   . ALA B 1 55  ? 37.651  29.873  8.803   1.00 26.74  ? 55  ALA B C   1 
ATOM   1533 O O   . ALA B 1 55  ? 38.424  28.956  8.479   1.00 25.76  ? 55  ALA B O   1 
ATOM   1534 C CB  . ALA B 1 55  ? 36.223  30.889  7.046   1.00 25.94  ? 55  ALA B CB  1 
ATOM   1535 N N   . LEU B 1 56  ? 37.984  30.847  9.655   1.00 26.34  ? 56  LEU B N   1 
ATOM   1536 C CA  . LEU B 1 56  ? 39.273  30.842  10.333  1.00 26.71  ? 56  LEU B CA  1 
ATOM   1537 C C   . LEU B 1 56  ? 39.304  29.805  11.402  1.00 28.25  ? 56  LEU B C   1 
ATOM   1538 O O   . LEU B 1 56  ? 40.232  29.023  11.483  1.00 27.31  ? 56  LEU B O   1 
ATOM   1539 C CB  . LEU B 1 56  ? 39.559  32.184  10.977  1.00 27.72  ? 56  LEU B CB  1 
ATOM   1540 C CG  . LEU B 1 56  ? 39.684  33.371  10.032  1.00 27.03  ? 56  LEU B CG  1 
ATOM   1541 C CD1 . LEU B 1 56  ? 39.428  34.630  10.771  1.00 24.38  ? 56  LEU B CD1 1 
ATOM   1542 C CD2 . LEU B 1 56  ? 41.059  33.343  9.439   1.00 24.36  ? 56  LEU B CD2 1 
ATOM   1543 N N   . ARG B 1 57  ? 38.290  29.798  12.246  1.00 30.22  ? 57  ARG B N   1 
ATOM   1544 C CA  . ARG B 1 57  ? 38.318  28.871  13.341  1.00 33.39  ? 57  ARG B CA  1 
ATOM   1545 C C   . ARG B 1 57  ? 38.487  27.477  12.761  1.00 33.60  ? 57  ARG B C   1 
ATOM   1546 O O   . ARG B 1 57  ? 39.207  26.625  13.280  1.00 34.27  ? 57  ARG B O   1 
ATOM   1547 C CB  . ARG B 1 57  ? 37.012  28.940  14.129  1.00 34.81  ? 57  ARG B CB  1 
ATOM   1548 C CG  . ARG B 1 57  ? 37.012  28.057  15.338  1.00 36.66  ? 57  ARG B CG  1 
ATOM   1549 C CD  . ARG B 1 57  ? 35.668  27.913  15.899  1.00 40.17  ? 57  ARG B CD  1 
ATOM   1550 N NE  . ARG B 1 57  ? 35.026  26.738  15.353  1.00 41.58  ? 57  ARG B NE  1 
ATOM   1551 C CZ  . ARG B 1 57  ? 33.988  26.785  14.555  1.00 43.53  ? 57  ARG B CZ  1 
ATOM   1552 N NH1 . ARG B 1 57  ? 33.470  27.942  14.208  1.00 44.47  ? 57  ARG B NH1 1 
ATOM   1553 N NH2 . ARG B 1 57  ? 33.468  25.676  14.099  1.00 51.77  ? 57  ARG B NH2 1 
ATOM   1554 N N   . GLU B 1 58  ? 37.781  27.248  11.673  1.00 33.18  ? 58  GLU B N   1 
ATOM   1555 C CA  . GLU B 1 58  ? 37.686  25.933  11.142  1.00 33.24  ? 58  GLU B CA  1 
ATOM   1556 C C   . GLU B 1 58  ? 38.925  25.575  10.344  1.00 32.70  ? 58  GLU B C   1 
ATOM   1557 O O   . GLU B 1 58  ? 39.302  24.421  10.289  1.00 34.36  ? 58  GLU B O   1 
ATOM   1558 C CB  . GLU B 1 58  ? 36.398  25.804  10.381  1.00 33.39  ? 58  GLU B CB  1 
ATOM   1559 C CG  . GLU B 1 58  ? 35.930  24.420  10.258  1.00 36.59  ? 58  GLU B CG  1 
ATOM   1560 C CD  . GLU B 1 58  ? 35.190  23.919  11.439  1.00 39.59  ? 58  GLU B CD  1 
ATOM   1561 O OE1 . GLU B 1 58  ? 34.232  24.556  11.866  1.00 38.29  ? 58  GLU B OE1 1 
ATOM   1562 O OE2 . GLU B 1 58  ? 35.559  22.843  11.905  1.00 42.75  ? 58  GLU B OE2 1 
ATOM   1563 N N   . THR B 1 59  ? 39.595  26.555  9.761   1.00 31.76  ? 59  THR B N   1 
ATOM   1564 C CA  . THR B 1 59  ? 40.904  26.278  9.160   1.00 31.40  ? 59  THR B CA  1 
ATOM   1565 C C   . THR B 1 59  ? 41.926  25.804  10.199  1.00 33.59  ? 59  THR B C   1 
ATOM   1566 O O   . THR B 1 59  ? 42.583  24.816  9.981   1.00 33.95  ? 59  THR B O   1 
ATOM   1567 C CB  . THR B 1 59  ? 41.428  27.472  8.360   1.00 30.38  ? 59  THR B CB  1 
ATOM   1568 O OG1 . THR B 1 59  ? 40.497  27.756  7.311   1.00 27.35  ? 59  THR B OG1 1 
ATOM   1569 C CG2 . THR B 1 59  ? 42.750  27.164  7.735   1.00 28.02  ? 59  THR B CG2 1 
ATOM   1570 N N   . GLN B 1 60  ? 42.029  26.481  11.338  1.00 35.88  ? 60  GLN B N   1 
ATOM   1571 C CA  . GLN B 1 60  ? 42.902  26.010  12.406  1.00 39.00  ? 60  GLN B CA  1 
ATOM   1572 C C   . GLN B 1 60  ? 42.532  24.631  12.977  1.00 39.77  ? 60  GLN B C   1 
ATOM   1573 O O   . GLN B 1 60  ? 43.411  23.829  13.249  1.00 40.57  ? 60  GLN B O   1 
ATOM   1574 C CB  . GLN B 1 60  ? 43.128  27.090  13.487  1.00 40.08  ? 60  GLN B CB  1 
ATOM   1575 C CG  . GLN B 1 60  ? 42.425  26.952  14.827  1.00 47.54  ? 60  GLN B CG  1 
ATOM   1576 C CD  . GLN B 1 60  ? 42.938  25.814  15.728  1.00 57.35  ? 60  GLN B CD  1 
ATOM   1577 O OE1 . GLN B 1 60  ? 44.090  25.384  15.648  1.00 62.10  ? 60  GLN B OE1 1 
ATOM   1578 N NE2 . GLN B 1 60  ? 42.060  25.323  16.585  1.00 60.08  ? 60  GLN B NE2 1 
ATOM   1579 N N   . GLU B 1 61  ? 41.246  24.353  13.149  1.00 40.02  ? 61  GLU B N   1 
ATOM   1580 C CA  . GLU B 1 61  ? 40.808  23.049  13.666  1.00 42.44  ? 61  GLU B CA  1 
ATOM   1581 C C   . GLU B 1 61  ? 41.109  21.886  12.715  1.00 41.83  ? 61  GLU B C   1 
ATOM   1582 O O   . GLU B 1 61  ? 41.575  20.829  13.101  1.00 43.32  ? 61  GLU B O   1 
ATOM   1583 C CB  . GLU B 1 61  ? 39.310  23.097  13.948  1.00 42.26  ? 61  GLU B CB  1 
ATOM   1584 C CG  . GLU B 1 61  ? 38.993  23.235  15.377  1.00 49.30  ? 61  GLU B CG  1 
ATOM   1585 C CD  . GLU B 1 61  ? 37.659  23.886  15.627  1.00 56.07  ? 61  GLU B CD  1 
ATOM   1586 O OE1 . GLU B 1 61  ? 37.664  25.062  16.028  1.00 61.26  ? 61  GLU B OE1 1 
ATOM   1587 O OE2 . GLU B 1 61  ? 36.616  23.236  15.443  1.00 55.60  ? 61  GLU B OE2 1 
ATOM   1588 N N   . GLU B 1 62  ? 40.792  22.117  11.458  1.00 39.96  ? 62  GLU B N   1 
ATOM   1589 C CA  . GLU B 1 62  ? 40.903  21.125  10.449  1.00 40.20  ? 62  GLU B CA  1 
ATOM   1590 C C   . GLU B 1 62  ? 42.315  20.968  9.909   1.00 39.39  ? 62  GLU B C   1 
ATOM   1591 O O   . GLU B 1 62  ? 42.758  19.871  9.626   1.00 40.48  ? 62  GLU B O   1 
ATOM   1592 C CB  . GLU B 1 62  ? 39.925  21.489  9.361   1.00 39.26  ? 62  GLU B CB  1 
ATOM   1593 C CG  . GLU B 1 62  ? 38.966  20.399  9.008   1.00 44.31  ? 62  GLU B CG  1 
ATOM   1594 C CD  . GLU B 1 62  ? 38.059  19.987  10.123  1.00 49.93  ? 62  GLU B CD  1 
ATOM   1595 O OE1 . GLU B 1 62  ? 38.291  20.326  11.288  1.00 55.59  ? 62  GLU B OE1 1 
ATOM   1596 O OE2 . GLU B 1 62  ? 37.077  19.307  9.835   1.00 54.95  ? 62  GLU B OE2 1 
ATOM   1597 N N   . ALA B 1 63  ? 43.019  22.075  9.770   1.00 37.34  ? 63  ALA B N   1 
ATOM   1598 C CA  . ALA B 1 63  ? 44.329  22.056  9.142   1.00 37.33  ? 63  ALA B CA  1 
ATOM   1599 C C   . ALA B 1 63  ? 45.488  22.526  10.010  1.00 38.09  ? 63  ALA B C   1 
ATOM   1600 O O   . ALA B 1 63  ? 46.634  22.492  9.570   1.00 39.86  ? 63  ALA B O   1 
ATOM   1601 C CB  . ALA B 1 63  ? 44.314  22.846  7.837   1.00 35.19  ? 63  ALA B CB  1 
ATOM   1602 N N   . GLY B 1 64  ? 45.214  22.970  11.226  1.00 38.28  ? 64  GLY B N   1 
ATOM   1603 C CA  . GLY B 1 64  ? 46.291  23.378  12.089  1.00 39.28  ? 64  GLY B CA  1 
ATOM   1604 C C   . GLY B 1 64  ? 46.919  24.721  11.790  1.00 39.24  ? 64  GLY B C   1 
ATOM   1605 O O   . GLY B 1 64  ? 47.905  25.055  12.402  1.00 40.59  ? 64  GLY B O   1 
ATOM   1606 N N   . ILE B 1 65  ? 46.345  25.509  10.887  1.00 38.14  ? 65  ILE B N   1 
ATOM   1607 C CA  . ILE B 1 65  ? 46.853  26.840  10.586  1.00 37.82  ? 65  ILE B CA  1 
ATOM   1608 C C   . ILE B 1 65  ? 46.126  27.946  11.313  1.00 39.58  ? 65  ILE B C   1 
ATOM   1609 O O   . ILE B 1 65  ? 44.937  28.081  11.183  1.00 37.04  ? 65  ILE B O   1 
ATOM   1610 C CB  . ILE B 1 65  ? 46.746  27.149  9.102   1.00 36.23  ? 65  ILE B CB  1 
ATOM   1611 C CG1 . ILE B 1 65  ? 47.418  26.055  8.307   1.00 34.15  ? 65  ILE B CG1 1 
ATOM   1612 C CG2 . ILE B 1 65  ? 47.437  28.459  8.795   1.00 34.69  ? 65  ILE B CG2 1 
ATOM   1613 C CD1 . ILE B 1 65  ? 46.935  25.964  6.918   1.00 29.66  ? 65  ILE B CD1 1 
ATOM   1614 N N   . GLU B 1 66  ? 46.878  28.746  12.059  1.00 43.84  ? 66  GLU B N   1 
ATOM   1615 C CA  . GLU B 1 66  ? 46.339  29.832  12.864  1.00 47.79  ? 66  GLU B CA  1 
ATOM   1616 C C   . GLU B 1 66  ? 46.358  31.094  12.073  1.00 46.98  ? 66  GLU B C   1 
ATOM   1617 O O   . GLU B 1 66  ? 47.038  31.168  11.090  1.00 46.48  ? 66  GLU B O   1 
ATOM   1618 C CB  . GLU B 1 66  ? 47.167  30.048  14.123  1.00 51.84  ? 66  GLU B CB  1 
ATOM   1619 C CG  . GLU B 1 66  ? 48.007  28.897  14.563  1.00 63.49  ? 66  GLU B CG  1 
ATOM   1620 C CD  . GLU B 1 66  ? 47.503  28.234  15.825  1.00 79.31  ? 66  GLU B CD  1 
ATOM   1621 O OE1 . GLU B 1 66  ? 46.370  28.535  16.258  1.00 82.70  ? 66  GLU B OE1 1 
ATOM   1622 O OE2 . GLU B 1 66  ? 48.245  27.398  16.383  1.00 84.64  ? 66  GLU B OE2 1 
ATOM   1623 N N   . ALA B 1 67  ? 45.638  32.100  12.538  1.00 48.42  ? 67  ALA B N   1 
ATOM   1624 C CA  . ALA B 1 67  ? 45.496  33.385  11.832  1.00 49.62  ? 67  ALA B CA  1 
ATOM   1625 C C   . ALA B 1 67  ? 46.813  34.160  11.571  1.00 52.24  ? 67  ALA B C   1 
ATOM   1626 O O   . ALA B 1 67  ? 46.935  34.866  10.572  1.00 51.06  ? 67  ALA B O   1 
ATOM   1627 C CB  . ALA B 1 67  ? 44.486  34.250  12.537  1.00 50.22  ? 67  ALA B CB  1 
ATOM   1628 N N   . GLY B 1 68  ? 47.784  34.009  12.474  1.00 54.73  ? 68  GLY B N   1 
ATOM   1629 C CA  . GLY B 1 68  ? 49.146  34.482  12.267  1.00 55.99  ? 68  GLY B CA  1 
ATOM   1630 C C   . GLY B 1 68  ? 49.802  33.915  11.012  1.00 54.17  ? 68  GLY B C   1 
ATOM   1631 O O   . GLY B 1 68  ? 50.541  34.619  10.327  1.00 55.58  ? 68  GLY B O   1 
ATOM   1632 N N   . GLN B 1 69  ? 49.515  32.650  10.704  1.00 50.74  ? 69  GLN B N   1 
ATOM   1633 C CA  . GLN B 1 69  ? 50.098  31.947  9.558   1.00 48.65  ? 69  GLN B CA  1 
ATOM   1634 C C   . GLN B 1 69  ? 49.360  32.190  8.228   1.00 46.66  ? 69  GLN B C   1 
ATOM   1635 O O   . GLN B 1 69  ? 49.741  31.647  7.203   1.00 45.79  ? 69  GLN B O   1 
ATOM   1636 C CB  . GLN B 1 69  ? 50.165  30.451  9.845   1.00 48.05  ? 69  GLN B CB  1 
ATOM   1637 C CG  . GLN B 1 69  ? 51.130  30.020  10.958  1.00 50.55  ? 69  GLN B CG  1 
ATOM   1638 C CD  . GLN B 1 69  ? 50.679  28.755  11.748  1.00 52.17  ? 69  GLN B CD  1 
ATOM   1639 O OE1 . GLN B 1 69  ? 51.159  28.519  12.837  1.00 55.91  ? 69  GLN B OE1 1 
ATOM   1640 N NE2 . GLN B 1 69  ? 49.762  27.974  11.207  1.00 46.82  ? 69  GLN B NE2 1 
ATOM   1641 N N   . LEU B 1 70  ? 48.323  33.030  8.258   1.00 45.37  ? 70  LEU B N   1 
ATOM   1642 C CA  . LEU B 1 70  ? 47.454  33.290  7.117   1.00 42.60  ? 70  LEU B CA  1 
ATOM   1643 C C   . LEU B 1 70  ? 47.252  34.751  6.810   1.00 43.70  ? 70  LEU B C   1 
ATOM   1644 O O   . LEU B 1 70  ? 47.370  35.599  7.677   1.00 49.54  ? 70  LEU B O   1 
ATOM   1645 C CB  . LEU B 1 70  ? 46.060  32.849  7.476   1.00 40.98  ? 70  LEU B CB  1 
ATOM   1646 C CG  . LEU B 1 70  ? 45.716  31.405  7.560   1.00 37.88  ? 70  LEU B CG  1 
ATOM   1647 C CD1 . LEU B 1 70  ? 44.339  31.384  8.090   1.00 35.77  ? 70  LEU B CD1 1 
ATOM   1648 C CD2 . LEU B 1 70  ? 45.742  30.888  6.175   1.00 38.67  ? 70  LEU B CD2 1 
ATOM   1649 N N   . THR B 1 71  ? 46.852  35.031  5.582   1.00 42.35  ? 71  THR B N   1 
ATOM   1650 C CA  . THR B 1 71  ? 46.298  36.328  5.234   1.00 42.41  ? 71  THR B CA  1 
ATOM   1651 C C   . THR B 1 71  ? 45.099  36.144  4.336   1.00 40.45  ? 71  THR B C   1 
ATOM   1652 O O   . THR B 1 71  ? 45.186  35.508  3.292   1.00 38.65  ? 71  THR B O   1 
ATOM   1653 C CB  . THR B 1 71  ? 47.316  37.215  4.535   1.00 44.52  ? 71  THR B CB  1 
ATOM   1654 O OG1 . THR B 1 71  ? 48.173  37.783  5.515   1.00 47.80  ? 71  THR B OG1 1 
ATOM   1655 C CG2 . THR B 1 71  ? 46.637  38.330  3.841   1.00 44.24  ? 71  THR B CG2 1 
ATOM   1656 N N   . ILE B 1 72  ? 43.977  36.704  4.749   1.00 40.33  ? 72  ILE B N   1 
ATOM   1657 C CA  . ILE B 1 72  ? 42.778  36.674  3.930   1.00 39.97  ? 72  ILE B CA  1 
ATOM   1658 C C   . ILE B 1 72  ? 42.838  37.676  2.764   1.00 41.61  ? 72  ILE B C   1 
ATOM   1659 O O   . ILE B 1 72  ? 43.083  38.859  2.957   1.00 44.18  ? 72  ILE B O   1 
ATOM   1660 C CB  . ILE B 1 72  ? 41.568  36.980  4.776   1.00 40.80  ? 72  ILE B CB  1 
ATOM   1661 C CG1 . ILE B 1 72  ? 41.498  35.988  5.937   1.00 39.20  ? 72  ILE B CG1 1 
ATOM   1662 C CG2 . ILE B 1 72  ? 40.299  36.952  3.929   1.00 39.86  ? 72  ILE B CG2 1 
ATOM   1663 C CD1 . ILE B 1 72  ? 40.290  35.168  5.916   1.00 36.24  ? 72  ILE B CD1 1 
ATOM   1664 N N   . ILE B 1 73  ? 42.609  37.190  1.555   1.00 40.38  ? 73  ILE B N   1 
ATOM   1665 C CA  . ILE B 1 73  ? 42.657  38.044  0.404   1.00 42.29  ? 73  ILE B CA  1 
ATOM   1666 C C   . ILE B 1 73  ? 41.295  38.712  0.250   1.00 44.77  ? 73  ILE B C   1 
ATOM   1667 O O   . ILE B 1 73  ? 40.313  38.051  -0.042  1.00 43.36  ? 73  ILE B O   1 
ATOM   1668 C CB  . ILE B 1 73  ? 42.996  37.230  -0.835  1.00 40.85  ? 73  ILE B CB  1 
ATOM   1669 C CG1 . ILE B 1 73  ? 44.237  36.399  -0.593  1.00 37.80  ? 73  ILE B CG1 1 
ATOM   1670 C CG2 . ILE B 1 73  ? 43.185  38.111  -2.036  1.00 41.01  ? 73  ILE B CG2 1 
ATOM   1671 C CD1 . ILE B 1 73  ? 45.361  37.197  -0.115  1.00 37.24  ? 73  ILE B CD1 1 
ATOM   1672 N N   . GLU B 1 74  ? 41.226  40.018  0.474   1.00 48.72  ? 74  GLU B N   1 
ATOM   1673 C CA  . GLU B 1 74  ? 39.935  40.698  0.420   1.00 51.83  ? 74  GLU B CA  1 
ATOM   1674 C C   . GLU B 1 74  ? 39.383  40.749  -0.987  1.00 51.30  ? 74  GLU B C   1 
ATOM   1675 O O   . GLU B 1 74  ? 40.131  40.800  -1.943  1.00 52.18  ? 74  GLU B O   1 
ATOM   1676 C CB  . GLU B 1 74  ? 40.013  42.112  1.009   1.00 58.42  ? 74  GLU B CB  1 
ATOM   1677 C CG  . GLU B 1 74  ? 40.317  42.198  2.511   1.00 67.25  ? 74  GLU B CG  1 
ATOM   1678 C CD  . GLU B 1 74  ? 39.533  41.195  3.364   1.00 74.16  ? 74  GLU B CD  1 
ATOM   1679 O OE1 . GLU B 1 74  ? 38.295  41.090  3.205   1.00 74.60  ? 74  GLU B OE1 1 
ATOM   1680 O OE2 . GLU B 1 74  ? 40.164  40.506  4.203   1.00 76.48  ? 74  GLU B OE2 1 
ATOM   1681 N N   . GLY B 1 75  ? 38.066  40.723  -1.103  1.00 50.17  ? 75  GLY B N   1 
ATOM   1682 C CA  . GLY B 1 75  ? 37.417  40.868  -2.396  1.00 50.14  ? 75  GLY B CA  1 
ATOM   1683 C C   . GLY B 1 75  ? 36.960  39.600  -3.067  1.00 48.05  ? 75  GLY B C   1 
ATOM   1684 O O   . GLY B 1 75  ? 36.356  39.651  -4.135  1.00 51.80  ? 75  GLY B O   1 
ATOM   1685 N N   . PHE B 1 76  ? 37.231  38.461  -2.445  1.00 42.68  ? 76  PHE B N   1 
ATOM   1686 C CA  . PHE B 1 76  ? 36.771  37.201  -2.976  1.00 38.80  ? 76  PHE B CA  1 
ATOM   1687 C C   . PHE B 1 76  ? 36.013  36.394  -1.943  1.00 36.61  ? 76  PHE B C   1 
ATOM   1688 O O   . PHE B 1 76  ? 36.407  36.301  -0.794  1.00 36.34  ? 76  PHE B O   1 
ATOM   1689 C CB  . PHE B 1 76  ? 37.932  36.389  -3.520  1.00 37.35  ? 76  PHE B CB  1 
ATOM   1690 C CG  . PHE B 1 76  ? 37.521  35.054  -4.032  1.00 34.97  ? 76  PHE B CG  1 
ATOM   1691 C CD1 . PHE B 1 76  ? 37.134  34.896  -5.352  1.00 33.27  ? 76  PHE B CD1 1 
ATOM   1692 C CD2 . PHE B 1 76  ? 37.495  33.951  -3.172  1.00 29.78  ? 76  PHE B CD2 1 
ATOM   1693 C CE1 . PHE B 1 76  ? 36.751  33.645  -5.803  1.00 36.03  ? 76  PHE B CE1 1 
ATOM   1694 C CE2 . PHE B 1 76  ? 37.096  32.724  -3.605  1.00 27.82  ? 76  PHE B CE2 1 
ATOM   1695 C CZ  . PHE B 1 76  ? 36.720  32.550  -4.909  1.00 31.93  ? 76  PHE B CZ  1 
ATOM   1696 N N   . LYS B 1 77  ? 34.911  35.814  -2.368  1.00 35.69  ? 77  LYS B N   1 
ATOM   1697 C CA  . LYS B 1 77  ? 34.097  34.957  -1.526  1.00 34.04  ? 77  LYS B CA  1 
ATOM   1698 C C   . LYS B 1 77  ? 33.311  34.073  -2.488  1.00 34.30  ? 77  LYS B C   1 
ATOM   1699 O O   . LYS B 1 77  ? 32.982  34.476  -3.589  1.00 35.06  ? 77  LYS B O   1 
ATOM   1700 C CB  . LYS B 1 77  ? 33.140  35.804  -0.692  1.00 34.62  ? 77  LYS B CB  1 
ATOM   1701 C CG  . LYS B 1 77  ? 32.098  35.025  0.038   1.00 35.13  ? 77  LYS B CG  1 
ATOM   1702 C CD  . LYS B 1 77  ? 30.997  35.928  0.452   1.00 40.82  ? 77  LYS B CD  1 
ATOM   1703 C CE  . LYS B 1 77  ? 31.562  37.178  1.095   1.00 44.37  ? 77  LYS B CE  1 
ATOM   1704 N NZ  . LYS B 1 77  ? 30.500  37.859  1.895   1.00 50.28  ? 77  LYS B NZ  1 
ATOM   1705 N N   . ARG B 1 78  ? 33.026  32.859  -2.100  1.00 33.27  ? 78  ARG B N   1 
ATOM   1706 C CA  . ARG B 1 78  ? 32.299  32.006  -2.986  1.00 36.27  ? 78  ARG B CA  1 
ATOM   1707 C C   . ARG B 1 78  ? 31.393  31.021  -2.236  1.00 36.99  ? 78  ARG B C   1 
ATOM   1708 O O   . ARG B 1 78  ? 31.842  30.191  -1.452  1.00 35.93  ? 78  ARG B O   1 
ATOM   1709 C CB  . ARG B 1 78  ? 33.303  31.261  -3.831  1.00 37.22  ? 78  ARG B CB  1 
ATOM   1710 C CG  . ARG B 1 78  ? 32.711  30.147  -4.565  1.00 43.45  ? 78  ARG B CG  1 
ATOM   1711 C CD  . ARG B 1 78  ? 32.233  30.578  -5.903  1.00 51.28  ? 78  ARG B CD  1 
ATOM   1712 N NE  . ARG B 1 78  ? 31.854  29.383  -6.645  1.00 58.59  ? 78  ARG B NE  1 
ATOM   1713 C CZ  . ARG B 1 78  ? 30.665  29.182  -7.193  1.00 61.92  ? 78  ARG B CZ  1 
ATOM   1714 N NH1 . ARG B 1 78  ? 29.717  30.110  -7.116  1.00 63.77  ? 78  ARG B NH1 1 
ATOM   1715 N NH2 . ARG B 1 78  ? 30.433  28.047  -7.825  1.00 63.52  ? 78  ARG B NH2 1 
ATOM   1716 N N   . GLU B 1 79  ? 30.107  31.106  -2.485  1.00 37.62  ? 79  GLU B N   1 
ATOM   1717 C CA  . GLU B 1 79  ? 29.179  30.199  -1.852  1.00 40.34  ? 79  GLU B CA  1 
ATOM   1718 C C   . GLU B 1 79  ? 28.845  29.021  -2.748  1.00 42.67  ? 79  GLU B C   1 
ATOM   1719 O O   . GLU B 1 79  ? 28.339  29.188  -3.831  1.00 46.31  ? 79  GLU B O   1 
ATOM   1720 C CB  . GLU B 1 79  ? 27.915  30.948  -1.538  1.00 41.27  ? 79  GLU B CB  1 
ATOM   1721 C CG  . GLU B 1 79  ? 26.859  30.126  -0.926  1.00 45.25  ? 79  GLU B CG  1 
ATOM   1722 C CD  . GLU B 1 79  ? 25.685  30.968  -0.475  1.00 52.99  ? 79  GLU B CD  1 
ATOM   1723 O OE1 . GLU B 1 79  ? 25.885  32.042  0.127   1.00 55.07  ? 79  GLU B OE1 1 
ATOM   1724 O OE2 . GLU B 1 79  ? 24.546  30.564  -0.722  1.00 57.36  ? 79  GLU B OE2 1 
ATOM   1725 N N   . LEU B 1 80  ? 29.132  27.823  -2.277  1.00 44.11  ? 80  LEU B N   1 
ATOM   1726 C CA  . LEU B 1 80  ? 28.769  26.600  -2.955  1.00 46.87  ? 80  LEU B CA  1 
ATOM   1727 C C   . LEU B 1 80  ? 27.503  26.038  -2.375  1.00 51.54  ? 80  LEU B C   1 
ATOM   1728 O O   . LEU B 1 80  ? 27.421  25.859  -1.172  1.00 50.21  ? 80  LEU B O   1 
ATOM   1729 C CB  . LEU B 1 80  ? 29.845  25.552  -2.720  1.00 44.93  ? 80  LEU B CB  1 
ATOM   1730 C CG  . LEU B 1 80  ? 31.073  25.409  -3.586  1.00 40.17  ? 80  LEU B CG  1 
ATOM   1731 C CD1 . LEU B 1 80  ? 31.969  26.540  -3.323  1.00 39.78  ? 80  LEU B CD1 1 
ATOM   1732 C CD2 . LEU B 1 80  ? 31.759  24.182  -3.181  1.00 35.90  ? 80  LEU B CD2 1 
ATOM   1733 N N   . ASN B 1 81  ? 26.540  25.727  -3.244  1.00 58.34  ? 81  ASN B N   1 
ATOM   1734 C CA  . ASN B 1 81  ? 25.300  25.044  -2.859  1.00 65.23  ? 81  ASN B CA  1 
ATOM   1735 C C   . ASN B 1 81  ? 25.177  23.680  -3.495  1.00 70.27  ? 81  ASN B C   1 
ATOM   1736 O O   . ASN B 1 81  ? 25.051  23.593  -4.701  1.00 72.35  ? 81  ASN B O   1 
ATOM   1737 C CB  . ASN B 1 81  ? 24.122  25.864  -3.303  1.00 66.66  ? 81  ASN B CB  1 
ATOM   1738 C CG  . ASN B 1 81  ? 23.753  26.890  -2.315  1.00 68.28  ? 81  ASN B CG  1 
ATOM   1739 O OD1 . ASN B 1 81  ? 23.236  26.574  -1.263  1.00 73.02  ? 81  ASN B OD1 1 
ATOM   1740 N ND2 . ASN B 1 81  ? 24.001  28.142  -2.639  1.00 70.53  ? 81  ASN B ND2 1 
ATOM   1741 N N   . TYR B 1 82  ? 25.201  22.620  -2.699  1.00 76.92  ? 82  TYR B N   1 
ATOM   1742 C CA  . TYR B 1 82  ? 25.179  21.280  -3.257  1.00 83.02  ? 82  TYR B CA  1 
ATOM   1743 C C   . TYR B 1 82  ? 24.534  20.238  -2.364  1.00 88.79  ? 82  TYR B C   1 
ATOM   1744 O O   . TYR B 1 82  ? 24.069  20.543  -1.266  1.00 89.02  ? 82  TYR B O   1 
ATOM   1745 C CB  . TYR B 1 82  ? 26.586  20.841  -3.653  1.00 80.76  ? 82  TYR B CB  1 
ATOM   1746 C CG  . TYR B 1 82  ? 27.581  20.804  -2.523  1.00 78.32  ? 82  TYR B CG  1 
ATOM   1747 C CD1 . TYR B 1 82  ? 27.566  19.771  -1.592  1.00 79.69  ? 82  TYR B CD1 1 
ATOM   1748 C CD2 . TYR B 1 82  ? 28.556  21.786  -2.393  1.00 76.19  ? 82  TYR B CD2 1 
ATOM   1749 C CE1 . TYR B 1 82  ? 28.487  19.724  -0.545  1.00 76.66  ? 82  TYR B CE1 1 
ATOM   1750 C CE2 . TYR B 1 82  ? 29.484  21.743  -1.354  1.00 71.90  ? 82  TYR B CE2 1 
ATOM   1751 C CZ  . TYR B 1 82  ? 29.439  20.708  -0.436  1.00 72.36  ? 82  TYR B CZ  1 
ATOM   1752 O OH  . TYR B 1 82  ? 30.348  20.658  0.590   1.00 70.42  ? 82  TYR B OH  1 
ATOM   1753 N N   . VAL B 1 83  ? 24.501  19.003  -2.870  1.00 96.33  ? 83  VAL B N   1 
ATOM   1754 C CA  . VAL B 1 83  ? 23.825  17.874  -2.229  1.00 103.63 ? 83  VAL B CA  1 
ATOM   1755 C C   . VAL B 1 83  ? 24.856  16.814  -1.916  1.00 105.21 ? 83  VAL B C   1 
ATOM   1756 O O   . VAL B 1 83  ? 25.490  16.303  -2.832  1.00 104.65 ? 83  VAL B O   1 
ATOM   1757 C CB  . VAL B 1 83  ? 22.772  17.251  -3.174  1.00 108.83 ? 83  VAL B CB  1 
ATOM   1758 C CG1 . VAL B 1 83  ? 21.867  16.319  -2.398  1.00 117.32 ? 83  VAL B CG1 1 
ATOM   1759 C CG2 . VAL B 1 83  ? 21.948  18.341  -3.889  1.00 108.57 ? 83  VAL B CG2 1 
ATOM   1760 N N   . ALA B 1 84  ? 25.026  16.499  -0.641  1.00 108.93 ? 84  ALA B N   1 
ATOM   1761 C CA  . ALA B 1 84  ? 26.104  15.620  -0.235  1.00 111.95 ? 84  ALA B CA  1 
ATOM   1762 C C   . ALA B 1 84  ? 25.702  14.445  0.629   1.00 118.80 ? 84  ALA B C   1 
ATOM   1763 O O   . ALA B 1 84  ? 25.395  14.608  1.805   1.00 118.60 ? 84  ALA B O   1 
ATOM   1764 C CB  . ALA B 1 84  ? 27.149  16.420  0.472   1.00 107.35 ? 84  ALA B CB  1 
ATOM   1765 N N   . ARG B 1 85  ? 25.746  13.252  0.040   0.50 126.69 ? 85  ARG B N   1 
ATOM   1766 C CA  . ARG B 1 85  ? 25.356  12.031  0.732   0.50 136.12 ? 85  ARG B CA  1 
ATOM   1767 C C   . ARG B 1 85  ? 23.852  12.108  0.924   0.50 140.38 ? 85  ARG B C   1 
ATOM   1768 O O   . ARG B 1 85  ? 23.282  11.526  1.835   0.50 144.41 ? 85  ARG B O   1 
ATOM   1769 C CB  . ARG B 1 85  ? 26.076  11.931  2.067   0.50 57.88  ? 85  ARG B CB  1 
ATOM   1770 C CG  . ARG B 1 85  ? 26.248  10.529  2.591   0.50 60.72  ? 85  ARG B CG  1 
ATOM   1771 C CD  . ARG B 1 85  ? 27.013  10.576  3.900   0.50 58.94  ? 85  ARG B CD  1 
ATOM   1772 N NE  . ARG B 1 85  ? 27.591  11.898  4.105   0.50 54.79  ? 85  ARG B NE  1 
ATOM   1773 C CZ  . ARG B 1 85  ? 27.381  12.648  5.175   0.50 53.68  ? 85  ARG B CZ  1 
ATOM   1774 N NH1 . ARG B 1 85  ? 26.610  12.209  6.162   0.50 56.31  ? 85  ARG B NH1 1 
ATOM   1775 N NH2 . ARG B 1 85  ? 27.950  13.836  5.261   0.50 50.23  ? 85  ARG B NH2 1 
ATOM   1776 N N   . ASN B 1 86  ? 23.238  12.873  0.036   1.00 139.87 ? 86  ASN B N   1 
ATOM   1777 C CA  . ASN B 1 86  ? 21.802  13.084  -0.019  1.00 143.80 ? 86  ASN B CA  1 
ATOM   1778 C C   . ASN B 1 86  ? 21.213  14.158  0.866   1.00 138.74 ? 86  ASN B C   1 
ATOM   1779 O O   . ASN B 1 86  ? 20.019  14.402  0.843   1.00 142.69 ? 86  ASN B O   1 
ATOM   1780 C CB  . ASN B 1 86  ? 21.039  11.783  0.054   1.00 154.49 ? 86  ASN B CB  1 
ATOM   1781 C CG  . ASN B 1 86  ? 20.521  11.385  -1.281  1.00 163.66 ? 86  ASN B CG  1 
ATOM   1782 O OD1 . ASN B 1 86  ? 19.819  12.152  -1.926  1.00 168.45 ? 86  ASN B OD1 1 
ATOM   1783 N ND2 . ASN B 1 86  ? 20.892  10.208  -1.732  1.00 171.90 ? 86  ASN B ND2 1 
ATOM   1784 N N   . LYS B 1 87  ? 22.069  14.825  1.616   1.00 129.43 ? 87  LYS B N   1 
ATOM   1785 C CA  . LYS B 1 87  ? 21.664  16.019  2.363   1.00 120.22 ? 87  LYS B CA  1 
ATOM   1786 C C   . LYS B 1 87  ? 22.121  17.289  1.618   1.00 109.31 ? 87  LYS B C   1 
ATOM   1787 O O   . LYS B 1 87  ? 23.130  17.260  0.900   1.00 105.97 ? 87  LYS B O   1 
ATOM   1788 C CB  . LYS B 1 87  ? 22.221  15.986  3.775   1.00 118.93 ? 87  LYS B CB  1 
ATOM   1789 N N   . PRO B 1 88  ? 21.352  18.390  1.760   1.00 104.40 ? 88  PRO B N   1 
ATOM   1790 C CA  . PRO B 1 88  ? 21.676  19.661  1.105   1.00 96.83  ? 88  PRO B CA  1 
ATOM   1791 C C   . PRO B 1 88  ? 22.686  20.497  1.905   1.00 88.44  ? 88  PRO B C   1 
ATOM   1792 O O   . PRO B 1 88  ? 22.514  20.710  3.111   1.00 87.82  ? 88  PRO B O   1 
ATOM   1793 C CB  . PRO B 1 88  ? 20.320  20.371  1.035   1.00 99.34  ? 88  PRO B CB  1 
ATOM   1794 C CG  . PRO B 1 88  ? 19.585  19.877  2.208   1.00 104.55 ? 88  PRO B CG  1 
ATOM   1795 C CD  . PRO B 1 88  ? 20.065  18.464  2.482   1.00 107.89 ? 88  PRO B CD  1 
ATOM   1796 N N   . LYS B 1 89  ? 23.733  20.966  1.232   1.00 80.48  ? 89  LYS B N   1 
ATOM   1797 C CA  . LYS B 1 89  ? 24.805  21.687  1.910   1.00 72.19  ? 89  LYS B CA  1 
ATOM   1798 C C   . LYS B 1 89  ? 25.100  23.069  1.327   1.00 66.45  ? 89  LYS B C   1 
ATOM   1799 O O   . LYS B 1 89  ? 24.960  23.302  0.126   1.00 68.10  ? 89  LYS B O   1 
ATOM   1800 C CB  . LYS B 1 89  ? 26.084  20.846  1.924   1.00 43.42  ? 89  LYS B CB  1 
ATOM   1801 C CG  . LYS B 1 89  ? 27.167  21.377  2.849   1.00 40.83  ? 89  LYS B CG  1 
ATOM   1802 C CD  . LYS B 1 89  ? 26.800  21.162  4.308   1.00 41.41  ? 89  LYS B CD  1 
ATOM   1803 C CE  . LYS B 1 89  ? 28.008  21.344  5.214   1.00 39.13  ? 89  LYS B CE  1 
ATOM   1804 N NZ  . LYS B 1 89  ? 29.164  20.517  4.770   1.00 38.34  ? 89  LYS B NZ  1 
ATOM   1805 N N   . THR B 1 90  ? 25.517  23.975  2.206   1.00 58.20  ? 90  THR B N   1 
ATOM   1806 C CA  . THR B 1 90  ? 25.935  25.294  1.846   1.00 52.34  ? 90  THR B CA  1 
ATOM   1807 C C   . THR B 1 90  ? 27.343  25.536  2.387   1.00 46.77  ? 90  THR B C   1 
ATOM   1808 O O   . THR B 1 90  ? 27.586  25.345  3.562   1.00 46.78  ? 90  THR B O   1 
ATOM   1809 C CB  . THR B 1 90  ? 24.981  26.324  2.444   1.00 53.72  ? 90  THR B CB  1 
ATOM   1810 O OG1 . THR B 1 90  ? 23.927  26.585  1.520   1.00 57.24  ? 90  THR B OG1 1 
ATOM   1811 C CG2 . THR B 1 90  ? 25.690  27.630  2.739   1.00 50.51  ? 90  THR B CG2 1 
ATOM   1812 N N   . VAL B 1 91  ? 28.275  25.973  1.551   1.00 40.81  ? 91  VAL B N   1 
ATOM   1813 C CA  . VAL B 1 91  ? 29.602  26.227  2.066   1.00 35.27  ? 91  VAL B CA  1 
ATOM   1814 C C   . VAL B 1 91  ? 30.104  27.576  1.586   1.00 32.96  ? 91  VAL B C   1 
ATOM   1815 O O   . VAL B 1 91  ? 29.989  27.884  0.433   1.00 32.79  ? 91  VAL B O   1 
ATOM   1816 C CB  . VAL B 1 91  ? 30.581  25.060  1.705   1.00 34.13  ? 91  VAL B CB  1 
ATOM   1817 C CG1 . VAL B 1 91  ? 31.885  25.194  2.431   1.00 29.03  ? 91  VAL B CG1 1 
ATOM   1818 C CG2 . VAL B 1 91  ? 29.968  23.744  2.103   1.00 33.99  ? 91  VAL B CG2 1 
ATOM   1819 N N   . ILE B 1 92  ? 30.669  28.386  2.466   1.00 30.73  ? 92  ILE B N   1 
ATOM   1820 C CA  . ILE B 1 92  ? 31.231  29.628  2.001   1.00 29.74  ? 92  ILE B CA  1 
ATOM   1821 C C   . ILE B 1 92  ? 32.694  29.556  2.115   1.00 28.42  ? 92  ILE B C   1 
ATOM   1822 O O   . ILE B 1 92  ? 33.195  29.110  3.128   1.00 29.22  ? 92  ILE B O   1 
ATOM   1823 C CB  . ILE B 1 92  ? 30.815  30.816  2.804   1.00 30.60  ? 92  ILE B CB  1 
ATOM   1824 C CG1 . ILE B 1 92  ? 29.448  30.589  3.402   1.00 32.77  ? 92  ILE B CG1 1 
ATOM   1825 C CG2 . ILE B 1 92  ? 30.725  32.005  1.894   1.00 30.69  ? 92  ILE B CG2 1 
ATOM   1826 C CD1 . ILE B 1 92  ? 28.354  30.729  2.376   1.00 36.70  ? 92  ILE B CD1 1 
ATOM   1827 N N   . TYR B 1 93  ? 33.380  30.035  1.078   1.00 27.53  ? 93  TYR B N   1 
ATOM   1828 C CA  . TYR B 1 93  ? 34.816  30.059  1.073   1.00 25.90  ? 93  TYR B CA  1 
ATOM   1829 C C   . TYR B 1 93  ? 35.349  31.459  0.785   1.00 25.89  ? 93  TYR B C   1 
ATOM   1830 O O   . TYR B 1 93  ? 34.829  32.173  -0.066  1.00 26.84  ? 93  TYR B O   1 
ATOM   1831 C CB  . TYR B 1 93  ? 35.356  29.110  0.003   1.00 25.91  ? 93  TYR B CB  1 
ATOM   1832 C CG  . TYR B 1 93  ? 35.326  27.664  0.328   1.00 24.52  ? 93  TYR B CG  1 
ATOM   1833 C CD1 . TYR B 1 93  ? 36.230  27.109  1.226   1.00 24.79  ? 93  TYR B CD1 1 
ATOM   1834 C CD2 . TYR B 1 93  ? 34.442  26.820  -0.330  1.00 26.73  ? 93  TYR B CD2 1 
ATOM   1835 C CE1 . TYR B 1 93  ? 36.221  25.755  1.494   1.00 22.50  ? 93  TYR B CE1 1 
ATOM   1836 C CE2 . TYR B 1 93  ? 34.405  25.485  -0.068  1.00 25.05  ? 93  TYR B CE2 1 
ATOM   1837 C CZ  . TYR B 1 93  ? 35.292  24.965  0.832   1.00 26.13  ? 93  TYR B CZ  1 
ATOM   1838 O OH  . TYR B 1 93  ? 35.205  23.640  1.059   1.00 30.24  ? 93  TYR B OH  1 
ATOM   1839 N N   . TRP B 1 94  ? 36.442  31.791  1.461   1.00 24.33  ? 94  TRP B N   1 
ATOM   1840 C CA  . TRP B 1 94  ? 37.251  32.976  1.188   1.00 24.79  ? 94  TRP B CA  1 
ATOM   1841 C C   . TRP B 1 94  ? 38.625  32.465  0.769   1.00 24.26  ? 94  TRP B C   1 
ATOM   1842 O O   . TRP B 1 94  ? 38.903  31.287  0.956   1.00 24.09  ? 94  TRP B O   1 
ATOM   1843 C CB  . TRP B 1 94  ? 37.413  33.790  2.445   1.00 24.32  ? 94  TRP B CB  1 
ATOM   1844 C CG  . TRP B 1 94  ? 36.352  34.721  2.724   1.00 26.85  ? 94  TRP B CG  1 
ATOM   1845 C CD1 . TRP B 1 94  ? 36.335  36.061  2.439   1.00 28.50  ? 94  TRP B CD1 1 
ATOM   1846 C CD2 . TRP B 1 94  ? 35.141  34.443  3.424   1.00 30.57  ? 94  TRP B CD2 1 
ATOM   1847 N NE1 . TRP B 1 94  ? 35.167  36.628  2.897   1.00 31.30  ? 94  TRP B NE1 1 
ATOM   1848 C CE2 . TRP B 1 94  ? 34.416  35.654  3.501   1.00 31.23  ? 94  TRP B CE2 1 
ATOM   1849 C CE3 . TRP B 1 94  ? 34.586  33.283  3.991   1.00 30.64  ? 94  TRP B CE3 1 
ATOM   1850 C CZ2 . TRP B 1 94  ? 33.178  35.734  4.114   1.00 32.37  ? 94  TRP B CZ2 1 
ATOM   1851 C CZ3 . TRP B 1 94  ? 33.335  33.372  4.586   1.00 31.61  ? 94  TRP B CZ3 1 
ATOM   1852 C CH2 . TRP B 1 94  ? 32.655  34.589  4.652   1.00 31.26  ? 94  TRP B CH2 1 
ATOM   1853 N N   . LEU B 1 95  ? 39.473  33.318  0.203   1.00 25.04  ? 95  LEU B N   1 
ATOM   1854 C CA  . LEU B 1 95  ? 40.791  32.870  -0.203  1.00 25.51  ? 95  LEU B CA  1 
ATOM   1855 C C   . LEU B 1 95  ? 41.765  33.344  0.808   1.00 26.88  ? 95  LEU B C   1 
ATOM   1856 O O   . LEU B 1 95  ? 41.681  34.497  1.249   1.00 31.15  ? 95  LEU B O   1 
ATOM   1857 C CB  . LEU B 1 95  ? 41.217  33.529  -1.476  1.00 27.41  ? 95  LEU B CB  1 
ATOM   1858 C CG  . LEU B 1 95  ? 40.944  32.846  -2.782  1.00 29.23  ? 95  LEU B CG  1 
ATOM   1859 C CD1 . LEU B 1 95  ? 41.055  33.947  -3.755  1.00 33.71  ? 95  LEU B CD1 1 
ATOM   1860 C CD2 . LEU B 1 95  ? 42.011  31.845  -3.064  1.00 29.89  ? 95  LEU B CD2 1 
ATOM   1861 N N   . ALA B 1 96  ? 42.702  32.485  1.173   1.00 25.15  ? 96  ALA B N   1 
ATOM   1862 C CA  . ALA B 1 96  ? 43.710  32.888  2.115   1.00 26.64  ? 96  ALA B CA  1 
ATOM   1863 C C   . ALA B 1 96  ? 45.057  32.382  1.650   1.00 27.93  ? 96  ALA B C   1 
ATOM   1864 O O   . ALA B 1 96  ? 45.151  31.332  1.022   1.00 27.50  ? 96  ALA B O   1 
ATOM   1865 C CB  . ALA B 1 96  ? 43.377  32.388  3.516   1.00 24.27  ? 96  ALA B CB  1 
ATOM   1866 N N   . GLU B 1 97  ? 46.091  33.159  1.942   1.00 30.88  ? 97  GLU B N   1 
ATOM   1867 C CA  . GLU B 1 97  ? 47.434  32.858  1.516   1.00 33.18  ? 97  GLU B CA  1 
ATOM   1868 C C   . GLU B 1 97  ? 48.174  32.478  2.758   1.00 33.23  ? 97  GLU B C   1 
ATOM   1869 O O   . GLU B 1 97  ? 47.926  33.048  3.800   1.00 33.66  ? 97  GLU B O   1 
ATOM   1870 C CB  . GLU B 1 97  ? 48.057  34.097  0.894   1.00 35.91  ? 97  GLU B CB  1 
ATOM   1871 C CG  . GLU B 1 97  ? 49.409  33.895  0.273   1.00 41.49  ? 97  GLU B CG  1 
ATOM   1872 C CD  . GLU B 1 97  ? 50.003  35.189  -0.258  1.00 49.64  ? 97  GLU B CD  1 
ATOM   1873 O OE1 . GLU B 1 97  ? 51.142  35.180  -0.764  1.00 51.72  ? 97  GLU B OE1 1 
ATOM   1874 O OE2 . GLU B 1 97  ? 49.316  36.221  -0.162  1.00 53.79  ? 97  GLU B OE2 1 
ATOM   1875 N N   . VAL B 1 98  ? 49.047  31.485  2.666   1.00 33.34  ? 98  VAL B N   1 
ATOM   1876 C CA  . VAL B 1 98  ? 49.874  31.135  3.810   1.00 33.91  ? 98  VAL B CA  1 
ATOM   1877 C C   . VAL B 1 98  ? 51.141  31.952  3.825   1.00 38.60  ? 98  VAL B C   1 
ATOM   1878 O O   . VAL B 1 98  ? 51.788  32.126  2.814   1.00 43.08  ? 98  VAL B O   1 
ATOM   1879 C CB  . VAL B 1 98  ? 50.231  29.657  3.843   1.00 31.86  ? 98  VAL B CB  1 
ATOM   1880 C CG1 . VAL B 1 98  ? 49.051  28.849  4.291   1.00 25.66  ? 98  VAL B CG1 1 
ATOM   1881 C CG2 . VAL B 1 98  ? 50.748  29.193  2.493   1.00 31.56  ? 98  VAL B CG2 1 
ATOM   1882 N N   . LYS B 1 99  ? 51.503  32.438  4.988   1.00 41.55  ? 99  LYS B N   1 
ATOM   1883 C CA  . LYS B 1 99  ? 52.688  33.238  5.154   1.00 46.86  ? 99  LYS B CA  1 
ATOM   1884 C C   . LYS B 1 99  ? 53.959  32.503  4.746   1.00 48.64  ? 99  LYS B C   1 
ATOM   1885 O O   . LYS B 1 99  ? 54.867  33.084  4.179   1.00 51.51  ? 99  LYS B O   1 
ATOM   1886 C CB  . LYS B 1 99  ? 52.774  33.619  6.618   1.00 48.64  ? 99  LYS B CB  1 
ATOM   1887 C CG  . LYS B 1 99  ? 53.673  34.750  6.920   1.00 55.41  ? 99  LYS B CG  1 
ATOM   1888 C CD  . LYS B 1 99  ? 53.671  35.002  8.395   1.00 63.13  ? 99  LYS B CD  1 
ATOM   1889 N N   . ASP B 1 100 ? 54.002  31.210  5.044   1.00 48.03  ? 100 ASP B N   1 
ATOM   1890 C CA  . ASP B 1 100 ? 55.177  30.392  4.868   1.00 49.30  ? 100 ASP B CA  1 
ATOM   1891 C C   . ASP B 1 100 ? 54.873  29.129  4.089   1.00 47.11  ? 100 ASP B C   1 
ATOM   1892 O O   . ASP B 1 100 ? 53.908  28.406  4.365   1.00 43.93  ? 100 ASP B O   1 
ATOM   1893 C CB  . ASP B 1 100 ? 55.752  30.032  6.230   1.00 50.96  ? 100 ASP B CB  1 
ATOM   1894 C CG  . ASP B 1 100 ? 56.155  31.243  7.020   1.00 58.35  ? 100 ASP B CG  1 
ATOM   1895 O OD1 . ASP B 1 100 ? 56.137  31.210  8.246   1.00 66.69  ? 100 ASP B OD1 1 
ATOM   1896 O OD2 . ASP B 1 100 ? 56.487  32.259  6.414   1.00 66.73  ? 100 ASP B OD2 1 
ATOM   1897 N N   . TYR B 1 101 ? 55.730  28.873  3.109   1.00 49.12  ? 101 TYR B N   1 
ATOM   1898 C CA  . TYR B 1 101 ? 55.637  27.736  2.221   1.00 46.45  ? 101 TYR B CA  1 
ATOM   1899 C C   . TYR B 1 101 ? 55.620  26.432  3.020   1.00 44.72  ? 101 TYR B C   1 
ATOM   1900 O O   . TYR B 1 101 ? 55.002  25.444  2.619   1.00 45.11  ? 101 TYR B O   1 
ATOM   1901 C CB  . TYR B 1 101 ? 56.845  27.787  1.302   1.00 48.49  ? 101 TYR B CB  1 
ATOM   1902 C CG  . TYR B 1 101 ? 56.909  26.719  0.262   1.00 47.94  ? 101 TYR B CG  1 
ATOM   1903 C CD1 . TYR B 1 101 ? 56.283  26.886  -0.950  1.00 46.82  ? 101 TYR B CD1 1 
ATOM   1904 C CD2 . TYR B 1 101 ? 57.636  25.565  0.473   1.00 49.46  ? 101 TYR B CD2 1 
ATOM   1905 C CE1 . TYR B 1 101 ? 56.355  25.949  -1.910  1.00 48.05  ? 101 TYR B CE1 1 
ATOM   1906 C CE2 . TYR B 1 101 ? 57.722  24.609  -0.498  1.00 52.58  ? 101 TYR B CE2 1 
ATOM   1907 C CZ  . TYR B 1 101 ? 57.071  24.812  -1.687  1.00 52.04  ? 101 TYR B CZ  1 
ATOM   1908 O OH  . TYR B 1 101 ? 57.133  23.864  -2.653  1.00 54.27  ? 101 TYR B OH  1 
ATOM   1909 N N   . ASP B 1 102 ? 56.292  26.445  4.160   1.00 44.29  ? 102 ASP B N   1 
ATOM   1910 C CA  . ASP B 1 102 ? 56.510  25.236  4.893   1.00 43.09  ? 102 ASP B CA  1 
ATOM   1911 C C   . ASP B 1 102 ? 55.723  25.202  6.151   1.00 39.99  ? 102 ASP B C   1 
ATOM   1912 O O   . ASP B 1 102 ? 56.108  24.524  7.082   1.00 40.93  ? 102 ASP B O   1 
ATOM   1913 C CB  . ASP B 1 102 ? 57.992  25.075  5.205   1.00 48.32  ? 102 ASP B CB  1 
ATOM   1914 C CG  . ASP B 1 102 ? 58.511  26.112  6.170   1.00 54.75  ? 102 ASP B CG  1 
ATOM   1915 O OD1 . ASP B 1 102 ? 59.697  26.040  6.479   1.00 63.23  ? 102 ASP B OD1 1 
ATOM   1916 O OD2 . ASP B 1 102 ? 57.764  26.985  6.631   1.00 56.27  ? 102 ASP B OD2 1 
ATOM   1917 N N   . VAL B 1 103 ? 54.621  25.936  6.178   1.00 36.51  ? 103 VAL B N   1 
ATOM   1918 C CA  . VAL B 1 103 ? 53.797  26.058  7.356   1.00 32.97  ? 103 VAL B CA  1 
ATOM   1919 C C   . VAL B 1 103 ? 53.418  24.658  7.743   1.00 32.24  ? 103 VAL B C   1 
ATOM   1920 O O   . VAL B 1 103 ? 53.272  23.803  6.891   1.00 30.92  ? 103 VAL B O   1 
ATOM   1921 C CB  . VAL B 1 103 ? 52.537  26.936  7.073   1.00 31.26  ? 103 VAL B CB  1 
ATOM   1922 C CG1 . VAL B 1 103 ? 51.927  26.629  5.720   1.00 26.68  ? 103 VAL B CG1 1 
ATOM   1923 C CG2 . VAL B 1 103 ? 51.503  26.799  8.159   1.00 26.46  ? 103 VAL B CG2 1 
ATOM   1924 N N   . GLU B 1 104 ? 53.301  24.412  9.032   1.00 32.87  ? 104 GLU B N   1 
ATOM   1925 C CA  . GLU B 1 104 ? 52.952  23.094  9.478   1.00 34.76  ? 104 GLU B CA  1 
ATOM   1926 C C   . GLU B 1 104 ? 51.449  22.864  9.454   1.00 33.52  ? 104 GLU B C   1 
ATOM   1927 O O   . GLU B 1 104 ? 50.682  23.589  10.082  1.00 34.41  ? 104 GLU B O   1 
ATOM   1928 C CB  . GLU B 1 104 ? 53.520  22.814  10.868  1.00 36.32  ? 104 GLU B CB  1 
ATOM   1929 C CG  . GLU B 1 104 ? 53.479  21.340  11.203  1.00 43.58  ? 104 GLU B CG  1 
ATOM   1930 C CD  . GLU B 1 104 ? 53.387  21.042  12.695  1.00 51.37  ? 104 GLU B CD  1 
ATOM   1931 O OE1 . GLU B 1 104 ? 52.781  20.010  13.055  1.00 52.18  ? 104 GLU B OE1 1 
ATOM   1932 O OE2 . GLU B 1 104 ? 53.919  21.828  13.500  1.00 55.23  ? 104 GLU B OE2 1 
ATOM   1933 N N   . ILE B 1 105 ? 51.053  21.825  8.730   1.00 32.82  ? 105 ILE B N   1 
ATOM   1934 C CA  . ILE B 1 105 ? 49.671  21.393  8.631   1.00 31.22  ? 105 ILE B CA  1 
ATOM   1935 C C   . ILE B 1 105 ? 49.371  20.337  9.676   1.00 33.77  ? 105 ILE B C   1 
ATOM   1936 O O   . ILE B 1 105 ? 50.008  19.286  9.697   1.00 35.06  ? 105 ILE B O   1 
ATOM   1937 C CB  . ILE B 1 105 ? 49.453  20.701  7.291   1.00 29.95  ? 105 ILE B CB  1 
ATOM   1938 C CG1 . ILE B 1 105 ? 49.853  21.617  6.123   1.00 26.68  ? 105 ILE B CG1 1 
ATOM   1939 C CG2 . ILE B 1 105 ? 48.045  20.188  7.203   1.00 25.96  ? 105 ILE B CG2 1 
ATOM   1940 C CD1 . ILE B 1 105 ? 49.114  22.930  6.082   1.00 19.98  ? 105 ILE B CD1 1 
ATOM   1941 N N   . ARG B 1 106 ? 48.396  20.581  10.534  1.00 35.12  ? 106 ARG B N   1 
ATOM   1942 C CA  . ARG B 1 106 ? 48.080  19.565  11.492  1.00 38.31  ? 106 ARG B CA  1 
ATOM   1943 C C   . ARG B 1 106 ? 46.698  19.052  11.281  1.00 39.44  ? 106 ARG B C   1 
ATOM   1944 O O   . ARG B 1 106 ? 45.743  19.740  11.588  1.00 40.41  ? 106 ARG B O   1 
ATOM   1945 C CB  . ARG B 1 106 ? 48.186  20.103  12.904  1.00 39.84  ? 106 ARG B CB  1 
ATOM   1946 C CG  . ARG B 1 106 ? 49.476  20.753  13.207  1.00 41.89  ? 106 ARG B CG  1 
ATOM   1947 C CD  . ARG B 1 106 ? 49.738  20.776  14.671  1.00 45.69  ? 106 ARG B CD  1 
ATOM   1948 N NE  . ARG B 1 106 ? 50.733  21.797  14.979  0.33 48.86  ? 106 ARG B NE  1 
ATOM   1949 C CZ  . ARG B 1 106 ? 51.138  22.115  16.206  0.39 52.90  ? 106 ARG B CZ  1 
ATOM   1950 N NH1 . ARG B 1 106 ? 50.639  21.495  17.273  0.64 54.20  ? 106 ARG B NH1 1 
ATOM   1951 N NH2 . ARG B 1 106 ? 52.058  23.054  16.362  0.53 55.91  ? 106 ARG B NH2 1 
ATOM   1952 N N   . LEU B 1 107 ? 46.577  17.827  10.802  1.00 41.20  ? 107 LEU B N   1 
ATOM   1953 C CA  . LEU B 1 107 ? 45.258  17.254  10.665  1.00 43.38  ? 107 LEU B CA  1 
ATOM   1954 C C   . LEU B 1 107 ? 44.642  16.763  11.980  1.00 47.30  ? 107 LEU B C   1 
ATOM   1955 O O   . LEU B 1 107 ? 45.331  16.299  12.875  1.00 49.01  ? 107 LEU B O   1 
ATOM   1956 C CB  . LEU B 1 107 ? 45.259  16.168  9.597   1.00 42.94  ? 107 LEU B CB  1 
ATOM   1957 C CG  . LEU B 1 107 ? 46.032  16.568  8.342   1.00 37.99  ? 107 LEU B CG  1 
ATOM   1958 C CD1 . LEU B 1 107 ? 46.218  15.345  7.515   1.00 36.58  ? 107 LEU B CD1 1 
ATOM   1959 C CD2 . LEU B 1 107 ? 45.355  17.665  7.535   1.00 30.86  ? 107 LEU B CD2 1 
ATOM   1960 N N   . SER B 1 108 ? 43.329  16.913  12.087  1.00 50.49  ? 108 SER B N   1 
ATOM   1961 C CA  . SER B 1 108 ? 42.548  16.289  13.132  1.00 54.77  ? 108 SER B CA  1 
ATOM   1962 C C   . SER B 1 108 ? 42.127  14.933  12.586  1.00 57.63  ? 108 SER B C   1 
ATOM   1963 O O   . SER B 1 108 ? 42.438  14.606  11.449  1.00 56.91  ? 108 SER B O   1 
ATOM   1964 C CB  . SER B 1 108 ? 41.345  17.144  13.489  1.00 54.87  ? 108 SER B CB  1 
ATOM   1965 O OG  . SER B 1 108 ? 40.423  17.161  12.438  1.00 56.71  ? 108 SER B OG  1 
ATOM   1966 N N   . HIS B 1 109 ? 41.424  14.148  13.396  1.00 61.26  ? 109 HIS B N   1 
ATOM   1967 C CA  . HIS B 1 109 ? 41.005  12.804  13.013  1.00 64.37  ? 109 HIS B CA  1 
ATOM   1968 C C   . HIS B 1 109 ? 40.122  12.844  11.782  1.00 64.81  ? 109 HIS B C   1 
ATOM   1969 O O   . HIS B 1 109 ? 39.972  11.836  11.105  1.00 67.01  ? 109 HIS B O   1 
ATOM   1970 C CB  . HIS B 1 109 ? 40.296  12.104  14.170  1.00 67.64  ? 109 HIS B CB  1 
ATOM   1971 N N   . GLU B 1 110 ? 39.560  14.011  11.479  1.00 63.96  ? 110 GLU B N   1 
ATOM   1972 C CA  . GLU B 1 110 ? 38.697  14.155  10.315  1.00 64.63  ? 110 GLU B CA  1 
ATOM   1973 C C   . GLU B 1 110 ? 39.367  13.858  8.964   1.00 61.87  ? 110 GLU B C   1 
ATOM   1974 O O   . GLU B 1 110 ? 38.675  13.483  8.021   1.00 63.47  ? 110 GLU B O   1 
ATOM   1975 C CB  . GLU B 1 110 ? 38.016  15.514  10.296  1.00 64.46  ? 110 GLU B CB  1 
ATOM   1976 C CG  . GLU B 1 110 ? 36.907  15.651  11.325  1.00 74.04  ? 110 GLU B CG  1 
ATOM   1977 C CD  . GLU B 1 110 ? 35.959  16.816  11.056  1.00 79.28  ? 110 GLU B CD  1 
ATOM   1978 O OE1 . GLU B 1 110 ? 35.591  17.063  9.889   1.00 80.65  ? 110 GLU B OE1 1 
ATOM   1979 O OE2 . GLU B 1 110 ? 35.563  17.487  12.022  1.00 80.77  ? 110 GLU B OE2 1 
ATOM   1980 N N   . HIS B 1 111 ? 40.691  14.025  8.867   1.00 57.96  ? 111 HIS B N   1 
ATOM   1981 C CA  . HIS B 1 111 ? 41.420  13.878  7.589   1.00 55.37  ? 111 HIS B CA  1 
ATOM   1982 C C   . HIS B 1 111 ? 42.666  13.059  7.728   1.00 55.92  ? 111 HIS B C   1 
ATOM   1983 O O   . HIS B 1 111 ? 43.316  13.098  8.752   1.00 56.01  ? 111 HIS B O   1 
ATOM   1984 C CB  . HIS B 1 111 ? 41.776  15.230  6.973   1.00 51.52  ? 111 HIS B CB  1 
ATOM   1985 C CG  . HIS B 1 111 ? 40.630  16.182  6.942   1.00 47.83  ? 111 HIS B CG  1 
ATOM   1986 N ND1 . HIS B 1 111 ? 39.644  16.135  5.981   1.00 44.70  ? 111 HIS B ND1 1 
ATOM   1987 C CD2 . HIS B 1 111 ? 40.284  17.168  7.792   1.00 45.97  ? 111 HIS B CD2 1 
ATOM   1988 C CE1 . HIS B 1 111 ? 38.750  17.065  6.232   1.00 45.10  ? 111 HIS B CE1 1 
ATOM   1989 N NE2 . HIS B 1 111 ? 39.115  17.707  7.324   1.00 46.01  ? 111 HIS B NE2 1 
ATOM   1990 N N   . GLN B 1 112 ? 43.004  12.322  6.682   1.00 56.45  ? 112 GLN B N   1 
ATOM   1991 C CA  . GLN B 1 112 ? 44.100  11.382  6.772   1.00 57.54  ? 112 GLN B CA  1 
ATOM   1992 C C   . GLN B 1 112 ? 45.380  11.834  6.085   1.00 54.13  ? 112 GLN B C   1 
ATOM   1993 O O   . GLN B 1 112 ? 46.460  11.413  6.467   1.00 55.29  ? 112 GLN B O   1 
ATOM   1994 C CB  . GLN B 1 112 ? 43.657  10.023  6.256   1.00 63.54  ? 112 GLN B CB  1 
ATOM   1995 C CG  . GLN B 1 112 ? 42.583  10.073  5.183   1.00 68.76  ? 112 GLN B CG  1 
ATOM   1996 C CD  . GLN B 1 112 ? 42.456  8.764   4.447   1.00 76.82  ? 112 GLN B CD  1 
ATOM   1997 O OE1 . GLN B 1 112 ? 43.432  8.248   3.932   1.00 79.12  ? 112 GLN B OE1 1 
ATOM   1998 N NE2 . GLN B 1 112 ? 41.250  8.226   4.384   1.00 83.07  ? 112 GLN B NE2 1 
ATOM   1999 N N   . ALA B 1 113 ? 45.255  12.706  5.092   1.00 49.92  ? 113 ALA B N   1 
ATOM   2000 C CA  . ALA B 1 113 ? 46.396  13.232  4.368   1.00 45.71  ? 113 ALA B CA  1 
ATOM   2001 C C   . ALA B 1 113 ? 46.073  14.607  3.795   1.00 41.94  ? 113 ALA B C   1 
ATOM   2002 O O   . ALA B 1 113 ? 44.919  15.022  3.721   1.00 40.89  ? 113 ALA B O   1 
ATOM   2003 C CB  . ALA B 1 113 ? 46.780  12.279  3.261   1.00 47.37  ? 113 ALA B CB  1 
ATOM   2004 N N   . TYR B 1 114 ? 47.113  15.310  3.373   1.00 38.50  ? 114 TYR B N   1 
ATOM   2005 C CA  . TYR B 1 114 ? 46.945  16.570  2.708   1.00 34.18  ? 114 TYR B CA  1 
ATOM   2006 C C   . TYR B 1 114 ? 47.871  16.585  1.508   1.00 34.49  ? 114 TYR B C   1 
ATOM   2007 O O   . TYR B 1 114 ? 48.808  15.806  1.458   1.00 36.49  ? 114 TYR B O   1 
ATOM   2008 C CB  . TYR B 1 114 ? 47.210  17.705  3.680   1.00 31.56  ? 114 TYR B CB  1 
ATOM   2009 C CG  . TYR B 1 114 ? 48.645  18.034  3.912   1.00 30.39  ? 114 TYR B CG  1 
ATOM   2010 C CD1 . TYR B 1 114 ? 49.297  17.609  5.059   1.00 27.03  ? 114 TYR B CD1 1 
ATOM   2011 C CD2 . TYR B 1 114 ? 49.356  18.813  3.001   1.00 29.65  ? 114 TYR B CD2 1 
ATOM   2012 C CE1 . TYR B 1 114 ? 50.601  17.916  5.283   1.00 26.94  ? 114 TYR B CE1 1 
ATOM   2013 C CE2 . TYR B 1 114 ? 50.678  19.119  3.227   1.00 30.06  ? 114 TYR B CE2 1 
ATOM   2014 C CZ  . TYR B 1 114 ? 51.281  18.663  4.386   1.00 30.49  ? 114 TYR B CZ  1 
ATOM   2015 O OH  . TYR B 1 114 ? 52.584  18.947  4.667   1.00 34.78  ? 114 TYR B OH  1 
ATOM   2016 N N   . ARG B 1 115 ? 47.575  17.436  0.530   1.00 33.01  ? 115 ARG B N   1 
ATOM   2017 C CA  A ARG B 1 115 ? 48.348  17.599  -0.678  0.52 33.55  ? 115 ARG B CA  1 
ATOM   2018 C CA  B ARG B 1 115 ? 48.375  17.603  -0.655  0.48 33.19  ? 115 ARG B CA  1 
ATOM   2019 C C   . ARG B 1 115 ? 48.411  19.037  -0.990  1.00 32.05  ? 115 ARG B C   1 
ATOM   2020 O O   . ARG B 1 115 ? 47.401  19.645  -0.744  1.00 30.11  ? 115 ARG B O   1 
ATOM   2021 C CB  A ARG B 1 115 ? 47.686  16.878  -1.864  0.52 35.02  ? 115 ARG B CB  1 
ATOM   2022 C CB  B ARG B 1 115 ? 47.801  16.816  -1.845  0.48 34.53  ? 115 ARG B CB  1 
ATOM   2023 C CG  A ARG B 1 115 ? 47.894  15.382  -1.941  0.52 37.96  ? 115 ARG B CG  1 
ATOM   2024 C CG  B ARG B 1 115 ? 47.808  15.302  -1.702  0.48 35.68  ? 115 ARG B CG  1 
ATOM   2025 C CD  A ARG B 1 115 ? 49.222  15.030  -2.608  0.52 40.42  ? 115 ARG B CD  1 
ATOM   2026 C CD  B ARG B 1 115 ? 49.225  14.731  -1.702  0.48 34.65  ? 115 ARG B CD  1 
ATOM   2027 N NE  A ARG B 1 115 ? 49.278  13.624  -3.010  0.52 42.95  ? 115 ARG B NE  1 
ATOM   2028 N NE  B ARG B 1 115 ? 49.232  13.267  -1.673  0.48 33.93  ? 115 ARG B NE  1 
ATOM   2029 C CZ  A ARG B 1 115 ? 49.484  13.189  -4.254  0.52 45.57  ? 115 ARG B CZ  1 
ATOM   2030 C CZ  B ARG B 1 115 ? 49.010  12.549  -0.579  0.48 31.66  ? 115 ARG B CZ  1 
ATOM   2031 N NH1 A ARG B 1 115 ? 49.680  14.041  -5.261  0.52 43.32  ? 115 ARG B NH1 1 
ATOM   2032 N NH1 B ARG B 1 115 ? 48.758  13.169  0.561   0.48 29.90  ? 115 ARG B NH1 1 
ATOM   2033 N NH2 A ARG B 1 115 ? 49.519  11.884  -4.486  0.52 49.10  ? 115 ARG B NH2 1 
ATOM   2034 N NH2 B ARG B 1 115 ? 49.031  11.224  -0.622  0.48 32.08  ? 115 ARG B NH2 1 
ATOM   2035 N N   . TRP B 1 116 ? 49.493  19.554  -1.574  1.00 32.41  ? 116 TRP B N   1 
ATOM   2036 C CA  . TRP B 1 116 ? 49.541  20.936  -2.083  1.00 31.54  ? 116 TRP B CA  1 
ATOM   2037 C C   . TRP B 1 116 ? 49.514  20.828  -3.585  1.00 33.74  ? 116 TRP B C   1 
ATOM   2038 O O   . TRP B 1 116 ? 50.367  20.170  -4.161  1.00 35.29  ? 116 TRP B O   1 
ATOM   2039 C CB  . TRP B 1 116 ? 50.852  21.622  -1.730  1.00 30.60  ? 116 TRP B CB  1 
ATOM   2040 C CG  . TRP B 1 116 ? 50.897  22.231  -0.400  1.00 30.59  ? 116 TRP B CG  1 
ATOM   2041 C CD1 . TRP B 1 116 ? 51.599  21.785  0.673   1.00 31.57  ? 116 TRP B CD1 1 
ATOM   2042 C CD2 . TRP B 1 116 ? 50.242  23.431  0.027   1.00 29.79  ? 116 TRP B CD2 1 
ATOM   2043 N NE1 . TRP B 1 116 ? 51.417  22.621  1.746   1.00 29.80  ? 116 TRP B NE1 1 
ATOM   2044 C CE2 . TRP B 1 116 ? 50.588  23.639  1.377   1.00 28.80  ? 116 TRP B CE2 1 
ATOM   2045 C CE3 . TRP B 1 116 ? 49.400  24.348  -0.599  1.00 28.11  ? 116 TRP B CE3 1 
ATOM   2046 C CZ2 . TRP B 1 116 ? 50.123  24.722  2.109   1.00 28.91  ? 116 TRP B CZ2 1 
ATOM   2047 C CZ3 . TRP B 1 116 ? 48.943  25.415  0.117   1.00 30.02  ? 116 TRP B CZ3 1 
ATOM   2048 C CH2 . TRP B 1 116 ? 49.302  25.602  1.468   1.00 28.67  ? 116 TRP B CH2 1 
ATOM   2049 N N   . LEU B 1 117 ? 48.581  21.502  -4.242  1.00 33.85  ? 117 LEU B N   1 
ATOM   2050 C CA  . LEU B 1 117 ? 48.428  21.303  -5.672  1.00 36.34  ? 117 LEU B CA  1 
ATOM   2051 C C   . LEU B 1 117 ? 48.241  22.532  -6.538  1.00 38.30  ? 117 LEU B C   1 
ATOM   2052 O O   . LEU B 1 117 ? 47.600  23.506  -6.138  1.00 38.34  ? 117 LEU B O   1 
ATOM   2053 C CB  . LEU B 1 117 ? 47.259  20.366  -5.928  1.00 35.86  ? 117 LEU B CB  1 
ATOM   2054 C CG  . LEU B 1 117 ? 47.217  19.056  -5.147  1.00 36.50  ? 117 LEU B CG  1 
ATOM   2055 C CD1 . LEU B 1 117 ? 45.948  18.348  -5.504  1.00 36.08  ? 117 LEU B CD1 1 
ATOM   2056 C CD2 . LEU B 1 117 ? 48.388  18.158  -5.468  1.00 37.52  ? 117 LEU B CD2 1 
ATOM   2057 N N   . GLY B 1 118 ? 48.790  22.462  -7.750  1.00 41.35  ? 118 GLY B N   1 
ATOM   2058 C CA  . GLY B 1 118 ? 48.532  23.443  -8.792  1.00 42.63  ? 118 GLY B CA  1 
ATOM   2059 C C   . GLY B 1 118 ? 47.093  23.296  -9.207  1.00 43.05  ? 118 GLY B C   1 
ATOM   2060 O O   . GLY B 1 118 ? 46.483  22.249  -8.973  1.00 42.48  ? 118 GLY B O   1 
ATOM   2061 N N   . LEU B 1 119 ? 46.544  24.334  -9.826  1.00 44.49  ? 119 LEU B N   1 
ATOM   2062 C CA  . LEU B 1 119 ? 45.110  24.378  -10.084 1.00 45.54  ? 119 LEU B CA  1 
ATOM   2063 C C   . LEU B 1 119 ? 44.529  23.164  -10.820 1.00 49.84  ? 119 LEU B C   1 
ATOM   2064 O O   . LEU B 1 119 ? 43.474  22.684  -10.456 1.00 51.24  ? 119 LEU B O   1 
ATOM   2065 C CB  . LEU B 1 119 ? 44.715  25.686  -10.758 1.00 45.26  ? 119 LEU B CB  1 
ATOM   2066 C CG  . LEU B 1 119 ? 43.250  25.890  -11.173 1.00 43.77  ? 119 LEU B CG  1 
ATOM   2067 C CD1 . LEU B 1 119 ? 42.317  26.004  -9.983  1.00 37.92  ? 119 LEU B CD1 1 
ATOM   2068 C CD2 . LEU B 1 119 ? 43.153  27.116  -11.986 1.00 42.46  ? 119 LEU B CD2 1 
ATOM   2069 N N   . GLU B 1 120 ? 45.186  22.662  -11.835 1.00 54.26  ? 120 GLU B N   1 
ATOM   2070 C CA  . GLU B 1 120 ? 44.648  21.528  -12.555 1.00 60.14  ? 120 GLU B CA  1 
ATOM   2071 C C   . GLU B 1 120 ? 44.577  20.258  -11.741 1.00 58.00  ? 120 GLU B C   1 
ATOM   2072 O O   . GLU B 1 120 ? 43.593  19.561  -11.770 1.00 59.96  ? 120 GLU B O   1 
ATOM   2073 C CB  . GLU B 1 120 ? 45.469  21.272  -13.795 1.00 65.33  ? 120 GLU B CB  1 
ATOM   2074 C CG  . GLU B 1 120 ? 44.742  20.538  -14.850 1.00 76.70  ? 120 GLU B CG  1 
ATOM   2075 C CD  . GLU B 1 120 ? 45.658  20.223  -15.964 1.00 95.79  ? 120 GLU B CD  1 
ATOM   2076 O OE1 . GLU B 1 120 ? 46.769  20.767  -15.945 1.00 100.43 ? 120 GLU B OE1 1 
ATOM   2077 O OE2 . GLU B 1 120 ? 45.288  19.442  -16.853 1.00 109.21 ? 120 GLU B OE2 1 
ATOM   2078 N N   . GLU B 1 121 ? 45.634  19.947  -11.024 1.00 55.21  ? 121 GLU B N   1 
ATOM   2079 C CA  . GLU B 1 121 ? 45.653  18.740  -10.248 1.00 54.88  ? 121 GLU B CA  1 
ATOM   2080 C C   . GLU B 1 121 ? 44.665  18.866  -9.112  1.00 51.71  ? 121 GLU B C   1 
ATOM   2081 O O   . GLU B 1 121 ? 44.020  17.907  -8.759  1.00 51.63  ? 121 GLU B O   1 
ATOM   2082 C CB  . GLU B 1 121 ? 47.065  18.435  -9.780  1.00 55.07  ? 121 GLU B CB  1 
ATOM   2083 C CG  . GLU B 1 121 ? 48.045  18.241  -10.918 1.00 61.93  ? 121 GLU B CG  1 
ATOM   2084 C CD  . GLU B 1 121 ? 48.542  19.544  -11.547 0.00 58.96  ? 121 GLU B CD  1 
ATOM   2085 O OE1 . GLU B 1 121 ? 47.763  20.487  -11.688 1.00 78.23  ? 121 GLU B OE1 1 
ATOM   2086 O OE2 . GLU B 1 121 ? 49.724  19.630  -11.915 1.00 87.73  ? 121 GLU B OE2 1 
ATOM   2087 N N   . ALA B 1 122 ? 44.518  20.070  -8.572  1.00 48.78  ? 122 ALA B N   1 
ATOM   2088 C CA  . ALA B 1 122 ? 43.524  20.372  -7.542  1.00 46.12  ? 122 ALA B CA  1 
ATOM   2089 C C   . ALA B 1 122 ? 42.083  20.139  -7.982  1.00 46.99  ? 122 ALA B C   1 
ATOM   2090 O O   . ALA B 1 122 ? 41.310  19.580  -7.267  1.00 46.36  ? 122 ALA B O   1 
ATOM   2091 C CB  . ALA B 1 122 ? 43.688  21.772  -7.088  1.00 44.55  ? 122 ALA B CB  1 
ATOM   2092 N N   . CYS B 1 123 ? 41.719  20.601  -9.159  1.00 48.74  ? 123 CYS B N   1 
ATOM   2093 C CA  . CYS B 1 123 ? 40.426  20.309  -9.732  1.00 51.22  ? 123 CYS B CA  1 
ATOM   2094 C C   . CYS B 1 123 ? 40.222  18.833  -9.968  1.00 54.97  ? 123 CYS B C   1 
ATOM   2095 O O   . CYS B 1 123 ? 39.151  18.320  -9.690  1.00 54.89  ? 123 CYS B O   1 
ATOM   2096 C CB  . CYS B 1 123 ? 40.224  21.088  -11.020 1.00 52.59  ? 123 CYS B CB  1 
ATOM   2097 S SG  . CYS B 1 123 ? 40.339  22.848  -10.806 1.00 48.85  ? 123 CYS B SG  1 
ATOM   2098 N N   . GLN B 1 124 ? 41.249  18.153  -10.480 1.00 59.06  ? 124 GLN B N   1 
ATOM   2099 C CA  . GLN B 1 124 ? 41.179  16.702  -10.705 1.00 64.53  ? 124 GLN B CA  1 
ATOM   2100 C C   . GLN B 1 124 ? 40.856  15.931  -9.430  1.00 64.20  ? 124 GLN B C   1 
ATOM   2101 O O   . GLN B 1 124 ? 40.022  15.031  -9.437  1.00 68.09  ? 124 GLN B O   1 
ATOM   2102 C CB  . GLN B 1 124 ? 42.479  16.164  -11.335 1.00 70.06  ? 124 GLN B CB  1 
ATOM   2103 C CG  . GLN B 1 124 ? 42.482  15.997  -12.878 1.00 78.41  ? 124 GLN B CG  1 
ATOM   2104 C CD  . GLN B 1 124 ? 41.574  14.864  -13.382 1.00 88.66  ? 124 GLN B CD  1 
ATOM   2105 O OE1 . GLN B 1 124 ? 41.344  13.867  -12.685 1.00 91.93  ? 124 GLN B OE1 1 
ATOM   2106 N NE2 . GLN B 1 124 ? 41.062  15.017  -14.599 1.00 91.80  ? 124 GLN B NE2 1 
ATOM   2107 N N   . LEU B 1 125 ? 41.533  16.287  -8.343  1.00 61.58  ? 125 LEU B N   1 
ATOM   2108 C CA  . LEU B 1 125 ? 41.340  15.637  -7.054  1.00 61.19  ? 125 LEU B CA  1 
ATOM   2109 C C   . LEU B 1 125 ? 40.020  15.961  -6.369  1.00 61.21  ? 125 LEU B C   1 
ATOM   2110 O O   . LEU B 1 125 ? 39.368  15.100  -5.812  1.00 62.23  ? 125 LEU B O   1 
ATOM   2111 C CB  . LEU B 1 125 ? 42.465  16.020  -6.118  1.00 58.35  ? 125 LEU B CB  1 
ATOM   2112 C CG  . LEU B 1 125 ? 43.489  14.985  -5.702  1.00 59.15  ? 125 LEU B CG  1 
ATOM   2113 C CD1 . LEU B 1 125 ? 44.073  15.427  -4.396  1.00 55.71  ? 125 LEU B CD1 1 
ATOM   2114 C CD2 . LEU B 1 125 ? 42.860  13.632  -5.550  1.00 63.49  ? 125 LEU B CD2 1 
ATOM   2115 N N   . ALA B 1 126 ? 39.641  17.225  -6.387  1.00 61.57  ? 126 ALA B N   1 
ATOM   2116 C CA  . ALA B 1 126 ? 38.429  17.647  -5.730  1.00 61.52  ? 126 ALA B CA  1 
ATOM   2117 C C   . ALA B 1 126 ? 37.226  16.942  -6.337  1.00 67.18  ? 126 ALA B C   1 
ATOM   2118 O O   . ALA B 1 126 ? 36.308  16.567  -5.632  1.00 68.14  ? 126 ALA B O   1 
ATOM   2119 C CB  . ALA B 1 126 ? 38.290  19.130  -5.835  1.00 59.10  ? 126 ALA B CB  1 
ATOM   2120 N N   . GLN B 1 127 ? 37.255  16.752  -7.651  1.00 77.46  ? 127 GLN B N   1 
ATOM   2121 C CA  . GLN B 1 127 ? 36.218  16.019  -8.382  1.00 80.81  ? 127 GLN B CA  1 
ATOM   2122 C C   . GLN B 1 127 ? 34.889  16.756  -8.546  1.00 77.43  ? 127 GLN B C   1 
ATOM   2123 O O   . GLN B 1 127 ? 34.461  16.981  -9.675  1.00 78.19  ? 127 GLN B O   1 
ATOM   2124 C CB  . GLN B 1 127 ? 36.006  14.596  -7.827  1.00 84.98  ? 127 GLN B CB  1 
ATOM   2125 C CG  . GLN B 1 127 ? 37.049  13.564  -8.293  0.60 93.34  ? 127 GLN B CG  1 
ATOM   2126 C CD  . GLN B 1 127 ? 37.031  13.325  -9.797  0.99 99.81  ? 127 GLN B CD  1 
ATOM   2127 O OE1 . GLN B 1 127 ? 36.010  12.942  -10.366 1.00 102.52 ? 127 GLN B OE1 1 
ATOM   2128 N NE2 . GLN B 1 127 ? 38.167  13.549  -10.445 1.00 103.46 ? 127 GLN B NE2 1 
ATOM   2129 N N   . PHE B 1 128 ? 34.233  17.109  -7.446  1.00 74.18  ? 128 PHE B N   1 
ATOM   2130 C CA  . PHE B 1 128 ? 32.941  17.791  -7.523  1.00 69.98  ? 128 PHE B CA  1 
ATOM   2131 C C   . PHE B 1 128 ? 33.013  19.031  -8.413  1.00 65.60  ? 128 PHE B C   1 
ATOM   2132 O O   . PHE B 1 128 ? 33.996  19.770  -8.374  1.00 64.25  ? 128 PHE B O   1 
ATOM   2133 C CB  . PHE B 1 128 ? 32.454  18.175  -6.125  1.00 69.86  ? 128 PHE B CB  1 
ATOM   2134 C CG  . PHE B 1 128 ? 31.111  18.849  -6.115  1.00 73.48  ? 128 PHE B CG  1 
ATOM   2135 C CD1 . PHE B 1 128 ? 30.331  18.885  -7.259  1.00 79.90  ? 128 PHE B CD1 1 
ATOM   2136 C CD2 . PHE B 1 128 ? 30.629  19.446  -4.962  1.00 75.56  ? 128 PHE B CD2 1 
ATOM   2137 C CE1 . PHE B 1 128 ? 29.096  19.504  -7.253  1.00 82.68  ? 128 PHE B CE1 1 
ATOM   2138 C CE2 . PHE B 1 128 ? 29.395  20.067  -4.950  0.00 71.53  ? 128 PHE B CE2 1 
ATOM   2139 C CZ  . PHE B 1 128 ? 28.627  20.096  -6.097  1.00 84.85  ? 128 PHE B CZ  1 
ATOM   2140 N N   . LYS B 1 129 ? 31.959  19.255  -9.201  1.00 63.72  ? 129 LYS B N   1 
ATOM   2141 C CA  . LYS B 1 129 ? 31.880  20.403  -10.115 1.00 61.55  ? 129 LYS B CA  1 
ATOM   2142 C C   . LYS B 1 129 ? 31.874  21.783  -9.440  1.00 57.75  ? 129 LYS B C   1 
ATOM   2143 O O   . LYS B 1 129 ? 32.581  22.689  -9.882  1.00 56.00  ? 129 LYS B O   1 
ATOM   2144 C CB  . LYS B 1 129 ? 30.659  20.269  -11.029 1.00 64.01  ? 129 LYS B CB  1 
ATOM   2145 C CG  . LYS B 1 129 ? 29.401  19.794  -10.319 1.00 70.23  ? 129 LYS B CG  1 
ATOM   2146 C CD  . LYS B 1 129 ? 28.176  20.557  -10.798 0.00 80.75  ? 129 LYS B CD  1 
ATOM   2147 C CE  . LYS B 1 129 ? 26.895  19.815  -10.454 0.57 101.14 ? 129 LYS B CE  1 
ATOM   2148 N NZ  . LYS B 1 129 ? 26.154  19.391  -11.674 1.00 103.91 ? 129 LYS B NZ  1 
ATOM   2149 N N   . GLU B 1 130 ? 31.096  21.942  -8.371  1.00 55.69  ? 130 GLU B N   1 
ATOM   2150 C CA  . GLU B 1 130 ? 31.081  23.194  -7.639  1.00 54.91  ? 130 GLU B CA  1 
ATOM   2151 C C   . GLU B 1 130 ? 32.452  23.549  -7.040  1.00 51.21  ? 130 GLU B C   1 
ATOM   2152 O O   . GLU B 1 130 ? 32.853  24.705  -7.003  1.00 49.48  ? 130 GLU B O   1 
ATOM   2153 C CB  . GLU B 1 130 ? 30.041  23.143  -6.537  1.00 59.47  ? 130 GLU B CB  1 
ATOM   2154 C CG  . GLU B 1 130 ? 28.660  22.856  -7.022  1.00 72.27  ? 130 GLU B CG  1 
ATOM   2155 C CD  . GLU B 1 130 ? 27.794  24.084  -7.059  1.00 86.74  ? 130 GLU B CD  1 
ATOM   2156 O OE1 . GLU B 1 130 ? 26.945  24.235  -6.157  1.00 94.44  ? 130 GLU B OE1 1 
ATOM   2157 O OE2 . GLU B 1 130 ? 27.953  24.904  -7.985  1.00 90.67  ? 130 GLU B OE2 1 
ATOM   2158 N N   . MET B 1 131 ? 33.168  22.540  -6.571  1.00 49.54  ? 131 MET B N   1 
ATOM   2159 C CA  . MET B 1 131 ? 34.480  22.733  -6.004  1.00 47.20  ? 131 MET B CA  1 
ATOM   2160 C C   . MET B 1 131 ? 35.472  23.195  -7.059  1.00 45.40  ? 131 MET B C   1 
ATOM   2161 O O   . MET B 1 131 ? 36.215  24.147  -6.857  1.00 44.29  ? 131 MET B O   1 
ATOM   2162 C CB  . MET B 1 131 ? 34.966  21.416  -5.423  1.00 51.09  ? 131 MET B CB  1 
ATOM   2163 C CG  . MET B 1 131 ? 35.324  21.443  -3.967  1.00 54.50  ? 131 MET B CG  1 
ATOM   2164 S SD  . MET B 1 131 ? 36.326  22.827  -3.434  1.00 49.64  ? 131 MET B SD  1 
ATOM   2165 C CE  . MET B 1 131 ? 35.340  23.318  -2.062  1.00 47.98  ? 131 MET B CE  1 
ATOM   2166 N N   . LYS B 1 132 ? 35.513  22.496  -8.181  1.00 44.92  ? 132 LYS B N   1 
ATOM   2167 C CA  . LYS B 1 132 ? 36.451  22.852  -9.236  1.00 45.09  ? 132 LYS B CA  1 
ATOM   2168 C C   . LYS B 1 132 ? 36.205  24.282  -9.692  1.00 41.53  ? 132 LYS B C   1 
ATOM   2169 O O   . LYS B 1 132 ? 37.117  25.058  -9.935  1.00 40.28  ? 132 LYS B O   1 
ATOM   2170 C CB  . LYS B 1 132 ? 36.289  21.914  -10.429 1.00 50.33  ? 132 LYS B CB  1 
ATOM   2171 C CG  . LYS B 1 132 ? 36.427  20.448  -10.118 1.00 58.81  ? 132 LYS B CG  1 
ATOM   2172 C CD  . LYS B 1 132 ? 35.854  19.610  -11.249 1.00 67.22  ? 132 LYS B CD  1 
ATOM   2173 C CE  . LYS B 1 132 ? 36.912  19.140  -12.228 1.00 73.04  ? 132 LYS B CE  1 
ATOM   2174 N NZ  . LYS B 1 132 ? 36.297  18.422  -13.367 1.00 79.09  ? 132 LYS B NZ  1 
ATOM   2175 N N   . ALA B 1 133 ? 34.936  24.616  -9.794  1.00 38.85  ? 133 ALA B N   1 
ATOM   2176 C CA  . ALA B 1 133 ? 34.543  25.911  -10.241 1.00 36.66  ? 133 ALA B CA  1 
ATOM   2177 C C   . ALA B 1 133 ? 35.077  26.932  -9.307  1.00 34.08  ? 133 ALA B C   1 
ATOM   2178 O O   . ALA B 1 133 ? 35.665  27.890  -9.744  1.00 34.90  ? 133 ALA B O   1 
ATOM   2179 C CB  . ALA B 1 133 ? 33.065  26.007  -10.287 1.00 37.81  ? 133 ALA B CB  1 
ATOM   2180 N N   . ALA B 1 134 ? 34.866  26.733  -8.017  1.00 31.44  ? 134 ALA B N   1 
ATOM   2181 C CA  . ALA B 1 134 ? 35.301  27.699  -7.023  1.00 29.56  ? 134 ALA B CA  1 
ATOM   2182 C C   . ALA B 1 134 ? 36.816  27.872  -7.024  1.00 28.86  ? 134 ALA B C   1 
ATOM   2183 O O   . ALA B 1 134 ? 37.320  28.972  -6.841  1.00 27.99  ? 134 ALA B O   1 
ATOM   2184 C CB  . ALA B 1 134 ? 34.823  27.291  -5.653  1.00 28.91  ? 134 ALA B CB  1 
ATOM   2185 N N   . LEU B 1 135 ? 37.550  26.780  -7.197  1.00 29.53  ? 135 LEU B N   1 
ATOM   2186 C CA  . LEU B 1 135 ? 38.986  26.864  -7.157  1.00 30.62  ? 135 LEU B CA  1 
ATOM   2187 C C   . LEU B 1 135 ? 39.436  27.563  -8.413  1.00 32.68  ? 135 LEU B C   1 
ATOM   2188 O O   . LEU B 1 135 ? 40.370  28.367  -8.386  1.00 34.70  ? 135 LEU B O   1 
ATOM   2189 C CB  . LEU B 1 135 ? 39.596  25.484  -7.091  1.00 32.14  ? 135 LEU B CB  1 
ATOM   2190 C CG  . LEU B 1 135 ? 39.414  24.628  -5.841  1.00 30.48  ? 135 LEU B CG  1 
ATOM   2191 C CD1 . LEU B 1 135 ? 39.708  23.203  -6.193  1.00 30.56  ? 135 LEU B CD1 1 
ATOM   2192 C CD2 . LEU B 1 135 ? 40.366  25.107  -4.820  1.00 26.92  ? 135 LEU B CD2 1 
ATOM   2193 N N   . GLN B 1 136 ? 38.769  27.265  -9.519  1.00 33.48  ? 136 GLN B N   1 
ATOM   2194 C CA  . GLN B 1 136 ? 39.131  27.886  -10.748 1.00 35.91  ? 136 GLN B CA  1 
ATOM   2195 C C   . GLN B 1 136 ? 38.884  29.361  -10.662 1.00 35.30  ? 136 GLN B C   1 
ATOM   2196 O O   . GLN B 1 136 ? 39.695  30.129  -11.164 1.00 37.15  ? 136 GLN B O   1 
ATOM   2197 C CB  . GLN B 1 136 ? 38.362  27.284  -11.899 1.00 37.71  ? 136 GLN B CB  1 
ATOM   2198 C CG  . GLN B 1 136 ? 38.939  26.013  -12.404 1.00 44.95  ? 136 GLN B CG  1 
ATOM   2199 C CD  . GLN B 1 136 ? 37.975  25.288  -13.270 1.00 55.91  ? 136 GLN B CD  1 
ATOM   2200 O OE1 . GLN B 1 136 ? 37.014  25.871  -13.750 1.00 62.65  ? 136 GLN B OE1 1 
ATOM   2201 N NE2 . GLN B 1 136 ? 38.212  24.014  -13.483 1.00 60.27  ? 136 GLN B NE2 1 
ATOM   2202 N N   . GLU B 1 137 ? 37.772  29.774  -10.054 1.00 34.06  ? 137 GLU B N   1 
ATOM   2203 C CA  . GLU B 1 137 ? 37.514  31.193  -9.996  1.00 34.78  ? 137 GLU B CA  1 
ATOM   2204 C C   . GLU B 1 137 ? 38.434  31.879  -9.018  1.00 34.82  ? 137 GLU B C   1 
ATOM   2205 O O   . GLU B 1 137 ? 38.810  33.043  -9.209  1.00 34.71  ? 137 GLU B O   1 
ATOM   2206 C CB  . GLU B 1 137 ? 36.037  31.595  -9.836  1.00 35.40  ? 137 GLU B CB  1 
ATOM   2207 C CG  . GLU B 1 137 ? 35.127  30.690  -9.101  1.00 36.54  ? 137 GLU B CG  1 
ATOM   2208 C CD  . GLU B 1 137 ? 33.797  30.487  -9.801  1.00 40.13  ? 137 GLU B CD  1 
ATOM   2209 O OE1 . GLU B 1 137 ? 32.814  30.206  -9.108  1.00 41.94  ? 137 GLU B OE1 1 
ATOM   2210 O OE2 . GLU B 1 137 ? 33.731  30.561  -11.037 1.00 43.81  ? 137 GLU B OE2 1 
ATOM   2211 N N   . GLY B 1 138 ? 38.833  31.131  -7.992  1.00 35.17  ? 138 GLY B N   1 
ATOM   2212 C CA  . GLY B 1 138 ? 39.754  31.634  -6.972  1.00 35.16  ? 138 GLY B CA  1 
ATOM   2213 C C   . GLY B 1 138 ? 41.060  32.057  -7.603  1.00 36.54  ? 138 GLY B C   1 
ATOM   2214 O O   . GLY B 1 138 ? 41.586  33.126  -7.316  1.00 35.72  ? 138 GLY B O   1 
ATOM   2215 N N   . HIS B 1 139 ? 41.567  31.204  -8.481  1.00 38.69  ? 139 HIS B N   1 
ATOM   2216 C CA  . HIS B 1 139 ? 42.833  31.426  -9.146  1.00 42.56  ? 139 HIS B CA  1 
ATOM   2217 C C   . HIS B 1 139 ? 42.753  32.641  -10.058 1.00 43.66  ? 139 HIS B C   1 
ATOM   2218 O O   . HIS B 1 139 ? 43.621  33.522  -10.042 1.00 44.42  ? 139 HIS B O   1 
ATOM   2219 C CB  . HIS B 1 139 ? 43.153  30.186  -9.967  1.00 45.61  ? 139 HIS B CB  1 
ATOM   2220 C CG  . HIS B 1 139 ? 44.554  30.133  -10.493 1.00 50.78  ? 139 HIS B CG  1 
ATOM   2221 N ND1 . HIS B 1 139 ? 44.842  30.188  -11.836 1.00 57.18  ? 139 HIS B ND1 1 
ATOM   2222 C CD2 . HIS B 1 139 ? 45.739  29.995  -9.862  1.00 52.55  ? 139 HIS B CD2 1 
ATOM   2223 C CE1 . HIS B 1 139 ? 46.143  30.087  -12.009 1.00 60.16  ? 139 HIS B CE1 1 
ATOM   2224 N NE2 . HIS B 1 139 ? 46.710  29.975  -10.826 1.00 57.90  ? 139 HIS B NE2 1 
ATOM   2225 N N   . GLN B 1 140 ? 41.684  32.666  -10.842 1.00 44.64  ? 140 GLN B N   1 
ATOM   2226 C CA  . GLN B 1 140 ? 41.374  33.737  -11.748 1.00 46.88  ? 140 GLN B CA  1 
ATOM   2227 C C   . GLN B 1 140 ? 41.339  35.044  -11.014 1.00 44.88  ? 140 GLN B C   1 
ATOM   2228 O O   . GLN B 1 140 ? 41.869  36.029  -11.488 1.00 47.71  ? 140 GLN B O   1 
ATOM   2229 C CB  . GLN B 1 140 ? 40.020  33.468  -12.352 1.00 48.43  ? 140 GLN B CB  1 
ATOM   2230 C CG  . GLN B 1 140 ? 39.485  34.546  -13.250 1.00 57.08  ? 140 GLN B CG  1 
ATOM   2231 C CD  . GLN B 1 140 ? 38.365  34.053  -14.134 1.00 67.21  ? 140 GLN B CD  1 
ATOM   2232 O OE1 . GLN B 1 140 ? 37.835  32.961  -13.942 1.00 69.18  ? 140 GLN B OE1 1 
ATOM   2233 N NE2 . GLN B 1 140 ? 37.997  34.859  -15.108 1.00 75.68  ? 140 GLN B NE2 1 
ATOM   2234 N N   . PHE B 1 141 ? 40.718  35.066  -9.852  1.00 42.16  ? 141 PHE B N   1 
ATOM   2235 C CA  . PHE B 1 141 ? 40.736  36.260  -9.063  1.00 40.87  ? 141 PHE B CA  1 
ATOM   2236 C C   . PHE B 1 141 ? 42.155  36.623  -8.685  1.00 41.60  ? 141 PHE B C   1 
ATOM   2237 O O   . PHE B 1 141 ? 42.525  37.793  -8.732  1.00 42.03  ? 141 PHE B O   1 
ATOM   2238 C CB  . PHE B 1 141 ? 39.905  36.074  -7.816  1.00 39.73  ? 141 PHE B CB  1 
ATOM   2239 C CG  . PHE B 1 141 ? 40.054  37.182  -6.817  1.00 38.33  ? 141 PHE B CG  1 
ATOM   2240 C CD1 . PHE B 1 141 ? 40.971  37.077  -5.793  1.00 36.87  ? 141 PHE B CD1 1 
ATOM   2241 C CD2 . PHE B 1 141 ? 39.263  38.319  -6.896  1.00 39.17  ? 141 PHE B CD2 1 
ATOM   2242 C CE1 . PHE B 1 141 ? 41.104  38.082  -4.877  1.00 40.76  ? 141 PHE B CE1 1 
ATOM   2243 C CE2 . PHE B 1 141 ? 39.381  39.324  -5.981  1.00 42.46  ? 141 PHE B CE2 1 
ATOM   2244 C CZ  . PHE B 1 141 ? 40.301  39.215  -4.968  1.00 42.88  ? 141 PHE B CZ  1 
ATOM   2245 N N   . LEU B 1 142 ? 42.946  35.623  -8.293  1.00 42.43  ? 142 LEU B N   1 
ATOM   2246 C CA  . LEU B 1 142 ? 44.370  35.846  -7.953  1.00 43.89  ? 142 LEU B CA  1 
ATOM   2247 C C   . LEU B 1 142 ? 45.246  36.435  -9.067  1.00 47.09  ? 142 LEU B C   1 
ATOM   2248 O O   . LEU B 1 142 ? 45.971  37.379  -8.831  1.00 47.34  ? 142 LEU B O   1 
ATOM   2249 C CB  . LEU B 1 142 ? 45.007  34.584  -7.372  1.00 43.61  ? 142 LEU B CB  1 
ATOM   2250 C CG  . LEU B 1 142 ? 44.480  34.251  -5.981  1.00 39.28  ? 142 LEU B CG  1 
ATOM   2251 C CD1 . LEU B 1 142 ? 44.850  32.845  -5.578  1.00 36.09  ? 142 LEU B CD1 1 
ATOM   2252 C CD2 . LEU B 1 142 ? 44.994  35.263  -4.998  1.00 37.18  ? 142 LEU B CD2 1 
ATOM   2253 N N   . CYS B 1 143 ? 45.176  35.882  -10.266 1.00 50.84  ? 143 CYS B N   1 
ATOM   2254 C CA  . CYS B 1 143 ? 45.860  36.488  -11.399 1.00 56.89  ? 143 CYS B CA  1 
ATOM   2255 C C   . CYS B 1 143 ? 45.385  37.913  -11.718 1.00 57.75  ? 143 CYS B C   1 
ATOM   2256 O O   . CYS B 1 143 ? 46.189  38.762  -12.094 1.00 62.21  ? 143 CYS B O   1 
ATOM   2257 C CB  . CYS B 1 143 ? 45.705  35.626  -12.634 1.00 58.94  ? 143 CYS B CB  1 
ATOM   2258 S SG  . CYS B 1 143 ? 46.109  33.964  -12.352 1.00 68.41  ? 143 CYS B SG  1 
ATOM   2259 N N   . SER B 1 144 ? 44.089  38.170  -11.579 1.00 57.16  ? 144 SER B N   1 
ATOM   2260 C CA  . SER B 1 144 ? 43.568  39.488  -11.869 1.00 59.89  ? 144 SER B CA  1 
ATOM   2261 C C   . SER B 1 144 ? 44.126  40.539  -10.926 1.00 60.29  ? 144 SER B C   1 
ATOM   2262 O O   . SER B 1 144 ? 44.573  41.573  -11.356 1.00 64.54  ? 144 SER B O   1 
ATOM   2263 C CB  . SER B 1 144 ? 42.047  39.507  -11.834 1.00 59.16  ? 144 SER B CB  1 
ATOM   2264 O OG  . SER B 1 144 ? 41.595  39.859  -10.544 1.00 59.65  ? 144 SER B OG  1 
ATOM   2265 N N   . ILE B 1 145 ? 44.092  40.287  -9.633  1.00 59.16  ? 145 ILE B N   1 
ATOM   2266 C CA  . ILE B 1 145 ? 44.645  41.240  -8.700  1.00 59.87  ? 145 ILE B CA  1 
ATOM   2267 C C   . ILE B 1 145 ? 46.117  41.518  -9.001  1.00 62.76  ? 145 ILE B C   1 
ATOM   2268 O O   . ILE B 1 145 ? 46.566  42.648  -8.905  1.00 63.56  ? 145 ILE B O   1 
ATOM   2269 C CB  . ILE B 1 145 ? 44.497  40.719  -7.286  1.00 58.10  ? 145 ILE B CB  1 
ATOM   2270 C CG1 . ILE B 1 145 ? 43.026  40.599  -6.927  1.00 57.00  ? 145 ILE B CG1 1 
ATOM   2271 C CG2 . ILE B 1 145 ? 45.198  41.604  -6.315  1.00 58.56  ? 145 ILE B CG2 1 
ATOM   2272 C CD1 . ILE B 1 145 ? 42.182  41.778  -7.355  1.00 57.13  ? 145 ILE B CD1 1 
ATOM   2273 N N   . GLU B 1 146 ? 46.856  40.486  -9.361  1.00 65.83  ? 146 GLU B N   1 
ATOM   2274 C CA  . GLU B 1 146 ? 48.270  40.680  -9.603  1.00 71.55  ? 146 GLU B CA  1 
ATOM   2275 C C   . GLU B 1 146 ? 48.497  41.608  -10.794 1.00 77.69  ? 146 GLU B C   1 
ATOM   2276 O O   . GLU B 1 146 ? 49.449  42.374  -10.795 1.00 80.62  ? 146 GLU B O   1 
ATOM   2277 C CB  . GLU B 1 146 ? 49.014  39.355  -9.793  1.00 73.38  ? 146 GLU B CB  1 
ATOM   2278 N N   . ALA B 1 147 ? 47.617  41.530  -11.791 1.00 80.23  ? 147 ALA B N   1 
ATOM   2279 C CA  . ALA B 1 147 ? 47.649  42.456  -12.909 1.00 85.88  ? 147 ALA B CA  1 
ATOM   2280 C C   . ALA B 1 147 ? 47.631  43.895  -12.391 1.00 89.81  ? 147 ALA B C   1 
ATOM   2281 O O   . ALA B 1 147 ? 46.697  44.348  -11.710 1.00 89.92  ? 147 ALA B O   1 
ATOM   2282 C CB  . ALA B 1 147 ? 46.478  42.212  -13.807 1.00 84.99  ? 147 ALA B CB  1 
ATOM   2283 N N   . ARG C 1 4   ? 24.478  50.178  13.321  1.00 64.85  ? 4   ARG C N   1 
ATOM   2284 C CA  . ARG C 1 4   ? 25.170  48.860  13.351  1.00 64.19  ? 4   ARG C CA  1 
ATOM   2285 C C   . ARG C 1 4   ? 26.552  48.886  12.687  1.00 58.72  ? 4   ARG C C   1 
ATOM   2286 O O   . ARG C 1 4   ? 26.661  48.977  11.461  1.00 61.22  ? 4   ARG C O   1 
ATOM   2287 C CB  . ARG C 1 4   ? 24.303  47.778  12.712  1.00 67.66  ? 4   ARG C CB  1 
ATOM   2288 C CG  . ARG C 1 4   ? 24.327  46.475  13.471  1.00 69.55  ? 4   ARG C CG  1 
ATOM   2289 C CD  . ARG C 1 4   ? 25.709  45.869  13.535  1.00 71.27  ? 4   ARG C CD  1 
ATOM   2290 N NE  . ARG C 1 4   ? 25.964  44.911  12.461  1.00 77.34  ? 4   ARG C NE  1 
ATOM   2291 C CZ  . ARG C 1 4   ? 25.700  43.607  12.537  1.00 80.72  ? 4   ARG C CZ  1 
ATOM   2292 N NH1 . ARG C 1 4   ? 25.150  43.089  13.631  1.00 81.19  ? 4   ARG C NH1 1 
ATOM   2293 N NH2 . ARG C 1 4   ? 25.979  42.818  11.516  1.00 82.87  ? 4   ARG C NH2 1 
ATOM   2294 N N   . ALA C 1 5   ? 27.589  48.777  13.513  1.00 52.02  ? 5   ALA C N   1 
ATOM   2295 C CA  . ALA C 1 5   ? 28.951  48.986  13.070  1.00 48.75  ? 5   ALA C CA  1 
ATOM   2296 C C   . ALA C 1 5   ? 29.925  47.900  13.526  1.00 45.71  ? 5   ALA C C   1 
ATOM   2297 O O   . ALA C 1 5   ? 29.675  47.191  14.491  1.00 43.62  ? 5   ALA C O   1 
ATOM   2298 C CB  . ALA C 1 5   ? 29.421  50.349  13.519  1.00 47.75  ? 5   ALA C CB  1 
ATOM   2299 N N   . CYS C 1 6   ? 31.046  47.786  12.832  1.00 44.21  ? 6   CYS C N   1 
ATOM   2300 C CA  . CYS C 1 6   ? 32.025  46.813  13.193  1.00 42.20  ? 6   CYS C CA  1 
ATOM   2301 C C   . CYS C 1 6   ? 33.371  47.455  13.161  1.00 40.87  ? 6   CYS C C   1 
ATOM   2302 O O   . CYS C 1 6   ? 33.604  48.310  12.342  1.00 42.74  ? 6   CYS C O   1 
ATOM   2303 C CB  . CYS C 1 6   ? 31.945  45.646  12.234  1.00 43.29  ? 6   CYS C CB  1 
ATOM   2304 S SG  . CYS C 1 6   ? 30.350  44.818  12.335  1.00 48.35  ? 6   CYS C SG  1 
ATOM   2305 N N   . GLY C 1 7   ? 34.252  47.061  14.075  1.00 38.20  ? 7   GLY C N   1 
ATOM   2306 C CA  . GLY C 1 7   ? 35.586  47.627  14.139  1.00 35.38  ? 7   GLY C CA  1 
ATOM   2307 C C   . GLY C 1 7   ? 36.578  46.621  14.665  1.00 34.11  ? 7   GLY C C   1 
ATOM   2308 O O   . GLY C 1 7   ? 36.209  45.483  14.946  1.00 34.52  ? 7   GLY C O   1 
ATOM   2309 N N   . LEU C 1 8   ? 37.838  47.021  14.790  1.00 31.03  ? 8   LEU C N   1 
ATOM   2310 C CA  . LEU C 1 8   ? 38.822  46.128  15.343  1.00 28.94  ? 8   LEU C CA  1 
ATOM   2311 C C   . LEU C 1 8   ? 39.507  46.861  16.443  1.00 27.37  ? 8   LEU C C   1 
ATOM   2312 O O   . LEU C 1 8   ? 39.830  48.026  16.294  1.00 28.56  ? 8   LEU C O   1 
ATOM   2313 C CB  . LEU C 1 8   ? 39.862  45.713  14.318  1.00 29.56  ? 8   LEU C CB  1 
ATOM   2314 C CG  . LEU C 1 8   ? 39.398  44.948  13.070  1.00 32.67  ? 8   LEU C CG  1 
ATOM   2315 C CD1 . LEU C 1 8   ? 40.586  44.774  12.123  1.00 34.13  ? 8   LEU C CD1 1 
ATOM   2316 C CD2 . LEU C 1 8   ? 38.743  43.586  13.400  1.00 26.94  ? 8   LEU C CD2 1 
ATOM   2317 N N   . ILE C 1 9   ? 39.704  46.195  17.568  1.00 23.94  ? 9   ILE C N   1 
ATOM   2318 C CA  . ILE C 1 9   ? 40.463  46.773  18.601  1.00 21.78  ? 9   ILE C CA  1 
ATOM   2319 C C   . ILE C 1 9   ? 41.857  46.415  18.207  1.00 23.43  ? 9   ILE C C   1 
ATOM   2320 O O   . ILE C 1 9   ? 42.295  45.276  18.411  1.00 22.62  ? 9   ILE C O   1 
ATOM   2321 C CB  . ILE C 1 9   ? 40.173  46.127  19.933  1.00 21.90  ? 9   ILE C CB  1 
ATOM   2322 C CG1 . ILE C 1 9   ? 38.831  46.613  20.465  1.00 20.21  ? 9   ILE C CG1 1 
ATOM   2323 C CG2 . ILE C 1 9   ? 41.218  46.533  20.972  1.00 19.74  ? 9   ILE C CG2 1 
ATOM   2324 C CD1 . ILE C 1 9   ? 38.245  45.715  21.478  1.00 16.03  ? 9   ILE C CD1 1 
ATOM   2325 N N   . ILE C 1 10  ? 42.539  47.387  17.613  1.00 23.92  ? 10  ILE C N   1 
ATOM   2326 C CA  . ILE C 1 10  ? 43.896  47.218  17.191  1.00 25.28  ? 10  ILE C CA  1 
ATOM   2327 C C   . ILE C 1 10  ? 44.846  47.280  18.358  1.00 26.16  ? 10  ILE C C   1 
ATOM   2328 O O   . ILE C 1 10  ? 44.704  48.099  19.256  1.00 23.85  ? 10  ILE C O   1 
ATOM   2329 C CB  . ILE C 1 10  ? 44.257  48.275  16.191  1.00 26.74  ? 10  ILE C CB  1 
ATOM   2330 C CG1 . ILE C 1 10  ? 43.159  48.386  15.135  1.00 27.88  ? 10  ILE C CG1 1 
ATOM   2331 C CG2 . ILE C 1 10  ? 45.477  47.875  15.466  1.00 28.83  ? 10  ILE C CG2 1 
ATOM   2332 C CD1 . ILE C 1 10  ? 43.328  47.391  14.072  1.00 31.08  ? 10  ILE C CD1 1 
ATOM   2333 N N   . PHE C 1 11  ? 45.820  46.391  18.353  1.00 28.19  ? 11  PHE C N   1 
ATOM   2334 C CA  . PHE C 1 11  ? 46.816  46.434  19.380  1.00 32.66  ? 11  PHE C CA  1 
ATOM   2335 C C   . PHE C 1 11  ? 48.202  46.082  18.851  1.00 36.13  ? 11  PHE C C   1 
ATOM   2336 O O   . PHE C 1 11  ? 48.332  45.483  17.779  1.00 37.42  ? 11  PHE C O   1 
ATOM   2337 C CB  . PHE C 1 11  ? 46.419  45.542  20.547  1.00 31.78  ? 11  PHE C CB  1 
ATOM   2338 C CG  . PHE C 1 11  ? 46.589  44.105  20.278  1.00 34.33  ? 11  PHE C CG  1 
ATOM   2339 C CD1 . PHE C 1 11  ? 47.761  43.456  20.637  1.00 37.19  ? 11  PHE C CD1 1 
ATOM   2340 C CD2 . PHE C 1 11  ? 45.567  43.375  19.688  1.00 35.15  ? 11  PHE C CD2 1 
ATOM   2341 C CE1 . PHE C 1 11  ? 47.922  42.106  20.396  1.00 38.36  ? 11  PHE C CE1 1 
ATOM   2342 C CE2 . PHE C 1 11  ? 45.716  42.025  19.443  1.00 35.84  ? 11  PHE C CE2 1 
ATOM   2343 C CZ  . PHE C 1 11  ? 46.894  41.389  19.798  1.00 38.18  ? 11  PHE C CZ  1 
ATOM   2344 N N   . ARG C 1 12  ? 49.229  46.493  19.594  1.00 38.70  ? 12  ARG C N   1 
ATOM   2345 C CA  . ARG C 1 12  ? 50.579  46.054  19.321  1.00 42.34  ? 12  ARG C CA  1 
ATOM   2346 C C   . ARG C 1 12  ? 51.193  45.566  20.605  1.00 45.29  ? 12  ARG C C   1 
ATOM   2347 O O   . ARG C 1 12  ? 50.747  45.931  21.682  1.00 44.93  ? 12  ARG C O   1 
ATOM   2348 C CB  . ARG C 1 12  ? 51.413  47.158  18.700  1.00 42.80  ? 12  ARG C CB  1 
ATOM   2349 C CG  . ARG C 1 12  ? 51.684  48.347  19.578  1.00 44.13  ? 12  ARG C CG  1 
ATOM   2350 C CD  . ARG C 1 12  ? 52.270  49.452  18.766  1.00 45.32  ? 12  ARG C CD  1 
ATOM   2351 N NE  . ARG C 1 12  ? 52.611  50.609  19.573  1.00 45.75  ? 12  ARG C NE  1 
ATOM   2352 C CZ  . ARG C 1 12  ? 53.259  51.659  19.101  1.00 44.73  ? 12  ARG C CZ  1 
ATOM   2353 N NH1 . ARG C 1 12  ? 53.622  51.688  17.836  1.00 42.40  ? 12  ARG C NH1 1 
ATOM   2354 N NH2 . ARG C 1 12  ? 53.532  52.668  19.897  1.00 45.39  ? 12  ARG C NH2 1 
ATOM   2355 N N   . ARG C 1 13  ? 52.208  44.715  20.480  1.00 50.05  ? 13  ARG C N   1 
ATOM   2356 C CA  . ARG C 1 13  ? 52.882  44.115  21.627  1.00 54.87  ? 13  ARG C CA  1 
ATOM   2357 C C   . ARG C 1 13  ? 54.295  44.667  21.736  1.00 59.21  ? 13  ARG C C   1 
ATOM   2358 O O   . ARG C 1 13  ? 55.019  44.740  20.743  1.00 59.81  ? 13  ARG C O   1 
ATOM   2359 C CB  . ARG C 1 13  ? 52.919  42.592  21.494  1.00 55.28  ? 13  ARG C CB  1 
ATOM   2360 C CG  . ARG C 1 13  ? 51.601  41.909  21.824  1.00 55.26  ? 13  ARG C CG  1 
ATOM   2361 C CD  . ARG C 1 13  ? 51.825  40.498  22.343  1.00 57.98  ? 13  ARG C CD  1 
ATOM   2362 N NE  . ARG C 1 13  ? 52.191  39.573  21.274  1.00 61.61  ? 13  ARG C NE  1 
ATOM   2363 C CZ  . ARG C 1 13  ? 51.372  38.660  20.764  0.00 73.05  ? 13  ARG C CZ  1 
ATOM   2364 N NH1 . ARG C 1 13  ? 50.134  38.544  21.225  1.00 69.79  ? 13  ARG C NH1 1 
ATOM   2365 N NH2 . ARG C 1 13  ? 51.790  37.860  19.792  1.00 71.09  ? 13  ARG C NH2 1 
ATOM   2366 N N   . CYS C 1 14  ? 54.680  45.073  22.941  1.00 63.68  ? 14  CYS C N   1 
ATOM   2367 C CA  . CYS C 1 14  ? 55.957  45.724  23.133  1.00 69.18  ? 14  CYS C CA  1 
ATOM   2368 C C   . CYS C 1 14  ? 56.901  44.745  23.789  1.00 73.46  ? 14  CYS C C   1 
ATOM   2369 O O   . CYS C 1 14  ? 56.735  44.331  24.932  1.00 74.21  ? 14  CYS C O   1 
ATOM   2370 C CB  . CYS C 1 14  ? 55.767  46.989  23.952  1.00 68.95  ? 14  CYS C CB  1 
ATOM   2371 S SG  . CYS C 1 14  ? 54.234  47.895  23.524  1.00 73.77  ? 14  CYS C SG  1 
ATOM   2372 N N   . LEU C 1 15  ? 57.890  44.349  23.017  1.00 74.67  ? 15  LEU C N   1 
ATOM   2373 C CA  . LEU C 1 15  ? 58.748  43.256  23.399  1.00 80.71  ? 15  LEU C CA  1 
ATOM   2374 C C   . LEU C 1 15  ? 60.099  43.735  23.865  1.00 89.88  ? 15  LEU C C   1 
ATOM   2375 O O   . LEU C 1 15  ? 61.055  42.983  23.808  1.00 93.94  ? 15  LEU C O   1 
ATOM   2376 C CB  . LEU C 1 15  ? 58.908  42.273  22.229  1.00 79.69  ? 15  LEU C CB  1 
ATOM   2377 C CG  . LEU C 1 15  ? 57.602  41.905  21.516  1.00 75.95  ? 15  LEU C CG  1 
ATOM   2378 C CD1 . LEU C 1 15  ? 57.851  41.275  20.142  1.00 75.38  ? 15  LEU C CD1 1 
ATOM   2379 C CD2 . LEU C 1 15  ? 56.736  41.024  22.411  1.00 72.50  ? 15  LEU C CD2 1 
ATOM   2380 N N   . ILE C 1 16  ? 60.187  44.975  24.326  1.00 96.55  ? 16  ILE C N   1 
ATOM   2381 C CA  . ILE C 1 16  ? 61.471  45.494  24.798  1.00 104.40 ? 16  ILE C CA  1 
ATOM   2382 C C   . ILE C 1 16  ? 61.450  45.958  26.281  1.00 112.78 ? 16  ILE C C   1 
ATOM   2383 O O   . ILE C 1 16  ? 60.884  47.025  26.627  1.00 108.09 ? 16  ILE C O   1 
ATOM   2384 C CB  . ILE C 1 16  ? 62.036  46.548  23.830  1.00 102.05 ? 16  ILE C CB  1 
ATOM   2385 C CG1 . ILE C 1 16  ? 62.517  45.848  22.557  1.00 98.86  ? 16  ILE C CG1 1 
ATOM   2386 C CG2 . ILE C 1 16  ? 63.190  47.304  24.460  1.00 102.54 ? 16  ILE C CG2 1 
ATOM   2387 C CD1 . ILE C 1 16  ? 62.534  46.718  21.329  1.00 89.72  ? 16  ILE C CD1 1 
ATOM   2388 N N   . PRO C 1 17  ? 62.019  45.144  27.161  1.00 124.55 ? 17  PRO C N   1 
ATOM   2389 C CA  . PRO C 1 17  ? 61.785  45.283  28.603  1.00 131.45 ? 17  PRO C CA  1 
ATOM   2390 C C   . PRO C 1 17  ? 62.131  46.587  29.323  1.00 135.68 ? 17  PRO C C   1 
ATOM   2391 O O   . PRO C 1 17  ? 61.283  47.031  30.097  1.00 135.39 ? 17  PRO C O   1 
ATOM   2392 C CB  . PRO C 1 17  ? 62.622  44.141  29.194  0.61 135.49 ? 17  PRO C CB  1 
ATOM   2393 C CG  . PRO C 1 17  ? 62.656  43.115  28.121  1.00 133.17 ? 17  PRO C CG  1 
ATOM   2394 C CD  . PRO C 1 17  ? 62.693  43.877  26.827  0.22 127.17 ? 17  PRO C CD  1 
ATOM   2395 N N   . LYS C 1 18  ? 63.299  47.185  29.110  1.00 138.74 ? 18  LYS C N   1 
ATOM   2396 C CA  . LYS C 1 18  ? 63.627  48.450  29.782  1.00 139.36 ? 18  LYS C CA  1 
ATOM   2397 C C   . LYS C 1 18  ? 62.703  49.605  29.364  1.00 134.48 ? 18  LYS C C   1 
ATOM   2398 O O   . LYS C 1 18  ? 62.273  50.415  30.185  1.00 135.73 ? 18  LYS C O   1 
ATOM   2399 C CB  . LYS C 1 18  ? 65.088  48.829  29.526  1.00 145.37 ? 18  LYS C CB  1 
ATOM   2400 N N   . VAL C 1 19  ? 62.418  49.649  28.068  1.00 126.31 ? 19  VAL C N   1 
ATOM   2401 C CA  . VAL C 1 19  ? 61.574  50.645  27.403  1.00 116.28 ? 19  VAL C CA  1 
ATOM   2402 C C   . VAL C 1 19  ? 60.040  50.604  27.483  1.00 105.04 ? 19  VAL C C   1 
ATOM   2403 O O   . VAL C 1 19  ? 59.397  51.651  27.554  1.00 100.09 ? 19  VAL C O   1 
ATOM   2404 C CB  . VAL C 1 19  ? 61.955  50.763  25.909  1.00 118.14 ? 19  VAL C CB  1 
ATOM   2405 C CG1 . VAL C 1 19  ? 60.954  51.641  25.175  1.00 115.87 ? 19  VAL C CG1 1 
ATOM   2406 C CG2 . VAL C 1 19  ? 63.366  51.311  25.763  1.00 122.48 ? 19  VAL C CG2 1 
ATOM   2407 N N   . ASP C 1 20  ? 59.457  49.410  27.419  1.00 98.41  ? 20  ASP C N   1 
ATOM   2408 C CA  . ASP C 1 20  ? 58.006  49.275  27.204  1.00 91.76  ? 20  ASP C CA  1 
ATOM   2409 C C   . ASP C 1 20  ? 57.284  49.089  28.520  1.00 91.44  ? 20  ASP C C   1 
ATOM   2410 O O   . ASP C 1 20  ? 57.232  47.971  29.034  1.00 94.14  ? 20  ASP C O   1 
ATOM   2411 C CB  . ASP C 1 20  ? 57.735  48.040  26.348  1.00 89.10  ? 20  ASP C CB  1 
ATOM   2412 C CG  . ASP C 1 20  ? 58.170  48.232  24.928  1.00 90.27  ? 20  ASP C CG  1 
ATOM   2413 O OD1 . ASP C 1 20  ? 58.413  49.399  24.541  1.00 88.66  ? 20  ASP C OD1 1 
ATOM   2414 O OD2 . ASP C 1 20  ? 58.295  47.200  24.206  1.00 92.21  ? 20  ASP C OD2 1 
ATOM   2415 N N   . ASN C 1 21  ? 56.734  50.179  29.057  1.00 88.69  ? 21  ASN C N   1 
ATOM   2416 C CA  . ASN C 1 21  ? 55.980  50.155  30.314  1.00 89.25  ? 21  ASN C CA  1 
ATOM   2417 C C   . ASN C 1 21  ? 54.792  49.197  30.236  1.00 83.62  ? 21  ASN C C   1 
ATOM   2418 O O   . ASN C 1 21  ? 54.544  48.411  31.152  1.00 85.71  ? 21  ASN C O   1 
ATOM   2419 C CB  . ASN C 1 21  ? 55.468  51.560  30.682  1.00 94.66  ? 21  ASN C CB  1 
ATOM   2420 C CG  . ASN C 1 21  ? 56.432  52.677  30.285  1.00 107.77 ? 21  ASN C CG  1 
ATOM   2421 O OD1 . ASN C 1 21  ? 56.082  53.571  29.509  1.00 115.76 ? 21  ASN C OD1 1 
ATOM   2422 N ND2 . ASN C 1 21  ? 57.641  52.635  30.829  1.00 118.20 ? 21  ASN C ND2 1 
ATOM   2423 N N   . ASN C 1 22  ? 54.070  49.274  29.122  1.00 77.38  ? 22  ASN C N   1 
ATOM   2424 C CA  . ASN C 1 22  ? 52.902  48.448  28.878  1.00 68.44  ? 22  ASN C CA  1 
ATOM   2425 C C   . ASN C 1 22  ? 53.259  47.387  27.857  1.00 65.10  ? 22  ASN C C   1 
ATOM   2426 O O   . ASN C 1 22  ? 53.730  47.723  26.778  1.00 65.58  ? 22  ASN C O   1 
ATOM   2427 C CB  . ASN C 1 22  ? 51.768  49.323  28.344  1.00 66.46  ? 22  ASN C CB  1 
ATOM   2428 C CG  . ASN C 1 22  ? 51.584  50.614  29.152  1.00 67.32  ? 22  ASN C CG  1 
ATOM   2429 O OD1 . ASN C 1 22  ? 52.084  51.671  28.762  1.00 67.87  ? 22  ASN C OD1 1 
ATOM   2430 N ND2 . ASN C 1 22  ? 50.867  50.527  30.279  1.00 69.23  ? 22  ASN C ND2 1 
ATOM   2431 N N   . ALA C 1 23  ? 53.045  46.114  28.190  1.00 63.17  ? 23  ALA C N   1 
ATOM   2432 C CA  . ALA C 1 23  ? 53.303  45.034  27.250  1.00 58.97  ? 23  ALA C CA  1 
ATOM   2433 C C   . ALA C 1 23  ? 52.386  45.157  26.044  1.00 54.63  ? 23  ALA C C   1 
ATOM   2434 O O   . ALA C 1 23  ? 52.784  44.831  24.932  1.00 55.12  ? 23  ALA C O   1 
ATOM   2435 C CB  . ALA C 1 23  ? 53.134  43.714  27.900  1.00 59.36  ? 23  ALA C CB  1 
ATOM   2436 N N   . ILE C 1 24  ? 51.169  45.640  26.269  1.00 49.44  ? 24  ILE C N   1 
ATOM   2437 C CA  . ILE C 1 24  ? 50.209  45.815  25.202  1.00 44.91  ? 24  ILE C CA  1 
ATOM   2438 C C   . ILE C 1 24  ? 49.730  47.254  25.088  1.00 43.69  ? 24  ILE C C   1 
ATOM   2439 O O   . ILE C 1 24  ? 49.422  47.899  26.080  1.00 44.22  ? 24  ILE C O   1 
ATOM   2440 C CB  . ILE C 1 24  ? 49.012  44.872  25.393  1.00 43.98  ? 24  ILE C CB  1 
ATOM   2441 C CG1 . ILE C 1 24  ? 49.471  43.427  25.237  1.00 42.88  ? 24  ILE C CG1 1 
ATOM   2442 C CG2 . ILE C 1 24  ? 47.896  45.191  24.399  1.00 39.18  ? 24  ILE C CG2 1 
ATOM   2443 C CD1 . ILE C 1 24  ? 48.589  42.448  25.873  1.00 41.71  ? 24  ILE C CD1 1 
ATOM   2444 N N   . GLU C 1 25  ? 49.674  47.753  23.861  1.00 41.93  ? 25  GLU C N   1 
ATOM   2445 C CA  . GLU C 1 25  ? 49.154  49.073  23.589  1.00 39.90  ? 25  GLU C CA  1 
ATOM   2446 C C   . GLU C 1 25  ? 48.081  48.998  22.540  1.00 37.53  ? 25  GLU C C   1 
ATOM   2447 O O   . GLU C 1 25  ? 48.243  48.308  21.535  1.00 36.74  ? 25  GLU C O   1 
ATOM   2448 C CB  . GLU C 1 25  ? 50.248  49.961  23.078  1.00 41.54  ? 25  GLU C CB  1 
ATOM   2449 C CG  . GLU C 1 25  ? 51.020  50.662  24.128  1.00 45.30  ? 25  GLU C CG  1 
ATOM   2450 C CD  . GLU C 1 25  ? 52.226  51.349  23.544  1.00 51.37  ? 25  GLU C CD  1 
ATOM   2451 O OE1 . GLU C 1 25  ? 52.594  51.042  22.399  1.00 56.32  ? 25  GLU C OE1 1 
ATOM   2452 O OE2 . GLU C 1 25  ? 52.809  52.203  24.210  1.00 53.77  ? 25  GLU C OE2 1 
ATOM   2453 N N   . PHE C 1 26  ? 47.005  49.741  22.782  1.00 35.78  ? 26  PHE C N   1 
ATOM   2454 C CA  . PHE C 1 26  ? 45.845  49.819  21.906  1.00 35.03  ? 26  PHE C CA  1 
ATOM   2455 C C   . PHE C 1 26  ? 45.856  51.068  21.085  1.00 34.75  ? 26  PHE C C   1 
ATOM   2456 O O   . PHE C 1 26  ? 46.403  52.046  21.518  1.00 35.66  ? 26  PHE C O   1 
ATOM   2457 C CB  . PHE C 1 26  ? 44.590  49.828  22.744  1.00 34.15  ? 26  PHE C CB  1 
ATOM   2458 C CG  . PHE C 1 26  ? 44.422  48.602  23.571  1.00 35.57  ? 26  PHE C CG  1 
ATOM   2459 C CD1 . PHE C 1 26  ? 44.061  47.402  22.999  1.00 36.73  ? 26  PHE C CD1 1 
ATOM   2460 C CD2 . PHE C 1 26  ? 44.633  48.642  24.934  1.00 38.13  ? 26  PHE C CD2 1 
ATOM   2461 C CE1 . PHE C 1 26  ? 43.898  46.281  23.778  1.00 37.14  ? 26  PHE C CE1 1 
ATOM   2462 C CE2 . PHE C 1 26  ? 44.480  47.522  25.703  1.00 37.06  ? 26  PHE C CE2 1 
ATOM   2463 C CZ  . PHE C 1 26  ? 44.114  46.344  25.124  1.00 36.96  ? 26  PHE C CZ  1 
ATOM   2464 N N   . LEU C 1 27  ? 45.245  51.043  19.905  1.00 34.12  ? 27  LEU C N   1 
ATOM   2465 C CA  . LEU C 1 27  ? 45.211  52.229  19.058  1.00 34.27  ? 27  LEU C CA  1 
ATOM   2466 C C   . LEU C 1 27  ? 43.860  52.922  19.063  1.00 34.73  ? 27  LEU C C   1 
ATOM   2467 O O   . LEU C 1 27  ? 42.843  52.285  18.813  1.00 33.96  ? 27  LEU C O   1 
ATOM   2468 C CB  . LEU C 1 27  ? 45.598  51.880  17.636  1.00 34.25  ? 27  LEU C CB  1 
ATOM   2469 C CG  . LEU C 1 27  ? 45.427  53.012  16.610  1.00 34.59  ? 27  LEU C CG  1 
ATOM   2470 C CD1 . LEU C 1 27  ? 46.555  54.035  16.619  1.00 34.00  ? 27  LEU C CD1 1 
ATOM   2471 C CD2 . LEU C 1 27  ? 45.290  52.406  15.261  1.00 29.81  ? 27  LEU C CD2 1 
ATOM   2472 N N   . LEU C 1 28  ? 43.846  54.231  19.329  1.00 35.85  ? 28  LEU C N   1 
ATOM   2473 C CA  . LEU C 1 28  ? 42.585  54.984  19.344  1.00 36.09  ? 28  LEU C CA  1 
ATOM   2474 C C   . LEU C 1 28  ? 42.618  56.177  18.450  1.00 38.80  ? 28  LEU C C   1 
ATOM   2475 O O   . LEU C 1 28  ? 43.629  56.829  18.315  1.00 40.84  ? 28  LEU C O   1 
ATOM   2476 C CB  . LEU C 1 28  ? 42.222  55.429  20.737  1.00 34.61  ? 28  LEU C CB  1 
ATOM   2477 C CG  . LEU C 1 28  ? 41.989  54.314  21.738  1.00 32.67  ? 28  LEU C CG  1 
ATOM   2478 C CD1 . LEU C 1 28  ? 41.406  54.837  23.012  1.00 31.22  ? 28  LEU C CD1 1 
ATOM   2479 C CD2 . LEU C 1 28  ? 41.080  53.310  21.156  1.00 31.02  ? 28  LEU C CD2 1 
ATOM   2480 N N   . LEU C 1 29  ? 41.494  56.470  17.836  1.00 40.94  ? 29  LEU C N   1 
ATOM   2481 C CA  . LEU C 1 29  ? 41.406  57.616  16.959  1.00 44.29  ? 29  LEU C CA  1 
ATOM   2482 C C   . LEU C 1 29  ? 40.461  58.623  17.574  1.00 48.14  ? 29  LEU C C   1 
ATOM   2483 O O   . LEU C 1 29  ? 39.531  58.250  18.282  1.00 47.26  ? 29  LEU C O   1 
ATOM   2484 C CB  . LEU C 1 29  ? 40.883  57.199  15.603  1.00 42.67  ? 29  LEU C CB  1 
ATOM   2485 C CG  . LEU C 1 29  ? 41.491  55.937  15.027  1.00 41.08  ? 29  LEU C CG  1 
ATOM   2486 C CD1 . LEU C 1 29  ? 40.745  55.607  13.763  1.00 39.74  ? 29  LEU C CD1 1 
ATOM   2487 C CD2 . LEU C 1 29  ? 42.997  56.021  14.767  1.00 35.73  ? 29  LEU C CD2 1 
ATOM   2488 N N   . GLN C 1 30  ? 40.708  59.899  17.314  1.00 52.84  ? 30  GLN C N   1 
ATOM   2489 C CA  . GLN C 1 30  ? 39.845  60.945  17.798  1.00 57.13  ? 30  GLN C CA  1 
ATOM   2490 C C   . GLN C 1 30  ? 39.011  61.464  16.655  1.00 61.09  ? 30  GLN C C   1 
ATOM   2491 O O   . GLN C 1 30  ? 39.529  61.712  15.586  1.00 63.45  ? 30  GLN C O   1 
ATOM   2492 C CB  . GLN C 1 30  ? 40.668  62.067  18.378  1.00 57.54  ? 30  GLN C CB  1 
ATOM   2493 C CG  . GLN C 1 30  ? 39.859  62.919  19.288  1.00 60.02  ? 30  GLN C CG  1 
ATOM   2494 C CD  . GLN C 1 30  ? 40.635  64.042  19.892  1.00 62.72  ? 30  GLN C CD  1 
ATOM   2495 O OE1 . GLN C 1 30  ? 41.765  64.302  19.513  1.00 65.19  ? 30  GLN C OE1 1 
ATOM   2496 N NE2 . GLN C 1 30  ? 40.027  64.724  20.839  1.00 64.18  ? 30  GLN C NE2 1 
ATOM   2497 N N   . ALA C 1 31  ? 37.717  61.624  16.884  1.00 65.13  ? 31  ALA C N   1 
ATOM   2498 C CA  . ALA C 1 31  ? 36.833  62.164  15.864  1.00 70.51  ? 31  ALA C CA  1 
ATOM   2499 C C   . ALA C 1 31  ? 37.026  63.654  15.655  1.00 75.33  ? 31  ALA C C   1 
ATOM   2500 O O   . ALA C 1 31  ? 37.306  64.387  16.591  1.00 75.43  ? 31  ALA C O   1 
ATOM   2501 C CB  . ALA C 1 31  ? 35.402  61.868  16.211  1.00 69.72  ? 31  ALA C CB  1 
ATOM   2502 N N   . SER C 1 32  ? 36.875  64.086  14.408  1.00 83.88  ? 32  SER C N   1 
ATOM   2503 C CA  . SER C 1 32  ? 36.792  65.497  14.071  1.00 91.71  ? 32  SER C CA  1 
ATOM   2504 C C   . SER C 1 32  ? 35.422  66.048  14.456  1.00 98.51  ? 32  SER C C   1 
ATOM   2505 O O   . SER C 1 32  ? 35.315  67.114  15.050  1.00 99.87  ? 32  SER C O   1 
ATOM   2506 C CB  . SER C 1 32  ? 37.002  65.677  12.573  1.00 92.31  ? 32  SER C CB  1 
ATOM   2507 O OG  . SER C 1 32  ? 38.326  65.365  12.202  1.00 90.51  ? 32  SER C OG  1 
ATOM   2508 N N   . ASP C 1 33  ? 34.381  65.304  14.083  1.00 123.70 ? 33  ASP C N   1 
ATOM   2509 C CA  . ASP C 1 33  ? 32.993  65.673  14.313  1.00 138.67 ? 33  ASP C CA  1 
ATOM   2510 C C   . ASP C 1 33  ? 32.630  65.432  15.764  1.00 139.55 ? 33  ASP C C   1 
ATOM   2511 O O   . ASP C 1 33  ? 32.610  64.275  16.201  1.00 133.48 ? 33  ASP C O   1 
ATOM   2512 C CB  . ASP C 1 33  ? 32.096  64.799  13.437  1.00 144.07 ? 33  ASP C CB  1 
ATOM   2513 N N   . GLY C 1 34  ? 32.327  66.515  16.499  1.00 148.58 ? 34  GLY C N   1 
ATOM   2514 C CA  . GLY C 1 34  ? 31.960  66.428  17.925  1.00 150.58 ? 34  GLY C CA  1 
ATOM   2515 C C   . GLY C 1 34  ? 33.112  65.877  18.743  1.00 144.41 ? 34  GLY C C   1 
ATOM   2516 O O   . GLY C 1 34  ? 32.962  64.886  19.473  1.00 142.27 ? 34  GLY C O   1 
ATOM   2517 N N   . ILE C 1 35  ? 34.248  66.567  18.629  1.00 142.08 ? 35  ILE C N   1 
ATOM   2518 C CA  . ILE C 1 35  ? 35.583  66.068  18.990  1.00 132.06 ? 35  ILE C CA  1 
ATOM   2519 C C   . ILE C 1 35  ? 35.774  65.649  20.444  1.00 130.16 ? 35  ILE C C   1 
ATOM   2520 O O   . ILE C 1 35  ? 34.882  65.824  21.282  1.00 136.22 ? 35  ILE C O   1 
ATOM   2521 C CB  . ILE C 1 35  ? 36.675  67.117  18.657  1.00 128.43 ? 35  ILE C CB  1 
ATOM   2522 C CG1 . ILE C 1 35  ? 36.891  68.075  19.830  1.00 129.50 ? 35  ILE C CG1 1 
ATOM   2523 C CG2 . ILE C 1 35  ? 36.289  67.882  17.414  1.00 132.57 ? 35  ILE C CG2 1 
ATOM   2524 C CD1 . ILE C 1 35  ? 37.970  69.156  19.512  1.00 129.38 ? 35  ILE C CD1 1 
ATOM   2525 N N   . HIS C 1 36  ? 36.957  65.111  20.733  1.00 122.54 ? 36  HIS C N   1 
ATOM   2526 C CA  . HIS C 1 36  ? 37.251  64.489  22.027  1.00 116.94 ? 36  HIS C CA  1 
ATOM   2527 C C   . HIS C 1 36  ? 36.462  63.187  22.129  1.00 112.26 ? 36  HIS C C   1 
ATOM   2528 O O   . HIS C 1 36  ? 36.075  62.755  23.219  1.00 114.07 ? 36  HIS C O   1 
ATOM   2529 C CB  . HIS C 1 36  ? 36.938  65.438  23.198  1.00 122.70 ? 36  HIS C CB  1 
ATOM   2530 N N   . HIS C 1 37  ? 36.239  62.574  20.967  1.00 103.14 ? 37  HIS C N   1 
ATOM   2531 C CA  . HIS C 1 37  ? 35.584  61.282  20.862  1.00 95.29  ? 37  HIS C CA  1 
ATOM   2532 C C   . HIS C 1 37  ? 36.597  60.233  20.385  1.00 82.14  ? 37  HIS C C   1 
ATOM   2533 O O   . HIS C 1 37  ? 36.940  60.173  19.194  1.00 80.00  ? 37  HIS C O   1 
ATOM   2534 C CB  . HIS C 1 37  ? 34.428  61.401  19.880  1.00 102.65 ? 37  HIS C CB  1 
ATOM   2535 C CG  . HIS C 1 37  ? 33.266  60.511  20.189  1.00 107.85 ? 37  HIS C CG  1 
ATOM   2536 N ND1 . HIS C 1 37  ? 32.360  60.114  19.219  1.00 111.67 ? 37  HIS C ND1 1 
ATOM   2537 C CD2 . HIS C 1 37  ? 32.858  59.944  21.351  1.00 111.47 ? 37  HIS C CD2 1 
ATOM   2538 C CE1 . HIS C 1 37  ? 31.444  59.343  19.772  1.00 114.59 ? 37  HIS C CE1 1 
ATOM   2539 N NE2 . HIS C 1 37  ? 31.725  59.219  21.063  1.00 115.44 ? 37  HIS C NE2 1 
ATOM   2540 N N   . TRP C 1 38  ? 37.074  59.420  21.330  1.00 69.83  ? 38  TRP C N   1 
ATOM   2541 C CA  . TRP C 1 38  ? 38.114  58.427  21.077  1.00 58.61  ? 38  TRP C CA  1 
ATOM   2542 C C   . TRP C 1 38  ? 37.588  57.003  21.001  1.00 54.51  ? 38  TRP C C   1 
ATOM   2543 O O   . TRP C 1 38  ? 36.866  56.551  21.865  1.00 55.40  ? 38  TRP C O   1 
ATOM   2544 C CB  . TRP C 1 38  ? 39.149  58.460  22.185  1.00 56.76  ? 38  TRP C CB  1 
ATOM   2545 C CG  . TRP C 1 38  ? 39.995  59.667  22.271  1.00 53.70  ? 38  TRP C CG  1 
ATOM   2546 C CD1 . TRP C 1 38  ? 39.773  60.765  23.038  1.00 54.87  ? 38  TRP C CD1 1 
ATOM   2547 C CD2 . TRP C 1 38  ? 41.239  59.878  21.621  1.00 48.50  ? 38  TRP C CD2 1 
ATOM   2548 N NE1 . TRP C 1 38  ? 40.791  61.661  22.896  1.00 52.01  ? 38  TRP C NE1 1 
ATOM   2549 C CE2 . TRP C 1 38  ? 41.708  61.143  22.023  1.00 49.44  ? 38  TRP C CE2 1 
ATOM   2550 C CE3 . TRP C 1 38  ? 41.999  59.130  20.731  1.00 43.51  ? 38  TRP C CE3 1 
ATOM   2551 C CZ2 . TRP C 1 38  ? 42.910  61.671  21.566  1.00 45.68  ? 38  TRP C CZ2 1 
ATOM   2552 C CZ3 . TRP C 1 38  ? 43.180  59.662  20.274  1.00 42.19  ? 38  TRP C CZ3 1 
ATOM   2553 C CH2 . TRP C 1 38  ? 43.626  60.916  20.694  1.00 42.03  ? 38  TRP C CH2 1 
ATOM   2554 N N   . THR C 1 39  ? 37.977  56.289  19.959  1.00 48.30  ? 39  THR C N   1 
