data_3U71
# 
_entry.id   3U71 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3U71         
RCSB  RCSB068386   
WWPDB D_1000068386 
# 
_pdbx_database_status.entry_id                        3U71 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-10-13 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Naicker, P.'     1 
'Fanucchi, S.'    2 
'Achilonu, I.A.'  3 
'Fernandes, M.A.' 4 
'Dirr, H.W.'      5 
'Sayed, Y.'       6 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure analysis of South African wild type HIV-1 subtype C apo protease' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Naicker, P.'     1 
primary 'Fanucchi, S.'    2 
primary 'Achilonu, I.A.'  3 
primary 'Fernandes, M.A.' 4 
primary 'Dirr, H.W.'      5 
primary 'Sayed, Y.'       6 
# 
_cell.length_a           45.928 
_cell.length_b           45.928 
_cell.length_c           99.960 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3U71 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.entry_id                         3U71 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                92 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'HIV-1 Protease' 
_entity.formula_weight             10766.799 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              Q7K 
_entity.pdbx_fragment              'UNP residues 1-99' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PQITLWKRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQILIEICGKKAIGTVLVGPT
PVNIIGRNMLTQLGCTLNF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PQITLWKRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQILIEICGKKAIGTVLVGPT
PVNIIGRNMLTQLGCTLNF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  GLN n 
1 3  ILE n 
1 4  THR n 
1 5  LEU n 
1 6  TRP n 
1 7  LYS n 
1 8  ARG n 
1 9  PRO n 
1 10 LEU n 
1 11 VAL n 
1 12 SER n 
1 13 ILE n 
1 14 LYS n 
1 15 VAL n 
1 16 GLY n 
1 17 GLY n 
1 18 GLN n 
1 19 ILE n 
1 20 LYS n 
1 21 GLU n 
1 22 ALA n 
1 23 LEU n 
1 24 LEU n 
1 25 ASP n 
1 26 THR n 
1 27 GLY n 
1 28 ALA n 
1 29 ASP n 
1 30 ASP n 
1 31 THR n 
1 32 VAL n 
1 33 LEU n 
1 34 GLU n 
1 35 GLU n 
1 36 ILE n 
1 37 ASN n 
1 38 LEU n 
1 39 PRO n 
1 40 GLY n 
1 41 LYS n 
1 42 TRP n 
1 43 LYS n 
1 44 PRO n 
1 45 LYS n 
1 46 MET n 
1 47 ILE n 
1 48 GLY n 
1 49 GLY n 
1 50 ILE n 
1 51 GLY n 
1 52 GLY n 
1 53 PHE n 
1 54 ILE n 
1 55 LYS n 
1 56 VAL n 
1 57 ARG n 
1 58 GLN n 
1 59 TYR n 
1 60 ASP n 
1 61 GLN n 
1 62 ILE n 
1 63 LEU n 
1 64 ILE n 
1 65 GLU n 
1 66 ILE n 
1 67 CYS n 
1 68 GLY n 
1 69 LYS n 
1 70 LYS n 
1 71 ALA n 
1 72 ILE n 
1 73 GLY n 
1 74 THR n 
1 75 VAL n 
1 76 LEU n 
1 77 VAL n 
1 78 GLY n 
1 79 PRO n 
1 80 THR n 
1 81 PRO n 
1 82 VAL n 
1 83 ASN n 
1 84 ILE n 
1 85 ILE n 
1 86 GLY n 
1 87 ARG n 
1 88 ASN n 
1 89 MET n 
1 90 LEU n 
1 91 THR n 
1 92 GLN n 
1 93 LEU n 
1 94 GLY n 
1 95 CYS n 
1 96 THR n 
1 97 LEU n 
1 98 ASN n 
1 99 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 pol 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human immunodeficiency virus 1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11676 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-11b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q994Q3_9HIV1 
_struct_ref.pdbx_db_accession          Q994Q3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQILIEICGKKAIGTVLVGPT
PVNIIGRNMLTQLGCTLNF
;
_struct_ref.pdbx_align_begin           59 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3U71 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 99 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q994Q3 
_struct_ref_seq.db_align_beg                  59 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  157 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       99 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             3U71 
_struct_ref_seq_dif.mon_id                       LYS 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      7 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q994Q3 
_struct_ref_seq_dif.db_mon_id                    GLN 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          65 
_struct_ref_seq_dif.details                      'ENGINEERED MUTATION' 
_struct_ref_seq_dif.pdbx_auth_seq_num            7 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3U71 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   49.75 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
'0.2 M sodium citrate tribasic dihydrate, 20% w/v PEG3350, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'Bruker Platinum 135' 
_diffrn_detector.pdbx_collection_date   2009-10-05 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'BRUKER AXS MICROSTAR' 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     3U71 
_reflns.d_resolution_high            2.697 
_reflns.number_obs                   3193 
_reflns.pdbx_netI_over_sigmaI        91.204 
_reflns.pdbx_Rsym_value              0.200 
_reflns.pdbx_redundancy              8.180 
_reflns.percent_possible_obs         98.760 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_low             49.98 
_reflns.number_all                   ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.697 2.794 ? ? ? ? ? 0.413 ? ? ? ? ? 1  1 
2.794 2.906 ? ? ? ? ? 0.333 ? ? ? ? ? 2  1 
2.906 3.038 ? ? ? ? ? 0.306 ? ? ? ? ? 3  1 
3.038 3.198 ? ? ? ? ? 0.292 ? ? ? ? ? 4  1 
3.198 3.398 ? ? ? ? ? 0.276 ? ? ? ? ? 5  1 
3.398 3.661 ? ? ? ? ? 0.291 ? ? ? ? ? 6  1 
3.661 4.029 ? ? ? ? ? 0.260 ? ? ? ? ? 7  1 
4.029 4.612 ? ? ? ? ? 0.186 ? ? ? ? ? 8  1 
4.612 5.809 ? ? ? ? ? 0.148 ? ? ? ? ? 9  1 
5.809 ?     ? ? ? ? ? 0.148 ? ? ? ? ? 10 1 
# 
_refine.entry_id                                 3U71 
_refine.ls_d_res_high                            2.7200 
_refine.ls_d_res_low                             41.7300 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    100.0000 
_refine.ls_number_reflns_obs                     3193 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2195 
_refine.ls_R_factor_R_work                       0.2167 
_refine.ls_wR_factor_R_work                      0.2035 
_refine.ls_R_factor_R_free                       0.2826 
_refine.ls_wR_factor_R_free                      0.2448 
_refine.ls_percent_reflns_R_free                 4.3000 
_refine.ls_number_reflns_R_free                  137 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               25.7907 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.0800 
_refine.aniso_B[2][2]                            0.0800 
_refine.aniso_B[3][3]                            -0.1600 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9220 
_refine.correlation_coeff_Fo_to_Fc_free          0.8600 
_refine.overall_SU_R_Cruickshank_DPI             2.7395 
_refine.overall_SU_R_free                        0.3877 
_refine.pdbx_overall_ESU_R_Free                  0.3880 
_refine.overall_SU_ML                            0.3130 
_refine.overall_SU_B                             36.1500 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      2R8N 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.7822 
_refine.B_iso_max                                48.230 
_refine.B_iso_min                                11.200 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        755 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               755 
_refine_hist.d_res_high                       2.7200 
_refine_hist.d_res_low                        41.7300 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       767  0.017  0.022  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1037 1.776  1.998  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 98   6.389  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 25   38.890 25.600 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 147  17.039 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 3    6.506  15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         124  0.110  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   541  0.005  0.021  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            488  0.641  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           793  1.223  2.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it            279  1.702  3.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it           244  2.899  4.500  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.7200 
_refine_ls_shell.d_res_low                        2.7910 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               100.0000 
_refine_ls_shell.number_reflns_R_work             208 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3500 
_refine_ls_shell.R_factor_R_free                  0.3050 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             9 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                217 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3U71 
_struct.title                     'Crystal Structure Analysis of South African wild type HIV-1 Subtype C Protease' 
_struct.pdbx_descriptor           'HIV-1 Protease' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3U71 
_struct_keywords.text            'Beta sheet, apo, protease, South African, non-B subtype, viral polyprotein, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       GLY 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        86 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       THR 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        91 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        GLY 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         86 
_struct_conf.end_auth_comp_id        THR 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         91 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   8 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 43 ? GLY A 48 ? LYS A 43 GLY A 48 
A 2 PHE A 53 ? ILE A 66 ? PHE A 53 ILE A 66 
A 3 LYS A 69 ? VAL A 77 ? LYS A 69 VAL A 77 
A 4 VAL A 32 ? LEU A 33 ? VAL A 32 LEU A 33 
A 5 ASN A 83 ? ILE A 85 ? ASN A 83 ILE A 85 
A 6 GLN A 18 ? LEU A 24 ? GLN A 18 LEU A 24 
A 7 LEU A 10 ? VAL A 15 ? LEU A 10 VAL A 15 
A 8 PHE A 53 ? ILE A 66 ? PHE A 53 ILE A 66 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 47 ? N ILE A 47 O ILE A 54 ? O ILE A 54 
A 2 3 N ILE A 62 ? N ILE A 62 O GLY A 73 ? O GLY A 73 
A 3 4 O LEU A 76 ? O LEU A 76 N LEU A 33 ? N LEU A 33 
A 4 5 N VAL A 32 ? N VAL A 32 O ILE A 84 ? O ILE A 84 
A 5 6 O ASN A 83 ? O ASN A 83 N LEU A 23 ? N LEU A 23 
A 6 7 O ALA A 22 ? O ALA A 22 N VAL A 11 ? N VAL A 11 
A 7 8 N LYS A 14 ? N LYS A 14 O GLU A 65 ? O GLU A 65 
# 
_atom_sites.entry_id                    3U71 
_atom_sites.fract_transf_matrix[1][1]   0.021773 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021773 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010004 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1   N N   . PRO A 1 1  ? 4.813   10.671  -8.002  1.00 31.75 ? 1  PRO A N   1 
ATOM 2   C CA  . PRO A 1 1  ? 3.876   11.267  -7.080  1.00 31.87 ? 1  PRO A CA  1 
ATOM 3   C C   . PRO A 1 1  ? 4.040   10.715  -5.689  1.00 31.10 ? 1  PRO A C   1 
ATOM 4   O O   . PRO A 1 1  ? 4.600   9.657   -5.533  1.00 30.75 ? 1  PRO A O   1 
ATOM 5   C CB  . PRO A 1 1  ? 2.510   10.851  -7.651  1.00 31.02 ? 1  PRO A CB  1 
ATOM 6   C CG  . PRO A 1 1  ? 2.735   9.596   -8.292  1.00 30.46 ? 1  PRO A CG  1 
ATOM 7   C CD  . PRO A 1 1  ? 4.149   9.666   -8.851  1.00 32.06 ? 1  PRO A CD  1 
ATOM 8   N N   . GLN A 1 2  ? 3.574   11.460  -4.695  1.00 31.76 ? 2  GLN A N   1 
ATOM 9   C CA  . GLN A 1 2  ? 3.485   11.007  -3.310  1.00 31.42 ? 2  GLN A CA  1 
ATOM 10  C C   . GLN A 1 2  ? 2.015   10.878  -3.096  1.00 30.56 ? 2  GLN A C   1 
ATOM 11  O O   . GLN A 1 2  ? 1.285   11.852  -3.316  1.00 31.36 ? 2  GLN A O   1 
ATOM 12  C CB  . GLN A 1 2  ? 4.025   12.075  -2.361  1.00 32.64 ? 2  GLN A CB  1 
ATOM 13  C CG  . GLN A 1 2  ? 4.074   11.712  -0.865  1.00 34.43 ? 2  GLN A CG  1 
ATOM 14  C CD  . GLN A 1 2  ? 4.530   12.903  0.005   1.00 37.22 ? 2  GLN A CD  1 
ATOM 15  O OE1 . GLN A 1 2  ? 3.934   13.961  -0.037  1.00 39.19 ? 2  GLN A OE1 1 
ATOM 16  N NE2 . GLN A 1 2  ? 5.580   12.719  0.784   1.00 39.15 ? 2  GLN A NE2 1 
ATOM 17  N N   . ILE A 1 3  ? 1.566   9.690   -2.704  1.00 28.67 ? 3  ILE A N   1 
ATOM 18  C CA  . ILE A 1 3  ? 0.137   9.458   -2.604  1.00 27.06 ? 3  ILE A CA  1 
ATOM 19  C C   . ILE A 1 3  ? -0.251  9.362   -1.158  1.00 26.43 ? 3  ILE A C   1 
ATOM 20  O O   . ILE A 1 3  ? 0.365   8.634   -0.407  1.00 26.27 ? 3  ILE A O   1 
ATOM 21  C CB  . ILE A 1 3  ? -0.312  8.240   -3.444  1.00 26.02 ? 3  ILE A CB  1 
ATOM 22  C CG1 . ILE A 1 3  ? -0.032  8.516   -4.914  1.00 24.34 ? 3  ILE A CG1 1 
ATOM 23  C CG2 . ILE A 1 3  ? -1.807  7.945   -3.267  1.00 26.06 ? 3  ILE A CG2 1 
ATOM 24  C CD1 . ILE A 1 3  ? -0.917  7.803   -5.821  1.00 21.91 ? 3  ILE A CD1 1 
ATOM 25  N N   . THR A 1 4  ? -1.261  10.132  -0.777  1.00 26.57 ? 4  THR A N   1 
ATOM 26  C CA  . THR A 1 4  ? -1.803  10.119  0.582   1.00 26.33 ? 4  THR A CA  1 
ATOM 27  C C   . THR A 1 4  ? -2.940  9.111   0.764   1.00 25.61 ? 4  THR A C   1 
ATOM 28  O O   . THR A 1 4  ? -3.692  8.808   -0.179  1.00 26.31 ? 4  THR A O   1 
ATOM 29  C CB  . THR A 1 4  ? -2.305  11.475  0.928   1.00 27.11 ? 4  THR A CB  1 
ATOM 30  O OG1 . THR A 1 4  ? -1.242  12.386  0.720   1.00 27.74 ? 4  THR A OG1 1 
ATOM 31  C CG2 . THR A 1 4  ? -2.652  11.533  2.354   1.00 28.16 ? 4  THR A CG2 1 
ATOM 32  N N   . LEU A 1 5  ? -3.073  8.574   1.967   1.00 24.45 ? 5  LEU A N   1 
ATOM 33  C CA  . LEU A 1 5  ? -3.968  7.438   2.110   1.00 23.30 ? 5  LEU A CA  1 
ATOM 34  C C   . LEU A 1 5  ? -5.253  7.760   2.883   1.00 23.55 ? 5  LEU A C   1 
ATOM 35  O O   . LEU A 1 5  ? -5.838  6.917   3.598   1.00 23.02 ? 5  LEU A O   1 
ATOM 36  C CB  . LEU A 1 5  ? -3.198  6.230   2.637   1.00 22.70 ? 5  LEU A CB  1 
ATOM 37  C CG  . LEU A 1 5  ? -2.011  5.854   1.730   1.00 20.87 ? 5  LEU A CG  1 
ATOM 38  C CD1 . LEU A 1 5  ? -1.036  4.949   2.420   1.00 18.47 ? 5  LEU A CD1 1 
ATOM 39  C CD2 . LEU A 1 5  ? -2.475  5.274   0.416   1.00 18.01 ? 5  LEU A CD2 1 
ATOM 40  N N   . TRP A 1 6  ? -5.676  9.004   2.679   1.00 23.87 ? 6  TRP A N   1 
ATOM 41  C CA  . TRP A 1 6  ? -6.913  9.529   3.171   1.00 24.09 ? 6  TRP A CA  1 
ATOM 42  C C   . TRP A 1 6  ? -8.023  8.955   2.329   1.00 24.47 ? 6  TRP A C   1 
ATOM 43  O O   . TRP A 1 6  ? -9.044  8.554   2.881   1.00 24.93 ? 6  TRP A O   1 
ATOM 44  C CB  . TRP A 1 6  ? -6.912  11.047  3.049   1.00 24.89 ? 6  TRP A CB  1 
ATOM 45  C CG  . TRP A 1 6  ? -5.994  11.692  3.982   1.00 24.22 ? 6  TRP A CG  1 
ATOM 46  C CD1 . TRP A 1 6  ? -4.837  12.327  3.671   1.00 23.86 ? 6  TRP A CD1 1 
ATOM 47  C CD2 . TRP A 1 6  ? -6.127  11.766  5.405   1.00 24.56 ? 6  TRP A CD2 1 
ATOM 48  N NE1 . TRP A 1 6  ? -4.232  12.803  4.815   1.00 24.56 ? 6  TRP A NE1 1 
ATOM 49  C CE2 . TRP A 1 6  ? -5.009  12.474  5.892   1.00 23.76 ? 6  TRP A CE2 1 
ATOM 50  C CE3 . TRP A 1 6  ? -7.085  11.300  6.319   1.00 25.69 ? 6  TRP A CE3 1 
ATOM 51  C CZ2 . TRP A 1 6  ? -4.810  12.714  7.244   1.00 23.31 ? 6  TRP A CZ2 1 
ATOM 52  C CZ3 . TRP A 1 6  ? -6.895  11.555  7.667   1.00 25.07 ? 6  TRP A CZ3 1 
ATOM 53  C CH2 . TRP A 1 6  ? -5.761  12.254  8.116   1.00 23.72 ? 6  TRP A CH2 1 
ATOM 54  N N   . LYS A 1 7  ? -7.827  8.941   1.005   1.00 24.10 ? 7  LYS A N   1 
ATOM 55  C CA  . LYS A 1 7  ? -8.759  8.316   0.080   1.00 24.46 ? 7  LYS A CA  1 
ATOM 56  C C   . LYS A 1 7  ? -8.218  6.984   -0.395  1.00 23.52 ? 7  LYS A C   1 
ATOM 57  O O   . LYS A 1 7  ? -7.019  6.724   -0.302  1.00 23.60 ? 7  LYS A O   1 
ATOM 58  C CB  . LYS A 1 7  ? -8.960  9.173   -1.165  1.00 25.59 ? 7  LYS A CB  1 
ATOM 59  C CG  . LYS A 1 7  ? -9.483  10.584  -0.955  1.00 29.13 ? 7  LYS A CG  1 
ATOM 60  C CD  . LYS A 1 7  ? -9.064  11.488  -2.125  1.00 32.69 ? 7  LYS A CD  1 
ATOM 61  C CE  . LYS A 1 7  ? -9.960  11.326  -3.367  1.00 34.53 ? 7  LYS A CE  1 
ATOM 62  N NZ  . LYS A 1 7  ? -11.376 11.813  -3.136  1.00 34.11 ? 7  LYS A NZ  1 
ATOM 63  N N   . ARG A 1 8  ? -9.088  6.139   -0.945  1.00 22.86 ? 8  ARG A N   1 
ATOM 64  C CA  . ARG A 1 8  ? -8.609  4.949   -1.628  1.00 21.44 ? 8  ARG A CA  1 
ATOM 65  C C   . ARG A 1 8  ? -7.633  5.361   -2.751  1.00 21.27 ? 8  ARG A C   1 
ATOM 66  O O   . ARG A 1 8  ? -7.993  6.184   -3.583  1.00 22.36 ? 8  ARG A O   1 
ATOM 67  C CB  . ARG A 1 8  ? -9.771  4.204   -2.245  1.00 21.11 ? 8  ARG A CB  1 
ATOM 68  C CG  . ARG A 1 8  ? -10.574 3.369   -1.341  1.00 19.94 ? 8  ARG A CG  1 
ATOM 69  C CD  . ARG A 1 8  ? -11.541 2.675   -2.217  1.00 22.13 ? 8  ARG A CD  1 
ATOM 70  N NE  . ARG A 1 8  ? -12.258 1.635   -1.517  1.00 26.07 ? 8  ARG A NE  1 
ATOM 71  C CZ  . ARG A 1 8  ? -13.453 1.800   -0.972  1.00 28.19 ? 8  ARG A CZ  1 
ATOM 72  N NH1 . ARG A 1 8  ? -14.066 2.978   -1.069  1.00 31.51 ? 8  ARG A NH1 1 
ATOM 73  N NH2 . ARG A 1 8  ? -14.040 0.789   -0.343  1.00 26.76 ? 8  ARG A NH2 1 
ATOM 74  N N   . PRO A 1 9  ? -6.408  4.793   -2.789  1.00 20.29 ? 9  PRO A N   1 
ATOM 75  C CA  . PRO A 1 9  ? -5.446  5.175   -3.841  1.00 20.23 ? 9  PRO A CA  1 
ATOM 76  C C   . PRO A 1 9  ? -5.849  4.693   -5.227  1.00 19.78 ? 9  PRO A C   1 
ATOM 77  O O   . PRO A 1 9  ? -5.209  3.816   -5.795  1.00 19.04 ? 9  PRO A O   1 
ATOM 78  C CB  . PRO A 1 9  ? -4.141  4.499   -3.391  1.00 19.55 ? 9  PRO A CB  1 
ATOM 79  C CG  . PRO A 1 9  ? -4.590  3.359   -2.589  1.00 18.96 ? 9  PRO A CG  1 
ATOM 80  C CD  . PRO A 1 9  ? -5.859  3.759   -1.900  1.00 19.28 ? 9  PRO A CD  1 
ATOM 81  N N   . LEU A 1 10 ? -6.923  5.261   -5.752  1.00 20.55 ? 10 LEU A N   1 
ATOM 82  C CA  . LEU A 1 10 ? -7.432  4.862   -7.059  1.00 20.90 ? 10 LEU A CA  1 
ATOM 83  C C   . LEU A 1 10 ? -6.793  5.751   -8.080  1.00 21.89 ? 10 LEU A C   1 
ATOM 84  O O   . LEU A 1 10 ? -6.882  6.969   -8.006  1.00 23.22 ? 10 LEU A O   1 
ATOM 85  C CB  . LEU A 1 10 ? -8.953  4.962   -7.140  1.00 20.85 ? 10 LEU A CB  1 
