data_3U78
# 
_entry.id   3U78 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3U78         
RCSB  RCSB068393   
WWPDB D_1000068393 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3KVA 
_pdbx_database_related.details        'Structure of KIAA1718 Jumonji domain in complex with alpha-ketoglutarate' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3U78 
_pdbx_database_status.recvd_initial_deposition_date   2011-10-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Upadhyay, A.K.' 1 
'Cheng, X.'      2 
# 
_citation.id                        primary 
_citation.title                     
'An Analog of BIX-01294 Selectively Inhibits a Family of Histone H3 Lysine 9 Jumonji Demethylases.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            416 
_citation.page_first                319 
_citation.page_last                 327 
_citation.year                      2012 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22227394 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2011.12.036 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Upadhyay, A.K.' 1  
primary 'Rotili, D.'     2  
primary 'Han, J.W.'      3  
primary 'Hu, R.'         4  
primary 'Chang, Y.'      5  
primary 'Labella, D.'    6  
primary 'Zhang, X.'      7  
primary 'Yoon, Y.S.'     8  
primary 'Mai, A.'        9  
primary 'Cheng, X.'      10 
# 
_cell.entry_id           3U78 
_cell.length_a           77.429 
_cell.length_b           77.429 
_cell.length_c           289.685 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3U78 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Lysine-specific demethylase 7' 46081.043 1  1.14.11.- ? 'Jumonji domain (UNP residues 92-488)' ? 
2 non-polymer syn '2-OXOGLUTARIC ACID' 146.098   1  ?         ? ?                                      ? 
3 non-polymer syn 'NICKEL (II) ION' 58.693    1  ?         ? ?                                      ? 
4 non-polymer syn 'CHLORIDE ION' 35.453    1  ?         ? ?                                      ? 
5 non-polymer syn 'SULFATE ION' 96.063    1  ?         ? ?                                      ? 
6 non-polymer syn 1,2-ETHANEDIOL 62.068    2  ?         ? ?                                      ? 
7 non-polymer syn 
'7-[(5-aminopentyl)oxy]-N~4~-(1-benzylpiperidin-4-yl)-N~2~-[3-(dimethylamino)propyl]-6-methoxyquinazoline-2,4-diamine' 549.751   1 
?         ? ?                                      ? 
8 water       nat water 18.015    45 ?         ? ?                                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'KIAA1718, JmjC domain-containing histone demethylation protein 1D' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLR
LPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWV
ENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDK
VDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLL
ETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEENGKPVKSQGI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLR
LPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWV
ENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDK
VDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLL
ETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEENGKPVKSQGI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   LEU n 
1 3   MET n 
1 4   LYS n 
1 5   LYS n 
1 6   ARG n 
1 7   ARG n 
1 8   ASN n 
1 9   TRP n 
1 10  HIS n 
1 11  ARG n 
1 12  HIS n 
1 13  ASP n 
1 14  TYR n 
1 15  THR n 
1 16  GLU n 
1 17  ILE n 
1 18  ASP n 
1 19  ASP n 
1 20  GLY n 
1 21  SER n 
1 22  LYS n 
1 23  PRO n 
1 24  VAL n 
1 25  GLN n 
1 26  ALA n 
1 27  GLY n 
1 28  THR n 
1 29  ARG n 
1 30  THR n 
1 31  PHE n 
1 32  ILE n 
1 33  LYS n 
1 34  GLU n 
1 35  LEU n 
1 36  ARG n 
1 37  SER n 
1 38  ARG n 
1 39  VAL n 
1 40  PHE n 
1 41  PRO n 
1 42  SER n 
1 43  ALA n 
1 44  ASP n 
1 45  GLU n 
1 46  ILE n 
1 47  ILE n 
1 48  ILE n 
1 49  LYS n 
1 50  MET n 
1 51  HIS n 
1 52  GLY n 
1 53  SER n 
1 54  GLN n 
1 55  LEU n 
1 56  THR n 
1 57  GLN n 
1 58  ARG n 
1 59  TYR n 
1 60  LEU n 
1 61  GLU n 
1 62  LYS n 
1 63  HIS n 
1 64  GLY n 
1 65  PHE n 
1 66  ASP n 
1 67  VAL n 
1 68  PRO n 
1 69  ILE n 
1 70  MET n 
1 71  VAL n 
1 72  PRO n 
1 73  LYS n 
1 74  LEU n 
1 75  ASP n 
1 76  ASP n 
1 77  LEU n 
1 78  GLY n 
1 79  LEU n 
1 80  ARG n 
1 81  LEU n 
1 82  PRO n 
1 83  SER n 
1 84  PRO n 
1 85  THR n 
1 86  PHE n 
1 87  SER n 
1 88  VAL n 
1 89  MET n 
1 90  ASP n 
1 91  VAL n 
1 92  GLU n 
1 93  ARG n 
1 94  TYR n 
1 95  VAL n 
1 96  GLY n 
1 97  GLY n 
1 98  ASP n 
1 99  LYS n 
1 100 VAL n 
1 101 ILE n 
1 102 ASP n 
1 103 VAL n 
1 104 ILE n 
1 105 ASP n 
1 106 VAL n 
1 107 ALA n 
1 108 ARG n 
1 109 GLN n 
1 110 ALA n 
1 111 ASP n 
1 112 SER n 
1 113 LYS n 
1 114 MET n 
1 115 THR n 
1 116 LEU n 
1 117 HIS n 
1 118 ASN n 
1 119 TYR n 
1 120 VAL n 
1 121 LYS n 
1 122 TYR n 
1 123 PHE n 
1 124 MET n 
1 125 ASN n 
1 126 PRO n 
1 127 ASN n 
1 128 ARG n 
1 129 PRO n 
1 130 LYS n 
1 131 VAL n 
1 132 LEU n 
1 133 ASN n 
1 134 VAL n 
1 135 ILE n 
1 136 SER n 
1 137 LEU n 
1 138 GLU n 
1 139 PHE n 
1 140 SER n 
1 141 ASP n 
1 142 THR n 
1 143 LYS n 
1 144 MET n 
1 145 SER n 
1 146 GLU n 
1 147 LEU n 
1 148 VAL n 
1 149 GLU n 
1 150 VAL n 
1 151 PRO n 
1 152 ASP n 
1 153 ILE n 
1 154 ALA n 
1 155 LYS n 
1 156 LYS n 
1 157 LEU n 
1 158 SER n 
1 159 TRP n 
1 160 VAL n 
1 161 GLU n 
1 162 ASN n 
1 163 TYR n 
1 164 TRP n 
1 165 PRO n 
1 166 ASP n 
1 167 ASP n 
1 168 SER n 
1 169 VAL n 
1 170 PHE n 
1 171 PRO n 
1 172 LYS n 
1 173 PRO n 
1 174 PHE n 
1 175 VAL n 
1 176 GLN n 
1 177 LYS n 
1 178 TYR n 
1 179 CYS n 
1 180 LEU n 
1 181 MET n 
1 182 GLY n 
1 183 VAL n 
1 184 GLN n 
1 185 ASP n 
1 186 SER n 
1 187 TYR n 
1 188 THR n 
1 189 ASP n 
1 190 PHE n 
1 191 HIS n 
1 192 ILE n 
1 193 ASP n 
1 194 PHE n 
1 195 GLY n 
1 196 GLY n 
1 197 THR n 
1 198 SER n 
1 199 VAL n 
1 200 TRP n 
1 201 TYR n 
1 202 HIS n 
1 203 VAL n 
1 204 LEU n 
1 205 TRP n 
1 206 GLY n 
1 207 GLU n 
1 208 LYS n 
1 209 ILE n 
1 210 PHE n 
1 211 TYR n 
1 212 LEU n 
1 213 ILE n 
1 214 LYS n 
1 215 PRO n 
1 216 THR n 
1 217 ASP n 
1 218 GLU n 
1 219 ASN n 
1 220 LEU n 
1 221 ALA n 
1 222 ARG n 
1 223 TYR n 
1 224 GLU n 
1 225 SER n 
1 226 TRP n 
1 227 SER n 
1 228 SER n 
1 229 SER n 
1 230 VAL n 
1 231 THR n 
1 232 GLN n 
1 233 SER n 
1 234 GLU n 
1 235 VAL n 
1 236 PHE n 
1 237 PHE n 
1 238 GLY n 
1 239 ASP n 
1 240 LYS n 
1 241 VAL n 
1 242 ASP n 
1 243 LYS n 
1 244 CYS n 
1 245 TYR n 
1 246 LYS n 
1 247 CYS n 
1 248 VAL n 
1 249 VAL n 
1 250 LYS n 
1 251 GLN n 
1 252 GLY n 
1 253 HIS n 
1 254 THR n 
1 255 LEU n 
1 256 PHE n 
1 257 VAL n 
1 258 PRO n 
1 259 THR n 
1 260 GLY n 
1 261 TRP n 
1 262 ILE n 
1 263 HIS n 
1 264 ALA n 
1 265 VAL n 
1 266 LEU n 
1 267 THR n 
1 268 SER n 
1 269 GLN n 
1 270 ASP n 
1 271 CYS n 
1 272 MET n 
1 273 ALA n 
1 274 PHE n 
1 275 GLY n 
1 276 GLY n 
1 277 ASN n 
1 278 PHE n 
1 279 LEU n 
1 280 HIS n 
1 281 ASN n 
1 282 LEU n 
1 283 ASN n 
1 284 ILE n 
1 285 GLY n 
1 286 MET n 
1 287 GLN n 
1 288 LEU n 
1 289 ARG n 
1 290 CYS n 
1 291 TYR n 
1 292 GLU n 
1 293 MET n 
1 294 GLU n 
1 295 LYS n 
1 296 ARG n 
1 297 LEU n 
1 298 LYS n 
1 299 THR n 
1 300 PRO n 
1 301 ASP n 
1 302 LEU n 
1 303 PHE n 
1 304 LYS n 
1 305 PHE n 
1 306 PRO n 
1 307 PHE n 
1 308 PHE n 
1 309 GLU n 
1 310 ALA n 
1 311 ILE n 
1 312 CYS n 
1 313 TRP n 
1 314 PHE n 
1 315 VAL n 
1 316 ALA n 
1 317 LYS n 
1 318 ASN n 
1 319 LEU n 
1 320 LEU n 
1 321 GLU n 
1 322 THR n 
1 323 LEU n 
1 324 LYS n 
1 325 GLU n 
1 326 LEU n 
1 327 ARG n 
1 328 GLU n 
1 329 ASP n 
1 330 GLY n 
1 331 PHE n 
1 332 GLN n 
1 333 PRO n 
1 334 GLN n 
1 335 THR n 
1 336 TYR n 
1 337 LEU n 
1 338 VAL n 
1 339 GLN n 
1 340 GLY n 
1 341 VAL n 
1 342 LYS n 
1 343 ALA n 
1 344 LEU n 
1 345 HIS n 
1 346 THR n 
1 347 ALA n 
1 348 LEU n 
1 349 LYS n 
1 350 LEU n 
1 351 TRP n 
1 352 MET n 
1 353 LYS n 
1 354 LYS n 
1 355 GLU n 
1 356 LEU n 
1 357 VAL n 
1 358 SER n 
1 359 GLU n 
1 360 HIS n 
1 361 ALA n 
1 362 PHE n 
1 363 GLU n 
1 364 ILE n 
1 365 PRO n 
1 366 ASP n 
1 367 ASN n 
1 368 VAL n 
1 369 ARG n 
1 370 PRO n 
1 371 GLY n 
1 372 HIS n 
1 373 LEU n 
1 374 ILE n 
1 375 LYS n 
1 376 GLU n 
1 377 LEU n 
1 378 SER n 
1 379 LYS n 
1 380 VAL n 
1 381 ILE n 
1 382 ARG n 
1 383 ALA n 
1 384 ILE n 
1 385 GLU n 
1 386 GLU n 
1 387 GLU n 
1 388 ASN n 
1 389 GLY n 
1 390 LYS n 
1 391 PRO n 
1 392 VAL n 
1 393 LYS n 
1 394 SER n 
1 395 GLN n 
1 396 GLY n 
1 397 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'JHDM1D, KDM7, KIAA1718' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KDM7_HUMAN 
_struct_ref.pdbx_db_accession          Q6ZMT4 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLR
LPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWV
ENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDK
VDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLL
ETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEENGKPVKSQGI
;
_struct_ref.pdbx_align_begin           92 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3U78 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 397 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q6ZMT4 
_struct_ref_seq.db_align_beg                  92 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  488 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       92 
_struct_ref_seq.pdbx_auth_seq_align_end       488 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AKG non-polymer         . '2-OXOGLUTARIC ACID' ?                 'C5 H6 O5'       146.098 
ALA 'L-peptide linking' y ALANINE ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION' ?                 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE ?                 'C3 H7 N O2 S'   121.158 
E67 non-polymer         . 
'7-[(5-aminopentyl)oxy]-N~4~-(1-benzylpiperidin-4-yl)-N~2~-[3-(dimethylamino)propyl]-6-methoxyquinazoline-2,4-diamine' ? 
'C31 H47 N7 O2'  549.751 
EDO non-polymer         . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ?                 'C5 H11 N O2 S'  149.211 
NI  non-polymer         . 'NICKEL (II) ION' ?                 'Ni 2'           58.693  
PHE 'L-peptide linking' y PHENYLALANINE ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ?                 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION' ?                 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3U78 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.72 
_exptl_crystal.density_percent_sol   54.75 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.4 
_exptl_crystal_grow.pdbx_details    
'15-20% v/v PEG5000 MME, 0.2 M calcium chloride, 0.1 M Bis-Tris, pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 290K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-04-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Rosenbaum-Rock double-crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             1.00000 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3U78 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             26.593 
_reflns.d_resolution_high            2.689 
_reflns.number_obs                   14476 
_reflns.number_all                   14476 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.124 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        25.5 
_reflns.B_iso_Wilson_estimate        48.26 
_reflns.pdbx_redundancy              18.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.689 
_reflns_shell.d_res_low              2.89 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.708 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.2 
_reflns_shell.pdbx_redundancy        19.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1324 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3U78 
_refine.ls_number_reflns_obs                     14472 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.08 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             26.593 
_refine.ls_d_res_high                            2.689 
_refine.ls_percent_reflns_obs                    95.27 
_refine.ls_R_factor_obs                          0.2051 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1984 
_refine.ls_R_factor_R_free                       0.2645 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.01 
_refine.ls_number_reflns_R_free                  1448 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            8.0184 
_refine.aniso_B[2][2]                            8.0184 
_refine.aniso_B[3][3]                            -16.0368 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.319 
_refine.solvent_model_param_bsol                 41.322 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3KVA' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.42 
_refine.pdbx_overall_phase_error                 24.37 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2940 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         52 
_refine_hist.number_atoms_solvent             45 
_refine_hist.number_atoms_total               3037 
_refine_hist.d_res_high                       2.689 
_refine_hist.d_res_low                        26.593 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.008  ? ? 3067 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.195  ? ? 4156 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 16.359 ? ? 1125 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.080  ? ? 451  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.006  ? ? 523  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.689  2.7855  1136 0.2136 86.0 0.2919 . . 126 . . . . 'X-RAY DIFFRACTION' 
. 2.7855 2.8969  1186 0.2380 91.0 0.3598 . . 132 . . . . 'X-RAY DIFFRACTION' 
. 2.8969 3.0286  1227 0.2287 92.0 0.3013 . . 136 . . . . 'X-RAY DIFFRACTION' 
. 3.0286 3.1880  1275 0.2126 95.0 0.2912 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 3.1880 3.3873  1286 0.2186 96.0 0.2823 . . 143 . . . . 'X-RAY DIFFRACTION' 
. 3.3873 3.6483  1316 0.1912 98.0 0.2883 . . 147 . . . . 'X-RAY DIFFRACTION' 
. 3.6483 4.0143  1351 0.1891 99.0 0.2853 . . 149 . . . . 'X-RAY DIFFRACTION' 
. 4.0143 4.5926  1361 0.1583 99.0 0.2097 . . 151 . . . . 'X-RAY DIFFRACTION' 
. 4.5926 5.7764  1378 0.1612 98.0 0.2213 . . 154 . . . . 'X-RAY DIFFRACTION' 
. 5.7764 26.5943 1508 0.2007 98.0 0.2354 . . 168 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3U78 
_struct.title                     'E67-2 selectively inhibits KIAA1718, a human histone H3 lysine 9 Jumonji demethylase' 
_struct.pdbx_descriptor           'Lysine-specific demethylase 7 (E.C.1.14.11.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3U78 
_struct_keywords.pdbx_keywords   'OXIDOREDUCTASE/OXIDOREDUCTASE INHIBITOR' 
_struct_keywords.text            
'epigenetics, histone lysine demethylation, BIX analogs, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 7 ? 