ATOM   2555 C CA  . THR C 1 39  ? 37.529  54.915  19.774  1.00 44.41  ? 39  THR C CA  1 
ATOM   2556 C C   . THR C 1 39  ? 38.477  54.204  18.841  1.00 38.86  ? 39  THR C C   1 
ATOM   2557 O O   . THR C 1 39  ? 39.277  54.835  18.162  1.00 36.96  ? 39  THR C O   1 
ATOM   2558 C CB  . THR C 1 39  ? 36.141  54.856  19.155  1.00 46.74  ? 39  THR C CB  1 
ATOM   2559 O OG1 . THR C 1 39  ? 36.237  54.306  17.844  1.00 45.11  ? 39  THR C OG1 1 
ATOM   2560 C CG2 . THR C 1 39  ? 35.583  56.227  19.029  1.00 49.60  ? 39  THR C CG2 1 
ATOM   2561 N N   . PRO C 1 40  ? 38.399  52.884  18.815  1.00 35.88  ? 40  PRO C N   1 
ATOM   2562 C CA  . PRO C 1 40  ? 39.167  52.093  17.865  1.00 33.53  ? 40  PRO C CA  1 
ATOM   2563 C C   . PRO C 1 40  ? 38.500  52.265  16.511  1.00 33.36  ? 40  PRO C C   1 
ATOM   2564 O O   . PRO C 1 40  ? 37.444  52.856  16.463  1.00 35.55  ? 40  PRO C O   1 
ATOM   2565 C CB  . PRO C 1 40  ? 39.011  50.669  18.395  1.00 33.35  ? 40  PRO C CB  1 
ATOM   2566 C CG  . PRO C 1 40  ? 38.005  50.738  19.436  1.00 35.31  ? 40  PRO C CG  1 
ATOM   2567 C CD  . PRO C 1 40  ? 37.970  52.094  19.964  1.00 37.08  ? 40  PRO C CD  1 
ATOM   2568 N N   . PRO C 1 41  ? 39.097  51.803  15.421  1.00 32.74  ? 41  PRO C N   1 
ATOM   2569 C CA  . PRO C 1 41  ? 38.414  51.990  14.144  1.00 34.65  ? 41  PRO C CA  1 
ATOM   2570 C C   . PRO C 1 41  ? 37.150  51.149  14.036  1.00 36.64  ? 41  PRO C C   1 
ATOM   2571 O O   . PRO C 1 41  ? 37.158  49.976  14.400  1.00 37.46  ? 41  PRO C O   1 
ATOM   2572 C CB  . PRO C 1 41  ? 39.458  51.521  13.121  1.00 34.24  ? 41  PRO C CB  1 
ATOM   2573 C CG  . PRO C 1 41  ? 40.651  51.099  13.914  1.00 31.76  ? 41  PRO C CG  1 
ATOM   2574 C CD  . PRO C 1 41  ? 40.542  51.682  15.236  1.00 31.61  ? 41  PRO C CD  1 
ATOM   2575 N N   . LYS C 1 42  ? 36.073  51.748  13.552  1.00 39.42  ? 42  LYS C N   1 
ATOM   2576 C CA  . LYS C 1 42  ? 34.815  51.036  13.352  1.00 41.68  ? 42  LYS C CA  1 
ATOM   2577 C C   . LYS C 1 42  ? 33.991  51.754  12.323  1.00 44.99  ? 42  LYS C C   1 
ATOM   2578 O O   . LYS C 1 42  ? 34.056  52.957  12.183  1.00 46.90  ? 42  LYS C O   1 
ATOM   2579 C CB  . LYS C 1 42  ? 34.010  50.980  14.646  1.00 42.59  ? 42  LYS C CB  1 
ATOM   2580 C CG  . LYS C 1 42  ? 33.876  52.308  15.272  1.00 44.06  ? 42  LYS C CG  1 
ATOM   2581 C CD  . LYS C 1 42  ? 32.530  52.474  15.876  1.00 50.33  ? 42  LYS C CD  1 
ATOM   2582 C CE  . LYS C 1 42  ? 32.563  53.586  16.902  1.00 55.19  ? 42  LYS C CE  1 
ATOM   2583 N NZ  . LYS C 1 42  ? 33.725  54.511  16.659  1.00 54.07  ? 42  LYS C NZ  1 
ATOM   2584 N N   . GLY C 1 43  ? 33.179  51.018  11.610  1.00 47.27  ? 43  GLY C N   1 
ATOM   2585 C CA  . GLY C 1 43  ? 32.355  51.650  10.613  1.00 52.38  ? 43  GLY C CA  1 
ATOM   2586 C C   . GLY C 1 43  ? 31.050  50.935  10.406  1.00 55.59  ? 43  GLY C C   1 
ATOM   2587 O O   . GLY C 1 43  ? 30.862  49.809  10.847  1.00 52.89  ? 43  GLY C O   1 
ATOM   2588 N N   . HIS C 1 44  ? 30.148  51.627  9.732   1.00 61.72  ? 44  HIS C N   1 
ATOM   2589 C CA  . HIS C 1 44  ? 28.848  51.115  9.342   1.00 68.38  ? 44  HIS C CA  1 
ATOM   2590 C C   . HIS C 1 44  ? 29.013  49.925  8.390   1.00 63.68  ? 44  HIS C C   1 
ATOM   2591 O O   . HIS C 1 44  ? 29.869  49.941  7.509   1.00 63.22  ? 44  HIS C O   1 
ATOM   2592 C CB  . HIS C 1 44  ? 28.081  52.273  8.699   1.00 79.85  ? 44  HIS C CB  1 
ATOM   2593 C CG  . HIS C 1 44  ? 28.575  53.624  9.156   1.00 96.32  ? 44  HIS C CG  1 
ATOM   2594 N ND1 . HIS C 1 44  ? 29.732  54.202  8.648   1.00 102.29 ? 44  HIS C ND1 1 
ATOM   2595 C CD2 . HIS C 1 44  ? 28.094  54.492  10.098  1.00 105.73 ? 44  HIS C CD2 1 
ATOM   2596 C CE1 . HIS C 1 44  ? 29.931  55.371  9.242   1.00 105.73 ? 44  HIS C CE1 1 
ATOM   2597 N NE2 . HIS C 1 44  ? 28.952  55.571  10.125  1.00 109.06 ? 44  HIS C NE2 1 
ATOM   2598 N N   . VAL C 1 45  ? 28.216  48.886  8.604   1.00 62.19  ? 45  VAL C N   1 
ATOM   2599 C CA  . VAL C 1 45  ? 28.235  47.702  7.765   1.00 60.98  ? 45  VAL C CA  1 
ATOM   2600 C C   . VAL C 1 45  ? 27.591  47.991  6.426   1.00 65.76  ? 45  VAL C C   1 
ATOM   2601 O O   . VAL C 1 45  ? 26.465  48.435  6.381   1.00 70.89  ? 45  VAL C O   1 
ATOM   2602 C CB  . VAL C 1 45  ? 27.438  46.563  8.408   1.00 59.05  ? 45  VAL C CB  1 
ATOM   2603 C CG1 . VAL C 1 45  ? 27.398  45.369  7.506   1.00 57.04  ? 45  VAL C CG1 1 
ATOM   2604 C CG2 . VAL C 1 45  ? 28.042  46.172  9.709   1.00 55.53  ? 45  VAL C CG2 1 
ATOM   2605 N N   . GLU C 1 46  ? 28.293  47.736  5.329   1.00 67.96  ? 46  GLU C N   1 
ATOM   2606 C CA  . GLU C 1 46  ? 27.706  47.917  4.007   1.00 73.70  ? 46  GLU C CA  1 
ATOM   2607 C C   . GLU C 1 46  ? 26.904  46.700  3.560   1.00 74.02  ? 46  GLU C C   1 
ATOM   2608 O O   . GLU C 1 46  ? 27.105  45.620  4.100   1.00 70.99  ? 46  GLU C O   1 
ATOM   2609 C CB  . GLU C 1 46  ? 28.772  48.309  3.012   1.00 75.57  ? 46  GLU C CB  1 
ATOM   2610 C CG  . GLU C 1 46  ? 28.945  49.807  2.953   1.00 84.49  ? 46  GLU C CG  1 
ATOM   2611 C CD  . GLU C 1 46  ? 30.305  50.236  2.456   1.00 93.93  ? 46  GLU C CD  1 
ATOM   2612 O OE1 . GLU C 1 46  ? 30.954  49.489  1.691   1.00 100.19 ? 46  GLU C OE1 1 
ATOM   2613 O OE2 . GLU C 1 46  ? 30.729  51.339  2.831   1.00 94.27  ? 46  GLU C OE2 1 
ATOM   2614 N N   . PRO C 1 47  ? 25.994  46.877  2.576   1.00 80.83  ? 47  PRO C N   1 
ATOM   2615 C CA  . PRO C 1 47  ? 24.933  45.924  2.189   1.00 81.78  ? 47  PRO C CA  1 
ATOM   2616 C C   . PRO C 1 47  ? 25.267  44.432  2.052   1.00 77.27  ? 47  PRO C C   1 
ATOM   2617 O O   . PRO C 1 47  ? 24.607  43.614  2.700   1.00 78.10  ? 47  PRO C O   1 
ATOM   2618 C CB  . PRO C 1 47  ? 24.439  46.470  0.835   1.00 87.77  ? 47  PRO C CB  1 
ATOM   2619 C CG  . PRO C 1 47  ? 25.378  47.583  0.469   1.00 90.98  ? 47  PRO C CG  1 
ATOM   2620 C CD  . PRO C 1 47  ? 25.901  48.100  1.764   1.00 87.93  ? 47  PRO C CD  1 
ATOM   2621 N N   . GLY C 1 48  ? 26.251  44.072  1.237   1.00 74.14  ? 48  GLY C N   1 
ATOM   2622 C CA  . GLY C 1 48  ? 26.542  42.659  1.015   1.00 70.49  ? 48  GLY C CA  1 
ATOM   2623 C C   . GLY C 1 48  ? 27.798  42.129  1.682   1.00 67.11  ? 48  GLY C C   1 
ATOM   2624 O O   . GLY C 1 48  ? 28.534  41.342  1.089   1.00 69.81  ? 48  GLY C O   1 
ATOM   2625 N N   . GLU C 1 49  ? 28.014  42.535  2.929   1.00 61.95  ? 49  GLU C N   1 
ATOM   2626 C CA  . GLU C 1 49  ? 29.287  42.410  3.582   1.00 57.54  ? 49  GLU C CA  1 
ATOM   2627 C C   . GLU C 1 49  ? 29.148  41.657  4.872   1.00 53.33  ? 49  GLU C C   1 
ATOM   2628 O O   . GLU C 1 49  ? 28.198  41.849  5.590   1.00 55.03  ? 49  GLU C O   1 
ATOM   2629 C CB  . GLU C 1 49  ? 29.788  43.802  3.904   1.00 58.51  ? 49  GLU C CB  1 
ATOM   2630 C CG  . GLU C 1 49  ? 31.211  44.096  3.508   1.00 61.49  ? 49  GLU C CG  1 
ATOM   2631 C CD  . GLU C 1 49  ? 31.638  45.505  3.910   1.00 64.15  ? 49  GLU C CD  1 
ATOM   2632 O OE1 . GLU C 1 49  ? 31.028  46.051  4.846   1.00 63.75  ? 49  GLU C OE1 1 
ATOM   2633 O OE2 . GLU C 1 49  ? 32.573  46.061  3.291   1.00 64.76  ? 49  GLU C OE2 1 
ATOM   2634 N N   . ASP C 1 50  ? 30.117  40.803  5.150   1.00 49.75  ? 50  ASP C N   1 
ATOM   2635 C CA  . ASP C 1 50  ? 30.287  40.144  6.418   1.00 46.31  ? 50  ASP C CA  1 
ATOM   2636 C C   . ASP C 1 50  ? 30.764  41.186  7.445   1.00 44.15  ? 50  ASP C C   1 
ATOM   2637 O O   . ASP C 1 50  ? 31.448  42.151  7.102   1.00 42.38  ? 50  ASP C O   1 
ATOM   2638 C CB  . ASP C 1 50  ? 31.341  39.060  6.225   1.00 46.83  ? 50  ASP C CB  1 
ATOM   2639 C CG  . ASP C 1 50  ? 31.405  38.117  7.353   1.00 48.48  ? 50  ASP C CG  1 
ATOM   2640 O OD1 . ASP C 1 50  ? 31.825  38.510  8.457   1.00 50.25  ? 50  ASP C OD1 1 
ATOM   2641 O OD2 . ASP C 1 50  ? 31.049  36.965  7.129   1.00 51.02  ? 50  ASP C OD2 1 
ATOM   2642 N N   . ASP C 1 51  ? 30.398  40.983  8.704   1.00 42.52  ? 51  ASP C N   1 
ATOM   2643 C CA  . ASP C 1 51  ? 30.747  41.934  9.765   1.00 41.70  ? 51  ASP C CA  1 
ATOM   2644 C C   . ASP C 1 51  ? 32.252  42.049  9.911   1.00 41.31  ? 51  ASP C C   1 
ATOM   2645 O O   . ASP C 1 51  ? 32.788  43.151  10.018  1.00 42.11  ? 51  ASP C O   1 
ATOM   2646 C CB  . ASP C 1 51  ? 30.128  41.521  11.092  1.00 42.26  ? 51  ASP C CB  1 
ATOM   2647 C CG  . ASP C 1 51  ? 28.648  41.753  11.119  1.00 43.53  ? 51  ASP C CG  1 
ATOM   2648 O OD1 . ASP C 1 51  ? 27.943  41.281  12.034  1.00 44.75  ? 51  ASP C OD1 1 
ATOM   2649 O OD2 . ASP C 1 51  ? 28.190  42.428  10.197  1.00 44.98  ? 51  ASP C OD2 1 
ATOM   2650 N N   . LEU C 1 52  ? 32.935  40.911  9.887   1.00 40.51  ? 52  LEU C N   1 
ATOM   2651 C CA  . LEU C 1 52  ? 34.375  40.905  9.943   1.00 39.97  ? 52  LEU C CA  1 
ATOM   2652 C C   . LEU C 1 52  ? 34.987  41.583  8.716   1.00 40.34  ? 52  LEU C C   1 
ATOM   2653 O O   . LEU C 1 52  ? 35.968  42.282  8.808   1.00 41.04  ? 52  LEU C O   1 
ATOM   2654 C CB  . LEU C 1 52  ? 34.855  39.483  10.117  1.00 41.17  ? 52  LEU C CB  1 
ATOM   2655 C CG  . LEU C 1 52  ? 36.176  39.209  10.806  1.00 40.12  ? 52  LEU C CG  1 
ATOM   2656 C CD1 . LEU C 1 52  ? 36.501  40.248  11.777  1.00 36.78  ? 52  LEU C CD1 1 
ATOM   2657 C CD2 . LEU C 1 52  ? 36.024  37.937  11.513  1.00 43.37  ? 52  LEU C CD2 1 
ATOM   2658 N N   . GLU C 1 53  ? 34.378  41.431  7.566   1.00 41.20  ? 53  GLU C N   1 
ATOM   2659 C CA  . GLU C 1 53  ? 34.849  42.188  6.416   1.00 43.65  ? 53  GLU C CA  1 
ATOM   2660 C C   . GLU C 1 53  ? 34.644  43.693  6.628   1.00 43.10  ? 53  GLU C C   1 
ATOM   2661 O O   . GLU C 1 53  ? 35.425  44.510  6.159   1.00 45.70  ? 53  GLU C O   1 
ATOM   2662 C CB  . GLU C 1 53  ? 34.169  41.729  5.132   1.00 44.95  ? 53  GLU C CB  1 
ATOM   2663 C CG  . GLU C 1 53  ? 34.659  40.402  4.591   1.00 48.56  ? 53  GLU C CG  1 
ATOM   2664 C CD  . GLU C 1 53  ? 33.659  39.785  3.643   1.00 52.52  ? 53  GLU C CD  1 
ATOM   2665 O OE1 . GLU C 1 53  ? 33.975  39.590  2.468   1.00 57.03  ? 53  GLU C OE1 1 
ATOM   2666 O OE2 . GLU C 1 53  ? 32.529  39.507  4.070   1.00 54.31  ? 53  GLU C OE2 1 
ATOM   2667 N N   . THR C 1 54  ? 33.582  44.055  7.328   1.00 41.40  ? 54  THR C N   1 
ATOM   2668 C CA  . THR C 1 54  ? 33.318  45.441  7.575   1.00 40.81  ? 54  THR C CA  1 
ATOM   2669 C C   . THR C 1 54  ? 34.410  45.970  8.473   1.00 39.86  ? 54  THR C C   1 
ATOM   2670 O O   . THR C 1 54  ? 34.938  47.051  8.284   1.00 42.60  ? 54  THR C O   1 
ATOM   2671 C CB  . THR C 1 54  ? 31.975  45.618  8.256   1.00 40.49  ? 54  THR C CB  1 
ATOM   2672 O OG1 . THR C 1 54  ? 30.935  45.216  7.366   1.00 41.85  ? 54  THR C OG1 1 
ATOM   2673 C CG2 . THR C 1 54  ? 31.764  47.047  8.618   1.00 40.52  ? 54  THR C CG2 1 
ATOM   2674 N N   . ALA C 1 55  ? 34.754  45.200  9.471   1.00 38.19  ? 55  ALA C N   1 
ATOM   2675 C CA  . ALA C 1 55  ? 35.734  45.658  10.414  1.00 37.32  ? 55  ALA C CA  1 
ATOM   2676 C C   . ALA C 1 55  ? 37.090  45.847  9.748   1.00 38.02  ? 55  ALA C C   1 
ATOM   2677 O O   . ALA C 1 55  ? 37.826  46.776  10.093  1.00 37.31  ? 55  ALA C O   1 
ATOM   2678 C CB  . ALA C 1 55  ? 35.837  44.692  11.560  1.00 36.75  ? 55  ALA C CB  1 
ATOM   2679 N N   . LEU C 1 56  ? 37.428  44.954  8.818   1.00 38.76  ? 56  LEU C N   1 
ATOM   2680 C CA  . LEU C 1 56  ? 38.715  45.020  8.157   1.00 40.31  ? 56  LEU C CA  1 
ATOM   2681 C C   . LEU C 1 56  ? 38.759  46.195  7.236   1.00 42.73  ? 56  LEU C C   1 
ATOM   2682 O O   . LEU C 1 56  ? 39.741  46.932  7.192   1.00 44.84  ? 56  LEU C O   1 
ATOM   2683 C CB  . LEU C 1 56  ? 39.005  43.735  7.392   1.00 41.35  ? 56  LEU C CB  1 
ATOM   2684 C CG  . LEU C 1 56  ? 39.570  42.629  8.291   1.00 39.83  ? 56  LEU C CG  1 
ATOM   2685 C CD1 . LEU C 1 56  ? 39.450  41.296  7.643   1.00 38.21  ? 56  LEU C CD1 1 
ATOM   2686 C CD2 . LEU C 1 56  ? 40.994  42.933  8.656   1.00 36.65  ? 56  LEU C CD2 1 
ATOM   2687 N N   . ARG C 1 57  ? 37.678  46.386  6.510   1.00 44.58  ? 57  ARG C N   1 
ATOM   2688 C CA  . ARG C 1 57  ? 37.609  47.447  5.506   1.00 49.11  ? 57  ARG C CA  1 
ATOM   2689 C C   . ARG C 1 57  ? 37.711  48.830  6.122   1.00 48.18  ? 57  ARG C C   1 
ATOM   2690 O O   . ARG C 1 57  ? 38.373  49.727  5.619   1.00 49.98  ? 57  ARG C O   1 
ATOM   2691 C CB  . ARG C 1 57  ? 36.293  47.339  4.744   1.00 49.88  ? 57  ARG C CB  1 
ATOM   2692 C CG  . ARG C 1 57  ? 36.229  48.247  3.575   1.00 55.08  ? 57  ARG C CG  1 
ATOM   2693 C CD  . ARG C 1 57  ? 34.819  48.404  3.114   1.00 58.42  ? 57  ARG C CD  1 
ATOM   2694 N NE  . ARG C 1 57  ? 34.208  49.544  3.769   1.00 60.36  ? 57  ARG C NE  1 
ATOM   2695 C CZ  . ARG C 1 57  ? 33.229  49.469  4.652   1.00 58.69  ? 57  ARG C CZ  1 
ATOM   2696 N NH1 . ARG C 1 57  ? 32.713  48.311  4.983   1.00 56.70  ? 57  ARG C NH1 1 
ATOM   2697 N NH2 . ARG C 1 57  ? 32.754  50.564  5.193   1.00 64.69  ? 57  ARG C NH2 1 
ATOM   2698 N N   . GLU C 1 58  ? 37.004  48.980  7.223   1.00 46.38  ? 58  GLU C N   1 
ATOM   2699 C CA  . GLU C 1 58  ? 36.931  50.235  7.894   1.00 45.98  ? 58  GLU C CA  1 
ATOM   2700 C C   . GLU C 1 58  ? 38.188  50.529  8.680   1.00 44.08  ? 58  GLU C C   1 
ATOM   2701 O O   . GLU C 1 58  ? 38.493  51.679  8.971   1.00 43.95  ? 58  GLU C O   1 
ATOM   2702 C CB  . GLU C 1 58  ? 35.728  50.265  8.793   1.00 44.96  ? 58  GLU C CB  1 
ATOM   2703 C CG  . GLU C 1 58  ? 35.352  51.659  9.048   1.00 48.50  ? 58  GLU C CG  1 
ATOM   2704 C CD  . GLU C 1 58  ? 34.309  52.104  8.121   1.00 52.75  ? 58  GLU C CD  1 
ATOM   2705 O OE1 . GLU C 1 58  ? 33.376  51.330  7.893   1.00 52.71  ? 58  GLU C OE1 1 
ATOM   2706 O OE2 . GLU C 1 58  ? 34.408  53.237  7.647   1.00 59.77  ? 58  GLU C OE2 1 
ATOM   2707 N N   . THR C 1 59  ? 38.913  49.483  9.037   1.00 42.40  ? 59  THR C N   1 
ATOM   2708 C CA  . THR C 1 59  ? 40.200  49.692  9.636   1.00 42.14  ? 59  THR C CA  1 
ATOM   2709 C C   . THR C 1 59  ? 41.108  50.315  8.610   1.00 45.42  ? 59  THR C C   1 
ATOM   2710 O O   . THR C 1 59  ? 41.760  51.276  8.918   1.00 44.97  ? 59  THR C O   1 
ATOM   2711 C CB  . THR C 1 59  ? 40.758  48.419  10.210  1.00 41.26  ? 59  THR C CB  1 
ATOM   2712 O OG1 . THR C 1 59  ? 40.049  48.144  11.419  1.00 40.25  ? 59  THR C OG1 1 
ATOM   2713 C CG2 . THR C 1 59  ? 42.215  48.571  10.554  1.00 40.12  ? 59  THR C CG2 1 
ATOM   2714 N N   . GLN C 1 60  ? 41.121  49.786  7.389   1.00 49.49  ? 60  GLN C N   1 
ATOM   2715 C CA  . GLN C 1 60  ? 41.783  50.459  6.272   1.00 54.97  ? 60  GLN C CA  1 
ATOM   2716 C C   . GLN C 1 60  ? 41.231  51.876  6.026   1.00 56.70  ? 60  GLN C C   1 
ATOM   2717 O O   . GLN C 1 60  ? 41.984  52.843  5.998   1.00 58.52  ? 60  GLN C O   1 
ATOM   2718 C CB  . GLN C 1 60  ? 41.806  49.565  5.002   1.00 60.10  ? 60  GLN C CB  1 
ATOM   2719 C CG  . GLN C 1 60  ? 41.571  50.242  3.621   1.00 70.68  ? 60  GLN C CG  1 
ATOM   2720 C CD  . GLN C 1 60  ? 42.708  51.161  3.157   1.00 81.16  ? 60  GLN C CD  1 
ATOM   2721 O OE1 . GLN C 1 60  ? 43.876  50.790  3.185   1.00 84.85  ? 60  GLN C OE1 1 
ATOM   2722 N NE2 . GLN C 1 60  ? 42.354  52.365  2.711   1.00 85.94  ? 60  GLN C NE2 1 
ATOM   2723 N N   . GLU C 1 61  ? 39.926  52.022  5.875   1.00 56.99  ? 61  GLU C N   1 
ATOM   2724 C CA  . GLU C 1 61  ? 39.414  53.359  5.649   1.00 60.52  ? 61  GLU C CA  1 
ATOM   2725 C C   . GLU C 1 61  ? 39.836  54.288  6.767   1.00 57.93  ? 61  GLU C C   1 
ATOM   2726 O O   . GLU C 1 61  ? 40.430  55.303  6.511   1.00 61.53  ? 61  GLU C O   1 
ATOM   2727 C CB  . GLU C 1 61  ? 37.888  53.375  5.458   1.00 61.68  ? 61  GLU C CB  1 
ATOM   2728 C CG  . GLU C 1 61  ? 37.439  52.793  4.098   1.00 70.94  ? 61  GLU C CG  1 
ATOM   2729 C CD  . GLU C 1 61  ? 35.919  52.700  3.915   1.00 77.96  ? 61  GLU C CD  1 
ATOM   2730 O OE1 . GLU C 1 61  ? 35.473  51.779  3.213   1.00 77.76  ? 61  GLU C OE1 1 
ATOM   2731 O OE2 . GLU C 1 61  ? 35.172  53.539  4.456   1.00 84.50  ? 61  GLU C OE2 1 
ATOM   2732 N N   . GLU C 1 62  ? 39.569  53.927  8.012   1.00 53.38  ? 62  GLU C N   1 
ATOM   2733 C CA  . GLU C 1 62  ? 39.827  54.841  9.131   1.00 51.43  ? 62  GLU C CA  1 
ATOM   2734 C C   . GLU C 1 62  ? 41.282  55.117  9.537   1.00 49.29  ? 62  GLU C C   1 
ATOM   2735 O O   . GLU C 1 62  ? 41.639  56.245  9.786   1.00 50.25  ? 62  GLU C O   1 
ATOM   2736 C CB  . GLU C 1 62  ? 39.048  54.417  10.365  1.00 48.49  ? 62  GLU C CB  1 
ATOM   2737 C CG  . GLU C 1 62  ? 37.569  54.317  10.172  1.00 52.56  ? 62  GLU C CG  1 
ATOM   2738 C CD  . GLU C 1 62  ? 36.939  55.633  9.900   1.00 60.19  ? 62  GLU C CD  1 
ATOM   2739 O OE1 . GLU C 1 62  ? 35.863  55.893  10.452  1.00 65.19  ? 62  GLU C OE1 1 
ATOM   2740 O OE2 . GLU C 1 62  ? 37.506  56.413  9.124   1.00 66.88  ? 62  GLU C OE2 1 
ATOM   2741 N N   . ALA C 1 63  ? 42.097  54.084  9.635   1.00 46.65  ? 63  ALA C N   1 
ATOM   2742 C CA  . ALA C 1 63  ? 43.449  54.221  10.102  1.00 45.68  ? 63  ALA C CA  1 
ATOM   2743 C C   . ALA C 1 63  ? 44.446  53.847  9.046   1.00 49.61  ? 63  ALA C C   1 
ATOM   2744 O O   . ALA C 1 63  ? 45.638  53.835  9.311   1.00 50.28  ? 63  ALA C O   1 
ATOM   2745 C CB  . ALA C 1 63  ? 43.661  53.340  11.276  1.00 41.89  ? 63  ALA C CB  1 
ATOM   2746 N N   . GLY C 1 64  ? 43.961  53.495  7.865   1.00 53.52  ? 64  GLY C N   1 
ATOM   2747 C CA  . GLY C 1 64  ? 44.826  53.170  6.745   1.00 58.68  ? 64  GLY C CA  1 
ATOM   2748 C C   . GLY C 1 64  ? 45.687  51.939  6.918   1.00 59.16  ? 64  GLY C C   1 
ATOM   2749 O O   . GLY C 1 64  ? 46.718  51.811  6.255   1.00 63.08  ? 64  GLY C O   1 
ATOM   2750 N N   . ILE C 1 65  ? 45.274  51.045  7.815   1.00 56.42  ? 65  ILE C N   1 
ATOM   2751 C CA  . ILE C 1 65  ? 45.922  49.739  7.960   1.00 57.67  ? 65  ILE C CA  1 
ATOM   2752 C C   . ILE C 1 65  ? 45.170  48.684  7.109   1.00 61.66  ? 65  ILE C C   1 
ATOM   2753 O O   . ILE C 1 65  ? 43.943  48.606  7.137   1.00 60.71  ? 65  ILE C O   1 
ATOM   2754 C CB  . ILE C 1 65  ? 46.015  49.323  9.440   1.00 53.25  ? 65  ILE C CB  1 
ATOM   2755 C CG1 . ILE C 1 65  ? 46.767  50.370  10.243  1.00 50.64  ? 65  ILE C CG1 1 
ATOM   2756 C CG2 . ILE C 1 65  ? 46.777  48.040  9.609   1.00 54.04  ? 65  ILE C CG2 1 
ATOM   2757 C CD1 . ILE C 1 65  ? 46.730  50.095  11.733  1.00 43.24  ? 65  ILE C CD1 1 
ATOM   2758 N N   . GLU C 1 66  ? 45.904  47.889  6.342   1.00 66.81  ? 66  GLU C N   1 
ATOM   2759 C CA  . GLU C 1 66  ? 45.274  46.925  5.445   1.00 71.49  ? 66  GLU C CA  1 
ATOM   2760 C C   . GLU C 1 66  ? 45.371  45.502  5.956   1.00 70.97  ? 66  GLU C C   1 
ATOM   2761 O O   . GLU C 1 66  ? 46.298  45.161  6.693   1.00 71.74  ? 66  GLU C O   1 
ATOM   2762 C CB  . GLU C 1 66  ? 45.823  47.025  4.008   1.00 81.05  ? 66  GLU C CB  1 
ATOM   2763 C CG  . GLU C 1 66  ? 47.222  47.609  3.904   1.00 93.97  ? 66  GLU C CG  1 
ATOM   2764 C CD  . GLU C 1 66  ? 47.461  48.301  2.582   1.00 112.32 ? 66  GLU C CD  1 
ATOM   2765 O OE1 . GLU C 1 66  ? 47.715  49.528  2.596   1.00 115.29 ? 66  GLU C OE1 1 
ATOM   2766 O OE2 . GLU C 1 66  ? 47.398  47.618  1.534   1.00 122.74 ? 66  GLU C OE2 1 
ATOM   2767 N N   . ALA C 1 67  ? 44.423  44.675  5.509   1.00 69.13  ? 67  ALA C N   1 
ATOM   2768 C CA  . ALA C 1 67  ? 44.263  43.299  5.954   1.00 67.48  ? 67  ALA C CA  1 
ATOM   2769 C C   . ALA C 1 67  ? 45.569  42.553  6.036   1.00 67.26  ? 67  ALA C C   1 
ATOM   2770 O O   . ALA C 1 67  ? 45.776  41.787  6.955   1.00 65.54  ? 67  ALA C O   1 
ATOM   2771 C CB  . ALA C 1 67  ? 43.296  42.565  5.048   1.00 70.76  ? 67  ALA C CB  1 
ATOM   2772 N N   . GLY C 1 68  ? 46.458  42.795  5.088   1.00 69.64  ? 68  GLY C N   1 
ATOM   2773 C CA  . GLY C 1 68  ? 47.730  42.102  5.058   1.00 69.32  ? 68  GLY C CA  1 
ATOM   2774 C C   . GLY C 1 68  ? 48.522  42.408  6.300   1.00 65.46  ? 68  GLY C C   1 
ATOM   2775 O O   . GLY C 1 68  ? 49.265  41.565  6.805   1.00 64.80  ? 68  GLY C O   1 
ATOM   2776 N N   . GLN C 1 69  ? 48.341  43.625  6.798   1.00 63.14  ? 69  GLN C N   1 
ATOM   2777 C CA  . GLN C 1 69  ? 49.107  44.134  7.926   1.00 59.76  ? 69  GLN C CA  1 
ATOM   2778 C C   . GLN C 1 69  ? 48.560  43.797  9.310   1.00 55.26  ? 69  GLN C C   1 
ATOM   2779 O O   . GLN C 1 69  ? 49.187  44.138  10.290  1.00 53.72  ? 69  GLN C O   1 
ATOM   2780 C CB  . GLN C 1 69  ? 49.239  45.644  7.818   1.00 60.94  ? 69  GLN C CB  1 
ATOM   2781 C CG  . GLN C 1 69  ? 50.111  46.120  6.707   1.00 66.28  ? 69  GLN C CG  1 
ATOM   2782 C CD  . GLN C 1 69  ? 49.916  47.597  6.407   1.00 71.35  ? 69  GLN C CD  1 
ATOM   2783 O OE1 . GLN C 1 69  ? 50.788  48.240  5.831   1.00 77.26  ? 69  GLN C OE1 1 
ATOM   2784 N NE2 . GLN C 1 69  ? 48.768  48.139  6.784   1.00 68.24  ? 69  GLN C NE2 1 
ATOM   2785 N N   . LEU C 1 70  ? 47.414  43.123  9.389   1.00 53.59  ? 70  LEU C N   1 
ATOM   2786 C CA  . LEU C 1 70  ? 46.794  42.771  10.662  1.00 49.47  ? 70  LEU C CA  1 
ATOM   2787 C C   . LEU C 1 70  ? 46.639  41.279  10.758  1.00 49.18  ? 70  LEU C C   1 
ATOM   2788 O O   . LEU C 1 70  ? 46.682  40.593  9.771   1.00 51.26  ? 70  LEU C O   1 
ATOM   2789 C CB  . LEU C 1 70  ? 45.386  43.369  10.783  1.00 48.05  ? 70  LEU C CB  1 
ATOM   2790 C CG  . LEU C 1 70  ? 45.142  44.821  10.424  1.00 48.36  ? 70  LEU C CG  1 
ATOM   2791 C CD1 . LEU C 1 70  ? 43.736  45.012  10.087  1.00 49.14  ? 70  LEU C CD1 1 
ATOM   2792 C CD2 . LEU C 1 70  ? 45.462  45.695  11.562  1.00 47.89  ? 70  LEU C CD2 1 
ATOM   2793 N N   . THR C 1 71  ? 46.412  40.808  11.975  1.00 46.90  ? 71  THR C N   1 
ATOM   2794 C CA  . THR C 1 71  ? 46.055  39.433  12.259  1.00 46.21  ? 71  THR C CA  1 
ATOM   2795 C C   . THR C 1 71  ? 44.844  39.479  13.185  1.00 44.26  ? 71  THR C C   1 
ATOM   2796 O O   . THR C 1 71  ? 44.881  40.125  14.219  1.00 42.43  ? 71  THR C O   1 
ATOM   2797 C CB  . THR C 1 71  ? 47.209  38.724  12.979  1.00 45.86  ? 71  THR C CB  1 
ATOM   2798 O OG1 . THR C 1 71  ? 48.389  38.796  12.177  1.00 47.81  ? 71  THR C OG1 1 
ATOM   2799 C CG2 . THR C 1 71  ? 46.865  37.305  13.271  1.00 45.18  ? 71  THR C CG2 1 
ATOM   2800 N N   . ILE C 1 72  ? 43.772  38.794  12.815  1.00 44.50  ? 72  ILE C N   1 
ATOM   2801 C CA  . ILE C 1 72  ? 42.591  38.724  13.650  1.00 42.67  ? 72  ILE C CA  1 
ATOM   2802 C C   . ILE C 1 72  ? 42.854  37.706  14.709  1.00 42.78  ? 72  ILE C C   1 
ATOM   2803 O O   . ILE C 1 72  ? 43.359  36.667  14.429  1.00 46.11  ? 72  ILE C O   1 
ATOM   2804 C CB  . ILE C 1 72  ? 41.374  38.292  12.854  1.00 44.32  ? 72  ILE C CB  1 
ATOM   2805 C CG1 . ILE C 1 72  ? 40.964  39.401  11.881  1.00 42.18  ? 72  ILE C CG1 1 
ATOM   2806 C CG2 . ILE C 1 72  ? 40.237  37.901  13.795  1.00 43.10  ? 72  ILE C CG2 1 
ATOM   2807 C CD1 . ILE C 1 72  ? 40.596  40.649  12.541  1.00 39.09  ? 72  ILE C CD1 1 
ATOM   2808 N N   . ILE C 1 73  ? 42.530  37.993  15.946  1.00 41.29  ? 73  ILE C N   1 
ATOM   2809 C CA  . ILE C 1 73  ? 42.920  37.091  16.982  1.00 41.55  ? 73  ILE C CA  1 
ATOM   2810 C C   . ILE C 1 73  ? 41.726  36.273  17.183  1.00 44.49  ? 73  ILE C C   1 
ATOM   2811 O O   . ILE C 1 73  ? 40.701  36.802  17.547  1.00 44.82  ? 73  ILE C O   1 
ATOM   2812 C CB  . ILE C 1 73  ? 43.224  37.834  18.301  1.00 39.22  ? 73  ILE C CB  1 
ATOM   2813 C CG1 . ILE C 1 73  ? 44.524  38.666  18.227  1.00 35.55  ? 73  ILE C CG1 1 
ATOM   2814 C CG2 . ILE C 1 73  ? 43.334  36.856  19.425  1.00 39.58  ? 73  ILE C CG2 1 
ATOM   2815 C CD1 . ILE C 1 73  ? 45.634  38.084  17.378  1.00 27.79  ? 73  ILE C CD1 1 
ATOM   2816 N N   . GLU C 1 74  ? 41.837  34.979  16.944  1.00 48.90  ? 74  GLU C N   1 
ATOM   2817 C CA  . GLU C 1 74  ? 40.692  34.067  17.066  1.00 52.53  ? 74  GLU C CA  1 
ATOM   2818 C C   . GLU C 1 74  ? 40.235  33.884  18.514  1.00 51.35  ? 74  GLU C C   1 
ATOM   2819 O O   . GLU C 1 74  ? 41.047  33.879  19.434  1.00 52.15  ? 74  GLU C O   1 
ATOM   2820 C CB  . GLU C 1 74  ? 41.017  32.718  16.423  1.00 57.79  ? 74  GLU C CB  1 
ATOM   2821 C CG  . GLU C 1 74  ? 41.318  32.805  14.906  1.00 65.68  ? 74  GLU C CG  1 
ATOM   2822 C CD  . GLU C 1 74  ? 42.197  31.657  14.363  1.00 76.57  ? 74  GLU C CD  1 
ATOM   2823 O OE1 . GLU C 1 74  ? 43.402  31.536  14.724  1.00 77.85  ? 74  GLU C OE1 1 
ATOM   2824 O OE2 . GLU C 1 74  ? 41.682  30.890  13.540  1.00 82.22  ? 74  GLU C OE2 1 
ATOM   2825 N N   . GLY C 1 75  ? 38.929  33.742  18.708  1.00 50.67  ? 75  GLY C N   1 
ATOM   2826 C CA  . GLY C 1 75  ? 38.365  33.503  20.033  1.00 48.91  ? 75  GLY C CA  1 
ATOM   2827 C C   . GLY C 1 75  ? 37.853  34.691  20.827  1.00 45.01  ? 75  GLY C C   1 
ATOM   2828 O O   . GLY C 1 75  ? 37.335  34.507  21.900  1.00 47.97  ? 75  GLY C O   1 
ATOM   2829 N N   . PHE C 1 76  ? 37.981  35.903  20.321  1.00 39.84  ? 76  PHE C N   1 
ATOM   2830 C CA  . PHE C 1 76  ? 37.499  37.057  21.045  1.00 36.20  ? 76  PHE C CA  1 
ATOM   2831 C C   . PHE C 1 76  ? 36.568  37.888  20.168  1.00 35.71  ? 76  PHE C C   1 
ATOM   2832 O O   . PHE C 1 76  ? 36.828  38.101  19.005  1.00 38.76  ? 76  PHE C O   1 
ATOM   2833 C CB  . PHE C 1 76  ? 38.661  37.924  21.560  1.00 33.60  ? 76  PHE C CB  1 
ATOM   2834 C CG  . PHE C 1 76  ? 38.215  39.159  22.290  1.00 29.28  ? 76  PHE C CG  1 
ATOM   2835 C CD1 . PHE C 1 76  ? 38.071  39.159  23.678  1.00 26.01  ? 76  PHE C CD1 1 
ATOM   2836 C CD2 . PHE C 1 76  ? 37.925  40.329  21.584  1.00 24.90  ? 76  PHE C CD2 1 
ATOM   2837 C CE1 . PHE C 1 76  ? 37.636  40.289  24.344  1.00 23.43  ? 76  PHE C CE1 1 
ATOM   2838 C CE2 . PHE C 1 76  ? 37.469  41.480  22.252  1.00 22.19  ? 76  PHE C CE2 1 
ATOM   2839 C CZ  . PHE C 1 76  ? 37.324  41.452  23.634  1.00 24.60  ? 76  PHE C CZ  1 
ATOM   2840 N N   . LYS C 1 77  ? 35.485  38.370  20.743  1.00 34.69  ? 77  LYS C N   1 
ATOM   2841 C CA  . LYS C 1 77  ? 34.545  39.170  20.032  1.00 33.70  ? 77  LYS C CA  1 
ATOM   2842 C C   . LYS C 1 77  ? 33.760  39.870  21.143  1.00 33.77  ? 77  LYS C C   1 
ATOM   2843 O O   . LYS C 1 77  ? 33.528  39.289  22.168  1.00 33.83  ? 77  LYS C O   1 
ATOM   2844 C CB  . LYS C 1 77  ? 33.656  38.226  19.257  1.00 35.17  ? 77  LYS C CB  1 
ATOM   2845 C CG  . LYS C 1 77  ? 32.788  38.819  18.206  1.00 35.68  ? 77  LYS C CG  1 
ATOM   2846 C CD  . LYS C 1 77  ? 31.743  37.784  17.945  1.00 41.62  ? 77  LYS C CD  1 
ATOM   2847 C CE  . LYS C 1 77  ? 31.058  37.936  16.624  1.00 46.56  ? 77  LYS C CE  1 
ATOM   2848 N NZ  . LYS C 1 77  ? 29.963  36.945  16.585  1.00 52.48  ? 77  LYS C NZ  1 
ATOM   2849 N N   . ARG C 1 78  ? 33.382  41.122  20.968  1.00 33.38  ? 78  ARG C N   1 
ATOM   2850 C CA  . ARG C 1 78  ? 32.594  41.796  21.989  1.00 35.69  ? 78  ARG C CA  1 
ATOM   2851 C C   . ARG C 1 78  ? 31.613  42.683  21.289  1.00 37.52  ? 78  ARG C C   1 
ATOM   2852 O O   . ARG C 1 78  ? 31.936  43.307  20.278  1.00 37.70  ? 78  ARG C O   1 
ATOM   2853 C CB  . ARG C 1 78  ? 33.471  42.666  22.909  1.00 34.83  ? 78  ARG C CB  1 
ATOM   2854 C CG  . ARG C 1 78  ? 33.784  42.105  24.295  1.00 37.90  ? 78  ARG C CG  1 
ATOM   2855 C CD  . ARG C 1 78  ? 33.209  40.679  24.537  1.00 42.61  ? 78  ARG C CD  1 
ATOM   2856 N NE  . ARG C 1 78  ? 34.225  39.684  24.906  1.00 42.72  ? 78  ARG C NE  1 
ATOM   2857 C CZ  . ARG C 1 78  ? 34.422  39.257  26.136  1.00 41.79  ? 78  ARG C CZ  1 
ATOM   2858 N NH1 . ARG C 1 78  ? 33.678  39.720  27.100  1.00 43.42  ? 78  ARG C NH1 1 
ATOM   2859 N NH2 . ARG C 1 78  ? 35.357  38.387  26.394  1.00 42.22  ? 78  ARG C NH2 1 
ATOM   2860 N N   . GLU C 1 79  ? 30.409  42.759  21.817  1.00 40.17  ? 79  GLU C N   1 
ATOM   2861 C CA  . GLU C 1 79  ? 29.404  43.600  21.198  1.00 42.98  ? 79  GLU C CA  1 
ATOM   2862 C C   . GLU C 1 79  ? 28.923  44.727  22.095  1.00 44.07  ? 79  GLU C C   1 
ATOM   2863 O O   . GLU C 1 79  ? 28.447  44.487  23.188  1.00 46.07  ? 79  GLU C O   1 
ATOM   2864 C CB  . GLU C 1 79  ? 28.234  42.744  20.825  1.00 44.97  ? 79  GLU C CB  1 
ATOM   2865 C CG  . GLU C 1 79  ? 27.053  43.478  20.334  1.00 48.39  ? 79  GLU C CG  1 
ATOM   2866 C CD  . GLU C 1 79  ? 26.091  42.525  19.708  1.00 56.72  ? 79  GLU C CD  1 
ATOM   2867 O OE1 . GLU C 1 79  ? 26.578  41.623  18.989  1.00 61.10  ? 79  GLU C OE1 1 
ATOM   2868 O OE2 . GLU C 1 79  ? 24.874  42.649  19.941  1.00 59.49  ? 79  GLU C OE2 1 
ATOM   2869 N N   . LEU C 1 80  ? 29.027  45.961  21.628  1.00 44.51  ? 80  LEU C N   1 
ATOM   2870 C CA  . LEU C 1 80  ? 28.560  47.078  22.427  1.00 45.93  ? 80  LEU C CA  1 
ATOM   2871 C C   . LEU C 1 80  ? 27.233  47.550  21.933  1.00 49.77  ? 80  LEU C C   1 
ATOM   2872 O O   . LEU C 1 80  ? 27.056  47.803  20.763  1.00 48.97  ? 80  LEU C O   1 
ATOM   2873 C CB  . LEU C 1 80  ? 29.553  48.224  22.423  1.00 44.01  ? 80  LEU C CB  1 
ATOM   2874 C CG  . LEU C 1 80  ? 30.835  47.875  23.142  1.00 39.42  ? 80  LEU C CG  1 
ATOM   2875 C CD1 . LEU C 1 80  ? 31.570  46.880  22.335  1.00 37.54  ? 80  LEU C CD1 1 
ATOM   2876 C CD2 . LEU C 1 80  ? 31.629  49.080  23.232  1.00 37.30  ? 80  LEU C CD2 1 
ATOM   2877 N N   . ASN C 1 81  ? 26.289  47.602  22.858  1.00 55.52  ? 81  ASN C N   1 
ATOM   2878 C CA  . ASN C 1 81  ? 24.957  48.139  22.626  1.00 61.34  ? 81  ASN C CA  1 
ATOM   2879 C C   . ASN C 1 81  ? 24.826  49.318  23.530  1.00 64.48  ? 81  ASN C C   1 
ATOM   2880 O O   . ASN C 1 81  ? 24.937  49.181  24.727  1.00 65.55  ? 81  ASN C O   1 
ATOM   2881 C CB  . ASN C 1 81  ? 23.888  47.127  23.000  1.00 62.61  ? 81  ASN C CB  1 
ATOM   2882 C CG  . ASN C 1 81  ? 23.669  46.098  21.927  1.00 66.76  ? 81  ASN C CG  1 
ATOM   2883 O OD1 . ASN C 1 81  ? 23.249  46.425  20.821  1.00 70.95  ? 81  ASN C OD1 1 
ATOM   2884 N ND2 . ASN C 1 81  ? 23.936  44.841  22.245  1.00 68.50  ? 81  ASN C ND2 1 
ATOM   2885 N N   . TYR C 1 82  ? 24.614  50.488  22.963  1.00 70.14  ? 82  TYR C N   1 
ATOM   2886 C CA  . TYR C 1 82  ? 24.484  51.685  23.770  1.00 74.67  ? 82  TYR C CA  1 
ATOM   2887 C C   . TYR C 1 82  ? 23.647  52.697  23.038  1.00 79.33  ? 82  TYR C C   1 
ATOM   2888 O O   . TYR C 1 82  ? 23.279  52.483  21.893  1.00 79.96  ? 82  TYR C O   1 
ATOM   2889 C CB  . TYR C 1 82  ? 25.854  52.267  24.130  1.00 72.77  ? 82  TYR C CB  1 
ATOM   2890 C CG  . TYR C 1 82  ? 26.727  52.619  22.956  1.00 71.90  ? 82  TYR C CG  1 
ATOM   2891 C CD1 . TYR C 1 82  ? 26.650  53.859  22.363  1.00 72.71  ? 82  TYR C CD1 1 
ATOM   2892 C CD2 . TYR C 1 82  ? 27.647  51.712  22.450  1.00 71.49  ? 82  TYR C CD2 1 
ATOM   2893 C CE1 . TYR C 1 82  ? 27.452  54.178  21.296  1.00 71.75  ? 82  TYR C CE1 1 
ATOM   2894 C CE2 . TYR C 1 82  ? 28.456  52.037  21.391  1.00 68.31  ? 82  TYR C CE2 1 
ATOM   2895 C CZ  . TYR C 1 82  ? 28.345  53.268  20.821  1.00 68.83  ? 82  TYR C CZ  1 
ATOM   2896 O OH  . TYR C 1 82  ? 29.133  53.600  19.764  1.00 69.30  ? 82  TYR C OH  1 
ATOM   2897 N N   . VAL C 1 83  ? 23.330  53.787  23.717  1.00 85.38  ? 83  VAL C N   1 
ATOM   2898 C CA  . VAL C 1 83  ? 22.626  54.893  23.096  1.00 91.50  ? 83  VAL C CA  1 
ATOM   2899 C C   . VAL C 1 83  ? 23.596  56.065  23.044  1.00 93.63  ? 83  VAL C C   1 
ATOM   2900 O O   . VAL C 1 83  ? 24.212  56.399  24.045  1.00 92.44  ? 83  VAL C O   1 
ATOM   2901 C CB  . VAL C 1 83  ? 21.340  55.256  23.872  1.00 94.20  ? 83  VAL C CB  1 
ATOM   2902 C CG1 . VAL C 1 83  ? 20.773  56.580  23.380  1.00 101.22 ? 83  VAL C CG1 1 
ATOM   2903 C CG2 . VAL C 1 83  ? 20.296  54.150  23.718  1.00 93.95  ? 83  VAL C CG2 1 
ATOM   2904 N N   . ALA C 1 84  ? 23.752  56.667  21.870  1.00 98.62  ? 84  ALA C N   1 
ATOM   2905 C CA  . ALA C 1 84  ? 24.719  57.745  21.695  1.00 102.70 ? 84  ALA C CA  1 
ATOM   2906 C C   . ALA C 1 84  ? 24.139  58.969  21.012  1.00 109.00 ? 84  ALA C C   1 
ATOM   2907 O O   . ALA C 1 84  ? 23.605  58.872  19.907  1.00 109.83 ? 84  ALA C O   1 
ATOM   2908 C CB  . ALA C 1 84  ? 25.914  57.248  20.917  1.00 100.81 ? 84  ALA C CB  1 
ATOM   2909 N N   . ARG C 1 85  ? 24.281  60.123  21.666  1.00 115.34 ? 85  ARG C N   1 
ATOM   2910 C CA  . ARG C 1 85  ? 23.735  61.388  21.166  1.00 124.21 ? 85  ARG C CA  1 
ATOM   2911 C C   . ARG C 1 85  ? 22.269  61.187  20.778  1.00 126.59 ? 85  ARG C C   1 
ATOM   2912 O O   . ARG C 1 85  ? 21.801  61.674  19.743  1.00 130.04 ? 85  ARG C O   1 
ATOM   2913 C CB  . ARG C 1 85  ? 24.568  61.932  19.994  1.00 128.73 ? 85  ARG C CB  1 
ATOM   2914 N N   . ASN C 1 86  ? 21.568  60.440  21.629  1.00 125.29 ? 86  ASN C N   1 
ATOM   2915 C CA  . ASN C 1 86  ? 20.146  60.131  21.469  1.00 127.34 ? 86  ASN C CA  1 
ATOM   2916 C C   . ASN C 1 86  ? 19.747  59.249  20.275  1.00 123.55 ? 86  ASN C C   1 
ATOM   2917 O O   . ASN C 1 86  ? 18.619  59.329  19.781  1.00 126.69 ? 86  ASN C O   1 
ATOM   2918 C CB  . ASN C 1 86  ? 19.305  61.411  21.532  1.00 135.59 ? 86  ASN C CB  1 
ATOM   2919 C CG  . ASN C 1 86  ? 19.028  61.836  22.956  1.00 142.09 ? 86  ASN C CG  1 
ATOM   2920 O OD1 . ASN C 1 86  ? 18.138  61.286  23.623  1.00 146.74 ? 86  ASN C OD1 1 
ATOM   2921 N ND2 . ASN C 1 86  ? 19.806  62.805  23.441  1.00 148.28 ? 86  ASN C ND2 1 
ATOM   2922 N N   . LYS C 1 87  ? 20.674  58.404  19.829  1.00 116.20 ? 87  LYS C N   1 
ATOM   2923 C CA  . LYS C 1 87  ? 20.379  57.337  18.873  1.00 108.04 ? 87  LYS C CA  1 
ATOM   2924 C C   . LYS C 1 87  ? 21.029  56.060  19.413  1.00 98.02  ? 87  LYS C C   1 
ATOM   2925 O O   . LYS C 1 87  ? 22.062  56.136  20.082  1.00 95.76  ? 87  LYS C O   1 
ATOM   2926 C CB  . LYS C 1 87  ? 20.899  57.691  17.489  1.00 109.29 ? 87  LYS C CB  1 
ATOM   2927 N N   . PRO C 1 88  ? 20.411  54.888  19.171  1.00 92.82  ? 88  PRO C N   1 
ATOM   2928 C CA  . PRO C 1 88  ? 20.956  53.618  19.662  1.00 86.18  ? 88  PRO C CA  1 
ATOM   2929 C C   . PRO C 1 88  ? 21.888  52.880  18.683  1.00 80.59  ? 88  PRO C C   1 
ATOM   2930 O O   . PRO C 1 88  ? 21.479  52.481  17.598  1.00 81.05  ? 88  PRO C O   1 
ATOM   2931 C CB  . PRO C 1 88  ? 19.704  52.805  19.968  1.00 87.36  ? 88  PRO C CB  1 
ATOM   2932 C CG  . PRO C 1 88  ? 18.671  53.362  19.073  1.00 91.95  ? 88  PRO C CG  1 
ATOM   2933 C CD  . PRO C 1 88  ? 18.948  54.816  18.973  1.00 94.92  ? 88  PRO C CD  1 
ATOM   2934 N N   . LYS C 1 89  ? 23.135  52.694  19.115  1.00 73.68  ? 89  LYS C N   1 
ATOM   2935 C CA  . LYS C 1 89  ? 24.210  52.164  18.290  1.00 68.01  ? 89  LYS C CA  1 
ATOM   2936 C C   . LYS C 1 89  ? 24.608  50.766  18.722  1.00 63.55  ? 89  LYS C C   1 
ATOM   2937 O O   . LYS C 1 89  ? 24.627  50.466  19.914  1.00 65.17  ? 89  LYS C O   1 
ATOM   2938 C CB  . LYS C 1 89  ? 25.441  53.061  18.407  1.00 66.87  ? 89  LYS C CB  1 
ATOM   2939 C CG  . LYS C 1 89  ? 25.134  54.521  18.641  1.00 69.65  ? 89  LYS C CG  1 
ATOM   2940 C CD  . LYS C 1 89  ? 25.281  55.361  17.375  1.00 74.86  ? 89  LYS C CD  1 
ATOM   2941 C CE  . LYS C 1 89  ? 23.936  55.841  16.829  1.00 81.61  ? 89  LYS C CE  1 
ATOM   2942 N NZ  . LYS C 1 89  ? 24.044  57.120  16.046  1.00 86.48  ? 89  LYS C NZ  1 
ATOM   2943 N N   . THR C 1 90  ? 24.941  49.923  17.752  1.00 59.06  ? 90  THR C N   1 
ATOM   2944 C CA  . THR C 1 90  ? 25.459  48.600  18.025  1.00 51.33  ? 90  THR C CA  1 
ATOM   2945 C C   . THR C 1 90  ? 26.793  48.462  17.341  1.00 47.24  ? 90  THR C C   1 
ATOM   2946 O O   . THR C 1 90  ? 26.902  48.726  16.166  1.00 47.72  ? 90  THR C O   1 
ATOM   2947 C CB  . THR C 1 90  ? 24.512  47.543  17.492  1.00 52.71  ? 90  THR C CB  1 
ATOM   2948 O OG1 . THR C 1 90  ? 23.318  47.594  18.269  1.00 55.48  ? 90  THR C OG1 1 
ATOM   2949 C CG2 . THR C 1 90  ? 25.116  46.150  17.589  1.00 48.42  ? 90  THR C CG2 1 
ATOM   2950 N N   . VAL C 1 91  ? 27.812  48.046  18.073  1.00 41.72  ? 91  VAL C N   1 
ATOM   2951 C CA  . VAL C 1 91  ? 29.119  47.870  17.487  1.00 37.85  ? 91  VAL C CA  1 
ATOM   2952 C C   . VAL C 1 91  ? 29.707  46.529  17.844  1.00 37.36  ? 91  VAL C C   1 
ATOM   2953 O O   . VAL C 1 91  ? 29.638  46.087  18.988  1.00 36.85  ? 91  VAL C O   1 
ATOM   2954 C CB  . VAL C 1 91  ? 30.085  48.919  17.995  1.00 36.54  ? 91  VAL C CB  1 
ATOM   2955 C CG1 . VAL C 1 91  ? 31.312  48.965  17.105  1.00 31.77  ? 91  VAL C CG1 1 
ATOM   2956 C CG2 . VAL C 1 91  ? 29.389  50.251  18.060  1.00 34.74  ? 91  VAL C CG2 1 
ATOM   2957 N N   . ILE C 1 92  ? 30.318  45.877  16.872  1.00 36.93  ? 92  ILE C N   1 
ATOM   2958 C CA  . ILE C 1 92  ? 30.978  44.624  17.168  1.00 35.84  ? 92  ILE C CA  1 
ATOM   2959 C C   . ILE C 1 92  ? 32.466  44.773  16.948  1.00 34.78  ? 92  ILE C C   1 
ATOM   2960 O O   . ILE C 1 92  ? 32.911  45.194  15.865  1.00 35.63  ? 92  ILE C O   1 
ATOM   2961 C CB  . ILE C 1 92  ? 30.458  43.533  16.297  1.00 37.09  ? 92  ILE C CB  1 
ATOM   2962 C CG1 . ILE C 1 92  ? 28.956  43.448  16.480  1.00 39.48  ? 92  ILE C CG1 1 
ATOM   2963 C CG2 . ILE C 1 92  ? 31.086  42.247  16.665  1.00 36.82  ? 92  ILE C CG2 1 
ATOM   2964 C CD1 . ILE C 1 92  ? 28.370  42.338  15.716  1.00 45.27  ? 92  ILE C CD1 1 
ATOM   2965 N N   . TYR C 1 93  ? 33.230  44.444  17.987  1.00 32.20  ? 93  TYR C N   1 
ATOM   2966 C CA  . TYR C 1 93  ? 34.667  44.527  17.910  1.00 30.11  ? 93  TYR C CA  1 
ATOM   2967 C C   . TYR C 1 93  ? 35.346  43.161  17.935  1.00 29.47  ? 93  TYR C C   1 
ATOM   2968 O O   . TYR C 1 93  ? 34.878  42.223  18.595  1.00 31.09  ? 93  TYR C O   1 
ATOM   2969 C CB  . TYR C 1 93  ? 35.206  45.381  19.049  1.00 29.41  ? 93  TYR C CB  1 
ATOM   2970 C CG  . TYR C 1 93  ? 35.001  46.852  18.873  1.00 28.06  ? 93  TYR C CG  1 
ATOM   2971 C CD1 . TYR C 1 93  ? 35.728  47.570  17.940  1.00 28.61  ? 93  TYR C CD1 1 
ATOM   2972 C CD2 . TYR C 1 93  ? 34.112  47.526  19.678  1.00 28.56  ? 93  TYR C CD2 1 
ATOM   2973 C CE1 . TYR C 1 93  ? 35.539  48.918  17.807  1.00 29.05  ? 93  TYR C CE1 1 
ATOM   2974 C CE2 . TYR C 1 93  ? 33.906  48.851  19.541  1.00 29.40  ? 93  TYR C CE2 1 
ATOM   2975 C CZ  . TYR C 1 93  ? 34.618  49.540  18.623  1.00 30.20  ? 93  TYR C CZ  1 
ATOM   2976 O OH  . TYR C 1 93  ? 34.362  50.860  18.541  1.00 34.41  ? 93  TYR C OH  1 
ATOM   2977 N N   . TRP C 1 94  ? 36.464  43.074  17.232  1.00 32.49  ? 94  TRP C N   1 
ATOM   2978 C CA  . TRP C 1 94  ? 37.335  41.929  17.264  1.00 34.31  ? 94  TRP C CA  1 
ATOM   2979 C C   . TRP C 1 94  ? 38.669  42.523  17.651  1.00 33.96  ? 94  TRP C C   1 
ATOM   2980 O O   . TRP C 1 94  ? 38.849  43.733  17.616  1.00 32.12  ? 94  TRP C O   1 
ATOM   2981 C CB  . TRP C 1 94  ? 37.440  41.286  15.887  1.00 34.42  ? 94  TRP C CB  1 
ATOM   2982 C CG  . TRP C 1 94  ? 36.334  40.368  15.553  1.00 37.93  ? 94  TRP C CG  1 
ATOM   2983 C CD1 . TRP C 1 94  ? 36.300  39.036  15.796  1.00 41.41  ? 94  TRP C CD1 1 
ATOM   2984 C CD2 . TRP C 1 94  ? 35.079  40.691  14.923  1.00 36.26  ? 94  TRP C CD2 1 
ATOM   2985 N NE1 . TRP C 1 94  ? 35.108  38.510  15.382  1.00 42.54  ? 94  TRP C NE1 1 
ATOM   2986 C CE2 . TRP C 1 94  ? 34.345  39.504  14.834  1.00 38.80  ? 94  TRP C CE2 1 
ATOM   2987 C CE3 . TRP C 1 94  ? 34.514  41.861  14.420  1.00 31.85  ? 94  TRP C CE3 1 
ATOM   2988 C CZ2 . TRP C 1 94  ? 33.087  39.456  14.264  1.00 35.23  ? 94  TRP C CZ2 1 
ATOM   2989 C CZ3 . TRP C 1 94  ? 33.267  41.804  13.872  1.00 29.62  ? 94  TRP C CZ3 1 
ATOM   2990 C CH2 . TRP C 1 94  ? 32.566  40.623  13.798  1.00 30.50  ? 94  TRP C CH2 1 
ATOM   2991 N N   . LEU C 1 95  ? 39.618  41.685  18.015  1.00 35.99  ? 95  LEU C N   1 
ATOM   2992 C CA  . LEU C 1 95  ? 40.941  42.160  18.301  1.00 35.14  ? 95  LEU C CA  1 
ATOM   2993 C C   . LEU C 1 95  ? 41.748  41.837  17.102  1.00 35.69  ? 95  LEU C C   1 
ATOM   2994 O O   . LEU C 1 95  ? 41.560  40.785  16.508  1.00 37.60  ? 95  LEU C O   1 
ATOM   2995 C CB  . LEU C 1 95  ? 41.519  41.373  19.439  1.00 37.53  ? 95  LEU C CB  1 
ATOM   2996 C CG  . LEU C 1 95  ? 41.311  41.834  20.858  1.00 39.88  ? 95  LEU C CG  1 
ATOM   2997 C CD1 . LEU C 1 95  ? 41.583  40.616  21.708  1.00 44.97  ? 95  LEU C CD1 1 
ATOM   2998 C CD2 . LEU C 1 95  ? 42.262  42.968  21.201  1.00 40.19  ? 95  LEU C CD2 1 
ATOM   2999 N N   . ALA C 1 96  ? 42.660  42.729  16.747  1.00 33.54  ? 96  ALA C N   1 
ATOM   3000 C CA  . ALA C 1 96  ? 43.584  42.458  15.666  1.00 34.91  ? 96  ALA C CA  1 
ATOM   3001 C C   . ALA C 1 96  ? 44.946  42.936  16.068  1.00 36.38  ? 96  ALA C C   1 
ATOM   3002 O O   . ALA C 1 96  ? 45.098  44.072  16.436  1.00 35.42  ? 96  ALA C O   1 
ATOM   3003 C CB  . ALA C 1 96  ? 43.146  43.153  14.405  1.00 30.41  ? 96  ALA C CB  1 
ATOM   3004 N N   . GLU C 1 97  ? 45.943  42.070  15.986  1.00 41.19  ? 97  GLU C N   1 
ATOM   3005 C CA  . GLU C 1 97  ? 47.318  42.456  16.237  1.00 43.69  ? 97  GLU C CA  1 
ATOM   3006 C C   . GLU C 1 97  ? 47.982  42.979  14.984  1.00 44.18  ? 97  GLU C C   1 
ATOM   3007 O O   . GLU C 1 97  ? 47.720  42.477  13.898  1.00 45.13  ? 97  GLU C O   1 
ATOM   3008 C CB  . GLU C 1 97  ? 48.096  41.268  16.717  1.00 46.03  ? 97  GLU C CB  1 
ATOM   3009 C CG  . GLU C 1 97  ? 49.537  41.608  17.001  1.00 49.79  ? 97  GLU C CG  1 
ATOM   3010 C CD  . GLU C 1 97  ? 50.169  40.618  17.929  1.00 55.36  ? 97  GLU C CD  1 
ATOM   3011 O OE1 . GLU C 1 97  ? 51.067  41.007  18.682  1.00 57.78  ? 97  GLU C OE1 1 
ATOM   3012 O OE2 . GLU C 1 97  ? 49.754  39.449  17.918  1.00 58.18  ? 97  GLU C OE2 1 
ATOM   3013 N N   . VAL C 1 98  ? 48.851  43.973  15.117  1.00 44.44  ? 98  VAL C N   1 
ATOM   3014 C CA  . VAL C 1 98  ? 49.553  44.436  13.924  1.00 45.59  ? 98  VAL C CA  1 
ATOM   3015 C C   . VAL C 1 98  ? 50.770  43.576  13.601  1.00 49.72  ? 98  VAL C C   1 
ATOM   3016 O O   . VAL C 1 98  ? 51.398  43.015  14.499  1.00 52.11  ? 98  VAL C O   1 
ATOM   3017 C CB  . VAL C 1 98  ? 49.967  45.929  13.966  1.00 43.94  ? 98  VAL C CB  1 
ATOM   3018 C CG1 . VAL C 1 98  ? 48.757  46.832  13.795  1.00 40.25  ? 98  VAL C CG1 1 
ATOM   3019 C CG2 . VAL C 1 98  ? 50.756  46.260  15.226  1.00 42.31  ? 98  VAL C CG2 1 
ATOM   3020 N N   . LYS C 1 99  ? 51.095  43.475  12.314  1.00 51.24  ? 99  LYS C N   1 
ATOM   3021 C CA  . LYS C 1 99  ? 52.278  42.750  11.881  1.00 54.27  ? 99  LYS C CA  1 
ATOM   3022 C C   . LYS C 1 99  ? 53.540  43.516  12.193  1.00 54.19  ? 99  LYS C C   1 
ATOM   3023 O O   . LYS C 1 99  ? 54.546  42.938  12.541  1.00 56.18  ? 99  LYS C O   1 
ATOM   3024 C CB  . LYS C 1 99  ? 52.199  42.397  10.402  1.00 56.82  ? 99  LYS C CB  1 
ATOM   3025 C CG  . LYS C 1 99  ? 51.879  40.935  10.128  1.00 69.04  ? 99  LYS C CG  1 
ATOM   3026 C CD  . LYS C 1 99  ? 53.151  40.057  10.228  1.00 82.53  ? 99  LYS C CD  1 
ATOM   3027 C CE  . LYS C 1 99  ? 52.880  38.577  9.880   1.00 95.65  ? 99  LYS C CE  1 
ATOM   3028 N NZ  . LYS C 1 99  ? 52.148  37.832  10.954  1.00 97.43  ? 99  LYS C NZ  1 
ATOM   3029 N N   . ASP C 1 100 ? 53.477  44.829  12.058  1.00 53.66  ? 100 ASP C N   1 
ATOM   3030 C CA  . ASP C 1 100 ? 54.599  45.693  12.398  1.00 54.11  ? 100 ASP C CA  1 
ATOM   3031 C C   . ASP C 1 100 ? 54.250  46.728  13.427  1.00 51.78  ? 100 ASP C C   1 
ATOM   3032 O O   . ASP C 1 100 ? 53.334  47.504  13.254  1.00 49.63  ? 100 ASP C O   1 
ATOM   3033 C CB  . ASP C 1 100 ? 55.134  46.397  11.168  1.00 57.87  ? 100 ASP C CB  1 
ATOM   3034 C CG  . ASP C 1 100 ? 56.118  45.567  10.411  1.00 65.48  ? 100 ASP C CG  1 
ATOM   3035 O OD1 . ASP C 1 100 ? 56.376  45.928  9.258   1.00 75.61  ? 100 ASP C OD1 1 
ATOM   3036 O OD2 . ASP C 1 100 ? 56.631  44.566  10.952  1.00 70.40  ? 100 ASP C OD2 1 
ATOM   3037 N N   . TYR C 1 101 ? 55.031  46.738  14.492  1.00 52.24  ? 101 TYR C N   1 
ATOM   3038 C CA  . TYR C 1 101 ? 54.865  47.646  15.601  1.00 51.27  ? 101 TYR C CA  1 
ATOM   3039 C C   . TYR C 1 101 ? 54.809  49.085  15.120  1.00 49.97  ? 101 TYR C C   1 
ATOM   3040 O O   . TYR C 1 101 ? 54.050  49.889  15.632  1.00 49.46  ? 101 TYR C O   1 
ATOM   3041 C CB  . TYR C 1 101 ? 56.027  47.454  16.569  1.00 52.97  ? 101 TYR C CB  1 
ATOM   3042 C CG  . TYR C 1 101 ? 55.933  48.270  17.827  1.00 53.40  ? 101 TYR C CG  1 
ATOM   3043 C CD1 . TYR C 1 101 ? 55.376  47.739  18.976  1.00 54.05  ? 101 TYR C CD1 1 
ATOM   3044 C CD2 . TYR C 1 101 ? 56.402  49.562  17.865  1.00 53.23  ? 101 TYR C CD2 1 
ATOM   3045 C CE1 . TYR C 1 101 ? 55.295  48.466  20.101  1.00 54.21  ? 101 TYR C CE1 1 
ATOM   3046 C CE2 . TYR C 1 101 ? 56.312  50.296  18.977  1.00 54.18  ? 101 TYR C CE2 1 
ATOM   3047 C CZ  . TYR C 1 101 ? 55.762  49.749  20.092  1.00 55.44  ? 101 TYR C CZ  1 
ATOM   3048 O OH  . TYR C 1 101 ? 55.664  50.520  21.210  1.00 57.89  ? 101 TYR C OH  1 
ATOM   3049 N N   . ASP C 1 102 ? 55.604  49.414  14.123  1.00 49.97  ? 102 ASP C N   1 
ATOM   3050 C CA  . ASP C 1 102 ? 55.633  50.762  13.652  1.00 49.24  ? 102 ASP C CA  1 
ATOM   3051 C C   . ASP C 1 102 ? 54.840  50.966  12.378  1.00 47.20  ? 102 ASP C C   1 
ATOM   3052 O O   . ASP C 1 102 ? 55.125  51.869  11.615  1.00 49.08  ? 102 ASP C O   1 
ATOM   3053 C CB  . ASP C 1 102 ? 57.067  51.263  13.537  1.00 51.82  ? 102 ASP C CB  1 
ATOM   3054 C CG  . ASP C 1 102 ? 57.936  50.368  12.700  1.00 56.96  ? 102 ASP C CG  1 
ATOM   3055 O OD1 . ASP C 1 102 ? 57.451  49.300  12.274  1.00 62.71  ? 102 ASP C OD1 1 
ATOM   3056 O OD2 . ASP C 1 102 ? 59.112  50.716  12.477  1.00 60.22  ? 102 ASP C OD2 1 
ATOM   3057 N N   . VAL C 1 103 ? 53.813  50.151  12.186  1.00 44.52  ? 103 VAL C N   1 
ATOM   3058 C CA  . VAL C 1 103 ? 52.900  50.250  11.042  1.00 41.93  ? 103 VAL C CA  1 
ATOM   3059 C C   . VAL C 1 103 ? 52.351  51.655  10.937  1.00 40.78  ? 103 VAL C C   1 
ATOM   3060 O O   . VAL C 1 103 ? 52.131  52.308  11.940  1.00 41.00  ? 103 VAL C O   1 
ATOM   3061 C CB  . VAL C 1 103 ? 51.707  49.255  11.201  1.00 40.80  ? 103 VAL C CB  1 
ATOM   3062 C CG1 . VAL C 1 103 ? 50.825  49.668  12.355  1.00 38.08  ? 103 VAL C CG1 1 
ATOM   3063 C CG2 . VAL C 1 103 ? 50.864  49.140  9.931   1.00 36.17  ? 103 VAL C CG2 1 
ATOM   3064 N N   . GLU C 1 104 ? 52.115  52.113  9.722   1.00 41.29  ? 104 GLU C N   1 
ATOM   3065 C CA  . GLU C 1 104 ? 51.747  53.492  9.504   1.00 41.54  ? 104 GLU C CA  1 
ATOM   3066 C C   . GLU C 1 104 ? 50.284  53.760  9.695   1.00 39.23  ? 104 GLU C C   1 
ATOM   3067 O O   . GLU C 1 104 ? 49.456  53.171  9.049   1.00 39.30  ? 104 GLU C O   1 
ATOM   3068 C CB  . GLU C 1 104 ? 52.168  53.952  8.117   1.00 42.92  ? 104 GLU C CB  1 
ATOM   3069 C CG  . GLU C 1 104 ? 52.295  55.447  8.020   1.00 47.07  ? 104 GLU C CG  1 
ATOM   3070 C CD  . GLU C 1 104 ? 52.304  55.964  6.604   1.00 53.32  ? 104 GLU C CD  1 
ATOM   3071 O OE1 . GLU C 1 104 ? 51.873  57.110  6.371   1.00 54.54  ? 104 GLU C OE1 1 
ATOM   3072 O OE2 . GLU C 1 104 ? 52.752  55.229  5.715   1.00 59.83  ? 104 GLU C OE2 1 
ATOM   3073 N N   . ILE C 1 105 ? 49.982  54.693  10.575  1.00 38.36  ? 105 ILE C N   1 
ATOM   3074 C CA  . ILE C 1 105 ? 48.630  55.158  10.749  1.00 37.00  ? 105 ILE C CA  1 
ATOM   3075 C C   . ILE C 1 105 ? 48.427  56.343  9.832   1.00 38.75  ? 105 ILE C C   1 
ATOM   3076 O O   . ILE C 1 105 ? 49.113  57.353  9.962   1.00 39.41  ? 105 ILE C O   1 
ATOM   3077 C CB  . ILE C 1 105 ? 48.343  55.589  12.225  1.00 35.91  ? 105 ILE C CB  1 
ATOM   3078 C CG1 . ILE C 1 105 ? 48.388  54.409  13.211  1.00 32.75  ? 105 ILE C CG1 1 
ATOM   3079 C CG2 . ILE C 1 105 ? 46.967  56.224  12.340  1.00 31.30  ? 105 ILE C CG2 1 
ATOM   3080 C CD1 . ILE C 1 105 ? 48.992  53.194  12.705  1.00 30.72  ? 105 ILE C CD1 1 
ATOM   3081 N N   . ARG C 1 106 ? 47.488  56.212  8.900   1.00 52.20  ? 106 ARG C N   1 
ATOM   3082 C CA  . ARG C 1 106 ? 47.072  57.330  8.051   1.00 56.87  ? 106 ARG C CA  1 
ATOM   3083 C C   . ARG C 1 106 ? 45.625  57.592  8.341   1.00 56.18  ? 106 ARG C C   1 
ATOM   3084 O O   . ARG C 1 106 ? 44.793  56.775  8.008   1.00 58.81  ? 106 ARG C O   1 
ATOM   3085 C CB  . ARG C 1 106 ? 47.230  56.978  6.570   1.00 63.59  ? 106 ARG C CB  1 
ATOM   3086 C CG  . ARG C 1 106 ? 48.212  55.841  6.330   1.00 71.33  ? 106 ARG C CG  1 
ATOM   3087 C CD  . ARG C 1 106 ? 48.495  55.547  4.847   1.00 87.06  ? 106 ARG C CD  1 
ATOM   3088 N NE  . ARG C 1 106 ? 49.189  54.255  4.727   1.00 94.98  ? 106 ARG C NE  1 
ATOM   3089 C CZ  . ARG C 1 106 ? 50.124  53.950  3.828   1.00 101.04 ? 106 ARG C CZ  1 
ATOM   3090 N NH1 . ARG C 1 106 ? 50.519  54.841  2.926   1.00 111.44 ? 106 ARG C NH1 1 
ATOM   3091 N NH2 . ARG C 1 106 ? 50.671  52.741  3.841   1.00 99.57  ? 106 ARG C NH2 1 
ATOM   3092 N N   . LEU C 1 107 ? 45.319  58.711  8.979   1.00 56.24  ? 107 LEU C N   1 
ATOM   3093 C CA  . LEU C 1 107 ? 43.931  59.021  9.295   1.00 56.91  ? 107 LEU C CA  1 
ATOM   3094 C C   . LEU C 1 107 ? 43.095  59.416  8.094   1.00 61.89  ? 107 LEU C C   1 
ATOM   3095 O O   . LEU C 1 107 ? 43.572  59.950  7.119   1.00 64.57  ? 107 LEU C O   1 
ATOM   3096 C CB  . LEU C 1 107 ? 43.814  60.118  10.348  1.00 54.45  ? 107 LEU C CB  1 
ATOM   3097 C CG  . LEU C 1 107 ? 44.439  59.815  11.699  1.00 51.15  ? 107 LEU C CG  1 
ATOM   3098 C CD1 . LEU C 1 107 ? 43.988  60.875  12.664  1.00 48.94  ? 107 LEU C CD1 1 
ATOM   3099 C CD2 . LEU C 1 107 ? 44.053  58.424  12.175  1.00 46.10  ? 107 LEU C CD2 1 
ATOM   3100 N N   . SER C 1 108 ? 41.815  59.132  8.198   1.00 66.44  ? 108 SER C N   1 
ATOM   3101 C CA  . SER C 1 108 ? 40.862  59.607  7.252   1.00 71.52  ? 108 SER C CA  1 
ATOM   3102 C C   . SER C 1 108 ? 40.575  61.026  7.670   1.00 71.50  ? 108 SER C C   1 
ATOM   3103 O O   . SER C 1 108 ? 41.165  61.548  8.601   1.00 69.34  ? 108 SER C O   1 
ATOM   3104 C CB  . SER C 1 108 ? 39.593  58.758  7.318   1.00 73.50  ? 108 SER C CB  1 
ATOM   3105 O OG  . SER C 1 108 ? 38.516  59.390  6.642   1.00 80.25  ? 108 SER C OG  1 
ATOM   3106 N N   . HIS C 1 109 ? 39.647  61.635  6.964   1.00 77.27  ? 109 HIS C N   1 
ATOM   3107 C CA  . HIS C 1 109 ? 39.179  62.972  7.225   1.00 79.21  ? 109 HIS C CA  1 
ATOM   3108 C C   . HIS C 1 109 ? 38.351  62.960  8.516   1.00 77.57  ? 109 HIS C C   1 
ATOM   3109 O O   . HIS C 1 109 ? 38.205  63.974  9.180   1.00 77.01  ? 109 HIS C O   1 
ATOM   3110 C CB  . HIS C 1 109 ? 38.382  63.412  5.987   1.00 85.39  ? 109 HIS C CB  1 
ATOM   3111 C CG  . HIS C 1 109 ? 38.801  62.696  4.722   1.00 93.19  ? 109 HIS C CG  1 
ATOM   3112 N ND1 . HIS C 1 109 ? 38.191  61.535  4.278   1.00 92.98  ? 109 HIS C ND1 1 
ATOM   3113 C CD2 . HIS C 1 109 ? 39.801  62.959  3.836   1.00 98.50  ? 109 HIS C CD2 1 
ATOM   3114 C CE1 . HIS C 1 109 ? 38.784  61.124  3.169   1.00 96.10  ? 109 HIS C CE1 1 
ATOM   3115 N NE2 . HIS C 1 109 ? 39.766  61.970  2.881   1.00 100.33 ? 109 HIS C NE2 1 
ATOM   3116 N N   . GLU C 1 110 ? 37.848  61.781  8.880   1.00 77.56  ? 110 GLU C N   1 
ATOM   3117 C CA  . GLU C 1 110 ? 36.914  61.595  10.007  1.00 75.17  ? 110 GLU C CA  1 
ATOM   3118 C C   . GLU C 1 110 ? 37.536  61.747  11.384  1.00 68.87  ? 110 GLU C C   1 
ATOM   3119 O O   . GLU C 1 110 ? 36.824  61.970  12.356  1.00 68.30  ? 110 GLU C O   1 
ATOM   3120 C CB  . GLU C 1 110 ? 36.202  60.252  9.896   1.00 77.31  ? 110 GLU C CB  1 
ATOM   3121 C CG  . GLU C 1 110 ? 36.008  59.808  8.444   1.00 87.58  ? 110 GLU C CG  1 
ATOM   3122 C CD  . GLU C 1 110 ? 35.170  58.520  8.316   1.00 94.92  ? 110 GLU C CD  1 
ATOM   3123 O OE1 . GLU C 1 110 ? 34.251  58.297  9.144   1.00 95.98  ? 110 GLU C OE1 1 
ATOM   3124 O OE2 . GLU C 1 110 ? 35.437  57.733  7.372   1.00 97.56  ? 110 GLU C OE2 1 
ATOM   3125 N N   . HIS C 1 111 ? 38.859  61.628  11.467  1.00 64.30  ? 111 HIS C N   1 
ATOM   3126 C CA  . HIS C 1 111 ? 39.559  61.871  12.729  1.00 60.30  ? 111 HIS C CA  1 
ATOM   3127 C C   . HIS C 1 111 ? 40.720  62.847  12.629  1.00 60.16  ? 111 HIS C C   1 
ATOM   3128 O O   . HIS C 1 111 ? 41.318  63.012  11.584  1.00 61.85  ? 111 HIS C O   1 
ATOM   3129 C CB  . HIS C 1 111 ? 40.032  60.563  13.332  1.00 57.42  ? 111 HIS C CB  1 
ATOM   3130 C CG  . HIS C 1 111 ? 39.030  59.469  13.207  1.00 55.05  ? 111 HIS C CG  1 
ATOM   3131 N ND1 . HIS C 1 111 ? 38.073  59.213  14.167  1.00 50.89  ? 111 HIS C ND1 1 
ATOM   3132 C CD2 . HIS C 1 111 ? 38.820  58.579  12.210  1.00 54.21  ? 111 HIS C CD2 1 
ATOM   3133 C CE1 . HIS C 1 111 ? 37.322  58.206  13.767  1.00 50.90  ? 111 HIS C CE1 1 
ATOM   3134 N NE2 . HIS C 1 111 ? 37.755  57.803  12.585  1.00 52.95  ? 111 HIS C NE2 1 
ATOM   3135 N N   . GLN C 1 112 ? 41.020  63.500  13.736  1.00 58.39  ? 112 GLN C N   1 
ATOM   3136 C CA  . GLN C 1 112 ? 42.049  64.509  13.750  1.00 58.87  ? 112 GLN C CA  1 
ATOM   3137 C C   . GLN C 1 112 ? 43.291  64.041  14.475  1.00 55.48  ? 112 GLN C C   1 
ATOM   3138 O O   . GLN C 1 112 ? 44.297  64.718  14.427  1.00 58.19  ? 112 GLN C O   1 
ATOM   3139 C CB  . GLN C 1 112 ? 41.521  65.783  14.400  1.00 61.24  ? 112 GLN C CB  1 
ATOM   3140 C CG  . GLN C 1 112 ? 40.300  65.545  15.259  1.00 65.36  ? 112 GLN C CG  1 
ATOM   3141 C CD  . GLN C 1 112 ? 40.255  66.395  16.490  1.00 70.19  ? 112 GLN C CD  1 
ATOM   3142 O OE1 . GLN C 1 112 ? 40.990  66.182  17.440  1.00 70.83  ? 112 GLN C OE1 1 
ATOM   3143 N NE2 . GLN C 1 112 ? 39.364  67.350  16.494  1.00 76.78  ? 112 GLN C NE2 1 
ATOM   3144 N N   . ALA C 1 113 ? 43.216  62.903  15.163  1.00 50.66  ? 113 ALA C N   1 
ATOM   3145 C CA  . ALA C 1 113 ? 44.331  62.416  15.977  1.00 46.09  ? 113 ALA C CA  1 
ATOM   3146 C C   . ALA C 1 113 ? 44.227  60.931  16.328  1.00 42.66  ? 113 ALA C C   1 
ATOM   3147 O O   . ALA C 1 113 ? 43.152  60.339  16.278  1.00 41.41  ? 113 ALA C O   1 
ATOM   3148 C CB  . ALA C 1 113 ? 44.443  63.230  17.238  1.00 45.81  ? 113 ALA C CB  1 
ATOM   3149 N N   . TYR C 1 114 ? 45.361  60.352  16.707  1.00 40.15  ? 114 TYR C N   1 
ATOM   3150 C CA  . TYR C 1 114 ? 45.437  58.971  17.172  1.00 36.70  ? 114 TYR C CA  1 
ATOM   3151 C C   . TYR C 1 114 ? 46.495  58.826  18.243  1.00 36.04  ? 114 TYR C C   1 
ATOM   3152 O O   . TYR C 1 114 ? 47.377  59.652  18.347  1.00 37.49  ? 114 TYR C O   1 
ATOM   3153 C CB  . TYR C 1 114 ? 45.783  58.055  16.011  1.00 36.09  ? 114 TYR C CB  1 
ATOM   3154 C CG  . TYR C 1 114 ? 47.195  58.180  15.485  1.00 34.07  ? 114 TYR C CG  1 
ATOM   3155 C CD1 . TYR C 1 114 ? 47.465  58.973  14.403  1.00 35.22  ? 114 TYR C CD1 1 
ATOM   3156 C CD2 . TYR C 1 114 ? 48.235  57.474  16.055  1.00 31.70  ? 114 TYR C CD2 1 
ATOM   3157 C CE1 . TYR C 1 114 ? 48.722  59.075  13.893  1.00 37.99  ? 114 TYR C CE1 1 
ATOM   3158 C CE2 . TYR C 1 114 ? 49.503  57.565  15.576  1.00 34.03  ? 114 TYR C CE2 1 
ATOM   3159 C CZ  . TYR C 1 114 ? 49.747  58.369  14.483  1.00 40.59  ? 114 TYR C CZ  1 
ATOM   3160 O OH  . TYR C 1 114 ? 51.021  58.473  13.957  1.00 46.42  ? 114 TYR C OH  1 
ATOM   3161 N N   . ARG C 1 115 ? 46.418  57.764  19.027  1.00 34.30  ? 115 ARG C N   1 
ATOM   3162 C CA  . ARG C 1 115 ? 47.417  57.497  20.051  1.00 34.20  ? 115 ARG C CA  1 
ATOM   3163 C C   . ARG C 1 115 ? 47.509  56.003  20.224  1.00 33.41  ? 115 ARG C C   1 
ATOM   3164 O O   . ARG C 1 115 ? 46.497  55.310  20.128  1.00 33.07  ? 115 ARG C O   1 
ATOM   3165 C CB  . ARG C 1 115 ? 47.006  58.104  21.409  1.00 34.96  ? 115 ARG C CB  1 
ATOM   3166 C CG  . ARG C 1 115 ? 47.318  59.587  21.609  1.00 36.03  ? 115 ARG C CG  1 
ATOM   3167 C CD  . ARG C 1 115 ? 48.789  59.812  21.533  1.00 37.10  ? 115 ARG C CD  1 
ATOM   3168 N NE  . ARG C 1 115 ? 49.197  61.183  21.765  1.00 40.92  ? 115 ARG C NE  1 
ATOM   3169 C CZ  . ARG C 1 115 ? 49.080  62.185  20.889  1.00 43.61  ? 115 ARG C CZ  1 
ATOM   3170 N NH1 . ARG C 1 115 ? 48.508  62.004  19.711  1.00 39.75  ? 115 ARG C NH1 1 
ATOM   3171 N NH2 . ARG C 1 115 ? 49.532  63.393  21.202  1.00 45.48  ? 115 ARG C NH2 1 
ATOM   3172 N N   . TRP C 1 116 ? 48.715  55.502  20.473  1.00 33.09  ? 116 TRP C N   1 
ATOM   3173 C CA  . TRP C 1 116 ? 48.894  54.129  20.872  1.00 31.71  ? 116 TRP C CA  1 
ATOM   3174 C C   . TRP C 1 116 ? 49.020  54.275  22.370  1.00 31.72  ? 116 TRP C C   1 
ATOM   3175 O O   . TRP C 1 116 ? 49.877  54.986  22.837  1.00 32.41  ? 116 TRP C O   1 
ATOM   3176 C CB  . TRP C 1 116 ? 50.191  53.540  20.306  1.00 32.39  ? 116 TRP C CB  1 
ATOM   3177 C CG  . TRP C 1 116 ? 50.153  53.012  18.889  1.00 31.95  ? 116 TRP C CG  1 
ATOM   3178 C CD1 . TRP C 1 116 ? 50.746  53.575  17.808  1.00 33.01  ? 116 TRP C CD1 1 
ATOM   3179 C CD2 . TRP C 1 116 ? 49.553  51.801  18.425  1.00 30.59  ? 116 TRP C CD2 1 
ATOM   3180 N NE1 . TRP C 1 116 ? 50.521  52.824  16.695  1.00 33.95  ? 116 TRP C NE1 1 
ATOM   3181 C CE2 . TRP C 1 116 ? 49.792  51.721  17.047  1.00 32.06  ? 116 TRP C CE2 1 
ATOM   3182 C CE3 . TRP C 1 116 ? 48.810  50.793  19.032  1.00 31.07  ? 116 TRP C CE3 1 
ATOM   3183 C CZ2 . TRP C 1 116 ? 49.324  50.665  16.263  1.00 31.04  ? 116 TRP C CZ2 1 
ATOM   3184 C CZ3 . TRP C 1 116 ? 48.344  49.739  18.245  1.00 31.13  ? 116 TRP C CZ3 1 
ATOM   3185 C CH2 . TRP C 1 116 ? 48.616  49.686  16.876  1.00 29.86  ? 116 TRP C CH2 1 
ATOM   3186 N N   . LEU C 1 117 ? 48.152  53.615  23.116  1.00 31.29  ? 117 LEU C N   1 
ATOM   3187 C CA  . LEU C 1 117 ? 48.144  53.720  24.574  1.00 33.33  ? 117 LEU C CA  1 
ATOM   3188 C C   . LEU C 1 117 ? 48.038  52.387  25.310  1.00 33.73  ? 117 LEU C C   1 
ATOM   3189 O O   . LEU C 1 117 ? 47.432  51.442  24.826  1.00 34.91  ? 117 LEU C O   1 
ATOM   3190 C CB  . LEU C 1 117 ? 46.954  54.556  25.006  1.00 32.96  ? 117 LEU C CB  1 
ATOM   3191 C CG  . LEU C 1 117 ? 46.779  55.879  24.290  1.00 34.32  ? 117 LEU C CG  1 
ATOM   3192 C CD1 . LEU C 1 117 ? 45.344  56.342  24.408  1.00 34.29  ? 117 LEU C CD1 1 
ATOM   3193 C CD2 . LEU C 1 117 ? 47.728  56.918  24.839  1.00 34.57  ? 117 LEU C CD2 1 
ATOM   3194 N N   . GLY C 1 118 ? 48.577  52.323  26.509  1.00 35.26  ? 118 GLY C N   1 
ATOM   3195 C CA  . GLY C 1 118 ? 48.382  51.154  27.355  1.00 35.86  ? 118 GLY C CA  1 
ATOM   3196 C C   . GLY C 1 118 ? 46.978  51.197  27.900  1.00 36.08  ? 118 GLY C C   1 
ATOM   3197 O O   . GLY C 1 118 ? 46.295  52.177  27.730  1.00 35.39  ? 118 GLY C O   1 
ATOM   3198 N N   . LEU C 1 119 ? 46.557  50.148  28.582  1.00 37.05  ? 119 LEU C N   1 
ATOM   3199 C CA  . LEU C 1 119 ? 45.179  50.051  29.003  1.00 38.62  ? 119 LEU C CA  1 
ATOM   3200 C C   . LEU C 1 119 ? 44.675  51.201  29.879  1.00 43.39  ? 119 LEU C C   1 
ATOM   3201 O O   . LEU C 1 119 ? 43.568  51.683  29.670  1.00 44.55  ? 119 LEU C O   1 
ATOM   3202 C CB  . LEU C 1 119 ? 44.930  48.708  29.665  1.00 37.22  ? 119 LEU C CB  1 
ATOM   3203 C CG  . LEU C 1 119 ? 43.498  48.374  30.071  1.00 36.11  ? 119 LEU C CG  1 
ATOM   3204 C CD1 . LEU C 1 119 ? 42.568  48.014  28.911  1.00 26.34  ? 119 LEU C CD1 1 
ATOM   3205 C CD2 . LEU C 1 119 ? 43.571  47.260  31.028  1.00 33.96  ? 119 LEU C CD2 1 
ATOM   3206 N N   . GLU C 1 120 ? 45.456  51.659  30.843  1.00 47.93  ? 120 GLU C N   1 
ATOM   3207 C CA  . GLU C 1 120 ? 44.914  52.649  31.746  1.00 54.27  ? 120 GLU C CA  1 
ATOM   3208 C C   . GLU C 1 120 ? 44.532  53.906  31.001  1.00 53.13  ? 120 GLU C C   1 
ATOM   3209 O O   . GLU C 1 120 ? 43.419  54.398  31.133  1.00 53.57  ? 120 GLU C O   1 
ATOM   3210 C CB  . GLU C 1 120 ? 45.905  52.988  32.858  1.00 61.36  ? 120 GLU C CB  1 
ATOM   3211 C CG  . GLU C 1 120 ? 45.547  52.452  34.243  1.00 73.18  ? 120 GLU C CG  1 
ATOM   3212 C CD  . GLU C 1 120 ? 46.602  52.800  35.260  1.00 88.40  ? 120 GLU C CD  1 
ATOM   3213 O OE1 . GLU C 1 120 ? 47.768  52.961  34.864  1.00 91.14  ? 120 GLU C OE1 1 
ATOM   3214 O OE2 . GLU C 1 120 ? 46.274  52.923  36.451  1.00 98.44  ? 120 GLU C OE2 1 
ATOM   3215 N N   . GLU C 1 121 ? 45.462  54.419  30.213  1.00 51.55  ? 121 GLU C N   1 
ATOM   3216 C CA  . GLU C 1 121 ? 45.226  55.631  29.464  1.00 51.30  ? 121 GLU C CA  1 
ATOM   3217 C C   . GLU C 1 121 ? 44.137  55.384  28.449  1.00 48.05  ? 121 GLU C C   1 
ATOM   3218 O O   . GLU C 1 121 ? 43.199  56.150  28.332  1.00 49.24  ? 121 GLU C O   1 
ATOM   3219 C CB  . GLU C 1 121 ? 46.501  56.090  28.753  1.00 51.73  ? 121 GLU C CB  1 
ATOM   3220 C CG  . GLU C 1 121 ? 47.721  56.343  29.664  1.00 62.06  ? 121 GLU C CG  1 
ATOM   3221 C CD  . GLU C 1 121 ? 48.343  55.070  30.293  1.00 70.79  ? 121 GLU C CD  1 
ATOM   3222 O OE1 . GLU C 1 121 ? 47.881  53.937  30.021  1.00 71.26  ? 121 GLU C OE1 1 
ATOM   3223 O OE2 . GLU C 1 121 ? 49.306  55.214  31.078  1.00 80.84  ? 121 GLU C OE2 1 
ATOM   3224 N N   . ALA C 1 122 ? 44.232  54.304  27.714  1.00 44.56  ? 122 ALA C N   1 
ATOM   3225 C CA  . ALA C 1 122 ? 43.251  54.080  26.702  1.00 43.17  ? 122 ALA C CA  1 
ATOM   3226 C C   . ALA C 1 122 ? 41.882  54.087  27.309  1.00 45.05  ? 122 ALA C C   1 
ATOM   3227 O O   . ALA C 1 122 ? 40.951  54.570  26.702  1.00 45.24  ? 122 ALA C O   1 
ATOM   3228 C CB  . ALA C 1 122 ? 43.491  52.796  26.033  1.00 41.37  ? 122 ALA C CB  1 
ATOM   3229 N N   . CYS C 1 123 ? 41.755  53.534  28.511  1.00 47.52  ? 123 CYS C N   1 
ATOM   3230 C CA  . CYS C 1 123 ? 40.464  53.465  29.187  1.00 50.70  ? 123 CYS C CA  1 
ATOM   3231 C C   . CYS C 1 123 ? 39.972  54.855  29.575  1.00 55.46  ? 123 CYS C C   1 
ATOM   3232 O O   . CYS C 1 123 ? 38.780  55.150  29.495  1.00 56.69  ? 123 CYS C O   1 
ATOM   3233 C CB  . CYS C 1 123 ? 40.555  52.573  30.427  1.00 51.59  ? 123 CYS C CB  1 
ATOM   3234 S SG  . CYS C 1 123 ? 40.109  50.845  30.139  1.00 47.02  ? 123 CYS C SG  1 
ATOM   3235 N N   . GLN C 1 124 ? 40.904  55.702  29.997  1.00 59.17  ? 124 GLN C N   1 
ATOM   3236 C CA  . GLN C 1 124 ? 40.589  57.072  30.400  1.00 64.58  ? 124 GLN C CA  1 
ATOM   3237 C C   . GLN C 1 124 ? 40.065  57.887  29.236  1.00 64.35  ? 124 GLN C C   1 
ATOM   3238 O O   . GLN C 1 124 ? 39.201  58.722  29.424  1.00 68.52  ? 124 GLN C O   1 
ATOM   3239 C CB  . GLN C 1 124 ? 41.810  57.768  30.996  1.00 69.18  ? 124 GLN C CB  1 
ATOM   3240 N N   . LEU C 1 125 ? 40.602  57.658  28.043  1.00 60.80  ? 125 LEU C N   1 
ATOM   3241 C CA  . LEU C 1 125 ? 40.107  58.336  26.863  1.00 59.91  ? 125 LEU C CA  1 
ATOM   3242 C C   . LEU C 1 125 ? 38.774  57.807  26.410  1.00 60.30  ? 125 LEU C C   1 
ATOM   3243 O O   . LEU C 1 125 ? 37.923  58.573  26.016  1.00 62.33  ? 125 LEU C O   1 
ATOM   3244 C CB  . LEU C 1 125 ? 41.089  58.240  25.713  1.00 56.85  ? 125 LEU C CB  1 
ATOM   3245 C CG  . LEU C 1 125 ? 42.400  58.962  25.898  1.00 56.31  ? 125 LEU C CG  1 
ATOM   3246 C CD1 . LEU C 1 125 ? 42.902  59.404  24.579  1.00 52.99  ? 125 LEU C CD1 1 
ATOM   3247 C CD2 . LEU C 1 125 ? 42.152  60.150  26.750  1.00 62.33  ? 125 LEU C CD2 1 
ATOM   3248 N N   . ALA C 1 126 ? 38.577  56.501  26.419  1.00 60.16  ? 126 ALA C N   1 
ATOM   3249 C CA  . ALA C 1 126 ? 37.302  55.988  25.933  1.00 61.56  ? 126 ALA C CA  1 
ATOM   3250 C C   . ALA C 1 126 ? 36.206  56.625  26.755  1.00 67.25  ? 126 ALA C C   1 
ATOM   3251 O O   . ALA C 1 126 ? 35.192  57.065  26.223  1.00 66.64  ? 126 ALA C O   1 
ATOM   3252 C CB  . ALA C 1 126 ? 37.242  54.488  26.032  1.00 59.67  ? 126 ALA C CB  1 
ATOM   3253 N N   . GLN C 1 127 ? 36.424  56.631  28.069  1.00 73.64  ? 127 GLN C N   1 
ATOM   3254 C CA  . GLN C 1 127 ? 35.509  57.255  29.011  1.00 77.54  ? 127 GLN C CA  1 
ATOM   3255 C C   . GLN C 1 127 ? 34.232  56.446  29.109  1.00 78.57  ? 127 GLN C C   1 
ATOM   3256 O O   . GLN C 1 127 ? 33.808  56.021  30.183  1.00 84.89  ? 127 GLN C O   1 
ATOM   3257 C CB  . GLN C 1 127 ? 35.192  58.689  28.582  1.00 77.21  ? 127 GLN C CB  1 
ATOM   3258 N N   . PHE C 1 128 ? 33.628  56.260  27.945  1.00 74.08  ? 128 PHE C N   1 
ATOM   3259 C CA  . PHE C 1 128 ? 32.350  55.600  27.789  1.00 73.84  ? 128 PHE C CA  1 
ATOM   3260 C C   . PHE C 1 128 ? 32.362  54.108  28.213  1.00 71.49  ? 128 PHE C C   1 
ATOM   3261 O O   . PHE C 1 128 ? 33.143  53.330  27.708  1.00 70.05  ? 128 PHE C O   1 
ATOM   3262 C CB  . PHE C 1 128 ? 31.962  55.789  26.341  1.00 72.38  ? 128 PHE C CB  1 
ATOM   3263 C CG  . PHE C 1 128 ? 31.032  54.789  25.850  1.00 75.99  ? 128 PHE C CG  1 
ATOM   3264 C CD1 . PHE C 1 128 ? 31.278  54.146  24.655  1.00 78.35  ? 128 PHE C CD1 1 
ATOM   3265 C CD2 . PHE C 1 128 ? 29.902  54.467  26.583  1.00 83.05  ? 128 PHE C CD2 1 
ATOM   3266 C CE1 . PHE C 1 128 ? 30.412  53.197  24.187  1.00 81.40  ? 128 PHE C CE1 1 
ATOM   3267 C CE2 . PHE C 1 128 ? 29.030  53.519  26.139  1.00 86.89  ? 128 PHE C CE2 1 
ATOM   3268 C CZ  . PHE C 1 128 ? 29.282  52.880  24.930  1.00 86.39  ? 128 PHE C CZ  1 
ATOM   3269 N N   . LYS C 1 129 ? 31.555  53.763  29.201  1.00 72.54  ? 129 LYS C N   1 
ATOM   3270 C CA  . LYS C 1 129 ? 31.637  52.507  29.938  1.00 71.68  ? 129 LYS C CA  1 
ATOM   3271 C C   . LYS C 1 129 ? 31.756  51.214  29.156  1.00 66.52  ? 129 LYS C C   1 
ATOM   3272 O O   . LYS C 1 129 ? 32.554  50.358  29.462  1.00 63.82  ? 129 LYS C O   1 
ATOM   3273 C CB  . LYS C 1 129 ? 30.459  52.405  30.904  1.00 77.77  ? 129 LYS C CB  1 
ATOM   3274 C CG  . LYS C 1 129 ? 30.475  53.409  32.034  1.00 89.15  ? 129 LYS C CG  1 
ATOM   3275 C CD  . LYS C 1 129 ? 29.258  53.266  32.944  1.00 97.83  ? 129 LYS C CD  1 
ATOM   3276 C CE  . LYS C 1 129 ? 29.267  54.253  34.104  1.00 107.66 ? 129 LYS C CE  1 
ATOM   3277 N NZ  . LYS C 1 129 ? 28.057  54.116  34.972  1.00 111.22 ? 129 LYS C NZ  1 
ATOM   3278 N N   . GLU C 1 130 ? 30.915  51.059  28.163  1.00 63.77  ? 130 GLU C N   1 
ATOM   3279 C CA  A GLU C 1 130 ? 30.906  49.848  27.397  0.60 59.66  ? 130 GLU C CA  1 
ATOM   3280 C CA  B GLU C 1 130 ? 30.959  49.794  27.342  0.40 59.50  ? 130 GLU C CA  1 
ATOM   3281 C C   . GLU C 1 130 ? 32.251  49.663  26.728  1.00 53.38  ? 130 GLU C C   1 
ATOM   3282 O O   . GLU C 1 130 ? 32.708  48.569  26.606  1.00 51.52  ? 130 GLU C O   1 
ATOM   3283 C CB  A GLU C 1 130 ? 29.770  49.900  26.378  0.60 61.35  ? 130 GLU C CB  1 
ATOM   3284 C CB  B GLU C 1 130 ? 29.890  49.819  26.259  0.40 61.03  ? 130 GLU C CB  1 
ATOM   3285 C CG  A GLU C 1 130 ? 28.401  49.667  26.950  0.60 71.62  ? 130 GLU C CG  1 
ATOM   3286 C CG  B GLU C 1 130 ? 28.520  49.479  26.721  0.40 70.93  ? 130 GLU C CG  1 
ATOM   3287 C CD  A GLU C 1 130 ? 27.839  48.310  26.580  0.60 84.17  ? 130 GLU C CD  1 
ATOM   3288 C CD  B GLU C 1 130 ? 27.874  50.662  27.336  0.40 85.51  ? 130 GLU C CD  1 
ATOM   3289 O OE1 A GLU C 1 130 ? 28.128  47.322  27.273  0.60 88.00  ? 130 GLU C OE1 1 
ATOM   3290 O OE1 B GLU C 1 130 ? 28.584  51.641  27.602  0.40 89.71  ? 130 GLU C OE1 1 
ATOM   3291 O OE2 A GLU C 1 130 ? 27.094  48.217  25.592  0.60 89.95  ? 130 GLU C OE2 1 
ATOM   3292 O OE2 B GLU C 1 130 ? 26.652  50.632  27.541  0.40 92.55  ? 130 GLU C OE2 1 
ATOM   3293 N N   . MET C 1 131 ? 32.878  50.746  26.312  1.00 49.57  ? 131 MET C N   1 
ATOM   3294 C CA  . MET C 1 131 ? 34.145  50.700  25.615  1.00 44.61  ? 131 MET C CA  1 
ATOM   3295 C C   . MET C 1 131 ? 35.337  50.413  26.493  1.00 43.31  ? 131 MET C C   1 
ATOM   3296 O O   . MET C 1 131 ? 36.273  49.794  26.076  1.00 41.11  ? 131 MET C O   1 
ATOM   3297 C CB  . MET C 1 131 ? 34.351  51.996  24.851  1.00 43.47  ? 131 MET C CB  1 
ATOM   3298 C CG  . MET C 1 131 ? 35.526  52.001  23.925  1.00 40.78  ? 131 MET C CG  1 
ATOM   3299 S SD  . MET C 1 131 ? 35.457  50.811  22.634  1.00 39.19  ? 131 MET C SD  1 
ATOM   3300 C CE  . MET C 1 131 ? 34.165  51.508  21.679  1.00 48.06  ? 131 MET C CE  1 
ATOM   3301 N N   . LYS C 1 132 ? 35.299  50.901  27.708  1.00 44.51  ? 132 LYS C N   1 
ATOM   3302 C CA  . LYS C 1 132 ? 36.315  50.616  28.698  1.00 43.97  ? 132 LYS C CA  1 
ATOM   3303 C C   . LYS C 1 132 ? 36.299  49.148  29.016  1.00 41.32  ? 132 LYS C C   1 
ATOM   3304 O O   . LYS C 1 132 ? 37.345  48.529  29.103  1.00 41.08  ? 132 LYS C O   1 
ATOM   3305 C CB  . LYS C 1 132 ? 36.031  51.387  29.966  1.00 49.12  ? 132 LYS C CB  1 
ATOM   3306 C CG  . LYS C 1 132 ? 36.128  52.869  29.807  1.00 59.64  ? 132 LYS C CG  1 
ATOM   3307 C CD  . LYS C 1 132 ? 35.536  53.539  31.005  1.00 72.45  ? 132 LYS C CD  1 
ATOM   3308 C CE  . LYS C 1 132 ? 36.030  54.961  31.116  1.00 76.52  ? 132 LYS C CE  1 
ATOM   3309 N NZ  . LYS C 1 132 ? 35.638  55.498  32.461  1.00 85.28  ? 132 LYS C NZ  1 
ATOM   3310 N N   . ALA C 1 133 ? 35.107  48.597  29.198  1.00 39.00  ? 133 ALA C N   1 
ATOM   3311 C CA  . ALA C 1 133 ? 34.937  47.177  29.425  1.00 36.14  ? 133 ALA C CA  1 
ATOM   3312 C C   . ALA C 1 133 ? 35.561  46.365  28.310  1.00 31.90  ? 133 ALA C C   1 
ATOM   3313 O O   . ALA C 1 133 ? 36.417  45.553  28.555  1.00 31.47  ? 133 ALA C O   1 
ATOM   3314 C CB  . ALA C 1 133 ? 33.498  46.844  29.526  1.00 36.67  ? 133 ALA C CB  1 
ATOM   3315 N N   . ALA C 1 134 ? 35.155  46.615  27.083  1.00 27.18  ? 134 ALA C N   1 
ATOM   3316 C CA  . ALA C 1 134 ? 35.663  45.874  25.952  1.00 25.92  ? 134 ALA C CA  1 
ATOM   3317 C C   . ALA C 1 134 ? 37.175  45.865  25.902  1.00 25.15  ? 134 ALA C C   1 
ATOM   3318 O O   . ALA C 1 134 ? 37.786  44.848  25.567  1.00 24.48  ? 134 ALA C O   1 
ATOM   3319 C CB  . ALA C 1 134 ? 35.134  46.507  24.654  1.00 23.55  ? 134 ALA C CB  1 
ATOM   3320 N N   . LEU C 1 135 ? 37.762  47.036  26.170  1.00 25.63  ? 135 LEU C N   1 
ATOM   3321 C CA  . LEU C 1 135 ? 39.194  47.207  26.154  1.00 25.29  ? 135 LEU C CA  1 
ATOM   3322 C C   . LEU C 1 135 ? 39.837  46.390  27.258  1.00 27.47  ? 135 LEU C C   1 
ATOM   3323 O O   . LEU C 1 135 ? 40.827  45.714  27.024  1.00 27.38  ? 135 LEU C O   1 
ATOM   3324 C CB  . LEU C 1 135 ? 39.554  48.685  26.306  1.00 25.17  ? 135 LEU C CB  1 
ATOM   3325 C CG  . LEU C 1 135 ? 39.318  49.608  25.102  1.00 23.62  ? 135 LEU C CG  1 
ATOM   3326 C CD1 . LEU C 1 135 ? 39.636  51.049  25.453  1.00 21.60  ? 135 LEU C CD1 1 
ATOM   3327 C CD2 . LEU C 1 135 ? 40.117  49.174  23.871  1.00 16.41  ? 135 LEU C CD2 1 
ATOM   3328 N N   . GLN C 1 136 ? 39.267  46.457  28.453  1.00 30.51  ? 136 GLN C N   1 
ATOM   3329 C CA  . GLN C 1 136 ? 39.754  45.698  29.585  1.00 33.57  ? 136 GLN C CA  1 
ATOM   3330 C C   . GLN C 1 136 ? 39.675  44.209  29.353  1.00 33.02  ? 136 GLN C C   1 
ATOM   3331 O O   . GLN C 1 136 ? 40.612  43.478  29.647  1.00 33.10  ? 136 GLN C O   1 
ATOM   3332 C CB  . GLN C 1 136 ? 38.907  46.025  30.787  1.00 37.38  ? 136 GLN C CB  1 
ATOM   3333 C CG  . GLN C 1 136 ? 39.587  46.929  31.769  1.00 49.50  ? 136 GLN C CG  1 
ATOM   3334 C CD  . GLN C 1 136 ? 38.626  47.712  32.646  1.00 60.67  ? 136 GLN C CD  1 
ATOM   3335 O OE1 . GLN C 1 136 ? 37.604  47.189  33.101  1.00 67.34  ? 136 GLN C OE1 1 
ATOM   3336 N NE2 . GLN C 1 136 ? 38.956  48.978  32.891  1.00 61.91  ? 136 GLN C NE2 1 
ATOM   3337 N N   . GLU C 1 137 ? 38.549  43.754  28.832  1.00 31.98  ? 137 GLU C N   1 
ATOM   3338 C CA  . GLU C 1 137 ? 38.370  42.344  28.618  1.00 33.20  ? 137 GLU C CA  1 
ATOM   3339 C C   . GLU C 1 137 ? 39.279  41.860  27.502  1.00 31.74  ? 137 GLU C C   1 
ATOM   3340 O O   . GLU C 1 137 ? 39.824  40.763  27.589  1.00 32.41  ? 137 GLU C O   1 
ATOM   3341 C CB  . GLU C 1 137 ? 36.901  41.959  28.379  1.00 34.05  ? 137 GLU C CB  1 
ATOM   3342 C CG  . GLU C 1 137 ? 35.987  43.119  28.473  1.00 38.74  ? 137 GLU C CG  1 
ATOM   3343 C CD  . GLU C 1 137 ? 34.627  42.856  29.045  1.00 43.94  ? 137 GLU C CD  1 
ATOM   3344 O OE1 . GLU C 1 137 ? 33.699  42.614  28.257  1.00 46.46  ? 137 GLU C OE1 1 
ATOM   3345 O OE2 . GLU C 1 137 ? 34.462  43.014  30.272  1.00 49.09  ? 137 GLU C OE2 1 
ATOM   3346 N N   . GLY C 1 138 ? 39.460  42.663  26.458  1.00 30.08  ? 138 GLY C N   1 
ATOM   3347 C CA  . GLY C 1 138 ? 40.397  42.313  25.398  1.00 29.68  ? 138 GLY C CA  1 
ATOM   3348 C C   . GLY C 1 138 ? 41.820  42.145  25.927  1.00 31.43  ? 138 GLY C C   1 
ATOM   3349 O O   . GLY C 1 138 ? 42.552  41.219  25.578  1.00 30.33  ? 138 GLY C O   1 
ATOM   3350 N N   . HIS C 1 139 ? 42.224  43.066  26.770  1.00 33.08  ? 139 HIS C N   1 
ATOM   3351 C CA  . HIS C 1 139 ? 43.510  42.975  27.364  1.00 36.47  ? 139 HIS C CA  1 
ATOM   3352 C C   . HIS C 1 139 ? 43.619  41.637  28.095  1.00 38.99  ? 139 HIS C C   1 
ATOM   3353 O O   . HIS C 1 139 ? 44.566  40.855  27.904  1.00 38.90  ? 139 HIS C O   1 
ATOM   3354 C CB  . HIS C 1 139 ? 43.664  44.131  28.341  1.00 38.05  ? 139 HIS C CB  1 
ATOM   3355 C CG  . HIS C 1 139 ? 45.041  44.261  28.891  1.00 42.34  ? 139 HIS C CG  1 
ATOM   3356 N ND1 . HIS C 1 139 ? 45.400  43.753  30.119  1.00 48.07  ? 139 HIS C ND1 1 
ATOM   3357 C CD2 . HIS C 1 139 ? 46.157  44.810  28.366  1.00 42.58  ? 139 HIS C CD2 1 
ATOM   3358 C CE1 . HIS C 1 139 ? 46.680  43.991  30.330  1.00 49.37  ? 139 HIS C CE1 1 
ATOM   3359 N NE2 . HIS C 1 139 ? 47.162  44.631  29.280  1.00 46.16  ? 139 HIS C NE2 1 
ATOM   3360 N N   . GLN C 1 140 ? 42.621  41.371  28.929  1.00 41.49  ? 140 GLN C N   1 
ATOM   3361 C CA  . GLN C 1 140 ? 42.643  40.186  29.759  1.00 44.34  ? 140 GLN C CA  1 
ATOM   3362 C C   . GLN C 1 140 ? 42.756  38.960  28.894  1.00 42.49  ? 140 GLN C C   1 
ATOM   3363 O O   . GLN C 1 140 ? 43.493  38.049  29.198  1.00 44.02  ? 140 GLN C O   1 
ATOM   3364 C CB  . GLN C 1 140 ? 41.382  40.134  30.594  1.00 47.06  ? 140 GLN C CB  1 
ATOM   3365 C CG  . GLN C 1 140 ? 41.592  39.599  31.986  1.00 57.09  ? 140 GLN C CG  1 
ATOM   3366 C CD  . GLN C 1 140 ? 40.336  39.033  32.557  1.00 67.04  ? 140 GLN C CD  1 
ATOM   3367 O OE1 . GLN C 1 140 ? 39.245  39.367  32.125  1.00 68.97  ? 140 GLN C OE1 1 
ATOM   3368 N NE2 . GLN C 1 140 ? 40.478  38.162  33.522  1.00 75.32  ? 140 GLN C NE2 1 
ATOM   3369 N N   . PHE C 1 141 ? 42.026  38.966  27.792  1.00 40.22  ? 141 PHE C N   1 
ATOM   3370 C CA  . PHE C 1 141 ? 42.032  37.861  26.855  1.00 39.68  ? 141 PHE C CA  1 
ATOM   3371 C C   . PHE C 1 141 ? 43.433  37.548  26.346  1.00 39.71  ? 141 PHE C C   1 
ATOM   3372 O O   . PHE C 1 141 ? 43.897  36.411  26.437  1.00 40.24  ? 141 PHE C O   1 
ATOM   3373 C CB  . PHE C 1 141 ? 41.093  38.168  25.692  1.00 37.82  ? 141 PHE C CB  1 
ATOM   3374 C CG  . PHE C 1 141 ? 41.005  37.069  24.681  1.00 37.36  ? 141 PHE C CG  1 
ATOM   3375 C CD1 . PHE C 1 141 ? 41.680  37.163  23.493  1.00 35.69  ? 141 PHE C CD1 1 
ATOM   3376 C CD2 . PHE C 1 141 ? 40.270  35.938  24.933  1.00 41.23  ? 141 PHE C CD2 1 
ATOM   3377 C CE1 . PHE C 1 141 ? 41.618  36.186  22.584  1.00 37.90  ? 141 PHE C CE1 1 
ATOM   3378 C CE2 . PHE C 1 141 ? 40.215  34.936  24.017  1.00 43.53  ? 141 PHE C CE2 1 
ATOM   3379 C CZ  . PHE C 1 141 ? 40.892  35.061  22.843  1.00 41.33  ? 141 PHE C CZ  1 
ATOM   3380 N N   . LEU C 1 142 ? 44.096  38.577  25.825  1.00 38.91  ? 142 LEU C N   1 
ATOM   3381 C CA  . LEU C 1 142 ? 45.467  38.477  25.369  1.00 38.97  ? 142 LEU C CA  1 
ATOM   3382 C C   . LEU C 1 142 ? 46.455  37.958  26.412  1.00 42.05  ? 142 LEU C C   1 
ATOM   3383 O O   . LEU C 1 142 ? 47.300  37.121  26.124  1.00 41.70  ? 142 LEU C O   1 
ATOM   3384 C CB  . LEU C 1 142 ? 45.919  39.832  24.865  1.00 36.43  ? 142 LEU C CB  1 
ATOM   3385 C CG  . LEU C 1 142 ? 45.236  40.316  23.600  1.00 32.45  ? 142 LEU C CG  1 
ATOM   3386 C CD1 . LEU C 1 142 ? 45.637  41.747  23.330  1.00 25.04  ? 142 LEU C CD1 1 
ATOM   3387 C CD2 . LEU C 1 142 ? 45.580  39.417  22.440  1.00 28.82  ? 142 LEU C CD2 1 
ATOM   3388 N N   . CYS C 1 143 ? 46.352  38.464  27.620  1.00 45.47  ? 143 CYS C N   1 
ATOM   3389 C CA  . CYS C 1 143 ? 47.265  38.034  28.657  1.00 51.47  ? 143 CYS C CA  1 
ATOM   3390 C C   . CYS C 1 143 ? 47.193  36.548  28.933  1.00 55.22  ? 143 CYS C C   1 
ATOM   3391 O O   . CYS C 1 143 ? 48.217  35.893  29.095  1.00 59.82  ? 143 CYS C O   1 
ATOM   3392 C CB  . CYS C 1 143 ? 47.004  38.809  29.927  1.00 51.49  ? 143 CYS C CB  1 
ATOM   3393 S SG  . CYS C 1 143 ? 47.554  40.446  29.737  1.00 54.50  ? 143 CYS C SG  1 
ATOM   3394 N N   . SER C 1 144 ? 45.974  36.029  28.996  1.00 57.18  ? 144 SER C N   1 
ATOM   3395 C CA  . SER C 1 144 ? 45.746  34.633  29.289  1.00 60.38  ? 144 SER C CA  1 
ATOM   3396 C C   . SER C 1 144 ? 46.141  33.756  28.118  1.00 60.93  ? 144 SER C C   1 
ATOM   3397 O O   . SER C 1 144 ? 46.747  32.731  28.298  1.00 63.30  ? 144 SER C O   1 
ATOM   3398 C CB  . SER C 1 144 ? 44.298  34.410  29.740  1.00 60.72  ? 144 SER C CB  1 
ATOM   3399 O OG  . SER C 1 144 ? 43.496  33.928  28.681  1.00 63.08  ? 144 SER C OG  1 
ATOM   3400 N N   . ILE C 1 145 ? 45.836  34.153  26.903  1.00 60.79  ? 145 ILE C N   1 
ATOM   3401 C CA  . ILE C 1 145 ? 46.263  33.304  25.812  1.00 63.08  ? 145 ILE C CA  1 
ATOM   3402 C C   . ILE C 1 145 ? 47.769  33.360  25.618  1.00 65.44  ? 145 ILE C C   1 
ATOM   3403 O O   . ILE C 1 145 ? 48.346  32.420  25.116  1.00 67.53  ? 145 ILE C O   1 
ATOM   3404 C CB  . ILE C 1 145 ? 45.507  33.549  24.484  1.00 61.54  ? 145 ILE C CB  1 
ATOM   3405 C CG1 . ILE C 1 145 ? 45.839  34.914  23.905  1.00 59.75  ? 145 ILE C CG1 1 
ATOM   3406 C CG2 . ILE C 1 145 ? 44.021  33.433  24.673  1.00 60.63  ? 145 ILE C CG2 1 
ATOM   3407 C CD1 . ILE C 1 145 ? 46.774  34.832  22.728  1.00 61.06  ? 145 ILE C CD1 1 
ATOM   3408 N N   . GLU C 1 146 ? 48.397  34.451  26.040  1.00 66.91  ? 146 GLU C N   1 
ATOM   3409 C CA  . GLU C 1 146 ? 49.843  34.603  25.922  1.00 70.40  ? 146 GLU C CA  1 
ATOM   3410 C C   . GLU C 1 146 ? 50.607  33.822  26.977  1.00 75.38  ? 146 GLU C C   1 
ATOM   3411 O O   . GLU C 1 146 ? 51.784  33.538  26.805  1.00 78.12  ? 146 GLU C O   1 
ATOM   3412 C CB  . GLU C 1 146 ? 50.242  36.073  25.968  1.00 68.91  ? 146 GLU C CB  1 
ATOM   3413 N N   . ALA C 1 147 ? 49.939  33.483  28.068  1.00 78.02  ? 147 ALA C N   1 
ATOM   3414 C CA  . ALA C 1 147 ? 50.508  32.588  29.050  1.00 82.40  ? 147 ALA C CA  1 
ATOM   3415 C C   . ALA C 1 147 ? 50.325  31.136  28.587  1.00 87.67  ? 147 ALA C C   1 
ATOM   3416 O O   . ALA C 1 147 ? 49.325  30.733  27.991  1.00 88.13  ? 147 ALA C O   1 
ATOM   3417 C CB  . ALA C 1 147 ? 49.886  32.816  30.405  1.00 82.52  ? 147 ALA C CB  1 
ATOM   3418 N N   . ARG D 1 4   ? 12.053  13.229  3.624   1.00 65.65  ? 4   ARG D N   1 
ATOM   3419 C CA  . ARG D 1 4   ? 11.095  12.085  3.619   1.00 65.18  ? 4   ARG D CA  1 
ATOM   3420 C C   . ARG D 1 4   ? 9.747   12.412  4.265   1.00 59.98  ? 4   ARG D C   1 
ATOM   3421 O O   . ARG D 1 4   ? 9.666   12.650  5.465   1.00 61.32  ? 4   ARG D O   1 
ATOM   3422 C CB  . ARG D 1 4   ? 11.719  10.874  4.302   1.00 70.48  ? 4   ARG D CB  1 
ATOM   3423 C CG  . ARG D 1 4   ? 10.721  9.826   4.729   1.00 73.92  ? 4   ARG D CG  1 
ATOM   3424 C CD  . ARG D 1 4   ? 10.490  8.829   3.642   1.00 75.13  ? 4   ARG D CD  1 
ATOM   3425 N NE  . ARG D 1 4   ? 10.483  7.470   4.161   1.00 81.54  ? 4   ARG D NE  1 
ATOM   3426 C CZ  . ARG D 1 4   ? 11.029  6.435   3.530   1.00 87.99  ? 4   ARG D CZ  1 
ATOM   3427 N NH1 . ARG D 1 4   ? 11.637  6.600   2.357   1.00 88.06  ? 4   ARG D NH1 1 
ATOM   3428 N NH2 . ARG D 1 4   ? 10.974  5.230   4.075   1.00 93.35  ? 4   ARG D NH2 1 
ATOM   3429 N N   . ALA D 1 5   ? 8.699   12.395  3.448   1.00 53.80  ? 5   ALA D N   1 
ATOM   3430 C CA  . ALA D 1 5   ? 7.360   12.730  3.881   1.00 50.11  ? 5   ALA D CA  1 
ATOM   3431 C C   . ALA D 1 5   ? 6.328   11.692  3.427   1.00 47.41  ? 5   ALA D C   1 
ATOM   3432 O O   . ALA D 1 5   ? 6.523   11.014  2.426   1.00 45.54  ? 5   ALA D O   1 
ATOM   3433 C CB  . ALA D 1 5   ? 7.001   14.107  3.380   1.00 48.41  ? 5   ALA D CB  1 
ATOM   3434 N N   . CYS D 1 6   ? 5.232   11.575  4.169   1.00 46.04  ? 6   CYS D N   1 
ATOM   3435 C CA  . CYS D 1 6   ? 4.188   10.629  3.831   1.00 44.26  ? 6   CYS D CA  1 
ATOM   3436 C C   . CYS D 1 6   ? 2.839   11.269  3.836   1.00 42.27  ? 6   CYS D C   1 
ATOM   3437 O O   . CYS D 1 6   ? 2.578   12.149  4.619   1.00 43.64  ? 6   CYS D O   1 
ATOM   3438 C CB  . CYS D 1 6   ? 4.209   9.466   4.786   1.00 46.38  ? 6   CYS D CB  1 
ATOM   3439 S SG  . CYS D 1 6   ? 5.768   8.636   4.714   1.00 51.16  ? 6   CYS D SG  1 
ATOM   3440 N N   . GLY D 1 7   ? 1.981   10.824  2.932   1.00 39.71  ? 7   GLY D N   1 
ATOM   3441 C CA  . GLY D 1 7   ? 0.656   11.376  2.800   1.00 36.06  ? 7   GLY D CA  1 
ATOM   3442 C C   . GLY D 1 7   ? -0.295  10.323  2.293   1.00 35.47  ? 7   GLY D C   1 
ATOM   3443 O O   . GLY D 1 7   ? 0.097   9.167   2.084   1.00 36.32  ? 7   GLY D O   1 
ATOM   3444 N N   . LEU D 1 8   ? -1.551  10.714  2.102   1.00 32.47  ? 8   LEU D N   1 
ATOM   3445 C CA  . LEU D 1 8   ? -2.531  9.797   1.601   1.00 31.01  ? 8   LEU D CA  1 
ATOM   3446 C C   . LEU D 1 8   ? -3.241  10.524  0.515   1.00 29.32  ? 8   LEU D C   1 
ATOM   3447 O O   . LEU D 1 8   ? -3.657  11.654  0.708   1.00 29.53  ? 8   LEU D O   1 
ATOM   3448 C CB  . LEU D 1 8   ? -3.544  9.425   2.670   1.00 31.63  ? 8   LEU D CB  1 
ATOM   3449 C CG  . LEU D 1 8   ? -3.065  8.580   3.865   1.00 36.52  ? 8   LEU D CG  1 
ATOM   3450 C CD1 . LEU D 1 8   ? -4.204  8.376   4.884   1.00 37.87  ? 8   LEU D CD1 1 
ATOM   3451 C CD2 . LEU D 1 8   ? -2.436  7.234   3.463   1.00 32.88  ? 8   LEU D CD2 1 
ATOM   3452 N N   . ILE D 1 9   ? -3.385  9.897   -0.644  1.00 27.03  ? 9   ILE D N   1 
ATOM   3453 C CA  . ILE D 1 9   ? -4.200  10.496  -1.650  1.00 24.32  ? 9   ILE D CA  1 
ATOM   3454 C C   . ILE D 1 9   ? -5.600  10.146  -1.271  1.00 25.41  ? 9   ILE D C   1 
ATOM   3455 O O   . ILE D 1 9   ? -6.051  9.025   -1.516  1.00 26.15  ? 9   ILE D O   1 
ATOM   3456 C CB  . ILE D 1 9   ? -3.931  9.914   -3.021  1.00 24.20  ? 9   ILE D CB  1 
ATOM   3457 C CG1 . ILE D 1 9   ? -2.551  10.335  -3.484  1.00 22.98  ? 9   ILE D CG1 1 
ATOM   3458 C CG2 . ILE D 1 9   ? -4.937  10.437  -4.037  1.00 20.75  ? 9   ILE D CG2 1 
ATOM   3459 C CD1 . ILE D 1 9   ? -2.018  9.502   -4.584  1.00 20.28  ? 9   ILE D CD1 1 
ATOM   3460 N N   . ILE D 1 10  ? -6.277  11.107  -0.657  1.00 25.69  ? 10  ILE D N   1 
ATOM   3461 C CA  . ILE D 1 10  ? -7.675  10.982  -0.260  1.00 25.97  ? 10  ILE D CA  1 
ATOM   3462 C C   . ILE D 1 10  ? -8.622  11.028  -1.436  1.00 26.38  ? 10  ILE D C   1 
ATOM   3463 O O   . ILE D 1 10  ? -8.509  11.866  -2.320  1.00 25.43  ? 10  ILE D O   1 
ATOM   3464 C CB  . ILE D 1 10  ? -8.009  12.079  0.691   1.00 26.26  ? 10  ILE D CB  1 
ATOM   3465 C CG1 . ILE D 1 10  ? -6.911  12.174  1.762   1.00 27.95  ? 10  ILE D CG1 1 
ATOM   3466 C CG2 . ILE D 1 10  ? -9.249  11.776  1.381   1.00 27.64  ? 10  ILE D CG2 1 
ATOM   3467 C CD1 . ILE D 1 10  ? -7.050  11.139  2.821   1.00 31.49  ? 10  ILE D CD1 1 
ATOM   3468 N N   . PHE D 1 11  ? -9.553  10.101  -1.458  1.00 28.03  ? 11  PHE D N   1 
ATOM   3469 C CA  . PHE D 1 11  ? -10.544 10.136  -2.501  1.00 32.02  ? 11  PHE D CA  1 
ATOM   3470 C C   . PHE D 1 11  ? -11.938 9.831   -1.977  1.00 34.82  ? 11  PHE D C   1 
ATOM   3471 O O   . PHE D 1 11  ? -12.092 9.247   -0.894  1.00 35.93  ? 11  PHE D O   1 
ATOM   3472 C CB  . PHE D 1 11  ? -10.168 9.203   -3.653  1.00 31.24  ? 11  PHE D CB  1 
ATOM   3473 C CG  . PHE D 1 11  ? -10.405 7.773   -3.368  1.00 32.89  ? 11  PHE D CG  1 
ATOM   3474 C CD1 . PHE D 1 11  ? -11.611 7.186   -3.676  1.00 34.92  ? 11  PHE D CD1 1 
ATOM   3475 C CD2 . PHE D 1 11  ? -9.407  6.996   -2.817  1.00 34.79  ? 11  PHE D CD2 1 
ATOM   3476 C CE1 . PHE D 1 11  ? -11.822 5.856   -3.415  1.00 36.86  ? 11  PHE D CE1 1 
ATOM   3477 C CE2 . PHE D 1 11  ? -9.608  5.658   -2.539  1.00 35.10  ? 11  PHE D CE2 1 
ATOM   3478 C CZ  . PHE D 1 11  ? -10.806 5.090   -2.837  1.00 38.15  ? 11  PHE D CZ  1 
ATOM   3479 N N   . ARG D 1 12  ? -12.944 10.237  -2.743  1.00 36.87  ? 12  ARG D N   1 
ATOM   3480 C CA  . ARG D 1 12  ? -14.282 9.793   -2.458  1.00 40.51  ? 12  ARG D CA  1 
ATOM   3481 C C   . ARG D 1 12  ? -14.915 9.274   -3.725  1.00 43.48  ? 12  ARG D C   1 
ATOM   3482 O O   . ARG D 1 12  ? -14.546 9.675   -4.814  1.00 43.77  ? 12  ARG D O   1 
ATOM   3483 C CB  . ARG D 1 12  ? -15.100 10.882  -1.784  1.00 40.25  ? 12  ARG D CB  1 
ATOM   3484 C CG  . ARG D 1 12  ? -15.383 12.052  -2.611  1.00 40.63  ? 12  ARG D CG  1 
ATOM   3485 C CD  . ARG D 1 12  ? -15.998 13.134  -1.804  1.00 40.83  ? 12  ARG D CD  1 
ATOM   3486 N NE  . ARG D 1 12  ? -16.296 14.270  -2.662  1.00 42.06  ? 12  ARG D NE  1 
ATOM   3487 C CZ  . ARG D 1 12  ? -16.969 15.336  -2.280  1.00 41.54  ? 12  ARG D CZ  1 
ATOM   3488 N NH1 . ARG D 1 12  ? -17.414 15.419  -1.048  1.00 40.73  ? 12  ARG D NH1 1 
ATOM   3489 N NH2 . ARG D 1 12  ? -17.186 16.305  -3.135  1.00 41.59  ? 12  ARG D NH2 1 
ATOM   3490 N N   . ARG D 1 13  ? -15.871 8.364   -3.568  1.00 47.83  ? 13  ARG D N   1 
ATOM   3491 C CA  . ARG D 1 13  ? -16.573 7.779   -4.701  1.00 52.19  ? 13  ARG D CA  1 
ATOM   3492 C C   . ARG D 1 13  ? -17.955 8.400   -4.751  1.00 55.92  ? 13  ARG D C   1 
ATOM   3493 O O   . ARG D 1 13  ? -18.670 8.425   -3.749  1.00 56.39  ? 13  ARG D O   1 
ATOM   3494 C CB  . ARG D 1 13  ? -16.677 6.262   -4.547  1.00 52.81  ? 13  ARG D CB  1 
ATOM   3495 C CG  . ARG D 1 13  ? -15.608 5.486   -5.299  1.00 53.17  ? 13  ARG D CG  1 
ATOM   3496 C CD  . ARG D 1 13  ? -15.787 3.987   -5.122  1.00 55.52  ? 13  ARG D CD  1 
ATOM   3497 N NE  . ARG D 1 13  ? -14.539 3.259   -5.330  0.73 57.56  ? 13  ARG D NE  1 
ATOM   3498 C CZ  . ARG D 1 13  ? -14.095 2.860   -6.518  0.00 50.82  ? 13  ARG D CZ  1 
ATOM   3499 N NH1 . ARG D 1 13  ? -14.799 3.119   -7.611  1.00 65.67  ? 13  ARG D NH1 1 
ATOM   3500 N NH2 . ARG D 1 13  ? -12.948 2.203   -6.612  1.00 59.27  ? 13  ARG D NH2 1 
ATOM   3501 N N   . CYS D 1 14  ? -18.327 8.919   -5.915  1.00 61.59  ? 14  CYS D N   1 
ATOM   3502 C CA  . CYS D 1 14  ? -19.579 9.637   -6.036  1.00 65.79  ? 14  CYS D CA  1 
ATOM   3503 C C   . CYS D 1 14  ? -20.589 8.722   -6.672  1.00 69.57  ? 14  CYS D C   1 
ATOM   3504 O O   . CYS D 1 14  ? -20.493 8.359   -7.832  1.00 71.49  ? 14  CYS D O   1 
ATOM   3505 C CB  . CYS D 1 14  ? -19.390 10.896  -6.870  1.00 66.03  ? 14  CYS D CB  1 
ATOM   3506 S SG  . CYS D 1 14  ? -17.857 11.827  -6.548  1.00 68.10  ? 14  CYS D SG  1 
ATOM   3507 N N   . LEU D 1 15  ? -21.559 8.335   -5.874  1.00 69.96  ? 15  LEU D N   1 
ATOM   3508 C CA  . LEU D 1 15  ? -22.438 7.252   -6.236  1.00 75.72  ? 15  LEU D CA  1 
ATOM   3509 C C   . LEU D 1 15  ? -23.787 7.661   -6.777  1.00 84.69  ? 15  LEU D C   1 
ATOM   3510 O O   . LEU D 1 15  ? -24.671 6.827   -6.861  1.00 88.24  ? 15  LEU D O   1 
ATOM   3511 C CB  . LEU D 1 15  ? -22.613 6.307   -5.044  1.00 74.34  ? 15  LEU D CB  1 
ATOM   3512 C CG  . LEU D 1 15  ? -21.290 5.676   -4.621  1.00 71.50  ? 15  LEU D CG  1 
ATOM   3513 C CD1 . LEU D 1 15  ? -21.432 4.978   -3.281  1.00 70.97  ? 15  LEU D CD1 1 
ATOM   3514 C CD2 . LEU D 1 15  ? -20.731 4.748   -5.706  1.00 68.64  ? 15  LEU D CD2 1 
ATOM   3515 N N   . ILE D 1 16  ? -23.959 8.922   -7.148  1.00 91.92  ? 16  ILE D N   1 
ATOM   3516 C CA  . ILE D 1 16  ? -25.237 9.352   -7.710  1.00 99.72  ? 16  ILE D CA  1 
ATOM   3517 C C   . ILE D 1 16  ? -25.122 9.729   -9.207  1.00 108.45 ? 16  ILE D C   1 
ATOM   3518 O O   . ILE D 1 16  ? -24.454 10.707  -9.571  1.00 104.16 ? 16  ILE D O   1 
ATOM   3519 C CB  . ILE D 1 16  ? -25.880 10.450  -6.853  1.00 97.61  ? 16  ILE D CB  1 
ATOM   3520 C CG1 . ILE D 1 16  ? -26.218 9.875   -5.476  1.00 93.78  ? 16  ILE D CG1 1 
ATOM   3521 C CG2 . ILE D 1 16  ? -27.133 10.994  -7.523  1.00 98.30  ? 16  ILE D CG2 1 
ATOM   3522 C CD1 . ILE D 1 16  ? -25.945 10.809  -4.322  1.00 84.68  ? 16  ILE D CD1 1 
ATOM   3523 N N   . PRO D 1 17  ? -25.759 8.926   -10.077 1.00 120.05 ? 17  PRO D N   1 
ATOM   3524 C CA  . PRO D 1 17  ? -25.603 9.080   -11.527 1.00 127.55 ? 17  PRO D CA  1 
ATOM   3525 C C   . PRO D 1 17  ? -26.269 10.340  -12.088 1.00 132.92 ? 17  PRO D C   1 
ATOM   3526 O O   . PRO D 1 17  ? -27.318 10.763  -11.600 1.00 134.02 ? 17  PRO D O   1 
ATOM   3527 C CB  . PRO D 1 17  ? -26.278 7.810   -12.090 0.61 130.75 ? 17  PRO D CB  1 
ATOM   3528 C CG  . PRO D 1 17  ? -26.557 6.923   -10.879 1.00 127.93 ? 17  PRO D CG  1 
ATOM   3529 C CD  . PRO D 1 17  ? -26.725 7.863   -9.748  0.22 122.72 ? 17  PRO D CD  1 
ATOM   3530 N N   . LYS D 1 18  ? -25.650 10.946  -13.098 1.00 135.62 ? 18  LYS D N   1 
ATOM   3531 C CA  . LYS D 1 18  ? -26.209 12.132  -13.750 1.00 137.49 ? 18  LYS D CA  1 
ATOM   3532 C C   . LYS D 1 18  ? -26.075 13.407  -12.913 1.00 133.69 ? 18  LYS D C   1 
ATOM   3533 O O   . LYS D 1 18  ? -26.406 14.500  -13.371 1.00 136.76 ? 18  LYS D O   1 
ATOM   3534 C CB  . LYS D 1 18  ? -27.678 11.898  -14.113 1.00 142.95 ? 18  LYS D CB  1 
ATOM   3535 N N   . VAL D 1 19  ? -25.590 13.254  -11.686 1.00 124.53 ? 19  VAL D N   1 
ATOM   3536 C CA  . VAL D 1 19  ? -25.409 14.375  -10.752 1.00 115.51 ? 19  VAL D CA  1 
ATOM   3537 C C   . VAL D 1 19  ? -23.869 14.434  -10.625 1.00 104.42 ? 19  VAL D C   1 
ATOM   3538 O O   . VAL D 1 19  ? -23.276 15.523  -10.694 1.00 100.38 ? 19  VAL D O   1 
ATOM   3539 C CB  . VAL D 1 19  ? -26.036 14.126  -9.335  1.00 116.59 ? 19  VAL D CB  1 
ATOM   3540 C CG1 . VAL D 1 19  ? -25.248 14.837  -8.240  1.00 114.25 ? 19  VAL D CG1 1 
ATOM   3541 C CG2 . VAL D 1 19  ? -27.483 14.551  -9.331  1.00 120.85 ? 19  VAL D CG2 1 
ATOM   3542 N N   . ASP D 1 20  ? -23.228 13.278  -10.443 1.00 96.87  ? 20  ASP D N   1 
ATOM   3543 C CA  . ASP D 1 20  ? -21.773 13.220  -10.256 1.00 90.42  ? 20  ASP D CA  1 
ATOM   3544 C C   . ASP D 1 20  ? -21.061 12.900  -11.553 1.00 90.71  ? 20  ASP D C   1 
ATOM   3545 O O   . ASP D 1 20  ? -20.968 11.735  -11.940 1.00 92.89  ? 20  ASP D O   1 
ATOM   3546 C CB  . ASP D 1 20  ? -21.409 12.158  -9.221  1.00 86.75  ? 20  ASP D CB  1 
ATOM   3547 C CG  . ASP D 1 20  ? -21.794 12.550  -7.819  1.00 86.99  ? 20  ASP D CG  1 
ATOM   3548 O OD1 . ASP D 1 20  ? -22.083 13.752  -7.585  1.00 84.98  ? 20  ASP D OD1 1 
ATOM   3549 O OD2 . ASP D 1 20  ? -21.806 11.643  -6.957  1.00 87.52  ? 20  ASP D OD2 1 
ATOM   3550 N N   . ASN D 1 21  ? -20.559 13.934  -12.219 1.00 89.02  ? 21  ASN D N   1 
ATOM   3551 C CA  . ASN D 1 21  ? -19.804 13.756  -13.449 1.00 90.39  ? 21  ASN D CA  1 
ATOM   3552 C C   . ASN D 1 21  ? -18.594 12.849  -13.248 1.00 84.24  ? 21  ASN D C   1 
ATOM   3553 O O   . ASN D 1 21  ? -18.262 12.034  -14.110 1.00 86.54  ? 21  ASN D O   1 
ATOM   3554 C CB  . ASN D 1 21  ? -19.400 15.104  -14.035 1.00 97.39  ? 21  ASN D CB  1 
ATOM   3555 C CG  . ASN D 1 21  ? -20.540 15.773  -14.771 1.00 112.88 ? 21  ASN D CG  1 
ATOM   3556 O OD1 . ASN D 1 21  ? -20.800 15.478  -15.937 1.00 124.39 ? 21  ASN D OD1 1 
ATOM   3557 N ND2 . ASN D 1 21  ? -21.233 16.676  -14.093 1.00 121.57 ? 21  ASN D ND2 1 
ATOM   3558 N N   . ASN D 1 22  ? -17.960 12.982  -12.087 1.00 77.85  ? 22  ASN D N   1 
ATOM   3559 C CA  . ASN D 1 22  ? -16.779 12.214  -11.746 1.00 69.93  ? 22  ASN D CA  1 
ATOM   3560 C C   . ASN D 1 22  ? -17.165 11.059  -10.830 1.00 66.26  ? 22  ASN D C   1 
ATOM   3561 O O   . ASN D 1 22  ? -17.772 11.269  -9.790  1.00 67.27  ? 22  ASN D O   1 
ATOM   3562 C CB  . ASN D 1 22  ? -15.748 13.116  -11.054 1.00 67.78  ? 22  ASN D CB  1 
ATOM   3563 C CG  . ASN D 1 22  ? -15.348 14.335  -11.898 1.00 71.28  ? 22  ASN D CG  1 
ATOM   3564 O OD1 . ASN D 1 22  ? -14.614 14.221  -12.878 1.00 72.17  ? 22  ASN D OD1 1 
ATOM   3565 N ND2 . ASN D 1 22  ? -15.814 15.511  -11.493 1.00 72.63  ? 22  ASN D ND2 1 
ATOM   3566 N N   . ALA D 1 23  ? -16.831 9.833   -11.213 1.00 61.61  ? 23  ALA D N   1 
ATOM   3567 C CA  . ALA D 1 23  ? -17.065 8.711   -10.331 1.00 57.09  ? 23  ALA D CA  1 
ATOM   3568 C C   . ALA D 1 23  ? -16.146 8.864   -9.136  1.00 52.64  ? 23  ALA D C   1 
ATOM   3569 O O   . ALA D 1 23  ? -16.495 8.494   -8.020  1.00 52.15  ? 23  ALA D O   1 
ATOM   3570 C CB  . ALA D 1 23  ? -16.821 7.434   -11.032 1.00 58.07  ? 23  ALA D CB  1 
ATOM   3571 N N   . ILE D 1 24  ? -14.978 9.444   -9.371  1.00 47.88  ? 24  ILE D N   1 
ATOM   3572 C CA  . ILE D 1 24  ? -14.016 9.634   -8.312  1.00 43.22  ? 24  ILE D CA  1 
ATOM   3573 C C   . ILE D 1 24  ? -13.505 11.070  -8.182  1.00 41.71  ? 24  ILE D C   1 
ATOM   3574 O O   . ILE D 1 24  ? -13.133 11.701  -9.159  1.00 43.61  ? 24  ILE D O   1 
ATOM   3575 C CB  . ILE D 1 24  ? -12.872 8.640   -8.479  1.00 42.47  ? 24  ILE D CB  1 
ATOM   3576 C CG1 . ILE D 1 24  ? -13.432 7.221   -8.345  1.00 41.83  ? 24  ILE D CG1 1 
ATOM   3577 C CG2 . ILE D 1 24  ? -11.772 8.924   -7.478  1.00 38.17  ? 24  ILE D CG2 1 