ATOM 86  C CG  . LEU A 1 10 ? -9.705  3.904   -6.333  1.00 20.45 ? 10 LEU A CG  1 
ATOM 87  C CD1 . LEU A 1 10 ? -11.130 4.340   -6.074  1.00 20.35 ? 10 LEU A CD1 1 
ATOM 88  C CD2 . LEU A 1 10 ? -9.653  2.521   -6.980  1.00 18.76 ? 10 LEU A CD2 1 
ATOM 89  N N   . VAL A 1 11 ? -6.117  5.137   -9.032  1.00 22.17 ? 11 VAL A N   1 
ATOM 90  C CA  . VAL A 1 11 ? -5.413  5.889   -10.057 1.00 22.40 ? 11 VAL A CA  1 
ATOM 91  C C   . VAL A 1 11 ? -5.876  5.458   -11.436 1.00 22.69 ? 11 VAL A C   1 
ATOM 92  O O   . VAL A 1 11 ? -6.398  4.342   -11.628 1.00 21.76 ? 11 VAL A O   1 
ATOM 93  C CB  . VAL A 1 11 ? -3.875  5.733   -9.930  1.00 21.72 ? 11 VAL A CB  1 
ATOM 94  C CG1 . VAL A 1 11 ? -3.393  6.378   -8.673  1.00 22.21 ? 11 VAL A CG1 1 
ATOM 95  C CG2 . VAL A 1 11 ? -3.490  4.280   -9.919  1.00 20.00 ? 11 VAL A CG2 1 
ATOM 96  N N   . SER A 1 12 ? -5.678  6.365   -12.387 1.00 23.80 ? 12 SER A N   1 
ATOM 97  C CA  . SER A 1 12 ? -5.836  6.052   -13.791 1.00 24.47 ? 12 SER A CA  1 
ATOM 98  C C   . SER A 1 12 ? -4.611  5.289   -14.376 1.00 23.75 ? 12 SER A C   1 
ATOM 99  O O   . SER A 1 12 ? -3.432  5.685   -14.186 1.00 23.83 ? 12 SER A O   1 
ATOM 100 C CB  . SER A 1 12 ? -6.131  7.320   -14.579 1.00 25.82 ? 12 SER A CB  1 
ATOM 101 O OG  . SER A 1 12 ? -6.942  7.009   -15.706 1.00 28.14 ? 12 SER A OG  1 
ATOM 102 N N   . ILE A 1 13 ? -4.923  4.200   -15.087 1.00 22.52 ? 13 ILE A N   1 
ATOM 103 C CA  . ILE A 1 13 ? -3.924  3.325   -15.686 1.00 20.96 ? 13 ILE A CA  1 
ATOM 104 C C   . ILE A 1 13 ? -4.122  3.097   -17.181 1.00 20.28 ? 13 ILE A C   1 
ATOM 105 O O   . ILE A 1 13 ? -5.248  2.992   -17.658 1.00 19.87 ? 13 ILE A O   1 
ATOM 106 C CB  . ILE A 1 13 ? -3.832  1.947   -14.950 1.00 20.52 ? 13 ILE A CB  1 
ATOM 107 C CG1 . ILE A 1 13 ? -4.987  1.038   -15.256 1.00 18.47 ? 13 ILE A CG1 1 
ATOM 108 C CG2 . ILE A 1 13 ? -3.743  2.111   -13.442 1.00 21.20 ? 13 ILE A CG2 1 
ATOM 109 C CD1 . ILE A 1 13 ? -4.661  -0.316  -14.876 1.00 18.02 ? 13 ILE A CD1 1 
ATOM 110 N N   . LYS A 1 14 ? -3.003  3.033   -17.896 1.00 19.70 ? 14 LYS A N   1 
ATOM 111 C CA  . LYS A 1 14 ? -2.966  2.743   -19.328 1.00 18.87 ? 14 LYS A CA  1 
ATOM 112 C C   . LYS A 1 14 ? -2.388  1.364   -19.529 1.00 18.28 ? 14 LYS A C   1 
ATOM 113 O O   . LYS A 1 14 ? -1.209  1.141   -19.313 1.00 18.04 ? 14 LYS A O   1 
ATOM 114 C CB  . LYS A 1 14 ? -2.097  3.748   -20.058 1.00 18.86 ? 14 LYS A CB  1 
ATOM 115 C CG  . LYS A 1 14 ? -2.610  5.140   -20.044 1.00 18.38 ? 14 LYS A CG  1 
ATOM 116 C CD  . LYS A 1 14 ? -1.544  5.990   -20.627 1.00 20.86 ? 14 LYS A CD  1 
ATOM 117 C CE  . LYS A 1 14 ? -2.089  7.046   -21.535 1.00 23.91 ? 14 LYS A CE  1 
ATOM 118 N NZ  . LYS A 1 14 ? -1.069  8.125   -21.652 1.00 27.22 ? 14 LYS A NZ  1 
ATOM 119 N N   . VAL A 1 15 ? -3.251  0.446   -19.934 1.00 18.41 ? 15 VAL A N   1 
ATOM 120 C CA  . VAL A 1 15 ? -2.917  -0.956  -20.163 1.00 18.33 ? 15 VAL A CA  1 
ATOM 121 C C   . VAL A 1 15 ? -3.667  -1.416  -21.398 1.00 18.92 ? 15 VAL A C   1 
ATOM 122 O O   . VAL A 1 15 ? -4.870  -1.205  -21.480 1.00 19.45 ? 15 VAL A O   1 
ATOM 123 C CB  . VAL A 1 15 ? -3.339  -1.853  -18.968 1.00 17.36 ? 15 VAL A CB  1 
ATOM 124 C CG1 . VAL A 1 15 ? -4.808  -1.850  -18.816 1.00 18.11 ? 15 VAL A CG1 1 
ATOM 125 C CG2 . VAL A 1 15 ? -2.902  -3.278  -19.161 1.00 17.06 ? 15 VAL A CG2 1 
ATOM 126 N N   . GLY A 1 16 ? -2.949  -2.006  -22.357 1.00 19.58 ? 16 GLY A N   1 
ATOM 127 C CA  . GLY A 1 16 ? -3.547  -2.665  -23.524 1.00 19.84 ? 16 GLY A CA  1 
ATOM 128 C C   . GLY A 1 16 ? -4.455  -1.813  -24.389 1.00 20.30 ? 16 GLY A C   1 
ATOM 129 O O   . GLY A 1 16 ? -5.431  -2.312  -24.937 1.00 20.14 ? 16 GLY A O   1 
ATOM 130 N N   . GLY A 1 17 ? -4.147  -0.523  -24.491 1.00 21.03 ? 17 GLY A N   1 
ATOM 131 C CA  . GLY A 1 17 ? -4.912  0.383   -25.347 1.00 22.82 ? 17 GLY A CA  1 
ATOM 132 C C   . GLY A 1 17 ? -6.176  0.941   -24.723 1.00 23.87 ? 17 GLY A C   1 
ATOM 133 O O   . GLY A 1 17 ? -6.914  1.714   -25.346 1.00 24.86 ? 17 GLY A O   1 
ATOM 134 N N   . GLN A 1 18 ? -6.416  0.527   -23.491 1.00 24.17 ? 18 GLN A N   1 
ATOM 135 C CA  . GLN A 1 18 ? -7.518  0.966   -22.699 1.00 25.06 ? 18 GLN A CA  1 
ATOM 136 C C   . GLN A 1 18 ? -6.962  1.867   -21.644 1.00 24.70 ? 18 GLN A C   1 
ATOM 137 O O   . GLN A 1 18 ? -5.791  1.751   -21.275 1.00 24.42 ? 18 GLN A O   1 
ATOM 138 C CB  . GLN A 1 18 ? -8.148  -0.227  -21.971 1.00 25.84 ? 18 GLN A CB  1 
ATOM 139 C CG  . GLN A 1 18 ? -8.729  -1.338  -22.853 1.00 28.39 ? 18 GLN A CG  1 
ATOM 140 C CD  . GLN A 1 18 ? -9.433  -0.780  -24.041 1.00 33.80 ? 18 GLN A CD  1 
ATOM 141 O OE1 . GLN A 1 18 ? -10.273 0.131   -23.923 1.00 36.36 ? 18 GLN A OE1 1 
ATOM 142 N NE2 . GLN A 1 18 ? -9.082  -1.294  -25.218 1.00 37.31 ? 18 GLN A NE2 1 
ATOM 143 N N   . ILE A 1 19 ? -7.818  2.755   -21.151 1.00 24.77 ? 19 ILE A N   1 
ATOM 144 C CA  . ILE A 1 19 ? -7.558  3.483   -19.925 1.00 24.26 ? 19 ILE A CA  1 
ATOM 145 C C   . ILE A 1 19 ? -8.591  3.030   -18.909 1.00 24.08 ? 19 ILE A C   1 
ATOM 146 O O   . ILE A 1 19 ? -9.767  3.248   -19.124 1.00 24.97 ? 19 ILE A O   1 
ATOM 147 C CB  . ILE A 1 19 ? -7.645  4.994   -20.118 1.00 24.82 ? 19 ILE A CB  1 
ATOM 148 C CG1 . ILE A 1 19 ? -6.543  5.506   -21.075 1.00 24.45 ? 19 ILE A CG1 1 
ATOM 149 C CG2 . ILE A 1 19 ? -7.548  5.647   -18.790 1.00 25.00 ? 19 ILE A CG2 1 
ATOM 150 C CD1 . ILE A 1 19 ? -6.652  7.001   -21.461 1.00 24.08 ? 19 ILE A CD1 1 
ATOM 151 N N   . LYS A 1 20 ? -8.140  2.377   -17.833 1.00 23.47 ? 20 LYS A N   1 
ATOM 152 C CA  . LYS A 1 20 ? -8.997  1.863   -16.771 1.00 23.29 ? 20 LYS A CA  1 
ATOM 153 C C   . LYS A 1 20 ? -8.677  2.575   -15.467 1.00 22.86 ? 20 LYS A C   1 
ATOM 154 O O   . LYS A 1 20 ? -7.779  3.411   -15.411 1.00 22.71 ? 20 LYS A O   1 
ATOM 155 C CB  . LYS A 1 20 ? -8.764  0.381   -16.542 1.00 23.13 ? 20 LYS A CB  1 
ATOM 156 C CG  . LYS A 1 20 ? -9.141  -0.569  -17.667 1.00 26.55 ? 20 LYS A CG  1 
ATOM 157 C CD  . LYS A 1 20 ? -10.545 -0.320  -18.243 1.00 31.98 ? 20 LYS A CD  1 
ATOM 158 C CE  . LYS A 1 20 ? -10.910 -1.391  -19.298 1.00 33.56 ? 20 LYS A CE  1 
ATOM 159 N NZ  . LYS A 1 20 ? -12.026 -0.968  -20.209 1.00 34.44 ? 20 LYS A NZ  1 
ATOM 160 N N   . GLU A 1 21 ? -9.415  2.243   -14.415 1.00 22.60 ? 21 GLU A N   1 
ATOM 161 C CA  . GLU A 1 21 ? -9.118  2.771   -13.089 1.00 22.53 ? 21 GLU A CA  1 
ATOM 162 C C   . GLU A 1 21 ? -8.815  1.637   -12.106 1.00 21.16 ? 21 GLU A C   1 
ATOM 163 O O   . GLU A 1 21 ? -9.581  0.671   -12.032 1.00 20.92 ? 21 GLU A O   1 
ATOM 164 C CB  . GLU A 1 21 ? -10.298 3.574   -12.592 1.00 23.84 ? 21 GLU A CB  1 
ATOM 165 C CG  . GLU A 1 21 ? -9.990  4.385   -11.349 1.00 26.41 ? 21 GLU A CG  1 
ATOM 166 C CD  . GLU A 1 21 ? -11.239 4.900   -10.653 1.00 30.08 ? 21 GLU A CD  1 
ATOM 167 O OE1 . GLU A 1 21 ? -12.007 4.080   -10.069 1.00 30.42 ? 21 GLU A OE1 1 
ATOM 168 O OE2 . GLU A 1 21 ? -11.431 6.133   -10.686 1.00 30.98 ? 21 GLU A OE2 1 
ATOM 169 N N   . ALA A 1 22 ? -7.722  1.757   -11.350 1.00 19.68 ? 22 ALA A N   1 
ATOM 170 C CA  . ALA A 1 22 ? -7.213  0.630   -10.587 1.00 18.39 ? 22 ALA A CA  1 
ATOM 171 C C   . ALA A 1 22 ? -6.644  1.036   -9.270  1.00 18.21 ? 22 ALA A C   1 
ATOM 172 O O   . ALA A 1 22 ? -6.164  2.143   -9.137  1.00 19.53 ? 22 ALA A O   1 
ATOM 173 C CB  . ALA A 1 22 ? -6.157  -0.043  -11.372 1.00 18.49 ? 22 ALA A CB  1 
ATOM 174 N N   . LEU A 1 23 ? -6.633  0.129   -8.303  1.00 17.46 ? 23 LEU A N   1 
ATOM 175 C CA  . LEU A 1 23 ? -6.225  0.473   -6.943  1.00 16.89 ? 23 LEU A CA  1 
ATOM 176 C C   . LEU A 1 23 ? -4.794  0.071   -6.671  1.00 17.29 ? 23 LEU A C   1 
ATOM 177 O O   . LEU A 1 23 ? -4.399  -1.067  -6.965  1.00 18.04 ? 23 LEU A O   1 
ATOM 178 C CB  . LEU A 1 23 ? -7.135  -0.219  -5.941  1.00 16.35 ? 23 LEU A CB  1 
ATOM 179 C CG  . LEU A 1 23 ? -6.894  -0.099  -4.435  1.00 15.18 ? 23 LEU A CG  1 
ATOM 180 C CD1 . LEU A 1 23 ? -7.502  1.134   -3.908  1.00 14.52 ? 23 LEU A CD1 1 
ATOM 181 C CD2 . LEU A 1 23 ? -7.512  -1.261  -3.763  1.00 12.77 ? 23 LEU A CD2 1 
ATOM 182 N N   . LEU A 1 24 ? -4.015  0.995   -6.102  1.00 17.35 ? 24 LEU A N   1 
ATOM 183 C CA  . LEU A 1 24 ? -2.658  0.703   -5.619  1.00 16.16 ? 24 LEU A CA  1 
ATOM 184 C C   . LEU A 1 24 ? -2.749  -0.040  -4.304  1.00 15.94 ? 24 LEU A C   1 
ATOM 185 O O   . LEU A 1 24 ? -3.026  0.559   -3.261  1.00 15.63 ? 24 LEU A O   1 
ATOM 186 C CB  . LEU A 1 24 ? -1.853  1.990   -5.421  1.00 16.31 ? 24 LEU A CB  1 
ATOM 187 C CG  . LEU A 1 24 ? -1.658  2.893   -6.638  1.00 16.78 ? 24 LEU A CG  1 
ATOM 188 C CD1 . LEU A 1 24 ? -0.421  3.793   -6.518  1.00 14.38 ? 24 LEU A CD1 1 
ATOM 189 C CD2 . LEU A 1 24 ? -1.600  2.037   -7.900  1.00 15.54 ? 24 LEU A CD2 1 
ATOM 190 N N   . ASP A 1 25 ? -2.505  -1.344  -4.356  1.00 15.74 ? 25 ASP A N   1 
ATOM 191 C CA  . ASP A 1 25 ? -2.795  -2.241  -3.237  1.00 15.63 ? 25 ASP A CA  1 
ATOM 192 C C   . ASP A 1 25 ? -1.585  -3.025  -2.747  1.00 15.44 ? 25 ASP A C   1 
ATOM 193 O O   . ASP A 1 25 ? -1.250  -4.056  -3.309  1.00 15.93 ? 25 ASP A O   1 
ATOM 194 C CB  . ASP A 1 25 ? -3.880  -3.218  -3.678  1.00 15.73 ? 25 ASP A CB  1 
ATOM 195 C CG  . ASP A 1 25 ? -4.389  -4.059  -2.556  1.00 17.25 ? 25 ASP A CG  1 
ATOM 196 O OD1 . ASP A 1 25 ? -3.684  -4.135  -1.539  1.00 21.78 ? 25 ASP A OD1 1 
ATOM 197 O OD2 . ASP A 1 25 ? -5.492  -4.634  -2.668  1.00 17.95 ? 25 ASP A OD2 1 
ATOM 198 N N   . THR A 1 26 ? -0.945  -2.572  -1.683  1.00 15.41 ? 26 THR A N   1 
ATOM 199 C CA  . THR A 1 26 ? 0.274   -3.234  -1.222  1.00 15.76 ? 26 THR A CA  1 
ATOM 200 C C   . THR A 1 26 ? -0.020  -4.588  -0.553  1.00 16.42 ? 26 THR A C   1 
ATOM 201 O O   . THR A 1 26 ? 0.890   -5.441  -0.370  1.00 17.46 ? 26 THR A O   1 
ATOM 202 C CB  . THR A 1 26 ? 1.088   -2.327  -0.306  1.00 15.76 ? 26 THR A CB  1 
ATOM 203 O OG1 . THR A 1 26 ? 0.347   -2.045  0.879   1.00 16.74 ? 26 THR A OG1 1 
ATOM 204 C CG2 . THR A 1 26 ? 1.372   -1.016  -0.987  1.00 15.26 ? 26 THR A CG2 1 
ATOM 205 N N   . GLY A 1 27 ? -1.297  -4.790  -0.224  1.00 16.12 ? 27 GLY A N   1 
ATOM 206 C CA  . GLY A 1 27 ? -1.764  -6.007  0.386   1.00 16.47 ? 27 GLY A CA  1 
ATOM 207 C C   . GLY A 1 27 ? -1.859  -7.154  -0.602  1.00 17.37 ? 27 GLY A C   1 
ATOM 208 O O   . GLY A 1 27 ? -1.936  -8.311  -0.181  1.00 17.07 ? 27 GLY A O   1 
ATOM 209 N N   . ALA A 1 28 ? -1.851  -6.823  -1.903  1.00 18.31 ? 28 ALA A N   1 
ATOM 210 C CA  . ALA A 1 28 ? -1.994  -7.788  -3.016  1.00 19.53 ? 28 ALA A CA  1 
ATOM 211 C C   . ALA A 1 28 ? -0.641  -8.205  -3.576  1.00 20.75 ? 28 ALA A C   1 
ATOM 212 O O   . ALA A 1 28 ? 0.214   -7.356  -3.826  1.00 21.24 ? 28 ALA A O   1 
ATOM 213 C CB  . ALA A 1 28 ? -2.812  -7.206  -4.111  1.00 19.16 ? 28 ALA A CB  1 
ATOM 214 N N   . ASP A 1 29 ? -0.439  -9.509  -3.765  1.00 22.05 ? 29 ASP A N   1 
ATOM 215 C CA  . ASP A 1 29 ? 0.829   -9.981  -4.279  1.00 23.42 ? 29 ASP A CA  1 
ATOM 216 C C   . ASP A 1 29 ? 0.875   -9.650  -5.736  1.00 23.53 ? 29 ASP A C   1 
ATOM 217 O O   . ASP A 1 29 ? 1.854   -9.095  -6.179  1.00 23.97 ? 29 ASP A O   1 
ATOM 218 C CB  . ASP A 1 29 ? 1.013   -11.494 -4.113  1.00 24.96 ? 29 ASP A CB  1 
ATOM 219 C CG  . ASP A 1 29 ? 0.944   -11.962 -2.669  1.00 26.79 ? 29 ASP A CG  1 
ATOM 220 O OD1 . ASP A 1 29 ? 1.538   -11.314 -1.776  1.00 29.18 ? 29 ASP A OD1 1 
ATOM 221 O OD2 . ASP A 1 29 ? 0.311   -13.019 -2.442  1.00 29.55 ? 29 ASP A OD2 1 
ATOM 222 N N   . ASP A 1 30 ? -0.214  -9.963  -6.449  1.00 24.30 ? 30 ASP A N   1 
ATOM 223 C CA  . ASP A 1 30 ? -0.322  -9.949  -7.939  1.00 25.09 ? 30 ASP A CA  1 
ATOM 224 C C   . ASP A 1 30 ? -1.212  -8.820  -8.525  1.00 24.64 ? 30 ASP A C   1 
ATOM 225 O O   . ASP A 1 30 ? -1.879  -8.109  -7.773  1.00 24.61 ? 30 ASP A O   1 
ATOM 226 C CB  . ASP A 1 30 ? -0.823  -11.326 -8.433  1.00 25.50 ? 30 ASP A CB  1 
ATOM 227 C CG  . ASP A 1 30 ? -0.127  -12.500 -7.730  1.00 27.58 ? 30 ASP A CG  1 
ATOM 228 O OD1 . ASP A 1 30 ? 1.121   -12.573 -7.753  1.00 30.41 ? 30 ASP A OD1 1 
ATOM 229 O OD2 . ASP A 1 30 ? -0.821  -13.361 -7.151  1.00 28.31 ? 30 ASP A OD2 1 
ATOM 230 N N   . THR A 1 31 ? -1.223  -8.662  -9.856  1.00 24.64 ? 31 THR A N   1 
ATOM 231 C CA  . THR A 1 31 ? -2.032  -7.616  -10.498 1.00 23.98 ? 31 THR A CA  1 
ATOM 232 C C   . THR A 1 31 ? -3.203  -8.188  -11.276 1.00 24.62 ? 31 THR A C   1 
ATOM 233 O O   . THR A 1 31 ? -3.031  -8.894  -12.258 1.00 25.51 ? 31 THR A O   1 
ATOM 234 C CB  . THR A 1 31 ? -1.189  -6.740  -11.404 1.00 23.68 ? 31 THR A CB  1 
ATOM 235 O OG1 . THR A 1 31 ? -0.274  -5.998  -10.602 1.00 24.44 ? 31 THR A OG1 1 
ATOM 236 C CG2 . THR A 1 31 ? -2.033  -5.764  -12.165 1.00 22.80 ? 31 THR A CG2 1 
ATOM 237 N N   . VAL A 1 32 ? -4.410  -7.879  -10.828 1.00 24.91 ? 32 VAL A N   1 
ATOM 238 C CA  . VAL A 1 32 ? -5.603  -8.405  -11.466 1.00 25.32 ? 32 VAL A CA  1 
ATOM 239 C C   . VAL A 1 32 ? -6.500  -7.295  -11.971 1.00 25.64 ? 32 VAL A C   1 
ATOM 240 O O   . VAL A 1 32 ? -6.863  -6.410  -11.219 1.00 25.56 ? 32 VAL A O   1 
ATOM 241 C CB  . VAL A 1 32 ? -6.433  -9.240  -10.513 1.00 25.42 ? 32 VAL A CB  1 
ATOM 242 C CG1 . VAL A 1 32 ? -7.285  -10.197 -11.316 1.00 24.85 ? 32 VAL A CG1 1 
ATOM 243 C CG2 . VAL A 1 32 ? -5.537  -9.955  -9.482  1.00 24.54 ? 32 VAL A CG2 1 
ATOM 244 N N   . LEU A 1 33 ? -6.862  -7.388  -13.245 1.00 26.54 ? 33 LEU A N   1 
ATOM 245 C CA  . LEU A 1 33 ? -7.683  -6.415  -13.934 1.00 27.11 ? 33 LEU A CA  1 
ATOM 246 C C   . LEU A 1 33 ? -8.926  -7.118  -14.437 1.00 28.57 ? 33 LEU A C   1 
ATOM 247 O O   . LEU A 1 33 ? -8.932  -8.327  -14.645 1.00 28.64 ? 33 LEU A O   1 
ATOM 248 C CB  . LEU A 1 33 ? -6.912  -5.824  -15.108 1.00 26.56 ? 33 LEU A CB  1 
ATOM 249 C CG  . LEU A 1 33 ? -5.607  -5.037  -14.897 1.00 25.12 ? 33 LEU A CG  1 
ATOM 250 C CD1 . LEU A 1 33 ? -5.414  -4.128  -16.072 1.00 23.57 ? 33 LEU A CD1 1 
ATOM 251 C CD2 . LEU A 1 33 ? -5.577  -4.189  -13.648 1.00 23.37 ? 33 LEU A CD2 1 
ATOM 252 N N   . GLU A 1 34 ? -10.000 -6.365  -14.596 1.00 30.50 ? 34 GLU A N   1 
ATOM 253 C CA  . GLU A 1 34 ? -11.238 -6.906  -15.155 1.00 32.77 ? 34 GLU A CA  1 
ATOM 254 C C   . GLU A 1 34 ? -10.978 -7.246  -16.594 1.00 33.52 ? 34 GLU A C   1 
ATOM 255 O O   . GLU A 1 34 ? -9.911  -6.945  -17.118 1.00 33.90 ? 34 GLU A O   1 
ATOM 256 C CB  . GLU A 1 34 ? -12.325 -5.855  -15.112 1.00 33.58 ? 34 GLU A CB  1 
ATOM 257 C CG  . GLU A 1 34 ? -12.119 -4.719  -16.133 1.00 36.28 ? 34 GLU A CG  1 
ATOM 258 C CD  . GLU A 1 34 ? -12.786 -3.428  -15.698 1.00 41.14 ? 34 GLU A CD  1 
ATOM 259 O OE1 . GLU A 1 34 ? -13.630 -3.468  -14.751 1.00 43.22 ? 34 GLU A OE1 1 
ATOM 260 O OE2 . GLU A 1 34 ? -12.452 -2.375  -16.295 1.00 43.44 ? 34 GLU A OE2 1 
ATOM 261 N N   . GLU A 1 35 ? -11.952 -7.844  -17.256 1.00 34.67 ? 35 GLU A N   1 
ATOM 262 C CA  . GLU A 1 35 ? -11.729 -8.263  -18.628 1.00 35.55 ? 35 GLU A CA  1 
ATOM 263 C C   . GLU A 1 35 ? -11.118 -7.182  -19.531 1.00 35.86 ? 35 GLU A C   1 
ATOM 264 O O   . GLU A 1 35 ? -11.640 -6.061  -19.641 1.00 36.72 ? 35 GLU A O   1 
ATOM 265 C CB  . GLU A 1 35 ? -13.004 -8.787  -19.249 1.00 36.24 ? 35 GLU A CB  1 
ATOM 266 C CG  . GLU A 1 35 ? -12.727 -9.667  -20.420 1.00 37.02 ? 35 GLU A CG  1 
ATOM 267 C CD  . GLU A 1 35 ? -12.023 -10.942 -20.005 1.00 37.31 ? 35 GLU A CD  1 
ATOM 268 O OE1 . GLU A 1 35 ? -10.969 -11.227 -20.595 1.00 37.33 ? 35 GLU A OE1 1 
ATOM 269 O OE2 . GLU A 1 35 ? -12.511 -11.658 -19.100 1.00 38.09 ? 35 GLU A OE2 1 
ATOM 270 N N   . ILE A 1 36 ? -10.005 -7.541  -20.165 1.00 35.40 ? 36 ILE A N   1 
ATOM 271 C CA  . ILE A 1 36 ? -9.329  -6.677  -21.104 1.00 35.11 ? 36 ILE A CA  1 
ATOM 272 C C   . ILE A 1 36 ? -8.599  -7.525  -22.160 1.00 35.48 ? 36 ILE A C   1 
ATOM 273 O O   . ILE A 1 36 ? -8.229  -8.680  -21.918 1.00 35.12 ? 36 ILE A O   1 
ATOM 274 C CB  . ILE A 1 36 ? -8.421  -5.679  -20.363 1.00 34.58 ? 36 ILE A CB  1 
ATOM 275 C CG1 . ILE A 1 36 ? -7.715  -4.758  -21.325 1.00 34.92 ? 36 ILE A CG1 1 
ATOM 276 C CG2 . ILE A 1 36 ? -7.385  -6.379  -19.537 1.00 34.86 ? 36 ILE A CG2 1 
ATOM 277 C CD1 . ILE A 1 36 ? -6.640  -4.009  -20.682 1.00 35.11 ? 36 ILE A CD1 1 
ATOM 278 N N   . ASN A 1 37 ? -8.431  -6.957  -23.346 1.00 36.29 ? 37 ASN A N   1 
ATOM 279 C CA  . ASN A 1 37 ? -7.846  -7.688  -24.456 1.00 37.12 ? 37 ASN A CA  1 
ATOM 280 C C   . ASN A 1 37 ? -6.366  -7.450  -24.672 1.00 36.69 ? 37 ASN A C   1 
ATOM 281 O O   . ASN A 1 37 ? -5.935  -6.622  -25.499 1.00 36.78 ? 37 ASN A O   1 
ATOM 282 C CB  . ASN A 1 37 ? -8.620  -7.442  -25.741 1.00 38.65 ? 37 ASN A CB  1 
ATOM 283 C CG  . ASN A 1 37 ? -9.574  -8.570  -26.061 1.00 41.15 ? 37 ASN A CG  1 
ATOM 284 O OD1 . ASN A 1 37 ? -10.419 -8.960  -25.230 1.00 43.89 ? 37 ASN A OD1 1 
ATOM 285 N ND2 . ASN A 1 37 ? -9.444  -9.109  -27.270 1.00 42.74 ? 37 ASN A ND2 1 
ATOM 286 N N   . LEU A 1 38 ? -5.599  -8.233  -23.929 1.00 35.95 ? 38 LEU A N   1 
ATOM 287 C CA  . LEU A 1 38 ? -4.165  -8.152  -23.945 1.00 35.09 ? 38 LEU A CA  1 
ATOM 288 C C   . LEU A 1 38 ? -3.552  -9.082  -24.967 1.00 35.91 ? 38 LEU A C   1 
ATOM 289 O O   . LEU A 1 38 ? -4.130  -10.133 -25.319 1.00 35.21 ? 38 LEU A O   1 
ATOM 290 C CB  . LEU A 1 38 ? -3.588  -8.440  -22.559 1.00 34.46 ? 38 LEU A CB  1 
ATOM 291 C CG  . LEU A 1 38 ? -4.161  -7.609  -21.423 1.00 32.24 ? 38 LEU A CG  1 
ATOM 292 C CD1 . LEU A 1 38 ? -3.625  -8.095  -20.117 1.00 30.87 ? 38 LEU A CD1 1 
ATOM 293 C CD2 . LEU A 1 38 ? -3.823  -6.180  -21.652 1.00 32.58 ? 38 LEU A CD2 1 
ATOM 294 N N   . PRO A 1 39 ? -2.355  -8.680  -25.445 1.00 36.91 ? 39 PRO A N   1 
ATOM 295 C CA  . PRO A 1 39 ? -1.538  -9.415  -26.408 1.00 37.61 ? 39 PRO A CA  1 
ATOM 296 C C   . PRO A 1 39 ? -0.980  -10.670 -25.757 1.00 37.50 ? 39 PRO A C   1 
ATOM 297 O O   . PRO A 1 39 ? -0.909  -10.736 -24.518 1.00 37.31 ? 39 PRO A O   1 
ATOM 298 C CB  . PRO A 1 39 ? -0.389  -8.437  -26.701 1.00 37.85 ? 39 PRO A CB  1 
ATOM 299 C CG  . PRO A 1 39 ? -0.306  -7.575  -25.460 1.00 37.10 ? 39 PRO A CG  1 
ATOM 300 C CD  . PRO A 1 39 ? -1.710  -7.408  -25.033 1.00 36.65 ? 39 PRO A CD  1 
ATOM 301 N N   . GLY A 1 40 ? -0.602  -11.648 -26.581 1.00 37.49 ? 40 GLY A N   1 