I N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 28  ? ARG A 38  ? THR A 119 ARG A 129 1 ? 11 
HELX_P HELX_P2  2  SER A 42  ? ILE A 46  ? SER A 133 ILE A 137 5 ? 5  
HELX_P HELX_P3  3  HIS A 51  ? LEU A 55  ? HIS A 142 LEU A 146 5 ? 5  
HELX_P HELX_P4  4  THR A 56  ? GLY A 64  ? THR A 147 GLY A 155 1 ? 9  
HELX_P HELX_P5  5  SER A 87  ? GLY A 96  ? SER A 178 GLY A 187 1 ? 10 
HELX_P HELX_P6  6  LEU A 116 ? ASN A 125 ? LEU A 207 ASN A 216 1 ? 10 
HELX_P HELX_P7  7  THR A 142 ? VAL A 148 ? THR A 233 VAL A 239 5 ? 7  
HELX_P HELX_P8  8  PRO A 151 ? SER A 158 ? PRO A 242 SER A 249 1 ? 8  
HELX_P HELX_P9  9  SER A 158 ? TRP A 164 ? SER A 249 TRP A 255 1 ? 7  
HELX_P HELX_P10 10 ASP A 193 ? THR A 197 ? ASP A 284 THR A 288 5 ? 5  
HELX_P HELX_P11 11 THR A 216 ? SER A 228 ? THR A 307 SER A 319 1 ? 13 
HELX_P HELX_P12 12 THR A 231 ? VAL A 235 ? THR A 322 VAL A 326 5 ? 5  
HELX_P HELX_P13 13 PHE A 236 ? VAL A 241 ? PHE A 327 VAL A 332 5 ? 6  
HELX_P HELX_P14 14 ASN A 283 ? LEU A 297 ? ASN A 374 LEU A 388 1 ? 15 
HELX_P HELX_P15 15 THR A 299 ? PHE A 305 ? THR A 390 PHE A 396 5 ? 7  
HELX_P HELX_P16 16 PHE A 307 ? GLU A 328 ? PHE A 398 GLU A 419 1 ? 22 
HELX_P HELX_P17 17 GLN A 334 ? LYS A 353 ? GLN A 425 LYS A 444 1 ? 20 
HELX_P HELX_P18 18 LEU A 356 ? ILE A 364 ? LEU A 447 ILE A 455 5 ? 9  
HELX_P HELX_P19 19 ARG A 369 ? ARG A 382 ? ARG A 460 ARG A 473 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B AKG .   O5  ? ? ? 1_555 C NI  . NI ? ? A AKG 701 A NI  702 1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc2 metalc ? ? B AKG .   O1  ? ? ? 1_555 C NI  . NI ? ? A AKG 701 A NI  702 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc3 metalc ? ? A HIS 191 NE2 ? ? ? 1_555 C NI  . NI ? ? A HIS 282 A NI  702 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc4 metalc ? ? A ASP 193 OD1 ? ? ? 1_555 C NI  . NI ? ? A ASP 284 A NI  702 1_555 ? ? ? ? ? ? ? 2.263 ? 
metalc5 metalc ? ? C NI  .   NI  ? ? ? 1_555 I HOH . O  ? ? A NI  702 A HOH 801 1_555 ? ? ? ? ? ? ? 2.266 ? 
metalc6 metalc ? ? A HIS 263 NE2 ? ? ? 1_555 C NI  . NI ? ? A HIS 354 A NI  702 1_555 ? ? ? ? ? ? ? 2.330 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 48  ? LYS A 49  ? ILE A 139 LYS A 140 
A 2 ILE A 69  ? VAL A 71  ? ILE A 160 VAL A 162 
A 3 THR A 254 ? VAL A 257 ? THR A 345 VAL A 348 
A 4 SER A 198 ? ILE A 213 ? SER A 289 ILE A 304 
A 5 ILE A 262 ? PHE A 278 ? ILE A 353 PHE A 369 
A 6 SER A 186 ? HIS A 191 ? SER A 277 HIS A 282 
B 1 ALA A 110 ? THR A 115 ? ALA A 201 THR A 206 
B 2 VAL A 100 ? ASP A 105 ? VAL A 191 ASP A 196 
B 3 LEU A 132 ? GLU A 138 ? LEU A 223 GLU A 229 
B 4 TYR A 178 ? GLY A 182 ? TYR A 269 GLY A 273 
B 5 ILE A 262 ? PHE A 278 ? ILE A 353 PHE A 369 
B 6 SER A 198 ? ILE A 213 ? SER A 289 ILE A 304 
B 7 TYR A 245 ? LYS A 250 ? TYR A 336 LYS A 341 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 48  ? N ILE A 139 O MET A 70  ? O MET A 161 
A 2 3 N VAL A 71  ? N VAL A 162 O THR A 254 ? O THR A 345 
A 3 4 O LEU A 255 ? O LEU A 346 N TYR A 201 ? N TYR A 292 
A 4 5 N HIS A 202 ? N HIS A 293 O PHE A 274 ? O PHE A 365 
A 5 6 O THR A 267 ? O THR A 358 N SER A 186 ? N SER A 277 
B 1 2 O SER A 112 ? O SER A 203 N VAL A 103 ? N VAL A 194 
B 2 3 N ILE A 104 ? N ILE A 195 O ASN A 133 ? O ASN A 224 
B 3 4 N VAL A 134 ? N VAL A 225 O MET A 181 ? O MET A 272 
B 4 5 N TYR A 178 ? N TYR A 269 O GLY A 275 ? O GLY A 366 
B 5 6 O PHE A 274 ? O PHE A 365 N HIS A 202 ? N HIS A 293 
B 6 7 N PHE A 210 ? N PHE A 301 O CYS A 247 ? O CYS A 338 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE AKG A 701' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NI A 702'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL A 703'  
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 704' 
AC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE EDO A 705' 
AC6 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE EDO A 706' 
AC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE E67 A 707' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 ASN A 133 ? ASN A 224 . ? 1_555  ? 
2  AC1 13 ILE A 135 ? ILE A 226 . ? 1_555  ? 
3  AC1 13 THR A 188 ? THR A 279 . ? 1_555  ? 
4  AC1 13 HIS A 191 ? HIS A 282 . ? 1_555  ? 
5  AC1 13 ASP A 193 ? ASP A 284 . ? 1_555  ? 
6  AC1 13 TYR A 201 ? TYR A 292 . ? 1_555  ? 
7  AC1 13 LYS A 208 ? LYS A 299 . ? 1_555  ? 
8  AC1 13 HIS A 263 ? HIS A 354 . ? 1_555  ? 
9  AC1 13 VAL A 265 ? VAL A 356 . ? 1_555  ? 
10 AC1 13 NI  C .   ? NI  A 702 . ? 1_555  ? 
11 AC1 13 E67 H .   ? E67 A 707 . ? 1_555  ? 
12 AC1 13 HOH I .   ? HOH A 801 . ? 1_555  ? 
13 AC1 13 HOH I .   ? HOH A 843 . ? 1_555  ? 
14 AC2 5  HIS A 191 ? HIS A 282 . ? 1_555  ? 
15 AC2 5  ASP A 193 ? ASP A 284 . ? 1_555  ? 
16 AC2 5  HIS A 263 ? HIS A 354 . ? 1_555  ? 
17 AC2 5  AKG B .   ? AKG A 701 . ? 1_555  ? 
18 AC2 5  HOH I .   ? HOH A 801 . ? 1_555  ? 
19 AC3 5  SER A 158 ? SER A 249 . ? 1_555  ? 
20 AC3 5  TRP A 159 ? TRP A 250 . ? 1_555  ? 
21 AC3 5  VAL A 160 ? VAL A 251 . ? 1_555  ? 
22 AC3 5  PHE A 278 ? PHE A 369 . ? 1_555  ? 
23 AC3 5  LEU A 279 ? LEU A 370 . ? 1_555  ? 
24 AC4 3  GLU A 218 ? GLU A 309 . ? 1_555  ? 
25 AC4 3  ARG A 222 ? ARG A 313 . ? 1_555  ? 
26 AC4 3  ASP A 242 ? ASP A 333 . ? 1_555  ? 
27 AC5 2  LYS A 62  ? LYS A 153 . ? 1_555  ? 
28 AC5 2  HOH I .   ? HOH A 873 . ? 1_555  ? 
29 AC6 1  ASP A 76  ? ASP A 167 . ? 1_555  ? 
30 AC7 9  GLN A 109 ? GLN A 200 . ? 1_555  ? 
31 AC7 9  ASP A 111 ? ASP A 202 . ? 12_565 ? 
32 AC7 9  LYS A 113 ? LYS A 204 . ? 12_565 ? 
33 AC7 9  ASP A 189 ? ASP A 280 . ? 1_555  ? 
34 AC7 9  ASP A 193 ? ASP A 284 . ? 1_555  ? 
35 AC7 9  PHE A 194 ? PHE A 285 . ? 1_555  ? 
36 AC7 9  PRO A 300 ? PRO A 391 . ? 1_555  ? 
37 AC7 9  ASP A 301 ? ASP A 392 . ? 1_555  ? 
38 AC7 9  AKG B .   ? AKG A 701 . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          3U78 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3U78 
_atom_sites.fract_transf_matrix[1][1]   0.012915 
_atom_sites.fract_transf_matrix[1][2]   0.007457 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014913 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003452 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
NI 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 23  ? -64.618 19.487 22.146  1.00 59.09  ? 114 PRO A N   1 
ATOM   2    C  CA  . PRO A 1 23  ? -63.565 20.307 21.541  1.00 59.58  ? 114 PRO A CA  1 
ATOM   3    C  C   . PRO A 1 23  ? -62.659 19.485 20.635  1.00 57.04  ? 114 PRO A C   1 
ATOM   4    O  O   . PRO A 1 23  ? -62.068 18.521 21.111  1.00 54.52  ? 114 PRO A O   1 
ATOM   5    C  CB  . PRO A 1 23  ? -62.767 20.786 22.759  1.00 61.40  ? 114 PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 23  ? -62.983 19.720 23.826  1.00 59.49  ? 114 PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 23  ? -64.159 18.849 23.394  1.00 64.52  ? 114 PRO A CD  1 
ATOM   8    N  N   . VAL A 1 24  ? -62.555 19.862 19.361  1.00 54.22  ? 115 VAL A N   1 
ATOM   9    C  CA  . VAL A 1 24  ? -61.672 19.185 18.414  1.00 48.48  ? 115 VAL A CA  1 
ATOM   10   C  C   . VAL A 1 24  ? -60.212 19.530 18.696  1.00 50.68  ? 115 VAL A C   1 
ATOM   11   O  O   . VAL A 1 24  ? -59.828 20.698 18.640  1.00 50.66  ? 115 VAL A O   1 
ATOM   12   C  CB  . VAL A 1 24  ? -61.992 19.620 16.978  1.00 55.82  ? 115 VAL A CB  1 
ATOM   13   C  CG1 . VAL A 1 24  ? -61.271 18.732 15.954  1.00 46.93  ? 115 VAL A CG1 1 
ATOM   14   C  CG2 . VAL A 1 24  ? -63.497 19.608 16.753  1.00 59.51  ? 115 VAL A CG2 1 
ATOM   15   N  N   . GLN A 1 25  ? -59.399 18.519 18.994  1.00 46.60  ? 116 GLN A N   1 
ATOM   16   C  CA  . GLN A 1 25  ? -57.997 18.747 19.350  1.00 47.03  ? 116 GLN A CA  1 
ATOM   17   C  C   . GLN A 1 25  ? -57.094 18.559 18.135  1.00 46.30  ? 116 GLN A C   1 
ATOM   18   O  O   . GLN A 1 25  ? -57.293 17.645 17.331  1.00 39.83  ? 116 GLN A O   1 
ATOM   19   C  CB  . GLN A 1 25  ? -57.552 17.824 20.502  1.00 48.13  ? 116 GLN A CB  1 
ATOM   20   C  CG  . GLN A 1 25  ? -58.171 18.142 21.880  1.00 47.91  ? 116 GLN A CG  1 
ATOM   21   C  CD  . GLN A 1 25  ? -57.336 19.117 22.702  1.00 59.66  ? 116 GLN A CD  1 
ATOM   22   O  OE1 . GLN A 1 25  ? -57.559 19.293 23.906  1.00 67.98  ? 116 GLN A OE1 1 
ATOM   23   N  NE2 . GLN A 1 25  ? -56.361 19.750 22.057  1.00 57.44  ? 116 GLN A NE2 1 
ATOM   24   N  N   . ALA A 1 26  ? -56.097 19.429 18.011  1.00 48.90  ? 117 ALA A N   1 
ATOM   25   C  CA  . ALA A 1 26  ? -55.220 19.427 16.844  1.00 39.08  ? 117 ALA A CA  1 
ATOM   26   C  C   . ALA A 1 26  ? -54.497 18.101 16.684  1.00 38.61  ? 117 ALA A C   1 
ATOM   27   O  O   . ALA A 1 26  ? -54.056 17.491 17.655  1.00 39.38  ? 117 ALA A O   1 
ATOM   28   C  CB  . ALA A 1 26  ? -54.223 20.554 16.953  1.00 41.59  ? 117 ALA A CB  1 
ATOM   29   N  N   . GLY A 1 27  ? -54.358 17.662 15.449  1.00 37.69  ? 118 GLY A N   1 
ATOM   30   C  CA  . GLY A 1 27  ? -53.619 16.447 15.177  1.00 37.93  ? 118 GLY A CA  1 
ATOM   31   C  C   . GLY A 1 27  ? -54.458 15.192 15.281  1.00 38.82  ? 118 GLY A C   1 
ATOM   32   O  O   . GLY A 1 27  ? -54.096 14.171 14.708  1.00 38.37  ? 118 GLY A O   1 
ATOM   33   N  N   . THR A 1 28  ? -55.572 15.259 16.007  1.00 36.87  ? 119 THR A N   1 
ATOM   34   C  CA  . THR A 1 28  ? -56.442 14.090 16.160  1.00 40.93  ? 119 THR A CA  1 
ATOM   35   C  C   . THR A 1 28  ? -57.199 13.794 14.868  1.00 42.17  ? 119 THR A C   1 
ATOM   36   O  O   . THR A 1 28  ? -57.406 14.678 14.040  1.00 46.48  ? 119 THR A O   1 
ATOM   37   C  CB  . THR A 1 28  ? -57.472 14.255 17.298  1.00 39.53  ? 119 THR A CB  1 
ATOM   38   O  OG1 . THR A 1 28  ? -58.571 15.059 16.852  1.00 40.05  ? 119 THR A OG1 1 
ATOM   39   C  CG2 . THR A 1 28  ? -56.832 14.895 18.516  1.00 42.05  ? 119 THR A CG2 1 
ATOM   40   N  N   . ARG A 1 29  ? -57.628 12.549 14.709  1.00 41.56  ? 120 ARG A N   1 
ATOM   41   C  CA  . ARG A 1 29  ? -58.326 12.138 13.498  1.00 48.62  ? 120 ARG A CA  1 
ATOM   42   C  C   . ARG A 1 29  ? -59.572 12.972 13.190  1.00 45.86  ? 120 ARG A C   1 
ATOM   43   O  O   . ARG A 1 29  ? -59.928 13.143 12.027  1.00 43.82  ? 120 ARG A O   1 
ATOM   44   C  CB  . ARG A 1 29  ? -58.701 10.658 13.552  1.00 43.27  ? 120 ARG A CB  1 
ATOM   45   C  CG  . ARG A 1 29  ? -59.470 10.223 12.328  1.00 49.68  ? 120 ARG A CG  1 
ATOM   46   C  CD  . ARG A 1 29  ? -59.613 8.726  12.238  1.00 49.84  ? 120 ARG A CD  1 
ATOM   47   N  NE  . ARG A 1 29  ? -60.144 8.320  10.941  1.00 54.79  ? 120 ARG A NE  1 
ATOM   48   C  CZ  . ARG A 1 29  ? -59.503 8.487  9.786   1.00 59.64  ? 120 ARG A CZ  1 
ATOM   49   N  NH1 . ARG A 1 29  ? -58.305 9.069  9.770   1.00 64.72  ? 120 ARG A NH1 1 
ATOM   50   N  NH2 . ARG A 1 29  ? -60.057 8.083  8.646   1.00 49.45  ? 120 ARG A NH2 1 
ATOM   51   N  N   . THR A 1 30  ? -60.234 13.474 14.229  1.00 44.14  ? 121 THR A N   1 
ATOM   52   C  CA  . THR A 1 30  ? -61.441 14.277 14.058  1.00 44.25  ? 121 THR A CA  1 
ATOM   53   C  C   . THR A 1 30  ? -61.065 15.603 13.431  1.00 47.39  ? 121 THR A C   1 
ATOM   54   O  O   . THR A 1 30  ? -61.702 16.092 12.490  1.00 46.42  ? 121 THR A O   1 
ATOM   55   C  CB  . THR A 1 30  ? -62.092 14.583 15.399  1.00 49.05  ? 121 THR A CB  1 
ATOM   56   O  OG1 . THR A 1 30  ? -62.676 13.388 15.943  1.00 46.89  ? 121 THR A OG1 1 