ATOM   3578 C CD1 . ILE D 1 24  ? -12.453 6.110   -8.516  1.00 40.94  ? 24  ILE D CD1 1 
ATOM   3579 N N   . GLU D 1 25  ? -13.496 11.579  -6.960  1.00 38.95  ? 25  GLU D N   1 
ATOM   3580 C CA  . GLU D 1 25  ? -12.991 12.910  -6.675  1.00 37.27  ? 25  GLU D CA  1 
ATOM   3581 C C   . GLU D 1 25  ? -11.907 12.797  -5.638  1.00 34.50  ? 25  GLU D C   1 
ATOM   3582 O O   . GLU D 1 25  ? -12.026 11.980  -4.723  1.00 32.91  ? 25  GLU D O   1 
ATOM   3583 C CB  . GLU D 1 25  ? -14.089 13.799  -6.125  1.00 38.42  ? 25  GLU D CB  1 
ATOM   3584 C CG  . GLU D 1 25  ? -15.098 14.232  -7.133  1.00 43.64  ? 25  GLU D CG  1 
ATOM   3585 C CD  . GLU D 1 25  ? -16.027 15.260  -6.575  1.00 50.75  ? 25  GLU D CD  1 
ATOM   3586 O OE1 . GLU D 1 25  ? -16.410 15.129  -5.405  1.00 56.66  ? 25  GLU D OE1 1 
ATOM   3587 O OE2 . GLU D 1 25  ? -16.368 16.222  -7.275  1.00 53.40  ? 25  GLU D OE2 1 
ATOM   3588 N N   . PHE D 1 26  ? -10.866 13.626  -5.795  1.00 32.70  ? 26  PHE D N   1 
ATOM   3589 C CA  . PHE D 1 26  ? -9.703  13.694  -4.897  1.00 31.87  ? 26  PHE D CA  1 
ATOM   3590 C C   . PHE D 1 26  ? -9.737  14.919  -4.040  1.00 31.96  ? 26  PHE D C   1 
ATOM   3591 O O   . PHE D 1 26  ? -10.363 15.865  -4.400  1.00 33.54  ? 26  PHE D O   1 
ATOM   3592 C CB  . PHE D 1 26  ? -8.423  13.717  -5.700  1.00 31.22  ? 26  PHE D CB  1 
ATOM   3593 C CG  . PHE D 1 26  ? -8.201  12.471  -6.467  1.00 32.93  ? 26  PHE D CG  1 
ATOM   3594 C CD1 . PHE D 1 26  ? -7.872  11.306  -5.815  1.00 33.01  ? 26  PHE D CD1 1 
ATOM   3595 C CD2 . PHE D 1 26  ? -8.372  12.434  -7.834  1.00 34.96  ? 26  PHE D CD2 1 
ATOM   3596 C CE1 . PHE D 1 26  ? -7.672  10.150  -6.509  1.00 32.93  ? 26  PHE D CE1 1 
ATOM   3597 C CE2 . PHE D 1 26  ? -8.165  11.277  -8.522  1.00 34.62  ? 26  PHE D CE2 1 
ATOM   3598 C CZ  . PHE D 1 26  ? -7.822  10.135  -7.858  1.00 33.60  ? 26  PHE D CZ  1 
ATOM   3599 N N   . LEU D 1 27  ? -9.093  14.898  -2.885  1.00 31.34  ? 27  LEU D N   1 
ATOM   3600 C CA  . LEU D 1 27  ? -9.039  16.077  -2.064  1.00 31.71  ? 27  LEU D CA  1 
ATOM   3601 C C   . LEU D 1 27  ? -7.676  16.751  -2.148  1.00 32.71  ? 27  LEU D C   1 
ATOM   3602 O O   . LEU D 1 27  ? -6.672  16.119  -1.890  1.00 34.40  ? 27  LEU D O   1 
ATOM   3603 C CB  . LEU D 1 27  ? -9.330  15.703  -0.630  1.00 31.92  ? 27  LEU D CB  1 
ATOM   3604 C CG  . LEU D 1 27  ? -9.135  16.801  0.430   1.00 31.94  ? 27  LEU D CG  1 
ATOM   3605 C CD1 . LEU D 1 27  ? -10.202 17.867  0.355   1.00 31.04  ? 27  LEU D CD1 1 
ATOM   3606 C CD2 . LEU D 1 27  ? -9.142  16.158  1.756   1.00 27.48  ? 27  LEU D CD2 1 
ATOM   3607 N N   . LEU D 1 28  ? -7.625  18.031  -2.502  1.00 34.21  ? 28  LEU D N   1 
ATOM   3608 C CA  . LEU D 1 28  ? -6.345  18.758  -2.523  1.00 34.34  ? 28  LEU D CA  1 
ATOM   3609 C C   . LEU D 1 28  ? -6.370  19.971  -1.622  1.00 37.30  ? 28  LEU D C   1 
ATOM   3610 O O   . LEU D 1 28  ? -7.354  20.681  -1.552  1.00 39.12  ? 28  LEU D O   1 
ATOM   3611 C CB  . LEU D 1 28  ? -5.985  19.185  -3.926  1.00 33.51  ? 28  LEU D CB  1 
ATOM   3612 C CG  . LEU D 1 28  ? -5.753  18.079  -4.949  1.00 30.82  ? 28  LEU D CG  1 
ATOM   3613 C CD1 . LEU D 1 28  ? -5.248  18.642  -6.250  1.00 29.12  ? 28  LEU D CD1 1 
ATOM   3614 C CD2 . LEU D 1 28  ? -4.762  17.164  -4.401  1.00 25.58  ? 28  LEU D CD2 1 
ATOM   3615 N N   . LEU D 1 29  ? -5.293  20.201  -0.905  1.00 39.35  ? 29  LEU D N   1 
ATOM   3616 C CA  . LEU D 1 29  ? -5.239  21.359  -0.019  1.00 43.12  ? 29  LEU D CA  1 
ATOM   3617 C C   . LEU D 1 29  ? -4.293  22.358  -0.637  1.00 46.40  ? 29  LEU D C   1 
ATOM   3618 O O   . LEU D 1 29  ? -3.371  21.980  -1.348  1.00 45.45  ? 29  LEU D O   1 
ATOM   3619 C CB  . LEU D 1 29  ? -4.725  20.981  1.359   1.00 41.59  ? 29  LEU D CB  1 
ATOM   3620 C CG  . LEU D 1 29  ? -5.234  19.706  2.004   1.00 40.30  ? 29  LEU D CG  1 
ATOM   3621 C CD1 . LEU D 1 29  ? -4.456  19.462  3.284   1.00 38.34  ? 29  LEU D CD1 1 
ATOM   3622 C CD2 . LEU D 1 29  ? -6.744  19.721  2.250   1.00 36.70  ? 29  LEU D CD2 1 
ATOM   3623 N N   . GLN D 1 30  ? -4.528  23.630  -0.374  1.00 51.83  ? 30  GLN D N   1 
ATOM   3624 C CA  . GLN D 1 30  ? -3.665  24.691  -0.886  1.00 57.11  ? 30  GLN D CA  1 
ATOM   3625 C C   . GLN D 1 30  ? -2.814  25.233  0.236   1.00 60.86  ? 30  GLN D C   1 
ATOM   3626 O O   . GLN D 1 30  ? -3.335  25.554  1.290   1.00 63.68  ? 30  GLN D O   1 
ATOM   3627 C CB  . GLN D 1 30  ? -4.494  25.824  -1.460  1.00 58.23  ? 30  GLN D CB  1 
ATOM   3628 C CG  . GLN D 1 30  ? -3.751  26.604  -2.461  1.00 60.69  ? 30  GLN D CG  1 
ATOM   3629 C CD  . GLN D 1 30  ? -4.506  27.807  -2.913  1.00 65.77  ? 30  GLN D CD  1 
ATOM   3630 O OE1 . GLN D 1 30  ? -5.569  28.109  -2.398  1.00 69.48  ? 30  GLN D OE1 1 
ATOM   3631 N NE2 . GLN D 1 30  ? -3.956  28.517  -3.876  1.00 67.56  ? 30  GLN D NE2 1 
ATOM   3632 N N   . ALA D 1 31  ? -1.509  25.332  0.012   1.00 64.62  ? 31  ALA D N   1 
ATOM   3633 C CA  . ALA D 1 31  ? -0.607  25.805  1.050   1.00 69.79  ? 31  ALA D CA  1 
ATOM   3634 C C   . ALA D 1 31  ? -0.755  27.300  1.284   1.00 75.52  ? 31  ALA D C   1 
ATOM   3635 O O   . ALA D 1 31  ? -0.812  28.069  0.339   1.00 76.47  ? 31  ALA D O   1 
ATOM   3636 C CB  . ALA D 1 31  ? 0.815   25.445  0.706   1.00 68.39  ? 31  ALA D CB  1 
ATOM   3637 N N   . SER D 1 32  ? -0.840  27.708  2.548   1.00 82.09  ? 32  SER D N   1 
ATOM   3638 C CA  . SER D 1 32  ? -0.902  29.131  2.879   1.00 90.56  ? 32  SER D CA  1 
ATOM   3639 C C   . SER D 1 32  ? 0.439   29.787  2.608   1.00 96.90  ? 32  SER D C   1 
ATOM   3640 O O   . SER D 1 32  ? 0.511   30.780  1.887   1.00 98.01  ? 32  SER D O   1 
ATOM   3641 C CB  . SER D 1 32  ? -1.337  29.346  4.323   1.00 90.88  ? 32  SER D CB  1 
ATOM   3642 O OG  . SER D 1 32  ? -0.655  28.477  5.194   1.00 89.39  ? 32  SER D OG  1 
ATOM   3643 N N   . ASP D 1 33  ? 1.497   29.204  3.175   1.00 110.47 ? 33  ASP D N   1 
ATOM   3644 C CA  . ASP D 1 33  ? 2.879   29.617  2.924   1.00 119.90 ? 33  ASP D CA  1 
ATOM   3645 C C   . ASP D 1 33  ? 3.235   29.309  1.483   1.00 119.26 ? 33  ASP D C   1 
ATOM   3646 O O   . ASP D 1 33  ? 3.273   28.146  1.100   1.00 114.94 ? 33  ASP D O   1 
ATOM   3647 C CB  . ASP D 1 33  ? 3.839   28.845  3.838   1.00 123.65 ? 33  ASP D CB  1 
ATOM   3648 C CG  . ASP D 1 33  ? 3.847   29.358  5.272   1.00 132.47 ? 33  ASP D CG  1 
ATOM   3649 O OD1 . ASP D 1 33  ? 2.764   29.549  5.867   1.00 132.42 ? 33  ASP D OD1 1 
ATOM   3650 O OD2 . ASP D 1 33  ? 4.955   29.551  5.814   1.00 140.82 ? 33  ASP D OD2 1 
ATOM   3651 N N   . GLY D 1 34  ? 3.447   30.386  0.731   1.00 126.38 ? 34  GLY D N   1 
ATOM   3652 C CA  . GLY D 1 34  ? 3.823   30.418  -0.672  1.00 130.16 ? 34  GLY D CA  1 
ATOM   3653 C C   . GLY D 1 34  ? 2.634   30.647  -1.588  1.00 130.80 ? 34  GLY D C   1 
ATOM   3654 O O   . GLY D 1 34  ? 2.772   31.225  -2.666  1.00 133.57 ? 34  GLY D O   1 
ATOM   3655 N N   . ILE D 1 35  ? 1.459   30.213  -1.146  1.00 128.48 ? 35  ILE D N   1 
ATOM   3656 C CA  . ILE D 1 35  ? 0.201   30.475  -1.841  1.00 124.54 ? 35  ILE D CA  1 
ATOM   3657 C C   . ILE D 1 35  ? 0.129   29.846  -3.232  1.00 120.65 ? 35  ILE D C   1 
ATOM   3658 O O   . ILE D 1 35  ? -0.750  30.189  -4.023  1.00 120.29 ? 35  ILE D O   1 
ATOM   3659 C CB  . ILE D 1 35  ? -0.067  31.988  -1.965  1.00 118.05 ? 35  ILE D CB  1 
ATOM   3660 C CG1 . ILE D 1 35  ? -1.570  32.268  -1.924  1.00 116.14 ? 35  ILE D CG1 1 
ATOM   3661 C CG2 . ILE D 1 35  ? 0.548   32.535  -3.244  1.00 119.90 ? 35  ILE D CG2 1 
ATOM   3662 C CD1 . ILE D 1 35  ? -1.989  33.474  -2.738  1.00 118.20 ? 35  ILE D CD1 1 
ATOM   3663 N N   . HIS D 1 36  ? 1.050   28.940  -3.539  1.00 118.11 ? 36  HIS D N   1 
ATOM   3664 C CA  . HIS D 1 36  ? 1.084   28.332  -4.869  1.00 114.48 ? 36  HIS D CA  1 
ATOM   3665 C C   . HIS D 1 36  ? 1.045   26.808  -4.908  1.00 105.54 ? 36  HIS D C   1 
ATOM   3666 O O   . HIS D 1 36  ? 1.278   26.215  -5.961  1.00 105.54 ? 36  HIS D O   1 
ATOM   3667 C CB  . HIS D 1 36  ? 2.305   28.835  -5.646  1.00 121.81 ? 36  HIS D CB  1 
ATOM   3668 C CG  . HIS D 1 36  ? 3.603   28.636  -4.927  1.00 127.33 ? 36  HIS D CG  1 
ATOM   3669 N ND1 . HIS D 1 36  ? 3.674   28.148  -3.640  1.00 127.64 ? 36  HIS D ND1 1 
ATOM   3670 C CD2 . HIS D 1 36  ? 4.881   28.860  -5.316  1.00 133.39 ? 36  HIS D CD2 1 
ATOM   3671 C CE1 . HIS D 1 36  ? 4.940   28.079  -3.267  1.00 131.37 ? 36  HIS D CE1 1 
ATOM   3672 N NE2 . HIS D 1 36  ? 5.692   28.505  -4.265  1.00 137.22 ? 36  HIS D NE2 1 
ATOM   3673 N N   . HIS D 1 37  ? 0.775   26.166  -3.778  1.00 95.37  ? 37  HIS D N   1 
ATOM   3674 C CA  . HIS D 1 37  ? 0.820   24.709  -3.757  1.00 84.00  ? 37  HIS D CA  1 
ATOM   3675 C C   . HIS D 1 37  ? -0.466  23.957  -3.425  1.00 74.40  ? 37  HIS D C   1 
ATOM   3676 O O   . HIS D 1 37  ? -1.130  24.225  -2.423  1.00 73.09  ? 37  HIS D O   1 
ATOM   3677 C CB  . HIS D 1 37  ? 1.939   24.236  -2.821  1.00 85.15  ? 37  HIS D CB  1 
ATOM   3678 N N   . TRP D 1 38  ? -0.785  22.994  -4.284  1.00 63.47  ? 38  TRP D N   1 
ATOM   3679 C CA  . TRP D 1 38  ? -1.886  22.068  -4.078  1.00 54.51  ? 38  TRP D CA  1 
ATOM   3680 C C   . TRP D 1 38  ? -1.389  20.639  -4.003  1.00 49.88  ? 38  TRP D C   1 
ATOM   3681 O O   . TRP D 1 38  ? -0.737  20.162  -4.912  1.00 49.13  ? 38  TRP D O   1 
ATOM   3682 C CB  . TRP D 1 38  ? -2.843  22.140  -5.248  1.00 53.81  ? 38  TRP D CB  1 
ATOM   3683 C CG  . TRP D 1 38  ? -3.682  23.347  -5.306  1.00 52.89  ? 38  TRP D CG  1 
ATOM   3684 C CD1 . TRP D 1 38  ? -3.436  24.477  -6.025  1.00 54.33  ? 38  TRP D CD1 1 
ATOM   3685 C CD2 . TRP D 1 38  ? -4.934  23.548  -4.656  1.00 50.06  ? 38  TRP D CD2 1 
ATOM   3686 N NE1 . TRP D 1 38  ? -4.456  25.372  -5.863  1.00 54.21  ? 38  TRP D NE1 1 
ATOM   3687 C CE2 . TRP D 1 38  ? -5.391  24.827  -5.023  1.00 52.28  ? 38  TRP D CE2 1 
ATOM   3688 C CE3 . TRP D 1 38  ? -5.716  22.773  -3.808  1.00 45.92  ? 38  TRP D CE3 1 
ATOM   3689 C CZ2 . TRP D 1 38  ? -6.595  25.347  -4.559  1.00 50.48  ? 38  TRP D CZ2 1 
ATOM   3690 C CZ3 . TRP D 1 38  ? -6.893  23.292  -3.348  1.00 45.94  ? 38  TRP D CZ3 1 
ATOM   3691 C CH2 . TRP D 1 38  ? -7.323  24.564  -3.720  1.00 47.70  ? 38  TRP D CH2 1 
ATOM   3692 N N   . THR D 1 39  ? -1.724  19.950  -2.922  1.00 44.82  ? 39  THR D N   1 
ATOM   3693 C CA  . THR D 1 39  ? -1.352  18.551  -2.755  1.00 40.56  ? 39  THR D CA  1 
ATOM   3694 C C   . THR D 1 39  ? -2.301  17.870  -1.796  1.00 37.28  ? 39  THR D C   1 
ATOM   3695 O O   . THR D 1 39  ? -3.000  18.531  -1.019  1.00 37.53  ? 39  THR D O   1 
ATOM   3696 C CB  . THR D 1 39  ? 0.050   18.406  -2.156  1.00 41.57  ? 39  THR D CB  1 
ATOM   3697 O OG1 . THR D 1 39  ? -0.020  18.551  -0.725  1.00 41.56  ? 39  THR D OG1 1 
ATOM   3698 C CG2 . THR D 1 39  ? 0.968   19.448  -2.725  1.00 41.87  ? 39  THR D CG2 1 
ATOM   3699 N N   . PRO D 1 40  ? -2.302  16.540  -1.820  1.00 34.11  ? 40  PRO D N   1 
ATOM   3700 C CA  . PRO D 1 40  ? -3.030  15.729  -0.854  1.00 32.31  ? 40  PRO D CA  1 
ATOM   3701 C C   . PRO D 1 40  ? -2.355  15.976  0.495   1.00 32.12  ? 40  PRO D C   1 
ATOM   3702 O O   . PRO D 1 40  ? -1.291  16.570  0.521   1.00 32.44  ? 40  PRO D O   1 
ATOM   3703 C CB  . PRO D 1 40  ? -2.744  14.305  -1.326  1.00 32.11  ? 40  PRO D CB  1 
ATOM   3704 C CG  . PRO D 1 40  ? -2.211  14.413  -2.658  1.00 31.84  ? 40  PRO D CG  1 
ATOM   3705 C CD  . PRO D 1 40  ? -1.601  15.723  -2.816  1.00 33.99  ? 40  PRO D CD  1 
ATOM   3706 N N   . PRO D 1 41  ? -2.949  15.556  1.604   1.00 31.89  ? 41  PRO D N   1 
ATOM   3707 C CA  . PRO D 1 41  ? -2.267  15.770  2.862   1.00 33.29  ? 41  PRO D CA  1 
ATOM   3708 C C   . PRO D 1 41  ? -0.978  14.947  2.961   1.00 34.27  ? 41  PRO D C   1 
ATOM   3709 O O   . PRO D 1 41  ? -0.965  13.767  2.629   1.00 34.92  ? 41  PRO D O   1 
ATOM   3710 C CB  . PRO D 1 41  ? -3.293  15.279  3.894   1.00 33.47  ? 41  PRO D CB  1 
ATOM   3711 C CG  . PRO D 1 41  ? -4.391  14.724  3.139   1.00 32.12  ? 41  PRO D CG  1 
ATOM   3712 C CD  . PRO D 1 41  ? -4.373  15.316  1.815   1.00 31.86  ? 41  PRO D CD  1 
ATOM   3713 N N   . LYS D 1 42  ? 0.100   15.566  3.404   1.00 35.98  ? 42  LYS D N   1 
ATOM   3714 C CA  . LYS D 1 42  ? 1.335   14.852  3.566   1.00 37.34  ? 42  LYS D CA  1 
ATOM   3715 C C   . LYS D 1 42  ? 2.209   15.534  4.600   1.00 40.14  ? 42  LYS D C   1 
ATOM   3716 O O   . LYS D 1 42  ? 2.038   16.698  4.914   1.00 41.36  ? 42  LYS D O   1 
ATOM   3717 C CB  . LYS D 1 42  ? 2.050   14.754  2.226   1.00 37.11  ? 42  LYS D CB  1 
ATOM   3718 C CG  . LYS D 1 42  ? 3.071   15.783  2.043   1.00 38.79  ? 42  LYS D CG  1 
ATOM   3719 C CD  . LYS D 1 42  ? 3.252   16.086  0.629   1.00 41.98  ? 42  LYS D CD  1 
ATOM   3720 C CE  . LYS D 1 42  ? 3.664   17.523  0.458   1.00 46.17  ? 42  LYS D CE  1 
ATOM   3721 N NZ  . LYS D 1 42  ? 2.475   18.304  0.039   1.00 46.94  ? 42  LYS D NZ  1 
ATOM   3722 N N   . GLY D 1 43  ? 3.159   14.806  5.137   1.00 42.08  ? 43  GLY D N   1 
ATOM   3723 C CA  . GLY D 1 43  ? 3.971   15.372  6.189   1.00 46.99  ? 43  GLY D CA  1 
ATOM   3724 C C   . GLY D 1 43  ? 5.257   14.648  6.453   1.00 50.06  ? 43  GLY D C   1 
ATOM   3725 O O   . GLY D 1 43  ? 5.471   13.529  6.012   1.00 48.17  ? 43  GLY D O   1 
ATOM   3726 N N   . HIS D 1 44  ? 6.119   15.332  7.175   1.00 55.75  ? 44  HIS D N   1 
ATOM   3727 C CA  . HIS D 1 44  ? 7.430   14.843  7.597   1.00 61.88  ? 44  HIS D CA  1 
ATOM   3728 C C   . HIS D 1 44  ? 7.308   13.654  8.556   1.00 58.68  ? 44  HIS D C   1 
ATOM   3729 O O   . HIS D 1 44  ? 6.531   13.676  9.492   1.00 58.71  ? 44  HIS D O   1 
ATOM   3730 C CB  . HIS D 1 44  ? 8.130   16.033  8.260   1.00 72.47  ? 44  HIS D CB  1 
ATOM   3731 C CG  . HIS D 1 44  ? 7.192   17.191  8.508   1.00 85.79  ? 44  HIS D CG  1 
ATOM   3732 N ND1 . HIS D 1 44  ? 6.519   17.358  9.719   1.00 94.52  ? 44  HIS D ND1 1 
ATOM   3733 C CD2 . HIS D 1 44  ? 6.756   18.187  7.675   1.00 91.54  ? 44  HIS D CD2 1 
ATOM   3734 C CE1 . HIS D 1 44  ? 5.738   18.425  9.630   1.00 97.24  ? 44  HIS D CE1 1 
ATOM   3735 N NE2 . HIS D 1 44  ? 5.864   18.946  8.402   1.00 95.65  ? 44  HIS D NE2 1 
ATOM   3736 N N   . VAL D 1 45  ? 8.067   12.607  8.297   1.00 57.49  ? 45  VAL D N   1 
ATOM   3737 C CA  . VAL D 1 45  ? 8.049   11.420  9.138   1.00 57.52  ? 45  VAL D CA  1 
ATOM   3738 C C   . VAL D 1 45  ? 8.743   11.692  10.458  1.00 62.53  ? 45  VAL D C   1 
ATOM   3739 O O   . VAL D 1 45  ? 9.860   12.156  10.474  1.00 65.24  ? 45  VAL D O   1 
ATOM   3740 C CB  . VAL D 1 45  ? 8.770   10.258  8.448   1.00 55.43  ? 45  VAL D CB  1 
ATOM   3741 C CG1 . VAL D 1 45  ? 8.694   9.034   9.281   1.00 55.02  ? 45  VAL D CG1 1 
ATOM   3742 C CG2 . VAL D 1 45  ? 8.149   9.980   7.126   1.00 50.97  ? 45  VAL D CG2 1 
ATOM   3743 N N   . GLU D 1 46  ? 8.077   11.403  11.567  1.00 65.92  ? 46  GLU D N   1 
ATOM   3744 C CA  . GLU D 1 46  ? 8.668   11.593  12.884  1.00 72.09  ? 46  GLU D CA  1 
ATOM   3745 C C   . GLU D 1 46  ? 9.450   10.363  13.369  1.00 75.69  ? 46  GLU D C   1 
ATOM   3746 O O   . GLU D 1 46  ? 9.280   9.286   12.809  1.00 73.20  ? 46  GLU D O   1 
ATOM   3747 C CB  . GLU D 1 46  ? 7.605   12.070  13.854  1.00 74.98  ? 46  GLU D CB  1 
ATOM   3748 C CG  . GLU D 1 46  ? 7.398   13.572  13.743  1.00 82.80  ? 46  GLU D CG  1 
ATOM   3749 C CD  . GLU D 1 46  ? 6.148   14.080  14.445  1.00 93.30  ? 46  GLU D CD  1 
ATOM   3750 O OE1 . GLU D 1 46  ? 5.632   13.405  15.358  1.00 101.71 ? 46  GLU D OE1 1 
ATOM   3751 O OE2 . GLU D 1 46  ? 5.677   15.176  14.083  1.00 94.23  ? 46  GLU D OE2 1 
ATOM   3752 N N   . PRO D 1 47  ? 10.319  10.516  14.394  1.00 85.02  ? 47  PRO D N   1 
ATOM   3753 C CA  . PRO D 1 47  ? 11.344  9.514   14.758  1.00 88.66  ? 47  PRO D CA  1 
ATOM   3754 C C   . PRO D 1 47  ? 10.946  8.039   14.906  1.00 84.49  ? 47  PRO D C   1 
ATOM   3755 O O   . PRO D 1 47  ? 11.636  7.186   14.355  1.00 84.82  ? 47  PRO D O   1 
ATOM   3756 C CB  . PRO D 1 47  ? 11.914  10.044  16.089  1.00 95.35  ? 47  PRO D CB  1 
ATOM   3757 C CG  . PRO D 1 47  ? 11.037  11.157  16.496  1.00 97.97  ? 47  PRO D CG  1 
ATOM   3758 C CD  . PRO D 1 47  ? 10.439  11.708  15.247  1.00 91.99  ? 47  PRO D CD  1 
ATOM   3759 N N   . GLY D 1 48  ? 9.875   7.738   15.628  1.00 80.49  ? 48  GLY D N   1 
ATOM   3760 C CA  . GLY D 1 48  ? 9.501   6.347   15.880  1.00 80.51  ? 48  GLY D CA  1 
ATOM   3761 C C   . GLY D 1 48  ? 8.237   5.875   15.183  1.00 74.67  ? 48  GLY D C   1 
ATOM   3762 O O   . GLY D 1 48  ? 7.430   5.141   15.765  1.00 78.90  ? 48  GLY D O   1 
ATOM   3763 N N   . GLU D 1 49  ? 8.092   6.276   13.924  1.00 66.15  ? 49  GLU D N   1 
ATOM   3764 C CA  . GLU D 1 49  ? 6.864   6.139   13.194  1.00 61.03  ? 49  GLU D CA  1 
ATOM   3765 C C   . GLU D 1 49  ? 7.018   5.337   11.946  1.00 56.52  ? 49  GLU D C   1 
ATOM   3766 O O   . GLU D 1 49  ? 7.957   5.503   11.204  1.00 56.95  ? 49  GLU D O   1 
ATOM   3767 C CB  . GLU D 1 49  ? 6.372   7.515   12.785  1.00 60.81  ? 49  GLU D CB  1 
ATOM   3768 C CG  . GLU D 1 49  ? 5.122   7.984   13.481  1.00 65.40  ? 49  GLU D CG  1 
ATOM   3769 C CD  . GLU D 1 49  ? 4.661   9.345   13.002  1.00 65.44  ? 49  GLU D CD  1 
ATOM   3770 O OE1 . GLU D 1 49  ? 5.312   9.904   12.100  1.00 65.32  ? 49  GLU D OE1 1 
ATOM   3771 O OE2 . GLU D 1 49  ? 3.655   9.853   13.533  1.00 65.37  ? 49  GLU D OE2 1 
ATOM   3772 N N   . ASP D 1 50  ? 6.047   4.482   11.711  1.00 52.86  ? 50  ASP D N   1 
ATOM   3773 C CA  . ASP D 1 50  ? 5.867   3.838   10.451  1.00 48.92  ? 50  ASP D CA  1 
ATOM   3774 C C   . ASP D 1 50  ? 5.414   4.884   9.424   1.00 45.57  ? 50  ASP D C   1 
ATOM   3775 O O   . ASP D 1 50  ? 4.689   5.828   9.746   1.00 43.29  ? 50  ASP D O   1 
ATOM   3776 C CB  . ASP D 1 50  ? 4.782   2.797   10.626  1.00 49.85  ? 50  ASP D CB  1 
ATOM   3777 C CG  . ASP D 1 50  ? 4.863   1.720   9.625   1.00 51.47  ? 50  ASP D CG  1 
ATOM   3778 O OD1 . ASP D 1 50  ? 4.206   1.836   8.585   1.00 51.46  ? 50  ASP D OD1 1 
ATOM   3779 O OD2 . ASP D 1 50  ? 5.582   0.751   9.879   1.00 54.18  ? 50  ASP D OD2 1 
ATOM   3780 N N   . ASP D 1 51  ? 5.840   4.705   8.182   1.00 42.76  ? 51  ASP D N   1 
ATOM   3781 C CA  . ASP D 1 51  ? 5.515   5.646   7.116   1.00 40.28  ? 51  ASP D CA  1 
ATOM   3782 C C   . ASP D 1 51  ? 4.005   5.801   6.966   1.00 39.54  ? 51  ASP D C   1 
ATOM   3783 O O   . ASP D 1 51  ? 3.509   6.915   6.795   1.00 38.84  ? 51  ASP D O   1 
ATOM   3784 C CB  . ASP D 1 51  ? 6.144   5.202   5.798   1.00 39.55  ? 51  ASP D CB  1 
ATOM   3785 C CG  . ASP D 1 51  ? 7.631   5.474   5.751   1.00 41.28  ? 51  ASP D CG  1 
ATOM   3786 O OD1 . ASP D 1 51  ? 8.352   4.933   4.880   1.00 41.49  ? 51  ASP D OD1 1 
ATOM   3787 O OD2 . ASP D 1 51  ? 8.087   6.243   6.608   1.00 43.42  ? 51  ASP D OD2 1 
ATOM   3788 N N   . LEU D 1 52  ? 3.287   4.681   7.042   1.00 39.05  ? 52  LEU D N   1 
ATOM   3789 C CA  . LEU D 1 52  ? 1.847   4.675   6.971   1.00 38.51  ? 52  LEU D CA  1 
ATOM   3790 C C   . LEU D 1 52  ? 1.211   5.365   8.193   1.00 39.70  ? 52  LEU D C   1 
ATOM   3791 O O   . LEU D 1 52  ? 0.262   6.136   8.077   1.00 39.64  ? 52  LEU D O   1 
ATOM   3792 C CB  . LEU D 1 52  ? 1.363   3.253   6.805   1.00 39.51  ? 52  LEU D CB  1 
ATOM   3793 C CG  . LEU D 1 52  ? 0.024   3.043   6.122   1.00 38.65  ? 52  LEU D CG  1 
ATOM   3794 C CD1 . LEU D 1 52  ? -0.230  4.042   5.030   1.00 34.26  ? 52  LEU D CD1 1 
ATOM   3795 C CD2 . LEU D 1 52  ? 0.059   1.679   5.557   1.00 41.59  ? 52  LEU D CD2 1 
ATOM   3796 N N   . GLU D 1 53  ? 1.765   5.144   9.365   1.00 40.80  ? 53  GLU D N   1 
ATOM   3797 C CA  . GLU D 1 53  ? 1.318   5.925   10.488  1.00 42.93  ? 53  GLU D CA  1 
ATOM   3798 C C   . GLU D 1 53  ? 1.518   7.422   10.229  1.00 41.44  ? 53  GLU D C   1 
ATOM   3799 O O   . GLU D 1 53  ? 0.706   8.231   10.633  1.00 43.63  ? 53  GLU D O   1 
ATOM   3800 C CB  . GLU D 1 53  ? 2.015   5.489   11.778  1.00 45.61  ? 53  GLU D CB  1 
ATOM   3801 C CG  . GLU D 1 53  ? 1.601   4.123   12.312  1.00 49.37  ? 53  GLU D CG  1 
ATOM   3802 C CD  . GLU D 1 53  ? 2.578   3.587   13.343  1.00 54.04  ? 53  GLU D CD  1 
ATOM   3803 O OE1 . GLU D 1 53  ? 2.168   3.309   14.466  1.00 59.48  ? 53  GLU D OE1 1 
ATOM   3804 O OE2 . GLU D 1 53  ? 3.770   3.444   13.038  1.00 55.77  ? 53  GLU D OE2 1 
ATOM   3805 N N   . THR D 1 54  ? 2.600   7.793   9.567   1.00 39.07  ? 54  THR D N   1 
ATOM   3806 C CA  . THR D 1 54  ? 2.854   9.188   9.339   1.00 38.71  ? 54  THR D CA  1 
ATOM   3807 C C   . THR D 1 54  ? 1.769   9.726   8.446   1.00 37.55  ? 54  THR D C   1 
ATOM   3808 O O   . THR D 1 54  ? 1.166   10.764  8.692   1.00 38.55  ? 54  THR D O   1 
ATOM   3809 C CB  . THR D 1 54  ? 4.179   9.388   8.646   1.00 37.69  ? 54  THR D CB  1 
ATOM   3810 O OG1 . THR D 1 54  ? 5.213   8.895   9.486   1.00 41.64  ? 54  THR D OG1 1 
ATOM   3811 C CG2 . THR D 1 54  ? 4.433   10.846  8.398   1.00 37.33  ? 54  THR D CG2 1 
ATOM   3812 N N   . ALA D 1 55  ? 1.525   8.993   7.390   1.00 35.61  ? 55  ALA D N   1 
ATOM   3813 C CA  . ALA D 1 55  ? 0.552   9.398   6.447   1.00 34.82  ? 55  ALA D CA  1 
ATOM   3814 C C   . ALA D 1 55  ? -0.778  9.644   7.155   1.00 37.22  ? 55  ALA D C   1 
ATOM   3815 O O   . ALA D 1 55  ? -1.503  10.608  6.818   1.00 36.05  ? 55  ALA D O   1 
ATOM   3816 C CB  . ALA D 1 55  ? 0.399   8.332   5.417   1.00 33.72  ? 55  ALA D CB  1 
ATOM   3817 N N   . LEU D 1 56  ? -1.106  8.767   8.115   1.00 37.65  ? 56  LEU D N   1 
ATOM   3818 C CA  . LEU D 1 56  ? -2.386  8.827   8.787   1.00 39.15  ? 56  LEU D CA  1 
ATOM   3819 C C   . LEU D 1 56  ? -2.488  9.979   9.756   1.00 42.08  ? 56  LEU D C   1 
ATOM   3820 O O   . LEU D 1 56  ? -3.496  10.690  9.789   1.00 43.84  ? 56  LEU D O   1 
ATOM   3821 C CB  . LEU D 1 56  ? -2.688  7.506   9.474   1.00 40.26  ? 56  LEU D CB  1 
ATOM   3822 C CG  . LEU D 1 56  ? -3.271  6.416   8.560   1.00 38.85  ? 56  LEU D CG  1 
ATOM   3823 C CD1 . LEU D 1 56  ? -3.127  5.103   9.224   1.00 36.46  ? 56  LEU D CD1 1 
ATOM   3824 C CD2 . LEU D 1 56  ? -4.714  6.691   8.195   1.00 35.38  ? 56  LEU D CD2 1 
ATOM   3825 N N   . ARG D 1 57  ? -1.447  10.172  10.544  1.00 44.27  ? 57  ARG D N   1 
ATOM   3826 C CA  . ARG D 1 57  ? -1.437  11.230  11.553  1.00 48.56  ? 57  ARG D CA  1 
ATOM   3827 C C   . ARG D 1 57  ? -1.493  12.598  10.901  1.00 47.94  ? 57  ARG D C   1 
ATOM   3828 O O   . ARG D 1 57  ? -2.206  13.511  11.316  1.00 50.12  ? 57  ARG D O   1 
ATOM   3829 C CB  . ARG D 1 57  ? -0.160  11.128  12.386  1.00 50.22  ? 57  ARG D CB  1 
ATOM   3830 C CG  . ARG D 1 57  ? 0.103   12.328  13.239  1.00 53.78  ? 57  ARG D CG  1 
ATOM   3831 C CD  . ARG D 1 57  ? 1.539   12.379  13.694  1.00 56.67  ? 57  ARG D CD  1 
ATOM   3832 N NE  . ARG D 1 57  ? 2.265   13.412  12.979  1.00 57.79  ? 57  ARG D NE  1 
ATOM   3833 C CZ  . ARG D 1 57  ? 3.317   13.188  12.205  1.00 58.41  ? 57  ARG D CZ  1 
ATOM   3834 N NH1 . ARG D 1 57  ? 3.796   11.967  12.054  1.00 56.87  ? 57  ARG D NH1 1 
ATOM   3835 N NH2 . ARG D 1 57  ? 3.897   14.190  11.585  1.00 63.66  ? 57  ARG D NH2 1 
ATOM   3836 N N   . GLU D 1 58  ? -0.681  12.718  9.875   1.00 46.69  ? 58  GLU D N   1 
ATOM   3837 C CA  . GLU D 1 58  ? -0.538  13.932  9.144   1.00 45.15  ? 58  GLU D CA  1 
ATOM   3838 C C   . GLU D 1 58  ? -1.806  14.252  8.363   1.00 43.25  ? 58  GLU D C   1 
ATOM   3839 O O   . GLU D 1 58  ? -2.137  15.425  8.146   1.00 43.36  ? 58  GLU D O   1 
ATOM   3840 C CB  . GLU D 1 58  ? 0.653   13.805  8.227   1.00 43.67  ? 58  GLU D CB  1 
ATOM   3841 C CG  . GLU D 1 58  ? 1.176   15.133  7.828   1.00 47.05  ? 58  GLU D CG  1 
ATOM   3842 C CD  . GLU D 1 58  ? 2.008   15.786  8.878   1.00 51.77  ? 58  GLU D CD  1 
ATOM   3843 O OE1 . GLU D 1 58  ? 3.018   15.199  9.294   1.00 54.23  ? 58  GLU D OE1 1 
ATOM   3844 O OE2 . GLU D 1 58  ? 1.670   16.914  9.250   1.00 56.53  ? 58  GLU D OE2 1 
ATOM   3845 N N   . THR D 1 59  ? -2.520  13.215  7.940   1.00 41.10  ? 59  THR D N   1 
ATOM   3846 C CA  . THR D 1 59  ? -3.781  13.441  7.271   1.00 40.35  ? 59  THR D CA  1 
ATOM   3847 C C   . THR D 1 59  ? -4.765  14.109  8.210   1.00 43.32  ? 59  THR D C   1 
ATOM   3848 O O   . THR D 1 59  ? -5.317  15.108  7.874   1.00 42.09  ? 59  THR D O   1 
ATOM   3849 C CB  . THR D 1 59  ? -4.335  12.157  6.702   1.00 39.55  ? 59  THR D CB  1 
ATOM   3850 O OG1 . THR D 1 59  ? -3.598  11.826  5.520   1.00 38.34  ? 59  THR D OG1 1 
ATOM   3851 C CG2 . THR D 1 59  ? -5.772  12.331  6.306   1.00 38.90  ? 59  THR D CG2 1 
ATOM   3852 N N   . GLN D 1 60  ? -4.951  13.551  9.399   1.00 47.58  ? 60  GLN D N   1 
ATOM   3853 C CA  . GLN D 1 60  ? -5.700  14.191  10.468  1.00 52.83  ? 60  GLN D CA  1 
ATOM   3854 C C   . GLN D 1 60  ? -5.110  15.564  10.812  1.00 54.56  ? 60  GLN D C   1 
ATOM   3855 O O   . GLN D 1 60  ? -5.817  16.558  10.885  1.00 55.76  ? 60  GLN D O   1 
ATOM   3856 C CB  . GLN D 1 60  ? -5.794  13.245  11.692  1.00 57.85  ? 60  GLN D CB  1 
ATOM   3857 C CG  . GLN D 1 60  ? -5.452  13.830  13.093  1.00 67.99  ? 60  GLN D CG  1 
ATOM   3858 C CD  . GLN D 1 60  ? -6.438  14.880  13.595  1.00 76.75  ? 60  GLN D CD  1 
ATOM   3859 O OE1 . GLN D 1 60  ? -7.639  14.752  13.424  1.00 79.76  ? 60  GLN D OE1 1 
ATOM   3860 N NE2 . GLN D 1 60  ? -5.921  15.925  14.220  1.00 83.15  ? 60  GLN D NE2 1 
ATOM   3861 N N   . GLU D 1 61  ? -3.806  15.620  11.002  1.00 55.31  ? 61  GLU D N   1 
ATOM   3862 C CA  . GLU D 1 61  ? -3.179  16.885  11.323  1.00 59.42  ? 61  GLU D CA  1 
ATOM   3863 C C   . GLU D 1 61  ? -3.628  17.956  10.322  1.00 57.71  ? 61  GLU D C   1 
ATOM   3864 O O   . GLU D 1 61  ? -4.191  18.956  10.714  1.00 61.42  ? 61  GLU D O   1 
ATOM   3865 C CB  . GLU D 1 61  ? -1.653  16.717  11.318  1.00 59.81  ? 61  GLU D CB  1 
ATOM   3866 C CG  . GLU D 1 61  ? -0.909  17.315  12.503  1.00 68.29  ? 61  GLU D CG  1 
ATOM   3867 C CD  . GLU D 1 61  ? 0.009   16.311  13.225  1.00 74.99  ? 61  GLU D CD  1 
ATOM   3868 O OE1 . GLU D 1 61  ? -0.494  15.400  13.910  1.00 78.89  ? 61  GLU D OE1 1 
ATOM   3869 O OE2 . GLU D 1 61  ? 1.239   16.440  13.131  1.00 75.93  ? 61  GLU D OE2 1 
ATOM   3870 N N   . GLU D 1 62  ? -3.404  17.731  9.032   1.00 53.42  ? 62  GLU D N   1 
ATOM   3871 C CA  . GLU D 1 62  ? -3.726  18.714  7.994   1.00 52.27  ? 62  GLU D CA  1 
ATOM   3872 C C   . GLU D 1 62  ? -5.143  18.892  7.440   1.00 50.33  ? 62  GLU D C   1 
ATOM   3873 O O   . GLU D 1 62  ? -5.507  19.976  7.036   1.00 51.09  ? 62  GLU D O   1 
ATOM   3874 C CB  . GLU D 1 62  ? -2.813  18.520  6.810   1.00 49.87  ? 62  GLU D CB  1 
ATOM   3875 C CG  . GLU D 1 62  ? -1.775  19.584  6.739   1.00 55.26  ? 62  GLU D CG  1 
ATOM   3876 C CD  . GLU D 1 62  ? -0.399  19.006  7.017   1.00 59.65  ? 62  GLU D CD  1 
ATOM   3877 O OE1 . GLU D 1 62  ? -0.222  17.881  6.555   1.00 61.12  ? 62  GLU D OE1 1 
ATOM   3878 O OE2 . GLU D 1 62  ? 0.482   19.647  7.662   1.00 65.25  ? 62  GLU D OE2 1 
ATOM   3879 N N   . ALA D 1 63  ? -5.894  17.815  7.334   1.00 48.17  ? 63  ALA D N   1 
ATOM   3880 C CA  . ALA D 1 63  ? -7.225  17.868  6.775   1.00 47.49  ? 63  ALA D CA  1 
ATOM   3881 C C   . ALA D 1 63  ? -8.247  17.620  7.836   1.00 50.97  ? 63  ALA D C   1 
ATOM   3882 O O   . ALA D 1 63  ? -9.433  17.721  7.570   1.00 52.06  ? 63  ALA D O   1 
ATOM   3883 C CB  . ALA D 1 63  ? -7.379  16.834  5.722   1.00 44.41  ? 63  ALA D CB  1 
ATOM   3884 N N   . GLY D 1 64  ? -7.778  17.273  9.033   1.00 53.82  ? 64  GLY D N   1 
ATOM   3885 C CA  . GLY D 1 64  ? -8.632  17.022  10.169  1.00 57.48  ? 64  GLY D CA  1 
ATOM   3886 C C   . GLY D 1 64  ? -9.414  15.744  10.045  1.00 57.80  ? 64  GLY D C   1 
ATOM   3887 O O   . GLY D 1 64  ? -10.431 15.579  10.710  1.00 61.23  ? 64  GLY D O   1 
ATOM   3888 N N   . ILE D 1 65  ? -8.947  14.833  9.196   1.00 55.46  ? 65  ILE D N   1 
ATOM   3889 C CA  . ILE D 1 65  ? -9.598  13.529  9.023   1.00 55.89  ? 65  ILE D CA  1 
ATOM   3890 C C   . ILE D 1 65  ? -8.946  12.403  9.870   1.00 59.55  ? 65  ILE D C   1 
ATOM   3891 O O   . ILE D 1 65  ? -7.759  12.091  9.750   1.00 57.10  ? 65  ILE D O   1 
ATOM   3892 C CB  . ILE D 1 65  ? -9.710  13.155  7.532   1.00 52.22  ? 65  ILE D CB  1 
ATOM   3893 C CG1 . ILE D 1 65  ? -10.418 14.265  6.772   1.00 49.35  ? 65  ILE D CG1 1 
ATOM   3894 C CG2 . ILE D 1 65  ? -10.508 11.880  7.329   1.00 51.48  ? 65  ILE D CG2 1 
ATOM   3895 C CD1 . ILE D 1 65  ? -10.408 14.035  5.295   1.00 43.32  ? 65  ILE D CD1 1 
ATOM   3896 N N   . GLU D 1 66  ? -9.761  11.830  10.749  1.00 65.25  ? 66  GLU D N   1 
ATOM   3897 C CA  . GLU D 1 66  ? -9.332  10.823  11.694  1.00 68.81  ? 66  GLU D CA  1 
ATOM   3898 C C   . GLU D 1 66  ? -9.108  9.542   10.940  1.00 66.42  ? 66  GLU D C   1 
ATOM   3899 O O   . GLU D 1 66  ? -9.779  9.287   9.950   1.00 65.57  ? 66  GLU D O   1 
ATOM   3900 C CB  . GLU D 1 66  ? -10.410 10.601  12.764  1.00 76.83  ? 66  GLU D CB  1 
ATOM   3901 C CG  . GLU D 1 66  ? -10.323 11.500  13.993  1.00 92.14  ? 66  GLU D CG  1 
ATOM   3902 C CD  . GLU D 1 66  ? -9.757  10.774  15.210  1.00 110.28 ? 66  GLU D CD  1 
ATOM   3903 O OE1 . GLU D 1 66  ? -10.447 10.726  16.260  1.00 124.67 ? 66  GLU D OE1 1 
ATOM   3904 O OE2 . GLU D 1 66  ? -8.625  10.242  15.121  1.00 111.75 ? 66  GLU D OE2 1 
ATOM   3905 N N   . ALA D 1 67  ? -8.174  8.735   11.450  1.00 67.18  ? 67  ALA D N   1 
ATOM   3906 C CA  . ALA D 1 67  ? -7.882  7.389   10.967  1.00 66.70  ? 67  ALA D CA  1 
ATOM   3907 C C   . ALA D 1 67  ? -9.142  6.567   10.831  1.00 68.23  ? 67  ALA D C   1 
ATOM   3908 O O   . ALA D 1 67  ? -9.350  5.905   9.837   1.00 67.97  ? 67  ALA D O   1 
ATOM   3909 C CB  . ALA D 1 67  ? -6.918  6.699   11.921  1.00 69.53  ? 67  ALA D CB  1 
ATOM   3910 N N   . GLY D 1 68  ? -9.986  6.642   11.841  1.00 62.22  ? 68  GLY D N   1 
ATOM   3911 C CA  . GLY D 1 68  ? -11.206 5.877   11.893  1.00 63.10  ? 68  GLY D CA  1 
ATOM   3912 C C   . GLY D 1 68  ? -12.114 6.127   10.728  1.00 62.25  ? 68  GLY D C   1 
ATOM   3913 O O   . GLY D 1 68  ? -12.849 5.234   10.341  1.00 63.33  ? 68  GLY D O   1 
ATOM   3914 N N   . GLN D 1 69  ? -12.053 7.331   10.155  1.00 60.55  ? 69  GLN D N   1 
ATOM   3915 C CA  . GLN D 1 69  ? -12.941 7.711   9.035   1.00 59.66  ? 69  GLN D CA  1 
ATOM   3916 C C   . GLN D 1 69  ? -12.339 7.475   7.647   1.00 57.06  ? 69  GLN D C   1 
ATOM   3917 O O   . GLN D 1 69  ? -12.879 7.973   6.661   1.00 57.07  ? 69  GLN D O   1 
ATOM   3918 C CB  . GLN D 1 69  ? -13.401 9.164   9.133   1.00 59.51  ? 69  GLN D CB  1 
ATOM   3919 C CG  . GLN D 1 69  ? -12.938 9.871   10.367  1.00 63.03  ? 69  GLN D CG  1 
ATOM   3920 C CD  . GLN D 1 69  ? -13.562 11.233  10.526  1.00 65.26  ? 69  GLN D CD  1 
ATOM   3921 O OE1 . GLN D 1 69  ? -14.773 11.373  10.443  1.00 68.82  ? 69  GLN D OE1 1 
ATOM   3922 N NE2 . GLN D 1 69  ? -12.738 12.247  10.768  1.00 62.69  ? 69  GLN D NE2 1 
ATOM   3923 N N   . LEU D 1 70  ? -11.243 6.716   7.574   1.00 54.37  ? 70  LEU D N   1 
ATOM   3924 C CA  . LEU D 1 70  ? -10.577 6.436   6.320   1.00 51.42  ? 70  LEU D CA  1 
ATOM   3925 C C   . LEU D 1 70  ? -10.379 4.958   6.195   1.00 51.62  ? 70  LEU D C   1 
ATOM   3926 O O   . LEU D 1 70  ? -10.280 4.269   7.185   1.00 54.45  ? 70  LEU D O   1 
ATOM   3927 C CB  . LEU D 1 70  ? -9.178  7.054   6.294   1.00 49.31  ? 70  LEU D CB  1 
ATOM   3928 C CG  . LEU D 1 70  ? -8.994  8.524   6.575   1.00 48.34  ? 70  LEU D CG  1 
ATOM   3929 C CD1 . LEU D 1 70  ? -7.560  8.831   6.684   1.00 47.03  ? 70  LEU D CD1 1 
ATOM   3930 C CD2 . LEU D 1 70  ? -9.572  9.307   5.458   1.00 48.79  ? 70  LEU D CD2 1 
ATOM   3931 N N   . THR D 1 71  ? -10.262 4.495   4.960   1.00 49.92  ? 71  THR D N   1 
ATOM   3932 C CA  . THR D 1 71  ? -9.849  3.147   4.659   1.00 49.20  ? 71  THR D CA  1 
ATOM   3933 C C   . THR D 1 71  ? -8.625  3.238   3.757   1.00 47.36  ? 71  THR D C   1 
ATOM   3934 O O   . THR D 1 71  ? -8.647  3.954   2.779   1.00 46.69  ? 71  THR D O   1 
ATOM   3935 C CB  . THR D 1 71  ? -10.970 2.393   3.939   1.00 50.15  ? 71  THR D CB  1 
ATOM   3936 O OG1 . THR D 1 71  ? -12.073 2.258   4.826   1.00 52.58  ? 71  THR D OG1 1 
ATOM   3937 C CG2 . THR D 1 71  ? -10.516 1.034   3.488   1.00 49.06  ? 71  THR D CG2 1 
ATOM   3938 N N   . ILE D 1 72  ? -7.562  2.520   4.096   1.00 46.63  ? 72  ILE D N   1 
ATOM   3939 C CA  . ILE D 1 72  ? -6.369  2.467   3.267   1.00 45.03  ? 72  ILE D CA  1 
ATOM   3940 C C   . ILE D 1 72  ? -6.620  1.444   2.193   1.00 46.19  ? 72  ILE D C   1 
ATOM   3941 O O   . ILE D 1 72  ? -7.080  0.363   2.465   1.00 48.08  ? 72  ILE D O   1 
ATOM   3942 C CB  . ILE D 1 72  ? -5.126  2.012   4.052   1.00 45.46  ? 72  ILE D CB  1 
ATOM   3943 C CG1 . ILE D 1 72  ? -4.691  3.052   5.090   1.00 41.87  ? 72  ILE D CG1 1 
ATOM   3944 C CG2 . ILE D 1 72  ? -4.004  1.658   3.090   1.00 44.40  ? 72  ILE D CG2 1 
ATOM   3945 C CD1 . ILE D 1 72  ? -4.135  4.259   4.487   1.00 41.64  ? 72  ILE D CD1 1 
ATOM   3946 N N   . ILE D 1 73  ? -6.320  1.777   0.956   1.00 45.62  ? 73  ILE D N   1 
ATOM   3947 C CA  . ILE D 1 73  ? -6.621  0.874   -0.119  1.00 46.22  ? 73  ILE D CA  1 
ATOM   3948 C C   . ILE D 1 73  ? -5.402  0.067   -0.378  1.00 48.32  ? 73  ILE D C   1 
ATOM   3949 O O   . ILE D 1 73  ? -4.407  0.594   -0.842  1.00 47.59  ? 73  ILE D O   1 
ATOM   3950 C CB  . ILE D 1 73  ? -6.978  1.647   -1.385  1.00 44.77  ? 73  ILE D CB  1 
ATOM   3951 C CG1 . ILE D 1 73  ? -8.220  2.499   -1.153  1.00 41.84  ? 73  ILE D CG1 1 
ATOM   3952 C CG2 . ILE D 1 73  ? -7.195  0.704   -2.545  1.00 44.56  ? 73  ILE D CG2 1 
ATOM   3953 C CD1 . ILE D 1 73  ? -9.424  1.749   -0.751  1.00 34.44  ? 73  ILE D CD1 1 
ATOM   3954 N N   . GLU D 1 74  ? -5.480  -1.219  -0.075  1.00 51.98  ? 74  GLU D N   1 
ATOM   3955 C CA  . GLU D 1 74  ? -4.351  -2.136  -0.236  1.00 54.54  ? 74  GLU D CA  1 
ATOM   3956 C C   . GLU D 1 74  ? -3.900  -2.321  -1.680  1.00 53.78  ? 74  GLU D C   1 
ATOM   3957 O O   . GLU D 1 74  ? -4.707  -2.358  -2.598  1.00 54.72  ? 74  GLU D O   1 
ATOM   3958 C CB  . GLU D 1 74  ? -4.686  -3.481  0.378   1.00 58.85  ? 74  GLU D CB  1 
ATOM   3959 C CG  . GLU D 1 74  ? -4.605  -3.491  1.913   1.00 66.60  ? 74  GLU D CG  1 
ATOM   3960 C CD  . GLU D 1 74  ? -5.479  -4.578  2.541   1.00 77.43  ? 74  GLU D CD  1 
ATOM   3961 O OE1 . GLU D 1 74  ? -5.628  -5.666  1.918   1.00 81.12  ? 74  GLU D OE1 1 
ATOM   3962 O OE2 . GLU D 1 74  ? -6.015  -4.339  3.647   1.00 81.58  ? 74  GLU D OE2 1 
ATOM   3963 N N   . GLY D 1 75  ? -2.591  -2.419  -1.865  1.00 52.71  ? 75  GLY D N   1 
ATOM   3964 C CA  . GLY D 1 75  ? -2.005  -2.672  -3.172  1.00 51.93  ? 75  GLY D CA  1 
ATOM   3965 C C   . GLY D 1 75  ? -1.490  -1.485  -3.946  1.00 48.52  ? 75  GLY D C   1 
ATOM   3966 O O   . GLY D 1 75  ? -0.911  -1.656  -5.001  1.00 50.13  ? 75  GLY D O   1 
ATOM   3967 N N   . PHE D 1 76  ? -1.683  -0.280  -3.443  1.00 44.69  ? 76  PHE D N   1 
ATOM   3968 C CA  . PHE D 1 76  ? -1.186  0.882   -4.155  1.00 41.54  ? 76  PHE D CA  1 
ATOM   3969 C C   . PHE D 1 76  ? -0.239  1.670   -3.266  1.00 40.70  ? 76  PHE D C   1 
ATOM   3970 O O   . PHE D 1 76  ? -0.499  1.872   -2.093  1.00 41.03  ? 76  PHE D O   1 
ATOM   3971 C CB  . PHE D 1 76  ? -2.336  1.761   -4.637  1.00 39.95  ? 76  PHE D CB  1 
ATOM   3972 C CG  . PHE D 1 76  ? -1.896  3.004   -5.348  1.00 36.45  ? 76  PHE D CG  1 
ATOM   3973 C CD1 . PHE D 1 76  ? -1.795  3.035   -6.740  1.00 33.36  ? 76  PHE D CD1 1 
ATOM   3974 C CD2 . PHE D 1 76  ? -1.598  4.159   -4.631  1.00 32.89  ? 76  PHE D CD2 1 
ATOM   3975 C CE1 . PHE D 1 76  ? -1.379  4.176   -7.404  1.00 31.33  ? 76  PHE D CE1 1 
ATOM   3976 C CE2 . PHE D 1 76  ? -1.173  5.324   -5.292  1.00 31.29  ? 76  PHE D CE2 1 
ATOM   3977 C CZ  . PHE D 1 76  ? -1.055  5.320   -6.686  1.00 32.09  ? 76  PHE D CZ  1 
ATOM   3978 N N   . LYS D 1 77  ? 0.875   2.093   -3.835  1.00 39.75  ? 77  LYS D N   1 
ATOM   3979 C CA  . LYS D 1 77  ? 1.829   2.926   -3.162  1.00 37.94  ? 77  LYS D CA  1 
ATOM   3980 C C   . LYS D 1 77  ? 2.527   3.626   -4.305  1.00 37.94  ? 77  LYS D C   1 
ATOM   3981 O O   . LYS D 1 77  ? 2.663   3.059   -5.368  1.00 37.47  ? 77  LYS D O   1 
ATOM   3982 C CB  . LYS D 1 77  ? 2.807   2.031   -2.452  1.00 38.93  ? 77  LYS D CB  1 
ATOM   3983 C CG  . LYS D 1 77  ? 3.463   2.574   -1.234  1.00 38.35  ? 77  LYS D CG  1 
ATOM   3984 C CD  . LYS D 1 77  ? 4.637   1.693   -1.018  1.00 42.15  ? 77  LYS D CD  1 
ATOM   3985 C CE  . LYS D 1 77  ? 5.159   1.765   0.359   1.00 45.43  ? 77  LYS D CE  1 
ATOM   3986 N NZ  . LYS D 1 77  ? 6.214   0.752   0.472   1.00 50.14  ? 77  LYS D NZ  1 
ATOM   3987 N N   . ARG D 1 78  ? 2.924   4.868   -4.114  1.00 37.74  ? 78  ARG D N   1 
ATOM   3988 C CA  . ARG D 1 78  ? 3.654   5.587   -5.141  1.00 39.75  ? 78  ARG D CA  1 
ATOM   3989 C C   . ARG D 1 78  ? 4.599   6.471   -4.411  1.00 40.70  ? 78  ARG D C   1 
ATOM   3990 O O   . ARG D 1 78  ? 4.235   7.085   -3.419  1.00 41.11  ? 78  ARG D O   1 
ATOM   3991 C CB  . ARG D 1 78  ? 2.726   6.444   -6.004  1.00 39.25  ? 78  ARG D CB  1 
ATOM   3992 C CG  . ARG D 1 78  ? 2.644   6.027   -7.476  1.00 42.62  ? 78  ARG D CG  1 
ATOM   3993 C CD  . ARG D 1 78  ? 3.160   4.583   -7.785  1.00 44.94  ? 78  ARG D CD  1 
ATOM   3994 N NE  . ARG D 1 78  ? 2.604   4.060   -9.037  1.00 44.96  ? 78  ARG D NE  1 
ATOM   3995 C CZ  . ARG D 1 78  ? 1.751   3.044   -9.120  1.00 42.82  ? 78  ARG D CZ  1 
ATOM   3996 N NH1 . ARG D 1 78  ? 1.392   2.379   -8.046  1.00 41.55  ? 78  ARG D NH1 1 
ATOM   3997 N NH2 . ARG D 1 78  ? 1.284   2.677   -10.276 1.00 37.22  ? 78  ARG D NH2 1 
ATOM   3998 N N   . GLU D 1 79  ? 5.821   6.530   -4.888  1.00 43.05  ? 79  GLU D N   1 
ATOM   3999 C CA  . GLU D 1 79  ? 6.835   7.317   -4.243  1.00 44.71  ? 79  GLU D CA  1 
ATOM   4000 C C   . GLU D 1 79  ? 7.241   8.438   -5.144  1.00 45.81  ? 79  GLU D C   1 
ATOM   4001 O O   . GLU D 1 79  ? 7.575   8.213   -6.291  1.00 47.09  ? 79  GLU D O   1 
ATOM   4002 C CB  . GLU D 1 79  ? 8.035   6.444   -4.019  1.00 46.22  ? 79  GLU D CB  1 
ATOM   4003 C CG  . GLU D 1 79  ? 9.190   7.111   -3.370  1.00 49.03  ? 79  GLU D CG  1 
ATOM   4004 C CD  . GLU D 1 79  ? 10.133  6.101   -2.774  1.00 55.81  ? 79  GLU D CD  1 
ATOM   4005 O OE1 . GLU D 1 79  ? 9.653   5.077   -2.225  1.00 58.49  ? 79  GLU D OE1 1 
ATOM   4006 O OE2 . GLU D 1 79  ? 11.355  6.319   -2.867  1.00 60.50  ? 79  GLU D OE2 1 
ATOM   4007 N N   . LEU D 1 80  ? 7.230   9.653   -4.618  1.00 46.85  ? 80  LEU D N   1 
ATOM   4008 C CA  . LEU D 1 80  ? 7.673   10.814  -5.379  1.00 48.51  ? 80  LEU D CA  1 
ATOM   4009 C C   . LEU D 1 80  ? 9.053   11.265  -4.977  1.00 52.07  ? 80  LEU D C   1 
ATOM   4010 O O   . LEU D 1 80  ? 9.328   11.478  -3.809  1.00 51.31  ? 80  LEU D O   1 
ATOM   4011 C CB  . LEU D 1 80  ? 6.697   11.968  -5.239  1.00 46.38  ? 80  LEU D CB  1 
ATOM   4012 C CG  . LEU D 1 80  ? 5.495   11.887  -6.159  1.00 43.26  ? 80  LEU D CG  1 
ATOM   4013 C CD1 . LEU D 1 80  ? 4.831   10.583  -5.975  1.00 42.26  ? 80  LEU D CD1 1 
ATOM   4014 C CD2 . LEU D 1 80  ? 4.551   12.949  -5.803  1.00 41.12  ? 80  LEU D CD2 1 
ATOM   4015 N N   . ASN D 1 81  ? 9.931   11.368  -5.965  1.00 57.29  ? 81  ASN D N   1 
ATOM   4016 C CA  . ASN D 1 81  ? 11.243  11.968  -5.774  1.00 62.42  ? 81  ASN D CA  1 
ATOM   4017 C C   . ASN D 1 81  ? 11.347  13.150  -6.674  1.00 65.47  ? 81  ASN D C   1 
ATOM   4018 O O   . ASN D 1 81  ? 11.190  13.041  -7.879  1.00 67.52  ? 81  ASN D O   1 
ATOM   4019 C CB  . ASN D 1 81  ? 12.359  10.989  -6.082  1.00 63.57  ? 81  ASN D CB  1 
ATOM   4020 C CG  . ASN D 1 81  ? 12.540  9.975   -4.989  1.00 66.56  ? 81  ASN D CG  1 
ATOM   4021 O OD1 . ASN D 1 81  ? 12.859  10.324  -3.853  1.00 69.01  ? 81  ASN D OD1 1 
ATOM   4022 N ND2 . ASN D 1 81  ? 12.335  8.707   -5.317  1.00 69.08  ? 81  ASN D ND2 1 
ATOM   4023 N N   . TYR D 1 82  ? 11.571  14.300  -6.075  1.00 69.31  ? 82  TYR D N   1 
ATOM   4024 C CA  . TYR D 1 82  ? 11.676  15.511  -6.840  1.00 73.18  ? 82  TYR D CA  1 
ATOM   4025 C C   . TYR D 1 82  ? 12.474  16.517  -6.068  1.00 76.99  ? 82  TYR D C   1 
ATOM   4026 O O   . TYR D 1 82  ? 12.781  16.313  -4.897  1.00 77.27  ? 82  TYR D O   1 
ATOM   4027 C CB  . TYR D 1 82  ? 10.296  16.062  -7.180  1.00 71.30  ? 82  TYR D CB  1 
ATOM   4028 C CG  . TYR D 1 82  ? 9.415   16.391  -5.999  1.00 70.36  ? 82  TYR D CG  1 
ATOM   4029 C CD1 . TYR D 1 82  ? 9.492   17.619  -5.372  1.00 70.05  ? 82  TYR D CD1 1 
ATOM   4030 C CD2 . TYR D 1 82  ? 8.477   15.480  -5.529  1.00 70.57  ? 82  TYR D CD2 1 
ATOM   4031 C CE1 . TYR D 1 82  ? 8.674   17.921  -4.306  1.00 69.05  ? 82  TYR D CE1 1 
ATOM   4032 C CE2 . TYR D 1 82  ? 7.648   15.790  -4.465  1.00 67.38  ? 82  TYR D CE2 1 
ATOM   4033 C CZ  . TYR D 1 82  ? 7.758   17.007  -3.864  1.00 66.97  ? 82  TYR D CZ  1 
ATOM   4034 O OH  . TYR D 1 82  ? 6.958   17.313  -2.803  1.00 66.74  ? 82  TYR D OH  1 
ATOM   4035 N N   . VAL D 1 83  ? 12.809  17.604  -6.745  1.00 82.48  ? 83  VAL D N   1 
ATOM   4036 C CA  . VAL D 1 83  ? 13.530  18.704  -6.140  1.00 87.43  ? 83  VAL D CA  1 
ATOM   4037 C C   . VAL D 1 83  ? 12.574  19.884  -6.044  1.00 88.66  ? 83  VAL D C   1 
ATOM   4038 O O   . VAL D 1 83  ? 11.903  20.210  -7.012  1.00 87.36  ? 83  VAL D O   1 
ATOM   4039 C CB  . VAL D 1 83  ? 14.784  19.046  -6.962  1.00 89.78  ? 83  VAL D CB  1 
ATOM   4040 C CG1 . VAL D 1 83  ? 15.336  20.403  -6.577  1.00 95.69  ? 83  VAL D CG1 1 
ATOM   4041 C CG2 . VAL D 1 83  ? 15.848  17.962  -6.786  1.00 90.15  ? 83  VAL D CG2 1 
ATOM   4042 N N   . ALA D 1 84  ? 12.485  20.487  -4.863  1.00 92.73  ? 84  ALA D N   1 
ATOM   4043 C CA  . ALA D 1 84  ? 11.567  21.592  -4.637  1.00 95.77  ? 84  ALA D CA  1 
ATOM   4044 C C   . ALA D 1 84  ? 12.232  22.746  -3.917  1.00 100.42 ? 84  ALA D C   1 
ATOM   4045 O O   . ALA D 1 84  ? 12.750  22.574  -2.810  1.00 100.68 ? 84  ALA D O   1 
ATOM   4046 C CB  . ALA D 1 84  ? 10.373  21.121  -3.855  1.00 94.22  ? 84  ALA D CB  1 
ATOM   4047 N N   . ARG D 1 85  ? 12.186  23.923  -4.541  1.00 105.68 ? 85  ARG D N   1 
ATOM   4048 C CA  . ARG D 1 85  ? 12.819  25.132  -4.012  1.00 112.59 ? 85  ARG D CA  1 
ATOM   4049 C C   . ARG D 1 85  ? 14.271  24.840  -3.649  1.00 114.83 ? 85  ARG D C   1 
ATOM   4050 O O   . ARG D 1 85  ? 14.736  25.186  -2.565  1.00 116.94 ? 85  ARG D O   1 
ATOM   4051 C CB  . ARG D 1 85  ? 12.041  25.682  -2.804  1.00 115.75 ? 85  ARG D CB  1 
ATOM   4052 N N   . ASN D 1 86  ? 14.969  24.177  -4.568  1.00 114.82 ? 86  ASN D N   1 
ATOM   4053 C CA  . ASN D 1 86  ? 16.371  23.798  -4.397  1.00 116.99 ? 86  ASN D CA  1 
ATOM   4054 C C   . ASN D 1 86  ? 16.683  22.918  -3.182  1.00 113.42 ? 86  ASN D C   1 
ATOM   4055 O O   . ASN D 1 86  ? 17.760  23.002  -2.596  1.00 115.91 ? 86  ASN D O   1 
ATOM   4056 C CB  . ASN D 1 86  ? 17.278  25.029  -4.439  1.00 123.66 ? 86  ASN D CB  1 
ATOM   4057 C CG  . ASN D 1 86  ? 17.648  25.416  -5.848  1.00 130.38 ? 86  ASN D CG  1 
ATOM   4058 O OD1 . ASN D 1 86  ? 18.666  24.971  -6.377  1.00 136.20 ? 86  ASN D OD1 1 
ATOM   4059 N ND2 . ASN D 1 86  ? 16.810  26.231  -6.477  1.00 135.44 ? 86  ASN D ND2 1 
ATOM   4060 N N   . LYS D 1 87  ? 15.727  22.076  -2.815  1.00 106.89 ? 87  LYS D N   1 
ATOM   4061 C CA  . LYS D 1 87  ? 15.931  21.019  -1.835  1.00 99.13  ? 87  LYS D CA  1 
ATOM   4062 C C   . LYS D 1 87  ? 15.256  19.790  -2.422  1.00 90.85  ? 87  LYS D C   1 
ATOM   4063 O O   . LYS D 1 87  ? 14.176  19.916  -2.994  1.00 89.16  ? 87  LYS D O   1 
ATOM   4064 C CB  . LYS D 1 87  ? 15.309  21.398  -0.516  1.00 98.85  ? 87  LYS D CB  1 
ATOM   4065 N N   . PRO D 1 88  ? 15.895  18.608  -2.321  1.00 86.42  ? 88  PRO D N   1 
ATOM   4066 C CA  . PRO D 1 88  ? 15.324  17.341  -2.807  1.00 81.23  ? 88  PRO D CA  1 
ATOM   4067 C C   . PRO D 1 88  ? 14.405  16.609  -1.811  1.00 75.76  ? 88  PRO D C   1 
ATOM   4068 O O   . PRO D 1 88  ? 14.797  16.326  -0.686  1.00 75.61  ? 88  PRO D O   1 
ATOM   4069 C CB  . PRO D 1 88  ? 16.562  16.506  -3.127  1.00 82.52  ? 88  PRO D CB  1 
ATOM   4070 C CG  . PRO D 1 88  ? 17.602  17.048  -2.258  1.00 85.98  ? 88  PRO D CG  1 
ATOM   4071 C CD  . PRO D 1 88  ? 17.367  18.515  -2.213  1.00 88.06  ? 88  PRO D CD  1 
ATOM   4072 N N   . LYS D 1 89  ? 13.192  16.297  -2.257  1.00 69.49  ? 89  LYS D N   1 
ATOM   4073 C CA  . LYS D 1 89  ? 12.181  15.704  -1.405  1.00 63.82  ? 89  LYS D CA  1 
ATOM   4074 C C   . LYS D 1 89  ? 11.903  14.263  -1.768  1.00 60.74  ? 89  LYS D C   1 
ATOM   4075 O O   . LYS D 1 89  ? 12.201  13.818  -2.867  1.00 63.58  ? 89  LYS D O   1 
ATOM   4076 C CB  . LYS D 1 89  ? 10.877  16.477  -1.526  1.00 62.34  ? 89  LYS D CB  1 
ATOM   4077 C CG  . LYS D 1 89  ? 11.049  17.922  -1.834  1.00 63.93  ? 89  LYS D CG  1 
ATOM   4078 C CD  . LYS D 1 89  ? 10.961  18.752  -0.591  1.00 68.38  ? 89  LYS D CD  1 
ATOM   4079 C CE  . LYS D 1 89  ? 12.334  19.099  -0.031  1.00 74.76  ? 89  LYS D CE  1 
ATOM   4080 N NZ  . LYS D 1 89  ? 12.283  20.301  0.864   1.00 78.16  ? 89  LYS D NZ  1 
ATOM   4081 N N   . THR D 1 90  ? 11.319  13.546  -0.823  1.00 54.85  ? 90  THR D N   1 
ATOM   4082 C CA  . THR D 1 90  ? 10.771  12.240  -1.063  1.00 49.20  ? 90  THR D CA  1 
ATOM   4083 C C   . THR D 1 90  ? 9.432   12.242  -0.392  1.00 44.91  ? 90  THR D C   1 
ATOM   4084 O O   . THR D 1 90  ? 9.320   12.663  0.738   1.00 44.38  ? 90  THR D O   1 
ATOM   4085 C CB  . THR D 1 90  ? 11.667  11.167  -0.457  1.00 50.30  ? 90  THR D CB  1 
ATOM   4086 O OG1 . THR D 1 90  ? 12.916  11.212  -1.148  1.00 52.77  ? 90  THR D OG1 1 
ATOM   4087 C CG2 . THR D 1 90  ? 11.058  9.763   -0.588  1.00 46.37  ? 90  THR D CG2 1 
ATOM   4088 N N   . VAL D 1 91  ? 8.414   11.800  -1.103  1.00 40.34  ? 91  VAL D N   1 
ATOM   4089 C CA  . VAL D 1 91  ? 7.107   11.639  -0.520  1.00 36.58  ? 91  VAL D CA  1 
ATOM   4090 C C   . VAL D 1 91  ? 6.533   10.271  -0.861  1.00 36.40  ? 91  VAL D C   1 
ATOM   4091 O O   . VAL D 1 91  ? 6.584   9.847   -1.995  1.00 36.69  ? 91  VAL D O   1 
ATOM   4092 C CB  . VAL D 1 91  ? 6.161   12.694  -1.047  1.00 35.45  ? 91  VAL D CB  1 
ATOM   4093 C CG1 . VAL D 1 91  ? 4.905   12.678  -0.252  1.00 32.65  ? 91  VAL D CG1 1 
ATOM   4094 C CG2 . VAL D 1 91  ? 6.809   14.050  -0.964  1.00 34.23  ? 91  VAL D CG2 1 
ATOM   4095 N N   . ILE D 1 92  ? 5.977   9.568   0.108   1.00 35.52  ? 92  ILE D N   1 
ATOM   4096 C CA  . ILE D 1 92  ? 5.286   8.332   -0.218  1.00 34.83  ? 92  ILE D CA  1 
ATOM   4097 C C   . ILE D 1 92  ? 3.807   8.553   -0.007  1.00 34.42  ? 92  ILE D C   1 
ATOM   4098 O O   . ILE D 1 92  ? 3.388   9.074   1.046   1.00 34.00  ? 92  ILE D O   1 
ATOM   4099 C CB  . ILE D 1 92  ? 5.721   7.169   0.657   1.00 35.17  ? 92  ILE D CB  1 
ATOM   4100 C CG1 . ILE D 1 92  ? 7.169   7.341   1.089   1.00 37.14  ? 92  ILE D CG1 1 
ATOM   4101 C CG2 . ILE D 1 92  ? 5.530   5.879   -0.069  1.00 35.66  ? 92  ILE D CG2 1 
ATOM   4102 C CD1 . ILE D 1 92  ? 8.159   7.183   0.003   1.00 39.71  ? 92  ILE D CD1 1 
ATOM   4103 N N   . TYR D 1 93  ? 3.011   8.179   -1.013  1.00 33.28  ? 93  TYR D N   1 
ATOM   4104 C CA  . TYR D 1 93  ? 1.567   8.261   -0.868  1.00 31.54  ? 93  TYR D CA  1 
ATOM   4105 C C   . TYR D 1 93  ? 0.916   6.884   -0.928  1.00 31.45  ? 93  TYR D C   1 
ATOM   4106 O O   . TYR D 1 93  ? 1.423   5.981   -1.579  1.00 32.66  ? 93  TYR D O   1 
ATOM   4107 C CB  . TYR D 1 93  ? 0.966   9.123   -1.963  1.00 31.23  ? 93  TYR D CB  1 
ATOM   4108 C CG  . TYR D 1 93  ? 1.209   10.592  -1.837  1.00 29.14  ? 93  TYR D CG  1 
ATOM   4109 C CD1 . TYR D 1 93  ? 0.529   11.356  -0.907  1.00 29.13  ? 93  TYR D CD1 1 
ATOM   4110 C CD2 . TYR D 1 93  ? 2.081   11.217  -2.690  1.00 29.03  ? 93  TYR D CD2 1 
ATOM   4111 C CE1 . TYR D 1 93  ? 0.751   12.686  -0.811  1.00 29.01  ? 93  TYR D CE1 1 
ATOM   4112 C CE2 . TYR D 1 93  ? 2.320   12.530  -2.600  1.00 29.52  ? 93  TYR D CE2 1 
ATOM   4113 C CZ  . TYR D 1 93  ? 1.652   13.266  -1.666  1.00 31.15  ? 93  TYR D CZ  1 
ATOM   4114 O OH  . TYR D 1 93  ? 1.908   14.601  -1.608  1.00 34.55  ? 93  TYR D OH  1 
ATOM   4115 N N   . TRP D 1 94  ? -0.220  6.756   -0.261  1.00 29.67  ? 94  TRP D N   1 
ATOM   4116 C CA  . TRP D 1 94  ? -1.078  5.595   -0.342  1.00 29.79  ? 94  TRP D CA  1 
ATOM   4117 C C   . TRP D 1 94  ? -2.414  6.173   -0.733  1.00 29.81  ? 94  TRP D C   1 
ATOM   4118 O O   . TRP D 1 94  ? -2.589  7.384   -0.734  1.00 29.67  ? 94  TRP D O   1 
ATOM   4119 C CB  . TRP D 1 94  ? -1.201  4.909   1.009   1.00 29.86  ? 94  TRP D CB  1 
ATOM   4120 C CG  . TRP D 1 94  ? -0.048  4.072   1.369   1.00 31.85  ? 94  TRP D CG  1 
ATOM   4121 C CD1 . TRP D 1 94  ? 0.091   2.754   1.109   1.00 32.87  ? 94  TRP D CD1 1 
ATOM   4122 C CD2 . TRP D 1 94  ? 1.159   4.481   2.046   1.00 31.27  ? 94  TRP D CD2 1 
ATOM   4123 N NE1 . TRP D 1 94  ? 1.305   2.307   1.557   1.00 33.92  ? 94  TRP D NE1 1 
ATOM   4124 C CE2 . TRP D 1 94  ? 1.978   3.345   2.146   1.00 31.00  ? 94  TRP D CE2 1 
ATOM   4125 C CE3 . TRP D 1 94  ? 1.618   5.687   2.579   1.00 29.28  ? 94  TRP D CE3 1 
ATOM   4126 C CZ2 . TRP D 1 94  ? 3.214   3.374   2.765   1.00 25.53  ? 94  TRP D CZ2 1 
ATOM   4127 C CZ3 . TRP D 1 94  ? 2.867   5.711   3.194   1.00 27.79  ? 94  TRP D CZ3 1 
ATOM   4128 C CH2 . TRP D 1 94  ? 3.643   4.572   3.276   1.00 25.99  ? 94  TRP D CH2 1 
ATOM   4129 N N   . LEU D 1 95  ? -3.368  5.329   -1.064  1.00 30.36  ? 95  LEU D N   1 
ATOM   4130 C CA  . LEU D 1 95  ? -4.678  5.817   -1.355  1.00 30.36  ? 95  LEU D CA  1 
ATOM   4131 C C   . LEU D 1 95  ? -5.533  5.500   -0.171  1.00 31.41  ? 95  LEU D C   1 
ATOM   4132 O O   . LEU D 1 95  ? -5.436  4.411   0.398   1.00 32.05  ? 95  LEU D O   1 
ATOM   4133 C CB  . LEU D 1 95  ? -5.247  5.054   -2.509  1.00 31.17  ? 95  LEU D CB  1 
ATOM   4134 C CG  . LEU D 1 95  ? -4.924  5.427   -3.934  1.00 33.30  ? 95  LEU D CG  1 
ATOM   4135 C CD1 . LEU D 1 95  ? -5.340  4.273   -4.794  1.00 34.08  ? 95  LEU D CD1 1 
ATOM   4136 C CD2 . LEU D 1 95  ? -5.702  6.654   -4.309  1.00 35.16  ? 95  LEU D CD2 1 
ATOM   4137 N N   . ALA D 1 96  ? -6.402  6.436   0.184   1.00 30.84  ? 96  ALA D N   1 
ATOM   4138 C CA  . ALA D 1 96  ? -7.358  6.190   1.251   1.00 31.64  ? 96  ALA D CA  1 
ATOM   4139 C C   . ALA D 1 96  ? -8.729  6.700   0.857   1.00 32.61  ? 96  ALA D C   1 
ATOM   4140 O O   . ALA D 1 96  ? -8.879  7.857   0.537   1.00 31.86  ? 96  ALA D O   1 
ATOM   4141 C CB  . ALA D 1 96  ? -6.882  6.847   2.543   1.00 28.88  ? 96  ALA D CB  1 
ATOM   4142 N N   . GLU D 1 97  ? -9.727  5.833   0.885   1.00 36.05  ? 97  GLU D N   1 
ATOM   4143 C CA  . GLU D 1 97  ? -11.103 6.252   0.716   1.00 38.95  ? 97  GLU D CA  1 
ATOM   4144 C C   . GLU D 1 97  ? -11.748 6.761   2.002   1.00 40.42  ? 97  GLU D C   1 
ATOM   4145 O O   . GLU D 1 97  ? -11.476 6.239   3.083   1.00 41.34  ? 97  GLU D O   1 
ATOM   4146 C CB  . GLU D 1 97  ? -11.927 5.104   0.212   1.00 40.46  ? 97  GLU D CB  1 
ATOM   4147 C CG  . GLU D 1 97  ? -13.352 5.527   -0.149  1.00 44.48  ? 97  GLU D CG  1 
ATOM   4148 C CD  . GLU D 1 97  ? -14.059 4.457   -0.951  1.00 49.83  ? 97  GLU D CD  1 
ATOM   4149 O OE1 . GLU D 1 97  ? -14.801 4.790   -1.886  1.00 52.95  ? 97  GLU D OE1 1 
ATOM   4150 O OE2 . GLU D 1 97  ? -13.855 3.269   -0.658  1.00 51.69  ? 97  GLU D OE2 1 
ATOM   4151 N N   . VAL D 1 98  ? -12.628 7.756   1.881   1.00 41.22  ? 98  VAL D N   1 
ATOM   4152 C CA  . VAL D 1 98  ? -13.385 8.225   3.055   1.00 42.69  ? 98  VAL D CA  1 
ATOM   4153 C C   . VAL D 1 98  ? -14.620 7.372   3.362   1.00 46.06  ? 98  VAL D C   1 
ATOM   4154 O O   . VAL D 1 98  ? -15.298 6.890   2.456   1.00 46.71  ? 98  VAL D O   1 
ATOM   4155 C CB  . VAL D 1 98  ? -13.802 9.725   2.978   1.00 41.77  ? 98  VAL D CB  1 
ATOM   4156 C CG1 . VAL D 1 98  ? -12.608 10.631  3.199   1.00 38.92  ? 98  VAL D CG1 1 
ATOM   4157 C CG2 . VAL D 1 98  ? -14.512 10.052  1.681   1.00 38.78  ? 98  VAL D CG2 1 
ATOM   4158 N N   . LYS D 1 99  ? -14.861 7.152   4.653   1.00 48.75  ? 99  LYS D N   1 
ATOM   4159 C CA  . LYS D 1 99  ? -16.028 6.408   5.114   1.00 52.20  ? 99  LYS D CA  1 
ATOM   4160 C C   . LYS D 1 99  ? -17.298 7.165   4.754   1.00 52.86  ? 99  LYS D C   1 
ATOM   4161 O O   . LYS D 1 99  ? -18.285 6.577   4.311   1.00 54.69  ? 99  LYS D O   1 
ATOM   4162 C CB  . LYS D 1 99  ? -15.959 6.182   6.625   1.00 53.33  ? 99  LYS D CB  1 
ATOM   4163 C CG  . LYS D 1 99  ? -15.019 5.063   7.043   0.64 57.26  ? 99  LYS D CG  1 
ATOM   4164 C CD  . LYS D 1 99  ? -14.807 5.053   8.548   0.64 62.10  ? 99  LYS D CD  1 
ATOM   4165 C CE  . LYS D 1 99  ? -14.144 3.763   9.004   1.00 58.16  ? 99  LYS D CE  1 
ATOM   4166 N NZ  . LYS D 1 99  ? -14.526 2.608   8.144   0.00 49.80  ? 99  LYS D NZ  1 
ATOM   4167 N N   . ASP D 1 100 ? -17.257 8.481   4.941   1.00 49.88  ? 100 ASP D N   1 
ATOM   4168 C CA  . ASP D 1 100 ? -18.364 9.345   4.576   1.00 51.52  ? 100 ASP D CA  1 
ATOM   4169 C C   . ASP D 1 100 ? -17.987 10.391  3.565   1.00 48.12  ? 100 ASP D C   1 
ATOM   4170 O O   . ASP D 1 100 ? -17.020 11.099  3.719   1.00 46.05  ? 100 ASP D O   1 
ATOM   4171 C CB  . ASP D 1 100 ? -18.965 10.002  5.797   1.00 55.62  ? 100 ASP D CB  1 
ATOM   4172 C CG  . ASP D 1 100 ? -19.928 9.106   6.497   1.00 65.46  ? 100 ASP D CG  1 
ATOM   4173 O OD1 . ASP D 1 100 ? -20.155 9.332   7.690   1.00 76.19  ? 100 ASP D OD1 1 
ATOM   4174 O OD2 . ASP D 1 100 ? -20.459 8.175   5.856   1.00 70.08  ? 100 ASP D OD2 1 
ATOM   4175 N N   . TYR D 1 101 ? -18.779 10.459  2.513   1.00 48.15  ? 101 TYR D N   1 
ATOM   4176 C CA  . TYR D 1 101 ? -18.602 11.392  1.432   1.00 46.00  ? 101 TYR D CA  1 
ATOM   4177 C C   . TYR D 1 101 ? -18.576 12.832  1.907   1.00 45.47  ? 101 TYR D C   1 
ATOM   4178 O O   . TYR D 1 101 ? -17.812 13.631  1.411   1.00 43.71  ? 101 TYR D O   1 
ATOM   4179 C CB  . TYR D 1 101 ? -19.765 11.218  0.485   1.00 48.66  ? 101 TYR D CB  1 
ATOM   4180 C CG  . TYR D 1 101 ? -19.653 11.974  -0.797  1.00 49.03  ? 101 TYR D CG  1 
ATOM   4181 C CD1 . TYR D 1 101 ? -19.141 11.365  -1.917  1.00 49.53  ? 101 TYR D CD1 1 
ATOM   4182 C CD2 . TYR D 1 101 ? -20.070 13.273  -0.893  1.00 48.76  ? 101 TYR D CD2 1 
ATOM   4183 C CE1 . TYR D 1 101 ? -19.048 12.021  -3.081  1.00 50.24  ? 101 TYR D CE1 1 
ATOM   4184 C CE2 . TYR D 1 101 ? -19.974 13.941  -2.051  1.00 50.33  ? 101 TYR D CE2 1 
ATOM   4185 C CZ  . TYR D 1 101 ? -19.464 13.310  -3.148  1.00 51.63  ? 101 TYR D CZ  1 
ATOM   4186 O OH  . TYR D 1 101 ? -19.342 13.974  -4.340  1.00 54.84  ? 101 TYR D OH  1 
ATOM   4187 N N   . ASP D 1 102 ? -19.415 13.180  2.863   1.00 46.93  ? 102 ASP D N   1 
ATOM   4188 C CA  . ASP D 1 102 ? -19.443 14.543  3.316   1.00 47.41  ? 102 ASP D CA  1 
ATOM   4189 C C   . ASP D 1 102 ? -18.643 14.760  4.568   1.00 46.38  ? 102 ASP D C   1 
ATOM   4190 O O   . ASP D 1 102 ? -18.899 15.689  5.302   1.00 49.10  ? 102 ASP D O   1 
ATOM   4191 C CB  . ASP D 1 102 ? -20.871 15.043  3.476   1.00 51.13  ? 102 ASP D CB  1 
ATOM   4192 C CG  . ASP D 1 102 ? -21.721 14.131  4.308   1.00 57.66  ? 102 ASP D CG  1 
ATOM   4193 O OD1 . ASP D 1 102 ? -21.294 12.989  4.590   1.00 64.01  ? 102 ASP D OD1 1 
ATOM   4194 O OD2 . ASP D 1 102 ? -22.838 14.546  4.663   1.00 61.64  ? 102 ASP D OD2 1 
ATOM   4195 N N   . VAL D 1 103 ? -17.648 13.908  4.782   1.00 44.03  ? 103 VAL D N   1 
ATOM   4196 C CA  . VAL D 1 103 ? -16.715 14.000  5.906   1.00 42.66  ? 103 VAL D CA  1 
ATOM   4197 C C   . VAL D 1 103 ? -16.198 15.431  5.997   1.00 42.69  ? 103 VAL D C   1 
ATOM   4198 O O   . VAL D 1 103 ? -15.993 16.082  4.978   1.00 44.11  ? 103 VAL D O   1 
ATOM   4199 C CB  . VAL D 1 103 ? -15.504 13.061  5.662   1.00 40.25  ? 103 VAL D CB  1 
ATOM   4200 C CG1 . VAL D 1 103 ? -14.614 13.628  4.568   1.00 35.69  ? 103 VAL D CG1 1 
ATOM   4201 C CG2 . VAL D 1 103 ? -14.694 12.811  6.943   1.00 37.98  ? 103 VAL D CG2 1 
ATOM   4202 N N   . GLU D 1 104 ? -15.985 15.917  7.211   1.00 44.85  ? 104 GLU D N   1 
ATOM   4203 C CA  . GLU D 1 104 ? -15.594 17.303  7.412   1.00 46.04  ? 104 GLU D CA  1 
ATOM   4204 C C   . GLU D 1 104 ? -14.106 17.532  7.311   1.00 44.45  ? 104 GLU D C   1 
ATOM   4205 O O   . GLU D 1 104 ? -13.326 16.907  7.994   1.00 45.51  ? 104 GLU D O   1 
ATOM   4206 C CB  . GLU D 1 104 ? -16.107 17.849  8.746   1.00 49.18  ? 104 GLU D CB  1 
ATOM   4207 C CG  . GLU D 1 104 ? -15.467 19.184  9.123   1.00 54.16  ? 104 GLU D CG  1 
ATOM   4208 C CD  . GLU D 1 104 ? -15.999 19.822  10.411  1.00 62.34  ? 104 GLU D CD  1 
ATOM   4209 O OE1 . GLU D 1 104 ? -15.676 21.007  10.673  1.00 63.60  ? 104 GLU D OE1 1 
ATOM   4210 O OE2 . GLU D 1 104 ? -16.734 19.151  11.159  1.00 66.94  ? 104 GLU D OE2 1 
ATOM   4211 N N   . ILE D 1 105 ? -13.737 18.479  6.472   1.00 43.43  ? 105 ILE D N   1 
ATOM   4212 C CA  . ILE D 1 105 ? -12.367 18.883  6.322   1.00 43.17  ? 105 ILE D CA  1 
ATOM   4213 C C   . ILE D 1 105 ? -12.125 20.100  7.183   1.00 47.04  ? 105 ILE D C   1 
ATOM   4214 O O   . ILE D 1 105 ? -12.754 21.126  6.977   1.00 47.89  ? 105 ILE D O   1 
ATOM   4215 C CB  . ILE D 1 105 ? -12.065 19.288  4.848   1.00 40.92  ? 105 ILE D CB  1 
ATOM   4216 C CG1 . ILE D 1 105 ? -11.915 18.076  3.927   1.00 36.15  ? 105 ILE D CG1 1 
ATOM   4217 C CG2 . ILE D 1 105 ? -10.761 20.048  4.766   1.00 39.62  ? 105 ILE D CG2 1 
ATOM   4218 C CD1 . ILE D 1 105 ? -12.862 16.988  4.167   1.00 33.61  ? 105 ILE D CD1 1 
ATOM   4219 N N   . ARG D 1 106 ? -11.209 19.986  8.140   1.00 50.79  ? 106 ARG D N   1 
ATOM   4220 C CA  . ARG D 1 106 ? -10.743 21.136  8.914   1.00 55.29  ? 106 ARG D CA  1 
ATOM   4221 C C   . ARG D 1 106 ? -9.292  21.368  8.579   1.00 55.29  ? 106 ARG D C   1 
ATOM   4222 O O   . ARG D 1 106 ? -8.465  20.526  8.875   1.00 55.77  ? 106 ARG D O   1 
ATOM   4223 C CB  . ARG D 1 106 ? -10.820 20.872  10.424  1.00 59.81  ? 106 ARG D CB  1 
ATOM   4224 C CG  . ARG D 1 106 ? -12.066 20.169  10.945  1.00 66.23  ? 106 ARG D CG  1 
ATOM   4225 C CD  . ARG D 1 106 ? -12.032 20.026  12.494  1.00 80.02  ? 106 ARG D CD  1 
ATOM   4226 N NE  . ARG D 1 106 ? -11.012 19.067  12.922  1.00 86.61  ? 106 ARG D NE  1 
ATOM   4227 C CZ  . ARG D 1 106 ? -9.964  19.351  13.691  1.00 90.44  ? 106 ARG D CZ  1 
ATOM   4228 N NH1 . ARG D 1 106 ? -9.790  20.579  14.171  1.00 94.64  ? 106 ARG D NH1 1 
ATOM   4229 N NH2 . ARG D 1 106 ? -9.094  18.389  13.988  1.00 88.35  ? 106 ARG D NH2 1 
ATOM   4230 N N   . LEU D 1 107 ? -8.965  22.501  7.985   1.00 56.27  ? 107 LEU D N   1 
ATOM   4231 C CA  . LEU D 1 107 ? -7.560  22.819  7.736   1.00 58.11  ? 107 LEU D CA  1 
ATOM   4232 C C   . LEU D 1 107 ? -6.773  23.237  8.977   1.00 63.60  ? 107 LEU D C   1 
ATOM   4233 O O   . LEU D 1 107 ? -7.312  23.718  9.958   1.00 66.22  ? 107 LEU D O   1 
ATOM   4234 C CB  . LEU D 1 107 ? -7.409  23.921  6.687   1.00 56.91  ? 107 LEU D CB  1 
ATOM   4235 C CG  . LEU D 1 107 ? -8.129  23.754  5.366   1.00 52.70  ? 107 LEU D CG  1 
ATOM   4236 C CD1 . LEU D 1 107 ? -7.789  24.920  4.474   1.00 50.58  ? 107 LEU D CD1 1 
ATOM   4237 C CD2 . LEU D 1 107 ? -7.750  22.422  4.744   1.00 46.65  ? 107 LEU D CD2 1 
ATOM   4238 N N   . SER D 1 108 ? -5.473  23.044  8.899   1.00 67.63  ? 108 SER D N   1 
ATOM   4239 C CA  . SER D 1 108 ? -4.548  23.608  9.846   1.00 75.79  ? 108 SER D CA  1 
ATOM   4240 C C   . SER D 1 108 ? -4.184  24.985  9.274   1.00 80.70  ? 108 SER D C   1 
ATOM   4241 O O   . SER D 1 108 ? -4.754  25.401  8.267   1.00 76.26  ? 108 SER D O   1 
ATOM   4242 C CB  . SER D 1 108 ? -3.342  22.673  10.009  1.00 78.43  ? 108 SER D CB  1 
ATOM   4243 O OG  . SER D 1 108 ? -2.125  23.375  10.206  1.00 87.58  ? 108 SER D OG  1 
ATOM   4244 N N   . HIS D 1 109 ? -3.266  25.700  9.920   1.00 89.36  ? 109 HIS D N   1 
ATOM   4245 C CA  . HIS D 1 109 ? -2.789  26.967  9.392   1.00 92.53  ? 109 HIS D CA  1 
ATOM   4246 C C   . HIS D 1 109 ? -1.986  26.726  8.111   1.00 89.09  ? 109 HIS D C   1 
ATOM   4247 O O   . HIS D 1 109 ? -1.846  27.634  7.288   1.00 89.75  ? 109 HIS D O   1 
ATOM   4248 C CB  . HIS D 1 109 ? -1.938  27.694  10.437  1.00 106.21 ? 109 HIS D CB  1 
ATOM   4249 C CG  . HIS D 1 109 ? -0.661  26.985  10.778  1.00 114.46 ? 109 HIS D CG  1 
ATOM   4250 N ND1 . HIS D 1 109 ? -0.604  25.943  11.683  1.00 117.92 ? 109 HIS D ND1 1 
ATOM   4251 C CD2 . HIS D 1 109 ? 0.606   27.163  10.327  1.00 114.61 ? 109 HIS D CD2 1 
ATOM   4252 C CE1 . HIS D 1 109 ? 0.641   25.512  11.776  1.00 119.41 ? 109 HIS D CE1 1 
ATOM   4253 N NE2 . HIS D 1 109 ? 1.394   26.233  10.961  1.00 116.57 ? 109 HIS D NE2 1 
ATOM   4254 N N   . GLU D 1 110 ? -1.479  25.489  7.945   1.00 87.65  ? 110 GLU D N   1 
ATOM   4255 C CA  . GLU D 1 110 ? -0.584  25.132  6.826   1.00 83.14  ? 110 GLU D CA  1 
ATOM   4256 C C   . GLU D 1 110 ? -1.294  25.374  5.470   1.00 75.25  ? 110 GLU D C   1 
ATOM   4257 O O   . GLU D 1 110 ? -0.639  25.656  4.471   1.00 74.22  ? 110 GLU D O   1 
ATOM   4258 C CB  . GLU D 1 110 ? -0.077  23.678  6.964   1.00 83.41  ? 110 GLU D CB  1 
ATOM   4259 C CG  . GLU D 1 110 ? 0.839   23.378  8.195   0.01 94.16  ? 110 GLU D CG  1 
ATOM   4260 C CD  . GLU D 1 110 ? 2.100   24.272  8.206   0.01 107.62 ? 110 GLU D CD  1 
ATOM   4261 O OE1 . GLU D 1 110 ? 2.686   24.503  7.103   0.01 110.32 ? 110 GLU D OE1 1 
ATOM   4262 O OE2 . GLU D 1 110 ? 2.528   24.755  9.318   0.01 114.42 ? 110 GLU D OE2 1 
ATOM   4263 N N   . HIS D 1 111 ? -2.624  25.289  5.441   1.00 70.06  ? 111 HIS D N   1 
ATOM   4264 C CA  . HIS D 1 111 ? -3.369  25.595  4.219   1.00 66.32  ? 111 HIS D CA  1 
ATOM   4265 C C   . HIS D 1 111 ? -4.502  26.598  4.354   1.00 66.40  ? 111 HIS D C   1 
ATOM   4266 O O   . HIS D 1 111 ? -5.096  26.747  5.393   1.00 67.82  ? 111 HIS D O   1 
ATOM   4267 C CB  . HIS D 1 111 ? -3.864  24.306  3.570   1.00 61.95  ? 111 HIS D CB  1 
ATOM   4268 C CG  . HIS D 1 111 ? -2.817  23.243  3.529   1.00 59.22  ? 111 HIS D CG  1 
ATOM   4269 N ND1 . HIS D 1 111 ? -1.894  23.134  2.507   1.00 55.23  ? 111 HIS D ND1 1 
ATOM   4270 C CD2 . HIS D 1 111 ? -2.514  22.272  4.420   1.00 56.96  ? 111 HIS D CD2 1 
ATOM   4271 C CE1 . HIS D 1 111 ? -1.083  22.127  2.761   1.00 54.15  ? 111 HIS D CE1 1 
ATOM   4272 N NE2 . HIS D 1 111 ? -1.440  21.586  3.914   1.00 55.73  ? 111 HIS D NE2 1 
ATOM   4273 N N   . GLN D 1 112 ? -4.791  27.279  3.266   1.00 65.60  ? 112 GLN D N   1 
ATOM   4274 C CA  . GLN D 1 112 ? -5.816  28.293  3.266   1.00 66.21  ? 112 GLN D CA  1 
ATOM   4275 C C   . GLN D 1 112 ? -7.079  27.863  2.553   1.00 62.26  ? 112 GLN D C   1 
ATOM   4276 O O   . GLN D 1 112 ? -8.084  28.543  2.658   1.00 65.63  ? 112 GLN D O   1 
ATOM   4277 C CB  . GLN D 1 112 ? -5.279  29.558  2.608   1.00 70.91  ? 112 GLN D CB  1 
ATOM   4278 C CG  . GLN D 1 112 ? -4.030  29.325  1.793   1.00 74.68  ? 112 GLN D CG  1 
ATOM   4279 C CD  . GLN D 1 112 ? -4.146  29.864  0.415   1.00 79.66  ? 112 GLN D CD  1 
ATOM   4280 O OE1 . GLN D 1 112 ? -3.558  30.868  0.092   1.00 83.53  ? 112 GLN D OE1 1 
ATOM   4281 N NE2 . GLN D 1 112 ? -4.916  29.200  -0.411  1.00 80.77  ? 112 GLN D NE2 1 
ATOM   4282 N N   . ALA D 1 113 ? -7.025  26.765  1.800   1.00 56.62  ? 113 ALA D N   1 
ATOM   4283 C CA  . ALA D 1 113 ? -8.192  26.283  1.049   1.00 51.61  ? 113 ALA D CA  1 
ATOM   4284 C C   . ALA D 1 113 ? -8.114  24.798  0.702   1.00 47.43  ? 113 ALA D C   1 
ATOM   4285 O O   . ALA D 1 113 ? -7.061  24.179  0.820   1.00 46.84  ? 113 ALA D O   1 
ATOM   4286 C CB  . ALA D 1 113 ? -8.388  27.107  -0.213  1.00 51.85  ? 113 ALA D CB  1 
ATOM   4287 N N   . TYR D 1 114 ? -9.230  24.238  0.246   1.00 43.60  ? 114 TYR D N   1 
ATOM   4288 C CA  . TYR D 1 114 ? -9.253  22.862  -0.205  1.00 39.30  ? 114 TYR D CA  1 
ATOM   4289 C C   . TYR D 1 114 ? -10.261 22.659  -1.316  1.00 38.22  ? 114 TYR D C   1 
ATOM   4290 O O   . TYR D 1 114 ? -11.137 23.470  -1.489  1.00 39.90  ? 114 TYR D O   1 
ATOM   4291 C CB  . TYR D 1 114 ? -9.565  21.956  0.974   1.00 37.58  ? 114 TYR D CB  1 
ATOM   4292 C CG  . TYR D 1 114 ? -10.974 22.041  1.512   1.00 35.79  ? 114 TYR D CG  1 
ATOM   4293 C CD1 . TYR D 1 114 ? -11.269 22.840  2.592   1.00 36.30  ? 114 TYR D CD1 1 
ATOM   4294 C CD2 . TYR D 1 114 ? -11.989 21.281  0.972   1.00 32.24  ? 114 TYR D CD2 1 
ATOM   4295 C CE1 . TYR D 1 114 ? -12.529 22.894  3.105   1.00 37.24  ? 114 TYR D CE1 1 
ATOM   4296 C CE2 . TYR D 1 114 ? -13.256 21.338  1.462   1.00 33.43  ? 114 TYR D CE2 1 
ATOM   4297 C CZ  . TYR D 1 114 ? -13.523 22.142  2.533   1.00 37.80  ? 114 TYR D CZ  1 
ATOM   4298 O OH  . TYR D 1 114 ? -14.794 22.192  3.044   1.00 41.82  ? 114 TYR D OH  1 
ATOM   4299 N N   . ARG D 1 115 ? -10.149 21.569  -2.058  1.00 36.16  ? 115 ARG D N   1 
ATOM   4300 C CA  . ARG D 1 115 ? -11.139 21.242  -3.078  1.00 36.03  ? 115 ARG D CA  1 
ATOM   4301 C C   . ARG D 1 115 ? -11.283 19.745  -3.233  1.00 34.49  ? 115 ARG D C   1 
ATOM   4302 O O   . ARG D 1 115 ? -10.299 19.026  -3.128  1.00 33.24  ? 115 ARG D O   1 
ATOM   4303 C CB  . ARG D 1 115 ? -10.715 21.801  -4.439  1.00 37.44  ? 115 ARG D CB  1 
ATOM   4304 C CG  . ARG D 1 115 ? -11.114 23.235  -4.724  1.00 39.88  ? 115 ARG D CG  1 
ATOM   4305 C CD  . ARG D 1 115 ? -12.501 23.505  -4.271  1.00 40.11  ? 115 ARG D CD  1 
ATOM   4306 N NE  . ARG D 1 115 ? -12.978 24.798  -4.720  1.00 44.59  ? 115 ARG D NE  1 
ATOM   4307 C CZ  . ARG D 1 115 ? -12.944 25.927  -4.001  1.00 46.85  ? 115 ARG D CZ  1 
ATOM   4308 N NH1 . ARG D 1 115 ? -12.421 25.968  -2.780  1.00 45.42  ? 115 ARG D NH1 1 
ATOM   4309 N NH2 . ARG D 1 115 ? -13.444 27.039  -4.517  1.00 48.07  ? 115 ARG D NH2 1 
ATOM   4310 N N   . TRP D 1 116 ? -12.504 19.286  -3.479  1.00 34.35  ? 116 TRP D N   1 
ATOM   4311 C CA  . TRP D 1 116 ? -12.754 17.935  -3.933  1.00 33.68  ? 116 TRP D CA  1 
ATOM   4312 C C   . TRP D 1 116 ? -12.844 18.059  -5.446  1.00 35.04  ? 116 TRP D C   1 
ATOM   4313 O O   . TRP D 1 116 ? -13.671 18.798  -5.956  1.00 37.17  ? 116 TRP D O   1 
ATOM   4314 C CB  . TRP D 1 116 ? -14.075 17.391  -3.378  1.00 33.65  ? 116 TRP D CB  1 
ATOM   4315 C CG  . TRP D 1 116 ? -14.012 16.862  -1.961  1.00 33.03  ? 116 TRP D CG  1 
ATOM   4316 C CD1 . TRP D 1 116 ? -14.573 17.430  -0.867  1.00 33.83  ? 116 TRP D CD1 1 
ATOM   4317 C CD2 . TRP D 1 116 ? -13.403 15.647  -1.503  1.00 29.86  ? 116 TRP D CD2 1 
ATOM   4318 N NE1 . TRP D 1 116 ? -14.333 16.680  0.242   1.00 31.31  ? 116 TRP D NE1 1 
ATOM   4319 C CE2 . TRP D 1 116 ? -13.615 15.574  -0.118  1.00 30.27  ? 116 TRP D CE2 1 
ATOM   4320 C CE3 . TRP D 1 116 ? -12.682 14.630  -2.121  1.00 29.34  ? 116 TRP D CE3 1 
ATOM   4321 C CZ2 . TRP D 1 116 ? -13.126 14.521  0.668   1.00 27.94  ? 116 TRP D CZ2 1 
ATOM   4322 C CZ3 . TRP D 1 116 ? -12.192 13.584  -1.333  1.00 29.46  ? 116 TRP D CZ3 1 
ATOM   4323 C CH2 . TRP D 1 116 ? -12.426 13.545  0.049   1.00 26.17  ? 116 TRP D CH2 1 
ATOM   4324 N N   . LEU D 1 117 ? -11.992 17.344  -6.157  1.00 34.44  ? 117 LEU D N   1 
ATOM   4325 C CA  . LEU D 1 117 ? -11.884 17.479  -7.602  1.00 36.89  ? 117 LEU D CA  1 
ATOM   4326 C C   . LEU D 1 117 ? -11.792 16.149  -8.345  1.00 37.23  ? 117 LEU D C   1 
ATOM   4327 O O   . LEU D 1 117 ? -11.203 15.197  -7.865  1.00 36.79  ? 117 LEU D O   1 
ATOM   4328 C CB  . LEU D 1 117 ? -10.622 18.264  -7.938  1.00 36.88  ? 117 LEU D CB  1 
ATOM   4329 C CG  . LEU D 1 117 ? -10.349 19.633  -7.312  1.00 38.98  ? 117 LEU D CG  1 
ATOM   4330 C CD1 . LEU D 1 117 ? -8.875  19.959  -7.356  1.00 37.53  ? 117 LEU D CD1 1 
ATOM   4331 C CD2 . LEU D 1 117 ? -11.147 20.750  -7.980  1.00 41.37  ? 117 LEU D CD2 1 
ATOM   4332 N N   . GLY D 1 118 ? -12.324 16.099  -9.549  1.00 39.45  ? 118 GLY D N   1 
ATOM   4333 C CA  . GLY D 1 118 ? -12.140 14.944  -10.416 1.00 40.66  ? 118 GLY D CA  1 
ATOM   4334 C C   . GLY D 1 118 ? -10.730 14.935  -10.953 1.00 40.28  ? 118 GLY D C   1 
ATOM   4335 O O   . GLY D 1 118 ? -10.027 15.904  -10.799 1.00 39.55  ? 118 GLY D O   1 
ATOM   4336 N N   . LEU D 1 119 ? -10.327 13.865  -11.618 1.00 41.06  ? 119 LEU D N   1 
ATOM   4337 C CA  . LEU D 1 119 ? -8.953  13.749  -12.046 1.00 41.96  ? 119 LEU D CA  1 
ATOM   4338 C C   . LEU D 1 119 ? -8.448  14.920  -12.882 1.00 46.71  ? 119 LEU D C   1 
ATOM   4339 O O   . LEU D 1 119 ? -7.315  15.326  -12.743 1.00 46.31  ? 119 LEU D O   1 
ATOM   4340 C CB  . LEU D 1 119 ? -8.706  12.419  -12.745 1.00 41.00  ? 119 LEU D CB  1 
ATOM   4341 C CG  . LEU D 1 119 ? -7.235  12.136  -13.095 1.00 39.46  ? 119 LEU D CG  1 
ATOM   4342 C CD1 . LEU D 1 119 ? -6.341  11.818  -11.898 1.00 27.55  ? 119 LEU D CD1 1 
ATOM   4343 C CD2 . LEU D 1 119 ? -7.163  11.046  -14.112 1.00 37.02  ? 119 LEU D CD2 1 
ATOM   4344 N N   . GLU D 1 120 ? -9.286  15.478  -13.732 1.00 52.61  ? 120 GLU D N   1 
ATOM   4345 C CA  . GLU D 1 120 ? -8.837  16.539  -14.599 1.00 59.81  ? 120 GLU D CA  1 
ATOM   4346 C C   . GLU D 1 120 ? -8.420  17.813  -13.871 1.00 58.85  ? 120 GLU D C   1 
ATOM   4347 O O   . GLU D 1 120 ? -7.288  18.262  -14.027 1.00 59.85  ? 120 GLU D O   1 
ATOM   4348 C CB  . GLU D 1 120 ? -9.953  16.881  -15.576 1.00 70.38  ? 120 GLU D CB  1 
ATOM   4349 C CG  . GLU D 1 120 ? -9.504  17.344  -16.945 1.00 83.60  ? 120 GLU D CG  1 
ATOM   4350 C CD  . GLU D 1 120 ? -9.615  16.244  -17.938 1.00 96.86  ? 120 GLU D CD  1 
ATOM   4351 O OE1 . GLU D 1 120 ? -10.441 16.363  -18.865 1.00 103.42 ? 120 GLU D OE1 1 
ATOM   4352 O OE2 . GLU D 1 120 ? -8.895  15.243  -17.761 1.00 101.23 ? 120 GLU D OE2 1 
ATOM   4353 N N   . GLU D 1 121 ? -9.337  18.399  -13.104 1.00 57.62  ? 121 GLU D N   1 
ATOM   4354 C CA  . GLU D 1 121 ? -9.067  19.640  -12.410 1.00 57.59  ? 121 GLU D CA  1 
ATOM   4355 C C   . GLU D 1 121 ? -7.957  19.343  -11.429 1.00 53.58  ? 121 GLU D C   1 
ATOM   4356 O O   . GLU D 1 121 ? -7.081  20.155  -11.198 1.00 54.32  ? 121 GLU D O   1 
ATOM   4357 C CB  . GLU D 1 121 ? -10.331 20.159  -11.700 1.00 60.04  ? 121 GLU D CB  1 
ATOM   4358 C CG  . GLU D 1 121 ? -11.463 20.554  -12.636 1.00 74.16  ? 121 GLU D CG  1 
ATOM   4359 C CD  . GLU D 1 121 ? -12.365 19.366  -13.059 1.00 87.60  ? 121 GLU D CD  1 
ATOM   4360 O OE1 . GLU D 1 121 ? -12.051 18.201  -12.646 1.00 89.94  ? 121 GLU D OE1 1 
ATOM   4361 O OE2 . GLU D 1 121 ? -13.376 19.574  -13.783 1.00 97.01  ? 121 GLU D OE2 1 
ATOM   4362 N N   . ALA D 1 122 ? -7.978  18.154  -10.862 1.00 49.40  ? 122 ALA D N   1 
ATOM   4363 C CA  . ALA D 1 122 ? -6.980  17.796  -9.895  1.00 46.68  ? 122 ALA D CA  1 
ATOM   4364 C C   . ALA D 1 122 ? -5.582  17.806  -10.437 1.00 48.05  ? 122 ALA D C   1 
ATOM   4365 O O   . ALA D 1 122 ? -4.675  18.281  -9.785  1.00 47.44  ? 122 ALA D O   1 
ATOM   4366 C CB  . ALA D 1 122 ? -7.266  16.476  -9.363  1.00 44.20  ? 122 ALA D CB  1 
ATOM   4367 N N   . CYS D 1 123 ? -5.385  17.256  -11.618 1.00 50.43  ? 123 CYS D N   1 
ATOM   4368 C CA  . CYS D 1 123 ? -4.050  17.221  -12.181 1.00 52.78  ? 123 CYS D CA  1 
ATOM   4369 C C   . CYS D 1 123 ? -3.602  18.619  -12.541 1.00 58.12  ? 123 CYS D C   1 
ATOM   4370 O O   . CYS D 1 123 ? -2.426  18.965  -12.433 1.00 58.73  ? 123 CYS D O   1 
ATOM   4371 C CB  . CYS D 1 123 ? -4.018  16.331  -13.389 1.00 53.00  ? 123 CYS D CB  1 
ATOM   4372 S SG  . CYS D 1 123 ? -3.894  14.678  -12.933 1.00 47.07  ? 123 CYS D SG  1 
ATOM   4373 N N   . GLN D 1 124 ? -4.570  19.420  -12.969 1.00 62.77  ? 124 GLN D N   1 
ATOM   4374 C CA  . GLN D 1 124 ? -4.340  20.795  -13.376 1.00 71.01  ? 124 GLN D CA  1 
ATOM   4375 C C   . GLN D 1 124 ? -3.756  21.576  -12.233 1.00 68.22  ? 124 GLN D C   1 
ATOM   4376 O O   . GLN D 1 124 ? -2.861  22.377  -12.419 1.00 71.05  ? 124 GLN D O   1 
ATOM   4377 C CB  . GLN D 1 124 ? -5.674  21.439  -13.708 1.00 77.14  ? 124 GLN D CB  1 
ATOM   4378 C CG  . GLN D 1 124 ? -5.898  21.883  -15.131 1.00 87.69  ? 124 GLN D CG  1 
ATOM   4379 C CD  . GLN D 1 124 ? -7.143  22.742  -15.214 1.00 91.02  ? 124 GLN D CD  1 
ATOM   4380 O OE1 . GLN D 1 124 ? -8.264  22.245  -15.022 1.00 89.06  ? 124 GLN D OE1 1 
ATOM   4381 N NE2 . GLN D 1 124 ? -6.951  24.047  -15.460 1.00 93.52  ? 124 GLN D NE2 1 
ATOM   4382 N N   . LEU D 1 125 ? -4.313  21.357  -11.053 1.00 65.23  ? 125 LEU D N   1 
ATOM   4383 C CA  . LEU D 1 125 ? -3.890  22.048  -9.859  1.00 64.51  ? 125 LEU D CA  1 
ATOM   4384 C C   . LEU D 1 125 ? -2.539  21.604  -9.375  1.00 64.39  ? 125 LEU D C   1 
ATOM   4385 O O   . LEU D 1 125 ? -1.727  22.421  -8.978  1.00 66.14  ? 125 LEU D O   1 
ATOM   4386 C CB  . LEU D 1 125 ? -4.922  21.892  -8.755  1.00 61.30  ? 125 LEU D CB  1 
ATOM   4387 C CG  . LEU D 1 125 ? -6.185  22.708  -8.983  1.00 61.55  ? 125 LEU D CG  1 
ATOM   4388 C CD1 . LEU D 1 125 ? -6.997  22.840  -7.722  1.00 57.73  ? 125 LEU D CD1 1 
ATOM   4389 C CD2 . LEU D 1 125 ? -5.778  24.066  -9.453  1.00 66.78  ? 125 LEU D CD2 1 
ATOM   4390 N N   . ALA D 1 126 ? -2.284  20.310  -9.388  1.00 63.39  ? 126 ALA D N   1 
ATOM   4391 C CA  . ALA D 1 126 ? -0.986  19.850  -8.922  1.00 65.62  ? 126 ALA D CA  1 
ATOM   4392 C C   . ALA D 1 126 ? 0.092   20.547  -9.730  1.00 71.43  ? 126 ALA D C   1 
ATOM   4393 O O   . ALA D 1 126 ? 1.078   21.012  -9.172  1.00 70.80  ? 126 ALA D O   1 
ATOM   4394 C CB  . ALA D 1 126 ? -0.861  18.340  -9.045  1.00 61.77  ? 126 ALA D CB  1 
ATOM   4395 N N   . GLN D 1 127 ? -0.113  20.593  -11.053 1.00 76.49  ? 127 GLN D N   1 
ATOM   4396 C CA  . GLN D 1 127 ? 0.778   21.256  -12.011 1.00 81.03  ? 127 GLN D CA  1 
ATOM   4397 C C   . GLN D 1 127 ? 2.202   20.708  -11.925 1.00 84.03  ? 127 GLN D C   1 
ATOM   4398 O O   . GLN D 1 127 ? 3.117   21.192  -12.589 1.00 94.39  ? 127 GLN D O   1 
ATOM   4399 C CB  . GLN D 1 127 ? 0.747   22.775  -11.840 1.00 81.67  ? 127 GLN D CB  1 
ATOM   4400 N N   . PHE D 1 128 ? 2.387   19.693  -11.101 1.00 78.09  ? 128 PHE D N   1 
ATOM   4401 C CA  . PHE D 1 128 ? 3.696   19.169  -10.831 1.00 75.73  ? 128 PHE D CA  1 
ATOM   4402 C C   . PHE D 1 128 ? 3.751   17.695  -11.268 1.00 70.68  ? 128 PHE D C   1 
ATOM   4403 O O   . PHE D 1 128 ? 2.988   16.867  -10.798 1.00 67.58  ? 128 PHE D O   1 
ATOM   4404 C CB  . PHE D 1 128 ? 3.973   19.359  -9.358  1.00 72.88  ? 128 PHE D CB  1 
ATOM   4405 C CG  . PHE D 1 128 ? 5.154   18.653  -8.895  1.00 76.79  ? 128 PHE D CG  1 
ATOM   4406 C CD1 . PHE D 1 128 ? 6.318   18.696  -9.632  1.00 85.21  ? 128 PHE D CD1 1 
ATOM   4407 C CD2 . PHE D 1 128 ? 5.115   17.934  -7.721  1.00 78.02  ? 128 PHE D CD2 1 
ATOM   4408 C CE1 . PHE D 1 128 ? 7.424   18.034  -9.220  1.00 87.98  ? 128 PHE D CE1 1 
ATOM   4409 C CE2 . PHE D 1 128 ? 6.216   17.270  -7.286  1.00 81.09  ? 128 PHE D CE2 1 
ATOM   4410 C CZ  . PHE D 1 128 ? 7.382   17.321  -8.041  1.00 86.45  ? 128 PHE D CZ  1 
ATOM   4411 N N   . LYS D 1 129 ? 4.661   17.388  -12.176 1.00 71.05  ? 129 LYS D N   1 
ATOM   4412 C CA  . LYS D 1 129 ? 4.585   16.211  -13.032 1.00 69.32  ? 129 LYS D CA  1 
ATOM   4413 C C   . LYS D 1 129 ? 4.369   14.893  -12.284 1.00 63.08  ? 129 LYS D C   1 
ATOM   4414 O O   . LYS D 1 129 ? 3.535   14.068  -12.654 1.00 61.90  ? 129 LYS D O   1 
ATOM   4415 C CB  . LYS D 1 129 ? 5.881   16.119  -13.841 1.00 73.05  ? 129 LYS D CB  1 
ATOM   4416 C CG  . LYS D 1 129 ? 5.714   15.999  -15.327 1.00 81.13  ? 129 LYS D CG  1 
ATOM   4417 C CD  . LYS D 1 129 ? 7.051   15.649  -15.936 1.00 89.90  ? 129 LYS D CD  1 
ATOM   4418 C CE  . LYS D 1 129 ? 7.499   16.707  -16.915 1.00 102.69 ? 129 LYS D CE  1 
ATOM   4419 N NZ  . LYS D 1 129 ? 8.971   16.677  -17.124 1.00 108.18 ? 129 LYS D NZ  1 
ATOM   4420 N N   . GLU D 1 130 ? 5.150   14.698  -11.238 1.00 58.94  ? 130 GLU D N   1 
ATOM   4421 C CA  . GLU D 1 130 ? 5.124   13.476  -10.486 1.00 53.39  ? 130 GLU D CA  1 
ATOM   4422 C C   . GLU D 1 130 ? 3.817   13.354  -9.755  1.00 47.55  ? 130 GLU D C   1 
ATOM   4423 O O   . GLU D 1 130 ? 3.302   12.278  -9.605  1.00 45.04  ? 130 GLU D O   1 
ATOM   4424 C CB  . GLU D 1 130 ? 6.252   13.499  -9.476  1.00 57.29  ? 130 GLU D CB  1 
ATOM   4425 C CG  . GLU D 1 130 ? 7.112   14.713  -9.615  1.00 69.15  ? 130 GLU D CG  1 
ATOM   4426 C CD  . GLU D 1 130 ? 8.341   14.455  -10.415 1.00 81.09  ? 130 GLU D CD  1 
ATOM   4427 O OE1 . GLU D 1 130 ? 8.951   13.380  -10.210 1.00 84.34  ? 130 GLU D OE1 1 
ATOM   4428 O OE2 . GLU D 1 130 ? 8.702   15.339  -11.223 1.00 87.30  ? 130 GLU D OE2 1 
ATOM   4429 N N   . MET D 1 131 ? 3.293   14.465  -9.276  1.00 44.92  ? 131 MET D N   1 
ATOM   4430 C CA  . MET D 1 131 ? 2.023   14.461  -8.582  1.00 40.45  ? 131 MET D CA  1 
ATOM   4431 C C   . MET D 1 131 ? 0.892   14.116  -9.507  1.00 39.22  ? 131 MET D C   1 
ATOM   4432 O O   . MET D 1 131 ? -0.016  13.414  -9.122  1.00 36.71  ? 131 MET D O   1 
ATOM   4433 C CB  . MET D 1 131 ? 1.756   15.806  -7.912  1.00 41.55  ? 131 MET D CB  1 
ATOM   4434 C CG  . MET D 1 131 ? 0.588   15.814  -6.958  1.00 39.04  ? 131 MET D CG  1 
ATOM   4435 S SD  . MET D 1 131 ? 0.813   14.603  -5.654  1.00 36.62  ? 131 MET D SD  1 
ATOM   4436 C CE  . MET D 1 131 ? 2.007   15.478  -4.657  1.00 44.23  ? 131 MET D CE  1 
ATOM   4437 N N   . LYS D 1 132 ? 0.928   14.639  -10.719 1.00 48.09  ? 132 LYS D N   1 
ATOM   4438 C CA  . LYS D 1 132 ? -0.100  14.332  -11.686 1.00 47.47  ? 132 LYS D CA  1 
ATOM   4439 C C   . LYS D 1 132 ? -0.058  12.868  -12.042 1.00 44.18  ? 132 LYS D C   1 
ATOM   4440 O O   . LYS D 1 132 ? -1.089  12.236  -12.153 1.00 43.69  ? 132 LYS D O   1 
ATOM   4441 C CB  . LYS D 1 132 ? 0.069   15.144  -12.950 1.00 53.59  ? 132 LYS D CB  1 
ATOM   4442 C CG  . LYS D 1 132 ? 0.277   16.599  -12.749 1.00 63.58  ? 132 LYS D CG  1 
ATOM   4443 C CD  . LYS D 1 132 ? 0.550   17.216  -14.099 1.00 76.31  ? 132 LYS D CD  1 
ATOM   4444 C CE  . LYS D 1 132 ? 0.814   18.681  -13.987 1.00 82.38  ? 132 LYS D CE  1 
ATOM   4445 N NZ  . LYS D 1 132 ? 0.835   19.316  -15.321 1.00 91.45  ? 132 LYS D NZ  1 
ATOM   4446 N N   . ALA D 1 133 ? 1.141   12.337  -12.241 1.00 42.53  ? 133 ALA D N   1 
ATOM   4447 C CA  . ALA D 1 133 ? 1.332   10.920  -12.531 1.00 39.07  ? 133 ALA D CA  1 
ATOM   4448 C C   . ALA D 1 133 ? 0.733   10.094  -11.426 1.00 34.33  ? 133 ALA D C   1 
ATOM   4449 O O   . ALA D 1 133 ? -0.008  9.172   -11.655 1.00 33.21  ? 133 ALA D O   1 
ATOM   4450 C CB  . ALA D 1 133 ? 2.790   10.615  -12.632 1.00 40.52  ? 133 ALA D CB  1 
ATOM   4451 N N   . ALA D 1 134 ? 1.052   10.462  -10.209 1.00 30.61  ? 134 ALA D N   1 
ATOM   4452 C CA  . ALA D 1 134 ? 0.593   9.744   -9.059  1.00 28.18  ? 134 ALA D CA  1 
ATOM   4453 C C   . ALA D 1 134 ? -0.913  9.655   -9.031  1.00 26.14  ? 134 ALA D C   1 
ATOM   4454 O O   . ALA D 1 134 ? -1.471  8.585   -8.773  1.00 23.85  ? 134 ALA D O   1 
ATOM   4455 C CB  . ALA D 1 134 ? 1.097   10.463  -7.784  1.00 26.28  ? 134 ALA D CB  1 
ATOM   4456 N N   . LEU D 1 135 ? -1.550  10.813  -9.233  1.00 26.47  ? 135 LEU D N   1 
ATOM   4457 C CA  . LEU D 1 135 ? -2.992  10.913  -9.231  1.00 25.91  ? 135 LEU D CA  1 
ATOM   4458 C C   . LEU D 1 135 ? -3.585  10.087  -10.355 1.00 27.32  ? 135 LEU D C   1 
ATOM   4459 O O   . LEU D 1 135 ? -4.519  9.334   -10.132 1.00 26.58  ? 135 LEU D O   1 
ATOM   4460 C CB  . LEU D 1 135 ? -3.444  12.361  -9.342  1.00 26.15  ? 135 LEU D CB  1 
ATOM   4461 C CG  . LEU D 1 135 ? -3.128  13.295  -8.174  1.00 26.34  ? 135 LEU D CG  1 
ATOM   4462 C CD1 . LEU D 1 135 ? -3.360  14.738  -8.563  1.00 25.67  ? 135 LEU D CD1 1 
ATOM   4463 C CD2 . LEU D 1 135 ? -3.877  12.962  -6.878  1.00 20.89  ? 135 LEU D CD2 1 
ATOM   4464 N N   . GLN D 1 136 ? -3.039  10.211  -11.555 1.00 30.80  ? 136 GLN D N   1 
ATOM   4465 C CA  . GLN D 1 136 ? -3.546  9.453   -12.679 1.00 34.11  ? 136 GLN D CA  1 
ATOM   4466 C C   . GLN D 1 136 ? -3.453  7.969   -12.430 1.00 32.96  ? 136 GLN D C   1 
ATOM   4467 O O   . GLN D 1 136 ? -4.377  7.216   -12.691 1.00 33.12  ? 136 GLN D O   1 
ATOM   4468 C CB  . GLN D 1 136 ? -2.755  9.777   -13.899 1.00 39.35  ? 136 GLN D CB  1 
ATOM   4469 C CG  . GLN D 1 136 ? -2.803  11.215  -14.278 1.00 51.11  ? 136 GLN D CG  1 
ATOM   4470 C CD  . GLN D 1 136 ? -2.281  11.477  -15.679 1.00 62.81  ? 136 GLN D CD  1 
ATOM   4471 O OE1 . GLN D 1 136 ? -1.441  10.735  -16.196 1.00 67.66  ? 136 GLN D OE1 1 
ATOM   4472 N NE2 . GLN D 1 136 ? -2.777  12.543  -16.296 1.00 65.81  ? 136 GLN D NE2 1 
ATOM   4473 N N   . GLU D 1 137 ? -2.326  7.557   -11.894 1.00 32.10  ? 137 GLU D N   1 
ATOM   4474 C CA  . GLU D 1 137 ? -2.110  6.179   -11.600 1.00 32.11  ? 137 GLU D CA  1 
ATOM   4475 C C   . GLU D 1 137 ? -3.034  5.652   -10.527 1.00 30.64  ? 137 GLU D C   1 
ATOM   4476 O O   . GLU D 1 137 ? -3.500  4.527   -10.623 1.00 30.25  ? 137 GLU D O   1 
ATOM   4477 C CB  . GLU D 1 137 ? -0.676  5.960   -11.210 1.00 32.53  ? 137 GLU D CB  1 
ATOM   4478 C CG  . GLU D 1 137 ? 0.227   5.938   -12.386 1.00 38.15  ? 137 GLU D CG  1 
ATOM   4479 C CD  . GLU D 1 137 ? 1.625   6.348   -12.055 1.00 44.85  ? 137 GLU D CD  1 
ATOM   4480 O OE1 . GLU D 1 137 ? 2.046   6.182   -10.898 1.00 47.29  ? 137 GLU D OE1 1 
ATOM   4481 O OE2 . GLU D 1 137 ? 2.316   6.849   -12.954 1.00 50.76  ? 137 GLU D OE2 1 
ATOM   4482 N N   . GLY D 1 138 ? -3.305  6.453   -9.505  1.00 29.69  ? 138 GLY D N   1 
ATOM   4483 C CA  . GLY D 1 138 ? -4.261  6.064   -8.471  1.00 30.21  ? 138 GLY D CA  1 
ATOM   4484 C C   . GLY D 1 138 ? -5.691  5.920   -8.979  1.00 32.59  ? 138 GLY D C   1 
ATOM   4485 O O   . GLY D 1 138 ? -6.423  5.000   -8.601  1.00 31.29  ? 138 GLY D O   1 
ATOM   4486 N N   . HIS D 1 139 ? -6.107  6.851   -9.820  1.00 35.42  ? 139 HIS D N   1 
ATOM   4487 C CA  . HIS D 1 139 ? -7.402  6.744   -10.415 1.00 39.31  ? 139 HIS D CA  1 
ATOM   4488 C C   . HIS D 1 139 ? -7.494  5.407   -11.156 1.00 41.12  ? 139 HIS D C   1 
ATOM   4489 O O   . HIS D 1 139 ? -8.437  4.630   -10.978 1.00 41.21  ? 139 HIS D O   1 
ATOM   4490 C CB  . HIS D 1 139 ? -7.607  7.919   -11.372 1.00 43.39  ? 139 HIS D CB  1 
ATOM   4491 C CG  . HIS D 1 139 ? -9.018  8.073   -11.841 1.00 46.91  ? 139 HIS D CG  1 
ATOM   4492 N ND1 . HIS D 1 139 ? -9.460  7.551   -13.035 1.00 50.67  ? 139 HIS D ND1 1 
ATOM   4493 C CD2 . HIS D 1 139 ? -10.087 8.674   -11.270 1.00 47.67  ? 139 HIS D CD2 1 
ATOM   4494 C CE1 . HIS D 1 139 ? -10.741 7.827   -13.183 1.00 53.30  ? 139 HIS D CE1 1 
ATOM   4495 N NE2 . HIS D 1 139 ? -11.146 8.508   -12.127 1.00 52.10  ? 139 HIS D NE2 1 
ATOM   4496 N N   . GLN D 1 140 ? -6.474  5.138   -11.964 1.00 42.92  ? 140 GLN D N   1 
ATOM   4497 C CA  . GLN D 1 140 ? -6.451  3.951   -12.804 1.00 45.39  ? 140 GLN D CA  1 
ATOM   4498 C C   . GLN D 1 140 ? -6.494  2.693   -11.979 1.00 43.02  ? 140 GLN D C   1 
ATOM   4499 O O   . GLN D 1 140 ? -7.148  1.739   -12.337 1.00 44.63  ? 140 GLN D O   1 
ATOM   4500 C CB  . GLN D 1 140 ? -5.211  3.948   -13.676 1.00 47.20  ? 140 GLN D CB  1 
ATOM   4501 C CG  . GLN D 1 140 ? -5.401  3.238   -14.982 1.00 56.97  ? 140 GLN D CG  1 
ATOM   4502 C CD  . GLN D 1 140 ? -4.188  2.467   -15.386 1.00 67.09  ? 140 GLN D CD  1 
ATOM   4503 O OE1 . GLN D 1 140 ? -3.108  2.696   -14.882 1.00 68.43  ? 140 GLN D OE1 1 
ATOM   4504 N NE2 . GLN D 1 140 ? -4.361  1.538   -16.291 1.00 75.00  ? 140 GLN D NE2 1 
ATOM   4505 N N   . PHE D 1 141 ? -5.773  2.701   -10.872 1.00 40.49  ? 141 PHE D N   1 
ATOM   4506 C CA  . PHE D 1 141 ? -5.743  1.568   -9.984  1.00 39.24  ? 141 PHE D CA  1 
ATOM   4507 C C   . PHE D 1 141 ? -7.144  1.268   -9.462  1.00 39.54  ? 141 PHE D C   1 
ATOM   4508 O O   . PHE D 1 141 ? -7.617  0.140   -9.556  1.00 39.67  ? 141 PHE D O   1 
ATOM   4509 C CB  . PHE D 1 141 ? -4.779  1.858   -8.846  1.00 37.20  ? 141 PHE D CB  1 
ATOM   4510 C CG  . PHE D 1 141 ? -4.783  0.832   -7.778  1.00 36.27  ? 141 PHE D CG  1 
ATOM   4511 C CD1 . PHE D 1 141 ? -5.422  1.071   -6.597  1.00 33.85  ? 141 PHE D CD1 1 
ATOM   4512 C CD2 . PHE D 1 141 ? -4.163  -0.380  -7.958  1.00 38.77  ? 141 PHE D CD2 1 
ATOM   4513 C CE1 . PHE D 1 141 ? -5.444  0.148   -5.618  1.00 36.06  ? 141 PHE D CE1 1 
ATOM   4514 C CE2 . PHE D 1 141 ? -4.184  -1.320  -6.964  1.00 41.04  ? 141 PHE D CE2 1 
ATOM   4515 C CZ  . PHE D 1 141 ? -4.822  -1.054  -5.791  1.00 38.32  ? 141 PHE D CZ  1 
ATOM   4516 N N   . LEU D 1 142 ? -7.799  2.302   -8.937  1.00 39.34  ? 142 LEU D N   1 
ATOM   4517 C CA  . LEU D 1 142 ? -9.160  2.208   -8.450  1.00 39.87  ? 142 LEU D CA  1 
ATOM   4518 C C   . LEU D 1 142 ? -10.158 1.729   -9.477  1.00 43.22  ? 142 LEU D C   1 
ATOM   4519 O O   . LEU D 1 142 ? -11.015 0.922   -9.177  1.00 43.55  ? 142 LEU D O   1 
ATOM   4520 C CB  . LEU D 1 142 ? -9.617  3.560   -7.949  1.00 38.85  ? 142 LEU D CB  1 
ATOM   4521 C CG  . LEU D 1 142 ? -8.989  4.117   -6.683  1.00 35.17  ? 142 LEU D CG  1 
ATOM   4522 C CD1 . LEU D 1 142 ? -9.411  5.569   -6.505  1.00 30.16  ? 142 LEU D CD1 1 
ATOM   4523 C CD2 . LEU D 1 142 ? -9.378  3.270   -5.495  1.00 31.05  ? 142 LEU D CD2 1 
ATOM   4524 N N   . CYS D 1 143 ? -10.070 2.247   -10.682 1.00 46.75  ? 143 CYS D N   1 
ATOM   4525 C CA  . CYS D 1 143 ? -11.030 1.861   -11.695 1.00 53.47  ? 143 CYS D CA  1 
ATOM   4526 C C   . CYS D 1 143 ? -10.925 0.387   -12.020 1.00 56.35  ? 143 CYS D C   1 
ATOM   4527 O O   . CYS D 1 143 ? -11.927 -0.290  -12.220 1.00 60.70  ? 143 CYS D O   1 
ATOM   4528 C CB  . CYS D 1 143 ? -10.846 2.688   -12.948 1.00 54.37  ? 143 CYS D CB  1 
ATOM   4529 S SG  . CYS D 1 143 ? -11.449 4.307   -12.698 1.00 58.41  ? 143 CYS D SG  1 
ATOM   4530 N N   . SER D 1 144 ? -9.692  -0.089  -12.075 1.00 58.04  ? 144 SER D N   1 
ATOM   4531 C CA  . SER D 1 144 ? -9.392  -1.465  -12.365 1.00 60.08  ? 144 SER D CA  1 
ATOM   4532 C C   . SER D 1 144 ? -9.831  -2.391  -11.251 1.00 60.29  ? 144 SER D C   1 
ATOM   4533 O O   . SER D 1 144 ? -10.369 -3.441  -11.506 1.00 63.12  ? 144 SER D O   1 
ATOM   4534 C CB  . SER D 1 144 ? -7.908  -1.601  -12.650 1.00 59.41  ? 144 SER D CB  1 
ATOM   4535 O OG  . SER D 1 144 ? -7.454  -2.884  -12.308 1.00 61.49  ? 144 SER D OG  1 
ATOM   4536 N N   . ILE D 1 145 ? -9.635  -2.030  -10.000 1.00 60.05  ? 145 ILE D N   1 
ATOM   4537 C CA  . ILE D 1 145 ? -10.111 -2.937  -8.969  1.00 61.57  ? 145 ILE D CA  1 
ATOM   4538 C C   . ILE D 1 145 ? -11.615 -2.836  -8.694  1.00 64.27  ? 145 ILE D C   1 
ATOM   4539 O O   . ILE D 1 145 ? -12.174 -3.707  -8.060  1.00 67.55  ? 145 ILE D O   1 
ATOM   4540 C CB  . ILE D 1 145 ? -9.270  -2.900  -7.693  1.00 58.88  ? 145 ILE D CB  1 
ATOM   4541 C CG1 . ILE D 1 145 ? -9.373  -1.558  -7.002  1.00 56.64  ? 145 ILE D CG1 1 
ATOM   4542 C CG2 . ILE D 1 145 ? -7.842  -3.321  -7.980  1.00 57.04  ? 145 ILE D CG2 1 
ATOM   4543 C CD1 . ILE D 1 145 ? -10.239 -1.621  -5.811  1.00 57.91  ? 145 ILE D CD1 1 
ATOM   4544 N N   . GLU D 1 146 ? -12.263 -1.790  -9.196  1.00 66.98  ? 146 GLU D N   1 
ATOM   4545 C CA  . GLU D 1 146 ? -13.714 -1.666  -9.137  1.00 71.50  ? 146 GLU D CA  1 
ATOM   4546 C C   . GLU D 1 146 ? -14.385 -2.589  -10.152 1.00 76.98  ? 146 GLU D C   1 
ATOM   4547 O O   . GLU D 1 146 ? -15.466 -3.097  -9.915  1.00 79.66  ? 146 GLU D O   1 
ATOM   4548 C CB  . GLU D 1 146 ? -14.133 -0.225  -9.394  1.00 71.54  ? 146 GLU D CB  1 
ATOM   4549 N N   . ALA D 1 147 ? -13.733 -2.787  -11.291 1.00 80.05  ? 147 ALA D N   1 
ATOM   4550 C CA  . ALA D 1 147 ? -14.124 -3.814  -12.227 1.00 84.77  ? 147 ALA D CA  1 
ATOM   4551 C C   . ALA D 1 147 ? -13.556 -5.133  -11.705 1.00 87.06  ? 147 ALA D C   1 
ATOM   4552 O O   . ALA D 1 147 ? -13.937 -5.641  -10.651 1.00 89.79  ? 147 ALA D O   1 
ATOM   4553 C CB  . ALA D 1 147 ? -13.591 -3.497  -13.611 1.00 85.40  ? 147 ALA D CB  1 
HETATM 4554 S S   . SO4 E 2 .   ? 7.271   -13.652 -4.533  1.00 68.83  ? 156 SO4 A S   1 
HETATM 4555 O O1  . SO4 E 2 .   ? 8.530   -12.952 -4.229  1.00 64.91  ? 156 SO4 A O1  1 
HETATM 4556 O O2  . SO4 E 2 .   ? 7.085   -13.754 -5.986  1.00 70.13  ? 156 SO4 A O2  1 
HETATM 4557 O O3  . SO4 E 2 .   ? 7.358   -15.019 -4.016  1.00 68.46  ? 156 SO4 A O3  1 
HETATM 4558 O O4  . SO4 E 2 .   ? 6.133   -12.931 -3.953  1.00 67.17  ? 156 SO4 A O4  1 
HETATM 4559 S S   . SO4 F 2 .   ? 18.903  5.115   -18.953 1.00 140.48 ? 157 SO4 A S   1 
HETATM 4560 O O1  . SO4 F 2 .   ? 18.666  6.180   -19.932 1.00 140.36 ? 157 SO4 A O1  1 
HETATM 4561 O O2  . SO4 F 2 .   ? 17.711  4.879   -18.149 1.00 140.23 ? 157 SO4 A O2  1 
HETATM 4562 O O3  . SO4 F 2 .   ? 19.220  3.878   -19.666 1.00 140.37 ? 157 SO4 A O3  1 
HETATM 4563 O O4  . SO4 F 2 .   ? 19.982  5.514   -18.046 1.00 140.39 ? 157 SO4 A O4  1 
HETATM 4564 S S   . SO4 G 2 .   ? 20.727  -5.013  -33.566 1.00 160.64 ? 158 SO4 A S   1 
HETATM 4565 O O1  . SO4 G 2 .   ? 21.254  -5.075  -34.931 1.00 160.78 ? 158 SO4 A O1  1 
HETATM 4566 O O2  . SO4 G 2 .   ? 19.750  -3.927  -33.459 1.00 160.37 ? 158 SO4 A O2  1 
HETATM 4567 O O3  . SO4 G 2 .   ? 20.124  -6.305  -33.265 1.00 160.64 ? 158 SO4 A O3  1 
HETATM 4568 O O4  . SO4 G 2 .   ? 21.809  -4.760  -32.616 1.00 160.98 ? 158 SO4 A O4  1 
HETATM 4569 C C1  . GOL H 3 .   ? 5.378   -18.722 -16.615 1.00 83.74  ? 159 GOL A C1  1 
HETATM 4570 O O1  . GOL H 3 .   ? 5.119   -17.334 -16.711 1.00 83.27  ? 159 GOL A O1  1 
HETATM 4571 C C2  . GOL H 3 .   ? 4.230   -19.455 -17.295 1.00 85.31  ? 159 GOL A C2  1 
HETATM 4572 O O2  . GOL H 3 .   ? 3.002   -19.016 -16.738 1.00 85.32  ? 159 GOL A O2  1 
HETATM 4573 C C3  . GOL H 3 .   ? 4.411   -20.985 -17.259 1.00 86.74  ? 159 GOL A C3  1 
HETATM 4574 O O3  . GOL H 3 .   ? 4.892   -21.534 -18.493 1.00 86.27  ? 159 GOL A O3  1 
HETATM 4575 S S   . SO4 I 2 .   ? 49.927  29.148  -11.794 1.00 72.26  ? 156 SO4 B S   1 
HETATM 4576 O O1  . SO4 I 2 .   ? 51.352  29.296  -12.135 1.00 71.53  ? 156 SO4 B O1  1 
HETATM 4577 O O2  . SO4 I 2 .   ? 49.416  27.801  -12.104 1.00 63.30  ? 156 SO4 B O2  1 
HETATM 4578 O O3  . SO4 I 2 .   ? 49.830  29.441  -10.358 1.00 72.40  ? 156 SO4 B O3  1 
HETATM 4579 O O4  . SO4 I 2 .   ? 49.127  30.130  -12.525 1.00 71.99  ? 156 SO4 B O4  1 
HETATM 4580 S S   . SO4 J 2 .   ? 43.614  37.926  8.739   1.00 115.47 ? 157 SO4 B S   1 
HETATM 4581 O O1  . SO4 J 2 .   ? 44.446  37.621  7.568   1.00 115.69 ? 157 SO4 B O1  1 
HETATM 4582 O O2  . SO4 J 2 .   ? 42.232  37.640  8.374   1.00 115.65 ? 157 SO4 B O2  1 
HETATM 4583 O O3  . SO4 J 2 .   ? 43.974  37.110  9.923   1.00 111.52 ? 157 SO4 B O3  1 
HETATM 4584 O O4  . SO4 J 2 .   ? 43.733  39.366  8.982   1.00 114.52 ? 157 SO4 B O4  1 
HETATM 4585 S S   . SO4 K 2 .   ? 32.660  20.744  12.485  1.00 139.33 ? 158 SO4 B S   1 
HETATM 4586 O O1  . SO4 K 2 .   ? 34.056  20.337  12.292  1.00 139.16 ? 158 SO4 B O1  1 
HETATM 4587 O O2  . SO4 K 2 .   ? 31.896  20.403  11.277  1.00 138.64 ? 158 SO4 B O2  1 
HETATM 4588 O O3  . SO4 K 2 .   ? 32.103  20.014  13.622  1.00 139.02 ? 158 SO4 B O3  1 
HETATM 4589 O O4  . SO4 K 2 .   ? 32.575  22.180  12.774  1.00 138.76 ? 158 SO4 B O4  1 
HETATM 4590 S S   . SO4 L 2 .   ? 31.240  17.260  2.149   0.60 55.45  ? 159 SO4 B S   1 
HETATM 4591 O O1  . SO4 L 2 .   ? 32.498  16.976  1.464   0.60 55.45  ? 159 SO4 B O1  1 
HETATM 4592 O O2  . SO4 L 2 .   ? 30.261  16.229  1.817   0.60 55.45  ? 159 SO4 B O2  1 
HETATM 4593 O O3  . SO4 L 2 .   ? 31.464  17.272  3.592   0.60 55.45  ? 159 SO4 B O3  1 
HETATM 4594 O O4  . SO4 L 2 .   ? 30.737  18.563  1.724   0.60 55.45  ? 159 SO4 B O4  1 
HETATM 4595 S S   . SO4 M 2 .   ? 52.969  56.532  16.327  1.00 65.52  ? 156 SO4 C S   1 
HETATM 4596 O O1  . SO4 M 2 .   ? 52.992  57.730  15.488  1.00 65.01  ? 156 SO4 C O1  1 
HETATM 4597 O O2  . SO4 M 2 .   ? 51.947  55.682  15.704  1.00 68.45  ? 156 SO4 C O2  1 
HETATM 4598 O O3  . SO4 M 2 .   ? 54.251  55.801  16.348  1.00 61.22  ? 156 SO4 C O3  1 
HETATM 4599 O O4  . SO4 M 2 .   ? 52.621  56.889  17.725  1.00 65.07  ? 156 SO4 C O4  1 
HETATM 4600 S S   . SO4 N 2 .   ? 50.162  45.631  30.296  1.00 83.52  ? 157 SO4 C S   1 