ATOM 302 C CA  . GLY A 1 40 ? 0.161   -12.778 -26.098 1.00 36.56 ? 40 GLY A CA  1 
ATOM 303 C C   . GLY A 1 40 ? -0.627  -14.033 -25.765 1.00 36.03 ? 40 GLY A C   1 
ATOM 304 O O   . GLY A 1 40 ? -1.841  -14.126 -25.981 1.00 35.62 ? 40 GLY A O   1 
ATOM 305 N N   . LYS A 1 41 ? 0.130   -15.009 -25.269 1.00 35.73 ? 41 LYS A N   1 
ATOM 306 C CA  . LYS A 1 41 ? -0.337  -16.298 -24.821 1.00 34.80 ? 41 LYS A CA  1 
ATOM 307 C C   . LYS A 1 41 ? -0.520  -16.048 -23.373 1.00 33.13 ? 41 LYS A C   1 
ATOM 308 O O   . LYS A 1 41 ? 0.215   -15.260 -22.779 1.00 32.70 ? 41 LYS A O   1 
ATOM 309 C CB  . LYS A 1 41 ? 0.769   -17.346 -24.976 1.00 35.85 ? 41 LYS A CB  1 
ATOM 310 C CG  . LYS A 1 41 ? 0.301   -18.793 -25.063 1.00 37.51 ? 41 LYS A CG  1 
ATOM 311 C CD  . LYS A 1 41 ? 1.486   -19.765 -25.145 1.00 41.15 ? 41 LYS A CD  1 
ATOM 312 C CE  . LYS A 1 41 ? 2.318   -19.626 -26.452 1.00 42.90 ? 41 LYS A CE  1 
ATOM 313 N NZ  . LYS A 1 41 ? 3.620   -20.382 -26.436 1.00 43.64 ? 41 LYS A NZ  1 
ATOM 314 N N   . TRP A 1 42 ? -1.489  -16.732 -22.804 1.00 32.15 ? 42 TRP A N   1 
ATOM 315 C CA  . TRP A 1 42 ? -1.753  -16.626 -21.412 1.00 31.33 ? 42 TRP A CA  1 
ATOM 316 C C   . TRP A 1 42 ? -1.812  -18.013 -20.902 1.00 32.34 ? 42 TRP A C   1 
ATOM 317 O O   . TRP A 1 42 ? -2.156  -18.904 -21.648 1.00 33.16 ? 42 TRP A O   1 
ATOM 318 C CB  . TRP A 1 42 ? -3.087  -15.952 -21.203 1.00 30.27 ? 42 TRP A CB  1 
ATOM 319 C CG  . TRP A 1 42 ? -4.207  -16.554 -21.972 1.00 29.00 ? 42 TRP A CG  1 
ATOM 320 C CD1 . TRP A 1 42 ? -4.632  -16.193 -23.210 1.00 27.39 ? 42 TRP A CD1 1 
ATOM 321 C CD2 . TRP A 1 42 ? -5.081  -17.604 -21.538 1.00 29.37 ? 42 TRP A CD2 1 
ATOM 322 N NE1 . TRP A 1 42 ? -5.709  -16.954 -23.586 1.00 27.28 ? 42 TRP A NE1 1 
ATOM 323 C CE2 . TRP A 1 42 ? -6.015  -17.820 -22.572 1.00 28.31 ? 42 TRP A CE2 1 
ATOM 324 C CE3 . TRP A 1 42 ? -5.168  -18.384 -20.368 1.00 28.86 ? 42 TRP A CE3 1 
ATOM 325 C CZ2 . TRP A 1 42 ? -7.010  -18.781 -22.482 1.00 27.78 ? 42 TRP A CZ2 1 
ATOM 326 C CZ3 . TRP A 1 42 ? -6.160  -19.325 -20.277 1.00 27.97 ? 42 TRP A CZ3 1 
ATOM 327 C CH2 . TRP A 1 42 ? -7.067  -19.523 -21.334 1.00 28.51 ? 42 TRP A CH2 1 
ATOM 328 N N   . LYS A 1 43 ? -1.457  -18.187 -19.639 1.00 33.11 ? 43 LYS A N   1 
ATOM 329 C CA  . LYS A 1 43 ? -1.559  -19.464 -18.933 1.00 34.81 ? 43 LYS A CA  1 
ATOM 330 C C   . LYS A 1 43 ? -2.722  -19.358 -17.948 1.00 34.65 ? 43 LYS A C   1 
ATOM 331 O O   . LYS A 1 43 ? -3.016  -18.279 -17.459 1.00 33.71 ? 43 LYS A O   1 
ATOM 332 C CB  . LYS A 1 43 ? -0.239  -19.745 -18.192 1.00 35.40 ? 43 LYS A CB  1 
ATOM 333 C CG  . LYS A 1 43 ? -0.242  -20.879 -17.133 1.00 38.21 ? 43 LYS A CG  1 
ATOM 334 C CD  . LYS A 1 43 ? 0.864   -20.693 -16.087 1.00 41.29 ? 43 LYS A CD  1 
ATOM 335 C CE  . LYS A 1 43 ? 2.268   -20.622 -16.738 1.00 43.86 ? 43 LYS A CE  1 
ATOM 336 N NZ  . LYS A 1 43 ? 3.160   -19.597 -16.096 1.00 43.20 ? 43 LYS A NZ  1 
ATOM 337 N N   . PRO A 1 44 ? -3.402  -20.473 -17.658 1.00 36.06 ? 44 PRO A N   1 
ATOM 338 C CA  . PRO A 1 44 ? -4.446  -20.379 -16.642 1.00 36.05 ? 44 PRO A CA  1 
ATOM 339 C C   . PRO A 1 44 ? -3.880  -20.498 -15.236 1.00 36.15 ? 44 PRO A C   1 
ATOM 340 O O   . PRO A 1 44 ? -3.072  -21.378 -14.985 1.00 36.75 ? 44 PRO A O   1 
ATOM 341 C CB  . PRO A 1 44 ? -5.335  -21.567 -16.966 1.00 37.18 ? 44 PRO A CB  1 
ATOM 342 C CG  . PRO A 1 44 ? -4.406  -22.577 -17.595 1.00 37.95 ? 44 PRO A CG  1 
ATOM 343 C CD  . PRO A 1 44 ? -3.357  -21.800 -18.308 1.00 37.40 ? 44 PRO A CD  1 
ATOM 344 N N   . LYS A 1 45 ? -4.298  -19.606 -14.342 1.00 35.96 ? 45 LYS A N   1 
ATOM 345 C CA  . LYS A 1 45 ? -3.780  -19.566 -12.973 1.00 36.81 ? 45 LYS A CA  1 
ATOM 346 C C   . LYS A 1 45 ? -4.924  -19.552 -11.962 1.00 37.35 ? 45 LYS A C   1 
ATOM 347 O O   . LYS A 1 45 ? -5.976  -19.002 -12.253 1.00 37.40 ? 45 LYS A O   1 
ATOM 348 C CB  . LYS A 1 45 ? -2.874  -18.346 -12.754 1.00 35.67 ? 45 LYS A CB  1 
ATOM 349 C CG  . LYS A 1 45 ? -1.867  -18.512 -11.587 1.00 36.83 ? 45 LYS A CG  1 
ATOM 350 C CD  . LYS A 1 45 ? -1.037  -17.244 -11.273 1.00 35.95 ? 45 LYS A CD  1 
ATOM 351 C CE  . LYS A 1 45 ? -0.099  -17.430 -10.065 1.00 36.50 ? 45 LYS A CE  1 
ATOM 352 N NZ  . LYS A 1 45 ? 0.573   -16.165 -9.620  1.00 34.51 ? 45 LYS A NZ  1 
ATOM 353 N N   . MET A 1 46 ? -4.729  -20.185 -10.799 1.00 38.63 ? 46 MET A N   1 
ATOM 354 C CA  . MET A 1 46 ? -5.650  -20.047 -9.658  1.00 39.22 ? 46 MET A CA  1 
ATOM 355 C C   . MET A 1 46 ? -5.180  -18.953 -8.712  1.00 38.41 ? 46 MET A C   1 
ATOM 356 O O   . MET A 1 46 ? -4.044  -19.004 -8.216  1.00 38.94 ? 46 MET A O   1 
ATOM 357 C CB  . MET A 1 46 ? -5.747  -21.328 -8.818  1.00 40.62 ? 46 MET A CB  1 
ATOM 358 C CG  . MET A 1 46 ? -6.423  -22.562 -9.441  1.00 43.55 ? 46 MET A CG  1 
ATOM 359 S SD  . MET A 1 46 ? -7.819  -22.283 -10.537 1.00 48.23 ? 46 MET A SD  1 
ATOM 360 C CE  . MET A 1 46 ? -9.000  -21.399 -9.528  1.00 47.58 ? 46 MET A CE  1 
ATOM 361 N N   . ILE A 1 47 ? -6.042  -17.977 -8.447  1.00 37.43 ? 47 ILE A N   1 
ATOM 362 C CA  . ILE A 1 47 ? -5.811  -17.084 -7.332  1.00 36.65 ? 47 ILE A CA  1 
ATOM 363 C C   . ILE A 1 47 ? -6.973  -17.135 -6.374  1.00 37.06 ? 47 ILE A C   1 
ATOM 364 O O   . ILE A 1 47 ? -7.943  -17.843 -6.601  1.00 38.14 ? 47 ILE A O   1 
ATOM 365 C CB  . ILE A 1 47 ? -5.536  -15.650 -7.753  1.00 35.61 ? 47 ILE A CB  1 
ATOM 366 C CG1 . ILE A 1 47 ? -6.732  -15.092 -8.520  1.00 35.63 ? 47 ILE A CG1 1 
ATOM 367 C CG2 . ILE A 1 47 ? -4.251  -15.583 -8.536  1.00 35.32 ? 47 ILE A CG2 1 
ATOM 368 C CD1 . ILE A 1 47 ? -6.916  -13.593 -8.396  1.00 33.28 ? 47 ILE A CD1 1 
ATOM 369 N N   . GLY A 1 48 ? -6.866  -16.374 -5.296  1.00 37.04 ? 48 GLY A N   1 
ATOM 370 C CA  . GLY A 1 48 ? -7.761  -16.509 -4.167  1.00 37.31 ? 48 GLY A CA  1 
ATOM 371 C C   . GLY A 1 48 ? -7.093  -17.460 -3.182  1.00 38.04 ? 48 GLY A C   1 
ATOM 372 O O   . GLY A 1 48 ? -5.915  -17.301 -2.809  1.00 37.48 ? 48 GLY A O   1 
ATOM 373 N N   . GLY A 1 49 ? -7.843  -18.483 -2.791  1.00 38.76 ? 49 GLY A N   1 
ATOM 374 C CA  . GLY A 1 49 ? -7.426  -19.373 -1.725  1.00 38.76 ? 49 GLY A CA  1 
ATOM 375 C C   . GLY A 1 49 ? -8.402  -19.269 -0.573  1.00 38.69 ? 49 GLY A C   1 
ATOM 376 O O   . GLY A 1 49 ? -8.865  -20.297 -0.050  1.00 39.87 ? 49 GLY A O   1 
ATOM 377 N N   . ILE A 1 50 ? -8.737  -18.035 -0.190  1.00 37.38 ? 50 ILE A N   1 
ATOM 378 C CA  . ILE A 1 50 ? -9.601  -17.815 0.970   1.00 37.20 ? 50 ILE A CA  1 
ATOM 379 C C   . ILE A 1 50 ? -11.103 -17.714 0.614   1.00 37.62 ? 50 ILE A C   1 
ATOM 380 O O   . ILE A 1 50 ? -11.555 -16.735 0.023   1.00 38.14 ? 50 ILE A O   1 
ATOM 381 C CB  . ILE A 1 50 ? -9.103  -16.638 1.836   1.00 36.31 ? 50 ILE A CB  1 
ATOM 382 C CG1 . ILE A 1 50 ? -7.733  -16.986 2.450   1.00 36.35 ? 50 ILE A CG1 1 
ATOM 383 C CG2 . ILE A 1 50 ? -10.094 -16.363 2.936   1.00 36.32 ? 50 ILE A CG2 1 
ATOM 384 C CD1 . ILE A 1 50 ? -6.804  -15.814 2.696   1.00 35.95 ? 50 ILE A CD1 1 
ATOM 385 N N   . GLY A 1 51 ? -11.870 -18.744 0.971   1.00 37.92 ? 51 GLY A N   1 
ATOM 386 C CA  . GLY A 1 51 ? -13.288 -18.791 0.640   1.00 37.52 ? 51 GLY A CA  1 
ATOM 387 C C   . GLY A 1 51 ? -13.566 -19.524 -0.657  1.00 37.62 ? 51 GLY A C   1 
ATOM 388 O O   . GLY A 1 51 ? -14.721 -19.861 -0.944  1.00 38.00 ? 51 GLY A O   1 
ATOM 389 N N   . GLY A 1 52 ? -12.489 -19.770 -1.419  1.00 36.90 ? 52 GLY A N   1 
ATOM 390 C CA  . GLY A 1 52 ? -12.498 -20.432 -2.741  1.00 35.83 ? 52 GLY A CA  1 
ATOM 391 C C   . GLY A 1 52 ? -11.482 -19.798 -3.687  1.00 33.98 ? 52 GLY A C   1 
ATOM 392 O O   . GLY A 1 52 ? -10.951 -18.716 -3.418  1.00 33.23 ? 52 GLY A O   1 
ATOM 393 N N   . PHE A 1 53 ? -11.231 -20.464 -4.810  1.00 33.51 ? 53 PHE A N   1 
ATOM 394 C CA  . PHE A 1 53 ? -10.325 -19.968 -5.853  1.00 31.79 ? 53 PHE A CA  1 
ATOM 395 C C   . PHE A 1 53 ? -11.055 -19.311 -7.041  1.00 30.85 ? 53 PHE A C   1 
ATOM 396 O O   . PHE A 1 53 ? -12.196 -19.638 -7.354  1.00 31.15 ? 53 PHE A O   1 
ATOM 397 C CB  . PHE A 1 53 ? -9.518  -21.138 -6.415  1.00 32.66 ? 53 PHE A CB  1 
ATOM 398 C CG  . PHE A 1 53 ? -8.478  -21.682 -5.491  1.00 32.19 ? 53 PHE A CG  1 
ATOM 399 C CD1 . PHE A 1 53 ? -8.658  -22.917 -4.884  1.00 33.70 ? 53 PHE A CD1 1 
ATOM 400 C CD2 . PHE A 1 53 ? -7.304  -20.989 -5.262  1.00 31.32 ? 53 PHE A CD2 1 
ATOM 401 C CE1 . PHE A 1 53 ? -7.697  -23.437 -4.040  1.00 33.76 ? 53 PHE A CE1 1 
ATOM 402 C CE2 . PHE A 1 53 ? -6.334  -21.498 -4.423  1.00 32.16 ? 53 PHE A CE2 1 
ATOM 403 C CZ  . PHE A 1 53 ? -6.529  -22.722 -3.811  1.00 33.38 ? 53 PHE A CZ  1 
ATOM 404 N N   . ILE A 1 54 ? -10.366 -18.417 -7.733  1.00 29.25 ? 54 ILE A N   1 
ATOM 405 C CA  . ILE A 1 54 ? -10.904 -17.745 -8.901  1.00 28.14 ? 54 ILE A CA  1 
ATOM 406 C C   . ILE A 1 54 ? -9.901  -18.010 -10.002 1.00 27.85 ? 54 ILE A C   1 
ATOM 407 O O   . ILE A 1 54 ? -8.714  -17.732 -9.842  1.00 27.16 ? 54 ILE A O   1 
ATOM 408 C CB  . ILE A 1 54 ? -11.028 -16.215 -8.658  1.00 27.53 ? 54 ILE A CB  1 
ATOM 409 C CG1 . ILE A 1 54 ? -12.068 -15.905 -7.553  1.00 28.29 ? 54 ILE A CG1 1 
ATOM 410 C CG2 . ILE A 1 54 ? -11.255 -15.436 -9.974  1.00 26.85 ? 54 ILE A CG2 1 
ATOM 411 C CD1 . ILE A 1 54 ? -13.391 -15.289 -8.029  1.00 29.71 ? 54 ILE A CD1 1 
ATOM 412 N N   . LYS A 1 55 ? -10.387 -18.572 -11.108 1.00 28.07 ? 55 LYS A N   1 
ATOM 413 C CA  . LYS A 1 55 ? -9.577  -18.872 -12.280 1.00 27.87 ? 55 LYS A CA  1 
ATOM 414 C C   . LYS A 1 55 ? -9.361  -17.621 -13.137 1.00 26.24 ? 55 LYS A C   1 
ATOM 415 O O   . LYS A 1 55 ? -10.311 -17.035 -13.652 1.00 27.06 ? 55 LYS A O   1 
ATOM 416 C CB  . LYS A 1 55 ? -10.256 -19.977 -13.090 1.00 29.27 ? 55 LYS A CB  1 
ATOM 417 C CG  . LYS A 1 55 ? -9.524  -20.403 -14.385 1.00 32.28 ? 55 LYS A CG  1 
ATOM 418 C CD  . LYS A 1 55 ? -8.421  -21.462 -14.172 1.00 35.28 ? 55 LYS A CD  1 
ATOM 419 C CE  . LYS A 1 55 ? -8.596  -22.680 -15.110 1.00 36.81 ? 55 LYS A CE  1 
ATOM 420 N NZ  . LYS A 1 55 ? -9.812  -23.509 -14.776 1.00 36.31 ? 55 LYS A NZ  1 
ATOM 421 N N   . VAL A 1 56 ? -8.114  -17.199 -13.281 1.00 24.41 ? 56 VAL A N   1 
ATOM 422 C CA  . VAL A 1 56 ? -7.795  -16.032 -14.098 1.00 22.01 ? 56 VAL A CA  1 
ATOM 423 C C   . VAL A 1 56 ? -6.842  -16.378 -15.259 1.00 21.92 ? 56 VAL A C   1 
ATOM 424 O O   . VAL A 1 56 ? -6.435  -17.545 -15.440 1.00 22.74 ? 56 VAL A O   1 
ATOM 425 C CB  . VAL A 1 56 ? -7.290  -14.857 -13.239 1.00 21.17 ? 56 VAL A CB  1 
ATOM 426 C CG1 . VAL A 1 56 ? -8.319  -14.516 -12.196 1.00 20.88 ? 56 VAL A CG1 1 
ATOM 427 C CG2 . VAL A 1 56 ? -5.988  -15.172 -12.563 1.00 19.77 ? 56 VAL A CG2 1 
ATOM 428 N N   . ARG A 1 57 ? -6.520  -15.383 -16.072 1.00 20.45 ? 57 ARG A N   1 
ATOM 429 C CA  . ARG A 1 57 ? -5.674  -15.615 -17.210 1.00 19.79 ? 57 ARG A CA  1 
ATOM 430 C C   . ARG A 1 57 ? -4.387  -14.880 -17.005 1.00 18.96 ? 57 ARG A C   1 
ATOM 431 O O   . ARG A 1 57 ? -4.372  -13.663 -17.016 1.00 18.46 ? 57 ARG A O   1 
ATOM 432 C CB  . ARG A 1 57 ? -6.353  -15.098 -18.452 1.00 19.89 ? 57 ARG A CB  1 
ATOM 433 C CG  . ARG A 1 57 ? -7.291  -16.076 -19.077 1.00 21.60 ? 57 ARG A CG  1 
ATOM 434 C CD  . ARG A 1 57 ? -7.706  -15.565 -20.398 1.00 22.40 ? 57 ARG A CD  1 
ATOM 435 N NE  . ARG A 1 57 ? -8.345  -14.291 -20.176 1.00 24.58 ? 57 ARG A NE  1 
ATOM 436 C CZ  . ARG A 1 57 ? -8.973  -13.595 -21.106 1.00 26.02 ? 57 ARG A CZ  1 
ATOM 437 N NH1 . ARG A 1 57 ? -9.051  -14.043 -22.351 1.00 27.98 ? 57 ARG A NH1 1 
ATOM 438 N NH2 . ARG A 1 57 ? -9.518  -12.438 -20.791 1.00 24.88 ? 57 ARG A NH2 1 
ATOM 439 N N   . GLN A 1 58 ? -3.303  -15.615 -16.817 1.00 19.00 ? 58 GLN A N   1 
ATOM 440 C CA  . GLN A 1 58 ? -2.011  -14.998 -16.575 1.00 18.96 ? 58 GLN A CA  1 
ATOM 441 C C   . GLN A 1 58 ? -1.275  -14.623 -17.847 1.00 19.29 ? 58 GLN A C   1 
ATOM 442 O O   . GLN A 1 58 ? -0.913  -15.487 -18.626 1.00 20.92 ? 58 GLN A O   1 
ATOM 443 C CB  . GLN A 1 58 ? -1.127  -15.911 -15.764 1.00 18.73 ? 58 GLN A CB  1 
ATOM 444 C CG  . GLN A 1 58 ? 0.072   -15.208 -15.344 1.00 19.87 ? 58 GLN A CG  1 
ATOM 445 C CD  . GLN A 1 58 ? 1.134   -16.103 -14.824 1.00 24.15 ? 58 GLN A CD  1 
ATOM 446 O OE1 . GLN A 1 58 ? 0.883   -17.040 -14.066 1.00 26.06 ? 58 GLN A OE1 1 
ATOM 447 N NE2 . GLN A 1 58 ? 2.362   -15.814 -15.217 1.00 27.32 ? 58 GLN A NE2 1 
ATOM 448 N N   . TYR A 1 59 ? -1.044  -13.335 -18.042 1.00 18.89 ? 59 TYR A N   1 
ATOM 449 C CA  . TYR A 1 59 ? -0.334  -12.842 -19.192 1.00 19.47 ? 59 TYR A CA  1 
ATOM 450 C C   . TYR A 1 59 ? 0.983   -12.290 -18.728 1.00 20.27 ? 59 TYR A C   1 
ATOM 451 O O   . TYR A 1 59 ? 1.054   -11.683 -17.677 1.00 20.88 ? 59 TYR A O   1 
ATOM 452 C CB  . TYR A 1 59 ? -1.091  -11.697 -19.824 1.00 19.04 ? 59 TYR A CB  1 
ATOM 453 C CG  . TYR A 1 59 ? -2.332  -12.095 -20.575 1.00 19.45 ? 59 TYR A CG  1 
ATOM 454 C CD1 . TYR A 1 59 ? -3.534  -12.247 -19.910 1.00 19.45 ? 59 TYR A CD1 1 
ATOM 455 C CD2 . TYR A 1 59 ? -2.319  -12.266 -21.948 1.00 18.70 ? 59 TYR A CD2 1 
ATOM 456 C CE1 . TYR A 1 59 ? -4.667  -12.597 -20.571 1.00 19.68 ? 59 TYR A CE1 1 
ATOM 457 C CE2 . TYR A 1 59 ? -3.476  -12.618 -22.623 1.00 19.95 ? 59 TYR A CE2 1 
ATOM 458 C CZ  . TYR A 1 59 ? -4.641  -12.782 -21.913 1.00 18.80 ? 59 TYR A CZ  1 
ATOM 459 O OH  . TYR A 1 59 ? -5.810  -13.110 -22.517 1.00 19.36 ? 59 TYR A OH  1 
ATOM 460 N N   . ASP A 1 60 ? 2.039   -12.454 -19.506 1.00 21.05 ? 60 ASP A N   1 
ATOM 461 C CA  . ASP A 1 60 ? 3.307   -11.997 -19.018 1.00 21.23 ? 60 ASP A CA  1 
ATOM 462 C C   . ASP A 1 60 ? 3.811   -10.736 -19.703 1.00 21.13 ? 60 ASP A C   1 
ATOM 463 O O   . ASP A 1 60 ? 3.401   -10.405 -20.806 1.00 21.69 ? 60 ASP A O   1 
ATOM 464 C CB  . ASP A 1 60 ? 4.323   -13.136 -19.073 1.00 22.45 ? 60 ASP A CB  1 
ATOM 465 C CG  . ASP A 1 60 ? 4.172   -14.097 -17.921 1.00 22.86 ? 60 ASP A CG  1 
ATOM 466 O OD1 . ASP A 1 60 ? 3.805   -13.658 -16.814 1.00 25.74 ? 60 ASP A OD1 1 
ATOM 467 O OD2 . ASP A 1 60 ? 4.426   -15.291 -18.109 1.00 23.83 ? 60 ASP A OD2 1 
ATOM 468 N N   . GLN A 1 61 ? 4.700   -10.039 -19.009 1.00 20.73 ? 61 GLN A N   1 
ATOM 469 C CA  . GLN A 1 61 ? 5.394   -8.893  -19.534 1.00 20.39 ? 61 GLN A CA  1 
ATOM 470 C C   . GLN A 1 61 ? 4.524   -7.938  -20.274 1.00 19.42 ? 61 GLN A C   1 
ATOM 471 O O   . GLN A 1 61 ? 4.798   -7.583  -21.406 1.00 19.45 ? 61 GLN A O   1 
ATOM 472 C CB  . GLN A 1 61 ? 6.537   -9.350  -20.363 1.00 21.66 ? 61 GLN A CB  1 
ATOM 473 C CG  . GLN A 1 61 ? 7.455   -10.132 -19.463 1.00 24.34 ? 61 GLN A CG  1 
ATOM 474 C CD  . GLN A 1 61 ? 8.516   -10.886 -20.208 1.00 25.22 ? 61 GLN A CD  1 
ATOM 475 O OE1 . GLN A 1 61 ? 8.535   -10.912 -21.441 1.00 24.73 ? 61 GLN A OE1 1 
ATOM 476 N NE2 . GLN A 1 61 ? 9.403   -11.531 -19.456 1.00 26.54 ? 61 GLN A NE2 1 
ATOM 477 N N   . ILE A 1 62 ? 3.479   -7.509  -19.570 1.00 18.16 ? 62 ILE A N   1 
ATOM 478 C CA  . ILE A 1 62 ? 2.480   -6.586  -20.072 1.00 16.85 ? 62 ILE A CA  1 
ATOM 479 C C   . ILE A 1 62 ? 2.896   -5.242  -19.524 1.00 17.23 ? 62 ILE A C   1 
ATOM 480 O O   . ILE A 1 62 ? 3.395   -5.168  -18.401 1.00 17.27 ? 62 ILE A O   1 
ATOM 481 C CB  . ILE A 1 62 ? 1.040   -6.984  -19.561 1.00 15.51 ? 62 ILE A CB  1 
ATOM 482 C CG1 . ILE A 1 62 ? 0.629   -8.400  -20.002 1.00 13.38 ? 62 ILE A CG1 1 
ATOM 483 C CG2 . ILE A 1 62 ? -0.001  -5.932  -19.898 1.00 14.70 ? 62 ILE A CG2 1 
ATOM 484 C CD1 . ILE A 1 62 ? 0.625   -8.685  -21.476 1.00 11.20 ? 62 ILE A CD1 1 
ATOM 485 N N   . LEU A 1 63 ? 2.695   -4.198  -20.314 1.00 17.74 ? 63 LEU A N   1 
ATOM 486 C CA  . LEU A 1 63 ? 3.052   -2.844  -19.937 1.00 18.80 ? 63 LEU A CA  1 
ATOM 487 C C   . LEU A 1 63 ? 1.828   -2.050  -19.536 1.00 18.91 ? 63 LEU A C   1 
ATOM 488 O O   . LEU A 1 63 ? 0.838   -2.008  -20.253 1.00 19.23 ? 63 LEU A O   1 
ATOM 489 C CB  . LEU A 1 63 ? 3.792   -2.171  -21.097 1.00 19.95 ? 63 LEU A CB  1 
ATOM 490 C CG  . LEU A 1 63 ? 3.960   -0.667  -21.292 1.00 20.44 ? 63 LEU A CG  1 
ATOM 491 C CD1 . LEU A 1 63 ? 5.210   -0.179  -20.672 1.00 20.40 ? 63 LEU A CD1 1 
ATOM 492 C CD2 . LEU A 1 63 ? 3.991   -0.391  -22.786 1.00 22.64 ? 63 LEU A CD2 1 
ATOM 493 N N   . ILE A 1 64 ? 1.897   -1.459  -18.357 1.00 19.54 ? 64 ILE A N   1 
ATOM 494 C CA  . ILE A 1 64 ? 0.882   -0.553  -17.873 1.00 20.02 ? 64 ILE A CA  1 
ATOM 495 C C   . ILE A 1 64 ? 1.612   0.771   -17.555 1.00 21.16 ? 64 ILE A C   1 
ATOM 496 O O   . ILE A 1 64 ? 2.795   0.793   -17.205 1.00 21.02 ? 64 ILE A O   1 
ATOM 497 C CB  . ILE A 1 64 ? 0.180   -1.052  -16.569 1.00 19.43 ? 64 ILE A CB  1 
ATOM 498 C CG1 . ILE A 1 64 ? 1.140   -1.003  -15.399 1.00 21.32 ? 64 ILE A CG1 1 
ATOM 499 C CG2 . ILE A 1 64 ? -0.370  -2.463  -16.657 1.00 18.29 ? 64 ILE A CG2 1 
ATOM 500 C CD1 . ILE A 1 64 ? 0.440   -0.904  -14.074 1.00 25.77 ? 64 ILE A CD1 1 
ATOM 501 N N   . GLU A 1 65 ? 0.911   1.882   -17.661 1.00 21.87 ? 65 GLU A N   1 
ATOM 502 C CA  . GLU A 1 65 ? 1.521   3.113   -17.290 1.00 23.04 ? 65 GLU A CA  1 
ATOM 503 C C   . GLU A 1 65 ? 0.648   3.705   -16.230 1.00 23.52 ? 65 GLU A C   1 
ATOM 504 O O   . GLU A 1 65 ? -0.559  3.591   -16.304 1.00 23.24 ? 65 GLU A O   1 
ATOM 505 C CB  . GLU A 1 65 ? 1.602   4.025   -18.487 1.00 23.82 ? 65 GLU A CB  1 
ATOM 506 C CG  . GLU A 1 65 ? 2.082   5.397   -18.166 1.00 25.13 ? 65 GLU A CG  1 
ATOM 507 C CD  . GLU A 1 65 ? 1.817   6.362   -19.276 1.00 28.23 ? 65 GLU A CD  1 
ATOM 508 O OE1 . GLU A 1 65 ? 2.075   6.019   -20.462 1.00 25.71 ? 65 GLU A OE1 1 
ATOM 509 O OE2 . GLU A 1 65 ? 1.334   7.471   -18.938 1.00 32.20 ? 65 GLU A OE2 1 
ATOM 510 N N   . ILE A 1 66 ? 1.274   4.295   -15.221 1.00 24.81 ? 66 ILE A N   1 
ATOM 511 C CA  . ILE A 1 66 ? 0.575   4.973   -14.147 1.00 26.21 ? 66 ILE A CA  1 
ATOM 512 C C   . ILE A 1 66 ? 1.234   6.309   -13.809 1.00 27.92 ? 66 ILE A C   1 
ATOM 513 O O   . ILE A 1 66 ? 2.451   6.384   -13.627 1.00 28.17 ? 66 ILE A O   1 
ATOM 514 C CB  . ILE A 1 66 ? 0.525   4.122   -12.866 1.00 25.68 ? 66 ILE A CB  1 
ATOM 515 C CG1 . ILE A 1 66 ? 0.018   2.705   -13.168 1.00 24.78 ? 66 ILE A CG1 1 
ATOM 516 C CG2 . ILE A 1 66 ? -0.331  4.831   -11.805 1.00 26.19 ? 66 ILE A CG2 1 
ATOM 517 C CD1 . ILE A 1 66 ? -0.471  1.965   -11.967 1.00 24.04 ? 66 ILE A CD1 1 