ATOM   57   C  CG2 . THR A 1 30  ? -63.154 15.661 15.230  1.00 45.77  ? 121 THR A CG2 1 
ATOM   58   N  N   . PHE A 1 31  ? -60.011 16.180 13.979  1.00 43.10  ? 122 PHE A N   1 
ATOM   59   C  CA  . PHE A 1 31  ? -59.473 17.427 13.488  1.00 42.55  ? 122 PHE A CA  1 
ATOM   60   C  C   . PHE A 1 31  ? -58.985 17.280 12.055  1.00 45.60  ? 122 PHE A C   1 
ATOM   61   O  O   . PHE A 1 31  ? -59.045 18.224 11.266  1.00 48.24  ? 122 PHE A O   1 
ATOM   62   C  CB  . PHE A 1 31  ? -58.336 17.852 14.404  1.00 42.45  ? 122 PHE A CB  1 
ATOM   63   C  CG  . PHE A 1 31  ? -57.497 18.959 13.866  1.00 38.57  ? 122 PHE A CG  1 
ATOM   64   C  CD1 . PHE A 1 31  ? -57.753 20.270 14.224  1.00 38.75  ? 122 PHE A CD1 1 
ATOM   65   C  CD2 . PHE A 1 31  ? -56.429 18.685 13.035  1.00 37.43  ? 122 PHE A CD2 1 
ATOM   66   C  CE1 . PHE A 1 31  ? -56.980 21.293 13.745  1.00 35.53  ? 122 PHE A CE1 1 
ATOM   67   C  CE2 . PHE A 1 31  ? -55.643 19.694 12.552  1.00 37.95  ? 122 PHE A CE2 1 
ATOM   68   C  CZ  . PHE A 1 31  ? -55.917 21.012 12.911  1.00 40.74  ? 122 PHE A CZ  1 
ATOM   69   N  N   . ILE A 1 32  ? -58.488 16.093 11.727  1.00 43.56  ? 123 ILE A N   1 
ATOM   70   C  CA  . ILE A 1 32  ? -58.013 15.810 10.383  1.00 41.24  ? 123 ILE A CA  1 
ATOM   71   C  C   . ILE A 1 32  ? -59.179 15.713 9.392   1.00 41.83  ? 123 ILE A C   1 
ATOM   72   O  O   . ILE A 1 32  ? -59.053 16.156 8.258   1.00 47.22  ? 123 ILE A O   1 
ATOM   73   C  CB  . ILE A 1 32  ? -57.138 14.530 10.353  1.00 45.50  ? 123 ILE A CB  1 
ATOM   74   C  CG1 . ILE A 1 32  ? -55.853 14.752 11.143  1.00 46.29  ? 123 ILE A CG1 1 
ATOM   75   C  CG2 . ILE A 1 32  ? -56.766 14.153 8.934   1.00 44.33  ? 123 ILE A CG2 1 
ATOM   76   C  CD1 . ILE A 1 32  ? -54.938 15.764 10.521  1.00 41.57  ? 123 ILE A CD1 1 
ATOM   77   N  N   . LYS A 1 33  ? -60.311 15.150 9.814   1.00 43.59  ? 124 LYS A N   1 
ATOM   78   C  CA  . LYS A 1 33  ? -61.508 15.118 8.967   1.00 46.29  ? 124 LYS A CA  1 
ATOM   79   C  C   . LYS A 1 33  ? -61.933 16.532 8.597   1.00 46.96  ? 124 LYS A C   1 
ATOM   80   O  O   . LYS A 1 33  ? -62.279 16.804 7.450   1.00 47.34  ? 124 LYS A O   1 
ATOM   81   C  CB  . LYS A 1 33  ? -62.679 14.400 9.646   1.00 46.79  ? 124 LYS A CB  1 
ATOM   82   N  N   . GLU A 1 34  ? -61.906 17.438 9.563   1.00 42.37  ? 125 GLU A N   1 
ATOM   83   C  CA  . GLU A 1 34  ? -62.250 18.813 9.267   1.00 44.91  ? 125 GLU A CA  1 
ATOM   84   C  C   . GLU A 1 34  ? -61.234 19.485 8.353   1.00 48.48  ? 125 GLU A C   1 
ATOM   85   O  O   . GLU A 1 34  ? -61.602 20.133 7.371   1.00 46.27  ? 125 GLU A O   1 
ATOM   86   C  CB  . GLU A 1 34  ? -62.465 19.596 10.549  1.00 45.96  ? 125 GLU A CB  1 
ATOM   87   C  CG  . GLU A 1 34  ? -63.814 19.277 11.148  1.00 55.38  ? 125 GLU A CG  1 
ATOM   88   C  CD  . GLU A 1 34  ? -63.840 19.366 12.667  1.00 61.18  ? 125 GLU A CD  1 
ATOM   89   O  OE1 . GLU A 1 34  ? -63.219 20.306 13.223  1.00 61.71  ? 125 GLU A OE1 1 
ATOM   90   O  OE2 . GLU A 1 34  ? -64.492 18.495 13.301  1.00 58.57  ? 125 GLU A OE2 1 
ATOM   91   N  N   . LEU A 1 35  ? -59.955 19.310 8.658   1.00 46.29  ? 126 LEU A N   1 
ATOM   92   C  CA  . LEU A 1 35  ? -58.916 19.895 7.831   1.00 43.42  ? 126 LEU A CA  1 
ATOM   93   C  C   . LEU A 1 35  ? -59.047 19.449 6.376   1.00 47.23  ? 126 LEU A C   1 
ATOM   94   O  O   . LEU A 1 35  ? -58.836 20.227 5.439   1.00 42.93  ? 126 LEU A O   1 
ATOM   95   C  CB  . LEU A 1 35  ? -57.547 19.511 8.362   1.00 35.84  ? 126 LEU A CB  1 
ATOM   96   C  CG  . LEU A 1 35  ? -56.372 20.189 7.664   1.00 40.38  ? 126 LEU A CG  1 
ATOM   97   C  CD1 . LEU A 1 35  ? -56.569 21.696 7.578   1.00 38.26  ? 126 LEU A CD1 1 
ATOM   98   C  CD2 . LEU A 1 35  ? -55.088 19.864 8.391   1.00 42.86  ? 126 LEU A CD2 1 
ATOM   99   N  N   . ARG A 1 36  ? -59.383 18.182 6.191   1.00 41.20  ? 127 ARG A N   1 
ATOM   100  C  CA  . ARG A 1 36  ? -59.440 17.631 4.860   1.00 45.26  ? 127 ARG A CA  1 
ATOM   101  C  C   . ARG A 1 36  ? -60.715 18.070 4.136   1.00 50.02  ? 127 ARG A C   1 
ATOM   102  O  O   . ARG A 1 36  ? -60.824 17.959 2.910   1.00 46.91  ? 127 ARG A O   1 
ATOM   103  C  CB  . ARG A 1 36  ? -59.335 16.108 4.922   1.00 47.12  ? 127 ARG A CB  1 
ATOM   104  C  CG  . ARG A 1 36  ? -57.915 15.591 5.097   1.00 45.21  ? 127 ARG A CG  1 
ATOM   105  C  CD  . ARG A 1 36  ? -57.833 14.115 4.742   1.00 47.80  ? 127 ARG A CD  1 
ATOM   106  N  NE  . ARG A 1 36  ? -56.495 13.555 4.906   1.00 45.40  ? 127 ARG A NE  1 
ATOM   107  C  CZ  . ARG A 1 36  ? -55.688 13.257 3.899   1.00 44.94  ? 127 ARG A CZ  1 
ATOM   108  N  NH1 . ARG A 1 36  ? -56.090 13.473 2.653   1.00 50.29  ? 127 ARG A NH1 1 
ATOM   109  N  NH2 . ARG A 1 36  ? -54.484 12.745 4.132   1.00 42.60  ? 127 ARG A NH2 1 
ATOM   110  N  N   . SER A 1 37  ? -61.661 18.587 4.912   1.00 48.40  ? 128 SER A N   1 
ATOM   111  C  CA  . SER A 1 37  ? -62.965 18.996 4.409   1.00 46.88  ? 128 SER A CA  1 
ATOM   112  C  C   . SER A 1 37  ? -63.027 20.461 3.965   1.00 49.80  ? 128 SER A C   1 
ATOM   113  O  O   . SER A 1 37  ? -63.583 20.768 2.903   1.00 56.71  ? 128 SER A O   1 
ATOM   114  C  CB  . SER A 1 37  ? -64.037 18.738 5.471   1.00 47.40  ? 128 SER A CB  1 
ATOM   115  O  OG  . SER A 1 37  ? -64.201 17.350 5.663   1.00 47.47  ? 128 SER A OG  1 
ATOM   116  N  N   . ARG A 1 38  ? -62.479 21.365 4.771   1.00 47.33  ? 129 ARG A N   1 
ATOM   117  C  CA  . ARG A 1 38  ? -62.512 22.782 4.429   1.00 49.26  ? 129 ARG A CA  1 
ATOM   118  C  C   . ARG A 1 38  ? -61.926 22.976 3.043   1.00 52.47  ? 129 ARG A C   1 
ATOM   119  O  O   . ARG A 1 38  ? -60.906 22.381 2.698   1.00 50.28  ? 129 ARG A O   1 
ATOM   120  C  CB  . ARG A 1 38  ? -61.746 23.621 5.452   1.00 47.72  ? 129 ARG A CB  1 
ATOM   121  C  CG  . ARG A 1 38  ? -62.597 24.706 6.133   1.00 57.06  ? 129 ARG A CG  1 
ATOM   122  C  CD  . ARG A 1 38  ? -62.023 25.105 7.502   1.00 52.54  ? 129 ARG A CD  1 
ATOM   123  N  NE  . ARG A 1 38  ? -61.390 23.960 8.155   1.00 59.32  ? 129 ARG A NE  1 
ATOM   124  C  CZ  . ARG A 1 38  ? -61.070 23.882 9.447   1.00 56.58  ? 129 ARG A CZ  1 
ATOM   125  N  NH1 . ARG A 1 38  ? -61.339 24.893 10.272  1.00 54.02  ? 129 ARG A NH1 1 
ATOM   126  N  NH2 . ARG A 1 38  ? -60.488 22.774 9.910   1.00 45.47  ? 129 ARG A NH2 1 
ATOM   127  N  N   . VAL A 1 39  ? -62.596 23.766 2.218   1.00 59.46  ? 130 VAL A N   1 
ATOM   128  C  CA  . VAL A 1 39  ? -61.933 24.244 1.009   1.00 59.82  ? 130 VAL A CA  1 
ATOM   129  C  C   . VAL A 1 39  ? -61.404 25.640 1.329   1.00 58.84  ? 130 VAL A C   1 
ATOM   130  O  O   . VAL A 1 39  ? -62.123 26.512 1.848   1.00 59.51  ? 130 VAL A O   1 
ATOM   131  C  CB  . VAL A 1 39  ? -62.823 24.244 -0.257  1.00 56.46  ? 130 VAL A CB  1 
ATOM   132  C  CG1 . VAL A 1 39  ? -61.963 24.521 -1.481  1.00 54.25  ? 130 VAL A CG1 1 
ATOM   133  C  CG2 . VAL A 1 39  ? -63.557 22.902 -0.417  1.00 48.74  ? 130 VAL A CG2 1 
ATOM   134  N  N   . PHE A 1 40  ? -60.118 25.814 1.073   1.00 51.43  ? 131 PHE A N   1 
ATOM   135  C  CA  . PHE A 1 40  ? -59.436 27.024 1.455   1.00 46.01  ? 131 PHE A CA  1 
ATOM   136  C  C   . PHE A 1 40  ? -59.203 27.795 0.192   1.00 46.45  ? 131 PHE A C   1 
ATOM   137  O  O   . PHE A 1 40  ? -59.159 27.208 -0.903  1.00 46.40  ? 131 PHE A O   1 
ATOM   138  C  CB  . PHE A 1 40  ? -58.079 26.690 2.076   1.00 44.72  ? 131 PHE A CB  1 
ATOM   139  C  CG  . PHE A 1 40  ? -58.166 25.944 3.363   1.00 42.18  ? 131 PHE A CG  1 
ATOM   140  C  CD1 . PHE A 1 40  ? -58.343 24.569 3.372   1.00 43.82  ? 131 PHE A CD1 1 
ATOM   141  C  CD2 . PHE A 1 40  ? -58.055 26.611 4.568   1.00 37.44  ? 131 PHE A CD2 1 
ATOM   142  C  CE1 . PHE A 1 40  ? -58.416 23.882 4.560   1.00 41.82  ? 131 PHE A CE1 1 
ATOM   143  C  CE2 . PHE A 1 40  ? -58.127 25.926 5.751   1.00 38.50  ? 131 PHE A CE2 1 
ATOM   144  C  CZ  . PHE A 1 40  ? -58.308 24.561 5.748   1.00 42.27  ? 131 PHE A CZ  1 
ATOM   145  N  N   . PRO A 1 41  ? -59.034 29.112 0.327   1.00 43.17  ? 132 PRO A N   1 
ATOM   146  C  CA  . PRO A 1 41  ? -58.620 29.813 -0.883  1.00 41.55  ? 132 PRO A CA  1 
ATOM   147  C  C   . PRO A 1 41  ? -57.363 29.137 -1.413  1.00 37.56  ? 132 PRO A C   1 
ATOM   148  O  O   . PRO A 1 41  ? -56.467 28.839 -0.630  1.00 40.71  ? 132 PRO A O   1 
ATOM   149  C  CB  . PRO A 1 41  ? -58.300 31.226 -0.384  1.00 40.74  ? 132 PRO A CB  1 
ATOM   150  C  CG  . PRO A 1 41  ? -58.065 31.098 1.072   1.00 38.19  ? 132 PRO A CG  1 
ATOM   151  C  CD  . PRO A 1 41  ? -58.842 29.906 1.551   1.00 38.11  ? 132 PRO A CD  1 
ATOM   152  N  N   . SER A 1 42  ? -57.310 28.875 -2.709  1.00 38.22  ? 133 SER A N   1 
ATOM   153  C  CA  . SER A 1 42  ? -56.102 28.340 -3.316  1.00 42.15  ? 133 SER A CA  1 
ATOM   154  C  C   . SER A 1 42  ? -54.888 29.243 -3.086  1.00 39.73  ? 133 SER A C   1 
ATOM   155  O  O   . SER A 1 42  ? -54.963 30.464 -3.236  1.00 40.39  ? 133 SER A O   1 
ATOM   156  C  CB  . SER A 1 42  ? -56.295 28.152 -4.824  1.00 39.34  ? 133 SER A CB  1 
ATOM   157  O  OG  . SER A 1 42  ? -55.115 27.634 -5.417  1.00 35.62  ? 133 SER A OG  1 
ATOM   158  N  N   . ALA A 1 43  ? -53.759 28.637 -2.744  1.00 35.20  ? 134 ALA A N   1 
ATOM   159  C  CA  . ALA A 1 43  ? -52.517 29.381 -2.739  1.00 37.58  ? 134 ALA A CA  1 
ATOM   160  C  C   . ALA A 1 43  ? -52.184 29.928 -4.149  1.00 39.21  ? 134 ALA A C   1 
ATOM   161  O  O   . ALA A 1 43  ? -51.251 30.707 -4.312  1.00 38.94  ? 134 ALA A O   1 
ATOM   162  C  CB  . ALA A 1 43  ? -51.394 28.529 -2.201  1.00 36.56  ? 134 ALA A CB  1 
ATOM   163  N  N   . ASP A 1 44  ? -52.947 29.548 -5.168  1.00 34.83  ? 135 ASP A N   1 
ATOM   164  C  CA  . ASP A 1 44  ? -52.697 30.136 -6.483  1.00 41.45  ? 135 ASP A CA  1 
ATOM   165  C  C   . ASP A 1 44  ? -52.930 31.647 -6.485  1.00 41.54  ? 135 ASP A C   1 
ATOM   166  O  O   . ASP A 1 44  ? -52.387 32.377 -7.302  1.00 38.65  ? 135 ASP A O   1 
ATOM   167  C  CB  . ASP A 1 44  ? -53.531 29.464 -7.561  1.00 41.41  ? 135 ASP A CB  1 
ATOM   168  C  CG  . ASP A 1 44  ? -53.078 28.051 -7.833  1.00 49.80  ? 135 ASP A CG  1 
ATOM   169  O  OD1 . ASP A 1 44  ? -51.888 27.761 -7.553  1.00 47.02  ? 135 ASP A OD1 1 
ATOM   170  O  OD2 . ASP A 1 44  ? -53.907 27.238 -8.319  1.00 52.01  ? 135 ASP A OD2 1 
ATOM   171  N  N   . GLU A 1 45  ? -53.726 32.114 -5.538  1.00 45.06  ? 136 GLU A N   1 
ATOM   172  C  CA  . GLU A 1 45  ? -54.024 33.530 -5.458  1.00 42.80  ? 136 GLU A CA  1 
ATOM   173  C  C   . GLU A 1 45  ? -52.835 34.394 -5.106  1.00 41.95  ? 136 GLU A C   1 
ATOM   174  O  O   . GLU A 1 45  ? -52.859 35.598 -5.353  1.00 48.68  ? 136 GLU A O   1 
ATOM   175  C  CB  . GLU A 1 45  ? -55.144 33.772 -4.463  1.00 36.11  ? 136 GLU A CB  1 
ATOM   176  C  CG  . GLU A 1 45  ? -56.388 33.053 -4.876  1.00 40.34  ? 136 GLU A CG  1 
ATOM   177  C  CD  . GLU A 1 45  ? -57.586 33.943 -4.801  1.00 46.68  ? 136 GLU A CD  1 
ATOM   178  O  OE1 . GLU A 1 45  ? -57.760 34.561 -3.716  1.00 44.61  ? 136 GLU A OE1 1 
ATOM   179  O  OE2 . GLU A 1 45  ? -58.322 34.035 -5.820  1.00 41.06  ? 136 GLU A OE2 1 
ATOM   180  N  N   . ILE A 1 46  ? -51.794 33.806 -4.533  1.00 38.19  ? 137 ILE A N   1 
ATOM   181  C  CA  . ILE A 1 46  ? -50.710 34.638 -4.049  1.00 36.12  ? 137 ILE A CA  1 
ATOM   182  C  C   . ILE A 1 46  ? -49.328 34.153 -4.393  1.00 36.79  ? 137 ILE A C   1 