HETATM 4601 O O1  . SO4 N 2 .   ? 51.599  45.299  30.279  1.00 83.52  ? 157 SO4 C O1  1 
HETATM 4602 O O2  . SO4 N 2 .   ? 49.699  45.596  28.893  1.00 85.08  ? 157 SO4 C O2  1 
HETATM 4603 O O3  . SO4 N 2 .   ? 49.429  44.653  31.114  1.00 84.10  ? 157 SO4 C O3  1 
HETATM 4604 O O4  . SO4 N 2 .   ? 49.898  46.970  30.843  1.00 80.82  ? 157 SO4 C O4  1 
HETATM 4605 S S   . SO4 O 2 .   ? 58.446  46.022  14.267  1.00 112.64 ? 158 SO4 C S   1 
HETATM 4606 O O1  . SO4 O 2 .   ? 59.262  45.500  13.165  1.00 113.18 ? 158 SO4 C O1  1 
HETATM 4607 O O2  . SO4 O 2 .   ? 57.278  45.146  14.432  1.00 111.56 ? 158 SO4 C O2  1 
HETATM 4608 O O3  . SO4 O 2 .   ? 59.204  46.105  15.524  1.00 111.15 ? 158 SO4 C O3  1 
HETATM 4609 O O4  . SO4 O 2 .   ? 58.037  47.376  13.914  1.00 113.08 ? 158 SO4 C O4  1 
HETATM 4610 S S   . SO4 P 2 .   ? 29.760  56.929  18.295  1.00 125.51 ? 159 SO4 C S   1 
HETATM 4611 O O1  . SO4 P 2 .   ? 30.185  57.683  17.110  1.00 124.08 ? 159 SO4 C O1  1 
HETATM 4612 O O2  . SO4 P 2 .   ? 28.986  55.753  17.878  1.00 125.31 ? 159 SO4 C O2  1 
HETATM 4613 O O3  . SO4 P 2 .   ? 30.923  56.507  19.088  1.00 124.60 ? 159 SO4 C O3  1 
HETATM 4614 O O4  . SO4 P 2 .   ? 28.910  57.776  19.134  1.00 125.62 ? 159 SO4 C O4  1 
HETATM 4615 S S   . SO4 Q 2 .   ? 54.115  43.217  17.455  0.60 73.04  ? 160 SO4 C S   1 
HETATM 4616 O O1  . SO4 Q 2 .   ? 55.031  43.021  16.207  0.60 63.63  ? 160 SO4 C O1  1 
HETATM 4617 O O2  . SO4 Q 2 .   ? 52.868  44.110  17.254  0.60 64.66  ? 160 SO4 C O2  1 
HETATM 4618 O O3  . SO4 Q 2 .   ? 53.614  41.809  17.766  0.60 70.07  ? 160 SO4 C O3  1 
HETATM 4619 O O4  . SO4 Q 2 .   ? 54.875  43.786  18.674  0.60 68.04  ? 160 SO4 C O4  1 
HETATM 4620 S S   . SO4 R 2 .   ? -16.828 20.271  0.677   1.00 66.94  ? 156 SO4 D S   1 
HETATM 4621 O O1  . SO4 R 2 .   ? -16.447 20.635  -0.694  1.00 65.54  ? 156 SO4 D O1  1 
HETATM 4622 O O2  . SO4 R 2 .   ? -18.136 19.582  0.619   1.00 62.08  ? 156 SO4 D O2  1 
HETATM 4623 O O3  . SO4 R 2 .   ? -15.820 19.347  1.194   1.00 69.43  ? 156 SO4 D O3  1 
HETATM 4624 O O4  . SO4 R 2 .   ? -16.802 21.441  1.587   1.00 64.93  ? 156 SO4 D O4  1 
HETATM 4625 S S   . SO4 S 2 .   ? -14.049 9.324   -13.278 1.00 85.62  ? 157 SO4 D S   1 
HETATM 4626 O O1  . SO4 S 2 .   ? -13.510 8.073   -13.817 1.00 86.50  ? 157 SO4 D O1  1 
HETATM 4627 O O2  . SO4 S 2 .   ? -13.395 10.449  -13.965 1.00 83.31  ? 157 SO4 D O2  1 
HETATM 4628 O O3  . SO4 S 2 .   ? -15.509 9.348   -13.447 1.00 85.24  ? 157 SO4 D O3  1 
HETATM 4629 O O4  . SO4 S 2 .   ? -13.788 9.382   -11.834 1.00 87.39  ? 157 SO4 D O4  1 
HETATM 4630 S S   . SO4 T 2 .   ? -7.511  1.226   8.026   1.00 131.40 ? 158 SO4 D S   1 
HETATM 4631 O O1  . SO4 T 2 .   ? -6.884  0.731   6.794   1.00 128.93 ? 158 SO4 D O1  1 
HETATM 4632 O O2  . SO4 T 2 .   ? -8.901  1.577   7.727   1.00 132.02 ? 158 SO4 D O2  1 
HETATM 4633 O O3  . SO4 T 2 .   ? -7.520  0.165   9.032   1.00 132.13 ? 158 SO4 D O3  1 
HETATM 4634 O O4  . SO4 T 2 .   ? -6.813  2.387   8.595   1.00 129.89 ? 158 SO4 D O4  1 
HETATM 4635 S S   . SO4 U 2 .   ? -22.210 9.750   2.917   1.00 136.97 ? 159 SO4 D S   1 
HETATM 4636 O O1  . SO4 U 2 .   ? -21.293 8.610   2.989   1.00 136.28 ? 159 SO4 D O1  1 
HETATM 4637 O O2  . SO4 U 2 .   ? -22.918 9.767   1.634   1.00 136.10 ? 159 SO4 D O2  1 
HETATM 4638 O O3  . SO4 U 2 .   ? -23.169 9.656   4.019   1.00 137.45 ? 159 SO4 D O3  1 
HETATM 4639 O O4  . SO4 U 2 .   ? -21.472 11.001  3.062   1.00 137.71 ? 159 SO4 D O4  1 
HETATM 4640 S S   . SO4 V 2 .   ? 6.166   20.605  -1.505  1.00 127.94 ? 160 SO4 D S   1 
HETATM 4641 O O1  . SO4 V 2 .   ? 7.379   21.086  -2.176  1.00 127.83 ? 160 SO4 D O1  1 
HETATM 4642 O O2  . SO4 V 2 .   ? 4.994   20.776  -2.373  1.00 126.68 ? 160 SO4 D O2  1 
HETATM 4643 O O3  . SO4 V 2 .   ? 6.373   19.192  -1.180  1.00 128.48 ? 160 SO4 D O3  1 
HETATM 4644 O O4  . SO4 V 2 .   ? 5.959   21.340  -0.256  1.00 127.29 ? 160 SO4 D O4  1 
HETATM 4645 O O   . HOH W 4 .   ? 16.505  5.216   -26.214 1.00 56.11  ? 160 HOH A O   1 
HETATM 4646 O O   . HOH W 4 .   ? -9.517  -12.817 -7.355  1.00 51.84  ? 161 HOH A O   1 
HETATM 4647 O O   . HOH W 4 .   ? 10.933  -6.239  -15.747 1.00 31.98  ? 162 HOH A O   1 
HETATM 4648 O O   . HOH W 4 .   ? 9.588   -11.804 -7.106  1.00 36.57  ? 163 HOH A O   1 
HETATM 4649 O O   . HOH W 4 .   ? 11.902  -18.457 -8.401  1.00 42.62  ? 164 HOH A O   1 
HETATM 4650 O O   . HOH W 4 .   ? 18.776  1.119   -22.506 1.00 47.34  ? 165 HOH A O   1 
HETATM 4651 O O   . HOH W 4 .   ? 13.279  -9.374  -32.740 1.00 44.71  ? 166 HOH A O   1 
HETATM 4652 O O   . HOH W 4 .   ? 15.824  -17.460 -23.734 1.00 38.56  ? 167 HOH A O   1 
HETATM 4653 O O   . HOH W 4 .   ? 10.851  -14.559 -28.133 1.00 20.61  ? 168 HOH A O   1 
HETATM 4654 O O   . HOH W 4 .   ? 4.557   8.084   -10.086 1.00 51.36  ? 169 HOH A O   1 
HETATM 4655 O O   . HOH W 4 .   ? 15.770  -17.807 -11.394 1.00 29.97  ? 170 HOH A O   1 
HETATM 4656 O O   . HOH W 4 .   ? 23.809  -12.931 -15.747 1.00 31.86  ? 171 HOH A O   1 
HETATM 4657 O O   . HOH W 4 .   ? 19.692  -15.323 -12.018 1.00 32.94  ? 172 HOH A O   1 
HETATM 4658 O O   . HOH W 4 .   ? 4.406   11.417  -29.868 1.00 40.63  ? 173 HOH A O   1 
HETATM 4659 O O   . HOH W 4 .   ? 16.376  -14.113 -7.866  1.00 38.21  ? 174 HOH A O   1 
HETATM 4660 O O   . HOH W 4 .   ? 8.726   -11.427 -2.348  1.00 49.02  ? 175 HOH A O   1 
HETATM 4661 O O   . HOH W 4 .   ? -1.623  0.582   -9.936  1.00 34.46  ? 176 HOH A O   1 
HETATM 4662 O O   . HOH W 4 .   ? 0.214   8.300   -25.399 1.00 33.57  ? 177 HOH A O   1 
HETATM 4663 O O   . HOH W 4 .   ? 8.652   -21.316 -25.158 1.00 43.65  ? 178 HOH A O   1 
HETATM 4664 O O   . HOH W 4 .   ? -0.083  -4.057  -0.217  1.00 49.27  ? 179 HOH A O   1 
HETATM 4665 O O   . HOH W 4 .   ? 7.746   -0.237  -2.618  1.00 54.88  ? 180 HOH A O   1 
HETATM 4666 O O   . HOH W 4 .   ? 15.563  -20.474 -11.398 1.00 37.43  ? 181 HOH A O   1 
HETATM 4667 O O   . HOH W 4 .   ? 13.876  -20.813 -8.530  1.00 56.00  ? 182 HOH A O   1 
HETATM 4668 O O   . HOH W 4 .   ? 9.004   12.065  -30.863 1.00 47.30  ? 183 HOH A O   1 
HETATM 4669 O O   . HOH W 4 .   ? 6.520   -23.464 -22.545 1.00 47.69  ? 184 HOH A O   1 
HETATM 4670 O O   . HOH W 4 .   ? -8.378  -12.012 -9.654  1.00 66.69  ? 185 HOH A O   1 
HETATM 4671 O O   . HOH W 4 .   ? 14.909  11.491  -9.096  1.00 63.06  ? 186 HOH A O   1 
HETATM 4672 O O   . HOH W 4 .   ? 13.366  -16.847 -20.423 1.00 26.96  ? 187 HOH A O   1 
HETATM 4673 O O   . HOH W 4 .   ? 5.108   -6.782  -2.985  1.00 46.51  ? 188 HOH A O   1 
HETATM 4674 O O   . HOH W 4 .   ? 8.632   -24.095 -19.592 1.00 54.31  ? 189 HOH A O   1 
HETATM 4675 O O   . HOH W 4 .   ? 15.678  3.490   -28.864 1.00 43.24  ? 190 HOH A O   1 
HETATM 4676 O O   . HOH W 4 .   ? 18.560  8.168   -23.198 1.00 65.78  ? 191 HOH A O   1 
HETATM 4677 O O   . HOH W 4 .   ? 6.028   -22.466 -14.473 1.00 37.33  ? 192 HOH A O   1 
HETATM 4678 O O   . HOH W 4 .   ? 18.480  -4.924  -26.235 1.00 31.49  ? 193 HOH A O   1 
HETATM 4679 O O   . HOH W 4 .   ? 19.162  6.831   -7.001  1.00 49.42  ? 194 HOH A O   1 
HETATM 4680 O O   . HOH W 4 .   ? 13.017  2.211   -2.604  1.00 63.11  ? 195 HOH A O   1 
HETATM 4681 O O   . HOH W 4 .   ? 7.421   2.454   -2.974  1.00 41.10  ? 196 HOH A O   1 
HETATM 4682 O O   . HOH W 4 .   ? -9.160  -7.780  -5.172  1.00 49.72  ? 197 HOH A O   1 
HETATM 4683 O O   . HOH W 4 .   ? -9.452  -15.132 -5.685  1.00 52.28  ? 198 HOH A O   1 
HETATM 4684 O O   . HOH X 4 .   ? 42.585  25.226  -0.634  1.00 31.57  ? 160 HOH B O   1 
HETATM 4685 O O   . HOH X 4 .   ? 37.854  32.710  14.624  1.00 26.43  ? 161 HOH B O   1 
HETATM 4686 O O   . HOH X 4 .   ? 59.895  29.310  6.199   1.00 47.24  ? 162 HOH B O   1 
HETATM 4687 O O   . HOH X 4 .   ? 56.926  21.792  -9.046  1.00 45.28  ? 163 HOH B O   1 
HETATM 4688 O O   . HOH X 4 .   ? 53.353  31.147  0.171   1.00 40.69  ? 164 HOH B O   1 
HETATM 4689 O O   . HOH X 4 .   ? 28.055  36.358  8.953   1.00 36.15  ? 165 HOH B O   1 
HETATM 4690 O O   . HOH X 4 .   ? 44.134  41.423  0.861   1.00 48.21  ? 166 HOH B O   1 
HETATM 4691 O O   . HOH X 4 .   ? 47.324  41.344  1.499   1.00 41.20  ? 167 HOH B O   1 
HETATM 4692 O O   . HOH X 4 .   ? 60.582  27.204  3.440   1.00 48.16  ? 168 HOH B O   1 
HETATM 4693 O O   . HOH X 4 .   ? 53.422  20.238  7.287   1.00 22.40  ? 169 HOH B O   1 
HETATM 4694 O O   . HOH X 4 .   ? 53.827  20.687  -5.099  1.00 34.71  ? 170 HOH B O   1 
HETATM 4695 O O   . HOH X 4 .   ? 56.572  20.536  -4.859  1.00 37.99  ? 171 HOH B O   1 
HETATM 4696 O O   . HOH X 4 .   ? 42.302  15.140  17.017  1.00 44.55  ? 172 HOH B O   1 
HETATM 4697 O O   . HOH X 4 .   ? 33.853  28.956  -13.473 1.00 25.62  ? 173 HOH B O   1 
HETATM 4698 O O   . HOH X 4 .   ? 47.693  26.954  -13.700 1.00 39.99  ? 174 HOH B O   1 
HETATM 4699 O O   . HOH X 4 .   ? 38.606  36.059  -0.014  1.00 24.53  ? 175 HOH B O   1 
HETATM 4700 O O   . HOH X 4 .   ? 36.621  28.370  -14.014 1.00 38.86  ? 176 HOH B O   1 
HETATM 4701 O O   . HOH X 4 .   ? 33.518  31.420  17.429  1.00 42.49  ? 177 HOH B O   1 
HETATM 4702 O O   . HOH X 4 .   ? 40.066  15.547  16.307  1.00 49.64  ? 178 HOH B O   1 
HETATM 4703 O O   . HOH X 4 .   ? 50.592  45.811  -9.627  1.00 39.95  ? 179 HOH B O   1 
HETATM 4704 O O   . HOH X 4 .   ? 51.464  45.405  -11.870 1.00 59.85  ? 180 HOH B O   1 
HETATM 4705 O O   . HOH X 4 .   ? 33.110  15.213  -3.311  1.00 111.37 ? 181 HOH B O   1 
HETATM 4706 O O   . HOH X 4 .   ? 45.532  23.299  16.329  1.00 38.60  ? 182 HOH B O   1 
HETATM 4707 O O   . HOH X 4 .   ? 57.989  31.291  2.654   1.00 48.84  ? 183 HOH B O   1 
HETATM 4708 O O   . HOH X 4 .   ? 34.218  23.154  18.191  1.00 48.88  ? 184 HOH B O   1 
HETATM 4709 O O   . HOH X 4 .   ? 58.195  32.883  4.887   1.00 51.53  ? 185 HOH B O   1 
HETATM 4710 O O   . HOH X 4 .   ? 37.039  37.331  -16.352 1.00 55.22  ? 186 HOH B O   1 
HETATM 4711 O O   . HOH X 4 .   ? 52.955  26.077  15.808  1.00 54.45  ? 187 HOH B O   1 
HETATM 4712 O O   . HOH X 4 .   ? 42.395  30.861  -13.784 1.00 43.97  ? 188 HOH B O   1 
HETATM 4713 O O   . HOH X 4 .   ? 30.704  40.041  0.543   1.00 65.21  ? 189 HOH B O   1 
HETATM 4714 O O   . HOH X 4 .   ? 48.175  26.955  -9.480  1.00 39.13  ? 190 HOH B O   1 
HETATM 4715 O O   . HOH X 4 .   ? 50.678  20.188  -8.617  1.00 37.32  ? 191 HOH B O   1 
HETATM 4716 O O   . HOH X 4 .   ? 52.575  30.183  7.637   1.00 51.63  ? 192 HOH B O   1 
HETATM 4717 O O   . HOH X 4 .   ? 34.751  38.169  -5.519  1.00 50.81  ? 193 HOH B O   1 
HETATM 4718 O O   . HOH X 4 .   ? 53.128  22.931  3.964   1.00 42.19  ? 194 HOH B O   1 
HETATM 4719 O O   . HOH X 4 .   ? 43.824  33.103  -14.727 1.00 51.31  ? 195 HOH B O   1 
HETATM 4720 O O   . HOH X 4 .   ? 43.068  43.368  -14.467 1.00 53.01  ? 196 HOH B O   1 
HETATM 4721 O O   . HOH X 4 .   ? 44.562  45.254  -10.975 1.00 46.43  ? 197 HOH B O   1 
HETATM 4722 O O   . HOH X 4 .   ? 31.359  20.912  6.547   1.00 49.38  ? 198 HOH B O   1 
HETATM 4723 O O   . HOH X 4 .   ? 24.136  28.541  13.521  1.00 47.02  ? 199 HOH B O   1 
HETATM 4724 O O   . HOH X 4 .   ? 24.823  31.923  13.398  1.00 45.62  ? 200 HOH B O   1 
HETATM 4725 O O   . HOH X 4 .   ? 29.301  17.042  -9.350  1.00 41.38  ? 201 HOH B O   1 
HETATM 4726 O O   . HOH X 4 .   ? 27.693  17.482  6.577   1.00 52.90  ? 202 HOH B O   1 
HETATM 4727 O O   . HOH Y 4 .   ? 40.535  29.656  16.533  1.00 30.94  ? 161 HOH C O   1 
HETATM 4728 O O   . HOH Y 4 .   ? 55.373  50.874  25.868  1.00 51.87  ? 162 HOH C O   1 
HETATM 4729 O O   . HOH Y 4 .   ? 47.384  28.964  27.550  1.00 46.36  ? 163 HOH C O   1 
HETATM 4730 O O   . HOH Y 4 .   ? 52.233  43.301  33.162  1.00 55.45  ? 164 HOH C O   1 
HETATM 4731 O O   . HOH Y 4 .   ? 27.472  57.129  25.000  1.00 49.13  ? 165 HOH C O   1 
HETATM 4732 O O   . HOH Y 4 .   ? 43.129  30.284  11.283  1.00 23.41  ? 166 HOH C O   1 
HETATM 4733 O O   . HOH Y 4 .   ? 43.428  32.393  19.784  1.00 49.15  ? 167 HOH C O   1 
HETATM 4734 O O   . HOH Y 4 .   ? 28.639  38.816  13.390  1.00 51.20  ? 168 HOH C O   1 
HETATM 4735 O O   . HOH Y 4 .   ? 42.206  49.827  19.512  1.00 17.91  ? 169 HOH C O   1 
HETATM 4736 O O   . HOH Y 4 .   ? 52.359  52.217  14.760  1.00 42.26  ? 170 HOH C O   1 
HETATM 4737 O O   . HOH Y 4 .   ? 34.875  44.143  32.425  1.00 46.06  ? 171 HOH C O   1 
HETATM 4738 O O   . HOH Y 4 .   ? 32.025  44.346  27.230  1.00 48.90  ? 172 HOH C O   1 
HETATM 4739 O O   . HOH Y 4 .   ? 55.154  53.666  15.793  1.00 42.05  ? 173 HOH C O   1 
HETATM 4740 O O   . HOH Y 4 .   ? 28.900  35.956  5.313   1.00 19.40  ? 174 HOH C O   1 
HETATM 4741 O O   . HOH Y 4 .   ? 43.591  42.649  32.194  1.00 31.44  ? 175 HOH C O   1 
HETATM 4742 O O   . HOH Y 4 .   ? 47.925  47.790  27.969  1.00 39.67  ? 176 HOH C O   1 
HETATM 4743 O O   . HOH Y 4 .   ? 31.408  47.661  -0.011  1.00 63.77  ? 177 HOH C O   1 
HETATM 4744 O O   . HOH Y 4 .   ? 59.151  47.491  11.117  1.00 41.22  ? 178 HOH C O   1 
HETATM 4745 O O   . HOH Y 4 .   ? 36.146  60.143  24.013  1.00 62.03  ? 179 HOH C O   1 
HETATM 4746 O O   . HOH Y 4 .   ? 48.549  50.632  31.568  1.00 55.36  ? 180 HOH C O   1 
HETATM 4747 O O   . HOH Y 4 .   ? 28.235  53.717  15.649  1.00 39.58  ? 181 HOH C O   1 
HETATM 4748 O O   . HOH Y 4 .   ? 36.732  36.039  24.708  1.00 52.62  ? 182 HOH C O   1 
HETATM 4749 O O   . HOH Y 4 .   ? 28.004  45.703  0.220   1.00 49.60  ? 183 HOH C O   1 
HETATM 4750 O O   . HOH Y 4 .   ? 29.828  54.349  13.218  1.00 70.12  ? 184 HOH C O   1 
HETATM 4751 O O   . HOH Y 4 .   ? 23.747  53.369  13.268  1.00 50.57  ? 185 HOH C O   1 
HETATM 4752 O O   . HOH Y 4 .   ? 35.825  61.640  5.208   1.00 60.04  ? 186 HOH C O   1 
HETATM 4753 O O   . HOH Y 4 .   ? 56.546  54.318  18.407  1.00 42.37  ? 187 HOH C O   1 
HETATM 4754 O O   . HOH Y 4 .   ? 54.346  49.749  7.253   1.00 58.44  ? 188 HOH C O   1 
HETATM 4755 O O   . HOH Y 4 .   ? 41.151  53.495  33.776  1.00 51.07  ? 189 HOH C O   1 
HETATM 4756 O O   . HOH Y 4 .   ? 50.813  29.567  25.448  1.00 62.59  ? 190 HOH C O   1 
HETATM 4757 O O   . HOH Y 4 .   ? 26.926  38.007  15.225  1.00 57.97  ? 191 HOH C O   1 
HETATM 4758 O O   . HOH Z 4 .   ? -2.846  2.819   -1.315  1.00 24.73  ? 161 HOH D O   1 
HETATM 4759 O O   . HOH Z 4 .   ? -4.034  -6.730  0.191   1.00 36.97  ? 162 HOH D O   1 
HETATM 4760 O O   . HOH Z 4 .   ? 10.846  15.544  -15.898 1.00 57.58  ? 163 HOH D O   1 
HETATM 4761 O O   . HOH Z 4 .   ? -16.105 15.962  2.135   1.00 36.37  ? 164 HOH D O   1 
HETATM 4762 O O   . HOH Z 4 .   ? -18.273 3.274   3.207   1.00 52.43  ? 165 HOH D O   1 
HETATM 4763 O O   . HOH Z 4 .   ? -19.052 14.602  -9.050  1.00 51.29  ? 166 HOH D O   1 
HETATM 4764 O O   . HOH Z 4 .   ? -3.156  25.417  13.504  1.00 62.98  ? 167 HOH D O   1 
HETATM 4765 O O   . HOH Z 4 .   ? -7.482  6.389   -15.259 1.00 33.65  ? 168 HOH D O   1 
HETATM 4766 O O   . HOH Z 4 .   ? -0.548  -0.534  -7.667  1.00 39.32  ? 169 HOH D O   1 
HETATM 4767 O O   . HOH Z 4 .   ? 1.365   7.841   -15.453 1.00 40.55  ? 170 HOH D O   1 
HETATM 4768 O O   . HOH Z 4 .   ? 7.523   2.702   3.834   1.00 36.68  ? 171 HOH D O   1 
HETATM 4769 O O   . HOH Z 4 .   ? -7.304  -3.882  -3.083  1.00 41.20  ? 172 HOH D O   1 
HETATM 4770 O O   . HOH Z 4 .   ? -11.576 25.787  0.776   1.00 39.47  ? 173 HOH D O   1 
HETATM 4771 O O   . HOH Z 4 .   ? -11.279 -7.587  -10.796 1.00 39.66  ? 174 HOH D O   1 
HETATM 4772 O O   . HOH Z 4 .   ? 8.405   17.150  11.103  1.00 64.51  ? 175 HOH D O   1 
HETATM 4773 O O   . HOH Z 4 .   ? 1.658   -0.399  -5.511  1.00 19.02  ? 176 HOH D O   1 
HETATM 4774 O O   . HOH Z 4 .   ? -18.774 17.351  1.182   1.00 45.71  ? 177 HOH D O   1 
HETATM 4775 O O   . HOH Z 4 .   ? -20.821 16.613  -4.359  1.00 45.20  ? 178 HOH D O   1 
HETATM 4776 O O   . HOH Z 4 .   ? -5.593  13.921  -16.858 1.00 59.43  ? 179 HOH D O   1 
HETATM 4777 O O   . HOH Z 4 .   ? 4.392   11.296  16.894  1.00 63.51  ? 180 HOH D O   1 
HETATM 4778 O O   . HOH Z 4 .   ? 8.397   9.271   16.628  1.00 61.83  ? 181 HOH D O   1 
HETATM 4779 O O   . HOH Z 4 .   ? -14.934 21.131  -2.560  1.00 42.24  ? 182 HOH D O   1 
HETATM 4780 O O   . HOH Z 4 .   ? -11.976 14.231  -14.950 1.00 50.45  ? 183 HOH D O   1 
HETATM 4781 O O   . HOH Z 4 .   ? -1.087  -0.788  0.001   1.00 57.90  ? 184 HOH D O   1 
HETATM 4782 O O   . HOH Z 4 .   ? -17.302 14.589  9.513   1.00 54.63  ? 185 HOH D O   1 
HETATM 4783 O O   . HOH Z 4 .   ? 2.059   7.643   14.808  1.00 51.71  ? 186 HOH D O   1 
HETATM 4784 O O   . HOH Z 4 .   ? -1.673  25.723  -9.267  1.00 42.36  ? 187 HOH D O   1 
HETATM 4785 O O   . HOH Z 4 .   ? -14.234 -6.851  -8.596  1.00 56.02  ? 188 HOH D O   1 
HETATM 4786 O O   . HOH Z 4 .   ? -13.732 -5.719  -6.225  1.00 46.53  ? 189 HOH D O   1 
HETATM 4787 O O   . HOH Z 4 .   ? 12.129  6.215   12.426  1.00 66.73  ? 190 HOH D O   1 
HETATM 4788 O O   . HOH Z 4 .   ? -20.009 17.987  -1.574  1.00 42.38  ? 191 HOH D O   1 
HETATM 4789 O O   . HOH Z 4 .   ? -17.025 7.153   -1.024  1.00 45.64  ? 192 HOH D O   1 
HETATM 4790 O O   . HOH Z 4 .   ? -22.265 9.058   -3.171  1.00 45.86  ? 193 HOH D O   1 
HETATM 4791 O O   . HOH Z 4 .   ? -4.707  30.713  6.564   1.00 58.18  ? 194 HOH D O   1 
HETATM 4792 O O   . HOH Z 4 .   ? 7.458   17.417  -19.689 1.00 85.12  ? 195 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ARG A 4   ? 0.7626 0.6327 0.5840 -0.0575 0.1290  -0.1112 4   ARG A N   
2    C CA  . ARG A 4   ? 0.7433 0.6216 0.5653 -0.0585 0.1135  -0.0899 4   ARG A CA  
3    C C   . ARG A 4   ? 0.7317 0.5917 0.5658 -0.0624 0.1087  -0.0897 4   ARG A C   
4    O O   . ARG A 4   ? 0.7641 0.5897 0.5804 -0.0692 0.1150  -0.0992 4   ARG A O   
5    C CB  . ARG A 4   ? 0.7702 0.6438 0.5661 -0.0642 0.1115  -0.0795 4   ARG A CB  
6    C CG  . ARG A 4   ? 0.8116 0.6929 0.6186 -0.0646 0.0970  -0.0540 4   ARG A CG  
7    C CD  . ARG A 4   ? 0.8933 0.7615 0.6837 -0.0734 0.0924  -0.0446 4   ARG A CD  
8    N NE  . ARG A 4   ? 0.9584 0.8413 0.7668 -0.0712 0.0845  -0.0157 4   ARG A NE  
9    C CZ  . ARG A 4   ? 1.0004 0.9042 0.8179 -0.0604 0.0913  0.0002  4   ARG A CZ  
10   N NH1 . ARG A 4   ? 1.0117 0.9247 0.8190 -0.0520 0.1003  -0.0104 4   ARG A NH1 
11   N NH2 . ARG A 4   ? 1.0263 0.9351 0.8625 -0.0573 0.0891  0.0287  4   ARG A NH2 
12   N N   . ALA A 5   ? 0.6671 0.5439 0.5251 -0.0574 0.0982  -0.0785 5   ALA A N   
13   C CA  . ALA A 5   ? 0.6274 0.4919 0.4980 -0.0602 0.0943  -0.0772 5   ALA A CA  
14   C C   . ALA A 5   ? 0.5885 0.4668 0.4670 -0.0580 0.0794  -0.0565 5   ALA A C   
15   O O   . ALA A 5   ? 0.5622 0.4603 0.4449 -0.0505 0.0754  -0.0443 5   ALA A O   
16   C CB  . ALA A 5   ? 0.6177 0.4892 0.5184 -0.0553 0.0992  -0.0866 5   ALA A CB  
17   N N   . CYS A 6   ? 0.5882 0.4505 0.4672 -0.0635 0.0729  -0.0516 6   CYS A N   
18   C CA  . CYS A 6   ? 0.5618 0.4369 0.4558 -0.0606 0.0597  -0.0320 6   CYS A CA  
19   C C   . CYS A 6   ? 0.5619 0.4336 0.4693 -0.0605 0.0575  -0.0335 6   CYS A C   
20   O O   . CYS A 6   ? 0.6095 0.4574 0.5071 -0.0666 0.0653  -0.0459 6   CYS A O   
21   C CB  . CYS A 6   ? 0.5895 0.4479 0.4722 -0.0690 0.0483  -0.0185 6   CYS A CB  
22   S SG  . CYS A 6   ? 0.5719 0.4388 0.4451 -0.0688 0.0511  -0.0107 6   CYS A SG  
23   N N   . GLY A 7   ? 0.5286 0.4203 0.4569 -0.0527 0.0502  -0.0201 7   GLY A N   
24   C CA  . GLY A 7   ? 0.5002 0.3923 0.4409 -0.0521 0.0490  -0.0217 7   GLY A CA  
25   C C   . GLY A 7   ? 0.4763 0.3831 0.4352 -0.0451 0.0398  -0.0045 7   GLY A C   
26   O O   . GLY A 7   ? 0.4835 0.3967 0.4494 -0.0407 0.0350  0.0113  7   GLY A O   
27   N N   . LEU A 8   ? 0.4467 0.3578 0.4162 -0.0433 0.0398  -0.0066 8   LEU A N   
28   C CA  . LEU A 8   ? 0.4145 0.3398 0.4030 -0.0345 0.0338  0.0077  8   LEU A CA  
29   C C   . LEU A 8   ? 0.3787 0.3206 0.3803 -0.0233 0.0389  0.0004  8   LEU A C   
30   O O   . LEU A 8   ? 0.3607 0.3011 0.3630 -0.0278 0.0438  -0.0123 8   LEU A O   
31   C CB  . LEU A 8   ? 0.4282 0.3381 0.4144 -0.0443 0.0237  0.0167  8   LEU A CB  
32   C CG  . LEU A 8   ? 0.4825 0.3690 0.4569 -0.0557 0.0111  0.0273  8   LEU A CG  
33   C CD1 . LEU A 8   ? 0.5377 0.3979 0.5013 -0.0667 -0.0027 0.0340  8   LEU A CD1 
34   C CD2 . LEU A 8   ? 0.4187 0.3198 0.4177 -0.0480 0.0066  0.0466  8   LEU A CD2 
35   N N   . ILE A 9   ? 0.3602 0.3124 0.3718 -0.0079 0.0389  0.0103  9   ILE A N   
36   C CA  . ILE A 9   ? 0.3456 0.3065 0.3653 0.0041  0.0408  0.0052  9   ILE A CA  
37   C C   . ILE A 9   ? 0.3546 0.3216 0.3869 0.0026  0.0392  0.0116  9   ILE A C   
38   O O   . ILE A 9   ? 0.3601 0.3282 0.4040 0.0092  0.0378  0.0279  9   ILE A O   
39   C CB  . ILE A 9   ? 0.3616 0.3165 0.3763 0.0226  0.0435  0.0141  9   ILE A CB  
40   C CG1 . ILE A 9   ? 0.3835 0.3279 0.3791 0.0230  0.0435  0.0087  9   ILE A CG1 
41   C CG2 . ILE A 9   ? 0.3341 0.2886 0.3501 0.0364  0.0435  0.0080  9   ILE A CG2 
42   C CD1 . ILE A 9   ? 0.3960 0.3203 0.3733 0.0412  0.0486  0.0215  9   ILE A CD1 
43   N N   . ILE A 10  ? 0.3502 0.3187 0.3819 -0.0067 0.0408  0.0005  10  ILE A N   
44   C CA  . ILE A 10  ? 0.3473 0.3186 0.3840 -0.0098 0.0396  0.0057  10  ILE A CA  
45   C C   . ILE A 10  ? 0.3468 0.3345 0.3969 0.0061  0.0434  0.0036  10  ILE A C   
46   O O   . ILE A 10  ? 0.3435 0.3351 0.3947 0.0129  0.0458  -0.0077 10  ILE A O   
47   C CB  . ILE A 10  ? 0.3568 0.3134 0.3793 -0.0258 0.0443  -0.0033 10  ILE A CB  
48   C CG1 . ILE A 10  ? 0.4005 0.3291 0.4007 -0.0397 0.0404  -0.0009 10  ILE A CG1 
49   C CG2 . ILE A 10  ? 0.3655 0.3207 0.3855 -0.0293 0.0439  0.0020  10  ILE A CG2 
50   C CD1 . ILE A 10  ? 0.4250 0.3363 0.4158 -0.0471 0.0266  0.0144  10  ILE A CD1 
51   N N   . PHE A 11  ? 0.3603 0.3541 0.4211 0.0127  0.0423  0.0150  11  PHE A N   
52   C CA  . PHE A 11  ? 0.3907 0.3962 0.4603 0.0285  0.0480  0.0119  11  PHE A CA  
53   C C   . PHE A 11  ? 0.4190 0.4329 0.4976 0.0258  0.0477  0.0190  11  PHE A C   
54   O O   . PHE A 11  ? 0.4428 0.4490 0.5231 0.0147  0.0394  0.0313  11  PHE A O   
55   C CB  . PHE A 11  ? 0.4040 0.4020 0.4774 0.0495  0.0520  0.0208  11  PHE A CB  
56   C CG  . PHE A 11  ? 0.4472 0.4428 0.5406 0.0549  0.0529  0.0424  11  PHE A CG  
57   C CD1 . PHE A 11  ? 0.4368 0.4401 0.5492 0.0655  0.0575  0.0500  11  PHE A CD1 
58   C CD2 . PHE A 11  ? 0.4714 0.4570 0.5697 0.0500  0.0494  0.0564  11  PHE A CD2 
59   C CE1 . PHE A 11  ? 0.4890 0.4894 0.6308 0.0712  0.0578  0.0723  11  PHE A CE1 
60   C CE2 . PHE A 11  ? 0.5184 0.5013 0.6459 0.0547  0.0492  0.0794  11  PHE A CE2 
61   C CZ  . PHE A 11  ? 0.5244 0.5142 0.6768 0.0654  0.0530  0.0882  11  PHE A CZ  
62   N N   . ARG A 12  ? 0.4297 0.4562 0.5119 0.0357  0.0546  0.0114  12  ARG A N   
63   C CA  . ARG A 12  ? 0.4550 0.4911 0.5453 0.0358  0.0557  0.0180  12  ARG A CA  
64   C C   . ARG A 12  ? 0.4733 0.5181 0.5766 0.0595  0.0646  0.0185  12  ARG A C   
65   O O   . ARG A 12  ? 0.4717 0.5100 0.5684 0.0747  0.0699  0.0098  12  ARG A O   
66   C CB  . ARG A 12  ? 0.4499 0.4896 0.5258 0.0210  0.0595  0.0084  12  ARG A CB  
67   C CG  . ARG A 12  ? 0.4408 0.4946 0.5186 0.0293  0.0692  -0.0070 12  ARG A CG  
68   C CD  . ARG A 12  ? 0.4291 0.4832 0.4966 0.0136  0.0768  -0.0122 12  ARG A CD  
69   N NE  . ARG A 12  ? 0.4224 0.4883 0.4996 0.0187  0.0839  -0.0261 12  ARG A NE  
70   C CZ  . ARG A 12  ? 0.4206 0.4893 0.4976 0.0081  0.0952  -0.0305 12  ARG A CZ  
71   N NH1 . ARG A 12  ? 0.3891 0.4433 0.4470 -0.0072 0.1033  -0.0227 12  ARG A NH1 
72   N NH2 . ARG A 12  ? 0.4404 0.5203 0.5348 0.0133  0.0983  -0.0413 12  ARG A NH2 
73   N N   . ARG A 13  ? 0.5065 0.5594 0.6252 0.0631  0.0655  0.0291  13  ARG A N   
74   C CA  . ARG A 13  ? 0.5500 0.6068 0.6832 0.0875  0.0773  0.0312  13  ARG A CA  
75   C C   . ARG A 13  ? 0.5557 0.6304 0.6814 0.0888  0.0843  0.0181  13  ARG A C   
76   O O   . ARG A 13  ? 0.5491 0.6338 0.6708 0.0725  0.0800  0.0197  13  ARG A O   
77   C CB  . ARG A 13  ? 0.5828 0.6372 0.7490 0.0933  0.0753  0.0544  13  ARG A CB  
78   C CG  . ARG A 13  ? 0.6154 0.6518 0.7963 0.0984  0.0743  0.0702  13  ARG A CG  
79   C CD  . ARG A 13  ? 0.7005 0.7347 0.9274 0.1092  0.0765  0.0953  13  ARG A CD  
80   N NE  . ARG A 13  ? 0.8086 0.8245 1.0551 0.1132  0.0777  0.1143  13  ARG A NE  
81   C CZ  . ARG A 13  ? 0.8505 0.8442 1.0939 0.1359  0.0982  0.1189  13  ARG A CZ  
82   N NH1 . ARG A 13  ? 0.8717 0.8538 1.0900 0.1573  0.1163  0.1045  13  ARG A NH1 
83   N NH2 . ARG A 13  ? 0.8843 0.8610 1.1450 0.1373  0.1008  0.1387  13  ARG A NH2 
84   N N   . CYS A 14  ? 0.5925 0.6650 0.7104 0.1085  0.0951  0.0054  14  CYS A N   
85   C CA  . CYS A 14  ? 0.6113 0.7009 0.7220 0.1117  0.1029  -0.0086 14  CYS A CA  
86   C C   . CYS A 14  ? 0.6539 0.7429 0.7760 0.1369  0.1166  -0.0053 14  CYS A C   
87   O O   . CYS A 14  ? 0.7039 0.7695 0.8178 0.1602  0.1253  -0.0092 14  CYS A O   
88   C CB  . CYS A 14  ? 0.6108 0.6935 0.7034 0.1138  0.1014  -0.0274 14  CYS A CB  
89   S SG  . CYS A 14  ? 0.5867 0.6672 0.6748 0.0881  0.0893  -0.0307 14  CYS A SG  
90   N N   . LEU A 15  ? 0.6891 0.7961 0.8258 0.1349  0.1199  0.0015  15  LEU A N   
91   C CA  . LEU A 15  ? 0.7577 0.8642 0.9165 0.1585  0.1336  0.0096  15  LEU A CA  
92   C C   . LEU A 15  ? 0.8265 0.9524 0.9767 0.1676  0.1464  -0.0047 15  LEU A C   
93   O O   . LEU A 15  ? 0.8315 0.9812 0.9841 0.1529  0.1434  -0.0026 15  LEU A O   
94   C CB  . LEU A 15  ? 0.7528 0.8636 0.9469 0.1496  0.1240  0.0345  15  LEU A CB  
95   C CG  . LEU A 15  ? 0.7607 0.8530 0.9668 0.1404  0.1113  0.0506  15  LEU A CG  
96   C CD1 . LEU A 15  ? 0.7688 0.8655 0.9996 0.1204  0.0914  0.0713  15  LEU A CD1 
97   C CD2 . LEU A 15  ? 0.7745 0.8400 0.9979 0.1669  0.1265  0.0611  15  LEU A CD2 
98   N N   . ILE A 16  ? 0.9283 1.0376 1.0632 0.1927  0.1608  -0.0190 16  ILE A N   
99   C CA  . ILE A 16  ? 0.9808 1.1066 1.1006 0.2000  0.1716  -0.0372 16  ILE A CA  
100  C C   . ILE A 16  ? 1.1121 1.2059 1.2140 0.2346  0.1892  -0.0500 16  ILE A C   
101  O O   . ILE A 16  ? 1.1052 1.1557 1.1937 0.2511  0.1914  -0.0479 16  ILE A O   
102  C CB  . ILE A 16  ? 0.9278 1.0671 1.0261 0.1779  0.1606  -0.0522 16  ILE A CB  
103  C CG1 . ILE A 16  ? 0.8484 1.0233 0.9443 0.1646  0.1669  -0.0578 16  ILE A CG1 
104  C CG2 . ILE A 16  ? 0.9407 1.0494 1.0143 0.1930  0.1586  -0.0691 16  ILE A CG2 
105  C CD1 . ILE A 16  ? 0.7169 0.9067 0.8145 0.1332  0.1572  -0.0449 16  ILE A CD1 
106  N N   . PRO A 17  ? 1.6930 1.4377 1.6491 0.3283  0.2232  0.2258  17  PRO A N   
107  C CA  . PRO A 17  ? 1.8297 1.5402 1.7565 0.3613  0.2466  0.2410  17  PRO A CA  
108  C C   . PRO A 17  ? 1.8857 1.5982 1.7551 0.3818  0.2376  0.2303  17  PRO A C   
109  O O   . PRO A 17  ? 1.9097 1.6154 1.7611 0.4009  0.2444  0.2279  17  PRO A O   
110  C CB  . PRO A 17  ? 1.8773 1.5752 1.8357 0.3700  0.2659  0.2484  17  PRO A CB  
111  C CG  . PRO A 17  ? 1.8181 1.5352 1.8351 0.3415  0.2586  0.2431  17  PRO A CG  
112  C CD  . PRO A 17  ? 1.7047 1.4573 1.7122 0.3167  0.2275  0.2244  17  PRO A CD  
113  N N   . LYS A 18  ? 1.8943 1.6164 1.7378 0.3785  0.2225  0.2228  18  LYS A N   
114  C CA  . LYS A 18  ? 1.9041 1.6295 1.6970 0.3989  0.2125  0.2094  18  LYS A CA  
115  C C   . LYS A 18  ? 1.8276 1.5847 1.6131 0.3832  0.1873  0.1842  18  LYS A C   
116  O O   . LYS A 18  ? 1.8561 1.6204 1.6047 0.3962  0.1754  0.1681  18  LYS A O   
117  C CB  . LYS A 18  ? 2.0104 1.7076 1.7725 0.4377  0.2341  0.2194  18  LYS A CB  
118  N N   . VAL A 19  ? 1.6956 1.4726 1.5176 0.3563  0.1790  0.1795  19  VAL A N   
119  C CA  . VAL A 19  ? 1.5488 1.3578 1.3678 0.3393  0.1554  0.1568  19  VAL A CA  
120  C C   . VAL A 19  ? 1.4040 1.2329 1.2134 0.3245  0.1362  0.1451  19  VAL A C   
121  O O   . VAL A 19  ? 1.3421 1.1884 1.1292 0.3241  0.1196  0.1254  19  VAL A O   
122  C CB  . VAL A 19  ? 1.5361 1.3650 1.4000 0.3144  0.1502  0.1551  19  VAL A CB  
123  C CG1 . VAL A 19  ? 1.5498 1.3743 1.4161 0.3264  0.1574  0.1523  19  VAL A CG1 
124  C CG2 . VAL A 19  ? 1.5508 1.3697 1.4556 0.3036  0.1627  0.1728  19  VAL A CG2 
125  N N   . ASP A 20  ? 1.3159 1.1415 1.1454 0.3125  0.1393  0.1574  20  ASP A N   
126  C CA  . ASP A 20  ? 1.2327 1.0756 1.0618 0.2966  0.1241  0.1504  20  ASP A CA  
127  C C   . ASP A 20  ? 1.2660 1.0906 1.0691 0.3175  0.1298  0.1543  20  ASP A C   
128  O O   . ASP A 20  ? 1.3220 1.1233 1.1293 0.3278  0.1460  0.1723  20  ASP A O   
129  C CB  . ASP A 20  ? 1.1736 1.0277 1.0417 0.2695  0.1218  0.1597  20  ASP A CB  
130  C CG  . ASP A 20  ? 1.1304 1.0064 1.0265 0.2511  0.1145  0.1541  20  ASP A CG  
131  O OD1 . ASP A 20  ? 1.0726 0.9728 0.9610 0.2433  0.0989  0.1375  20  ASP A OD1 
132  O OD2 . ASP A 20  ? 1.1317 1.0019 1.0596 0.2448  0.1239  0.1652  20  ASP A OD2 
133  N N   . ASN A 21  ? 1.2372 1.0738 1.0155 0.3246  0.1160  0.1357  21  ASN A N   
134  C CA  . ASN A 21  ? 1.2750 1.1022 1.0322 0.3437  0.1162  0.1334  21  ASN A CA  
135  C C   . ASN A 21  ? 1.2132 1.0363 0.9943 0.3292  0.1200  0.1492  21  ASN A C   
136  O O   . ASN A 21  ? 1.2688 1.0694 1.0435 0.3462  0.1338  0.1639  21  ASN A O   
137  C CB  . ASN A 21  ? 1.3306 1.1819 1.0776 0.3397  0.0959  0.1077  21  ASN A CB  
138  C CG  . ASN A 21  ? 1.5306 1.3735 1.2432 0.3732  0.0944  0.0938  21  ASN A CG  
139  O OD1 . ASN A 21  ? 1.6669 1.5042 1.3769 0.3843  0.0953  0.0958  21  ASN A OD1 
140  N ND2 . ASN A 21  ? 1.6584 1.5023 1.3449 0.3906  0.0909  0.0776  21  ASN A ND2 
141  N N   . ASN A 22  ? 1.1095 0.9553 0.9255 0.2928  0.1094  0.1503  22  ASN A N   
142  C CA  . ASN A 22  ? 0.9949 0.8409 0.8338 0.2763  0.1100  0.1626  22  ASN A CA  
143  C C   . ASN A 22  ? 0.9336 0.7805 0.8041 0.2554  0.1156  0.1763  22  ASN A C   
144  O O   . ASN A 22  ? 0.9113 0.7752 0.7942 0.2418  0.1094  0.1701  22  ASN A O   
145  C CB  . ASN A 22  ? 0.9560 0.8271 0.8027 0.2597  0.0930  0.1495  22  ASN A CB  
146  C CG  . ASN A 22  ? 0.9666 0.8462 0.7896 0.2756  0.0829  0.1276  22  ASN A CG  
147  O OD1 . ASN A 22  ? 1.0008 0.8857 0.8094 0.2822  0.0794  0.1154  22  ASN A OD1 
148  N ND2 . ASN A 22  ? 1.0000 0.8823 0.8214 0.2824  0.0774  0.1206  22  ASN A ND2 
149  N N   . ALA A 23  ? 0.9017 0.7315 0.7864 0.2538  0.1265  0.1933  23  ALA A N   
150  C CA  . ALA A 23  ? 0.8446 0.6769 0.7632 0.2337  0.1301  0.2036  23  ALA A CA  
151  C C   . ALA A 23  ? 0.7698 0.6283 0.7066 0.2074  0.1152  0.1996  23  ALA A C   
152  O O   . ALA A 23  ? 0.7529 0.6229 0.7157 0.1903  0.1130  0.2025  23  ALA A O   
153  C CB  . ALA A 23  ? 0.8755 0.6792 0.8040 0.2417  0.1476  0.2220  23  ALA A CB  
154  N N   . ILE A 24  ? 0.7201 0.5885 0.6446 0.2062  0.1054  0.1924  24  ILE A N   
155  C CA  . ILE A 24  ? 0.6591 0.5511 0.6001 0.1837  0.0936  0.1901  24  ILE A CA  
156  C C   . ILE A 24  ? 0.6227 0.5377 0.5532 0.1811  0.0802  0.1727  24  ILE A C   
157  O O   . ILE A 24  ? 0.6410 0.5511 0.5521 0.1970  0.0783  0.1629  24  ILE A O   
158  C CB  . ILE A 24  ? 0.7044 0.5867 0.6538 0.1795  0.0961  0.2011  24  ILE A CB  
159  C CG1 . ILE A 24  ? 0.6611 0.5289 0.6305 0.1724  0.1061  0.2169  24  ILE A CG1 
160  C CG2 . ILE A 24  ? 0.6154 0.5217 0.5757 0.1621  0.0839  0.1960  24  ILE A CG2 
161  C CD1 . ILE A 24  ? 0.6673 0.5132 0.6362 0.1790  0.1140  0.2284  24  ILE A CD1 
162  N N   . GLU A 25  ? 0.5625 0.5034 0.5070 0.1626  0.0712  0.1682  25  GLU A N   
163  C CA  . GLU A 25  ? 0.5336 0.4974 0.4730 0.1576  0.0595  0.1527  25  GLU A CA  
164  C C   . GLU A 25  ? 0.4931 0.4786 0.4537 0.1365  0.0537  0.1570  25  GLU A C   
165  O O   . GLU A 25  ? 0.4720 0.4651 0.4487 0.1238  0.0547  0.1673  25  GLU A O   
166  C CB  . GLU A 25  ? 0.5238 0.5007 0.4548 0.1590  0.0541  0.1404  25  GLU A CB  
167  C CG  . GLU A 25  ? 0.5932 0.5525 0.4990 0.1817  0.0582  0.1320  25  GLU A CG  
168  C CD  . GLU A 25  ? 0.6514 0.6232 0.5527 0.1812  0.0534  0.1219  25  GLU A CD  
169  O OE1 . GLU A 25  ? 0.7235 0.6854 0.6027 0.1988  0.0546  0.1122  25  GLU A OE1 
170  O OE2 . GLU A 25  ? 0.6480 0.6410 0.5674 0.1645  0.0477  0.1228  25  GLU A OE2 
171  N N   . PHE A 26  ? 0.4753 0.4709 0.4372 0.1347  0.0481  0.1481  26  PHE A N   
172  C CA  . PHE A 26  ? 0.4519 0.4665 0.4349 0.1169  0.0450  0.1531  26  PHE A CA  
173  C C   . PHE A 26  ? 0.4356 0.4775 0.4226 0.1073  0.0375  0.1427  26  PHE A C   
174  O O   . PHE A 26  ? 0.4532 0.4989 0.4270 0.1155  0.0327  0.1262  26  PHE A O   
175  C CB  . PHE A 26  ? 0.4667 0.4755 0.4567 0.1207  0.0451  0.1504  26  PHE A CB  
176  C CG  . PHE A 26  ? 0.4987 0.4828 0.4854 0.1301  0.0517  0.1609  26  PHE A CG  
177  C CD1 . PHE A 26  ? 0.5023 0.4811 0.5031 0.1188  0.0566  0.1788  26  PHE A CD1 
178  C CD2 . PHE A 26  ? 0.5459 0.5121 0.5137 0.1519  0.0533  0.1528  26  PHE A CD2 
179  C CE1 . PHE A 26  ? 0.5263 0.4821 0.5241 0.1271  0.0628  0.1882  26  PHE A CE1 
180  C CE2 . PHE A 26  ? 0.5701 0.5140 0.5335 0.1620  0.0603  0.1635  26  PHE A CE2 
181  C CZ  . PHE A 26  ? 0.5682 0.5068 0.5476 0.1487  0.0651  0.1811  26  PHE A CZ  
182  N N   . LEU A 27  ? 0.4107 0.4718 0.4152 0.0912  0.0370  0.1523  27  LEU A N   
183  C CA  . LEU A 27  ? 0.3878 0.4760 0.3978 0.0824  0.0315  0.1446  27  LEU A CA  
184  C C   . LEU A 27  ? 0.3928 0.4898 0.4195 0.0768  0.0321  0.1411  27  LEU A C   
185  O O   . LEU A 27  ? 0.3962 0.4921 0.4401 0.0695  0.0371  0.1543  27  LEU A O   
186  C CB  . LEU A 27  ? 0.3679 0.4748 0.3873 0.0712  0.0314  0.1573  27  LEU A CB  
187  C CG  . LEU A 27  ? 0.3377 0.4750 0.3611 0.0635  0.0263  0.1522  27  LEU A CG  
188  C CD1 . LEU A 27  ? 0.3222 0.4648 0.3294 0.0702  0.0188  0.1349  27  LEU A CD1 
189  C CD2 . LEU A 27  ? 0.2986 0.4531 0.3309 0.0565  0.0268  0.1662  27  LEU A CD2 
190  N N   . LEU A 28  ? 0.3949 0.5008 0.4194 0.0804  0.0273  0.1224  28  LEU A N   
191  C CA  . LEU A 28  ? 0.4083 0.5264 0.4561 0.0740  0.0285  0.1172  28  LEU A CA  
192  C C   . LEU A 28  ? 0.4211 0.5644 0.4735 0.0653  0.0260  0.1120  28  LEU A C   
193  O O   . LEU A 28  ? 0.4288 0.5777 0.4628 0.0692  0.0197  0.1011  28  LEU A O   
194  C CB  . LEU A 28  ? 0.4070 0.5147 0.4555 0.0871  0.0252  0.0964  28  LEU A CB  
195  C CG  . LEU A 28  ? 0.4121 0.4964 0.4564 0.0989  0.0273  0.0997  28  LEU A CG  
196  C CD1 . LEU A 28  ? 0.4409 0.5206 0.4868 0.1146  0.0224  0.0759  28  LEU A CD1 
197  C CD2 . LEU A 28  ? 0.4050 0.4882 0.4733 0.0880  0.0337  0.1187  28  LEU A CD2 
198  N N   . LEU A 29  ? 0.4442 0.6029 0.5222 0.0540  0.0316  0.1205  29  LEU A N   
199  C CA  . LEU A 29  ? 0.4662 0.6499 0.5512 0.0461  0.0316  0.1182  29  LEU A CA  
200  C C   . LEU A 29  ? 0.5069 0.6960 0.6159 0.0454  0.0333  0.1018  29  LEU A C   
201  O O   . LEU A 29  ? 0.5112 0.6920 0.6433 0.0455  0.0383  0.1027  29  LEU A O   
202  C CB  . LEU A 29  ? 0.4519 0.6503 0.5486 0.0356  0.0392  0.1432  29  LEU A CB  
203  C CG  . LEU A 29  ? 0.4270 0.6210 0.5078 0.0366  0.0381  0.1590  29  LEU A CG  
204  C CD1 . LEU A 29  ? 0.4038 0.6170 0.4950 0.0293  0.0445  0.1798  29  LEU A CD1 
205  C CD2 . LEU A 29  ? 0.3907 0.5868 0.4470 0.0430  0.0285  0.1483  29  LEU A CD2 
206  N N   . GLN A 30  ? 0.5542 0.7574 0.6599 0.0454  0.0286  0.0849  30  GLN A N   
207  C CA  . GLN A 30  ? 0.6200 0.8292 0.7522 0.0450  0.0302  0.0662  30  GLN A CA  
208  C C   . GLN A 30  ? 0.6557 0.8850 0.8184 0.0321  0.0416  0.0808  30  GLN A C   
209  O O   . GLN A 30  ? 0.6548 0.9015 0.8074 0.0263  0.0427  0.0918  30  GLN A O   
210  C CB  . GLN A 30  ? 0.6262 0.8397 0.7402 0.0519  0.0196  0.0389  30  GLN A CB  
211  C CG  . GLN A 30  ? 0.6560 0.8753 0.7985 0.0533  0.0199  0.0142  30  GLN A CG  
212  C CD  . GLN A 30  ? 0.6656 0.8847 0.7865 0.0632  0.0077  -0.0160 30  GLN A CD  
213  O OE1 . GLN A 30  ? 0.6643 0.8909 0.7576 0.0619  0.0014  -0.0165 30  GLN A OE1 
214  N NE2 . GLN A 30  ? 0.6948 0.9066 0.8299 0.0741  0.0038  -0.0430 30  GLN A NE2 
215  N N   . ALA A 31  ? 0.7153 0.9434 0.9169 0.0289  0.0506  0.0809  31  ALA A N   
216  C CA  . ALA A 31  ? 0.7769 1.0231 1.0118 0.0181  0.0642  0.0943  31  ALA A CA  
217  C C   . ALA A 31  ? 0.8638 1.1268 1.1044 0.0163  0.0629  0.0764  31  ALA A C   
218  O O   . ALA A 31  ? 0.8876 1.1462 1.1282 0.0230  0.0540  0.0465  31  ALA A O   
219  C CB  . ALA A 31  ? 0.7790 1.0193 1.0593 0.0157  0.0744  0.0965  31  ALA A CB  
220  N N   . SER A 32  ? 0.9490 1.2320 1.1929 0.0086  0.0717  0.0942  32  SER A N   
221  C CA  . SER A 32  ? 1.0120 1.3123 1.2661 0.0057  0.0732  0.0804  32  SER A CA  
222  C C   . SER A 32  ? 1.0894 1.3912 1.3978 0.0019  0.0863  0.0716  32  SER A C   
223  O O   . SER A 32  ? 1.1179 1.4216 1.4410 0.0038  0.0820  0.0431  32  SER A O   
224  C CB  . SER A 32  ? 0.9756 1.2984 1.2155 0.0012  0.0789  0.1036  32  SER A CB  
225  O OG  . SER A 32  ? 0.9576 1.2843 1.1532 0.0056  0.0632  0.0986  32  SER A OG  
226  N N   . ASP A 33  ? 1.1458 1.4468 1.4860 -0.0030 0.1023  0.0956  33  ASP A N   
227  C CA  . ASP A 33  ? 1.2204 1.5238 1.6201 -0.0073 0.1180  0.0919  33  ASP A CA  
228  C C   . ASP A 33  ? 1.2563 1.5422 1.6811 -0.0018 0.1118  0.0702  33  ASP A C   
229  O O   . ASP A 33  ? 1.2320 1.5052 1.6499 0.0001  0.1097  0.0820  33  ASP A O   
230  C CB  . ASP A 33  ? 0.2593 0.5708 0.6828 -0.0142 0.1396  0.1294  33  ASP A CB  
231  N N   . GLY A 34  ? 1.4066 1.6909 1.8523 0.0026  0.1062  0.0397  34  GLY A N   
232  C CA  . GLY A 34  ? 1.4456 1.7158 1.9077 0.0130  0.0954  0.0114  34  GLY A CA  
233  C C   . GLY A 34  ? 1.4434 1.7061 1.8616 0.0257  0.0742  -0.0191 34  GLY A C   
234  O O   . GLY A 34  ? 1.4808 1.7378 1.9173 0.0371  0.0652  -0.0526 34  GLY A O   
235  N N   . ILE A 35  ? 1.4892 1.7469 1.8799 -0.0699 -0.0311 0.2789  35  ILE A N   
236  C CA  . ILE A 35  ? 1.4361 1.6958 1.7824 -0.0499 0.0020  0.2500  35  ILE A CA  
237  C C   . ILE A 35  ? 1.3788 1.5762 1.6996 -0.0554 -0.0241 0.1868  35  ILE A C   
238  O O   . ILE A 35  ? 1.3579 1.5609 1.6588 -0.0444 -0.0041 0.1681  35  ILE A O   
239  C CB  . ILE A 35  ? 1.4557 1.7919 1.8429 -0.0428 0.0262  0.3174  35  ILE A CB  
240  C CG1 . ILE A 35  ? 1.4215 1.7641 1.7331 -0.0069 0.0773  0.2886  35  ILE A CG1 
241  C CG2 . ILE A 35  ? 1.5141 1.8527 1.9800 -0.0783 -0.0228 0.3504  35  ILE A CG2 
242  C CD1 . ILE A 35  ? 1.4678 1.8750 1.8068 0.0018  0.0992  0.3415  35  ILE A CD1 
243  N N   . HIS A 36  ? 1.3572 1.4974 1.6717 -0.0649 -0.0672 0.1553  36  HIS A N   
244  C CA  . HIS A 36  ? 1.3124 1.3975 1.6018 -0.0572 -0.0974 0.1064  36  HIS A CA  
245  C C   . HIS A 36  ? 1.2166 1.2581 1.4462 -0.0368 -0.1021 0.0549  36  HIS A C   
246  O O   . HIS A 36  ? 1.2233 1.2299 1.4233 -0.0158 -0.1201 0.0181  36  HIS A O   
247  C CB  . HIS A 36  ? 1.4360 1.4836 1.7738 -0.0776 -0.1652 0.1288  36  HIS A CB  
248  C CG  . HIS A 36  ? 1.4909 1.4731 1.7915 -0.0563 -0.2005 0.0799  36  HIS A CG  
249  N ND1 . HIS A 36  ? 1.4567 1.4526 1.7406 -0.0378 -0.1712 0.0536  36  HIS A ND1 
250  C CD2 . HIS A 36  ? 1.6041 1.5045 1.8721 -0.0418 -0.2639 0.0533  36  HIS A CD2 
251  C CE1 . HIS A 36  ? 1.5254 1.4577 1.7747 -0.0113 -0.2118 0.0151  36  HIS A CE1 
252  N NE2 . HIS A 36  ? 1.6367 1.5062 1.8687 -0.0092 -0.2696 0.0138  36  HIS A NE2 
253  N N   . HIS A 37  ? 1.1052 1.1522 1.3183 -0.0386 -0.0879 0.0579  37  HIS A N   
254  C CA  . HIS A 37  ? 0.9863 0.9989 1.1501 -0.0219 -0.0964 0.0223  37  HIS A CA  
255  C C   . HIS A 37  ? 0.8517 0.8852 0.9743 -0.0074 -0.0530 0.0030  37  HIS A C   
256  O O   . HIS A 37  ? 0.8281 0.8842 0.9451 -0.0130 -0.0215 0.0175  37  HIS A O   
257  C CB  . HIS A 37  ? 0.6244 0.6195 0.7953 -0.0356 -0.1191 0.0368  37  HIS A CB  
258  C CG  . HIS A 37  ? 0.6497 0.5953 0.7723 -0.0159 -0.1504 0.0062  37  HIS A CG  
259  N ND1 . HIS A 37  ? 0.7159 0.6146 0.8381 -0.0224 -0.2023 0.0115  37  HIS A ND1 
260  C CD2 . HIS A 37  ? 0.6269 0.5664 0.6964 0.0151  -0.1388 -0.0232 37  HIS A CD2 
261  C CE1 . HIS A 37  ? 0.7364 0.5966 0.7946 0.0097  -0.2187 -0.0186 37  HIS A CE1 
262  N NE2 . HIS A 37  ? 0.6803 0.5725 0.7105 0.0339  -0.1781 -0.0357 37  HIS A NE2 
263  N N   . TRP A 38  ? 0.8515 0.8736 0.9417 0.0192  -0.0594 -0.0275 38  TRP A N   
264  C CA  . TRP A 38  ? 0.7338 0.7773 0.7963 0.0257  -0.0302 -0.0329 38  TRP A CA  
265  C C   . TRP A 38  ? 0.6971 0.7324 0.7303 0.0408  -0.0413 -0.0380 38  TRP A C   
266  O O   . TRP A 38  ? 0.7247 0.7478 0.7412 0.0691  -0.0638 -0.0485 38  TRP A O   
267  C CB  . TRP A 38  ? 0.7039 0.7696 0.7643 0.0402  -0.0167 -0.0441 38  TRP A CB  
268  C CG  . TRP A 38  ? 0.6709 0.7492 0.7501 0.0297  -0.0002 -0.0397 38  TRP A CG  
269  C CD1 . TRP A 38  ? 0.6904 0.7645 0.7995 0.0254  -0.0124 -0.0355 38  TRP A CD1 
270  C CD2 . TRP A 38  ? 0.6188 0.7120 0.6815 0.0252  0.0271  -0.0355 38  TRP A CD2 
271  N NE1 . TRP A 38  ? 0.6592 0.7574 0.7760 0.0191  0.0135  -0.0260 38  TRP A NE1 
272  C CE2 . TRP A 38  ? 0.6346 0.7409 0.7159 0.0225  0.0381  -0.0288 38  TRP A CE2 
273  C CE3 . TRP A 38  ? 0.5834 0.6723 0.6118 0.0246  0.0364  -0.0341 38  TRP A CE3 
274  C CZ2 . TRP A 38  ? 0.6141 0.7315 0.6710 0.0261  0.0635  -0.0241 38  TRP A CZ2 
275  C CZ3 . TRP A 38  ? 0.6090 0.6947 0.6101 0.0265  0.0522  -0.0321 38  TRP A CZ3 
276  C CH2 . TRP A 38  ? 0.6094 0.7105 0.6201 0.0306  0.0684  -0.0288 38  TRP A CH2 
277  N N   . THR A 39  ? 0.6153 0.6553 0.6354 0.0278  -0.0264 -0.0281 39  THR A N   
278  C CA  . THR A 39  ? 0.5633 0.6050 0.5580 0.0393  -0.0325 -0.0247 39  THR A CA  
279  C C   . THR A 39  ? 0.5040 0.5613 0.4883 0.0275  -0.0169 -0.0096 39  THR A C   
280  O O   . THR A 39  ? 0.4862 0.5368 0.4706 0.0120  -0.0057 -0.0068 39  THR A O   
281  C CB  . THR A 39  ? 0.5933 0.6070 0.5796 0.0327  -0.0476 -0.0251 39  THR A CB  
282  O OG1 . THR A 39  ? 0.5499 0.5595 0.5474 0.0056  -0.0314 -0.0150 39  THR A OG1 
283  C CG2 . THR A 39  ? 0.6324 0.6154 0.6278 0.0393  -0.0797 -0.0342 39  THR A CG2 
284  N N   . PRO A 40  ? 0.4684 0.5428 0.4383 0.0385  -0.0218 0.0046  40  PRO A N   
285  C CA  . PRO A 40  ? 0.4358 0.5152 0.4000 0.0198  -0.0188 0.0265  40  PRO A CA  
286  C C   . PRO A 40  ? 0.4273 0.4690 0.3774 -0.0003 -0.0146 0.0212  40  PRO A C   
287  O O   . PRO A 40  ? 0.4351 0.4622 0.3884 0.0010  -0.0139 0.0069  40  PRO A O   
288  C CB  . PRO A 40  ? 0.4311 0.5544 0.3925 0.0420  -0.0250 0.0537  40  PRO A CB  
289  C CG  . PRO A 40  ? 0.4545 0.6004 0.4170 0.0808  -0.0275 0.0439  40  PRO A CG  
290  C CD  . PRO A 40  ? 0.4816 0.5805 0.4388 0.0778  -0.0324 0.0088  40  PRO A CD  
291  N N   . PRO A 41  ? 0.4217 0.4437 0.3570 -0.0181 -0.0170 0.0351  41  PRO A N   
292  C CA  . PRO A 41  ? 0.4313 0.4188 0.3506 -0.0286 -0.0107 0.0288  41  PRO A CA  
293  C C   . PRO A 41  ? 0.4379 0.4361 0.3566 -0.0258 -0.0100 0.0289  41  PRO A C   
294  O O   . PRO A 41  ? 0.3919 0.4156 0.3056 -0.0197 -0.0160 0.0469  41  PRO A O   
295  C CB  . PRO A 41  ? 0.4592 0.4129 0.3523 -0.0422 -0.0239 0.0450  41  PRO A CB  
296  C CG  . PRO A 41  ? 0.4609 0.4386 0.3663 -0.0449 -0.0418 0.0660  41  PRO A CG  
297  C CD  . PRO A 41  ? 0.4231 0.4391 0.3527 -0.0285 -0.0309 0.0538  41  PRO A CD  
298  N N   . LYS A 42  ? 0.4689 0.4516 0.3927 -0.0281 -0.0038 0.0149  42  LYS A N   
299  C CA  . LYS A 42  ? 0.4964 0.4772 0.4121 -0.0273 -0.0067 0.0121  42  LYS A CA  
300  C C   . LYS A 42  ? 0.5266 0.4887 0.4545 -0.0388 0.0006  0.0062  42  LYS A C   
301  O O   . LYS A 42  ? 0.5430 0.5032 0.4886 -0.0404 0.0091  0.0090  42  LYS A O   
302  C CB  . LYS A 42  ? 0.5119 0.5041 0.4225 -0.0046 -0.0232 0.0046  42  LYS A CB  
303  C CG  . LYS A 42  ? 0.5569 0.5299 0.4868 -0.0057 -0.0382 -0.0089 42  LYS A CG  
304  C CD  . LYS A 42  ? 0.6186 0.5936 0.5504 0.0152  -0.0554 -0.0161 42  LYS A CD  
305  C CE  . LYS A 42  ? 0.7000 0.6487 0.6576 0.0070  -0.0813 -0.0216 42  LYS A CE  
306  N NZ  . LYS A 42  ? 0.7161 0.6774 0.7180 -0.0216 -0.0636 -0.0065 42  LYS A NZ  
307  N N   . GLY A 43  ? 0.5516 0.5074 0.4703 -0.0421 -0.0015 0.0032  43  GLY A N   
308  C CA  . GLY A 43  ? 0.5843 0.5321 0.5220 -0.0522 0.0043  0.0031  43  GLY A CA  
309  C C   . GLY A 43  ? 0.6244 0.5640 0.5448 -0.0552 -0.0013 -0.0031 43  GLY A C   
310  O O   . GLY A 43  ? 0.5986 0.5397 0.4864 -0.0448 -0.0081 -0.0053 43  GLY A O   
311  N N   . HIS A 44  ? 0.6844 0.6213 0.6267 -0.0654 0.0028  -0.0010 44  HIS A N   
312  C CA  . HIS A 44  ? 0.7679 0.6941 0.6973 -0.0700 -0.0065 -0.0087 44  HIS A CA  
313  C C   . HIS A 44  ? 0.7228 0.6446 0.6223 -0.0735 0.0157  -0.0112 44  HIS A C   
314  O O   . HIS A 44  ? 0.7116 0.6308 0.6134 -0.0767 0.0365  -0.0053 44  HIS A O   
315  C CB  . HIS A 44  ? 0.8724 0.8054 0.8520 -0.0829 -0.0156 0.0020  44  HIS A CB  
316  C CG  . HIS A 44  ? 1.0709 0.9989 1.0811 -0.0862 -0.0549 0.0096  44  HIS A CG  
317  N ND1 . HIS A 44  ? 1.1746 1.1281 1.2365 -0.0901 -0.0546 0.0330  44  HIS A ND1 
318  C CD2 . HIS A 44  ? 1.2340 1.1267 1.2231 -0.0829 -0.1016 -0.0008 44  HIS A CD2 
319  C CE1 . HIS A 44  ? 1.2707 1.2075 1.3528 -0.0964 -0.1004 0.0389  44  HIS A CE1 
320  N NE2 . HIS A 44  ? 1.3152 1.2072 1.3493 -0.0906 -0.1334 0.0162  44  HIS A NE2 
321  N N   . VAL A 45  ? 0.7267 0.6412 0.5907 -0.0688 0.0066  -0.0192 45  VAL A N   
322  C CA  . VAL A 45  ? 0.7142 0.6276 0.5493 -0.0734 0.0252  -0.0187 45  VAL A CA  
323  C C   . VAL A 45  ? 0.7390 0.6464 0.5990 -0.0882 0.0407  -0.0234 45  VAL A C   
324  O O   . VAL A 45  ? 0.8038 0.7106 0.6902 -0.0931 0.0274  -0.0271 45  VAL A O   
325  C CB  . VAL A 45  ? 0.7270 0.6377 0.5109 -0.0551 0.0102  -0.0238 45  VAL A CB  
326  C CG1 . VAL A 45  ? 0.7039 0.6183 0.4602 -0.0607 0.0302  -0.0207 45  VAL A CG1 
327  C CG2 . VAL A 45  ? 0.7114 0.6402 0.4674 -0.0305 0.0030  -0.0106 45  VAL A CG2 
328  N N   . GLU A 46  ? 0.7430 0.6439 0.5955 -0.0938 0.0642  -0.0192 46  GLU A N   
329  C CA  . GLU A 46  ? 0.7883 0.6842 0.6562 -0.0992 0.0828  -0.0237 46  GLU A CA  
330  C C   . GLU A 46  ? 0.8020 0.6956 0.6405 -0.1063 0.0862  -0.0337 46  GLU A C   
331  O O   . GLU A 46  ? 0.7841 0.6803 0.5821 -0.1027 0.0805  -0.0302 46  GLU A O   
332  C CB  . GLU A 46  ? 0.7956 0.6678 0.6514 -0.0936 0.0998  -0.0181 46  GLU A CB  
333  C CG  . GLU A 46  ? 0.8716 0.7396 0.7421 -0.0762 0.0997  -0.0090 46  GLU A CG  
334  C CD  . GLU A 46  ? 1.0051 0.9032 0.9229 -0.0630 0.1107  0.0004  46  GLU A CD  
335  O OE1 . GLU A 46  ? 1.1147 1.0199 1.0424 -0.0422 0.1137  0.0146  46  GLU A OE1 
336  O OE2 . GLU A 46  ? 1.0090 0.9286 0.9558 -0.0718 0.1150  -0.0001 46  GLU A OE2 
337  N N   . PRO A 47  ? 0.9048 0.8169 0.8263 0.0265  0.0238  0.0060  47  PRO A N   
338  C CA  . PRO A 47  ? 0.9370 0.8444 0.8492 0.0307  0.0263  0.0038  47  PRO A CA  
339  C C   . PRO A 47  ? 0.9370 0.8487 0.8490 0.0333  0.0192  0.0017  47  PRO A C   
340  O O   . PRO A 47  ? 0.9795 0.8953 0.8913 0.0312  0.0196  0.0017  47  PRO A O   
341  C CB  . PRO A 47  ? 0.9857 0.8801 0.8866 0.0406  0.0325  0.0038  47  PRO A CB  
342  C CG  . PRO A 47  ? 0.9849 0.8786 0.8922 0.0372  0.0375  0.0077  47  PRO A CG  
343  C CD  . PRO A 47  ? 0.9324 0.8372 0.8520 0.0295  0.0308  0.0090  47  PRO A CD  
344  N N   . GLY A 48  ? 0.9293 0.8397 0.8413 0.0379  0.0123  0.0004  48  GLY A N   
345  C CA  . GLY A 48  ? 0.9467 0.8623 0.8620 0.0394  0.0043  -0.0011 48  GLY A CA  
346  C C   . GLY A 48  ? 0.8816 0.8106 0.8114 0.0309  0.0003  0.0006  48  GLY A C   
347  O O   . GLY A 48  ? 0.8969 0.8318 0.8305 0.0310  -0.0018 0.0013  48  GLY A O   
348  N N   . GLU A 49  ? 0.8125 0.7459 0.7500 0.0243  0.0003  0.0021  49  GLU A N   
349  C CA  . GLU A 49  ? 0.7509 0.6946 0.7018 0.0182  -0.0048 0.0034  49  GLU A CA  
350  C C   . GLU A 49  ? 0.7109 0.6632 0.6695 0.0140  -0.0038 0.0057  49  GLU A C   
351  O O   . GLU A 49  ? 0.7107 0.6618 0.6651 0.0119  0.0021  0.0069  49  GLU A O   
352  C CB  . GLU A 49  ? 0.7242 0.6690 0.6783 0.0136  -0.0033 0.0044  49  GLU A CB  
353  C CG  . GLU A 49  ? 0.7354 0.6824 0.6951 0.0129  -0.0100 0.0042  49  GLU A CG  
354  C CD  . GLU A 49  ? 0.7475 0.6918 0.7049 0.0120  -0.0076 0.0055  49  GLU A CD  
355  O OE1 . GLU A 49  ? 0.7436 0.6903 0.7024 0.0084  -0.0019 0.0071  49  GLU A OE1 
356  O OE2 . GLU A 49  ? 0.7931 0.7323 0.7469 0.0152  -0.0119 0.0052  49  GLU A OE2 
357  N N   . ASP A 50  ? 0.6719 0.6317 0.6418 0.0131  -0.0098 0.0068  50  ASP A N   
358  C CA  . ASP A 50  ? 0.6309 0.5991 0.6109 0.0098  -0.0087 0.0103  50  ASP A CA  
359  C C   . ASP A 50  ? 0.5931 0.5635 0.5765 0.0043  -0.0063 0.0109  50  ASP A C   
360  O O   . ASP A 50  ? 0.5961 0.5651 0.5792 0.0025  -0.0078 0.0092  50  ASP A O   
361  C CB  . ASP A 50  ? 0.6326 0.6081 0.6266 0.0100  -0.0160 0.0116  50  ASP A CB  
362  C CG  . ASP A 50  ? 0.6418 0.6254 0.6466 0.0090  -0.0137 0.0167  50  ASP A CG  
363  O OD1 . ASP A 50  ? 0.6216 0.6102 0.6367 0.0055  -0.0140 0.0185  50  ASP A OD1 
364  O OD2 . ASP A 50  ? 0.6948 0.6789 0.6966 0.0127  -0.0106 0.0195  50  ASP A OD2 
365  N N   . ASP A 51  ? 0.5505 0.5233 0.5357 0.0026  -0.0024 0.0138  51  ASP A N   
366  C CA  . ASP A 51  ? 0.4999 0.4734 0.4863 -0.0014 -0.0007 0.0137  51  ASP A CA  
367  C C   . ASP A 51  ? 0.4802 0.4601 0.4779 -0.0037 -0.0045 0.0136  51  ASP A C   
368  O O   . ASP A 51  ? 0.4607 0.4402 0.4571 -0.0063 -0.0047 0.0119  51  ASP A O   
369  C CB  . ASP A 51  ? 0.4996 0.4711 0.4823 -0.0011 0.0036  0.0166  51  ASP A CB  
370  C CG  . ASP A 51  ? 0.4817 0.4439 0.4503 -0.0019 0.0073  0.0155  51  ASP A CG  
371  O OD1 . ASP A 51  ? 0.5190 0.4764 0.4815 -0.0021 0.0097  0.0171  51  ASP A OD1 
372  O OD2 . ASP A 51  ? 0.4814 0.4397 0.4442 -0.0019 0.0079  0.0131  51  ASP A OD2 
373  N N   . LEU A 52  ? 0.4743 0.4600 0.4834 -0.0026 -0.0073 0.0159  52  LEU A N   
374  C CA  . LEU A 52  ? 0.4604 0.4510 0.4801 -0.0048 -0.0110 0.0157  52  LEU A CA  
375  C C   . LEU A 52  ? 0.4793 0.4663 0.4955 -0.0051 -0.0165 0.0123  52  LEU A C   
376  O O   . LEU A 52  ? 0.4905 0.4783 0.5093 -0.0071 -0.0183 0.0115  52  LEU A O   
377  C CB  . LEU A 52  ? 0.4653 0.4625 0.5000 -0.0038 -0.0129 0.0196  52  LEU A CB  
378  C CG  . LEU A 52  ? 0.4471 0.4500 0.4957 -0.0059 -0.0139 0.0213  52  LEU A CG  
379  C CD1 . LEU A 52  ? 0.3212 0.3232 0.3654 -0.0073 -0.0094 0.0203  52  LEU A CD1 
380  C CD2 . LEU A 52  ? 0.4804 0.4893 0.5429 -0.0035 -0.0115 0.0274  52  LEU A CD2 
381  N N   . GLU A 53  ? 0.4956 0.4771 0.5041 -0.0021 -0.0186 0.0105  53  GLU A N   
382  C CA  . GLU A 53  ? 0.4958 0.4700 0.4966 -0.0001 -0.0230 0.0077  53  GLU A CA  
383  C C   . GLU A 53  ? 0.4708 0.4416 0.4634 -0.0012 -0.0185 0.0073  53  GLU A C   
384  O O   . GLU A 53  ? 0.4832 0.4501 0.4723 -0.0006 -0.0210 0.0067  53  GLU A O   
385  C CB  . GLU A 53  ? 0.5297 0.4974 0.5214 0.0050  -0.0240 0.0062  53  GLU A CB  
386  C CG  . GLU A 53  ? 0.5801 0.5421 0.5701 0.0087  -0.0328 0.0041  53  GLU A CG  
387  C CD  . GLU A 53  ? 0.6320 0.5894 0.6150 0.0146  -0.0340 0.0027  53  GLU A CD  
388  O OE1 . GLU A 53  ? 0.7006 0.6510 0.6793 0.0190  -0.0420 0.0003  53  GLU A OE1 
389  O OE2 . GLU A 53  ? 0.6282 0.5876 0.6082 0.0155  -0.0273 0.0038  53  GLU A OE2 
390  N N   . THR A 54  ? 0.4316 0.4031 0.4209 -0.0027 -0.0122 0.0080  54  THR A N   
391  C CA  . THR A 54  ? 0.4049 0.3752 0.3899 -0.0046 -0.0081 0.0085  54  THR A CA  
392  C C   . THR A 54  ? 0.3761 0.3528 0.3677 -0.0081 -0.0082 0.0094  54  THR A C   
393  O O   . THR A 54  ? 0.3654 0.3414 0.3544 -0.0083 -0.0075 0.0101  54  THR A O   
394  C CB  . THR A 54  ? 0.4114 0.3810 0.3934 -0.0065 -0.0029 0.0090  54  THR A CB  
395  O OG1 . THR A 54  ? 0.4339 0.3975 0.4089 -0.0029 -0.0015 0.0082  54  THR A OG1 
396  C CG2 . THR A 54  ? 0.3952 0.3645 0.3757 -0.0089 0.0002  0.0100  54  THR A CG2 
397  N N   . ALA A 55  ? 0.3437 0.3260 0.3429 -0.0100 -0.0082 0.0099  55  ALA A N   
398  C CA  . ALA A 55  ? 0.3409 0.3285 0.3453 -0.0122 -0.0074 0.0105  55  ALA A CA  
399  C C   . ALA A 55  ? 0.3507 0.3379 0.3563 -0.0117 -0.0108 0.0102  55  ALA A C   
400  O O   . ALA A 55  ? 0.3424 0.3310 0.3462 -0.0126 -0.0092 0.0106  55  ALA A O   
401  C CB  . ALA A 55  ? 0.3301 0.3217 0.3420 -0.0121 -0.0061 0.0119  55  ALA A CB  
402  N N   . LEU A 56  ? 0.3582 0.3427 0.3661 -0.0101 -0.0158 0.0097  56  LEU A N   
403  C CA  . LEU A 56  ? 0.3689 0.3496 0.3753 -0.0095 -0.0205 0.0091  56  LEU A CA  
404  C C   . LEU A 56  ? 0.3883 0.3605 0.3811 -0.0066 -0.0203 0.0089  56  LEU A C   
405  O O   . LEU A 56  ? 0.3970 0.3671 0.3848 -0.0062 -0.0196 0.0098  56  LEU A O   
406  C CB  . LEU A 56  ? 0.3850 0.3636 0.3975 -0.0088 -0.0280 0.0083  56  LEU A CB  
407  C CG  . LEU A 56  ? 0.3777 0.3650 0.4066 -0.0111 -0.0280 0.0103  56  LEU A CG  
408  C CD1 . LEU A 56  ? 0.3829 0.3705 0.4193 -0.0100 -0.0344 0.0105  56  LEU A CD1 
409  C CD2 . LEU A 56  ? 0.3187 0.3081 0.3538 -0.0135 -0.0282 0.0108  56  LEU A CD2 
410  N N   . ARG A 57  ? 0.4149 0.3814 0.4008 -0.0034 -0.0201 0.0084  57  ARG A N   
411  C CA  . ARG A 57  ? 0.4667 0.4234 0.4395 0.0011  -0.0190 0.0094  57  ARG A CA  
412  C C   . ARG A 57  ? 0.4647 0.4260 0.4369 -0.0006 -0.0125 0.0122  57  ARG A C   
413  O O   . ARG A 57  ? 0.4776 0.4342 0.4421 0.0019  -0.0114 0.0145  57  ARG A O   
414  C CB  . ARG A 57  ? 0.4906 0.4408 0.4566 0.0055  -0.0175 0.0088  57  ARG A CB  
415  C CG  . ARG A 57  ? 0.5328 0.4699 0.4841 0.0126  -0.0162 0.0104  57  ARG A CG  
416  C CD  . ARG A 57  ? 0.5736 0.5056 0.5195 0.0168  -0.0114 0.0107  57  ARG A CD  
417  N NE  . ARG A 57  ? 0.5929 0.5312 0.5435 0.0135  -0.0034 0.0139  57  ARG A NE  
418  C CZ  . ARG A 57  ? 0.5962 0.5411 0.5537 0.0089  -0.0002 0.0132  57  ARG A CZ  
419  N NH1 . ARG A 57  ? 0.6231 0.5696 0.5826 0.0080  -0.0028 0.0101  57  ARG A NH1 
420  N NH2 . ARG A 57  ? 0.6400 0.5894 0.6020 0.0054  0.0053  0.0160  57  ARG A NH2 
421  N N   . GLU A 58  ? 0.4520 0.4218 0.4316 -0.0046 -0.0084 0.0124  58  GLU A N   
422  C CA  . GLU A 58  ? 0.4445 0.4193 0.4253 -0.0068 -0.0034 0.0150  58  GLU A CA  
423  C C   . GLU A 58  ? 0.4305 0.4108 0.4135 -0.0084 -0.0031 0.0158  58  GLU A C   
424  O O   . GLU A 58  ? 0.4324 0.4147 0.4132 -0.0079 0.0002  0.0189  58  GLU A O   
425  C CB  . GLU A 58  ? 0.4425 0.4222 0.4291 -0.0106 -0.0012 0.0142  58  GLU A CB  
426  C CG  . GLU A 58  ? 0.4937 0.4752 0.4811 -0.0123 0.0027  0.0167  58  GLU A CG  
427  C CD  . GLU A 58  ? 0.5333 0.5071 0.5149 -0.0082 0.0055  0.0190  58  GLU A CD  
428  O OE1 . GLU A 58  ? 0.5653 0.5330 0.5431 -0.0060 0.0052  0.0171  58  GLU A OE1 
429  O OE2 . GLU A 58  ? 0.5641 0.5378 0.5450 -0.0064 0.0088  0.0233  58  GLU A OE2 
430  N N   . THR A 59  ? 0.4118 0.3946 0.3997 -0.0099 -0.0061 0.0137  59  THR A N   
431  C CA  . THR A 59  ? 0.3990 0.3850 0.3876 -0.0105 -0.0055 0.0141  59  THR A CA  
432  C C   . THR A 59  ? 0.4280 0.4057 0.4056 -0.0069 -0.0067 0.0158  59  THR A C   
433  O O   . THR A 59  ? 0.4315 0.4110 0.4050 -0.0062 -0.0034 0.0180  59  THR A O   
434  C CB  . THR A 59  ? 0.3886 0.3780 0.3862 -0.0123 -0.0077 0.0122  59  THR A CB  
435  O OG1 . THR A 59  ? 0.3586 0.3539 0.3633 -0.0141 -0.0054 0.0116  59  THR A OG1 
436  C CG2 . THR A 59  ? 0.3800 0.3717 0.3776 -0.0125 -0.0059 0.0126  59  THR A CG2 
437  N N   . GLN A 60  ? 0.4636 0.4308 0.4347 -0.0038 -0.0116 0.0150  60  GLN A N   
438  C CA  . GLN A 60  ? 0.5082 0.4632 0.4644 0.0011  -0.0130 0.0170  60  GLN A CA  
439  C C   . GLN A 60  ? 0.5128 0.4654 0.4605 0.0053  -0.0066 0.0219  60  GLN A C   
440  O O   . GLN A 60  ? 0.5182 0.4667 0.4562 0.0086  -0.0037 0.0257  60  GLN A O   
441  C CB  . GLN A 60  ? 0.5369 0.4792 0.4869 0.0042  -0.0213 0.0145  60  GLN A CB  
442  C CG  . GLN A 60  ? 0.6588 0.5876 0.5952 0.0115  -0.0221 0.0156  60  GLN A CG  
443  C CD  . GLN A 60  ? 0.7806 0.6987 0.7000 0.0183  -0.0175 0.0207  60  GLN A CD  
444  O OE1 . GLN A 60  ? 0.8235 0.7368 0.7347 0.0192  -0.0179 0.0223  60  GLN A OE1 
445  N NE2 . GLN A 60  ? 0.8359 0.7500 0.7500 0.0235  -0.0121 0.0240  60  GLN A NE2 
446  N N   . GLU A 61  ? 0.5095 0.4649 0.4616 0.0053  -0.0038 0.0226  61  GLU A N   
447  C CA  . GLU A 61  ? 0.5379 0.4920 0.4857 0.0089  0.0026  0.0282  61  GLU A CA  
448  C C   . GLU A 61  ? 0.5169 0.4836 0.4718 0.0054  0.0077  0.0317  61  GLU A C   
449  O O   . GLU A 61  ? 0.5265 0.4917 0.4750 0.0093  0.0122  0.0375  61  GLU A O   
450  C CB  . GLU A 61  ? 0.5269 0.4806 0.4790 0.0091  0.0045  0.0279  61  GLU A CB  
451  C CG  . GLU A 61  ? 0.6429 0.5805 0.5818 0.0172  0.0033  0.0282  61  GLU A CG  
452  C CD  . GLU A 61  ? 0.7473 0.6831 0.6889 0.0178  0.0043  0.0262  61  GLU A CD  
453  O OE1 . GLU A 61  ? 0.8273 0.7537 0.7618 0.0218  -0.0004 0.0225  61  GLU A OE1 
454  O OE2 . GLU A 61  ? 0.7696 0.7124 0.7197 0.0147  0.0097  0.0282  61  GLU A OE2 
455  N N   . GLU A 62  ? 0.4950 0.4735 0.4623 -0.0011 0.0069  0.0284  62  GLU A N   
456  C CA  . GLU A 62  ? 0.4801 0.4705 0.4548 -0.0045 0.0102  0.0304  62  GLU A CA  
457  C C   . GLU A 62  ? 0.4700 0.4630 0.4405 -0.0037 0.0111  0.0309  62  GLU A C   
458  O O   . GLU A 62  ? 0.4648 0.4638 0.4349 -0.0027 0.0152  0.0353  62  GLU A O   
459  C CB  . GLU A 62  ? 0.4693 0.4670 0.4548 -0.0104 0.0082  0.0261  62  GLU A CB  
460  C CG  . GLU A 62  ? 0.5285 0.5327 0.5218 -0.0135 0.0103  0.0285  62  GLU A CG  
461  C CD  . GLU A 62  ? 0.5984 0.5966 0.5903 -0.0111 0.0128  0.0322  62  GLU A CD  
462  O OE1 . GLU A 62  ? 0.6777 0.6675 0.6651 -0.0091 0.0114  0.0297  62  GLU A OE1 
463  O OE2 . GLU A 62  ? 0.6148 0.6171 0.6111 -0.0108 0.0166  0.0379  62  GLU A OE2 
464  N N   . ALA A 63  ? 0.4581 0.4470 0.4260 -0.0039 0.0075  0.0268  63  ALA A N   
465  C CA  . ALA A 63  ? 0.4570 0.4477 0.4213 -0.0035 0.0088  0.0265  63  ALA A CA  
466  C C   . ALA A 63  ? 0.4788 0.4568 0.4299 0.0002  0.0065  0.0269  63  ALA A C   
467  O O   . ALA A 63  ? 0.4919 0.4696 0.4381 0.0009  0.0082  0.0270  63  ALA A O   
468  C CB  . ALA A 63  ? 0.4264 0.4244 0.4010 -0.0074 0.0076  0.0217  63  ALA A CB  
469  N N   . GLY A 64  ? 0.4968 0.4627 0.4408 0.0032  0.0025  0.0269  64  GLY A N   
470  C CA  . GLY A 64  ? 0.5206 0.4710 0.4493 0.0073  -0.0012 0.0272  64  GLY A CA  
471  C C   . GLY A 64  ? 0.5198 0.4678 0.4537 0.0036  -0.0078 0.0220  64  GLY A C   
472  O O   . GLY A 64  ? 0.5363 0.4711 0.4583 0.0059  -0.0120 0.0218  64  GLY A O   
473  N N   . ILE A 65  ? 0.4956 0.4550 0.4469 -0.0016 -0.0087 0.0186  65  ILE A N   
474  C CA  . ILE A 65  ? 0.4932 0.4529 0.4542 -0.0052 -0.0137 0.0151  65  ILE A CA  
475  C C   . ILE A 65  ? 0.5306 0.4855 0.4967 -0.0059 -0.0216 0.0127  65  ILE A C   
476  O O   . ILE A 65  ? 0.5015 0.4625 0.4756 -0.0067 -0.0211 0.0120  65  ILE A O   
477  C CB  . ILE A 65  ? 0.4533 0.4272 0.4301 -0.0090 -0.0092 0.0140  65  ILE A CB  
478  C CG1 . ILE A 65  ? 0.3997 0.3791 0.3714 -0.0078 -0.0018 0.0158  65  ILE A CG1 
479  C CG2 . ILE A 65  ? 0.4329 0.4070 0.4212 -0.0119 -0.0130 0.0121  65  ILE A CG2 
480  C CD1 . ILE A 65  ? 0.3096 0.3009 0.2930 -0.0096 0.0029  0.0147  65  ILE A CD1 
481  N N   . GLU A 66  ? 0.6102 0.5534 0.5710 -0.0053 -0.0293 0.0114  66  GLU A N   
482  C CA  . GLU A 66  ? 0.6585 0.5954 0.6229 -0.0053 -0.0388 0.0090  66  GLU A CA  
483  C C   . GLU A 66  ? 0.6361 0.5836 0.6225 -0.0108 -0.0417 0.0076  66  GLU A C   
484  O O   . GLU A 66  ? 0.6097 0.5650 0.6060 -0.0140 -0.0375 0.0083  66  GLU A O   
485  C CB  . GLU A 66  ? 0.7462 0.6637 0.6935 -0.0019 -0.0473 0.0082  66  GLU A CB  
486  C CG  . GLU A 66  ? 0.9315 0.8351 0.8628 0.0049  -0.0513 0.0081  66  GLU A CG  
487  C CD  . GLU A 66  ? 1.1074 0.9974 1.0147 0.0122  -0.0466 0.0118  66  GLU A CD  
488  O OE1 . GLU A 66  ? 1.1488 1.0349 1.0473 0.0181  -0.0426 0.0138  66  GLU A OE1 
489  O OE2 . GLU A 66  ? 1.1872 1.0698 1.0840 0.0126  -0.0462 0.0132  66  GLU A OE2 
490  N N   . ALA A 67  ? 0.6539 0.6011 0.6476 -0.0109 -0.0485 0.0062  67  ALA A N   
491  C CA  . ALA A 67  ? 0.6609 0.6194 0.6773 -0.0152 -0.0504 0.0065  67  ALA A CA  
492  C C   . ALA A 67  ? 0.6925 0.6507 0.7207 -0.0194 -0.0551 0.0069  67  ALA A C   
493  O O   . ALA A 67  ? 0.6771 0.6467 0.7248 -0.0226 -0.0515 0.0090  67  ALA A O   
494  C CB  . ALA A 67  ? 0.6723 0.6301 0.6924 -0.0136 -0.0569 0.0055  67  ALA A CB  
495  N N   . GLY A 68  ? 0.7318 0.6753 0.7470 -0.0189 -0.0627 0.0052  68  GLY A N   
496  C CA  . GLY A 68  ? 0.7607 0.7009 0.7837 -0.0232 -0.0670 0.0054  68  GLY A CA  
497  C C   . GLY A 68  ? 0.7275 0.6752 0.7539 -0.0246 -0.0554 0.0073  68  GLY A C   
498  O O   . GLY A 68  ? 0.7470 0.6981 0.7883 -0.0285 -0.0554 0.0084  68  GLY A O   
499  N N   . GLN A 69  ? 0.6837 0.6342 0.6970 -0.0210 -0.0456 0.0079  69  GLN A N   
500  C CA  . GLN A 69  ? 0.6503 0.6070 0.6629 -0.0208 -0.0348 0.0093  69  GLN A CA  
501  C C   . GLN A 69  ? 0.6102 0.5828 0.6397 -0.0212 -0.0264 0.0107  69  GLN A C   
502  O O   . GLN A 69  ? 0.5856 0.5639 0.6148 -0.0199 -0.0172 0.0116  69  GLN A O   
503  C CB  . GLN A 69  ? 0.6433 0.5939 0.6326 -0.0163 -0.0297 0.0097  69  GLN A CB  
504  C CG  . GLN A 69  ? 0.6880 0.6195 0.6557 -0.0136 -0.0369 0.0093  69  GLN A CG  
505  C CD  . GLN A 69  ? 0.7087 0.6338 0.6542 -0.0074 -0.0323 0.0115  69  GLN A CD  
506  O OE1 . GLN A 69  ? 0.7680 0.6757 0.6930 -0.0032 -0.0367 0.0123  69  GLN A OE1 
507  N NE2 . GLN A 69  ? 0.6114 0.5491 0.5608 -0.0064 -0.0239 0.0131  69  GLN A NE2 
508  N N   . LEU A 70  ? 0.6000 0.5782 0.6426 -0.0221 -0.0299 0.0112  70  LEU A N   
509  C CA  . LEU A 70  ? 0.5637 0.5535 0.6177 -0.0211 -0.0229 0.0130  70  LEU A CA  
510  C C   . LEU A 70  ? 0.5727 0.5687 0.6488 -0.0228 -0.0252 0.0158  70  LEU A C   
511  O O   . LEU A 70  ? 0.6220 0.6152 0.7046 -0.0250 -0.0345 0.0156  70  LEU A O   
512  C CB  . LEU A 70  ? 0.5437 0.5333 0.5890 -0.0192 -0.0238 0.0121  70  LEU A CB  
513  C CG  . LEU A 70  ? 0.5126 0.5012 0.5419 -0.0170 -0.0184 0.0113  70  LEU A CG  
514  C CD1 . LEU A 70  ? 0.4816 0.4713 0.5086 -0.0159 -0.0189 0.0110  70  LEU A CD1 
515  C CD2 . LEU A 70  ? 0.5241 0.5199 0.5573 -0.0163 -0.0098 0.0123  70  LEU A CD2 
516  N N   . THR A 71  ? 0.5517 0.5559 0.6388 -0.0210 -0.0166 0.0188  71  THR A N   
517  C CA  . THR A 71  ? 0.5538 0.5649 0.6611 -0.0208 -0.0167 0.0232  71  THR A CA  
518  C C   . THR A 71  ? 0.5247 0.5401 0.6297 -0.0163 -0.0087 0.0254  71  THR A C   
519  O O   . THR A 71  ? 0.5012 0.5170 0.6008 -0.0131 -0.0003 0.0256  71  THR A O   
520  C CB  . THR A 71  ? 0.5781 0.5923 0.7054 -0.0223 -0.0148 0.0270  71  THR A CB  
521  O OG1 . THR A 71  ? 0.6255 0.6371 0.7625 -0.0272 -0.0263 0.0266  71  THR A OG1 
522  C CG2 . THR A 71  ? 0.5678 0.5900 0.7130 -0.0188 -0.0075 0.0335  71  THR A CG2 
523  N N   . ILE A 72  ? 0.5244 0.5417 0.6319 -0.0157 -0.0118 0.0267  72  ILE A N   
524  C CA  . ILE A 72  ? 0.5161 0.5351 0.6202 -0.0114 -0.0052 0.0293  72  ILE A CA  
525  C C   . ILE A 72  ? 0.5373 0.5610 0.6578 -0.0074 0.0021  0.0363  72  ILE A C   
526  O O   . ILE A 72  ? 0.5812 0.6099 0.7209 -0.0083 -0.0002 0.0411  72  ILE A O   
527  C CB  . ILE A 72  ? 0.5194 0.5381 0.6202 -0.0114 -0.0103 0.0290  72  ILE A CB  
528  C CG1 . ILE A 72  ? 0.5023 0.5150 0.5859 -0.0135 -0.0157 0.0229  72  ILE A CG1 
529  C CG2 . ILE A 72  ? 0.5070 0.5255 0.6022 -0.0067 -0.0034 0.0321  72  ILE A CG2 
530  C CD1 . ILE A 72  ? 0.4684 0.4779 0.5362 -0.0117 -0.0114 0.0211  72  ILE A CD1 
531  N N   . ILE A 73  ? 0.5195 0.5406 0.6322 -0.0023 0.0109  0.0374  73  ILE A N   
532  C CA  . ILE A 73  ? 0.5373 0.5598 0.6616 0.0038  0.0193  0.0448  73  ILE A CA  
533  C C   . ILE A 73  ? 0.5655 0.5875 0.6878 0.0075  0.0203  0.0491  73  ILE A C   
534  O O   . ILE A 73  ? 0.5631 0.5790 0.6668 0.0095  0.0214  0.0465  73  ILE A O   
535  C CB  . ILE A 73  ? 0.5198 0.5370 0.6330 0.0095  0.0279  0.0439  73  ILE A CB  
536  C CG1 . ILE A 73  ? 0.4867 0.5041 0.5980 0.0059  0.0270  0.0390  73  ILE A CG1 
537  C CG2 . ILE A 73  ? 0.5139 0.5300 0.6376 0.0180  0.0379  0.0523  73  ILE A CG2 
538  C CD1 . ILE A 73  ? 0.4274 0.4495 0.5575 0.0012  0.0234  0.0408  73  ILE A CD1 
539  N N   . GLU A 74  ? 0.6068 0.6349 0.7481 0.0081  0.0197  0.0560  74  GLU A N   
540  C CA  . GLU A 74  ? 0.6406 0.6684 0.7794 0.0126  0.0217  0.0613  74  GLU A CA  
541  C C   . GLU A 74  ? 0.6335 0.6540 0.7636 0.0223  0.0329  0.0671  74  GLU A C   
542  O O   . GLU A 74  ? 0.6448 0.6635 0.7803 0.0266  0.0398  0.0702  74  GLU A O   
543  C CB  . GLU A 74  ? 0.7175 0.7551 0.8806 0.0114  0.0183  0.0684  74  GLU A CB  
544  C CG  . GLU A 74  ? 0.8150 0.8578 0.9871 0.0026  0.0056  0.0629  74  GLU A CG  
545  C CD  . GLU A 74  ? 0.9056 0.9429 1.0559 -0.0004 -0.0014 0.0540  74  GLU A CD  
546  O OE1 . GLU A 74  ? 0.9262 0.9617 1.0733 -0.0060 -0.0094 0.0472  74  GLU A OE1 
547  O OE2 . GLU A 74  ? 0.9359 0.9695 1.0716 0.0032  0.0015  0.0543  74  GLU A OE2 
548  N N   . GLY A 75  ? 0.6246 0.6388 0.7389 0.0263  0.0345  0.0686  75  GLY A N   
549  C CA  . GLY A 75  ? 0.6288 0.6325 0.7307 0.0368  0.0443  0.0747  75  GLY A CA  
550  C C   . GLY A 75  ? 0.6109 0.6014 0.6860 0.0390  0.0453  0.0682  75  GLY A C   
551  O O   . GLY A 75  ? 0.6529 0.6314 0.7142 0.0484  0.0523  0.0727  75  GLY A O   
552  N N   . PHE A 76  ? 0.5384 0.5302 0.6057 0.0308  0.0381  0.0582  76  PHE A N   
553  C CA  . PHE A 76  ? 0.4972 0.4784 0.5421 0.0316  0.0375  0.0522  76  PHE A CA  
554  C C   . PHE A 76  ? 0.4744 0.4557 0.5086 0.0238  0.0298  0.0449  76  PHE A C   
555  O O   . PHE A 76  ? 0.4585 0.4485 0.5015 0.0167  0.0241  0.0414  76  PHE A O   
556  C CB  . PHE A 76  ? 0.4838 0.4655 0.5297 0.0317  0.0389  0.0483  76  PHE A CB  
557  C CG  . PHE A 76  ? 0.4545 0.4268 0.4796 0.0321  0.0370  0.0420  76  PHE A CG  
558  C CD1 . PHE A 76  ? 0.4454 0.4042 0.4557 0.0417  0.0420  0.0443  76  PHE A CD1 
559  C CD2 . PHE A 76  ? 0.3789 0.3554 0.3994 0.0235  0.0299  0.0344  76  PHE A CD2 
560  C CE1 . PHE A 76  ? 0.4749 0.4249 0.4669 0.0416  0.0383  0.0382  76  PHE A CE1 
561  C CE2 . PHE A 76  ? 0.3749 0.3445 0.3797 0.0231  0.0274  0.0294  76  PHE A CE2 
562  C CZ  . PHE A 76  ? 0.4247 0.3813 0.4154 0.0315  0.0307  0.0308  76  PHE A CZ  
563  N N   . LYS A 77  ? 0.4770 0.4468 0.4912 0.0258  0.0298  0.0431  77  LYS A N   
564  C CA  . LYS A 77  ? 0.4671 0.4350 0.4703 0.0193  0.0239  0.0371  77  LYS A CA  
565  C C   . LYS A 77  ? 0.4814 0.4349 0.4638 0.0221  0.0240  0.0348  77  LYS A C   
566  O O   . LYS A 77  ? 0.4889 0.4312 0.4615 0.0305  0.0286  0.0393  77  LYS A O   
567  C CB  . LYS A 77  ? 0.4809 0.4493 0.4840 0.0192  0.0236  0.0401  77  LYS A CB  
568  C CG  . LYS A 77  ? 0.4852 0.4512 0.4779 0.0136  0.0191  0.0348  77  LYS A CG  
569  C CD  . LYS A 77  ? 0.5479 0.5113 0.5363 0.0165  0.0211  0.0388  77  LYS A CD  
570  C CE  . LYS A 77  ? 0.5967 0.5695 0.6029 0.0202  0.0234  0.0456  77  LYS A CE  
571  N NZ  . LYS A 77  ? 0.6485 0.6223 0.6539 0.0230  0.0246  0.0499  77  LYS A NZ  
572  N N   . ARG A 78  ? 0.4774 0.4303 0.4530 0.0155  0.0186  0.0284  78  ARG A N   
573  C CA  . ARG A 78  ? 0.5107 0.4505 0.4685 0.0166  0.0165  0.0258  78  ARG A CA  
574  C C   . ARG A 78  ? 0.5179 0.4562 0.4695 0.0088  0.0112  0.0213  78  ARG A C   
575  O O   . ARG A 78  ? 0.5027 0.4511 0.4633 0.0020  0.0080  0.0177  78  ARG A O   
576  C CB  . ARG A 78  ? 0.5124 0.4543 0.4720 0.0171  0.0154  0.0226  78  ARG A CB  
577  C CG  . ARG A 78  ? 0.5674 0.4964 0.5102 0.0180  0.0113  0.0193  78  ARG A CG  
578  C CD  . ARG A 78  ? 0.6287 0.5445 0.5603 0.0291  0.0153  0.0224  78  ARG A CD  
579  N NE  . ARG A 78  ? 0.7096 0.6053 0.6191 0.0331  0.0132  0.0232  78  ARG A NE  
580  C CZ  . ARG A 78  ? 0.7003 0.5841 0.5950 0.0315  0.0060  0.0184  78  ARG A CZ  
581  N NH1 . ARG A 78  ? 0.6729 0.5650 0.5741 0.0259  0.0004  0.0129  78  ARG A NH1 
582  N NH2 . ARG A 78  ? 0.7261 0.5890 0.5989 0.0356  0.0039  0.0196  78  ARG A NH2 
583  N N   . GLU A 79  ? 0.5586 0.4832 0.4942 0.0103  0.0108  0.0221  79  GLU A N   
584  C CA  . GLU A 79  ? 0.5855 0.5070 0.5152 0.0032  0.0066  0.0183  79  GLU A CA  
585  C C   . GLU A 79  ? 0.6236 0.5354 0.5430 0.0010  0.0011  0.0146  79  GLU A C   
586  O O   . GLU A 79  ? 0.6667 0.5630 0.5704 0.0068  0.0007  0.0157  79  GLU A O   
587  C CB  . GLU A 79  ? 0.6052 0.5164 0.5225 0.0056  0.0094  0.0211  79  GLU A CB  
588  C CG  . GLU A 79  ? 0.6537 0.5579 0.5622 -0.0008 0.0059  0.0176  79  GLU A CG  
589  C CD  . GLU A 79  ? 0.7231 0.6199 0.6211 0.0012  0.0099  0.0201  79  GLU A CD  
590  O OE1 . GLU A 79  ? 0.7524 0.6579 0.6582 0.0044  0.0140  0.0231  79  GLU A OE1 
591  O OE2 . GLU A 79  ? 0.7837 0.6658 0.6654 -0.0001 0.0087  0.0190  79  GLU A OE2 
592  N N   . LEU A 80  ? 0.6332 0.5536 0.5614 -0.0068 -0.0033 0.0107  80  LEU A N   
593  C CA  . LEU A 80  ? 0.6694 0.5838 0.5923 -0.0103 -0.0098 0.0073  80  LEU A CA  
594  C C   . LEU A 80  ? 0.7276 0.6340 0.6442 -0.0166 -0.0132 0.0060  80  LEU A C   
595  O O   . LEU A 80  ? 0.7047 0.6191 0.6300 -0.0214 -0.0113 0.0062  80  LEU A O   
596  C CB  . LEU A 80  ? 0.6339 0.5645 0.5729 -0.0152 -0.0120 0.0053  80  LEU A CB  
597  C CG  . LEU A 80  ? 0.5970 0.5291 0.5360 -0.0105 -0.0129 0.0042  80  LEU A CG  
598  C CD1 . LEU A 80  ? 0.5961 0.5272 0.5340 -0.0018 -0.0062 0.0073  80  LEU A CD1 
599  C CD2 . LEU A 80  ? 0.5300 0.4783 0.4836 -0.0151 -0.0138 0.0030  80  LEU A CD2 
600  N N   . ASN A 81  ? 0.8221 0.7108 0.7222 -0.0161 -0.0184 0.0046  81  ASN A N   
601  C CA  . ASN A 81  ? 0.9023 0.7817 0.7964 -0.0230 -0.0223 0.0031  81  ASN A CA  
602  C C   . ASN A 81  ? 0.9702 0.8455 0.8650 -0.0291 -0.0322 -0.0002 81  ASN A C   
603  O O   . ASN A 81  ? 1.0346 0.8953 0.9147 -0.0249 -0.0376 -0.0017 81  ASN A O   
604  C CB  . ASN A 81  ? 0.9326 0.7910 0.8036 -0.0175 -0.0201 0.0050  81  ASN A CB  
605  C CG  . ASN A 81  ? 0.9381 0.8007 0.8103 -0.0161 -0.0120 0.0080  81  ASN A CG  
606  O OD1 . ASN A 81  ? 0.9907 0.8556 0.8670 -0.0222 -0.0113 0.0070  81  ASN A OD1 
607  N ND2 . ASN A 81  ? 0.9657 0.8291 0.8346 -0.0074 -0.0056 0.0119  81  ASN A ND2 
608  N N   . TYR A 82  ? 1.0291 0.9169 0.9411 -0.0382 -0.0347 -0.0010 82  TYR A N   
609  C CA  . TYR A 82  ? 1.1082 0.9962 1.0262 -0.0449 -0.0446 -0.0034 82  TYR A CA  
610  C C   . TYR A 82  ? 1.1613 1.0564 1.0950 -0.0554 -0.0466 -0.0026 82  TYR A C   
611  O O   . TYR A 82  ? 1.1555 1.0511 1.0910 -0.0571 -0.0401 -0.0007 82  TYR A O   
612  C CB  . TYR A 82  ? 1.0821 0.9846 1.0113 -0.0425 -0.0460 -0.0040 82  TYR A CB  
613  C CG  . TYR A 82  ? 1.0378 0.9625 0.9869 -0.0440 -0.0391 -0.0015 82  TYR A CG  
614  C CD1 . TYR A 82  ? 1.0425 0.9808 1.0101 -0.0518 -0.0406 0.0000  82  TYR A CD1 
615  C CD2 . TYR A 82  ? 1.0088 0.9400 0.9582 -0.0372 -0.0310 -0.0001 82  TYR A CD2 
616  C CE1 . TYR A 82  ? 0.9948 0.9504 0.9771 -0.0516 -0.0339 0.0029  82  TYR A CE1 
617  C CE2 . TYR A 82  ? 0.9415 0.8899 0.9062 -0.0382 -0.0258 0.0019  82  TYR A CE2 
618  C CZ  . TYR A 82  ? 0.9411 0.9006 0.9205 -0.0448 -0.0270 0.0034  82  TYR A CZ  
619  O OH  . TYR A 82  ? 0.9093 0.8826 0.9001 -0.0444 -0.0216 0.0060  82  TYR A OH  
620  N N   . VAL A 83  ? 1.2493 1.1497 1.1946 -0.0619 -0.0553 -0.0035 83  VAL A N   
621  C CA  . VAL A 83  ? 1.3240 1.2300 1.2862 -0.0724 -0.0585 -0.0018 83  VAL A CA  
622  C C   . VAL A 83  ? 1.3322 1.2613 1.3191 -0.0758 -0.0588 0.0008  83  VAL A C   
623  O O   . VAL A 83  ? 1.3342 1.2675 1.3239 -0.0754 -0.0660 -0.0007 83  VAL A O   
624  C CB  . VAL A 83  ? 1.3969 1.2854 1.3511 -0.0787 -0.0713 -0.0046 83  VAL A CB  
625  C CG1 . VAL A 83  ? 1.4827 1.3749 1.4545 -0.0896 -0.0726 -0.0019 83  VAL A CG1 
626  C CG2 . VAL A 83  ? 1.4155 1.2770 1.3389 -0.0731 -0.0727 -0.0075 83  VAL A CG2 
627  N N   . ALA A 84  ? 1.3600 1.3027 1.3628 -0.0777 -0.0504 0.0053  84  ALA A N   
628  C CA  . ALA A 84  ? 1.3929 1.3565 1.4177 -0.0796 -0.0489 0.0096  84  ALA A CA  
629  C C   . ALA A 84  ? 1.4595 1.4298 1.5044 -0.0874 -0.0474 0.0150  84  ALA A C   
630  O O   . ALA A 84  ? 1.4536 1.4188 1.4974 -0.0874 -0.0402 0.0168  84  ALA A O   
631  C CB  . ALA A 84  ? 1.3366 1.3109 1.3612 -0.0719 -0.0390 0.0113  84  ALA A CB  
632  N N   . ARG A 85  ? 1.5458 1.5278 1.6096 -0.0932 -0.0538 0.0181  85  ARG A N   
633  C CA  . ARG A 85  ? 1.6428 1.6332 1.7299 -0.1004 -0.0520 0.0250  85  ARG A CA  
634  C C   . ARG A 85  ? 1.6921 1.6660 1.7753 -0.1067 -0.0542 0.0236  85  ARG A C   
635  O O   . ARG A 85  ? 1.7162 1.6914 1.8102 -0.1086 -0.0462 0.0287  85  ARG A O   
636  C CB  . ARG A 85  ? 1.6521 1.6545 1.7484 -0.0949 -0.0383 0.0317  85  ARG A CB  
637  N N   . ASN A 86  ? 1.7142 1.6706 1.7802 -0.1091 -0.0645 0.0170  86  ASN A N   
638  C CA  . ASN A 86  ? 1.7627 1.7002 1.8205 -0.1149 -0.0674 0.0151  86  ASN A CA  
639  C C   . ASN A 86  ? 1.6908 1.6193 1.7335 -0.1087 -0.0545 0.0149  86  ASN A C   
640  O O   . ASN A 86  ? 1.7305 1.6488 1.7727 -0.1127 -0.0512 0.0161  86  ASN A O   
641  C CB  . ASN A 86  ? 1.8722 1.8164 1.9574 -0.1259 -0.0709 0.0208  86  ASN A CB  
642  C CG  . ASN A 86  ? 2.0010 1.9430 2.0940 -0.1345 -0.0884 0.0186  86  ASN A CG  
643  O OD1 . ASN A 86  ? 2.0867 2.0092 2.1572 -0.1345 -0.0991 0.0115  86  ASN A OD1 
644  N ND2 . ASN A 86  ? 2.0906 2.0518 2.2148 -0.1410 -0.0918 0.0251  86  ASN A ND2 
645  N N   . LYS A 87  ? 1.5774 1.5099 1.6083 -0.0989 -0.0474 0.0135  87  LYS A N   
646  C CA  . LYS A 87  ? 1.4580 1.3836 1.4746 -0.0921 -0.0361 0.0131  87  LYS A CA  
647  C C   . LYS A 87  ? 1.3437 1.2607 1.3369 -0.0840 -0.0366 0.0084  87  LYS A C   
648  O O   . LYS A 87  ? 1.3206 1.2431 1.3128 -0.0813 -0.0415 0.0067  87  LYS A O   
649  C CB  . LYS A 87  ? 1.4265 1.3680 1.4574 -0.0876 -0.0251 0.0183  87  LYS A CB  
650  N N   . PRO A 88  ? 1.2804 1.1839 1.2550 -0.0794 -0.0308 0.0068  88  PRO A N   
651  C CA  . PRO A 88  ? 1.2055 1.1008 1.1591 -0.0711 -0.0301 0.0039  88  PRO A CA  
652  C C   . PRO A 88  ? 1.0971 1.0053 1.0537 -0.0631 -0.0218 0.0053  88  PRO A C   
653  O O   . PRO A 88  ? 1.0778 0.9905 1.0385 -0.0611 -0.0138 0.0072  88  PRO A O   
654  C CB  . PRO A 88  ? 1.2367 1.1113 1.1693 -0.0701 -0.0276 0.0028  88  PRO A CB  
655  C CG  . PRO A 88  ? 1.2794 1.1565 1.2233 -0.0748 -0.0219 0.0052  88  PRO A CG  
656  C CD  . PRO A 88  ? 1.3107 1.2025 1.2807 -0.0824 -0.0261 0.0077  88  PRO A CD  
657  N N   . LYS A 89  ? 1.0075 0.9199 0.9609 -0.0583 -0.0242 0.0040  89  LYS A N   
658  C CA  . LYS A 89  ? 0.8994 0.8246 0.8582 -0.0521 -0.0183 0.0052  89  LYS A CA  
659  C C   . LYS A 89  ? 0.8457 0.7646 0.7899 -0.0440 -0.0154 0.0045  89  LYS A C   
660  O O   . LYS A 89  ? 0.8860 0.7936 0.8172 -0.0413 -0.0192 0.0032  89  LYS A O   
661  C CB  . LYS A 89  ? 0.8791 0.8189 0.8520 -0.0534 -0.0217 0.0057  89  LYS A CB  
662  C CG  . LYS A 89  ? 0.8825 0.8359 0.8742 -0.0576 -0.0194 0.0091  89  LYS A CG  
663  N N   . THR A 90  ? 0.7404 0.6661 0.6873 -0.0395 -0.0089 0.0059  90  THR A N   
664  C CA  . THR A 90  ? 0.6770 0.6012 0.6165 -0.0321 -0.0060 0.0066  90  THR A CA  
665  C C   . THR A 90  ? 0.6088 0.5480 0.5611 -0.0294 -0.0035 0.0075  90  THR A C   
666  O O   . THR A 90  ? 0.6010 0.5468 0.5603 -0.0298 -0.0007 0.0082  90  THR A O   
667  C CB  . THR A 90  ? 0.6895 0.6041 0.6167 -0.0284 -0.0012 0.0077  90  THR A CB  
668  O OG1 . THR A 90  ? 0.7398 0.6378 0.6520 -0.0305 -0.0034 0.0069  90  THR A OG1 
669  C CG2 . THR A 90  ? 0.6552 0.5700 0.5778 -0.0207 0.0018  0.0098  90  THR A CG2 
670  N N   . VAL A 91  ? 0.5513 0.4942 0.5052 -0.0260 -0.0044 0.0076  91  VAL A N   
671  C CA  . VAL A 91  ? 0.4839 0.4394 0.4491 -0.0241 -0.0025 0.0083  91  VAL A CA  
672  C C   . VAL A 91  ? 0.4647 0.4192 0.4278 -0.0178 -0.0001 0.0100  91  VAL A C   
673  O O   . VAL A 91  ? 0.4661 0.4129 0.4212 -0.0144 -0.0004 0.0105  91  VAL A O   
674  C CB  . VAL A 91  ? 0.4786 0.4430 0.4525 -0.0267 -0.0052 0.0075  91  VAL A CB  
675  C CG1 . VAL A 91  ? 0.3986 0.3741 0.3821 -0.0254 -0.0030 0.0085  91  VAL A CG1 
676  C CG2 . VAL A 91  ? 0.4557 0.4202 0.4326 -0.0330 -0.0081 0.0072  91  VAL A CG2 
677  N N   . ILE A 92  ? 0.4286 0.3900 0.3988 -0.0157 0.0020  0.0112  92  ILE A N   
678  C CA  . ILE A 92  ? 0.4298 0.3922 0.4023 -0.0103 0.0043  0.0139  92  ILE A CA  
679  C C   . ILE A 92  ? 0.4087 0.3812 0.3929 -0.0104 0.0039  0.0137  92  ILE A C   
680  O O   . ILE A 92  ? 0.4181 0.3966 0.4080 -0.0133 0.0025  0.0124  92  ILE A O   
681  C CB  . ILE A 92  ? 0.4365 0.3992 0.4099 -0.0079 0.0062  0.0159  92  ILE A CB  
682  C CG1 . ILE A 92  ? 0.4738 0.4269 0.4347 -0.0084 0.0072  0.0155  92  ILE A CG1 
683  C CG2 . ILE A 92  ? 0.4422 0.4040 0.4172 -0.0019 0.0092  0.0203  92  ILE A CG2 
684  C CD1 . ILE A 92  ? 0.5366 0.4779 0.4844 -0.0049 0.0089  0.0176  92  ILE A CD1 
685  N N   . TYR A 93  ? 0.3957 0.3684 0.3821 -0.0064 0.0058  0.0153  93  TYR A N   
686  C CA  . TYR A 93  ? 0.3613 0.3427 0.3583 -0.0063 0.0063  0.0152  93  TYR A CA  
687  C C   . TYR A 93  ? 0.3578 0.3412 0.3631 -0.0017 0.0094  0.0192  93  TYR A C   
688  O O   . TYR A 93  ? 0.3768 0.3539 0.3780 0.0034  0.0127  0.0226  93  TYR A O   
689  C CB  . TYR A 93  ? 0.3640 0.3448 0.3577 -0.0056 0.0064  0.0135  93  TYR A CB  
690  C CG  . TYR A 93  ? 0.3370 0.3207 0.3289 -0.0107 0.0031  0.0105  93  TYR A CG  
691  C CD1 . TYR A 93  ? 0.3265 0.3184 0.3249 -0.0136 0.0026  0.0100  93  TYR A CD1 
692  C CD2 . TYR A 93  ? 0.3608 0.3383 0.3443 -0.0121 0.0005  0.0089  93  TYR A CD2 
693  C CE1 . TYR A 93  ? 0.2918 0.2871 0.2897 -0.0173 0.0007  0.0089  93  TYR A CE1 
694  C CE2 . TYR A 93  ? 0.3545 0.3362 0.3397 -0.0170 -0.0025 0.0073  93  TYR A CE2 
695  C CZ  . TYR A 93  ? 0.3505 0.3419 0.3435 -0.0193 -0.0017 0.0078  93  TYR A CZ  
696  O OH  . TYR A 93  ? 0.3823 0.3783 0.3779 -0.0233 -0.0037 0.0078  93  TYR A OH  
697  N N   . TRP A 94  ? 0.3322 0.3234 0.3491 -0.0033 0.0084  0.0193  94  TRP A N   
698  C CA  . TRP A 94  ? 0.3200 0.3154 0.3497 -0.0002 0.0108  0.0231  94  TRP A CA  
699  C C   . TRP A 94  ? 0.3075 0.3066 0.3415 -0.0007 0.0120  0.0216  94  TRP A C   
700  O O   . TRP A 94  ? 0.3159 0.3155 0.3433 -0.0034 0.0103  0.0179  94  TRP A O   
701  C CB  . TRP A 94  ? 0.3109 0.3111 0.3506 -0.0026 0.0069  0.0240  94  TRP A CB  
702  C CG  . TRP A 94  ? 0.3210 0.3195 0.3603 -0.0005 0.0069  0.0270  94  TRP A CG  
703  C CD1 . TRP A 94  ? 0.3382 0.3394 0.3883 0.0030  0.0092  0.0328  94  TRP A CD1 
704  C CD2 . TRP A 94  ? 0.3578 0.3519 0.3860 -0.0017 0.0051  0.0249  94  TRP A CD2 
705  N NE1 . TRP A 94  ? 0.3546 0.3534 0.3994 0.0047  0.0090  0.0346  94  TRP A NE1 
706  C CE2 . TRP A 94  ? 0.3600 0.3539 0.3906 0.0018  0.0066  0.0293  94  TRP A CE2 
707  C CE3 . TRP A 94  ? 0.3684 0.3588 0.3854 -0.0049 0.0032  0.0203  94  TRP A CE3 
708  C CZ2 . TRP A 94  ? 0.3720 0.3613 0.3923 0.0023  0.0062  0.0285  94  TRP A CZ2 
709  C CZ3 . TRP A 94  ? 0.3786 0.3642 0.3868 -0.0046 0.0030  0.0198  94  TRP A CZ3 
710  C CH2 . TRP A 94  ? 0.3779 0.3626 0.3868 -0.0009 0.0046  0.0234  94  TRP A CH2 
711  N N   . LEU A 95  ? 0.2981 0.2999 0.3434 0.0023  0.0155  0.0249  95  LEU A N   
712  C CA  . LEU A 95  ? 0.2923 0.2963 0.3403 0.0029  0.0181  0.0237  95  LEU A CA  
713  C C   . LEU A 95  ? 0.3090 0.3181 0.3682 -0.0013 0.0144  0.0236  95  LEU A C   
714  O O   . LEU A 95  ? 0.3831 0.3946 0.4546 -0.0018 0.0127  0.0270  95  LEU A O   
715  C CB  . LEU A 95  ? 0.3097 0.3118 0.3638 0.0099  0.0254  0.0283  95  LEU A CB  
716  C CG  . LEU A 95  ? 0.3526 0.3479 0.3948 0.0164  0.0306  0.0275  95  LEU A CG  
717  C CD1 . LEU A 95  ? 0.4198 0.4124 0.4707 0.0245  0.0384  0.0340  95  LEU A CD1 
718  C CD2 . LEU A 95  ? 0.3749 0.3729 0.4134 0.0151  0.0310  0.0232  95  LEU A CD2 
719  N N   . ALA A 96  ? 0.2834 0.2935 0.3385 -0.0041 0.0128  0.0202  96  ALA A N   
720  C CA  . ALA A 96  ? 0.3021 0.3136 0.3651 -0.0078 0.0084  0.0201  96  ALA A CA  
721  C C   . ALA A 96  ? 0.3193 0.3310 0.3813 -0.0073 0.0120  0.0191  96  ALA A C   
722  O O   . ALA A 96  ? 0.3228 0.3341 0.3745 -0.0051 0.0160  0.0172  96  ALA A O   
723  C CB  . ALA A 96  ? 0.2818 0.2910 0.3365 -0.0116 0.0012  0.0171  96  ALA A CB  
724  N N   . GLU A 97  ? 0.3536 0.3656 0.4265 -0.0092 0.0103  0.0204  97  GLU A N   
725  C CA  . GLU A 97  ? 0.3894 0.4004 0.4617 -0.0083 0.0149  0.0199  97  GLU A CA  
726  C C   . GLU A 97  ? 0.4001 0.4068 0.4656 -0.0126 0.0085  0.0175  97  GLU A C   
727  O O   . GLU A 97  ? 0.4315 0.4360 0.5009 -0.0161 0.0003  0.0173  97  GLU A O   
728  C CB  . GLU A 97  ? 0.4152 0.4282 0.5063 -0.0067 0.0191  0.0243  97  GLU A CB  
729  C CG  . GLU A 97  ? 0.4700 0.4814 0.5609 -0.0048 0.0257  0.0241  97  GLU A CG  
730  C CD  . GLU A 97  ? 0.5674 0.5806 0.6796 -0.0032 0.0305  0.0294  97  GLU A CD  
731  O OE1 . GLU A 97  ? 0.6135 0.6247 0.7278 -0.0019 0.0363  0.0296  97  GLU A OE1 
732  O OE2 . GLU A 97  ? 0.6026 0.6194 0.7298 -0.0031 0.0289  0.0338  97  GLU A OE2 
733  N N   . VAL A 98  ? 0.4034 0.4077 0.4566 -0.0115 0.0122  0.0156  98  VAL A N   
734  C CA  . VAL A 98  ? 0.4191 0.4164 0.4624 -0.0143 0.0069  0.0141  98  VAL A CA  
735  C C   . VAL A 98  ? 0.4670 0.4608 0.5192 -0.0160 0.0070  0.0151  98  VAL A C   
736  O O   . VAL A 98  ? 0.4819 0.4779 0.5393 -0.0135 0.0152  0.0162  98  VAL A O   
737  C CB  . VAL A 98  ? 0.4023 0.3978 0.4259 -0.0120 0.0104  0.0128  98  VAL A CB  
738  C CG1 . VAL A 98  ? 0.3285 0.3260 0.3446 -0.0117 0.0080  0.0123  98  VAL A CG1 
739  C CG2 . VAL A 98  ? 0.3905 0.3903 0.4127 -0.0079 0.0203  0.0128  98  VAL A CG2 
740  N N   . LYS A 99  ? 0.5112 0.4981 0.5643 -0.0201 -0.0025 0.0145  99  LYS A N   
741  C CA  . LYS A 99  ? 0.5765 0.5577 0.6378 -0.0234 -0.0055 0.0151  99  LYS A CA  
742  C C   . LYS A 99  ? 0.5985 0.5735 0.6455 -0.0217 0.0008  0.0143  99  LYS A C   
743  O O   . LYS A 99  ? 0.6233 0.5977 0.6803 -0.0224 0.0052  0.0155  99  LYS A O   
744  C CB  . LYS A 99  ? 0.6067 0.5785 0.6643 -0.0273 -0.0193 0.0136  99  LYS A CB  
745  C CG  . LYS A 99  ? 0.6917 0.6563 0.7593 -0.0320 -0.0263 0.0140  99  LYS A CG  
746  C CD  . LYS A 99  ? 0.7961 0.7487 0.8545 -0.0343 -0.0408 0.0117  99  LYS A CD  
748  N NZ  . LYS A 99  ? 0.9165 0.8470 0.9755 -0.0414 -0.0654 0.0091  99  LYS A NZ  
749  N N   . ASP A 100 ? 0.6035 0.5737 0.6271 -0.0189 0.0021  0.0128  100 ASP A N   
750  C CA  . ASP A 100 ? 0.6245 0.5880 0.6306 -0.0165 0.0081  0.0125  100 ASP A CA  
751  C C   . ASP A 100 ? 0.5914 0.5629 0.5872 -0.0110 0.0181  0.0126  100 ASP A C   
752  O O   . ASP A 100 ? 0.5589 0.5348 0.5495 -0.0097 0.0170  0.0126  100 ASP A O   
753  C CB  . ASP A 100 ? 0.6637 0.6118 0.6486 -0.0171 0.0000  0.0119  100 ASP A CB  
754  C CG  . ASP A 100 ? 0.7868 0.7239 0.7794 -0.0224 -0.0111 0.0111  100 ASP A CG  
755  O OD1 . ASP A 100 ? 0.9076 0.8339 0.8903 -0.0232 -0.0219 0.0102  100 ASP A OD1 
756  O OD2 . ASP A 100 ? 0.8722 0.8107 0.8810 -0.0256 -0.0096 0.0116  100 ASP A OD2 
757  N N   . TYR A 101 ? 0.6134 0.5863 0.6067 -0.0078 0.0279  0.0127  101 TYR A N   
758  C CA  . TYR A 101 ? 0.5831 0.5634 0.5669 -0.0021 0.0372  0.0126  101 TYR A CA  
759  C C   . TYR A 101 ? 0.5641 0.5417 0.5269 -0.0004 0.0358  0.0135  101 TYR A C   
760  O O   . TYR A 101 ? 0.5727 0.5587 0.5320 0.0022  0.0387  0.0139  101 TYR A O   
761  C CB  . TYR A 101 ? 0.5863 0.5648 0.5674 0.0015  0.0474  0.0124  101 TYR A CB  
762  C CG  . TYR A 101 ? 0.5715 0.5569 0.5428 0.0085  0.0573  0.0119  101 TYR A CG  
763  C CD1 . TYR A 101 ? 0.5632 0.5562 0.5456 0.0128  0.0630  0.0112  101 TYR A CD1 
764  C CD2 . TYR A 101 ? 0.5848 0.5680 0.5348 0.0118  0.0612  0.0125  101 TYR A CD2 
765  C CE1 . TYR A 101 ? 0.5743 0.5722 0.5470 0.0197  0.0708  0.0101  101 TYR A CE1 
766  C CE2 . TYR A 101 ? 0.6075 0.5981 0.5497 0.0184  0.0696  0.0120  101 TYR A CE2 
767  C CZ  . TYR A 101 ? 0.6140 0.6117 0.5676 0.0221  0.0737  0.0103  101 TYR A CZ  
768  O OH  . TYR A 101 ? 0.6405 0.6443 0.5854 0.0292  0.0806  0.0093  101 TYR A OH  
769  N N   . ASP A 102 ? 0.5724 0.5375 0.5217 -0.0018 0.0308  0.0144  102 ASP A N   
770  C CA  . ASP A 102 ? 0.5780 0.5378 0.5046 0.0016  0.0320  0.0169  102 ASP A CA  
771  C C   . ASP A 102 ? 0.5553 0.5090 0.4772 0.0004  0.0230  0.0181  102 ASP A C   
772  O O   . ASP A 102 ? 0.5833 0.5265 0.4850 0.0036  0.0222  0.0210  102 ASP A O   
773  C CB  . ASP A 102 ? 0.6519 0.5983 0.5598 0.0037  0.0353  0.0179  102 ASP A CB  
774  C CG  . ASP A 102 ? 0.7314 0.6615 0.6375 -0.0005 0.0255  0.0169  102 ASP A CG  
775  O OD1 . ASP A 102 ? 0.8227 0.7372 0.7074 0.0014  0.0254  0.0183  102 ASP A OD1 
776  O OD2 . ASP A 102 ? 0.7831 0.7148 0.7078 -0.0055 0.0173  0.0150  102 ASP A OD2 
777  N N   . VAL A 103 ? 0.4323 0.4341 0.4651 0.0357  0.0700  -0.0047 103 VAL A N   
778  C CA  . VAL A 103 ? 0.3818 0.3924 0.4076 0.0256  0.0634  -0.0093 103 VAL A CA  
779  C C   . VAL A 103 ? 0.3812 0.3964 0.4031 0.0231  0.0599  -0.0111 103 VAL A C   
780  O O   . VAL A 103 ? 0.3702 0.3820 0.3894 0.0306  0.0573  -0.0063 103 VAL A O   
781  C CB  . VAL A 103 ? 0.3563 0.3653 0.3709 0.0266  0.0543  -0.0038 103 VAL A CB  
782  C CG1 . VAL A 103 ? 0.3036 0.3065 0.3109 0.0359  0.0499  0.0039  103 VAL A CG1 
783  C CG2 . VAL A 103 ? 0.3057 0.3230 0.3118 0.0173  0.0464  -0.0059 103 VAL A CG2 
784  N N   . GLU A 104 ? 0.3879 0.4115 0.4098 0.0124  0.0603  -0.0186 104 GLU A N   
785  C CA  . GLU A 104 ? 0.4127 0.4406 0.4317 0.0086  0.0583  -0.0217 104 GLU A CA  
786  C C   . GLU A 104 ? 0.3997 0.4278 0.4042 0.0088  0.0481  -0.0163 104 GLU A C   
787  O O   . GLU A 104 ? 0.3991 0.4297 0.3948 0.0036  0.0426  -0.0145 104 GLU A O   
788  C CB  . GLU A 104 ? 0.4347 0.4716 0.4573 -0.0041 0.0631  -0.0320 104 GLU A CB  
789  C CG  . GLU A 104 ? 0.5248 0.5651 0.5494 -0.0081 0.0647  -0.0373 104 GLU A CG  
790  C CD  . GLU A 104 ? 0.5784 0.6284 0.6001 -0.0230 0.0675  -0.0471 104 GLU A CD  
791  O OE1 . GLU A 104 ? 0.5817 0.6340 0.5981 -0.0277 0.0659  -0.0498 104 GLU A OE1 
792  O OE2 . GLU A 104 ? 0.6187 0.6746 0.6432 -0.0302 0.0715  -0.0527 104 GLU A OE2 
793  N N   . ILE A 105 ? 0.3905 0.4163 0.3941 0.0151  0.0456  -0.0138 105 ILE A N   
794  C CA  . ILE A 105 ? 0.3757 0.4019 0.3688 0.0153  0.0377  -0.0105 105 ILE A CA  
795  C C   . ILE A 105 ? 0.3993 0.4311 0.3907 0.0061  0.0383  -0.0170 105 ILE A C   
796  O O   . ILE A 105 ? 0.4181 0.4515 0.4181 0.0060  0.0432  -0.0227 105 ILE A O   
797  C CB  . ILE A 105 ? 0.3669 0.3900 0.3616 0.0261  0.0355  -0.0069 105 ILE A CB  
798  C CG1 . ILE A 105 ? 0.3455 0.3625 0.3404 0.0353  0.0357  -0.0002 105 ILE A CG1 
799  C CG2 . ILE A 105 ? 0.3426 0.3675 0.3296 0.0254  0.0289  -0.0059 105 ILE A CG2 
800  C CD1 . ILE A 105 ? 0.3073 0.3223 0.2957 0.0330  0.0321  0.0034  105 ILE A CD1 
801  N N   . ARG A 106 ? 0.4098 0.4444 0.3908 -0.0015 0.0340  -0.0161 106 ARG A N   
802  C CA  . ARG A 106 ? 0.4484 0.4874 0.4262 -0.0110 0.0357  -0.0222 106 ARG A CA  
803  C C   . ARG A 106 ? 0.4703 0.5079 0.4402 -0.0106 0.0300  -0.0185 106 ARG A C   
804  O O   . ARG A 106 ? 0.5057 0.5427 0.4666 -0.0131 0.0248  -0.0125 106 ARG A O   
805  C CB  . ARG A 106 ? 0.4586 0.5037 0.4310 -0.0232 0.0378  -0.0260 106 ARG A CB  
806  N N   . LEU A 107 ? 0.4918 0.5291 0.4669 -0.0072 0.0312  -0.0223 107 LEU A N   
807  C CA  . LEU A 107 ? 0.5120 0.5484 0.4823 -0.0068 0.0271  -0.0205 107 LEU A CA  
808  C C   . LEU A 107 ? 0.5676 0.6058 0.5300 -0.0187 0.0288  -0.0235 107 LEU A C   
809  O O   . LEU A 107 ? 0.5848 0.6262 0.5472 -0.0274 0.0342  -0.0301 107 LEU A O   
810  C CB  . LEU A 107 ? 0.4916 0.5284 0.4709 0.0015  0.0271  -0.0241 107 LEU A CB  
811  C CG  . LEU A 107 ? 0.4420 0.4772 0.4273 0.0133  0.0257  -0.0206 107 LEU A CG  
812  C CD1 . LEU A 107 ? 0.4402 0.4782 0.4343 0.0200  0.0256  -0.0252 107 LEU A CD1 
813  C CD2 . LEU A 107 ? 0.3865 0.4186 0.3659 0.0189  0.0204  -0.0125 107 LEU A CD2 
814  N N   . SER A 108 ? 0.6121 0.6480 0.5685 -0.0191 0.0249  -0.0185 108 SER A N   
815  C CA  . SER A 108 ? 0.6664 0.7024 0.6155 -0.0289 0.0270  -0.0202 108 SER A CA  
816  C C   . SER A 108 ? 0.6892 0.7249 0.6465 -0.0261 0.0295  -0.0271 108 SER A C   
817  O O   . SER A 108 ? 0.6732 0.7099 0.6408 -0.0167 0.0285  -0.0301 108 SER A O   
818  C CB  . SER A 108 ? 0.6765 0.7098 0.6158 -0.0313 0.0218  -0.0098 108 SER A CB  
819  O OG  . SER A 108 ? 0.6836 0.7136 0.6280 -0.0241 0.0187  -0.0063 108 SER A OG  
820  N N   . HIS A 109 ? 0.7341 0.7688 0.6869 -0.0344 0.0329  -0.0298 109 HIS A N   
821  C CA  . HIS A 109 ? 0.7553 0.7902 0.7171 -0.0333 0.0364  -0.0382 109 HIS A CA  
822  C C   . HIS A 109 ? 0.7472 0.7816 0.7162 -0.0226 0.0316  -0.0356 109 HIS A C   
823  O O   . HIS A 109 ? 0.7494 0.7866 0.7293 -0.0177 0.0327  -0.0435 109 HIS A O   
824  C CB  . HIS A 109 ? 0.7949 0.8272 0.7491 -0.0450 0.0418  -0.0405 109 HIS A CB  
825  C CG  . HIS A 109 ? 0.8406 0.8682 0.7859 -0.0466 0.0389  -0.0297 109 HIS A CG  
826  N ND1 . HIS A 109 ? 0.8684 0.8946 0.7997 -0.0520 0.0358  -0.0193 109 HIS A ND1 
827  C CD2 . HIS A 109 ? 0.8710 0.8954 0.8214 -0.0434 0.0387  -0.0279 109 HIS A CD2 
828  C CE1 . HIS A 109 ? 0.9035 0.9251 0.8320 -0.0516 0.0335  -0.0103 109 HIS A CE1 
829  N NE2 . HIS A 109 ? 0.8952 0.9153 0.8356 -0.0466 0.0358  -0.0156 109 HIS A NE2 
830  N N   . GLU A 110 ? 0.7508 0.7826 0.7149 -0.0192 0.0264  -0.0254 110 GLU A N   
831  C CA  . GLU A 110 ? 0.7739 0.8060 0.7453 -0.0105 0.0228  -0.0238 110 GLU A CA  
832  C C   . GLU A 110 ? 0.7232 0.7599 0.7034 0.0001  0.0205  -0.0284 110 GLU A C   
833  O O   . GLU A 110 ? 0.7228 0.7626 0.7105 0.0063  0.0189  -0.0319 110 GLU A O   
834  C CB  . GLU A 110 ? 0.8040 0.8324 0.7706 -0.0093 0.0182  -0.0125 110 GLU A CB  
835  C CG  . GLU A 110 ? 0.9171 0.9410 0.8785 -0.0171 0.0196  -0.0066 110 GLU A CG  
836  C CD  . GLU A 110 ? 0.9798 1.0003 0.9398 -0.0152 0.0145  0.0050  110 GLU A CD  
837  O OE1 . GLU A 110 ? 0.9984 1.0197 0.9660 -0.0073 0.0113  0.0061  110 GLU A OE1 
838  O OE2 . GLU A 110 ? 0.9816 0.9991 0.9332 -0.0220 0.0137  0.0131  110 GLU A OE2 
839  N N   . HIS A 111 ? 0.6680 0.7058 0.6478 0.0020  0.0206  -0.0287 111 HIS A N   
840  C CA  . HIS A 111 ? 0.6319 0.6731 0.6185 0.0126  0.0183  -0.0303 111 HIS A CA  
841  C C   . HIS A 111 ? 0.6391 0.6829 0.6324 0.0125  0.0218  -0.0370 111 HIS A C   
842  O O   . HIS A 111 ? 0.6749 0.7174 0.6663 0.0042  0.0263  -0.0392 111 HIS A O   
843  C CB  . HIS A 111 ? 0.6001 0.6384 0.5819 0.0179  0.0149  -0.0214 111 HIS A CB  
844  C CG  . HIS A 111 ? 0.5548 0.5906 0.5331 0.0182  0.0116  -0.0151 111 HIS A CG  
845  N ND1 . HIS A 111 ? 0.5224 0.5541 0.4941 0.0114  0.0110  -0.0087 111 HIS A ND1 
846  C CD2 . HIS A 111 ? 0.5149 0.5526 0.4968 0.0241  0.0088  -0.0150 111 HIS A CD2 
847  C CE1 . HIS A 111 ? 0.5293 0.5594 0.5024 0.0136  0.0082  -0.0042 111 HIS A CE1 
848  N NE2 . HIS A 111 ? 0.5240 0.5577 0.5035 0.0208  0.0074  -0.0086 111 HIS A NE2 
849  N N   . GLN A 112 ? 0.6375 0.6858 0.6397 0.0218  0.0199  -0.0405 112 GLN A N   
850  C CA  . GLN A 112 ? 0.6426 0.6938 0.6552 0.0225  0.0231  -0.0473 112 GLN A CA  
851  C C   . GLN A 112 ? 0.6102 0.6612 0.6264 0.0314  0.0220  -0.0423 112 GLN A C   
852  O O   . GLN A 112 ? 0.6223 0.6741 0.6480 0.0311  0.0258  -0.0460 112 GLN A O   
853  C CB  . GLN A 112 ? 0.6817 0.7393 0.7049 0.0254  0.0222  -0.0566 112 GLN A CB  
854  C CG  . GLN A 112 ? 0.7550 0.8168 0.7771 0.0333  0.0162  -0.0554 112 GLN A CG  
855  C CD  . GLN A 112 ? 0.8427 0.9136 0.8776 0.0386  0.0142  -0.0654 112 GLN A CD  
856  O OE1 . GLN A 112 ? 0.8769 0.9541 0.9155 0.0491  0.0089  -0.0644 112 GLN A OE1 
857  N NE2 . GLN A 112 ? 0.8910 0.9630 0.9326 0.0312  0.0185  -0.0751 112 GLN A NE2 
858  N N   . ALA A 113 ? 0.5637 0.6132 0.5734 0.0389  0.0176  -0.0341 113 ALA A N   
859  C CA  . ALA A 113 ? 0.5227 0.5703 0.5338 0.0472  0.0174  -0.0279 113 ALA A CA  
860  C C   . ALA A 113 ? 0.4825 0.5256 0.4829 0.0502  0.0150  -0.0190 113 ALA A C   
861  O O   . ALA A 113 ? 0.4721 0.5153 0.4663 0.0484  0.0120  -0.0179 113 ALA A O   
862  C CB  . ALA A 113 ? 0.5371 0.5907 0.5562 0.0579  0.0139  -0.0294 113 ALA A CB  
863  N N   . TYR A 114 ? 0.4464 0.4853 0.4467 0.0548  0.0171  -0.0130 114 TYR A N   
864  C CA  . TYR A 114 ? 0.4034 0.4381 0.3955 0.0590  0.0154  -0.0054 114 TYR A CA  
865  C C   . TYR A 114 ? 0.4232 0.4571 0.4166 0.0702  0.0152  -0.0001 114 TYR A C   
866  O O   . TYR A 114 ? 0.4544 0.4904 0.4565 0.0742  0.0168  -0.0015 114 TYR A O   
867  C CB  . TYR A 114 ? 0.3657 0.3947 0.3550 0.0518  0.0190  -0.0029 114 TYR A CB  
868  C CG  . TYR A 114 ? 0.3652 0.3908 0.3610 0.0524  0.0252  -0.0021 114 TYR A CG  
869  C CD1 . TYR A 114 ? 0.3282 0.3555 0.3311 0.0446  0.0301  -0.0082 114 TYR A CD1 
870  C CD2 . TYR A 114 ? 0.3605 0.3810 0.3561 0.0599  0.0273  0.0043  114 TYR A CD2 