ATOM 518 N N   . CYS A 1 67 ? 0.420   7.354   -13.719 1.00 29.47 ? 67 CYS A N   1 
ATOM 519 C CA  . CYS A 1 67 ? 0.917   8.703   -13.452 1.00 32.03 ? 67 CYS A CA  1 
ATOM 520 C C   . CYS A 1 67 ? 2.262   9.004   -14.110 1.00 32.31 ? 67 CYS A C   1 
ATOM 521 O O   . CYS A 1 67 ? 3.140   9.584   -13.478 1.00 33.37 ? 67 CYS A O   1 
ATOM 522 C CB  . CYS A 1 67 ? 1.050   8.948   -11.954 1.00 32.22 ? 67 CYS A CB  1 
ATOM 523 S SG  . CYS A 1 67 ? -0.460  8.651   -11.030 1.00 38.13 ? 67 CYS A SG  1 
ATOM 524 N N   . GLY A 1 68 ? 2.436   8.607   -15.364 1.00 32.10 ? 68 GLY A N   1 
ATOM 525 C CA  . GLY A 1 68 ? 3.597   9.038   -16.120 1.00 32.13 ? 68 GLY A CA  1 
ATOM 526 C C   . GLY A 1 68 ? 4.660   7.974   -16.175 1.00 31.48 ? 68 GLY A C   1 
ATOM 527 O O   . GLY A 1 68 ? 5.513   7.993   -17.037 1.00 32.11 ? 68 GLY A O   1 
ATOM 528 N N   . LYS A 1 69 ? 4.594   7.020   -15.266 1.00 30.25 ? 69 LYS A N   1 
ATOM 529 C CA  . LYS A 1 69 ? 5.660   6.051   -15.142 1.00 29.65 ? 69 LYS A CA  1 
ATOM 530 C C   . LYS A 1 69 ? 5.223   4.688   -15.737 1.00 27.81 ? 69 LYS A C   1 
ATOM 531 O O   . LYS A 1 69 ? 4.124   4.225   -15.477 1.00 26.69 ? 69 LYS A O   1 
ATOM 532 C CB  . LYS A 1 69 ? 6.110   6.012   -13.663 1.00 29.67 ? 69 LYS A CB  1 
ATOM 533 C CG  . LYS A 1 69 ? 7.052   4.860   -13.251 1.00 32.30 ? 69 LYS A CG  1 
ATOM 534 C CD  . LYS A 1 69 ? 8.552   5.167   -13.369 1.00 35.24 ? 69 LYS A CD  1 
ATOM 535 C CE  . LYS A 1 69 ? 9.409   3.913   -13.073 1.00 34.41 ? 69 LYS A CE  1 
ATOM 536 N NZ  . LYS A 1 69 ? 10.879  4.209   -13.016 1.00 34.22 ? 69 LYS A NZ  1 
ATOM 537 N N   . LYS A 1 70 ? 6.080   4.079   -16.557 1.00 27.27 ? 70 LYS A N   1 
ATOM 538 C CA  . LYS A 1 70 ? 5.796   2.786   -17.204 1.00 26.28 ? 70 LYS A CA  1 
ATOM 539 C C   . LYS A 1 70 ? 6.346   1.579   -16.436 1.00 24.84 ? 70 LYS A C   1 
ATOM 540 O O   . LYS A 1 70 ? 7.390   1.654   -15.785 1.00 24.48 ? 70 LYS A O   1 
ATOM 541 C CB  . LYS A 1 70 ? 6.322   2.769   -18.639 1.00 27.33 ? 70 LYS A CB  1 
ATOM 542 C CG  . LYS A 1 70 ? 5.765   3.903   -19.534 1.00 31.24 ? 70 LYS A CG  1 
ATOM 543 C CD  . LYS A 1 70 ? 6.675   4.244   -20.729 1.00 38.02 ? 70 LYS A CD  1 
ATOM 544 C CE  . LYS A 1 70 ? 8.037   4.904   -20.289 1.00 42.53 ? 70 LYS A CE  1 
ATOM 545 N NZ  . LYS A 1 70 ? 8.297   6.305   -20.797 1.00 45.09 ? 70 LYS A NZ  1 
ATOM 546 N N   . ALA A 1 71 ? 5.619   0.469   -16.515 1.00 23.44 ? 71 ALA A N   1 
ATOM 547 C CA  . ALA A 1 71 ? 5.986   -0.778  -15.848 1.00 22.23 ? 71 ALA A CA  1 
ATOM 548 C C   . ALA A 1 71 ? 5.744   -1.973  -16.742 1.00 21.79 ? 71 ALA A C   1 
ATOM 549 O O   . ALA A 1 71 ? 4.748   -2.009  -17.444 1.00 22.40 ? 71 ALA A O   1 
ATOM 550 C CB  . ALA A 1 71 ? 5.195   -0.937  -14.632 1.00 21.39 ? 71 ALA A CB  1 
ATOM 551 N N   . ILE A 1 72 ? 6.638   -2.959  -16.706 1.00 21.29 ? 72 ILE A N   1 
ATOM 552 C CA  . ILE A 1 72 ? 6.414   -4.251  -17.375 1.00 19.94 ? 72 ILE A CA  1 
ATOM 553 C C   . ILE A 1 72 ? 6.187   -5.390  -16.368 1.00 19.21 ? 72 ILE A C   1 
ATOM 554 O O   . ILE A 1 72 ? 7.059   -5.732  -15.603 1.00 20.04 ? 72 ILE A O   1 
ATOM 555 C CB  . ILE A 1 72 ? 7.532   -4.560  -18.377 1.00 20.10 ? 72 ILE A CB  1 
ATOM 556 C CG1 . ILE A 1 72 ? 7.282   -3.783  -19.654 1.00 20.68 ? 72 ILE A CG1 1 
ATOM 557 C CG2 . ILE A 1 72 ? 7.538   -5.978  -18.783 1.00 20.38 ? 72 ILE A CG2 1 
ATOM 558 C CD1 . ILE A 1 72 ? 7.794   -2.389  -19.574 1.00 23.45 ? 72 ILE A CD1 1 
ATOM 559 N N   . GLY A 1 73 ? 5.009   -5.985  -16.345 1.00 18.37 ? 73 GLY A N   1 
ATOM 560 C CA  . GLY A 1 73 ? 4.823   -7.102  -15.424 1.00 17.33 ? 73 GLY A CA  1 
ATOM 561 C C   . GLY A 1 73 ? 3.766   -8.097  -15.831 1.00 16.42 ? 73 GLY A C   1 
ATOM 562 O O   . GLY A 1 73 ? 3.094   -7.921  -16.847 1.00 15.89 ? 73 GLY A O   1 
ATOM 563 N N   . THR A 1 74 ? 3.638   -9.143  -15.020 1.00 16.33 ? 74 THR A N   1 
ATOM 564 C CA  . THR A 1 74 ? 2.594   -10.147 -15.176 1.00 16.02 ? 74 THR A CA  1 
ATOM 565 C C   . THR A 1 74 ? 1.296   -9.513  -14.794 1.00 15.57 ? 74 THR A C   1 
ATOM 566 O O   . THR A 1 74 ? 1.206   -8.865  -13.757 1.00 15.25 ? 74 THR A O   1 
ATOM 567 C CB  . THR A 1 74 ? 2.780   -11.334 -14.223 1.00 15.87 ? 74 THR A CB  1 
ATOM 568 O OG1 . THR A 1 74 ? 4.139   -11.778 -14.246 1.00 17.60 ? 74 THR A OG1 1 
ATOM 569 C CG2 . THR A 1 74 ? 1.896   -12.457 -14.608 1.00 14.69 ? 74 THR A CG2 1 
ATOM 570 N N   . VAL A 1 75 ? 0.291   -9.717  -15.637 1.00 15.89 ? 75 VAL A N   1 
ATOM 571 C CA  . VAL A 1 75 ? -1.067  -9.278  -15.375 1.00 15.35 ? 75 VAL A CA  1 
ATOM 572 C C   . VAL A 1 75 ? -2.032  -10.415 -15.609 1.00 15.61 ? 75 VAL A C   1 
ATOM 573 O O   . VAL A 1 75 ? -1.999  -11.077 -16.627 1.00 15.65 ? 75 VAL A O   1 
ATOM 574 C CB  . VAL A 1 75 ? -1.440  -8.078  -16.237 1.00 15.30 ? 75 VAL A CB  1 
ATOM 575 C CG1 . VAL A 1 75 ? -2.803  -7.526  -15.831 1.00 14.51 ? 75 VAL A CG1 1 
ATOM 576 C CG2 . VAL A 1 75 ? -0.378  -7.021  -16.087 1.00 15.32 ? 75 VAL A CG2 1 
ATOM 577 N N   . LEU A 1 76 ? -2.895  -10.614 -14.632 1.00 16.51 ? 76 LEU A N   1 
ATOM 578 C CA  . LEU A 1 76 ? -3.880  -11.668 -14.636 1.00 17.58 ? 76 LEU A CA  1 
ATOM 579 C C   . LEU A 1 76 ? -5.234  -11.018 -14.916 1.00 18.53 ? 76 LEU A C   1 
ATOM 580 O O   . LEU A 1 76 ? -5.607  -10.029 -14.280 1.00 18.59 ? 76 LEU A O   1 
ATOM 581 C CB  . LEU A 1 76 ? -3.921  -12.358 -13.266 1.00 17.31 ? 76 LEU A CB  1 
ATOM 582 C CG  . LEU A 1 76 ? -2.670  -12.511 -12.403 1.00 15.64 ? 76 LEU A CG  1 
ATOM 583 C CD1 . LEU A 1 76 ? -3.000  -12.892 -10.975 1.00 13.68 ? 76 LEU A CD1 1 
ATOM 584 C CD2 . LEU A 1 76 ? -1.829  -13.546 -13.006 1.00 14.95 ? 76 LEU A CD2 1 
ATOM 585 N N   . VAL A 1 77 ? -5.970  -11.592 -15.857 1.00 19.89 ? 77 VAL A N   1 
ATOM 586 C CA  . VAL A 1 77 ? -7.251  -11.056 -16.286 1.00 20.65 ? 77 VAL A CA  1 
ATOM 587 C C   . VAL A 1 77 ? -8.367  -12.018 -15.878 1.00 22.63 ? 77 VAL A C   1 
ATOM 588 O O   . VAL A 1 77 ? -8.335  -13.201 -16.206 1.00 23.33 ? 77 VAL A O   1 
ATOM 589 C CB  . VAL A 1 77 ? -7.239  -10.773 -17.812 1.00 19.96 ? 77 VAL A CB  1 
ATOM 590 C CG1 . VAL A 1 77 ? -8.483  -10.089 -18.247 1.00 18.71 ? 77 VAL A CG1 1 
ATOM 591 C CG2 . VAL A 1 77 ? -6.082  -9.903  -18.132 1.00 18.40 ? 77 VAL A CG2 1 
ATOM 592 N N   . GLY A 1 78 ? -9.330  -11.496 -15.129 1.00 24.47 ? 78 GLY A N   1 
ATOM 593 C CA  . GLY A 1 78 ? -10.521 -12.240 -14.736 1.00 27.17 ? 78 GLY A CA  1 
ATOM 594 C C   . GLY A 1 78 ? -11.441 -11.328 -13.955 1.00 29.00 ? 78 GLY A C   1 
ATOM 595 O O   . GLY A 1 78 ? -11.067 -10.173 -13.686 1.00 28.78 ? 78 GLY A O   1 
ATOM 596 N N   . PRO A 1 79 ? -12.633 -11.840 -13.562 1.00 30.89 ? 79 PRO A N   1 
ATOM 597 C CA  . PRO A 1 79 ? -13.685 -11.096 -12.829 1.00 31.72 ? 79 PRO A CA  1 
ATOM 598 C C   . PRO A 1 79 ? -13.218 -10.633 -11.467 1.00 31.80 ? 79 PRO A C   1 
ATOM 599 O O   . PRO A 1 79 ? -13.089 -11.437 -10.551 1.00 32.34 ? 79 PRO A O   1 
ATOM 600 C CB  . PRO A 1 79 ? -14.806 -12.119 -12.655 1.00 32.84 ? 79 PRO A CB  1 
ATOM 601 C CG  . PRO A 1 79 ? -14.159 -13.454 -12.779 1.00 33.60 ? 79 PRO A CG  1 
ATOM 602 C CD  . PRO A 1 79 ? -12.939 -13.279 -13.669 1.00 31.73 ? 79 PRO A CD  1 
ATOM 603 N N   . THR A 1 80 ? -12.942 -9.340  -11.355 1.00 32.09 ? 80 THR A N   1 
ATOM 604 C CA  . THR A 1 80 ? -12.456 -8.737  -10.114 1.00 31.72 ? 80 THR A CA  1 
ATOM 605 C C   . THR A 1 80 ? -13.252 -7.460  -9.796  1.00 32.59 ? 80 THR A C   1 
ATOM 606 O O   . THR A 1 80 ? -13.376 -6.561  -10.663 1.00 33.23 ? 80 THR A O   1 
ATOM 607 C CB  . THR A 1 80 ? -10.962 -8.404  -10.175 1.00 30.79 ? 80 THR A CB  1 
ATOM 608 O OG1 . THR A 1 80 ? -10.655 -7.436  -9.168  1.00 29.43 ? 80 THR A OG1 1 
ATOM 609 C CG2 . THR A 1 80 ? -10.619 -7.807  -11.493 1.00 30.70 ? 80 THR A CG2 1 
ATOM 610 N N   . PRO A 1 81 ? -13.786 -7.376  -8.549  1.00 32.65 ? 81 PRO A N   1 
ATOM 611 C CA  . PRO A 1 81 ? -14.664 -6.295  -8.050  1.00 32.41 ? 81 PRO A CA  1 
ATOM 612 C C   . PRO A 1 81 ? -14.084 -4.907  -8.304  1.00 31.54 ? 81 PRO A C   1 
ATOM 613 O O   . PRO A 1 81 ? -14.819 -3.938  -8.524  1.00 31.95 ? 81 PRO A O   1 
ATOM 614 C CB  . PRO A 1 81 ? -14.711 -6.558  -6.535  1.00 32.45 ? 81 PRO A CB  1 
ATOM 615 C CG  . PRO A 1 81 ? -14.441 -8.004  -6.390  1.00 33.00 ? 81 PRO A CG  1 
ATOM 616 C CD  . PRO A 1 81 ? -13.512 -8.387  -7.505  1.00 32.45 ? 81 PRO A CD  1 
ATOM 617 N N   . VAL A 1 82 ? -12.760 -4.830  -8.241  1.00 30.27 ? 82 VAL A N   1 
ATOM 618 C CA  . VAL A 1 82 ? -12.018 -3.608  -8.500  1.00 29.19 ? 82 VAL A CA  1 
ATOM 619 C C   . VAL A 1 82 ? -10.654 -4.024  -9.062  1.00 27.08 ? 82 VAL A C   1 
ATOM 620 O O   . VAL A 1 82 ? -10.164 -5.115  -8.745  1.00 27.32 ? 82 VAL A O   1 
ATOM 621 C CB  . VAL A 1 82 ? -11.953 -2.702  -7.199  1.00 29.99 ? 82 VAL A CB  1 
ATOM 622 C CG1 . VAL A 1 82 ? -11.523 -3.509  -5.950  1.00 29.87 ? 82 VAL A CG1 1 
ATOM 623 C CG2 . VAL A 1 82 ? -11.121 -1.389  -7.409  1.00 30.57 ? 82 VAL A CG2 1 
ATOM 624 N N   . ASN A 1 83 ? -10.074 -3.196  -9.931  1.00 24.59 ? 83 ASN A N   1 
ATOM 625 C CA  . ASN A 1 83 ? -8.790  -3.508  -10.541 1.00 21.77 ? 83 ASN A CA  1 
ATOM 626 C C   . ASN A 1 83 ? -7.687  -3.274  -9.593  1.00 20.67 ? 83 ASN A C   1 
ATOM 627 O O   . ASN A 1 83 ? -7.552  -2.170  -9.092  1.00 21.24 ? 83 ASN A O   1 
ATOM 628 C CB  . ASN A 1 83 ? -8.528  -2.626  -11.736 1.00 21.54 ? 83 ASN A CB  1 
ATOM 629 C CG  . ASN A 1 83 ? -9.538  -2.799  -12.781 1.00 20.75 ? 83 ASN A CG  1 
ATOM 630 O OD1 . ASN A 1 83 ? -10.053 -3.899  -12.963 1.00 21.27 ? 83 ASN A OD1 1 
ATOM 631 N ND2 . ASN A 1 83 ? -9.858  -1.723  -13.483 1.00 18.67 ? 83 ASN A ND2 1 
ATOM 632 N N   . ILE A 1 84 ? -6.863  -4.297  -9.388  1.00 19.49 ? 84 ILE A N   1 
ATOM 633 C CA  . ILE A 1 84 ? -5.761  -4.251  -8.424  1.00 17.70 ? 84 ILE A CA  1 
ATOM 634 C C   . ILE A 1 84 ? -4.402  -4.089  -9.072  1.00 16.78 ? 84 ILE A C   1 
ATOM 635 O O   . ILE A 1 84 ? -4.048  -4.845  -9.920  1.00 16.44 ? 84 ILE A O   1 
ATOM 636 C CB  . ILE A 1 84 ? -5.741  -5.537  -7.555  1.00 17.38 ? 84 ILE A CB  1 
ATOM 637 C CG1 . ILE A 1 84 ? -7.037  -5.675  -6.769  1.00 16.28 ? 84 ILE A CG1 1 
ATOM 638 C CG2 . ILE A 1 84 ? -4.529  -5.558  -6.643  1.00 16.67 ? 84 ILE A CG2 1 
ATOM 639 C CD1 . ILE A 1 84 ? -7.451  -4.407  -6.099  1.00 16.19 ? 84 ILE A CD1 1 
ATOM 640 N N   . ILE A 1 85 ? -3.641  -3.096  -8.645  1.00 16.70 ? 85 ILE A N   1 
ATOM 641 C CA  . ILE A 1 85 ? -2.230  -3.034  -8.961  1.00 16.54 ? 85 ILE A CA  1 
ATOM 642 C C   . ILE A 1 85 ? -1.515  -3.528  -7.707  1.00 16.75 ? 85 ILE A C   1 
ATOM 643 O O   . ILE A 1 85 ? -1.347  -2.785  -6.772  1.00 17.42 ? 85 ILE A O   1 
ATOM 644 C CB  . ILE A 1 85 ? -1.801  -1.594  -9.274  1.00 16.46 ? 85 ILE A CB  1 
ATOM 645 C CG1 . ILE A 1 85 ? -2.674  -0.971  -10.354 1.00 16.50 ? 85 ILE A CG1 1 
ATOM 646 C CG2 . ILE A 1 85 ? -0.384  -1.554  -9.776  1.00 17.31 ? 85 ILE A CG2 1 
ATOM 647 C CD1 . ILE A 1 85 ? -2.542  -1.679  -11.683 1.00 18.58 ? 85 ILE A CD1 1 
ATOM 648 N N   . GLY A 1 86 ? -1.125  -4.790  -7.661  1.00 17.12 ? 86 GLY A N   1 
ATOM 649 C CA  . GLY A 1 86 ? -0.436  -5.318  -6.500  1.00 17.38 ? 86 GLY A CA  1 
ATOM 650 C C   . GLY A 1 86 ? 1.076   -5.190  -6.588  1.00 18.37 ? 86 GLY A C   1 
ATOM 651 O O   . GLY A 1 86 ? 1.607   -4.502  -7.442  1.00 18.90 ? 86 GLY A O   1 
ATOM 652 N N   . ARG A 1 87 ? 1.794   -5.892  -5.725  1.00 18.97 ? 87 ARG A N   1 
ATOM 653 C CA  . ARG A 1 87 ? 3.189   -5.579  -5.541  1.00 19.51 ? 87 ARG A CA  1 
ATOM 654 C C   . ARG A 1 87 ? 4.067   -5.916  -6.723  1.00 20.23 ? 87 ARG A C   1 
ATOM 655 O O   . ARG A 1 87 ? 5.076   -5.249  -6.929  1.00 21.55 ? 87 ARG A O   1 
ATOM 656 C CB  . ARG A 1 87 ? 3.744   -6.202  -4.259  1.00 20.08 ? 87 ARG A CB  1 
ATOM 657 C CG  . ARG A 1 87 ? 3.020   -5.798  -2.963  1.00 19.19 ? 87 ARG A CG  1 
ATOM 658 C CD  . ARG A 1 87 ? 3.690   -6.405  -1.738  1.00 20.11 ? 87 ARG A CD  1 
ATOM 659 N NE  . ARG A 1 87 ? 3.461   -7.844  -1.652  1.00 20.63 ? 87 ARG A NE  1 
ATOM 660 C CZ  . ARG A 1 87 ? 4.303   -8.776  -2.091  1.00 19.29 ? 87 ARG A CZ  1 
ATOM 661 N NH1 . ARG A 1 87 ? 5.458   -8.441  -2.654  1.00 20.65 ? 87 ARG A NH1 1 
ATOM 662 N NH2 . ARG A 1 87 ? 3.974   -10.047 -1.981  1.00 18.59 ? 87 ARG A NH2 1 
ATOM 663 N N   . ASN A 1 88 ? 3.722   -6.928  -7.509  1.00 20.20 ? 88 ASN A N   1 
ATOM 664 C CA  . ASN A 1 88 ? 4.570   -7.255  -8.673  1.00 20.43 ? 88 ASN A CA  1 
ATOM 665 C C   . ASN A 1 88 ? 4.776   -6.011  -9.517  1.00 20.20 ? 88 ASN A C   1 
ATOM 666 O O   . ASN A 1 88 ? 5.870   -5.801  -10.064 1.00 21.34 ? 88 ASN A O   1 
ATOM 667 C CB  . ASN A 1 88 ? 4.028   -8.414  -9.526  1.00 20.37 ? 88 ASN A CB  1 
ATOM 668 C CG  . ASN A 1 88 ? 2.773   -8.037  -10.309 1.00 21.45 ? 88 ASN A CG  1 
ATOM 669 O OD1 . ASN A 1 88 ? 1.860   -7.374  -9.789  1.00 22.94 ? 88 ASN A OD1 1 
ATOM 670 N ND2 . ASN A 1 88 ? 2.717   -8.462  -11.562 1.00 21.03 ? 88 ASN A ND2 1 
ATOM 671 N N   . MET A 1 89 ? 3.736   -5.172  -9.572  1.00 19.03 ? 89 MET A N   1 
ATOM 672 C CA  . MET A 1 89 ? 3.736   -3.982  -10.401 1.00 18.03 ? 89 MET A CA  1 
ATOM 673 C C   . MET A 1 89 ? 4.072   -2.787  -9.576  1.00 17.29 ? 89 MET A C   1 
ATOM 674 O O   . MET A 1 89 ? 4.636   -1.835  -10.068 1.00 17.75 ? 89 MET A O   1 
ATOM 675 C CB  . MET A 1 89 ? 2.392   -3.790  -11.078 1.00 18.06 ? 89 MET A CB  1 
ATOM 676 C CG  . MET A 1 89 ? 2.149   -4.710  -12.268 1.00 18.43 ? 89 MET A CG  1 
ATOM 677 S SD  . MET A 1 89 ? 3.196   -4.281  -13.669 1.00 20.87 ? 89 MET A SD  1 
ATOM 678 C CE  . MET A 1 89 ? 2.126   -4.655  -15.036 1.00 16.60 ? 89 MET A CE  1 
ATOM 679 N N   . LEU A 1 90 ? 3.777   -2.827  -8.297  1.00 16.69 ? 90 LEU A N   1 
ATOM 680 C CA  . LEU A 1 90 ? 4.198   -1.704  -7.485  1.00 16.77 ? 90 LEU A CA  1 
ATOM 681 C C   . LEU A 1 90 ? 5.715   -1.582  -7.467  1.00 17.88 ? 90 LEU A C   1 
ATOM 682 O O   . LEU A 1 90 ? 6.237   -0.532  -7.733  1.00 18.34 ? 90 LEU A O   1 
ATOM 683 C CB  . LEU A 1 90 ? 3.522   -1.692  -6.108  1.00 16.34 ? 90 LEU A CB  1 
ATOM 684 C CG  . LEU A 1 90 ? 2.046   -1.236  -6.254  1.00 14.83 ? 90 LEU A CG  1 
ATOM 685 C CD1 . LEU A 1 90 ? 1.253   -1.462  -5.024  1.00 15.35 ? 90 LEU A CD1 1 
ATOM 686 C CD2 . LEU A 1 90 ? 1.910   0.198   -6.644  1.00 13.26 ? 90 LEU A CD2 1 
ATOM 687 N N   . THR A 1 91 ? 6.430   -2.677  -7.251  1.00 19.32 ? 91 THR A N   1 
ATOM 688 C CA  . THR A 1 91 ? 7.896   -2.654  -7.328  1.00 20.68 ? 91 THR A CA  1 
ATOM 689 C C   . THR A 1 91 ? 8.420   -2.163  -8.650  1.00 21.95 ? 91 THR A C   1 
ATOM 690 O O   . THR A 1 91 ? 9.478   -1.545  -8.671  1.00 23.32 ? 91 THR A O   1 
ATOM 691 C CB  . THR A 1 91 ? 8.508   -4.015  -7.134  1.00 20.44 ? 91 THR A CB  1 
ATOM 692 O OG1 . THR A 1 91 ? 7.980   -4.889  -8.122  1.00 21.89 ? 91 THR A OG1 1 
ATOM 693 C CG2 . THR A 1 91 ? 8.150   -4.547  -5.815  1.00 20.17 ? 91 THR A CG2 1 
ATOM 694 N N   . GLN A 1 92 ? 7.714   -2.447  -9.753  1.00 22.75 ? 92 GLN A N   1 
ATOM 695 C CA  . GLN A 1 92 ? 8.190   -2.010  -11.088 1.00 24.13 ? 92 GLN A CA  1 
ATOM 696 C C   . GLN A 1 92 ? 8.125   -0.487  -11.243 1.00 24.61 ? 92 GLN A C   1 
ATOM 697 O O   . GLN A 1 92 ? 9.036   0.123   -11.828 1.00 26.12 ? 92 GLN A O   1 
ATOM 698 C CB  . GLN A 1 92 ? 7.478   -2.705  -12.254 1.00 23.61 ? 92 GLN A CB  1 
ATOM 699 C CG  . GLN A 1 92 ? 7.532   -4.248  -12.265 1.00 25.56 ? 92 GLN A CG  1 
ATOM 700 C CD  . GLN A 1 92 ? 8.943   -4.871  -12.262 1.00 28.13 ? 92 GLN A CD  1 
ATOM 701 O OE1 . GLN A 1 92 ? 9.922   -4.293  -12.749 1.00 27.50 ? 92 GLN A OE1 1 
ATOM 702 N NE2 . GLN A 1 92 ? 9.034   -6.073  -11.698 1.00 29.80 ? 92 GLN A NE2 1 
ATOM 703 N N   . LEU A 1 93 ? 7.082   0.128   -10.683 1.00 23.76 ? 93 LEU A N   1 
ATOM 704 C CA  . LEU A 1 93 ? 6.946   1.585   -10.714 1.00 23.49 ? 93 LEU A CA  1 
ATOM 705 C C   . LEU A 1 93 ? 7.917   2.314   -9.795  1.00 24.03 ? 93 LEU A C   1 
ATOM 706 O O   . LEU A 1 93 ? 7.938   3.550   -9.751  1.00 24.65 ? 93 LEU A O   1 
ATOM 707 C CB  . LEU A 1 93 ? 5.510   1.989   -10.409 1.00 22.33 ? 93 LEU A CB  1 
ATOM 708 C CG  . LEU A 1 93 ? 4.539   1.356   -11.389 1.00 21.52 ? 93 LEU A CG  1 
ATOM 709 C CD1 . LEU A 1 93 ? 3.177   1.376   -10.787 1.00 22.23 ? 93 LEU A CD1 1 
ATOM 710 C CD2 . LEU A 1 93 ? 4.541   2.055   -12.725 1.00 20.49 ? 93 LEU A CD2 1 
ATOM 711 N N   . GLY A 1 94 ? 8.740   1.552   -9.086  1.00 24.20 ? 94 GLY A N   1 
ATOM 712 C CA  . GLY A 1 94 ? 9.676   2.136   -8.119  1.00 25.58 ? 94 GLY A CA  1 
ATOM 713 C C   . GLY A 1 94 ? 8.963   2.649   -6.877  1.00 25.50 ? 94 GLY A C   1 
ATOM 714 O O   . GLY A 1 94 ? 9.381   3.640   -6.244  1.00 26.14 ? 94 GLY A O   1 
ATOM 715 N N   . CYS A 1 95 ? 7.896   1.935   -6.524  1.00 24.77 ? 95 CYS A N   1 
ATOM 716 C CA  . CYS A 1 95 ? 6.967   2.346   -5.508  1.00 23.91 ? 95 CYS A CA  1 
ATOM 717 C C   . CYS A 1 95 ? 7.352   1.834   -4.152  1.00 24.09 ? 95 CYS A C   1 
ATOM 718 O O   . CYS A 1 95 ? 7.657   0.652   -3.957  1.00 24.15 ? 95 CYS A O   1 
ATOM 719 C CB  . CYS A 1 95 ? 5.600   1.832   -5.850  1.00 23.34 ? 95 CYS A CB  1 
ATOM 720 S SG  . CYS A 1 95 ? 4.332   2.759   -5.140  1.00 23.54 ? 95 CYS A SG  1 
ATOM 721 N N   . THR A 1 96 ? 7.326   2.762   -3.207  1.00 24.56 ? 96 THR A N   1 
ATOM 722 C CA  . THR A 1 96 ? 7.600   2.482   -1.818  1.00 23.88 ? 96 THR A CA  1 
ATOM 723 C C   . THR A 1 96 ? 6.454   3.033   -0.985  1.00 23.09 ? 96 THR A C   1 
ATOM 724 O O   . THR A 1 96 ? 5.752   3.960   -1.417  1.00 22.37 ? 96 THR A O   1 
ATOM 725 C CB  . THR A 1 96 ? 8.905   3.166   -1.373  1.00 25.17 ? 96 THR A CB  1 
ATOM 726 O OG1 . THR A 1 96 ? 8.841   4.580   -1.668  1.00 25.60 ? 96 THR A OG1 1 
ATOM 727 C CG2 . THR A 1 96 ? 10.111  2.516   -2.077  1.00 25.24 ? 96 THR A CG2 1 
ATOM 728 N N   . LEU A 1 97 ? 6.258   2.399   0.176   1.00 22.43 ? 97 LEU A N   1 
ATOM 729 C CA  . LEU A 1 97 ? 5.544   2.941   1.320   1.00 21.64 ? 97 LEU A CA  1 
ATOM 730 C C   . LEU A 1 97 ? 6.555   3.692   2.161   1.00 22.71 ? 97 LEU A C   1 
ATOM 731 O O   . LEU A 1 97 ? 7.706   3.264   2.275   1.00 23.92 ? 97 LEU A O   1 
ATOM 732 C CB  . LEU A 1 97 ? 4.999   1.807   2.166   1.00 20.76 ? 97 LEU A CB  1 
ATOM 733 C CG  . LEU A 1 97 ? 3.734   1.082   1.760   1.00 18.64 ? 97 LEU A CG  1 