ATOM   183  O  O   . ILE A 1 46  ? -48.409 34.963 -4.494  1.00 43.31  ? 137 ILE A O   1 
ATOM   184  C  CB  . ILE A 1 46  ? -50.784 34.844 -2.542  1.00 37.58  ? 137 ILE A CB  1 
ATOM   185  C  CG1 . ILE A 1 46  ? -50.640 33.505 -1.823  1.00 37.88  ? 137 ILE A CG1 1 
ATOM   186  C  CG2 . ILE A 1 46  ? -52.094 35.487 -2.181  1.00 43.72  ? 137 ILE A CG2 1 
ATOM   187  C  CD1 . ILE A 1 46  ? -50.246 33.657 -0.376  1.00 44.29  ? 137 ILE A CD1 1 
ATOM   188  N  N   . ILE A 1 47  ? -49.160 32.849 -4.561  1.00 30.81  ? 138 ILE A N   1 
ATOM   189  C  CA  . ILE A 1 47  ? -47.830 32.346 -4.854  1.00 32.88  ? 138 ILE A CA  1 
ATOM   190  C  C   . ILE A 1 47  ? -47.436 32.628 -6.297  1.00 39.82  ? 138 ILE A C   1 
ATOM   191  O  O   . ILE A 1 47  ? -48.278 32.779 -7.176  1.00 41.07  ? 138 ILE A O   1 
ATOM   192  C  CB  . ILE A 1 47  ? -47.680 30.849 -4.584  1.00 38.33  ? 138 ILE A CB  1 
ATOM   193  C  CG1 . ILE A 1 47  ? -48.395 30.042 -5.657  1.00 39.71  ? 138 ILE A CG1 1 
ATOM   194  C  CG2 . ILE A 1 47  ? -48.165 30.484 -3.163  1.00 40.96  ? 138 ILE A CG2 1 
ATOM   195  C  CD1 . ILE A 1 47  ? -48.276 28.552 -5.446  1.00 49.61  ? 138 ILE A CD1 1 
ATOM   196  N  N   . ILE A 1 48  ? -46.140 32.705 -6.530  1.00 38.41  ? 139 ILE A N   1 
ATOM   197  C  CA  . ILE A 1 48  ? -45.615 32.966 -7.846  1.00 33.81  ? 139 ILE A CA  1 
ATOM   198  C  C   . ILE A 1 48  ? -44.971 31.680 -8.321  1.00 35.61  ? 139 ILE A C   1 
ATOM   199  O  O   . ILE A 1 48  ? -44.084 31.155 -7.653  1.00 38.98  ? 139 ILE A O   1 
ATOM   200  C  CB  . ILE A 1 48  ? -44.555 34.071 -7.769  1.00 35.86  ? 139 ILE A CB  1 
ATOM   201  C  CG1 . ILE A 1 48  ? -45.180 35.383 -7.291  1.00 38.95  ? 139 ILE A CG1 1 
ATOM   202  C  CG2 . ILE A 1 48  ? -43.883 34.284 -9.092  1.00 33.87  ? 139 ILE A CG2 1 
ATOM   203  C  CD1 . ILE A 1 48  ? -44.173 36.511 -7.192  1.00 36.59  ? 139 ILE A CD1 1 
ATOM   204  N  N   . LYS A 1 49  ? -45.427 31.152 -9.458  1.00 41.80  ? 140 LYS A N   1 
ATOM   205  C  CA  . LYS A 1 49  ? -44.778 29.992 -10.072 1.00 34.88  ? 140 LYS A CA  1 
ATOM   206  C  C   . LYS A 1 49  ? -43.689 30.442 -11.013 1.00 33.58  ? 140 LYS A C   1 
ATOM   207  O  O   . LYS A 1 49  ? -43.865 31.389 -11.768 1.00 39.96  ? 140 LYS A O   1 
ATOM   208  C  CB  . LYS A 1 49  ? -45.781 29.132 -10.824 1.00 39.89  ? 140 LYS A CB  1 
ATOM   209  C  CG  . LYS A 1 49  ? -46.913 28.625 -9.944  1.00 47.24  ? 140 LYS A CG  1 
ATOM   210  C  CD  . LYS A 1 49  ? -47.889 27.754 -10.718 1.00 53.50  ? 140 LYS A CD  1 
ATOM   211  C  CE  . LYS A 1 49  ? -49.159 27.528 -9.899  1.00 61.16  ? 140 LYS A CE  1 
ATOM   212  N  NZ  . LYS A 1 49  ? -50.238 26.837 -10.673 1.00 65.22  ? 140 LYS A NZ  1 
ATOM   213  N  N   . MET A 1 50  ? -42.546 29.785 -10.952 1.00 32.66  ? 141 MET A N   1 
ATOM   214  C  CA  . MET A 1 50  ? -41.467 30.118 -11.863 1.00 41.28  ? 141 MET A CA  1 
ATOM   215  C  C   . MET A 1 50  ? -40.508 28.952 -12.125 1.00 42.69  ? 141 MET A C   1 
ATOM   216  O  O   . MET A 1 50  ? -40.581 27.909 -11.478 1.00 42.91  ? 141 MET A O   1 
ATOM   217  C  CB  . MET A 1 50  ? -40.737 31.385 -11.408 1.00 41.34  ? 141 MET A CB  1 
ATOM   218  C  CG  . MET A 1 50  ? -40.142 31.354 -10.026 1.00 40.48  ? 141 MET A CG  1 
ATOM   219  S  SD  . MET A 1 50  ? -39.241 32.888 -9.666  1.00 46.97  ? 141 MET A SD  1 
ATOM   220  C  CE  . MET A 1 50  ? -40.531 33.957 -9.077  1.00 42.57  ? 141 MET A CE  1 
ATOM   221  N  N   . HIS A 1 51  ? -39.632 29.119 -13.105 1.00 44.88  ? 142 HIS A N   1 
ATOM   222  C  CA  . HIS A 1 51  ? -38.677 28.070 -13.447 1.00 47.35  ? 142 HIS A CA  1 
ATOM   223  C  C   . HIS A 1 51  ? -37.438 28.272 -12.606 1.00 39.13  ? 142 HIS A C   1 
ATOM   224  O  O   . HIS A 1 51  ? -37.149 29.397 -12.209 1.00 42.90  ? 142 HIS A O   1 
ATOM   225  C  CB  . HIS A 1 51  ? -38.287 28.123 -14.940 1.00 45.48  ? 142 HIS A CB  1 
ATOM   226  C  CG  . HIS A 1 51  ? -39.445 27.991 -15.881 1.00 51.25  ? 142 HIS A CG  1 
ATOM   227  N  ND1 . HIS A 1 51  ? -40.234 29.061 -16.244 1.00 51.43  ? 142 HIS A ND1 1 
ATOM   228  C  CD2 . HIS A 1 51  ? -39.947 26.916 -16.535 1.00 57.46  ? 142 HIS A CD2 1 
ATOM   229  C  CE1 . HIS A 1 51  ? -41.170 28.652 -17.083 1.00 58.65  ? 142 HIS A CE1 1 
ATOM   230  N  NE2 . HIS A 1 51  ? -41.017 27.354 -17.279 1.00 55.05  ? 142 HIS A NE2 1 
ATOM   231  N  N   . GLY A 1 52  ? -36.707 27.192 -12.355 1.00 33.00  ? 143 GLY A N   1 
ATOM   232  C  CA  . GLY A 1 52  ? -35.406 27.286 -11.731 1.00 37.59  ? 143 GLY A CA  1 
ATOM   233  C  C   . GLY A 1 52  ? -34.643 28.568 -12.030 1.00 44.15  ? 143 GLY A C   1 
ATOM   234  O  O   . GLY A 1 52  ? -34.241 29.278 -11.110 1.00 43.50  ? 143 GLY A O   1 
ATOM   235  N  N   . SER A 1 53  ? -34.477 28.881 -13.314 1.00 45.59  ? 144 SER A N   1 
ATOM   236  C  CA  . SER A 1 53  ? -33.566 29.939 -13.767 1.00 45.27  ? 144 SER A CA  1 
ATOM   237  C  C   . SER A 1 53  ? -34.057 31.371 -13.570 1.00 42.25  ? 144 SER A C   1 
ATOM   238  O  O   . SER A 1 53  ? -33.308 32.321 -13.780 1.00 35.99  ? 144 SER A O   1 
ATOM   239  C  CB  . SER A 1 53  ? -33.221 29.727 -15.239 1.00 39.44  ? 144 SER A CB  1 
ATOM   240  O  OG  . SER A 1 53  ? -34.395 29.413 -15.963 1.00 47.84  ? 144 SER A OG  1 
ATOM   241  N  N   . GLN A 1 54  ? -35.313 31.533 -13.187 1.00 39.51  ? 145 GLN A N   1 
ATOM   242  C  CA  . GLN A 1 54  ? -35.836 32.859 -12.938 1.00 39.66  ? 145 GLN A CA  1 
ATOM   243  C  C   . GLN A 1 54  ? -35.542 33.242 -11.483 1.00 46.48  ? 145 GLN A C   1 
ATOM   244  O  O   . GLN A 1 54  ? -35.482 34.424 -11.119 1.00 44.32  ? 145 GLN A O   1 
ATOM   245  C  CB  . GLN A 1 54  ? -37.339 32.882 -13.204 1.00 42.94  ? 145 GLN A CB  1 
ATOM   246  C  CG  . GLN A 1 54  ? -37.738 32.517 -14.641 1.00 50.52  ? 145 GLN A CG  1 
ATOM   247  C  CD  . GLN A 1 54  ? -39.254 32.294 -14.816 1.00 51.81  ? 145 GLN A CD  1 
ATOM   248  O  OE1 . GLN A 1 54  ? -40.052 32.557 -13.914 1.00 50.94  ? 145 GLN A OE1 1 
ATOM   249  N  NE2 . GLN A 1 54  ? -39.643 31.803 -15.984 1.00 56.59  ? 145 GLN A NE2 1 
ATOM   250  N  N   . LEU A 1 55  ? -35.354 32.228 -10.647 1.00 42.45  ? 146 LEU A N   1 
ATOM   251  C  CA  . LEU A 1 55  ? -35.200 32.463 -9.221  1.00 37.84  ? 146 LEU A CA  1 
ATOM   252  C  C   . LEU A 1 55  ? -33.759 32.843 -8.915  1.00 38.35  ? 146 LEU A C   1 
ATOM   253  O  O   . LEU A 1 55  ? -32.889 31.987 -8.689  1.00 36.93  ? 146 LEU A O   1 
ATOM   254  C  CB  . LEU A 1 55  ? -35.637 31.233 -8.439  1.00 38.46  ? 146 LEU A CB  1 
ATOM   255  C  CG  . LEU A 1 55  ? -35.816 31.295 -6.934  1.00 30.87  ? 146 LEU A CG  1 
ATOM   256  C  CD1 . LEU A 1 55  ? -36.827 32.330 -6.544  1.00 30.99  ? 146 LEU A CD1 1 
ATOM   257  C  CD2 . LEU A 1 55  ? -36.293 29.939 -6.518  1.00 33.09  ? 146 LEU A CD2 1 
ATOM   258  N  N   . THR A 1 56  ? -33.527 34.149 -8.931  1.00 37.47  ? 147 THR A N   1 
ATOM   259  C  CA  . THR A 1 56  ? -32.207 34.718 -8.756  1.00 39.10  ? 147 THR A CA  1 
ATOM   260  C  C   . THR A 1 56  ? -32.275 35.833 -7.741  1.00 39.78  ? 147 THR A C   1 
ATOM   261  O  O   . THR A 1 56  ? -33.330 36.439 -7.518  1.00 40.03  ? 147 THR A O   1 
ATOM   262  C  CB  . THR A 1 56  ? -31.670 35.349 -10.080 1.00 46.05  ? 147 THR A CB  1 
ATOM   263  O  OG1 . THR A 1 56  ? -32.555 36.392 -10.524 1.00 39.15  ? 147 THR A OG1 1 
ATOM   264  C  CG2 . THR A 1 56  ? -31.536 34.302 -11.177 1.00 38.67  ? 147 THR A CG2 1 
ATOM   265  N  N   . GLN A 1 57  ? -31.127 36.105 -7.141  1.00 37.71  ? 148 GLN A N   1 
ATOM   266  C  CA  . GLN A 1 57  ? -30.959 37.262 -6.300  1.00 41.07  ? 148 GLN A CA  1 
ATOM   267  C  C   . GLN A 1 57  ? -31.500 38.518 -7.006  1.00 49.47  ? 148 GLN A C   1 
ATOM   268  O  O   . GLN A 1 57  ? -32.273 39.280 -6.422  1.00 52.35  ? 148 GLN A O   1 
ATOM   269  C  CB  . GLN A 1 57  ? -29.486 37.407 -5.961  1.00 39.35  ? 148 GLN A CB  1 
ATOM   270  C  CG  . GLN A 1 57  ? -29.165 38.434 -4.922  1.00 50.30  ? 148 GLN A CG  1 
ATOM   271  C  CD  . GLN A 1 57  ? -27.730 38.312 -4.442  1.00 56.69  ? 148 GLN A CD  1 
ATOM   272  O  OE1 . GLN A 1 57  ? -26.820 37.957 -5.214  1.00 45.11  ? 148 GLN A OE1 1 
ATOM   273  N  NE2 . GLN A 1 57  ? -27.520 38.586 -3.154  1.00 57.92  ? 148 GLN A NE2 1 
ATOM   274  N  N   . ARG A 1 58  ? -31.122 38.723 -8.268  1.00 48.34  ? 149 ARG A N   1 
ATOM   275  C  CA  . ARG A 1 58  ? -31.521 39.933 -8.978  1.00 46.61  ? 149 ARG A CA  1 
ATOM   276  C  C   . ARG A 1 58  ? -33.032 40.070 -8.964  1.00 44.79  ? 149 ARG A C   1 
ATOM   277  O  O   . ARG A 1 58  ? -33.577 41.113 -8.600  1.00 44.63  ? 149 ARG A O   1 
ATOM   278  C  CB  . ARG A 1 58  ? -31.028 39.907 -10.423 1.00 60.49  ? 149 ARG A CB  1 
ATOM   279  C  CG  . ARG A 1 58  ? -30.399 41.209 -10.901 1.00 62.73  ? 149 ARG A CG  1 
ATOM   280  C  CD  . ARG A 1 58  ? -28.879 41.127 -10.792 1.00 75.10  ? 149 ARG A CD  1 
ATOM   281  N  NE  . ARG A 1 58  ? -28.203 41.525 -12.029 1.00 82.03  ? 149 ARG A NE  1 
ATOM   282  C  CZ  . ARG A 1 58  ? -27.009 41.070 -12.407 1.00 80.50  ? 149 ARG A CZ  1 
ATOM   283  N  NH1 . ARG A 1 58  ? -26.365 40.192 -11.643 1.00 74.94  ? 149 ARG A NH1 1 
ATOM   284  N  NH2 . ARG A 1 58  ? -26.461 41.486 -13.549 1.00 71.07  ? 149 ARG A NH2 1 
ATOM   285  N  N   . TYR A 1 59  ? -33.715 39.012 -9.373  1.00 44.42  ? 150 TYR A N   1 
ATOM   286  C  CA  . TYR A 1 59  ? -35.164 39.036 -9.364  1.00 42.61  ? 150 TYR A CA  1 
ATOM   287  C  C   . TYR A 1 59  ? -35.680 39.531 -8.017  1.00 45.76  ? 150 TYR A C   1 
ATOM   288  O  O   . TYR A 1 59  ? -36.389 40.532 -7.951  1.00 49.54  ? 150 TYR A O   1 
ATOM   289  C  CB  . TYR A 1 59  ? -35.744 37.659 -9.682  1.00 37.76  ? 150 TYR A CB  1 
ATOM   290  C  CG  . TYR A 1 59  ? -37.236 37.606 -9.487  1.00 45.69  ? 150 TYR A CG  1 
ATOM   291  C  CD1 . TYR A 1 59  ? -38.096 37.991 -10.499 1.00 47.77  ? 150 TYR A CD1 1 
ATOM   292  C  CD2 . TYR A 1 59  ? -37.790 37.187 -8.284  1.00 47.03  ? 150 TYR A CD2 1 
ATOM   293  C  CE1 . TYR A 1 59  ? -39.467 37.955 -10.339 1.00 45.63  ? 150 TYR A CE1 1 
ATOM   294  C  CE2 . TYR A 1 59  ? -39.175 37.149 -8.109  1.00 50.71  ? 150 TYR A CE2 1 
ATOM   295  C  CZ  . TYR A 1 59  ? -40.007 37.537 -9.148  1.00 51.43  ? 150 TYR A CZ  1 
ATOM   296  O  OH  . TYR A 1 59  ? -41.381 37.506 -9.007  1.00 55.30  ? 150 TYR A OH  1 
ATOM   297  N  N   . LEU A 1 60  ? -35.297 38.839 -6.944  1.00 44.90  ? 151 LEU A N   1 
ATOM   298  C  CA  . LEU A 1 60  ? -35.890 39.061 -5.628  1.00 41.69  ? 151 LEU A CA  1 
ATOM   299  C  C   . LEU A 1 60  ? -35.604 40.443 -5.051  1.00 44.89  ? 151 LEU A C   1 
ATOM   300  O  O   . LEU A 1 60  ? -36.432 40.990 -4.319  1.00 45.56  ? 151 LEU A O   1 
ATOM   301  C  CB  . LEU A 1 60  ? -35.447 37.979 -4.645  1.00 42.44  ? 151 LEU A CB  1 
ATOM   302  C  CG  . LEU A 1 60  ? -35.794 36.536 -5.009  1.00 41.20  ? 151 LEU A CG  1 
ATOM   303  C  CD1 . LEU A 1 60  ? -34.917 35.579 -4.229  1.00 32.87  ? 151 LEU A CD1 1 
ATOM   304  C  CD2 . LEU A 1 60  ? -37.276 36.251 -4.787  1.00 36.18  ? 151 LEU A CD2 1 
ATOM   305  N  N   . GLU A 1 61  ? -34.441 41.006 -5.363  1.00 41.46  ? 152 GLU A N   1 
ATOM   306  C  CA  . GLU A 1 61  ? -34.147 42.379 -4.960  1.00 46.10  ? 152 GLU A CA  1 
ATOM   307  C  C   . GLU A 1 61  ? -35.102 43.378 -5.613  1.00 51.47  ? 152 GLU A C   1 