871  C CE1 . TYR A 114 ? 0.3271 0.3520 0.3386 0.0445  0.0368  -0.0087 114 TYR A CE1 
872  C CE2 . TYR A 114 ? 0.3594 0.3763 0.3633 0.0602  0.0344  0.0047  114 TYR A CE2 
873  C CZ  . TYR A 114 ? 0.3792 0.3988 0.3919 0.0524  0.0390  -0.0021 114 TYR A CZ  
874  O OH  . TYR A 114 ? 0.4497 0.4665 0.4734 0.0519  0.0471  -0.0032 114 TYR A OH  
875  N N   . ARG A 115 ? 0.4078 0.4388 0.3930 0.0753  0.0136  0.0060  115 ARG A N   
876  C CA  . ARG A 115 ? 0.4321 0.4612 0.4155 0.0855  0.0142  0.0127  115 ARG A CA  
877  C C   . ARG A 115 ? 0.4148 0.4361 0.3909 0.0857  0.0169  0.0187  115 ARG A C   
878  O O   . ARG A 115 ? 0.3945 0.4153 0.3660 0.0811  0.0150  0.0176  115 ARG A O   
879  C CB  . ARG A 115 ? 0.4599 0.4975 0.4394 0.0933  0.0077  0.0122  115 ARG A CB  
880  C CG  . ARG A 115 ? 0.5096 0.5561 0.4981 0.0955  0.0044  0.0061  115 ARG A CG  
881  C CD  . ARG A 115 ? 0.6095 0.6570 0.6021 0.1057  0.0042  0.0117  115 ARG A CD  
882  N NE  . ARG A 115 ? 0.6929 0.7521 0.6902 0.1120  -0.0024 0.0077  115 ARG A NE  
883  C CZ  . ARG A 115 ? 0.7815 0.8464 0.7734 0.1227  -0.0076 0.0132  115 ARG A CZ  
884  N NH1 . ARG A 115 ? 0.7798 0.8388 0.7604 0.1280  -0.0059 0.0234  115 ARG A NH1 
885  N NH2 . ARG A 115 ? 0.8301 0.9073 0.8278 0.1281  -0.0143 0.0086  115 ARG A NH2 
886  N N   . TRP A 116 ? 0.4235 0.4383 0.4003 0.0911  0.0219  0.0249  116 TRP A N   
887  C CA  . TRP A 116 ? 0.4170 0.4240 0.3873 0.0924  0.0253  0.0304  116 TRP A CA  
888  C C   . TRP A 116 ? 0.4510 0.4592 0.4120 0.1019  0.0230  0.0361  116 TRP A C   
889  O O   . TRP A 116 ? 0.4828 0.4919 0.4448 0.1096  0.0234  0.0405  116 TRP A O   
890  C CB  . TRP A 116 ? 0.4094 0.4080 0.3868 0.0921  0.0338  0.0333  116 TRP A CB  
891  C CG  . TRP A 116 ? 0.3990 0.3962 0.3824 0.0821  0.0367  0.0281  116 TRP A CG  
892  C CD1 . TRP A 116 ? 0.3926 0.3916 0.3860 0.0765  0.0401  0.0231  116 TRP A CD1 
893  C CD2 . TRP A 116 ? 0.3654 0.3598 0.3456 0.0763  0.0363  0.0272  116 TRP A CD2 
894  N NE1 . TRP A 116 ? 0.3639 0.3625 0.3584 0.0674  0.0414  0.0192  116 TRP A NE1 
895  C CE2 . TRP A 116 ? 0.3527 0.3484 0.3396 0.0675  0.0386  0.0221  116 TRP A CE2 
896  C CE3 . TRP A 116 ? 0.3501 0.3417 0.3232 0.0773  0.0342  0.0296  116 TRP A CE3 
897  C CZ2 . TRP A 116 ? 0.3570 0.3519 0.3434 0.0607  0.0377  0.0204  116 TRP A CZ2 
898  C CZ3 . TRP A 116 ? 0.3610 0.3509 0.3359 0.0705  0.0339  0.0277  116 TRP A CZ3 
899  C CH2 . TRP A 116 ? 0.3338 0.3255 0.3150 0.0627  0.0351  0.0236  116 TRP A CH2 
900  N N   . LEU A 117 ? 0.4503 0.4587 0.4025 0.1014  0.0209  0.0362  117 LEU A N   
901  C CA  . LEU A 117 ? 0.4923 0.5046 0.4339 0.1091  0.0181  0.0399  117 LEU A CA  
902  C C   . LEU A 117 ? 0.5163 0.5223 0.4486 0.1100  0.0218  0.0437  117 LEU A C   
903  O O   . LEU A 117 ? 0.5019 0.5037 0.4363 0.1035  0.0237  0.0408  117 LEU A O   
904  C CB  . LEU A 117 ? 0.4849 0.5096 0.4251 0.1081  0.0104  0.0330  117 LEU A CB  
905  C CG  . LEU A 117 ? 0.4958 0.5287 0.4445 0.1079  0.0062  0.0279  117 LEU A CG  
906  C CD1 . LEU A 117 ? 0.4844 0.5289 0.4322 0.1064  0.0000  0.0202  117 LEU A CD1 
907  C CD2 . LEU A 117 ? 0.5174 0.5521 0.4671 0.1171  0.0056  0.0333  117 LEU A CD2 
908  N N   . GLY A 118 ? 0.5816 0.5875 0.5038 0.1182  0.0226  0.0503  118 GLY A N   
909  C CA  . GLY A 118 ? 0.5947 0.5962 0.5055 0.1194  0.0261  0.0533  118 GLY A CA  
910  C C   . GLY A 118 ? 0.5782 0.5899 0.4854 0.1157  0.0205  0.0457  118 GLY A C   
911  O O   . GLY A 118 ? 0.5676 0.5906 0.4785 0.1151  0.0136  0.0399  118 GLY A O   
912  N N   . LEU A 119 ? 0.5872 0.5952 0.4891 0.1130  0.0241  0.0447  119 LEU A N   
913  C CA  . LEU A 119 ? 0.5899 0.6065 0.4930 0.1078  0.0205  0.0361  119 LEU A CA  
914  C C   . LEU A 119 ? 0.6330 0.6656 0.5302 0.1115  0.0134  0.0318  119 LEU A C   
915  O O   . LEU A 119 ? 0.6281 0.6696 0.5334 0.1073  0.0089  0.0237  119 LEU A O   
916  C CB  . LEU A 119 ? 0.5861 0.5964 0.4853 0.1046  0.0266  0.0353  119 LEU A CB  
917  C CG  . LEU A 119 ? 0.5471 0.5658 0.4488 0.0992  0.0250  0.0262  119 LEU A CG  
918  C CD1 . LEU A 119 ? 0.4491 0.4707 0.3669 0.0926  0.0213  0.0196  119 LEU A CD1 
919  C CD2 . LEU A 119 ? 0.5241 0.5337 0.4239 0.0962  0.0326  0.0262  119 LEU A CD2 
920  N N   . GLU A 120 ? 0.7109 0.7478 0.5948 0.1192  0.0122  0.0374  120 GLU A N   
921  C CA  . GLU A 120 ? 0.7775 0.8320 0.6561 0.1226  0.0046  0.0322  120 GLU A CA  
922  C C   . GLU A 120 ? 0.7514 0.8146 0.6412 0.1234  -0.0021 0.0276  120 GLU A C   
923  O O   . GLU A 120 ? 0.7477 0.8236 0.6428 0.1205  -0.0067 0.0176  120 GLU A O   
924  C CB  . GLU A 120 ? 0.8509 0.9093 0.7116 0.1315  0.0035  0.0404  120 GLU A CB  
925  C CG  . GLU A 120 ? 0.9784 1.0568 0.8313 0.1339  -0.0038 0.0336  120 GLU A CG  
926  C CD  . GLU A 120 ? 1.2406 1.3236 1.0752 0.1435  -0.0063 0.0436  120 GLU A CD  
927  O OE1 . GLU A 120 ? 1.3762 1.4692 1.1961 0.1437  -0.0072 0.0411  120 GLU A OE1 
928  O OE2 . GLU A 120 ? 1.3268 1.4034 1.1621 0.1506  -0.0070 0.0541  120 GLU A OE2 
929  N N   . GLU A 121 ? 0.7395 0.7960 0.6345 0.1268  -0.0017 0.0339  121 GLU A N   
930  C CA  . GLU A 121 ? 0.7369 0.8010 0.6432 0.1274  -0.0071 0.0292  121 GLU A CA  
931  C C   . GLU A 121 ? 0.6750 0.7382 0.5941 0.1176  -0.0065 0.0201  121 GLU A C   
932  O O   . GLU A 121 ? 0.6636 0.7371 0.5901 0.1157  -0.0110 0.0117  121 GLU A O   
933  C CB  . GLU A 121 ? 0.7737 0.8304 0.6848 0.1325  -0.0055 0.0375  121 GLU A CB  
934  C CG  . GLU A 121 ? 0.9579 1.0150 0.8576 0.1433  -0.0063 0.0485  121 GLU A CG  
935  C CD  . GLU A 121 ? 1.0999 1.1437 0.9880 0.1444  0.0016  0.0578  121 GLU A CD  
936  O OE1 . GLU A 121 ? 1.0986 1.1359 0.9857 0.1371  0.0064  0.0541  121 GLU A OE1 
937  O OE2 . GLU A 121 ? 1.2152 1.2547 1.0960 0.1527  0.0034  0.0690  121 GLU A OE2 
938  N N   . ALA A 122 ? 0.6318 0.6828 0.5534 0.1115  -0.0007 0.0219  122 ALA A N   
939  C CA  . ALA A 122 ? 0.5862 0.6354 0.5185 0.1024  -0.0001 0.0155  122 ALA A CA  
940  C C   . ALA A 122 ? 0.5845 0.6444 0.5194 0.0991  -0.0030 0.0064  122 ALA A C   
941  O O   . ALA A 122 ? 0.5607 0.6252 0.5052 0.0946  -0.0050 0.0000  122 ALA A O   
942  C CB  . ALA A 122 ? 0.5655 0.6014 0.4992 0.0976  0.0055  0.0196  122 ALA A CB  
943  N N   . CYS A 123 ? 0.6044 0.6678 0.5315 0.1006  -0.0021 0.0057  123 CYS A N   
944  C CA  . CYS A 123 ? 0.6200 0.6951 0.5507 0.0975  -0.0037 -0.0041 123 CYS A CA  
945  C C   . CYS A 123 ? 0.6626 0.7534 0.5948 0.1012  -0.0097 -0.0109 123 CYS A C   
946  O O   . CYS A 123 ? 0.6499 0.7490 0.5926 0.0969  -0.0110 -0.0206 123 CYS A O   
947  C CB  . CYS A 123 ? 0.6392 0.7161 0.5599 0.0985  -0.0008 -0.0041 123 CYS A CB  
948  S SG  . CYS A 123 ? 0.5860 0.6459 0.5081 0.0935  0.0068  0.0010  123 CYS A SG  
949  N N   . GLN A 124 ? 0.7232 0.8179 0.6461 0.1094  -0.0132 -0.0057 124 GLN A N   
950  C CA  . GLN A 124 ? 0.7872 0.8974 0.7122 0.1142  -0.0199 -0.0116 124 GLN A CA  
951  C C   . GLN A 124 ? 0.7666 0.8765 0.7067 0.1103  -0.0209 -0.0171 124 GLN A C   
952  O O   . GLN A 124 ? 0.7968 0.9199 0.7449 0.1096  -0.0244 -0.0276 124 GLN A O   
953  C CB  . GLN A 124 ? 0.8925 1.0049 0.8062 0.1243  -0.0236 -0.0024 124 GLN A CB  
954  C CG  . GLN A 124 ? 1.0442 1.1691 0.9424 0.1299  -0.0270 -0.0022 124 GLN A CG  
955  C CD  . GLN A 124 ? 1.1541 1.3011 1.0553 0.1330  -0.0351 -0.0128 124 GLN A CD  
956  O OE1 . GLN A 124 ? 1.2473 1.4083 1.1370 0.1361  -0.0384 -0.0155 124 GLN A OE1 
957  N NE2 . GLN A 124 ? 1.1400 1.2911 1.0569 0.1318  -0.0379 -0.0197 124 GLN A NE2 
958  N N   . LEU A 125 ? 0.7365 0.8321 0.6805 0.1075  -0.0174 -0.0108 125 LEU A N   
959  C CA  . LEU A 125 ? 0.7171 0.8107 0.6737 0.1023  -0.0170 -0.0155 125 LEU A CA  
960  C C   . LEU A 125 ? 0.7010 0.7928 0.6662 0.0931  -0.0141 -0.0219 125 LEU A C   
961  O O   . LEU A 125 ? 0.6975 0.7944 0.6726 0.0895  -0.0147 -0.0297 125 LEU A O   
962  C CB  . LEU A 125 ? 0.6950 0.7754 0.6525 0.1015  -0.0137 -0.0074 125 LEU A CB  
963  C CG  . LEU A 125 ? 0.7031 0.7860 0.6661 0.1057  -0.0157 -0.0071 125 LEU A CG  
964  C CD1 . LEU A 125 ? 0.6664 0.7372 0.6345 0.1001  -0.0106 -0.0039 125 LEU A CD1 
965  C CD2 . LEU A 125 ? 0.7592 0.8544 0.7315 0.1047  -0.0195 -0.0183 125 LEU A CD2 
966  N N   . ALA A 126 ? 0.6958 0.7797 0.6586 0.0893  -0.0106 -0.0183 126 ALA A N   
967  C CA  . ALA A 126 ? 0.6980 0.7797 0.6705 0.0813  -0.0080 -0.0228 126 ALA A CA  
968  C C   . ALA A 126 ? 0.7400 0.8358 0.7199 0.0805  -0.0092 -0.0343 126 ALA A C   
969  O O   . ALA A 126 ? 0.7331 0.8299 0.7245 0.0749  -0.0076 -0.0402 126 ALA A O   
970  C CB  . ALA A 126 ? 0.6788 0.7506 0.6493 0.0783  -0.0046 -0.0171 126 ALA A CB  
971  N N   . GLN A 127 ? 0.8011 0.9079 0.7743 0.0860  -0.0116 -0.0376 127 GLN A N   
972  C CA  . GLN A 127 ? 0.8528 0.9766 0.8325 0.0860  -0.0131 -0.0503 127 GLN A CA  
973  C C   . GLN A 127 ? 0.8774 1.0026 0.8673 0.0794  -0.0083 -0.0569 127 GLN A C   
974  O O   . GLN A 127 ? 0.8990 1.0351 0.8867 0.0803  -0.0081 -0.0632 127 GLN A O   
975  C CB  . GLN A 127 ? 0.8561 0.9881 0.8455 0.0862  -0.0157 -0.0584 127 GLN A CB  
976  N N   . PHE A 128 ? 0.8597 0.9744 0.8611 0.0726  -0.0044 -0.0554 128 PHE A N   
977  C CA  . PHE A 128 ? 0.8278 0.9421 0.8431 0.0661  0.0006  -0.0605 128 PHE A CA  
978  C C   . PHE A 128 ? 0.7765 0.8864 0.7871 0.0657  0.0030  -0.0565 128 PHE A C   
979  O O   . PHE A 128 ? 0.7634 0.8623 0.7630 0.0678  0.0024  -0.0461 128 PHE A O   
980  C CB  . PHE A 128 ? 0.8096 0.9119 0.8359 0.0600  0.0033  -0.0561 128 PHE A CB  
981  C CG  . PHE A 128 ? 0.8689 0.9679 0.9111 0.0539  0.0084  -0.0581 128 PHE A CG  
982  C CD1 . PHE A 128 ? 0.9703 1.0815 1.0233 0.0526  0.0117  -0.0697 128 PHE A CD1 
983  C CD2 . PHE A 128 ? 0.8761 0.9610 0.9238 0.0493  0.0101  -0.0487 128 PHE A CD2 
984  C CE1 . PHE A 128 ? 0.9899 1.0980 1.0612 0.0468  0.0174  -0.0720 128 PHE A CE1 
985  C CE2 . PHE A 128 ? 0.9285 1.0101 0.9931 0.0443  0.0145  -0.0495 128 PHE A CE2 
986  C CZ  . PHE A 128 ? 0.9817 1.0745 1.0594 0.0430  0.0187  -0.0613 128 PHE A CZ  
987  N N   . LYS A 129 ? 0.7728 0.8915 0.7930 0.0627  0.0066  -0.0660 129 LYS A N   
988  C CA  . LYS A 129 ? 0.7654 0.8822 0.7813 0.0620  0.0097  -0.0649 129 LYS A CA  
989  C C   . LYS A 129 ? 0.7069 0.8062 0.7278 0.0583  0.0127  -0.0550 129 LYS A C   
990  O O   . LYS A 129 ? 0.6973 0.7895 0.7077 0.0601  0.0135  -0.0487 129 LYS A O   
991  C CB  . LYS A 129 ? 0.8114 0.9431 0.8386 0.0583  0.0139  -0.0793 129 LYS A CB  
992  C CG  . LYS A 129 ? 0.9085 1.0445 0.9600 0.0526  0.0178  -0.0885 129 LYS A CG  
993  C CD  . LYS A 129 ? 1.0389 1.1875 1.1052 0.0477  0.0240  -0.1026 129 LYS A CD  
994  C CE  . LYS A 129 ? 1.1057 1.2534 1.2007 0.0412  0.0302  -0.1093 129 LYS A CE  
995  N NZ  . LYS A 129 ? 1.1722 1.3374 1.2773 0.0407  0.0311  -0.1243 129 LYS A NZ  
996  N N   . GLU A 130 ? 0.6596 0.7521 0.6967 0.0535  0.0143  -0.0535 130 GLU A N   
997  C CA  . GLU A 130 ? 0.6224 0.7001 0.6657 0.0503  0.0160  -0.0443 130 GLU A CA  
998  C C   . GLU A 130 ? 0.5704 0.6367 0.5985 0.0534  0.0124  -0.0323 130 GLU A C   
999  O O   . GLU A 130 ? 0.5452 0.6018 0.5720 0.0529  0.0136  -0.0260 130 GLU A O   
1000 C CB  . GLU A 130 ? 0.6298 0.7036 0.6934 0.0448  0.0180  -0.0442 130 GLU A CB  
1001 C CG  . GLU A 130 ? 0.7638 0.8374 0.8471 0.0402  0.0234  -0.0486 130 GLU A CG  
1002 C CD  . GLU A 130 ? 0.9460 1.0266 1.0508 0.0361  0.0277  -0.0573 130 GLU A CD  
1003 O OE1 . GLU A 130 ? 1.0297 1.1196 1.1324 0.0372  0.0271  -0.0643 130 GLU A OE1 
1004 O OE2 . GLU A 130 ? 1.0011 1.0777 1.1268 0.0317  0.0322  -0.0577 130 GLU A OE2 
1005 N N   . MET A 131 ? 0.5348 0.6025 0.5532 0.0564  0.0087  -0.0302 131 MET A N   
1006 C CA  . MET A 131 ? 0.4960 0.5543 0.5018 0.0591  0.0064  -0.0205 131 MET A CA  
1007 C C   . MET A 131 ? 0.4990 0.5575 0.4906 0.0644  0.0069  -0.0185 131 MET A C   
1008 O O   . MET A 131 ? 0.4822 0.5305 0.4680 0.0654  0.0079  -0.0109 131 MET A O   
1009 C CB  . MET A 131 ? 0.4961 0.5563 0.4974 0.0604  0.0032  -0.0199 131 MET A CB  
1010 C CG  . MET A 131 ? 0.4664 0.5173 0.4579 0.0618  0.0019  -0.0109 131 MET A CG  
1011 S SD  . MET A 131 ? 0.4323 0.4701 0.4293 0.0561  0.0028  -0.0024 131 MET A SD  
1012 C CE  . MET A 131 ? 0.4207 0.4598 0.4302 0.0497  0.0024  -0.0044 131 MET A CE  
1013 N N   . LYS A 132 ? 0.5102 0.5807 0.4961 0.0679  0.0065  -0.0253 132 LYS A N   
1014 C CA  . LYS A 132 ? 0.5314 0.6024 0.5012 0.0734  0.0069  -0.0222 132 LYS A CA  
1015 C C   . LYS A 132 ? 0.4982 0.5618 0.4700 0.0705  0.0121  -0.0210 132 LYS A C   
1016 O O   . LYS A 132 ? 0.4936 0.5481 0.4557 0.0728  0.0143  -0.0141 132 LYS A O   
1017 C CB  . LYS A 132 ? 0.6103 0.6979 0.5735 0.0772  0.0047  -0.0303 132 LYS A CB  
1018 C CG  . LYS A 132 ? 0.7015 0.7978 0.6620 0.0816  -0.0008 -0.0320 132 LYS A CG  
1019 C CD  . LYS A 132 ? 0.8334 0.9489 0.7908 0.0844  -0.0036 -0.0423 132 LYS A CD  
1020 C CE  . LYS A 132 ? 0.8981 1.0179 0.8358 0.0915  -0.0056 -0.0374 132 LYS A CE  
1021 N NZ  . LYS A 132 ? 0.9913 1.1314 0.9242 0.0961  -0.0112 -0.0455 132 LYS A NZ  
1022 N N   . ALA A 133 ? 0.4665 0.5340 0.4533 0.0649  0.0148  -0.0285 133 ALA A N   
1023 C CA  . ALA A 133 ? 0.4405 0.5023 0.4338 0.0611  0.0202  -0.0296 133 ALA A CA  
1024 C C   . ALA A 133 ? 0.3972 0.4433 0.3939 0.0598  0.0209  -0.0203 133 ALA A C   
1025 O O   . ALA A 133 ? 0.4107 0.4494 0.4041 0.0597  0.0249  -0.0179 133 ALA A O   
1026 C CB  . ALA A 133 ? 0.4382 0.5063 0.4520 0.0550  0.0230  -0.0391 133 ALA A CB  
1027 N N   . ALA A 134 ? 0.3430 0.3848 0.3464 0.0584  0.0173  -0.0158 134 ALA A N   
1028 C CA  . ALA A 134 ? 0.3046 0.3338 0.3127 0.0565  0.0170  -0.0078 134 ALA A CA  
1029 C C   . ALA A 134 ? 0.3008 0.3230 0.2935 0.0609  0.0173  -0.0009 134 ALA A C   
1030 O O   . ALA A 134 ? 0.2916 0.3044 0.2865 0.0600  0.0197  0.0029  134 ALA A O   
1031 C CB  . ALA A 134 ? 0.2621 0.2901 0.2796 0.0532  0.0132  -0.0049 134 ALA A CB  
1032 N N   . LEU A 135 ? 0.3039 0.3309 0.2833 0.0658  0.0151  0.0000  135 LEU A N   
1033 C CA  . LEU A 135 ? 0.3138 0.3342 0.2809 0.0704  0.0162  0.0066  135 LEU A CA  
1034 C C   . LEU A 135 ? 0.3614 0.3786 0.3198 0.0732  0.0215  0.0072  135 LEU A C   
1035 O O   . LEU A 135 ? 0.3747 0.3816 0.3302 0.0742  0.0254  0.0123  135 LEU A O   
1036 C CB  . LEU A 135 ? 0.3184 0.3456 0.2763 0.0753  0.0126  0.0072  135 LEU A CB  
1037 C CG  . LEU A 135 ? 0.2765 0.3081 0.2408 0.0728  0.0083  0.0053  135 LEU A CG  
1038 C CD1 . LEU A 135 ? 0.2851 0.3260 0.2425 0.0780  0.0053  0.0030  135 LEU A CD1 
1039 C CD2 . LEU A 135 ? 0.2050 0.2283 0.1715 0.0704  0.0083  0.0107  135 LEU A CD2 
1040 N N   . GLN A 136 ? 0.3943 0.4206 0.3485 0.0740  0.0221  0.0014  136 GLN A N   
1041 C CA  . GLN A 136 ? 0.4449 0.4692 0.3896 0.0754  0.0276  0.0011  136 GLN A CA  
1042 C C   . GLN A 136 ? 0.4458 0.4599 0.4017 0.0703  0.0332  0.0003  136 GLN A C   
1043 O O   . GLN A 136 ? 0.4786 0.4836 0.4270 0.0718  0.0388  0.0040  136 GLN A O   
1044 C CB  . GLN A 136 ? 0.4717 0.5100 0.4119 0.0753  0.0273  -0.0071 136 GLN A CB  
1045 C CG  . GLN A 136 ? 0.5511 0.6001 0.4769 0.0818  0.0224  -0.0061 136 GLN A CG  
1046 C CD  . GLN A 136 ? 0.6730 0.7390 0.5987 0.0805  0.0207  -0.0165 136 GLN A CD  
1047 O OE1 . GLN A 136 ? 0.7414 0.8104 0.6768 0.0746  0.0247  -0.0246 136 GLN A OE1 
1048 N NE2 . GLN A 136 ? 0.7128 0.7909 0.6295 0.0859  0.0149  -0.0174 136 GLN A NE2 
1049 N N   . GLU A 137 ? 0.4259 0.4409 0.4004 0.0643  0.0321  -0.0043 137 GLU A N   
1050 C CA  . GLU A 137 ? 0.4367 0.4427 0.4243 0.0598  0.0370  -0.0054 137 GLU A CA  
1051 C C   . GLU A 137 ? 0.4321 0.4267 0.4220 0.0603  0.0365  0.0018  137 GLU A C   
1052 O O   . GLU A 137 ? 0.4365 0.4219 0.4302 0.0591  0.0418  0.0023  137 GLU A O   
1053 C CB  . GLU A 137 ? 0.4289 0.4388 0.4380 0.0535  0.0373  -0.0126 137 GLU A CB  
1054 C CG  . GLU A 137 ? 0.4320 0.4492 0.4520 0.0517  0.0317  -0.0140 137 GLU A CG  
1055 C CD  . GLU A 137 ? 0.4593 0.4870 0.4911 0.0480  0.0340  -0.0242 137 GLU A CD  
1056 O OE1 . GLU A 137 ? 0.4367 0.4672 0.4851 0.0448  0.0318  -0.0257 137 GLU A OE1 
1057 O OE2 . GLU A 137 ? 0.5090 0.5429 0.5334 0.0480  0.0384  -0.0309 137 GLU A OE2 
1058 N N   . GLY A 138 ? 0.4175 0.4133 0.4048 0.0621  0.0309  0.0064  138 GLY A N   
1059 C CA  . GLY A 138 ? 0.4022 0.3896 0.3905 0.0624  0.0305  0.0123  138 GLY A CA  
1060 C C   . GLY A 138 ? 0.4394 0.4192 0.4160 0.0666  0.0369  0.0156  138 GLY A C   
1061 O O   . GLY A 138 ? 0.4277 0.3984 0.4097 0.0654  0.0410  0.0169  138 GLY A O   
1062 N N   . HIS A 139 ? 0.4714 0.4551 0.4324 0.0717  0.0378  0.0169  139 HIS A N   
1063 C CA  . HIS A 139 ? 0.5257 0.5023 0.4741 0.0767  0.0439  0.0219  139 HIS A CA  
1064 C C   . HIS A 139 ? 0.5659 0.5350 0.5146 0.0749  0.0520  0.0196  139 HIS A C   
1065 O O   . HIS A 139 ? 0.5832 0.5414 0.5335 0.0751  0.0585  0.0221  139 HIS A O   
1066 C CB  . HIS A 139 ? 0.5540 0.5385 0.4862 0.0828  0.0416  0.0240  139 HIS A CB  
1067 C CG  . HIS A 139 ? 0.6054 0.5829 0.5244 0.0891  0.0470  0.0315  139 HIS A CG  
1068 N ND1 . HIS A 139 ? 0.6852 0.6618 0.5897 0.0925  0.0519  0.0335  139 HIS A ND1 
1069 C CD2 . HIS A 139 ? 0.6268 0.5979 0.5456 0.0926  0.0488  0.0377  139 HIS A CD2 
1070 C CE1 . HIS A 139 ? 0.7234 0.6925 0.6190 0.0984  0.0563  0.0419  139 HIS A CE1 
1071 N NE2 . HIS A 139 ? 0.6813 0.6468 0.5867 0.0985  0.0549  0.0441  139 HIS A NE2 
1072 N N   . GLN A 140 ? 0.5900 0.5658 0.5384 0.0725  0.0522  0.0138  140 GLN A N   
1073 C CA  . GLN A 140 ? 0.6318 0.6025 0.5823 0.0692  0.0600  0.0093  140 GLN A CA  
1074 C C   . GLN A 140 ? 0.6035 0.5645 0.5731 0.0644  0.0629  0.0075  140 GLN A C   
1075 O O   . GLN A 140 ? 0.6387 0.5897 0.6085 0.0637  0.0712  0.0072  140 GLN A O   
1076 C CB  . GLN A 140 ? 0.6793 0.6614 0.6326 0.0656  0.0585  0.0011  140 GLN A CB  
1077 C CG  . GLN A 140 ? 0.7998 0.7788 0.7618 0.0599  0.0660  -0.0062 140 GLN A CG  
1078 C CD  . GLN A 140 ? 0.9205 0.9132 0.8838 0.0566  0.0653  -0.0152 140 GLN A CD  
1079 O OE1 . GLN A 140 ? 0.9329 0.9372 0.8949 0.0581  0.0582  -0.0164 140 GLN A OE1 
1080 N NE2 . GLN A 140 ? 1.0101 1.0018 0.9766 0.0516  0.0733  -0.0227 140 GLN A NE2 
1081 N N   . PHE A 141 ? 0.5554 0.5194 0.5411 0.0613  0.0560  0.0065  141 PHE A N   
1082 C CA  . PHE A 141 ? 0.5432 0.4994 0.5462 0.0577  0.0572  0.0058  141 PHE A CA  
1083 C C   . PHE A 141 ? 0.5576 0.5043 0.5550 0.0607  0.0619  0.0104  141 PHE A C   
1084 O O   . PHE A 141 ? 0.5736 0.5115 0.5783 0.0590  0.0688  0.0081  141 PHE A O   
1085 C CB  . PHE A 141 ? 0.5109 0.4723 0.5284 0.0549  0.0480  0.0066  141 PHE A CB  
1086 C CG  . PHE A 141 ? 0.4822 0.4375 0.5163 0.0520  0.0471  0.0070  141 PHE A CG  
1087 C CD1 . PHE A 141 ? 0.4681 0.4219 0.5001 0.0532  0.0443  0.0114  141 PHE A CD1 
1088 C CD2 . PHE A 141 ? 0.4820 0.4346 0.5352 0.0478  0.0490  0.0022  141 PHE A CD2 
1089 C CE1 . PHE A 141 ? 0.5035 0.4541 0.5504 0.0504  0.0427  0.0109  141 PHE A CE1 
1090 C CE2 . PHE A 141 ? 0.5162 0.4650 0.5857 0.0456  0.0470  0.0024  141 PHE A CE2 
1091 C CZ  . PHE A 141 ? 0.5112 0.4595 0.5770 0.0469  0.0435  0.0067  141 PHE A CZ  
1092 N N   . LEU A 142 ? 0.5594 0.5082 0.5460 0.0649  0.0587  0.0160  142 LEU A N   
1093 C CA  . LEU A 142 ? 0.5811 0.5216 0.5647 0.0676  0.0639  0.0199  142 LEU A CA  
1094 C C   . LEU A 142 ? 0.6528 0.5830 0.6273 0.0705  0.0755  0.0212  142 LEU A C   
1095 O O   . LEU A 142 ? 0.6619 0.5827 0.6430 0.0700  0.0825  0.0208  142 LEU A O   
1096 C CB  . LEU A 142 ? 0.5463 0.4915 0.5210 0.0714  0.0593  0.0251  142 LEU A CB  
1097 C CG  . LEU A 142 ? 0.4703 0.4223 0.4547 0.0678  0.0504  0.0243  142 LEU A CG  
1098 C CD1 . LEU A 142 ? 0.4007 0.3579 0.3763 0.0710  0.0468  0.0279  142 LEU A CD1 
1099 C CD2 . LEU A 142 ? 0.4432 0.3908 0.4417 0.0639  0.0515  0.0225  142 LEU A CD2 
1100 N N   . CYS A 143 ? 0.6970 0.6294 0.6559 0.0732  0.0778  0.0224  143 CYS A N   
1101 C CA  . CYS A 143 ? 0.7978 0.7204 0.7460 0.0754  0.0891  0.0242  143 CYS A CA  
1102 C C   . CYS A 143 ? 0.8170 0.7314 0.7782 0.0697  0.0969  0.0172  143 CYS A C   
1103 O O   . CYS A 143 ? 0.8722 0.7746 0.8333 0.0702  0.1074  0.0180  143 CYS A O   
1104 C CB  . CYS A 143 ? 0.8080 0.7370 0.7355 0.0790  0.0887  0.0268  143 CYS A CB  
1105 S SG  . CYS A 143 ? 0.8892 0.8266 0.8038 0.0864  0.0806  0.0349  143 CYS A SG  
1106 N N   . SER A 144 ? 0.8089 0.7294 0.7833 0.0642  0.0924  0.0100  144 SER A N   
1107 C CA  . SER A 144 ? 0.8504 0.7638 0.8410 0.0586  0.0991  0.0026  144 SER A CA  
1108 C C   . SER A 144 ? 0.8522 0.7585 0.8605 0.0573  0.1003  0.0016  144 SER A C   
1109 O O   . SER A 144 ? 0.8919 0.7874 0.9049 0.0562  0.1105  -0.0010 144 SER A O   
1110 C CB  . SER A 144 ? 0.8327 0.7547 0.8375 0.0531  0.0939  -0.0046 144 SER A CB  
1111 O OG  . SER A 144 ? 0.8333 0.7604 0.8560 0.0514  0.0840  -0.0046 144 SER A OG  
1112 N N   . ILE A 145 ? 0.8322 0.7448 0.8501 0.0571  0.0902  0.0033  145 ILE A N   
1113 C CA  . ILE A 145 ? 0.8434 0.7517 0.8772 0.0556  0.0907  0.0017  145 ILE A CA  
1114 C C   . ILE A 145 ? 0.8932 0.7908 0.9192 0.0590  0.1019  0.0039  145 ILE A C   
1115 O O   . ILE A 145 ? 0.9167 0.8069 0.9563 0.0569  0.1087  -0.0007 145 ILE A O   
1116 C CB  . ILE A 145 ? 0.7991 0.7165 0.8378 0.0555  0.0789  0.0047  145 ILE A CB  
1117 C CG1 . ILE A 145 ? 0.7664 0.6924 0.8164 0.0519  0.0690  0.0028  145 ILE A CG1 
1118 C CG2 . ILE A 145 ? 0.7991 0.7139 0.8521 0.0538  0.0796  0.0023  145 ILE A CG2 
1119 C CD1 . ILE A 145 ? 0.7710 0.6933 0.8379 0.0478  0.0729  -0.0038 145 ILE A CD1 
1120 N N   . GLU A 146 ? 0.9263 0.8232 0.9318 0.0643  0.1043  0.0110  146 GLU A N   
1121 C CA  . GLU A 146 ? 1.0124 0.8990 1.0112 0.0683  0.1153  0.0149  146 GLU A CA  
1122 C C   . GLU A 146 ? 1.1059 0.9799 1.1059 0.0666  0.1290  0.0111  146 GLU A C   
1123 O O   . GLU A 146 ? 1.1558 1.0197 1.1640 0.0666  0.1391  0.0093  146 GLU A O   
1124 C CB  . GLU A 146 ? 1.0449 0.9334 1.0219 0.0748  0.1147  0.0242  146 GLU A CB  
1125 C CG  . GLU A 146 ? 1.0503 0.9430 1.0290 0.0777  0.1100  0.0284  146 GLU A CG  
1127 O OE1 . GLU A 146 ? 0.9036 0.8117 0.8632 0.0842  0.0960  0.0376  146 GLU A OE1 
1128 O OE2 . GLU A 146 ? 1.1584 1.0479 1.1052 0.0891  0.1152  0.0432  146 GLU A OE2 
1129 N N   . ALA A 147 ? 1.1342 1.0090 1.1269 0.0646  0.1302  0.0089  147 ALA A N   
1130 C CA  . ALA A 147 ? 1.2084 1.0719 1.2022 0.0617  0.1435  0.0040  147 ALA A CA  
1131 C C   . ALA A 147 ? 1.2434 1.1080 1.2623 0.0546  0.1418  -0.0069 147 ALA A C   
1132 O O   . ALA A 147 ? 1.2601 1.1222 1.2997 0.0526  0.1419  -0.0117 147 ALA A O   
1133 C CB  . ALA A 147 ? 1.2103 1.0748 1.1810 0.0631  0.1467  0.0073  147 ALA A CB  
1134 N N   . ARG B 4   ? 0.7005 0.7936 0.5623 -0.0594 0.0075  0.0696  4   ARG B N   
1135 C CA  . ARG B 4   ? 0.6889 0.7758 0.5606 -0.0510 0.0223  0.0644  4   ARG B CA  
1136 C C   . ARG B 4   ? 0.6403 0.7120 0.5332 -0.0480 0.0234  0.0532  4   ARG B C   
1137 O O   . ARG B 4   ? 0.6169 0.6923 0.5203 -0.0477 0.0167  0.0515  4   ARG B O   
1138 C CB  . ARG B 4   ? 0.7199 0.8207 0.5890 -0.0442 0.0295  0.0723  4   ARG B CB  
1139 C CG  . ARG B 4   ? 0.7682 0.8611 0.6570 -0.0365 0.0394  0.0649  4   ARG B CG  
1140 C CD  . ARG B 4   ? 0.8046 0.8965 0.6966 -0.0295 0.0567  0.0669  4   ARG B CD  
1141 N NE  . ARG B 4   ? 0.8673 0.9676 0.7610 -0.0228 0.0662  0.0730  4   ARG B NE  
1142 C CZ  . ARG B 4   ? 0.9592 1.0653 0.8533 -0.0154 0.0831  0.0808  4   ARG B CZ  
1143 N NH1 . ARG B 4   ? 0.9427 1.0514 0.8361 -0.0137 0.0912  0.0833  4   ARG B NH1 
1144 N NH2 . ARG B 4   ? 1.0356 1.1470 0.9320 -0.0089 0.0927  0.0866  4   ARG B NH2 
1145 N N   . ALA B 5   ? 0.5882 0.6470 0.4872 -0.0453 0.0320  0.0465  5   ALA B N   
1146 C CA  . ALA B 5   ? 0.5241 0.5690 0.4395 -0.0432 0.0329  0.0371  5   ALA B CA  
1147 C C   . ALA B 5   ? 0.4899 0.5290 0.4161 -0.0355 0.0463  0.0330  5   ALA B C   
1148 O O   . ALA B 5   ? 0.4895 0.5325 0.4111 -0.0320 0.0548  0.0369  5   ALA B O   
1149 C CB  . ALA B 5   ? 0.5195 0.5515 0.4316 -0.0483 0.0270  0.0333  5   ALA B CB  
1150 N N   . CYS B 6   ? 0.4583 0.4909 0.4001 -0.0330 0.0485  0.0259  6   CYS B N   
1151 C CA  . CYS B 6   ? 0.4467 0.4725 0.4011 -0.0264 0.0605  0.0218  6   CYS B CA  
1152 C C   . CYS B 6   ? 0.4349 0.4485 0.3974 -0.0259 0.0595  0.0147  6   CYS B C   
1153 O O   . CYS B 6   ? 0.4320 0.4449 0.3958 -0.0299 0.0517  0.0118  6   CYS B O   
1154 C CB  . CYS B 6   ? 0.4362 0.4682 0.4028 -0.0234 0.0679  0.0200  6   CYS B CB  
1155 S SG  . CYS B 6   ? 0.4861 0.5316 0.4428 -0.0211 0.0729  0.0305  6   CYS B SG  
1156 N N   . GLY B 7   ? 0.4222 0.4286 0.3908 -0.0201 0.0678  0.0134  7   GLY B N   
1157 C CA  . GLY B 7   ? 0.3927 0.3884 0.3663 -0.0188 0.0667  0.0084  7   GLY B CA  
1158 C C   . GLY B 7   ? 0.3849 0.3769 0.3710 -0.0117 0.0768  0.0072  7   GLY B C   
1159 O O   . GLY B 7   ? 0.4013 0.3987 0.3960 -0.0077 0.0860  0.0097  7   GLY B O   
1160 N N   . LEU B 8   ? 0.3532 0.3364 0.3406 -0.0094 0.0756  0.0046  8   LEU B N   
1161 C CA  . LEU B 8   ? 0.3407 0.3215 0.3397 -0.0022 0.0839  0.0050  8   LEU B CA  
1162 C C   . LEU B 8   ? 0.3362 0.3103 0.3281 0.0031  0.0810  0.0073  8   LEU B C   
1163 O O   . LEU B 8   ? 0.3465 0.3126 0.3286 0.0007  0.0740  0.0054  8   LEU B O   
1164 C CB  . LEU B 8   ? 0.3275 0.3079 0.3387 -0.0041 0.0870  -0.0009 8   LEU B CB  
1165 C CG  . LEU B 8   ? 0.3493 0.3376 0.3723 -0.0080 0.0925  -0.0054 8   LEU B CG  
1166 C CD1 . LEU B 8   ? 0.3664 0.3577 0.4001 -0.0117 0.0946  -0.0137 8   LEU B CD1 
1167 C CD2 . LEU B 8   ? 0.3130 0.3025 0.3474 -0.0023 0.1040  -0.0013 8   LEU B CD2 
1168 N N   . ILE B 9   ? 0.3268 0.3062 0.3252 0.0113  0.0871  0.0121  9   ILE B N   
1169 C CA  . ILE B 9   ? 0.3181 0.2943 0.3122 0.0180  0.0844  0.0138  9   ILE B CA  
1170 C C   . ILE B 9   ? 0.3194 0.2898 0.3229 0.0214  0.0866  0.0131  9   ILE B C   
1171 O O   . ILE B 9   ? 0.3199 0.2958 0.3399 0.0268  0.0947  0.0160  9   ILE B O   
1172 C CB  . ILE B 9   ? 0.3209 0.3121 0.3216 0.0268  0.0902  0.0201  9   ILE B CB  
1173 C CG1 . ILE B 9   ? 0.3413 0.3415 0.3292 0.0223  0.0874  0.0203  9   ILE B CG1 
1174 C CG2 . ILE B 9   ? 0.2865 0.2785 0.2876 0.0362  0.0879  0.0221  9   ILE B CG2 
1175 C CD1 . ILE B 9   ? 0.3224 0.3469 0.3191 0.0301  0.0966  0.0282  9   ILE B CD1 
1176 N N   . ILE B 10  ? 0.3167 0.2773 0.3101 0.0180  0.0804  0.0099  10  ILE B N   
1177 C CA  . ILE B 10  ? 0.3109 0.2689 0.3098 0.0201  0.0824  0.0097  10  ILE B CA  
1178 C C   . ILE B 10  ? 0.3332 0.2894 0.3299 0.0308  0.0811  0.0153  10  ILE B C   
1179 O O   . ILE B 10  ? 0.3326 0.2851 0.3171 0.0343  0.0759  0.0166  10  ILE B O   
1180 C CB  . ILE B 10  ? 0.3140 0.2681 0.3032 0.0130  0.0778  0.0064  10  ILE B CB  
1181 C CG1 . ILE B 10  ? 0.3202 0.2817 0.3145 0.0037  0.0784  0.0014  10  ILE B CG1 
1182 C CG2 . ILE B 10  ? 0.3125 0.2683 0.3045 0.0145  0.0803  0.0069  10  ILE B CG2 
1183 C CD1 . ILE B 10  ? 0.3354 0.3055 0.3461 0.0011  0.0855  -0.0032 10  ILE B CD1 
1184 N N   . PHE B 11  ? 0.3506 0.3105 0.3601 0.0359  0.0860  0.0183  11  PHE B N   
1185 C CA  . PHE B 11  ? 0.3913 0.3525 0.4001 0.0470  0.0841  0.0250  11  PHE B CA  
1186 C C   . PHE B 11  ? 0.4184 0.3796 0.4329 0.0478  0.0865  0.0268  11  PHE B C   
1187 O O   . PHE B 11  ? 0.4240 0.3873 0.4495 0.0402  0.0923  0.0220  11  PHE B O   
1188 C CB  . PHE B 11  ? 0.3947 0.3691 0.4195 0.0568  0.0888  0.0312  11  PHE B CB  
1189 C CG  . PHE B 11  ? 0.4156 0.3971 0.4653 0.0584  0.0992  0.0340  11  PHE B CG  
1190 C CD1 . PHE B 11  ? 0.3741 0.3588 0.4356 0.0658  0.1013  0.0400  11  PHE B CD1 
1191 C CD2 . PHE B 11  ? 0.4151 0.3995 0.4765 0.0527  0.1074  0.0310  11  PHE B CD2 
1192 C CE1 . PHE B 11  ? 0.4375 0.4269 0.5243 0.0667  0.1120  0.0422  11  PHE B CE1 
1193 C CE2 . PHE B 11  ? 0.4397 0.4280 0.5257 0.0543  0.1189  0.0331  11  PHE B CE2 
1194 C CZ  . PHE B 11  ? 0.4495 0.4397 0.5495 0.0609  0.1216  0.0383  11  PHE B CZ  
1195 N N   . ARG B 12  ? 0.4425 0.4030 0.4491 0.0569  0.0822  0.0335  12  ARG B N   
1196 C CA  . ARG B 12  ? 0.4778 0.4412 0.4888 0.0588  0.0841  0.0374  12  ARG B CA  
1197 C C   . ARG B 12  ? 0.5075 0.4783 0.5258 0.0734  0.0823  0.0481  12  ARG B C   
1198 O O   . ARG B 12  ? 0.5006 0.4748 0.5149 0.0828  0.0778  0.0519  12  ARG B O   
1199 C CB  . ARG B 12  ? 0.4841 0.4419 0.4738 0.0549  0.0801  0.0373  12  ARG B CB  
1200 C CG  . ARG B 12  ? 0.4986 0.4493 0.4684 0.0641  0.0728  0.0433  12  ARG B CG  
1201 C CD  . ARG B 12  ? 0.5017 0.4482 0.4523 0.0612  0.0718  0.0455  12  ARG B CD  
1202 N NE  . ARG B 12  ? 0.5323 0.4690 0.4638 0.0706  0.0661  0.0510  12  ARG B NE  
1203 C CZ  . ARG B 12  ? 0.5309 0.4607 0.4428 0.0708  0.0659  0.0550  12  ARG B CZ  
1204 N NH1 . ARG B 12  ? 0.4763 0.4126 0.3857 0.0624  0.0708  0.0550  12  ARG B NH1 
1205 N NH2 . ARG B 12  ? 0.5669 0.4858 0.4628 0.0801  0.0616  0.0592  12  ARG B NH2 
1206 N N   . ARG B 13  ? 0.5419 0.5183 0.5726 0.0753  0.0859  0.0526  13  ARG B N   
1207 C CA  . ARG B 13  ? 0.5795 0.5661 0.6200 0.0901  0.0838  0.0646  13  ARG B CA  
1208 C C   . ARG B 13  ? 0.6106 0.5956 0.6310 0.0952  0.0766  0.0716  13  ARG B C   
1209 O O   . ARG B 13  ? 0.6130 0.5947 0.6239 0.0867  0.0780  0.0693  13  ARG B O   
1210 C CB  . ARG B 13  ? 0.5960 0.5911 0.6674 0.0909  0.0933  0.0677  13  ARG B CB  
1211 C CG  . ARG B 13  ? 0.6036 0.5981 0.6946 0.0835  0.1037  0.0604  13  ARG B CG  
1212 C CD  . ARG B 13  ? 0.6605 0.6597 0.7816 0.0838  0.1144  0.0634  13  ARG B CD  
1213 N NE  . ARG B 13  ? 0.7468 0.7478 0.8911 0.0820  0.1263  0.0609  13  ARG B NE  
1214 C CZ  . ARG B 13  ? 0.7558 0.7707 0.9184 0.0943  0.1315  0.0712  13  ARG B CZ  
1215 N NH1 . ARG B 13  ? 0.7523 0.7825 0.9141 0.1094  0.1246  0.0833  13  ARG B NH1 
1216 N NH2 . ARG B 13  ? 0.7535 0.7702 0.9355 0.0923  0.1442  0.0699  13  ARG B NH2 
1217 N N   . CYS B 14  ? 0.6506 0.6413 0.6642 0.1098  0.0692  0.0807  14  CYS B N   
1218 C CA  . CYS B 14  ? 0.7041 0.6940 0.6968 0.1176  0.0619  0.0896  14  CYS B CA  
1219 C C   . CYS B 14  ? 0.7438 0.7499 0.7538 0.1305  0.0603  0.1028  14  CYS B C   
1220 O O   . CYS B 14  ? 0.7586 0.7784 0.7810 0.1442  0.0570  0.1095  14  CYS B O   
1221 C CB  . CYS B 14  ? 0.7047 0.6891 0.6770 0.1254  0.0542  0.0894  14  CYS B CB  
1222 S SG  . CYS B 14  ? 0.6817 0.6495 0.6426 0.1112  0.0567  0.0745  14  CYS B SG  
1223 N N   . LEU B 15  ? 0.7995 0.8077 0.8121 0.1259  0.0631  0.1069  15  LEU B N   
1224 C CA  . LEU B 15  ? 0.8573 0.8807 0.8929 0.1352  0.0637  0.1190  15  LEU B CA  
1225 C C   . LEU B 15  ? 0.9575 0.9883 0.9746 0.1470  0.0542  0.1339  15  LEU B C   
1226 O O   . LEU B 15  ? 0.9974 1.0254 0.9980 0.1397  0.0546  0.1355  15  LEU B O   
1227 C CB  . LEU B 15  ? 0.8466 0.8684 0.9038 0.1208  0.0750  0.1121  15  LEU B CB  
1228 C CG  . LEU B 15  ? 0.8236 0.8385 0.8994 0.1099  0.0851  0.0983  15  LEU B CG  
1229 C CD1 . LEU B 15  ? 0.8303 0.8399 0.9154 0.0921  0.0949  0.0867  15  LEU B CD1 
1230 C CD2 . LEU B 15  ? 0.7917 0.8181 0.9000 0.1209  0.0903  0.1046  15  LEU B CD2 
1231 N N   . ILE B 16  ? 1.0390 1.0831 1.0594 0.1659  0.0460  0.1455  16  ILE B N   
1232 C CA  . ILE B 16  ? 1.1216 1.1717 1.1187 0.1790  0.0352  0.1594  16  ILE B CA  
1233 C C   . ILE B 16  ? 1.2087 1.2823 1.2207 0.2018  0.0265  0.1738  16  ILE B C   
1234 O O   . ILE B 16  ? 1.1400 1.2259 1.1754 0.2081  0.0283  0.1715  16  ILE B O   
1235 C CB  . ILE B 16  ? 1.1005 1.1334 1.0600 0.1767  0.0310  0.1534  16  ILE B CB  
1236 C CG1 . ILE B 16  ? 1.0769 1.1061 1.0047 0.1767  0.0278  0.1630  16  ILE B CG1 
1237 C CG2 . ILE B 16  ? 1.0779 1.1161 1.0352 0.1915  0.0236  0.1536  16  ILE B CG2 
1238 C CD1 . ILE B 16  ? 0.9682 0.9854 0.8820 0.1569  0.0368  0.1534  16  ILE B CD1 
1239 N N   . PRO B 17  ? 1.3464 1.4302 1.3446 0.2146  0.0170  0.1898  17  PRO B N   
1240 C CA  . PRO B 17  ? 1.4143 1.5256 1.4272 0.2379  0.0074  0.2054  17  PRO B CA  
1241 C C   . PRO B 17  ? 1.4557 1.5693 1.4469 0.2509  -0.0021 0.2034  17  PRO B C   
1242 O O   . PRO B 17  ? 1.4629 1.5817 1.4311 0.2646  -0.0129 0.2149  17  PRO B O   
1243 C CB  . PRO B 17  ? 1.4482 1.5683 1.4517 0.2448  0.0008  0.2235  17  PRO B CB  
1244 C CG  . PRO B 17  ? 1.4390 1.5439 1.4441 0.2233  0.0115  0.2165  17  PRO B CG  
1245 C CD  . PRO B 17  ? 1.3836 1.4637 1.3727 0.2056  0.0193  0.1958  17  PRO B CD  
1246 N N   . LYS B 18  ? 1.4714 1.5816 1.4699 0.2462  0.0022  0.1886  18  LYS B N   
1247 C CA  . LYS B 18  ? 1.4690 1.5824 1.4517 0.2561  -0.0050 0.1828  18  LYS B CA  
1248 C C   . LYS B 18  ? 1.4550 1.5348 1.3970 0.2458  -0.0052 0.1720  18  LYS B C   
1249 O O   . LYS B 18  ? 1.4862 1.5616 1.4131 0.2504  -0.0092 0.1639  18  LYS B O   
1250 C CB  . LYS B 18  ? 1.5095 1.6528 1.4942 0.2808  -0.0177 0.1995  18  LYS B CB  
1251 N N   . VAL B 19  ? 1.3730 1.4314 1.2993 0.2317  0.0002  0.1719  19  VAL B N   
1252 C CA  . VAL B 19  ? 1.2865 1.3163 1.1782 0.2219  0.0026  0.1642  19  VAL B CA  
1253 C C   . VAL B 19  ? 1.1709 1.1856 1.0666 0.2087  0.0090  0.1449  19  VAL B C   
1254 O O   . VAL B 19  ? 1.1381 1.1351 1.0119 0.2073  0.0085  0.1372  19  VAL B O   
1255 C CB  . VAL B 19  ? 1.3172 1.3362 1.1964 0.2087  0.0090  0.1683  19  VAL B CB  
1256 C CG1 . VAL B 19  ? 1.3285 1.3518 1.1807 0.2207  0.0024  0.1862  19  VAL B CG1 
1257 C CG2 . VAL B 19  ? 1.3187 1.3495 1.2301 0.1997  0.0151  0.1678  19  VAL B CG2 
1258 N N   . ASP B 20  ? 1.0757 1.0974 1.0001 0.1991  0.0157  0.1381  20  ASP B N   
1259 C CA  . ASP B 20  ? 1.0175 1.0283 0.9482 0.1856  0.0221  0.1215  20  ASP B CA  
1260 C C   . ASP B 20  ? 1.0077 1.0398 0.9585 0.1947  0.0198  0.1180  20  ASP B C   
1261 O O   . ASP B 20  ? 1.0205 1.0774 1.0000 0.2019  0.0213  0.1252  20  ASP B O   
1262 C CB  . ASP B 20  ? 0.9818 0.9874 0.9288 0.1689  0.0319  0.1159  20  ASP B CB  
1263 C CG  . ASP B 20  ? 0.9792 0.9713 0.9087 0.1588  0.0351  0.1180  20  ASP B CG  
1264 O OD1 . ASP B 20  ? 0.9585 0.9341 0.8619 0.1546  0.0350  0.1150  20  ASP B OD1 
1265 O OD2 . ASP B 20  ? 0.9759 0.9758 0.9196 0.1546  0.0391  0.1224  20  ASP B OD2 
1266 N N   . ASN B 21  ? 0.9920 1.0160 0.9282 0.1942  0.0173  0.1073  21  ASN B N   
1267 C CA  . ASN B 21  ? 0.9975 1.0432 0.9493 0.1995  0.0164  0.1005  21  ASN B CA  
1268 C C   . ASN B 21  ? 0.9272 0.9861 0.9078 0.1913  0.0254  0.0984  21  ASN B C   
1269 O O   . ASN B 21  ? 0.9337 1.0247 0.9415 0.2021  0.0266  0.1061  21  ASN B O   
1270 C CB  . ASN B 21  ? 1.0926 1.1171 1.0231 0.1905  0.0164  0.0845  21  ASN B CB  
1271 C CG  . ASN B 21  ? 1.2603 1.3048 1.1911 0.2020  0.0105  0.0788  21  ASN B CG  
1272 O OD1 . ASN B 21  ? 1.3693 1.4404 1.3200 0.2025  0.0127  0.0734  21  ASN B OD1 
1273 N ND2 . ASN B 21  ? 1.3925 1.4263 1.3006 0.2112  0.0038  0.0796  21  ASN B ND2 
1274 N N   . ASN B 22  ? 0.8724 0.9079 0.8477 0.1732  0.0322  0.0893  22  ASN B N   
1275 C CA  . ASN B 22  ? 0.7570 0.7996 0.7549 0.1636  0.0415  0.0858  22  ASN B CA  
1276 C C   . ASN B 22  ? 0.7112 0.7460 0.7202 0.1570  0.0476  0.0913  22  ASN B C   
1277 O O   . ASN B 22  ? 0.7231 0.7382 0.7146 0.1507  0.0463  0.0914  22  ASN B O   
1278 C CB  . ASN B 22  ? 0.7578 0.7817 0.7422 0.1478  0.0442  0.0709  22  ASN B CB  
1279 C CG  . ASN B 22  ? 0.7698 0.7996 0.7434 0.1512  0.0394  0.0625  22  ASN B CG  
1280 O OD1 . ASN B 22  ? 0.7990 0.8061 0.7494 0.1456  0.0360  0.0546  22  ASN B OD1 
1281 N ND2 . ASN B 22  ? 0.8115 0.8740 0.8036 0.1600  0.0404  0.0640  22  ASN B ND2 
1282 N N   . ALA B 23  ? 0.6535 0.7055 0.6923 0.1582  0.0557  0.0958  23  ALA B N   
1283 C CA  . ALA B 23  ? 0.6097 0.6521 0.6610 0.1490  0.0635  0.0971  23  ALA B CA  
1284 C C   . ALA B 23  ? 0.5720 0.5972 0.6194 0.1309  0.0703  0.0839  23  ALA B C   
1285 O O   . ALA B 23  ? 0.5842 0.5981 0.6354 0.1201  0.0758  0.0804  23  ALA B O   
1286 C CB  . ALA B 23  ? 0.6002 0.6660 0.6874 0.1590  0.0706  0.1089  23  ALA B CB  
1287 N N   . ILE B 24  ? 0.5228 0.5487 0.5625 0.1278  0.0695  0.0763  24  ILE B N   
1288 C CA  . ILE B 24  ? 0.4915 0.5033 0.5251 0.1121  0.0738  0.0651  24  ILE B CA  
1289 C C   . ILE B 24  ? 0.4805 0.4764 0.4859 0.1063  0.0663  0.0566  24  ILE B C   
1290 O O   . ILE B 24  ? 0.4806 0.4841 0.4789 0.1133  0.0614  0.0558  24  ILE B O   
1291 C CB  . ILE B 24  ? 0.4894 0.5190 0.5428 0.1121  0.0823  0.0649  24  ILE B CB  
1292 C CG1 . ILE B 24  ? 0.4688 0.5160 0.5551 0.1198  0.0928  0.0753  24  ILE B CG1 
1293 C CG2 . ILE B 24  ? 0.4520 0.4675 0.4961 0.0965  0.0851  0.0545  24  ILE B CG2 
1294 C CD1 . ILE B 24  ? 0.4691 0.5019 0.5648 0.1127  0.0982  0.0747  24  ILE B CD1 
1295 N N   . GLU B 25  ? 0.4571 0.4332 0.4487 0.0935  0.0664  0.0500  25  GLU B N   
1296 C CA  . GLU B 25  ? 0.4644 0.4248 0.4339 0.0865  0.0619  0.0424  25  GLU B CA  
1297 C C   . GLU B 25  ? 0.4540 0.4083 0.4250 0.0720  0.0657  0.0344  25  GLU B C   
1298 O O   . GLU B 25  ? 0.4425 0.3965 0.4225 0.0651  0.0705  0.0335  25  GLU B O   
1299 C CB  . GLU B 25  ? 0.4728 0.4183 0.4226 0.0871  0.0581  0.0449  25  GLU B CB  
1300 C CG  . GLU B 25  ? 0.5292 0.4774 0.4695 0.1018  0.0522  0.0517  25  GLU B CG  
1301 C CD  . GLU B 25  ? 0.6086 0.5445 0.5292 0.1040  0.0504  0.0577  25  GLU B CD  
1302 O OE1 . GLU B 25  ? 0.6581 0.5933 0.5666 0.1160  0.0453  0.0633  25  GLU B OE1 
1303 O OE2 . GLU B 25  ? 0.6097 0.5395 0.5265 0.0946  0.0545  0.0573  25  GLU B OE2 
1304 N N   . PHE B 26  ? 0.4484 0.3994 0.4108 0.0672  0.0633  0.0281  26  PHE B N   
1305 C CA  . PHE B 26  ? 0.4422 0.3893 0.4045 0.0545  0.0653  0.0221  26  PHE B CA  
1306 C C   . PHE B 26  ? 0.4637 0.3933 0.4097 0.0462  0.0618  0.0180  26  PHE B C   
1307 O O   . PHE B 26  ? 0.5066 0.4257 0.4391 0.0493  0.0581  0.0174  26  PHE B O   
1308 C CB  . PHE B 26  ? 0.4502 0.4084 0.4140 0.0536  0.0654  0.0190  26  PHE B CB  
1309 C CG  . PHE B 26  ? 0.4518 0.4329 0.4342 0.0623  0.0710  0.0249  26  PHE B CG  
1310 C CD1 . PHE B 26  ? 0.4507 0.4393 0.4490 0.0598  0.0788  0.0278  26  PHE B CD1 
1311 C CD2 . PHE B 26  ? 0.4625 0.4596 0.4483 0.0742  0.0695  0.0282  26  PHE B CD2 
1312 C CE1 . PHE B 26  ? 0.4411 0.4512 0.4594 0.0690  0.0863  0.0353  26  PHE B CE1 
1313 C CE2 . PHE B 26  ? 0.4531 0.4759 0.4594 0.0838  0.0759  0.0360  26  PHE B CE2 
1314 C CZ  . PHE B 26  ? 0.4625 0.4912 0.4856 0.0813  0.0851  0.0403  26  PHE B CZ  
1315 N N   . LEU B 27  ? 0.4556 0.3835 0.4044 0.0361  0.0637  0.0156  27  LEU B N   
1316 C CA  . LEU B 27  ? 0.4580 0.3743 0.3955 0.0288  0.0614  0.0137  27  LEU B CA  
1317 C C   . LEU B 27  ? 0.4694 0.3819 0.4022 0.0214  0.0585  0.0089  27  LEU B C   
1318 O O   . LEU B 27  ? 0.4657 0.3876 0.4056 0.0162  0.0593  0.0069  27  LEU B O   
1319 C CB  . LEU B 27  ? 0.4455 0.3684 0.3904 0.0222  0.0645  0.0139  27  LEU B CB  
1320 C CG  . LEU B 27  ? 0.4317 0.3514 0.3706 0.0158  0.0638  0.0145  27  LEU B CG  
1321 C CD1 . LEU B 27  ? 0.4134 0.3245 0.3402 0.0218  0.0650  0.0206  27  LEU B CD1 
1322 C CD2 . LEU B 27  ? 0.3467 0.2824 0.2976 0.0092  0.0668  0.0127  27  LEU B CD2 
1323 N N   . LEU B 28  ? 0.4943 0.3929 0.4150 0.0208  0.0557  0.0072  28  LEU B N   
1324 C CA  . LEU B 28  ? 0.5185 0.4116 0.4346 0.0117  0.0531  0.0024  28  LEU B CA  
1325 C C   . LEU B 28  ? 0.5502 0.4320 0.4630 0.0067  0.0533  0.0048  28  LEU B C   
1326 O O   . LEU B 28  ? 0.5664 0.4398 0.4745 0.0121  0.0558  0.0092  28  LEU B O   
1327 C CB  . LEU B 28  ? 0.5290 0.4162 0.4367 0.0138  0.0510  -0.0031 28  LEU B CB  
1328 C CG  . LEU B 28  ? 0.5044 0.4097 0.4168 0.0188  0.0512  -0.0052 28  LEU B CG  
1329 C CD1 . LEU B 28  ? 0.5331 0.4354 0.4367 0.0184  0.0491  -0.0132 28  LEU B CD1 
1330 C CD2 . LEU B 28  ? 0.4719 0.3932 0.3918 0.0126  0.0526  -0.0046 28  LEU B CD2 
1331 N N   . LEU B 29  ? 0.5698 0.4542 0.4857 -0.0026 0.0513  0.0038  29  LEU B N   
1332 C CA  . LEU B 29  ? 0.6056 0.4848 0.5231 -0.0066 0.0523  0.0082  29  LEU B CA  
1333 C C   . LEU B 29  ? 0.6660 0.5301 0.5781 -0.0127 0.0502  0.0048  29  LEU B C   
1334 O O   . LEU B 29  ? 0.6640 0.5304 0.5736 -0.0183 0.0466  -0.0008 29  LEU B O   
1335 C CB  . LEU B 29  ? 0.5728 0.4709 0.5016 -0.0121 0.0512  0.0109  29  LEU B CB  
1336 C CG  . LEU B 29  ? 0.5380 0.4529 0.4750 -0.0090 0.0537  0.0115  29  LEU B CG  
1337 C CD1 . LEU B 29  ? 0.5090 0.4428 0.4570 -0.0152 0.0523  0.0125  29  LEU B CD1 
1338 C CD2 . LEU B 29  ? 0.5063 0.4209 0.4420 -0.0022 0.0586  0.0156  29  LEU B CD2 
1339 N N   . GLN B 30  ? 0.7409 0.5902 0.6512 -0.0116 0.0538  0.0085  30  GLN B N   
1340 C CA  . GLN B 30  ? 0.8291 0.6604 0.7362 -0.0181 0.0533  0.0043  30  GLN B CA  
1341 C C   . GLN B 30  ? 0.8606 0.6989 0.7779 -0.0268 0.0513  0.0090  30  GLN B C   
1342 O O   . GLN B 30  ? 0.8606 0.7085 0.7877 -0.0247 0.0543  0.0187  30  GLN B O   
1343 C CB  . GLN B 30  ? 0.8616 0.6703 0.7631 -0.0121 0.0599  0.0064  30  GLN B CB  
1344 C CG  . GLN B 30  ? 0.9259 0.7127 0.8249 -0.0191 0.0608  -0.0007 30  GLN B CG  
1345 C CD  . GLN B 30  ? 0.9838 0.7455 0.8761 -0.0121 0.0685  -0.0005 30  GLN B CD  
1346 O OE1 . GLN B 30  ? 1.0189 0.7784 0.9123 -0.0039 0.0753  0.0108  30  GLN B OE1 
1347 N NE2 . GLN B 30  ? 1.0284 0.7728 0.9134 -0.0155 0.0681  -0.0132 30  GLN B NE2 
1348 N N   . ALA B 31  ? 0.9210 0.7581 0.8364 -0.0364 0.0462  0.0029  31  ALA B N   
1349 C CA  . ALA B 31  ? 0.9776 0.8207 0.9022 -0.0447 0.0431  0.0081  31  ALA B CA  
1350 C C   . ALA B 31  ? 1.0574 0.8842 0.9900 -0.0442 0.0493  0.0146  31  ALA B C   
1351 O O   . ALA B 31  ? 1.1183 0.9207 1.0449 -0.0430 0.0545  0.0095  31  ALA B O   
1352 C CB  . ALA B 31  ? 0.9796 0.8233 0.8977 -0.0552 0.0371  0.0005  31  ALA B CB  
1353 N N   . SER B 32  ? 1.1126 0.9553 1.0602 -0.0440 0.0497  0.0264  32  SER B N   
1354 C CA  . SER B 32  ? 1.1942 1.0278 1.1546 -0.0430 0.0568  0.0361  32  SER B CA  
1355 C C   . SER B 32  ? 1.2813 1.0964 1.2439 -0.0536 0.0550  0.0321  32  SER B C   
1356 O O   . SER B 32  ? 1.3486 1.1400 1.3153 -0.0534 0.0633  0.0331  32  SER B O   
1357 C CB  . SER B 32  ? 1.1492 1.0140 1.1284 -0.0391 0.0576  0.0508  32  SER B CB  
1358 O OG  . SER B 32  ? 1.1587 1.0283 1.1416 -0.0286 0.0679  0.0593  32  SER B OG  
1359 N N   . ASP B 33  ? 1.4216 1.2484 1.3815 -0.0630 0.0449  0.0278  33  ASP B N   
1360 C CA  . ASP B 33  ? 1.5501 1.3640 1.5112 -0.0750 0.0419  0.0239  33  ASP B CA  
1361 C C   . ASP B 33  ? 1.5698 1.3737 1.5118 -0.0832 0.0379  0.0070  33  ASP B C   
1362 O O   . ASP B 33  ? 1.5066 1.3286 1.4382 -0.0836 0.0316  0.0032  33  ASP B O   
1363 C CB  . ASP B 33  ? 0.4725 0.3122 0.4458 -0.0799 0.0333  0.0347  33  ASP B CB  
1364 N N   . GLY B 34  ? 1.9033 1.9513 1.9279 -0.1373 0.1369  0.3241  34  GLY B N   
1365 C CA  . GLY B 34  ? 2.2126 1.9651 1.9396 -0.2240 0.1251  0.3378  34  GLY B CA  
1366 C C   . GLY B 34  ? 2.3858 1.8436 2.0158 -0.2367 0.2830  0.2860  34  GLY B C   
1367 O O   . GLY B 34  ? 2.7101 1.8319 2.0739 -0.3387 0.3544  0.2840  34  GLY B O   
1368 N N   . ILE B 35  ? 2.1975 1.7674 2.0251 -0.1452 0.3447  0.2612  35  ILE B N   
1369 C CA  . ILE B 35  ? 2.2624 1.6240 2.0845 -0.1204 0.5007  0.2539  35  ILE B CA  
1370 C C   . ILE B 35  ? 2.4218 1.4904 2.0056 -0.1682 0.5326  0.1929  35  ILE B C   
1371 O O   . ILE B 35  ? 2.5174 1.3954 2.0786 -0.1419 0.6641  0.1887  35  ILE B O   
1372 C CB  . ILE B 35  ? 2.4037 1.6215 2.2570 -0.1447 0.6409  0.2972  35  ILE B CB  
1373 C CG1 . ILE B 35  ? 2.3515 1.5162 2.4006 -0.0801 0.8105  0.3613  35  ILE B CG1 
1374 C CG2 . ILE B 35  ? 2.8186 1.6476 2.3127 -0.2608 0.6980  0.2611  35  ILE B CG2 
1375 C CD1 . ILE B 35  ? 2.0868 1.6025 2.4333 -0.0276 0.7490  0.4448  35  ILE B CD1 
1376 N N   . HIS B 36  ? 2.4385 1.4858 1.8739 -0.2539 0.4095  0.1664  36  HIS B N   
1377 C CA  . HIS B 36  ? 2.5567 1.3624 1.7944 -0.3528 0.4098  0.1120  36  HIS B CA  
1378 C C   . HIS B 36  ? 2.2619 1.2814 1.6063 -0.3318 0.2618  0.0910  36  HIS B C   
1379 O O   . HIS B 36  ? 2.3412 1.2392 1.5737 -0.4472 0.2075  0.0556  36  HIS B O   
1380 C CB  . HIS B 36  ? 2.9534 1.4567 1.8804 -0.5687 0.4091  0.1322  36  HIS B CB  
1381 C CG  . HIS B 36  ? 3.0520 1.4756 1.8585 -0.7388 0.3004  0.1215  36  HIS B CG  
1382 N ND1 . HIS B 36  ? 3.3044 1.3850 1.8672 -0.9044 0.3729  0.0593  36  HIS B ND1 
1383 C CD2 . HIS B 36  ? 2.9380 1.5958 1.8766 -0.7866 0.1285  0.1771  36  HIS B CD2 
1384 C CE1 . HIS B 36  ? 3.2993 1.4333 1.8549 -1.0714 0.2228  0.0766  36  HIS B CE1 
1385 N NE2 . HIS B 36  ? 3.0893 1.5765 1.8931 -0.9957 0.0782  0.1593  36  HIS B NE2 
1386 N N   . HIS B 37  ? 1.9063 1.2366 1.4694 -0.2079 0.2012  0.1137  37  HIS B N   
1387 C CA  . HIS B 37  ? 1.6201 1.1354 1.2922 -0.1805 0.0891  0.0976  37  HIS B CA  
1388 C C   . HIS B 37  ? 1.4038 0.9601 1.1040 -0.0727 0.1038  0.0532  37  HIS B C   
1389 O O   . HIS B 37  ? 1.3084 0.9495 1.0759 0.0240  0.1659  0.0858  37  HIS B O   
1390 C CB  . HIS B 37  ? 1.0866 0.8637 0.9372 -0.1165 0.0463  0.1472  37  HIS B CB  
1391 C CG  . HIS B 37  ? 1.0148 0.9177 0.9789 -0.1502 -0.0493 0.1815  37  HIS B CG  
1392 N ND1 . HIS B 37  ? 1.1402 0.9581 1.0582 -0.3113 -0.1236 0.2592  37  HIS B ND1 
1393 C CD2 . HIS B 37  ? 0.8507 0.9465 0.9888 -0.0626 -0.0663 0.1756  37  HIS B CD2 
1394 C CE1 . HIS B 37  ? 1.0178 1.0090 1.1428 -0.3121 -0.1881 0.3183  37  HIS B CE1 
1395 N NE2 . HIS B 37  ? 0.8520 1.0014 1.1098 -0.1473 -0.1416 0.2536  37  HIS B NE2 
1396 N N   . TRP B 38  ? 1.3774 0.8842 1.0219 -0.1158 0.0279  0.0025  38  TRP B N   
1397 C CA  . TRP B 38  ? 1.1714 0.7248 0.7999 -0.0156 0.0017  -0.0227 38  TRP B CA  
1398 C C   . TRP B 38  ? 0.9603 0.7100 0.6904 0.0002  -0.1291 -0.0507 38  TRP B C   
1399 O O   . TRP B 38  ? 0.9617 0.7283 0.7492 -0.1165 -0.2202 -0.0705 38  TRP B O   
1400 C CB  . TRP B 38  ? 1.2747 0.6066 0.7492 -0.0720 0.0166  -0.0663 38  TRP B CB  
1401 C CG  . TRP B 38  ? 1.4328 0.5563 0.8363 -0.0442 0.1905  -0.0225 38  TRP B CG  
1402 C CD1 . TRP B 38  ? 1.6928 0.5780 1.0020 -0.1477 0.3101  -0.0285 38  TRP B CD1 
1403 C CD2 . TRP B 38  ? 1.3518 0.4743 0.7843 0.0837  0.2768  0.0660  38  TRP B CD2 
1404 N NE1 . TRP B 38  ? 1.7763 0.5149 1.0934 -0.0752 0.4852  0.0311  38  TRP B NE1 
1405 C CE2 . TRP B 38  ? 1.5743 0.4709 0.9952 0.0640  0.4653  0.1089  38  TRP B CE2 
1406 C CE3 . TRP B 38  ? 1.1357 0.4138 0.5908 0.1956  0.2146  0.1443  38  TRP B CE3 
1407 C CZ2 . TRP B 38  ? 1.5497 0.4023 1.0598 0.1584  0.6014  0.2447  38  TRP B CZ2 
1408 C CZ3 . TRP B 38  ? 1.1572 0.3842 0.6468 0.2689  0.3273  0.2969  38  TRP B CZ3 
1409 C CH2 . TRP B 38  ? 1.3313 0.3626 0.8869 0.2536  0.5227  0.3545  38  TRP B CH2 
1410 N N   . THR B 39  ? 0.7297 0.6074 0.6225 -0.0126 0.0213  -0.0190 39  THR B N   
1411 C CA  . THR B 39  ? 0.6388 0.5337 0.5376 -0.0139 0.0159  -0.0188 39  THR B CA  
1412 C C   . THR B 39  ? 0.5737 0.4771 0.4769 -0.0085 0.0155  -0.0111 39  THR B C   
1413 O O   . THR B 39  ? 0.5723 0.4712 0.4750 -0.0049 0.0192  -0.0053 39  THR B O   
1414 C CB  . THR B 39  ? 0.6460 0.5453 0.5505 -0.0220 0.0143  -0.0209 39  THR B CB  
1415 O OG1 . THR B 39  ? 0.6890 0.5947 0.5926 -0.0271 0.0107  -0.0284 39  THR B OG1 
1416 C CG2 . THR B 39  ? 0.5774 0.4895 0.4892 -0.0211 0.0122  -0.0157 39  THR B CG2 
1417 N N   . PRO B 40  ? 0.5133 0.4298 0.4214 -0.0080 0.0117  -0.0111 40  PRO B N   
1418 C CA  . PRO B 40  ? 0.4576 0.3829 0.3717 -0.0047 0.0112  -0.0058 40  PRO B CA  
1419 C C   . PRO B 40  ? 0.4287 0.3582 0.3480 -0.0090 0.0113  -0.0048 40  PRO B C   
1420 O O   . PRO B 40  ? 0.4441 0.3714 0.3632 -0.0142 0.0108  -0.0079 40  PRO B O   
1421 C CB  . PRO B 40  ? 0.4332 0.3687 0.3512 -0.0038 0.0082  -0.0074 40  PRO B CB  
1422 C CG  . PRO B 40  ? 0.4639 0.3968 0.3759 -0.0029 0.0076  -0.0112 40  PRO B CG  
1423 C CD  . PRO B 40  ? 0.5047 0.4275 0.4113 -0.0079 0.0087  -0.0157 40  PRO B CD  
1424 N N   . PRO B 41  ? 0.4039 0.3405 0.3280 -0.0072 0.0118  -0.0009 41  PRO B N   
1425 C CA  . PRO B 41  ? 0.3965 0.3391 0.3250 -0.0105 0.0119  0.0000  41  PRO B CA  
1426 C C   . PRO B 41  ? 0.4102 0.3601 0.3431 -0.0150 0.0086  -0.0040 41  PRO B C   
1427 O O   . PRO B 41  ? 0.3845 0.3399 0.3204 -0.0142 0.0065  -0.0059 41  PRO B O   
1428 C CB  . PRO B 41  ? 0.3883 0.3410 0.3211 -0.0075 0.0125  0.0032  41  PRO B CB  
1429 C CG  . PRO B 41  ? 0.3950 0.3429 0.3240 -0.0026 0.0140  0.0059  41  PRO B CG  
1430 C CD  . PRO B 41  ? 0.3852 0.3262 0.3109 -0.0024 0.0125  0.0026  41  PRO B CD  
1431 N N   . LYS B 42  ? 0.4465 0.3967 0.3803 -0.0192 0.0086  -0.0044 42  LYS B N   
1432 C CA  . LYS B 42  ? 0.4579 0.4166 0.3956 -0.0229 0.0056  -0.0072 42  LYS B CA  
1433 C C   . LYS B 42  ? 0.4851 0.4468 0.4254 -0.0267 0.0062  -0.0055 42  LYS B C   
1434 O O   . LYS B 42  ? 0.5055 0.4605 0.4444 -0.0268 0.0095  -0.0023 42  LYS B O   
1435 C CB  . LYS B 42  ? 0.4661 0.4229 0.4010 -0.0247 0.0036  -0.0112 42  LYS B CB  
1436 C CG  . LYS B 42  ? 0.5122 0.4650 0.4447 -0.0305 0.0034  -0.0137 42  LYS B CG  
1437 C CD  . LYS B 42  ? 0.5586 0.5000 0.4849 -0.0305 0.0049  -0.0164 42  LYS B CD  
1438 C CE  . LYS B 42  ? 0.6528 0.5921 0.5776 -0.0377 0.0042  -0.0212 42  LYS B CE  
1439 N NZ  . LYS B 42  ? 0.7231 0.6464 0.6448 -0.0400 0.0084  -0.0221 42  LYS B NZ  
1440 N N   . GLY B 43  ? 0.4963 0.4684 0.4406 -0.0289 0.0037  -0.0067 43  GLY B N   
1441 C CA  . GLY B 43  ? 0.5259 0.5039 0.4736 -0.0317 0.0039  -0.0043 43  GLY B CA  
1442 C C   . GLY B 43  ? 0.5572 0.5464 0.5080 -0.0338 0.0008  -0.0061 43  GLY B C   
1443 O O   . GLY B 43  ? 0.5287 0.5210 0.4794 -0.0324 -0.0009 -0.0089 43  GLY B O   
1444 N N   . HIS B 44  ? 0.6132 0.6089 0.5672 -0.0364 0.0007  -0.0035 44  HIS B N   
1445 C CA  . HIS B 44  ? 0.6611 0.6683 0.6177 -0.0384 -0.0019 -0.0041 44  HIS B CA  
1446 C C   . HIS B 44  ? 0.6294 0.6479 0.5889 -0.0341 -0.0029 -0.0048 44  HIS B C   
1447 O O   . HIS B 44  ? 0.6215 0.6440 0.5829 -0.0308 -0.0017 -0.0037 44  HIS B O   
1448 C CB  . HIS B 44  ? 0.7583 0.7690 0.7179 -0.0427 -0.0013 -0.0002 44  HIS B CB  
1449 C CG  . HIS B 44  ? 0.9387 0.9376 0.8965 -0.0487 0.0000  -0.0012 44  HIS B CG  
1450 N ND1 . HIS B 44  ? 1.0633 1.0520 1.0224 -0.0499 0.0042  0.0021  44  HIS B ND1 
1451 C CD2 . HIS B 44  ? 1.0511 1.0472 1.0061 -0.0538 -0.0018 -0.0058 44  HIS B CD2 
1452 C CE1 . HIS B 44  ? 1.1285 1.1063 1.0858 -0.0561 0.0050  -0.0012 44  HIS B CE1 
1453 N NE2 . HIS B 44  ? 1.1245 1.1079 1.0791 -0.0589 0.0009  -0.0066 44  HIS B NE2 
1454 N N   . VAL B 45  ? 0.6248 0.6494 0.5846 -0.0340 -0.0047 -0.0067 45  VAL B N   
1455 C CA  . VAL B 45  ? 0.6243 0.6587 0.5871 -0.0302 -0.0050 -0.0080 45  VAL B CA  
1456 C C   . VAL B 45  ? 0.6587 0.7051 0.6245 -0.0298 -0.0055 -0.0054 45  VAL B C   
1457 O O   . VAL B 45  ? 0.7110 0.7617 0.6772 -0.0330 -0.0064 -0.0019 45  VAL B O   
1458 C CB  . VAL B 45  ? 0.6156 0.6533 0.5778 -0.0295 -0.0057 -0.0090 45  VAL B CB  
1459 C CG1 . VAL B 45  ? 0.6096 0.6567 0.5749 -0.0256 -0.0051 -0.0101 45  VAL B CG1 
1460 C CG2 . VAL B 45  ? 0.5743 0.6033 0.5351 -0.0277 -0.0045 -0.0110 45  VAL B CG2 
1461 N N   . GLU B 46  ? 0.6749 0.7283 0.6432 -0.0261 -0.0048 -0.0073 46  GLU B N   
1462 C CA  . GLU B 46  ? 0.7274 0.7954 0.6985 -0.0243 -0.0052 -0.0054 46  GLU B CA  
1463 C C   . GLU B 46  ? 0.7566 0.8333 0.7286 -0.0222 -0.0062 -0.0074 46  GLU B C   
1464 O O   . GLU B 46  ? 0.7459 0.8174 0.7174 -0.0208 -0.0055 -0.0114 46  GLU B O   
1465 C CB  . GLU B 46  ? 0.7334 0.8070 0.7064 -0.0212 -0.0040 -0.0078 46  GLU B CB  
1466 C CG  . GLU B 46  ? 0.8369 0.9257 0.8125 -0.0190 -0.0036 -0.0034 46  GLU B CG  
1467 C CD  . GLU B 46  ? 0.9276 1.0112 0.9032 -0.0209 -0.0018 0.0042  46  GLU B CD  
1468 O OE1 . GLU B 46  ? 0.9538 1.0311 0.9284 -0.0202 0.0002  0.0053  46  GLU B OE1 
1469 O OE2 . GLU B 46  ? 0.9550 1.0408 0.9321 -0.0229 -0.0021 0.0094  46  GLU B OE2 
1470 N N   . PRO B 47  ? 0.8041 0.8945 0.7777 -0.0212 -0.0072 -0.0039 47  PRO B N   
1471 C CA  . PRO B 47  ? 0.8302 0.9296 0.8039 -0.0185 -0.0078 -0.0047 47  PRO B CA  
1472 C C   . PRO B 47  ? 0.8514 0.9489 0.8255 -0.0146 -0.0061 -0.0120 47  PRO B C   
1473 O O   . PRO B 47  ? 0.9052 1.0001 0.8783 -0.0131 -0.0050 -0.0125 47  PRO B O   
1474 C CB  . PRO B 47  ? 0.8591 0.9753 0.8352 -0.0164 -0.0086 -0.0006 47  PRO B CB  
1475 C CG  . PRO B 47  ? 0.8550 0.9682 0.8324 -0.0203 -0.0086 0.0057  47  PRO B CG  
1476 C CD  . PRO B 47  ? 0.8296 0.9262 0.8051 -0.0230 -0.0074 0.0030  47  PRO B CD  
1477 N N   . GLY B 48  ? 0.8434 0.9427 0.8194 -0.0129 -0.0052 -0.0175 48  GLY B N   
1478 C CA  . GLY B 48  ? 0.8516 0.9467 0.8293 -0.0106 -0.0029 -0.0256 48  GLY B CA  
1479 C C   . GLY B 48  ? 0.8104 0.8888 0.7885 -0.0119 -0.0007 -0.0276 48  GLY B C   
1480 O O   . GLY B 48  ? 0.8301 0.9032 0.8099 -0.0096 0.0021  -0.0309 48  GLY B O   
1481 N N   . GLU B 49  ? 0.7303 0.8007 0.7069 -0.0150 -0.0016 -0.0247 49  GLU B N   
1482 C CA  . GLU B 49  ? 0.6723 0.7297 0.6499 -0.0159 0.0001  -0.0270 49  GLU B CA  
1483 C C   . GLU B 49  ? 0.6416 0.6887 0.6197 -0.0146 0.0025  -0.0263 49  GLU B C   
1484 O O   . GLU B 49  ? 0.6564 0.7032 0.6316 -0.0146 0.0018  -0.0214 49  GLU B O   
1485 C CB  . GLU B 49  ? 0.6511 0.7039 0.6260 -0.0185 -0.0013 -0.0232 49  GLU B CB  
1486 C CG  . GLU B 49  ? 0.6709 0.7292 0.6474 -0.0186 -0.0012 -0.0256 49  GLU B CG  
1487 C CD  . GLU B 49  ? 0.6717 0.7243 0.6455 -0.0200 -0.0013 -0.0210 49  GLU B CD  
1488 O OE1 . GLU B 49  ? 0.6654 0.7104 0.6358 -0.0216 -0.0019 -0.0164 49  GLU B OE1 
1489 O OE2 . GLU B 49  ? 0.6883 0.7447 0.6633 -0.0194 -0.0006 -0.0223 49  GLU B OE2 
1490 N N   . ASP B 50  ? 0.6045 0.6444 0.5868 -0.0135 0.0056  -0.0309 50  ASP B N   
1491 C CA  . ASP B 50  ? 0.5723 0.6019 0.5565 -0.0118 0.0087  -0.0291 50  ASP B CA  
1492 C C   . ASP B 50  ? 0.5416 0.5657 0.5219 -0.0137 0.0066  -0.0247 50  ASP B C   
1493 O O   . ASP B 50  ? 0.5266 0.5508 0.5048 -0.0162 0.0043  -0.0250 50  ASP B O   
1494 C CB  . ASP B 50  ? 0.5758 0.5990 0.5669 -0.0113 0.0126  -0.0350 50  ASP B CB  
1495 C CG  . ASP B 50  ? 0.5839 0.5979 0.5790 -0.0081 0.0174  -0.0323 50  ASP B CG  
1496 O OD1 . ASP B 50  ? 0.5753 0.5827 0.5718 -0.0085 0.0180  -0.0304 50  ASP B OD1 
1497 O OD2 . ASP B 50  ? 0.6340 0.6482 0.6311 -0.0044 0.0210  -0.0311 50  ASP B OD2 
1498 N N   . ASP B 51  ? 0.5098 0.5300 0.4890 -0.0118 0.0079  -0.0206 51  ASP B N   
1499 C CA  . ASP B 51  ? 0.4780 0.4942 0.4527 -0.0134 0.0058  -0.0175 51  ASP B CA  
1500 C C   . ASP B 51  ? 0.4630 0.4714 0.4391 -0.0138 0.0065  -0.0189 51  ASP B C   
1501 O O   . ASP B 51  ? 0.4421 0.4481 0.4138 -0.0159 0.0043  -0.0180 51  ASP B O   
1502 C CB  . ASP B 51  ? 0.4766 0.4945 0.4496 -0.0110 0.0068  -0.0132 51  ASP B CB  
1503 C CG  . ASP B 51  ? 0.4696 0.4968 0.4381 -0.0133 0.0040  -0.0111 51  ASP B CG  
1504 O OD1 . ASP B 51  ? 0.5063 0.5381 0.4723 -0.0125 0.0038  -0.0082 51  ASP B OD1 
1505 O OD2 . ASP B 51  ? 0.4878 0.5196 0.4555 -0.0158 0.0019  -0.0121 51  ASP B OD2 
1506 N N   . LEU B 52  ? 0.4565 0.4609 0.4392 -0.0117 0.0101  -0.0210 52  LEU B N   
1507 C CA  . LEU B 52  ? 0.4479 0.4473 0.4333 -0.0124 0.0108  -0.0224 52  LEU B CA  
1508 C C   . LEU B 52  ? 0.4615 0.4663 0.4463 -0.0156 0.0087  -0.0263 52  LEU B C   
1509 O O   . LEU B 52  ? 0.4800 0.4837 0.4637 -0.0165 0.0080  -0.0258 52  LEU B O   
1510 C CB  . LEU B 52  ? 0.4585 0.4531 0.4529 -0.0102 0.0158  -0.0239 52  LEU B CB  
1511 C CG  . LEU B 52  ? 0.4449 0.4336 0.4436 -0.0098 0.0177  -0.0228 52  LEU B CG  
1512 C CD1 . LEU B 52  ? 0.3342 0.3209 0.3258 -0.0085 0.0152  -0.0175 52  LEU B CD1 
1513 C CD2 . LEU B 52  ? 0.4761 0.4591 0.4840 -0.0063 0.0238  -0.0211 52  LEU B CD2 
1514 N N   . GLU B 53  ? 0.4691 0.4817 0.4544 -0.0166 0.0078  -0.0296 53  GLU B N   
1515 C CA  . GLU B 53  ? 0.4614 0.4833 0.4461 -0.0186 0.0059  -0.0324 53  GLU B CA  
1516 C C   . GLU B 53  ? 0.4381 0.4614 0.4162 -0.0193 0.0034  -0.0271 53  GLU B C   
1517 O O   . GLU B 53  ? 0.4385 0.4667 0.4161 -0.0198 0.0030  -0.0268 53  GLU B O   
1518 C CB  . GLU B 53  ? 0.4931 0.5243 0.4792 -0.0184 0.0056  -0.0362 53  GLU B CB  
1519 C CG  . GLU B 53  ? 0.5211 0.5620 0.5118 -0.0196 0.0061  -0.0438 53  GLU B CG  
1520 C CD  . GLU B 53  ? 0.5681 0.6164 0.5604 -0.0184 0.0065  -0.0485 53  GLU B CD  
1521 O OE1 . GLU B 53  ? 0.6287 0.6870 0.6243 -0.0193 0.0068  -0.0560 53  GLU B OE1 
1522 O OE2 . GLU B 53  ? 0.5756 0.6214 0.5657 -0.0163 0.0067  -0.0448 53  GLU B OE2 
1523 N N   . THR B 54  ? 0.4069 0.4267 0.3806 -0.0194 0.0022  -0.0229 54  THR B N   
1524 C CA  . THR B 54  ? 0.3905 0.4079 0.3588 -0.0207 0.0009  -0.0182 54  THR B CA  
1525 C C   . THR B 54  ? 0.3773 0.3849 0.3428 -0.0200 0.0018  -0.0162 54  THR B C   
1526 O O   . THR B 54  ? 0.3712 0.3777 0.3338 -0.0200 0.0022  -0.0134 54  THR B O   
1527 C CB  . THR B 54  ? 0.4004 0.4160 0.3654 -0.0222 -0.0004 -0.0157 54  THR B CB  
1528 O OG1 . THR B 54  ? 0.4367 0.4616 0.4040 -0.0222 -0.0011 -0.0166 54  THR B OG1 
1529 C CG2 . THR B 54  ? 0.3810 0.3935 0.3420 -0.0247 -0.0010 -0.0122 54  THR B CG2 
1530 N N   . ALA B 55  ? 0.3530 0.3544 0.3197 -0.0185 0.0028  -0.0168 55  ALA B N   
1531 C CA  . ALA B 55  ? 0.3482 0.3414 0.3120 -0.0169 0.0036  -0.0146 55  ALA B CA  
1532 C C   . ALA B 55  ? 0.3517 0.3471 0.3171 -0.0163 0.0046  -0.0145 55  ALA B C   
1533 O O   . ALA B 55  ? 0.3423 0.3332 0.3032 -0.0151 0.0052  -0.0111 55  ALA B O   
1534 C CB  . ALA B 55  ? 0.3432 0.3325 0.3096 -0.0144 0.0049  -0.0144 55  ALA B CB  
1535 N N   . LEU B 56  ? 0.3420 0.3450 0.3138 -0.0170 0.0052  -0.0184 56  LEU B N   
1536 C CA  . LEU B 56  ? 0.3437 0.3533 0.3176 -0.0171 0.0059  -0.0191 56  LEU B CA  
1537 C C   . LEU B 56  ? 0.3614 0.3800 0.3320 -0.0172 0.0053  -0.0170 56  LEU B C   
1538 O O   . LEU B 56  ? 0.3499 0.3701 0.3176 -0.0156 0.0064  -0.0129 56  LEU B O   
1539 C CB  . LEU B 56  ? 0.3515 0.3679 0.3337 -0.0190 0.0069  -0.0258 56  LEU B CB  
1540 C CG  . LEU B 56  ? 0.3437 0.3514 0.3319 -0.0186 0.0091  -0.0273 56  LEU B CG  
1541 C CD1 . LEU B 56  ? 0.3060 0.3179 0.3024 -0.0208 0.0108  -0.0348 56  LEU B CD1 
1542 C CD2 . LEU B 56  ? 0.3101 0.3157 0.2997 -0.0179 0.0102  -0.0246 56  LEU B CD2 
1543 N N   . ARG B 57  ? 0.3836 0.4092 0.3551 -0.0183 0.0042  -0.0188 57  ARG B N   
1544 C CA  . ARG B 57  ? 0.4207 0.4573 0.3906 -0.0175 0.0043  -0.0157 57  ARG B CA  
1545 C C   . ARG B 57  ? 0.4284 0.4555 0.3924 -0.0160 0.0057  -0.0084 57  ARG B C   
1546 O O   . ARG B 57  ? 0.4357 0.4682 0.3981 -0.0138 0.0078  -0.0035 57  ARG B O   
1547 C CB  . ARG B 57  ? 0.4357 0.4797 0.4069 -0.0183 0.0029  -0.0170 57  ARG B CB  
1548 C CG  . ARG B 57  ? 0.4545 0.5127 0.4257 -0.0166 0.0034  -0.0129 57  ARG B CG  
1549 C CD  . ARG B 57  ? 0.4970 0.5604 0.4689 -0.0171 0.0022  -0.0121 57  ARG B CD  
1550 N NE  . ARG B 57  ? 0.5194 0.5721 0.4880 -0.0180 0.0029  -0.0056 57  ARG B NE  
1551 C CZ  . ARG B 57  ? 0.5479 0.5908 0.5150 -0.0206 0.0015  -0.0062 57  ARG B CZ  
1552 N NH1 . ARG B 57  ? 0.5596 0.6019 0.5280 -0.0213 0.0000  -0.0114 57  ARG B NH1 
1553 N NH2 . ARG B 57  ? 0.6559 0.6903 0.6207 -0.0226 0.0023  -0.0016 57  ARG B NH2 
1554 N N   . GLU B 58  ? 0.4288 0.4421 0.3896 -0.0172 0.0051  -0.0079 58  GLU B N   
1555 C CA  . GLU B 58  ? 0.4348 0.4377 0.3902 -0.0169 0.0066  -0.0030 58  GLU B CA  
1556 C C   . GLU B 58  ? 0.4320 0.4266 0.3837 -0.0142 0.0086  -0.0005 58  GLU B C   
1557 O O   . GLU B 58  ? 0.4564 0.4451 0.4041 -0.0125 0.0114  0.0043  58  GLU B O   
1558 C CB  . GLU B 58  ? 0.4398 0.4350 0.3935 -0.0200 0.0049  -0.0046 58  GLU B CB  
1559 C CG  . GLU B 58  ? 0.4840 0.4716 0.4344 -0.0217 0.0065  -0.0012 58  GLU B CG  
1560 C CD  . GLU B 58  ? 0.5180 0.5145 0.4717 -0.0230 0.0069  0.0016  58  GLU B CD  
1561 O OE1 . GLU B 58  ? 0.4976 0.5027 0.4543 -0.0247 0.0045  -0.0005 58  GLU B OE1 
1562 O OE2 . GLU B 58  ? 0.5588 0.5534 0.5121 -0.0217 0.0104  0.0068  58  GLU B OE2 
1563 N N   . THR B 59  ? 0.4196 0.4138 0.3731 -0.0133 0.0079  -0.0030 59  THR B N   
1564 C CA  . THR B 59  ? 0.4176 0.4072 0.3681 -0.0100 0.0099  0.0002  59  THR B CA  
1565 C C   . THR B 59  ? 0.4415 0.4422 0.3923 -0.0076 0.0122  0.0044  59  THR B C   
1566 O O   . THR B 59  ? 0.4494 0.4452 0.3952 -0.0042 0.0151  0.0100  59  THR B O   
1567 C CB  . THR B 59  ? 0.4040 0.3924 0.3580 -0.0094 0.0090  -0.0022 59  THR B CB  
1568 O OG1 . THR B 59  ? 0.3687 0.3487 0.3217 -0.0101 0.0078  -0.0042 59  THR B OG1 
1569 C CG2 . THR B 59  ? 0.3761 0.3612 0.3270 -0.0057 0.0109  0.0020  59  THR B CG2 
1570 N N   . GLN B 60  ? 0.4633 0.4803 0.4197 -0.0089 0.0112  0.0016  60  GLN B N   
1571 C CA  . GLN B 60  ? 0.4973 0.5300 0.4543 -0.0062 0.0134  0.0057  60  GLN B CA  
1572 C C   . GLN B 60  ? 0.5081 0.5410 0.4618 -0.0035 0.0165  0.0128  60  GLN B C   
1573 O O   . GLN B 60  ? 0.5176 0.5551 0.4687 0.0009  0.0204  0.0199  60  GLN B O   
1574 C CB  . GLN B 60  ? 0.5020 0.5547 0.4660 -0.0086 0.0116  -0.0005 60  GLN B CB  
1575 C CG  . GLN B 60  ? 0.5903 0.6590 0.5569 -0.0088 0.0111  -0.0015 60  GLN B CG  
1576 C CD  . GLN B 60  ? 0.7104 0.7935 0.6751 -0.0039 0.0145  0.0070  60  GLN B CD  
1577 O OE1 . GLN B 60  ? 0.7695 0.8575 0.7321 -0.0006 0.0172  0.0124  60  GLN B OE1 
1578 N NE2 . GLN B 60  ? 0.7420 0.8329 0.7079 -0.0029 0.0150  0.0093  60  GLN B NE2 
1579 N N   . GLU B 61  ? 0.5126 0.5409 0.4669 -0.0059 0.0155  0.0117  61  GLU B N   
1580 C CA  . GLU B 61  ? 0.5441 0.5711 0.4971 -0.0039 0.0192  0.0189  61  GLU B CA  
1581 C C   . GLU B 61  ? 0.5450 0.5523 0.4919 -0.0019 0.0233  0.0241  61  GLU B C   
1582 O O   . GLU B 61  ? 0.5644 0.5716 0.5099 0.0023  0.0288  0.0321  61  GLU B O   
1583 C CB  . GLU B 61  ? 0.5413 0.5674 0.4969 -0.0078 0.0169  0.0161  61  GLU B CB  
1584 C CG  . GLU B 61  ? 0.6218 0.6689 0.5824 -0.0066 0.0167  0.0175  61  GLU B CG  
1585 C CD  . GLU B 61  ? 0.7055 0.7557 0.6692 -0.0104 0.0128  0.0122  61  GLU B CD  
1586 O OE1 . GLU B 61  ? 0.7666 0.8278 0.7330 -0.0112 0.0097  0.0055  61  GLU B OE1 
1587 O OE2 . GLU B 61  ? 0.7023 0.7442 0.6658 -0.0126 0.0131  0.0146  61  GLU B OE2 
1588 N N   . GLU B 62  ? 0.5278 0.5189 0.4715 -0.0047 0.0211  0.0192  62  GLU B N   
1589 C CA  . GLU B 62  ? 0.5392 0.5112 0.4769 -0.0038 0.0242  0.0213  62  GLU B CA  
1590 C C   . GLU B 62  ? 0.5317 0.5002 0.4647 0.0015  0.0269  0.0250  62  GLU B C   
1591 O O   . GLU B 62  ? 0.5507 0.5082 0.4790 0.0051  0.0322  0.0303  62  GLU B O   
1592 C CB  . GLU B 62  ? 0.5316 0.4924 0.4677 -0.0087 0.0202  0.0141  62  GLU B CB  
1593 C CG  . GLU B 62  ? 0.6006 0.5481 0.5348 -0.0123 0.0221  0.0136  62  GLU B CG  
1594 C CD  . GLU B 62  ? 0.6676 0.6222 0.6072 -0.0149 0.0231  0.0163  62  GLU B CD  
1595 O OE1 . GLU B 62  ? 0.7325 0.7030 0.6764 -0.0124 0.0232  0.0199  62  GLU B OE1 
1596 O OE2 . GLU B 62  ? 0.7342 0.6797 0.6739 -0.0196 0.0236  0.0146  62  GLU B OE2 
1597 N N   . ALA B 63  ? 0.5020 0.4799 0.4368 0.0022  0.0239  0.0225  63  ALA B N   
1598 C CA  . ALA B 63  ? 0.5039 0.4797 0.4347 0.0069  0.0258  0.0261  63  ALA B CA  
1599 C C   . ALA B 63  ? 0.5057 0.5015 0.4398 0.0098  0.0265  0.0297  63  ALA B C   
1600 O O   . ALA B 63  ? 0.5289 0.5255 0.4600 0.0139  0.0283  0.0337  63  ALA B O   
1601 C CB  . ALA B 63  ? 0.4800 0.4472 0.4096 0.0056  0.0223  0.0209  63  ALA B CB  
1602 N N   . GLY B 64  ? 0.5003 0.5138 0.4404 0.0077  0.0252  0.0281  64  GLY B N   
1603 C CA  . GLY B 64  ? 0.5044 0.5401 0.4477 0.0097  0.0258  0.0303  64  GLY B CA  
1604 C C   . GLY B 64  ? 0.4999 0.5429 0.4478 0.0065  0.0221  0.0242  64  GLY B C   
1605 O O   . GLY B 64  ? 0.5099 0.5717 0.4605 0.0074  0.0226  0.0254  64  GLY B O   
1606 N N   . ILE B 65  ? 0.4899 0.5196 0.4394 0.0028  0.0188  0.0178  65  ILE B N   
1607 C CA  . ILE B 65  ? 0.4822 0.5168 0.4379 -0.0003 0.0163  0.0123  65  ILE B CA  
1608 C C   . ILE B 65  ? 0.4990 0.5420 0.4626 -0.0060 0.0135  0.0032  65  ILE B C   
1609 O O   . ILE B 65  ? 0.4698 0.5040 0.4336 -0.0079 0.0120  -0.0001 65  ILE B O   
1610 C CB  . ILE B 65  ? 0.4686 0.4852 0.4226 0.0002  0.0156  0.0120  65  ILE B CB  
1611 C CG1 . ILE B 65  ? 0.4484 0.4553 0.3937 0.0062  0.0185  0.0199  65  ILE B CG1 
1612 C CG2 . ILE B 65  ? 0.4448 0.4666 0.4066 -0.0022 0.0145  0.0085  65  ILE B CG2 
1613 C CD1 . ILE B 65  ? 0.3988 0.3879 0.3401 0.0075  0.0179  0.0193  65  ILE B CD1 
1614 N N   . GLU B 66  ? 0.5450 0.6056 0.5151 -0.0087 0.0130  -0.0008 66  GLU B N   
1615 C CA  . GLU B 66  ? 0.5893 0.6593 0.5671 -0.0140 0.0110  -0.0107 66  GLU B CA  
1616 C C   . GLU B 66  ? 0.5802 0.6400 0.5648 -0.0177 0.0105  -0.0164 66  GLU B C   
1617 O O   . GLU B 66  ? 0.5766 0.6283 0.5610 -0.0161 0.0115  -0.0124 66  GLU B O   
1618 C CB  . GLU B 66  ? 0.6304 0.7268 0.6122 -0.0157 0.0110  -0.0139 66  GLU B CB  
1619 C CG  . GLU B 66  ? 0.7752 0.8854 0.7515 -0.0104 0.0133  -0.0045 66  GLU B CG  
1620 C CD  . GLU B 66  ? 0.9704 1.0976 0.9453 -0.0079 0.0138  -0.0028 66  GLU B CD  
1621 O OE1 . GLU B 66  ? 1.0133 1.1384 0.9902 -0.0101 0.0120  -0.0084 66  GLU B OE1 
1622 O OE2 . GLU B 66  ? 1.0334 1.1772 1.0054 -0.0030 0.0166  0.0051  66  GLU B OE2 
1623 N N   . ALA B 67  ? 0.5957 0.6568 0.5869 -0.0219 0.0096  -0.0253 67  ALA B N   
1624 C CA  . ALA B 67  ? 0.6121 0.6619 0.6112 -0.0249 0.0107  -0.0305 67  ALA B CA  
1625 C C   . ALA B 67  ? 0.6411 0.6955 0.6481 -0.0279 0.0122  -0.0322 67  ALA B C   
1626 O O   . ALA B 67  ? 0.6285 0.6705 0.6408 -0.0280 0.0141  -0.0311 67  ALA B O   
1627 C CB  . ALA B 67  ? 0.6175 0.6686 0.6218 -0.0281 0.0105  -0.0396 67  ALA B CB  
1628 N N   . GLY B 68  ? 0.6655 0.7399 0.6738 -0.0302 0.0117  -0.0343 68  GLY B N   
1629 C CA  . GLY B 68  ? 0.6767 0.7593 0.6913 -0.0331 0.0128  -0.0343 68  GLY B CA  
1630 C C   . GLY B 68  ? 0.6587 0.7308 0.6686 -0.0278 0.0138  -0.0229 68  GLY B C   
1631 O O   . GLY B 68  ? 0.6753 0.7440 0.6923 -0.0296 0.0153  -0.0221 68  GLY B O   
1632 N N   . GLN B 69  ? 0.6210 0.6875 0.6193 -0.0212 0.0133  -0.0142 69  GLN B N   
1633 C CA  . GLN B 69  ? 0.5999 0.6567 0.5917 -0.0151 0.0144  -0.0038 69  GLN B CA  
1634 C C   . GLN B 69  ? 0.5820 0.6174 0.5732 -0.0124 0.0149  -0.0017 69  GLN B C   
1635 O O   . GLN B 69  ? 0.5756 0.6028 0.5612 -0.0070 0.0156  0.0059  69  GLN B O   
1636 C CB  . GLN B 69  ? 0.5952 0.6552 0.5753 -0.0092 0.0149  0.0037  69  GLN B CB  
1637 C CG  . GLN B 69  ? 0.6190 0.7031 0.5984 -0.0090 0.0156  0.0058  69  GLN B CG  
1638 C CD  . GLN B 69  ? 0.6405 0.7299 0.6117 -0.0044 0.0168  0.0106  69  GLN B CD  
1639 O OE1 . GLN B 69  ? 0.6801 0.7920 0.6521 -0.0042 0.0174  0.0112  69  GLN B OE1 
1640 N NE2 . GLN B 69  ? 0.5813 0.6517 0.5457 -0.0010 0.0174  0.0139  69  GLN B NE2 
1641 N N   . LEU B 70  ? 0.5662 0.5945 0.5632 -0.0156 0.0147  -0.0083 70  LEU B N   
1642 C CA  . LEU B 70  ? 0.5366 0.5486 0.5332 -0.0127 0.0154  -0.0063 70  LEU B CA  
1643 C C   . LEU B 70  ? 0.5479 0.5553 0.5570 -0.0157 0.0177  -0.0106 70  LEU B C   
1644 O O   . LEU B 70  ? 0.6168 0.6308 0.6346 -0.0214 0.0185  -0.0182 70  LEU B O   
1645 C CB  . LEU B 70  ? 0.5194 0.5270 0.5106 -0.0126 0.0138  -0.0091 70  LEU B CB  
1646 C CG  . LEU B 70  ? 0.4846 0.4903 0.4641 -0.0095 0.0124  -0.0048 70  LEU B CG  
1647 C CD1 . LEU B 70  ? 0.4586 0.4629 0.4373 -0.0115 0.0111  -0.0092 70  LEU B CD1 
1648 C CD2 . LEU B 70  ? 0.5006 0.4946 0.4741 -0.0045 0.0129  0.0011  70  LEU B CD2 
1649 N N   . THR B 71  ? 0.5342 0.5305 0.5442 -0.0114 0.0194  -0.0058 71  THR B N   
1650 C CA  . THR B 71  ? 0.5334 0.5233 0.5545 -0.0124 0.0228  -0.0083 71  THR B CA  
1651 C C   . THR B 71  ? 0.5130 0.4946 0.5291 -0.0071 0.0230  -0.0045 71  THR B C   
1652 O O   . THR B 71  ? 0.4933 0.4722 0.5028 -0.0016 0.0224  0.0022  71  THR B O   
1653 C CB  . THR B 71  ? 0.5567 0.5456 0.5892 -0.0122 0.0265  -0.0045 71  THR B CB  
1654 O OG1 . THR B 71  ? 0.5926 0.5899 0.6337 -0.0195 0.0272  -0.0112 71  THR B OG1 
1655 C CG2 . THR B 71  ? 0.5528 0.5327 0.5952 -0.0101 0.0314  -0.0033 71  THR B CG2 
1656 N N   . ILE B 72  ? 0.5112 0.4906 0.5303 -0.0086 0.0241  -0.0093 72  ILE B N   
1657 C CA  . ILE B 72  ? 0.5094 0.4841 0.5249 -0.0039 0.0247  -0.0057 72  ILE B CA  
1658 C C   . ILE B 72  ? 0.5284 0.4989 0.5534 0.0010  0.0300  0.0003  72  ILE B C   
1659 O O   . ILE B 72  ? 0.5577 0.5254 0.5954 -0.0007 0.0349  -0.0013 72  ILE B O   
1660 C CB  . ILE B 72  ? 0.5196 0.4950 0.5354 -0.0064 0.0245  -0.0116 72  ILE B CB  
1661 C CG1 . ILE B 72  ? 0.5001 0.4815 0.5076 -0.0104 0.0198  -0.0163 72  ILE B CG1 
1662 C CG2 . ILE B 72  ? 0.5096 0.4832 0.5217 -0.0015 0.0253  -0.0074 72  ILE B CG2 
1663 C CD1 . ILE B 72  ? 0.4656 0.4473 0.4639 -0.0092 0.0170  -0.0154 72  ILE B CD1 
1664 N N   . ILE B 73  ? 0.5147 0.4854 0.5339 0.0073  0.0295  0.0074  73  ILE B N   
1665 C CA  . ILE B 73  ? 0.5363 0.5062 0.5641 0.0136  0.0348  0.0148  73  ILE B CA  
1666 C C   . ILE B 73  ? 0.5666 0.5367 0.5976 0.0163  0.0381  0.0154  73  ILE B C   
1667 O O   . ILE B 73  ? 0.5506 0.5248 0.5720 0.0184  0.0352  0.0157  73  ILE B O   
1668 C CB  . ILE B 73  ? 0.5196 0.4930 0.5394 0.0201  0.0328  0.0219  73  ILE B CB  
1669 C CG1 . ILE B 73  ? 0.4829 0.4562 0.4970 0.0180  0.0294  0.0216  73  ILE B CG1 
1670 C CG2 . ILE B 73  ? 0.5176 0.4932 0.5472 0.0276  0.0385  0.0311  73  ILE B CG2 
1671 C CD1 . ILE B 73  ? 0.4721 0.4450 0.4979 0.0144  0.0322  0.0214  73  ILE B CD1 
1672 N N   . GLU B 74  ? 0.6135 0.5793 0.6582 0.0161  0.0447  0.0153  74  GLU B N   
1673 C CA  . GLU B 74  ? 0.6518 0.6178 0.6996 0.0195  0.0490  0.0164  74  GLU B CA  
1674 C C   . GLU B 74  ? 0.6430 0.6160 0.6900 0.0291  0.0518  0.0268  74  GLU B C   
1675 O O   . GLU B 74  ? 0.6523 0.6275 0.7027 0.0339  0.0536  0.0340  74  GLU B O   
1676 C CB  . GLU B 74  ? 0.7329 0.6906 0.7960 0.0174  0.0568  0.0135  74  GLU B CB  
1677 C CG  . GLU B 74  ? 0.8457 0.7995 0.9099 0.0078  0.0544  0.0012  74  GLU B CG  
1678 C CD  . GLU B 74  ? 0.9360 0.8953 0.9862 0.0045  0.0469  -0.0049 74  GLU B CD  
1679 O OE1 . GLU B 74  ? 0.9423 0.9047 0.9873 0.0083  0.0469  -0.0027 74  GLU B OE1 
1680 O OE2 . GLU B 74  ? 0.9662 0.9284 1.0112 -0.0014 0.0415  -0.0112 74  GLU B OE2 
1681 N N   . GLY B 75  ? 0.6284 0.6072 0.6707 0.0321  0.0520  0.0279  75  GLY B N   
1682 C CA  . GLY B 75  ? 0.6244 0.6140 0.6665 0.0417  0.0553  0.0378  75  GLY B CA  
1683 C C   . GLY B 75  ? 0.5990 0.6000 0.6265 0.0430  0.0482  0.0378  75  GLY B C   
1684 O O   . GLY B 75  ? 0.6427 0.6565 0.6689 0.0506  0.0501  0.0449  75  GLY B O   
1685 N N   . PHE B 76  ? 0.5358 0.5330 0.5525 0.0356  0.0404  0.0299  76  PHE B N   
1686 C CA  . PHE B 76  ? 0.4886 0.4938 0.4918 0.0353  0.0341  0.0281  76  PHE B CA  
1687 C C   . PHE B 76  ? 0.4643 0.4676 0.4588 0.0274  0.0286  0.0199  76  PHE B C   
1688 O O   . PHE B 76  ? 0.4636 0.4581 0.4588 0.0213  0.0270  0.0144  76  PHE B O   
1689 C CB  . PHE B 76  ? 0.4728 0.4754 0.4706 0.0358  0.0309  0.0284  76  PHE B CB  
1690 C CG  . PHE B 76  ? 0.4454 0.4536 0.4296 0.0347  0.0251  0.0249  76  PHE B CG  
1691 C CD1 . PHE B 76  ? 0.4206 0.4421 0.4014 0.0414  0.0255  0.0290  76  PHE B CD1 
1692 C CD2 . PHE B 76  ? 0.3850 0.3859 0.3602 0.0269  0.0198  0.0172  76  PHE B CD2 
1693 C CE1 . PHE B 76  ? 0.4582 0.4842 0.4265 0.0392  0.0203  0.0236  76  PHE B CE1 
1694 C CE2 . PHE B 76  ? 0.3632 0.3668 0.3269 0.0250  0.0155  0.0132  76  PHE B CE2 
1695 C CZ  . PHE B 76  ? 0.4125 0.4279 0.3725 0.0304  0.0155  0.0154  76  PHE B CZ  
1696 N N   . LYS B 77  ? 0.4518 0.4654 0.4387 0.0277  0.0260  0.0193  77  LYS B N   
1697 C CA  . LYS B 77  ? 0.4336 0.4471 0.4127 0.0205  0.0209  0.0127  77  LYS B CA  
1698 C C   . LYS B 77  ? 0.4357 0.4614 0.4059 0.0210  0.0175  0.0122  77  LYS B C   
1699 O O   . LYS B 77  ? 0.4408 0.4789 0.4123 0.0276  0.0200  0.0175  77  LYS B O   
1700 C CB  . LYS B 77  ? 0.4384 0.4540 0.4228 0.0199  0.0236  0.0127  77  LYS B CB  
1701 C CG  . LYS B 77  ? 0.4459 0.4655 0.4232 0.0138  0.0189  0.0079  77  LYS B CG  
1702 C CD  . LYS B 77  ? 0.5143 0.5405 0.4960 0.0161  0.0223  0.0103  77  LYS B CD  
1703 C CE  . LYS B 77  ? 0.5590 0.5755 0.5511 0.0185  0.0282  0.0109  77  LYS B CE  
1704 N NZ  . LYS B 77  ? 0.6320 0.6518 0.6266 0.0191  0.0308  0.0107  77  LYS B NZ  
1705 N N   . ARG B 78  ? 0.4264 0.4495 0.3880 0.0140  0.0123  0.0059  78  ARG B N   
1706 C CA  . ARG B 78  ? 0.4634 0.4975 0.4172 0.0129  0.0092  0.0036  78  ARG B CA  
1707 C C   . ARG B 78  ? 0.4745 0.5081 0.4226 0.0039  0.0049  -0.0025 78  ARG B C   
1708 O O   . ARG B 78  ? 0.4664 0.4874 0.4114 -0.0016 0.0027  -0.0067 78  ARG B O   
1709 C CB  . ARG B 78  ? 0.4788 0.5082 0.4272 0.0146  0.0079  0.0022  78  ARG B CB  
1710 C CG  . ARG B 78  ? 0.5582 0.5950 0.4975 0.0113  0.0043  -0.0034 78  ARG B CG  
1711 C CD  . ARG B 78  ? 0.6506 0.7076 0.5899 0.0181  0.0056  -0.0001 78  ARG B CD  
1712 N NE  . ARG B 78  ? 0.7444 0.8076 0.6742 0.0139  0.0017  -0.0079 78  ARG B NE  
1713 C CZ  . ARG B 78  ? 0.7809 0.8636 0.7080 0.0118  0.0000  -0.0109 78  ARG B CZ  
1714 N NH1 . ARG B 78  ? 0.7972 0.8959 0.7297 0.0147  0.0019  -0.0051 78  ARG B NH1 
1715 N NH2 . ARG B 78  ? 0.8027 0.8892 0.7215 0.0067  -0.0033 -0.0199 78  ARG B NH2 
1716 N N   . GLU B 79  ? 0.4801 0.4740 0.4751 0.0547  0.0252  -0.0098 79  GLU B N   
1717 C CA  . GLU B 79  ? 0.5108 0.5133 0.5085 0.0487  0.0188  -0.0122 79  GLU B CA  
1718 C C   . GLU B 79  ? 0.5402 0.5452 0.5356 0.0512  0.0108  -0.0130 79  GLU B C   
1719 O O   . GLU B 79  ? 0.5869 0.5936 0.5790 0.0597  0.0100  -0.0129 79  GLU B O   
1720 C CB  . GLU B 79  ? 0.5194 0.5293 0.5194 0.0505  0.0211  -0.0130 79  GLU B CB  
1721 C CG  . GLU B 79  ? 0.5649 0.5855 0.5688 0.0449  0.0152  -0.0145 79  GLU B CG  
1722 C CD  . GLU B 79  ? 0.6593 0.6885 0.6655 0.0468  0.0186  -0.0150 79  GLU B CD  
1723 O OE1 . GLU B 79  ? 0.6867 0.7127 0.6929 0.0474  0.0252  -0.0152 79  GLU B OE1 
1724 O OE2 . GLU B 79  ? 0.7106 0.7498 0.7187 0.0479  0.0143  -0.0153 79  GLU B OE2 
1725 N N   . LEU B 80  ? 0.5580 0.5630 0.5549 0.0441  0.0047  -0.0140 80  LEU B N   
1726 C CA  . LEU B 80  ? 0.5929 0.5992 0.5886 0.0448  -0.0038 -0.0157 80  LEU B CA  
1727 C C   . LEU B 80  ? 0.6468 0.6628 0.6487 0.0388  -0.0088 -0.0170 80  LEU B C   
1728 O O   . LEU B 80  ? 0.6272 0.6464 0.6340 0.0303  -0.0082 -0.0162 80  LEU B O   
1729 C CB  . LEU B 80  ? 0.5709 0.5705 0.5654 0.0402  -0.0076 -0.0155 80  LEU B CB  
1730 C CG  . LEU B 80  ? 0.5157 0.5069 0.5037 0.0465  -0.0070 -0.0146 80  LEU B CG  
1731 C CD1 . LEU B 80  ? 0.5120 0.4997 0.4995 0.0476  0.0017  -0.0119 80  LEU B CD1 
1732 C CD2 . LEU B 80  ? 0.4630 0.4500 0.4508 0.0408  -0.0123 -0.0151 80  LEU B CD2 
1733 N N   . ASN B 81  ? 0.7311 0.7525 0.7329 0.0433  -0.0139 -0.0189 81  ASN B N   
1734 C CA  . ASN B 81  ? 0.8127 0.8442 0.8215 0.0374  -0.0199 -0.0201 81  ASN B CA  
1735 C C   . ASN B 81  ? 0.8771 0.9065 0.8864 0.0359  -0.0298 -0.0229 81  ASN B C   
1736 O O   . ASN B 81  ? 0.9052 0.9337 0.9099 0.0441  -0.0332 -0.0255 81  ASN B O   
1737 C CB  . ASN B 81  ? 0.8271 0.8688 0.8367 0.0435  -0.0180 -0.0206 81  ASN B CB  
1738 C CG  . ASN B 81  ? 0.8449 0.8921 0.8573 0.0416  -0.0107 -0.0185 81  ASN B CG  
1739 O OD1 . ASN B 81  ? 0.9004 0.9548 0.9192 0.0334  -0.0117 -0.0175 81  ASN B OD1 
1740 N ND2 . ASN B 81  ? 0.8761 0.9199 0.8838 0.0494  -0.0031 -0.0175 81  ASN B ND2 
1741 N N   . TYR B 82  ? 0.9596 0.9882 0.9746 0.0259  -0.0346 -0.0223 82  TYR B N   
1742 C CA  . TYR B 82  ? 1.0382 1.0621 1.0540 0.0240  -0.0443 -0.0252 82  TYR B CA  
1743 C C   . TYR B 82  ? 1.1066 1.1347 1.1324 0.0124  -0.0498 -0.0240 82  TYR B C   
1744 O O   . TYR B 82  ? 1.1045 1.1410 1.1367 0.0059  -0.0460 -0.0204 82  TYR B O   
1745 C CB  . TYR B 82  ? 1.0167 1.0270 1.0247 0.0273  -0.0448 -0.0257 82  TYR B CB  
1746 C CG  . TYR B 82  ? 0.9874 0.9926 0.9958 0.0210  -0.0401 -0.0220 82  TYR B CG  
1747 C CD1 . TYR B 82  ? 1.0031 1.0073 1.0175 0.0111  -0.0440 -0.0204 82  TYR B CD1 
1748 C CD2 . TYR B 82  ? 0.9632 0.9651 0.9664 0.0250  -0.0319 -0.0200 82  TYR B CD2 
1749 C CE1 . TYR B 82  ? 0.9658 0.9668 0.9801 0.0060  -0.0398 -0.0170 82  TYR B CE1 
1750 C CE2 . TYR B 82  ? 0.9098 0.9083 0.9136 0.0192  -0.0281 -0.0173 82  TYR B CE2 
1751 C CZ  . TYR B 82  ? 0.9139 0.9126 0.9227 0.0102  -0.0321 -0.0159 82  TYR B CZ  
1752 O OH  . TYR B 82  ? 0.8899 0.8868 0.8989 0.0053  -0.0285 -0.0132 82  TYR B OH  
1753 N N   . VAL B 83  ? 1.2035 1.2256 1.2308 0.0102  -0.0590 -0.0269 83  VAL B N   
1754 C CA  . VAL B 83  ? 1.2915 1.3163 1.3295 -0.0006 -0.0656 -0.0258 83  VAL B CA  
1755 C C   . VAL B 83  ? 1.3168 1.3278 1.3529 -0.0047 -0.0687 -0.0249 83  VAL B C   
1756 O O   . VAL B 83  ? 1.3157 1.3157 1.3448 0.0009  -0.0734 -0.0290 83  VAL B O   
1757 C CB  . VAL B 83  ? 1.3544 1.3834 1.3971 0.0000  -0.0752 -0.0308 83  VAL B CB  
1758 C CG1 . VAL B 83  ? 1.4552 1.4903 1.5118 -0.0124 -0.0805 -0.0283 83  VAL B CG1 
1759 C CG2 . VAL B 83  ? 1.3477 1.3889 1.3885 0.0082  -0.0725 -0.0330 83  VAL B CG2 
1760 N N   . ALA B 84  ? 1.3615 1.3738 1.4033 -0.0136 -0.0660 -0.0195 84  ALA B N   
1761 C CA  . ALA B 84  ? 1.4048 1.4047 1.4439 -0.0166 -0.0674 -0.0177 84  ALA B CA  
1762 C C   . ALA B 84  ? 1.4882 1.4878 1.5377 -0.0277 -0.0719 -0.0137 84  ALA B C   
1763 O O   . ALA B 84  ? 1.4804 1.4892 1.5364 -0.0344 -0.0674 -0.0079 84  ALA B O   
1764 C CB  . ALA B 84  ? 1.3488 1.3481 1.3818 -0.0147 -0.0583 -0.0144 84  ALA B CB  
1765 N N   . ARG B 85  ? 1.5915 1.5798 1.6420 -0.0290 -0.0809 -0.0167 85  ARG B N   
1766 C CA  . ARG B 85  ? 1.7084 1.6939 1.7696 -0.0396 -0.0860 -0.0128 85  ARG B CA  
1767 C C   . ARG B 85  ? 1.7530 1.7534 1.8273 -0.0462 -0.0882 -0.0114 85  ARG B C   
1768 O O   . ARG B 85  ? 1.7983 1.8042 1.8841 -0.0560 -0.0889 -0.0054 85  ARG B O   
1769 C CB  . ARG B 85  ? 0.7172 0.7030 0.7789 -0.0444 -0.0796 -0.0051 85  ARG B CB  
1770 C CG  . ARG B 85  ? 0.7544 0.7303 0.8222 -0.0520 -0.0846 -0.0011 85  ARG B CG  
1771 C CD  . ARG B 85  ? 0.7314 0.7098 0.7981 -0.0550 -0.0773 0.0064  85  ARG B CD  
1772 N NE  . ARG B 85  ? 0.6792 0.6651 0.7373 -0.0487 -0.0686 0.0057  85  ARG B NE  
1773 C CZ  . ARG B 85  ? 0.6593 0.6594 0.7205 -0.0514 -0.0612 0.0105  85  ARG B CZ  
1774 N NH1 . ARG B 85  ? 0.6858 0.6956 0.7580 -0.0598 -0.0609 0.0172  85  ARG B NH1 
1775 N NH2 . ARG B 85  ? 0.6167 0.6213 0.6702 -0.0456 -0.0542 0.0086  85  ARG B NH2 
1776 N N   . ASN B 86  ? 1.7448 1.7527 1.8169 -0.0399 -0.0889 -0.0167 86  ASN B N   
1777 C CA  . ASN B 86  ? 1.7857 1.8093 1.8686 -0.0439 -0.0912 -0.0167 86  ASN B CA  
1778 C C   . ASN B 86  ? 1.7145 1.7559 1.8011 -0.0451 -0.0824 -0.0113 86  ASN B C   
1779 O O   . ASN B 86  ? 1.7567 1.8128 1.8519 -0.0476 -0.0836 -0.0108 86  ASN B O   
1780 C CB  . ASN B 86  ? 1.9171 1.9390 2.0136 -0.0541 -0.1004 -0.0160 86  ASN B CB  
1781 C CG  . ASN B 86  ? 2.0342 2.0527 2.1311 -0.0506 -0.1103 -0.0250 86  ASN B CG  
1782 O OD1 . ASN B 86  ? 2.0913 2.1216 2.1873 -0.0452 -0.1102 -0.0288 86  ASN B OD1 
1783 N ND2 . ASN B 86  ? 2.1439 2.1463 2.2412 -0.0526 -0.1190 -0.0289 86  ASN B ND2 
1784 N N   . LYS B 87  ? 1.5992 1.6395 1.6787 -0.0428 -0.0737 -0.0077 87  LYS B N   
1785 C CA  . LYS B 87  ? 1.4774 1.5328 1.5574 -0.0415 -0.0650 -0.0042 87  LYS B CA  
1786 C C   . LYS B 87  ? 1.3439 1.3973 1.4119 -0.0300 -0.0597 -0.0089 87  LYS B C   
1787 O O   . LYS B 87  ? 1.3093 1.3492 1.3676 -0.0239 -0.0604 -0.0125 87  LYS B O   
1788 C CB  . LYS B 87  ? 1.4600 1.5173 1.5412 -0.0467 -0.0588 0.0024  87  LYS B CB  
1789 N N   . PRO B 88  ? 1.2768 1.3441 1.3458 -0.0268 -0.0545 -0.0084 88  PRO B N   
1790 C CA  . PRO B 88  ? 1.1848 1.2506 1.2436 -0.0160 -0.0488 -0.0118 88  PRO B CA  
1791 C C   . PRO B 88  ? 1.0820 1.1438 1.1342 -0.0142 -0.0399 -0.0097 88  PRO B C   
1792 O O   . PRO B 88  ? 1.0701 1.1401 1.1265 -0.0192 -0.0356 -0.0056 88  PRO B O   
1793 C CB  . PRO B 88  ? 1.2093 1.2919 1.2733 -0.0141 -0.0475 -0.0116 88  PRO B CB  
1794 C CG  . PRO B 88  ? 1.2674 1.3621 1.3427 -0.0240 -0.0478 -0.0061 88  PRO B CG  
1795 C CD  . PRO B 88  ? 1.3112 1.3965 1.3913 -0.0326 -0.0539 -0.0043 88  PRO B CD  
1796 N N   . LYS B 89  ? 0.9875 1.0401 1.0303 -0.0059 -0.0373 -0.0128 89  LYS B N   
1797 C CA  . LYS B 89  ? 0.8859 0.9329 0.9238 -0.0060 -0.0305 -0.0111 89  LYS B CA  
1798 C C   . LYS B 89  ? 0.8168 0.8609 0.8471 0.0027  -0.0231 -0.0129 89  LYS B C   
1799 O O   . LYS B 89  ? 0.8402 0.8814 0.8659 0.0107  -0.0235 -0.0154 89  LYS B O   
1800 C CB  . LYS B 89  ? 0.5271 0.5609 0.5615 -0.0080 -0.0339 -0.0111 89  LYS B CB  
1801 C CG  . LYS B 89  ? 0.4973 0.5264 0.5274 -0.0088 -0.0276 -0.0094 89  LYS B CG  
1802 C CD  . LYS B 89  ? 0.4994 0.5381 0.5358 -0.0166 -0.0250 -0.0054 89  LYS B CD  
1803 C CE  . LYS B 89  ? 0.4730 0.5083 0.5052 -0.0172 -0.0194 -0.0045 89  LYS B CE  
1804 N NZ  . LYS B 89  ? 0.4680 0.4921 0.4965 -0.0180 -0.0226 -0.0041 89  LYS B NZ  
1805 N N   . THR B 90  ? 0.7128 0.7573 0.7411 0.0031  -0.0158 -0.0119 90  THR B N   
1806 C CA  . THR B 90  ? 0.6418 0.6823 0.6643 0.0105  -0.0089 -0.0133 90  THR B CA  
1807 C C   . THR B 90  ? 0.5754 0.6073 0.5944 0.0089  -0.0047 -0.0130 90  THR B C   
1808 O O   . THR B 90  ? 0.5733 0.6088 0.5952 0.0025  -0.0035 -0.0117 90  THR B O   
1809 C CB  . THR B 90  ? 0.6549 0.7060 0.6800 0.0118  -0.0039 -0.0131 90  THR B CB  
1810 O OG1 . THR B 90  ? 0.6975 0.7542 0.7228 0.0178  -0.0056 -0.0140 90  THR B OG1 
1811 C CG2 . THR B 90  ? 0.6176 0.6632 0.6384 0.0157  0.0041  -0.0140 90  THR B CG2 
1812 N N   . VAL B 91  ? 0.5051 0.5271 0.5183 0.0149  -0.0023 -0.0138 91  VAL B N   
1813 C CA  . VAL B 91  ? 0.4379 0.4533 0.4489 0.0130  0.0015  -0.0134 91  VAL B CA  
1814 C C   . VAL B 91  ? 0.4115 0.4214 0.4192 0.0195  0.0086  -0.0140 91  VAL B C   
1815 O O   . VAL B 91  ? 0.4116 0.4180 0.4160 0.0269  0.0090  -0.0138 91  VAL B O   
1816 C CB  . VAL B 91  ? 0.4267 0.4347 0.4351 0.0116  -0.0032 -0.0127 91  VAL B CB  
1817 C CG1 . VAL B 91  ? 0.3638 0.3680 0.3711 0.0084  0.0002  -0.0120 91  VAL B CG1 
1818 C CG2 . VAL B 91  ? 0.4224 0.4343 0.4348 0.0054  -0.0103 -0.0119 91  VAL B CG2 
1819 N N   . ILE B 92  ? 0.3832 0.3923 0.3921 0.0168  0.0141  -0.0145 92  ILE B N   
1820 C CA  . ILE B 92  ? 0.3736 0.3758 0.3806 0.0221  0.0207  -0.0147 92  ILE B CA  
1821 C C   . ILE B 92  ? 0.3593 0.3550 0.3654 0.0199  0.0222  -0.0141 92  ILE B C   
1822 O O   . ILE B 92  ? 0.3678 0.3663 0.3759 0.0131  0.0211  -0.0148 92  ILE B O   
1823 C CB  . ILE B 92  ? 0.3829 0.3876 0.3922 0.0216  0.0262  -0.0166 92  ILE B CB  
1824 C CG1 . ILE B 92  ? 0.4058 0.4216 0.4176 0.0198  0.0238  -0.0174 92  ILE B CG1 
1825 C CG2 . ILE B 92  ? 0.3867 0.3850 0.3941 0.0297  0.0317  -0.0160 92  ILE B CG2 
1826 C CD1 . ILE B 92  ? 0.4551 0.4736 0.4656 0.0268  0.0228  -0.0165 92  ILE B CD1 
1827 N N   . TYR B 93  ? 0.3513 0.3397 0.3548 0.0260  0.0253  -0.0123 93  TYR B N   
1828 C CA  . TYR B 93  ? 0.3325 0.3156 0.3358 0.0245  0.0273  -0.0111 93  TYR B CA  
1829 C C   . TYR B 93  ? 0.3338 0.3109 0.3388 0.0277  0.0349  -0.0102 93  TYR B C   
1830 O O   . TYR B 93  ? 0.3472 0.3215 0.3510 0.0348  0.0381  -0.0086 93  TYR B O   
1831 C CB  . TYR B 93  ? 0.3352 0.3153 0.3338 0.0290  0.0233  -0.0087 93  TYR B CB  
1832 C CG  . TYR B 93  ? 0.3171 0.2998 0.3145 0.0249  0.0160  -0.0093 93  TYR B CG  
1833 C CD1 . TYR B 93  ? 0.3198 0.3034 0.3184 0.0185  0.0150  -0.0093 93  TYR B CD1 
1834 C CD2 . TYR B 93  ? 0.3455 0.3295 0.3405 0.0279  0.0100  -0.0099 93  TYR B CD2 
1835 C CE1 . TYR B 93  ? 0.2909 0.2756 0.2882 0.0152  0.0085  -0.0091 93  TYR B CE1 
1836 C CE2 . TYR B 93  ? 0.3242 0.3089 0.3187 0.0239  0.0031  -0.0103 93  TYR B CE2 
1837 C CZ  . TYR B 93  ? 0.3376 0.3221 0.3331 0.0179  0.0027  -0.0096 93  TYR B CZ  
1838 O OH  . TYR B 93  ? 0.3898 0.3740 0.3849 0.0145  -0.0037 -0.0095 93  TYR B OH  
1839 N N   . TRP B 94  ? 0.3136 0.2889 0.3219 0.0225  0.0377  -0.0108 94  TRP B N   
1840 C CA  . TRP B 94  ? 0.3206 0.2892 0.3321 0.0240  0.0444  -0.0094 94  TRP B CA  
1841 C C   . TRP B 94  ? 0.3144 0.2817 0.3256 0.0236  0.0440  -0.0062 94  TRP B C   
1842 O O   . TRP B 94  ? 0.3119 0.2830 0.3203 0.0214  0.0387  -0.0063 94  TRP B O   
1843 C CB  . TRP B 94  ? 0.3127 0.2816 0.3295 0.0172  0.0473  -0.0138 94  TRP B CB  
1844 C CG  . TRP B 94  ? 0.3449 0.3127 0.3626 0.0192  0.0502  -0.0164 94  TRP B CG  
1845 C CD1 . TRP B 94  ? 0.3675 0.3274 0.3880 0.0224  0.0565  -0.0162 94  TRP B CD1 
1846 C CD2 . TRP B 94  ? 0.3900 0.3649 0.4063 0.0181  0.0472  -0.0195 94  TRP B CD2 
1847 N NE1 . TRP B 94  ? 0.4026 0.3639 0.4225 0.0241  0.0574  -0.0194 94  TRP B NE1 
1848 C CE2 . TRP B 94  ? 0.3992 0.3706 0.4166 0.0216  0.0518  -0.0213 94  TRP B CE2 
1849 C CE3 . TRP B 94  ? 0.3884 0.3726 0.4030 0.0147  0.0412  -0.0203 94  TRP B CE3 
1850 C CZ2 . TRP B 94  ? 0.4118 0.3899 0.4282 0.0222  0.0507  -0.0241 94  TRP B CZ2 
1851 C CZ3 . TRP B 94  ? 0.3984 0.3895 0.4130 0.0147  0.0402  -0.0224 94  TRP B CZ3 
1852 C CH2 . TRP B 94  ? 0.3946 0.3832 0.4098 0.0186  0.0449  -0.0244 94  TRP B CH2 
1853 N N   . LEU B 95  ? 0.3250 0.2870 0.3391 0.0260  0.0497  -0.0029 95  LEU B N   
1854 C CA  . LEU B 95  ? 0.3308 0.2932 0.3450 0.0261  0.0497  0.0006  95  LEU B CA  
1855 C C   . LEU B 95  ? 0.3456 0.3089 0.3667 0.0177  0.0520  -0.0016 95  LEU B C   
1856 O O   . LEU B 95  ? 0.3991 0.3585 0.4259 0.0148  0.0565  -0.0037 95  LEU B O   
1857 C CB  . LEU B 95  ? 0.3564 0.3141 0.3707 0.0339  0.0551  0.0067  95  LEU B CB  
1858 C CG  . LEU B 95  ? 0.3817 0.3402 0.3885 0.0439  0.0527  0.0107  95  LEU B CG  
1859 C CD1 . LEU B 95  ? 0.4394 0.3932 0.4481 0.0510  0.0599  0.0162  95  LEU B CD1 
1860 C CD2 . LEU B 95  ? 0.3901 0.3518 0.3937 0.0447  0.0495  0.0130  95  LEU B CD2 
1861 N N   . ALA B 96  ? 0.3222 0.2905 0.3428 0.0141  0.0488  -0.0013 96  ALA B N   
1862 C CA  . ALA B 96  ? 0.3379 0.3090 0.3652 0.0063  0.0505  -0.0037 96  ALA B CA  
1863 C C   . ALA B 96  ? 0.3532 0.3273 0.3807 0.0071  0.0506  0.0008  96  ALA B C   
1864 O O   . ALA B 96  ? 0.3493 0.3253 0.3701 0.0122  0.0470  0.0038  96  ALA B O   
1865 C CB  . ALA B 96  ? 0.3059 0.2832 0.3329 -0.0005 0.0462  -0.0097 96  ALA B CB  
1866 N N   . GLU B 97  ? 0.3875 0.3625 0.4232 0.0024  0.0546  0.0012  97  GLU B N   
1867 C CA  . GLU B 97  ? 0.4145 0.3939 0.4521 0.0029  0.0556  0.0060  97  GLU B CA  
1868 C C   . GLU B 97  ? 0.4114 0.3990 0.4521 -0.0052 0.0527  0.0016  97  GLU B C   
1869 O O   . GLU B 97  ? 0.4151 0.4033 0.4605 -0.0118 0.0527  -0.0044 97  GLU B O   
1870 C CB  . GLU B 97  ? 0.4476 0.4228 0.4940 0.0032  0.0627  0.0105  97  GLU B CB  
1871 C CG  . GLU B 97  ? 0.5155 0.4961 0.5647 0.0049  0.0648  0.0172  97  GLU B CG  
1872 C CD  . GLU B 97  ? 0.6165 0.5932 0.6765 0.0040  0.0723  0.0222  97  GLU B CD  
1873 O OE1 . GLU B 97  ? 0.6394 0.6217 0.7038 0.0049  0.0750  0.0285  97  GLU B OE1 
1874 O OE2 . GLU B 97  ? 0.6703 0.6385 0.7347 0.0026  0.0757  0.0201  97  GLU B OE2 
1875 N N   . VAL B 98  ? 0.4116 0.4060 0.4489 -0.0039 0.0499  0.0045  98  VAL B N   
1876 C CA  . VAL B 98  ? 0.4148 0.4185 0.4551 -0.0110 0.0475  0.0010  98  VAL B CA  
1877 C C   . VAL B 98  ? 0.4692 0.4772 0.5199 -0.0153 0.0517  0.0027  98  VAL B C   
1878 O O   . VAL B 98  ? 0.5255 0.5331 0.5781 -0.0110 0.0551  0.0093  98  VAL B O   
1879 C CB  . VAL B 98  ? 0.3895 0.3991 0.4215 -0.0078 0.0424  0.0030  98  VAL B CB  
1880 C CG1 . VAL B 98  ? 0.3143 0.3216 0.3389 -0.0071 0.0375  -0.0001 98  VAL B CG1 
1881 C CG2 . VAL B 98  ? 0.3879 0.3960 0.4152 0.0008  0.0433  0.0103  98  VAL B CG2 
1882 N N   . LYS B 99  ? 0.5025 0.5157 0.5602 -0.0238 0.0513  -0.0033 99  LYS B N   
1883 C CA  . LYS B 99  ? 0.5643 0.5824 0.6336 -0.0296 0.0546  -0.0031 99  LYS B CA  
1884 C C   . LYS B 99  ? 0.5836 0.6118 0.6526 -0.0274 0.0542  0.0029  99  LYS B C   
1885 O O   . LYS B 99  ? 0.6164 0.6468 0.6937 -0.0282 0.0583  0.0078  99  LYS B O   
1886 C CB  . LYS B 99  ? 0.5831 0.6070 0.6578 -0.0384 0.0523  -0.0124 99  LYS B CB  
1887 C CG  . LYS B 99  ? 0.6636 0.6895 0.7520 -0.0459 0.0553  -0.0149 99  LYS B CG  
1888 C CD  . LYS B 99  ? 0.7581 0.7906 0.8498 -0.0534 0.0519  -0.0253 99  LYS B CD  
1889 N N   . ASP B 100 ? 0.5770 0.6113 0.6364 -0.0244 0.0493  0.0030  100 ASP B N   
1890 C CA  . ASP B 100 ? 0.5902 0.6351 0.6479 -0.0220 0.0481  0.0077  100 ASP B CA  
1891 C C   . ASP B 100 ? 0.5678 0.6098 0.6124 -0.0123 0.0452  0.0125  100 ASP B C   
1892 O O   . ASP B 100 ? 0.5319 0.5691 0.5681 -0.0103 0.0411  0.0098  100 ASP B O   
1893 C CB  . ASP B 100 ? 0.6065 0.6636 0.6661 -0.0286 0.0445  0.0021  100 ASP B CB  
1894 C CG  . ASP B 100 ? 0.6940 0.7557 0.7671 -0.0381 0.0467  -0.0031 100 ASP B CG  
1895 O OD1 . ASP B 100 ? 0.7977 0.8637 0.8723 -0.0438 0.0441  -0.0109 100 ASP B OD1 
1896 O OD2 . ASP B 100 ? 0.7971 0.8584 0.8798 -0.0398 0.0511  0.0004  100 ASP B OD2 
1897 N N   . TYR B 101 ? 0.5924 0.6378 0.6360 -0.0062 0.0472  0.0198  101 TYR B N   
1898 C CA  . TYR B 101 ? 0.5635 0.6063 0.5950 0.0041  0.0446  0.0245  101 TYR B CA  
1899 C C   . TYR B 101 ? 0.5432 0.5898 0.5662 0.0044  0.0385  0.0216  101 TYR B C   
1900 O O   . TYR B 101 ? 0.5539 0.5939 0.5662 0.0110  0.0346  0.0222  101 TYR B O   
1901 C CB  . TYR B 101 ? 0.5861 0.6362 0.6199 0.0095  0.0481  0.0323  101 TYR B CB  
1902 C CG  . TYR B 101 ? 0.5839 0.6321 0.6053 0.0216  0.0459  0.0373  101 TYR B CG  
1903 C CD1 . TYR B 101 ? 0.5741 0.6139 0.5909 0.0299  0.0476  0.0408  101 TYR B CD1 
1904 C CD2 . TYR B 101 ? 0.6031 0.6586 0.6174 0.0254  0.0421  0.0385  101 TYR B CD2 
1905 C CE1 . TYR B 101 ? 0.5940 0.6323 0.5993 0.0415  0.0452  0.0444  101 TYR B CE1 
1906 C CE2 . TYR B 101 ? 0.6473 0.7002 0.6500 0.0371  0.0399  0.0425  101 TYR B CE2 
1907 C CZ  . TYR B 101 ? 0.6448 0.6891 0.6431 0.0450  0.0412  0.0450  101 TYR B CZ  
1908 O OH  . TYR B 101 ? 0.6779 0.7198 0.6642 0.0572  0.0384  0.0478  101 TYR B OH  
1909 N N   . ASP B 102 ? 0.5325 0.5897 0.5606 -0.0025 0.0376  0.0185  102 ASP B N   
1910 C CA  . ASP B 102 ? 0.5178 0.5806 0.5385 -0.0015 0.0327  0.0174  102 ASP B CA  
1911 C C   . ASP B 102 ? 0.4785 0.5412 0.4997 -0.0082 0.0300  0.0109  102 ASP B C   
1912 O O   . ASP B 102 ? 0.4883 0.5596 0.5072 -0.0100 0.0272  0.0094  102 ASP B O   
1913 C CB  . ASP B 102 ? 0.5778 0.6556 0.6023 -0.0024 0.0335  0.0200  102 ASP B CB  
1914 C CG  . ASP B 102 ? 0.6517 0.7395 0.6890 -0.0127 0.0356  0.0154  102 ASP B CG  
1915 O OD1 . ASP B 102 ? 0.7531 0.8546 0.7947 -0.0142 0.0361  0.0169  102 ASP B OD1 
1916 O OD2 . ASP B 102 ? 0.6708 0.7534 0.7138 -0.0190 0.0366  0.0100  102 ASP B OD2 
1917 N N   . VAL B 103 ? 0.4364 0.4905 0.4602 -0.0112 0.0311  0.0072  103 VAL B N   
1918 C CA  . VAL B 103 ? 0.3911 0.4458 0.4158 -0.0172 0.0291  0.0010  103 VAL B CA  
1919 C C   . VAL B 103 ? 0.3849 0.4397 0.4001 -0.0140 0.0242  0.0021  103 VAL B C   
1920 O O   . VAL B 103 ? 0.3731 0.4211 0.3806 -0.0071 0.0223  0.0063  103 VAL B O   
1921 C CB  . VAL B 103 ? 0.3722 0.4160 0.3992 -0.0184 0.0310  -0.0018 103 VAL B CB  
1922 C CG1 . VAL B 103 ? 0.3201 0.3526 0.3409 -0.0105 0.0311  0.0027  103 VAL B CG1 
1923 C CG2 . VAL B 103 ? 0.3118 0.3561 0.3373 -0.0223 0.0284  -0.0070 103 VAL B CG2 
1924 N N   . GLU B 104 ? 0.3902 0.4527 0.4057 -0.0187 0.0222  -0.0014 104 GLU B N   
1925 C CA  . GLU B 104 ? 0.4168 0.4795 0.4243 -0.0161 0.0180  0.0004  104 GLU B CA  
1926 C C   . GLU B 104 ? 0.4053 0.4583 0.4097 -0.0160 0.0161  -0.0005 104 GLU B C   
1927 O O   . GLU B 104 ? 0.4150 0.4689 0.4235 -0.0206 0.0172  -0.0049 104 GLU B O   
1928 C CB  . GLU B 104 ? 0.4314 0.5085 0.4401 -0.0200 0.0168  -0.0016 104 GLU B CB  
1929 C CG  . GLU B 104 ? 0.5260 0.6036 0.5262 -0.0160 0.0130  0.0024  104 GLU B CG  
1930 C CD  . GLU B 104 ? 0.6206 0.7100 0.6210 -0.0197 0.0117  0.0004  104 GLU B CD  
1931 O OE1 . GLU B 104 ? 0.6336 0.7203 0.6284 -0.0178 0.0091  0.0035  104 GLU B OE1 
1932 O OE2 . GLU B 104 ? 0.6634 0.7652 0.6698 -0.0242 0.0132  -0.0041 104 GLU B OE2 
1933 N N   . ILE B 105 ? 0.4020 0.4460 0.3990 -0.0104 0.0131  0.0033  105 ILE B N   
1934 C CA  . ILE B 105 ? 0.3855 0.4208 0.3797 -0.0101 0.0105  0.0031  105 ILE B CA  
1935 C C   . ILE B 105 ? 0.4174 0.4568 0.4087 -0.0119 0.0071  0.0044  105 ILE B C   
1936 O O   . ILE B 105 ? 0.4353 0.4752 0.4215 -0.0086 0.0048  0.0080  105 ILE B O   
1937 C CB  . ILE B 105 ? 0.3755 0.3989 0.3634 -0.0029 0.0080  0.0063  105 ILE B CB  
1938 C CG1 . ILE B 105 ? 0.3347 0.3547 0.3244 0.0007  0.0116  0.0067  105 ILE B CG1 
1939 C CG2 . ILE B 105 ? 0.3282 0.3436 0.3142 -0.0032 0.0046  0.0058  105 ILE B CG2 
1940 C CD1 . ILE B 105 ? 0.2481 0.2665 0.2442 -0.0028 0.0152  0.0034  105 ILE B CD1 
1941 N N   . ARG B 106 ? 0.4325 0.4750 0.4268 -0.0166 0.0071  0.0021  106 ARG B N   
1942 C CA  . ARG B 106 ? 0.4722 0.5191 0.4642 -0.0179 0.0045  0.0046  106 ARG B CA  