ATOM 734 C CD1 . LEU A 1 97 ? 3.590   -0.050  2.683   1.00 17.59 ? 97 LEU A CD1 1 
ATOM 735 C CD2 . LEU A 1 97 ? 2.567   1.999   1.912   1.00 18.86 ? 97 LEU A CD2 1 
ATOM 736 N N   . ASN A 1 98 ? 6.133   4.786   2.777   1.00 23.07 ? 98 ASN A N   1 
ATOM 737 C CA  . ASN A 1 98 ? 7.054   5.691   3.451   1.00 24.00 ? 98 ASN A CA  1 
ATOM 738 C C   . ASN A 1 98 ? 6.383   6.342   4.657   1.00 24.74 ? 98 ASN A C   1 
ATOM 739 O O   . ASN A 1 98 ? 5.258   6.849   4.541   1.00 25.35 ? 98 ASN A O   1 
ATOM 740 C CB  . ASN A 1 98 ? 7.471   6.800   2.483   1.00 24.50 ? 98 ASN A CB  1 
ATOM 741 C CG  . ASN A 1 98 ? 8.518   6.366   1.492   1.00 23.82 ? 98 ASN A CG  1 
ATOM 742 O OD1 . ASN A 1 98 ? 8.226   6.066   0.346   1.00 22.57 ? 98 ASN A OD1 1 
ATOM 743 N ND2 . ASN A 1 98 ? 9.755   6.374   1.923   1.00 25.53 ? 98 ASN A ND2 1 
ATOM 744 N N   . PHE A 1 99 ? 7.059   6.336   5.804   1.00 25.29 ? 99 PHE A N   1 
ATOM 745 C CA  . PHE A 1 99 ? 6.598   7.052   7.003   1.00 25.64 ? 99 PHE A CA  1 
ATOM 746 C C   . PHE A 1 99 ? 7.717   7.358   7.988   1.00 26.70 ? 99 PHE A C   1 
ATOM 747 O O   . PHE A 1 99 ? 7.507   7.656   9.161   1.00 27.03 ? 99 PHE A O   1 
ATOM 748 C CB  . PHE A 1 99 ? 5.427   6.347   7.708   1.00 24.87 ? 99 PHE A CB  1 
ATOM 749 C CG  . PHE A 1 99 ? 5.695   4.928   8.135   1.00 23.38 ? 99 PHE A CG  1 
ATOM 750 C CD1 . PHE A 1 99 ? 5.631   3.881   7.221   1.00 22.13 ? 99 PHE A CD1 1 
ATOM 751 C CD2 . PHE A 1 99 ? 5.920   4.632   9.472   1.00 24.02 ? 99 PHE A CD2 1 
ATOM 752 C CE1 . PHE A 1 99 ? 5.844   2.561   7.621   1.00 22.57 ? 99 PHE A CE1 1 
ATOM 753 C CE2 . PHE A 1 99 ? 6.136   3.307   9.894   1.00 25.10 ? 99 PHE A CE2 1 
ATOM 754 C CZ  . PHE A 1 99 ? 6.100   2.271   8.963   1.00 23.96 ? 99 PHE A CZ  1 
ATOM 755 O OXT . PHE A 1 99 ? 8.882   7.323   7.614   1.00 28.03 ? 99 PHE A OXT 1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N N   . PRO A 1  ? 0.5133 0.3731 0.3199 -0.0639 -0.0015 -0.0002 1  PRO A N   
2   C CA  . PRO A 1  ? 0.5285 0.3605 0.3217 -0.0509 -0.0028 0.0041  1  PRO A CA  
3   C C   . PRO A 1  ? 0.5098 0.3527 0.3192 -0.0457 -0.0023 0.0018  1  PRO A C   
4   O O   . PRO A 1  ? 0.4864 0.3599 0.3218 -0.0473 -0.0017 -0.0025 1  PRO A O   
5   C CB  . PRO A 1  ? 0.5136 0.3479 0.3167 -0.0335 -0.0038 0.0074  1  PRO A CB  
6   C CG  . PRO A 1  ? 0.4851 0.3546 0.3174 -0.0344 -0.0028 0.0036  1  PRO A CG  
7   C CD  . PRO A 1  ? 0.5022 0.3839 0.3319 -0.0540 -0.0014 -0.0007 1  PRO A CD  
8   N N   . GLN A 2  ? 0.5329 0.3490 0.3248 -0.0395 -0.0028 0.0045  2  GLN A N   
9   C CA  . GLN A 2  ? 0.5222 0.3447 0.3269 -0.0326 -0.0025 0.0032  2  GLN A CA  
10  C C   . GLN A 2  ? 0.5122 0.3279 0.3208 -0.0129 -0.0030 0.0063  2  GLN A C   
11  O O   . GLN A 2  ? 0.5397 0.3273 0.3246 -0.0062 -0.0038 0.0100  2  GLN A O   
12  C CB  . GLN A 2  ? 0.5556 0.3509 0.3336 -0.0414 -0.0024 0.0037  2  GLN A CB  
13  C CG  . GLN A 2  ? 0.5732 0.3734 0.3614 -0.0369 -0.0021 0.0022  2  GLN A CG  
14  C CD  . GLN A 2  ? 0.6295 0.3981 0.3864 -0.0462 -0.0019 0.0030  2  GLN A CD  
15  O OE1 . GLN A 2  ? 0.6758 0.4093 0.4039 -0.0420 -0.0021 0.0062  2  GLN A OE1 
16  N NE2 . GLN A 2  ? 0.6483 0.4291 0.4100 -0.0583 -0.0017 0.0001  2  GLN A NE2 
17  N N   . ILE A 3  ? 0.4704 0.3116 0.3072 -0.0037 -0.0029 0.0049  3  ILE A N   
18  C CA  . ILE A 3  ? 0.4478 0.2894 0.2907 0.0134  -0.0031 0.0074  3  ILE A CA  
19  C C   . ILE A 3  ? 0.4400 0.2786 0.2854 0.0208  -0.0026 0.0071  3  ILE A C   
20  O O   . ILE A 3  ? 0.4282 0.2815 0.2883 0.0158  -0.0025 0.0044  3  ILE A O   
21  C CB  . ILE A 3  ? 0.4165 0.2870 0.2850 0.0177  -0.0033 0.0067  3  ILE A CB  
22  C CG1 . ILE A 3  ? 0.3976 0.2676 0.2594 0.0109  -0.0037 0.0073  3  ILE A CG1 
23  C CG2 . ILE A 3  ? 0.4130 0.2885 0.2884 0.0339  -0.0035 0.0091  3  ILE A CG2 
24  C CD1 . ILE A 3  ? 0.3565 0.2432 0.2325 0.0185  -0.0041 0.0085  3  ILE A CD1 
25  N N   . THR A 4  ? 0.4535 0.2726 0.2833 0.0330  -0.0024 0.0096  4  THR A N   
26  C CA  . THR A 4  ? 0.4512 0.2673 0.2817 0.0413  -0.0014 0.0091  4  THR A CA  
27  C C   . THR A 4  ? 0.4263 0.2675 0.2793 0.0533  -0.0011 0.0092  4  THR A C   
28  O O   . THR A 4  ? 0.4285 0.2816 0.2892 0.0599  -0.0016 0.0106  4  THR A O   
29  C CB  . THR A 4  ? 0.4822 0.2649 0.2829 0.0491  -0.0012 0.0109  4  THR A CB  
30  O OG1 . THR A 4  ? 0.5064 0.2642 0.2834 0.0355  -0.0016 0.0110  4  THR A OG1 
31  C CG2 . THR A 4  ? 0.4972 0.2759 0.2967 0.0551  0.0002  0.0095  4  THR A CG2 
32  N N   . LEU A 5  ? 0.4054 0.2553 0.2683 0.0548  -0.0003 0.0076  5  LEU A N   
33  C CA  . LEU A 5  ? 0.3748 0.2509 0.2594 0.0613  -0.0003 0.0074  5  LEU A CA  
34  C C   . LEU A 5  ? 0.3797 0.2554 0.2596 0.0750  0.0012  0.0079  5  LEU A C   
35  O O   . LEU A 5  ? 0.3622 0.2563 0.2560 0.0772  0.0018  0.0070  5  LEU A O   
36  C CB  . LEU A 5  ? 0.3554 0.2484 0.2586 0.0518  -0.0014 0.0052  5  LEU A CB  
37  C CG  . LEU A 5  ? 0.3280 0.2269 0.2378 0.0408  -0.0028 0.0039  5  LEU A CG  
38  C CD1 . LEU A 5  ? 0.2899 0.1995 0.2124 0.0328  -0.0045 0.0012  5  LEU A CD1 
39  C CD2 . LEU A 5  ? 0.2832 0.1971 0.2037 0.0431  -0.0032 0.0045  5  LEU A CD2 
40  N N   . TRP A 6  ? 0.3982 0.2520 0.2566 0.0839  0.0017  0.0091  6  TRP A N   
41  C CA  . TRP A 6  ? 0.4041 0.2563 0.2549 0.0999  0.0030  0.0091  6  TRP A CA  
42  C C   . TRP A 6  ? 0.3954 0.2735 0.2608 0.1088  0.0025  0.0103  6  TRP A C   
43  O O   . TRP A 6  ? 0.3914 0.2895 0.2662 0.1172  0.0038  0.0093  6  TRP A O   
44  C CB  . TRP A 6  ? 0.4361 0.2529 0.2564 0.1073  0.0027  0.0099  6  TRP A CB  
45  C CG  . TRP A 6  ? 0.4423 0.2329 0.2450 0.0989  0.0035  0.0086  6  TRP A CG  
46  C CD1 . TRP A 6  ? 0.4517 0.2176 0.2370 0.0862  0.0024  0.0093  6  TRP A CD1 
47  C CD2 . TRP A 6  ? 0.4486 0.2360 0.2484 0.1009  0.0057  0.0062  6  TRP A CD2 
48  N NE1 . TRP A 6  ? 0.4715 0.2185 0.2428 0.0800  0.0037  0.0076  6  TRP A NE1 
49  C CE2 . TRP A 6  ? 0.4545 0.2135 0.2345 0.0892  0.0056  0.0057  6  TRP A CE2 
50  C CE3 . TRP A 6  ? 0.4526 0.2593 0.2639 0.1102  0.0078  0.0042  6  TRP A CE3 
51  C CZ2 . TRP A 6  ? 0.4551 0.2037 0.2268 0.0870  0.0074  0.0035  6  TRP A CZ2 
52  C CZ3 . TRP A 6  ? 0.4512 0.2472 0.2540 0.1083  0.0097  0.0019  6  TRP A CZ3 
53  C CH2 . TRP A 6  ? 0.4503 0.2170 0.2337 0.0970  0.0095  0.0017  6  TRP A CH2 
54  N N   . LYS A 7  ? 0.3901 0.2689 0.2564 0.1062  0.0006  0.0123  7  LYS A N   
55  C CA  . LYS A 7  ? 0.3814 0.2860 0.2620 0.1119  -0.0001 0.0137  7  LYS A CA  
56  C C   . LYS A 7  ? 0.3552 0.2809 0.2573 0.0984  -0.0007 0.0132  7  LYS A C   
57  O O   . LYS A 7  ? 0.3583 0.2762 0.2619 0.0860  -0.0010 0.0120  7  LYS A O   
58  C CB  . LYS A 7  ? 0.4052 0.2959 0.2711 0.1183  -0.0023 0.0165  7  LYS A CB  
59  C CG  . LYS A 7  ? 0.4677 0.3316 0.3075 0.1336  -0.0030 0.0174  7  LYS A CG  
60  C CD  . LYS A 7  ? 0.5286 0.3659 0.3473 0.1326  -0.0059 0.0204  7  LYS A CD  
61  C CE  . LYS A 7  ? 0.5441 0.3987 0.3689 0.1413  -0.0084 0.0231  7  LYS A CE  
62  N NZ  . LYS A 7  ? 0.5379 0.4000 0.3580 0.1640  -0.0092 0.0233  7  LYS A NZ  
63  N N   . ARG A 8  ? 0.3328 0.2854 0.2502 0.1010  -0.0010 0.0139  8  ARG A N   
64  C CA  . ARG A 8  ? 0.3042 0.2724 0.2379 0.0893  -0.0018 0.0134  8  ARG A CA  
65  C C   . ARG A 8  ? 0.3092 0.2629 0.2359 0.0824  -0.0030 0.0141  8  ARG A C   
66  O O   . ARG A 8  ? 0.3298 0.2748 0.2448 0.0886  -0.0040 0.0164  8  ARG A O   
67  C CB  . ARG A 8  ? 0.2868 0.2824 0.2328 0.0930  -0.0021 0.0145  8  ARG A CB  
68  C CG  . ARG A 8  ? 0.2614 0.2780 0.2180 0.0934  -0.0011 0.0134  8  ARG A CG  
69  C CD  . ARG A 8  ? 0.2772 0.3197 0.2438 0.0938  -0.0016 0.0146  8  ARG A CD  
70  N NE  . ARG A 8  ? 0.3162 0.3811 0.2930 0.0895  -0.0009 0.0135  8  ARG A NE  
71  C CZ  . ARG A 8  ? 0.3366 0.4204 0.3139 0.0975  0.0004  0.0134  8  ARG A CZ  
72  N NH1 . ARG A 8  ? 0.3820 0.4643 0.3507 0.1128  0.0009  0.0141  8  ARG A NH1 
73  N NH2 . ARG A 8  ? 0.3091 0.4134 0.2942 0.0903  0.0011  0.0124  8  ARG A NH2 
74  N N   . PRO A 9  ? 0.2952 0.2472 0.2282 0.0699  -0.0033 0.0119  9  PRO A N   
75  C CA  . PRO A 9  ? 0.3000 0.2419 0.2265 0.0619  -0.0040 0.0118  9  PRO A CA  
76  C C   . PRO A 9  ? 0.2870 0.2434 0.2209 0.0612  -0.0047 0.0128  9  PRO A C   
77  O O   . PRO A 9  ? 0.2701 0.2378 0.2156 0.0524  -0.0048 0.0105  9  PRO A O   
78  C CB  . PRO A 9  ? 0.2876 0.2320 0.2229 0.0504  -0.0040 0.0082  9  PRO A CB  
79  C CG  . PRO A 9  ? 0.2697 0.2302 0.2204 0.0520  -0.0042 0.0070  9  PRO A CG  
80  C CD  . PRO A 9  ? 0.2752 0.2360 0.2211 0.0628  -0.0033 0.0092  9  PRO A CD  
81  N N   . LEU A 10 ? 0.2992 0.2558 0.2259 0.0711  -0.0054 0.0161  10 LEU A N   
82  C CA  . LEU A 10 ? 0.2968 0.2679 0.2293 0.0709  -0.0064 0.0176  10 LEU A CA  
83  C C   . LEU A 10 ? 0.3206 0.2736 0.2375 0.0665  -0.0074 0.0190  10 LEU A C   
84  O O   . LEU A 10 ? 0.3517 0.2819 0.2483 0.0723  -0.0084 0.0214  10 LEU A O   
85  C CB  . LEU A 10 ? 0.2911 0.2760 0.2248 0.0839  -0.0071 0.0204  10 LEU A CB  
86  C CG  . LEU A 10 ? 0.2727 0.2815 0.2226 0.0852  -0.0060 0.0190  10 LEU A CG  
87  C CD1 . LEU A 10 ? 0.2681 0.2892 0.2156 0.0995  -0.0063 0.0210  10 LEU A CD1 
88  C CD2 . LEU A 10 ? 0.2393 0.2683 0.2051 0.0750  -0.0061 0.0176  10 LEU A CD2 
89  N N   . VAL A 11 ? 0.3188 0.2803 0.2432 0.0557  -0.0072 0.0173  11 VAL A N   
90  C CA  . VAL A 11 ? 0.3315 0.2782 0.2412 0.0483  -0.0079 0.0182  11 VAL A CA  
91  C C   . VAL A 11 ? 0.3287 0.2896 0.2436 0.0467  -0.0088 0.0195  11 VAL A C   
92  O O   . VAL A 11 ? 0.3033 0.2873 0.2360 0.0471  -0.0084 0.0184  11 VAL A O   
93  C CB  . VAL A 11 ? 0.3238 0.2667 0.2347 0.0342  -0.0064 0.0138  11 VAL A CB  
94  C CG1 . VAL A 11 ? 0.3389 0.2647 0.2402 0.0346  -0.0059 0.0132  11 VAL A CG1 
95  C CG2 . VAL A 11 ? 0.2861 0.2531 0.2204 0.0290  -0.0052 0.0093  11 VAL A CG2 
96  N N   . SER A 12 ? 0.3541 0.2992 0.2510 0.0437  -0.0103 0.0221  12 SER A N   
97  C CA  . SER A 12 ? 0.3583 0.3140 0.2574 0.0387  -0.0111 0.0231  12 SER A CA  
98  C C   . SER A 12 ? 0.3422 0.3087 0.2514 0.0230  -0.0087 0.0178  12 SER A C   
99  O O   . SER A 12 ? 0.3492 0.3050 0.2511 0.0132  -0.0075 0.0151  12 SER A O   
100 C CB  . SER A 12 ? 0.3914 0.3245 0.2652 0.0418  -0.0142 0.0282  12 SER A CB  
101 O OG  . SER A 12 ? 0.4148 0.3621 0.2923 0.0443  -0.0160 0.0309  12 SER A OG  
102 N N   . ILE A 13 ? 0.3138 0.3027 0.2391 0.0207  -0.0081 0.0162  13 ILE A N   
103 C CA  . ILE A 13 ? 0.2858 0.2880 0.2223 0.0086  -0.0058 0.0104  13 ILE A CA  
104 C C   . ILE A 13 ? 0.2745 0.2857 0.2100 0.0028  -0.0060 0.0109  13 ILE A C   
105 O O   . ILE A 13 ? 0.2672 0.2847 0.2031 0.0089  -0.0078 0.0150  13 ILE A O   
106 C CB  . ILE A 13 ? 0.2675 0.2870 0.2252 0.0099  -0.0044 0.0057  13 ILE A CB  
107 C CG1 . ILE A 13 ? 0.2328 0.2680 0.2007 0.0147  -0.0051 0.0072  13 ILE A CG1 
108 C CG2 . ILE A 13 ? 0.2783 0.2900 0.2372 0.0158  -0.0046 0.0056  13 ILE A CG2 
109 C CD1 . ILE A 13 ? 0.2179 0.2654 0.2012 0.0121  -0.0041 0.0020  13 ILE A CD1 
110 N N   . LYS A 14 ? 0.2669 0.2803 0.2010 -0.0095 -0.0041 0.0066  14 LYS A N   
111 C CA  . LYS A 14 ? 0.2535 0.2764 0.1869 -0.0176 -0.0036 0.0056  14 LYS A CA  
112 C C   . LYS A 14 ? 0.2327 0.2763 0.1851 -0.0223 -0.0008 -0.0018 14 LYS A C   
113 O O   . LYS A 14 ? 0.2267 0.2747 0.1839 -0.0286 0.0013  -0.0080 14 LYS A O   
114 C CB  . LYS A 14 ? 0.2638 0.2739 0.1787 -0.0292 -0.0033 0.0057  14 LYS A CB  
115 C CG  . LYS A 14 ? 0.2743 0.2587 0.1651 -0.0254 -0.0067 0.0132  14 LYS A CG  
116 C CD  . LYS A 14 ? 0.3166 0.2878 0.1883 -0.0403 -0.0060 0.0121  14 LYS A CD  
117 C CE  . LYS A 14 ? 0.3707 0.3208 0.2167 -0.0415 -0.0098 0.0190  14 LYS A CE  
118 N NZ  . LYS A 14 ? 0.4282 0.3565 0.2492 -0.0556 -0.0098 0.0190  14 LYS A NZ  
119 N N   . VAL A 15 ? 0.2270 0.2832 0.1890 -0.0190 -0.0012 -0.0014 15 VAL A N   
120 C CA  . VAL A 15 ? 0.2156 0.2878 0.1927 -0.0220 0.0007  -0.0081 15 VAL A CA  
121 C C   . VAL A 15 ? 0.2201 0.3017 0.1967 -0.0254 0.0005  -0.0067 15 VAL A C   
122 O O   . VAL A 15 ? 0.2280 0.3098 0.2012 -0.0201 -0.0017 -0.0003 15 VAL A O   
123 C CB  . VAL A 15 ? 0.1985 0.2736 0.1873 -0.0138 0.0000  -0.0090 15 VAL A CB  
124 C CG1 . VAL A 15 ? 0.2079 0.2847 0.1955 -0.0071 -0.0021 -0.0025 15 VAL A CG1 
125 C CG2 . VAL A 15 ? 0.1874 0.2732 0.1876 -0.0164 0.0013  -0.0162 15 VAL A CG2 
126 N N   . GLY A 16 ? 0.2245 0.3153 0.2041 -0.0341 0.0029  -0.0128 16 GLY A N   
127 C CA  . GLY A 16 ? 0.2242 0.3251 0.2043 -0.0387 0.0033  -0.0130 16 GLY A CA  
128 C C   . GLY A 16 ? 0.2351 0.3331 0.2030 -0.0401 0.0009  -0.0051 16 GLY A C   
129 O O   . GLY A 16 ? 0.2298 0.3362 0.1990 -0.0399 -0.0002 -0.0024 16 GLY A O   
130 N N   . GLY A 17 ? 0.2531 0.3383 0.2075 -0.0417 -0.0001 -0.0013 17 GLY A N   
131 C CA  . GLY A 17 ? 0.2829 0.3616 0.2223 -0.0423 -0.0032 0.0062  17 GLY A CA  
132 C C   . GLY A 17 ? 0.2994 0.3724 0.2348 -0.0291 -0.0074 0.0143  17 GLY A C   
133 O O   . GLY A 17 ? 0.3182 0.3856 0.2407 -0.0264 -0.0110 0.0211  17 GLY A O   
134 N N   . GLN A 18 ? 0.2989 0.3742 0.2451 -0.0206 -0.0071 0.0134  18 GLN A N   
135 C CA  . GLN A 18 ? 0.3114 0.3846 0.2561 -0.0076 -0.0101 0.0194  18 GLN A CA  
136 C C   . GLN A 18 ? 0.3155 0.3699 0.2530 -0.0025 -0.0103 0.0198  18 GLN A C   
137 O O   . GLN A 18 ? 0.3128 0.3621 0.2529 -0.0089 -0.0076 0.0145  18 GLN A O   
138 C CB  . GLN A 18 ? 0.3102 0.3999 0.2715 -0.0037 -0.0092 0.0173  18 GLN A CB  
139 C CG  . GLN A 18 ? 0.3339 0.4423 0.3024 -0.0100 -0.0087 0.0161  18 GLN A CG  
140 C CD  . GLN A 18 ? 0.4043 0.5168 0.3631 -0.0110 -0.0114 0.0216  18 GLN A CD  
141 O OE1 . GLN A 18 ? 0.4401 0.5503 0.3910 -0.0012 -0.0150 0.0282  18 GLN A OE1 
142 N NE2 . GLN A 18 ? 0.4470 0.5653 0.4051 -0.0223 -0.0099 0.0187  18 GLN A NE2 
143 N N   . ILE A 19 ? 0.3225 0.3677 0.2508 0.0095  -0.0135 0.0259  19 ILE A N   
144 C CA  . ILE A 19 ? 0.3236 0.3520 0.2461 0.0168  -0.0137 0.0264  19 ILE A CA  
145 C C   . ILE A 19 ? 0.3131 0.3542 0.2473 0.0287  -0.0142 0.0275  19 ILE A C   
146 O O   . ILE A 19 ? 0.3223 0.3717 0.2545 0.0379  -0.0169 0.0322  19 ILE A O   
147 C CB  . ILE A 19 ? 0.3474 0.3501 0.2453 0.0217  -0.0171 0.0319  19 ILE A CB  
148 C CG1 . ILE A 19 ? 0.3525 0.3410 0.2356 0.0070  -0.0166 0.0307  19 ILE A CG1 
149 C CG2 . ILE A 19 ? 0.3571 0.3434 0.2491 0.0303  -0.0172 0.0322  19 ILE A CG2 
150 C CD1 . ILE A 19 ? 0.3677 0.3262 0.2209 0.0097  -0.0209 0.0368  19 ILE A CD1 
151 N N   . LYS A 20 ? 0.3004 0.3447 0.2464 0.0278  -0.0116 0.0232  20 LYS A N   
152 C CA  . LYS A 20 ? 0.2907 0.3469 0.2472 0.0364  -0.0116 0.0236  20 LYS A CA  
153 C C   . LYS A 20 ? 0.2926 0.3324 0.2436 0.0431  -0.0113 0.0234  20 LYS A C   
154 O O   . LYS A 20 ? 0.3015 0.3207 0.2404 0.0402  -0.0112 0.0230  20 LYS A O   
155 C CB  . LYS A 20 ? 0.2780 0.3496 0.2510 0.0289  -0.0094 0.0186  20 LYS A CB  
156 C CG  . LYS A 20 ? 0.3137 0.4022 0.2929 0.0215  -0.0093 0.0177  20 LYS A CG  
157 C CD  . LYS A 20 ? 0.3786 0.4814 0.3551 0.0273  -0.0118 0.0234  20 LYS A CD  
158 C CE  . LYS A 20 ? 0.3907 0.5111 0.3732 0.0179  -0.0114 0.0222  20 LYS A CE  
159 N NZ  . LYS A 20 ? 0.3992 0.5327 0.3767 0.0215  -0.0143 0.0278  20 LYS A NZ  
160 N N   . GLU A 21 ? 0.2837 0.3328 0.2423 0.0508  -0.0111 0.0237  21 GLU A N   
161 C CA  . GLU A 21 ? 0.2887 0.3238 0.2434 0.0563  -0.0104 0.0229  21 GLU A CA  
162 C C   . GLU A 21 ? 0.2634 0.3079 0.2327 0.0517  -0.0086 0.0188  21 GLU A C   
163 O O   . GLU A 21 ? 0.2503 0.3142 0.2303 0.0512  -0.0085 0.0185  21 GLU A O   
164 C CB  . GLU A 21 ? 0.3075 0.3431 0.2550 0.0714  -0.0121 0.0269  21 GLU A CB  
165 C CG  . GLU A 21 ? 0.3497 0.3657 0.2880 0.0779  -0.0115 0.0264  21 GLU A CG  
166 C CD  . GLU A 21 ? 0.3951 0.4175 0.3303 0.0940  -0.0125 0.0286  21 GLU A CD  
167 O OE1 . GLU A 21 ? 0.3867 0.4330 0.3359 0.0959  -0.0114 0.0276  21 GLU A OE1 
168 O OE2 . GLU A 21 ? 0.4190 0.4217 0.3361 0.1045  -0.0144 0.0312  21 GLU A OE2 
169 N N   . ALA A 22 ? 0.2497 0.2803 0.2178 0.0479  -0.0075 0.0157  22 ALA A N   
170 C CA  . ALA A 22 ? 0.2270 0.2640 0.2075 0.0426  -0.0065 0.0116  22 ALA A CA  
171 C C   . ALA A 22 ? 0.2301 0.2541 0.2075 0.0446  -0.0060 0.0104  22 ALA A C   
172 O O   . ALA A 22 ? 0.2565 0.2636 0.2217 0.0459  -0.0060 0.0114  22 ALA A O   
173 C CB  . ALA A 22 ? 0.2259 0.2649 0.2117 0.0325  -0.0059 0.0074  22 ALA A CB  
174 N N   . LEU A 23 ? 0.2156 0.2455 0.2022 0.0435  -0.0060 0.0082  23 LEU A N   
175 C CA  . LEU A 23 ? 0.2130 0.2319 0.1967 0.0457  -0.0058 0.0075  23 LEU A CA  
176 C C   . LEU A 23 ? 0.2187 0.2319 0.2062 0.0383  -0.0060 0.0032  23 LEU A C   
177 O O   . LEU A 23 ? 0.2220 0.2439 0.2193 0.0336  -0.0067 0.0000  23 LEU A O   
178 C CB  . LEU A 23 ? 0.2009 0.2298 0.1905 0.0489  -0.0060 0.0080  23 LEU A CB  
179 C CG  . LEU A 23 ? 0.1894 0.2100 0.1772 0.0506  -0.0059 0.0072  23 LEU A CG  
180 C CD1 . LEU A 23 ? 0.1871 0.1999 0.1643 0.0596  -0.0048 0.0098  23 LEU A CD1 
181 C CD2 . LEU A 23 ? 0.1524 0.1849 0.1478 0.0483  -0.0066 0.0067  23 LEU A CD2 
182 N N   . LEU A 24 ? 0.2271 0.2258 0.2060 0.0376  -0.0056 0.0029  24 LEU A N   
183 C CA  . LEU A 24 ? 0.2117 0.2078 0.1943 0.0313  -0.0061 -0.0011 24 LEU A CA  
184 C C   . LEU A 24 ? 0.2063 0.2040 0.1953 0.0333  -0.0073 -0.0020 24 LEU A C   
185 O O   . LEU A 24 ? 0.2076 0.1963 0.1900 0.0367  -0.0070 -0.0002 24 LEU A O   
186 C CB  . LEU A 24 ? 0.2234 0.2039 0.1923 0.0280  -0.0053 -0.0008 24 LEU A CB  
187 C CG  . LEU A 24 ? 0.2355 0.2092 0.1928 0.0241  -0.0045 0.0003  24 LEU A CG  
188 C CD1 . LEU A 24 ? 0.2130 0.1748 0.1583 0.0152  -0.0039 -0.0012 24 LEU A CD1 
189 C CD2 . LEU A 24 ? 0.2108 0.2006 0.1787 0.0206  -0.0044 -0.0017 24 LEU A CD2 
190 N N   . ASP A 25 ? 0.1970 0.2042 0.1969 0.0311  -0.0089 -0.0050 25 ASP A N   
191 C CA  . ASP A 25 ? 0.1939 0.2018 0.1980 0.0324  -0.0109 -0.0052 25 ASP A CA  
192 C C   . ASP A 25 ? 0.1898 0.1970 0.1997 0.0298  -0.0135 -0.0095 25 ASP A C   
193 O O   . ASP A 25 ? 0.1920 0.2049 0.2082 0.0286  -0.0152 -0.0127 25 ASP A O   
194 C CB  . ASP A 25 ? 0.1907 0.2081 0.1989 0.0327  -0.0113 -0.0041 25 ASP A CB  
195 C CG  . ASP A 25 ? 0.2099 0.2268 0.2186 0.0325  -0.0132 -0.0035 25 ASP A CG  
196 O OD1 . ASP A 25 ? 0.2700 0.2792 0.2782 0.0322  -0.0149 -0.0047 25 ASP A OD1 