ATOM   308  O  O   . GLU A 1 61  ? -35.362 44.454 -5.062  1.00 53.17  ? 152 GLU A O   1 
ATOM   309  C  CB  . GLU A 1 61  ? -32.728 42.765 -5.340  1.00 47.27  ? 152 GLU A CB  1 
ATOM   310  C  CG  . GLU A 1 61  ? -31.661 42.247 -4.433  1.00 53.24  ? 152 GLU A CG  1 
ATOM   311  C  CD  . GLU A 1 61  ? -30.278 42.596 -4.945  1.00 63.24  ? 152 GLU A CD  1 
ATOM   312  O  OE1 . GLU A 1 61  ? -29.305 42.416 -4.181  1.00 58.26  ? 152 GLU A OE1 1 
ATOM   313  O  OE2 . GLU A 1 61  ? -30.170 43.043 -6.117  1.00 60.98  ? 152 GLU A OE2 1 
ATOM   314  N  N   . LYS A 1 62  ? -35.606 43.031 -6.793  1.00 40.02  ? 153 LYS A N   1 
ATOM   315  C  CA  . LYS A 1 62  ? -36.416 43.961 -7.561  1.00 46.32  ? 153 LYS A CA  1 
ATOM   316  C  C   . LYS A 1 62  ? -37.888 43.792 -7.240  1.00 47.28  ? 153 LYS A C   1 
ATOM   317  O  O   . LYS A 1 62  ? -38.586 44.771 -7.000  1.00 50.00  ? 153 LYS A O   1 
ATOM   318  C  CB  . LYS A 1 62  ? -36.171 43.793 -9.071  1.00 48.77  ? 153 LYS A CB  1 
ATOM   319  N  N   . HIS A 1 63  ? -38.353 42.548 -7.231  1.00 47.15  ? 154 HIS A N   1 
ATOM   320  C  CA  . HIS A 1 63  ? -39.766 42.255 -6.996  1.00 50.82  ? 154 HIS A CA  1 
ATOM   321  C  C   . HIS A 1 63  ? -40.070 41.911 -5.540  1.00 46.46  ? 154 HIS A C   1 
ATOM   322  O  O   . HIS A 1 63  ? -41.232 41.833 -5.136  1.00 42.75  ? 154 HIS A O   1 
ATOM   323  C  CB  . HIS A 1 63  ? -40.219 41.096 -7.880  1.00 54.53  ? 154 HIS A CB  1 
ATOM   324  C  CG  . HIS A 1 63  ? -40.133 41.386 -9.345  1.00 57.11  ? 154 HIS A CG  1 
ATOM   325  N  ND1 . HIS A 1 63  ? -38.947 41.329 -10.046 1.00 51.04  ? 154 HIS A ND1 1 
ATOM   326  C  CD2 . HIS A 1 63  ? -41.086 41.739 -10.240 1.00 51.49  ? 154 HIS A CD2 1 
ATOM   327  C  CE1 . HIS A 1 63  ? -39.173 41.639 -11.309 1.00 55.83  ? 154 HIS A CE1 1 
ATOM   328  N  NE2 . HIS A 1 63  ? -40.462 41.890 -11.454 1.00 57.89  ? 154 HIS A NE2 1 
ATOM   329  N  N   . GLY A 1 64  ? -39.016 41.686 -4.766  1.00 44.54  ? 155 GLY A N   1 
ATOM   330  C  CA  . GLY A 1 64  ? -39.164 41.296 -3.381  1.00 44.81  ? 155 GLY A CA  1 
ATOM   331  C  C   . GLY A 1 64  ? -39.378 39.807 -3.201  1.00 44.99  ? 155 GLY A C   1 
ATOM   332  O  O   . GLY A 1 64  ? -39.710 39.078 -4.145  1.00 44.09  ? 155 GLY A O   1 
ATOM   333  N  N   . PHE A 1 65  ? -39.176 39.354 -1.968  1.00 46.88  ? 156 PHE A N   1 
ATOM   334  C  CA  . PHE A 1 65  ? -39.458 37.977 -1.591  1.00 38.50  ? 156 PHE A CA  1 
ATOM   335  C  C   . PHE A 1 65  ? -40.499 38.005 -0.477  1.00 37.19  ? 156 PHE A C   1 
ATOM   336  O  O   . PHE A 1 65  ? -40.178 37.701 0.656   1.00 39.24  ? 156 PHE A O   1 
ATOM   337  C  CB  . PHE A 1 65  ? -38.178 37.309 -1.093  1.00 32.78  ? 156 PHE A CB  1 
ATOM   338  C  CG  . PHE A 1 65  ? -38.327 35.846 -0.782  1.00 37.10  ? 156 PHE A CG  1 
ATOM   339  C  CD1 . PHE A 1 65  ? -39.380 35.108 -1.303  1.00 38.05  ? 156 PHE A CD1 1 
ATOM   340  C  CD2 . PHE A 1 65  ? -37.406 35.202 0.036   1.00 37.06  ? 156 PHE A CD2 1 
ATOM   341  C  CE1 . PHE A 1 65  ? -39.506 33.748 -1.005  1.00 37.99  ? 156 PHE A CE1 1 
ATOM   342  C  CE2 . PHE A 1 65  ? -37.523 33.846 0.333   1.00 31.84  ? 156 PHE A CE2 1 
ATOM   343  C  CZ  . PHE A 1 65  ? -38.567 33.124 -0.174  1.00 34.35  ? 156 PHE A CZ  1 
ATOM   344  N  N   . ASP A 1 66  ? -41.733 38.388 -0.804  1.00 37.73  ? 157 ASP A N   1 
ATOM   345  C  CA  . ASP A 1 66  ? -42.791 38.529 0.192   1.00 33.64  ? 157 ASP A CA  1 
ATOM   346  C  C   . ASP A 1 66  ? -43.985 37.581 0.018   1.00 35.06  ? 157 ASP A C   1 
ATOM   347  O  O   . ASP A 1 66  ? -44.973 37.667 0.766   1.00 33.98  ? 157 ASP A O   1 
ATOM   348  C  CB  . ASP A 1 66  ? -43.258 39.990 0.356   1.00 38.81  ? 157 ASP A CB  1 
ATOM   349  C  CG  . ASP A 1 66  ? -42.837 40.901 -0.792  1.00 55.93  ? 157 ASP A CG  1 
ATOM   350  O  OD1 . ASP A 1 66  ? -43.179 40.584 -1.960  1.00 54.84  ? 157 ASP A OD1 1 
ATOM   351  O  OD2 . ASP A 1 66  ? -42.171 41.942 -0.516  1.00 56.79  ? 157 ASP A OD2 1 
ATOM   352  N  N   . VAL A 1 67  ? -43.876 36.664 -0.939  1.00 29.91  ? 158 VAL A N   1 
ATOM   353  C  CA  . VAL A 1 67  ? -44.879 35.626 -1.146  1.00 31.13  ? 158 VAL A CA  1 
ATOM   354  C  C   . VAL A 1 67  ? -44.196 34.310 -1.501  1.00 31.90  ? 158 VAL A C   1 
ATOM   355  O  O   . VAL A 1 67  ? -43.114 34.309 -2.066  1.00 33.42  ? 158 VAL A O   1 
ATOM   356  C  CB  . VAL A 1 67  ? -45.874 35.999 -2.275  1.00 35.88  ? 158 VAL A CB  1 
ATOM   357  C  CG1 . VAL A 1 67  ? -46.710 37.215 -1.889  1.00 26.73  ? 158 VAL A CG1 1 
ATOM   358  C  CG2 . VAL A 1 67  ? -45.128 36.246 -3.590  1.00 34.21  ? 158 VAL A CG2 1 
ATOM   359  N  N   . PRO A 1 68  ? -44.818 33.175 -1.159  1.00 34.45  ? 159 PRO A N   1 
ATOM   360  C  CA  . PRO A 1 68  ? -44.133 31.908 -1.439  1.00 31.76  ? 159 PRO A CA  1 
ATOM   361  C  C   . PRO A 1 68  ? -43.899 31.740 -2.923  1.00 34.41  ? 159 PRO A C   1 
ATOM   362  O  O   . PRO A 1 68  ? -44.743 32.142 -3.706  1.00 36.56  ? 159 PRO A O   1 
ATOM   363  C  CB  . PRO A 1 68  ? -45.122 30.855 -0.960  1.00 31.43  ? 159 PRO A CB  1 
ATOM   364  C  CG  . PRO A 1 68  ? -45.936 31.547 0.095   1.00 34.64  ? 159 PRO A CG  1 
ATOM   365  C  CD  . PRO A 1 68  ? -46.031 32.992 -0.341  1.00 36.01  ? 159 PRO A CD  1 
ATOM   366  N  N   . ILE A 1 69  ? -42.770 31.154 -3.299  1.00 30.92  ? 160 ILE A N   1 
ATOM   367  C  CA  . ILE A 1 69  ? -42.474 30.922 -4.691  1.00 31.33  ? 160 ILE A CA  1 
ATOM   368  C  C   . ILE A 1 69  ? -42.465 29.433 -4.957  1.00 36.87  ? 160 ILE A C   1 
ATOM   369  O  O   . ILE A 1 69  ? -41.764 28.690 -4.289  1.00 35.96  ? 160 ILE A O   1 
ATOM   370  C  CB  . ILE A 1 69  ? -41.117 31.505 -5.082  1.00 35.02  ? 160 ILE A CB  1 
ATOM   371  C  CG1 . ILE A 1 69  ? -41.181 33.031 -5.103  1.00 30.49  ? 160 ILE A CG1 1 
ATOM   372  C  CG2 . ILE A 1 69  ? -40.675 30.969 -6.447  1.00 32.39  ? 160 ILE A CG2 1 
ATOM   373  C  CD1 . ILE A 1 69  ? -39.826 33.674 -5.182  1.00 26.36  ? 160 ILE A CD1 1 
ATOM   374  N  N   . MET A 1 70  ? -43.262 28.997 -5.928  1.00 38.15  ? 161 MET A N   1 
ATOM   375  C  CA  . MET A 1 70  ? -43.331 27.589 -6.273  1.00 35.99  ? 161 MET A CA  1 
ATOM   376  C  C   . MET A 1 70  ? -42.556 27.325 -7.559  1.00 38.37  ? 161 MET A C   1 
ATOM   377  O  O   . MET A 1 70  ? -42.737 27.997 -8.545  1.00 39.88  ? 161 MET A O   1 
ATOM   378  C  CB  . MET A 1 70  ? -44.782 27.150 -6.437  1.00 35.11  ? 161 MET A CB  1 
ATOM   379  C  CG  . MET A 1 70  ? -44.927 25.805 -7.134  1.00 45.24  ? 161 MET A CG  1 
ATOM   380  S  SD  . MET A 1 70  ? -44.334 24.436 -6.122  1.00 49.49  ? 161 MET A SD  1 
ATOM   381  C  CE  . MET A 1 70  ? -45.698 24.268 -4.975  1.00 38.50  ? 161 MET A CE  1 
ATOM   382  N  N   . VAL A 1 71  ? -41.681 26.340 -7.528  1.00 37.59  ? 162 VAL A N   1 
ATOM   383  C  CA  . VAL A 1 71  ? -40.881 25.989 -8.672  1.00 38.42  ? 162 VAL A CA  1 
ATOM   384  C  C   . VAL A 1 71  ? -41.216 24.540 -9.012  1.00 41.96  ? 162 VAL A C   1 
ATOM   385  O  O   . VAL A 1 71  ? -40.663 23.624 -8.406  1.00 43.45  ? 162 VAL A O   1 
ATOM   386  C  CB  . VAL A 1 71  ? -39.395 26.098 -8.317  1.00 39.08  ? 162 VAL A CB  1 
ATOM   387  C  CG1 . VAL A 1 71  ? -38.536 25.662 -9.469  1.00 34.76  ? 162 VAL A CG1 1 
ATOM   388  C  CG2 . VAL A 1 71  ? -39.057 27.509 -7.876  1.00 36.88  ? 162 VAL A CG2 1 
ATOM   389  N  N   . PRO A 1 72  ? -42.133 24.325 -9.976  1.00 44.47  ? 163 PRO A N   1 
ATOM   390  C  CA  . PRO A 1 72  ? -42.650 22.981 -10.266 1.00 39.74  ? 163 PRO A CA  1 
ATOM   391  C  C   . PRO A 1 72  ? -41.578 21.980 -10.682 1.00 39.61  ? 163 PRO A C   1 
ATOM   392  O  O   . PRO A 1 72  ? -41.645 20.834 -10.267 1.00 37.55  ? 163 PRO A O   1 
ATOM   393  C  CB  . PRO A 1 72  ? -43.630 23.222 -11.420 1.00 36.46  ? 163 PRO A CB  1 
ATOM   394  C  CG  . PRO A 1 72  ? -44.030 24.643 -11.299 1.00 38.44  ? 163 PRO A CG  1 
ATOM   395  C  CD  . PRO A 1 72  ? -42.796 25.354 -10.801 1.00 43.02  ? 163 PRO A CD  1 
ATOM   396  N  N   . LYS A 1 73  ? -40.620 22.388 -11.503 1.00 40.93  ? 164 LYS A N   1 
ATOM   397  C  CA  . LYS A 1 73  ? -39.573 21.463 -11.919 1.00 43.34  ? 164 LYS A CA  1 
ATOM   398  C  C   . LYS A 1 73  ? -38.316 21.857 -11.203 1.00 43.57  ? 164 LYS A C   1 
ATOM   399  O  O   . LYS A 1 73  ? -38.101 23.037 -10.955 1.00 46.82  ? 164 LYS A O   1 
ATOM   400  C  CB  . LYS A 1 73  ? -39.340 21.511 -13.443 1.00 52.34  ? 164 LYS A CB  1 
ATOM   401  C  CG  . LYS A 1 73  ? -40.273 20.616 -14.275 1.00 51.42  ? 164 LYS A CG  1 
ATOM   402  C  CD  . LYS A 1 73  ? -39.715 20.303 -15.692 1.00 66.83  ? 164 LYS A CD  1 
ATOM   403  C  CE  . LYS A 1 73  ? -39.985 21.401 -16.739 1.00 57.53  ? 164 LYS A CE  1 
ATOM   404  N  NZ  . LYS A 1 73  ? -38.885 22.421 -16.832 1.00 59.65  ? 164 LYS A NZ  1 
ATOM   405  N  N   . LEU A 1 74  ? -37.471 20.890 -10.873 1.00 45.21  ? 165 LEU A N   1 
ATOM   406  C  CA  . LEU A 1 74  ? -36.261 21.223 -10.126 1.00 47.50  ? 165 LEU A CA  1 
ATOM   407  C  C   . LEU A 1 74  ? -35.105 21.668 -11.032 1.00 47.35  ? 165 LEU A C   1 
ATOM   408  O  O   . LEU A 1 74  ? -33.970 21.831 -10.575 1.00 50.33  ? 165 LEU A O   1 
ATOM   409  C  CB  . LEU A 1 74  ? -35.858 20.082 -9.178  1.00 46.36  ? 165 LEU A CB  1 
ATOM   410  C  CG  . LEU A 1 74  ? -34.853 19.002 -9.584  1.00 47.22  ? 165 LEU A CG  1 
ATOM   411  C  CD1 . LEU A 1 74  ? -34.847 17.884 -8.552  1.00 43.46  ? 165 LEU A CD1 1 
ATOM   412  C  CD2 . LEU A 1 74  ? -35.172 18.447 -10.948 1.00 54.76  ? 165 LEU A CD2 1 
ATOM   413  N  N   . ASP A 1 75  ? -35.407 21.896 -12.307 1.00 47.37  ? 166 ASP A N   1 
ATOM   414  C  CA  . ASP A 1 75  ? -34.401 22.346 -13.277 1.00 53.26  ? 166 ASP A CA  1 
ATOM   415  C  C   . ASP A 1 75  ? -33.801 23.709 -12.934 1.00 49.08  ? 166 ASP A C   1 
ATOM   416  O  O   . ASP A 1 75  ? -34.528 24.669 -12.672 1.00 46.88  ? 166 ASP A O   1 
ATOM   417  C  CB  . ASP A 1 75  ? -34.995 22.418 -14.690 1.00 54.68  ? 166 ASP A CB  1 
ATOM   418  C  CG  . ASP A 1 75  ? -35.397 21.055 -15.236 1.00 60.96  ? 166 ASP A CG  1 
ATOM   419  O  OD1 . ASP A 1 75  ? -35.645 20.122 -14.430 1.00 63.63  ? 166 ASP A OD1 1 
ATOM   420  O  OD2 . ASP A 1 75  ? -35.471 20.927 -16.481 1.00 61.56  ? 166 ASP A OD2 1 
ATOM   421  N  N   . ASP A 1 76  ? -32.474 23.782 -12.955 1.00 46.74  ? 167 ASP A N   1 
ATOM   422  C  CA  . ASP A 1 76  ? -31.746 25.035 -12.750 1.00 50.07  ? 167 ASP A CA  1 
ATOM   423  C  C   . ASP A 1 76  ? -31.721 25.578 -11.299 1.00 54.88  ? 167 ASP A C   1 
ATOM   424  O  O   . ASP A 1 76  ? -31.206 26.682 -11.042 1.00 48.61  ? 167 ASP A O   1 
ATOM   425  C  CB  . ASP A 1 76  ? -32.253 26.114 -13.720 1.00 52.32  ? 167 ASP A CB  1 
ATOM   426  C  CG  . ASP A 1 76  ? -32.123 25.700 -15.171 1.00 54.20  ? 167 ASP A CG  1 
ATOM   427  O  OD1 . ASP A 1 76  ? -31.097 25.074 -15.521 1.00 52.29  ? 167 ASP A OD1 1 
ATOM   428  O  OD2 . ASP A 1 76  ? -33.061 25.988 -15.951 1.00 56.19  ? 167 ASP A OD2 1 
ATOM   429  N  N   . LEU A 1 77  ? -32.266 24.816 -10.354 1.00 49.84  ? 168 LEU A N   1 
ATOM   430  C  CA  . LEU A 1 77  ? -32.246 25.271 -8.976  1.00 46.09  ? 168 LEU A CA  1 
ATOM   431  C  C   . LEU A 1 77  ? -30.886 25.005 -8.369  1.00 45.03  ? 168 LEU A C   1 
ATOM   432  O  O   . LEU A 1 77  ? -30.489 25.663 -7.413  1.00 50.43  ? 168 LEU A O   1 
ATOM   433  C  CB  . LEU A 1 77  ? -33.334 24.599 -8.143  1.00 46.69  ? 168 LEU A CB  1 