1943 C C   . ARG B 106 ? 0.4894 0.5282 0.4808 -0.0183 0.0018  0.0061  106 ARG B C   
1944 O O   . ARG B 106 ? 0.4998 0.5403 0.4951 -0.0215 0.0031  0.0034  106 ARG B O   
1945 C CB  . ARG B 106 ? 0.4854 0.5468 0.4814 -0.0227 0.0064  0.0016  106 ARG B CB  
1946 C CG  . ARG B 106 ? 0.5073 0.5784 0.5058 -0.0236 0.0087  -0.0010 106 ARG B CG  
1947 C CD  . ARG B 106 ? 0.5497 0.6364 0.5497 -0.0267 0.0090  -0.0029 106 ARG B CD  
1948 N NE  . ARG B 106 ? 0.5850 0.6812 0.5899 -0.0292 0.0113  -0.0081 106 ARG B NE  
1949 C CZ  . ARG B 106 ? 0.6304 0.7418 0.6377 -0.0320 0.0116  -0.0120 106 ARG B CZ  
1950 N NH1 . ARG B 106 ? 0.6450 0.7647 0.6495 -0.0319 0.0103  -0.0106 106 ARG B NH1 
1951 N NH2 . ARG B 106 ? 0.6642 0.7830 0.6769 -0.0347 0.0132  -0.0173 106 ARG B NH2 
1952 N N   . LEU B 107 ? 0.5162 0.5463 0.5029 -0.0151 -0.0020 0.0102  107 LEU B N   
1953 C CA  . LEU B 107 ? 0.5458 0.5690 0.5332 -0.0164 -0.0050 0.0117  107 LEU B CA  
1954 C C   . LEU B 107 ? 0.5918 0.6234 0.5819 -0.0209 -0.0054 0.0144  107 LEU B C   
1955 O O   . LEU B 107 ? 0.6112 0.6509 0.6000 -0.0212 -0.0049 0.0170  107 LEU B O   
1956 C CB  . LEU B 107 ? 0.5465 0.5560 0.5287 -0.0115 -0.0096 0.0142  107 LEU B CB  
1957 C CG  . LEU B 107 ? 0.4871 0.4905 0.4655 -0.0055 -0.0090 0.0125  107 LEU B CG  
1958 C CD1 . LEU B 107 ? 0.4754 0.4671 0.4473 0.0000  -0.0139 0.0148  107 LEU B CD1 
1959 C CD2 . LEU B 107 ? 0.3969 0.3973 0.3781 -0.0051 -0.0070 0.0088  107 LEU B CD2 
1960 N N   . SER B 108 ? 0.6310 0.6620 0.6251 -0.0240 -0.0060 0.0142  108 SER B N   
1961 C CA  . SER B 108 ? 0.6820 0.7196 0.6791 -0.0278 -0.0068 0.0183  108 SER B CA  
1962 C C   . SER B 108 ? 0.7227 0.7483 0.7186 -0.0270 -0.0118 0.0230  108 SER B C   
1963 O O   . SER B 108 ? 0.7189 0.7321 0.7110 -0.0232 -0.0146 0.0219  108 SER B O   
1964 C CB  . SER B 108 ? 0.6794 0.7234 0.6819 -0.0312 -0.0049 0.0158  108 SER B CB  
1965 O OG  . SER B 108 ? 0.7056 0.7394 0.7094 -0.0307 -0.0072 0.0148  108 SER B OG  
1966 N N   . HIS B 109 ? 0.7663 0.7956 0.7657 -0.0305 -0.0130 0.0284  109 HIS B N   
1967 C CA  . HIS B 109 ? 0.8095 0.8269 0.8091 -0.0308 -0.0179 0.0333  109 HIS B CA  
1968 C C   . HIS B 109 ? 0.8184 0.8241 0.8197 -0.0307 -0.0217 0.0300  109 HIS B C   
1969 O O   . HIS B 109 ? 0.8510 0.8436 0.8513 -0.0296 -0.0267 0.0316  109 HIS B O   
1970 C CB  . HIS B 109 ? 0.8465 0.8718 0.8516 -0.0354 -0.0177 0.0404  109 HIS B CB  
1971 N N   . GLU B 110 ? 0.8054 0.8156 0.8090 -0.0312 -0.0194 0.0252  110 GLU B N   
1972 C CA  . GLU B 110 ? 0.8164 0.8176 0.8214 -0.0304 -0.0226 0.0218  110 GLU B CA  
1973 C C   . GLU B 110 ? 0.7883 0.7755 0.7867 -0.0242 -0.0259 0.0188  110 GLU B C   
1974 O O   . GLU B 110 ? 0.8115 0.7895 0.8104 -0.0231 -0.0305 0.0170  110 GLU B O   
1975 C CB  . GLU B 110 ? 0.8105 0.8198 0.8186 -0.0312 -0.0188 0.0176  110 GLU B CB  
1976 C CG  . GLU B 110 ? 0.9255 0.9469 0.9407 -0.0366 -0.0173 0.0205  110 GLU B CG  
1977 C CD  . GLU B 110 ? 0.9891 1.0156 1.0074 -0.0366 -0.0150 0.0163  110 GLU B CD  
1978 O OE1 . GLU B 110 ? 1.0094 1.0278 1.0267 -0.0338 -0.0170 0.0130  110 GLU B OE1 
1979 O OE2 . GLU B 110 ? 1.0027 1.0419 1.0240 -0.0387 -0.0111 0.0165  110 GLU B OE2 
1980 N N   . HIS B 111 ? 0.7409 0.7277 0.7333 -0.0198 -0.0237 0.0180  111 HIS B N   
1981 C CA  . HIS B 111 ? 0.7141 0.6900 0.6996 -0.0128 -0.0259 0.0154  111 HIS B CA  
1982 C C   . HIS B 111 ? 0.7242 0.6968 0.7037 -0.0091 -0.0268 0.0181  111 HIS B C   
1983 O O   . HIS B 111 ? 0.7222 0.7039 0.7020 -0.0110 -0.0236 0.0208  111 HIS B O   
1984 C CB  . HIS B 111 ? 0.6646 0.6440 0.6488 -0.0095 -0.0216 0.0112  111 HIS B CB  
1985 C CG  . HIS B 111 ? 0.6146 0.5984 0.6042 -0.0124 -0.0197 0.0086  111 HIS B CG  
1986 N ND1 . HIS B 111 ? 0.5769 0.5542 0.5672 -0.0107 -0.0231 0.0065  111 HIS B ND1 
1987 C CD2 . HIS B 111 ? 0.5858 0.5805 0.5802 -0.0166 -0.0150 0.0077  111 HIS B CD2 
1988 C CE1 . HIS B 111 ? 0.5780 0.5623 0.5733 -0.0135 -0.0203 0.0049  111 HIS B CE1 
1989 N NE2 . HIS B 111 ? 0.5853 0.5796 0.5830 -0.0170 -0.0153 0.0055  111 HIS B NE2 
1990 N N   . GLN B 112 ? 0.7371 0.6971 0.7105 -0.0031 -0.0313 0.0172  112 GLN B N   
1991 C CA  . GLN B 112 ? 0.7545 0.7099 0.7216 0.0012  -0.0328 0.0201  112 GLN B CA  
1992 C C   . GLN B 112 ? 0.7132 0.6698 0.6735 0.0087  -0.0304 0.0185  112 GLN B C   
1993 O O   . GLN B 112 ? 0.7284 0.6876 0.6845 0.0115  -0.0293 0.0213  112 GLN B O   
1994 C CB  . GLN B 112 ? 0.8363 0.7763 0.8012 0.0029  -0.0400 0.0208  112 GLN B CB  
1995 C CG  . GLN B 112 ? 0.9048 0.8362 0.8713 0.0035  -0.0445 0.0162  112 GLN B CG  
1996 C CD  . GLN B 112 ? 1.0138 0.9285 0.9763 0.0073  -0.0523 0.0152  112 GLN B CD  
1997 O OE1 . GLN B 112 ? 1.0482 0.9559 1.0021 0.0150  -0.0539 0.0147  112 GLN B OE1 
1998 N NE2 . GLN B 112 ? 1.0930 1.0015 1.0618 0.0021  -0.0573 0.0145  112 GLN B NE2 
1999 N N   . ALA B 113 ? 0.6603 0.6162 0.6199 0.0120  -0.0292 0.0147  113 ALA B N   
2000 C CA  . ALA B 113 ? 0.6080 0.5662 0.5624 0.0191  -0.0263 0.0140  113 ALA B CA  
2001 C C   . ALA B 113 ? 0.5576 0.5204 0.5155 0.0191  -0.0222 0.0111  113 ALA B C   
2002 O O   . ALA B 113 ? 0.5431 0.5048 0.5054 0.0155  -0.0227 0.0090  113 ALA B O   
2003 C CB  . ALA B 113 ? 0.6361 0.5822 0.5817 0.0282  -0.0314 0.0134  113 ALA B CB  
2004 N N   . TYR B 114 ? 0.5130 0.4809 0.4689 0.0234  -0.0180 0.0116  114 TYR B N   
2005 C CA  . TYR B 114 ? 0.4564 0.4272 0.4151 0.0247  -0.0138 0.0098  114 TYR B CA  
2006 C C   . TYR B 114 ? 0.4631 0.4318 0.4155 0.0345  -0.0132 0.0109  114 TYR B C   
2007 O O   . TYR B 114 ? 0.4905 0.4586 0.4373 0.0390  -0.0148 0.0131  114 TYR B O   
2008 C CB  . TYR B 114 ? 0.4168 0.3990 0.3831 0.0177  -0.0077 0.0097  114 TYR B CB  
2009 C CG  . TYR B 114 ? 0.3992 0.3897 0.3655 0.0188  -0.0038 0.0118  114 TYR B CG  
2010 C CD1 . TYR B 114 ? 0.3538 0.3520 0.3210 0.0149  -0.0037 0.0132  114 TYR B CD1 
2011 C CD2 . TYR B 114 ? 0.3894 0.3816 0.3556 0.0238  0.0000  0.0127  114 TYR B CD2 
2012 C CE1 . TYR B 114 ? 0.3494 0.3568 0.3174 0.0157  -0.0004 0.0148  114 TYR B CE1 
2013 C CE2 . TYR B 114 ? 0.3910 0.3923 0.3587 0.0241  0.0034  0.0150  114 TYR B CE2 
2014 C CZ  . TYR B 114 ? 0.3935 0.4026 0.3622 0.0199  0.0029  0.0156  114 TYR B CZ  
2015 O OH  . TYR B 114 ? 0.4436 0.4633 0.4143 0.0198  0.0061  0.0175  114 TYR B OH  
2016 N N   . ARG B 115 ? 0.4445 0.4122 0.3972 0.0385  -0.0109 0.0099  115 ARG B N   
2017 C CA  A ARG B 115 ? 0.4534 0.4206 0.4006 0.0485  -0.0095 0.0117  115 ARG B CA  
2018 C CA  B ARG B 115 ? 0.4487 0.4162 0.3960 0.0484  -0.0094 0.0117  115 ARG B CA  
2019 C C   . ARG B 115 ? 0.4306 0.4036 0.3836 0.0479  -0.0027 0.0127  115 ARG B C   
2020 O O   . ARG B 115 ? 0.4046 0.3768 0.3627 0.0429  -0.0018 0.0104  115 ARG B O   
2021 C CB  A ARG B 115 ? 0.4780 0.4351 0.4175 0.0571  -0.0154 0.0093  115 ARG B CB  
2022 C CB  B ARG B 115 ? 0.4718 0.4291 0.4109 0.0574  -0.0154 0.0095  115 ARG B CB  
2023 C CG  A ARG B 115 ? 0.5204 0.4695 0.4522 0.0612  -0.0225 0.0084  115 ARG B CG  
2024 C CG  B ARG B 115 ? 0.4913 0.4402 0.4240 0.0593  -0.0228 0.0083  115 ARG B CG  
2025 C CD  A ARG B 115 ? 0.5537 0.5045 0.4775 0.0715  -0.0218 0.0112  115 ARG B CD  
2026 C CD  B ARG B 115 ? 0.4794 0.4309 0.4062 0.0651  -0.0222 0.0116  115 ARG B CD  
2027 N NE  A ARG B 115 ? 0.5924 0.5326 0.5069 0.0782  -0.0293 0.0093  115 ARG B NE  
2028 N NE  B ARG B 115 ? 0.4760 0.4173 0.3957 0.0684  -0.0294 0.0105  115 ARG B NE  
2029 C CZ  A ARG B 115 ? 0.6304 0.5654 0.5355 0.0904  -0.0327 0.0078  115 ARG B CZ  
2030 C CZ  B ARG B 115 ? 0.4472 0.3859 0.3695 0.0612  -0.0318 0.0110  115 ARG B CZ  
2031 N NH1 A ARG B 115 ? 0.6005 0.5411 0.5041 0.0978  -0.0289 0.0089  115 ARG B NH1 
2032 N NH1 B ARG B 115 ? 0.4194 0.3662 0.3505 0.0508  -0.0277 0.0123  115 ARG B NH1 
2033 N NH2 A ARG B 115 ? 0.6814 0.6055 0.5785 0.0958  -0.0400 0.0053  115 ARG B NH2 
2034 N NH2 B ARG B 115 ? 0.4582 0.3862 0.3743 0.0646  -0.0381 0.0103  115 ARG B NH2 
2035 N N   . TRP B 116 ? 0.4335 0.4119 0.3859 0.0532  0.0018  0.0163  116 TRP B N   
2036 C CA  . TRP B 116 ? 0.4193 0.4016 0.3774 0.0538  0.0084  0.0182  116 TRP B CA  
2037 C C   . TRP B 116 ? 0.4507 0.4296 0.4015 0.0660  0.0078  0.0199  116 TRP B C   
2038 O O   . TRP B 116 ? 0.4722 0.4523 0.4162 0.0740  0.0063  0.0224  116 TRP B O   
2039 C CB  . TRP B 116 ? 0.4021 0.3943 0.3661 0.0512  0.0144  0.0221  116 TRP B CB  
2040 C CG  . TRP B 116 ? 0.3972 0.3947 0.3703 0.0396  0.0170  0.0201  116 TRP B CG  
2041 C CD1 . TRP B 116 ? 0.4069 0.4109 0.3816 0.0342  0.0160  0.0198  116 TRP B CD1 
2042 C CD2 . TRP B 116 ? 0.3842 0.3818 0.3659 0.0327  0.0210  0.0179  116 TRP B CD2 
2043 N NE1 . TRP B 116 ? 0.3799 0.3887 0.3635 0.0244  0.0188  0.0170  116 TRP B NE1 
2044 C CE2 . TRP B 116 ? 0.3673 0.3716 0.3552 0.0232  0.0218  0.0156  116 TRP B CE2 
2045 C CE3 . TRP B 116 ? 0.3636 0.3564 0.3477 0.0342  0.0239  0.0175  116 TRP B CE3 
2046 C CZ2 . TRP B 116 ? 0.3655 0.3712 0.3618 0.0154  0.0251  0.0124  116 TRP B CZ2 
2047 C CZ3 . TRP B 116 ? 0.3847 0.3783 0.3772 0.0264  0.0275  0.0149  116 TRP B CZ3 
2048 C CH2 . TRP B 116 ? 0.3636 0.3633 0.3621 0.0170  0.0279  0.0120  116 TRP B CH2 
2049 N N   . LEU B 117 ? 0.4528 0.4285 0.4046 0.0683  0.0091  0.0189  117 LEU B N   
2050 C CA  . LEU B 117 ? 0.4879 0.4609 0.4318 0.0809  0.0075  0.0199  117 LEU B CA  
2051 C C   . LEU B 117 ? 0.5109 0.4865 0.4577 0.0858  0.0139  0.0233  117 LEU B C   
2052 O O   . LEU B 117 ? 0.5089 0.4844 0.4633 0.0793  0.0178  0.0227  117 LEU B O   
2053 C CB  . LEU B 117 ? 0.4867 0.4513 0.4245 0.0830  -0.0006 0.0142  117 LEU B CB  
2054 C CG  . LEU B 117 ? 0.4973 0.4570 0.4324 0.0784  -0.0077 0.0109  117 LEU B CG  
2055 C CD1 . LEU B 117 ? 0.4958 0.4474 0.4274 0.0797  -0.0152 0.0055  117 LEU B CD1 
2056 C CD2 . LEU B 117 ? 0.5128 0.4725 0.4400 0.0859  -0.0098 0.0129  117 LEU B CD2 
2057 N N   . GLY B 118 ? 0.5509 0.5289 0.4911 0.0981  0.0151  0.0271  118 GLY B N   
2058 C CA  . GLY B 118 ? 0.5661 0.5464 0.5070 0.1057  0.0204  0.0310  118 GLY B CA  
2059 C C   . GLY B 118 ? 0.5746 0.5490 0.5117 0.1083  0.0157  0.0257  118 GLY B C   
2060 O O   . GLY B 118 ? 0.5709 0.5398 0.5032 0.1070  0.0075  0.0196  118 GLY B O   
2061 N N   . LEU B 119 ? 0.5917 0.5674 0.5314 0.1121  0.0207  0.0282  119 LEU B N   
2062 C CA  . LEU B 119 ? 0.6068 0.5786 0.5448 0.1132  0.0171  0.0233  119 LEU B CA  
2063 C C   . LEU B 119 ? 0.6658 0.6345 0.5932 0.1216  0.0075  0.0176  119 LEU B C   
2064 O O   . LEU B 119 ? 0.6848 0.6493 0.6125 0.1167  0.0014  0.0114  119 LEU B O   
2065 C CB  . LEU B 119 ? 0.6013 0.5757 0.5427 0.1181  0.0245  0.0279  119 LEU B CB  
2066 C CG  . LEU B 119 ? 0.5836 0.5563 0.5231 0.1212  0.0218  0.0238  119 LEU B CG  
2067 C CD1 . LEU B 119 ? 0.5084 0.4776 0.4548 0.1083  0.0199  0.0186  119 LEU B CD1 
2068 C CD2 . LEU B 119 ? 0.5653 0.5412 0.5066 0.1289  0.0300  0.0301  119 LEU B CD2 
2069 N N   . GLU B 120 ? 0.7241 0.6950 0.6424 0.1340  0.0059  0.0194  120 GLU B N   
2070 C CA  . GLU B 120 ? 0.8032 0.7704 0.7114 0.1424  -0.0036 0.0129  120 GLU B CA  
2071 C C   . GLU B 120 ? 0.7789 0.7388 0.6858 0.1348  -0.0121 0.0068  120 GLU B C   
2072 O O   . GLU B 120 ? 0.8062 0.7608 0.7111 0.1335  -0.0200 0.0000  120 GLU B O   
2073 C CB  . GLU B 120 ? 0.8708 0.8426 0.7688 0.1584  -0.0033 0.0162  120 GLU B CB  
2074 C CG  . GLU B 120 ? 1.0188 0.9888 0.9063 0.1701  -0.0115 0.0098  120 GLU B CG  
2075 C CD  . GLU B 120 ? 1.2625 1.2376 1.1393 0.1863  -0.0113 0.0128  120 GLU B CD  
2076 O OE1 . GLU B 120 ? 1.3184 1.2997 1.1975 0.1878  -0.0033 0.0213  120 GLU B OE1 
2077 O OE2 . GLU B 120 ? 1.4365 1.4101 1.3028 0.1975  -0.0191 0.0067  120 GLU B OE2 
2078 N N   . GLU B 121 ? 0.7431 0.7030 0.6515 0.1300  -0.0104 0.0096  121 GLU B N   
2079 C CA  . GLU B 121 ? 0.7418 0.6947 0.6487 0.1237  -0.0176 0.0050  121 GLU B CA  
2080 C C   . GLU B 121 ? 0.6994 0.6494 0.6156 0.1095  -0.0188 0.0020  121 GLU B C   
2081 O O   . GLU B 121 ? 0.7010 0.6443 0.6163 0.1053  -0.0265 -0.0031 121 GLU B O   
2082 C CB  . GLU B 121 ? 0.7435 0.6990 0.6495 0.1231  -0.0149 0.0095  121 GLU B CB  
2083 C CG  . GLU B 121 ? 0.8322 0.7920 0.7287 0.1381  -0.0139 0.0128  121 GLU B CG  
2085 O OE1 . GLU B 121 ? 1.0320 1.0031 0.9373 0.1410  -0.0004 0.0211  121 GLU B OE1 
2086 O OE2 . GLU B 121 ? 1.1530 1.1297 1.0503 0.1501  0.0000  0.0264  121 GLU B OE2 
2087 N N   . ALA B 122 ? 0.6577 0.6127 0.5828 0.1024  -0.0113 0.0053  122 ALA B N   
2088 C CA  . ALA B 122 ? 0.6216 0.5756 0.5552 0.0902  -0.0114 0.0027  122 ALA B CA  
2089 C C   . ALA B 122 ? 0.6338 0.5850 0.5666 0.0915  -0.0172 -0.0024 122 ALA B C   
2090 O O   . ALA B 122 ? 0.6256 0.5738 0.5619 0.0834  -0.0220 -0.0060 122 ALA B O   
2091 C CB  . ALA B 122 ? 0.5970 0.5564 0.5390 0.0851  -0.0022 0.0068  122 ALA B CB  
2092 N N   . CYS B 123 ? 0.6566 0.6100 0.5852 0.1018  -0.0164 -0.0024 123 CYS B N   
2093 C CA  . CYS B 123 ? 0.6891 0.6412 0.6158 0.1048  -0.0226 -0.0078 123 CYS B CA  
2094 C C   . CYS B 123 ? 0.7407 0.6861 0.6618 0.1067  -0.0334 -0.0138 123 CYS B C   
2095 O O   . CYS B 123 ? 0.7394 0.6823 0.6638 0.1010  -0.0397 -0.0187 123 CYS B O   
2096 C CB  . CYS B 123 ? 0.7063 0.6634 0.6284 0.1175  -0.0193 -0.0061 123 CYS B CB  
2097 S SG  . CYS B 123 ? 0.6545 0.6174 0.5841 0.1155  -0.0068 0.0010  123 CYS B SG  
2098 N N   . GLN B 124 ? 0.7961 0.7387 0.7089 0.1147  -0.0355 -0.0133 124 GLN B N   
2099 C CA  . GLN B 124 ? 0.8703 0.8043 0.7769 0.1171  -0.0459 -0.0193 124 GLN B CA  
2100 C C   . GLN B 124 ? 0.8659 0.7938 0.7793 0.1034  -0.0499 -0.0210 124 GLN B C   
2101 O O   . GLN B 124 ? 0.9170 0.8387 0.8311 0.1005  -0.0585 -0.0266 124 GLN B O   
2102 C CB  . GLN B 124 ? 0.9444 0.8768 0.8408 0.1282  -0.0463 -0.0176 124 GLN B CB  
2103 C CG  . GLN B 124 ? 1.0533 0.9871 0.9385 0.1451  -0.0500 -0.0207 124 GLN B CG  
2104 C CD  . GLN B 124 ? 1.1873 1.1131 1.0680 0.1479  -0.0623 -0.0304 124 GLN B CD  
2105 O OE1 . GLN B 124 ? 1.2311 1.1474 1.1143 0.1396  -0.0689 -0.0343 124 GLN B OE1 
2106 N NE2 . GLN B 124 ? 1.2280 1.1576 1.1023 0.1599  -0.0653 -0.0343 124 GLN B NE2 
2107 N N   . LEU B 125 ? 0.8302 0.7605 0.7490 0.0950  -0.0436 -0.0158 125 LEU B N   
2108 C CA  . LEU B 125 ? 0.8243 0.7508 0.7495 0.0825  -0.0460 -0.0159 125 LEU B CA  
2109 C C   . LEU B 125 ? 0.8206 0.7495 0.7554 0.0721  -0.0465 -0.0174 125 LEU B C   
2110 O O   . LEU B 125 ? 0.8338 0.7581 0.7725 0.0650  -0.0525 -0.0198 125 LEU B O   
2111 C CB  . LEU B 125 ? 0.7861 0.7168 0.7139 0.0777  -0.0389 -0.0102 125 LEU B CB  
2112 C CG  . LEU B 125 ? 0.7994 0.7252 0.7227 0.0781  -0.0415 -0.0089 125 LEU B CG  
2113 C CD1 . LEU B 125 ? 0.7515 0.6834 0.6816 0.0686  -0.0352 -0.0044 125 LEU B CD1 
2114 C CD2 . LEU B 125 ? 0.8582 0.7735 0.7803 0.0755  -0.0509 -0.0132 125 LEU B CD2 
2115 N N   . ALA B 126 ? 0.8211 0.7578 0.7602 0.0714  -0.0399 -0.0155 126 ALA B N   
2116 C CA  . ALA B 126 ? 0.8162 0.7569 0.7641 0.0625  -0.0394 -0.0165 126 ALA B CA  
2117 C C   . ALA B 126 ? 0.8890 0.8268 0.8368 0.0638  -0.0482 -0.0221 126 ALA B C   
2118 O O   . ALA B 126 ? 0.8985 0.8368 0.8535 0.0548  -0.0516 -0.0233 126 ALA B O   
2119 C CB  . ALA B 126 ? 0.7821 0.7303 0.7330 0.0639  -0.0310 -0.0139 126 ALA B CB  
2120 N N   . GLN B 127 ? 1.0133 0.9391 0.9904 0.0544  -0.1297 0.0372  127 GLN B N   
2121 C CA  . GLN B 127 ? 1.0632 0.9873 1.0197 0.0606  -0.1358 0.0372  127 GLN B CA  
2122 C C   . GLN B 127 ? 1.0235 0.9555 0.9627 0.0575  -0.1213 0.0435  127 GLN B C   
2123 O O   . GLN B 127 ? 1.0344 0.9690 0.9673 0.0699  -0.1113 0.0446  127 GLN B O   
2124 C CB  . GLN B 127 ? 1.1240 1.0331 1.0715 0.0505  -0.1688 0.0373  127 GLN B CB  
2125 C CG  . GLN B 127 ? 1.2253 1.1260 1.1950 0.0624  -0.1853 0.0285  127 GLN B CG  
2126 C CD  . GLN B 127 ? 1.3080 1.2105 1.2738 0.0838  -0.1708 0.0214  127 GLN B CD  
2127 O OE1 . GLN B 127 ? 1.3536 1.2511 1.2905 0.0860  -0.1740 0.0256  127 GLN B OE1 
2128 N NE2 . GLN B 127 ? 1.3435 1.2504 1.3371 0.0971  -0.1545 0.0108  127 GLN B NE2 
2129 N N   . PHE B 128 ? 0.9843 0.9170 0.9171 0.0389  -0.1208 0.0472  128 PHE B N   
2130 C CA  . PHE B 128 ? 0.9293 0.8711 0.8585 0.0358  -0.1064 0.0509  128 PHE B CA  
2131 C C   . PHE B 128 ? 0.8657 0.8184 0.8084 0.0500  -0.0842 0.0519  128 PHE B C   
2132 O O   . PHE B 128 ? 0.8441 0.8004 0.7966 0.0537  -0.0728 0.0497  128 PHE B O   
2133 C CB  . PHE B 128 ? 0.9296 0.8703 0.8544 0.0116  -0.1008 0.0501  128 PHE B CB  
2134 C CG  . PHE B 128 ? 0.9688 0.9208 0.9020 0.0078  -0.0837 0.0506  128 PHE B CG  
2135 C CD1 . PHE B 128 ? 1.0446 1.0035 0.9875 0.0236  -0.0835 0.0554  128 PHE B CD1 
2136 C CD2 . PHE B 128 ? 0.9949 0.9475 0.9285 -0.0133 -0.0682 0.0459  128 PHE B CD2 
2137 C CE1 . PHE B 128 ? 1.0698 1.0388 1.0327 0.0203  -0.0710 0.0564  128 PHE B CE1 
2139 C CZ  . PHE B 128 ? 1.0920 1.0666 1.0650 0.0019  -0.0532 0.0493  128 PHE B CZ  
2140 N N   . LYS B 129 ? 0.8406 0.7962 0.7840 0.0558  -0.0812 0.0567  129 LYS B N   
2141 C CA  . LYS B 129 ? 0.8081 0.7687 0.7618 0.0654  -0.0667 0.0595  129 LYS B CA  
2142 C C   . LYS B 129 ? 0.7492 0.7216 0.7231 0.0599  -0.0479 0.0579  129 LYS B C   
2143 O O   . LYS B 129 ? 0.7244 0.7001 0.7030 0.0665  -0.0374 0.0577  129 LYS B O   
2144 C CB  . LYS B 129 ? 0.8416 0.7963 0.7939 0.0685  -0.0750 0.0677  129 LYS B CB  
2145 C CG  . LYS B 129 ? 0.9165 0.8747 0.8772 0.0581  -0.0824 0.0705  129 LYS B CG  
2147 C CE  . LYS B 129 ? 1.2949 1.2574 1.2903 0.0504  -0.0908 0.0823  129 LYS B CE  
2148 N NZ  . LYS B 129 ? 1.3374 1.2837 1.3269 0.0563  -0.1106 0.0962  129 LYS B NZ  
2149 N N   . GLU B 130 ? 0.7183 0.6955 0.7019 0.0464  -0.0424 0.0556  130 GLU B N   
2150 C CA  . GLU B 130 ? 0.7001 0.6851 0.7009 0.0395  -0.0227 0.0518  130 GLU B CA  
2151 C C   . GLU B 130 ? 0.6582 0.6391 0.6484 0.0363  -0.0175 0.0497  130 GLU B C   
2152 O O   . GLU B 130 ? 0.6315 0.6171 0.6314 0.0389  -0.0040 0.0497  130 GLU B O   
2153 C CB  . GLU B 130 ? 0.7543 0.7416 0.7635 0.0216  -0.0141 0.0462  130 GLU B CB  
2154 C CG  . GLU B 130 ? 0.9078 0.9009 0.9370 0.0237  -0.0186 0.0488  130 GLU B CG  
2155 C CD  . GLU B 130 ? 1.0730 1.0776 1.1449 0.0250  -0.0015 0.0457  130 GLU B CD  
2156 O OE1 . GLU B 130 ? 1.1621 1.1728 1.2534 0.0106  0.0138  0.0368  130 GLU B OE1 
2157 O OE2 . GLU B 130 ? 1.1170 1.1232 1.2046 0.0385  -0.0034 0.0511  130 GLU B OE2 
2158 N N   . MET B 131 ? 0.6464 0.6169 0.6191 0.0300  -0.0314 0.0492  131 MET B N   
2159 C CA  . MET B 131 ? 0.6207 0.5838 0.5889 0.0256  -0.0323 0.0495  131 MET B CA  
2160 C C   . MET B 131 ? 0.5920 0.5624 0.5703 0.0446  -0.0282 0.0512  131 MET B C   
2161 O O   . MET B 131 ? 0.5753 0.5480 0.5594 0.0450  -0.0180 0.0530  131 MET B O   
2162 C CB  . MET B 131 ? 0.6793 0.6272 0.6344 0.0150  -0.0552 0.0494  131 MET B CB  
2163 C CG  . MET B 131 ? 0.7337 0.6629 0.6741 -0.0112 -0.0600 0.0503  131 MET B CG  
2164 S SD  . MET B 131 ? 0.6722 0.5968 0.6170 -0.0154 -0.0447 0.0542  131 MET B SD  
2165 C CE  . MET B 131 ? 0.6644 0.5741 0.5845 -0.0468 -0.0299 0.0501  131 MET B CE  
2166 N N   . LYS B 132 ? 0.5860 0.5577 0.5630 0.0582  -0.0357 0.0502  132 LYS B N   
2167 C CA  . LYS B 132 ? 0.5849 0.5611 0.5669 0.0722  -0.0285 0.0489  132 LYS B CA  
2168 C C   . LYS B 132 ? 0.5359 0.5205 0.5214 0.0752  -0.0131 0.0522  132 LYS B C   
2169 O O   . LYS B 132 ? 0.5170 0.5064 0.5070 0.0790  -0.0037 0.0526  132 LYS B O   
2170 C CB  . LYS B 132 ? 0.6565 0.6272 0.6283 0.0823  -0.0355 0.0458  132 LYS B CB  
2171 C CG  . LYS B 132 ? 0.7678 0.7293 0.7371 0.0810  -0.0538 0.0421  132 LYS B CG  
2172 C CD  . LYS B 132 ? 0.8832 0.8356 0.8353 0.0887  -0.0606 0.0409  132 LYS B CD  
2173 C CE  . LYS B 132 ? 0.9581 0.9054 0.9114 0.0993  -0.0548 0.0313  132 LYS B CE  
2174 N NZ  . LYS B 132 ? 1.0487 0.9804 0.9757 0.1034  -0.0594 0.0306  132 LYS B NZ  
2175 N N   . ALA B 133 ? 0.5011 0.4869 0.4882 0.0726  -0.0127 0.0549  133 ALA B N   
2176 C CA  . ALA B 133 ? 0.4683 0.4596 0.4647 0.0746  -0.0039 0.0583  133 ALA B CA  
2177 C C   . ALA B 133 ? 0.4310 0.4278 0.4360 0.0694  0.0076  0.0580  133 ALA B C   
2178 O O   . ALA B 133 ? 0.4396 0.4403 0.4458 0.0735  0.0137  0.0604  133 ALA B O   
2179 C CB  . ALA B 133 ? 0.4785 0.4699 0.4879 0.0714  -0.0078 0.0605  133 ALA B CB  
2180 N N   . ALA B 134 ? 0.3982 0.3920 0.4042 0.0577  0.0101  0.0555  134 ALA B N   
2181 C CA  . ALA B 134 ? 0.3745 0.3666 0.3820 0.0488  0.0215  0.0557  134 ALA B CA  
2182 C C   . ALA B 134 ? 0.3685 0.3583 0.3695 0.0519  0.0199  0.0599  134 ALA B C   
2183 O O   . ALA B 134 ? 0.3564 0.3478 0.3591 0.0517  0.0281  0.0634  134 ALA B O   
2184 C CB  . ALA B 134 ? 0.3724 0.3539 0.3719 0.0297  0.0241  0.0515  134 ALA B CB  
2185 N N   . LEU B 135 ? 0.3795 0.3652 0.3770 0.0546  0.0084  0.0594  135 LEU B N   
2186 C CA  . LEU B 135 ? 0.3921 0.3764 0.3949 0.0572  0.0065  0.0626  135 LEU B CA  
2187 C C   . LEU B 135 ? 0.4124 0.4096 0.4197 0.0709  0.0158  0.0625  135 LEU B C   
2188 O O   . LEU B 135 ? 0.4351 0.4360 0.4470 0.0721  0.0216  0.0668  135 LEU B O   
2189 C CB  . LEU B 135 ? 0.4117 0.3889 0.4206 0.0574  -0.0089 0.0598  135 LEU B CB  
2190 C CG  . LEU B 135 ? 0.3994 0.3581 0.4003 0.0393  -0.0254 0.0611  135 LEU B CG  
2191 C CD1 . LEU B 135 ? 0.3987 0.3537 0.4088 0.0443  -0.0432 0.0564  135 LEU B CD1 
2192 C CD2 . LEU B 135 ? 0.3588 0.3030 0.3609 0.0258  -0.0299 0.0689  135 LEU B CD2 
2193 N N   . GLN B 136 ? 0.4231 0.4239 0.4250 0.0784  0.0158  0.0587  136 GLN B N   
2194 C CA  . GLN B 136 ? 0.4537 0.4600 0.4504 0.0852  0.0232  0.0584  136 GLN B CA  
2195 C C   . GLN B 136 ? 0.4445 0.4552 0.4412 0.0824  0.0288  0.0644  136 GLN B C   
2196 O O   . GLN B 136 ? 0.4674 0.4830 0.4609 0.0840  0.0347  0.0665  136 GLN B O   
2197 C CB  . GLN B 136 ? 0.4832 0.4833 0.4663 0.0883  0.0189  0.0552  136 GLN B CB  
2198 C CG  . GLN B 136 ? 0.5776 0.5727 0.5574 0.0930  0.0174  0.0473  136 GLN B CG  
2199 C CD  . GLN B 136 ? 0.7267 0.7096 0.6879 0.0934  0.0098  0.0463  136 GLN B CD  
2200 O OE1 . GLN B 136 ? 0.8172 0.7946 0.7686 0.0897  0.0058  0.0526  136 GLN B OE1 
2201 N NE2 . GLN B 136 ? 0.7852 0.7612 0.7435 0.0972  0.0053  0.0392  136 GLN B NE2 
2202 N N   . GLU B 137 ? 0.4274 0.4366 0.4301 0.0778  0.0274  0.0661  137 GLU B N   
2203 C CA  . GLU B 137 ? 0.4334 0.4460 0.4420 0.0761  0.0316  0.0701  137 GLU B CA  
2204 C C   . GLU B 137 ? 0.4340 0.4468 0.4421 0.0721  0.0383  0.0739  137 GLU B C   
2205 O O   . GLU B 137 ? 0.4319 0.4479 0.4389 0.0728  0.0409  0.0786  137 GLU B O   
2206 C CB  . GLU B 137 ? 0.4357 0.4477 0.4615 0.0736  0.0299  0.0687  137 GLU B CB  
2207 C CG  . GLU B 137 ? 0.4484 0.4578 0.4820 0.0688  0.0302  0.0636  137 GLU B CG  
2208 C CD  . GLU B 137 ? 0.4887 0.4976 0.5384 0.0707  0.0218  0.0635  137 GLU B CD  
2209 O OE1 . GLU B 137 ? 0.5054 0.5156 0.5724 0.0655  0.0254  0.0588  137 GLU B OE1 
2210 O OE2 . GLU B 137 ? 0.5387 0.5432 0.5825 0.0750  0.0111  0.0684  137 GLU B OE2 
2211 N N   . GLY B 138 ? 0.4417 0.4471 0.4475 0.0657  0.0377  0.0733  138 GLY B N   
2212 C CA  . GLY B 138 ? 0.4457 0.4431 0.4470 0.0579  0.0399  0.0795  138 GLY B CA  
2213 C C   . GLY B 138 ? 0.4600 0.4649 0.4633 0.0649  0.0399  0.0853  138 GLY B C   
2214 O O   . GLY B 138 ? 0.4511 0.4552 0.4507 0.0627  0.0430  0.0927  138 GLY B O   
2215 N N   . HIS B 139 ? 0.4828 0.4946 0.4922 0.0726  0.0378  0.0808  139 HIS B N   
2216 C CA  . HIS B 139 ? 0.5267 0.5473 0.5430 0.0780  0.0419  0.0824  139 HIS B CA  
2217 C C   . HIS B 139 ? 0.5419 0.5710 0.5460 0.0800  0.0480  0.0847  139 HIS B C   
2218 O O   . HIS B 139 ? 0.5500 0.5837 0.5537 0.0790  0.0510  0.0917  139 HIS B O   
2219 C CB  . HIS B 139 ? 0.5609 0.5852 0.5866 0.0846  0.0425  0.0721  139 HIS B CB  
2220 C CG  . HIS B 139 ? 0.6174 0.6509 0.6608 0.0889  0.0502  0.0696  139 HIS B CG  
2221 N ND1 . HIS B 139 ? 0.6982 0.7398 0.7344 0.0922  0.0630  0.0608  139 HIS B ND1 
2222 C CD2 . HIS B 139 ? 0.6307 0.6646 0.7014 0.0882  0.0471  0.0739  139 HIS B CD2 
2223 C CE1 . HIS B 139 ? 0.7248 0.7752 0.7858 0.0945  0.0717  0.0574  139 HIS B CE1 
2224 N NE2 . HIS B 139 ? 0.6888 0.7357 0.7754 0.0935  0.0607  0.0662  139 HIS B NE2 
2225 N N   . GLN B 140 ? 0.5578 0.5862 0.5518 0.0810  0.0464  0.0803  140 GLN B N   
2226 C CA  . GLN B 140 ? 0.5900 0.6199 0.5710 0.0790  0.0452  0.0831  140 GLN B CA  
2227 C C   . GLN B 140 ? 0.5637 0.5941 0.5471 0.0762  0.0434  0.0915  140 GLN B C   
2228 O O   . GLN B 140 ? 0.6015 0.6355 0.5755 0.0741  0.0425  0.0968  140 GLN B O   
2229 C CB  . GLN B 140 ? 0.6134 0.6359 0.5907 0.0780  0.0373  0.0800  140 GLN B CB  
2230 C CG  . GLN B 140 ? 0.7278 0.7454 0.6953 0.0726  0.0283  0.0845  140 GLN B CG  
2231 C CD  . GLN B 140 ? 0.8622 0.8670 0.8243 0.0693  0.0170  0.0831  140 GLN B CD  
2232 O OE1 . GLN B 140 ? 0.8862 0.8882 0.8540 0.0728  0.0170  0.0789  140 GLN B OE1 
2233 N NE2 . GLN B 140 ? 0.9773 0.9709 0.9269 0.0604  0.0041  0.0882  140 GLN B NE2 
2234 N N   . PHE B 141 ? 0.5280 0.5528 0.5211 0.0743  0.0435  0.0919  141 PHE B N   
2235 C CA  . PHE B 141 ? 0.5127 0.5341 0.5060 0.0706  0.0446  0.0981  141 PHE B CA  
2236 C C   . PHE B 141 ? 0.5245 0.5460 0.5100 0.0690  0.0463  0.1074  141 PHE B C   
2237 O O   . PHE B 141 ? 0.5319 0.5545 0.5103 0.0679  0.0444  0.1149  141 PHE B O   
2238 C CB  . PHE B 141 ? 0.4993 0.5105 0.4997 0.0647  0.0496  0.0940  141 PHE B CB  
2239 C CG  . PHE B 141 ? 0.4864 0.4879 0.4818 0.0581  0.0545  0.0989  141 PHE B CG  
2240 C CD1 . PHE B 141 ? 0.4776 0.4651 0.4581 0.0495  0.0563  0.1063  141 PHE B CD1 
2241 C CD2 . PHE B 141 ? 0.4930 0.4955 0.4996 0.0592  0.0554  0.0965  141 PHE B CD2 
2242 C CE1 . PHE B 141 ? 0.5357 0.5084 0.5043 0.0410  0.0608  0.1116  141 PHE B CE1 
2243 C CE2 . PHE B 141 ? 0.5405 0.5316 0.5411 0.0531  0.0614  0.0993  141 PHE B CE2 
2244 C CZ  . PHE B 141 ? 0.5590 0.5340 0.5363 0.0434  0.0652  0.1071  141 PHE B CZ  
2245 N N   . LEU B 142 ? 0.5342 0.5533 0.5245 0.0684  0.0471  0.1077  142 LEU B N   
2246 C CA  . LEU B 142 ? 0.5521 0.5706 0.5449 0.0666  0.0461  0.1177  142 LEU B CA  
2247 C C   . LEU B 142 ? 0.5878 0.6219 0.5794 0.0710  0.0493  0.1201  142 LEU B C   
2248 O O   . LEU B 142 ? 0.5926 0.6269 0.5791 0.0684  0.0476  0.1311  142 LEU B O   
2249 C CB  . LEU B 142 ? 0.5457 0.5569 0.5541 0.0644  0.0418  0.1172  142 LEU B CB  
2250 C CG  . LEU B 142 ? 0.5016 0.4895 0.5013 0.0519  0.0360  0.1198  142 LEU B CG  
2251 C CD1 . LEU B 142 ? 0.4592 0.4381 0.4737 0.0480  0.0260  0.1174  142 LEU B CD1 
2252 C CD2 . LEU B 142 ? 0.4856 0.4560 0.4709 0.0411  0.0334  0.1340  142 LEU B CD2 
2253 N N   . CYS B 143 ? 0.6316 0.6760 0.6238 0.0750  0.0544  0.1097  143 CYS B N   
2254 C CA  . CYS B 143 ? 0.7079 0.7634 0.6901 0.0735  0.0598  0.1094  143 CYS B CA  
2255 C C   . CYS B 143 ? 0.7267 0.7806 0.6869 0.0685  0.0521  0.1167  143 CYS B C   
2256 O O   . CYS B 143 ? 0.7844 0.8445 0.7346 0.0643  0.0524  0.1233  143 CYS B O   
2257 C CB  . CYS B 143 ? 0.7346 0.7932 0.7115 0.0737  0.0678  0.0952  143 CYS B CB  
2258 S SG  . CYS B 143 ? 0.8448 0.9041 0.8504 0.0806  0.0739  0.0846  143 CYS B SG  
2259 N N   . SER B 144 ? 0.7233 0.7688 0.6798 0.0683  0.0440  0.1152  144 SER B N   
2260 C CA  . SER B 144 ? 0.7628 0.8050 0.7078 0.0640  0.0329  0.1211  144 SER B CA  
2261 C C   . SER B 144 ? 0.7688 0.8095 0.7125 0.0635  0.0304  0.1329  144 SER B C   
2262 O O   . SER B 144 ? 0.8265 0.8697 0.7560 0.0591  0.0233  0.1405  144 SER B O   
2263 C CB  . SER B 144 ? 0.7527 0.7867 0.7083 0.0649  0.0247  0.1160  144 SER B CB  
2264 O OG  . SER B 144 ? 0.7556 0.7848 0.7259 0.0673  0.0270  0.1175  144 SER B OG  
2265 N N   . ILE B 145 ? 0.7538 0.7865 0.7072 0.0651  0.0347  0.1352  145 ILE B N   
2266 C CA  . ILE B 145 ? 0.7681 0.7925 0.7138 0.0620  0.0322  0.1475  145 ILE B CA  
2267 C C   . ILE B 145 ? 0.8044 0.8369 0.7433 0.0606  0.0314  0.1587  145 ILE B C   
2268 O O   . ILE B 145 ? 0.8195 0.8503 0.7450 0.0577  0.0245  0.1702  145 ILE B O   
2269 C CB  . ILE B 145 ? 0.7504 0.7576 0.6995 0.0581  0.0377  0.1482  145 ILE B CB  
2270 C CG1 . ILE B 145 ? 0.7359 0.7364 0.6934 0.0574  0.0420  0.1359  145 ILE B CG1 
2271 C CG2 . ILE B 145 ? 0.7664 0.7579 0.7004 0.0515  0.0346  0.1629  145 ILE B CG2 
2272 C CD1 . ILE B 145 ? 0.7349 0.7381 0.6976 0.0598  0.0366  0.1332  145 ILE B CD1 
2273 N N   . GLU B 146 ? 0.8359 0.8775 0.7876 0.0626  0.0386  0.1546  146 GLU B N   
2274 C CA  . GLU B 146 ? 0.9036 0.9549 0.8600 0.0611  0.0406  0.1634  146 GLU B CA  
2275 C C   . GLU B 146 ? 0.9838 1.0475 0.9204 0.0569  0.0393  0.1639  146 GLU B C   
2276 O O   . GLU B 146 ? 1.0212 1.0898 0.9520 0.0532  0.0365  0.1759  146 GLU B O   
2277 C CB  . GLU B 146 ? 0.9145 0.9740 0.8995 0.0646  0.0502  0.1555  146 GLU B CB  
2278 N N   . ALA B 147 ? 1.0197 1.0848 0.9436 0.0546  0.0386  0.1524  147 ALA B N   
2279 C CA  . ALA B 147 ? 1.0991 1.1676 0.9962 0.0447  0.0317  0.1536  147 ALA B CA  
2280 C C   . ALA B 147 ? 1.1552 1.2179 1.0391 0.0424  0.0152  0.1687  147 ALA B C   
2281 O O   . ALA B 147 ? 1.1591 1.2103 1.0471 0.0462  0.0055  0.1707  147 ALA B O   
2282 C CB  . ALA B 147 ? 1.0944 1.1548 0.9797 0.0402  0.0257  0.1428  147 ALA B CB  
2283 N N   . ARG C 4   ? 0.8511 0.8355 0.7773 0.0034  -0.0595 0.0623  4   ARG C N   
2284 C CA  . ARG C 4   ? 0.8381 0.8280 0.7726 0.0023  -0.0624 0.0494  4   ARG C CA  
2285 C C   . ARG C 4   ? 0.7684 0.7654 0.6972 -0.0009 -0.0594 0.0436  4   ARG C C   
2286 O O   . ARG C 4   ? 0.7984 0.8076 0.7198 -0.0015 -0.0596 0.0419  4   ARG C O   
2287 C CB  . ARG C 4   ? 0.8758 0.8772 0.8176 0.0040  -0.0684 0.0427  4   ARG C CB  
2288 C CG  . ARG C 4   ? 0.8954 0.8946 0.8525 0.0049  -0.0708 0.0337  4   ARG C CG  
2289 C CD  . ARG C 4   ? 0.9150 0.9171 0.8754 0.0017  -0.0686 0.0248  4   ARG C CD  
2290 N NE  . ARG C 4   ? 0.9855 1.0035 0.9494 0.0000  -0.0706 0.0140  4   ARG C NE  
2291 C CZ  . ARG C 4   ? 1.0214 1.0454 1.0000 0.0007  -0.0731 0.0046  4   ARG C CZ  
2292 N NH1 . ARG C 4   ? 1.0259 1.0413 1.0173 0.0038  -0.0741 0.0052  4   ARG C NH1 
2293 N NH2 . ARG C 4   ? 1.0429 1.0815 1.0241 -0.0016 -0.0740 -0.0053 4   ARG C NH2 
2294 N N   . ALA C 5   ? 0.6849 0.6739 0.6175 -0.0028 -0.0568 0.0405  5   ALA C N   
2295 C CA  . ALA C 5   ? 0.6440 0.6360 0.5721 -0.0059 -0.0530 0.0368  5   ALA C CA  
2296 C C   . ALA C 5   ? 0.6019 0.5940 0.5407 -0.0082 -0.0537 0.0268  5   ALA C C   
2297 O O   . ALA C 5   ? 0.5737 0.5605 0.5230 -0.0072 -0.0561 0.0246  5   ALA C O   
2298 C CB  . ALA C 5   ? 0.6373 0.6191 0.5579 -0.0065 -0.0473 0.0454  5   ALA C CB  
2299 N N   . CYS C 6   ? 0.5817 0.5795 0.5185 -0.0110 -0.0511 0.0214  6   CYS C N   
2300 C CA  . CYS C 6   ? 0.5524 0.5508 0.5002 -0.0136 -0.0511 0.0129  6   CYS C CA  
2301 C C   . CYS C 6   ? 0.5383 0.5323 0.4822 -0.0164 -0.0463 0.0133  6   CYS C C   
2302 O O   . CYS C 6   ? 0.5649 0.5609 0.4981 -0.0165 -0.0428 0.0167  6   CYS C O   
2303 C CB  . CYS C 6   ? 0.5598 0.5716 0.5132 -0.0148 -0.0530 0.0032  6   CYS C CB  
2304 S SG  . CYS C 6   ? 0.6196 0.6367 0.5808 -0.0112 -0.0587 0.0016  6   CYS C SG  
2305 N N   . GLY C 7   ? 0.5033 0.4913 0.4566 -0.0184 -0.0459 0.0104  7   GLY C N   
2306 C CA  . GLY C 7   ? 0.4697 0.4529 0.4216 -0.0211 -0.0416 0.0104  7   GLY C CA  
2307 C C   . GLY C 7   ? 0.4490 0.4321 0.4147 -0.0240 -0.0423 0.0035  7   GLY C C   
2308 O O   . GLY C 7   ? 0.4490 0.4366 0.4257 -0.0237 -0.0454 -0.0011 7   GLY C O   
2309 N N   . LEU C 8   ? 0.4111 0.3897 0.3780 -0.0267 -0.0390 0.0029  8   LEU C N   
2310 C CA  . LEU C 8   ? 0.3800 0.3583 0.3610 -0.0297 -0.0395 -0.0023 8   LEU C CA  
2311 C C   . LEU C 8   ? 0.3635 0.3313 0.3449 -0.0304 -0.0393 0.0018  8   LEU C C   
2312 O O   . LEU C 8   ? 0.3834 0.3459 0.3558 -0.0305 -0.0360 0.0058  8   LEU C O   
2313 C CB  . LEU C 8   ? 0.3848 0.3686 0.3697 -0.0331 -0.0357 -0.0086 8   LEU C CB  
2314 C CG  . LEU C 8   ? 0.4206 0.4157 0.4049 -0.0335 -0.0351 -0.0145 8   LEU C CG  
2315 C CD1 . LEU C 8   ? 0.4377 0.4349 0.4239 -0.0374 -0.0299 -0.0196 8   LEU C CD1 
2316 C CD2 . LEU C 8   ? 0.3413 0.3434 0.3387 -0.0332 -0.0387 -0.0196 8   LEU C CD2 
2317 N N   . ILE C 9   ? 0.3173 0.2826 0.3096 -0.0309 -0.0425 0.0009  9   ILE C N   
2318 C CA  . ILE C 9   ? 0.2924 0.2491 0.2858 -0.0322 -0.0428 0.0037  9   ILE C CA  
2319 C C   . ILE C 9   ? 0.3095 0.2686 0.3121 -0.0361 -0.0405 -0.0010 9   ILE C C   
2320 O O   . ILE C 9   ? 0.2930 0.2568 0.3096 -0.0378 -0.0419 -0.0053 9   ILE C O   
2321 C CB  . ILE C 9   ? 0.2923 0.2462 0.2935 -0.0310 -0.0473 0.0047  9   ILE C CB  
2322 C CG1 . ILE C 9   ? 0.2758 0.2243 0.2676 -0.0272 -0.0490 0.0103  9   ILE C CG1 
2323 C CG2 . ILE C 9   ? 0.2662 0.2132 0.2705 -0.0334 -0.0482 0.0061  9   ILE C CG2 
2324 C CD1 . ILE C 9   ? 0.2204 0.1681 0.2205 -0.0247 -0.0529 0.0106  9   ILE C CD1 
2325 N N   . ILE C 10  ? 0.3190 0.2747 0.3149 -0.0374 -0.0362 -0.0001 10  ILE C N   
2326 C CA  . ILE C 10  ? 0.3335 0.2894 0.3376 -0.0409 -0.0331 -0.0041 10  ILE C CA  
2327 C C   . ILE C 10  ? 0.3435 0.2935 0.3566 -0.0432 -0.0354 -0.0035 10  ILE C C   
2328 O O   . ILE C 10  ? 0.3184 0.2617 0.3259 -0.0422 -0.0370 0.0006  10  ILE C O   
2329 C CB  . ILE C 10  ? 0.3561 0.3095 0.3503 -0.0407 -0.0273 -0.0028 10  ILE C CB  
2330 C CG1 . ILE C 10  ? 0.3724 0.3319 0.3549 -0.0378 -0.0259 -0.0018 10  ILE C CG1 
2331 C CG2 . ILE C 10  ? 0.3793 0.3338 0.3821 -0.0440 -0.0234 -0.0077 10  ILE C CG2 
2332 C CD1 . ILE C 10  ? 0.4087 0.3764 0.3957 -0.0395 -0.0244 -0.0080 10  ILE C CD1 
2333 N N   . PHE C 11  ? 0.3634 0.3163 0.3912 -0.0465 -0.0354 -0.0076 11  PHE C N   
2334 C CA  . PHE C 11  ? 0.4183 0.3668 0.4556 -0.0489 -0.0378 -0.0070 11  PHE C CA  
2335 C C   . PHE C 11  ? 0.4579 0.4067 0.5080 -0.0530 -0.0345 -0.0108 11  PHE C C   
2336 O O   . PHE C 11  ? 0.4714 0.4248 0.5252 -0.0543 -0.0306 -0.0146 11  PHE C O   
2337 C CB  . PHE C 11  ? 0.4035 0.3547 0.4490 -0.0481 -0.0436 -0.0059 11  PHE C CB  
2338 C CG  . PHE C 11  ? 0.4278 0.3875 0.4889 -0.0496 -0.0435 -0.0098 11  PHE C CG  
2339 C CD1 . PHE C 11  ? 0.4578 0.4192 0.5358 -0.0532 -0.0438 -0.0113 11  PHE C CD1 
2340 C CD2 . PHE C 11  ? 0.4360 0.4027 0.4967 -0.0474 -0.0428 -0.0119 11  PHE C CD2 
2341 C CE1 . PHE C 11  ? 0.4643 0.4341 0.5590 -0.0548 -0.0425 -0.0146 11  PHE C CE1 
2342 C CE2 . PHE C 11  ? 0.4364 0.4117 0.5134 -0.0490 -0.0417 -0.0161 11  PHE C CE2 
2343 C CZ  . PHE C 11  ? 0.4597 0.4366 0.5540 -0.0528 -0.0411 -0.0173 11  PHE C CZ  
2344 N N   . ARG C 12  ? 0.4900 0.4334 0.5467 -0.0552 -0.0359 -0.0098 12  ARG C N   
2345 C CA  . ARG C 12  ? 0.5312 0.4742 0.6033 -0.0593 -0.0336 -0.0127 12  ARG C CA  
2346 C C   . ARG C 12  ? 0.5640 0.5074 0.6492 -0.0614 -0.0393 -0.0114 12  ARG C C   
2347 O O   . ARG C 12  ? 0.5621 0.5037 0.6413 -0.0596 -0.0444 -0.0083 12  ARG C O   
2348 C CB  . ARG C 12  ? 0.5408 0.4762 0.6091 -0.0601 -0.0283 -0.0132 12  ARG C CB  
2349 C CG  . ARG C 12  ? 0.5617 0.4900 0.6249 -0.0594 -0.0303 -0.0104 12  ARG C CG  
2350 C CD  . ARG C 12  ? 0.5804 0.5021 0.6392 -0.0589 -0.0233 -0.0109 12  ARG C CD  
2351 N NE  . ARG C 12  ? 0.5890 0.5041 0.6451 -0.0586 -0.0242 -0.0091 12  ARG C NE  
2352 C CZ  . ARG C 12  ? 0.5783 0.4871 0.6339 -0.0581 -0.0181 -0.0095 12  ARG C CZ  
2353 N NH1 . ARG C 12  ? 0.5489 0.4567 0.6052 -0.0574 -0.0109 -0.0111 12  ARG C NH1 
2354 N NH2 . ARG C 12  ? 0.5888 0.4925 0.6433 -0.0581 -0.0188 -0.0086 12  ARG C NH2 
2355 N N   . ARG C 13  ? 0.6173 0.5634 0.7207 -0.0652 -0.0383 -0.0135 13  ARG C N   
2356 C CA  . ARG C 13  ? 0.6726 0.6209 0.7911 -0.0674 -0.0436 -0.0117 13  ARG C CA  
2357 C C   . ARG C 13  ? 0.7266 0.6687 0.8541 -0.0709 -0.0430 -0.0120 13  ARG C C   
2358 O O   . ARG C 13  ? 0.7334 0.6725 0.8664 -0.0732 -0.0370 -0.0147 13  ARG C O   
2359 C CB  . ARG C 13  ? 0.6689 0.6264 0.8049 -0.0691 -0.0427 -0.0130 13  ARG C CB  
2360 C CG  . ARG C 13  ? 0.6677 0.6320 0.7996 -0.0653 -0.0451 -0.0122 13  ARG C CG  
2361 C CD  . ARG C 13  ? 0.6922 0.6655 0.8452 -0.0666 -0.0462 -0.0116 13  ARG C CD  
2362 N NE  . ARG C 13  ? 0.7316 0.7102 0.8988 -0.0700 -0.0394 -0.0159 13  ARG C NE  
2364 N NH1 . ARG C 13  ? 0.8332 0.8226 0.9959 -0.0638 -0.0397 -0.0176 13  ARG C NH1 
2365 N NH2 . ARG C 13  ? 0.8419 0.8327 1.0262 -0.0726 -0.0297 -0.0234 13  ARG C NH2 
2366 N N   . CYS C 14  ? 0.7835 0.7236 0.9123 -0.0714 -0.0491 -0.0095 14  CYS C N   
2367 C CA  . CYS C 14  ? 0.8526 0.7866 0.9893 -0.0744 -0.0493 -0.0100 14  CYS C CA  
2368 C C   . CYS C 14  ? 0.8979 0.8369 1.0561 -0.0781 -0.0533 -0.0086 14  CYS C C   
2369 O O   . CYS C 14  ? 0.9048 0.8487 1.0658 -0.0777 -0.0601 -0.0056 14  CYS C O   
2370 C CB  . CYS C 14  ? 0.8561 0.7844 0.9791 -0.0728 -0.0529 -0.0088 14  CYS C CB  
2371 S SG  . CYS C 14  ? 0.9265 0.8519 1.0243 -0.0678 -0.0496 -0.0081 14  CYS C SG  
2372 N N   . LEU C 15  ? 0.9085 0.8461 1.0823 -0.0817 -0.0483 -0.0105 15  LEU C N   
2373 C CA  . LEU C 15  ? 0.9754 0.9185 1.1723 -0.0855 -0.0501 -0.0088 15  LEU C CA  
2374 C C   . LEU C 15  ? 1.0891 1.0272 1.2984 -0.0890 -0.0528 -0.0081 15  LEU C C   
2375 O O   . LEU C 15  ? 1.1328 1.0728 1.3635 -0.0930 -0.0518 -0.0071 15  LEU C O   
2376 C CB  . LEU C 15  ? 0.9576 0.9033 1.1667 -0.0879 -0.0421 -0.0112 15  LEU C CB  
2377 C CG  . LEU C 15  ? 0.9130 0.8632 1.1093 -0.0847 -0.0384 -0.0133 15  LEU C CG  
2378 C CD1 . LEU C 15  ? 0.9031 0.8533 1.1074 -0.0875 -0.0291 -0.0173 15  LEU C CD1 
2379 C CD2 . LEU C 15  ? 0.8653 0.8254 1.0637 -0.0824 -0.0435 -0.0106 15  LEU C CD2 
2380 N N   . ILE C 16  ? 1.1798 1.1115 1.3772 -0.0876 -0.0559 -0.0087 16  ILE C N   
2381 C CA  . ILE C 16  ? 1.2767 1.2037 1.4863 -0.0909 -0.0589 -0.0088 16  ILE C CA  
2382 C C   . ILE C 16  ? 1.3837 1.3133 1.5880 -0.0905 -0.0690 -0.0068 16  ILE C C   
2383 O O   . ILE C 16  ? 1.3317 1.2572 1.5178 -0.0880 -0.0705 -0.0081 16  ILE C O   
2384 C CB  . ILE C 16  ? 1.2514 1.1674 1.4587 -0.0908 -0.0515 -0.0126 16  ILE C CB  
2385 C CG1 . ILE C 16  ? 1.2076 1.1212 1.4274 -0.0929 -0.0427 -0.0141 16  ILE C CG1 
2386 C CG2 . ILE C 16  ? 1.2559 1.1667 1.4732 -0.0932 -0.0553 -0.0134 16  ILE C CG2 
2387 C CD1 . ILE C 16  ? 1.0981 1.0021 1.3086 -0.0909 -0.0333 -0.0175 16  ILE C CD1 
2388 N N   . PRO C 17  ? 1.5253 1.4620 1.7451 -0.0930 -0.0757 -0.0033 17  PRO C N   
2389 C CA  . PRO C 17  ? 1.6131 1.5548 1.8263 -0.0922 -0.0857 -0.0006 17  PRO C CA  
2390 C C   . PRO C 17  ? 1.6717 1.6078 1.8754 -0.0927 -0.0905 -0.0030 17  PRO C C   
2391 O O   . PRO C 17  ? 1.6737 1.6105 1.8596 -0.0902 -0.0946 -0.0025 17  PRO C O   
2392 C CB  . PRO C 17  ? 1.6536 1.6042 1.8901 -0.0954 -0.0905 0.0038  17  PRO C CB  
2393 C CG  . PRO C 17  ? 1.6189 1.5716 1.8693 -0.0965 -0.0823 0.0042  17  PRO C CG  
2394 C CD  . PRO C 17  ? 1.5487 1.4908 1.7921 -0.0963 -0.0734 -0.0009 17  PRO C CD  
2395 N N   . LYS C 18  ? 1.7085 1.6390 1.9239 -0.0958 -0.0897 -0.0056 18  LYS C N   
2396 C CA  . LYS C 18  ? 1.7206 1.6461 1.9283 -0.0964 -0.0936 -0.0089 18  LYS C CA  
2397 C C   . LYS C 18  ? 1.6685 1.5868 1.8543 -0.0930 -0.0877 -0.0123 18  LYS C C   
2398 O O   . LYS C 18  ? 1.6894 1.6066 1.8609 -0.0922 -0.0915 -0.0136 18  LYS C O   
2399 C CB  . LYS C 18  ? 1.7918 1.7123 2.0192 -0.1002 -0.0929 -0.0114 18  LYS C CB  
2400 N N   . VAL C 19  ? 1.5671 1.4807 1.7511 -0.0911 -0.0780 -0.0136 19  VAL C N   
2401 C CA  . VAL C 19  ? 1.4483 1.3555 1.6142 -0.0875 -0.0705 -0.0158 19  VAL C CA  
2402 C C   . VAL C 19  ? 1.3120 1.2218 1.4570 -0.0837 -0.0700 -0.0137 19  VAL C C   
2403 O O   . VAL C 19  ? 1.2559 1.1613 1.3854 -0.0816 -0.0673 -0.0148 19  VAL C O   
2404 C CB  . VAL C 19  ? 1.4717 1.3728 1.6440 -0.0867 -0.0599 -0.0177 19  VAL C CB  
2405 C CG1 . VAL C 19  ? 1.4507 1.3474 1.6040 -0.0825 -0.0522 -0.0186 19  VAL C CG1 
2406 C CG2 . VAL C 19  ? 1.5232 1.4178 1.7126 -0.0894 -0.0582 -0.0207 19  VAL C CG2 
2407 N N   . ASP C 20  ? 1.2255 1.1420 1.3715 -0.0828 -0.0716 -0.0106 20  ASP C N   
2408 C CA  . ASP C 20  ? 1.1464 1.0646 1.2753 -0.0788 -0.0695 -0.0089 20  ASP C CA  
2409 C C   . ASP C 20  ? 1.1443 1.0664 1.2636 -0.0777 -0.0774 -0.0060 20  ASP C C   
2410 O O   . ASP C 20  ? 1.1735 1.1028 1.3006 -0.0778 -0.0822 -0.0032 20  ASP C O   
2411 C CB  . ASP C 20  ? 1.1084 1.0320 1.2449 -0.0782 -0.0661 -0.0078 20  ASP C CB  
2412 C CG  . ASP C 20  ? 1.1233 1.0422 1.2643 -0.0786 -0.0571 -0.0106 20  ASP C CG  
2413 O OD1 . ASP C 20  ? 1.1073 1.0189 1.2423 -0.0779 -0.0527 -0.0127 20  ASP C OD1 
2414 O OD2 . ASP C 20  ? 1.1431 1.0659 1.2946 -0.0797 -0.0539 -0.0107 20  ASP C OD2 
2415 N N   . ASN C 21  ? 1.1165 1.0336 1.2197 -0.0765 -0.0778 -0.0067 21  ASN C N   
2416 C CA  . ASN C 21  ? 1.1269 1.0456 1.2184 -0.0753 -0.0844 -0.0042 21  ASN C CA  
2417 C C   . ASN C 21  ? 1.0562 0.9791 1.1419 -0.0716 -0.0843 -0.0006 21  ASN C C   
2418 O O   . ASN C 21  ? 1.0804 1.0084 1.1675 -0.0707 -0.0904 0.0023  21  ASN C O   
2419 C CB  . ASN C 21  ? 1.2035 1.1147 1.2782 -0.0748 -0.0822 -0.0057 21  ASN C CB  
2420 C CG  . ASN C 21  ? 1.3696 1.2754 1.4497 -0.0773 -0.0780 -0.0101 21  ASN C CG  
2421 O OD1 . ASN C 21  ? 1.4748 1.3753 1.5481 -0.0757 -0.0699 -0.0114 21  ASN C OD1 
2422 N ND2 . ASN C 21  ? 1.4966 1.4042 1.5900 -0.0809 -0.0832 -0.0122 21  ASN C ND2 
2423 N N   . ASN C 22  ? 0.9796 0.9007 1.0594 -0.0691 -0.0772 -0.0010 22  ASN C N   
2424 C CA  . ASN C 22  ? 0.8668 0.7917 0.9418 -0.0655 -0.0763 0.0014  22  ASN C CA  
2425 C C   . ASN C 22  ? 0.8175 0.7484 0.9073 -0.0660 -0.0730 0.0003  22  ASN C C   
2426 O O   . ASN C 22  ? 0.8233 0.7518 0.9163 -0.0673 -0.0672 -0.0022 22  ASN C O   
2427 C CB  . ASN C 22  ? 0.8495 0.7687 0.9069 -0.0625 -0.0709 0.0017  22  ASN C CB  
2428 C CG  . ASN C 22  ? 0.8673 0.7790 0.9115 -0.0630 -0.0715 0.0019  22  ASN C CG  
2429 O OD1 . ASN C 22  ? 0.8763 0.7833 0.9191 -0.0646 -0.0672 -0.0003 22  ASN C OD1 
2430 N ND2 . ASN C 22  ? 0.8948 0.8053 0.9300 -0.0617 -0.0762 0.0045  22  ASN C ND2 
2431 N N   . ALA C 23  ? 0.7874 0.7259 0.8868 -0.0651 -0.0759 0.0024  23  ALA C N   
2432 C CA  . ALA C 23  ? 0.7271 0.6718 0.8414 -0.0660 -0.0720 0.0011  23  ALA C CA  
2433 C C   . ALA C 23  ? 0.6758 0.6194 0.7804 -0.0636 -0.0655 -0.0008 23  ALA C C   
2434 O O   . ALA C 23  ? 0.6789 0.6241 0.7913 -0.0653 -0.0601 -0.0036 23  ALA C O   
2435 C CB  . ALA C 23  ? 0.7250 0.6785 0.8517 -0.0650 -0.0755 0.0038  23  ALA C CB  
2436 N N   . ILE C 24  ? 0.6166 0.5573 0.7044 -0.0599 -0.0659 0.0006  24  ILE C N   
2437 C CA  . ILE C 24  ? 0.5628 0.5030 0.6404 -0.0573 -0.0607 -0.0004 24  ILE C CA  
2438 C C   . ILE C 24  ? 0.5561 0.4882 0.6156 -0.0559 -0.0584 0.0004  24  ILE C C   
2439 O O   . ILE C 24  ? 0.5674 0.4947 0.6180 -0.0551 -0.0617 0.0028  24  ILE C O   
2440 C CB  . ILE C 24  ? 0.5494 0.4950 0.6264 -0.0536 -0.0621 0.0009  24  ILE C CB  
2441 C CG1 . ILE C 24  ? 0.5257 0.4806 0.6228 -0.0551 -0.0619 -0.0005 24  ILE C CG1 
2442 C CG2 . ILE C 24  ? 0.4931 0.4380 0.5575 -0.0508 -0.0578 0.0001  24  ILE C CG2 
2443 C CD1 . ILE C 24  ? 0.5077 0.4680 0.6091 -0.0515 -0.0644 0.0014  24  ILE C CD1 
2444 N N   . GLU C 25  ? 0.5359 0.4666 0.5904 -0.0557 -0.0523 -0.0012 25  GLU C N   
2445 C CA  . GLU C 25  ? 0.5175 0.4419 0.5566 -0.0539 -0.0486 0.0002  25  GLU C CA  
2446 C C   . GLU C 25  ? 0.4895 0.4166 0.5197 -0.0509 -0.0447 0.0007  25  GLU C C   
2447 O O   . GLU C 25  ? 0.4759 0.4082 0.5119 -0.0513 -0.0419 -0.0019 25  GLU C O   
2448 C CB  . GLU C 25  ? 0.5389 0.4587 0.5808 -0.0561 -0.0441 -0.0017 25  GLU C CB  
2449 C CG  . GLU C 25  ? 0.5873 0.5020 0.6317 -0.0584 -0.0471 -0.0017 25  GLU C CG  
2450 C CD  . GLU C 25  ? 0.6631 0.5739 0.7147 -0.0605 -0.0423 -0.0044 25  GLU C CD  
2451 O OE1 . GLU C 25  ? 0.7236 0.6358 0.7805 -0.0605 -0.0373 -0.0062 25  GLU C OE1 
2452 O OE2 . GLU C 25  ? 0.6949 0.6008 0.7473 -0.0620 -0.0430 -0.0051 25  GLU C OE2 
2453 N N   . PHE C 26  ? 0.4732 0.3967 0.4894 -0.0481 -0.0442 0.0043  26  PHE C N   
2454 C CA  . PHE C 26  ? 0.4662 0.3920 0.4725 -0.0449 -0.0412 0.0059  26  PHE C CA  
2455 C C   . PHE C 26  ? 0.4669 0.3893 0.4639 -0.0441 -0.0347 0.0074  26  PHE C C   
2456 O O   . PHE C 26  ? 0.4809 0.3973 0.4765 -0.0453 -0.0328 0.0083  26  PHE C O   
2457 C CB  . PHE C 26  ? 0.4586 0.3821 0.4568 -0.0421 -0.0446 0.0098  26  PHE C CB  
2458 C CG  . PHE C 26  ? 0.4725 0.3995 0.4796 -0.0417 -0.0503 0.0090  26  PHE C CG  
2459 C CD1 . PHE C 26  ? 0.4818 0.4169 0.4966 -0.0405 -0.0509 0.0066  26  PHE C CD1 
2460 C CD2 . PHE C 26  ? 0.5059 0.4285 0.5141 -0.0423 -0.0547 0.0107  26  PHE C CD2 
2461 C CE1 . PHE C 26  ? 0.4825 0.4212 0.5073 -0.0396 -0.0552 0.0062  26  PHE C CE1 
2462 C CE2 . PHE C 26  ? 0.4883 0.4145 0.5050 -0.0412 -0.0594 0.0108  26  PHE C CE2 
2463 C CZ  . PHE C 26  ? 0.4814 0.4157 0.5071 -0.0397 -0.0593 0.0087  26  PHE C CZ  
2464 N N   . LEU C 27  ? 0.4595 0.3862 0.4506 -0.0420 -0.0310 0.0078  27  LEU C N   
2465 C CA  . LEU C 27  ? 0.4651 0.3895 0.4474 -0.0405 -0.0242 0.0103  27  LEU C CA  
2466 C C   . LEU C 27  ? 0.4754 0.3988 0.4451 -0.0373 -0.0229 0.0161  27  LEU C C   
2467 O O   . LEU C 27  ? 0.4653 0.3933 0.4316 -0.0354 -0.0256 0.0170  27  LEU C O   
2468 C CB  . LEU C 27  ? 0.4625 0.3924 0.4462 -0.0404 -0.0199 0.0073  27  LEU C CB  
2469 C CG  . LEU C 27  ? 0.4704 0.3996 0.4441 -0.0378 -0.0124 0.0106  27  LEU C CG  
2470 C CD1 . LEU C 27  ? 0.4639 0.3864 0.4414 -0.0386 -0.0066 0.0105  27  LEU C CD1 
2471 C CD2 . LEU C 27  ? 0.4083 0.3447 0.3795 -0.0369 -0.0102 0.0082  27  LEU C CD2 
2472 N N   . LEU C 28  ? 0.4936 0.4108 0.4577 -0.0369 -0.0183 0.0200  28  LEU C N   
2473 C CA  . LEU C 28  ? 0.5007 0.4163 0.4542 -0.0342 -0.0160 0.0265  28  LEU C CA  
2474 C C   . LEU C 28  ? 0.5368 0.4523 0.4849 -0.0324 -0.0074 0.0303  28  LEU C C   
2475 O O   . LEU C 28  ? 0.5621 0.4749 0.5145 -0.0334 -0.0025 0.0287  28  LEU C O   
2476 C CB  . LEU C 28  ? 0.4852 0.3929 0.4368 -0.0352 -0.0181 0.0290  28  LEU C CB  
2477 C CG  . LEU C 28  ? 0.4595 0.3668 0.4150 -0.0360 -0.0263 0.0269  28  LEU C CG  
2478 C CD1 . LEU C 28  ? 0.4455 0.3443 0.3961 -0.0364 -0.0275 0.0304  28  LEU C CD1 
2479 C CD2 . LEU C 28  ? 0.4366 0.3505 0.3915 -0.0335 -0.0294 0.0269  28  LEU C CD2 
2480 N N   . LEU C 29  ? 0.5656 0.4844 0.5053 -0.0295 -0.0053 0.0356  29  LEU C N   
2481 C CA  . LEU C 29  ? 0.6093 0.5294 0.5439 -0.0271 0.0033  0.0407  29  LEU C CA  
2482 C C   . LEU C 29  ? 0.6615 0.5765 0.5911 -0.0263 0.0066  0.0481  29  LEU C C   
2483 O O   . LEU C 29  ? 0.6519 0.5646 0.5790 -0.0264 0.0017  0.0501  29  LEU C O   
2484 C CB  . LEU C 29  ? 0.5876 0.5170 0.5164 -0.0243 0.0037  0.0417  29  LEU C CB  
2485 C CG  . LEU C 29  ? 0.5642 0.4992 0.4973 -0.0256 -0.0005 0.0342  29  LEU C CG  
2486 C CD1 . LEU C 29  ? 0.5467 0.4912 0.4720 -0.0229 -0.0003 0.0356  29  LEU C CD1 
2487 C CD2 . LEU C 29  ? 0.4949 0.4272 0.4355 -0.0274 0.0032  0.0291  29  LEU C CD2 
2488 N N   . GLN C 30  ? 0.7217 0.6346 0.6511 -0.0253 0.0158  0.0523  30  GLN C N   
2489 C CA  . GLN C 30  ? 0.7787 0.6871 0.7047 -0.0249 0.0210  0.0599  30  GLN C CA  
2490 C C   . GLN C 30  ? 0.8285 0.7438 0.7486 -0.0209 0.0265  0.0677  30  GLN C C   
2491 O O   . GLN C 30  ? 0.8566 0.7775 0.7765 -0.0186 0.0314  0.0678  30  GLN C O   
2492 C CB  . GLN C 30  ? 0.7842 0.6860 0.7161 -0.0267 0.0285  0.0593  30  GLN C CB  
2493 C CG  . GLN C 30  ? 0.8184 0.7134 0.7486 -0.0281 0.0322  0.0650  30  GLN C CG  
2494 C CD  . GLN C 30  ? 0.8525 0.7413 0.7891 -0.0304 0.0401  0.0637  30  GLN C CD  
2495 O OE1 . GLN C 30  ? 0.8811 0.7713 0.8243 -0.0302 0.0437  0.0594  30  GLN C OE1 
2496 N NE2 . GLN C 30  ? 0.8736 0.7555 0.8093 -0.0326 0.0432  0.0673  30  GLN C NE2 
2497 N N   . ALA C 31  ? 0.8815 0.7961 0.7968 -0.0201 0.0258  0.0745  31  ALA C N   
2498 C CA  . ALA C 31  ? 0.9491 0.8708 0.8592 -0.0164 0.0307  0.0832  31  ALA C CA  
2499 C C   . ALA C 31  ? 1.0096 0.9300 0.9225 -0.0153 0.0432  0.0900  31  ALA C C   
2500 O O   . ALA C 31  ? 1.0120 0.9241 0.9299 -0.0178 0.0480  0.0902  31  ALA C O   
2501 C CB  . ALA C 31  ? 0.9406 0.8613 0.8468 -0.0160 0.0260  0.0887  31  ALA C CB  
2502 N N   . SER C 32  ? 1.1159 1.0452 1.0257 -0.0113 0.0489  0.0956  32  SER C N   
2503 C CA  . SER C 32  ? 1.2138 1.1441 1.1267 -0.0091 0.0617  0.1044  32  SER C CA  
2504 C C   . SER C 32  ? 1.3008 1.2294 1.2124 -0.0092 0.0641  0.1147  32  SER C C   
2505 O O   . SER C 32  ? 1.3181 1.2408 1.2355 -0.0105 0.0731  0.1197  32  SER C O   
2506 C CB  . SER C 32  ? 1.2189 1.1602 1.1280 -0.0042 0.0664  0.1077  32  SER C CB  
2507 O OG  . SER C 32  ? 1.1954 1.1364 1.1071 -0.0040 0.0669  0.0992  32  SER C OG  
2508 N N   . ASP C 33  ? 1.5128 1.4628 1.7243 -0.0254 -0.2981 -0.0726 33  ASP C N   
2509 C CA  . ASP C 33  ? 1.6721 1.6345 1.9621 -0.0227 -0.3292 -0.1125 33  ASP C CA  
2510 C C   . ASP C 33  ? 1.6420 1.6711 1.9888 -0.0198 -0.2980 -0.1501 33  ASP C C   
2511 O O   . ASP C 33  ? 1.5703 1.6164 1.8849 -0.0228 -0.2570 -0.1521 33  ASP C O   
2512 C CB  . ASP C 33  ? 1.7608 1.6888 2.0242 -0.0261 -0.3367 -0.1156 33  ASP C CB  
2513 N N   . GLY C 34  ? 1.7148 1.7830 2.1476 -0.0172 -0.3196 -0.1808 34  GLY C N   
2514 C CA  . GLY C 34  ? 1.6947 1.8367 2.1897 -0.0209 -0.2919 -0.2222 34  GLY C CA  
2515 C C   . GLY C 34  ? 1.6237 1.7935 2.0695 -0.0222 -0.2397 -0.1984 34  GLY C C   
2516 O O   . GLY C 34  ? 1.5934 1.7914 2.0207 -0.0311 -0.2017 -0.2083 34  GLY C O   
2517 N N   . ILE C 35  ? 1.6040 1.7639 2.0304 -0.0146 -0.2414 -0.1683 35  ILE C N   
2518 C CA  . ILE C 35  ? 1.4982 1.6604 1.8589 -0.0121 -0.1993 -0.1354 35  ILE C CA  
2519 C C   . ILE C 35  ? 1.4471 1.6712 1.8270 -0.0177 -0.1579 -0.1527 35  ILE C C   
2520 O O   . ILE C 35  ? 1.4834 1.7599 1.9323 -0.0270 -0.1584 -0.1937 35  ILE C O   
2521 C CB  . ILE C 35  ? 1.4609 1.6070 1.8116 -0.0035 -0.2128 -0.1094 35  ILE C CB  
2522 C CG1 . ILE C 35  ? 1.4283 1.6374 1.8547 0.0015  -0.2078 -0.1318 35  ILE C CG1 
2523 C CG2 . ILE C 35  ? 1.5293 1.6238 1.8836 -0.0044 -0.2656 -0.0999 35  ILE C CG2 
2524 C CD1 . ILE C 35  ? 1.4346 1.6281 1.8528 0.0110  -0.2213 -0.1069 35  ILE C CD1 
2525 N N   . HIS C 36  ? 1.3726 1.5913 1.6919 -0.0147 -0.1239 -0.1237 36  HIS C N   
2526 C CA  . HIS C 36  ? 1.2873 1.5515 1.6043 -0.0233 -0.0850 -0.1311 36  HIS C CA  
2527 C C   . HIS C 36  ? 1.2391 1.4975 1.5287 -0.0382 -0.0715 -0.1395 36  HIS C C   
2528 O O   . HIS C 36  ? 1.2411 1.5441 1.5488 -0.0552 -0.0508 -0.1602 36  HIS C O   
2529 C CB  . HIS C 36  ? 1.3068 1.6443 1.7109 -0.0286 -0.0841 -0.1659 36  HIS C CB  
2530 N N   . HIS C 37  ? 1.1569 1.3608 1.4010 -0.0342 -0.0837 -0.1232 37  HIS C N   
2531 C CA  . HIS C 37  ? 1.0732 1.2628 1.2843 -0.0448 -0.0720 -0.1261 37  HIS C CA  
2532 C C   . HIS C 37  ? 0.9466 1.0946 1.0794 -0.0400 -0.0539 -0.0891 37  HIS C C   
2533 O O   . HIS C 37  ? 0.9458 1.0501 1.0438 -0.0311 -0.0665 -0.0691 37  HIS C O   
2534 C CB  . HIS C 37  ? 1.1677 1.3327 1.3996 -0.0433 -0.1019 -0.1425 37  HIS C CB  
2535 C CG  . HIS C 37  ? 1.2263 1.4049 1.4665 -0.0575 -0.0933 -0.1696 37  HIS C CG  
2536 N ND1 . HIS C 37  ? 1.2877 1.4331 1.5220 -0.0549 -0.1107 -0.1771 37  HIS C ND1 
2537 C CD2 . HIS C 37  ? 1.2543 1.4759 1.5052 -0.0771 -0.0691 -0.1918 37  HIS C CD2 
2538 C CE1 . HIS C 37  ? 1.3146 1.4821 1.5572 -0.0698 -0.0962 -0.2044 37  HIS C CE1 
2539 N NE2 . HIS C 37  ? 1.3074 1.5209 1.5578 -0.0858 -0.0713 -0.2134 37  HIS C NE2 
2540 N N   . TRP C 38  ? 0.7937 0.9573 0.9020 -0.0487 -0.0269 -0.0826 38  TRP C N   
2541 C CA  . TRP C 38  ? 0.6835 0.8131 0.7300 -0.0443 -0.0124 -0.0535 38  TRP C CA  
2542 C C   . TRP C 38  ? 0.6477 0.7599 0.6635 -0.0551 -0.0053 -0.0511 38  TRP C C   
2543 O O   . TRP C 38  ? 0.6469 0.7838 0.6740 -0.0728 0.0032  -0.0662 38  TRP C O   
2544 C CB  . TRP C 38  ? 0.6555 0.8063 0.6946 -0.0456 0.0072  -0.0449 38  TRP C CB  
2545 C CG  . TRP C 38  ? 0.6062 0.7698 0.6641 -0.0321 0.0061  -0.0416 38  TRP C CG  
2546 C CD1 . TRP C 38  ? 0.5873 0.7975 0.7000 -0.0334 0.0053  -0.0597 38  TRP C CD1 
2547 C CD2 . TRP C 38  ? 0.5616 0.6954 0.5856 -0.0168 0.0071  -0.0220 38  TRP C CD2 
2548 N NE1 . TRP C 38  ? 0.5511 0.7595 0.6654 -0.0175 0.0052  -0.0492 38  TRP C NE1 
2549 C CE2 . TRP C 38  ? 0.5537 0.7142 0.6104 -0.0082 0.0070  -0.0265 38  TRP C CE2 
2550 C CE3 . TRP C 38  ? 0.5294 0.6210 0.5026 -0.0115 0.0083  -0.0054 38  TRP C CE3 
2551 C CZ2 . TRP C 38  ? 0.5202 0.6622 0.5531 0.0052  0.0092  -0.0132 38  TRP C CZ2 
2552 C CZ3 . TRP C 38  ? 0.5244 0.6015 0.4769 -0.0006 0.0105  0.0035  38  TRP C CZ3 
2553 C CH2 . TRP C 38  ? 0.5060 0.6061 0.4846 0.0074  0.0115  0.0005  38  TRP C CH2 
2554 N N   . THR C 39  ? 0.5951 0.6674 0.5725 -0.0469 -0.0087 -0.0335 39  THR C N   
2555 C CA  . THR C 39  ? 0.5601 0.6148 0.5123 -0.0544 -0.0040 -0.0302 39  THR C CA  
2556 C C   . THR C 39  ? 0.5135 0.5341 0.4288 -0.0446 -0.0043 -0.0104 39  THR C C   
2557 O O   . THR C 39  ? 0.4958 0.5054 0.4029 -0.0348 -0.0092 -0.0029 39  THR C O   
2558 C CB  . THR C 39  ? 0.5841 0.6367 0.5550 -0.0575 -0.0152 -0.0482 39  THR C CB  
2559 O OG1 . THR C 39  ? 0.5831 0.6019 0.5290 -0.0484 -0.0225 -0.0360 39  THR C OG1 
2560 C CG2 . THR C 39  ? 0.5999 0.6694 0.6151 -0.0536 -0.0315 -0.0668 39  THR C CG2 
2561 N N   . PRO C 40  ? 0.4872 0.4934 0.3823 -0.0498 0.0001  -0.0047 40  PRO C N   
2562 C CA  . PRO C 40  ? 0.4738 0.4545 0.3456 -0.0423 -0.0019 0.0063  40  PRO C CA  
2563 C C   . PRO C 40  ? 0.4743 0.4449 0.3484 -0.0383 -0.0117 0.0018  40  PRO C C   
2564 O O   . PRO C 40  ? 0.4930 0.4713 0.3862 -0.0402 -0.0184 -0.0091 40  PRO C O   
2565 C CB  . PRO C 40  ? 0.4777 0.4503 0.3389 -0.0511 0.0013  0.0106  40  PRO C CB  
2566 C CG  . PRO C 40  ? 0.4930 0.4845 0.3640 -0.0663 0.0058  0.0020  40  PRO C CG  
2567 C CD  . PRO C 40  ? 0.4998 0.5167 0.3920 -0.0662 0.0080  -0.0069 40  PRO C CD  
2568 N N   . PRO C 41  ? 0.4767 0.4325 0.3346 -0.0349 -0.0141 0.0070  41  PRO C N   
2569 C CA  . PRO C 41  ? 0.5039 0.4513 0.3613 -0.0353 -0.0243 0.0040  41  PRO C CA  
2570 C C   . PRO C 41  ? 0.5258 0.4726 0.3935 -0.0366 -0.0241 -0.0034 41  PRO C C   
2571 O O   . PRO C 41  ? 0.5370 0.4838 0.4024 -0.0382 -0.0161 -0.0023 41  PRO C O   
2572 C CB  . PRO C 41  ? 0.5072 0.4479 0.3456 -0.0370 -0.0230 0.0077  41  PRO C CB  
2573 C CG  . PRO C 41  ? 0.4761 0.4197 0.3106 -0.0343 -0.0140 0.0091  41  PRO C CG  
2574 C CD  . PRO C 41  ? 0.4691 0.4199 0.3120 -0.0320 -0.0104 0.0118  41  PRO C CD  
2575 N N   . LYS C 42  ? 0.5578 0.5018 0.4382 -0.0363 -0.0351 -0.0121 42  LYS C N   
2576 C CA  . LYS C 42  ? 0.5833 0.5262 0.4742 -0.0364 -0.0345 -0.0238 42  LYS C CA  
2577 C C   . LYS C 42  ? 0.6261 0.5573 0.5259 -0.0342 -0.0524 -0.0308 42  LYS C C   
2578 O O   . LYS C 42  ? 0.6494 0.5758 0.5565 -0.0345 -0.0686 -0.0307 42  LYS C O   
2579 C CB  . LYS C 42  ? 0.5836 0.5423 0.4921 -0.0423 -0.0276 -0.0388 42  LYS C CB  
2580 C CG  . LYS C 42  ? 0.5900 0.5625 0.5213 -0.0441 -0.0358 -0.0492 42  LYS C CG  
2581 C CD  . LYS C 42  ? 0.6538 0.6433 0.6152 -0.0512 -0.0371 -0.0779 42  LYS C CD  
2582 C CE  . LYS C 42  ? 0.6960 0.7131 0.6878 -0.0573 -0.0400 -0.0921 42  LYS C CE  
2583 N NZ  . LYS C 42  ? 0.6856 0.6965 0.6723 -0.0487 -0.0480 -0.0725 42  LYS C NZ  
2584 N N   . GLY C 43  ? 0.6567 0.5815 0.5576 -0.0320 -0.0522 -0.0371 43  GLY C N   
2585 C CA  . GLY C 43  ? 0.7240 0.6333 0.6326 -0.0304 -0.0725 -0.0437 43  GLY C CA  
2586 C C   . GLY C 43  ? 0.7603 0.6683 0.6835 -0.0257 -0.0695 -0.0621 43  GLY C C   
2587 O O   . GLY C 43  ? 0.7230 0.6417 0.6446 -0.0248 -0.0501 -0.0660 43  GLY C O   
2588 N N   . HIS C 44  ? 0.8383 0.7305 0.7762 -0.0231 -0.0917 -0.0739 44  HIS C N   
2589 C CA  . HIS C 44  ? 0.9193 0.8060 0.8727 -0.0168 -0.0927 -0.0950 44  HIS C CA  
2590 C C   . HIS C 44  ? 0.8667 0.7533 0.7994 -0.0146 -0.0781 -0.0823 44  HIS C C   
2591 O O   . HIS C 44  ? 0.8695 0.7522 0.7802 -0.0203 -0.0815 -0.0614 44  HIS C O   
2592 C CB  . HIS C 44  ? 1.0657 0.9290 1.0393 -0.0149 -0.1279 -0.1071 44  HIS C CB  
2593 C CG  . HIS C 44  ? 1.2709 1.1313 1.2573 -0.0197 -0.1497 -0.1036 44  HIS C CG  
2594 N ND1 . HIS C 44  ? 1.3598 1.2092 1.3175 -0.0276 -0.1595 -0.0738 44  HIS C ND1 
2595 C CD2 . HIS C 44  ? 1.3725 1.2443 1.4003 -0.0191 -0.1623 -0.1289 44  HIS C CD2 
2596 C CE1 . HIS C 44  ? 1.3957 1.2461 1.3751 -0.0291 -0.1779 -0.0776 44  HIS C CE1 
2597 N NE2 . HIS C 44  ? 1.4173 1.2833 1.4430 -0.0236 -0.1805 -0.1113 44  HIS C NE2 
2598 N N   . VAL C 45  ? 0.8418 0.7372 0.7836 -0.0086 -0.0608 -0.0978 45  VAL C N   
2599 C CA  . VAL C 45  ? 0.8276 0.7285 0.7607 -0.0045 -0.0465 -0.0905 45  VAL C CA  
2600 C C   . VAL C 45  ? 0.8930 0.7780 0.8275 -0.0011 -0.0627 -0.0936 45  VAL C C   
2601 O O   . VAL C 45  ? 0.9568 0.8276 0.9089 0.0051  -0.0760 -0.1153 45  VAL C O   
2602 C CB  . VAL C 45  ? 0.7959 0.7082 0.7393 0.0003  -0.0256 -0.1077 45  VAL C CB  
2603 C CG1 . VAL C 45  ? 0.7679 0.6885 0.7108 0.0067  -0.0126 -0.1022 45  VAL C CG1 
2604 C CG2 . VAL C 45  ? 0.7496 0.6740 0.6861 -0.0079 -0.0125 -0.1018 45  VAL C CG2 
2605 N N   . GLU C 46  ? 0.9251 0.8140 0.8428 -0.0075 -0.0631 -0.0749 46  GLU C N   
2606 C CA  . GLU C 46  ? 1.0034 0.8789 0.9176 -0.0090 -0.0781 -0.0752 46  GLU C CA  
2607 C C   . GLU C 46  ? 0.9980 0.8873 0.9270 0.0029  -0.0589 -0.0884 46  GLU C C   
2608 O O   . GLU C 46  ? 0.9491 0.8611 0.8868 0.0086  -0.0342 -0.0908 46  GLU C O   
2609 C CB  . GLU C 46  ? 1.0357 0.9128 0.9226 -0.0286 -0.0881 -0.0522 46  GLU C CB  
2610 C CG  . GLU C 46  ? 1.1636 1.0108 1.0358 -0.0400 -0.1209 -0.0427 46  GLU C CG  
2611 C CD  . GLU C 46  ? 1.2921 1.1450 1.1317 -0.0632 -0.1250 -0.0206 46  GLU C CD  
2612 O OE1 . GLU C 46  ? 1.3671 1.2453 1.1941 -0.0759 -0.1091 -0.0151 46  GLU C OE1 
2613 O OE2 . GLU C 46  ? 1.3057 1.1409 1.1351 -0.0703 -0.1440 -0.0121 46  GLU C OE2 
2614 N N   . PRO C 47  ? 1.0883 0.9620 1.0209 0.0064  -0.0726 -0.0964 47  PRO C N   
2615 C CA  . PRO C 47  ? 1.0916 0.9727 1.0427 0.0218  -0.0574 -0.1153 47  PRO C CA  
2616 C C   . PRO C 47  ? 1.0189 0.9373 0.9794 0.0267  -0.0250 -0.1128 47  PRO C C   
2617 O O   . PRO C 47  ? 1.0214 0.9476 0.9983 0.0404  -0.0062 -0.1297 47  PRO C O   
2618 C CB  . PRO C 47  ? 1.1772 1.0372 1.1204 0.0166  -0.0819 -0.1121 47  PRO C CB  
2619 C CG  . PRO C 47  ? 1.2323 1.0765 1.1477 -0.0062 -0.1086 -0.0876 47  PRO C CG  
2620 C CD  . PRO C 47  ? 1.1934 1.0359 1.1113 -0.0054 -0.1085 -0.0874 47  PRO C CD  
2621 N N   . GLY C 48  ? 0.9735 0.9164 0.9268 0.0137  -0.0198 -0.0953 48  GLY C N   
2622 C CA  . GLY C 48  ? 0.9070 0.8892 0.8820 0.0187  0.0062  -0.0976 48  GLY C CA  
2623 C C   . GLY C 48  ? 0.8550 0.8599 0.8347 0.0118  0.0163  -0.0881 48  GLY C C   
2624 O O   . GLY C 48  ? 0.8714 0.9124 0.8684 0.0051  0.0264  -0.0866 48  GLY C O   
2625 N N   . GLU C 49  ? 0.7994 0.7855 0.7690 0.0129  0.0124  -0.0852 49  GLU C N   
2626 C CA  . GLU C 49  ? 0.7410 0.7376 0.7077 0.0041  0.0139  -0.0742 49  GLU C CA  
2627 C C   . GLU C 49  ? 0.6855 0.6795 0.6613 0.0123  0.0237  -0.0773 49  GLU C C   
2628 O O   . GLU C 49  ? 0.7148 0.6906 0.6855 0.0183  0.0248  -0.0866 49  GLU C O   
2629 C CB  . GLU C 49  ? 0.7697 0.7436 0.7095 -0.0067 -0.0034 -0.0641 49  GLU C CB  
2630 C CG  . GLU C 49  ? 0.8066 0.7948 0.7349 -0.0240 -0.0074 -0.0529 49  GLU C CG  
2631 C CD  . GLU C 49  ? 0.8574 0.8209 0.7589 -0.0331 -0.0243 -0.0427 49  GLU C CD  
2632 O OE1 . GLU C 49  ? 0.8596 0.8016 0.7606 -0.0242 -0.0300 -0.0455 49  GLU C OE1 
2633 O OE2 . GLU C 49  ? 0.8697 0.8383 0.7525 -0.0511 -0.0316 -0.0347 49  GLU C OE2 
2634 N N   . ASP C 50  ? 0.6291 0.6417 0.6193 0.0092  0.0282  -0.0716 50  ASP C N   
2635 C CA  . ASP C 50  ? 0.5872 0.5925 0.5798 0.0102  0.0304  -0.0682 50  ASP C CA  
2636 C C   . ASP C 50  ? 0.5757 0.5599 0.5417 0.0017  0.0216  -0.0596 50  ASP C C   
2637 O O   . ASP C 50  ? 0.5580 0.5404 0.5117 -0.0044 0.0136  -0.0538 50  ASP C O   
2638 C CB  . ASP C 50  ? 0.5759 0.6055 0.5979 0.0085  0.0296  -0.0659 50  ASP C CB  
2639 C CG  . ASP C 50  ? 0.5974 0.6174 0.6271 0.0093  0.0274  -0.0615 50  ASP C CG  
2640 O OD1 . ASP C 50  ? 0.6305 0.6338 0.6447 0.0013  0.0183  -0.0514 50  ASP C OD1 
2641 O OD2 . ASP C 50  ? 0.6198 0.6483 0.6704 0.0165  0.0335  -0.0674 50  ASP C OD2 
2642 N N   . ASP C 51  ? 0.5627 0.5333 0.5193 -0.0010 0.0235  -0.0593 51  ASP C N   
2643 C CA  . ASP C 51  ? 0.5640 0.5207 0.4997 -0.0101 0.0174  -0.0538 51  ASP C CA  
2644 C C   . ASP C 51  ? 0.5586 0.5184 0.4925 -0.0150 0.0100  -0.0398 51  ASP C C   
2645 O O   . ASP C 51  ? 0.5746 0.5298 0.4955 -0.0186 0.0044  -0.0354 51  ASP C O   
2646 C CB  . ASP C 51  ? 0.5774 0.5256 0.5026 -0.0191 0.0221  -0.0575 51  ASP C CB  
2647 C CG  . ASP C 51  ? 0.5942 0.5403 0.5193 -0.0178 0.0295  -0.0796 51  ASP C CG  
2648 O OD1 . ASP C 51  ? 0.6132 0.5573 0.5295 -0.0288 0.0367  -0.0892 51  ASP C OD1 
2649 O OD2 . ASP C 51  ? 0.6099 0.5557 0.5432 -0.0079 0.0265  -0.0893 51  ASP C OD2 
2650 N N   . LEU C 52  ? 0.5399 0.5079 0.4912 -0.0146 0.0082  -0.0356 52  LEU C N   
2651 C CA  . LEU C 52  ? 0.5296 0.5021 0.4870 -0.0182 -0.0002 -0.0297 52  LEU C CA  
2652 C C   . LEU C 52  ? 0.5277 0.5169 0.4879 -0.0193 0.0000  -0.0354 52  LEU C C   
2653 O O   . LEU C 52  ? 0.5404 0.5287 0.4900 -0.0249 -0.0044 -0.0328 52  LEU C O   
2654 C CB  . LEU C 52  ? 0.5337 0.5112 0.5194 -0.0173 -0.0075 -0.0297 52  LEU C CB  
2655 C CG  . LEU C 52  ? 0.5203 0.4903 0.5136 -0.0219 -0.0223 -0.0246 52  LEU C CG  
2656 C CD1 . LEU C 52  ? 0.4952 0.4469 0.4551 -0.0280 -0.0230 -0.0144 52  LEU C CD1 
2657 C CD2 . LEU C 52  ? 0.5610 0.5182 0.5686 -0.0241 -0.0342 -0.0186 52  LEU C CD2 
2658 N N   . GLU C 53  ? 0.5300 0.5344 0.5007 -0.0169 0.0053  -0.0433 53  GLU C N   
2659 C CA  . GLU C 53  ? 0.5591 0.5770 0.5223 -0.0257 0.0040  -0.0468 53  GLU C CA  
2660 C C   . GLU C 53  ? 0.5714 0.5660 0.5003 -0.0299 -0.0023 -0.0381 53  GLU C C   
2661 O O   . GLU C 53  ? 0.6089 0.6056 0.5216 -0.0413 -0.0076 -0.0357 53  GLU C O   
2662 C CB  . GLU C 53  ? 0.5632 0.6022 0.5423 -0.0254 0.0099  -0.0558 53  GLU C CB  
2663 C CG  . GLU C 53  ? 0.5825 0.6576 0.6049 -0.0252 0.0147  -0.0690 53  GLU C CG  
2664 C CD  . GLU C 53  ? 0.6195 0.7139 0.6618 -0.0194 0.0237  -0.0770 53  GLU C CD  
2665 O OE1 . GLU C 53  ? 0.6591 0.7887 0.7189 -0.0303 0.0275  -0.0882 53  GLU C OE1 
2666 O OE2 . GLU C 53  ? 0.6490 0.7256 0.6888 -0.0057 0.0282  -0.0744 53  GLU C OE2 
2667 N N   . THR C 54  ? 0.5592 0.5337 0.4801 -0.0226 -0.0030 -0.0367 54  THR C N   
2668 C CA  . THR C 54  ? 0.5643 0.5202 0.4658 -0.0253 -0.0127 -0.0330 54  THR C CA  
2669 C C   . THR C 54  ? 0.5570 0.5096 0.4479 -0.0298 -0.0148 -0.0250 54  THR C C   
2670 O O   . THR C 54  ? 0.5988 0.5453 0.4742 -0.0362 -0.0231 -0.0197 54  THR C O   
2671 C CB  . THR C 54  ? 0.5630 0.5059 0.4693 -0.0180 -0.0127 -0.0423 54  THR C CB  
2672 O OG1 . THR C 54  ? 0.5768 0.5203 0.4928 -0.0119 -0.0112 -0.0522 54  THR C OG1 
2673 C CG2 . THR C 54  ? 0.5707 0.4991 0.4696 -0.0207 -0.0263 -0.0432 54  THR C CG2 
2674 N N   . ALA C 55  ? 0.5328 0.4874 0.4307 -0.0275 -0.0088 -0.0234 55  ALA C N   
2675 C CA  . ALA C 55  ? 0.5263 0.4766 0.4149 -0.0307 -0.0107 -0.0163 55  ALA C CA  
2676 C C   . ALA C 55  ? 0.5334 0.4927 0.4184 -0.0360 -0.0130 -0.0161 55  ALA C C   
2677 O O   . ALA C 55  ? 0.5307 0.4853 0.4014 -0.0391 -0.0156 -0.0119 55  ALA C O   
2678 C CB  . ALA C 55  ? 0.5183 0.4652 0.4127 -0.0308 -0.0080 -0.0132 55  ALA C CB  
2679 N N   . LEU C 56  ? 0.5317 0.5080 0.4327 -0.0383 -0.0110 -0.0244 56  LEU C N   
2680 C CA  . LEU C 56  ? 0.5454 0.5379 0.4480 -0.0480 -0.0118 -0.0330 56  LEU C CA  
2681 C C   . LEU C 56  ? 0.5850 0.5772 0.4612 -0.0607 -0.0146 -0.0309 56  LEU C C   
2682 O O   . LEU C 56  ? 0.6172 0.6099 0.4763 -0.0701 -0.0162 -0.0321 56  LEU C O   
2683 C CB  . LEU C 56  ? 0.5384 0.5578 0.4749 -0.0502 -0.0097 -0.0489 56  LEU C CB  
2684 C CG  . LEU C 56  ? 0.5100 0.5278 0.4756 -0.0422 -0.0151 -0.0533 56  LEU C CG  
2685 C CD1 . LEU C 56  ? 0.4667 0.5095 0.4755 -0.0406 -0.0163 -0.0679 56  LEU C CD1 
2686 C CD2 . LEU C 56  ? 0.4695 0.4879 0.4350 -0.0467 -0.0199 -0.0619 56  LEU C CD2 
2687 N N   . ARG C 57  ? 0.6113 0.5998 0.4824 -0.0620 -0.0174 -0.0277 57  ARG C N   
2688 C CA  . ARG C 57  ? 0.6797 0.6626 0.5235 -0.0782 -0.0266 -0.0229 57  ARG C CA  
2689 C C   . ARG C 57  ? 0.6838 0.6420 0.5046 -0.0783 -0.0374 -0.0111 57  ARG C C   
2690 O O   . ARG C 57  ? 0.7165 0.6708 0.5116 -0.0948 -0.0450 -0.0069 57  ARG C O   
2691 C CB  . ARG C 57  ? 0.6905 0.6676 0.5370 -0.0764 -0.0316 -0.0215 57  ARG C CB  
2692 C CG  . ARG C 57  ? 0.7684 0.7380 0.5863 -0.0976 -0.0458 -0.0152 57  ARG C CG  
2693 C CD  . ARG C 57  ? 0.8161 0.7673 0.6363 -0.0913 -0.0569 -0.0124 57  ARG C CD  
2694 N NE  . ARG C 57  ? 0.8540 0.7714 0.6679 -0.0830 -0.0754 -0.0052 57  ARG C NE  
2695 C CZ  . ARG C 57  ? 0.8289 0.7353 0.6655 -0.0625 -0.0751 -0.0124 57  ARG C CZ  
2696 N NH1 . ARG C 57  ? 0.7915 0.7123 0.6505 -0.0487 -0.0573 -0.0229 57  ARG C NH1 
2697 N NH2 . ARG C 57  ? 0.9118 0.7950 0.7508 -0.0583 -0.0936 -0.0119 57  ARG C NH2 
2698 N N   . GLU C 58  ? 0.6618 0.6061 0.4941 -0.0619 -0.0382 -0.0077 58  GLU C N   
2699 C CA  . GLU C 58  ? 0.6652 0.5928 0.4890 -0.0599 -0.0486 -0.0008 58  GLU C CA  
2700 C C   . GLU C 58  ? 0.6415 0.5743 0.4587 -0.0601 -0.0417 0.0014  58  GLU C C   
2701 O O   . GLU C 58  ? 0.6464 0.5704 0.4531 -0.0623 -0.0498 0.0073  58  GLU C O   
2702 C CB  . GLU C 58  ? 0.6478 0.5683 0.4922 -0.0467 -0.0501 -0.0055 58  GLU C CB  
2703 C CG  . GLU C 58  ? 0.6967 0.6033 0.5426 -0.0471 -0.0678 -0.0040 58  GLU C CG  
2704 C CD  . GLU C 58  ? 0.7552 0.6451 0.6037 -0.0496 -0.0878 -0.0068 58  GLU C CD  
2705 O OE1 . GLU C 58  ? 0.7501 0.6413 0.6111 -0.0435 -0.0831 -0.0165 58  GLU C OE1 
2706 O OE2 . GLU C 58  ? 0.8531 0.7263 0.6916 -0.0579 -0.1101 0.0003  58  GLU C OE2 
2707 N N   . THR C 59  ? 0.6126 0.5587 0.4394 -0.0568 -0.0290 -0.0045 59  THR C N   
2708 C CA  . THR C 59  ? 0.6101 0.5599 0.4310 -0.0572 -0.0238 -0.0058 59  THR C CA  
2709 C C   . THR C 59  ? 0.6575 0.6125 0.4557 -0.0742 -0.0263 -0.0099 59  THR C C   
2710 O O   . THR C 59  ? 0.6590 0.6082 0.4413 -0.0768 -0.0278 -0.0063 59  THR C O   
2711 C CB  . THR C 59  ? 0.5897 0.5477 0.4302 -0.0508 -0.0166 -0.0133 59  THR C CB  
2712 O OG1 . THR C 59  ? 0.5768 0.5257 0.4265 -0.0411 -0.0156 -0.0058 59  THR C OG1 
2713 C CG2 . THR C 59  ? 0.5753 0.5369 0.4119 -0.0523 -0.0136 -0.0207 59  THR C CG2 
2714 N N   . GLN C 60  ? 0.7052 0.6739 0.5013 -0.0886 -0.0261 -0.0185 60  GLN C N   
2715 C CA  . GLN C 60  ? 0.7823 0.7573 0.5490 -0.1142 -0.0300 -0.0224 60  GLN C CA  
2716 C C   . GLN C 60  ? 0.8223 0.7716 0.5602 -0.1220 -0.0472 -0.0038 60  GLN C C   
2717 O O   . GLN C 60  ? 0.8562 0.7987 0.5686 -0.1338 -0.0515 -0.0005 60  GLN C O   
2718 C CB  . GLN C 60  ? 0.8360 0.8380 0.6095 -0.1327 -0.0259 -0.0377 60  GLN C CB  
2719 C CG  . GLN C 60  ? 0.9816 0.9835 0.7202 -0.1638 -0.0362 -0.0325 60  GLN C CG  
2720 C CD  . GLN C 60  ? 1.1265 1.1312 0.8258 -0.1932 -0.0381 -0.0372 60  GLN C CD  
2721 O OE1 . GLN C 60  ? 1.1627 1.1927 0.8682 -0.2021 -0.0251 -0.0608 60  GLN C OE1 
2722 N NE2 . GLN C 60  ? 1.2095 1.1866 0.8691 -0.2100 -0.0569 -0.0168 60  GLN C NE2 
2723 N N   . GLU C 61  ? 0.8290 0.7625 0.5739 -0.1153 -0.0597 0.0062  61  GLU C N   
2724 C CA  . GLU C 61  ? 0.8889 0.7953 0.6152 -0.1224 -0.0832 0.0209  61  GLU C CA  
2725 C C   . GLU C 61  ? 0.8574 0.7556 0.5880 -0.1105 -0.0851 0.0257  61  GLU C C   
2726 O O   . GLU C 61  ? 0.9148 0.8026 0.6204 -0.1246 -0.0960 0.0331  61  GLU C O   
2727 C CB  . GLU C 61  ? 0.9036 0.7929 0.6469 -0.1130 -0.0991 0.0247  61  GLU C CB  
2728 C CG  . GLU C 61  ? 1.0236 0.9166 0.7550 -0.1298 -0.1031 0.0237  61  GLU C CG  
2729 C CD  . GLU C 61  ? 1.1118 0.9874 0.8628 -0.1173 -0.1172 0.0233  61  GLU C CD  
2730 O OE1 . GLU C 61  ? 1.1031 0.9914 0.8600 -0.1190 -0.1089 0.0172  61  GLU C OE1 
2731 O OE2 . GLU C 61  ? 1.1977 1.0498 0.9628 -0.1059 -0.1367 0.0251  61  GLU C OE2 
2732 N N   . GLU C 62  ? 0.7874 0.6923 0.5483 -0.0874 -0.0739 0.0212  62  GLU C N   
2733 C CA  . GLU C 62  ? 0.7598 0.6627 0.5313 -0.0765 -0.0753 0.0244  62  GLU C CA  
2734 C C   . GLU C 62  ? 0.7350 0.6467 0.4910 -0.0785 -0.0622 0.0231  62  GLU C C   
2735 O O   . GLU C 62  ? 0.7512 0.6568 0.5009 -0.0798 -0.0703 0.0290  62  GLU C O   
2736 C CB  . GLU C 62  ? 0.7082 0.6197 0.5143 -0.0578 -0.0674 0.0183  62  GLU C CB  
2737 C CG  . GLU C 62  ? 0.7555 0.6596 0.5819 -0.0541 -0.0797 0.0132  62  GLU C CG  
2738 C CD  . GLU C 62  ? 0.8544 0.7423 0.6901 -0.0569 -0.1076 0.0149  62  GLU C CD  
2739 O OE1 . GLU C 62  ? 0.9057 0.7954 0.7755 -0.0486 -0.1169 0.0027  62  GLU C OE1 
2740 O OE2 . GLU C 62  ? 0.9522 0.8257 0.7631 -0.0697 -0.1228 0.0262  62  GLU C OE2 
2741 N N   . ALA C 63  ? 0.6971 0.6231 0.4520 -0.0776 -0.0438 0.0129  63  ALA C N   
2742 C CA  . ALA C 63  ? 0.6851 0.6189 0.4313 -0.0766 -0.0313 0.0058  63  ALA C CA  
2743 C C   . ALA C 63  ? 0.7390 0.6828 0.4631 -0.0968 -0.0256 -0.0085 63  ALA C C   
2744 O O   . ALA C 63  ? 0.7465 0.6986 0.4651 -0.0975 -0.0147 -0.0219 63  ALA C O   
2745 C CB  . ALA C 63  ? 0.6265 0.5680 0.3970 -0.0591 -0.0186 0.0006  63  ALA C CB  
2746 N N   . GLY C 64  ? 0.7907 0.7373 0.5051 -0.1144 -0.0323 -0.0098 64  GLY C N   
2747 C CA  . GLY C 64  ? 0.8566 0.8213 0.5514 -0.1414 -0.0269 -0.0279 64  GLY C CA  
2748 C C   . GLY C 64  ? 0.8454 0.8351 0.5671 -0.1370 -0.0118 -0.0550 64  GLY C C   
2749 O O   . GLY C 64  ? 0.8915 0.9019 0.6033 -0.1588 -0.0048 -0.0796 64  GLY C O   
2750 N N   . ILE C 65  ? 0.7994 0.7873 0.5567 -0.1118 -0.0093 -0.0532 65  ILE C N   
2751 C CA  . ILE C 65  ? 0.7974 0.8043 0.5891 -0.1067 -0.0032 -0.0774 65  ILE C CA  
2752 C C   . ILE C 65  ? 0.8346 0.8590 0.6491 -0.1128 -0.0052 -0.0834 65  ILE C C   
2753 O O   . ILE C 65  ? 0.8260 0.8386 0.6419 -0.1043 -0.0097 -0.0640 65  ILE C O   
2754 C CB  . ILE C 65  ? 0.7391 0.7308 0.5533 -0.0804 -0.0035 -0.0707 65  ILE C CB  
2755 C CG1 . ILE C 65  ? 0.7164 0.6962 0.5113 -0.0742 0.0005  -0.0664 65  ILE C CG1 
2756 C CG2 . ILE C 65  ? 0.7324 0.7366 0.5841 -0.0760 -0.0052 -0.0956 65  ILE C CG2 
2757 C CD1 . ILE C 65  ? 0.6221 0.5873 0.4334 -0.0526 -0.0002 -0.0554 65  ILE C CD1 
2758 N N   . GLU C 66  ? 0.8819 0.9382 0.7183 -0.1281 -0.0015 -0.1144 66  GLU C N   
2759 C CA  . GLU C 66  ? 0.9241 1.0052 0.7867 -0.1358 -0.0018 -0.1234 66  GLU C CA  
2760 C C   . GLU C 66  ? 0.8954 0.9872 0.8138 -0.1178 -0.0053 -0.1383 66  GLU C C   
2761 O O   . GLU C 66  ? 0.8989 0.9879 0.8390 -0.1085 -0.0091 -0.1538 66  GLU C O   
2762 C CB  . GLU C 66  ? 1.0359 1.1549 0.8884 -0.1729 0.0033  -0.1494 66  GLU C CB  
2763 C CG  . GLU C 66  ? 1.2013 1.3328 1.0362 -0.1929 0.0086  -0.1755 66  GLU C CG  
2764 C CD  . GLU C 66  ? 1.4402 1.5936 1.2335 -0.2372 0.0122  -0.1851 66  GLU C CD  
2765 O OE1 . GLU C 66  ? 1.5031 1.6334 1.2440 -0.2500 0.0104  -0.1698 66  GLU C OE1 
2766 O OE2 . GLU C 66  ? 1.5518 1.7467 1.3648 -0.2615 0.0159  -0.2079 66  GLU C OE2 
2767 N N   . ALA C 67  ? 0.9441 0.9069 0.7754 0.0277  0.0512  -0.0825 67  ALA C N   
2768 C CA  . ALA C 67  ? 0.9081 0.8822 0.7736 0.0234  0.0394  -0.0962 67  ALA C CA  
2769 C C   . ALA C 67  ? 0.9002 0.8743 0.7808 0.0118  0.0354  -0.1141 67  ALA C C   
2770 O O   . ALA C 67  ? 0.8742 0.8388 0.7771 0.0059  0.0296  -0.1193 67  ALA C O   
2771 C CB  . ALA C 67  ? 0.9324 0.9414 0.8148 0.0302  0.0297  -0.1040 67  ALA C CB  
2772 N N   . GLY C 68  ? 0.9309 0.9157 0.7991 0.0081  0.0382  -0.1233 68  GLY C N   
2773 C CA  . GLY C 68  ? 0.9214 0.9084 0.8038 -0.0032 0.0336  -0.1435 68  GLY C CA  
2774 C C   . GLY C 68  ? 0.8867 0.8368 0.7635 -0.0092 0.0401  -0.1396 68  GLY C C   
2775 O O   . GLY C 68  ? 0.8728 0.8183 0.7709 -0.0178 0.0332  -0.1541 68  GLY C O   
2776 N N   . GLN C 69  ? 0.8745 0.7997 0.7248 -0.0040 0.0531  -0.1203 69  GLN C N   
2777 C CA  . GLN C 69  ? 0.8452 0.7375 0.6876 -0.0079 0.0619  -0.1163 69  GLN C CA  
2778 C C   . GLN C 69  ? 0.7877 0.6657 0.6460 -0.0070 0.0592  -0.1083 69  GLN C C   
2779 O O   . GLN C 69  ? 0.7772 0.6321 0.6318 -0.0098 0.0658  -0.1064 69  GLN C O   
2780 C CB  . GLN C 69  ? 0.8765 0.7512 0.6874 -0.0028 0.0773  -0.1009 69  GLN C CB  
2781 C CG  . GLN C 69  ? 0.9482 0.8296 0.7403 -0.0062 0.0830  -0.1073 69  GLN C CG  
2782 C CD  . GLN C 69  ? 1.0256 0.8951 0.7901 0.0005  0.0963  -0.0878 69  GLN C CD  
2783 O OE1 . GLN C 69  ? 1.1078 0.9729 0.8546 -0.0029 0.1048  -0.0892 69  GLN C OE1 
2784 N NE2 . GLN C 69  ? 0.9886 0.8533 0.7508 0.0097  0.0976  -0.0698 69  GLN C NE2 
2785 N N   . LEU C 70  ? 0.7552 0.6489 0.6317 -0.0032 0.0497  -0.1044 70  LEU C N   
2786 C CA  . LEU C 70  ? 0.7010 0.5854 0.5929 -0.0031 0.0466  -0.0956 70  LEU C CA  
2787 C C   . LEU C 70  ? 0.6803 0.5808 0.6072 -0.0085 0.0313  -0.1070 70  LEU C C   
2788 O O   . LEU C 70  ? 0.6948 0.6175 0.6354 -0.0097 0.0228  -0.1205 70  LEU C O   
2789 C CB  . LEU C 70  ? 0.6846 0.5726 0.5683 0.0065  0.0491  -0.0787 70  LEU C CB  
2790 C CG  . LEU C 70  ? 0.7014 0.5804 0.5554 0.0143  0.0611  -0.0659 70  LEU C CG  
2791 C CD1 . LEU C 70  ? 0.7076 0.5994 0.5598 0.0232  0.0581  -0.0564 70  LEU C CD1 
2792 C CD2 . LEU C 70  ? 0.7064 0.5617 0.5513 0.0142  0.0713  -0.0566 70  LEU C CD2 
2793 N N   . THR C 71  ? 0.6491 0.5403 0.5923 -0.0117 0.0277  -0.1008 71  THR C N   
2794 C CA  . THR C 71  ? 0.6238 0.5285 0.6034 -0.0164 0.0131  -0.1063 71  THR C CA  
2795 C C   . THR C 71  ? 0.5979 0.5016 0.5819 -0.0126 0.0132  -0.0891 71  THR C C   
2796 O O   . THR C 71  ? 0.5845 0.4718 0.5556 -0.0127 0.0212  -0.0772 71  THR C O   
2797 C CB  . THR C 71  ? 0.6175 0.5102 0.6144 -0.0268 0.0077  -0.1158 71  THR C CB  
2798 O OG1 . THR C 71  ? 0.6449 0.5369 0.6347 -0.0309 0.0087  -0.1333 71  THR C OG1 
2799 C CG2 . THR C 71  ? 0.5908 0.4969 0.6288 -0.0322 -0.0082 -0.1201 71  THR C CG2 
2800 N N   . ILE C 72  ? 0.5877 0.5114 0.5915 -0.0092 0.0045  -0.0890 72  ILE C N   
2801 C CA  . ILE C 72  ? 0.5618 0.4871 0.5722 -0.0066 0.0035  -0.0747 72  ILE C CA  
2802 C C   . ILE C 72  ? 0.5546 0.4769 0.5938 -0.0161 -0.0050 -0.0728 72  ILE C C   
2803 O O   . ILE C 72  ? 0.5850 0.5148 0.6519 -0.0219 -0.0158 -0.0846 72  ILE C O   
2804 C CB  . ILE C 72  ? 0.5708 0.5188 0.5941 0.0004  -0.0027 -0.0773 72  ILE C CB  
2805 C CG1 . ILE C 72  ? 0.5531 0.5042 0.5453 0.0108  0.0059  -0.0757 72  ILE C CG1 
2806 C CG2 . ILE C 72  ? 0.5493 0.5005 0.5876 0.0003  -0.0064 -0.0655 72  ILE C CG2 
2807 C CD1 . ILE C 72  ? 0.5291 0.4633 0.4927 0.0149  0.0170  -0.0604 72  ILE C CD1 
2808 N N   . ILE C 73  ? 0.5404 0.4534 0.5750 -0.0180 -0.0009 -0.0581 73  ILE C N   
2809 C CA  . ILE C 73  ? 0.5365 0.4462 0.5958 -0.0276 -0.0085 -0.0545 73  ILE C CA  
2810 C C   . ILE C 73  ? 0.5599 0.4857 0.6447 -0.0278 -0.0174 -0.0479 73  ILE C C   
2811 O O   . ILE C 73  ? 0.5667 0.4964 0.6397 -0.0232 -0.0123 -0.0368 73  ILE C O   
2812 C CB  . ILE C 73  ? 0.5176 0.4131 0.5593 -0.0299 0.0009  -0.0417 73  ILE C CB  
2813 C CG1 . ILE C 73  ? 0.4850 0.3624 0.5032 -0.0297 0.0110  -0.0491 73  ILE C CG1 
2814 C CG2 . ILE C 73  ? 0.5127 0.4099 0.5809 -0.0392 -0.0077 -0.0340 73  ILE C CG2 
2815 C CD1 . ILE C 73  ? 0.3848 0.2587 0.4122 -0.0339 0.0050  -0.0671 73  ILE C CD1 
2816 N N   . GLU C 74  ? 0.5999 0.5360 0.7220 -0.0332 -0.0311 -0.0556 74  GLU C N   
2817 C CA  . GLU C 74  ? 0.6299 0.5829 0.7829 -0.0335 -0.0405 -0.0506 74  GLU C CA  
2818 C C   . GLU C 74  ? 0.6140 0.5641 0.7730 -0.0400 -0.0407 -0.0312 74  GLU C C   
2819 O O   . GLU C 74  ? 0.6286 0.5670 0.7857 -0.0473 -0.0400 -0.0246 74  GLU C O   
2820 C CB  . GLU C 74  ? 0.6774 0.6436 0.8748 -0.0378 -0.0558 -0.0653 74  GLU C CB  
2821 C CG  . GLU C 74  ? 0.7737 0.7521 0.9696 -0.0312 -0.0567 -0.0863 74  GLU C CG  
2822 C CD  . GLU C 74  ? 0.8946 0.8832 1.1312 -0.0378 -0.0712 -0.1053 74  GLU C CD  
2823 O OE1 . GLU C 74  ? 0.9154 0.8898 1.1528 -0.0459 -0.0736 -0.1098 74  GLU C OE1 
2824 O OE2 . GLU C 74  ? 0.9474 0.9599 1.2167 -0.0344 -0.0805 -0.1178 74  GLU C OE2 
2825 N N   . GLY C 75  ? 0.5989 0.5614 0.7649 -0.0372 -0.0417 -0.0228 75  GLY C N   
2826 C CA  . GLY C 75  ? 0.5730 0.5383 0.7469 -0.0440 -0.0426 -0.0044 75  GLY C CA  
2827 C C   . GLY C 75  ? 0.5358 0.4986 0.6755 -0.0414 -0.0303 0.0074  75  GLY C C   
2828 O O   . GLY C 75  ? 0.5688 0.5387 0.7150 -0.0474 -0.0311 0.0216  75  GLY C O   
2829 N N   . PHE C 76  ? 0.4843 0.4392 0.5902 -0.0330 -0.0195 0.0017  76  PHE C N   
2830 C CA  . PHE C 76  ? 0.4474 0.4019 0.5260 -0.0301 -0.0089 0.0109  76  PHE C CA  
2831 C C   . PHE C 76  ? 0.4467 0.4044 0.5054 -0.0188 -0.0038 0.0053  76  PHE C C   
2832 O O   . PHE C 76  ? 0.4895 0.4429 0.5400 -0.0119 -0.0028 -0.0055 76  PHE C O   
2833 C CB  . PHE C 76  ? 0.4264 0.3666 0.4836 -0.0312 0.0002  0.0116  76  PHE C CB  
2834 C CG  . PHE C 76  ? 0.3785 0.3214 0.4125 -0.0277 0.0108  0.0186  76  PHE C CG  
2835 C CD1 . PHE C 76  ? 0.3320 0.2852 0.3710 -0.0345 0.0120  0.0304  76  PHE C CD1 
2836 C CD2 . PHE C 76  ? 0.3328 0.2706 0.3423 -0.0176 0.0190  0.0133  76  PHE C CD2 
2837 C CE1 . PHE C 76  ? 0.3024 0.2630 0.3246 -0.0313 0.0208  0.0342  76  PHE C CE1 
2838 C CE2 . PHE C 76  ? 0.3025 0.2446 0.2958 -0.0143 0.0274  0.0182  76  PHE C CE2 
2839 C CZ  . PHE C 76  ? 0.3264 0.2810 0.3271 -0.0211 0.0282  0.0274  76  PHE C CZ  
2840 N N   . LYS C 77  ? 0.4333 0.4001 0.4844 -0.0172 -0.0008 0.0125  77  LYS C N   
2841 C CA  . LYS C 77  ? 0.4259 0.3955 0.4591 -0.0068 0.0029  0.0077  77  LYS C CA  
2842 C C   . LYS C 77  ? 0.4270 0.4048 0.4509 -0.0087 0.0073  0.0166  77  LYS C C   
2843 O O   . LYS C 77  ? 0.4193 0.4076 0.4586 -0.0176 0.0038  0.0253  77  LYS C O   
2844 C CB  . LYS C 77  ? 0.4338 0.4150 0.4874 -0.0036 -0.0055 0.0013  77  LYS C CB  
2845 C CG  . LYS C 77  ? 0.4443 0.4286 0.4827 0.0086  -0.0033 -0.0070 77  LYS C CG  
2846 C CD  . LYS C 77  ? 0.5057 0.5055 0.5699 0.0096  -0.0116 -0.0112 77  LYS C CD  
2847 C CE  . LYS C 77  ? 0.5681 0.5743 0.6267 0.0224  -0.0122 -0.0236 77  LYS C CE  
2848 N NZ  . LYS C 77  ? 0.6285 0.6507 0.7146 0.0231  -0.0193 -0.0278 77  LYS C NZ  
2849 N N   . ARG C 78  ? 0.4309 0.4059 0.4315 -0.0009 0.0143  0.0145  78  ARG C N   
2850 C CA  . ARG C 78  ? 0.4579 0.4447 0.4533 -0.0028 0.0172  0.0199  78  ARG C CA  
2851 C C   . ARG C 78  ? 0.4864 0.4734 0.4659 0.0076  0.0189  0.0135  78  ARG C C   
2852 O O   . ARG C 78  ? 0.4980 0.4723 0.4622 0.0164  0.0222  0.0082  78  ARG C O   
2853 C CB  . ARG C 78  ? 0.4512 0.4350 0.4372 -0.0058 0.0252  0.0243  78  ARG C CB  
2854 C CG  . ARG C 78  ? 0.4806 0.4775 0.4816 -0.0174 0.0239  0.0337  78  ARG C CG  
2855 C CD  . ARG C 78  ? 0.5287 0.5371 0.5531 -0.0257 0.0140  0.0397  78  ARG C CD  
2856 N NE  . ARG C 78  ? 0.5261 0.5299 0.5670 -0.0342 0.0099  0.0457  78  ARG C NE  
2857 C CZ  . ARG C 78  ? 0.5061 0.5228 0.5588 -0.0444 0.0084  0.0569  78  ARG C CZ  
2858 N NH1 . ARG C 78  ? 0.5208 0.5582 0.5708 -0.0477 0.0108  0.0626  78  ARG C NH1 
2859 N NH2 . ARG C 78  ? 0.5086 0.5192 0.5762 -0.0513 0.0039  0.0619  78  ARG C NH2 
2860 N N   . GLU C 79  ? 0.5137 0.5158 0.4967 0.0065  0.0163  0.0139  79  GLU C N   
2861 C CA  . GLU C 79  ? 0.5538 0.5562 0.5228 0.0165  0.0166  0.0066  79  GLU C CA  
2862 C C   . GLU C 79  ? 0.5669 0.5788 0.5287 0.0157  0.0200  0.0069  79  GLU C C   
2863 O O   . GLU C 79  ? 0.5826 0.6125 0.5551 0.0073  0.0181  0.0102  79  GLU C O   
2864 C CB  . GLU C 79  ? 0.5719 0.5845 0.5522 0.0179  0.0096  0.0018  79  GLU C CB  
2865 C CG  . GLU C 79  ? 0.6183 0.6336 0.5864 0.0273  0.0086  -0.0065 79  GLU C CG  
2866 C CD  . GLU C 79  ? 0.7174 0.7401 0.6973 0.0309  0.0024  -0.0135 79  GLU C CD  
2867 O OE1 . GLU C 79  ? 0.7703 0.7896 0.7614 0.0323  0.0001  -0.0150 79  GLU C OE1 
2868 O OE2 . GLU C 79  ? 0.7490 0.7821 0.7291 0.0323  -0.0002 -0.0191 79  GLU C OE2 
2869 N N   . LEU C 80  ? 0.5811 0.5830 0.5269 0.0244  0.0244  0.0033  80  LEU C N   
2870 C CA  . LEU C 80  ? 0.5962 0.6089 0.5400 0.0243  0.0264  0.0012  80  LEU C CA  
2871 C C   . LEU C 80  ? 0.6455 0.6621 0.5834 0.0317  0.0216  -0.0070 80  LEU C C   
2872 O O   . LEU C 80  ? 0.6439 0.6466 0.5701 0.0417  0.0208  -0.0105 80  LEU C O   
2873 C CB  . LEU C 80  ? 0.5785 0.5794 0.5142 0.0284  0.0340  0.0024  80  LEU C CB  
2874 C CG  . LEU C 80  ? 0.5184 0.5183 0.4607 0.0208  0.0393  0.0086  80  LEU C CG  
2875 C CD1 . LEU C 80  ? 0.5004 0.4849 0.4408 0.0203  0.0383  0.0111  80  LEU C CD1 
2876 C CD2 . LEU C 80  ? 0.4961 0.4877 0.4332 0.0253  0.0471  0.0076  80  LEU C CD2 
2877 N N   . ASN C 81  ? 0.7083 0.7460 0.6550 0.0261  0.0180  -0.0106 81  ASN C N   
2878 C CA  . ASN C 81  ? 0.7810 0.8254 0.7239 0.0316  0.0128  -0.0209 81  ASN C CA  
2879 C C   . ASN C 81  ? 0.8147 0.8730 0.7620 0.0296  0.0140  -0.0250 81  ASN C C   
2880 O O   . ASN C 81  ? 0.8170 0.8967 0.7766 0.0194  0.0149  -0.0230 81  ASN C O   
2881 C CB  . ASN C 81  ? 0.7882 0.8496 0.7410 0.0254  0.0069  -0.0243 81  ASN C CB  
2882 C CG  . ASN C 81  ? 0.8447 0.8950 0.7968 0.0307  0.0041  -0.0254 81  ASN C CG  
2883 O OD1 . ASN C 81  ? 0.9055 0.9440 0.8462 0.0424  0.0026  -0.0324 81  ASN C OD1 
2884 N ND2 . ASN C 81  ? 0.8601 0.9160 0.8264 0.0224  0.0030  -0.0188 81  ASN C ND2 
2885 N N   . TYR C 82  ? 0.8922 0.9407 0.8319 0.0392  0.0136  -0.0308 82  TYR C N   
2886 C CA  . TYR C 82  ? 0.9415 1.0046 0.8907 0.0382  0.0136  -0.0368 82  TYR C CA  
2887 C C   . TYR C 82  ? 1.0053 1.0602 0.9486 0.0487  0.0083  -0.0460 82  TYR C C   
2888 O O   . TYR C 82  ? 1.0239 1.0610 0.9532 0.0571  0.0057  -0.0462 82  TYR C O   
2889 C CB  . TYR C 82  ? 0.9180 0.9756 0.8714 0.0376  0.0221  -0.0299 82  TYR C CB  
2890 C CG  . TYR C 82  ? 0.9218 0.9487 0.8610 0.0470  0.0269  -0.0235 82  TYR C CG  
2891 C CD1 . TYR C 82  ? 0.9372 0.9522 0.8732 0.0565  0.0267  -0.0261 82  TYR C CD1 
2892 C CD2 . TYR C 82  ? 0.9246 0.9360 0.8554 0.0457  0.0312  -0.0147 82  TYR C CD2 
2893 C CE1 . TYR C 82  ? 0.9381 0.9272 0.8607 0.0641  0.0314  -0.0187 82  TYR C CE1 
2894 C CE2 . TYR C 82  ? 0.8969 0.8838 0.8147 0.0532  0.0357  -0.0098 82  TYR C CE2 
2895 C CZ  . TYR C 82  ? 0.9086 0.8849 0.8214 0.0621  0.0361  -0.0111 82  TYR C CZ  
2896 O OH  . TYR C 82  ? 0.9265 0.8804 0.8259 0.0688  0.0407  -0.0047 82  TYR C OH  
2897 N N   . VAL C 83  ? 1.0725 1.1428 1.0288 0.0481  0.0059  -0.0545 83  VAL C N   
2898 C CA  . VAL C 83  ? 1.1532 1.2154 1.1080 0.0579  -0.0001 -0.0632 83  VAL C CA  
2899 C C   . VAL C 83  ? 1.1811 1.2332 1.1430 0.0628  0.0050  -0.0586 83  VAL C C   
2900 O O   . VAL C 83  ? 1.1547 1.2238 1.1335 0.0569  0.0095  -0.0593 83  VAL C O   
2901 C CB  . VAL C 83  ? 1.1735 1.2633 1.1423 0.0536  -0.0092 -0.0800 83  VAL C CB  
2902 C CG1 . VAL C 83  ? 1.2633 1.3458 1.2365 0.0631  -0.0163 -0.0895 83  VAL C CG1 
2903 C CG2 . VAL C 83  ? 1.1713 1.2667 1.1314 0.0506  -0.0143 -0.0852 83  VAL C CG2 
2904 N N   . ALA C 84  ? 1.2571 1.2829 1.2069 0.0737  0.0048  -0.0536 84  ALA C N   
2905 C CA  . ALA C 84  ? 1.3110 1.3238 1.2672 0.0787  0.0104  -0.0473 84  ALA C CA  
2906 C C   . ALA C 84  ? 1.3934 1.3953 1.3528 0.0886  0.0033  -0.0507 84  ALA C C   
2907 O O   . ALA C 84  ? 1.4156 1.4005 1.3567 0.0963  -0.0011 -0.0481 84  ALA C O   
2908 C CB  . ALA C 84  ? 1.3009 1.2898 1.2395 0.0808  0.0196  -0.0326 84  ALA C CB  
2909 N N   . ARG C 85  ? 1.4615 1.4744 1.4462 0.0888  0.0023  -0.0567 85  ARG C N   
2910 C CA  . ARG C 85  ? 1.5730 1.5779 1.5683 0.0974  -0.0058 -0.0607 85  ARG C CA  
2911 C C   . ARG C 85  ? 1.6050 1.6130 1.5917 0.1002  -0.0182 -0.0714 85  ARG C C   
2912 O O   . ARG C 85  ? 1.6586 1.6473 1.6348 0.1097  -0.0244 -0.0684 85  ARG C O   
2913 C CB  . ARG C 85  ? 1.6453 1.6181 1.6276 0.1063  -0.0005 -0.0438 85  ARG C CB  
2914 N N   . ASN C 86  ? 1.5787 1.6119 1.5695 0.0917  -0.0215 -0.0837 86  ASN C N   
2915 C CA  . ASN C 86  ? 1.6043 1.6449 1.5889 0.0925  -0.0325 -0.0974 86  ASN C CA  
2916 C C   . ASN C 86  ? 1.5737 1.5929 1.5276 0.0992  -0.0330 -0.0912 86  ASN C C   
2917 O O   . ASN C 86  ? 1.6165 1.6333 1.5638 0.1048  -0.0425 -0.1015 86  ASN C O   
2918 C CB  . ASN C 86  ? 1.6999 1.7468 1.7051 0.0972  -0.0449 -0.1118 86  ASN C CB  
2919 C CG  . ASN C 86  ? 1.7587 1.8434 1.7967 0.0875  -0.0489 -0.1291 86  ASN C CG  
2920 O OD1 . ASN C 86  ? 1.8084 1.9178 1.8492 0.0798  -0.0542 -0.1437 86  ASN C OD1 
2921 N ND2 . ASN C 86  ? 1.8258 1.9178 1.8904 0.0876  -0.0460 -0.1281 86  ASN C ND2 
2922 N N   . LYS C 87  ? 1.4907 1.4965 1.4278 0.0988  -0.0230 -0.0762 87  LYS C N   
2923 C CA  . LYS C 87  ? 1.3992 1.3932 1.3126 0.1032  -0.0224 -0.0725 87  LYS C CA  
2924 C C   . LYS C 87  ? 1.2698 1.2724 1.1820 0.0934  -0.0144 -0.0668 87  LYS C C   
2925 O O   . LYS C 87  ? 1.2368 1.2432 1.1582 0.0868  -0.0070 -0.0596 87  LYS C O   
2926 C CB  . LYS C 87  ? 1.4299 1.3975 1.3251 0.1146  -0.0199 -0.0593 87  LYS C CB  
2927 N N   . PRO C 88  ? 1.2054 1.2121 1.1089 0.0924  -0.0161 -0.0708 88  PRO C N   
2928 C CA  . PRO C 88  ? 1.1178 1.1327 1.0236 0.0829  -0.0102 -0.0651 88  PRO C CA  
2929 C C   . PRO C 88  ? 1.0575 1.0546 0.9499 0.0869  -0.0039 -0.0529 88  PRO C C   
2930 O O   . PRO C 88  ? 1.0703 1.0586 0.9504 0.0956  -0.0062 -0.0545 88  PRO C O   
2931 C CB  . PRO C 88  ? 1.1264 1.1574 1.0353 0.0794  -0.0165 -0.0775 88  PRO C CB  
2932 C CG  . PRO C 88  ? 1.1908 1.2131 1.0898 0.0913  -0.0240 -0.0878 88  PRO C CG  
2933 C CD  . PRO C 88  ? 1.2305 1.2441 1.1317 0.0964  -0.0257 -0.0862 88  PRO C CD  
2934 N N   . LYS C 89  ? 0.9693 0.9641 0.8660 0.0803  0.0037  -0.0425 89  LYS C N   
2935 C CA  . LYS C 89  ? 0.9061 0.8852 0.7927 0.0826  0.0098  -0.0321 89  LYS C CA  
2936 C C   . LYS C 89  ? 0.8445 0.8316 0.7385 0.0734  0.0119  -0.0294 89  LYS C C   
2937 O O   . LYS C 89  ? 0.8554 0.8577 0.7628 0.0630  0.0123  -0.0296 89  LYS C O   
2938 C CB  . LYS C 89  ? 0.8955 0.8632 0.7819 0.0824  0.0170  -0.0232 89  LYS C CB  
2939 C CG  . LYS C 89  ? 0.9292 0.8962 0.8210 0.0867  0.0150  -0.0261 89  LYS C CG  
2940 C CD  . LYS C 89  ? 1.0066 0.9533 0.8843 0.0982  0.0149  -0.0201 89  LYS C CD  
2941 C CE  . LYS C 89  ? 1.0933 1.0406 0.9666 0.1068  0.0051  -0.0281 89  LYS C CE  
2942 N NZ  . LYS C 89  ? 1.1620 1.0934 1.0301 0.1162  0.0037  -0.0217 89  LYS C NZ  
2943 N N   . THR C 90  ? 0.7925 0.7716 0.6799 0.0771  0.0126  -0.0269 90  THR C N   
2944 C CA  . THR C 90  ? 0.6893 0.6737 0.5871 0.0690  0.0137  -0.0239 90  THR C CA  
2945 C C   . THR C 90  ? 0.6444 0.6148 0.5357 0.0701  0.0191  -0.0168 90  THR C C   
2946 O O   . THR C 90  ? 0.6577 0.6189 0.5363 0.0793  0.0195  -0.0171 90  THR C O   
2947 C CB  . THR C 90  ? 0.7025 0.6951 0.6051 0.0720  0.0079  -0.0315 90  THR C CB  
2948 O OG1 . THR C 90  ? 0.7304 0.7372 0.6400 0.0688  0.0033  -0.0388 90  THR C OG1 
2949 C CG2 . THR C 90  ? 0.6418 0.6388 0.5592 0.0646  0.0080  -0.0282 90  THR C CG2 
2950 N N   . VAL C 91  ? 0.5715 0.5418 0.4716 0.0605  0.0232  -0.0110 91  VAL C N   
2951 C CA  . VAL C 91  ? 0.5286 0.4860 0.4235 0.0604  0.0280  -0.0064 91  VAL C CA  
2952 C C   . VAL C 91  ? 0.5156 0.4779 0.4258 0.0513  0.0265  -0.0051 91  VAL C C   
2953 O O   . VAL C 91  ? 0.5014 0.4736 0.4251 0.0420  0.0255  -0.0025 91  VAL C O   
2954 C CB  . VAL C 91  ? 0.5168 0.4645 0.4069 0.0586  0.0355  -0.0009 91  VAL C CB  
2955 C CG1 . VAL C 91  ? 0.4649 0.3972 0.3447 0.0609  0.0407  0.0020  91  VAL C CG1 
2956 C CG2 . VAL C 91  ? 0.4962 0.4432 0.3802 0.0652  0.0355  -0.0022 91  VAL C CG2 
2957 N N   . ILE C 92  ? 0.5120 0.4692 0.4217 0.0534  0.0258  -0.0070 92  ILE C N   
2958 C CA  . ILE C 92  ? 0.4910 0.4519 0.4186 0.0446  0.0232  -0.0066 92  ILE C CA  
2959 C C   . ILE C 92  ? 0.4839 0.4316 0.4058 0.0419  0.0285  -0.0046 92  ILE C C   
2960 O O   . ILE C 92  ? 0.5018 0.4418 0.4099 0.0485  0.0312  -0.0070 92  ILE C O   
2961 C CB  . ILE C 92  ? 0.4996 0.4700 0.4396 0.0480  0.0163  -0.0140 92  ILE C CB  
2962 C CG1 . ILE C 92  ? 0.5244 0.5067 0.4687 0.0516  0.0119  -0.0177 92  ILE C CG1 
2963 C CG2 . ILE C 92  ? 0.4868 0.4616 0.4505 0.0385  0.0121  -0.0137 92  ILE C CG2 
2964 C CD1 . ILE C 92  ? 0.5884 0.5823 0.5492 0.0555  0.0055  -0.0263 92  ILE C CD1 
2965 N N   . TYR C 93  ? 0.4483 0.3945 0.3803 0.0321  0.0302  -0.0002 93  TYR C N   
2966 C CA  . TYR C 93  ? 0.4274 0.3608 0.3554 0.0287  0.0351  0.0000  93  TYR C CA  
2967 C C   . TYR C 93  ? 0.4121 0.3477 0.3597 0.0208  0.0292  -0.0026 93  TYR C C   
2968 O O   . TYR C 93  ? 0.4223 0.3688 0.3900 0.0144  0.0227  -0.0001 93  TYR C O   
2969 C CB  . TYR C 93  ? 0.4217 0.3503 0.3453 0.0251  0.0426  0.0054  93  TYR C CB  
2970 C CG  . TYR C 93  ? 0.4123 0.3346 0.3191 0.0330  0.0494  0.0066  93  TYR C CG  
2971 C CD1 . TYR C 93  ? 0.4294 0.3370 0.3205 0.0387  0.0551  0.0055  93  TYR C CD1 
2972 C CD2 . TYR C 93  ? 0.4144 0.3471 0.3235 0.0339  0.0496  0.0085  93  TYR C CD2 
2973 C CE1 . TYR C 93  ? 0.4408 0.3424 0.3204 0.0457  0.0606  0.0080  93  TYR C CE1 
2974 C CE2 . TYR C 93  ? 0.4301 0.3580 0.3290 0.0409  0.0542  0.0088  93  TYR C CE2 
2975 C CZ  . TYR C 93  ? 0.4502 0.3618 0.3353 0.0469  0.0596  0.0093  93  TYR C CZ  
2976 O OH  . TYR C 93  ? 0.5070 0.4142 0.3860 0.0536  0.0633  0.0108  93  TYR C OH  
2977 N N   . TRP C 94  ? 0.4769 0.3785 0.3788 -0.0573 0.0763  0.0352  94  TRP C N   
2978 C CA  . TRP C 94  ? 0.4910 0.3856 0.4270 -0.0512 0.0893  0.0348  94  TRP C CA  
2979 C C   . TRP C 94  ? 0.4804 0.3856 0.4241 -0.0412 0.0817  0.0364  94  TRP C C   
2980 O O   . TRP C 94  ? 0.4589 0.3754 0.3860 -0.0426 0.0694  0.0346  94  TRP C O   
2981 C CB  . TRP C 94  ? 0.4908 0.3780 0.4390 -0.0660 0.1047  0.0157  94  TRP C CB  
2982 C CG  . TRP C 94  ? 0.5368 0.4133 0.4911 -0.0723 0.1157  0.0115  94  TRP C CG  
2983 C CD1 . TRP C 94  ? 0.5740 0.4404 0.5589 -0.0677 0.1278  0.0151  94  TRP C CD1 
2984 C CD2 . TRP C 94  ? 0.5238 0.3989 0.4550 -0.0837 0.1166  0.0018  94  TRP C CD2 
2985 N NE1 . TRP C 94  ? 0.5904 0.4492 0.5765 -0.0753 0.1357  0.0085  94  TRP C NE1 
2986 C CE2 . TRP C 94  ? 0.5527 0.4167 0.5047 -0.0850 0.1291  -0.0006 94  TRP C CE2 
2987 C CE3 . TRP C 94  ? 0.4774 0.3598 0.3729 -0.0924 0.1089  -0.0057 94  TRP C CE3 
2988 C CZ2 . TRP C 94  ? 0.5134 0.3736 0.4515 -0.0941 0.1338  -0.0121 94  TRP C CZ2 
2989 C CZ3 . TRP C 94  ? 0.4563 0.3346 0.3342 -0.1012 0.1139  -0.0164 94  TRP C CZ3 
2990 C CH2 . TRP C 94  ? 0.4641 0.3316 0.3628 -0.1018 0.1260  -0.0202 94  TRP C CH2 
2991 N N   . LEU C 95  ? 0.4986 0.4005 0.4682 -0.0309 0.0896  0.0389  95  LEU C N   
2992 C CA  . LEU C 95  ? 0.4821 0.3929 0.4600 -0.0215 0.0845  0.0370  95  LEU C CA  
2993 C C   . LEU C 95  ? 0.4875 0.3927 0.4757 -0.0343 0.0949  0.0208  95  LEU C C   
2994 O O   . LEU C 95  ? 0.5110 0.4057 0.5118 -0.0416 0.1077  0.0153  95  LEU C O   
2995 C CB  . LEU C 95  ? 0.5055 0.4168 0.5033 -0.0003 0.0881  0.0485  95  LEU C CB  
2996 C CG  . LEU C 95  ? 0.5315 0.4574 0.5264 0.0223  0.0753  0.0648  95  LEU C CG  
2997 C CD1 . LEU C 95  ? 0.5899 0.5119 0.6067 0.0409  0.0871  0.0759  95  LEU C CD1 
2998 C CD2 . LEU C 95  ? 0.5301 0.4730 0.5239 0.0320  0.0618  0.0602  95  LEU C CD2 
2999 N N   . ALA C 96  ? 0.4583 0.3719 0.4440 -0.0360 0.0890  0.0133  96  ALA C N   
3000 C CA  . ALA C 96  ? 0.4729 0.3839 0.4695 -0.0454 0.0974  -0.0005 96  ALA C CA  
3001 C C   . ALA C 96  ? 0.4865 0.4041 0.4915 -0.0352 0.0923  -0.0021 96  ALA C C   
3002 O O   . ALA C 96  ? 0.4731 0.4015 0.4711 -0.0306 0.0810  -0.0002 96  ALA C O   
3003 C CB  . ALA C 96  ? 0.4188 0.3343 0.4023 -0.0616 0.0980  -0.0112 96  ALA C CB  
3004 N N   . GLU C 97  ? 0.5442 0.4558 0.5648 -0.0316 0.1004  -0.0069 97  GLU C N   
3005 C CA  . GLU C 97  ? 0.5719 0.4884 0.5997 -0.0229 0.0971  -0.0119 97  GLU C CA  
3006 C C   . GLU C 97  ? 0.5769 0.4965 0.6051 -0.0362 0.0979  -0.0240 97  GLU C C   
3007 O O   . GLU C 97  ? 0.5897 0.5059 0.6190 -0.0492 0.1050  -0.0304 97  GLU C O   
3008 C CB  . GLU C 97  ? 0.6000 0.5084 0.6404 -0.0127 0.1059  -0.0121 97  GLU C CB  
3009 C CG  . GLU C 97  ? 0.6444 0.5571 0.6900 -0.0027 0.1034  -0.0194 97  GLU C CG  
3010 C CD  . GLU C 97  ? 0.7140 0.6219 0.7672 0.0144  0.1106  -0.0171 97  GLU C CD  
3011 O OE1 . GLU C 97  ? 0.7414 0.6565 0.7973 0.0308  0.1072  -0.0202 97  GLU C OE1 
3012 O OE2 . GLU C 97  ? 0.7515 0.6494 0.8096 0.0126  0.1205  -0.0127 97  GLU C OE2 
3013 N N   . VAL C 98  ? 0.5766 0.5048 0.6071 -0.0313 0.0908  -0.0275 98  VAL C N   
3014 C CA  . VAL C 98  ? 0.5888 0.5206 0.6226 -0.0423 0.0927  -0.0372 98  VAL C CA  
3015 C C   . VAL C 98  ? 0.6398 0.5654 0.6837 -0.0411 0.0990  -0.0452 98  VAL C C   
3016 O O   . VAL C 98  ? 0.6704 0.5909 0.7186 -0.0286 0.0999  -0.0448 98  VAL C O   
3017 C CB  . VAL C 98  ? 0.5633 0.5071 0.5990 -0.0403 0.0838  -0.0383 98  VAL C CB  