197 O OD2 . ASP A 25 ? 0.2162 0.2408 0.2249 0.0316  -0.0132 -0.0016 25 ASP A OD2 
198 N N   . THR A 26 ? 0.1927 0.1930 0.1997 0.0295  -0.0143 -0.0097 26 THR A N   
199 C CA  . THR A 26 ? 0.1949 0.1966 0.2073 0.0281  -0.0174 -0.0139 26 THR A CA  
200 C C   . THR A 26 ? 0.2026 0.2029 0.2183 0.0300  -0.0212 -0.0144 26 THR A C   
201 O O   . THR A 26 ? 0.2139 0.2153 0.2342 0.0309  -0.0249 -0.0182 26 THR A O   
202 C CB  . THR A 26 ? 0.1985 0.1943 0.2060 0.0260  -0.0174 -0.0139 26 THR A CB  
203 O OG1 . THR A 26 ? 0.2161 0.2026 0.2173 0.0278  -0.0173 -0.0104 26 THR A OG1 
204 C CG2 . THR A 26 ? 0.1955 0.1888 0.1955 0.0224  -0.0140 -0.0133 26 THR A CG2 
205 N N   . GLY A 27 ? 0.2008 0.1988 0.2128 0.0305  -0.0206 -0.0107 27 GLY A N   
206 C CA  . GLY A 27 ? 0.2067 0.2012 0.2177 0.0299  -0.0240 -0.0103 27 GLY A CA  
207 C C   . GLY A 27 ? 0.2163 0.2137 0.2299 0.0290  -0.0256 -0.0127 27 GLY A C   
208 O O   . GLY A 27 ? 0.2160 0.2063 0.2263 0.0281  -0.0296 -0.0134 27 GLY A O   
209 N N   . ALA A 28 ? 0.2244 0.2297 0.2415 0.0290  -0.0228 -0.0138 28 ALA A N   
210 C CA  . ALA A 28 ? 0.2382 0.2468 0.2569 0.0277  -0.0235 -0.0163 28 ALA A CA  
211 C C   . ALA A 28 ? 0.2514 0.2615 0.2754 0.0300  -0.0252 -0.0224 28 ALA A C   
212 O O   . ALA A 28 ? 0.2542 0.2704 0.2823 0.0306  -0.0234 -0.0242 28 ALA A O   
213 C CB  . ALA A 28 ? 0.2303 0.2481 0.2494 0.0260  -0.0196 -0.0140 28 ALA A CB  
214 N N   . ASP A 29 ? 0.2701 0.2747 0.2926 0.0312  -0.0288 -0.0258 29 ASP A N   
215 C CA  . ASP A 29 ? 0.2847 0.2925 0.3123 0.0356  -0.0306 -0.0326 29 ASP A CA  
216 C C   . ASP A 29 ? 0.2809 0.3003 0.3127 0.0334  -0.0265 -0.0348 29 ASP A C   
217 O O   . ASP A 29 ? 0.2809 0.3109 0.3189 0.0343  -0.0248 -0.0386 29 ASP A O   
218 C CB  . ASP A 29 ? 0.3105 0.3055 0.3323 0.0392  -0.0361 -0.0360 29 ASP A CB  
219 C CG  . ASP A 29 ? 0.3408 0.3213 0.3556 0.0406  -0.0411 -0.0335 29 ASP A CG  
220 O OD1 . ASP A 29 ? 0.3690 0.3521 0.3876 0.0426  -0.0419 -0.0328 29 ASP A OD1 
221 O OD2 . ASP A 29 ? 0.3844 0.3497 0.3883 0.0386  -0.0446 -0.0324 29 ASP A OD2 
222 N N   . ASP A 30 ? 0.2924 0.3109 0.3200 0.0294  -0.0248 -0.0323 30 ASP A N   
223 C CA  . ASP A 30 ? 0.2988 0.3263 0.3282 0.0266  -0.0216 -0.0345 30 ASP A CA  
224 C C   . ASP A 30 ? 0.2904 0.3261 0.3196 0.0221  -0.0173 -0.0290 30 ASP A C   
225 O O   . ASP A 30 ? 0.2914 0.3253 0.3182 0.0221  -0.0167 -0.0236 30 ASP A O   
226 C CB  . ASP A 30 ? 0.3088 0.3283 0.3318 0.0253  -0.0237 -0.0365 30 ASP A CB  
227 C CG  . ASP A 30 ? 0.3412 0.3466 0.3599 0.0309  -0.0292 -0.0411 30 ASP A CG  
228 O OD1 . ASP A 30 ? 0.3738 0.3831 0.3984 0.0375  -0.0305 -0.0471 30 ASP A OD1 
229 O OD2 . ASP A 30 ? 0.3588 0.3494 0.3671 0.0288  -0.0326 -0.0387 30 ASP A OD2 
230 N N   . THR A 31 ? 0.2872 0.3312 0.3176 0.0191  -0.0146 -0.0306 31 THR A N   
231 C CA  . THR A 31 ? 0.2774 0.3278 0.3058 0.0159  -0.0115 -0.0254 31 THR A CA  
232 C C   . THR A 31 ? 0.2854 0.3394 0.3104 0.0122  -0.0111 -0.0229 31 THR A C   
233 O O   . THR A 31 ? 0.2959 0.3524 0.3207 0.0094  -0.0107 -0.0268 31 THR A O   
234 C CB  . THR A 31 ? 0.2706 0.3280 0.3008 0.0138  -0.0088 -0.0278 31 THR A CB  
235 O OG1 . THR A 31 ? 0.2805 0.3358 0.3120 0.0154  -0.0089 -0.0286 31 THR A OG1 
236 C CG2 . THR A 31 ? 0.2601 0.3207 0.2855 0.0110  -0.0066 -0.0223 31 THR A CG2 
237 N N   . VAL A 32 ? 0.2897 0.3452 0.3115 0.0120  -0.0111 -0.0169 32 VAL A N   
238 C CA  . VAL A 32 ? 0.2937 0.3561 0.3121 0.0075  -0.0109 -0.0142 32 VAL A CA  
239 C C   . VAL A 32 ? 0.2946 0.3675 0.3121 0.0084  -0.0090 -0.0086 32 VAL A C   
240 O O   . VAL A 32 ? 0.2938 0.3667 0.3106 0.0132  -0.0088 -0.0049 32 VAL A O   
241 C CB  . VAL A 32 ? 0.2973 0.3566 0.3116 0.0054  -0.0131 -0.0122 32 VAL A CB  
242 C CG1 . VAL A 32 ? 0.2902 0.3544 0.2993 -0.0020 -0.0134 -0.0120 32 VAL A CG1 
243 C CG2 . VAL A 32 ? 0.2915 0.3361 0.3048 0.0076  -0.0160 -0.0160 32 VAL A CG2 
244 N N   . LEU A 33 ? 0.3036 0.3847 0.3201 0.0043  -0.0080 -0.0084 33 LEU A N   
245 C CA  . LEU A 33 ? 0.3082 0.3991 0.3227 0.0057  -0.0071 -0.0033 33 LEU A CA  
246 C C   . LEU A 33 ? 0.3229 0.4269 0.3357 0.0007  -0.0077 -0.0008 33 LEU A C   
247 O O   . LEU A 33 ? 0.3246 0.4274 0.3360 -0.0058 -0.0082 -0.0039 33 LEU A O   
248 C CB  . LEU A 33 ? 0.3019 0.3918 0.3154 0.0038  -0.0057 -0.0050 33 LEU A CB  
249 C CG  . LEU A 33 ? 0.2870 0.3671 0.3004 0.0056  -0.0048 -0.0078 33 LEU A CG  
250 C CD1 . LEU A 33 ? 0.2686 0.3500 0.2768 0.0028  -0.0036 -0.0064 33 LEU A CD1 
251 C CD2 . LEU A 33 ? 0.2680 0.3401 0.2797 0.0119  -0.0053 -0.0050 33 LEU A CD2 
252 N N   . GLU A 34 ? 0.3435 0.4600 0.3551 0.0041  -0.0078 0.0046  34 GLU A N   
253 C CA  . GLU A 34 ? 0.3668 0.5009 0.3772 -0.0009 -0.0084 0.0073  34 GLU A CA  
254 C C   . GLU A 34 ? 0.3763 0.5122 0.3849 -0.0077 -0.0078 0.0055  34 GLU A C   
255 O O   . GLU A 34 ? 0.3846 0.5099 0.3933 -0.0075 -0.0069 0.0024  34 GLU A O   
256 C CB  . GLU A 34 ? 0.3722 0.5213 0.3823 0.0069  -0.0089 0.0131  34 GLU A CB  
257 C CG  . GLU A 34 ? 0.4081 0.5551 0.4151 0.0118  -0.0091 0.0155  34 GLU A CG  
258 C CD  . GLU A 34 ? 0.4694 0.6199 0.4735 0.0244  -0.0102 0.0202  34 GLU A CD  
259 O OE1 . GLU A 34 ? 0.4911 0.6530 0.4977 0.0292  -0.0105 0.0217  34 GLU A OE1 
260 O OE2 . GLU A 34 ? 0.5040 0.6447 0.5018 0.0295  -0.0110 0.0222  34 GLU A OE2 
261 N N   . GLU A 35 ? 0.3866 0.5374 0.3931 -0.0145 -0.0084 0.0073  35 GLU A N   
262 C CA  . GLU A 35 ? 0.3982 0.5504 0.4020 -0.0222 -0.0077 0.0053  35 GLU A CA  
263 C C   . GLU A 35 ? 0.4033 0.5521 0.4068 -0.0184 -0.0071 0.0060  35 GLU A C   
264 O O   . GLU A 35 ? 0.4125 0.5676 0.4148 -0.0114 -0.0082 0.0113  35 GLU A O   
265 C CB  . GLU A 35 ? 0.4014 0.5732 0.4021 -0.0299 -0.0086 0.0085  35 GLU A CB  
266 C CG  . GLU A 35 ? 0.4139 0.5830 0.4098 -0.0407 -0.0078 0.0049  35 GLU A CG  
267 C CD  . GLU A 35 ? 0.4249 0.5760 0.4168 -0.0464 -0.0074 -0.0015 35 GLU A CD  
268 O OE1 . GLU A 35 ? 0.4297 0.5679 0.4206 -0.0474 -0.0062 -0.0070 35 GLU A OE1 
269 O OE2 . GLU A 35 ? 0.4363 0.5858 0.4248 -0.0498 -0.0086 -0.0012 35 GLU A OE2 
270 N N   . ILE A 36 ? 0.4012 0.5394 0.4041 -0.0230 -0.0055 0.0004  36 ILE A N   
271 C CA  . ILE A 36 ? 0.3994 0.5345 0.4001 -0.0229 -0.0046 0.0002  36 ILE A CA  
272 C C   . ILE A 36 ? 0.4052 0.5383 0.4046 -0.0319 -0.0026 -0.0062 36 ILE A C   
273 O O   . ILE A 36 ? 0.4020 0.5298 0.4025 -0.0350 -0.0020 -0.0118 36 ILE A O   
274 C CB  . ILE A 36 ? 0.3965 0.5191 0.3980 -0.0158 -0.0042 -0.0002 36 ILE A CB  
275 C CG1 . ILE A 36 ? 0.4041 0.5222 0.4003 -0.0181 -0.0033 -0.0003 36 ILE A CG1 
276 C CG2 . ILE A 36 ? 0.4018 0.5145 0.4081 -0.0154 -0.0032 -0.0066 36 ILE A CG2 
277 C CD1 . ILE A 36 ? 0.4109 0.5166 0.4064 -0.0149 -0.0025 -0.0023 36 ILE A CD1 
278 N N   . ASN A 37 ? 0.4155 0.5521 0.4110 -0.0358 -0.0019 -0.0054 37 ASN A N   
279 C CA  . ASN A 37 ? 0.4264 0.5639 0.4201 -0.0446 0.0002  -0.0115 37 ASN A CA  
280 C C   . ASN A 37 ? 0.4228 0.5532 0.4180 -0.0452 0.0028  -0.0183 37 ASN A C   
281 O O   . ASN A 37 ? 0.4249 0.5566 0.4159 -0.0488 0.0038  -0.0178 37 ASN A O   
282 C CB  . ASN A 37 ? 0.4441 0.5924 0.4318 -0.0511 -0.0003 -0.0072 37 ASN A CB  
283 C CG  . ASN A 37 ? 0.4735 0.6305 0.4592 -0.0579 -0.0009 -0.0070 37 ASN A CG  
284 O OD1 . ASN A 37 ? 0.5064 0.6675 0.4935 -0.0557 -0.0026 -0.0040 37 ASN A OD1 
285 N ND2 . ASN A 37 ? 0.4943 0.6544 0.4752 -0.0673 0.0005  -0.0104 37 ASN A ND2 
286 N N   . LEU A 38 ? 0.4140 0.5378 0.4141 -0.0422 0.0036  -0.0249 38 LEU A N   
287 C CA  . LEU A 38 ? 0.4028 0.5239 0.4064 -0.0415 0.0058  -0.0324 38 LEU A CA  
288 C C   . LEU A 38 ? 0.4123 0.5369 0.4150 -0.0472 0.0084  -0.0410 38 LEU A C   
289 O O   . LEU A 38 ? 0.4050 0.5283 0.4042 -0.0502 0.0081  -0.0426 38 LEU A O   
290 C CB  . LEU A 38 ? 0.3955 0.5087 0.4050 -0.0335 0.0048  -0.0353 38 LEU A CB  
291 C CG  . LEU A 38 ? 0.3687 0.4774 0.3787 -0.0274 0.0025  -0.0277 38 LEU A CG  
292 C CD1 . LEU A 38 ? 0.3522 0.4532 0.3673 -0.0209 0.0013  -0.0309 38 LEU A CD1 
293 C CD2 . LEU A 38 ? 0.3741 0.4828 0.3808 -0.0280 0.0032  -0.0243 38 LEU A CD2 
294 N N   . PRO A 39 ? 0.4228 0.5522 0.4274 -0.0492 0.0111  -0.0471 39 PRO A N   
295 C CA  . PRO A 39 ? 0.4295 0.5650 0.4342 -0.0534 0.0143  -0.0570 39 PRO A CA  
296 C C   . PRO A 39 ? 0.4288 0.5582 0.4375 -0.0457 0.0138  -0.0653 39 PRO A C   
297 O O   . PRO A 39 ? 0.4276 0.5496 0.4403 -0.0379 0.0113  -0.0638 39 PRO A O   
298 C CB  . PRO A 39 ? 0.4291 0.5732 0.4356 -0.0565 0.0168  -0.0603 39 PRO A CB  
299 C CG  . PRO A 39 ? 0.4208 0.5587 0.4299 -0.0506 0.0146  -0.0549 39 PRO A CG  
300 C CD  . PRO A 39 ? 0.4191 0.5487 0.4246 -0.0481 0.0114  -0.0448 39 PRO A CD  
301 N N   . GLY A 40 ? 0.4290 0.5601 0.4352 -0.0477 0.0159  -0.0739 40 GLY A N   
302 C CA  . GLY A 40 ? 0.4188 0.5433 0.4270 -0.0388 0.0153  -0.0835 40 GLY A CA  
303 C C   . GLY A 40 ? 0.4208 0.5276 0.4204 -0.0367 0.0124  -0.0832 40 GLY A C   
304 O O   . GLY A 40 ? 0.4194 0.5219 0.4120 -0.0438 0.0112  -0.0758 40 GLY A O   
305 N N   . LYS A 41 ? 0.4203 0.5176 0.4195 -0.0271 0.0110  -0.0918 41 LYS A N   
306 C CA  . LYS A 41 ? 0.4195 0.4949 0.4075 -0.0238 0.0076  -0.0933 41 LYS A CA  
307 C C   . LYS A 41 ? 0.3997 0.4674 0.3915 -0.0178 0.0036  -0.0872 41 LYS A C   
308 O O   . LYS A 41 ? 0.3872 0.4648 0.3903 -0.0121 0.0038  -0.0873 41 LYS A O   
309 C CB  . LYS A 41 ? 0.4363 0.5045 0.4213 -0.0136 0.0075  -0.1064 41 LYS A CB  
310 C CG  . LYS A 41 ? 0.4721 0.5143 0.4388 -0.0131 0.0048  -0.1100 41 LYS A CG  
311 C CD  . LYS A 41 ? 0.5222 0.5559 0.4853 0.0006  0.0042  -0.1236 41 LYS A CD  
312 C CE  . LYS A 41 ? 0.5358 0.5898 0.5042 0.0003  0.0099  -0.1338 41 LYS A CE  
313 N NZ  . LYS A 41 ? 0.5451 0.5984 0.5143 0.0168  0.0095  -0.1480 41 LYS A NZ  
314 N N   . TRP A 42 ? 0.3966 0.4471 0.3777 -0.0204 0.0002  -0.0822 42 TRP A N   
315 C CA  . TRP A 42 ? 0.3887 0.4305 0.3712 -0.0158 -0.0035 -0.0766 42 TRP A CA  
316 C C   . TRP A 42 ? 0.4148 0.4311 0.3826 -0.0124 -0.0077 -0.0805 42 TRP A C   
317 O O   . TRP A 42 ? 0.4334 0.4387 0.3878 -0.0178 -0.0075 -0.0837 42 TRP A O   
318 C CB  . TRP A 42 ? 0.3732 0.4213 0.3554 -0.0247 -0.0037 -0.0652 42 TRP A CB  
319 C CG  . TRP A 42 ? 0.3622 0.4073 0.3321 -0.0362 -0.0035 -0.0624 42 TRP A CG  
320 C CD1 . TRP A 42 ? 0.3373 0.3961 0.3070 -0.0447 -0.0004 -0.0610 42 TRP A CD1 
321 C CD2 . TRP A 42 ? 0.3776 0.4057 0.3323 -0.0420 -0.0067 -0.0602 42 TRP A CD2 
322 N NE1 . TRP A 42 ? 0.3423 0.3953 0.2987 -0.0551 -0.0013 -0.0582 42 TRP A NE1 
323 C CE2 . TRP A 42 ? 0.3648 0.3992 0.3113 -0.0544 -0.0051 -0.0577 42 TRP A CE2 
324 C CE3 . TRP A 42 ? 0.3811 0.3888 0.3265 -0.0391 -0.0110 -0.0600 42 TRP A CE3 
325 C CZ2 . TRP A 42 ? 0.3678 0.3901 0.2974 -0.0648 -0.0074 -0.0552 42 TRP A CZ2 
326 C CZ3 . TRP A 42 ? 0.3805 0.3742 0.3080 -0.0496 -0.0134 -0.0573 42 TRP A CZ3 
327 C CH2 . TRP A 42 ? 0.3873 0.3889 0.3070 -0.0628 -0.0114 -0.0551 42 TRP A CH2 
328 N N   . LYS A 43 ? 0.4280 0.4332 0.3967 -0.0039 -0.0117 -0.0800 43 LYS A N   
329 C CA  . LYS A 43 ? 0.4648 0.4411 0.4165 -0.0006 -0.0170 -0.0822 43 LYS A CA  
330 C C   . LYS A 43 ? 0.4668 0.4366 0.4128 -0.0084 -0.0196 -0.0720 43 LYS A C   
331 O O   . LYS A 43 ? 0.4452 0.4316 0.4040 -0.0096 -0.0183 -0.0653 43 LYS A O   
332 C CB  . LYS A 43 ? 0.4730 0.4426 0.4293 0.0155  -0.0202 -0.0895 43 LYS A CB  
333 C CG  . LYS A 43 ? 0.5249 0.4626 0.4640 0.0214  -0.0273 -0.0903 43 LYS A CG  
334 C CD  . LYS A 43 ? 0.5604 0.4991 0.5093 0.0364  -0.0308 -0.0934 43 LYS A CD  
335 C CE  . LYS A 43 ? 0.5835 0.5386 0.5444 0.0493  -0.0287 -0.1046 43 LYS A CE  
336 N NZ  . LYS A 43 ? 0.5604 0.5391 0.5418 0.0563  -0.0280 -0.1046 43 LYS A NZ  
337 N N   . PRO A 44 ? 0.4999 0.4451 0.4251 -0.0145 -0.0234 -0.0709 44 PRO A N   
338 C CA  . PRO A 44 ? 0.5026 0.4444 0.4226 -0.0225 -0.0258 -0.0619 44 PRO A CA  
339 C C   . PRO A 44 ? 0.5085 0.4364 0.4286 -0.0128 -0.0305 -0.0617 44 PRO A C   
340 O O   . PRO A 44 ? 0.5269 0.4323 0.4369 -0.0038 -0.0346 -0.0683 44 PRO A O   
341 C CB  . PRO A 44 ? 0.5323 0.4530 0.4274 -0.0351 -0.0280 -0.0614 44 PRO A CB  
342 C CG  . PRO A 44 ? 0.5536 0.4519 0.4363 -0.0275 -0.0295 -0.0717 44 PRO A CG  
343 C CD  . PRO A 44 ? 0.5322 0.4527 0.4361 -0.0166 -0.0252 -0.0775 44 PRO A CD  
344 N N   . LYS A 45 ? 0.4981 0.4394 0.4288 -0.0140 -0.0301 -0.0545 45 LYS A N   
345 C CA  . LYS A 45 ? 0.5116 0.4429 0.4440 -0.0057 -0.0342 -0.0537 45 LYS A CA  
346 C C   . LYS A 45 ? 0.5221 0.4502 0.4466 -0.0156 -0.0360 -0.0453 45 LYS A C   
347 O O   . LYS A 45 ? 0.5154 0.4618 0.4436 -0.0254 -0.0326 -0.0396 45 LYS A O   
348 C CB  . LYS A 45 ? 0.4827 0.4350 0.4375 0.0044  -0.0316 -0.0545 45 LYS A CB  
349 C CG  . LYS A 45 ? 0.5006 0.4414 0.4572 0.0162  -0.0363 -0.0572 45 LYS A CG  
350 C CD  . LYS A 45 ? 0.4753 0.4378 0.4525 0.0236  -0.0338 -0.0572 45 LYS A CD  
351 C CE  . LYS A 45 ? 0.4852 0.4380 0.4636 0.0343  -0.0388 -0.0594 45 LYS A CE  
352 N NZ  . LYS A 45 ? 0.4475 0.4205 0.4433 0.0384  -0.0364 -0.0583 45 LYS A NZ  
353 N N   . MET A 46 ? 0.5496 0.4554 0.4625 -0.0131 -0.0415 -0.0450 46 MET A N   
354 C CA  . MET A 46 ? 0.5591 0.4645 0.4666 -0.0216 -0.0430 -0.0376 46 MET A CA  
355 C C   . MET A 46 ? 0.5381 0.4576 0.4636 -0.0128 -0.0422 -0.0351 46 MET A C   
356 O O   . MET A 46 ? 0.5466 0.4568 0.4760 -0.0010 -0.0452 -0.0391 46 MET A O   
357 C CB  . MET A 46 ? 0.5969 0.4678 0.4786 -0.0257 -0.0500 -0.0378 46 MET A CB  
358 C CG  . MET A 46 ? 0.6501 0.4990 0.5054 -0.0385 -0.0521 -0.0388 46 MET A CG  
359 S SD  . MET A 46 ? 0.7005 0.5752 0.5569 -0.0560 -0.0460 -0.0346 46 MET A SD  
360 C CE  . MET A 46 ? 0.6802 0.5816 0.5457 -0.0654 -0.0438 -0.0255 46 MET A CE  
361 N N   . ILE A 47 ? 0.5149 0.4567 0.4502 -0.0182 -0.0384 -0.0289 47 ILE A N   
362 C CA  . ILE A 47 ? 0.4989 0.4483 0.4450 -0.0124 -0.0383 -0.0259 47 ILE A CA  
363 C C   . ILE A 47 ? 0.5065 0.4575 0.4442 -0.0225 -0.0389 -0.0197 47 ILE A C   
364 O O   . ILE A 47 ? 0.5256 0.4737 0.4495 -0.0346 -0.0394 -0.0177 47 ILE A O   
365 C CB  . ILE A 47 ? 0.4709 0.4447 0.4373 -0.0062 -0.0331 -0.0250 47 ILE A CB  
366 C CG1 . ILE A 47 ? 0.4630 0.4578 0.4327 -0.0138 -0.0286 -0.0207 47 ILE A CG1 
367 C CG2 . ILE A 47 ? 0.4645 0.4383 0.4391 0.0028  -0.0326 -0.0316 47 ILE A CG2 
368 C CD1 . ILE A 47 ? 0.4218 0.4369 0.4057 -0.0091 -0.0247 -0.0169 47 ILE A CD1 
369 N N   . GLY A 48 ? 0.5018 0.4584 0.4471 -0.0182 -0.0387 -0.0169 48 GLY A N   
370 C CA  . GLY A 48 ? 0.5085 0.4642 0.4448 -0.0266 -0.0400 -0.0122 48 GLY A CA  
371 C C   . GLY A 48 ? 0.5324 0.4586 0.4541 -0.0255 -0.0467 -0.0138 48 GLY A C   
372 O O   . GLY A 48 ? 0.5262 0.4435 0.4541 -0.0141 -0.0491 -0.0168 48 GLY A O   
373 N N   . GLY A 49 ? 0.5536 0.4645 0.4543 -0.0381 -0.0501 -0.0119 49 GLY A N   
374 C CA  . GLY A 49 ? 0.5697 0.4507 0.4523 -0.0392 -0.0571 -0.0120 49 GLY A CA  
375 C C   . GLY A 49 ? 0.5696 0.4559 0.4444 -0.0510 -0.0570 -0.0067 49 GLY A C   
376 O O   . GLY A 49 ? 0.5997 0.4646 0.4503 -0.0632 -0.0616 -0.0051 49 GLY A O   
377 N N   . ILE A 50 ? 0.5376 0.4516 0.4307 -0.0478 -0.0517 -0.0041 50 ILE A N   
378 C CA  . ILE A 50 ? 0.5343 0.4569 0.4222 -0.0571 -0.0509 0.0000  50 ILE A CA  
379 C C   . ILE A 50 ? 0.5315 0.4803 0.4176 -0.0706 -0.0462 0.0029  50 ILE A C   
380 O O   . ILE A 50 ? 0.5224 0.5005 0.4260 -0.0659 -0.0404 0.0035  50 ILE A O   
381 C CB  . ILE A 50 ? 0.5139 0.4474 0.4182 -0.0461 -0.0487 0.0007  50 ILE A CB  
382 C CG1 . ILE A 50 ? 0.5244 0.4312 0.4253 -0.0366 -0.0549 -0.0015 50 ILE A CG1 
383 C CG2 . ILE A 50 ? 0.5114 0.4573 0.4110 -0.0556 -0.0469 0.0044  50 ILE A CG2 
384 C CD1 . ILE A 50 ? 0.5094 0.4264 0.4300 -0.0227 -0.0526 -0.0028 50 ILE A CD1 
385 N N   . GLY A 51 ? 0.5463 0.4846 0.4097 -0.0878 -0.0491 0.0046  51 GLY A N   
386 C CA  . GLY A 51 ? 0.5337 0.4986 0.3933 -0.1027 -0.0452 0.0070  51 GLY A CA  
387 C C   . GLY A 51 ? 0.5390 0.5004 0.3900 -0.1102 -0.0455 0.0057  51 GLY A C   
388 O O   . GLY A 51 ? 0.5409 0.5198 0.3830 -0.1262 -0.0436 0.0075  51 GLY A O   
389 N N   . GLY A 52 ? 0.5362 0.4761 0.3894 -0.0990 -0.0478 0.0021  52 GLY A N   
390 C CA  . GLY A 52 ? 0.5276 0.4600 0.3735 -0.1029 -0.0481 -0.0001 52 GLY A CA  
391 C C   . GLY A 52 ? 0.4964 0.4320 0.3625 -0.0848 -0.0460 -0.0039 52 GLY A C   
392 O O   . GLY A 52 ? 0.4755 0.4246 0.3624 -0.0710 -0.0435 -0.0039 52 GLY A O   
393 N N   . PHE A 53 ? 0.4972 0.4203 0.3557 -0.0861 -0.0469 -0.0071 53 PHE A N   
394 C CA  . PHE A 53 ? 0.4682 0.3959 0.3438 -0.0716 -0.0446 -0.0112 53 PHE A CA  
395 C C   . PHE A 53 ? 0.4414 0.4006 0.3301 -0.0747 -0.0388 -0.0100 53 PHE A C   
396 O O   . PHE A 53 ? 0.4441 0.4157 0.3237 -0.0893 -0.0376 -0.0072 53 PHE A O   
397 C CB  . PHE A 53 ? 0.4962 0.3899 0.3546 -0.0697 -0.0492 -0.0167 53 PHE A CB  
398 C CG  . PHE A 53 ? 0.5039 0.3662 0.3528 -0.0604 -0.0556 -0.0192 53 PHE A CG  
399 C CD1 . PHE A 53 ? 0.5444 0.3724 0.3634 -0.0699 -0.0621 -0.0189 53 PHE A CD1 
400 C CD2 . PHE A 53 ? 0.4853 0.3514 0.3530 -0.0427 -0.0555 -0.0221 53 PHE A CD2 
401 C CE1 . PHE A 53 ? 0.5587 0.3564 0.3675 -0.0601 -0.0689 -0.0210 53 PHE A CE1 
402 C CE2 . PHE A 53 ? 0.5074 0.3473 0.3670 -0.0333 -0.0619 -0.0246 53 PHE A CE2 
403 C CZ  . PHE A 53 ? 0.5441 0.3495 0.3745 -0.0411 -0.0688 -0.0240 53 PHE A CZ  
404 N N   . ILE A 54 ? 0.4103 0.3822 0.3189 -0.0615 -0.0356 -0.0121 54 ILE A N   
405 C CA  . ILE A 54 ? 0.3833 0.3819 0.3037 -0.0624 -0.0309 -0.0109 54 ILE A CA  
406 C C   . ILE A 54 ? 0.3830 0.3698 0.3053 -0.0557 -0.0308 -0.0166 54 ILE A C   
407 O O   . ILE A 54 ? 0.3746 0.3521 0.3052 -0.0431 -0.0316 -0.0203 54 ILE A O   
408 C CB  . ILE A 54 ? 0.3596 0.3848 0.3013 -0.0526 -0.0269 -0.0078 54 ILE A CB  
409 C CG1 . ILE A 54 ? 0.3646 0.4048 0.3052 -0.0580 -0.0265 -0.0029 54 ILE A CG1 
410 C CG2 . ILE A 54 ? 0.3396 0.3869 0.2934 -0.0498 -0.0230 -0.0073 54 ILE A CG2 
411 C CD1 . ILE A 54 ? 0.3692 0.4435 0.3160 -0.0629 -0.0229 0.0010  54 ILE A CD1 
412 N N   . LYS A 55 ? 0.3879 0.3766 0.3018 -0.0649 -0.0299 -0.0176 55 LYS A N   
413 C CA  . LYS A 55 ? 0.3883 0.3682 0.3025 -0.0603 -0.0292 -0.0234 55 LYS A CA  
414 C C   . LYS A 55 ? 0.3520 0.3577 0.2872 -0.0527 -0.0244 -0.0229 55 LYS A C   
415 O O   . LYS A 55 ? 0.3526 0.3822 0.2933 -0.0583 -0.0217 -0.0185 55 LYS A O   