ATOM   434  C  CG  . LEU A 1 77  ? -34.768 25.046 -8.412  1.00 39.63  ? 168 LEU A CG  1 
ATOM   435  C  CD1 . LEU A 1 77  ? -35.714 24.290 -7.501  1.00 44.38  ? 168 LEU A CD1 1 
ATOM   436  C  CD2 . LEU A 1 77  ? -34.911 26.530 -8.216  1.00 40.51  ? 168 LEU A CD2 1 
ATOM   437  N  N   . GLY A 1 78  ? -30.162 24.051 -8.936  1.00 40.66  ? 169 GLY A N   1 
ATOM   438  C  CA  . GLY A 1 78  ? -28.907 23.631 -8.354  1.00 40.78  ? 169 GLY A CA  1 
ATOM   439  C  C   . GLY A 1 78  ? -29.195 22.625 -7.251  1.00 48.95  ? 169 GLY A C   1 
ATOM   440  O  O   . GLY A 1 78  ? -28.307 22.221 -6.500  1.00 47.18  ? 169 GLY A O   1 
ATOM   441  N  N   . LEU A 1 79  ? -30.460 22.227 -7.162  1.00 48.08  ? 170 LEU A N   1 
ATOM   442  C  CA  . LEU A 1 79  ? -30.913 21.269 -6.172  1.00 43.72  ? 170 LEU A CA  1 
ATOM   443  C  C   . LEU A 1 79  ? -30.512 19.860 -6.572  1.00 46.01  ? 170 LEU A C   1 
ATOM   444  O  O   . LEU A 1 79  ? -31.079 19.296 -7.499  1.00 46.17  ? 170 LEU A O   1 
ATOM   445  C  CB  . LEU A 1 79  ? -32.433 21.341 -6.044  1.00 43.26  ? 170 LEU A CB  1 
ATOM   446  C  CG  . LEU A 1 79  ? -33.111 20.398 -5.037  1.00 47.42  ? 170 LEU A CG  1 
ATOM   447  C  CD1 . LEU A 1 79  ? -32.421 20.410 -3.675  1.00 38.38  ? 170 LEU A CD1 1 
ATOM   448  C  CD2 . LEU A 1 79  ? -34.603 20.736 -4.900  1.00 44.16  ? 170 LEU A CD2 1 
ATOM   449  N  N   . ARG A 1 80  ? -29.549 19.284 -5.866  1.00 43.76  ? 171 ARG A N   1 
ATOM   450  C  CA  . ARG A 1 80  ? -29.148 17.913 -6.146  1.00 47.65  ? 171 ARG A CA  1 
ATOM   451  C  C   . ARG A 1 80  ? -29.582 16.961 -5.029  1.00 50.70  ? 171 ARG A C   1 
ATOM   452  O  O   . ARG A 1 80  ? -29.197 17.129 -3.874  1.00 55.12  ? 171 ARG A O   1 
ATOM   453  C  CB  . ARG A 1 80  ? -27.639 17.833 -6.364  1.00 49.94  ? 171 ARG A CB  1 
ATOM   454  C  CG  . ARG A 1 80  ? -27.230 16.738 -7.321  1.00 62.40  ? 171 ARG A CG  1 
ATOM   455  C  CD  . ARG A 1 80  ? -25.727 16.698 -7.523  1.00 69.01  ? 171 ARG A CD  1 
ATOM   456  N  NE  . ARG A 1 80  ? -25.001 16.558 -6.259  1.00 64.71  ? 171 ARG A NE  1 
ATOM   457  C  CZ  . ARG A 1 80  ? -25.051 15.482 -5.477  1.00 60.73  ? 171 ARG A CZ  1 
ATOM   458  N  NH1 . ARG A 1 80  ? -25.805 14.437 -5.815  1.00 59.42  ? 171 ARG A NH1 1 
ATOM   459  N  NH2 . ARG A 1 80  ? -24.344 15.456 -4.353  1.00 57.83  ? 171 ARG A NH2 1 
ATOM   460  N  N   . LEU A 1 81  ? -30.400 15.969 -5.363  1.00 52.98  ? 172 LEU A N   1 
ATOM   461  C  CA  . LEU A 1 81  ? -30.840 15.004 -4.357  1.00 55.06  ? 172 LEU A CA  1 
ATOM   462  C  C   . LEU A 1 81  ? -31.102 13.603 -4.913  1.00 53.43  ? 172 LEU A C   1 
ATOM   463  O  O   . LEU A 1 81  ? -31.226 13.424 -6.125  1.00 54.84  ? 172 LEU A O   1 
ATOM   464  C  CB  . LEU A 1 81  ? -32.042 15.541 -3.565  1.00 53.45  ? 172 LEU A CB  1 
ATOM   465  C  CG  . LEU A 1 81  ? -33.228 16.170 -4.282  1.00 53.08  ? 172 LEU A CG  1 
ATOM   466  C  CD1 . LEU A 1 81  ? -33.965 15.117 -5.062  1.00 56.76  ? 172 LEU A CD1 1 
ATOM   467  C  CD2 . LEU A 1 81  ? -34.153 16.827 -3.262  1.00 45.85  ? 172 LEU A CD2 1 
ATOM   468  N  N   . PRO A 1 82  ? -31.164 12.605 -4.018  1.00 51.71  ? 173 PRO A N   1 
ATOM   469  C  CA  . PRO A 1 82  ? -31.382 11.197 -4.377  1.00 53.88  ? 173 PRO A CA  1 
ATOM   470  C  C   . PRO A 1 82  ? -32.528 10.992 -5.378  1.00 56.39  ? 173 PRO A C   1 
ATOM   471  O  O   . PRO A 1 82  ? -33.431 11.826 -5.460  1.00 58.22  ? 173 PRO A O   1 
ATOM   472  C  CB  . PRO A 1 82  ? -31.739 10.551 -3.029  1.00 50.16  ? 173 PRO A CB  1 
ATOM   473  C  CG  . PRO A 1 82  ? -31.022 11.381 -2.015  1.00 47.59  ? 173 PRO A CG  1 
ATOM   474  C  CD  . PRO A 1 82  ? -30.985 12.785 -2.562  1.00 49.99  ? 173 PRO A CD  1 
ATOM   475  N  N   . SER A 1 83  ? -32.483 9.891  -6.123  1.00 54.49  ? 174 SER A N   1 
ATOM   476  C  CA  . SER A 1 83  ? -33.592 9.489  -6.985  1.00 57.71  ? 174 SER A CA  1 
ATOM   477  C  C   . SER A 1 83  ? -34.891 9.353  -6.185  1.00 53.26  ? 174 SER A C   1 
ATOM   478  O  O   . SER A 1 83  ? -34.861 9.120  -4.982  1.00 52.42  ? 174 SER A O   1 
ATOM   479  C  CB  . SER A 1 83  ? -33.270 8.152  -7.651  1.00 55.07  ? 174 SER A CB  1 
ATOM   480  O  OG  . SER A 1 83  ? -32.938 7.179  -6.674  1.00 61.35  ? 174 SER A OG  1 
ATOM   481  N  N   . PRO A 1 84  ? -36.041 9.485  -6.860  1.00 56.39  ? 175 PRO A N   1 
ATOM   482  C  CA  . PRO A 1 84  ? -37.368 9.342  -6.238  1.00 52.89  ? 175 PRO A CA  1 
ATOM   483  C  C   . PRO A 1 84  ? -37.610 7.997  -5.553  1.00 52.65  ? 175 PRO A C   1 
ATOM   484  O  O   . PRO A 1 84  ? -38.719 7.786  -5.058  1.00 56.11  ? 175 PRO A O   1 
ATOM   485  C  CB  . PRO A 1 84  ? -38.328 9.454  -7.428  1.00 50.87  ? 175 PRO A CB  1 
ATOM   486  C  CG  . PRO A 1 84  ? -37.590 10.238 -8.440  1.00 56.13  ? 175 PRO A CG  1 
ATOM   487  C  CD  . PRO A 1 84  ? -36.130 9.896  -8.271  1.00 55.58  ? 175 PRO A CD  1 
ATOM   488  N  N   . THR A 1 85  ? -36.630 7.096  -5.539  1.00 50.92  ? 176 THR A N   1 
ATOM   489  C  CA  . THR A 1 85  ? -36.845 5.794  -4.904  1.00 53.40  ? 176 THR A CA  1 
ATOM   490  C  C   . THR A 1 85  ? -36.165 5.694  -3.551  1.00 57.65  ? 176 THR A C   1 
ATOM   491  O  O   . THR A 1 85  ? -36.346 4.705  -2.833  1.00 58.23  ? 176 THR A O   1 
ATOM   492  C  CB  . THR A 1 85  ? -36.369 4.605  -5.775  1.00 57.07  ? 176 THR A CB  1 
ATOM   493  O  OG1 . THR A 1 85  ? -35.058 4.872  -6.289  1.00 57.31  ? 176 THR A OG1 1 
ATOM   494  C  CG2 . THR A 1 85  ? -37.340 4.340  -6.921  1.00 50.11  ? 176 THR A CG2 1 
ATOM   495  N  N   . PHE A 1 86  ? -35.376 6.710  -3.213  1.00 52.55  ? 177 PHE A N   1 
ATOM   496  C  CA  . PHE A 1 86  ? -34.683 6.739  -1.935  1.00 46.97  ? 177 PHE A CA  1 
ATOM   497  C  C   . PHE A 1 86  ? -35.690 6.449  -0.828  1.00 51.39  ? 177 PHE A C   1 
ATOM   498  O  O   . PHE A 1 86  ? -36.662 7.185  -0.650  1.00 49.93  ? 177 PHE A O   1 
ATOM   499  C  CB  . PHE A 1 86  ? -34.031 8.099  -1.729  1.00 46.84  ? 177 PHE A CB  1 
ATOM   500  C  CG  . PHE A 1 86  ? -32.925 8.094  -0.720  1.00 46.74  ? 177 PHE A CG  1 
ATOM   501  C  CD1 . PHE A 1 86  ? -31.670 7.621  -1.055  1.00 49.46  ? 177 PHE A CD1 1 
ATOM   502  C  CD2 . PHE A 1 86  ? -33.133 8.579  0.557   1.00 44.01  ? 177 PHE A CD2 1 
ATOM   503  C  CE1 . PHE A 1 86  ? -30.645 7.620  -0.129  1.00 48.82  ? 177 PHE A CE1 1 
ATOM   504  C  CE2 . PHE A 1 86  ? -32.112 8.585  1.479   1.00 46.08  ? 177 PHE A CE2 1 
ATOM   505  C  CZ  . PHE A 1 86  ? -30.867 8.104  1.134   1.00 49.38  ? 177 PHE A CZ  1 
ATOM   506  N  N   . SER A 1 87  ? -35.467 5.367  -0.092  1.00 50.09  ? 178 SER A N   1 
ATOM   507  C  CA  . SER A 1 87  ? -36.448 4.920  0.883   1.00 51.15  ? 178 SER A CA  1 
ATOM   508  C  C   . SER A 1 87  ? -36.054 5.305  2.284   1.00 46.47  ? 178 SER A C   1 
ATOM   509  O  O   . SER A 1 87  ? -34.916 5.687  2.542   1.00 49.17  ? 178 SER A O   1 
ATOM   510  C  CB  . SER A 1 87  ? -36.605 3.408  0.824   1.00 55.49  ? 178 SER A CB  1 
ATOM   511  O  OG  . SER A 1 87  ? -35.402 2.781  1.219   1.00 55.10  ? 178 SER A OG  1 
ATOM   512  N  N   . VAL A 1 88  ? -37.012 5.181  3.189   1.00 47.39  ? 179 VAL A N   1 
ATOM   513  C  CA  . VAL A 1 88  ? -36.769 5.404  4.608   1.00 51.63  ? 179 VAL A CA  1 
ATOM   514  C  C   . VAL A 1 88  ? -35.590 4.557  5.108   1.00 51.49  ? 179 VAL A C   1 
ATOM   515  O  O   . VAL A 1 88  ? -34.824 4.985  5.964   1.00 50.03  ? 179 VAL A O   1 
ATOM   516  C  CB  . VAL A 1 88  ? -38.052 5.137  5.423   1.00 52.11  ? 179 VAL A CB  1 
ATOM   517  C  CG1 . VAL A 1 88  ? -37.731 4.547  6.769   1.00 56.86  ? 179 VAL A CG1 1 
ATOM   518  C  CG2 . VAL A 1 88  ? -38.864 6.420  5.566   1.00 44.62  ? 179 VAL A CG2 1 
ATOM   519  N  N   . MET A 1 89  ? -35.433 3.370  4.533   1.00 58.04  ? 180 MET A N   1 
ATOM   520  C  CA  . MET A 1 89  ? -34.368 2.446  4.912   1.00 56.64  ? 180 MET A CA  1 
ATOM   521  C  C   . MET A 1 89  ? -32.995 2.979  4.497   1.00 56.14  ? 180 MET A C   1 
ATOM   522  O  O   . MET A 1 89  ? -32.014 2.858  5.245   1.00 58.71  ? 180 MET A O   1 
ATOM   523  C  CB  . MET A 1 89  ? -34.633 1.071  4.288   1.00 58.95  ? 180 MET A CB  1 
ATOM   524  C  CG  . MET A 1 89  ? -34.037 -0.107 5.051   1.00 62.98  ? 180 MET A CG  1 
ATOM   525  S  SD  . MET A 1 89  ? -34.276 0.048  6.832   1.00 89.68  ? 180 MET A SD  1 
ATOM   526  C  CE  . MET A 1 89  ? -33.999 -1.639 7.385   1.00 80.76  ? 180 MET A CE  1 
ATOM   527  N  N   . ASP A 1 90  ? -32.929 3.578  3.311   1.00 51.35  ? 181 ASP A N   1 
ATOM   528  C  CA  . ASP A 1 90  ? -31.688 4.168  2.824   1.00 48.41  ? 181 ASP A CA  1 
ATOM   529  C  C   . ASP A 1 90  ? -31.266 5.337  3.697   1.00 54.87  ? 181 ASP A C   1 
ATOM   530  O  O   . ASP A 1 90  ? -30.085 5.529  3.966   1.00 58.25  ? 181 ASP A O   1 
ATOM   531  C  CB  . ASP A 1 90  ? -31.829 4.626  1.381   1.00 48.66  ? 181 ASP A CB  1 
ATOM   532  C  CG  . ASP A 1 90  ? -31.965 3.470  0.411   1.00 54.49  ? 181 ASP A CG  1 
ATOM   533  O  OD1 . ASP A 1 90  ? -32.756 3.605  -0.542  1.00 52.73  ? 181 ASP A OD1 1 
ATOM   534  O  OD2 . ASP A 1 90  ? -31.282 2.436  0.593   1.00 56.98  ? 181 ASP A OD2 1 
ATOM   535  N  N   . VAL A 1 91  ? -32.225 6.131  4.146   1.00 54.25  ? 182 VAL A N   1 
ATOM   536  C  CA  . VAL A 1 91  ? -31.874 7.164  5.091   1.00 53.59  ? 182 VAL A CA  1 
ATOM   537  C  C   . VAL A 1 91  ? -31.228 6.510  6.299   1.00 54.24  ? 182 VAL A C   1 
ATOM   538  O  O   . VAL A 1 91  ? -30.177 6.954  6.764   1.00 57.31  ? 182 VAL A O   1 
ATOM   539  C  CB  . VAL A 1 91  ? -33.081 7.990  5.542   1.00 52.65  ? 182 VAL A CB  1 
ATOM   540  C  CG1 . VAL A 1 91  ? -32.698 8.878  6.726   1.00 46.47  ? 182 VAL A CG1 1 
ATOM   541  C  CG2 . VAL A 1 91  ? -33.598 8.822  4.392   1.00 47.29  ? 182 VAL A CG2 1 
ATOM   542  N  N   . GLU A 1 92  ? -31.843 5.445  6.806   1.00 54.71  ? 183 GLU A N   1 
ATOM   543  C  CA  . GLU A 1 92  ? -31.347 4.843  8.039   1.00 56.10  ? 183 GLU A CA  1 
ATOM   544  C  C   . GLU A 1 92  ? -29.892 4.452  7.884   1.00 60.16  ? 183 GLU A C   1 
ATOM   545  O  O   . GLU A 1 92  ? -29.119 4.563  8.838   1.00 61.36  ? 183 GLU A O   1 
ATOM   546  C  CB  . GLU A 1 92  ? -32.153 3.623  8.470   1.00 54.80  ? 183 GLU A CB  1 
ATOM   547  C  CG  . GLU A 1 92  ? -31.519 2.927  9.661   1.00 53.48  ? 183 GLU A CG  1 
ATOM   548  C  CD  . GLU A 1 92  ? -32.254 1.679  10.089  1.00 57.92  ? 183 GLU A CD  1 
ATOM   549  O  OE1 . GLU A 1 92  ? -33.027 1.136  9.275   1.00 63.64  ? 183 GLU A OE1 1 
ATOM   550  O  OE2 . GLU A 1 92  ? -32.059 1.236  11.244  1.00 57.88  ? 183 GLU A OE2 1 
ATOM   551  N  N   . ARG A 1 93  ? -29.521 3.999  6.685   1.00 55.80  ? 184 ARG A N   1 
ATOM   552  C  CA  . ARG A 1 93  ? -28.136 3.622  6.407   1.00 58.70  ? 184 ARG A CA  1 
ATOM   553  C  C   . ARG A 1 93  ? -27.206 4.823  6.459   1.00 60.45  ? 184 ARG A C   1 
ATOM   554  O  O   . ARG A 1 93  ? -26.356 4.931  7.346   1.00 60.39  ? 184 ARG A O   1 
ATOM   555  C  CB  . ARG A 1 93  ? -28.006 2.992  5.023   1.00 63.46  ? 184 ARG A CB  1 
ATOM   556  C  CG  . ARG A 1 93  ? -28.819 1.727  4.794   1.00 66.04  ? 184 ARG A CG  1 
ATOM   557  C  CD  . ARG A 1 93  ? -28.652 1.296  3.340   1.00 68.66  ? 184 ARG A CD  1 
ATOM   558  N  NE  . ARG A 1 93  ? -27.272 1.515  2.903   1.00 75.58  ? 184 ARG A NE  1 