3018 C CG1 . VAL C 98  ? 0.5186 0.4695 0.5412 -0.0472 0.0785  -0.0329 98  VAL C CG1 
3019 C CG2 . VAL C 98  ? 0.5379 0.4861 0.5834 -0.0221 0.0764  -0.0379 98  VAL C CG2 
3020 N N   . LYS C 99  ? 0.6574 0.5851 0.7040 -0.0527 0.1031  -0.0527 99  LYS C N   
3021 C CA  . LYS C 99  ? 0.6946 0.6185 0.7486 -0.0527 0.1066  -0.0607 99  LYS C CA  
3022 C C   . LYS C 99  ? 0.6912 0.6183 0.7495 -0.0453 0.1019  -0.0649 99  LYS C C   
3023 O O   . LYS C 99  ? 0.7177 0.6388 0.7780 -0.0387 0.1032  -0.0701 99  LYS C O   
3024 C CB  . LYS C 99  ? 0.7238 0.6535 0.7814 -0.0648 0.1107  -0.0670 99  LYS C CB  
3025 C CG  . LYS C 99  ? 0.8788 0.8024 0.9417 -0.0680 0.1166  -0.0701 99  LYS C CG  
3026 C CD  . LYS C 99  ? 1.0504 0.9675 1.1176 -0.0642 0.1171  -0.0758 99  LYS C CD  
3027 C CE  . LYS C 99  ? 1.2150 1.1278 1.2914 -0.0678 0.1222  -0.0796 99  LYS C CE  
3028 N NZ  . LYS C 99  ? 1.2410 1.1417 1.3190 -0.0622 0.1276  -0.0722 99  LYS C NZ  
3029 N N   . ASP C 100 ? 0.6805 0.6172 0.7409 -0.0463 0.0968  -0.0634 100 ASP C N   
3030 C CA  . ASP C 100 ? 0.6816 0.6227 0.7515 -0.0385 0.0922  -0.0680 100 ASP C CA  
3031 C C   . ASP C 100 ? 0.6483 0.5968 0.7220 -0.0286 0.0842  -0.0638 100 ASP C C   
3032 O O   . ASP C 100 ? 0.6198 0.5755 0.6902 -0.0339 0.0807  -0.0578 100 ASP C O   
3033 C CB  . ASP C 100 ? 0.7240 0.6733 0.8014 -0.0474 0.0934  -0.0713 100 ASP C CB  
3034 C CG  . ASP C 100 ? 0.8212 0.7667 0.9001 -0.0507 0.0973  -0.0784 100 ASP C CG  
3035 O OD1 . ASP C 100 ? 0.9446 0.8989 1.0290 -0.0576 0.0991  -0.0792 100 ASP C OD1 
3036 O OD2 . ASP C 100 ? 0.8883 0.8237 0.9626 -0.0454 0.0984  -0.0826 100 ASP C OD2 
3037 N N   . TYR C 101 ? 0.6517 0.6003 0.7326 -0.0127 0.0808  -0.0683 101 TYR C N   
3038 C CA  . TYR C 101 ? 0.6329 0.5927 0.7224 0.0016  0.0714  -0.0666 101 TYR C CA  
3039 C C   . TYR C 101 ? 0.6087 0.5802 0.7096 -0.0044 0.0654  -0.0665 101 TYR C C   
3040 O O   . TYR C 101 ? 0.5982 0.5801 0.7006 -0.0008 0.0567  -0.0609 101 TYR C O   
3041 C CB  . TYR C 101 ? 0.6505 0.6115 0.7503 0.0211  0.0708  -0.0765 101 TYR C CB  
3042 C CG  . TYR C 101 ? 0.6462 0.6232 0.7593 0.0414  0.0603  -0.0770 101 TYR C CG  
3043 C CD1 . TYR C 101 ? 0.6545 0.6359 0.7630 0.0585  0.0582  -0.0709 101 TYR C CD1 
3044 C CD2 . TYR C 101 ? 0.6328 0.6231 0.7665 0.0452  0.0524  -0.0835 101 TYR C CD2 
3045 C CE1 . TYR C 101 ? 0.6454 0.6460 0.7680 0.0796  0.0472  -0.0717 101 TYR C CE1 
3046 C CE2 . TYR C 101 ? 0.6334 0.6418 0.7830 0.0649  0.0412  -0.0855 101 TYR C CE2 
3047 C CZ  . TYR C 101 ? 0.6494 0.6641 0.7929 0.0827  0.0380  -0.0799 101 TYR C CZ  
3048 O OH  . TYR C 101 ? 0.6665 0.7044 0.8284 0.1052  0.0249  -0.0821 101 TYR C OH  
3049 N N   . ASP C 102 ? 0.6061 0.5769 0.7153 -0.0133 0.0698  -0.0720 102 ASP C N   
3050 C CA  . ASP C 102 ? 0.5883 0.5705 0.7121 -0.0179 0.0663  -0.0712 102 ASP C CA  
3051 C C   . ASP C 102 ? 0.5654 0.5491 0.6789 -0.0349 0.0722  -0.0641 102 ASP C C   
3052 O O   . ASP C 102 ? 0.5824 0.5739 0.7084 -0.0402 0.0744  -0.0637 102 ASP C O   
3053 C CB  . ASP C 102 ? 0.6126 0.5972 0.7591 -0.0123 0.0670  -0.0814 102 ASP C CB  
3054 C CG  . ASP C 102 ? 0.6831 0.6571 0.8237 -0.0185 0.0757  -0.0864 102 ASP C CG  
3055 O OD1 . ASP C 102 ? 0.7651 0.7310 0.8864 -0.0260 0.0806  -0.0828 102 ASP C OD1 
3056 O OD2 . ASP C 102 ? 0.7190 0.6936 0.8753 -0.0155 0.0768  -0.0945 102 ASP C OD2 
3057 N N   . VAL C 103 ? 0.5403 0.5181 0.6330 -0.0415 0.0755  -0.0589 103 VAL C N   
3058 C CA  . VAL C 103 ? 0.5104 0.4915 0.5911 -0.0550 0.0817  -0.0544 103 VAL C CA  
3059 C C   . VAL C 103 ? 0.4909 0.4840 0.5743 -0.0575 0.0776  -0.0497 103 VAL C C   
3060 O O   . VAL C 103 ? 0.4909 0.4886 0.5781 -0.0502 0.0673  -0.0476 103 VAL C O   
3061 C CB  . VAL C 103 ? 0.5056 0.4791 0.5655 -0.0588 0.0837  -0.0508 103 VAL C CB  
3062 C CG1 . VAL C 103 ? 0.4733 0.4485 0.5248 -0.0527 0.0741  -0.0443 103 VAL C CG1 
3063 C CG2 . VAL C 103 ? 0.4492 0.4269 0.4980 -0.0706 0.0921  -0.0505 103 VAL C CG2 
3064 N N   . GLU C 104 ? 0.4954 0.4959 0.5775 -0.0664 0.0855  -0.0482 104 GLU C N   
3065 C CA  . GLU C 104 ? 0.4929 0.5054 0.5797 -0.0687 0.0839  -0.0438 104 GLU C CA  
3066 C C   . GLU C 104 ? 0.4712 0.4859 0.5335 -0.0736 0.0805  -0.0390 104 GLU C C   
3067 O O   . GLU C 104 ? 0.4794 0.4919 0.5217 -0.0802 0.0878  -0.0391 104 GLU C O   
3068 C CB  . GLU C 104 ? 0.5037 0.5258 0.6011 -0.0733 0.0955  -0.0432 104 GLU C CB  
3069 C CG  . GLU C 104 ? 0.5465 0.5808 0.6610 -0.0726 0.0946  -0.0391 104 GLU C CG  
3070 C CD  . GLU C 104 ? 0.6198 0.6666 0.7394 -0.0763 0.1085  -0.0354 104 GLU C CD  
3071 O OE1 . GLU C 104 ? 0.6305 0.6880 0.7535 -0.0778 0.1107  -0.0302 104 GLU C OE1 
3072 O OE2 . GLU C 104 ? 0.7014 0.7494 0.8225 -0.0762 0.1172  -0.0373 104 GLU C OE2 
3073 N N   . ILE C 105 ? 0.4572 0.4779 0.5222 -0.0697 0.0687  -0.0357 105 ILE C N   
3074 C CA  . ILE C 105 ? 0.4470 0.4715 0.4871 -0.0746 0.0636  -0.0308 105 ILE C CA  
3075 C C   . ILE C 105 ? 0.4646 0.5011 0.5063 -0.0809 0.0698  -0.0286 105 ILE C C   
3076 O O   . ILE C 105 ? 0.4616 0.5071 0.5287 -0.0772 0.0662  -0.0279 105 ILE C O   
3077 C CB  . ILE C 105 ? 0.4314 0.4600 0.4730 -0.0653 0.0449  -0.0276 105 ILE C CB  
3078 C CG1 . ILE C 105 ? 0.3958 0.4146 0.4337 -0.0562 0.0400  -0.0277 105 ILE C CG1 
3079 C CG2 . ILE C 105 ? 0.3802 0.4144 0.3943 -0.0713 0.0378  -0.0222 105 ILE C CG2 
3080 C CD1 . ILE C 105 ? 0.3734 0.3799 0.4140 -0.0577 0.0524  -0.0321 105 ILE C CD1 
3081 N N   . ARG C 106 ? 0.7369 0.6262 0.6200 -0.0421 0.0104  0.0286  106 ARG C N   
3082 C CA  . ARG C 106 ? 0.7875 0.6883 0.6849 -0.0499 0.0018  0.0381  106 ARG C CA  
3083 C C   . ARG C 106 ? 0.7764 0.6750 0.6829 -0.0604 -0.0102 0.0341  106 ARG C C   
3084 O O   . ARG C 106 ? 0.8245 0.7050 0.7048 -0.0655 -0.0118 0.0302  106 ARG C O   
3085 C CB  . ARG C 106 ? 0.8864 0.7779 0.7518 -0.0525 0.0070  0.0444  106 ARG C CB  
3086 C CG  . ARG C 106 ? 0.9989 0.8769 0.8344 -0.0427 0.0227  0.0409  106 ARG C CG  
3087 C CD  . ARG C 106 ? 1.2123 1.0816 1.0140 -0.0436 0.0301  0.0464  106 ARG C CD  
3088 N NE  . ARG C 106 ? 1.3283 1.1804 1.0999 -0.0350 0.0448  0.0388  106 ARG C NE  
3089 C CZ  . ARG C 106 ? 1.4133 1.2616 1.1642 -0.0286 0.0591  0.0429  106 ARG C CZ  
3090 N NH1 . ARG C 106 ? 1.5392 1.4007 1.2940 -0.0296 0.0610  0.0560  106 ARG C NH1 
3091 N NH2 . ARG C 106 ? 1.4075 1.2396 1.1360 -0.0213 0.0719  0.0342  106 ARG C NH2 
3092 N N   . LEU C 107 ? 0.7585 0.6743 0.7038 -0.0631 -0.0191 0.0352  107 LEU C N   
3093 C CA  . LEU C 107 ? 0.7630 0.6770 0.7222 -0.0731 -0.0293 0.0319  107 LEU C CA  
3094 C C   . LEU C 107 ? 0.8277 0.7385 0.7853 -0.0865 -0.0383 0.0408  107 LEU C C   
3095 O O   . LEU C 107 ? 0.8580 0.7776 0.8175 -0.0893 -0.0396 0.0510  107 LEU C O   
3096 C CB  . LEU C 107 ? 0.7110 0.6440 0.7138 -0.0722 -0.0357 0.0287  107 LEU C CB  
3097 C CG  . LEU C 107 ? 0.6677 0.6024 0.6732 -0.0612 -0.0297 0.0192  107 LEU C CG  
3098 C CD1 . LEU C 107 ? 0.6220 0.5715 0.6659 -0.0624 -0.0375 0.0141  107 LEU C CD1 
3099 C CD2 . LEU C 107 ? 0.6208 0.5368 0.5939 -0.0590 -0.0229 0.0111  107 LEU C CD2 
3100 N N   . SER C 108 ? 0.8906 0.7882 0.8456 -0.0952 -0.0449 0.0382  108 SER C N   
3101 C CA  . SER C 108 ? 0.9542 0.8475 0.9155 -0.1102 -0.0563 0.0473  108 SER C CA  
3102 C C   . SER C 108 ? 0.9285 0.8454 0.9428 -0.1160 -0.0650 0.0505  108 SER C C   
3103 O O   . SER C 108 ? 0.8870 0.8209 0.9264 -0.1072 -0.0621 0.0451  108 SER C O   
3104 C CB  . SER C 108 ? 0.9933 0.8619 0.9374 -0.1165 -0.0610 0.0445  108 SER C CB  
3105 O OG  . SER C 108 ? 1.0742 0.9388 1.0361 -0.1329 -0.0743 0.0541  108 SER C OG  
3106 N N   . HIS C 109 ? 0.9955 0.9122 1.0279 -0.1316 -0.0770 0.0596  109 HIS C N   
3107 C CA  . HIS C 109 ? 0.9948 0.9326 1.0820 -0.1402 -0.0873 0.0634  109 HIS C CA  
3108 C C   . HIS C 109 ? 0.9682 0.9027 1.0763 -0.1381 -0.0863 0.0524  109 HIS C C   
3109 O O   . HIS C 109 ? 0.9397 0.8933 1.0929 -0.1389 -0.0904 0.0493  109 HIS C O   
3110 C CB  . HIS C 109 ? 1.0717 1.0056 1.1671 -0.1596 -0.1005 0.0778  109 HIS C CB  
3111 C CG  . HIS C 109 ? 1.1917 1.1108 1.2382 -0.1616 -0.0984 0.0853  109 HIS C CG  
3112 N ND1 . HIS C 109 ? 1.2148 1.1018 1.2161 -0.1647 -0.0981 0.0840  109 HIS C ND1 
3113 C CD2 . HIS C 109 ? 1.2585 1.1904 1.2936 -0.1597 -0.0960 0.0939  109 HIS C CD2 
3114 C CE1 . HIS C 109 ? 1.2699 1.1495 1.2320 -0.1649 -0.0954 0.0897  109 HIS C CE1 
3115 N NE2 . HIS C 109 ? 1.3080 1.2150 1.2891 -0.1619 -0.0930 0.0961  109 HIS C NE2 
3116 N N   . GLU C 110 ? 0.9868 0.8979 1.0619 -0.1344 -0.0804 0.0463  110 GLU C N   
3117 C CA  . GLU C 110 ? 0.9537 0.8588 1.0432 -0.1329 -0.0785 0.0381  110 GLU C CA  
3118 C C   . GLU C 110 ? 0.8658 0.7854 0.9656 -0.1189 -0.0696 0.0251  110 GLU C C   
3119 O O   . GLU C 110 ? 0.8506 0.7724 0.9718 -0.1183 -0.0682 0.0184  110 GLU C O   
3120 C CB  . GLU C 110 ? 1.0026 0.8794 1.0554 -0.1330 -0.0767 0.0384  110 GLU C CB  
3121 C CG  . GLU C 110 ? 1.1484 1.0063 1.1728 -0.1430 -0.0843 0.0495  110 GLU C CG  
3122 C CD  . GLU C 110 ? 1.2619 1.0895 1.2550 -0.1436 -0.0863 0.0505  110 GLU C CD  
3123 O OE1 . GLU C 110 ? 1.2720 1.0934 1.2811 -0.1432 -0.0865 0.0487  110 GLU C OE1 
3124 O OE2 . GLU C 110 ? 1.3144 1.1245 1.2677 -0.1441 -0.0880 0.0536  110 GLU C OE2 
3125 N N   . HIS C 111 ? 0.8099 0.7383 0.8946 -0.1079 -0.0635 0.0222  111 HIS C N   
3126 C CA  . HIS C 111 ? 0.7514 0.6926 0.8468 -0.0957 -0.0575 0.0114  111 HIS C CA  
3127 C C   . HIS C 111 ? 0.7351 0.6972 0.8534 -0.0907 -0.0606 0.0138  111 HIS C C   
3128 O O   . HIS C 111 ? 0.7565 0.7227 0.8706 -0.0929 -0.0630 0.0240  111 HIS C O   
3129 C CB  . HIS C 111 ? 0.7323 0.6605 0.7886 -0.0850 -0.0469 0.0046  111 HIS C CB  
3130 C CG  . HIS C 111 ? 0.7174 0.6249 0.7494 -0.0889 -0.0456 0.0053  111 HIS C CG  
3131 N ND1 . HIS C 111 ? 0.6636 0.5671 0.7028 -0.0886 -0.0438 -0.0001 111 HIS C ND1 
3132 C CD2 . HIS C 111 ? 0.7228 0.6121 0.7246 -0.0929 -0.0468 0.0117  111 HIS C CD2 
3133 C CE1 . HIS C 111 ? 0.6774 0.5616 0.6949 -0.0920 -0.0448 0.0042  111 HIS C CE1 
3134 N NE2 . HIS C 111 ? 0.7144 0.5888 0.7083 -0.0947 -0.0473 0.0107  111 HIS C NE2 
3135 N N   . GLN C 112 ? 0.7000 0.6753 0.8431 -0.0837 -0.0609 0.0049  112 GLN C N   
3136 C CA  . GLN C 112 ? 0.6900 0.6850 0.8618 -0.0783 -0.0666 0.0077  112 GLN C CA  
3137 C C   . GLN C 112 ? 0.6541 0.6468 0.8068 -0.0644 -0.0598 0.0031  112 GLN C C   
3138 O O   . GLN C 112 ? 0.6775 0.6832 0.8501 -0.0583 -0.0643 0.0078  112 GLN C O   
3139 C CB  . GLN C 112 ? 0.6979 0.7098 0.9191 -0.0812 -0.0757 0.0015  112 GLN C CB  
3140 C CG  . GLN C 112 ? 0.7531 0.7558 0.9743 -0.0844 -0.0716 -0.0095 112 GLN C CG  
3141 C CD  . GLN C 112 ? 0.8003 0.8148 1.0516 -0.0787 -0.0737 -0.0229 112 GLN C CD  
3142 O OE1 . GLN C 112 ? 0.8137 0.8271 1.0504 -0.0673 -0.0695 -0.0317 112 GLN C OE1 
3143 N NE2 . GLN C 112 ? 0.8663 0.8910 1.1600 -0.0871 -0.0806 -0.0247 112 GLN C NE2 
3144 N N   . ALA C 113 ? 0.6099 0.5868 0.7281 -0.0597 -0.0501 -0.0046 113 ALA C N   
3145 C CA  . ALA C 113 ? 0.5585 0.5319 0.6608 -0.0484 -0.0444 -0.0089 113 ALA C CA  
3146 C C   . ALA C 113 ? 0.5345 0.4903 0.5961 -0.0462 -0.0340 -0.0132 113 ALA C C   
3147 O O   . ALA C 113 ? 0.5260 0.4728 0.5743 -0.0518 -0.0317 -0.0156 113 ALA C O   
3148 C CB  . ALA C 113 ? 0.5434 0.5265 0.6705 -0.0432 -0.0493 -0.0191 113 ALA C CB  
3149 N N   . TYR C 114 ? 0.5092 0.4605 0.5555 -0.0383 -0.0287 -0.0129 114 TYR C N   
3150 C CA  . TYR C 114 ? 0.4809 0.4185 0.4949 -0.0360 -0.0202 -0.0167 114 TYR C CA  
3151 C C   . TYR C 114 ? 0.4725 0.4103 0.4863 -0.0285 -0.0186 -0.0200 114 TYR C C   
3152 O O   . TYR C 114 ? 0.4819 0.4266 0.5157 -0.0240 -0.0234 -0.0166 114 TYR C O   
3153 C CB  . TYR C 114 ? 0.4850 0.4117 0.4744 -0.0368 -0.0142 -0.0092 114 TYR C CB  
3154 C CG  . TYR C 114 ? 0.4581 0.3864 0.4498 -0.0308 -0.0111 -0.0009 114 TYR C CG  
3155 C CD1 . TYR C 114 ? 0.4658 0.4018 0.4706 -0.0321 -0.0141 0.0086  114 TYR C CD1 
3156 C CD2 . TYR C 114 ? 0.4332 0.3553 0.4157 -0.0245 -0.0051 -0.0010 114 TYR C CD2 
3157 C CE1 . TYR C 114 ? 0.4990 0.4370 0.5072 -0.0259 -0.0101 0.0180  114 TYR C CE1 
3158 C CE2 . TYR C 114 ? 0.4611 0.3831 0.4485 -0.0189 -0.0013 0.0080  114 TYR C CE2 
3159 C CZ  . TYR C 114 ? 0.5374 0.4674 0.5373 -0.0188 -0.0032 0.0177  114 TYR C CZ  
3160 O OH  . TYR C 114 ? 0.6087 0.5395 0.6153 -0.0122 0.0017  0.0289  114 TYR C OH  
3161 N N   . ARG C 115 ? 0.4601 0.3901 0.4529 -0.0277 -0.0132 -0.0250 115 ARG C N   
3162 C CA  . ARG C 115 ? 0.4603 0.3883 0.4508 -0.0228 -0.0125 -0.0268 115 ARG C CA  
3163 C C   . ARG C 115 ? 0.4617 0.3801 0.4273 -0.0239 -0.0052 -0.0265 115 ARG C C   
3164 O O   . ARG C 115 ? 0.4627 0.3786 0.4152 -0.0275 -0.0027 -0.0292 115 ARG C O   
3165 C CB  . ARG C 115 ? 0.4647 0.3991 0.4642 -0.0220 -0.0172 -0.0370 115 ARG C CB  
3166 C CG  . ARG C 115 ? 0.4656 0.4092 0.4940 -0.0188 -0.0266 -0.0388 115 ARG C CG  
3167 C CD  . ARG C 115 ? 0.4770 0.4178 0.5148 -0.0132 -0.0303 -0.0305 115 ARG C CD  
3168 N NE  . ARG C 115 ? 0.5124 0.4616 0.5806 -0.0090 -0.0417 -0.0309 115 ARG C NE  
3169 C CZ  . ARG C 115 ? 0.5337 0.4941 0.6289 -0.0089 -0.0478 -0.0257 115 ARG C CZ  
3170 N NH1 . ARG C 115 ? 0.4847 0.4482 0.5772 -0.0140 -0.0433 -0.0200 115 ARG C NH1 
3171 N NH2 . ARG C 115 ? 0.5441 0.5130 0.6708 -0.0042 -0.0600 -0.0257 115 ARG C NH2 
3172 N N   . TRP C 116 ? 0.4604 0.3734 0.4233 -0.0209 -0.0027 -0.0222 116 TRP C N   
3173 C CA  . TRP C 116 ? 0.4507 0.3570 0.3969 -0.0226 0.0024  -0.0223 116 TRP C CA  
3174 C C   . TRP C 116 ? 0.4486 0.3586 0.3978 -0.0228 -0.0018 -0.0274 116 TRP C C   
3175 O O   . TRP C 116 ? 0.4533 0.3630 0.4150 -0.0201 -0.0067 -0.0258 116 TRP C O   
3176 C CB  . TRP C 116 ? 0.4623 0.3601 0.4080 -0.0202 0.0077  -0.0140 116 TRP C CB  
3177 C CG  . TRP C 116 ? 0.4626 0.3542 0.3971 -0.0199 0.0146  -0.0100 116 TRP C CG  
3178 C CD1 . TRP C 116 ? 0.4745 0.3650 0.4145 -0.0166 0.0174  -0.0030 116 TRP C CD1 
3179 C CD2 . TRP C 116 ? 0.4538 0.3391 0.3694 -0.0226 0.0189  -0.0125 116 TRP C CD2 
3180 N NE1 . TRP C 116 ? 0.4950 0.3781 0.4168 -0.0174 0.0240  -0.0021 116 TRP C NE1 
3181 C CE2 . TRP C 116 ? 0.4775 0.3562 0.3844 -0.0209 0.0243  -0.0084 116 TRP C CE2 
3182 C CE3 . TRP C 116 ? 0.4630 0.3482 0.3691 -0.0259 0.0178  -0.0173 116 TRP C CE3 
3183 C CZ2 . TRP C 116 ? 0.4742 0.3438 0.3612 -0.0224 0.0280  -0.0106 116 TRP C CZ2 
3184 C CZ3 . TRP C 116 ? 0.4715 0.3490 0.3622 -0.0270 0.0205  -0.0180 116 TRP C CZ3 
3185 C CH2 . TRP C 116 ? 0.4619 0.3304 0.3422 -0.0252 0.0253  -0.0155 116 TRP C CH2 
3186 N N   . LEU C 117 ? 0.4459 0.3591 0.3836 -0.0261 -0.0008 -0.0328 117 LEU C N   
3187 C CA  . LEU C 117 ? 0.4707 0.3885 0.4068 -0.0270 -0.0042 -0.0382 117 LEU C CA  
3188 C C   . LEU C 117 ? 0.4797 0.3986 0.4033 -0.0311 -0.0017 -0.0370 117 LEU C C   
3189 O O   . LEU C 117 ? 0.4967 0.4160 0.4135 -0.0329 0.0018  -0.0350 117 LEU C O   
3190 C CB  . LEU C 117 ? 0.4625 0.3884 0.4011 -0.0265 -0.0057 -0.0470 117 LEU C CB  
3191 C CG  . LEU C 117 ? 0.4731 0.4015 0.4293 -0.0240 -0.0094 -0.0486 117 LEU C CG  
3192 C CD1 . LEU C 117 ? 0.4691 0.4043 0.4291 -0.0256 -0.0084 -0.0555 117 LEU C CD1 
3193 C CD2 . LEU C 117 ? 0.4715 0.4002 0.4416 -0.0202 -0.0168 -0.0503 117 LEU C CD2 
3194 N N   . GLY C 118 ? 0.4994 0.4194 0.4210 -0.0330 -0.0052 -0.0380 118 GLY C N   
3195 C CA  . GLY C 118 ? 0.5083 0.4334 0.4206 -0.0382 -0.0043 -0.0363 118 GLY C CA  
3196 C C   . GLY C 118 ? 0.5102 0.4461 0.4145 -0.0379 -0.0022 -0.0425 118 GLY C C   
3197 O O   . GLY C 118 ? 0.4999 0.4376 0.4069 -0.0345 -0.0016 -0.0488 118 GLY C O   
3198 N N   . LEU C 119 ? 0.5219 0.4662 0.4197 -0.0418 -0.0012 -0.0397 119 LEU C N   
3199 C CA  . LEU C 119 ? 0.5398 0.4947 0.4326 -0.0408 0.0020  -0.0427 119 LEU C CA  
3200 C C   . LEU C 119 ? 0.6004 0.5597 0.4885 -0.0381 0.0030  -0.0525 119 LEU C C   
3201 O O   . LEU C 119 ? 0.6130 0.5754 0.5041 -0.0350 0.0069  -0.0565 119 LEU C O   
3202 C CB  . LEU C 119 ? 0.5194 0.4851 0.4094 -0.0452 0.0017  -0.0358 119 LEU C CB  
3203 C CG  . LEU C 119 ? 0.5019 0.4798 0.3900 -0.0436 0.0052  -0.0349 119 LEU C CG  
3204 C CD1 . LEU C 119 ? 0.3770 0.3508 0.2727 -0.0406 0.0062  -0.0311 119 LEU C CD1 
3205 C CD2 . LEU C 119 ? 0.4706 0.4622 0.3575 -0.0485 0.0031  -0.0277 119 LEU C CD2 
3206 N N   . GLU C 120 ? 0.6604 0.6183 0.5421 -0.0393 -0.0007 -0.0564 120 GLU C N   
3207 C CA  . GLU C 120 ? 0.7417 0.7038 0.6165 -0.0363 0.0005  -0.0673 120 GLU C CA  
3208 C C   . GLU C 120 ? 0.7243 0.6822 0.6121 -0.0310 0.0009  -0.0747 120 GLU C C   
3209 O O   . GLU C 120 ? 0.7270 0.6908 0.6173 -0.0284 0.0062  -0.0811 120 GLU C O   
3210 C CB  . GLU C 120 ? 0.8364 0.7943 0.7005 -0.0386 -0.0060 -0.0708 120 GLU C CB  
3211 C CG  . GLU C 120 ? 0.9890 0.9572 0.8341 -0.0424 -0.0040 -0.0719 120 GLU C CG  
3212 C CD  . GLU C 120 ? 1.1885 1.1487 1.0214 -0.0460 -0.0128 -0.0746 120 GLU C CD  
3213 O OE1 . GLU C 120 ? 1.2245 1.1714 1.0669 -0.0475 -0.0210 -0.0699 120 GLU C OE1 
3214 O OE2 . GLU C 120 ? 1.3203 1.2862 1.1338 -0.0472 -0.0117 -0.0808 120 GLU C OE2 
3215 N N   . GLU C 121 ? 0.7035 0.6521 0.6028 -0.0298 -0.0047 -0.0725 121 GLU C N   
3216 C CA  . GLU C 121 ? 0.6953 0.6421 0.6114 -0.0257 -0.0064 -0.0775 121 GLU C CA  
3217 C C   . GLU C 121 ? 0.6509 0.6005 0.5743 -0.0264 -0.0009 -0.0741 121 GLU C C   
3218 O O   . GLU C 121 ? 0.6611 0.6146 0.5949 -0.0250 0.0010  -0.0800 121 GLU C O   
3219 C CB  . GLU C 121 ? 0.6995 0.6375 0.6283 -0.0242 -0.0137 -0.0722 121 GLU C CB  
3220 C CG  . GLU C 121 ? 0.8339 0.7648 0.7592 -0.0239 -0.0218 -0.0725 121 GLU C CG  
3221 C CD  . GLU C 121 ? 0.9506 0.8782 0.8608 -0.0296 -0.0214 -0.0651 121 GLU C CD  
3222 O OE1 . GLU C 121 ? 0.9570 0.8894 0.8608 -0.0332 -0.0149 -0.0598 121 GLU C OE1 
3223 O OE2 . GLU C 121 ? 1.0815 1.0014 0.9886 -0.0311 -0.0290 -0.0639 121 GLU C OE2 
3224 N N   . ALA C 122 ? 0.6091 0.5555 0.5284 -0.0288 0.0008  -0.0646 122 ALA C N   
3225 C CA  . ALA C 122 ? 0.5899 0.5353 0.5147 -0.0297 0.0036  -0.0608 122 ALA C CA  
3226 C C   . ALA C 122 ? 0.6114 0.5640 0.5362 -0.0296 0.0084  -0.0643 122 ALA C C   
3227 O O   . ALA C 122 ? 0.6102 0.5618 0.5469 -0.0300 0.0094  -0.0645 122 ALA C O   
3228 C CB  . ALA C 122 ? 0.5713 0.5119 0.4886 -0.0319 0.0043  -0.0517 122 ALA C CB  
3229 N N   . CYS C 123 ? 0.6442 0.6040 0.5571 -0.0296 0.0114  -0.0657 123 CYS C N   
3230 C CA  . CYS C 123 ? 0.6817 0.6494 0.5950 -0.0284 0.0177  -0.0677 123 CYS C CA  
3231 C C   . CYS C 123 ? 0.7380 0.7080 0.6612 -0.0257 0.0202  -0.0793 123 CYS C C   
3232 O O   . CYS C 123 ? 0.7489 0.7210 0.6838 -0.0251 0.0253  -0.0800 123 CYS C O   
3233 C CB  . CYS C 123 ? 0.6949 0.6721 0.5929 -0.0291 0.0205  -0.0655 123 CYS C CB  
3234 S SG  . CYS C 123 ? 0.6361 0.6161 0.5341 -0.0313 0.0197  -0.0513 123 CYS C SG  
3235 N N   . GLN C 124 ? 0.7861 0.7547 0.7072 -0.0242 0.0159  -0.0880 124 GLN C N   
3236 C CA  . GLN C 124 ? 0.8500 0.8208 0.7827 -0.0211 0.0163  -0.1008 124 GLN C CA  
3237 C C   . GLN C 124 ? 0.8389 0.8075 0.7985 -0.0221 0.0141  -0.1000 124 GLN C C   
3238 O O   . GLN C 124 ? 0.8851 0.8576 0.8605 -0.0211 0.0177  -0.1076 124 GLN C O   
3239 C CB  . GLN C 124 ? 0.9111 0.8786 0.8388 -0.0189 0.0084  -0.1087 124 GLN C CB  
3240 N N   . LEU C 125 ? 0.7939 0.7565 0.7595 -0.0246 0.0084  -0.0907 125 LEU C N   
3241 C CA  . LEU C 125 ? 0.7753 0.7362 0.7646 -0.0273 0.0054  -0.0876 125 LEU C CA  
3242 C C   . LEU C 125 ? 0.7794 0.7382 0.7733 -0.0308 0.0105  -0.0809 125 LEU C C   
3243 O O   . LEU C 125 ? 0.7973 0.7569 0.8140 -0.0334 0.0104  -0.0821 125 LEU C O   
3244 C CB  . LEU C 125 ? 0.7378 0.6930 0.7291 -0.0287 -0.0013 -0.0791 125 LEU C CB  
3245 C CG  . LEU C 125 ? 0.7290 0.6849 0.7255 -0.0252 -0.0084 -0.0823 125 LEU C CG  
3246 C CD1 . LEU C 125 ? 0.6821 0.6365 0.6945 -0.0267 -0.0143 -0.0742 125 LEU C CD1 
3247 C CD2 . LEU C 125 ? 0.7980 0.7606 0.8095 -0.0223 -0.0108 -0.0950 125 LEU C CD2 
3248 N N   . ALA C 126 ? 0.7847 0.7404 0.7608 -0.0313 0.0136  -0.0726 126 ALA C N   
3249 C CA  . ALA C 126 ? 0.8015 0.7529 0.7845 -0.0341 0.0161  -0.0642 126 ALA C CA  
3250 C C   . ALA C 126 ? 0.8667 0.8244 0.8639 -0.0327 0.0233  -0.0703 126 ALA C C   
3251 O O   . ALA C 126 ? 0.8531 0.8069 0.8719 -0.0362 0.0237  -0.0669 126 ALA C O   
3252 C CB  . ALA C 126 ? 0.7843 0.7338 0.7490 -0.0335 0.0172  -0.0551 126 ALA C CB  
3253 N N   . GLN C 127 ? 0.9490 0.9155 0.9334 -0.0281 0.0293  -0.0789 127 GLN C N   
3254 C CA  . GLN C 127 ? 0.9930 0.9663 0.9867 -0.0253 0.0385  -0.0872 127 GLN C CA  
3255 C C   . GLN C 127 ? 1.0047 0.9780 1.0025 -0.0252 0.0457  -0.0763 127 GLN C C   
3256 O O   . GLN C 127 ? 1.0856 1.0672 1.0726 -0.0211 0.0548  -0.0770 127 GLN C O   
3257 C CB  . GLN C 127 ? 0.9791 0.9518 1.0027 -0.0272 0.0364  -0.0953 127 GLN C CB  
3258 N N   . PHE C 128 ? 0.9457 0.9090 0.9599 -0.0299 0.0407  -0.0650 128 PHE C N   
3259 C CA  . PHE C 128 ? 0.9404 0.8993 0.9657 -0.0305 0.0442  -0.0519 128 PHE C CA  
3260 C C   . PHE C 128 ? 0.9159 0.8787 0.9214 -0.0271 0.0447  -0.0412 128 PHE C C   
3261 O O   . PHE C 128 ? 0.9038 0.8632 0.8945 -0.0284 0.0368  -0.0367 128 PHE C O   
3262 C CB  . PHE C 128 ? 0.9206 0.8649 0.9645 -0.0377 0.0347  -0.0427 128 PHE C CB  
3263 C CG  . PHE C 128 ? 0.9682 0.9024 1.0166 -0.0390 0.0317  -0.0259 128 PHE C CG  
3264 C CD1 . PHE C 128 ? 1.0050 0.9257 1.0462 -0.0433 0.0202  -0.0164 128 PHE C CD1 
3265 C CD2 . PHE C 128 ? 1.0527 0.9900 1.1126 -0.0354 0.0403  -0.0189 128 PHE C CD2 
3266 C CE1 . PHE C 128 ? 1.0460 0.9551 1.0916 -0.0442 0.0150  -0.0008 128 PHE C CE1 
3267 C CE2 . PHE C 128 ? 1.1023 1.0294 1.1698 -0.0359 0.0356  -0.0013 128 PHE C CE2 
3268 C CZ  . PHE C 128 ? 1.1032 1.0153 1.1636 -0.0404 0.0218  0.0074  128 PHE C CZ  
3269 N N   . LYS C 129 ? 0.9257 0.8977 0.9327 -0.0225 0.0546  -0.0378 129 LYS C N   
3270 C CA  . LYS C 129 ? 0.9168 0.8995 0.9072 -0.0188 0.0562  -0.0295 129 LYS C CA  
3271 C C   . LYS C 129 ? 0.8543 0.8310 0.8420 -0.0204 0.0452  -0.0147 129 LYS C C   
3272 O O   . LYS C 129 ? 0.8231 0.8074 0.7942 -0.0200 0.0414  -0.0132 129 LYS C O   
3273 C CB  . LYS C 129 ? 0.9874 0.9799 0.9876 -0.0136 0.0689  -0.0240 129 LYS C CB  
3274 C CG  . LYS C 129 ? 1.1302 1.1328 1.1243 -0.0101 0.0819  -0.0404 129 LYS C CG  
3275 C CD  . LYS C 129 ? 1.2337 1.2459 1.2375 -0.0043 0.0967  -0.0338 129 LYS C CD  
3276 C CE  . LYS C 129 ? 1.3582 1.3798 1.3523 -0.0001 0.1110  -0.0521 129 LYS C CE  
3277 N NZ  . LYS C 129 ? 1.3970 1.4282 1.4005 0.0063  0.1279  -0.0453 129 LYS C NZ  
3278 N N   . GLU C 130 ? 0.8182 0.7806 0.8241 -0.0227 0.0393  -0.0035 130 GLU C N   
3279 C CA  A GLU C 130 ? 0.7693 0.7237 0.7735 -0.0235 0.0278  0.0098  130 GLU C CA  
3280 C CA  B GLU C 130 ? 0.7678 0.7217 0.7711 -0.0237 0.0270  0.0100  130 GLU C CA  
3281 C C   . GLU C 130 ? 0.6977 0.6473 0.6830 -0.0267 0.0199  0.0027  130 GLU C C   
3282 O O   . GLU C 130 ? 0.6765 0.6280 0.6529 -0.0260 0.0135  0.0083  130 GLU C O   
3283 C CB  A GLU C 130 ? 0.7899 0.7251 0.8160 -0.0264 0.0212  0.0221  130 GLU C CB  
3284 C CB  B GLU C 130 ? 0.7870 0.7211 0.8109 -0.0268 0.0197  0.0220  130 GLU C CB  
3285 C CG  A GLU C 130 ? 0.9113 0.8490 0.9607 -0.0228 0.0286  0.0331  130 GLU C CG  
3286 C CG  B GLU C 130 ? 0.9046 0.8399 0.9505 -0.0229 0.0235  0.0367  130 GLU C CG  
3287 C CD  A GLU C 130 ? 1.0685 1.0000 1.1293 -0.0200 0.0192  0.0537  130 GLU C CD  
3288 C CD  B GLU C 130 ? 1.0825 1.0219 1.1442 -0.0225 0.0370  0.0302  130 GLU C CD  
3289 O OE1 A GLU C 130 ? 1.1163 1.0604 1.1668 -0.0159 0.0157  0.0585  130 GLU C OE1 
3290 O OE1 B GLU C 130 ? 1.1368 1.0820 1.1896 -0.0241 0.0429  0.0130  130 GLU C OE1 
3291 O OE2 A GLU C 130 ? 1.1402 1.0540 1.2233 -0.0223 0.0137  0.0663  130 GLU C OE2 
3292 O OE2 B GLU C 130 ? 1.1648 1.1010 1.2503 -0.0204 0.0414  0.0425  130 GLU C OE2 
3293 N N   . MET C 131 ? 0.6521 0.5966 0.6346 -0.0300 0.0204  -0.0090 131 MET C N   
3294 C CA  . MET C 131 ? 0.5960 0.5353 0.5636 -0.0325 0.0143  -0.0145 131 MET C CA  
3295 C C   . MET C 131 ? 0.5810 0.5330 0.5315 -0.0305 0.0170  -0.0217 131 MET C C   
3296 O O   . MET C 131 ? 0.5576 0.5068 0.4973 -0.0316 0.0121  -0.0210 131 MET C O   
3297 C CB  . MET C 131 ? 0.5816 0.5127 0.5571 -0.0365 0.0130  -0.0219 131 MET C CB  
3298 C CG  . MET C 131 ? 0.5539 0.4780 0.5173 -0.0388 0.0069  -0.0246 131 MET C CG  
3299 S SD  . MET C 131 ? 0.5423 0.4501 0.4963 -0.0409 -0.0023 -0.0136 131 MET C SD  
3300 C CE  . MET C 131 ? 0.6534 0.5464 0.6263 -0.0468 -0.0073 -0.0066 131 MET C CE  
3301 N N   . LYS C 132 ? 0.5925 0.5574 0.5411 -0.0280 0.0250  -0.0287 132 LYS C N   
3302 C CA  . LYS C 132 ? 0.5873 0.5637 0.5196 -0.0272 0.0267  -0.0340 132 LYS C CA  
3303 C C   . LYS C 132 ? 0.5524 0.5369 0.4806 -0.0271 0.0237  -0.0228 132 LYS C C   
3304 O O   . LYS C 132 ? 0.5516 0.5386 0.4705 -0.0293 0.0194  -0.0225 132 LYS C O   
3305 C CB  . LYS C 132 ? 0.6498 0.6373 0.5790 -0.0245 0.0357  -0.0432 132 LYS C CB  
3306 C CG  . LYS C 132 ? 0.7825 0.7645 0.7190 -0.0243 0.0376  -0.0559 132 LYS C CG  
3307 C CD  . LYS C 132 ? 0.9418 0.9335 0.8775 -0.0206 0.0477  -0.0649 132 LYS C CD  
3308 C CE  . LYS C 132 ? 0.9929 0.9816 0.9326 -0.0200 0.0472  -0.0805 132 LYS C CE  
3309 N NZ  . LYS C 132 ? 1.1034 1.1015 1.0353 -0.0157 0.0572  -0.0917 132 LYS C NZ  
3310 N N   . ALA C 133 ? 0.5178 0.5069 0.4569 -0.0247 0.0254  -0.0124 133 ALA C N   
3311 C CA  . ALA C 133 ? 0.4774 0.4759 0.4196 -0.0240 0.0205  0.0005  133 ALA C CA  
3312 C C   . ALA C 133 ? 0.4276 0.4149 0.3696 -0.0265 0.0097  0.0046  133 ALA C C   
3313 O O   . ALA C 133 ? 0.4213 0.4160 0.3584 -0.0285 0.0057  0.0061  133 ALA C O   
3314 C CB  . ALA C 133 ? 0.4776 0.4786 0.4368 -0.0201 0.0222  0.0129  133 ALA C CB  
3315 N N   . ALA C 134 ? 0.3722 0.3409 0.3194 -0.0270 0.0052  0.0060  134 ALA C N   
3316 C CA  . ALA C 134 ? 0.3615 0.3175 0.3055 -0.0286 -0.0041 0.0087  134 ALA C CA  
3317 C C   . ALA C 134 ? 0.3559 0.3127 0.2869 -0.0312 -0.0036 0.0002  134 ALA C C   
3318 O O   . ALA C 134 ? 0.3480 0.3041 0.2778 -0.0321 -0.0092 0.0033  134 ALA C O   
3319 C CB  . ALA C 134 ? 0.3380 0.2724 0.2842 -0.0302 -0.0077 0.0087  134 ALA C CB  
3320 N N   . LEU C 135 ? 0.3642 0.3211 0.2884 -0.0322 0.0024  -0.0100 135 LEU C N   
3321 C CA  . LEU C 135 ? 0.3633 0.3193 0.2783 -0.0342 0.0028  -0.0167 135 LEU C CA  
3322 C C   . LEU C 135 ? 0.3866 0.3574 0.2995 -0.0359 0.0026  -0.0144 135 LEU C C   
3323 O O   . LEU C 135 ? 0.3864 0.3555 0.2982 -0.0384 -0.0005 -0.0131 135 LEU C O   
3324 C CB  . LEU C 135 ? 0.3633 0.3170 0.2760 -0.0340 0.0073  -0.0268 135 LEU C CB  
3325 C CG  . LEU C 135 ? 0.3467 0.2869 0.2639 -0.0344 0.0061  -0.0292 135 LEU C CG  
3326 C CD1 . LEU C 135 ? 0.3188 0.2616 0.2400 -0.0339 0.0090  -0.0386 135 LEU C CD1 
3327 C CD2 . LEU C 135 ? 0.2614 0.1893 0.1726 -0.0356 0.0022  -0.0268 135 LEU C CD2 
3328 N N   . GLN C 136 ? 0.4200 0.4056 0.3334 -0.0352 0.0063  -0.0134 136 GLN C N   
3329 C CA  . GLN C 136 ? 0.4539 0.4558 0.3655 -0.0381 0.0054  -0.0095 136 GLN C CA  
3330 C C   . GLN C 136 ? 0.4408 0.4494 0.3641 -0.0396 -0.0017 0.0018  136 GLN C C   
3331 O O   . GLN C 136 ? 0.4390 0.4536 0.3648 -0.0444 -0.0057 0.0044  136 GLN C O   
3332 C CB  . GLN C 136 ? 0.4981 0.5148 0.4071 -0.0361 0.0116  -0.0093 136 GLN C CB  
3333 C CG  . GLN C 136 ? 0.6556 0.6752 0.5499 -0.0377 0.0159  -0.0197 136 GLN C CG  
3334 C CD  . GLN C 136 ? 0.7961 0.8236 0.6853 -0.0337 0.0249  -0.0248 136 GLN C CD  
3335 O OE1 . GLN C 136 ? 0.8745 0.9145 0.7695 -0.0312 0.0286  -0.0165 136 GLN C OE1 
3336 N NE2 . GLN C 136 ? 0.8172 0.8375 0.6973 -0.0324 0.0285  -0.0382 136 GLN C NE2 
3337 N N   . GLU C 137 ? 0.4248 0.4317 0.3584 -0.0358 -0.0046 0.0093  137 GLU C N   
3338 C CA  . GLU C 137 ? 0.4330 0.4467 0.3814 -0.0361 -0.0135 0.0205  137 GLU C CA  
3339 C C   . GLU C 137 ? 0.4197 0.4186 0.3675 -0.0380 -0.0189 0.0173  137 GLU C C   
3340 O O   . GLU C 137 ? 0.4219 0.4289 0.3806 -0.0409 -0.0252 0.0222  137 GLU C O   
3341 C CB  . GLU C 137 ? 0.4391 0.4533 0.4011 -0.0308 -0.0171 0.0312  137 GLU C CB  
3342 C CG  . GLU C 137 ? 0.5020 0.5099 0.4599 -0.0275 -0.0089 0.0280  137 GLU C CG  
3343 C CD  . GLU C 137 ? 0.5592 0.5780 0.5321 -0.0229 -0.0077 0.0403  137 GLU C CD  
3344 O OE1 . GLU C 137 ? 0.5912 0.5975 0.5765 -0.0198 -0.0137 0.0487  137 GLU C OE1 
3345 O OE2 . GLU C 137 ? 0.6187 0.6566 0.5898 -0.0223 0.0000  0.0415  137 GLU C OE2 
3346 N N   . GLY C 138 ? 0.4091 0.3875 0.3460 -0.0367 -0.0164 0.0094  138 GLY C N   
3347 C CA  . GLY C 138 ? 0.4101 0.3742 0.3431 -0.0379 -0.0188 0.0055  138 GLY C CA  
3348 C C   . GLY C 138 ? 0.4302 0.4006 0.3633 -0.0426 -0.0164 0.0025  138 GLY C C   
3349 O O   . GLY C 138 ? 0.4142 0.3834 0.3548 -0.0448 -0.0199 0.0041  138 GLY C O   
3350 N N   . HIS C 139 ? 0.4516 0.4272 0.3778 -0.0444 -0.0109 -0.0018 139 HIS C N   
3351 C CA  . HIS C 139 ? 0.4929 0.4723 0.4203 -0.0496 -0.0102 -0.0028 139 HIS C CA  
3352 C C   . HIS C 139 ? 0.5138 0.5107 0.4568 -0.0546 -0.0164 0.0061  139 HIS C C   
3353 O O   . HIS C 139 ? 0.5092 0.5053 0.4632 -0.0591 -0.0194 0.0085  139 HIS C O   
3354 C CB  . HIS C 139 ? 0.5150 0.4983 0.4323 -0.0503 -0.0059 -0.0080 139 HIS C CB  
3355 C CG  . HIS C 139 ? 0.5699 0.5517 0.4870 -0.0557 -0.0065 -0.0089 139 HIS C CG  
3356 N ND1 . HIS C 139 ? 0.6369 0.6325 0.5571 -0.0624 -0.0099 -0.0040 139 HIS C ND1 
3357 C CD2 . HIS C 139 ? 0.5781 0.5455 0.4942 -0.0559 -0.0051 -0.0121 139 HIS C CD2 
3358 C CE1 . HIS C 139 ? 0.6556 0.6432 0.5769 -0.0671 -0.0113 -0.0044 139 HIS C CE1 
3359 N NE2 . HIS C 139 ? 0.6211 0.5916 0.5410 -0.0625 -0.0082 -0.0089 139 HIS C NE2 
3360 N N   . GLN C 140 ? 0.5386 0.5524 0.4855 -0.0540 -0.0182 0.0120  140 GLN C N   
3361 C CA  . GLN C 140 ? 0.5618 0.5969 0.5259 -0.0592 -0.0249 0.0223  140 GLN C CA  
3362 C C   . GLN C 140 ? 0.5326 0.5659 0.5157 -0.0592 -0.0327 0.0271  140 GLN C C   
3363 O O   . GLN C 140 ? 0.5428 0.5861 0.5433 -0.0659 -0.0382 0.0321  140 GLN C O   
3364 C CB  . GLN C 140 ? 0.5897 0.6427 0.5556 -0.0562 -0.0246 0.0293  140 GLN C CB  
3365 C CG  . GLN C 140 ? 0.7062 0.7842 0.6788 -0.0632 -0.0273 0.0375  140 GLN C CG  
3366 C CD  . GLN C 140 ? 0.8212 0.9204 0.8057 -0.0595 -0.0295 0.0493  140 GLN C CD  
3367 O OE1 . GLN C 140 ? 0.8481 0.9412 0.8312 -0.0513 -0.0264 0.0498  140 GLN C OE1 
3368 N NE2 . GLN C 140 ? 0.9128 1.0372 0.9117 -0.0661 -0.0354 0.0606  140 GLN C NE2 
3369 N N   . PHE C 141 ? 0.5095 0.5286 0.4898 -0.0522 -0.0338 0.0252  141 PHE C N   
3370 C CA  . PHE C 141 ? 0.4998 0.5132 0.4945 -0.0507 -0.0419 0.0277  141 PHE C CA  
3371 C C   . PHE C 141 ? 0.5024 0.5063 0.5001 -0.0551 -0.0402 0.0220  141 PHE C C   
3372 O O   . PHE C 141 ? 0.4984 0.5119 0.5185 -0.0593 -0.0469 0.0266  141 PHE C O   
3373 C CB  . PHE C 141 ? 0.4864 0.4799 0.4703 -0.0431 -0.0431 0.0250  141 PHE C CB  
3374 C CG  . PHE C 141 ? 0.4801 0.4645 0.4747 -0.0405 -0.0527 0.0263  141 PHE C CG  
3375 C CD1 . PHE C 141 ? 0.4707 0.4331 0.4522 -0.0394 -0.0497 0.0169  141 PHE C CD1 
3376 C CD2 . PHE C 141 ? 0.5165 0.5147 0.5350 -0.0388 -0.0650 0.0370  141 PHE C CD2 
3377 C CE1 . PHE C 141 ? 0.4998 0.4523 0.4878 -0.0367 -0.0580 0.0162  141 PHE C CE1 
3378 C CE2 . PHE C 141 ? 0.5453 0.5341 0.5744 -0.0360 -0.0754 0.0369  141 PHE C CE2 
3379 C CZ  . PHE C 141 ? 0.5310 0.4960 0.5432 -0.0349 -0.0715 0.0255  141 PHE C CZ  
3380 N N   . LEU C 142 ? 0.5047 0.4905 0.4830 -0.0541 -0.0310 0.0130  142 LEU C N   
3381 C CA  . LEU C 142 ? 0.5083 0.4834 0.4888 -0.0574 -0.0267 0.0087  142 LEU C CA  
3382 C C   . LEU C 142 ? 0.5361 0.5258 0.5357 -0.0669 -0.0288 0.0143  142 LEU C C   
3383 O O   . LEU C 142 ? 0.5261 0.5144 0.5436 -0.0709 -0.0303 0.0155  142 LEU C O   
3384 C CB  . LEU C 142 ? 0.4890 0.4468 0.4481 -0.0544 -0.0172 0.0012  142 LEU C CB  
3385 C CG  . LEU C 142 ? 0.4501 0.3906 0.3922 -0.0473 -0.0152 -0.0040 142 LEU C CG  
3386 C CD1 . LEU C 142 ? 0.3651 0.2948 0.2915 -0.0454 -0.0073 -0.0093 142 LEU C CD1 
3387 C CD2 . LEU C 142 ? 0.4076 0.3356 0.3517 -0.0453 -0.0163 -0.0064 142 LEU C CD2 
3388 N N   . CYS C 143 ? 0.5763 0.5790 0.5724 -0.0709 -0.0289 0.0177  143 CYS C N   
3389 C CA  . CYS C 143 ? 0.6428 0.6579 0.6549 -0.0816 -0.0324 0.0242  143 CYS C CA  
3390 C C   . CYS C 143 ? 0.6737 0.7079 0.7165 -0.0876 -0.0422 0.0334  143 CYS C C   
3391 O O   . CYS C 143 ? 0.7238 0.7603 0.7885 -0.0963 -0.0451 0.0374  143 CYS C O   
3392 C CB  . CYS C 143 ? 0.6440 0.6698 0.6426 -0.0846 -0.0318 0.0258  143 CYS C CB  
3393 S SG  . CYS C 143 ? 0.6977 0.7019 0.6708 -0.0804 -0.0232 0.0158  143 CYS C SG  
3394 N N   . SER C 144 ? 0.6919 0.7401 0.7402 -0.0830 -0.0482 0.0380  144 SER C N   
3395 C CA  . SER C 144 ? 0.7142 0.7841 0.7956 -0.0875 -0.0599 0.0482  144 SER C CA  
3396 C C   . SER C 144 ? 0.7192 0.7778 0.8180 -0.0853 -0.0631 0.0444  144 SER C C   
3397 O O   . SER C 144 ? 0.7348 0.8051 0.8652 -0.0930 -0.0702 0.0496  144 SER C O   
3398 C CB  . SER C 144 ? 0.7116 0.7999 0.7954 -0.0820 -0.0656 0.0563  144 SER C CB  
3399 O OG  . SER C 144 ? 0.7427 0.8221 0.8316 -0.0727 -0.0707 0.0551  144 SER C OG  
3400 N N   . ILE C 145 ? 0.7317 0.7671 0.8107 -0.0755 -0.0581 0.0348  145 ILE C N   
3401 C CA  . ILE C 145 ? 0.7603 0.7839 0.8525 -0.0734 -0.0605 0.0297  145 ILE C CA  
3402 C C   . ILE C 145 ? 0.7919 0.8045 0.8900 -0.0797 -0.0522 0.0253  145 ILE C C   
3403 O O   . ILE C 145 ? 0.8112 0.8221 0.9323 -0.0817 -0.0547 0.0237  145 ILE C O   
3404 C CB  . ILE C 145 ? 0.7561 0.7569 0.8253 -0.0619 -0.0592 0.0214  145 ILE C CB  
3405 C CG1 . ILE C 145 ? 0.7525 0.7306 0.7869 -0.0582 -0.0455 0.0123  145 ILE C CG1 
3406 C CG2 . ILE C 145 ? 0.7417 0.7513 0.8107 -0.0561 -0.0686 0.0282  145 ILE C CG2 
3407 C CD1 . ILE C 145 ? 0.7788 0.7351 0.8060 -0.0559 -0.0378 0.0030  145 ILE C CD1 
3408 N N   . GLU C 146 ? 0.8187 0.8240 0.8992 -0.0825 -0.0429 0.0240  146 GLU C N   
3409 C CA  . GLU C 146 ? 0.8644 0.8578 0.9525 -0.0883 -0.0353 0.0225  146 GLU C CA  
3410 C C   . GLU C 146 ? 0.9098 0.9212 1.0330 -0.1022 -0.0423 0.0329  146 GLU C C   
3411 O O   . GLU C 146 ? 0.9410 0.9440 1.0830 -0.1083 -0.0385 0.0338  146 GLU C O   
3412 C CB  . GLU C 146 ? 0.8602 0.8381 0.9200 -0.0856 -0.0252 0.0187  146 GLU C CB  
3413 N N   . ALA C 147 ? 0.9316 0.9678 1.0648 -0.1078 -0.0525 0.0418  147 ALA C N   
3414 C CA  . ALA C 147 ? 0.9678 1.0252 1.1377 -0.1224 -0.0620 0.0535  147 ALA C CA  
3415 C C   . ALA C 147 ? 1.0175 1.0880 1.2254 -0.1234 -0.0716 0.0559  147 ALA C C   
3416 O O   . ALA C 147 ? 1.0232 1.0966 1.2287 -0.1135 -0.0762 0.0528  147 ALA C O   
3417 C CB  . ALA C 147 ? 0.9636 1.0438 1.1278 -0.1281 -0.0688 0.0627  147 ALA C CB  
3418 N N   . ARG D 4   ? 0.8828 0.8394 0.7719 -0.0012 -0.0336 -0.0630 4   ARG D N   
3419 C CA  . ARG D 4   ? 0.8651 0.8306 0.7806 -0.0016 -0.0395 -0.0430 4   ARG D CA  
3420 C C   . ARG D 4   ? 0.7962 0.7779 0.7048 0.0036  -0.0367 -0.0295 4   ARG D C   
3421 O O   . ARG D 4   ? 0.8075 0.8127 0.7096 0.0067  -0.0347 -0.0212 4   ARG D O   
3422 C CB  . ARG D 4   ? 0.9177 0.8989 0.8613 -0.0033 -0.0464 -0.0291 4   ARG D CB  
3423 C CG  . ARG D 4   ? 0.9471 0.9451 0.9162 -0.0018 -0.0508 -0.0053 4   ARG D CG  
3424 C CD  . ARG D 4   ? 0.9570 0.9414 0.9560 -0.0066 -0.0545 -0.0053 4   ARG D CD  
3425 N NE  . ARG D 4   ? 1.0200 1.0207 1.0573 -0.0074 -0.0606 0.0146  4   ARG D NE  
3426 C CZ  . ARG D 4   ? 1.0916 1.0859 1.1657 -0.0135 -0.0648 0.0128  4   ARG D CZ  
3427 N NH1 . ARG D 4   ? 1.0995 1.0720 1.1743 -0.0204 -0.0636 -0.0094 4   ARG D NH1 
3428 N NH2 . ARG D 4   ? 1.1413 1.1521 1.2536 -0.0136 -0.0701 0.0329  4   ARG D NH2 
3429 N N   . ALA D 5   ? 0.7210 0.6910 0.6321 0.0036  -0.0367 -0.0284 5   ALA D N   
3430 C CA  . ALA D 5   ? 0.6723 0.6531 0.5783 0.0081  -0.0342 -0.0186 5   ALA D CA  
3431 C C   . ALA D 5   ? 0.6307 0.6107 0.5599 0.0079  -0.0384 -0.0057 5   ALA D C   
3432 O O   . ALA D 5   ? 0.6062 0.5726 0.5512 0.0037  -0.0416 -0.0092 5   ALA D O   
3433 C CB  . ALA D 5   ? 0.6634 0.6304 0.5455 0.0097  -0.0282 -0.0328 5   ALA D CB  
3434 N N   . CYS D 6   ? 0.6070 0.6031 0.5392 0.0116  -0.0375 0.0076  6   CYS D N   
3435 C CA  . CYS D 6   ? 0.5770 0.5738 0.5307 0.0125  -0.0402 0.0193  6   CYS D CA  
3436 C C   . CYS D 6   ? 0.5556 0.5517 0.4987 0.0162  -0.0369 0.0196  6   CYS D C   
3437 O O   . CYS D 6   ? 0.5751 0.5812 0.5017 0.0180  -0.0329 0.0179  6   CYS D O   
3438 C CB  . CYS D 6   ? 0.5891 0.6073 0.5658 0.0127  -0.0435 0.0385  6   CYS D CB  
3439 S SG  . CYS D 6   ? 0.6430 0.6611 0.6397 0.0081  -0.0486 0.0387  6   CYS D SG  
3440 N N   . GLY D 7   ? 0.5228 0.5081 0.4778 0.0166  -0.0383 0.0206  7   GLY D N   
3441 C CA  . GLY D 7   ? 0.4801 0.4622 0.4278 0.0201  -0.0362 0.0203  7   GLY D CA  
3442 C C   . GLY D 7   ? 0.4652 0.4467 0.4357 0.0214  -0.0381 0.0283  7   GLY D C   
3443 O O   . GLY D 7   ? 0.4669 0.4521 0.4610 0.0193  -0.0403 0.0342  7   GLY D O   
3444 N N   . LEU D 8   ? 0.4297 0.4074 0.3964 0.0248  -0.0367 0.0278  8   LEU D N   
3445 C CA  . LEU D 8   ? 0.4046 0.3819 0.3917 0.0267  -0.0375 0.0334  8   LEU D CA  
3446 C C   . LEU D 8   ? 0.3920 0.3528 0.3691 0.0272  -0.0380 0.0237  8   LEU D C   
3447 O O   . LEU D 8   ? 0.4021 0.3582 0.3614 0.0290  -0.0370 0.0189  8   LEU D O   
3448 C CB  . LEU D 8   ? 0.4050 0.3975 0.3994 0.0309  -0.0354 0.0448  8   LEU D CB  
3449 C CG  . LEU D 8   ? 0.4560 0.4690 0.4625 0.0302  -0.0354 0.0591  8   LEU D CG  
3450 C CD1 . LEU D 8   ? 0.4673 0.4948 0.4767 0.0328  -0.0329 0.0688  8   LEU D CD1 
3451 C CD2 . LEU D 8   ? 0.3993 0.4149 0.4351 0.0284  -0.0378 0.0663  8   LEU D CD2 
3452 N N   . ILE D 9   ? 0.3607 0.3146 0.3515 0.0248  -0.0396 0.0205  9   ILE D N   
3453 C CA  . ILE D 9   ? 0.3331 0.2748 0.3159 0.0250  -0.0410 0.0139  9   ILE D CA  
3454 C C   . ILE D 9   ? 0.3414 0.2891 0.3349 0.0312  -0.0395 0.0204  9   ILE D C   
3455 O O   . ILE D 9   ? 0.3409 0.2955 0.3572 0.0322  -0.0383 0.0244  9   ILE D O   
3456 C CB  . ILE D 9   ? 0.3295 0.2661 0.3236 0.0186  -0.0427 0.0075  9   ILE D CB  
3457 C CG1 . ILE D 9   ? 0.3210 0.2493 0.3028 0.0110  -0.0441 -0.0014 9   ILE D CG1 
3458 C CG2 . ILE D 9   ? 0.2910 0.2188 0.2783 0.0187  -0.0448 0.0032  9   ILE D CG2 
3459 C CD1 . ILE D 9   ? 0.2807 0.2098 0.2800 0.0021  -0.0446 -0.0085 9   ILE D CD1 
3460 N N   . ILE D 10  ? 0.3502 0.2961 0.3296 0.0350  -0.0389 0.0200  10  ILE D N   
3461 C CA  . ILE D 10  ? 0.3501 0.2995 0.3371 0.0404  -0.0374 0.0235  10  ILE D CA  
3462 C C   . ILE D 10  ? 0.3573 0.2963 0.3486 0.0418  -0.0399 0.0191  10  ILE D C   
3463 O O   . ILE D 10  ? 0.3534 0.2803 0.3325 0.0392  -0.0433 0.0131  10  ILE D O   
3464 C CB  . ILE D 10  ? 0.3576 0.3090 0.3309 0.0418  -0.0357 0.0214  10  ILE D CB  
3465 C CG1 . ILE D 10  ? 0.3773 0.3412 0.3431 0.0389  -0.0333 0.0241  10  ILE D CG1 
3466 C CG2 . ILE D 10  ? 0.3695 0.3280 0.3524 0.0456  -0.0334 0.0248  10  ILE D CG2 
3467 C CD1 . ILE D 10  ? 0.4119 0.3941 0.3904 0.0397  -0.0310 0.0351  10  ILE D CD1 
3468 N N   . PHE D 11  ? 0.3701 0.3150 0.3797 0.0456  -0.0379 0.0226  11  PHE D N   
3469 C CA  . PHE D 11  ? 0.4215 0.3591 0.4358 0.0474  -0.0400 0.0181  11  PHE D CA  
3470 C C   . PHE D 11  ? 0.4525 0.3931 0.4774 0.0541  -0.0374 0.0197  11  PHE D C   
3471 O O   . PHE D 11  ? 0.4604 0.4113 0.4935 0.0566  -0.0332 0.0254  11  PHE D O   
3472 C CB  . PHE D 11  ? 0.4055 0.3467 0.4346 0.0431  -0.0399 0.0157  11  PHE D CB  
3473 C CG  . PHE D 11  ? 0.4126 0.3674 0.4694 0.0457  -0.0346 0.0201  11  PHE D CG  
3474 C CD1 . PHE D 11  ? 0.4318 0.3903 0.5046 0.0507  -0.0318 0.0188  11  PHE D CD1 
3475 C CD2 . PHE D 11  ? 0.4293 0.3937 0.4986 0.0431  -0.0322 0.0255  11  PHE D CD2 
3476 C CE1 . PHE D 11  ? 0.4426 0.4140 0.5439 0.0533  -0.0258 0.0227  11  PHE D CE1 
3477 C CE2 . PHE D 11  ? 0.4187 0.3964 0.5184 0.0454  -0.0272 0.0310  11  PHE D CE2 
3478 C CZ  . PHE D 11  ? 0.4508 0.4320 0.5667 0.0505  -0.0235 0.0295  11  PHE D CZ  
3479 N N   . ARG D 12  ? 0.4813 0.4135 0.5061 0.0566  -0.0401 0.0149  12  ARG D N   
3480 C CA  . ARG D 12  ? 0.5224 0.4565 0.5601 0.0629  -0.0374 0.0142  12  ARG D CA  
3481 C C   . ARG D 12  ? 0.5564 0.4899 0.6057 0.0641  -0.0384 0.0101  12  ARG D C   
3482 O O   . ARG D 12  ? 0.5639 0.4930 0.6060 0.0594  -0.0431 0.0074  12  ARG D O   
3483 C CB  . ARG D 12  ? 0.5246 0.4512 0.5533 0.0653  -0.0389 0.0109  12  ARG D CB  
3484 C CG  . ARG D 12  ? 0.5372 0.4503 0.5562 0.0642  -0.0455 0.0063  12  ARG D CG  
3485 C CD  . ARG D 12  ? 0.5425 0.4504 0.5582 0.0652  -0.0460 0.0024  12  ARG D CD  
3486 N NE  . ARG D 12  ? 0.5641 0.4586 0.5752 0.0644  -0.0530 -0.0003 12  ARG D NE  
3487 C CZ  . ARG D 12  ? 0.5588 0.4464 0.5731 0.0650  -0.0548 -0.0050 12  ARG D CZ  
3488 N NH1 . ARG D 12  ? 0.5443 0.4383 0.5649 0.0654  -0.0495 -0.0093 12  ARG D NH1 
3489 N NH2 . ARG D 12  ? 0.5637 0.4396 0.5769 0.0642  -0.0619 -0.0052 12  ARG D NH2 
3490 N N   . ARG D 13  ? 0.6033 0.5430 0.6710 0.0698  -0.0334 0.0094  13  ARG D N   
3491 C CA  . ARG D 13  ? 0.6526 0.5956 0.7344 0.0714  -0.0327 0.0041  13  ARG D CA  
3492 C C   . ARG D 13  ? 0.7042 0.6374 0.7830 0.0772  -0.0354 -0.0006 13  ARG D C   
3493 O O   . ARG D 13  ? 0.7101 0.6409 0.7914 0.0822  -0.0325 -0.0010 13  ARG D O   
3494 C CB  . ARG D 13  ? 0.6464 0.6043 0.7557 0.0742  -0.0238 0.0051  13  ARG D CB  
3495 C CG  . ARG D 13  ? 0.6423 0.6120 0.7657 0.0672  -0.0216 0.0048  13  ARG D CG  
3496 C CD  . ARG D 13  ? 0.6554 0.6410 0.8130 0.0703  -0.0120 0.0056  13  ARG D CD  
3497 N NE  . ARG D 13  ? 0.6718 0.6686 0.8465 0.0631  -0.0095 0.0076  13  ARG D NE  
3499 N NH1 . ARG D 13  ? 0.7670 0.7750 0.9529 0.0541  -0.0094 -0.0096 13  ARG D NH1 
3500 N NH2 . ARG D 13  ? 0.6759 0.6922 0.8837 0.0482  -0.0058 0.0001  13  ARG D NH2 
3501 N N   . CYS D 14  ? 0.7791 0.7075 0.8533 0.0756  -0.0415 -0.0044 14  CYS D N   
3502 C CA  . CYS D 14  ? 0.8364 0.7543 0.9088 0.0806  -0.0460 -0.0084 14  CYS D CA  
3503 C C   . CYS D 14  ? 0.8756 0.8014 0.9662 0.0856  -0.0420 -0.0143 14  CYS D C   
3504 O O   . CYS D 14  ? 0.8953 0.8301 0.9908 0.0821  -0.0430 -0.0165 14  CYS D O   
3505 C CB  . CYS D 14  ? 0.8481 0.7557 0.9047 0.0757  -0.0564 -0.0068 14  CYS D CB  
3506 S SG  . CYS D 14  ? 0.8831 0.7851 0.9192 0.0679  -0.0597 -0.0012 14  CYS D SG  
3507 N N   . LEU D 15  ? 0.8777 0.8016 0.9789 0.0931  -0.0367 -0.0181 15  LEU D N   
3508 C CA  . LEU D 15  ? 0.9406 0.8739 1.0623 0.0991  -0.0296 -0.0246 15  LEU D CA  
3509 C C   . LEU D 15  ? 1.0558 0.9816 1.1804 0.1045  -0.0336 -0.0323 15  LEU D C   
3510 O O   . LEU D 15  ? 1.0931 1.0247 1.2346 0.1110  -0.0267 -0.0396 15  LEU D O   
3511 C CB  . LEU D 15  ? 0.9171 0.8554 1.0521 0.1040  -0.0192 -0.0240 15  LEU D CB  
3512 C CG  . LEU D 15  ? 0.8763 0.8255 1.0146 0.0990  -0.0151 -0.0153 15  LEU D CG  
3513 C CD1 . LEU D 15  ? 0.8653 0.8184 1.0128 0.1027  -0.0073 -0.0111 15  LEU D CD1 
3514 C CD2 . LEU D 15  ? 0.8289 0.7940 0.9848 0.0955  -0.0111 -0.0169 15  LEU D CD2 
3515 N N   . ILE D 16  ? 1.1563 1.0694 1.2668 0.1020  -0.0447 -0.0309 16  ILE D N   
3516 C CA  . ILE D 16  ? 1.2558 1.1617 1.3712 0.1069  -0.0502 -0.0371 16  ILE D CA  
3517 C C   . ILE D 16  ? 1.3663 1.2779 1.4764 0.1016  -0.0591 -0.0342 16  ILE D C   
3518 O O   . ILE D 16  ? 1.3190 1.2245 1.4140 0.0948  -0.0683 -0.0265 16  ILE D O   
3519 C CB  . ILE D 16  ? 1.2366 1.1239 1.3483 0.1091  -0.0555 -0.0392 16  ILE D CB  
3520 C CG1 . ILE D 16  ? 1.1859 1.0724 1.3049 0.1132  -0.0454 -0.0444 16  ILE D CG1 
3521 C CG2 . ILE D 16  ? 1.2458 1.1243 1.3646 0.1133  -0.0632 -0.0448 16  ILE D CG2 
3522 C CD1 . ILE D 16  ? 1.0764 0.9536 1.1874 0.1093  -0.0471 -0.0433 16  ILE D CD1 
3523 N N   . PRO D 17  ? 1.5043 1.4297 1.6273 0.1041  -0.0556 -0.0407 17  PRO D N   
3524 C CA  . PRO D 17  ? 1.5966 1.5343 1.7154 0.0970  -0.0625 -0.0384 17  PRO D CA  
3525 C C   . PRO D 17  ? 1.6718 1.5969 1.7816 0.0965  -0.0772 -0.0338 17  PRO D C   
3526 O O   . PRO D 17  ? 1.6883 1.5991 1.8046 0.1043  -0.0800 -0.0377 17  PRO D O   
3527 C CB  . PRO D 17  ? 1.6233 1.5815 1.7630 0.1011  -0.0523 -0.0493 17  PRO D CB  
3528 C CG  . PRO D 17  ? 1.5836 1.5390 1.7381 0.1101  -0.0393 -0.0554 17  PRO D CG  
3529 C CD  . PRO D 17  ? 1.5294 1.4609 1.6722 0.1134  -0.0447 -0.0513 17  PRO D CD  
3530 N N   . LYS D 18  ? 1.7083 1.6393 1.8052 0.0865  -0.0865 -0.0255 18  LYS D N   
3531 C CA  . LYS D 18  ? 1.7382 1.6588 1.8270 0.0841  -0.1022 -0.0171 18  LYS D CA  
3532 C C   . LYS D 18  ? 1.6998 1.5955 1.7843 0.0867  -0.1090 -0.0114 18  LYS D C   
3533 O O   . LYS D 18  ? 1.7423 1.6275 1.8264 0.0859  -0.1217 -0.0045 18  LYS D O   
3534 C CB  . LYS D 18  ? 1.8034 1.7210 1.9071 0.0933  -0.1052 -0.0236 18  LYS D CB  
3535 N N   . VAL D 19  ? 1.5866 1.4749 1.6701 0.0890  -0.1006 -0.0143 19  VAL D N   
3536 C CA  . VAL D 19  ? 1.4795 1.3489 1.5602 0.0894  -0.1044 -0.0110 19  VAL D CA  
3537 C C   . VAL D 19  ? 1.3433 1.2165 1.4076 0.0815  -0.1015 -0.0049 19  VAL D C   
3538 O O   . VAL D 19  ? 1.2984 1.1624 1.3532 0.0764  -0.1086 0.0025  19  VAL D O   
3539 C CB  . VAL D 19  ? 1.4920 1.3530 1.5846 0.0972  -0.0958 -0.0211 19  VAL D CB  
3540 C CG1 . VAL D 19  ? 1.4673 1.3199 1.5536 0.0940  -0.0936 -0.0191 19  VAL D CG1 
3541 C CG2 . VAL D 19  ? 1.5443 1.3946 1.6529 0.1035  -0.1012 -0.0274 19  VAL D CG2 
3542 N N   . ASP D 20  ? 1.2435 1.1301 1.3070 0.0805  -0.0910 -0.0085 20  ASP D N   
3543 C CA  . ASP D 20  ? 1.1649 1.0551 1.2153 0.0734  -0.0877 -0.0044 20  ASP D CA  
3544 C C   . ASP D 20  ? 1.1667 1.0706 1.2093 0.0638  -0.0903 -0.0015 20  ASP D C   
3545 O O   . ASP D 20  ? 1.1855 1.1064 1.2372 0.0623  -0.0830 -0.0069 20  ASP D O   
3546 C CB  . ASP D 20  ? 1.1138 1.0110 1.1712 0.0768  -0.0752 -0.0091 20  ASP D CB  
3547 C CG  . ASP D 20  ? 1.1194 1.0058 1.1800 0.0826  -0.0721 -0.0114 20  ASP D CG  
3548 O OD1 . ASP D 20  ? 1.0994 0.9726 1.1568 0.0825  -0.0788 -0.0101 20  ASP D OD1 
3549 O OD2 . ASP D 20  ? 1.1213 1.0141 1.1897 0.0862  -0.0625 -0.0146 20  ASP D OD2 
3550 N N   . ASN D 21  ? 1.1522 1.0499 1.1801 0.0563  -0.1001 0.0061  21  ASN D N   
3551 C CA  . ASN D 21  ? 1.1686 1.0794 1.1862 0.0445  -0.1032 0.0086  21  ASN D CA  
3552 C C   . ASN D 21  ? 1.0875 1.0090 1.1040 0.0388  -0.0934 0.0037  21  ASN D C   
3553 O O   . ASN D 21  ? 1.1091 1.0492 1.1298 0.0307  -0.0902 -0.0008 21  ASN D O   
3554 C CB  . ASN D 21  ? 1.2665 1.1662 1.2675 0.0374  -0.1150 0.0189  21  ASN D CB  
3555 C CG  . ASN D 21  ? 1.4621 1.3592 1.4674 0.0389  -0.1265 0.0253  21  ASN D CG  
3556 O OD1 . ASN D 21  ? 1.6033 1.5159 1.6070 0.0322  -0.1311 0.0270  21  ASN D OD1 
3557 N ND2 . ASN D 21  ? 1.5756 1.4549 1.5885 0.0470  -0.1313 0.0285  21  ASN D ND2 
3558 N N   . ASN D 22  ? 1.0109 0.9223 1.0244 0.0425  -0.0885 0.0038  22  ASN D N   
3559 C CA  . ASN D 22  ? 0.9079 0.8271 0.9219 0.0379  -0.0804 0.0004  22  ASN D CA  
3560 C C   . ASN D 22  ? 0.8523 0.7790 0.8860 0.0463  -0.0699 -0.0042 22  ASN D C   
3561 O O   . ASN D 22  ? 0.8671 0.7847 0.9041 0.0553  -0.0682 -0.0034 22  ASN D O   
3562 C CB  . ASN D 22  ? 0.8909 0.7961 0.8883 0.0360  -0.0819 0.0043  22  ASN D CB  
3563 C CG  . ASN D 22  ? 0.9444 0.8404 0.9232 0.0281  -0.0917 0.0097  22  ASN D CG  
3564 O OD1 . ASN D 22  ? 0.9563 0.8594 0.9264 0.0170  -0.0938 0.0089  22  ASN D OD1 
3565 N ND2 . ASN D 22  ? 0.9679 0.8487 0.9426 0.0331  -0.0974 0.0147  22  ASN D ND2 
3566 N N   . ALA D 23  ? 0.7823 0.7268 0.8315 0.0425  -0.0624 -0.0096 23  ALA D N   
3567 C CA  . ALA D 23  ? 0.7156 0.6676 0.7859 0.0499  -0.0522 -0.0123 23  ALA D CA  
3568 C C   . ALA D 23  ? 0.6642 0.6083 0.7276 0.0509  -0.0499 -0.0075 23  ALA D C   
3569 O O   . ALA D 23  ? 0.6555 0.5985 0.7272 0.0587  -0.0447 -0.0056 23  ALA D O   
3570 C CB  . ALA D 23  ? 0.7131 0.6869 0.8062 0.0446  -0.0444 -0.0191 23  ALA D CB  
3571 N N   . ILE D 24  ? 0.6108 0.5504 0.6580 0.0426  -0.0538 -0.0057 24  ILE D N   
3572 C CA  . ILE D 24  ? 0.5561 0.4901 0.5958 0.0428  -0.0519 -0.0019 24  ILE D CA  
3573 C C   . ILE D 24  ? 0.5507 0.4692 0.5650 0.0402  -0.0588 0.0008  24  ILE D C   
3574 O O   . ILE D 24  ? 0.5803 0.4946 0.5818 0.0329  -0.0646 0.0001  24  ILE D O   
3575 C CB  . ILE D 24  ? 0.5383 0.4846 0.5907 0.0357  -0.0467 -0.0042 24  ILE D CB  
3576 C CG1 . ILE D 24  ? 0.5145 0.4767 0.5981 0.0400  -0.0382 -0.0062 24  ILE D CG1 
3577 C CG2 . ILE D 24  ? 0.4891 0.4298 0.5314 0.0350  -0.0461 -0.0002 24  ILE D CG2 
3578 C CD1 . ILE D 24  ? 0.4908 0.4674 0.5971 0.0332  -0.0323 -0.0090 24  ILE D CD1 
3579 N N   . GLU D 25  ? 0.5199 0.4316 0.5284 0.0456  -0.0574 0.0038  25  GLU D N   
3580 C CA  . GLU D 25  ? 0.5090 0.4085 0.4984 0.0438  -0.0615 0.0050  25  GLU D CA  
3581 C C   . GLU D 25  ? 0.4742 0.3771 0.4592 0.0429  -0.0567 0.0059  25  GLU D C   
3582 O O   . GLU D 25  ? 0.4472 0.3593 0.4437 0.0468  -0.0513 0.0080  25  GLU D O   
3583 C CB  . GLU D 25  ? 0.5262 0.4172 0.5161 0.0502  -0.0638 0.0054  25  GLU D CB  
3584 C CG  . GLU D 25  ? 0.5935 0.4785 0.5858 0.0510  -0.0707 0.0056  25  GLU D CG  
3585 C CD  . GLU D 25  ? 0.6858 0.5608 0.6814 0.0560  -0.0737 0.0052  25  GLU D CD  
3586 O OE1 . GLU D 25  ? 0.7575 0.6349 0.7603 0.0605  -0.0682 0.0025  25  GLU D OE1 
3587 O OE2 . GLU D 25  ? 0.7235 0.5891 0.7161 0.0546  -0.0813 0.0074  25  GLU D OE2 
3588 N N   . PHE D 26  ? 0.4594 0.3553 0.4278 0.0376  -0.0589 0.0047  26  PHE D N   
3589 C CA  . PHE D 26  ? 0.4502 0.3489 0.4116 0.0360  -0.0550 0.0045  26  PHE D CA  
3590 C C   . PHE D 26  ? 0.4565 0.3499 0.4078 0.0386  -0.0543 0.0035  26  PHE D C   
3591 O O   . PHE D 26  ? 0.4806 0.3648 0.4290 0.0396  -0.0580 0.0027  26  PHE D O   
3592 C CB  . PHE D 26  ? 0.4465 0.3418 0.3978 0.0275  -0.0565 0.0009  26  PHE D CB  
3593 C CG  . PHE D 26  ? 0.4604 0.3646 0.4259 0.0226  -0.0556 -0.0006 26  PHE D CG  
3594 C CD1 . PHE D 26  ? 0.4516 0.3678 0.4345 0.0240  -0.0507 0.0013  26  PHE D CD1 
3595 C CD2 . PHE D 26  ? 0.4868 0.3899 0.4516 0.0160  -0.0594 -0.0040 26  PHE D CD2 
3596 C CE1 . PHE D 26  ? 0.4408 0.3669 0.4433 0.0190  -0.0487 -0.0013 26  PHE D CE1 
3597 C CE2 . PHE D 26  ? 0.4728 0.3878 0.4547 0.0100  -0.0571 -0.0079 26  PHE D CE2 
3598 C CZ  . PHE D 26  ? 0.4492 0.3755 0.4520 0.0117  -0.0513 -0.0072 26  PHE D CZ  
3599 N N   . LEU D 27  ? 0.4468 0.3481 0.3958 0.0392  -0.0494 0.0036  27  LEU D N   
3600 C CA  . LEU D 27  ? 0.4541 0.3545 0.3960 0.0402  -0.0471 0.0003  27  LEU D CA  
3601 C C   . LEU D 27  ? 0.4732 0.3697 0.4000 0.0358  -0.0460 -0.0038 27  LEU D C   
3602 O O   . LEU D 27  ? 0.4935 0.3963 0.4171 0.0335  -0.0439 -0.0034 27  LEU D O   
3603 C CB  . LEU D 27  ? 0.4493 0.3652 0.3984 0.0426  -0.0415 0.0020  27  LEU D CB  
3604 C CG  . LEU D 27  ? 0.4488 0.3713 0.3933 0.0416  -0.0368 -0.0034 27  LEU D CG  
3605 C CD1 . LEU D 27  ? 0.4374 0.3527 0.3892 0.0431  -0.0378 -0.0085 27  LEU D CD1 
3606 C CD2 . LEU D 27  ? 0.3843 0.3264 0.3332 0.0413  -0.0317 -0.0003 27  LEU D CD2 
3607 N N   . LEU D 28  ? 0.4981 0.3840 0.4176 0.0349  -0.0473 -0.0079 28  LEU D N   
3608 C CA  . LEU D 28  ? 0.5059 0.3876 0.4112 0.0314  -0.0449 -0.0134 28  LEU D CA  
3609 C C   . LEU D 28  ? 0.5415 0.4272 0.4482 0.0331  -0.0394 -0.0191 28  LEU D C   
3610 O O   . LEU D 28  ? 0.5618 0.4451 0.4793 0.0352  -0.0401 -0.0196 28  LEU D O   
3611 C CB  . LEU D 28  ? 0.5041 0.3698 0.3993 0.0268  -0.0504 -0.0141 28  LEU D CB  
3612 C CG  . LEU D 28  ? 0.4709 0.3351 0.3650 0.0221  -0.0547 -0.0118 28  LEU D CG  
3613 C CD1 . LEU D 28  ? 0.4581 0.3091 0.3390 0.0150  -0.0595 -0.0140 28  LEU D CD1 
3614 C CD2 . LEU D 28  ? 0.4014 0.2747 0.2956 0.0204  -0.0507 -0.0139 28  LEU D CD2 
3615 N N   . LEU D 29  ? 0.5676 0.4612 0.4663 0.0317  -0.0333 -0.0245 29  LEU D N   
3616 C CA  . LEU D 29  ? 0.6112 0.5131 0.5139 0.0323  -0.0261 -0.0324 29  LEU D CA  
3617 C C   . LEU D 29  ? 0.6606 0.5499 0.5525 0.0304  -0.0246 -0.0389 29  LEU D C   
3618 O O   . LEU D 29  ? 0.6564 0.5362 0.5342 0.0277  -0.0273 -0.0389 29  LEU D O   
3619 C CB  . LEU D 29  ? 0.5844 0.5090 0.4866 0.0316  -0.0190 -0.0349 29  LEU D CB  
3620 C CG  . LEU D 29  ? 0.5615 0.4998 0.4698 0.0323  -0.0203 -0.0265 29  LEU D CG  
3621 C CD1 . LEU D 29  ? 0.5302 0.4917 0.4348 0.0301  -0.0140 -0.0279 29  LEU D CD1 
3622 C CD2 . LEU D 29  ? 0.5099 0.4509 0.4336 0.0341  -0.0213 -0.0246 29  LEU D CD2 
3623 N N   . GLN D 30  ? 0.7262 0.6158 0.6273 0.0311  -0.0200 -0.0453 30  GLN D N   
3624 C CA  . GLN D 30  ? 0.7992 0.6775 0.6930 0.0298  -0.0170 -0.0519 30  GLN D CA  
3625 C C   . GLN D 30  ? 0.8410 0.7363 0.7347 0.0297  -0.0054 -0.0637 30  GLN D C   
3626 O O   . GLN D 30  ? 0.8653 0.7796 0.7746 0.0301  0.0010  -0.0685 30  GLN D O   
3627 C CB  . GLN D 30  ? 0.8122 0.6790 0.7213 0.0307  -0.0195 -0.0506 30  GLN D CB  
3628 C CG  . GLN D 30  ? 0.8527 0.7017 0.7514 0.0287  -0.0209 -0.0516 30  GLN D CG  
3629 C CD  . GLN D 30  ? 0.9137 0.7534 0.8317 0.0295  -0.0229 -0.0491 30  GLN D CD  
3630 O OE1 . GLN D 30  ? 0.9502 0.7976 0.8918 0.0316  -0.0224 -0.0488 30  GLN D OE1 
3631 N NE2 . GLN D 30  ? 0.9445 0.7678 0.8544 0.0273  -0.0253 -0.0473 30  GLN D NE2 
3632 N N   . ALA D 31  ? 0.8961 0.7862 0.7729 0.0284  -0.0023 -0.0697 31  ALA D N   
3633 C CA  . ALA D 31  ? 0.9562 0.8638 0.8316 0.0284  0.0091  -0.0818 31  ALA D CA  
3634 C C   . ALA D 31  ? 1.0222 0.9331 0.9140 0.0293  0.0181  -0.0922 31  ALA D C   
3635 O O   . ALA D 31  ? 1.0401 0.9315 0.9339 0.0296  0.0157  -0.0915 31  ALA D O   
3636 C CB  . ALA D 31  ? 0.9483 0.8478 0.8022 0.0269  0.0095  -0.0864 31  ALA D CB  
3637 N N   . SER D 32  ? 1.0918 1.0295 0.9977 0.0288  0.0287  -0.1017 32  SER D N   
3638 C CA  . SER D 32  ? 1.1893 1.1350 1.1165 0.0288  0.0399  -0.1145 32  SER D CA  
3639 C C   . SER D 32  ? 1.2759 1.2147 1.1908 0.0298  0.0474  -0.1253 32  SER D C   
3640 O O   . SER D 32  ? 1.2929 1.2154 1.2156 0.0310  0.0492  -0.1282 32  SER D O   
3641 C CB  . SER D 32  ? 1.1750 1.1558 1.1223 0.0258  0.0504  -0.1242 32  SER D CB  
3642 O OG  . SER D 32  ? 1.1547 1.1562 1.0853 0.0240  0.0528  -0.1249 32  SER D OG  
3643 N N   . ASP D 33  ? 1.4259 1.3063 1.4649 0.0564  -0.1799 -0.0302 33  ASP D N   
3644 C CA  . ASP D 33  ? 1.5294 1.4042 1.6217 0.0528  -0.1972 -0.0177 33  ASP D CA  
3645 C C   . ASP D 33  ? 1.5007 1.4036 1.6267 0.0442  -0.1761 0.0056  33  ASP D C   
3646 O O   . ASP D 33  ? 1.4496 1.3621 1.5553 0.0396  -0.1557 0.0110  33  ASP D O   
3647 C CB  . ASP D 33  ? 1.5867 1.4423 1.6689 0.0535  -0.2096 -0.0208 33  ASP D CB  
3648 C CG  . ASP D 33  ? 1.7154 1.5417 1.7761 0.0651  -0.2384 -0.0420 33  ASP D CG  
3649 O OD1 . ASP D 33  ? 1.7302 1.5519 1.7491 0.0754  -0.2370 -0.0590 33  ASP D OD1 
3650 O OD2 . ASP D 33  ? 1.8194 1.6269 1.9040 0.0653  -0.2629 -0.0405 33  ASP D OD2 
3651 N N   . GLY D 34  ? 1.5696 1.4857 1.7466 0.0441  -0.1820 0.0187  34  GLY D N   
3652 C CA  . GLY D 34  ? 1.5929 1.5402 1.8121 0.0409  -0.1653 0.0438  34  GLY D CA  
3653 C C   . GLY D 34  ? 1.5948 1.5704 1.8044 0.0393  -0.1422 0.0445  34  GLY D C   
3654 O O   . GLY D 34  ? 1.6053 1.6098 1.8599 0.0400  -0.1342 0.0636  34  GLY D O   
3655 N N   . ILE D 35  ? 1.5862 1.5556 1.7397 0.0381  -0.1317 0.0263  35  ILE D N   
3656 C CA  . ILE D 35  ? 1.5332 1.5255 1.6730 0.0356  -0.1121 0.0262  35  ILE D CA  
3657 C C   . ILE D 35  ? 1.4714 1.4953 1.6173 0.0313  -0.0866 0.0419  35  ILE D C   
3658 O O   . ILE D 35  ? 1.4583 1.5069 1.6052 0.0288  -0.0709 0.0465  35  ILE D O   
3659 C CB  . ILE D 35  ? 1.4350 1.4355 1.6148 0.0383  -0.1226 0.0291  35  ILE D CB  
3660 C CG1 . ILE D 35  ? 1.4204 1.4276 1.5645 0.0373  -0.1090 0.0202  35  ILE D CG1 
3661 C CG2 . ILE D 35  ? 1.4256 1.4603 1.6697 0.0377  -0.1160 0.0539  35  ILE D CG2 
3662 C CD1 . ILE D 35  ? 1.4226 1.4576 1.6106 0.0360  -0.1032 0.0319  35  ILE D CD1 
3663 N N   . HIS D 36  ? 1.4386 1.4615 1.5874 0.0316  -0.0824 0.0503  36  HIS D N   
3664 C CA  . HIS D 36  ? 1.3826 1.4328 1.5343 0.0317  -0.0600 0.0643  36  HIS D CA  
3665 C C   . HIS D 36  ? 1.2881 1.3280 1.3937 0.0290  -0.0474 0.0574  36  HIS D C   
3666 O O   . HIS D 36  ? 1.2826 1.3392 1.3883 0.0318  -0.0319 0.0677  36  HIS D O   
3667 C CB  . HIS D 36  ? 1.4488 1.5182 1.6609 0.0392  -0.0628 0.0896  36  HIS D CB  
3668 C CG  . HIS D 36  ? 1.5204 1.5662 1.7511 0.0416  -0.0805 0.0957  36  HIS D CG  
3669 N ND1 . HIS D 36  ? 1.5471 1.5584 1.7442 0.0373  -0.0940 0.0773  36  HIS D ND1 
3670 C CD2 . HIS D 36  ? 1.5777 1.6314 1.8589 0.0485  -0.0868 0.1210  36  HIS D CD2 
3671 C CE1 . HIS D 36  ? 1.5896 1.5874 1.8144 0.0396  -0.1081 0.0893  36  HIS D CE1 
3672 N NE2 . HIS D 36  ? 1.6385 1.6603 1.9149 0.0460  -0.1044 0.1169  36  HIS D NE2 
3673 N N   . HIS D 37  ? 1.1807 1.1941 1.2485 0.0255  -0.0544 0.0408  37  HIS D N   
3674 C CA  . HIS D 37  ? 1.0517 1.0557 1.0841 0.0229  -0.0441 0.0356  37  HIS D CA  
3675 C C   . HIS D 37  ? 0.9472 0.9465 0.9329 0.0175  -0.0365 0.0216  37  HIS D C   
3676 O O   . HIS D 37  ? 0.9401 0.9286 0.9084 0.0176  -0.0449 0.0115  37  HIS D O   
3677 C CB  . HIS D 37  ? 1.0724 1.0539 1.1089 0.0243  -0.0562 0.0352  37  HIS D CB  
3678 N N   . TRP D 38  ? 0.8126 0.8197 0.7792 0.0146  -0.0216 0.0225  38  TRP D N   
3679 C CA  . TRP D 38  ? 0.7134 0.7156 0.6418 0.0089  -0.0158 0.0129  38  TRP D CA  
3680 C C   . TRP D 38  ? 0.6645 0.6538 0.5768 0.0077  -0.0119 0.0096  38  TRP D C   
3681 O O   . TRP D 38  ? 0.6523 0.6450 0.5694 0.0102  -0.0040 0.0149  38  TRP D O   
3682 C CB  . TRP D 38  ? 0.7010 0.7224 0.6211 0.0052  -0.0039 0.0160  38  TRP D CB  
3683 C CG  . TRP D 38  ? 0.6814 0.7173 0.6107 0.0038  -0.0040 0.0192  38  TRP D CG  
3684 C CD1 . TRP D 38  ? 0.6818 0.7385 0.6439 0.0069  -0.0014 0.0289  38  TRP D CD1 
3685 C CD2 . TRP D 38  ? 0.6537 0.6869 0.5614 0.0001  -0.0053 0.0158  38  TRP D CD2 
3686 N NE1 . TRP D 38  ? 0.6772 0.7433 0.6391 0.0038  -0.0007 0.0297  38  TRP D NE1 
3687 C CE2 . TRP D 38  ? 0.6698 0.7205 0.5960 0.0001  -0.0028 0.0222  38  TRP D CE2 
3688 C CE3 . TRP D 38  ? 0.6156 0.6358 0.4932 -0.0018 -0.0077 0.0110  38  TRP D CE3 
3689 C CZ2 . TRP D 38  ? 0.6516 0.7040 0.5624 -0.0018 -0.0017 0.0234  38  TRP D CZ2 
3690 C CZ3 . TRP D 38  ? 0.6193 0.6428 0.4832 -0.0021 -0.0073 0.0142  38  TRP D CZ3 
3691 C CH2 . TRP D 38  ? 0.6321 0.6700 0.5101 -0.0022 -0.0039 0.0200  38  TRP D CH2 
3692 N N   . THR D 39  ? 0.6110 0.5873 0.5047 0.0057  -0.0167 0.0021  39  THR D N   
3693 C CA  . THR D 39  ? 0.5644 0.5302 0.4462 0.0038  -0.0129 -0.0007 39  THR D CA  
3694 C C   . THR D 39  ? 0.5306 0.4926 0.3931 0.0015  -0.0158 -0.0061 39  THR D C   
3695 O O   . THR D 39  ? 0.5346 0.4992 0.3919 0.0045  -0.0220 -0.0069 39  THR D O   
3696 C CB  . THR D 39  ? 0.5753 0.5304 0.4737 0.0073  -0.0174 0.0025  39  THR D CB  
3697 O OG1 . THR D 39  ? 0.5784 0.5263 0.4741 0.0093  -0.0282 -0.0025 39  THR D OG1 
3698 C CG2 . THR D 39  ? 0.5678 0.5281 0.4949 0.0119  -0.0199 0.0127  39  THR D CG2 
3699 N N   . PRO D 40  ? 0.4952 0.4517 0.3490 -0.0017 -0.0114 -0.0081 40  PRO D N   
3700 C CA  . PRO D 40  ? 0.4754 0.4319 0.3203 -0.0023 -0.0142 -0.0090 40  PRO D CA  
3701 C C   . PRO D 40  ? 0.4714 0.4251 0.3239 0.0046  -0.0210 -0.0094 40  PRO D C   
3702 O O   . PRO D 40  ? 0.4732 0.4214 0.3380 0.0068  -0.0240 -0.0094 40  PRO D O   
3703 C CB  . PRO D 40  ? 0.4754 0.4252 0.3192 -0.0070 -0.0086 -0.0108 40  PRO D CB  
3704 C CG  . PRO D 40  ? 0.4736 0.4199 0.3160 -0.0078 -0.0025 -0.0121 40  PRO D CG  
3705 C CD  . PRO D 40  ? 0.4953 0.4465 0.3493 -0.0031 -0.0035 -0.0082 40  PRO D CD  
3706 N N   . PRO D 41  ? 0.4685 0.4275 0.3157 0.0094  -0.0244 -0.0080 41  PRO D N   
3707 C CA  . PRO D 41  ? 0.4850 0.4426 0.3369 0.0180  -0.0313 -0.0096 41  PRO D CA  
3708 C C   . PRO D 41  ? 0.4947 0.4464 0.3607 0.0142  -0.0277 -0.0093 41  PRO D C   
3709 O O   . PRO D 41  ? 0.5013 0.4543 0.3709 0.0085  -0.0195 -0.0071 41  PRO D O   
3710 C CB  . PRO D 41  ? 0.4859 0.4563 0.3294 0.0265  -0.0326 -0.0047 41  PRO D CB  
3711 C CG  . PRO D 41  ? 0.4682 0.4444 0.3077 0.0197  -0.0271 0.0011  41  PRO D CG  
3712 C CD  . PRO D 41  ? 0.4683 0.4373 0.3047 0.0108  -0.0243 -0.0025 41  PRO D CD  
3713 N N   . LYS D 42  ? 0.5157 0.4600 0.3913 0.0173  -0.0346 -0.0103 42  LYS D N   
3714 C CA  . LYS D 42  ? 0.5299 0.4692 0.4196 0.0137  -0.0306 -0.0064 42  LYS D CA  
3715 C C   . LYS D 42  ? 0.5644 0.4984 0.4624 0.0196  -0.0434 -0.0071 42  LYS D C   
3716 O O   . LYS D 42  ? 0.5824 0.5118 0.4772 0.0259  -0.0565 -0.0119 42  LYS D O   
3717 C CB  . LYS D 42  ? 0.5269 0.4582 0.4247 0.0069  -0.0223 -0.0015 42  LYS D CB  
3718 C CG  . LYS D 42  ? 0.5454 0.4690 0.4593 0.0086  -0.0297 0.0038  42  LYS D CG  
3719 C CD  . LYS D 42  ? 0.5842 0.5075 0.5031 0.0073  -0.0227 0.0096  42  LYS D CD  
3720 C CE  . LYS D 42  ? 0.6313 0.5538 0.5691 0.0109  -0.0341 0.0147  42  LYS D CE  
3721 N NZ  . LYS D 42  ? 0.6413 0.5724 0.5696 0.0120  -0.0360 0.0079  42  LYS D NZ  
3722 N N   . GLY D 43  ? 0.5851 0.5188 0.4946 0.0175  -0.0405 -0.0022 43  GLY D N   
3723 C CA  . GLY D 43  ? 0.6466 0.5752 0.5634 0.0228  -0.0545 -0.0028 43  GLY D CA  
3724 C C   . GLY D 43  ? 0.6803 0.6067 0.6148 0.0168  -0.0494 0.0070  43  GLY D C   
3725 O O   . GLY D 43  ? 0.6531 0.5841 0.5929 0.0099  -0.0329 0.0137  43  GLY D O   
3726 N N   . HIS D 44  ? 0.7521 0.6698 0.6962 0.0195  -0.0651 0.0081  44  HIS D N   
3727 C CA  . HIS D 44  ? 0.8244 0.7393 0.7874 0.0139  -0.0638 0.0200  44  HIS D CA  
3728 C C   . HIS D 44  ? 0.7783 0.7122 0.7388 0.0154  -0.0531 0.0202  44  HIS D C   
3729 O O   . HIS D 44  ? 0.7790 0.7259 0.7259 0.0264  -0.0588 0.0105  44  HIS D O   
3730 C CB  . HIS D 44  ? 0.9604 0.8605 0.9324 0.0180  -0.0894 0.0184  44  HIS D CB  
3731 C CG  . HIS D 44  ? 1.1364 1.0313 1.0917 0.0290  -0.1071 0.0020  44  HIS D CG  
3732 N ND1 . HIS D 44  ? 1.2523 1.1534 1.1855 0.0430  -0.1178 -0.0122 44  HIS D ND1 
3733 C CD2 . HIS D 44  ? 1.2116 1.0981 1.1684 0.0297  -0.1134 -0.0010 44  HIS D CD2 
3734 C CE1 . HIS D 44  ? 1.2939 1.1871 1.2135 0.0517  -0.1305 -0.0238 44  HIS D CE1 
3735 N NE2 . HIS D 44  ? 1.2713 1.1562 1.2067 0.0425  -0.1279 -0.0173 44  HIS D NE2 
3736 N N   . VAL D 45  ? 0.7572 0.6946 0.7326 0.0061  -0.0363 0.0332  45  VAL D N   
3737 C CA  . VAL D 45  ? 0.7484 0.7072 0.7298 0.0062  -0.0240 0.0365  45  VAL D CA  
3738 C C   . VAL D 45  ? 0.8078 0.7724 0.7956 0.0111  -0.0368 0.0380  45  VAL D C   
3739 O O   . VAL D 45  ? 0.8430 0.7926 0.8431 0.0054  -0.0454 0.0468  45  VAL D O   
3740 C CB  . VAL D 45  ? 0.7170 0.6753 0.7137 -0.0054 -0.0021 0.0508  45  VAL D CB  
3741 C CG1 . VAL D 45  ? 0.6995 0.6827 0.7083 -0.0057 0.0111  0.0549  45  VAL D CG1 
3742 C CG2 . VAL D 45  ? 0.6665 0.6165 0.6536 -0.0083 0.0080  0.0476  45  VAL D CG2 
3743 N N   . GLU D 46  ? 0.8454 0.8332 0.8261 0.0230  -0.0387 0.0311  46  GLU D N   
3744 C CA  . GLU D 46  ? 0.9194 0.9165 0.9029 0.0307  -0.0508 0.0310  46  GLU D CA  
3745 C C   . GLU D 46  ? 0.9499 0.9685 0.9574 0.0229  -0.0328 0.0465  46  GLU D C   
3746 O O   . GLU D 46  ? 0.9103 0.9401 0.9307 0.0147  -0.0106 0.0548  46  GLU D O   
3747 C CB  . GLU D 46  ? 0.9589 0.9704 0.9194 0.0526  -0.0636 0.0166  46  GLU D CB  
3748 C CG  . GLU D 46  ? 1.0741 1.0579 1.0138 0.0603  -0.0888 0.0022  46  GLU D CG  
3749 C CD  . GLU D 46  ? 1.2131 1.2074 1.1242 0.0837  -0.0984 -0.0113 46  GLU D CD  
3750 O OE1 . GLU D 46  ? 1.3106 1.3358 1.2179 0.0985  -0.0908 -0.0088 46  GLU D OE1 
3751 O OE2 . GLU D 46  ? 1.2377 1.2110 1.1316 0.0887  -0.1129 -0.0223 46  GLU D OE2 
3752 N N   . PRO D 47  ? 1.0638 1.0878 1.0786 0.0252  -0.0428 0.0504  47  PRO D N   
3753 C CA  . PRO D 47  ? 1.0956 1.1358 1.1370 0.0139  -0.0263 0.0689  47  PRO D CA  
3754 C C   . PRO D 47  ? 1.0247 1.1006 1.0847 0.0123  0.0015  0.0781  47  PRO D C   
3755 O O   . PRO D 47  ? 1.0223 1.0973 1.1030 -0.0029 0.0213  0.0936  47  PRO D O   
3756 C CB  . PRO D 47  ? 1.1791 1.2259 1.2177 0.0234  -0.0465 0.0659  47  PRO D CB  
3757 C CG  . PRO D 47  ? 1.2256 1.2631 1.2338 0.0430  -0.0713 0.0440  47  PRO D CG  
3758 C CD  . PRO D 47  ? 1.1618 1.1738 1.1596 0.0383  -0.0724 0.0376  47  PRO D CD  
3759 N N   . GLY D 48  ? 0.9652 1.0722 1.0208 0.0291  0.0029  0.0709  48  GLY D N   
3760 C CA  . GLY D 48  ? 0.9436 1.0892 1.0262 0.0290  0.0268  0.0824  48  GLY D CA  
3761 C C   . GLY D 48  ? 0.8679 1.0189 0.9501 0.0318  0.0351  0.0787  48  GLY D C   
3762 O O   . GLY D 48  ? 0.9034 1.0921 1.0023 0.0433  0.0435  0.0842  48  GLY D O   
3763 N N   . GLU D 49  ? 0.7771 0.8924 0.8438 0.0217  0.0323  0.0719  49  GLU D N   
3764 C CA  . GLU D 49  ? 0.7159 0.8284 0.7744 0.0245  0.0336  0.0655  49  GLU D CA  
3765 C C   . GLU D 49  ? 0.6611 0.7567 0.7297 0.0081  0.0485  0.0693  49  GLU D C   
3766 O O   . GLU D 49  ? 0.6767 0.7455 0.7413 -0.0037 0.0517  0.0717  49  GLU D O   
3767 C CB  . GLU D 49  ? 0.7335 0.8186 0.7584 0.0308  0.0140  0.0508  49  GLU D CB  
3768 C CG  . GLU D 49  ? 0.7908 0.8939 0.8000 0.0515  0.0033  0.0443  49  GLU D CG  
3769 C CD  . GLU D 49  ? 0.8115 0.8859 0.7888 0.0562  -0.0142 0.0304  49  GLU D CD  
3770 O OE1 . GLU D 49  ? 0.8221 0.8654 0.7940 0.0431  -0.0182 0.0266  49  GLU D OE1 
3771 O OE2 . GLU D 49  ? 0.8130 0.8979 0.7727 0.0743  -0.0231 0.0256  49  GLU D OE2 
3772 N N   . ASP D 50  ? 0.6050 0.7164 0.6868 0.0095  0.0560  0.0708  50  ASP D N   
3773 C CA  . ASP D 50  ? 0.5614 0.6526 0.6448 -0.0022 0.0644  0.0691  50  ASP D CA  
3774 C C   . ASP D 50  ? 0.5410 0.5998 0.5906 -0.0025 0.0519  0.0560  50  ASP D C   
3775 O O   . ASP D 50  ? 0.5175 0.5782 0.5491 0.0078  0.0379  0.0490  50  ASP D O   
3776 C CB  . ASP D 50  ? 0.5556 0.6736 0.6645 0.0016  0.0692  0.0740  50  ASP D CB  
3777 C CG  . ASP D 50  ? 0.5765 0.6800 0.6991 -0.0109 0.0801  0.0746  50  ASP D CG  
3778 O OD1 . ASP D 50  ? 0.5900 0.6699 0.6950 -0.0138 0.0736  0.0650  50  ASP D OD1 
3779 O OD2 . ASP D 50  ? 0.5973 0.7129 0.7480 -0.0172 0.0949  0.0846  50  ASP D OD2 
3780 N N   . ASP D 51  ? 0.5176 0.5482 0.5587 -0.0127 0.0580  0.0537  51  ASP D N   
3781 C CA  . ASP D 51  ? 0.5046 0.5082 0.5174 -0.0128 0.0486  0.0436  51  ASP D CA  
3782 C C   . ASP D 51  ? 0.4960 0.5066 0.4996 -0.0071 0.0395  0.0356  51  ASP D C   
3783 O O   . ASP D 51  ? 0.4967 0.4993 0.4795 -0.0021 0.0278  0.0286  51  ASP D O   
3784 C CB  . ASP D 51  ? 0.5060 0.4839 0.5125 -0.0208 0.0591  0.0444  51  ASP D CB  
3785 C CG  . ASP D 51  ? 0.5310 0.4967 0.5406 -0.0243 0.0655  0.0558  51  ASP D CG  
3786 O OD1 . ASP D 51  ? 0.5397 0.4888 0.5477 -0.0282 0.0780  0.0621  51  ASP D OD1 
3787 O OD2 . ASP D 51  ? 0.5546 0.5269 0.5681 -0.0220 0.0569  0.0597  51  ASP D OD2 
3788 N N   . LEU D 52  ? 0.4784 0.5043 0.5009 -0.0081 0.0445  0.0389  52  LEU D N   
3789 C CA  . LEU D 52  ? 0.4690 0.5043 0.4898 -0.0031 0.0359  0.0371  52  LEU D CA  
3790 C C   . LEU D 52  ? 0.4758 0.5367 0.4956 0.0116  0.0274  0.0418  52  LEU D C   
3791 O O   . LEU D 52  ? 0.4819 0.5407 0.4832 0.0181  0.0175  0.0387  52  LEU D O   
3792 C CB  . LEU D 52  ? 0.4686 0.5142 0.5182 -0.0079 0.0413  0.0428  52  LEU D CB  
3793 C CG  . LEU D 52  ? 0.4599 0.5008 0.5075 -0.0089 0.0316  0.0405  52  LEU D CG  
3794 C CD1 . LEU D 52  ? 0.4264 0.4389 0.4362 -0.0115 0.0243  0.0280  52  LEU D CD1 
3795 C CD2 . LEU D 52  ? 0.4918 0.5259 0.5626 -0.0176 0.0360  0.0408  52  LEU D CD2 
3796 N N   . GLU D 53  ? 0.4762 0.5608 0.5129 0.0185  0.0315  0.0495  53  GLU D N   
3797 C CA  . GLU D 53  ? 0.4996 0.6043 0.5270 0.0362  0.0225  0.0515  53  GLU D CA  
3798 C C   . GLU D 53  ? 0.5015 0.5796 0.4932 0.0387  0.0101  0.0386  53  GLU D C   
3799 O O   . GLU D 53  ? 0.5337 0.6165 0.5072 0.0523  0.0001  0.0364  53  GLU D O   
3800 C CB  . GLU D 53  ? 0.5164 0.6511 0.5654 0.0444  0.0284  0.0606  53  GLU D CB  
3801 C CG  . GLU D 53  ? 0.5372 0.7101 0.6284 0.0478  0.0396  0.0771  53  GLU D CG  
3802 C CD  . GLU D 53  ? 0.5788 0.7793 0.6949 0.0505  0.0496  0.0861  53  GLU D CD  
3803 O OE1 . GLU D 53  ? 0.6275 0.8696 0.7627 0.0683  0.0511  0.0983  53  GLU D OE1 
3804 O OE2 . GLU D 53  ? 0.6062 0.7891 0.7236 0.0361  0.0566  0.0834  53  GLU D OE2 
3805 N N   . THR D 54  ? 0.4829 0.5342 0.4673 0.0268  0.0108  0.0325  54  THR D N   
3806 C CA  . THR D 54  ? 0.4939 0.5228 0.4540 0.0290  -0.0020 0.0230  54  THR D CA  
3807 C C   . THR D 54  ? 0.4889 0.5067 0.4311 0.0288  -0.0066 0.0171  54  THR D C   
3808 O O   . THR D 54  ? 0.5086 0.5240 0.4322 0.0387  -0.0177 0.0118  54  THR D O   
3809 C CB  . THR D 54  ? 0.4879 0.4929 0.4511 0.0165  0.0005  0.0233  54  THR D CB  
3810 O OG1 . THR D 54  ? 0.5286 0.5439 0.5095 0.0152  0.0052  0.0313  54  THR D OG1 
3811 C CG2 . THR D 54  ? 0.4956 0.4799 0.4427 0.0190  -0.0145 0.0162  54  THR D CG2 
3812 N N   . ALA D 55  ? 0.4650 0.4756 0.4124 0.0178  0.0019  0.0181  55  ALA D N   
3813 C CA  . ALA D 55  ? 0.4634 0.4641 0.3953 0.0156  -0.0015 0.0135  55  ALA D CA  
3814 C C   . ALA D 55  ? 0.4894 0.5090 0.4157 0.0281  -0.0080 0.0177  55  ALA D C   
3815 O O   . ALA D 55  ? 0.4834 0.4959 0.3902 0.0315  -0.0149 0.0140  55  ALA D O   
3816 C CB  . ALA D 55  ? 0.4494 0.4428 0.3890 0.0046  0.0068  0.0140  55  ALA D CB  
3817 N N   . LEU D 56  ? 0.4797 0.5255 0.4253 0.0359  -0.0046 0.0281  56  LEU D N   
3818 C CA  . LEU D 56  ? 0.4914 0.5596 0.4364 0.0507  -0.0087 0.0383  56  LEU D CA  
3819 C C   . LEU D 56  ? 0.5342 0.6073 0.4572 0.0694  -0.0174 0.0355  56  LEU D C   
3820 O O   . LEU D 56  ? 0.5622 0.6363 0.4670 0.0794  -0.0229 0.0381  56  LEU D O   
3821 C CB  . LEU D 56  ? 0.4838 0.5829 0.4630 0.0554  -0.0021 0.0541  56  LEU D CB  
3822 C CG  . LEU D 56  ? 0.4594 0.5559 0.4604 0.0418  0.0007  0.0600  56  LEU D CG  
3823 C CD1 . LEU D 56  ? 0.4060 0.5305 0.4485 0.0437  0.0078  0.0736  56  LEU D CD1 
3824 C CD2 . LEU D 56  ? 0.4172 0.5157 0.4110 0.0454  -0.0066 0.0685  56  LEU D CD2 
3825 N N   . ARG D 57  ? 0.5612 0.6359 0.4849 0.0746  -0.0192 0.0305  57  ARG D N   
3826 C CA  . ARG D 57  ? 0.6223 0.6989 0.5235 0.0945  -0.0306 0.0250  57  ARG D CA  
3827 C C   . ARG D 57  ? 0.6332 0.6801 0.5081 0.0915  -0.0412 0.0119  57  ARG D C   
3828 O O   . ARG D 57  ? 0.6688 0.7147 0.5206 0.1076  -0.0497 0.0094  57  ARG D O   
3829 C CB  . ARG D 57  ? 0.6396 0.7194 0.5488 0.0968  -0.0327 0.0210  57  ARG D CB  
3830 C CG  . ARG D 57  ? 0.6964 0.7671 0.5798 0.1140  -0.0491 0.0098  57  ARG D CG  
3831 C CD  . ARG D 57  ? 0.7329 0.7953 0.6247 0.1085  -0.0546 0.0042  57  ARG D CD  
3832 N NE  . ARG D 57  ? 0.7619 0.7881 0.6456 0.0962  -0.0667 -0.0071 57  ARG D NE  
3833 C CZ  . ARG D 57  ? 0.7690 0.7791 0.6710 0.0755  -0.0622 -0.0047 57  ARG D CZ  
3834 N NH1 . ARG D 57  ? 0.7373 0.7607 0.6626 0.0640  -0.0456 0.0062  57  ARG D NH1 
3835 N NH2 . ARG D 57  ? 0.8460 0.8276 0.7451 0.0677  -0.0741 -0.0110 57  ARG D NH2 
3836 N N   . GLU D 58  ? 0.6230 0.6469 0.5038 0.0720  -0.0397 0.0051  58  GLU D N   
3837 C CA  . GLU D 58  ? 0.6165 0.6157 0.4831 0.0670  -0.0483 -0.0046 58  GLU D CA  
3838 C C   . GLU D 58  ? 0.5966 0.5954 0.4511 0.0657  -0.0458 -0.0023 58  GLU D C   
3839 O O   . GLU D 58  ? 0.6071 0.5943 0.4459 0.0696  -0.0538 -0.0083 58  GLU D O   
3840 C CB  . GLU D 58  ? 0.5986 0.5803 0.4802 0.0491  -0.0447 -0.0064 58  GLU D CB  
3841 C CG  . GLU D 58  ? 0.6500 0.6106 0.5268 0.0476  -0.0569 -0.0137 58  GLU D CG  
3842 C CD  . GLU D 58  ? 0.7122 0.6657 0.5890 0.0567  -0.0725 -0.0190 58  GLU D CD  
3843 O OE1 . GLU D 58  ? 0.7379 0.6930 0.6294 0.0525  -0.0709 -0.0147 58  GLU D OE1 
3844 O OE2 . GLU D 58  ? 0.7801 0.7250 0.6426 0.0676  -0.0874 -0.0275 58  GLU D OE2 
3845 N N   . THR D 59  ? 0.5620 0.5733 0.4262 0.0596  -0.0356 0.0072  59  THR D N   
3846 C CA  . THR D 59  ? 0.5555 0.5680 0.4097 0.0580  -0.0342 0.0123  59  THR D CA  
3847 C C   . THR D 59  ? 0.5949 0.6194 0.4315 0.0787  -0.0397 0.0184  59  THR D C   
3848 O O   . THR D 59  ? 0.5880 0.6037 0.4074 0.0810  -0.0433 0.0159  59  THR D O   
3849 C CB  . THR D 59  ? 0.5367 0.5582 0.4077 0.0479  -0.0262 0.0219  59  THR D CB  
3850 O OG1 . THR D 59  ? 0.5254 0.5293 0.4020 0.0304  -0.0217 0.0139  59  THR D OG1 
3851 C CG2 . THR D 59  ? 0.5293 0.5566 0.3921 0.0491  -0.0270 0.0319  59  THR D CG2 
3852 N N   . GLN D 60  ? 0.6398 0.6863 0.4815 0.0956  -0.0393 0.0277  60  GLN D N   
3853 C CA  . GLN D 60  ? 0.7090 0.7679 0.5304 0.1218  -0.0445 0.0339  60  GLN D CA  
3854 C C   . GLN D 60  ? 0.7461 0.7837 0.5430 0.1306  -0.0568 0.0159  60  GLN D C   
3855 O O   . GLN D 60  ? 0.7715 0.8021 0.5449 0.1420  -0.0617 0.0149  60  GLN D O   
3856 C CB  . GLN D 60  ? 0.7569 0.8479 0.5930 0.1406  -0.0409 0.0481  60  GLN D CB  
3857 C CG  . GLN D 60  ? 0.8892 0.9884 0.7056 0.1687  -0.0492 0.0427  60  GLN D CG  
3858 C CD  . GLN D 60  ? 1.0118 1.1102 0.7939 0.1942  -0.0552 0.0460  60  GLN D CD  
3859 O OE1 . GLN D 60  ? 1.0461 1.1575 0.8270 0.2008  -0.0490 0.0652  60  GLN D OE1 
3860 N NE2 . GLN D 60  ? 1.1079 1.1892 0.8622 0.2090  -0.0682 0.0281  60  GLN D NE2 
3861 N N   . GLU D 61  ? 0.7570 0.7829 0.5613 0.1246  -0.0626 0.0029  61  GLU D N   
3862 C CA  . GLU D 61  ? 0.8221 0.8258 0.6096 0.1316  -0.0783 -0.0134 61  GLU D CA  
3863 C C   . GLU D 61  ? 0.8099 0.7944 0.5882 0.1228  -0.0810 -0.0185 61  GLU D C   
3864 O O   . GLU D 61  ? 0.8667 0.8444 0.6224 0.1386  -0.0893 -0.0229 61  GLU D O   
3865 C CB  . GLU D 61  ? 0.8251 0.8165 0.6310 0.1188  -0.0836 -0.0222 61  GLU D CB  
3866 C CG  . GLU D 61  ? 0.9386 0.9226 0.7332 0.1355  -0.1011 -0.0335 61  GLU D CG  
3867 C CD  . GLU D 61  ? 1.0126 1.0119 0.8248 0.1347  -0.0976 -0.0293 61  GLU D CD  
3868 O OE1 . GLU D 61  ? 1.0512 1.0802 0.8660 0.1469  -0.0873 -0.0183 61  GLU D OE1 
3869 O OE2 . GLU D 61  ? 1.0249 1.0086 0.8513 0.1226  -0.1049 -0.0343 61  GLU D OE2 
3870 N N   . GLU D 62  ? 0.7520 0.7298 0.5477 0.0995  -0.0731 -0.0170 62  GLU D N   
3871 C CA  . GLU D 62  ? 0.7427 0.7075 0.5357 0.0902  -0.0740 -0.0203 62  GLU D CA  
3872 C C   . GLU D 62  ? 0.7192 0.6927 0.5003 0.0901  -0.0654 -0.0103 62  GLU D C   
3873 O O   . GLU D 62  ? 0.7342 0.6993 0.5075 0.0904  -0.0686 -0.0135 62  GLU D O   
3874 C CB  . GLU D 62  ? 0.7077 0.6635 0.5236 0.0688  -0.0696 -0.0221 62  GLU D CB  
3875 C CG  . GLU D 62  ? 0.7785 0.7163 0.6046 0.0675  -0.0831 -0.0312 62  GLU D CG  
3876 C CD  . GLU D 62  ? 0.8298 0.7622 0.6741 0.0621  -0.0862 -0.0317 62  GLU D CD  
3877 O OE1 . GLU D 62  ? 0.8429 0.7832 0.6961 0.0520  -0.0726 -0.0248 62  GLU D OE1 
3878 O OE2 . GLU D 62  ? 0.9033 0.8226 0.7533 0.0675  -0.1024 -0.0381 62  GLU D OE2 
3879 N N   . ALA D 63  ? 0.6852 0.6753 0.4697 0.0875  -0.0548 0.0031  63  ALA D N   
3880 C CA  . ALA D 63  ? 0.6763 0.6747 0.4532 0.0852  -0.0476 0.0162  63  ALA D CA  
3881 C C   . ALA D 63  ? 0.7189 0.7347 0.4830 0.1067  -0.0466 0.0319  63  ALA D C   
3882 O O   . ALA D 63  ? 0.7323 0.7563 0.4892 0.1084  -0.0414 0.0475  63  ALA D O   
3883 C CB  . ALA D 63  ? 0.6303 0.6328 0.4240 0.0656  -0.0391 0.0223  63  ALA D CB  
3884 N N   . GLY D 64  ? 0.7527 0.7766 0.5155 0.1240  -0.0511 0.0304  64  GLY D N   
3885 C CA  . GLY D 64  ? 0.7956 0.8409 0.5475 0.1505  -0.0499 0.0473  64  GLY D CA  
3886 C C   . GLY D 64  ? 0.7840 0.8533 0.5586 0.1468  -0.0408 0.0711  64  GLY D C   
3887 O O   . GLY D 64  ? 0.8220 0.9122 0.5921 0.1673  -0.0379 0.0935  64  GLY D O   
3888 N N   . ILE D 65  ? 0.7467 0.8131 0.5472 0.1225  -0.0372 0.0680  65  ILE D N   
3889 C CA  . ILE D 65  ? 0.7363 0.8223 0.5647 0.1167  -0.0320 0.0886  65  ILE D CA  
3890 C C   . ILE D 65  ? 0.7672 0.8734 0.6219 0.1235  -0.0302 0.0926  65  ILE D C   
3891 O O   . ILE D 65  ? 0.7364 0.8329 0.6002 0.1121  -0.0299 0.0761  65  ILE D O   
3892 C CB  . ILE D 65  ? 0.6914 0.7619 0.5308 0.0881  -0.0303 0.0845  65  ILE D CB  
3893 C CG1 . ILE D 65  ? 0.6669 0.7246 0.4835 0.0830  -0.0305 0.0839  65  ILE D CG1 
3894 C CG2 . ILE D 65  ? 0.6669 0.7536 0.5355 0.0823  -0.0294 0.1057  65  ILE D CG2 
3895 C CD1 . ILE D 65  ? 0.5932 0.6363 0.4162 0.0574  -0.0293 0.0766  65  ILE D CD1 
3896 N N   . GLU D 66  ? 0.8243 0.9616 0.6931 0.1438  -0.0280 0.1181  66  GLU D N   
3897 C CA  . GLU D 66  ? 0.8504 1.0161 0.7478 0.1554  -0.0249 0.1275  66  GLU D CA  
3898 C C   . GLU D 66  ? 0.8069 0.9734 0.7433 0.1313  -0.0221 0.1301  66  GLU D C   
3899 O O   . GLU D 66  ? 0.7972 0.9528 0.7411 0.1147  -0.0239 0.1358  66  GLU D O   
3900 C CB  . GLU D 66  ? 0.9366 1.1402 0.8423 0.1869  -0.0228 0.1597  66  GLU D CB  
3901 C CG  . GLU D 66  ? 1.1385 1.3517 1.0106 0.2210  -0.0247 0.1572  66  GLU D CG  
3902 C CD  . GLU D 66  ? 1.3496 1.5978 1.2427 0.2419  -0.0216 0.1643  66  GLU D CD  
3903 O OE1 . GLU D 66  ? 1.5205 1.8033 1.4131 0.2769  -0.0191 0.1886  66  GLU D OE1 
3904 O OE2 . GLU D 66  ? 1.3637 1.6073 1.2747 0.2249  -0.0205 0.1477  66  GLU D OE2 
3905 N N   . ALA D 67  ? 0.8041 0.9837 0.7648 0.1306  -0.0181 0.1264  67  ALA D N   
3906 C CA  . ALA D 67  ? 0.7826 0.9671 0.7845 0.1121  -0.0146 0.1302  67  ALA D CA  
3907 C C   . ALA D 67  ? 0.7837 0.9890 0.8195 0.1139  -0.0170 0.1587  67  ALA D C   
3908 O O   . ALA D 67  ? 0.7796 0.9697 0.8330 0.0929  -0.0205 0.1574  67  ALA D O   
3909 C CB  . ALA D 67  ? 0.8023 1.0108 0.8287 0.1197  -0.0080 0.1308  67  ALA D CB  
3910 N N   . GLY D 68  ? 0.7456 0.7994 0.8189 -0.0037 0.0004  0.0987  68  GLY D N   
3911 C CA  . GLY D 68  ? 0.7488 0.8100 0.8383 0.0006  -0.0072 0.1128  68  GLY D CA  
3912 C C   . GLY D 68  ? 0.7447 0.7923 0.8279 0.0024  -0.0078 0.1146  68  GLY D C   
3913 O O   . GLY D 68  ? 0.7524 0.8023 0.8515 0.0041  -0.0172 0.1234  68  GLY D O   
3914 N N   . GLN D 69  ? 0.7355 0.7688 0.7961 0.0016  0.0016  0.1064  69  GLN D N   
3915 C CA  . GLN D 69  ? 0.7314 0.7510 0.7844 0.0030  0.0027  0.1074  69  GLN D CA  
3916 C C   . GLN D 69  ? 0.7028 0.7097 0.7556 -0.0001 0.0003  0.0952  69  GLN D C   
3917 O O   . GLN D 69  ? 0.7103 0.7041 0.7539 0.0003  0.0032  0.0929  69  GLN D O   
3918 C CB  . GLN D 69  ? 0.7404 0.7517 0.7690 0.0047  0.0141  0.1064  69  GLN D CB  
3919 C CG  . GLN D 69  ? 0.7866 0.8044 0.8036 0.0057  0.0204  0.1059  69  GLN D CG  
3920 C CD  . GLN D 69  ? 0.8258 0.8354 0.8182 0.0088  0.0299  0.1072  69  GLN D CD  
3921 O OE1 . GLN D 69  ? 0.8719 0.8805 0.8621 0.0132  0.0307  0.1181  69  GLN D OE1 
3922 N NE2 . GLN D 69  ? 0.8019 0.8051 0.7749 0.0066  0.0367  0.0968  69  GLN D NE2 
3923 N N   . LEU D 70  ? 0.6640 0.6750 0.7268 -0.0029 -0.0047 0.0880  70  LEU D N   
3924 C CA  . LEU D 70  ? 0.6303 0.6305 0.6926 -0.0045 -0.0073 0.0770  70  LEU D CA  
3925 C C   . LEU D 70  ? 0.6241 0.6300 0.7071 -0.0040 -0.0202 0.0802  70  LEU D C   
3926 O O   . LEU D 70  ? 0.6508 0.6709 0.7472 -0.0044 -0.0250 0.0867  70  LEU D O   
3927 C CB  . LEU D 70  ? 0.6080 0.6068 0.6586 -0.0082 -0.0005 0.0637  70  LEU D CB  
3928 C CG  . LEU D 70  ? 0.6043 0.5986 0.6337 -0.0098 0.0111  0.0587  70  LEU D CG  
3929 C CD1 . LEU D 70  ? 0.5893 0.5849 0.6124 -0.0137 0.0145  0.0486  70  LEU D CD1 
3930 C CD2 . LEU D 70  ? 0.6188 0.5991 0.6358 -0.0087 0.0157  0.0546  70  LEU D CD2 
3931 N N   . THR D 71  ? 0.6059 0.6002 0.6905 -0.0028 -0.0258 0.0749  71  THR D N   
3932 C CA  . THR D 71  ? 0.5908 0.5873 0.6910 -0.0019 -0.0382 0.0750  71  THR D CA  
3933 C C   . THR D 71  ? 0.5732 0.5616 0.6645 -0.0023 -0.0360 0.0608  71  THR D C   
3934 O O   . THR D 71  ? 0.5732 0.5487 0.6519 -0.0011 -0.0306 0.0540  71  THR D O   
3935 C CB  . THR D 71  ? 0.6025 0.5904 0.7124 0.0017  -0.0496 0.0839  71  THR D CB  
3936 O OG1 . THR D 71  ? 0.6269 0.6246 0.7464 0.0024  -0.0523 0.0991  71  THR D OG1 
3937 C CG2 . THR D 71  ? 0.5847 0.5716 0.7077 0.0034  -0.0637 0.0829  71  THR D CG2 
3938 N N   . ILE D 72  ? 0.5588 0.5558 0.6570 -0.0038 -0.0398 0.0570  72  ILE D N   
3939 C CA  . ILE D 72  ? 0.5429 0.5340 0.6339 -0.0032 -0.0388 0.0456  72  ILE D CA  
3940 C C   . ILE D 72  ? 0.5589 0.5395 0.6564 0.0020  -0.0511 0.0458  72  ILE D C   
3941 O O   . ILE D 72  ? 0.5767 0.5612 0.6888 0.0032  -0.0629 0.0535  72  ILE D O   
3942 C CB  . ILE D 72  ? 0.5423 0.5466 0.6381 -0.0068 -0.0386 0.0426  72  ILE D CB  
3943 C CG1 . ILE D 72  ? 0.4969 0.5095 0.5844 -0.0119 -0.0268 0.0415  72  ILE D CG1 
3944 C CG2 . ILE D 72  ? 0.5325 0.5309 0.6233 -0.0044 -0.0406 0.0336  72  ILE D CG2 
3945 C CD1 . ILE D 72  ? 0.5029 0.5068 0.5722 -0.0127 -0.0167 0.0330  72  ILE D CD1 
3946 N N   . ILE D 73  ? 0.5599 0.5268 0.6465 0.0057  -0.0492 0.0377  73  ILE D N   
3947 C CA  . ILE D 73  ? 0.5705 0.5246 0.6610 0.0119  -0.0612 0.0379  73  ILE D CA  
3948 C C   . ILE D 73  ? 0.5959 0.5524 0.6873 0.0144  -0.0666 0.0320  73  ILE D C   
3949 O O   . ILE D 73  ? 0.5908 0.5462 0.6712 0.0154  -0.0592 0.0233  73  ILE D O   
3950 C CB  . ILE D 73  ? 0.5619 0.4991 0.6400 0.0158  -0.0563 0.0321  73  ILE D CB  
3951 C CG1 . ILE D 73  ? 0.5264 0.4608 0.6022 0.0131  -0.0500 0.0381  73  ILE D CG1 
3952 C CG2 . ILE D 73  ? 0.5635 0.4854 0.6440 0.0233  -0.0691 0.0316  73  ILE D CG2 
3953 C CD1 . ILE D 73  ? 0.4283 0.3629 0.5171 0.0133  -0.0603 0.0512  73  ILE D CD1 
3954 N N   . GLU D 74  ? 0.6366 0.5971 0.7411 0.0157  -0.0800 0.0375  74  GLU D N   
3955 C CA  . GLU D 74  ? 0.6677 0.6312 0.7733 0.0183  -0.0865 0.0330  74  GLU D CA  
3956 C C   . GLU D 74  ? 0.6672 0.6144 0.7617 0.0270  -0.0903 0.0257  74  GLU D C   
3957 O O   . GLU D 74  ? 0.6852 0.6164 0.7772 0.0324  -0.0958 0.0266  74  GLU D O   
3958 C CB  . GLU D 74  ? 0.7142 0.6848 0.8368 0.0179  -0.1014 0.0411  74  GLU D CB  
3959 C CG  . GLU D 74  ? 0.8016 0.7920 0.9367 0.0100  -0.0978 0.0481  74  GLU D CG  
3960 C CD  . GLU D 74  ? 0.9295 0.9287 1.0837 0.0097  -0.1135 0.0567  74  GLU D CD  
3961 O OE1 . GLU D 74  ? 0.9773 0.9717 1.1332 0.0139  -0.1254 0.0544  74  GLU D OE1 
3962 O OE2 . GLU D 74  ? 0.9738 0.9849 1.1409 0.0058  -0.1145 0.0662  74  GLU D OE2 
3963 N N   . GLY D 75  ? 0.6546 0.6060 0.7422 0.0288  -0.0871 0.0190  75  GLY D N   
3964 C CA  . GLY D 75  ? 0.6526 0.5909 0.7294 0.0386  -0.0909 0.0126  75  GLY D CA  
3965 C C   . GLY D 75  ? 0.6156 0.5495 0.6782 0.0410  -0.0781 0.0051  75  GLY D C   
3966 O O   . GLY D 75  ? 0.6419 0.5670 0.6956 0.0499  -0.0804 0.0002  75  GLY D O   
3967 N N   . PHE D 76  ? 0.5658 0.5060 0.6260 0.0337  -0.0652 0.0046  76  PHE D N   
3968 C CA  . PHE D 76  ? 0.5311 0.4683 0.5787 0.0354  -0.0538 -0.0020 76  PHE D CA  
3969 C C   . PHE D 76  ? 0.5164 0.4690 0.5608 0.0276  -0.0423 -0.0032 76  PHE D C   
3970 O O   . PHE D 76  ? 0.5156 0.4777 0.5655 0.0193  -0.0390 0.0008  76  PHE D O   
3971 C CB  . PHE D 76  ? 0.5155 0.4421 0.5600 0.0350  -0.0492 -0.0025 76  PHE D CB  
3972 C CG  . PHE D 76  ? 0.4757 0.4004 0.5087 0.0361  -0.0376 -0.0095 76  PHE D CG  
3973 C CD1 . PHE D 76  ? 0.4428 0.3552 0.4694 0.0456  -0.0394 -0.0149 76  PHE D CD1 
3974 C CD2 . PHE D 76  ? 0.4287 0.3636 0.4572 0.0280  -0.0257 -0.0105 76  PHE D CD2 
3975 C CE1 . PHE D 76  ? 0.4201 0.3326 0.4377 0.0468  -0.0291 -0.0210 76  PHE D CE1 
3976 C CE2 . PHE D 76  ? 0.4121 0.3460 0.4305 0.0288  -0.0161 -0.0166 76  PHE D CE2 
3977 C CZ  . PHE D 76  ? 0.4272 0.3510 0.4411 0.0381  -0.0177 -0.0218 76  PHE D CZ  
3978 N N   . LYS D 77  ? 0.5067 0.4615 0.5420 0.0308  -0.0369 -0.0080 77  LYS D N   
3979 C CA  . LYS D 77  ? 0.4812 0.4483 0.5119 0.0239  -0.0266 -0.0086 77  LYS D CA  
3980 C C   . LYS D 77  ? 0.4859 0.4494 0.5059 0.0302  -0.0216 -0.0137 77  LYS D C   
3981 O O   . LYS D 77  ? 0.4834 0.4391 0.5011 0.0404  -0.0275 -0.0159 77  LYS D O   
3982 C CB  . LYS D 77  ? 0.4885 0.4666 0.5238 0.0219  -0.0302 -0.0058 77  LYS D CB  
3983 C CG  . LYS D 77  ? 0.4766 0.4680 0.5123 0.0117  -0.0223 -0.0035 77  LYS D CG  
3984 C CD  . LYS D 77  ? 0.5213 0.5212 0.5588 0.0125  -0.0255 -0.0020 77  LYS D CD  
3985 C CE  . LYS D 77  ? 0.5570 0.5698 0.5992 0.0023  -0.0211 0.0014  77  LYS D CE  
3986 N NZ  . LYS D 77  ? 0.6134 0.6336 0.6580 0.0036  -0.0251 0.0029  77  LYS D NZ  
3987 N N   . ARG D 78  ? 0.4838 0.4527 0.4973 0.0249  -0.0114 -0.0152 78  ARG D N   
3988 C CA  . ARG D 78  ? 0.5122 0.4806 0.5172 0.0305  -0.0067 -0.0189 78  ARG D CA  
3989 C C   . ARG D 78  ? 0.5218 0.5020 0.5225 0.0225  0.0010  -0.0171 78  ARG D C   
3990 O O   . ARG D 78  ? 0.5260 0.5091 0.5268 0.0132  0.0054  -0.0155 78  ARG D O   
3991 C CB  . ARG D 78  ? 0.5106 0.4687 0.5119 0.0331  -0.0032 -0.0235 78  ARG D CB  
3992 C CG  . ARG D 78  ? 0.5573 0.5051 0.5568 0.0458  -0.0080 -0.0274 78  ARG D CG  
3993 C CD  . ARG D 78  ? 0.5866 0.5324 0.5883 0.0548  -0.0184 -0.0254 78  ARG D CD  
3994 N NE  . ARG D 78  ? 0.5925 0.5231 0.5928 0.0667  -0.0253 -0.0286 78  ARG D NE  
3995 C CZ  . ARG D 78  ? 0.5676 0.4866 0.5726 0.0701  -0.0357 -0.0271 78  ARG D CZ  
3996 N NH1 . ARG D 78  ? 0.5478 0.4704 0.5604 0.0630  -0.0406 -0.0223 78  ARG D NH1 
3997 N NH2 . ARG D 78  ? 0.5026 0.4064 0.5050 0.0809  -0.0419 -0.0299 78  ARG D NH2 
3998 N N   . GLU D 79  ? 0.5509 0.5375 0.5473 0.0266  0.0023  -0.0163 79  GLU D N   
3999 C CA  . GLU D 79  ? 0.5696 0.5671 0.5619 0.0192  0.0084  -0.0130 79  GLU D CA  
4000 C C   . GLU D 79  ? 0.5855 0.5839 0.5709 0.0225  0.0134  -0.0150 79  GLU D C   
4001 O O   . GLU D 79  ? 0.6027 0.5998 0.5866 0.0330  0.0115  -0.0164 79  GLU D O   
4002 C CB  . GLU D 79  ? 0.5854 0.5916 0.5789 0.0210  0.0056  -0.0083 79  GLU D CB  
4003 C CG  . GLU D 79  ? 0.6187 0.6357 0.6083 0.0136  0.0109  -0.0032 79  GLU D CG  
4004 C CD  . GLU D 79  ? 0.7008 0.7260 0.6934 0.0123  0.0083  0.0019  79  GLU D CD  
4005 O OE1 . GLU D 79  ? 0.7330 0.7567 0.7325 0.0112  0.0035  0.0015  79  GLU D OE1 
4006 O OE2 . GLU D 79  ? 0.7588 0.7924 0.7472 0.0125  0.0107  0.0071  79  GLU D OE2 
4007 N N   . LEU D 80  ? 0.5994 0.6003 0.5805 0.0138  0.0193  -0.0147 80  LEU D N   
4008 C CA  . LEU D 80  ? 0.6213 0.6250 0.5966 0.0155  0.0235  -0.0159 80  LEU D CA  
4009 C C   . LEU D 80  ? 0.6637 0.6789 0.6357 0.0112  0.0253  -0.0092 80  LEU D C   
4010 O O   . LEU D 80  ? 0.6535 0.6717 0.6241 0.0015  0.0266  -0.0053 80  LEU D O   
4011 C CB  . LEU D 80  ? 0.5977 0.5953 0.5691 0.0097  0.0279  -0.0202 80  LEU D CB  
4012 C CG  . LEU D 80  ? 0.5612 0.5481 0.5344 0.0160  0.0275  -0.0267 80  LEU D CG  
4013 C CD1 . LEU D 80  ? 0.5484 0.5289 0.5280 0.0192  0.0219  -0.0264 80  LEU D CD1 
4014 C CD2 . LEU D 80  ? 0.5374 0.5189 0.5059 0.0090  0.0322  -0.0298 80  LEU D CD2 
4015 N N   . ASN D 81  ? 0.7281 0.7496 0.6989 0.0193  0.0250  -0.0071 81  ASN D N   
4016 C CA  . ASN D 81  ? 0.7903 0.8233 0.7579 0.0160  0.0266  0.0006  81  ASN D CA  
4017 C C   . ASN D 81  ? 0.8289 0.8648 0.7938 0.0189  0.0289  -0.0006 81  ASN D C   
4018 O O   . ASN D 81  ? 0.8545 0.8897 0.8211 0.0299  0.0283  -0.0041 81  ASN D O   
4019 C CB  . ASN D 81  ? 0.8017 0.8428 0.7706 0.0235  0.0238  0.0071  81  ASN D CB  
4020 C CG  . ASN D 81  ? 0.8386 0.8802 0.8101 0.0178  0.0219  0.0101  81  ASN D CG  
4021 O OD1 . ASN D 81  ? 0.8690 0.9134 0.8396 0.0064  0.0238  0.0142  81  ASN D OD1 
4022 N ND2 . ASN D 81  ? 0.8706 0.9089 0.8452 0.0259  0.0177  0.0081  81  ASN D ND2 
4023 N N   . TYR D 82  ? 0.8781 0.9165 0.8387 0.0091  0.0310  0.0019  82  TYR D N   
4024 C CA  . TYR D 82  ? 0.9266 0.9687 0.8851 0.0104  0.0325  0.0010  82  TYR D CA  
4025 C C   . TYR D 82  ? 0.9746 1.0224 0.9281 0.0001  0.0322  0.0085  82  TYR D C   
4026 O O   . TYR D 82  ? 0.9793 1.0259 0.9303 -0.0084 0.0315  0.0131  82  TYR D O   
4027 C CB  . TYR D 82  ? 0.9066 0.9382 0.8641 0.0099  0.0350  -0.0093 82  TYR D CB  
4028 C CG  . TYR D 82  ? 0.8994 0.9216 0.8521 -0.0009 0.0365  -0.0122 82  TYR D CG  
4029 C CD1 . TYR D 82  ? 0.8981 0.9201 0.8434 -0.0103 0.0375  -0.0107 82  TYR D CD1 
4030 C CD2 . TYR D 82  ? 0.9041 0.9176 0.8593 -0.0010 0.0362  -0.0158 82  TYR D CD2 
4031 C CE1 . TYR D 82  ? 0.8904 0.9033 0.8297 -0.0185 0.0387  -0.0130 82  TYR D CE1 
4032 C CE2 . TYR D 82  ? 0.8676 0.8738 0.8185 -0.0095 0.0376  -0.0174 82  TYR D CE2 
4033 C CZ  . TYR D 82  ? 0.8654 0.8712 0.8078 -0.0178 0.0392  -0.0161 82  TYR D CZ  
4034 O OH  . TYR D 82  ? 0.8670 0.8652 0.8035 -0.0247 0.0405  -0.0171 82  TYR D OH  
4035 N N   . VAL D 83  ? 1.0425 1.0964 0.9949 0.0011  0.0321  0.0099  83  VAL D N   
4036 C CA  . VAL D 83  ? 1.1054 1.1638 1.0525 -0.0083 0.0303  0.0174  83  VAL D CA  
4037 C C   . VAL D 83  ? 1.1256 1.1759 1.0670 -0.0143 0.0315  0.0097  83  VAL D C   
4038 O O   . VAL D 83  ? 1.1086 1.1580 1.0525 -0.0085 0.0336  0.0021  83  VAL D O   
4039 C CB  . VAL D 83  ? 1.1288 1.2026 1.0796 -0.0025 0.0278  0.0274  83  VAL D CB  
4040 C CG1 . VAL D 83  ? 1.2040 1.2816 1.1500 -0.0117 0.0245  0.0341  83  VAL D CG1 
4041 C CG2 . VAL D 83  ? 1.1300 1.2116 1.0836 0.0012  0.0265  0.0373  83  VAL D CG2 
4042 N N   . ALA D 84  ? 1.1822 1.2256 1.1152 -0.0254 0.0303  0.0115  84  ALA D N   
4043 C CA  . ALA D 84  ? 1.2265 1.2608 1.1512 -0.0311 0.0312  0.0047  84  ALA D CA  
4044 C C   . ALA D 84  ? 1.2885 1.3227 1.2040 -0.0405 0.0265  0.0118  84  ALA D C   
4045 O O   . ALA D 84  ? 1.2944 1.3255 1.2053 -0.0471 0.0241  0.0186  84  ALA D O   
4046 C CB  . ALA D 84  ? 1.2124 1.2340 1.1334 -0.0337 0.0343  -0.0022 84  ALA D CB  
4047 N N   . ARG D 85  ? 1.3552 1.3920 1.2681 -0.0411 0.0248  0.0101  85  ARG D N   
4048 C CA  . ARG D 85  ? 1.4459 1.4822 1.3498 -0.0494 0.0185  0.0172  85  ARG D CA  
4049 C C   . ARG D 85  ? 1.4702 1.5153 1.3772 -0.0516 0.0136  0.0316  85  ARG D C   
4050 O O   . ARG D 85  ? 1.5020 1.5408 1.4003 -0.0601 0.0091  0.0386  85  ARG D O   
4051 C CB  . ARG D 85  ? 1.4963 1.5163 1.3853 -0.0577 0.0179  0.0132  85  ARG D CB  
4052 N N   . ASN D 86  ? 1.4615 1.5206 1.3803 -0.0433 0.0145  0.0364  86  ASN D N   
4053 C CA  . ASN D 86  ? 1.4842 1.5538 1.4069 -0.0436 0.0108  0.0512  86  ASN D CA  
4054 C C   . ASN D 86  ? 1.4423 1.5054 1.3618 -0.0491 0.0115  0.0557  86  ASN D C   
4055 O O   . ASN D 86  ? 1.4732 1.5397 1.3910 -0.0547 0.0072  0.0684  86  ASN D O   
4056 C CB  . ASN D 86  ? 1.5673 1.6436 1.4873 -0.0489 0.0029  0.0624  86  ASN D CB  
4057 C CG  . ASN D 86  ? 1.6436 1.7364 1.5737 -0.0401 0.0019  0.0650  86  ASN D CG  
4058 O OD1 . ASN D 86  ? 1.7097 1.8170 1.6479 -0.0339 0.0006  0.0762  86  ASN D OD1 
4059 N ND2 . ASN D 86  ? 1.7084 1.7994 1.6380 -0.0388 0.0027  0.0547  86  ASN D ND2 
4060 N N   . LYS D 87  ? 1.3624 1.4166 1.2821 -0.0477 0.0166  0.0457  87  LYS D N   
4061 C CA  . LYS D 87  ? 1.2652 1.3158 1.1854 -0.0508 0.0182  0.0485  87  LYS D CA  
4062 C C   . LYS D 87  ? 1.1572 1.2089 1.0856 -0.0415 0.0231  0.0401  87  LYS D C   
4063 O O   . LYS D 87  ? 1.1372 1.1840 1.0663 -0.0371 0.0257  0.0294  87  LYS D O   
4064 C CB  . LYS D 87  ? 1.2698 1.3059 1.1798 -0.0603 0.0177  0.0451  87  LYS D CB  
4065 N N   . PRO D 88  ? 1.0971 1.1549 1.0315 -0.0384 0.0239  0.0452  88  PRO D N   
4066 C CA  . PRO D 88  ? 1.0291 1.0867 0.9705 -0.0295 0.0269  0.0382  88  PRO D CA  
4067 C C   . PRO D 88  ? 0.9631 1.0106 0.9046 -0.0337 0.0287  0.0316  88  PRO D C   
4068 O O   . PRO D 88  ? 0.9622 1.0084 0.9022 -0.0414 0.0282  0.0365  88  PRO D O   
4069 C CB  . PRO D 88  ? 1.0398 1.1093 0.9860 -0.0243 0.0259  0.0483  88  PRO D CB  
4070 C CG  . PRO D 88  ? 1.0841 1.1567 1.0260 -0.0342 0.0235  0.0601  88  PRO D CG  
4071 C CD  . PRO D 88  ? 1.1139 1.1823 1.0495 -0.0400 0.0212  0.0595  88  PRO D CD  
4072 N N   . LYS D 89  ? 0.8851 0.9261 0.8291 -0.0285 0.0306  0.0212  89  LYS D N   
4073 C CA  . LYS D 89  ? 0.8159 0.8481 0.7607 -0.0317 0.0318  0.0156  89  LYS D CA  
4074 C C   . LYS D 89  ? 0.7736 0.8069 0.7271 -0.0241 0.0313  0.0128  89  LYS D C   
4075 O O   . LYS D 89  ? 0.8069 0.8447 0.7641 -0.0145 0.0304  0.0125  89  LYS D O   
4076 C CB  . LYS D 89  ? 0.8019 0.8244 0.7421 -0.0324 0.0336  0.0070  89  LYS D CB  
4077 C CG  . LYS D 89  ? 0.8248 0.8470 0.7571 -0.0354 0.0335  0.0074  89  LYS D CG  
4078 C CD  . LYS D 89  ? 0.8869 0.9021 0.8090 -0.0455 0.0326  0.0097  89  LYS D CD  
4079 C CE  . LYS D 89  ? 0.9670 0.9874 0.8858 -0.0516 0.0292  0.0203  89  LYS D CE  
4080 N NZ  . LYS D 89  ? 1.0173 1.0292 0.9232 -0.0602 0.0269  0.0222  89  LYS D NZ  
4081 N N   . THR D 90  ? 0.6996 0.7286 0.6559 -0.0279 0.0312  0.0111  90  THR D N   
4082 C CA  . THR D 90  ? 0.6256 0.6534 0.5901 -0.0216 0.0294  0.0076  90  THR D CA  
4083 C C   . THR D 90  ? 0.5738 0.5932 0.5391 -0.0251 0.0300  0.0026  90  THR D C   
4084 O O   . THR D 90  ? 0.5689 0.5866 0.5307 -0.0332 0.0313  0.0046  90  THR D O   
4085 C CB  . THR D 90  ? 0.6356 0.6706 0.6050 -0.0232 0.0277  0.0135  90  THR D CB  
4086 O OG1 . THR D 90  ? 0.6646 0.7080 0.6322 -0.0191 0.0274  0.0195  90  THR D OG1 
4087 C CG2 . THR D 90  ? 0.5836 0.6168 0.5614 -0.0174 0.0243  0.0100  90  THR D CG2 
4088 N N   . VAL D 91  ? 0.5166 0.5302 0.4858 -0.0183 0.0289  -0.0031 91  VAL D N   
4089 C CA  . VAL D 91  ? 0.4706 0.4772 0.4420 -0.0204 0.0289  -0.0061 91  VAL D CA  