416 C CB  . LYS A 55 ? 0.4159 0.3862 0.3101 -0.0749 -0.0300 -0.0244 55 LYS A CB  
417 C CG  . LYS A 55 ? 0.4580 0.4186 0.3496 -0.0717 -0.0290 -0.0310 55 LYS A CG  
418 C CD  . LYS A 55 ? 0.5129 0.4373 0.3900 -0.0642 -0.0333 -0.0383 55 LYS A CD  
419 C CE  . LYS A 55 ? 0.5473 0.4501 0.4011 -0.0737 -0.0345 -0.0427 55 LYS A CE  
420 N NZ  . LYS A 55 ? 0.5528 0.4445 0.3822 -0.0930 -0.0370 -0.0380 55 LYS A NZ  
421 N N   . VAL A 56 ? 0.3266 0.3281 0.2726 -0.0402 -0.0239 -0.0275 56 VAL A N   
422 C CA  . VAL A 56 ? 0.2839 0.3058 0.2465 -0.0344 -0.0198 -0.0274 56 VAL A CA  
423 C C   . VAL A 56 ? 0.2844 0.3010 0.2474 -0.0314 -0.0185 -0.0346 56 VAL A C   
424 O O   . VAL A 56 ? 0.3057 0.3021 0.2561 -0.0322 -0.0209 -0.0402 56 VAL A O   
425 C CB  . VAL A 56 ? 0.2661 0.2955 0.2427 -0.0243 -0.0190 -0.0253 56 VAL A CB  
426 C CG1 . VAL A 56 ? 0.2602 0.2970 0.2359 -0.0274 -0.0196 -0.0187 56 VAL A CG1 
427 C CG2 . VAL A 56 ? 0.2535 0.2662 0.2312 -0.0152 -0.0216 -0.0306 56 VAL A CG2 
428 N N   . ARG A 57 ? 0.2559 0.2896 0.2312 -0.0282 -0.0150 -0.0347 57 ARG A N   
429 C CA  . ARG A 57 ? 0.2475 0.2804 0.2238 -0.0266 -0.0131 -0.0416 57 ARG A CA  
430 C C   . ARG A 57 ? 0.2316 0.2685 0.2203 -0.0162 -0.0120 -0.0455 57 ARG A C   
431 O O   . ARG A 57 ? 0.2172 0.2683 0.2158 -0.0147 -0.0099 -0.0418 57 ARG A O   
432 C CB  . ARG A 57 ? 0.2424 0.2928 0.2205 -0.0341 -0.0098 -0.0386 57 ARG A CB  
433 C CG  . ARG A 57 ? 0.2699 0.3164 0.2342 -0.0455 -0.0104 -0.0380 57 ARG A CG  
434 C CD  . ARG A 57 ? 0.2734 0.3373 0.2404 -0.0515 -0.0074 -0.0363 57 ARG A CD  
435 N NE  . ARG A 57 ? 0.2913 0.3743 0.2682 -0.0497 -0.0067 -0.0285 57 ARG A NE  
436 C CZ  . ARG A 57 ? 0.3029 0.4033 0.2823 -0.0538 -0.0051 -0.0243 57 ARG A CZ  
437 N NH1 . ARG A 57 ? 0.3288 0.4318 0.3024 -0.0616 -0.0037 -0.0269 57 ARG A NH1 
438 N NH2 . ARG A 57 ? 0.2813 0.3958 0.2679 -0.0496 -0.0052 -0.0175 57 ARG A NH2 
439 N N   . GLN A 58 ? 0.2369 0.2611 0.2239 -0.0090 -0.0138 -0.0533 58 GLN A N   
440 C CA  . GLN A 58 ? 0.2300 0.2612 0.2289 0.0002  -0.0131 -0.0579 58 GLN A CA  
441 C C   . GLN A 58 ? 0.2273 0.2729 0.2325 -0.0001 -0.0090 -0.0636 58 GLN A C   
442 O O   . GLN A 58 ? 0.2514 0.2923 0.2511 0.0003  -0.0086 -0.0707 58 GLN A O   
443 C CB  . GLN A 58 ? 0.2338 0.2487 0.2291 0.0098  -0.0173 -0.0640 58 GLN A CB  
444 C CG  . GLN A 58 ? 0.2404 0.2661 0.2484 0.0183  -0.0169 -0.0675 58 GLN A CG  
445 C CD  . GLN A 58 ? 0.2989 0.3136 0.3050 0.0297  -0.0209 -0.0754 58 GLN A CD  
446 O OE1 . GLN A 58 ? 0.3341 0.3271 0.3287 0.0326  -0.0259 -0.0749 58 GLN A OE1 
447 N NE2 . GLN A 58 ? 0.3305 0.3606 0.3470 0.0364  -0.0192 -0.0829 58 GLN A NE2 
448 N N   . TYR A 59 ? 0.2137 0.2755 0.2285 -0.0014 -0.0061 -0.0608 59 TYR A N   
449 C CA  . TYR A 59 ? 0.2145 0.2909 0.2342 -0.0037 -0.0021 -0.0656 59 TYR A CA  
450 C C   . TYR A 59 ? 0.2186 0.3036 0.2477 0.0025  -0.0017 -0.0704 59 TYR A C   
451 O O   . TYR A 59 ? 0.2257 0.3091 0.2584 0.0055  -0.0033 -0.0661 59 TYR A O   
452 C CB  . TYR A 59 ? 0.2054 0.2924 0.2254 -0.0118 0.0003  -0.0580 59 TYR A CB  
453 C CG  . TYR A 59 ? 0.2137 0.2994 0.2257 -0.0195 0.0005  -0.0537 59 TYR A CG  
454 C CD1 . TYR A 59 ? 0.2170 0.2971 0.2246 -0.0211 -0.0018 -0.0463 59 TYR A CD1 
455 C CD2 . TYR A 59 ? 0.2029 0.2956 0.2118 -0.0260 0.0032  -0.0569 59 TYR A CD2 
456 C CE1 . TYR A 59 ? 0.2215 0.3042 0.2220 -0.0290 -0.0018 -0.0424 59 TYR A CE1 
457 C CE2 . TYR A 59 ? 0.2212 0.3143 0.2225 -0.0338 0.0031  -0.0526 59 TYR A CE2 
458 C CZ  . TYR A 59 ? 0.2093 0.2980 0.2067 -0.0353 0.0004  -0.0454 59 TYR A CZ  
459 O OH  . TYR A 59 ? 0.2176 0.3102 0.2077 -0.0438 0.0001  -0.0410 59 TYR A OH  
460 N N   . ASP A 60 ? 0.2234 0.3198 0.2565 0.0039  0.0006  -0.0794 60 ASP A N   
461 C CA  . ASP A 60 ? 0.2187 0.3268 0.2609 0.0093  0.0008  -0.0845 60 ASP A CA  
462 C C   . ASP A 60 ? 0.2099 0.3365 0.2562 0.0011  0.0051  -0.0842 60 ASP A C   
463 O O   . ASP A 60 ? 0.2167 0.3482 0.2590 -0.0074 0.0081  -0.0827 60 ASP A O   
464 C CB  . ASP A 60 ? 0.2330 0.3425 0.2772 0.0195  -0.0004 -0.0961 60 ASP A CB  
465 C CG  . ASP A 60 ? 0.2465 0.3358 0.2862 0.0294  -0.0061 -0.0958 60 ASP A CG  
466 O OD1 . ASP A 60 ? 0.2852 0.3672 0.3255 0.0297  -0.0087 -0.0885 60 ASP A OD1 
467 O OD2 . ASP A 60 ? 0.2641 0.3432 0.2980 0.0368  -0.0083 -0.1029 60 ASP A OD2 
468 N N   . GLN A 61 ? 0.1998 0.3354 0.2522 0.0029  0.0049  -0.0854 61 GLN A N   
469 C CA  . GLN A 61 ? 0.1894 0.3417 0.2435 -0.0056 0.0085  -0.0863 61 GLN A CA  
470 C C   . GLN A 61 ? 0.1813 0.3295 0.2270 -0.0166 0.0106  -0.0781 61 GLN A C   
471 O O   . GLN A 61 ? 0.1788 0.3380 0.2219 -0.0251 0.0140  -0.0807 61 GLN A O   
472 C CB  . GLN A 61 ? 0.1968 0.3697 0.2565 -0.0051 0.0114  -0.0981 61 GLN A CB  
473 C CG  . GLN A 61 ? 0.2264 0.4040 0.2942 0.0078  0.0083  -0.1057 61 GLN A CG  
474 C CD  . GLN A 61 ? 0.2289 0.4266 0.3027 0.0130  0.0103  -0.1190 61 GLN A CD  
475 O OE1 . GLN A 61 ? 0.2202 0.4275 0.2918 0.0063  0.0144  -0.1230 61 GLN A OE1 
476 N NE2 . GLN A 61 ? 0.2410 0.4453 0.3220 0.0261  0.0072  -0.1262 61 GLN A NE2 
477 N N   . ILE A 62 ? 0.1722 0.3046 0.2131 -0.0157 0.0082  -0.0682 62 ILE A N   
478 C CA  . ILE A 62 ? 0.1606 0.2866 0.1928 -0.0227 0.0089  -0.0591 62 ILE A CA  
479 C C   . ILE A 62 ? 0.1674 0.2914 0.1955 -0.0262 0.0090  -0.0551 62 ILE A C   
480 O O   . ILE A 62 ? 0.1672 0.2892 0.1994 -0.0213 0.0075  -0.0559 62 ILE A O   
481 C CB  . ILE A 62 ? 0.1493 0.2615 0.1786 -0.0181 0.0060  -0.0514 62 ILE A CB  
482 C CG1 . ILE A 62 ? 0.1225 0.2334 0.1525 -0.0162 0.0055  -0.0554 62 ILE A CG1 
483 C CG2 . ILE A 62 ? 0.1435 0.2506 0.1643 -0.0223 0.0059  -0.0419 62 ILE A CG2 
484 C CD1 . ILE A 62 ? 0.0931 0.2121 0.1202 -0.0231 0.0082  -0.0591 62 ILE A CD1 
485 N N   . LEU A 63 ? 0.1776 0.3004 0.1959 -0.0351 0.0105  -0.0508 63 LEU A N   
486 C CA  . LEU A 63 ? 0.1962 0.3127 0.2054 -0.0403 0.0105  -0.0466 63 LEU A CA  
487 C C   . LEU A 63 ? 0.2071 0.3051 0.2063 -0.0370 0.0081  -0.0360 63 LEU A C   
488 O O   . LEU A 63 ? 0.2140 0.3083 0.2080 -0.0373 0.0074  -0.0312 63 LEU A O   
489 C CB  . LEU A 63 ? 0.2104 0.3359 0.2116 -0.0533 0.0135  -0.0496 63 LEU A CB  
490 C CG  . LEU A 63 ? 0.2260 0.3409 0.2097 -0.0637 0.0136  -0.0442 63 LEU A CG  
491 C CD1 . LEU A 63 ? 0.2233 0.3450 0.2067 -0.0694 0.0147  -0.0487 63 LEU A CD1 
492 C CD2 . LEU A 63 ? 0.2552 0.3753 0.2297 -0.0753 0.0156  -0.0448 63 LEU A CD2 
493 N N   . ILE A 64 ? 0.2193 0.3069 0.2160 -0.0330 0.0065  -0.0328 64 ILE A N   
494 C CA  . ILE A 64 ? 0.2349 0.3050 0.2207 -0.0288 0.0044  -0.0237 64 ILE A CA  
495 C C   . ILE A 64 ? 0.2577 0.3165 0.2295 -0.0354 0.0047  -0.0221 64 ILE A C   
496 O O   . ILE A 64 ? 0.2524 0.3186 0.2273 -0.0407 0.0060  -0.0277 64 ILE A O   
497 C CB  . ILE A 64 ? 0.2267 0.2915 0.2198 -0.0177 0.0023  -0.0212 64 ILE A CB  
498 C CG1 . ILE A 64 ? 0.2496 0.3134 0.2468 -0.0165 0.0021  -0.0246 64 ILE A CG1 
499 C CG2 . ILE A 64 ? 0.2052 0.2792 0.2102 -0.0130 0.0018  -0.0236 64 ILE A CG2 
500 C CD1 . ILE A 64 ? 0.3096 0.3625 0.3067 -0.0079 0.0001  -0.0201 64 ILE A CD1 
501 N N   . GLU A 65 ? 0.2785 0.3191 0.2333 -0.0351 0.0031  -0.0146 65 GLU A N   
502 C CA  . GLU A 65 ? 0.3042 0.3291 0.2421 -0.0414 0.0029  -0.0127 65 GLU A CA  
503 C C   . GLU A 65 ? 0.3190 0.3248 0.2495 -0.0307 0.0005  -0.0063 65 GLU A C   
504 O O   . GLU A 65 ? 0.3162 0.3189 0.2475 -0.0210 -0.0011 -0.0016 65 GLU A O   
505 C CB  . GLU A 65 ? 0.3236 0.3392 0.2420 -0.0521 0.0029  -0.0100 65 GLU A CB  
506 C CG  . GLU A 65 ? 0.3556 0.3486 0.2502 -0.0597 0.0020  -0.0069 65 GLU A CG  
507 C CD  . GLU A 65 ? 0.4087 0.3846 0.2791 -0.0675 0.0005  -0.0019 65 GLU A CD  
508 O OE1 . GLU A 65 ? 0.3714 0.3611 0.2440 -0.0765 0.0020  -0.0046 65 GLU A OE1 
509 O OE2 . GLU A 65 ? 0.4761 0.4232 0.3240 -0.0642 -0.0023 0.0046  65 GLU A OE2 
510 N N   . ILE A 66 ? 0.3410 0.3364 0.2650 -0.0324 0.0005  -0.0068 66 ILE A N   
511 C CA  . ILE A 66 ? 0.3686 0.3441 0.2830 -0.0229 -0.0013 -0.0015 66 ILE A CA  
512 C C   . ILE A 66 ? 0.4059 0.3583 0.2964 -0.0310 -0.0016 0.0001  66 ILE A C   
513 O O   . ILE A 66 ? 0.4072 0.3656 0.2974 -0.0426 0.0000  -0.0044 66 ILE A O   
514 C CB  . ILE A 66 ? 0.3528 0.3376 0.2850 -0.0147 -0.0012 -0.0040 66 ILE A CB  
515 C CG1 . ILE A 66 ? 0.3275 0.3332 0.2808 -0.0091 -0.0011 -0.0064 66 ILE A CG1 
516 C CG2 . ILE A 66 ? 0.3691 0.3347 0.2912 -0.0043 -0.0028 0.0012  66 ILE A CG2 
517 C CD1 . ILE A 66 ? 0.3129 0.3220 0.2783 0.0001  -0.0020 -0.0065 66 ILE A CD1 
518 N N   . CYS A 67 ? 0.4413 0.3676 0.3107 -0.0248 -0.0038 0.0066  67 CYS A N   
519 C CA  . CYS A 67 ? 0.4930 0.3903 0.3336 -0.0324 -0.0047 0.0090  67 CYS A CA  
520 C C   . CYS A 67 ? 0.4984 0.3993 0.3297 -0.0528 -0.0030 0.0052  67 CYS A C   
521 O O   . CYS A 67 ? 0.5189 0.4104 0.3383 -0.0626 -0.0023 0.0035  67 CYS A O   
522 C CB  . CYS A 67 ? 0.4991 0.3864 0.3385 -0.0275 -0.0046 0.0086  67 CYS A CB  
523 S SG  . CYS A 67 ? 0.5713 0.4567 0.4205 -0.0052 -0.0059 0.0122  67 CYS A SG  
524 N N   . GLY A 68 ? 0.4890 0.4051 0.3253 -0.0601 -0.0021 0.0034  68 GLY A N   
525 C CA  . GLY A 68 ? 0.4928 0.4116 0.3163 -0.0803 -0.0005 0.0002  68 GLY A CA  
526 C C   . GLY A 68 ? 0.4637 0.4193 0.3128 -0.0876 0.0028  -0.0085 68 GLY A C   
527 O O   . GLY A 68 ? 0.4682 0.4374 0.3144 -0.1027 0.0048  -0.0127 68 GLY A O   
528 N N   . LYS A 69 ? 0.4344 0.4066 0.3081 -0.0762 0.0033  -0.0117 69 LYS A N   
529 C CA  . LYS A 69 ? 0.4086 0.4130 0.3048 -0.0806 0.0057  -0.0203 69 LYS A CA  
530 C C   . LYS A 69 ? 0.3695 0.3967 0.2903 -0.0712 0.0064  -0.0238 69 LYS A C   
531 O O   . LYS A 69 ? 0.3548 0.3763 0.2830 -0.0576 0.0048  -0.0200 69 LYS A O   
532 C CB  . LYS A 69 ? 0.4069 0.4113 0.3090 -0.0769 0.0052  -0.0218 69 LYS A CB  
533 C CG  . LYS A 69 ? 0.4207 0.4576 0.3487 -0.0754 0.0063  -0.0303 69 LYS A CG  
534 C CD  . LYS A 69 ? 0.4526 0.5085 0.3779 -0.0919 0.0082  -0.0367 69 LYS A CD  
535 C CE  . LYS A 69 ? 0.4212 0.5121 0.3739 -0.0865 0.0087  -0.0457 69 LYS A CE  
536 N NZ  . LYS A 69 ? 0.4112 0.5257 0.3632 -0.1011 0.0104  -0.0525 69 LYS A NZ  
537 N N   . LYS A 70 ? 0.3506 0.4035 0.2820 -0.0793 0.0089  -0.0311 70 LYS A N   
538 C CA  . LYS A 70 ? 0.3247 0.3975 0.2763 -0.0719 0.0098  -0.0354 70 LYS A CA  
539 C C   . LYS A 70 ? 0.2918 0.3851 0.2666 -0.0631 0.0098  -0.0425 70 LYS A C   
540 O O   . LYS A 70 ? 0.2823 0.3867 0.2609 -0.0669 0.0102  -0.0472 70 LYS A O   
541 C CB  . LYS A 70 ? 0.3340 0.4218 0.2825 -0.0843 0.0125  -0.0398 70 LYS A CB  
542 C CG  . LYS A 70 ? 0.3991 0.4652 0.3226 -0.0935 0.0117  -0.0326 70 LYS A CG  
543 C CD  . LYS A 70 ? 0.4837 0.5630 0.3978 -0.1119 0.0146  -0.0373 70 LYS A CD  
544 C CE  . LYS A 70 ? 0.5409 0.6283 0.4468 -0.1268 0.0164  -0.0418 70 LYS A CE  
545 N NZ  . LYS A 70 ? 0.5909 0.6575 0.4647 -0.1454 0.0160  -0.0372 70 LYS A NZ  
546 N N   . ALA A 71 ? 0.2682 0.3655 0.2567 -0.0515 0.0089  -0.0431 71 ALA A N   
547 C CA  . ALA A 71 ? 0.2420 0.3532 0.2494 -0.0416 0.0080  -0.0492 71 ALA A CA  
548 C C   . ALA A 71 ? 0.2288 0.3519 0.2469 -0.0372 0.0087  -0.0539 71 ALA A C   
549 O O   . ALA A 71 ? 0.2409 0.3558 0.2542 -0.0370 0.0088  -0.0494 71 ALA A O   
550 C CB  . ALA A 71 ? 0.2359 0.3316 0.2450 -0.0311 0.0050  -0.0438 71 ALA A CB  
551 N N   . ILE A 72 ? 0.2118 0.3538 0.2434 -0.0331 0.0090  -0.0631 72 ILE A N   
552 C CA  . ILE A 72 ? 0.1892 0.3386 0.2297 -0.0267 0.0092  -0.0683 72 ILE A CA  
553 C C   . ILE A 72 ? 0.1791 0.3224 0.2284 -0.0131 0.0056  -0.0696 72 ILE A C   
554 O O   . ILE A 72 ? 0.1843 0.3359 0.2410 -0.0077 0.0039  -0.0747 72 ILE A O   
555 C CB  . ILE A 72 ? 0.1811 0.3554 0.2271 -0.0319 0.0125  -0.0787 72 ILE A CB  
556 C CG1 . ILE A 72 ? 0.1919 0.3669 0.2269 -0.0450 0.0157  -0.0762 72 ILE A CG1 
557 C CG2 . ILE A 72 ? 0.1794 0.3602 0.2345 -0.0225 0.0121  -0.0859 72 ILE A CG2 
558 C CD1 . ILE A 72 ? 0.2310 0.4054 0.2545 -0.0577 0.0169  -0.0730 72 ILE A CD1 
559 N N   . GLY A 73 ? 0.1740 0.3028 0.2213 -0.0082 0.0039  -0.0649 73 GLY A N   
560 C CA  . GLY A 73 ? 0.1616 0.2826 0.2141 0.0026  0.0002  -0.0663 73 GLY A CA  
561 C C   . GLY A 73 ? 0.1545 0.2651 0.2041 0.0054  -0.0008 -0.0647 73 GLY A C   
562 O O   . GLY A 73 ? 0.1492 0.2602 0.1942 -0.0005 0.0013  -0.0622 73 GLY A O   
563 N N   . THR A 74 ? 0.1561 0.2570 0.2071 0.0138  -0.0045 -0.0661 74 THR A N   
564 C CA  . THR A 74 ? 0.1584 0.2463 0.2038 0.0152  -0.0062 -0.0640 74 THR A CA  
565 C C   . THR A 74 ? 0.1574 0.2368 0.1974 0.0111  -0.0063 -0.0538 74 THR A C   
566 O O   . THR A 74 ? 0.1546 0.2297 0.1950 0.0128  -0.0075 -0.0492 74 THR A O   
567 C CB  . THR A 74 ? 0.1611 0.2363 0.2053 0.0242  -0.0110 -0.0671 74 THR A CB  
568 O OG1 . THR A 74 ? 0.1778 0.2624 0.2283 0.0315  -0.0119 -0.0767 74 THR A OG1 
569 C CG2 . THR A 74 ? 0.1536 0.2154 0.1891 0.0234  -0.0125 -0.0668 74 THR A CG2 
570 N N   . VAL A 75 ? 0.1634 0.2418 0.1984 0.0061  -0.0051 -0.0507 75 VAL A N   
571 C CA  . VAL A 75 ? 0.1597 0.2336 0.1899 0.0033  -0.0055 -0.0417 75 VAL A CA  
572 C C   . VAL A 75 ? 0.1669 0.2349 0.1913 0.0011  -0.0070 -0.0409 75 VAL A C   
573 O O   . VAL A 75 ? 0.1676 0.2374 0.1895 -0.0021 -0.0060 -0.0449 75 VAL A O   
574 C CB  . VAL A 75 ? 0.1571 0.2388 0.1853 -0.0018 -0.0027 -0.0371 75 VAL A CB  
575 C CG1 . VAL A 75 ? 0.1493 0.2285 0.1732 -0.0016 -0.0036 -0.0282 75 VAL A CG1 
576 C CG2 . VAL A 75 ? 0.1555 0.2407 0.1858 -0.0020 -0.0013 -0.0387 75 VAL A CG2 
577 N N   . LEU A 76 ? 0.1818 0.2426 0.2028 0.0018  -0.0093 -0.0357 76 LEU A N   
578 C CA  . LEU A 76 ? 0.1999 0.2546 0.2131 -0.0023 -0.0111 -0.0341 76 LEU A CA  
579 C C   . LEU A 76 ? 0.2090 0.2742 0.2205 -0.0072 -0.0098 -0.0264 76 LEU A C   
580 O O   . LEU A 76 ? 0.2074 0.2770 0.2217 -0.0042 -0.0094 -0.0212 76 LEU A O   
581 C CB  . LEU A 76 ? 0.2025 0.2433 0.2116 0.0006  -0.0149 -0.0338 76 LEU A CB  
582 C CG  . LEU A 76 ? 0.1829 0.2153 0.1958 0.0087  -0.0172 -0.0385 76 LEU A CG  
583 C CD1 . LEU A 76 ? 0.1639 0.1841 0.1718 0.0102  -0.0209 -0.0354 76 LEU A CD1 
584 C CD2 . LEU A 76 ? 0.1774 0.2029 0.1875 0.0115  -0.0184 -0.0467 76 LEU A CD2 
585 N N   . VAL A 77 ? 0.2267 0.2962 0.2329 -0.0142 -0.0092 -0.0259 77 VAL A N   
586 C CA  . VAL A 77 ? 0.2321 0.3155 0.2371 -0.0186 -0.0084 -0.0192 77 VAL A CA  
587 C C   . VAL A 77 ? 0.2598 0.3428 0.2569 -0.0253 -0.0103 -0.0167 77 VAL A C   
588 O O   . VAL A 77 ? 0.2747 0.3482 0.2634 -0.0313 -0.0113 -0.0204 77 VAL A O   
589 C CB  . VAL A 77 ? 0.2202 0.3130 0.2251 -0.0229 -0.0061 -0.0199 77 VAL A CB  
590 C CG1 . VAL A 77 ? 0.1995 0.3077 0.2036 -0.0253 -0.0059 -0.0127 77 VAL A CG1 
591 C CG2 . VAL A 77 ? 0.1988 0.2911 0.2091 -0.0185 -0.0044 -0.0229 77 VAL A CG2 
592 N N   . GLY A 78 ? 0.2796 0.3723 0.2778 -0.0244 -0.0107 -0.0107 78 GLY A N   
593 C CA  . GLY A 78 ? 0.3143 0.4126 0.3051 -0.0325 -0.0121 -0.0077 78 GLY A CA  
594 C C   . GLY A 78 ? 0.3306 0.4449 0.3261 -0.0283 -0.0118 -0.0018 78 GLY A C   
595 O O   . GLY A 78 ? 0.3249 0.4407 0.3276 -0.0186 -0.0108 -0.0003 78 GLY A O   
596 N N   . PRO A 79 ? 0.3524 0.4787 0.3425 -0.0360 -0.0126 0.0012  79 PRO A N   
597 C CA  . PRO A 79 ? 0.3547 0.5015 0.3489 -0.0325 -0.0121 0.0061  79 PRO A CA  
598 C C   . PRO A 79 ? 0.3582 0.4947 0.3553 -0.0244 -0.0123 0.0059  79 PRO A C   
599 O O   . PRO A 79 ? 0.3711 0.4955 0.3621 -0.0295 -0.0139 0.0045  79 PRO A O   
600 C CB  . PRO A 79 ? 0.3679 0.5265 0.3531 -0.0462 -0.0130 0.0075  79 PRO A CB  
601 C CG  . PRO A 79 ? 0.3899 0.5234 0.3634 -0.0558 -0.0148 0.0031  79 PRO A CG  
602 C CD  . PRO A 79 ? 0.3700 0.4881 0.3475 -0.0493 -0.0142 -0.0007 79 PRO A CD  
603 N N   . THR A 80 ? 0.3586 0.4976 0.3631 -0.0125 -0.0111 0.0075  80 THR A N   
604 C CA  . THR A 80 ? 0.3565 0.4853 0.3633 -0.0044 -0.0110 0.0073  80 THR A CA  
605 C C   . THR A 80 ? 0.3608 0.5059 0.3713 0.0055  -0.0097 0.0112  80 THR A C   
606 O O   . THR A 80 ? 0.3661 0.5176 0.3786 0.0119  -0.0091 0.0131  80 THR A O   
607 C CB  . THR A 80 ? 0.3509 0.4588 0.3601 0.0008  -0.0110 0.0039  80 THR A CB  
608 O OG1 . THR A 80 ? 0.3347 0.4372 0.3461 0.0095  -0.0105 0.0050  80 THR A OG1 
609 C CG2 . THR A 80 ? 0.3482 0.4586 0.3596 0.0029  -0.0099 0.0038  80 THR A CG2 
610 N N   . PRO A 81 ? 0.3600 0.5106 0.3699 0.0073  -0.0095 0.0122  81 PRO A N   
611 C CA  . PRO A 81 ? 0.3506 0.5180 0.3629 0.0176  -0.0082 0.0150  81 PRO A CA  
612 C C   . PRO A 81 ? 0.3430 0.4992 0.3559 0.0307  -0.0076 0.0158  81 PRO A C   
613 O O   . PRO A 81 ? 0.3439 0.5129 0.3568 0.0408  -0.0072 0.0184  81 PRO A O   
614 C CB  . PRO A 81 ? 0.3531 0.5164 0.3634 0.0161  -0.0080 0.0140  81 PRO A CB  
615 C CG  . PRO A 81 ? 0.3648 0.5187 0.3702 0.0019  -0.0097 0.0121  81 PRO A CG  
616 C CD  . PRO A 81 ? 0.3629 0.5016 0.3683 -0.0005 -0.0107 0.0102  81 PRO A CD  
617 N N   . VAL A 82 ? 0.3353 0.4673 0.3474 0.0304  -0.0078 0.0135  82 VAL A N   
618 C CA  . VAL A 82 ? 0.3273 0.4448 0.3370 0.0390  -0.0074 0.0139  82 VAL A CA  
619 C C   . VAL A 82 ? 0.3059 0.4065 0.3163 0.0328  -0.0078 0.0106  82 VAL A C   
620 O O   . VAL A 82 ? 0.3100 0.4055 0.3224 0.0256  -0.0086 0.0076  82 VAL A O   
621 C CB  . VAL A 82 ? 0.3414 0.4500 0.3479 0.0480  -0.0066 0.0143  82 VAL A CB  
622 C CG1 . VAL A 82 ? 0.3419 0.4432 0.3498 0.0422  -0.0068 0.0119  82 VAL A CG1 
623 C CG2 . VAL A 82 ? 0.3575 0.4463 0.3574 0.0552  -0.0064 0.0148  82 VAL A CG2 
624 N N   . ASN A 83 ? 0.2778 0.3707 0.2854 0.0354  -0.0075 0.0110  83 ASN A N   
625 C CA  . ASN A 83 ? 0.2456 0.3273 0.2543 0.0295  -0.0074 0.0072  83 ASN A CA  
626 C C   . ASN A 83 ? 0.2367 0.3033 0.2451 0.0304  -0.0073 0.0046  83 ASN A C   
627 O O   . ASN A 83 ? 0.2487 0.3065 0.2516 0.0360  -0.0069 0.0063  83 ASN A O   
628 C CB  . ASN A 83 ? 0.2451 0.3241 0.2491 0.0302  -0.0070 0.0085  83 ASN A CB  
629 C CG  . ASN A 83 ? 0.2300 0.3242 0.2339 0.0292  -0.0075 0.0112  83 ASN A CG  
630 O OD1 . ASN A 83 ? 0.2312 0.3372 0.2396 0.0235  -0.0077 0.0103  83 ASN A OD1 
631 N ND2 . ASN A 83 ? 0.2063 0.2995 0.2033 0.0342  -0.0081 0.0148  83 ASN A ND2 
632 N N   . ILE A 84 ? 0.2217 0.2842 0.2345 0.0252  -0.0081 0.0002  84 ILE A N   
633 C CA  . ILE A 84 ? 0.2026 0.2535 0.2163 0.0259  -0.0087 -0.0026 84 ILE A CA  
634 C C   . ILE A 84 ? 0.1919 0.2384 0.2070 0.0230  -0.0082 -0.0068 84 ILE A C   