ATOM   559  C  CZ  . ARG A 1 93  ? -26.900 1.750  1.647   1.00 74.81  ? 184 ARG A CZ  1 
ATOM   560  N  NH1 . ARG A 1 93  ? -27.806 1.804  0.676   1.00 72.55  ? 184 ARG A NH1 1 
ATOM   561  N  NH2 . ARG A 1 93  ? -25.614 1.939  1.368   1.00 73.38  ? 184 ARG A NH2 1 
ATOM   562  N  N   . TYR A 1 94  ? -27.368 5.712  5.485   1.00 57.04  ? 185 TYR A N   1 
ATOM   563  C  CA  . TYR A 1 94  ? -26.510 6.880  5.340   1.00 54.05  ? 185 TYR A CA  1 
ATOM   564  C  C   . TYR A 1 94  ? -26.411 7.728  6.598   1.00 56.46  ? 185 TYR A C   1 
ATOM   565  O  O   . TYR A 1 94  ? -25.384 8.356  6.842   1.00 60.73  ? 185 TYR A O   1 
ATOM   566  C  CB  . TYR A 1 94  ? -26.989 7.753  4.183   1.00 54.88  ? 185 TYR A CB  1 
ATOM   567  C  CG  . TYR A 1 94  ? -26.670 7.193  2.823   1.00 53.22  ? 185 TYR A CG  1 
ATOM   568  C  CD1 . TYR A 1 94  ? -25.528 7.583  2.147   1.00 54.85  ? 185 TYR A CD1 1 
ATOM   569  C  CD2 . TYR A 1 94  ? -27.505 6.278  2.220   1.00 51.23  ? 185 TYR A CD2 1 
ATOM   570  C  CE1 . TYR A 1 94  ? -25.228 7.075  0.902   1.00 53.82  ? 185 TYR A CE1 1 
ATOM   571  C  CE2 . TYR A 1 94  ? -27.217 5.764  0.975   1.00 58.73  ? 185 TYR A CE2 1 
ATOM   572  C  CZ  . TYR A 1 94  ? -26.076 6.164  0.318   1.00 57.08  ? 185 TYR A CZ  1 
ATOM   573  O  OH  . TYR A 1 94  ? -25.786 5.658  -0.930  1.00 53.66  ? 185 TYR A OH  1 
ATOM   574  N  N   . VAL A 1 95  ? -27.470 7.767  7.395   1.00 53.90  ? 186 VAL A N   1 
ATOM   575  C  CA  . VAL A 1 95  ? -27.440 8.605  8.584   1.00 51.80  ? 186 VAL A CA  1 
ATOM   576  C  C   . VAL A 1 95  ? -26.961 7.817  9.792   1.00 53.83  ? 186 VAL A C   1 
ATOM   577  O  O   . VAL A 1 95  ? -26.148 8.307  10.582  1.00 48.04  ? 186 VAL A O   1 
ATOM   578  C  CB  . VAL A 1 95  ? -28.802 9.258  8.852   1.00 48.73  ? 186 VAL A CB  1 
ATOM   579  C  CG1 . VAL A 1 95  ? -28.809 9.948  10.196  1.00 48.15  ? 186 VAL A CG1 1 
ATOM   580  C  CG2 . VAL A 1 95  ? -29.118 10.258 7.752   1.00 51.21  ? 186 VAL A CG2 1 
ATOM   581  N  N   . GLY A 1 96  ? -27.458 6.589  9.920   1.00 56.96  ? 187 GLY A N   1 
ATOM   582  C  CA  . GLY A 1 96  ? -27.118 5.728  11.040  1.00 52.59  ? 187 GLY A CA  1 
ATOM   583  C  C   . GLY A 1 96  ? -28.282 5.523  11.989  1.00 58.57  ? 187 GLY A C   1 
ATOM   584  O  O   . GLY A 1 96  ? -28.625 6.419  12.770  1.00 60.57  ? 187 GLY A O   1 
ATOM   585  N  N   . GLY A 1 97  ? -28.883 4.336  11.930  1.00 58.94  ? 188 GLY A N   1 
ATOM   586  C  CA  . GLY A 1 97  ? -30.061 4.029  12.722  1.00 53.81  ? 188 GLY A CA  1 
ATOM   587  C  C   . GLY A 1 97  ? -29.908 4.329  14.200  1.00 61.57  ? 188 GLY A C   1 
ATOM   588  O  O   . GLY A 1 97  ? -30.897 4.435  14.944  1.00 61.29  ? 188 GLY A O   1 
ATOM   589  N  N   . ASP A 1 98  ? -28.663 4.463  14.641  1.00 63.88  ? 189 ASP A N   1 
ATOM   590  C  CA  . ASP A 1 98  ? -28.396 4.676  16.057  1.00 67.64  ? 189 ASP A CA  1 
ATOM   591  C  C   . ASP A 1 98  ? -28.753 6.091  16.506  1.00 60.46  ? 189 ASP A C   1 
ATOM   592  O  O   . ASP A 1 98  ? -29.066 6.313  17.672  1.00 61.83  ? 189 ASP A O   1 
ATOM   593  C  CB  . ASP A 1 98  ? -26.935 4.345  16.392  1.00 72.91  ? 189 ASP A CB  1 
ATOM   594  C  CG  . ASP A 1 98  ? -26.789 3.023  17.145  1.00 77.77  ? 189 ASP A CG  1 
ATOM   595  O  OD1 . ASP A 1 98  ? -27.784 2.261  17.208  1.00 73.68  ? 189 ASP A OD1 1 
ATOM   596  O  OD2 . ASP A 1 98  ? -25.680 2.749  17.670  1.00 79.37  ? 189 ASP A OD2 1 
ATOM   597  N  N   . LYS A 1 99  ? -28.722 7.039  15.575  1.00 52.80  ? 190 LYS A N   1 
ATOM   598  C  CA  . LYS A 1 99  ? -28.996 8.432  15.904  1.00 53.70  ? 190 LYS A CA  1 
ATOM   599  C  C   . LYS A 1 99  ? -30.358 8.580  16.600  1.00 55.62  ? 190 LYS A C   1 
ATOM   600  O  O   . LYS A 1 99  ? -31.316 7.886  16.251  1.00 57.83  ? 190 LYS A O   1 
ATOM   601  C  CB  . LYS A 1 99  ? -28.908 9.285  14.632  1.00 50.46  ? 190 LYS A CB  1 
ATOM   602  C  CG  . LYS A 1 99  ? -29.164 10.782 14.814  1.00 51.57  ? 190 LYS A CG  1 
ATOM   603  C  CD  . LYS A 1 99  ? -28.908 11.527 13.494  1.00 51.35  ? 190 LYS A CD  1 
ATOM   604  C  CE  . LYS A 1 99  ? -29.362 12.978 13.549  1.00 37.33  ? 190 LYS A CE  1 
ATOM   605  N  NZ  . LYS A 1 99  ? -28.620 13.732 14.575  1.00 43.19  ? 190 LYS A NZ  1 
ATOM   606  N  N   . VAL A 1 100 ? -30.439 9.461  17.598  1.00 54.29  ? 191 VAL A N   1 
ATOM   607  C  CA  . VAL A 1 100 ? -31.706 9.726  18.294  1.00 51.67  ? 191 VAL A CA  1 
ATOM   608  C  C   . VAL A 1 100 ? -32.362 10.996 17.779  1.00 52.71  ? 191 VAL A C   1 
ATOM   609  O  O   . VAL A 1 100 ? -31.880 12.102 18.028  1.00 54.78  ? 191 VAL A O   1 
ATOM   610  C  CB  . VAL A 1 100 ? -31.527 9.887  19.813  1.00 57.05  ? 191 VAL A CB  1 
ATOM   611  C  CG1 . VAL A 1 100 ? -32.866 10.291 20.470  1.00 49.47  ? 191 VAL A CG1 1 
ATOM   612  C  CG2 . VAL A 1 100 ? -30.958 8.607  20.425  1.00 50.94  ? 191 VAL A CG2 1 
ATOM   613  N  N   . ILE A 1 101 ? -33.479 10.834 17.084  1.00 48.50  ? 192 ILE A N   1 
ATOM   614  C  CA  . ILE A 1 101 ? -34.104 11.944 16.392  1.00 50.56  ? 192 ILE A CA  1 
ATOM   615  C  C   . ILE A 1 101 ? -35.359 12.432 17.104  1.00 50.08  ? 192 ILE A C   1 
ATOM   616  O  O   . ILE A 1 101 ? -35.995 11.672 17.837  1.00 48.02  ? 192 ILE A O   1 
ATOM   617  C  CB  . ILE A 1 101 ? -34.479 11.516 14.978  1.00 44.37  ? 192 ILE A CB  1 
ATOM   618  C  CG1 . ILE A 1 101 ? -35.416 10.316 15.047  1.00 41.56  ? 192 ILE A CG1 1 
ATOM   619  C  CG2 . ILE A 1 101 ? -33.227 11.170 14.192  1.00 44.35  ? 192 ILE A CG2 1 
ATOM   620  C  CD1 . ILE A 1 101 ? -35.894 9.828  13.710  1.00 44.29  ? 192 ILE A CD1 1 
ATOM   621  N  N   . ASP A 1 102 ? -35.716 13.696 16.885  1.00 46.51  ? 193 ASP A N   1 
ATOM   622  C  CA  . ASP A 1 102 ? -36.976 14.211 17.386  1.00 44.26  ? 193 ASP A CA  1 
ATOM   623  C  C   . ASP A 1 102 ? -38.157 13.655 16.585  1.00 44.81  ? 193 ASP A C   1 
ATOM   624  O  O   . ASP A 1 102 ? -38.112 13.591 15.364  1.00 47.34  ? 193 ASP A O   1 
ATOM   625  C  CB  . ASP A 1 102 ? -36.997 15.735 17.385  1.00 45.16  ? 193 ASP A CB  1 
ATOM   626  C  CG  . ASP A 1 102 ? -37.976 16.304 18.431  1.00 67.26  ? 193 ASP A CG  1 
ATOM   627  O  OD1 . ASP A 1 102 ? -38.850 17.131 18.063  1.00 64.34  ? 193 ASP A OD1 1 
ATOM   628  O  OD2 . ASP A 1 102 ? -37.879 15.915 19.628  1.00 60.96  ? 193 ASP A OD2 1 
ATOM   629  N  N   . VAL A 1 103 ? -39.212 13.241 17.278  1.00 44.29  ? 194 VAL A N   1 
ATOM   630  C  CA  . VAL A 1 103 ? -40.384 12.673 16.618  1.00 42.62  ? 194 VAL A CA  1 
ATOM   631  C  C   . VAL A 1 103 ? -41.655 13.286 17.187  1.00 45.23  ? 194 VAL A C   1 
ATOM   632  O  O   . VAL A 1 103 ? -41.783 13.418 18.399  1.00 47.62  ? 194 VAL A O   1 
ATOM   633  C  CB  . VAL A 1 103 ? -40.438 11.146 16.797  1.00 38.97  ? 194 VAL A CB  1 
ATOM   634  C  CG1 . VAL A 1 103 ? -41.698 10.575 16.170  1.00 41.08  ? 194 VAL A CG1 1 
ATOM   635  C  CG2 . VAL A 1 103 ? -39.212 10.505 16.193  1.00 43.03  ? 194 VAL A CG2 1 
ATOM   636  N  N   . ILE A 1 104 ? -42.594 13.675 16.327  1.00 42.74  ? 195 ILE A N   1 
ATOM   637  C  CA  . ILE A 1 104 ? -43.849 14.230 16.831  1.00 41.82  ? 195 ILE A CA  1 
ATOM   638  C  C   . ILE A 1 104 ? -44.964 13.187 16.941  1.00 41.80  ? 195 ILE A C   1 
ATOM   639  O  O   . ILE A 1 104 ? -45.305 12.509 15.971  1.00 39.41  ? 195 ILE A O   1 
ATOM   640  C  CB  . ILE A 1 104 ? -44.352 15.469 16.040  1.00 36.93  ? 195 ILE A CB  1 
ATOM   641  C  CG1 . ILE A 1 104 ? -43.328 16.598 16.078  1.00 40.08  ? 195 ILE A CG1 1 
ATOM   642  C  CG2 . ILE A 1 104 ? -45.637 16.006 16.656  1.00 37.70  ? 195 ILE A CG2 1 
ATOM   643  C  CD1 . ILE A 1 104 ? -42.360 16.580 14.923  1.00 43.09  ? 195 ILE A CD1 1 
ATOM   644  N  N   . ASP A 1 105 ? -45.508 13.059 18.148  1.00 43.45  ? 196 ASP A N   1 
ATOM   645  C  CA  . ASP A 1 105 ? -46.756 12.349 18.367  1.00 44.26  ? 196 ASP A CA  1 
ATOM   646  C  C   . ASP A 1 105 ? -47.863 13.289 17.902  1.00 40.27  ? 196 ASP A C   1 
ATOM   647  O  O   . ASP A 1 105 ? -48.281 14.173 18.641  1.00 37.85  ? 196 ASP A O   1 
ATOM   648  C  CB  . ASP A 1 105 ? -46.915 12.021 19.857  1.00 47.93  ? 196 ASP A CB  1 
ATOM   649  C  CG  . ASP A 1 105 ? -47.964 10.959 20.112  1.00 53.90  ? 196 ASP A CG  1 
ATOM   650  O  OD1 . ASP A 1 105 ? -47.732 10.086 20.972  1.00 54.42  ? 196 ASP A OD1 1 
ATOM   651  O  OD2 . ASP A 1 105 ? -49.018 10.990 19.440  1.00 58.93  ? 196 ASP A OD2 1 
ATOM   652  N  N   . VAL A 1 106 ? -48.315 13.123 16.664  1.00 43.57  ? 197 VAL A N   1 
ATOM   653  C  CA  . VAL A 1 106 ? -49.224 14.100 16.067  1.00 39.01  ? 197 VAL A CA  1 
ATOM   654  C  C   . VAL A 1 106 ? -50.562 14.162 16.808  1.00 40.89  ? 197 VAL A C   1 
ATOM   655  O  O   . VAL A 1 106 ? -51.099 15.246 17.046  1.00 41.02  ? 197 VAL A O   1 
ATOM   656  C  CB  . VAL A 1 106 ? -49.439 13.865 14.559  1.00 37.58  ? 197 VAL A CB  1 
ATOM   657  C  CG1 . VAL A 1 106 ? -50.234 15.002 13.975  1.00 37.76  ? 197 VAL A CG1 1 
ATOM   658  C  CG2 . VAL A 1 106 ? -48.113 13.742 13.831  1.00 34.43  ? 197 VAL A CG2 1 
ATOM   659  N  N   . ALA A 1 107 ? -51.087 13.008 17.203  1.00 42.57  ? 198 ALA A N   1 
ATOM   660  C  CA  . ALA A 1 107 ? -52.310 12.995 18.007  1.00 44.97  ? 198 ALA A CA  1 
ATOM   661  C  C   . ALA A 1 107 ? -52.175 13.766 19.333  1.00 42.49  ? 198 ALA A C   1 
ATOM   662  O  O   . ALA A 1 107 ? -53.136 14.386 19.795  1.00 45.57  ? 198 ALA A O   1 
ATOM   663  C  CB  . ALA A 1 107 ? -52.779 11.573 18.253  1.00 46.65  ? 198 ALA A CB  1 
ATOM   664  N  N   . ARG A 1 108 ? -50.993 13.737 19.946  1.00 36.19  ? 199 ARG A N   1 
ATOM   665  C  CA  . ARG A 1 108 ? -50.791 14.443 21.216  1.00 43.27  ? 199 ARG A CA  1 
ATOM   666  C  C   . ARG A 1 108 ? -50.175 15.838 21.051  1.00 45.69  ? 199 ARG A C   1 
ATOM   667  O  O   . ARG A 1 108 ? -50.115 16.609 22.017  1.00 43.91  ? 199 ARG A O   1 
ATOM   668  C  CB  . ARG A 1 108 ? -49.919 13.618 22.188  1.00 47.56  ? 199 ARG A CB  1 
ATOM   669  C  CG  . ARG A 1 108 ? -50.532 12.299 22.657  1.00 55.36  ? 199 ARG A CG  1 
ATOM   670  C  CD  . ARG A 1 108 ? -49.655 11.559 23.690  1.00 56.81  ? 199 ARG A CD  1 
ATOM   671  N  NE  . ARG A 1 108 ? -48.869 12.473 24.516  1.00 54.30  ? 199 ARG A NE  1 
ATOM   672  C  CZ  . ARG A 1 108 ? -47.539 12.436 24.631  1.00 55.75  ? 199 ARG A CZ  1 
ATOM   673  N  NH1 . ARG A 1 108 ? -46.836 11.505 23.989  1.00 45.07  ? 199 ARG A NH1 1 
ATOM   674  N  NH2 . ARG A 1 108 ? -46.910 13.327 25.401  1.00 54.92  ? 199 ARG A NH2 1 
ATOM   675  N  N   . GLN A 1 109 ? -49.692 16.144 19.843  1.00 42.19  ? 200 GLN A N   1 
ATOM   676  C  CA  . GLN A 1 109 ? -48.948 17.385 19.584  1.00 40.47  ? 200 GLN A CA  1 
ATOM   677  C  C   . GLN A 1 109 ? -47.837 17.645 20.615  1.00 40.93  ? 200 GLN A C   1 
ATOM   678  O  O   . GLN A 1 109 ? -47.752 18.716 21.228  1.00 44.94  ? 200 GLN A O   1 
ATOM   679  C  CB  . GLN A 1 109 ? -49.900 18.575 19.471  1.00 40.43  ? 200 GLN A CB  1 
ATOM   680  C  CG  . GLN A 1 109 ? -50.811 18.506 18.248  1.00 41.79  ? 200 GLN A CG  1 
ATOM   681  C  CD  . GLN A 1 109 ? -50.094 18.865 16.962  1.00 41.92  ? 200 GLN A CD  1 
ATOM   682  O  OE1 . GLN A 1 109 ? -49.669 20.004 16.778  1.00 43.56  ? 200 GLN A OE1 1 
ATOM   683  N  NE2 . GLN A 1 109 ? -49.950 17.890 16.066  1.00 34.59  ? 200 GLN A NE2 1 
ATOM   684  N  N   . ALA A 1 110 ? -46.988 16.645 20.798  1.00 38.50  ? 201 ALA A N   1 