4090 C C   . VAL D 91  ? 0.4656 0.4703 0.4468 -0.0139 0.0241  -0.0076 91  VAL D C   
4091 O O   . VAL D 91  ? 0.4693 0.4721 0.4523 -0.0054 0.0218  -0.0101 91  VAL D O   
4092 C CB  . VAL D 91  ? 0.4610 0.4598 0.4260 -0.0197 0.0319  -0.0112 91  VAL D CB  
4093 C CG1 . VAL D 91  ? 0.4274 0.4201 0.3927 -0.0229 0.0326  -0.0120 91  VAL D CG1 
4094 C CG2 . VAL D 91  ? 0.4484 0.4489 0.4033 -0.0247 0.0350  -0.0100 91  VAL D CG2 
4095 N N   . ILE D 92  ? 0.4522 0.4573 0.4398 -0.0174 0.0220  -0.0057 92  ILE D N   
4096 C CA  . ILE D 92  ? 0.4413 0.4435 0.4383 -0.0115 0.0160  -0.0066 92  ILE D CA  
4097 C C   . ILE D 92  ? 0.4381 0.4329 0.4366 -0.0122 0.0161  -0.0079 92  ILE D C   
4098 O O   . ILE D 92  ? 0.4331 0.4290 0.4295 -0.0187 0.0192  -0.0056 92  ILE D O   
4099 C CB  . ILE D 92  ? 0.4401 0.4499 0.4461 -0.0141 0.0119  -0.0025 92  ILE D CB  
4100 C CG1 . ILE D 92  ? 0.4633 0.4819 0.4658 -0.0186 0.0148  0.0009  92  ILE D CG1 
4101 C CG2 . ILE D 92  ? 0.4446 0.4521 0.4579 -0.0059 0.0043  -0.0035 92  ILE D CG2 
4102 C CD1 . ILE D 92  ? 0.4964 0.5171 0.4953 -0.0118 0.0140  0.0008  92  ILE D CD1 
4103 N N   . TYR D 93  ? 0.4255 0.4122 0.4265 -0.0050 0.0127  -0.0108 93  TYR D N   
4104 C CA  . TYR D 93  ? 0.4052 0.3847 0.4084 -0.0053 0.0121  -0.0104 93  TYR D CA  
4105 C C   . TYR D 93  ? 0.4010 0.3781 0.4159 -0.0010 0.0031  -0.0077 93  TYR D C   
4106 O O   . TYR D 93  ? 0.4152 0.3917 0.4339 0.0048  -0.0028 -0.0087 93  TYR D O   
4107 C CB  . TYR D 93  ? 0.4067 0.3767 0.4029 -0.0016 0.0157  -0.0154 93  TYR D CB  
4108 C CG  . TYR D 93  ? 0.3838 0.3546 0.3686 -0.0065 0.0238  -0.0178 93  TYR D CG  
4109 C CD1 . TYR D 93  ? 0.3858 0.3557 0.3652 -0.0125 0.0279  -0.0158 93  TYR D CD1 
4110 C CD2 . TYR D 93  ? 0.3837 0.3561 0.3629 -0.0041 0.0265  -0.0215 93  TYR D CD2 
4111 C CE1 . TYR D 93  ? 0.3884 0.3577 0.3561 -0.0166 0.0340  -0.0180 93  TYR D CE1 
4112 C CE2 . TYR D 93  ? 0.3929 0.3662 0.3624 -0.0086 0.0323  -0.0232 93  TYR D CE2 
4113 C CZ  . TYR D 93  ? 0.4164 0.3875 0.3796 -0.0150 0.0358  -0.0218 93  TYR D CZ  
4114 O OH  . TYR D 93  ? 0.4632 0.4340 0.4153 -0.0192 0.0405  -0.0237 93  TYR D OH  
4115 N N   . TRP D 94  ? 0.3771 0.3528 0.3971 -0.0035 0.0016  -0.0036 94  TRP D N   
4116 C CA  . TRP D 94  ? 0.3760 0.3483 0.4074 0.0001  -0.0076 0.0002  94  TRP D CA  
4117 C C   . TRP D 94  ? 0.3805 0.3430 0.4091 0.0012  -0.0057 0.0010  94  TRP D C   
4118 O O   . TRP D 94  ? 0.3828 0.3432 0.4012 -0.0015 0.0028  -0.0014 94  TRP D O   
4119 C CB  . TRP D 94  ? 0.3698 0.3529 0.4118 -0.0046 -0.0111 0.0069  94  TRP D CB  
4120 C CG  . TRP D 94  ? 0.3901 0.3824 0.4375 -0.0055 -0.0146 0.0069  94  TRP D CG  
4121 C CD1 . TRP D 94  ? 0.3997 0.3927 0.4565 -0.0014 -0.0247 0.0082  94  TRP D CD1 
4122 C CD2 . TRP D 94  ? 0.3812 0.3827 0.4240 -0.0110 -0.0085 0.0059  94  TRP D CD2 
4123 N NE1 . TRP D 94  ? 0.4092 0.4119 0.4675 -0.0039 -0.0246 0.0077  94  TRP D NE1 
4124 C CE2 . TRP D 94  ? 0.3730 0.3812 0.4234 -0.0100 -0.0145 0.0067  94  TRP D CE2 
4125 C CE3 . TRP D 94  ? 0.3585 0.3626 0.3913 -0.0166 0.0007  0.0049  94  TRP D CE3 
4126 C CZ2 . TRP D 94  ? 0.3011 0.3188 0.3499 -0.0149 -0.0106 0.0069  94  TRP D CZ2 
4127 C CZ3 . TRP D 94  ? 0.3372 0.3499 0.3685 -0.0213 0.0035  0.0054  94  TRP D CZ3 
4128 C CH2 . TRP D 94  ? 0.3094 0.3290 0.3488 -0.0206 -0.0015 0.0065  94  TRP D CH2 
4129 N N   . LEU D 95  ? 0.3868 0.3426 0.4238 0.0051  -0.0141 0.0050  95  LEU D N   
4130 C CA  . LEU D 95  ? 0.3905 0.3374 0.4256 0.0057  -0.0124 0.0075  95  LEU D CA  
4131 C C   . LEU D 95  ? 0.3986 0.3524 0.4422 0.0021  -0.0150 0.0172  95  LEU D C   
4132 O O   . LEU D 95  ? 0.4003 0.3612 0.4561 0.0021  -0.0235 0.0224  95  LEU D O   
4133 C CB  . LEU D 95  ? 0.4037 0.3375 0.4431 0.0126  -0.0213 0.0074  95  LEU D CB  
4134 C CG  . LEU D 95  ? 0.4371 0.3597 0.4684 0.0185  -0.0192 -0.0009 95  LEU D CG  
4135 C CD1 . LEU D 95  ? 0.4488 0.3595 0.4865 0.0260  -0.0317 0.0007  95  LEU D CD1 
4136 C CD2 . LEU D 95  ? 0.4658 0.3816 0.4885 0.0164  -0.0099 -0.0032 95  LEU D CD2 
4137 N N   . ALA D 96  ? 0.3941 0.3464 0.4314 -0.0004 -0.0080 0.0202  96  ALA D N   
4138 C CA  . ALA D 96  ? 0.3994 0.3583 0.4442 -0.0022 -0.0102 0.0310  96  ALA D CA  
4139 C C   . ALA D 96  ? 0.4162 0.3657 0.4571 -0.0008 -0.0080 0.0358  96  ALA D C   
4140 O O   . ALA D 96  ? 0.4131 0.3569 0.4404 -0.0020 0.0014  0.0311  96  ALA D O   
4141 C CB  . ALA D 96  ? 0.3622 0.3329 0.4020 -0.0071 -0.0028 0.0319  96  ALA D CB  
4142 N N   . GLU D 97  ? 0.4563 0.4042 0.5092 0.0014  -0.0172 0.0459  97  GLU D N   
4143 C CA  . GLU D 97  ? 0.4962 0.4371 0.5466 0.0022  -0.0153 0.0537  97  GLU D CA  
4144 C C   . GLU D 97  ? 0.5118 0.4635 0.5605 0.0002  -0.0101 0.0634  97  GLU D C   
4145 O O   . GLU D 97  ? 0.5158 0.4812 0.5737 -0.0006 -0.0136 0.0688  97  GLU D O   
4146 C CB  . GLU D 97  ? 0.5129 0.4472 0.5771 0.0057  -0.0285 0.0625  97  GLU D CB  
4147 C CG  . GLU D 97  ? 0.5680 0.4927 0.6292 0.0065  -0.0268 0.0711  97  GLU D CG  
4148 C CD  . GLU D 97  ? 0.6357 0.5490 0.7084 0.0100  -0.0406 0.0781  97  GLU D CD  
4149 O OE1 . GLU D 97  ? 0.6820 0.5804 0.7494 0.0113  -0.0392 0.0784  97  GLU D OE1 
4150 O OE2 . GLU D 97  ? 0.6528 0.5714 0.7397 0.0114  -0.0534 0.0832  97  GLU D OE2 
4151 N N   . VAL D 98  ? 0.5278 0.4734 0.5648 0.0001  -0.0019 0.0659  98  VAL D N   
4152 C CA  . VAL D 98  ? 0.5444 0.4991 0.5782 0.0001  0.0024  0.0769  98  VAL D CA  
4153 C C   . VAL D 98  ? 0.5811 0.5394 0.6296 0.0029  -0.0065 0.0940  98  VAL D C   
4154 O O   . VAL D 98  ? 0.5907 0.5387 0.6452 0.0044  -0.0128 0.0978  98  VAL D O   
4155 C CB  . VAL D 98  ? 0.5420 0.4902 0.5547 -0.0007 0.0154  0.0736  98  VAL D CB  
4156 C CG1 . VAL D 98  ? 0.5100 0.4597 0.5088 -0.0037 0.0235  0.0607  98  VAL D CG1 
4157 C CG2 . VAL D 98  ? 0.5109 0.4437 0.5185 -0.0002 0.0174  0.0711  98  VAL D CG2 
4158 N N   . LYS D 99  ? 0.6078 0.5813 0.6629 0.0039  -0.0078 0.1046  99  LYS D N   
4159 C CA  . LYS D 99  ? 0.6443 0.6248 0.7141 0.0070  -0.0163 0.1231  99  LYS D CA  
4160 C C   . LYS D 99  ? 0.6592 0.6310 0.7183 0.0088  -0.0105 0.1316  99  LYS D C   
4161 O O   . LYS D 99  ? 0.6806 0.6479 0.7495 0.0105  -0.0183 0.1435  99  LYS D O   
4162 C CB  . LYS D 99  ? 0.6494 0.6496 0.7270 0.0085  -0.0171 0.1322  99  LYS D CB  
4163 C CG  . LYS D 99  ? 0.6897 0.7010 0.7849 0.0069  -0.0264 0.1293  99  LYS D CG  
4164 C CD  . LYS D 99  ? 0.7429 0.7731 0.8432 0.0079  -0.0244 0.1354  99  LYS D CD  
4165 C CE  . LYS D 99  ? 0.6836 0.7251 0.8011 0.0054  -0.0327 0.1315  99  LYS D CE  
4167 N N   . ASP D 100 ? 0.6348 0.5894 0.6710 0.1198  0.0465  0.0757  100 ASP D N   
4168 C CA  . ASP D 100 ? 0.6519 0.5939 0.7115 0.1154  0.0462  0.0839  100 ASP D CA  
4169 C C   . ASP D 100 ? 0.6100 0.5583 0.6601 0.0991  0.0300  0.0782  100 ASP D C   
4170 O O   . ASP D 100 ? 0.5921 0.5443 0.6131 0.0948  0.0265  0.0699  100 ASP D O   
4171 C CB  . ASP D 100 ? 0.7132 0.6327 0.7671 0.1274  0.0642  0.0915  100 ASP D CB  
4172 C CG  . ASP D 100 ? 0.8333 0.7395 0.9143 0.1438  0.0829  0.1033  100 ASP D CG  
4173 O OD1 . ASP D 100 ? 0.9803 0.8675 1.0471 0.1590  0.1010  0.1090  100 ASP D OD1 
4174 O OD2 . ASP D 100 ? 0.8770 0.7905 0.9949 0.1431  0.0800  0.1069  100 ASP D OD2 
4175 N N   . TYR D 101 ? 0.6011 0.5492 0.6789 0.0918  0.0202  0.0823  101 TYR D N   
4176 C CA  . TYR D 101 ? 0.5748 0.5265 0.6465 0.0787  0.0061  0.0789  101 TYR D CA  
4177 C C   . TYR D 101 ? 0.5757 0.5185 0.6331 0.0750  0.0116  0.0794  101 TYR D C   
4178 O O   . TYR D 101 ? 0.5571 0.5069 0.5965 0.0665  0.0045  0.0733  101 TYR D O   
4179 C CB  . TYR D 101 ? 0.5986 0.5444 0.7056 0.0768  -0.0029 0.0844  101 TYR D CB  
4180 C CG  . TYR D 101 ? 0.6047 0.5529 0.7051 0.0664  -0.0188 0.0811  101 TYR D CG  
4181 C CD1 . TYR D 101 ? 0.6093 0.5687 0.7039 0.0641  -0.0340 0.0755  101 TYR D CD1 
4182 C CD2 . TYR D 101 ? 0.6050 0.5434 0.7043 0.0602  -0.0176 0.0841  101 TYR D CD2 
4183 C CE1 . TYR D 101 ? 0.6219 0.5801 0.7070 0.0581  -0.0466 0.0735  101 TYR D CE1 
4184 C CE2 . TYR D 101 ? 0.6267 0.5662 0.7191 0.0529  -0.0301 0.0819  101 TYR D CE2 
4185 C CZ  . TYR D 101 ? 0.6432 0.5913 0.7270 0.0529  -0.0442 0.0768  101 TYR D CZ  
4186 O OH  . TYR D 101 ? 0.6883 0.6344 0.7607 0.0488  -0.0553 0.0753  101 TYR D OH  
4187 N N   . ASP D 102 ? 0.5961 0.5230 0.6638 0.0821  0.0253  0.0872  102 ASP D N   
4188 C CA  . ASP D 102 ? 0.6085 0.5279 0.6650 0.0788  0.0298  0.0877  102 ASP D CA  
4189 C C   . ASP D 102 ? 0.6057 0.5231 0.6331 0.0886  0.0391  0.0823  102 ASP D C   
4190 O O   . ASP D 102 ? 0.6457 0.5525 0.6674 0.0916  0.0465  0.0846  102 ASP D O   
4191 C CB  . ASP D 102 ? 0.6522 0.5534 0.7369 0.0788  0.0371  0.0993  102 ASP D CB  
4192 C CG  . ASP D 102 ? 0.7334 0.6192 0.8380 0.0928  0.0521  0.1086  102 ASP D CG  
4193 O OD1 . ASP D 102 ? 0.8133 0.7051 0.9137 0.1021  0.0554  0.1065  102 ASP D OD1 
4194 O OD2 . ASP D 102 ? 0.7826 0.6496 0.9098 0.0948  0.0618  0.1188  102 ASP D OD2 
4195 N N   . VAL D 103 ? 0.5791 0.5062 0.5876 0.0939  0.0372  0.0742  103 VAL D N   
4196 C CA  . VAL D 103 ? 0.5726 0.4975 0.5506 0.1049  0.0422  0.0655  103 VAL D CA  
4197 C C   . VAL D 103 ? 0.5764 0.5025 0.5431 0.0994  0.0372  0.0585  103 VAL D C   
4198 O O   . VAL D 103 ? 0.5879 0.5243 0.5635 0.0851  0.0276  0.0565  103 VAL D O   
4199 C CB  . VAL D 103 ? 0.5425 0.4823 0.5044 0.1043  0.0344  0.0547  103 VAL D CB  
4200 C CG1 . VAL D 103 ? 0.4809 0.4352 0.4399 0.0888  0.0199  0.0462  103 VAL D CG1 
4201 C CG2 . VAL D 103 ? 0.5258 0.4592 0.4578 0.1201  0.0402  0.0459  103 VAL D CG2 
4202 N N   . GLU D 104 ? 0.6137 0.5286 0.5615 0.1126  0.0439  0.0547  104 GLU D N   
4203 C CA  . GLU D 104 ? 0.6300 0.5461 0.5730 0.1095  0.0394  0.0478  104 GLU D CA  
4204 C C   . GLU D 104 ? 0.6104 0.5390 0.5395 0.1079  0.0279  0.0307  104 GLU D C   
4205 O O   . GLU D 104 ? 0.6316 0.5576 0.5399 0.1197  0.0267  0.0211  104 GLU D O   
4206 C CB  . GLU D 104 ? 0.6802 0.5771 0.6112 0.1258  0.0503  0.0509  104 GLU D CB  
4207 C CG  . GLU D 104 ? 0.7444 0.6446 0.6689 0.1264  0.0433  0.0398  104 GLU D CG  
4208 C CD  . GLU D 104 ? 0.8589 0.7394 0.7702 0.1434  0.0524  0.0427  104 GLU D CD  
4209 O OE1 . GLU D 104 ? 0.8731 0.7573 0.7859 0.1432  0.0465  0.0349  104 GLU D OE1 
4210 O OE2 . GLU D 104 ? 0.9272 0.7881 0.8281 0.1582  0.0663  0.0529  104 GLU D OE2 
4211 N N   . ILE D 105 ? 0.5889 0.5294 0.5319 0.0941  0.0202  0.0271  105 ILE D N   
4212 C CA  . ILE D 105 ? 0.5834 0.5341 0.5225 0.0922  0.0107  0.0116  105 ILE D CA  
4213 C C   . ILE D 105 ? 0.6336 0.5805 0.5730 0.1003  0.0096  0.0033  105 ILE D C   
4214 O O   . ILE D 105 ? 0.6382 0.5870 0.5942 0.0937  0.0122  0.0097  105 ILE D O   
4215 C CB  . ILE D 105 ? 0.5441 0.5089 0.5018 0.0745  0.0053  0.0133  105 ILE D CB  
4216 C CG1 . ILE D 105 ? 0.4830 0.4531 0.4374 0.0682  0.0022  0.0168  105 ILE D CG1 
4217 C CG2 . ILE D 105 ? 0.5231 0.4958 0.4862 0.0735  -0.0010 -0.0011 105 ILE D CG2 
4218 C CD1 . ILE D 105 ? 0.4541 0.4176 0.4053 0.0731  0.0072  0.0265  105 ILE D CD1 
4219 N N   . ARG D 106 ? 0.6888 0.6302 0.6106 0.1151  0.0047  -0.0118 106 ARG D N   
4220 C CA  . ARG D 106 ? 0.7456 0.6848 0.6702 0.1248  -0.0007 -0.0243 106 ARG D CA  
4221 C C   . ARG D 106 ? 0.7387 0.6880 0.6739 0.1223  -0.0123 -0.0421 106 ARG D C   
4222 O O   . ARG D 106 ? 0.7515 0.6967 0.6705 0.1296  -0.0177 -0.0529 106 ARG D O   
4223 C CB  . ARG D 106 ? 0.8194 0.7389 0.7141 0.1496  0.0008  -0.0303 106 ARG D CB  
4224 C CG  . ARG D 106 ? 0.9117 0.8149 0.7896 0.1580  0.0154  -0.0132 106 ARG D CG  
4225 C CD  . ARG D 106 ? 1.1054 0.9855 0.9492 0.1870  0.0183  -0.0197 106 ARG D CD  
4226 N NE  . ARG D 106 ? 1.1984 1.0743 1.0179 0.1999  0.0118  -0.0338 106 ARG D NE  
4227 C CZ  . ARG D 106 ? 1.2546 1.1239 1.0577 0.2166  -0.0011 -0.0548 106 ARG D CZ  
4228 N NH1 . ARG D 106 ? 1.3066 1.1733 1.1160 0.2243  -0.0094 -0.0649 106 ARG D NH1 
4229 N NH2 . ARG D 106 ? 1.2366 1.1016 1.0187 0.2262  -0.0067 -0.0667 106 ARG D NH2 
4230 N N   . LEU D 107 ? 0.7372 0.6987 0.7019 0.1127  -0.0154 -0.0454 107 LEU D N   
4231 C CA  . LEU D 107 ? 0.7523 0.7209 0.7345 0.1124  -0.0249 -0.0629 107 LEU D CA  
4232 C C   . LEU D 107 ? 0.8259 0.7859 0.8047 0.1326  -0.0361 -0.0842 107 LEU D C   
4233 O O   . LEU D 107 ? 0.8653 0.8168 0.8337 0.1463  -0.0367 -0.0856 107 LEU D O   
4234 C CB  . LEU D 107 ? 0.7194 0.7033 0.7394 0.0980  -0.0223 -0.0593 107 LEU D CB  
4235 C CG  . LEU D 107 ? 0.6619 0.6531 0.6872 0.0802  -0.0132 -0.0402 107 LEU D CG  
4236 C CD1 . LEU D 107 ? 0.6190 0.6229 0.6799 0.0708  -0.0101 -0.0393 107 LEU D CD1 
4237 C CD2 . LEU D 107 ? 0.5919 0.5808 0.5996 0.0754  -0.0139 -0.0378 107 LEU D CD2 
4238 N N   . SER D 108 ? 0.8735 0.8340 0.8618 0.1352  -0.0457 -0.1013 108 SER D N   
4239 C CA  . SER D 108 ? 0.9762 0.9300 0.9733 0.1532  -0.0597 -0.1250 108 SER D CA  
4240 C C   . SER D 108 ? 1.0166 0.9854 1.0640 0.1456  -0.0607 -0.1292 108 SER D C   
4241 O O   . SER D 108 ? 0.9501 0.9318 1.0156 0.1282  -0.0493 -0.1123 108 SER D O   
4242 C CB  . SER D 108 ? 1.0158 0.9612 1.0026 0.1590  -0.0697 -0.1417 108 SER D CB  
4243 O OG  . SER D 108 ? 1.1208 1.0657 1.1409 0.1666  -0.0832 -0.1647 108 SER D OG  
4244 N N   . HIS D 109 ? 1.1190 1.0856 1.1907 0.1600  -0.0744 -0.1519 109 HIS D N   
4245 C CA  . HIS D 109 ? 1.1355 1.1172 1.2629 0.1545  -0.0748 -0.1575 109 HIS D CA  
4246 C C   . HIS D 109 ? 1.0803 1.0692 1.2352 0.1381  -0.0678 -0.1541 109 HIS D C   
4247 O O   . HIS D 109 ? 1.0698 1.0725 1.2677 0.1284  -0.0598 -0.1490 109 HIS D O   
4248 C CB  . HIS D 109 ? 1.3028 1.2788 1.4537 0.1766  -0.0934 -0.1852 109 HIS D CB  
4249 C CG  . HIS D 109 ? 1.4125 1.3743 1.5620 0.1875  -0.1076 -0.2075 109 HIS D CG  
4250 N ND1 . HIS D 109 ? 1.4798 1.4220 1.5786 0.2025  -0.1165 -0.2156 109 HIS D ND1 
4251 C CD2 . HIS D 109 ? 1.3990 1.3621 1.5933 0.1857  -0.1136 -0.2230 109 HIS D CD2 
4252 C CE1 . HIS D 109 ? 1.4978 1.4305 1.6086 0.2086  -0.1290 -0.2361 109 HIS D CE1 
4253 N NE2 . HIS D 109 ? 1.4383 1.3827 1.6081 0.1982  -0.1276 -0.2410 109 HIS D NE2 
4254 N N   . GLU D 110 ? 1.0741 1.0530 1.2031 0.1358  -0.0696 -0.1560 110 GLU D N   
4255 C CA  . GLU D 110 ? 1.0089 0.9901 1.1596 0.1228  -0.0641 -0.1545 110 GLU D CA  
4256 C C   . GLU D 110 ? 0.9023 0.8961 1.0607 0.1037  -0.0460 -0.1295 110 GLU D C   
4257 O O   . GLU D 110 ? 0.8775 0.8751 1.0671 0.0954  -0.0381 -0.1266 110 GLU D O   
4258 C CB  . GLU D 110 ? 1.0283 0.9970 1.1436 0.1231  -0.0693 -0.1593 110 GLU D CB  
4259 C CG  . GLU D 110 ? 1.1719 1.1250 1.2805 0.1428  -0.0882 -0.1866 110 GLU D CG  
4260 C CD  . GLU D 110 ? 1.3239 1.2753 1.4895 0.1493  -0.0976 -0.2084 110 GLU D CD  
4261 O OE1 . GLU D 110 ? 1.3438 1.3010 1.5467 0.1359  -0.0878 -0.2030 110 GLU D OE1 
4262 O OE2 . GLU D 110 ? 1.4097 1.3523 1.5854 0.1699  -0.1150 -0.2317 110 GLU D OE2 
4263 N N   . HIS D 111 ? 0.8445 0.8421 0.9754 0.0987  -0.0394 -0.1117 111 HIS D N   
4264 C CA  . HIS D 111 ? 0.7917 0.7991 0.9289 0.0832  -0.0250 -0.0900 111 HIS D CA  
4265 C C   . HIS D 111 ? 0.7869 0.8033 0.9324 0.0813  -0.0198 -0.0795 111 HIS D C   
4266 O O   . HIS D 111 ? 0.8108 0.8239 0.9421 0.0901  -0.0252 -0.0829 111 HIS D O   
4267 C CB  . HIS D 111 ? 0.7504 0.7532 0.8500 0.0739  -0.0206 -0.0753 111 HIS D CB  
4268 C CG  . HIS D 111 ? 0.7222 0.7170 0.8106 0.0750  -0.0261 -0.0852 111 HIS D CG  
4269 N ND1 . HIS D 111 ? 0.6658 0.6601 0.7724 0.0678  -0.0211 -0.0848 111 HIS D ND1 
4270 C CD2 . HIS D 111 ? 0.7055 0.6913 0.7673 0.0833  -0.0355 -0.0961 111 HIS D CD2 
4271 C CE1 . HIS D 111 ? 0.6595 0.6456 0.7521 0.0697  -0.0280 -0.0951 111 HIS D CE1 
4272 N NE2 . HIS D 111 ? 0.6902 0.6718 0.7553 0.0789  -0.0372 -0.1024 111 HIS D NE2 
4273 N N   . GLN D 112 ? 0.7663 0.7924 0.9337 0.0703  -0.0083 -0.0662 112 GLN D N   
4274 C CA  . GLN D 112 ? 0.7667 0.8024 0.9462 0.0664  -0.0026 -0.0560 112 GLN D CA  
4275 C C   . GLN D 112 ? 0.7263 0.7601 0.8789 0.0550  0.0046  -0.0349 112 GLN D C   
4276 O O   . GLN D 112 ? 0.7660 0.8047 0.9229 0.0511  0.0083  -0.0259 112 GLN D O   
4277 C CB  . GLN D 112 ? 0.8051 0.8540 1.0348 0.0639  0.0053  -0.0570 112 GLN D CB  
4278 C CG  . GLN D 112 ? 0.8473 0.8931 1.0970 0.0638  0.0100  -0.0617 112 GLN D CG  
4279 C CD  . GLN D 112 ? 0.9026 0.9540 1.1699 0.0553  0.0264  -0.0457 112 GLN D CD  
4280 O OE1 . GLN D 112 ? 0.9335 0.9933 1.2469 0.0579  0.0347  -0.0487 112 GLN D OE1 
4281 N NE2 . GLN D 112 ? 0.9305 0.9763 1.1622 0.0469  0.0314  -0.0288 112 GLN D NE2 
4282 N N   . ALA D 113 ? 0.6654 0.6921 0.7937 0.0499  0.0060  -0.0277 113 ALA D N   
4283 C CA  . ALA D 113 ? 0.6105 0.6339 0.7165 0.0410  0.0104  -0.0096 113 ALA D CA  
4284 C C   . ALA D 113 ? 0.5708 0.5853 0.6459 0.0400  0.0068  -0.0067 113 ALA D C   
4285 O O   . ALA D 113 ? 0.5656 0.5772 0.6366 0.0437  0.0030  -0.0170 113 ALA D O   
4286 C CB  . ALA D 113 ? 0.6051 0.6349 0.7300 0.0331  0.0202  0.0018  113 ALA D CB  
4287 N N   . TYR D 114 ? 0.5299 0.5401 0.5866 0.0348  0.0075  0.0067  114 TYR D N   
4288 C CA  . TYR D 114 ? 0.4854 0.4896 0.5180 0.0338  0.0038  0.0103  114 TYR D CA  
4289 C C   . TYR D 114 ? 0.4748 0.4761 0.5009 0.0275  0.0050  0.0252  114 TYR D C   
4290 O O   . TYR D 114 ? 0.4925 0.4944 0.5290 0.0240  0.0081  0.0329  114 TYR D O   
4291 C CB  . TYR D 114 ? 0.4715 0.4702 0.4859 0.0406  -0.0007 0.0060  114 TYR D CB  
4292 C CG  . TYR D 114 ? 0.4515 0.4452 0.4629 0.0414  0.0014  0.0155  114 TYR D CG  
4293 C CD1 . TYR D 114 ? 0.4564 0.4485 0.4742 0.0472  0.0033  0.0120  114 TYR D CD1 
4294 C CD2 . TYR D 114 ? 0.4106 0.3993 0.4148 0.0378  0.0013  0.0274  114 TYR D CD2 
4295 C CE1 . TYR D 114 ? 0.4716 0.4562 0.4871 0.0484  0.0072  0.0216  114 TYR D CE1 
4296 C CE2 . TYR D 114 ? 0.4272 0.4087 0.4340 0.0389  0.0044  0.0361  114 TYR D CE2 
4297 C CZ  . TYR D 114 ? 0.4819 0.4606 0.4935 0.0438  0.0084  0.0340  114 TYR D CZ  
4298 O OH  . TYR D 114 ? 0.5352 0.5037 0.5499 0.0452  0.0134  0.0439  114 TYR D OH  
4299 N N   . ARG D 115 ? 0.4557 0.4531 0.4651 0.0267  0.0012  0.0284  115 ARG D N   
4300 C CA  . ARG D 115 ? 0.4581 0.4505 0.4603 0.0238  -0.0013 0.0403  115 ARG D CA  
4301 C C   . ARG D 115 ? 0.4453 0.4346 0.4306 0.0256  -0.0088 0.0409  115 ARG D C   
4302 O O   . ARG D 115 ? 0.4317 0.4233 0.4079 0.0271  -0.0104 0.0339  115 ARG D O   
4303 C CB  . ARG D 115 ? 0.4762 0.4670 0.4793 0.0226  0.0025  0.0452  115 ARG D CB  
4304 C CG  . ARG D 115 ? 0.5005 0.4934 0.5213 0.0203  0.0099  0.0504  115 ARG D CG  
4305 C CD  . ARG D 115 ? 0.5022 0.4934 0.5284 0.0171  0.0071  0.0560  115 ARG D CD  
4306 N NE  . ARG D 115 ? 0.5532 0.5463 0.5946 0.0137  0.0134  0.0622  115 ARG D NE  
4307 C CZ  . ARG D 115 ? 0.5715 0.5737 0.6346 0.0111  0.0199  0.0596  115 ARG D CZ  
4308 N NH1 . ARG D 115 ? 0.5489 0.5572 0.6196 0.0134  0.0199  0.0500  115 ARG D NH1 
4309 N NH2 . ARG D 115 ? 0.5813 0.5862 0.6586 0.0073  0.0256  0.0663  115 ARG D NH2 
4310 N N   . TRP D 116 ? 0.4453 0.4294 0.4302 0.0257  -0.0135 0.0488  116 TRP D N   
4311 C CA  . TRP D 116 ? 0.4406 0.4228 0.4160 0.0280  -0.0217 0.0505  116 TRP D CA  
4312 C C   . TRP D 116 ? 0.4619 0.4389 0.4303 0.0282  -0.0266 0.0559  116 TRP D C   
4313 O O   . TRP D 116 ? 0.4888 0.4598 0.4637 0.0276  -0.0272 0.0620  116 TRP D O   
4314 C CB  . TRP D 116 ? 0.4383 0.4158 0.4242 0.0303  -0.0242 0.0554  116 TRP D CB  
4315 C CG  . TRP D 116 ? 0.4297 0.4089 0.4161 0.0346  -0.0190 0.0515  116 TRP D CG  
4316 C CD1 . TRP D 116 ? 0.4388 0.4134 0.4330 0.0369  -0.0116 0.0530  116 TRP D CD1 
4317 C CD2 . TRP D 116 ? 0.3912 0.3754 0.3679 0.0387  -0.0202 0.0460  116 TRP D CD2 
4318 N NE1 . TRP D 116 ? 0.4093 0.3835 0.3965 0.0443  -0.0076 0.0489  116 TRP D NE1 
4319 C CE2 . TRP D 116 ? 0.3974 0.3782 0.3745 0.0451  -0.0127 0.0444  116 TRP D CE2 
4320 C CE3 . TRP D 116 ? 0.3859 0.3764 0.3525 0.0381  -0.0264 0.0425  116 TRP D CE3 
4321 C CZ2 . TRP D 116 ? 0.3702 0.3538 0.3374 0.0517  -0.0109 0.0392  116 TRP D CZ2 
4322 C CZ3 . TRP D 116 ? 0.3880 0.3835 0.3478 0.0422  -0.0251 0.0371  116 TRP D CZ3 
4323 C CH2 . TRP D 116 ? 0.3474 0.3393 0.3073 0.0493  -0.0172 0.0355  116 TRP D CH2 
4324 N N   . LEU D 117 ? 0.4591 0.4367 0.4126 0.0300  -0.0300 0.0537  117 LEU D N   
4325 C CA  . LEU D 117 ? 0.4971 0.4668 0.4378 0.0336  -0.0332 0.0586  117 LEU D CA  
4326 C C   . LEU D 117 ? 0.5069 0.4747 0.4328 0.0381  -0.0444 0.0584  117 LEU D C   
4327 O O   . LEU D 117 ? 0.4997 0.4752 0.4229 0.0365  -0.0459 0.0532  117 LEU D O   
4328 C CB  . LEU D 117 ? 0.4984 0.4676 0.4351 0.0331  -0.0219 0.0572  117 LEU D CB  
4329 C CG  . LEU D 117 ? 0.5174 0.4909 0.4725 0.0297  -0.0101 0.0556  117 LEU D CG  
4330 C CD1 . LEU D 117 ? 0.4975 0.4723 0.4562 0.0299  -0.0003 0.0505  117 LEU D CD1 
4331 C CD2 . LEU D 117 ? 0.5477 0.5156 0.5083 0.0308  -0.0066 0.0638  117 LEU D CD2 
4332 N N   . GLY D 118 ? 0.5421 0.4993 0.4575 0.0449  -0.0527 0.0633  118 GLY D N   
4333 C CA  . GLY D 118 ? 0.5638 0.5180 0.4631 0.0514  -0.0643 0.0627  118 GLY D CA  
4334 C C   . GLY D 118 ? 0.5661 0.5181 0.4459 0.0521  -0.0563 0.0624  118 GLY D C   
4335 O O   . GLY D 118 ? 0.5568 0.5073 0.4386 0.0492  -0.0423 0.0632  118 GLY D O   
4336 N N   . LEU D 119 ? 0.5819 0.5325 0.4456 0.0567  -0.0647 0.0615  119 LEU D N   
4337 C CA  . LEU D 119 ? 0.6000 0.5470 0.4473 0.0565  -0.0559 0.0616  119 LEU D CA  
4338 C C   . LEU D 119 ? 0.6694 0.6004 0.5047 0.0626  -0.0425 0.0684  119 LEU D C   
4339 O O   . LEU D 119 ? 0.6640 0.5936 0.5018 0.0592  -0.0281 0.0679  119 LEU D O   
4340 C CB  . LEU D 119 ? 0.5935 0.5402 0.4238 0.0613  -0.0680 0.0607  119 LEU D CB  
4341 C CG  . LEU D 119 ? 0.5805 0.5231 0.3955 0.0593  -0.0585 0.0607  119 LEU D CG  
4342 C CD1 . LEU D 119 ? 0.4196 0.3768 0.2504 0.0461  -0.0513 0.0529  119 LEU D CD1 
4343 C CD2 . LEU D 119 ? 0.5587 0.4961 0.3517 0.0677  -0.0710 0.0623  119 LEU D CD2 
4344 N N   . GLU D 120 ? 0.7519 0.6699 0.5772 0.0728  -0.0465 0.0744  120 GLU D N   
4345 C CA  . GLU D 120 ? 0.8529 0.7545 0.6651 0.0814  -0.0322 0.0821  120 GLU D CA  
4346 C C   . GLU D 120 ? 0.8304 0.7383 0.6673 0.0734  -0.0137 0.0823  120 GLU D C   
4347 O O   . GLU D 120 ? 0.8438 0.7469 0.6832 0.0742  0.0027  0.0843  120 GLU D O   
4348 C CB  . GLU D 120 ? 0.9973 0.8833 0.7933 0.0948  -0.0422 0.0873  120 GLU D CB  
4349 C CG  . GLU D 120 ? 1.1833 1.0452 0.9478 0.1122  -0.0334 0.0962  120 GLU D CG  
4350 C CD  . GLU D 120 ? 1.3663 1.2149 1.0991 0.1265  -0.0501 0.0961  120 GLU D CD  
4351 O OE1 . GLU D 120 ? 1.4622 1.2933 1.1738 0.1427  -0.0619 0.0985  120 GLU D OE1 
4352 O OE2 . GLU D 120 ? 1.4201 1.2759 1.1501 0.1217  -0.0528 0.0927  120 GLU D OE2 
4353 N N   . GLU D 121 ? 0.8046 0.7223 0.6624 0.0669  -0.0164 0.0803  121 GLU D N   
4354 C CA  . GLU D 121 ? 0.7933 0.7184 0.6763 0.0603  -0.0013 0.0799  121 GLU D CA  
4355 C C   . GLU D 121 ? 0.7335 0.6701 0.6321 0.0518  0.0046  0.0715  121 GLU D C   
4356 O O   . GLU D 121 ? 0.7367 0.6745 0.6527 0.0504  0.0192  0.0701  121 GLU D O   
4357 C CB  . GLU D 121 ? 0.8158 0.7488 0.7166 0.0544  -0.0074 0.0791  121 GLU D CB  
4358 C CG  . GLU D 121 ? 1.0028 0.9229 0.8920 0.0624  -0.0143 0.0860  121 GLU D CG  
4359 C CD  . GLU D 121 ? 1.1801 1.0935 1.0548 0.0679  -0.0356 0.0844  121 GLU D CD  
4360 O OE1 . GLU D 121 ? 1.2075 1.1284 1.0812 0.0650  -0.0432 0.0791  121 GLU D OE1 
4361 O OE2 . GLU D 121 ? 1.3059 1.2069 1.1730 0.0756  -0.0455 0.0877  121 GLU D OE2 
4362 N N   . ALA D 122 ? 0.6794 0.6237 0.5737 0.0471  -0.0070 0.0652  122 ALA D N   
4363 C CA  . ALA D 122 ? 0.6378 0.5915 0.5441 0.0399  -0.0036 0.0559  122 ALA D CA  
4364 C C   . ALA D 122 ? 0.6590 0.6042 0.5623 0.0420  0.0073  0.0558  122 ALA D C   
4365 O O   . ALA D 122 ? 0.6433 0.5917 0.5673 0.0382  0.0162  0.0491  122 ALA D O   
4366 C CB  . ALA D 122 ? 0.6060 0.5680 0.5054 0.0365  -0.0167 0.0508  122 ALA D CB  
4367 N N   . CYS D 123 ? 0.7016 0.6340 0.5804 0.0491  0.0063  0.0627  123 CYS D N   
4368 C CA  . CYS D 123 ? 0.7362 0.6569 0.6119 0.0517  0.0188  0.0643  123 CYS D CA  
4369 C C   . CYS D 123 ? 0.8013 0.7125 0.6944 0.0574  0.0384  0.0698  123 CYS D C   
4370 O O   . CYS D 123 ? 0.8044 0.7105 0.7166 0.0566  0.0523  0.0673  123 CYS D O   
4371 C CB  . CYS D 123 ? 0.7547 0.6618 0.5969 0.0603  0.0135  0.0716  123 CYS D CB  
4372 S SG  . CYS D 123 ? 0.6787 0.5982 0.5116 0.0522  -0.0032 0.0636  123 CYS D SG  
4373 N N   . GLN D 124 ? 0.8623 0.7708 0.7519 0.0635  0.0396  0.0771  124 GLN D N   
4374 C CA  . GLN D 124 ? 0.9633 0.8646 0.8699 0.0701  0.0587  0.0839  124 GLN D CA  
4375 C C   . GLN D 124 ? 0.9091 0.8244 0.8585 0.0616  0.0667  0.0745  124 GLN D C   
4376 O O   . GLN D 124 ? 0.9387 0.8481 0.9126 0.0657  0.0849  0.0761  124 GLN D O   
4377 C CB  . GLN D 124 ? 1.0435 0.9451 0.9423 0.0743  0.0540  0.0902  124 GLN D CB  
4378 C CG  . GLN D 124 ? 1.1927 1.0729 1.0659 0.0907  0.0628  0.1033  124 GLN D CG  
4379 C CD  . GLN D 124 ? 1.2330 1.1162 1.1088 0.0922  0.0593  0.1071  124 GLN D CD  
4380 O OE1 . GLN D 124 ? 1.2103 1.0979 1.0754 0.0887  0.0397  0.1041  124 GLN D OE1 
4381 N NE2 . GLN D 124 ? 1.2591 1.1403 1.1538 0.0969  0.0789  0.1135  124 GLN D NE2 
4382 N N   . LEU D 125 ? 0.8621 0.7946 0.8215 0.0517  0.0530  0.0647  125 LEU D N   
4383 C CA  . LEU D 125 ? 0.8365 0.7820 0.8326 0.0457  0.0562  0.0538  125 LEU D CA  
4384 C C   . LEU D 125 ? 0.8304 0.7744 0.8415 0.0431  0.0585  0.0431  125 LEU D C   
4385 O O   . LEU D 125 ? 0.8403 0.7855 0.8872 0.0441  0.0684  0.0367  125 LEU D O   
4386 C CB  . LEU D 125 ? 0.7907 0.7510 0.7873 0.0388  0.0416  0.0476  125 LEU D CB  
4387 C CG  . LEU D 125 ? 0.7929 0.7559 0.7898 0.0395  0.0417  0.0558  125 LEU D CG  
4388 C CD1 . LEU D 125 ? 0.7365 0.7124 0.7443 0.0332  0.0324  0.0493  125 LEU D CD1 
4389 C CD2 . LEU D 125 ? 0.8514 0.8127 0.8730 0.0441  0.0592  0.0607  125 LEU D CD2 
4390 N N   . ALA D 126 ? 0.8266 0.7678 0.8140 0.0400  0.0485  0.0402  126 ALA D N   
4391 C CA  . ALA D 126 ? 0.8510 0.7895 0.8527 0.0367  0.0498  0.0293  126 ALA D CA  
4392 C C   . ALA D 126 ? 0.9227 0.8456 0.9457 0.0430  0.0696  0.0343  126 ALA D C   
4393 O O   . ALA D 126 ? 0.9029 0.8248 0.9622 0.0425  0.0757  0.0240  126 ALA D O   
4394 C CB  . ALA D 126 ? 0.8127 0.7499 0.7842 0.0324  0.0383  0.0280  126 ALA D CB  
4395 N N   . GLN D 127 ? 0.9990 0.9076 0.9995 0.0510  0.0795  0.0500  127 GLN D N   
4396 C CA  . GLN D 127 ? 1.0580 0.9474 1.0735 0.0607  0.1025  0.0593  127 GLN D CA  
4397 C C   . GLN D 127 ? 1.0945 0.9724 1.1258 0.0581  0.1084  0.0526  127 GLN D C   
4398 O O   . GLN D 127 ? 1.2250 1.0846 1.2764 0.0659  0.1292  0.0590  127 GLN D O   
4399 C CB  . GLN D 127 ? 1.0508 0.9450 1.1073 0.0656  0.1172  0.0603  127 GLN D CB  
4400 N N   . PHE D 128 ? 1.0187 0.9059 1.0424 0.0476  0.0910  0.0399  128 PHE D N   
4401 C CA  . PHE D 128 ? 0.9858 0.8639 1.0275 0.0430  0.0933  0.0306  128 PHE D CA  
4402 C C   . PHE D 128 ? 0.9371 0.8110 0.9373 0.0380  0.0832  0.0337  128 PHE D C   
4403 O O   . PHE D 128 ? 0.9009 0.7904 0.8761 0.0318  0.0647  0.0296  128 PHE D O   
4404 C CB  . PHE D 128 ? 0.9342 0.8269 1.0079 0.0362  0.0814  0.0103  128 PHE D CB  
4405 C CG  . PHE D 128 ? 0.9816 0.8670 1.0691 0.0302  0.0773  -0.0026 128 PHE D CG  
4406 C CD1 . PHE D 128 ? 1.0891 0.9525 1.1959 0.0329  0.0941  0.0015  128 PHE D CD1 
4407 C CD2 . PHE D 128 ? 0.9948 0.8932 1.0761 0.0228  0.0577  -0.0188 128 PHE D CD2 
4408 C CE1 . PHE D 128 ? 1.1220 0.9769 1.2438 0.0264  0.0899  -0.0109 128 PHE D CE1 
4409 C CE2 . PHE D 128 ? 1.0323 0.9230 1.1255 0.0173  0.0529  -0.0318 128 PHE D CE2 
4410 C CZ  . PHE D 128 ? 1.1002 0.9693 1.2150 0.0181  0.0683  -0.0284 128 PHE D CZ  
4411 N N   . LYS D 129 ? 0.9503 0.8027 0.9463 0.0415  0.0968  0.0416  129 LYS D N   
4412 C CA  . LYS D 129 ? 0.9457 0.7901 0.8979 0.0416  0.0918  0.0507  129 LYS D CA  
4413 C C   . LYS D 129 ? 0.8665 0.7293 0.8007 0.0288  0.0690  0.0396  129 LYS D C   
4414 O O   . LYS D 129 ? 0.8609 0.7315 0.7594 0.0292  0.0561  0.0448  129 LYS D O   
4415 C CB  . LYS D 129 ? 0.9993 0.8161 0.9599 0.0457  0.1115  0.0577  129 LYS D CB  
4416 C CG  . LYS D 129 ? 1.1217 0.9161 1.0445 0.0600  0.1238  0.0776  129 LYS D CG  
4417 C CD  . LYS D 129 ? 1.2395 1.0068 1.1693 0.0616  0.1413  0.0830  129 LYS D CD  
4418 C CE  . LYS D 129 ? 1.4071 1.1451 1.3495 0.0798  0.1721  0.0991  129 LYS D CE  
4419 N NZ  . LYS D 129 ? 1.4747 1.1866 1.4487 0.0794  0.1930  0.1005  129 LYS D NZ  
4420 N N   . GLU D 130 ? 0.8032 0.6718 0.7644 0.0190  0.0641  0.0236  130 GLU D N   
4421 C CA  . GLU D 130 ? 0.7323 0.6163 0.6797 0.0078  0.0457  0.0127  130 GLU D CA  
4422 C C   . GLU D 130 ? 0.6550 0.5620 0.5894 0.0072  0.0300  0.0093  130 GLU D C   
4423 O O   . GLU D 130 ? 0.6266 0.5465 0.5379 0.0026  0.0166  0.0085  130 GLU D O   
4424 C CB  . GLU D 130 ? 0.7711 0.6529 0.7525 0.0005  0.0444  -0.0050 130 GLU D CB  
4425 C CG  . GLU D 130 ? 0.9132 0.7771 0.9370 0.0067  0.0621  -0.0063 130 GLU D CG  
4426 C CD  . GLU D 130 ? 1.0692 0.9082 1.1034 0.0058  0.0769  -0.0013 130 GLU D CD  
4427 O OE1 . GLU D 130 ? 1.1136 0.9517 1.1391 -0.0042 0.0687  -0.0082 130 GLU D OE1 
4428 O OE2 . GLU D 130 ? 1.1480 0.9678 1.2010 0.0156  0.0981  0.0097  130 GLU D OE2 
4429 N N   . MET D 131 ? 0.6140 0.5259 0.5670 0.0121  0.0327  0.0073  131 MET D N   
4430 C CA  . MET D 131 ? 0.5544 0.4847 0.4977 0.0123  0.0203  0.0055  131 MET D CA  
4431 C C   . MET D 131 ? 0.5482 0.4805 0.4614 0.0169  0.0162  0.0197  131 MET D C   
4432 O O   . MET D 131 ? 0.5165 0.4628 0.4155 0.0149  0.0030  0.0187  131 MET D O   
4433 C CB  . MET D 131 ? 0.5578 0.4915 0.5292 0.0165  0.0249  0.0008  131 MET D CB  
4434 C CG  . MET D 131 ? 0.5225 0.4729 0.4878 0.0162  0.0131  -0.0030 131 MET D CG  
4435 S SD  . MET D 131 ? 0.4911 0.4523 0.4481 0.0105  -0.0016 -0.0183 131 MET D SD  
4436 C CE  . MET D 131 ? 0.5774 0.5321 0.5710 0.0125  0.0007  -0.0366 131 MET D CE  
4437 N N   . LYS D 132 ? 0.6245 0.5601 0.6424 0.0658  0.0438  0.0562  132 LYS D N   
4438 C CA  . LYS D 132 ? 0.6158 0.5680 0.6197 0.0805  0.0508  0.0529  132 LYS D CA  
4439 C C   . LYS D 132 ? 0.5695 0.5326 0.5765 0.0827  0.0399  0.0466  132 LYS D C   
4440 O O   . LYS D 132 ? 0.5652 0.5359 0.5587 0.0856  0.0358  0.0393  132 LYS D O   
4441 C CB  . LYS D 132 ? 0.6889 0.6507 0.6965 0.0987  0.0689  0.0600  132 LYS D CB  
4442 C CG  . LYS D 132 ? 0.8172 0.7700 0.8283 0.0981  0.0822  0.0675  132 LYS D CG  
4443 C CD  . LYS D 132 ? 0.9741 0.9358 0.9895 0.1183  0.1009  0.0749  132 LYS D CD  
4444 C CE  . LYS D 132 ? 1.0513 1.0051 1.0737 0.1191  0.1167  0.0829  132 LYS D CE  
4445 N NZ  . LYS D 132 ? 1.1643 1.1256 1.1845 0.1409  0.1371  0.0900  132 LYS D NZ  
4446 N N   . ALA D 133 ? 0.5414 0.5051 0.5691 0.0816  0.0360  0.0495  133 ALA D N   
4447 C CA  . ALA D 133 ? 0.4926 0.4655 0.5261 0.0824  0.0263  0.0442  133 ALA D CA  
4448 C C   . ALA D 133 ? 0.4378 0.4050 0.4615 0.0684  0.0109  0.0360  133 ALA D C   
4449 O O   . ALA D 133 ? 0.4230 0.4000 0.4388 0.0717  0.0063  0.0285  133 ALA D O   
4450 C CB  . ALA D 133 ? 0.5028 0.4727 0.5640 0.0795  0.0244  0.0500  133 ALA D CB  
4451 N N   . ALA D 134 ? 0.3968 0.3457 0.4203 0.0532  0.0033  0.0375  134 ALA D N   
4452 C CA  . ALA D 134 ? 0.3740 0.3112 0.3852 0.0399  -0.0099 0.0309  134 ALA D CA  
4453 C C   . ALA D 134 ? 0.3541 0.2946 0.3443 0.0435  -0.0055 0.0242  134 ALA D C   
4454 O O   . ALA D 134 ? 0.3257 0.2689 0.3116 0.0411  -0.0126 0.0168  134 ALA D O   
4455 C CB  . ALA D 134 ? 0.3599 0.2714 0.3669 0.0248  -0.0170 0.0342  134 ALA D CB  
4456 N N   . LEU D 135 ? 0.3623 0.3012 0.3422 0.0487  0.0066  0.0271  135 LEU D N   
4457 C CA  . LEU D 135 ? 0.3596 0.3007 0.3239 0.0526  0.0122  0.0221  135 LEU D CA  
4458 C C   . LEU D 135 ? 0.3682 0.3326 0.3371 0.0665  0.0121  0.0162  135 LEU D C   
4459 O O   . LEU D 135 ? 0.3592 0.3262 0.3243 0.0656  0.0078  0.0083  135 LEU D O   
4460 C CB  . LEU D 135 ? 0.3670 0.3034 0.3230 0.0564  0.0261  0.0277  135 LEU D CB  
4461 C CG  . LEU D 135 ? 0.3809 0.2916 0.3280 0.0425  0.0274  0.0322  135 LEU D CG  
4462 C CD1 . LEU D 135 ? 0.3731 0.2842 0.3177 0.0488  0.0431  0.0389  135 LEU D CD1 
4463 C CD2 . LEU D 135 ? 0.3258 0.2137 0.2541 0.0294  0.0225  0.0270  135 LEU D CD2 
4464 N N   . GLN D 136 ? 0.4046 0.3838 0.3817 0.0799  0.0172  0.0198  136 GLN D N   
4465 C CA  . GLN D 136 ? 0.4400 0.4383 0.4175 0.0942  0.0160  0.0140  136 GLN D CA  
4466 C C   . GLN D 136 ? 0.4214 0.4243 0.4064 0.0886  0.0036  0.0061  136 GLN D C   
4467 O O   . GLN D 136 ? 0.4207 0.4334 0.4041 0.0931  -0.0009 -0.0027 136 GLN D O   
4468 C CB  . GLN D 136 ? 0.5023 0.5088 0.4838 0.1085  0.0242  0.0202  136 GLN D CB  
4469 C CG  . GLN D 136 ? 0.6545 0.6576 0.6297 0.1164  0.0383  0.0284  136 GLN D CG  
4470 C CD  . GLN D 136 ? 0.8006 0.8110 0.7747 0.1352  0.0489  0.0337  136 GLN D CD  
4471 O OE1 . GLN D 136 ? 0.8583 0.8714 0.8409 0.1389  0.0475  0.0342  136 GLN D OE1 
4472 N NE2 . GLN D 136 ? 0.8421 0.8536 0.8046 0.1476  0.0608  0.0383  136 GLN D NE2 
4473 N N   . GLU D 137 ? 0.4095 0.4049 0.4052 0.0784  -0.0020 0.0093  137 GLU D N   
4474 C CA  . GLU D 137 ? 0.4056 0.4045 0.4099 0.0723  -0.0129 0.0031  137 GLU D CA  
4475 C C   . GLU D 137 ? 0.3924 0.3825 0.3891 0.0620  -0.0193 -0.0042 137 GLU D C   
4476 O O   . GLU D 137 ? 0.3829 0.3820 0.3843 0.0631  -0.0248 -0.0125 137 GLU D O   
4477 C CB  . GLU D 137 ? 0.4084 0.3996 0.4279 0.0634  -0.0180 0.0094  137 GLU D CB  
4478 C CG  . GLU D 137 ? 0.4717 0.4734 0.5044 0.0747  -0.0115 0.0147  137 GLU D CG  
4479 C CD  . GLU D 137 ? 0.5539 0.5450 0.6052 0.0675  -0.0118 0.0241  137 GLU D CD  
4480 O OE1 . GLU D 137 ? 0.5874 0.5654 0.6438 0.0524  -0.0229 0.0247  137 GLU D OE1 
4481 O OE2 . GLU D 137 ? 0.6243 0.6186 0.6857 0.0776  -0.0009 0.0311  137 GLU D OE2 
4482 N N   . GLY D 138 ? 0.3908 0.3614 0.3758 0.0523  -0.0172 -0.0013 138 GLY D N   
4483 C CA  . GLY D 138 ? 0.4054 0.3624 0.3801 0.0437  -0.0194 -0.0074 138 GLY D CA  
4484 C C   . GLY D 138 ? 0.4317 0.4006 0.4059 0.0531  -0.0141 -0.0148 138 GLY D C   
4485 O O   . GLY D 138 ? 0.4144 0.3828 0.3917 0.0508  -0.0172 -0.0228 138 GLY D O   
4486 N N   . HIS D 139 ? 0.4650 0.4435 0.4370 0.0641  -0.0061 -0.0120 139 HIS D N   
4487 C CA  . HIS D 139 ? 0.5091 0.5002 0.4840 0.0743  -0.0036 -0.0188 139 HIS D CA  
4488 C C   . HIS D 139 ? 0.5214 0.5318 0.5090 0.0816  -0.0125 -0.0279 139 HIS D C   
4489 O O   . HIS D 139 ? 0.5186 0.5326 0.5143 0.0816  -0.0158 -0.0371 139 HIS D O   
4490 C CB  . HIS D 139 ? 0.5596 0.5594 0.5296 0.0870  0.0046  -0.0132 139 HIS D CB  
4491 C CG  . HIS D 139 ? 0.6002 0.6090 0.5728 0.0965  0.0067  -0.0188 139 HIS D CG  
4492 N ND1 . HIS D 139 ? 0.6392 0.6682 0.6178 0.1115  0.0007  -0.0254 139 HIS D ND1 
4493 C CD2 . HIS D 139 ? 0.6136 0.6125 0.5851 0.0932  0.0137  -0.0188 139 HIS D CD2 
4494 C CE1 . HIS D 139 ? 0.6697 0.7023 0.6530 0.1170  0.0019  -0.0295 139 HIS D CE1 
4495 N NE2 . HIS D 139 ? 0.6612 0.6762 0.6419 0.1060  0.0108  -0.0252 139 HIS D NE2 
4496 N N   . GLN D 140 ? 0.5396 0.5607 0.5304 0.0875  -0.0154 -0.0253 140 GLN D N   
4497 C CA  . GLN D 140 ? 0.5620 0.6004 0.5622 0.0956  -0.0227 -0.0332 140 GLN D CA  
4498 C C   . GLN D 140 ? 0.5294 0.5651 0.5400 0.0848  -0.0298 -0.0402 140 GLN D C   
4499 O O   . GLN D 140 ? 0.5425 0.5902 0.5627 0.0895  -0.0349 -0.0503 140 GLN D O   
4500 C CB  . GLN D 140 ? 0.5828 0.6270 0.5835 0.1023  -0.0213 -0.0271 140 GLN D CB  
4501 C CG  . GLN D 140 ? 0.7008 0.7616 0.7021 0.1174  -0.0247 -0.0339 140 GLN D CG  
4502 C CD  . GLN D 140 ? 0.8256 0.8892 0.8342 0.1174  -0.0257 -0.0315 140 GLN D CD  
4503 O OE1 . GLN D 140 ? 0.8437 0.8981 0.8583 0.1085  -0.0229 -0.0228 140 GLN D OE1 
4504 N NE2 . GLN D 140 ? 0.9215 0.9970 0.9311 0.1272  -0.0301 -0.0394 140 GLN D NE2 
4505 N N   . PHE D 141 ? 0.5038 0.5225 0.5122 0.0706  -0.0306 -0.0348 141 PHE D N   
4506 C CA  . PHE D 141 ? 0.4879 0.5001 0.5029 0.0602  -0.0366 -0.0399 141 PHE D CA  
4507 C C   . PHE D 141 ? 0.4926 0.5005 0.5089 0.0592  -0.0341 -0.0484 141 PHE D C   
4508 O O   . PHE D 141 ? 0.4867 0.5041 0.5163 0.0608  -0.0378 -0.0577 141 PHE D O   
4509 C CB  . PHE D 141 ? 0.4720 0.4621 0.4794 0.0460  -0.0388 -0.0317 141 PHE D CB  
4510 C CG  . PHE D 141 ? 0.4641 0.4416 0.4723 0.0353  -0.0443 -0.0357 141 PHE D CG  
4511 C CD1 . PHE D 141 ? 0.4465 0.3995 0.4399 0.0269  -0.0412 -0.0362 141 PHE D CD1 
4512 C CD2 . PHE D 141 ? 0.4874 0.4755 0.5099 0.0341  -0.0512 -0.0386 141 PHE D CD2 
4513 C CE1 . PHE D 141 ? 0.4804 0.4186 0.4711 0.0185  -0.0446 -0.0394 141 PHE D CE1 
4514 C CE2 . PHE D 141 ? 0.5203 0.4961 0.5428 0.0250  -0.0554 -0.0418 141 PHE D CE2 
4515 C CZ  . PHE D 141 ? 0.5001 0.4502 0.5057 0.0176  -0.0521 -0.0422 141 PHE D CZ  
4516 N N   . LEU D 142 ? 0.4990 0.4918 0.5038 0.0568  -0.0267 -0.0449 142 LEU D N   
4517 C CA  . LEU D 142 ? 0.5070 0.4925 0.5152 0.0564  -0.0212 -0.0513 142 LEU D CA  
4518 C C   . LEU D 142 ? 0.5354 0.5443 0.5621 0.0692  -0.0236 -0.0613 142 LEU D C   
4519 O O   . LEU D 142 ? 0.5347 0.5440 0.5759 0.0687  -0.0235 -0.0700 142 LEU D O   
4520 C CB  . LEU D 142 ? 0.5051 0.4725 0.4986 0.0535  -0.0113 -0.0445 142 LEU D CB  
4521 C CG  . LEU D 142 ? 0.4757 0.4123 0.4481 0.0397  -0.0081 -0.0365 142 LEU D CG  
4522 C CD1 . LEU D 142 ? 0.4210 0.3447 0.3803 0.0394  0.0023  -0.0297 142 LEU D CD1 
4523 C CD2 . LEU D 142 ? 0.4324 0.3467 0.4005 0.0304  -0.0068 -0.0408 142 LEU D CD2 
4524 N N   . CYS D 143 ? 0.5746 0.6010 0.6005 0.0814  -0.0258 -0.0600 143 CYS D N   
4525 C CA  . CYS D 143 ? 0.6482 0.6946 0.6887 0.0946  -0.0309 -0.0698 143 CYS D CA  
4526 C C   . CYS D 143 ? 0.6749 0.7351 0.7310 0.0964  -0.0398 -0.0802 143 CYS D C   
4527 O O   . CYS D 143 ? 0.7206 0.7899 0.7955 0.1010  -0.0438 -0.0912 143 CYS D O   
4528 C CB  . CYS D 143 ? 0.6588 0.7175 0.6893 0.1086  -0.0319 -0.0659 143 CYS D CB  
4529 S SG  . CYS D 143 ? 0.7174 0.7645 0.7372 0.1093  -0.0212 -0.0571 143 CYS D SG  
4530 N N   . SER D 144 ? 0.6976 0.7591 0.7485 0.0926  -0.0427 -0.0764 144 SER D N   
4531 C CA  . SER D 144 ? 0.7148 0.7885 0.7792 0.0931  -0.0497 -0.0845 144 SER D CA  
4532 C C   . SER D 144 ? 0.7158 0.7807 0.7938 0.0825  -0.0485 -0.0903 144 SER D C   
4533 O O   . SER D 144 ? 0.7416 0.8184 0.8383 0.0859  -0.0528 -0.1014 144 SER D O   
4534 C CB  . SER D 144 ? 0.7085 0.7832 0.7653 0.0910  -0.0509 -0.0767 144 SER D CB  
4535 O OG  . SER D 144 ? 0.7297 0.8075 0.7991 0.0844  -0.0548 -0.0811 144 SER D OG  
4536 N N   . ILE D 145 ? 0.7238 0.7659 0.7918 0.0703  -0.0424 -0.0834 145 ILE D N   
4537 C CA  . ILE D 145 ? 0.7435 0.7740 0.8215 0.0621  -0.0395 -0.0890 145 ILE D CA  
4538 C C   . ILE D 145 ? 0.7750 0.8007 0.8662 0.0650  -0.0328 -0.0961 145 ILE D C   
4539 O O   . ILE D 145 ? 0.8139 0.8331 0.9195 0.0615  -0.0291 -0.1028 145 ILE D O   
4540 C CB  . ILE D 145 ? 0.7237 0.7286 0.7847 0.0483  -0.0370 -0.0803 145 ILE D CB  
4541 C CG1 . ILE D 145 ? 0.7108 0.6918 0.7495 0.0432  -0.0301 -0.0712 145 ILE D CG1 
4542 C CG2 . ILE D 145 ? 0.6984 0.7110 0.7577 0.0455  -0.0450 -0.0753 145 ILE D CG2 
4543 C CD1 . ILE D 145 ? 0.7374 0.6919 0.7708 0.0367  -0.0205 -0.0728 145 ILE D CD1 
4544 N N   . GLU D 146 ? 0.8092 0.8378 0.8978 0.0720  -0.0306 -0.0944 146 GLU D N   
4545 C CA  . GLU D 146 ? 0.8606 0.8881 0.9680 0.0764  -0.0254 -0.1012 146 GLU D CA  
4546 C C   . GLU D 146 ? 0.9116 0.9652 1.0479 0.0875  -0.0353 -0.1151 146 GLU D C   
4547 O O   . GLU D 146 ? 0.9369 0.9903 1.0994 0.0889  -0.0326 -0.1240 146 GLU D O   
4548 C CB  . GLU D 146 ? 0.8662 0.8893 0.9625 0.0805  -0.0207 -0.0942 146 GLU D CB  
4549 N N   . ALA D 147 ? 0.9453 1.0194 1.0768 0.0958  -0.0465 -0.1168 147 ALA D N   
4550 C CA  . ALA D 147 ? 0.9903 1.0867 1.1438 0.1053  -0.0576 -0.1303 147 ALA D CA  
4551 C C   . ALA D 147 ? 1.0160 1.1127 1.1791 0.0974  -0.0573 -0.1345 147 ALA D C   
4552 O O   . ALA D 147 ? 1.0508 1.1343 1.2262 0.0890  -0.0492 -0.1364 147 ALA D O   
4553 C CB  . ALA D 147 ? 0.9979 1.1105 1.1363 0.1175  -0.0677 -0.1297 147 ALA D CB  
4645 O O   . HOH W .   ? 0.6856 0.6737 0.7726 -0.0769 -0.0297 0.0520  160 HOH A O   
4646 O O   . HOH W .   ? 0.6812 0.5383 0.7500 0.0539  0.1453  -0.0151 161 HOH A O   
4647 O O   . HOH W .   ? 0.3991 0.3756 0.4402 0.0060  0.0424  -0.0241 162 HOH A O   
4648 O O   . HOH W .   ? 0.5332 0.4287 0.4273 0.2215  0.0779  0.1567  163 HOH A O   
4649 O O   . HOH W .   ? 0.6209 0.5274 0.4708 0.2425  0.0810  0.1269  164 HOH A O   
4650 O O   . HOH W .   ? 0.5678 0.5836 0.6472 -0.0420 -0.0183 0.0424  165 HOH A O   
4651 O O   . HOH W .   ? 0.6391 0.5387 0.5208 0.0307  -0.0060 0.0350  166 HOH A O   
4652 O O   . HOH W .   ? 0.4706 0.4904 0.5040 0.0299  0.0605  -0.0157 167 HOH A O   
4653 O O   . HOH W .   ? 0.3155 0.2417 0.2257 0.0041  -0.0113 0.0211  168 HOH A O   
4654 O O   . HOH W .   ? 0.7386 0.6018 0.6110 0.0364  0.0142  0.0299  169 HOH A O   
4655 O O   . HOH W .   ? 0.4247 0.4306 0.2833 0.1928  0.0281  0.0700  170 HOH A O   
4656 O O   . HOH W .   ? 0.3777 0.4353 0.3972 0.0972  0.0045  -0.0062 171 HOH A O   
4657 O O   . HOH W .   ? 0.4139 0.4427 0.3949 0.1245  0.0133  0.0390  172 HOH A O   
4658 O O   . HOH W .   ? 0.6625 0.5601 0.3212 -0.0584 0.0503  -0.0416 173 HOH A O   
4659 O O   . HOH W .   ? 0.5036 0.5224 0.4256 0.1363  0.0147  0.0597  174 HOH A O   
4660 O O   . HOH W .   ? 0.6732 0.6581 0.5310 0.1200  0.0478  0.0603  175 HOH A O   
4661 O O   . HOH W .   ? 0.4515 0.3952 0.4624 0.0632  0.0582  0.0677  176 HOH A O   
4662 O O   . HOH W .   ? 0.4466 0.4128 0.4161 0.0099  0.0071  0.0199  177 HOH A O   
4663 O O   . HOH W .   ? 0.6140 0.5216 0.5230 -0.0074 -0.0025 0.0150  178 HOH A O   
4664 O O   . HOH W .   ? 0.6571 0.6208 0.5938 0.0556  0.0929  -0.0125 179 HOH A O   
4665 O O   . HOH W .   ? 0.6950 0.7446 0.6455 0.0652  0.0374  -0.0257 180 HOH A O   
4666 O O   . HOH W .   ? 0.5252 0.5217 0.3750 0.2063  0.0340  0.0698  181 HOH A O   
4667 O O   . HOH W .   ? 0.7957 0.7168 0.6153 0.2577  0.0711  0.0976  182 HOH A O   
4668 O O   . HOH W .   ? 0.6832 0.5616 0.5524 -0.1099 -0.0039 -0.0497 183 HOH A O   
4669 O O   . HOH W .   ? 0.6473 0.5649 0.5998 -0.0163 0.0097  0.0122  184 HOH A O   
4670 O O   . HOH W .   ? 0.8581 0.7406 0.9351 0.0533  0.1170  -0.0113 185 HOH A O   
4671 O O   . HOH W .   ? 0.8978 0.7349 0.7631 -0.0289 -0.0654 -0.0104 186 HOH A O   
4672 O O   . HOH W .   ? 0.3631 0.3578 0.3035 0.0046  0.0350  0.0193  187 HOH A O   
4673 O O   . HOH W .   ? 0.6274 0.6107 0.5289 0.0852  0.0569  0.0215  188 HOH A O   
4674 O O   . HOH W .   ? 0.7275 0.6689 0.6670 -0.0011 0.0460  0.0134  189 HOH A O   
4675 O O   . HOH W .   ? 0.5589 0.5319 0.5520 -0.0097 0.0207  0.0320  190 HOH A O   
4676 O O   . HOH W .   ? 0.8163 0.7120 0.9710 -0.1097 -0.2172 0.0724  191 HOH A O   
4677 O O   . HOH W .   ? 0.3956 0.5168 0.5058 0.0621  0.0909  0.0201  192 HOH A O   
4678 O O   . HOH W .   ? 0.4006 0.4107 0.3852 -0.0043 0.0212  0.0449  193 HOH A O   
4679 O O   . HOH W .   ? 0.5568 0.7064 0.6146 0.0560  0.0117  -0.0982 194 HOH A O   
4681 O O   . HOH W .   ? 0.5026 0.5625 0.4965 0.0522  0.0403  -0.0440 196 HOH A O   
4682 O O   . HOH W .   ? 0.6465 0.5244 0.7179 0.0419  0.1269  -0.0250 197 HOH A O   
4683 O O   . HOH W .   ? 0.7044 0.5350 0.7467 0.0613  0.1758  -0.0062 198 HOH A O   
4684 O O   . HOH X .   ? 0.4283 0.3777 0.3932 0.0216  0.0685  0.0101  160 HOH B O   
4685 O O   . HOH X .   ? 0.3218 0.3737 0.3088 -0.0218 0.0041  -0.0385 161 HOH B O   
4686 O O   . HOH X .   ? 0.5416 0.6393 0.6139 -0.0301 0.0460  0.0132  162 HOH B O   
4687 O O   . HOH X .   ? 0.6364 0.5833 0.5007 0.1705  0.0232  0.0938  163 HOH B O   
4688 O O   . HOH X .   ? 0.5139 0.4905 0.5413 0.0487  0.0946  0.0375  164 HOH B O   
4689 O O   . HOH X .   ? 0.4538 0.4833 0.4363 -0.0026 0.0149  -0.0142 165 HOH B O   
4690 O O   . HOH X .   ? 0.6008 0.5593 0.6713 0.0082  0.0515  0.0144  166 HOH B O   
4691 O O   . HOH X .   ? 0.5064 0.4716 0.5872 -0.0030 0.0490  0.0117  167 HOH B O   
4692 O O   . HOH X .   ? 0.5617 0.6571 0.6109 -0.0032 0.0468  0.0331  168 HOH B O   
4693 O O   . HOH X .   ? 0.2732 0.3187 0.2591 0.0034  0.0113  0.0130  169 HOH B O   
4694 O O   . HOH X .   ? 0.5185 0.4148 0.3854 0.1108  0.0463  0.0596  170 HOH B O   
4695 O O   . HOH X .   ? 0.5692 0.4672 0.4071 0.1275  0.0463  0.0849  171 HOH B O   
4696 O O   . HOH X .   ? 0.5389 0.6134 0.5404 -0.0338 -0.0031 0.0304  172 HOH B O   
4697 O O   . HOH X .   ? 0.3324 0.3123 0.3285 0.0777  -0.0104 0.0741  173 HOH B O   
4698 O O   . HOH X .   ? 0.4354 0.5933 0.4906 0.1686  0.0597  0.0698  174 HOH B O   
4699 O O   . HOH X .   ? 0.3172 0.2989 0.3156 0.0164  0.0258  0.0112  175 HOH B O   
4700 O O   . HOH X .   ? 0.5120 0.4951 0.4693 0.0825  0.0092  0.0638  176 HOH B O   
4701 O O   . HOH X .   ? 0.5165 0.6002 0.4977 -0.0171 -0.0009 -0.0323 177 HOH B O   
4702 O O   . HOH X .   ? 0.6029 0.6708 0.6123 -0.0381 -0.0047 0.0296  178 HOH B O   
4703 O O   . HOH X .   ? 0.5279 0.5800 0.4099 0.0427  0.0028  0.2237  179 HOH B O   
4704 O O   . HOH X .   ? 0.7693 0.8559 0.6487 0.0332  0.0184  0.2079  180 HOH B O   
4705 O O   . HOH X .   ? 1.6427 1.1766 1.4119 -0.7994 -0.3072 0.3479  181 HOH B O   
4706 O O   . HOH X .   ? 0.4689 0.5717 0.4258 0.0113  0.0270  0.0326  182 HOH B O   
4707 O O   . HOH X .   ? 0.5742 0.6325 0.6486 -0.0167 0.0593  0.0271  183 HOH B O   
4708 O O   . HOH X .   ? 0.6006 0.6811 0.5754 -0.0113 0.0113  0.0202  184 HOH B O   
4709 O O   . HOH X .   ? 0.6007 0.6632 0.6938 -0.0382 0.0576  0.0104  185 HOH B O   
4710 O O   . HOH X .   ? 0.7263 0.6976 0.6740 0.0402  -0.0354 0.1041  186 HOH B O   
4711 O O   . HOH X .   ? 0.6404 0.7574 0.6711 -0.0436 0.0184  -0.0309 187 HOH B O   
4712 O O   . HOH X .   ? 0.5575 0.5840 0.5292 0.0846  0.0594  0.0585  188 HOH B O   
4713 O O   . HOH X .   ? 0.8153 0.8351 0.8270 0.0341  0.0461  0.0238  189 HOH B O   
4714 O O   . HOH X .   ? 0.4746 0.5206 0.4916 0.1257  0.0631  0.0570  190 HOH B O   
4715 O O   . HOH X .   ? 0.5057 0.4857 0.4264 0.1159  0.0069  0.0290  191 HOH B O   
4716 O O   . HOH X .   ? 0.6437 0.6978 0.6201 0.0000  0.0181  0.0210  192 HOH B O   
4717 O O   . HOH X .   ? 0.6271 0.6696 0.6337 0.0549  0.0426  0.0455  193 HOH B O   
4718 O O   . HOH X .   ? 0.5767 0.5347 0.4916 0.0352  0.0826  0.0459  194 HOH B O   
4719 O O   . HOH X .   ? 0.6536 0.6916 0.6042 0.0731  0.0717  0.0661  195 HOH B O   
4720 O O   . HOH X .   ? 0.6995 0.7270 0.5873 0.0333  -0.0211 0.1401  196 HOH B O   
4721 O O   . HOH X .   ? 0.6096 0.6411 0.5132 0.0506  -0.0115 0.1658  197 HOH B O   
4722 O O   . HOH X .   ? 0.6539 0.6527 0.5695 -0.0588 0.0138  0.0260  198 HOH B O   
4723 O O   . HOH X .   ? 0.5800 0.6590 0.5473 -0.0303 -0.0095 0.0004  199 HOH B O   
4724 O O   . HOH X .   ? 0.5630 0.6383 0.5320 -0.0173 -0.0040 -0.0085 200 HOH B O   
4725 O O   . HOH X .   ? 0.5697 0.5130 0.4893 0.0447  -0.1199 0.0691  201 HOH B O   
4726 O O   . HOH X .   ? 0.7043 0.6516 0.6539 -0.0770 0.0068  -0.0202 202 HOH B O   
4727 O O   . HOH Y .   ? 0.3686 0.4587 0.3482 -0.0165 0.0050  -0.0238 161 HOH C O   
4728 O O   . HOH Y .   ? 0.6576 0.5680 0.7450 -0.0703 -0.0566 -0.0083 162 HOH C O   
4729 O O   . HOH Y .   ? 0.4727 0.5744 0.7143 -0.1029 -0.1004 0.0598  163 HOH C O   
4731 O O   . HOH Y .   ? 0.6025 0.6646 0.5997 0.0545  0.0338  -0.0432 165 HOH C O   
4732 O O   . HOH Y .   ? 0.2945 0.3247 0.2699 -0.0154 0.0086  -0.0150 166 HOH C O   
4733 O O   . HOH Y .   ? 0.5822 0.5045 0.7805 -0.0639 -0.0573 -0.0386 167 HOH C O   
4734 O O   . HOH Y .   ? 0.6394 0.6712 0.6346 -0.0019 0.0207  -0.0391 168 HOH C O   
4735 O O   . HOH Y .   ? 0.2548 0.1912 0.2343 -0.0354 -0.0363 0.0116  169 HOH C O   
4736 O O   . HOH Y .   ? 0.5543 0.4663 0.5847 -0.0501 0.0045  -0.0095 170 HOH C O   
4737 O O   . HOH Y .   ? 0.5801 0.6424 0.5273 -0.0237 0.0182  0.0292  171 HOH C O   
4738 O O   . HOH Y .   ? 0.6299 0.6050 0.6230 -0.0177 -0.0074 0.0476  172 HOH C O   
4739 O O   . HOH Y .   ? 0.5487 0.4424 0.6063 -0.0535 0.0092  -0.0123 173 HOH C O   
4740 O O   . HOH Y .   ? 0.2438 0.2686 0.2244 0.0020  0.0170  -0.0037 174 HOH C O   
4741 O O   . HOH Y .   ? 0.4108 0.4495 0.3343 -0.0655 -0.0127 0.0085  175 HOH C O   
4742 O O   . HOH Y .   ? 0.5155 0.4394 0.5524 -0.0509 -0.0689 0.0084  176 HOH C O   
4743 O O   . HOH Y .   ? 0.8848 0.8226 0.7153 -0.0935 -0.0776 -0.0205 177 HOH C O   
4744 O O   . HOH Y .   ? 0.5018 0.4523 0.6120 -0.0323 0.0898  -0.0944 178 HOH C O   
4745 O O   . HOH Y .   ? 0.6227 0.9072 0.8267 -0.0839 -0.0050 -0.1389 179 HOH C O   
4746 O O   . HOH Y .   ? 0.7300 0.6334 0.7399 -0.0561 -0.0782 0.0108  180 HOH C O   
4747 O O   . HOH Y .   ? 0.5784 0.4970 0.4284 0.0959  0.0326  0.0017  181 HOH C O   
4748 O O   . HOH Y .   ? 0.6351 0.6187 0.7456 -0.0552 -0.0150 0.0515  182 HOH C O   
4749 O O   . HOH Y .   ? 0.6821 0.6157 0.5867 -0.0290 -0.0528 -0.0611 183 HOH C O   
4750 O O   . HOH Y .   ? 0.8965 0.8422 0.9254 -0.0326 -0.1072 -0.1235 184 HOH C O   
4751 O O   . HOH Y .   ? 0.6798 0.6524 0.5890 0.0039  -0.0474 0.0910  185 HOH C O   
4752 O O   . HOH Y .   ? 0.7901 0.6564 0.8345 -0.1808 -0.1123 0.0832  186 HOH C O   
4753 O O   . HOH Y .   ? 0.5483 0.4349 0.6267 -0.0590 -0.0015 -0.0143 187 HOH C O   
4755 O O   . HOH Y .   ? 0.6961 0.6881 0.5562 -0.0275 0.0246  -0.0864 189 HOH C O   
4756 O O   . HOH Y .   ? 0.7047 0.7384 0.9347 -0.1063 -0.0654 0.0324  190 HOH C O   
4757 O O   . HOH Y .   ? 0.7196 0.7758 0.7069 -0.0003 0.0147  -0.0381 191 HOH C O   
4758 O O   . HOH Z .   ? 0.3091 0.2663 0.3640 0.0124  -0.0349 0.0087  161 HOH D O   
4759 O O   . HOH Z .   ? 0.4305 0.4017 0.5723 0.0257  -0.1382 0.0454  162 HOH D O   
4760 O O   . HOH Z .   ? 0.8260 0.6710 0.6906 -0.0350 -0.0147 0.0043  163 HOH D O   
4761 O O   . HOH Z .   ? 0.4809 0.4080 0.4929 0.0546  -0.0340 -0.0140 164 HOH D O   
4762 O O   . HOH Z .   ? 0.6379 0.6003 0.7537 0.0118  -0.0575 0.1539  165 HOH D O   
4763 O O   . HOH Z .   ? 0.6839 0.5611 0.7039 0.0624  -0.0867 0.0044  166 HOH D O   
4764 O O   . HOH Z .   ? 0.8265 0.7459 0.8204 0.2273  -0.1056 -0.1906 167 HOH D O   
4765 O O   . HOH Z .   ? 0.4165 0.4698 0.3922 0.1324  -0.0081 -0.0254 168 HOH D O   
4766 O O   . HOH Z .   ? 0.5261 0.4501 0.5178 0.0786  0.0662  0.0650  169 HOH D O   
4767 O O   . HOH Z .   ? 0.5595 0.4850 0.4960 0.0222  0.0242  0.0381  170 HOH D O   
4768 O O   . HOH Z .   ? 0.4793 0.4218 0.4923 -0.0323 0.0947  0.0530  171 HOH D O   
4769 O O   . HOH Z .   ? 0.5150 0.4241 0.6263 0.0375  -0.1255 0.0458  172 HOH D O   
4770 O O   . HOH Z .   ? 0.4714 0.4835 0.5445 0.0286  0.0136  0.0234  173 HOH D O   
4771 O O   . HOH Z .   ? 0.4151 0.5120 0.5797 0.0794  -0.0576 -0.1329 174 HOH D O   
4772 O O   . HOH Z .   ? 0.8674 0.7609 0.8226 0.0407  -0.1357 -0.0037 175 HOH D O   
4773 O O   . HOH Z .   ? 0.2385 0.2268 0.2572 0.0489  0.0526  -0.0146 176 HOH D O   
4774 O O   . HOH Z .   ? 0.5985 0.4977 0.6405 0.0598  -0.0428 -0.0291 177 HOH D O   
4775 O O   . HOH Z .   ? 0.6040 0.4599 0.6532 0.0757  -0.0746 -0.0131 178 HOH D O   
4776 O O   . HOH Z .   ? 0.8825 0.7534 0.6219 0.0984  -0.0262 0.0883  179 HOH D O   
4777 O O   . HOH Z .   ? 0.7926 0.9030 0.7175 0.1256  -0.0598 0.0116  180 HOH D O   
4778 O O   . HOH Z .   ? 0.7435 0.8528 0.7529 0.0650  -0.0302 0.0445  181 HOH D O   
4779 O O   . HOH Z .   ? 0.5373 0.5132 0.5541 0.0207  -0.0065 0.0614  182 HOH D O   
4780 O O   . HOH Z .   ? 0.6870 0.6023 0.6274 -0.0166 -0.0966 0.0026  183 HOH D O   
4781 O O   . HOH Z .   ? 0.7439 0.7226 0.7332 0.0374  0.0951  -0.0398 184 HOH D O   
4782 O O   . HOH Z .   ? 0.7559 0.6312 0.6883 0.1527  0.0776  0.0715  185 HOH D O   
4783 O O   . HOH Z .   ? 0.5967 0.7661 0.6019 0.0969  0.0012  0.0543  186 HOH D O   
4784 O O   . HOH Z .   ? 0.4748 0.6055 0.5291 0.0275  0.0204  0.0691  187 HOH D O   
4785 O O   . HOH Z .   ? 0.6281 0.6818 0.8182 0.0729  -0.0323 -0.1381 188 HOH D O   
4786 O O   . HOH Z .   ? 0.5444 0.5369 0.6864 0.0534  -0.0116 -0.1175 189 HOH D O   
4787 O O   . HOH Z .   ? 0.7980 0.8467 0.8906 -0.0244 0.0499  0.1086  190 HOH D O   
4788 O O   . HOH Z .   ? 0.5640 0.4297 0.6164 0.0679  -0.0616 -0.0242 191 HOH D O   
4789 O O   . HOH Z .   ? 0.5646 0.5176 0.6516 0.0790  -0.0211 0.0166  192 HOH D O   
4790 O O   . HOH Z .   ? 0.5788 0.4897 0.6739 0.0974  -0.0323 -0.0191 193 HOH D O   
4792 O O   . HOH Z .   ? 1.2245 0.9014 1.1080 0.1242  0.2162  0.1417  195 HOH D O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   LEU 3   3   ?   ?   ?   A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   CYS 6   6   6   CYS CYS A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  PHE 11  11  11  PHE PHE A . n 
A 1 12  ARG 12  12  12  ARG ARG A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  CYS 14  14  14  CYS CYS A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  PRO 17  17  17  PRO PRO A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  ASP 20  20  20  ASP ASP A . n 
A 1 21  ASN 21  21  21  ASN ASN A . n 
A 1 22  ASN 22  22  22  ASN ASN A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  ILE 24  24  24  ILE ILE A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  HIS 36  36  36  HIS HIS A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  TRP 38  38  38  TRP TRP A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  HIS 44  44  44  HIS HIS A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  GLN 60  60  60  GLN GLN A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  THR 71  71  71  THR THR A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  TYR 82  82  82  TYR TYR A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  LYS 87  87  87  LYS ALA A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  TYR 93  93  93  TYR TYR A . n 
A 1 94  TRP 94  94  94  TRP TRP A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 TYR 101 101 101 TYR TYR A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 HIS 109 109 109 HIS HIS A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 HIS 111 111 111 HIS HIS A . n 
A 1 112 GLN 112 112 112 GLN GLN A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 TRP 116 116 116 TRP TRP A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 CYS 123 123 123 CYS CYS A . n 
A 1 124 GLN 124 124 124 GLN GLN A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 GLN 127 127 127 GLN GLN A . n 
A 1 128 PHE 128 128 128 PHE PHE A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 MET 131 131 131 MET MET A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 GLN 136 136 136 GLN GLN A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 HIS 139 139 139 HIS HIS A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 PHE 141 141 141 PHE PHE A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 CYS 143 143 143 CYS CYS A . n 
A 1 144 SER 144 144 144 SER SER A . n 
A 1 145 ILE 145 145 145 ILE ILE A . n 
A 1 146 GLU 146 146 146 GLU GLU A . n 
A 1 147 ALA 147 147 147 ALA ALA A . n 
A 1 148 LEU 148 148 ?   ?   ?   A . n 
A 1 149 GLU 149 149 ?   ?   ?   A . n 
A 1 150 HIS 150 150 ?   ?   ?   A . n 
A 1 151 HIS 151 151 ?   ?   ?   A . n 
A 1 152 HIS 152 152 ?   ?   ?   A . n 
A 1 153 HIS 153 153 ?   ?   ?   A . n 
A 1 154 HIS 154 154 ?   ?   ?   A . n 
A 1 155 HIS 155 155 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ALA 2   2   ?   ?   ?   B . n 
B 1 3   LEU 3   3   ?   ?   ?   B . n 
B 1 4   ARG 4   4   4   ARG ARG B . n 
B 1 5   ALA 5   5   5   ALA ALA B . n 
B 1 6   CYS 6   6   6   CYS CYS B . n 
B 1 7   GLY 7   7   7   GLY GLY B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   ILE 9   9   9   ILE ILE B . n 
B 1 10  ILE 10  10  10  ILE ILE B . n 
B 1 11  PHE 11  11  11  PHE PHE B . n 
B 1 12  ARG 12  12  12  ARG ARG B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  CYS 14  14  14  CYS CYS B . n 
B 1 15  LEU 15  15  15  LEU LEU B . n 
B 1 16  ILE 16  16  16  ILE ILE B . n 
B 1 17  PRO 17  17  17  PRO PRO B . n 
B 1 18  LYS 18  18  18  LYS LYS B . n 
B 1 19  VAL 19  19  19  VAL VAL B . n 
B 1 20  ASP 20  20  20  ASP ASP B . n 
B 1 21  ASN 21  21  21  ASN ASN B . n 
B 1 22  ASN 22  22  22  ASN ASN B . n 
B 1 23  ALA 23  23  23  ALA ALA B . n 
B 1 24  ILE 24  24  24  ILE ILE B . n 
B 1 25  GLU 25  25  25  GLU GLU B . n 
B 1 26  PHE 26  26  26  PHE PHE B . n 
B 1 27  LEU 27  27  27  LEU LEU B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  LEU 29  29  29  LEU LEU B . n 
B 1 30  GLN 30  30  30  GLN GLN B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  SER 32  32  32  SER SER B . n 
B 1 33  ASP 33  33  33  ASP ASP B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  HIS 36  36  36  HIS HIS B . n 
B 1 37  HIS 37  37  37  HIS HIS B . n 
B 1 38  TRP 38  38  38  TRP TRP B . n 
B 1 39  THR 39  39  39  THR THR B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  LYS 42  42  42  LYS LYS B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  HIS 44  44  44  HIS HIS B . n 
B 1 45  VAL 45  45  45  VAL VAL B . n 
B 1 46  GLU 46  46  46  GLU GLU B . n 
B 1 47  PRO 47  47  47  PRO PRO B . n 
B 1 48  GLY 48  48  48  GLY GLY B . n 
B 1 49  GLU 49  49  49  GLU GLU B . n 
B 1 50  ASP 50  50  50  ASP ASP B . n 
B 1 51  ASP 51  51  51  ASP ASP B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  GLU 53  53  53  GLU GLU B . n 
B 1 54  THR 54  54  54  THR THR B . n 
B 1 55  ALA 55  55  55  ALA ALA B . n 
B 1 56  LEU 56  56  56  LEU LEU B . n 
B 1 57  ARG 57  57  57  ARG ARG B . n 
B 1 58  GLU 58  58  58  GLU GLU B . n 
B 1 59  THR 59  59  59  THR THR B . n 
B 1 60  GLN 60  60  60  GLN GLN B . n 
B 1 61  GLU 61  61  61  GLU GLU B . n 
B 1 62  GLU 62  62  62  GLU GLU B . n 
B 1 63  ALA 63  63  63  ALA ALA B . n 
B 1 64  GLY 64  64  64  GLY GLY B . n 
B 1 65  ILE 65  65  65  ILE ILE B . n 
B 1 66  GLU 66  66  66  GLU GLU B . n 
B 1 67  ALA 67  67  67  ALA ALA B . n 
B 1 68  GLY 68  68  68  GLY GLY B . n 
B 1 69  GLN 69  69  69  GLN GLN B . n 
B 1 70  LEU 70  70  70  LEU LEU B . n 
B 1 71  THR 71  71  71  THR THR B . n 
B 1 72  ILE 72  72  72  ILE ILE B . n 
B 1 73  ILE 73  73  73  ILE ILE B . n 
B 1 74  GLU 74  74  74  GLU GLU B . n 
B 1 75  GLY 75  75  75  GLY GLY B . n 
B 1 76  PHE 76  76  76  PHE PHE B . n 
B 1 77  LYS 77  77  77  LYS LYS B . n 
B 1 78  ARG 78  78  78  ARG ARG B . n 
B 1 79  GLU 79  79  79  GLU GLU B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  ASN 81  81  81  ASN ASN B . n 
B 1 82  TYR 82  82  82  TYR TYR B . n 
B 1 83  VAL 83  83  83  VAL VAL B . n 
B 1 84  ALA 84  84  84  ALA ALA B . n 
B 1 85  ARG 85  85  85  ARG ARG B . n 
B 1 86  ASN 86  86  86  ASN ASN B . n 
B 1 87  LYS 87  87  87  LYS ALA B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  THR 90  90  90  THR THR B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  ILE 92  92  92  ILE ILE B . n 
B 1 93  TYR 93  93  93  TYR TYR B . n 
B 1 94  TRP 94  94  94  TRP TRP B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  ALA 96  96  96  ALA ALA B . n 
B 1 97  GLU 97  97  97  GLU GLU B . n 
B 1 98  VAL 98  98  98  VAL VAL B . n 
B 1 99  LYS 99  99  99  LYS LYS B . n 
B 1 100 ASP 100 100 100 ASP ASP B . n 
B 1 101 TYR 101 101 101 TYR TYR B . n 
B 1 102 ASP 102 102 102 ASP ASP B . n 
B 1 103 VAL 103 103 103 VAL VAL B . n 
B 1 104 GLU 104 104 104 GLU GLU B . n 
B 1 105 ILE 105 105 105 ILE ILE B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 HIS 109 109 109 HIS ALA B . n 
B 1 110 GLU 110 110 110 GLU GLU B . n 
B 1 111 HIS 111 111 111 HIS HIS B . n 
B 1 112 GLN 112 112 112 GLN GLN B . n 
B 1 113 ALA 113 113 113 ALA ALA B . n 
B 1 114 TYR 114 114 114 TYR TYR B . n 
B 1 115 ARG 115 115 115 ARG ARG B . n 
B 1 116 TRP 116 116 116 TRP TRP B . n 
B 1 117 LEU 117 117 117 LEU LEU B . n 
B 1 118 GLY 118 118 118 GLY GLY B . n 
B 1 119 LEU 119 119 119 LEU LEU B . n 
B 1 120 GLU 120 120 120 GLU GLU B . n 
B 1 121 GLU 121 121 121 GLU GLU B . n 
B 1 122 ALA 122 122 122 ALA ALA B . n 
B 1 123 CYS 123 123 123 CYS CYS B . n 
B 1 124 GLN 124 124 124 GLN GLN B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 ALA 126 126 126 ALA ALA B . n 
B 1 127 GLN 127 127 127 GLN GLN B . n 
B 1 128 PHE 128 128 128 PHE PHE B . n 
B 1 129 LYS 129 129 129 LYS LYS B . n 
B 1 130 GLU 130 130 130 GLU GLU B . n 
B 1 131 MET 131 131 131 MET MET B . n 
B 1 132 LYS 132 132 132 LYS LYS B . n 
B 1 133 ALA 133 133 133 ALA ALA B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 LEU 135 135 135 LEU LEU B . n 
B 1 136 GLN 136 136 136 GLN GLN B . n 
B 1 137 GLU 137 137 137 GLU GLU B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 HIS 139 139 139 HIS HIS B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 PHE 141 141 141 PHE PHE B . n 
B 1 142 LEU 142 142 142 LEU LEU B . n 
B 1 143 CYS 143 143 143 CYS CYS B . n 
B 1 144 SER 144 144 144 SER SER B . n 
B 1 145 ILE 145 145 145 ILE ILE B . n 
B 1 146 GLU 146 146 146 GLU GLU B . n 
B 1 147 ALA 147 147 147 ALA ALA B . n 
B 1 148 LEU 148 148 ?   ?   ?   B . n 
B 1 149 GLU 149 149 ?   ?   ?   B . n 
B 1 150 HIS 150 150 ?   ?   ?   B . n 
B 1 151 HIS 151 151 ?   ?   ?   B . n 
B 1 152 HIS 152 152 ?   ?   ?   B . n 
B 1 153 HIS 153 153 ?   ?   ?   B . n 
B 1 154 HIS 154 154 ?   ?   ?   B . n 
B 1 155 HIS 155 155 ?   ?   ?   B . n 
C 1 1   MET 1   1   ?   ?   ?   C . n 
C 1 2   ALA 2   2   ?   ?   ?   C . n 
C 1 3   LEU 3   3   ?   ?   ?   C . n 
C 1 4   ARG 4   4   4   ARG ARG C . n 
C 1 5   ALA 5   5   5   ALA ALA C . n 
C 1 6   CYS 6   6   6   CYS CYS C . n 
C 1 7   GLY 7   7   7   GLY GLY C . n 
C 1 8   LEU 8   8   8   LEU LEU C . n 
C 1 9   ILE 9   9   9   ILE ILE C . n 
C 1 10  ILE 10  10  10  ILE ILE C . n 
C 1 11  PHE 11  11  11  PHE PHE C . n 
C 1 12  ARG 12  12  12  ARG ARG C . n 
C 1 13  ARG 13  13  13  ARG ARG C . n 
C 1 14  CYS 14  14  14  CYS CYS C . n 
C 1 15  LEU 15  15  15  LEU LEU C . n 
C 1 16  ILE 16  16  16  ILE ILE C . n 
C 1 17  PRO 17  17  17  PRO PRO C . n 
C 1 18  LYS 18  18  18  LYS LYS C . n 
C 1 19  VAL 19  19  19  VAL VAL C . n 
C 1 20  ASP 20  20  20  ASP ASP C . n 
C 1 21  ASN 21  21  21  ASN ASN C . n 
C 1 22  ASN 22  22  22  ASN ASN C . n 
C 1 23  ALA 23  23  23  ALA ALA C . n 
C 1 24  ILE 24  24  24  ILE ILE C . n 
C 1 25  GLU 25  25  25  GLU GLU C . n 
C 1 26  PHE 26  26  26  PHE PHE C . n 
C 1 27  LEU 27  27  27  LEU LEU C . n 
C 1 28  LEU 28  28  28  LEU LEU C . n 
C 1 29  LEU 29  29  29  LEU LEU C . n 
C 1 30  GLN 30  30  30  GLN GLN C . n 
C 1 31  ALA 31  31  31  ALA ALA C . n 
C 1 32  SER 32  32  32  SER SER C . n 
C 1 33  ASP 33  33  33  ASP ASP C . n 
C 1 34  GLY 34  34  34  GLY GLY C . n 
C 1 35  ILE 35  35  35  ILE ILE C . n 
C 1 36  HIS 36  36  36  HIS HIS C . n 
C 1 37  HIS 37  37  37  HIS HIS C . n 
C 1 38  TRP 38  38  38  TRP TRP C . n 
C 1 39  THR 39  39  39  THR THR C . n 
C 1 40  PRO 40  40  40  PRO PRO C . n 
C 1 41  PRO 41  41  41  PRO PRO C . n 
C 1 42  LYS 42  42  42  LYS LYS C . n 
C 1 43  GLY 43  43  43  GLY GLY C . n 
C 1 44  HIS 44  44  44  HIS HIS C . n 
C 1 45  VAL 45  45  45  VAL VAL C . n 
C 1 46  GLU 46  46  46  GLU GLU C . n 
C 1 47  PRO 47  47  47  PRO PRO C . n 
C 1 48  GLY 48  48  48  GLY GLY C . n 
C 1 49  GLU 49  49  49  GLU GLU C . n 
C 1 50  ASP 50  50  50  ASP ASP C . n 
C 1 51  ASP 51  51  51  ASP ASP C . n 
C 1 52  LEU 52  52  52  LEU LEU C . n 
C 1 53  GLU 53  53  53  GLU GLU C . n 
C 1 54  THR 54  54  54  THR THR C . n 
C 1 55  ALA 55  55  55  ALA ALA C . n 
C 1 56  LEU 56  56  56  LEU LEU C . n 
C 1 57  ARG 57  57  57  ARG ARG C . n 
C 1 58  GLU 58  58  58  GLU GLU C . n 
C 1 59  THR 59  59  59  THR THR C . n 
C 1 60  GLN 60  60  60  GLN GLN C . n 
C 1 61  GLU 61  61  61  GLU GLU C . n 
C 1 62  GLU 62  62  62  GLU GLU C . n 
C 1 63  ALA 63  63  63  ALA ALA C . n 
C 1 64  GLY 64  64  64  GLY GLY C . n 
C 1 65  ILE 65  65  65  ILE ILE C . n 
C 1 66  GLU 66  66  66  GLU GLU C . n 
C 1 67  ALA 67  67  67  ALA ALA C . n 
C 1 68  GLY 68  68  68  GLY GLY C . n 
C 1 69  GLN 69  69  69  GLN GLN C . n 
C 1 70  LEU 70  70  70  LEU LEU C . n 
C 1 71  THR 71  71  71  THR THR C . n 
C 1 72  ILE 72  72  72  ILE ILE C . n 
C 1 73  ILE 73  73  73  ILE ILE C . n 
C 1 74  GLU 74  74  74  GLU GLU C . n 
C 1 75  GLY 75  75  75  GLY GLY C . n 
C 1 76  PHE 76  76  76  PHE PHE C . n 
C 1 77  LYS 77  77  77  LYS LYS C . n 
C 1 78  ARG 78  78  78  ARG ARG C . n 
C 1 79  GLU 79  79  79  GLU GLU C . n 
C 1 80  LEU 80  80  80  LEU LEU C . n 
C 1 81  ASN 81  81  81  ASN ASN C . n 
C 1 82  TYR 82  82  82  TYR TYR C . n 
C 1 83  VAL 83  83  83  VAL VAL C . n 
C 1 84  ALA 84  84  84  ALA ALA C . n 
C 1 85  ARG 85  85  85  ARG ARG C . n 
C 1 86  ASN 86  86  86  ASN ASN C . n 
C 1 87  LYS 87  87  87  LYS ALA C . n 
C 1 88  PRO 88  88  88  PRO PRO C . n 
C 1 89  LYS 89  89  89  LYS LYS C . n 
C 1 90  THR 90  90  90  THR THR C . n 
C 1 91  VAL 91  91  91  VAL VAL C . n 
C 1 92  ILE 92  92  92  ILE ILE C . n 
C 1 93  TYR 93  93  93  TYR TYR C . n 
C 1 94  TRP 94  94  94  TRP TRP C . n 
C 1 95  LEU 95  95  95  LEU LEU C . n 
C 1 96  ALA 96  96  96  ALA ALA C . n 
C 1 97  GLU 97  97  97  GLU GLU C . n 
C 1 98  VAL 98  98  98  VAL VAL C . n 
C 1 99  LYS 99  99  99  LYS LYS C . n 
C 1 100 ASP 100 100 100 ASP ASP C . n 
C 1 101 TYR 101 101 101 TYR TYR C . n 
C 1 102 ASP 102 102 102 ASP ASP C . n 
C 1 103 VAL 103 103 103 VAL VAL C . n 
C 1 104 GLU 104 104 104 GLU GLU C . n 
C 1 105 ILE 105 105 105 ILE ILE C . n 
C 1 106 ARG 106 106 106 ARG ARG C . n 
C 1 107 LEU 107 107 107 LEU LEU C . n 
C 1 108 SER 108 108 108 SER SER C . n 
C 1 109 HIS 109 109 109 HIS HIS C . n 
C 1 110 GLU 110 110 110 GLU GLU C . n 
C 1 111 HIS 111 111 111 HIS HIS C . n 
C 1 112 GLN 112 112 112 GLN GLN C . n 
C 1 113 ALA 113 113 113 ALA ALA C . n 
C 1 114 TYR 114 114 114 TYR TYR C . n 
C 1 115 ARG 115 115 115 ARG ARG C . n 
C 1 116 TRP 116 116 116 TRP TRP C . n 
C 1 117 LEU 117 117 117 LEU LEU C . n 
C 1 118 GLY 118 118 118 GLY GLY C . n 
C 1 119 LEU 119 119 119 LEU LEU C . n 
C 1 120 GLU 120 120 120 GLU GLU C . n 
C 1 121 GLU 121 121 121 GLU GLU C . n 
C 1 122 ALA 122 122 122 ALA ALA C . n 
C 1 123 CYS 123 123 123 CYS CYS C . n 
C 1 124 GLN 124 124 124 GLN GLN C . n 
C 1 125 LEU 125 125 125 LEU LEU C . n 
C 1 126 ALA 126 126 126 ALA ALA C . n 
C 1 127 GLN 127 127 127 GLN GLN C . n 
C 1 128 PHE 128 128 128 PHE PHE C . n 
C 1 129 LYS 129 129 129 LYS LYS C . n 
C 1 130 GLU 130 130 130 GLU GLU C . n 
C 1 131 MET 131 131 131 MET MET C . n 
C 1 132 LYS 132 132 132 LYS LYS C . n 
C 1 133 ALA 133 133 133 ALA ALA C . n 
C 1 134 ALA 134 134 134 ALA ALA C . n 
C 1 135 LEU 135 135 135 LEU LEU C . n 
C 1 136 GLN 136 136 136 GLN GLN C . n 
C 1 137 GLU 137 137 137 GLU GLU C . n 
C 1 138 GLY 138 138 138 GLY GLY C . n 
C 1 139 HIS 139 139 139 HIS HIS C . n 
C 1 140 GLN 140 140 140 GLN GLN C . n 
C 1 141 PHE 141 141 141 PHE PHE C . n 
C 1 142 LEU 142 142 142 LEU LEU C . n 
C 1 143 CYS 143 143 143 CYS CYS C . n 
C 1 144 SER 144 144 144 SER SER C . n 
C 1 145 ILE 145 145 145 ILE ILE C . n 
C 1 146 GLU 146 146 146 GLU GLU C . n 
C 1 147 ALA 147 147 147 ALA ALA C . n 
C 1 148 LEU 148 148 ?   ?   ?   C . n 
C 1 149 GLU 149 149 ?   ?   ?   C . n 
C 1 150 HIS 150 150 ?   ?   ?   C . n 
C 1 151 HIS 151 151 ?   ?   ?   C . n 
C 1 152 HIS 152 152 ?   ?   ?   C . n 
C 1 153 HIS 153 153 ?   ?   ?   C . n 
C 1 154 HIS 154 154 ?   ?   ?   C . n 
C 1 155 HIS 155 155 ?   ?   ?   C . n 
D 1 1   MET 1   1   ?   ?   ?   D . n 
D 1 2   ALA 2   2   ?   ?   ?   D . n 
D 1 3   LEU 3   3   ?   ?   ?   D . n 
D 1 4   ARG 4   4   4   ARG ARG D . n 
D 1 5   ALA 5   5   5   ALA ALA D . n 
D 1 6   CYS 6   6   6   CYS CYS D . n 
D 1 7   GLY 7   7   7   GLY GLY D . n 
D 1 8   LEU 8   8   8   LEU LEU D . n 
D 1 9   ILE 9   9   9   ILE ILE D . n 
D 1 10  ILE 10  10  10  ILE ILE D . n 
D 1 11  PHE 11  11  11  PHE PHE D . n 
D 1 12  ARG 12  12  12  ARG ARG D . n 
D 1 13  ARG 13  13  13  ARG ARG D . n 
D 1 14  CYS 14  14  14  CYS CYS D . n 
D 1 15  LEU 15  15  15  LEU LEU D . n 
D 1 16  ILE 16  16  16  ILE ILE D . n 
D 1 17  PRO 17  17  17  PRO PRO D . n 
D 1 18  LYS 18  18  18  LYS LYS D . n 
D 1 19  VAL 19  19  19  VAL VAL D . n 
D 1 20  ASP 20  20  20  ASP ASP D . n 
D 1 21  ASN 21  21  21  ASN ASN D . n 
D 1 22  ASN 22  22  22  ASN ASN D . n 
D 1 23  ALA 23  23  23  ALA ALA D . n 
D 1 24  ILE 24  24  24  ILE ILE D . n 
D 1 25  GLU 25  25  25  GLU GLU D . n 
D 1 26  PHE 26  26  26  PHE PHE D . n 
D 1 27  LEU 27  27  27  LEU LEU D . n 
D 1 28  LEU 28  28  28  LEU LEU D . n 
D 1 29  LEU 29  29  29  LEU LEU D . n 
D 1 30  GLN 30  30  30  GLN GLN D . n 
D 1 31  ALA 31  31  31  ALA ALA D . n 
D 1 32  SER 32  32  32  SER SER D . n 
D 1 33  ASP 33  33  33  ASP ASP D . n 
D 1 34  GLY 34  34  34  GLY GLY D . n 
D 1 35  ILE 35  35  35  ILE ILE D . n 
D 1 36  HIS 36  36  36  HIS HIS D . n 
D 1 37  HIS 37  37  37  HIS HIS D . n 
D 1 38  TRP 38  38  38  TRP TRP D . n 
D 1 39  THR 39  39  39  THR THR D . n 
D 1 40  PRO 40  40  40  PRO PRO D . n 
D 1 41  PRO 41  41  41  PRO PRO D . n 
D 1 42  LYS 42  42  42  LYS LYS D . n 
D 1 43  GLY 43  43  43  GLY GLY D . n 
D 1 44  HIS 44  44  44  HIS HIS D . n 
D 1 45  VAL 45  45  45  VAL VAL D . n 
D 1 46  GLU 46  46  46  GLU GLU D . n 
D 1 47  PRO 47  47  47  PRO PRO D . n 
D 1 48  GLY 48  48  48  GLY GLY D . n 
D 1 49  GLU 49  49  49  GLU GLU D . n 
D 1 50  ASP 50  50  50  ASP ASP D . n 
D 1 51  ASP 51  51  51  ASP ASP D . n 
D 1 52  LEU 52  52  52  LEU LEU D . n 
D 1 53  GLU 53  53  53  GLU GLU D . n 
D 1 54  THR 54  54  54  THR THR D . n 
D 1 55  ALA 55  55  55  ALA ALA D . n 
D 1 56  LEU 56  56  56  LEU LEU D . n 
D 1 57  ARG 57  57  57  ARG ARG D . n 
D 1 58  GLU 58  58  58  GLU GLU D . n 
D 1 59  THR 59  59  59  THR THR D . n 
D 1 60  GLN 60  60  60  GLN GLN D . n 
D 1 61  GLU 61  61  61  GLU GLU D . n 
D 1 62  GLU 62  62  62  GLU GLU D . n 
D 1 63  ALA 63  63  63  ALA ALA D . n 
D 1 64  GLY 64  64  64  GLY GLY D . n 
D 1 65  ILE 65  65  65  ILE ILE D . n 
D 1 66  GLU 66  66  66  GLU GLU D . n 
D 1 67  ALA 67  67  67  ALA ALA D . n 
D 1 68  GLY 68  68  68  GLY GLY D . n 
D 1 69  GLN 69  69  69  GLN GLN D . n 
D 1 70  LEU 70  70  70  LEU LEU D . n 
D 1 71  THR 71  71  71  THR THR D . n 
D 1 72  ILE 72  72  72  ILE ILE D . n 
D 1 73  ILE 73  73  73  ILE ILE D . n 
D 1 74  GLU 74  74  74  GLU GLU D . n 
D 1 75  GLY 75  75  75  GLY GLY D . n 
D 1 76  PHE 76  76  76  PHE PHE D . n 
D 1 77  LYS 77  77  77  LYS LYS D . n 
D 1 78  ARG 78  78  78  ARG ARG D . n 
D 1 79  GLU 79  79  79  GLU GLU D . n 
D 1 80  LEU 80  80  80  LEU LEU D . n 
D 1 81  ASN 81  81  81  ASN ASN D . n 
D 1 82  TYR 82  82  82  TYR TYR D . n 
D 1 83  VAL 83  83  83  VAL VAL D . n 
D 1 84  ALA 84  84  84  ALA ALA D . n 
D 1 85  ARG 85  85  85  ARG ARG D . n 
D 1 86  ASN 86  86  86  ASN ASN D . n 
D 1 87  LYS 87  87  87  LYS ALA D . n 
D 1 88  PRO 88  88  88  PRO PRO D . n 
D 1 89  LYS 89  89  89  LYS LYS D . n 
D 1 90  THR 90  90  90  THR THR D . n 
D 1 91  VAL 91  91  91  VAL VAL D . n 
D 1 92  ILE 92  92  92  ILE ILE D . n 
D 1 93  TYR 93  93  93  TYR TYR D . n 
D 1 94  TRP 94  94  94  TRP TRP D . n 
D 1 95  LEU 95  95  95  LEU LEU D . n 
D 1 96  ALA 96  96  96  ALA ALA D . n 
D 1 97  GLU 97  97  97  GLU GLU D . n 
D 1 98  VAL 98  98  98  VAL VAL D . n 
D 1 99  LYS 99  99  99  LYS LYS D . n 
D 1 100 ASP 100 100 100 ASP ASP D . n 
D 1 101 TYR 101 101 101 TYR TYR D . n 
D 1 102 ASP 102 102 102 ASP ASP D . n 
D 1 103 VAL 103 103 103 VAL VAL D . n 
D 1 104 GLU 104 104 104 GLU GLU D . n 
D 1 105 ILE 105 105 105 ILE ILE D . n 
D 1 106 ARG 106 106 106 ARG ARG D . n 
D 1 107 LEU 107 107 107 LEU LEU D . n 
D 1 108 SER 108 108 108 SER SER D . n 
D 1 109 HIS 109 109 109 HIS HIS D . n 
D 1 110 GLU 110 110 110 GLU GLU D . n 
D 1 111 HIS 111 111 111 HIS HIS D . n 
D 1 112 GLN 112 112 112 GLN GLN D . n 
D 1 113 ALA 113 113 113 ALA ALA D . n 
D 1 114 TYR 114 114 114 TYR TYR D . n 
D 1 115 ARG 115 115 115 ARG ARG D . n 
D 1 116 TRP 116 116 116 TRP TRP D . n 
D 1 117 LEU 117 117 117 LEU LEU D . n 
D 1 118 GLY 118 118 118 GLY GLY D . n 
D 1 119 LEU 119 119 119 LEU LEU D . n 
D 1 120 GLU 120 120 120 GLU GLU D . n 
D 1 121 GLU 121 121 121 GLU GLU D . n 
D 1 122 ALA 122 122 122 ALA ALA D . n 
D 1 123 CYS 123 123 123 CYS CYS D . n 
D 1 124 GLN 124 124 124 GLN GLN D . n 
D 1 125 LEU 125 125 125 LEU LEU D . n 
D 1 126 ALA 126 126 126 ALA ALA D . n 
D 1 127 GLN 127 127 127 GLN GLN D . n 
D 1 128 PHE 128 128 128 PHE PHE D . n 
D 1 129 LYS 129 129 129 LYS LYS D . n 
D 1 130 GLU 130 130 130 GLU GLU D . n 
D 1 131 MET 131 131 131 MET MET D . n 
D 1 132 LYS 132 132 132 LYS LYS D . n 
D 1 133 ALA 133 133 133 ALA ALA D . n 
D 1 134 ALA 134 134 134 ALA ALA D . n 
D 1 135 LEU 135 135 135 LEU LEU D . n 
D 1 136 GLN 136 136 136 GLN GLN D . n 
D 1 137 GLU 137 137 137 GLU GLU D . n 
D 1 138 GLY 138 138 138 GLY GLY D . n 
D 1 139 HIS 139 139 139 HIS HIS D . n 
D 1 140 GLN 140 140 140 GLN GLN D . n 
D 1 141 PHE 141 141 141 PHE PHE D . n 
D 1 142 LEU 142 142 142 LEU LEU D . n 
D 1 143 CYS 143 143 143 CYS CYS D . n 
D 1 144 SER 144 144 144 SER SER D . n 
D 1 145 ILE 145 145 145 ILE ILE D . n 
D 1 146 GLU 146 146 146 GLU GLU D . n 
D 1 147 ALA 147 147 147 ALA ALA D . n 
D 1 148 LEU 148 148 ?   ?   ?   D . n 
D 1 149 GLU 149 149 ?   ?   ?   D . n 
D 1 150 HIS 150 150 ?   ?   ?   D . n 
D 1 151 HIS 151 151 ?   ?   ?   D . n 
D 1 152 HIS 152 152 ?   ?   ?   D . n 
D 1 153 HIS 153 153 ?   ?   ?   D . n 
D 1 154 HIS 154 154 ?   ?   ?   D . n 
D 1 155 HIS 155 155 ?   ?   ?   D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_and_software_defined_assembly PISA monomeric 1 
4 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E,F,G,H,W   
2 1 B,I,J,K,L,X   
3 1 C,M,N,O,P,Q,Y 
4 1 D,R,S,T,U,V,Z 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-10-10 
2 'Structure model' 1 1 2013-03-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 7.0010   -8.8078  -16.2044 0.0297 0.0165  0.0904  0.0151  0.0402  0.0227  -1.6945 6.2614  -0.3345 
-0.6812 -0.6243 -1.7283  -0.2842 0.0059  0.0190  -0.1403 0.5317  0.2591  -0.1931 0.0494  -0.2475 
'X-RAY DIFFRACTION' 2  ? refined 14.4085  -12.5713 -12.3758 0.0653 0.0901  -0.0060 0.1481  0.0301  0.1015  2.0387  1.0895  -0.2546 
-1.8930 -0.2977 0.9731   -0.2837 0.1132  0.2345  0.3521  0.5561  0.1444  0.0908  0.2986  -0.2723 
'X-RAY DIFFRACTION' 3  ? refined 16.4308  0.9650   -21.6007 0.0894 0.0742  0.0949  -0.0272 -0.0263 0.0024  2.3263  3.5531  6.3804  
-5.4981 5.3325  -6.7051  -0.4782 -0.0545 0.4731  0.0857  0.0287  -0.7732 -0.2719 0.1672  0.4495  
'X-RAY DIFFRACTION' 4  ? refined 7.3125   -1.2764  -21.5601 0.0509 0.0482  0.0623  -0.0147 -0.0014 0.0116  -0.0415 1.4124  0.8410  
-0.9548 -0.1962 -0.6334  -0.0024 -0.0032 -0.0174 -0.0334 0.0200  0.1108  -0.0730 0.0088  -0.0176 
'X-RAY DIFFRACTION' 5  ? refined 12.3307  -6.2199  -12.4052 0.0423 0.0607  -0.0019 0.0771  0.0096  0.0180  1.7058  1.1334  0.2319  
0.3154  -0.6242 0.5532   -0.1159 -0.1932 0.0011  0.1374  0.1179  0.0316  0.1008  0.1703  -0.0021 
'X-RAY DIFFRACTION' 6  ? refined 47.2411  25.4745  -2.3916  0.0708 0.0136  0.0359  0.0540  0.0674  0.0253  2.4058  -1.1976 1.1785  
-0.4609 -1.0038 -0.7893  0.2240  0.1092  0.1381  0.0388  -0.2155 0.0726  0.2544  -0.0706 -0.0085 
'X-RAY DIFFRACTION' 7  ? refined 38.5390  11.8233  -0.0807  0.8930 0.1280  0.4631  -0.1223 0.3200  0.0971  2.2186  10.3136 3.4754  
29.3745 -1.8089 -29.5672 -3.0077 -1.2847 -2.0545 -4.1528 1.5185  -0.2361 3.1548  -1.7356 1.4891  
'X-RAY DIFFRACTION' 8  ? refined 37.5816  29.9535  8.2890   0.0638 0.0560  0.0286  -0.0158 0.0048  -0.0140 1.7119  0.0254  1.1582  
-0.4203 -0.7127 -0.3489  0.0359  -0.1275 0.0818  -0.0507 -0.0375 -0.0169 0.0568  -0.0189 0.0016  
'X-RAY DIFFRACTION' 9  ? refined 40.8305  22.3161  1.1134   0.0514 0.0252  0.0343  0.0182  -0.0005 -0.0026 1.0945  0.3390  0.9066  
-0.5646 0.0248  -0.1614  0.2081  -0.0093 0.0157  -0.0994 -0.1461 0.0407  0.0610  0.0026  -0.0621 
'X-RAY DIFFRACTION' 10 ? refined 38.9846  29.8347  -9.3444  0.0425 0.0520  0.0462  0.0758  0.0308  0.0680  0.9884  5.0688  0.6833  
3.1705  1.5462  0.0030   0.2018  0.1982  -0.0765 -0.0870 -0.1390 -0.0027 0.0849  0.0402  -0.0628 
'X-RAY DIFFRACTION' 11 ? refined 47.1582  49.3695  20.9090  0.0859 0.0155  0.1042  -0.0479 -0.0379 0.0010  0.7655  0.7173  -0.3254 
-0.0373 -0.6235 -0.1303  0.0530  0.1073  -0.0745 -0.0410 0.0320  -0.2214 -0.1390 -0.0321 -0.0850 
'X-RAY DIFFRACTION' 12 ? refined 35.7198  50.8987  10.3274  0.1292 0.0506  -0.0147 -0.0402 -0.0486 -0.0070 3.3215  1.5916  0.3971  
3.0457  2.2577  3.4547   -0.2832 0.1061  0.1333  -0.2581 -0.0522 0.3412  -0.1787 0.1024  0.3354  
'X-RAY DIFFRACTION' 13 ? refined 32.8707  45.9770  18.1557  0.1092 0.0506  0.0233  0.0385  0.0365  0.0023  2.4350  -0.1542 -0.2397 
0.0198  0.4740  1.0641   0.1964  0.0779  -0.1750 -0.2108 -0.1333 0.0452  -0.1542 -0.2387 -0.0632 
'X-RAY DIFFRACTION' 14 ? refined 49.0142  46.4177  13.9445  0.0484 -0.0040 0.0743  -0.0446 0.0804  -0.0337 1.3890  -1.1366 -0.3797 
-2.0656 -0.0879 0.6627   -0.3197 0.0290  -0.2592 -0.0373 0.2923  -0.3067 0.2374  0.0090  0.0275  
'X-RAY DIFFRACTION' 15 ? refined 41.6891  50.8125  23.2835  0.0948 0.0178  0.0070  -0.0356 0.0035  -0.0351 1.7513  1.9614  -0.9025 
0.2671  0.8660  -1.1041  -0.0082 -0.2143 0.1425  -0.0225 0.0338  0.0890  0.0326  -0.0138 -0.0257 
'X-RAY DIFFRACTION' 16 ? refined -11.1431 13.0668  -4.0185  0.1009 0.0075  0.0799  0.0447  -0.0517 0.0078  2.3450  0.4023  -0.5208 
1.0681  -0.4320 0.8097   -0.0972 -0.0934 -0.0808 -0.0332 0.0547  0.1902  -0.2253 0.0261  0.0425  
'X-RAY DIFFRACTION' 17 ? refined 0.5029   14.6483  6.7663   0.1152 0.0783  -0.0082 0.0386  -0.0453 -0.0102 2.5933  1.2277  0.2019  
-1.8285 0.5951  -2.4671  -0.3519 -0.2720 0.0412  0.0761  0.1809  -0.2937 -0.2416 -0.2202 0.1710  
'X-RAY DIFFRACTION' 18 ? refined 1.3017   8.8802   -0.8711  0.0547 0.0321  0.0536  -0.0068 0.0154  -0.0115 -0.1178 -0.0449 0.1895  
-0.4799 0.6066  -0.8727  0.2025  -0.1019 -0.1923 -0.0368 -0.0884 0.0455  -0.0336 0.1506  -0.1141 
'X-RAY DIFFRACTION' 19 ? refined -7.5621  19.1265  -2.5329  0.0413 0.0372  0.0217  0.0290  -0.0065 0.0125  0.8288  2.6619  -1.3362 
-1.8780 -0.2505 0.2672   0.0364  0.0123  0.3718  -0.0619 0.1827  -0.0795 0.0164  0.0024  -0.2191 
'X-RAY DIFFRACTION' 20 ? refined -6.0707  4.6361   -10.8115 0.0348 0.0416  0.0271  0.0729  -0.0194 -0.0252 0.5571  3.0829  -0.2055 
-0.6122 -0.6164 -0.1198  0.3231  0.3311  -0.0516 0.0944  -0.3057 -0.0301 -0.1684 -0.0592 -0.0174 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 4   ? ? A 16  ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 17  ? ? A 34  ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 35  ? ? A 46  ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 47  ? ? A 102 ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 103 ? ? A 147 ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  B 4   ? ? B 33  ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  B 34  ? ? B 38  ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  B 39  ? ? B 78  ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  B 79  ? ? B 126 ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 B 127 ? ? B 147 ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 C 4   ? ? C 32  ? ? ? ? 
'X-RAY DIFFRACTION' 12 12 C 33  ? ? C 66  ? ? ? ? 
'X-RAY DIFFRACTION' 13 13 C 67  ? ? C 93  ? ? ? ? 
'X-RAY DIFFRACTION' 14 14 C 94  ? ? C 105 ? ? ? ? 
'X-RAY DIFFRACTION' 15 15 C 106 ? ? C 147 ? ? ? ? 
'X-RAY DIFFRACTION' 16 16 D 4   ? ? D 32  ? ? ? ? 
'X-RAY DIFFRACTION' 17 17 D 33  ? ? D 67  ? ? ? ? 
'X-RAY DIFFRACTION' 18 18 D 68  ? ? D 99  ? ? ? ? 
'X-RAY DIFFRACTION' 19 19 D 100 ? ? D 131 ? ? ? ? 
'X-RAY DIFFRACTION' 20 20 D 132 ? ? D 147 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.5.0110 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 18  ? ? 84.85  -5.12  
2  1 ILE A 35  ? ? 57.47  13.13  
3  1 GLN A 127 ? ? 74.44  -55.75 
4  1 LYS B 18  ? ? 83.71  -4.51  
5  1 ASN B 86  ? ? 84.78  0.40   
6  1 GLN B 127 ? ? 73.30  -60.19 
7  1 ILE C 35  ? ? -59.58 175.41 
8  1 HIS C 36  ? ? 70.05  30.42  
9  1 GLN C 127 ? ? 70.73  -56.00 
10 1 LYS D 18  ? ? 74.70  -5.69  
11 1 GLN D 127 ? ? 56.83  4.54   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 18  ? CG  ? A LYS 18  CG  
2   1 Y 1 A LYS 18  ? CD  ? A LYS 18  CD  
3   1 Y 1 A LYS 18  ? CE  ? A LYS 18  CE  
4   1 Y 1 A LYS 18  ? NZ  ? A LYS 18  NZ  
5   1 Y 1 A ASP 33  ? CG  ? A ASP 33  CG  
6   1 Y 1 A ASP 33  ? OD1 ? A ASP 33  OD1 
7   1 Y 1 A ASP 33  ? OD2 ? A ASP 33  OD2 
8   1 Y 1 A ARG 85  ? CG  ? A ARG 85  CG  
9   1 Y 1 A ARG 85  ? CD  ? A ARG 85  CD  
10  1 Y 1 A ARG 85  ? NE  ? A ARG 85  NE  
11  1 Y 1 A ARG 85  ? CZ  ? A ARG 85  CZ  
12  1 Y 1 A ARG 85  ? NH1 ? A ARG 85  NH1 
13  1 Y 1 A ARG 85  ? NH2 ? A ARG 85  NH2 
14  1 Y 1 A LYS 87  ? CG  ? A LYS 87  CG  
15  1 Y 1 A LYS 87  ? CD  ? A LYS 87  CD  
16  1 Y 1 A LYS 87  ? CE  ? A LYS 87  CE  
17  1 Y 1 A LYS 87  ? NZ  ? A LYS 87  NZ  
18  1 Y 1 A LYS 89  ? CD  ? A LYS 89  CD  
19  1 Y 1 A LYS 89  ? CE  ? A LYS 89  CE  
20  1 Y 1 A LYS 89  ? NZ  ? A LYS 89  NZ  
21  1 Y 0 A LYS 99  ? CE  ? A LYS 99  CE  
22  1 Y 1 A ARG 106 ? CG  ? A ARG 106 CG  
23  1 Y 1 A ARG 106 ? CD  ? A ARG 106 CD  
24  1 Y 1 A ARG 106 ? NE  ? A ARG 106 NE  
25  1 Y 1 A ARG 106 ? CZ  ? A ARG 106 CZ  
26  1 Y 1 A ARG 106 ? NH1 ? A ARG 106 NH1 
27  1 Y 1 A ARG 106 ? NH2 ? A ARG 106 NH2 
28  1 Y 1 A GLN 127 ? CG  ? A GLN 127 CG  
29  1 Y 1 A GLN 127 ? CD  ? A GLN 127 CD  
30  1 Y 1 A GLN 127 ? OE1 ? A GLN 127 OE1 
31  1 Y 1 A GLN 127 ? NE2 ? A GLN 127 NE2 
32  1 Y 0 A GLU 146 ? CD  ? A GLU 146 CD  
33  1 Y 1 B LYS 18  ? CG  ? B LYS 18  CG  
34  1 Y 1 B LYS 18  ? CD  ? B LYS 18  CD  
35  1 Y 1 B LYS 18  ? CE  ? B LYS 18  CE  
36  1 Y 1 B LYS 18  ? NZ  ? B LYS 18  NZ  
37  1 Y 1 B ASP 33  ? CG  ? B ASP 33  CG  
38  1 Y 1 B ASP 33  ? OD1 ? B ASP 33  OD1 
39  1 Y 1 B ASP 33  ? OD2 ? B ASP 33  OD2 
40  1 Y 1 B LYS 87  ? CG  ? B LYS 87  CG  
41  1 Y 1 B LYS 87  ? CD  ? B LYS 87  CD  
42  1 Y 1 B LYS 87  ? CE  ? B LYS 87  CE  
43  1 Y 1 B LYS 87  ? NZ  ? B LYS 87  NZ  
44  1 Y 1 B LYS 99  ? CE  ? B LYS 99  CE  
45  1 Y 1 B LYS 99  ? NZ  ? B LYS 99  NZ  
46  1 Y 1 B HIS 109 ? CG  ? B HIS 109 CG  
47  1 Y 1 B HIS 109 ? ND1 ? B HIS 109 ND1 
48  1 Y 1 B HIS 109 ? CD2 ? B HIS 109 CD2 
49  1 Y 1 B HIS 109 ? CE1 ? B HIS 109 CE1 
50  1 Y 1 B HIS 109 ? NE2 ? B HIS 109 NE2 
51  1 Y 0 B GLU 121 ? CD  ? B GLU 121 CD  
52  1 Y 0 B PHE 128 ? CE2 ? B PHE 128 CE2 
53  1 Y 0 B LYS 129 ? CD  ? B LYS 129 CD  
54  1 Y 1 B GLU 146 ? CG  ? B GLU 146 CG  
55  1 Y 1 B GLU 146 ? CD  ? B GLU 146 CD  
56  1 Y 1 B GLU 146 ? OE1 ? B GLU 146 OE1 
57  1 Y 1 B GLU 146 ? OE2 ? B GLU 146 OE2 
58  1 Y 0 C ARG 13  ? CZ  ? C ARG 13  CZ  
59  1 Y 1 C LYS 18  ? CG  ? C LYS 18  CG  
60  1 Y 1 C LYS 18  ? CD  ? C LYS 18  CD  
61  1 Y 1 C LYS 18  ? CE  ? C LYS 18  CE  
62  1 Y 1 C LYS 18  ? NZ  ? C LYS 18  NZ  
63  1 Y 1 C ASP 33  ? CG  ? C ASP 33  CG  
64  1 Y 1 C ASP 33  ? OD1 ? C ASP 33  OD1 
65  1 Y 1 C ASP 33  ? OD2 ? C ASP 33  OD2 
66  1 Y 1 C HIS 36  ? CG  ? C HIS 36  CG  
67  1 Y 1 C HIS 36  ? ND1 ? C HIS 36  ND1 
68  1 Y 1 C HIS 36  ? CD2 ? C HIS 36  CD2 
69  1 Y 1 C HIS 36  ? CE1 ? C HIS 36  CE1 
70  1 Y 1 C HIS 36  ? NE2 ? C HIS 36  NE2 
71  1 Y 1 C ARG 85  ? CG  ? C ARG 85  CG  
72  1 Y 1 C ARG 85  ? CD  ? C ARG 85  CD  
73  1 Y 1 C ARG 85  ? NE  ? C ARG 85  NE  
74  1 Y 1 C ARG 85  ? CZ  ? C ARG 85  CZ  
75  1 Y 1 C ARG 85  ? NH1 ? C ARG 85  NH1 
76  1 Y 1 C ARG 85  ? NH2 ? C ARG 85  NH2 
77  1 Y 1 C LYS 87  ? CG  ? C LYS 87  CG  
78  1 Y 1 C LYS 87  ? CD  ? C LYS 87  CD  
79  1 Y 1 C LYS 87  ? CE  ? C LYS 87  CE  
80  1 Y 1 C LYS 87  ? NZ  ? C LYS 87  NZ  
81  1 Y 1 C GLN 124 ? CG  ? C GLN 124 CG  
82  1 Y 1 C GLN 124 ? CD  ? C GLN 124 CD  
83  1 Y 1 C GLN 124 ? OE1 ? C GLN 124 OE1 
84  1 Y 1 C GLN 124 ? NE2 ? C GLN 124 NE2 
85  1 Y 1 C GLN 127 ? CG  ? C GLN 127 CG  
86  1 Y 1 C GLN 127 ? CD  ? C GLN 127 CD  
87  1 Y 1 C GLN 127 ? OE1 ? C GLN 127 OE1 
88  1 Y 1 C GLN 127 ? NE2 ? C GLN 127 NE2 
89  1 Y 1 C GLU 146 ? CG  ? C GLU 146 CG  
90  1 Y 1 C GLU 146 ? CD  ? C GLU 146 CD  
91  1 Y 1 C GLU 146 ? OE1 ? C GLU 146 OE1 
92  1 Y 1 C GLU 146 ? OE2 ? C GLU 146 OE2 
93  1 Y 0 D ARG 13  ? CZ  ? D ARG 13  CZ  
94  1 Y 1 D LYS 18  ? CG  ? D LYS 18  CG  
95  1 Y 1 D LYS 18  ? CD  ? D LYS 18  CD  
96  1 Y 1 D LYS 18  ? CE  ? D LYS 18  CE  
97  1 Y 1 D LYS 18  ? NZ  ? D LYS 18  NZ  
98  1 Y 1 D HIS 37  ? CG  ? D HIS 37  CG  
99  1 Y 1 D HIS 37  ? ND1 ? D HIS 37  ND1 
100 1 Y 1 D HIS 37  ? CD2 ? D HIS 37  CD2 
101 1 Y 1 D HIS 37  ? CE1 ? D HIS 37  CE1 
102 1 Y 1 D HIS 37  ? NE2 ? D HIS 37  NE2 
103 1 Y 1 D ARG 85  ? CG  ? D ARG 85  CG  
104 1 Y 1 D ARG 85  ? CD  ? D ARG 85  CD  
105 1 Y 1 D ARG 85  ? NE  ? D ARG 85  NE  
106 1 Y 1 D ARG 85  ? CZ  ? D ARG 85  CZ  
107 1 Y 1 D ARG 85  ? NH1 ? D ARG 85  NH1 
108 1 Y 1 D ARG 85  ? NH2 ? D ARG 85  NH2 
109 1 Y 1 D LYS 87  ? CG  ? D LYS 87  CG  
110 1 Y 1 D LYS 87  ? CD  ? D LYS 87  CD  
111 1 Y 1 D LYS 87  ? CE  ? D LYS 87  CE  
112 1 Y 1 D LYS 87  ? NZ  ? D LYS 87  NZ  
113 1 Y 0 D LYS 99  ? NZ  ? D LYS 99  NZ  
114 1 Y 1 D GLN 127 ? CG  ? D GLN 127 CG  
115 1 Y 1 D GLN 127 ? CD  ? D GLN 127 CD  
116 1 Y 1 D GLN 127 ? OE1 ? D GLN 127 OE1 
117 1 Y 1 D GLN 127 ? NE2 ? D GLN 127 NE2 
118 1 Y 1 D GLU 146 ? CG  ? D GLU 146 CG  
119 1 Y 1 D GLU 146 ? CD  ? D GLU 146 CD  
120 1 Y 1 D GLU 146 ? OE1 ? D GLU 146 OE1 
121 1 Y 1 D GLU 146 ? OE2 ? D GLU 146 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A LEU 3   ? A LEU 3   
4  1 Y 1 A LEU 148 ? A LEU 148 
5  1 Y 1 A GLU 149 ? A GLU 149 
6  1 Y 1 A HIS 150 ? A HIS 150 
7  1 Y 1 A HIS 151 ? A HIS 151 
8  1 Y 1 A HIS 152 ? A HIS 152 
9  1 Y 1 A HIS 153 ? A HIS 153 
10 1 Y 1 A HIS 154 ? A HIS 154 
11 1 Y 1 A HIS 155 ? A HIS 155 
12 1 Y 1 B MET 1   ? B MET 1   
13 1 Y 1 B ALA 2   ? B ALA 2   
14 1 Y 1 B LEU 3   ? B LEU 3   
15 1 Y 1 B LEU 148 ? B LEU 148 
16 1 Y 1 B GLU 149 ? B GLU 149 
17 1 Y 1 B HIS 150 ? B HIS 150 
18 1 Y 1 B HIS 151 ? B HIS 151 
19 1 Y 1 B HIS 152 ? B HIS 152 
20 1 Y 1 B HIS 153 ? B HIS 153 
21 1 Y 1 B HIS 154 ? B HIS 154 
22 1 Y 1 B HIS 155 ? B HIS 155 
23 1 Y 1 C MET 1   ? C MET 1   
24 1 Y 1 C ALA 2   ? C ALA 2   
25 1 Y 1 C LEU 3   ? C LEU 3   
26 1 Y 1 C LEU 148 ? C LEU 148 
27 1 Y 1 C GLU 149 ? C GLU 149 
28 1 Y 1 C HIS 150 ? C HIS 150 
29 1 Y 1 C HIS 151 ? C HIS 151 
30 1 Y 1 C HIS 152 ? C HIS 152 
31 1 Y 1 C HIS 153 ? C HIS 153 
32 1 Y 1 C HIS 154 ? C HIS 154 
33 1 Y 1 C HIS 155 ? C HIS 155 
34 1 Y 1 D MET 1   ? D MET 1   
35 1 Y 1 D ALA 2   ? D ALA 2   
36 1 Y 1 D LEU 3   ? D LEU 3   
37 1 Y 1 D LEU 148 ? D LEU 148 
38 1 Y 1 D GLU 149 ? D GLU 149 
39 1 Y 1 D HIS 150 ? D HIS 150 
40 1 Y 1 D HIS 151 ? D HIS 151 
41 1 Y 1 D HIS 152 ? D HIS 152 
42 1 Y 1 D HIS 153 ? D HIS 153 
43 1 Y 1 D HIS 154 ? D HIS 154 
44 1 Y 1 D HIS 155 ? D HIS 155 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 GLYCEROL      GOL 
4 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 SO4 1  156 1   SO4 SO4 A . 
F 2 SO4 1  157 11  SO4 SO4 A . 
G 2 SO4 1  158 16  SO4 SO4 A . 
H 3 GOL 1  159 1   GOL GOL A . 
I 2 SO4 1  156 3   SO4 SO4 B . 
J 2 SO4 1  157 8   SO4 SO4 B . 
K 2 SO4 1  158 13  SO4 SO4 B . 
L 2 SO4 1  159 18  SO4 SO4 B . 
M 2 SO4 1  156 4   SO4 SO4 C . 
N 2 SO4 1  157 5   SO4 SO4 C . 
O 2 SO4 1  158 9   SO4 SO4 C . 
P 2 SO4 1  159 14  SO4 SO4 C . 
Q 2 SO4 1  160 17  SO4 SO4 C . 
R 2 SO4 1  156 2   SO4 SO4 D . 
S 2 SO4 1  157 6   SO4 SO4 D . 
T 2 SO4 1  158 7   SO4 SO4 D . 
U 2 SO4 1  159 10  SO4 SO4 D . 
V 2 SO4 1  160 15  SO4 SO4 D . 
W 4 HOH 1  160 160 HOH HOH A . 
W 4 HOH 2  161 161 HOH HOH A . 
W 4 HOH 3  162 1   HOH HOH A . 
W 4 HOH 4  163 4   HOH HOH A . 
W 4 HOH 5  164 17  HOH HOH A . 
W 4 HOH 6  165 18  HOH HOH A . 
W 4 HOH 7  166 19  HOH HOH A . 
W 4 HOH 8  167 23  HOH HOH A . 
W 4 HOH 9  168 24  HOH HOH A . 
W 4 HOH 10 169 41  HOH HOH A . 
W 4 HOH 11 170 43  HOH HOH A . 
W 4 HOH 12 171 44  HOH HOH A . 
W 4 HOH 13 172 45  HOH HOH A . 
W 4 HOH 14 173 46  HOH HOH A . 
W 4 HOH 15 174 57  HOH HOH A . 
W 4 HOH 16 175 58  HOH HOH A . 
W 4 HOH 17 176 59  HOH HOH A . 
W 4 HOH 18 177 64  HOH HOH A . 
W 4 HOH 19 178 75  HOH HOH A . 
W 4 HOH 20 179 77  HOH HOH A . 
W 4 HOH 21 180 81  HOH HOH A . 
W 4 HOH 22 181 82  HOH HOH A . 
W 4 HOH 23 182 92  HOH HOH A . 
W 4 HOH 24 183 99  HOH HOH A . 
W 4 HOH 25 184 113 HOH HOH A . 
W 4 HOH 26 185 114 HOH HOH A . 
W 4 HOH 27 186 116 HOH HOH A . 
W 4 HOH 28 187 118 HOH HOH A . 
W 4 HOH 29 188 124 HOH HOH A . 
W 4 HOH 30 189 126 HOH HOH A . 
W 4 HOH 31 190 131 HOH HOH A . 
W 4 HOH 32 191 132 HOH HOH A . 
W 4 HOH 33 192 136 HOH HOH A . 
W 4 HOH 34 193 137 HOH HOH A . 
W 4 HOH 35 194 139 HOH HOH A . 
W 4 HOH 36 195 140 HOH HOH A . 
W 4 HOH 37 196 141 HOH HOH A . 
W 4 HOH 38 197 152 HOH HOH A . 
W 4 HOH 39 198 153 HOH HOH A . 
X 4 HOH 1  160 2   HOH HOH B . 
X 4 HOH 2  161 9   HOH HOH B . 
X 4 HOH 3  162 11  HOH HOH B . 
X 4 HOH 4  163 163 HOH HOH B . 
X 4 HOH 5  164 15  HOH HOH B . 
X 4 HOH 6  165 27  HOH HOH B . 
X 4 HOH 7  166 29  HOH HOH B . 
X 4 HOH 8  167 30  HOH HOH B . 
X 4 HOH 9  168 31  HOH HOH B . 
X 4 HOH 10 169 32  HOH HOH B . 
X 4 HOH 11 170 33  HOH HOH B . 
X 4 HOH 12 171 47  HOH HOH B . 
X 4 HOH 13 172 48  HOH HOH B . 
X 4 HOH 14 173 49  HOH HOH B . 
X 4 HOH 15 174 60  HOH HOH B . 
X 4 HOH 16 175 62  HOH HOH B . 
X 4 HOH 17 176 67  HOH HOH B . 
X 4 HOH 18 177 70  HOH HOH B . 
X 4 HOH 19 178 73  HOH HOH B . 
X 4 HOH 20 179 87  HOH HOH B . 
X 4 HOH 21 180 89  HOH HOH B . 
X 4 HOH 22 181 93  HOH HOH B . 
X 4 HOH 23 182 94  HOH HOH B . 
X 4 HOH 24 183 95  HOH HOH B . 
X 4 HOH 25 184 96  HOH HOH B . 
X 4 HOH 26 185 97  HOH HOH B . 
X 4 HOH 27 186 98  HOH HOH B . 
X 4 HOH 28 187 100 HOH HOH B . 
X 4 HOH 29 188 105 HOH HOH B . 
X 4 HOH 30 189 106 HOH HOH B . 
X 4 HOH 31 190 107 HOH HOH B . 
X 4 HOH 32 191 108 HOH HOH B . 
X 4 HOH 33 192 109 HOH HOH B . 
X 4 HOH 34 193 119 HOH HOH B . 
X 4 HOH 35 194 120 HOH HOH B . 
X 4 HOH 36 195 121 HOH HOH B . 
X 4 HOH 37 196 142 HOH HOH B . 
X 4 HOH 38 197 143 HOH HOH B . 
X 4 HOH 39 198 150 HOH HOH B . 
X 4 HOH 40 199 154 HOH HOH B . 
X 4 HOH 41 200 155 HOH HOH B . 
X 4 HOH 42 201 157 HOH HOH B . 
X 4 HOH 43 202 159 HOH HOH B . 
Y 4 HOH 1  161 10  HOH HOH C . 
Y 4 HOH 2  162 162 HOH HOH C . 
Y 4 HOH 3  163 12  HOH HOH C . 
Y 4 HOH 4  164 164 HOH HOH C . 
Y 4 HOH 5  165 22  HOH HOH C . 
Y 4 HOH 6  166 25  HOH HOH C . 
Y 4 HOH 7  167 26  HOH HOH C . 
Y 4 HOH 8  168 28  HOH HOH C . 
Y 4 HOH 9  169 34  HOH HOH C . 
Y 4 HOH 10 170 35  HOH HOH C . 
Y 4 HOH 11 171 37  HOH HOH C . 
Y 4 HOH 12 172 50  HOH HOH C . 
Y 4 HOH 13 173 56  HOH HOH C . 
Y 4 HOH 14 174 61  HOH HOH C . 
Y 4 HOH 15 175 63  HOH HOH C . 
Y 4 HOH 16 176 66  HOH HOH C . 
Y 4 HOH 17 177 72  HOH HOH C . 
Y 4 HOH 18 178 74  HOH HOH C . 
Y 4 HOH 19 179 76  HOH HOH C . 
Y 4 HOH 20 180 80  HOH HOH C . 
Y 4 HOH 21 181 83  HOH HOH C . 
Y 4 HOH 22 182 85  HOH HOH C . 
Y 4 HOH 23 183 88  HOH HOH C . 
Y 4 HOH 24 184 101 HOH HOH C . 
Y 4 HOH 25 185 111 HOH HOH C . 
Y 4 HOH 26 186 115 HOH HOH C . 
Y 4 HOH 27 187 135 HOH HOH C . 
Y 4 HOH 28 188 144 HOH HOH C . 
Y 4 HOH 29 189 145 HOH HOH C . 
Y 4 HOH 30 190 146 HOH HOH C . 
Y 4 HOH 31 191 151 HOH HOH C . 
Z 4 HOH 1  161 3   HOH HOH D . 
Z 4 HOH 2  162 5   HOH HOH D . 
Z 4 HOH 3  163 7   HOH HOH D . 
Z 4 HOH 4  164 8   HOH HOH D . 
Z 4 HOH 5  165 165 HOH HOH D . 
Z 4 HOH 6  166 166 HOH HOH D . 
Z 4 HOH 7  167 13  HOH HOH D . 
Z 4 HOH 8  168 16  HOH HOH D . 
Z 4 HOH 9  169 20  HOH HOH D . 
Z 4 HOH 10 170 21  HOH HOH D . 
Z 4 HOH 11 171 38  HOH HOH D . 
Z 4 HOH 12 172 39  HOH HOH D . 
Z 4 HOH 13 173 40  HOH HOH D . 
Z 4 HOH 14 174 42  HOH HOH D . 
Z 4 HOH 15 175 51  HOH HOH D . 
Z 4 HOH 16 176 52  HOH HOH D . 
Z 4 HOH 17 177 53  HOH HOH D . 
Z 4 HOH 18 178 54  HOH HOH D . 
Z 4 HOH 19 179 55  HOH HOH D . 
Z 4 HOH 20 180 65  HOH HOH D . 
Z 4 HOH 21 181 68  HOH HOH D . 
Z 4 HOH 22 182 69  HOH HOH D . 
Z 4 HOH 23 183 78  HOH HOH D . 
Z 4 HOH 24 184 79  HOH HOH D . 
Z 4 HOH 25 185 90  HOH HOH D . 
Z 4 HOH 26 186 91  HOH HOH D . 
Z 4 HOH 27 187 110 HOH HOH D . 
Z 4 HOH 28 188 123 HOH HOH D . 
Z 4 HOH 29 189 127 HOH HOH D . 
Z 4 HOH 30 190 130 HOH HOH D . 
Z 4 HOH 31 191 134 HOH HOH D . 
Z 4 HOH 32 192 147 HOH HOH D . 
Z 4 HOH 33 193 148 HOH HOH D . 
Z 4 HOH 34 194 149 HOH HOH D . 
Z 4 HOH 35 195 156 HOH HOH D . 
#