635 O O   . ILE A 84 ? 0.1850 0.2360 0.2035 0.0193  -0.0083 -0.0103 84 ILE A O   
636 C CB  . ILE A 84 ? 0.1983 0.2472 0.2147 0.0235  -0.0108 -0.0048 84 ILE A CB  
637 C CG1 . ILE A 84 ? 0.1832 0.2380 0.1972 0.0244  -0.0110 -0.0010 84 ILE A CG1 
638 C CG2 . ILE A 84 ? 0.1924 0.2307 0.2102 0.0247  -0.0122 -0.0080 84 ILE A CG2 
639 C CD1 . ILE A 84 ? 0.1833 0.2375 0.1942 0.0310  -0.0095 0.0022  84 ILE A CD1 
640 N N   . ILE A 85 ? 0.1948 0.2333 0.2064 0.0242  -0.0076 -0.0070 85 ILE A N   
641 C CA  . ILE A 85 ? 0.1925 0.2298 0.2061 0.0203  -0.0073 -0.0118 85 ILE A CA  
642 C C   . ILE A 85 ? 0.1952 0.2285 0.2127 0.0218  -0.0092 -0.0145 85 ILE A C   
643 O O   . ILE A 85 ? 0.2076 0.2334 0.2208 0.0232  -0.0092 -0.0127 85 ILE A O   
644 C CB  . ILE A 85 ? 0.1968 0.2273 0.2011 0.0183  -0.0057 -0.0100 85 ILE A CB  
645 C CG1 . ILE A 85 ? 0.1996 0.2305 0.1968 0.0186  -0.0047 -0.0059 85 ILE A CG1 
646 C CG2 . ILE A 85 ? 0.2056 0.2401 0.2118 0.0119  -0.0049 -0.0154 85 ILE A CG2 
647 C CD1 . ILE A 85 ? 0.2205 0.2625 0.2228 0.0136  -0.0041 -0.0088 85 ILE A CD1 
648 N N   . GLY A 86 ? 0.1965 0.2333 0.2206 0.0218  -0.0112 -0.0188 86 GLY A N   
649 C CA  . GLY A 86 ? 0.2004 0.2327 0.2273 0.0241  -0.0139 -0.0212 86 GLY A CA  
650 C C   . GLY A 86 ? 0.2098 0.2471 0.2410 0.0232  -0.0143 -0.0268 86 GLY A C   
651 O O   . GLY A 86 ? 0.2145 0.2582 0.2453 0.0193  -0.0118 -0.0285 86 GLY A O   
652 N N   . ARG A 87 ? 0.2166 0.2526 0.2516 0.0264  -0.0177 -0.0301 87 ARG A N   
653 C CA  . ARG A 87 ? 0.2194 0.2631 0.2585 0.0259  -0.0182 -0.0348 87 ARG A CA  
654 C C   . ARG A 87 ? 0.2218 0.2800 0.2669 0.0249  -0.0171 -0.0415 87 ARG A C   
655 O O   . ARG A 87 ? 0.2341 0.3033 0.2811 0.0210  -0.0156 -0.0447 87 ARG A O   
656 C CB  . ARG A 87 ? 0.2273 0.2671 0.2686 0.0306  -0.0228 -0.0363 87 ARG A CB  
657 C CG  . ARG A 87 ? 0.2225 0.2493 0.2573 0.0305  -0.0237 -0.0302 87 ARG A CG  
658 C CD  . ARG A 87 ? 0.2348 0.2579 0.2710 0.0343  -0.0287 -0.0319 87 ARG A CD  
659 N NE  . ARG A 87 ? 0.2435 0.2602 0.2799 0.0393  -0.0331 -0.0336 87 ARG A NE  
660 C CZ  . ARG A 87 ? 0.2233 0.2451 0.2644 0.0446  -0.0362 -0.0398 87 ARG A CZ  
661 N NH1 . ARG A 87 ? 0.2325 0.2709 0.2812 0.0455  -0.0351 -0.0454 87 ARG A NH1 
662 N NH2 . ARG A 87 ? 0.2198 0.2299 0.2565 0.0489  -0.0405 -0.0408 87 ARG A NH2 
663 N N   . ASN A 88 ? 0.2203 0.2794 0.2676 0.0274  -0.0176 -0.0441 88 ASN A N   
664 C CA  . ASN A 88 ? 0.2164 0.2904 0.2692 0.0269  -0.0160 -0.0514 88 ASN A CA  
665 C C   . ASN A 88 ? 0.2114 0.2941 0.2618 0.0182  -0.0114 -0.0504 88 ASN A C   
666 O O   . ASN A 88 ? 0.2191 0.3179 0.2738 0.0151  -0.0099 -0.0564 88 ASN A O   
667 C CB  . ASN A 88 ? 0.2168 0.2877 0.2692 0.0295  -0.0165 -0.0539 88 ASN A CB  
668 C CG  . ASN A 88 ? 0.2339 0.3006 0.2806 0.0236  -0.0135 -0.0481 88 ASN A CG  
669 O OD1 . ASN A 88 ? 0.2569 0.3157 0.2987 0.0216  -0.0130 -0.0408 88 ASN A OD1 
670 N ND2 . ASN A 88 ? 0.2264 0.2992 0.2735 0.0214  -0.0115 -0.0516 88 ASN A ND2 
671 N N   . MET A 89 ? 0.2027 0.2750 0.2451 0.0143  -0.0096 -0.0429 89 MET A N   
672 C CA  . MET A 89 ? 0.1916 0.2661 0.2273 0.0063  -0.0060 -0.0407 89 MET A CA  
673 C C   . MET A 89 ? 0.1868 0.2546 0.2153 0.0027  -0.0057 -0.0374 89 MET A C   
674 O O   . MET A 89 ? 0.1939 0.2645 0.2159 -0.0052 -0.0035 -0.0379 89 MET A O   
675 C CB  . MET A 89 ? 0.1966 0.2634 0.2262 0.0057  -0.0049 -0.0348 89 MET A CB  
676 C CG  . MET A 89 ? 0.1972 0.2719 0.2308 0.0052  -0.0041 -0.0382 89 MET A CG  
677 S SD  . MET A 89 ? 0.2231 0.3129 0.2567 -0.0033 -0.0007 -0.0440 89 MET A SD  
678 C CE  . MET A 89 ? 0.1700 0.2601 0.2004 -0.0057 0.0006  -0.0418 89 MET A CE  
679 N N   . LEU A 90 ? 0.1827 0.2407 0.2106 0.0075  -0.0080 -0.0344 90 LEU A N   
680 C CA  . LEU A 90 ? 0.1887 0.2396 0.2085 0.0035  -0.0076 -0.0320 90 LEU A CA  
681 C C   . LEU A 90 ? 0.1965 0.2625 0.2204 -0.0019 -0.0076 -0.0383 90 LEU A C   
682 O O   . LEU A 90 ? 0.2054 0.2713 0.2201 -0.0110 -0.0055 -0.0380 90 LEU A O   
683 C CB  . LEU A 90 ? 0.1888 0.2261 0.2059 0.0091  -0.0097 -0.0275 90 LEU A CB  
684 C CG  . LEU A 90 ? 0.1765 0.2014 0.1856 0.0121  -0.0084 -0.0208 90 LEU A CG  
685 C CD1 . LEU A 90 ? 0.1862 0.2023 0.1946 0.0179  -0.0100 -0.0173 90 LEU A CD1 
686 C CD2 . LEU A 90 ? 0.1648 0.1793 0.1595 0.0076  -0.0062 -0.0172 90 LEU A CD2 
687 N N   . THR A 91 ? 0.2060 0.2857 0.2423 0.0032  -0.0100 -0.0444 91 THR A N   
688 C CA  . THR A 91 ? 0.2143 0.3147 0.2566 -0.0006 -0.0101 -0.0515 91 THR A CA  
689 C C   . THR A 91 ? 0.2264 0.3408 0.2667 -0.0100 -0.0062 -0.0551 91 THR A C   
690 O O   . THR A 91 ? 0.2396 0.3680 0.2782 -0.0187 -0.0050 -0.0586 91 THR A O   
691 C CB  . THR A 91 ? 0.2022 0.3161 0.2581 0.0092  -0.0136 -0.0583 91 THR A CB  
692 O OG1 . THR A 91 ? 0.2193 0.3334 0.2788 0.0138  -0.0130 -0.0604 91 THR A OG1 
693 C CG2 . THR A 91 ? 0.2030 0.3036 0.2595 0.0172  -0.0180 -0.0552 91 THR A CG2 
694 N N   . GLN A 92 ? 0.2376 0.3495 0.2773 -0.0096 -0.0044 -0.0545 92 GLN A N   
695 C CA  . GLN A 92 ? 0.2516 0.3767 0.2883 -0.0195 -0.0007 -0.0580 92 GLN A CA  
696 C C   . GLN A 92 ? 0.2675 0.3807 0.2866 -0.0322 0.0014  -0.0525 92 GLN A C   
697 O O   . GLN A 92 ? 0.2839 0.4103 0.2982 -0.0441 0.0038  -0.0562 92 GLN A O   
698 C CB  . GLN A 92 ? 0.2440 0.3695 0.2835 -0.0166 0.0005  -0.0588 92 GLN A CB  
699 C CG  . GLN A 92 ? 0.2617 0.3950 0.3144 -0.0050 -0.0016 -0.0647 92 GLN A CG  
700 C CD  . GLN A 92 ? 0.2822 0.4403 0.3463 -0.0018 -0.0022 -0.0751 92 GLN A CD  
701 O OE1 . GLN A 92 ? 0.2675 0.4453 0.3321 -0.0105 0.0003  -0.0799 92 GLN A OE1 
702 N NE2 . GLN A 92 ? 0.3009 0.4582 0.3731 0.0108  -0.0061 -0.0787 92 GLN A NE2 
703 N N   . LEU A 93 ? 0.2688 0.3571 0.2769 -0.0297 0.0005  -0.0442 93 LEU A N   
704 C CA  . LEU A 93 ? 0.2780 0.3487 0.2658 -0.0394 0.0018  -0.0387 93 LEU A CA  
705 C C   . LEU A 93 ? 0.2871 0.3579 0.2680 -0.0472 0.0015  -0.0397 93 LEU A C   
706 O O   . LEU A 93 ? 0.3074 0.3609 0.2681 -0.0568 0.0023  -0.0356 93 LEU A O   
707 C CB  . LEU A 93 ? 0.2750 0.3203 0.2532 -0.0320 0.0007  -0.0302 93 LEU A CB  
708 C CG  . LEU A 93 ? 0.2623 0.3096 0.2458 -0.0264 0.0010  -0.0289 93 LEU A CG  
709 C CD1 . LEU A 93 ? 0.2775 0.3087 0.2583 -0.0161 -0.0005 -0.0223 93 LEU A CD1 
710 C CD2 . LEU A 93 ? 0.2539 0.2993 0.2252 -0.0358 0.0029  -0.0278 93 LEU A CD2 
711 N N   . GLY A 94 ? 0.2780 0.3674 0.2739 -0.0434 0.0000  -0.0453 94 GLY A N   
712 C CA  . GLY A 94 ? 0.2959 0.3888 0.2871 -0.0505 -0.0007 -0.0465 94 GLY A CA  
713 C C   . GLY A 94 ? 0.3070 0.3737 0.2882 -0.0460 -0.0024 -0.0397 94 GLY A C   
714 O O   . GLY A 94 ? 0.3234 0.3798 0.2898 -0.0552 -0.0022 -0.0377 94 GLY A O   
715 N N   . CYS A 95 ? 0.2985 0.3553 0.2872 -0.0326 -0.0041 -0.0365 95 CYS A N   
716 C CA  . CYS A 95 ? 0.2985 0.3315 0.2783 -0.0268 -0.0051 -0.0301 95 CYS A CA  
717 C C   . CYS A 95 ? 0.2967 0.3336 0.2847 -0.0221 -0.0079 -0.0314 95 CYS A C   
718 O O   . CYS A 95 ? 0.2868 0.3392 0.2914 -0.0150 -0.0104 -0.0355 95 CYS A O   
719 C CB  . CYS A 95 ? 0.2929 0.3173 0.2763 -0.0164 -0.0053 -0.0264 95 CYS A CB  
720 S SG  . CYS A 95 ? 0.3102 0.3066 0.2774 -0.0114 -0.0051 -0.0186 95 CYS A SG  
721 N N   . THR A 96 ? 0.3129 0.3330 0.2870 -0.0259 -0.0079 -0.0278 96 THR A N   
722 C CA  . THR A 96 ? 0.3033 0.3229 0.2812 -0.0228 -0.0105 -0.0279 96 THR A CA  
723 C C   . THR A 96 ? 0.3059 0.2996 0.2717 -0.0177 -0.0102 -0.0217 96 THR A C   
724 O O   . THR A 96 ? 0.3080 0.2835 0.2583 -0.0189 -0.0078 -0.0178 96 THR A O   
725 C CB  . THR A 96 ? 0.3191 0.3467 0.2903 -0.0351 -0.0106 -0.0307 96 THR A CB  
726 O OG1 . THR A 96 ? 0.3389 0.3471 0.2867 -0.0463 -0.0078 -0.0274 96 THR A OG1 
727 C CG2 . THR A 96 ? 0.3043 0.3642 0.2904 -0.0388 -0.0112 -0.0381 96 THR A CG2 
728 N N   . LEU A 97 ? 0.2954 0.2884 0.2682 -0.0111 -0.0127 -0.0211 97 LEU A N   
729 C CA  . LEU A 97 ? 0.2958 0.2688 0.2574 -0.0084 -0.0125 -0.0168 97 LEU A CA  
730 C C   . LEU A 97 ? 0.3138 0.2835 0.2654 -0.0180 -0.0130 -0.0177 97 LEU A C   
731 O O   . LEU A 97 ? 0.3197 0.3084 0.2805 -0.0227 -0.0151 -0.0218 97 LEU A O   
732 C CB  . LEU A 97 ? 0.2795 0.2558 0.2531 0.0006  -0.0154 -0.0163 97 LEU A CB  
733 C CG  . LEU A 97 ? 0.2510 0.2264 0.2308 0.0095  -0.0151 -0.0142 97 LEU A CG  
734 C CD1 . LEU A 97 ? 0.2334 0.2124 0.2224 0.0143  -0.0188 -0.0146 97 LEU A CD1 
735 C CD2 . LEU A 97 ? 0.2638 0.2222 0.2303 0.0126  -0.0122 -0.0097 97 LEU A CD2 
736 N N   . ASN A 98 ? 0.3325 0.2790 0.2648 -0.0205 -0.0112 -0.0142 98 ASN A N   
737 C CA  . ASN A 98 ? 0.3516 0.2910 0.2691 -0.0322 -0.0110 -0.0147 98 ASN A CA  
738 C C   . ASN A 98 ? 0.3742 0.2893 0.2764 -0.0294 -0.0103 -0.0112 98 ASN A C   
739 O O   . ASN A 98 ? 0.3919 0.2877 0.2833 -0.0222 -0.0082 -0.0081 98 ASN A O   
740 C CB  . ASN A 98 ? 0.3670 0.2973 0.2663 -0.0435 -0.0085 -0.0147 98 ASN A CB  
741 C CG  . ASN A 98 ? 0.3455 0.3027 0.2567 -0.0512 -0.0088 -0.0193 98 ASN A CG  
742 O OD1 . ASN A 98 ? 0.3253 0.2895 0.2428 -0.0484 -0.0078 -0.0200 98 ASN A OD1 
743 N ND2 . ASN A 98 ? 0.3608 0.3348 0.2743 -0.0615 -0.0101 -0.0229 98 ASN A ND2 
744 N N   . PHE A 99 ? 0.3809 0.2980 0.2819 -0.0347 -0.0121 -0.0121 99 PHE A N   
745 C CA  . PHE A 99 ? 0.3987 0.2925 0.2827 -0.0345 -0.0111 -0.0096 99 PHE A CA  
746 C C   . PHE A 99 ? 0.4135 0.3098 0.2910 -0.0463 -0.0128 -0.0110 99 PHE A C   
747 O O   . PHE A 99 ? 0.4255 0.3081 0.2934 -0.0465 -0.0128 -0.0096 99 PHE A O   
748 C CB  . PHE A 99 ? 0.3867 0.2781 0.2798 -0.0212 -0.0115 -0.0077 99 PHE A CB  
749 C CG  . PHE A 99 ? 0.3530 0.2665 0.2687 -0.0172 -0.0156 -0.0092 99 PHE A CG  
750 C CD1 . PHE A 99 ? 0.3249 0.2566 0.2591 -0.0116 -0.0172 -0.0107 99 PHE A CD1 
751 C CD2 . PHE A 99 ? 0.3611 0.2741 0.2773 -0.0184 -0.0181 -0.0089 99 PHE A CD2 
752 C CE1 . PHE A 99 ? 0.3197 0.2667 0.2709 -0.0070 -0.0216 -0.0121 99 PHE A CE1 
753 C CE2 . PHE A 99 ? 0.3634 0.2928 0.2973 -0.0141 -0.0228 -0.0099 99 PHE A CE2 
754 C CZ  . PHE A 99 ? 0.3382 0.2834 0.2888 -0.0080 -0.0247 -0.0115 99 PHE A CZ  
755 O OXT . PHE A 99 ? 0.4231 0.3371 0.3045 -0.0566 -0.0140 -0.0138 99 PHE A OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PRO 1  1  1  PRO PRO A . n 
A 1 2  GLN 2  2  2  GLN GLN A . n 
A 1 3  ILE 3  3  3  ILE ILE A . n 
A 1 4  THR 4  4  4  THR THR A . n 
A 1 5  LEU 5  5  5  LEU LEU A . n 
A 1 6  TRP 6  6  6  TRP TRP A . n 
A 1 7  LYS 7  7  7  LYS LYS A . n 
A 1 8  ARG 8  8  8  ARG ARG A . n 
A 1 9  PRO 9  9  9  PRO PRO A . n 
A 1 10 LEU 10 10 10 LEU LEU A . n 
A 1 11 VAL 11 11 11 VAL VAL A . n 
A 1 12 SER 12 12 12 SER SER A . n 
A 1 13 ILE 13 13 13 ILE ILE A . n 
A 1 14 LYS 14 14 14 LYS LYS A . n 
A 1 15 VAL 15 15 15 VAL VAL A . n 
A 1 16 GLY 16 16 16 GLY GLY A . n 
A 1 17 GLY 17 17 17 GLY GLY A . n 
A 1 18 GLN 18 18 18 GLN GLN A . n 
A 1 19 ILE 19 19 19 ILE ILE A . n 
A 1 20 LYS 20 20 20 LYS LYS A . n 
A 1 21 GLU 21 21 21 GLU GLU A . n 
A 1 22 ALA 22 22 22 ALA ALA A . n 
A 1 23 LEU 23 23 23 LEU LEU A . n 
A 1 24 LEU 24 24 24 LEU LEU A . n 
A 1 25 ASP 25 25 25 ASP ASP A . n 
A 1 26 THR 26 26 26 THR THR A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 ALA 28 28 28 ALA ALA A . n 
A 1 29 ASP 29 29 29 ASP ASP A . n 
A 1 30 ASP 30 30 30 ASP ASP A . n 
A 1 31 THR 31 31 31 THR THR A . n 
A 1 32 VAL 32 32 32 VAL VAL A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 GLU 34 34 34 GLU GLU A . n 
A 1 35 GLU 35 35 35 GLU GLU A . n 
A 1 36 ILE 36 36 36 ILE ILE A . n 
A 1 37 ASN 37 37 37 ASN ASN A . n 
A 1 38 LEU 38 38 38 LEU LEU A . n 
A 1 39 PRO 39 39 39 PRO PRO A . n 
A 1 40 GLY 40 40 40 GLY GLY A . n 
A 1 41 LYS 41 41 41 LYS LYS A . n 
A 1 42 TRP 42 42 42 TRP TRP A . n 
A 1 43 LYS 43 43 43 LYS LYS A . n 
A 1 44 PRO 44 44 44 PRO PRO A . n 
A 1 45 LYS 45 45 45 LYS LYS A . n 
A 1 46 MET 46 46 46 MET MET A . n 
A 1 47 ILE 47 47 47 ILE ILE A . n 
A 1 48 GLY 48 48 48 GLY GLY A . n 
A 1 49 GLY 49 49 49 GLY GLY A . n 
A 1 50 ILE 50 50 50 ILE ILE A . n 
A 1 51 GLY 51 51 51 GLY GLY A . n 
A 1 52 GLY 52 52 52 GLY GLY A . n 
A 1 53 PHE 53 53 53 PHE PHE A . n 
A 1 54 ILE 54 54 54 ILE ILE A . n 
A 1 55 LYS 55 55 55 LYS LYS A . n 
A 1 56 VAL 56 56 56 VAL VAL A . n 
A 1 57 ARG 57 57 57 ARG ARG A . n 
A 1 58 GLN 58 58 58 GLN GLN A . n 
A 1 59 TYR 59 59 59 TYR TYR A . n 
A 1 60 ASP 60 60 60 ASP ASP A . n 
A 1 61 GLN 61 61 61 GLN GLN A . n 
A 1 62 ILE 62 62 62 ILE ILE A . n 
A 1 63 LEU 63 63 63 LEU LEU A . n 
A 1 64 ILE 64 64 64 ILE ILE A . n 
A 1 65 GLU 65 65 65 GLU GLU A . n 
A 1 66 ILE 66 66 66 ILE ILE A . n 
A 1 67 CYS 67 67 67 CYS CYS A . n 
A 1 68 GLY 68 68 68 GLY GLY A . n 
A 1 69 LYS 69 69 69 LYS LYS A . n 
A 1 70 LYS 70 70 70 LYS LYS A . n 
A 1 71 ALA 71 71 71 ALA ALA A . n 
A 1 72 ILE 72 72 72 ILE ILE A . n 
A 1 73 GLY 73 73 73 GLY GLY A . n 
A 1 74 THR 74 74 74 THR THR A . n 
A 1 75 VAL 75 75 75 VAL VAL A . n 
A 1 76 LEU 76 76 76 LEU LEU A . n 
A 1 77 VAL 77 77 77 VAL VAL A . n 
A 1 78 GLY 78 78 78 GLY GLY A . n 
A 1 79 PRO 79 79 79 PRO PRO A . n 
A 1 80 THR 80 80 80 THR THR A . n 
A 1 81 PRO 81 81 81 PRO PRO A . n 
A 1 82 VAL 82 82 82 VAL VAL A . n 
A 1 83 ASN 83 83 83 ASN ASN A . n 
A 1 84 ILE 84 84 84 ILE ILE A . n 
A 1 85 ILE 85 85 85 ILE ILE A . n 
A 1 86 GLY 86 86 86 GLY GLY A . n 
A 1 87 ARG 87 87 87 ARG ARG A . n 
A 1 88 ASN 88 88 88 ASN ASN A . n 
A 1 89 MET 89 89 89 MET MET A . n 
A 1 90 LEU 90 90 90 LEU LEU A . n 
A 1 91 THR 91 91 91 THR THR A . n 
A 1 92 GLN 92 92 92 GLN GLN A . n 
A 1 93 LEU 93 93 93 LEU LEU A . n 
A 1 94 GLY 94 94 94 GLY GLY A . n 
A 1 95 CYS 95 95 95 CYS CYS A . n 
A 1 96 THR 96 96 96 THR THR A . n 
A 1 97 LEU 97 97 97 LEU LEU A . n 
A 1 98 ASN 98 98 98 ASN ASN A . n 
A 1 99 PHE 99 99 99 PHE PHE A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3020  ? 
1 MORE         -19   ? 
1 'SSA (A^2)'  10510 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2012-10-17 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_diffrn_reflns.diffrn_id                   1 
_diffrn_reflns.pdbx_d_res_high             2.697 
_diffrn_reflns.pdbx_d_res_low              ? 
_diffrn_reflns.pdbx_number_obs             5638 
_diffrn_reflns.pdbx_Rmerge_I_obs           ? 
_diffrn_reflns.pdbx_Rsym_value             0.200 
_diffrn_reflns.pdbx_chi_squared            ? 
_diffrn_reflns.av_sigmaI_over_netI         91.20 
_diffrn_reflns.pdbx_redundancy             8.18 
_diffrn_reflns.pdbx_percent_possible_obs   98.76 
_diffrn_reflns.number                      46145 
_diffrn_reflns.pdbx_observed_criterion     ? 
_diffrn_reflns.limit_h_max                 ? 
_diffrn_reflns.limit_h_min                 ? 
_diffrn_reflns.limit_k_max                 ? 
_diffrn_reflns.limit_k_min                 ? 
_diffrn_reflns.limit_l_max                 ? 
_diffrn_reflns.limit_l_min                 ? 
# 
loop_
_pdbx_diffrn_reflns_shell.diffrn_id 
_pdbx_diffrn_reflns_shell.d_res_high 
_pdbx_diffrn_reflns_shell.d_res_low 
_pdbx_diffrn_reflns_shell.number_obs 
_pdbx_diffrn_reflns_shell.rejects 
_pdbx_diffrn_reflns_shell.Rmerge_I_obs 
_pdbx_diffrn_reflns_shell.Rsym_value 
_pdbx_diffrn_reflns_shell.chi_squared 
_pdbx_diffrn_reflns_shell.redundancy 
_pdbx_diffrn_reflns_shell.percent_possible_obs 
1 2.70 2.79 ? ? ? 0.413 ? ? ? 
1 2.79 2.91 ? ? ? 0.333 ? ? ? 
1 2.91 3.04 ? ? ? 0.306 ? ? ? 
1 3.04 3.20 ? ? ? 0.292 ? ? ? 
1 3.20 3.40 ? ? ? 0.276 ? ? ? 
1 3.40 3.66 ? ? ? 0.291 ? ? ? 
1 3.66 4.03 ? ? ? 0.260 ? ? ? 
1 4.03 4.61 ? ? ? 0.186 ? ? ? 
1 4.61 5.81 ? ? ? 0.148 ? ? ? 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -2.6229 
_pdbx_refine_tls.origin_y         -4.5867 
_pdbx_refine_tls.origin_z         -11.2942 
_pdbx_refine_tls.T[1][1]          0.0218 
_pdbx_refine_tls.T[2][2]          0.0761 
_pdbx_refine_tls.T[3][3]          0.0419 
_pdbx_refine_tls.T[1][2]          0.0143 
_pdbx_refine_tls.T[1][3]          -0.0066 
_pdbx_refine_tls.T[2][3]          -0.0160 
_pdbx_refine_tls.L[1][1]          0.4157 
_pdbx_refine_tls.L[2][2]          0.4314 
_pdbx_refine_tls.L[3][3]          2.5586 
_pdbx_refine_tls.L[1][2]          0.4203 
_pdbx_refine_tls.L[1][3]          0.2807 
_pdbx_refine_tls.L[2][3]          0.2630 
_pdbx_refine_tls.S[1][1]          -0.0378 
_pdbx_refine_tls.S[2][2]          0.1308 
_pdbx_refine_tls.S[3][3]          -0.0930 
_pdbx_refine_tls.S[1][2]          0.1505 
_pdbx_refine_tls.S[1][3]          -0.0464 
_pdbx_refine_tls.S[2][3]          -0.0616 
_pdbx_refine_tls.S[2][1]          -0.0112 
_pdbx_refine_tls.S[3][1]          -0.0731 
_pdbx_refine_tls.S[3][2]          -0.0192 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     1 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     99 
_pdbx_refine_tls_group.selection_details   ? 
_pdbx_refine_tls_group.beg_label_asym_id   . 
_pdbx_refine_tls_group.beg_label_seq_id    . 
_pdbx_refine_tls_group.end_label_asym_id   . 
_pdbx_refine_tls_group.end_label_seq_id    . 
_pdbx_refine_tls_group.selection           ? 
# 
_pdbx_phasing_MR.entry_id                     3U71 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.720 
_pdbx_phasing_MR.d_res_low_rotation           41.740 
_pdbx_phasing_MR.d_res_high_translation       2.720 
_pdbx_phasing_MR.d_res_low_translation        41.740 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SAINT       V7.68A ?               package ?                    ?                        'data scaling'    
http://www.bruker-axs.de/                    ?          ? 
2 SAINT       V7.68A ?               package ?                    ?                        'data reduction'  
http://www.bruker-axs.de/                    ?          ? 
3 MOLREP      .      ?               program 'Alexei Vaguine'     alexei@ysbl.york.ac.uk   phasing           
http://www.ccp4.ac.uk/dist/html/molrep.html  Fortran_77 ? 
4 REFMAC      .      ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
5 PDB_EXTRACT 3.10   'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    35 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH2 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    57 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.90 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 9  ? ? -69.40 68.02 
2 1 CYS A 67 ? ? 36.07  43.26 
#