ATOM   685  C  CA  . ALA A 1 110 ? -45.904 16.730 21.764  1.00 47.24  ? 201 ALA A CA  1 
ATOM   686  C  C   . ALA A 1 110 ? -44.658 16.072 21.207  1.00 49.52  ? 201 ALA A C   1 
ATOM   687  O  O   . ALA A 1 110 ? -44.734 15.230 20.298  1.00 45.05  ? 201 ALA A O   1 
ATOM   688  C  CB  . ALA A 1 110 ? -46.305 16.070 23.078  1.00 47.21  ? 201 ALA A CB  1 
ATOM   689  N  N   . ASP A 1 111 ? -43.514 16.445 21.769  1.00 50.33  ? 202 ASP A N   1 
ATOM   690  C  CA  . ASP A 1 111 ? -42.238 15.945 21.287  1.00 54.96  ? 202 ASP A CA  1 
ATOM   691  C  C   . ASP A 1 111 ? -41.768 14.672 21.988  1.00 55.24  ? 202 ASP A C   1 
ATOM   692  O  O   . ASP A 1 111 ? -41.792 14.564 23.213  1.00 63.59  ? 202 ASP A O   1 
ATOM   693  C  CB  . ASP A 1 111 ? -41.188 17.039 21.377  1.00 56.48  ? 202 ASP A CB  1 
ATOM   694  C  CG  . ASP A 1 111 ? -41.657 18.321 20.749  1.00 61.64  ? 202 ASP A CG  1 
ATOM   695  O  OD1 . ASP A 1 111 ? -41.173 18.654 19.643  1.00 69.06  ? 202 ASP A OD1 1 
ATOM   696  O  OD2 . ASP A 1 111 ? -42.535 18.977 21.347  1.00 61.16  ? 202 ASP A OD2 1 
ATOM   697  N  N   . SER A 1 112 ? -41.349 13.715 21.175  1.00 45.44  ? 203 SER A N   1 
ATOM   698  C  CA  . SER A 1 112 ? -40.878 12.436 21.637  1.00 49.10  ? 203 SER A CA  1 
ATOM   699  C  C   . SER A 1 112 ? -39.492 12.216 21.074  1.00 50.83  ? 203 SER A C   1 
ATOM   700  O  O   . SER A 1 112 ? -39.015 12.994 20.261  1.00 53.24  ? 203 SER A O   1 
ATOM   701  C  CB  . SER A 1 112 ? -41.804 11.329 21.134  1.00 54.90  ? 203 SER A CB  1 
ATOM   702  O  OG  . SER A 1 112 ? -43.134 11.539 21.579  1.00 56.22  ? 203 SER A OG  1 
ATOM   703  N  N   . LYS A 1 113 ? -38.853 11.140 21.506  1.00 51.77  ? 204 LYS A N   1 
ATOM   704  C  CA  . LYS A 1 113 ? -37.531 10.786 21.034  1.00 46.50  ? 204 LYS A CA  1 
ATOM   705  C  C   . LYS A 1 113 ? -37.509 9.316  20.691  1.00 49.82  ? 204 LYS A C   1 
ATOM   706  O  O   . LYS A 1 113 ? -38.233 8.522  21.276  1.00 54.86  ? 204 LYS A O   1 
ATOM   707  C  CB  . LYS A 1 113 ? -36.485 11.077 22.101  1.00 39.17  ? 204 LYS A CB  1 
ATOM   708  C  CG  . LYS A 1 113 ? -36.266 12.555 22.366  1.00 44.24  ? 204 LYS A CG  1 
ATOM   709  C  CD  . LYS A 1 113 ? -35.404 13.190 21.287  1.00 49.35  ? 204 LYS A CD  1 
ATOM   710  C  CE  . LYS A 1 113 ? -35.010 14.601 21.677  1.00 54.08  ? 204 LYS A CE  1 
ATOM   711  N  NZ  . LYS A 1 113 ? -36.216 15.400 22.029  1.00 61.83  ? 204 LYS A NZ  1 
ATOM   712  N  N   . MET A 1 114 ? -36.691 8.953  19.720  1.00 51.58  ? 205 MET A N   1 
ATOM   713  C  CA  . MET A 1 114 ? -36.462 7.549  19.442  1.00 53.96  ? 205 MET A CA  1 
ATOM   714  C  C   . MET A 1 114 ? -35.309 7.426  18.463  1.00 54.49  ? 205 MET A C   1 
ATOM   715  O  O   . MET A 1 114 ? -34.792 8.429  17.974  1.00 55.90  ? 205 MET A O   1 
ATOM   716  C  CB  . MET A 1 114 ? -37.737 6.856  18.935  1.00 54.05  ? 205 MET A CB  1 
ATOM   717  C  CG  . MET A 1 114 ? -38.230 7.318  17.566  1.00 55.94  ? 205 MET A CG  1 
ATOM   718  S  SD  . MET A 1 114 ? -39.936 6.795  17.216  1.00 58.63  ? 205 MET A SD  1 
ATOM   719  C  CE  . MET A 1 114 ? -39.686 5.145  16.582  1.00 54.69  ? 205 MET A CE  1 
ATOM   720  N  N   . THR A 1 115 ? -34.884 6.199  18.210  1.00 54.32  ? 206 THR A N   1 
ATOM   721  C  CA  . THR A 1 115 ? -33.757 5.975  17.340  1.00 54.44  ? 206 THR A CA  1 
ATOM   722  C  C   . THR A 1 115 ? -34.284 6.080  15.939  1.00 55.16  ? 206 THR A C   1 
ATOM   723  O  O   . THR A 1 115 ? -35.422 5.697  15.671  1.00 58.30  ? 206 THR A O   1 
ATOM   724  C  CB  . THR A 1 115 ? -33.191 4.565  17.503  1.00 57.22  ? 206 THR A CB  1 
ATOM   725  O  OG1 . THR A 1 115 ? -34.160 3.617  17.041  1.00 54.86  ? 206 THR A OG1 1 
ATOM   726  C  CG2 . THR A 1 115 ? -32.835 4.282  18.960  1.00 47.62  ? 206 THR A CG2 1 
ATOM   727  N  N   . LEU A 1 116 ? -33.460 6.594  15.043  1.00 48.20  ? 207 LEU A N   1 
ATOM   728  C  CA  . LEU A 1 116 ? -33.820 6.578  13.650  1.00 53.56  ? 207 LEU A CA  1 
ATOM   729  C  C   . LEU A 1 116 ? -34.230 5.152  13.251  1.00 54.28  ? 207 LEU A C   1 
ATOM   730  O  O   . LEU A 1 116 ? -35.146 4.960  12.447  1.00 55.38  ? 207 LEU A O   1 
ATOM   731  C  CB  . LEU A 1 116 ? -32.645 7.075  12.811  1.00 56.93  ? 207 LEU A CB  1 
ATOM   732  C  CG  . LEU A 1 116 ? -32.867 7.050  11.304  1.00 54.03  ? 207 LEU A CG  1 
ATOM   733  C  CD1 . LEU A 1 116 ? -34.076 7.885  10.977  1.00 49.41  ? 207 LEU A CD1 1 
ATOM   734  C  CD2 . LEU A 1 116 ? -31.635 7.557  10.577  1.00 55.83  ? 207 LEU A CD2 1 
ATOM   735  N  N   . HIS A 1 117 ? -33.560 4.160  13.838  1.00 57.60  ? 208 HIS A N   1 
ATOM   736  C  CA  . HIS A 1 117 ? -33.806 2.744  13.531  1.00 56.23  ? 208 HIS A CA  1 
ATOM   737  C  C   . HIS A 1 117 ? -35.250 2.348  13.841  1.00 53.58  ? 208 HIS A C   1 
ATOM   738  O  O   . HIS A 1 117 ? -35.943 1.712  13.036  1.00 51.01  ? 208 HIS A O   1 
ATOM   739  C  CB  . HIS A 1 117 ? -32.823 1.854  14.305  1.00 57.50  ? 208 HIS A CB  1 
ATOM   740  C  CG  . HIS A 1 117 ? -33.134 0.388  14.227  1.00 60.94  ? 208 HIS A CG  1 
ATOM   741  N  ND1 . HIS A 1 117 ? -32.968 -0.352 13.073  1.00 60.16  ? 208 HIS A ND1 1 
ATOM   742  C  CD2 . HIS A 1 117 ? -33.601 -0.474 15.164  1.00 49.10  ? 208 HIS A CD2 1 
ATOM   743  C  CE1 . HIS A 1 117 ? -33.322 -1.606 13.302  1.00 55.41  ? 208 HIS A CE1 1 
ATOM   744  N  NE2 . HIS A 1 117 ? -33.714 -1.705 14.561  1.00 52.83  ? 208 HIS A NE2 1 
ATOM   745  N  N   . ASN A 1 118 ? -35.708 2.745  15.016  1.00 51.45  ? 209 ASN A N   1 
ATOM   746  C  CA  . ASN A 1 118 ? -37.081 2.484  15.382  1.00 57.21  ? 209 ASN A CA  1 
ATOM   747  C  C   . ASN A 1 118 ? -38.099 3.227  14.525  1.00 58.75  ? 209 ASN A C   1 
ATOM   748  O  O   . ASN A 1 118 ? -39.080 2.631  14.073  1.00 58.43  ? 209 ASN A O   1 
ATOM   749  C  CB  . ASN A 1 118 ? -37.293 2.759  16.859  1.00 54.72  ? 209 ASN A CB  1 
ATOM   750  C  CG  . ASN A 1 118 ? -36.609 1.725  17.728  1.00 61.93  ? 209 ASN A CG  1 
ATOM   751  O  OD1 . ASN A 1 118 ? -36.106 2.035  18.812  1.00 57.37  ? 209 ASN A OD1 1 
ATOM   752  N  ND2 . ASN A 1 118 ? -36.568 0.483  17.242  1.00 56.19  ? 209 ASN A ND2 1 
ATOM   753  N  N   . TYR A 1 119 ? -37.873 4.515  14.284  1.00 53.76  ? 210 TYR A N   1 
ATOM   754  C  CA  . TYR A 1 119 ? -38.846 5.247  13.505  1.00 51.31  ? 210 TYR A CA  1 
ATOM   755  C  C   . TYR A 1 119 ? -39.028 4.545  12.177  1.00 51.64  ? 210 TYR A C   1 
ATOM   756  O  O   . TYR A 1 119 ? -40.142 4.449  11.666  1.00 51.29  ? 210 TYR A O   1 
ATOM   757  C  CB  . TYR A 1 119 ? -38.483 6.719  13.301  1.00 51.90  ? 210 TYR A CB  1 
ATOM   758  C  CG  . TYR A 1 119 ? -39.558 7.430  12.500  1.00 48.53  ? 210 TYR A CG  1 
ATOM   759  C  CD1 . TYR A 1 119 ? -40.675 7.976  13.122  1.00 52.44  ? 210 TYR A CD1 1 
ATOM   760  C  CD2 . TYR A 1 119 ? -39.478 7.511  11.130  1.00 43.10  ? 210 TYR A CD2 1 
ATOM   761  C  CE1 . TYR A 1 119 ? -41.671 8.602  12.392  1.00 41.96  ? 210 TYR A CE1 1 
ATOM   762  C  CE2 . TYR A 1 119 ? -40.457 8.123  10.404  1.00 48.79  ? 210 TYR A CE2 1 
ATOM   763  C  CZ  . TYR A 1 119 ? -41.552 8.669  11.035  1.00 46.81  ? 210 TYR A CZ  1 
ATOM   764  O  OH  . TYR A 1 119 ? -42.527 9.281  10.273  1.00 50.94  ? 210 TYR A OH  1 
ATOM   765  N  N   . VAL A 1 120 ? -37.934 4.034  11.630  1.00 49.33  ? 211 VAL A N   1 
ATOM   766  C  CA  . VAL A 1 120 ? -38.017 3.316  10.371  1.00 52.91  ? 211 VAL A CA  1 
ATOM   767  C  C   . VAL A 1 120 ? -38.824 2.028  10.528  1.00 54.55  ? 211 VAL A C   1 
ATOM   768  O  O   . VAL A 1 120 ? -39.583 1.651  9.639   1.00 52.93  ? 211 VAL A O   1 
ATOM   769  C  CB  . VAL A 1 120 ? -36.634 3.002  9.818   1.00 50.65  ? 211 VAL A CB  1 
ATOM   770  C  CG1 . VAL A 1 120 ? -36.750 2.102  8.628   1.00 44.32  ? 211 VAL A CG1 1 
ATOM   771  C  CG2 . VAL A 1 120 ? -35.915 4.287  9.471   1.00 49.54  ? 211 VAL A CG2 1 
ATOM   772  N  N   . LYS A 1 121 ? -38.668 1.352  11.662  1.00 54.26  ? 212 LYS A N   1 
ATOM   773  C  CA  . LYS A 1 121 ? -39.485 0.172  11.920  1.00 55.99  ? 212 LYS A CA  1 
ATOM   774  C  C   . LYS A 1 121 ? -40.948 0.569  11.966  1.00 58.32  ? 212 LYS A C   1 
ATOM   775  O  O   . LYS A 1 121 ? -41.792 -0.018 11.282  1.00 62.04  ? 212 LYS A O   1 
ATOM   776  C  CB  . LYS A 1 121 ? -39.111 -0.482 13.246  1.00 61.33  ? 212 LYS A CB  1 
ATOM   777  C  CG  . LYS A 1 121 ? -37.872 -1.331 13.204  1.00 56.50  ? 212 LYS A CG  1 
ATOM   778  C  CD  . LYS A 1 121 ? -37.942 -2.399 14.269  1.00 64.37  ? 212 LYS A CD  1 
ATOM   779  C  CE  . LYS A 1 121 ? -38.379 -1.821 15.616  1.00 61.82  ? 212 LYS A CE  1 
ATOM   780  N  NZ  . LYS A 1 121 ? -38.323 -2.853 16.696  1.00 55.96  ? 212 LYS A NZ  1 
ATOM   781  N  N   . TYR A 1 122 ? -41.237 1.566  12.797  1.00 53.12  ? 213 TYR A N   1 
ATOM   782  C  CA  . TYR A 1 122 ? -42.586 2.068  12.955  1.00 50.70  ? 213 TYR A CA  1 
ATOM   783  C  C   . TYR A 1 122 ? -43.157 2.427  11.610  1.00 54.47  ? 213 TYR A C   1 
ATOM   784  O  O   . TYR A 1 122 ? -44.314 2.140  11.310  1.00 56.84  ? 213 TYR A O   1 
ATOM   785  C  CB  . TYR A 1 122 ? -42.580 3.316  13.817  1.00 50.13  ? 213 TYR A CB  1 
ATOM   786  C  CG  . TYR A 1 122 ? -43.722 4.236  13.490  1.00 54.24  ? 213 TYR A CG  1 
ATOM   787  C  CD1 . TYR A 1 122 ? -44.930 4.138  14.165  1.00 51.39  ? 213 TYR A CD1 1 
ATOM   788  C  CD2 . TYR A 1 122 ? -43.600 5.199  12.490  1.00 53.88  ? 213 TYR A CD2 1 
ATOM   789  C  CE1 . TYR A 1 122 ? -45.980 4.979  13.866  1.00 53.58  ? 213 TYR A CE1 1 
ATOM   790  C  CE2 . TYR A 1 122 ? -44.642 6.045  12.187  1.00 51.04  ? 213 TYR A CE2 1 
ATOM   791  C  CZ  . TYR A 1 122 ? -45.828 5.929  12.876  1.00 51.57  ? 213 TYR A CZ  1 
ATOM   792  O  OH  . TYR A 1 122 ? -46.868 6.762  12.572  1.00 49.47  ? 213 TYR A OH  1 
ATOM   793  N  N   . PHE A 1 123 ? -42.326 3.073  10.805  1.00 54.81  ? 214 PHE A N   1 
ATOM   794  C  CA  . PHE A 1 123 ? -42.751 3.582  9.519   1.00 55.27  ? 214 PHE A CA  1 
ATOM   795  C  C   . PHE A 1 123 ? -42.998 2.433  8.582   1.00 57.82  ? 214 PHE A C   1 
ATOM   796  O  O   . PHE A 1 123 ? -44.025 2.389  7.905   1.00 58.31  ? 214 PHE A O   1 
ATOM   797  C  CB  . PHE A 1 123 ? -41.671 4.485  8.931   1.00 52.53  ? 214 PHE A CB  1 
ATOM   798  C  CG  . PHE A 1 123 ? -42.124 5.306  7.751   1.00 51.50  ? 214 PHE A CG  1 
ATOM   799  C  CD1 . PHE A 1 123 ? -42.461 6.647  7.910   1.00 50.19  ? 214 PHE A CD1 1 
ATOM   800  C  CD2 . PHE A 1 123 ? -42.186 4.749  6.479   1.00 51.95  ? 214 PHE A CD2 1 
ATOM   801  C  CE1 . PHE A 1 123 ? -42.866 7.413  6.823   1.00 45.48  ? 214 PHE A CE1 1 
ATOM   802  C  CE2 . PHE A 1 123 ? -42.592 5.511  5.388   1.00 47.06  ? 214 PHE A CE2 1 
ATOM   803  C  CZ  . PHE A 1 123 ? -42.928 6.844  5.563   1.00 43.74  ? 214 PHE A CZ  1 
ATOM   804  N  N   . MET A 1 124 ? -42.045 1.504  8.549   1.00 61.68  ? 215 MET A N   1 
ATOM   805  C  CA  . MET A 1 124 ? -42.020 0.459  7.523   1.00 63.69  ? 215 MET A CA  1 
ATOM   806  C  C   . MET A 1 124 ? -43.181 -0.511 7.674   1.00 60.99  ? 215 MET A C   1 
ATOM   807  O  O   . MET A 1 124 ? -43.609 -1.146 6.714   1.00 62.30  ? 215 MET A O   1 
ATOM   808  C  CB  . MET A 1 124 ? -40.690 -0.310 7.543   1.00 65.80  ? 215 MET A CB  1 
ATOM   809  C  CG  . MET A 1 124 ? -39.637 0.175  6.548   1.00 55.52  ? 215 MET A CG  1 
ATOM   810  S  SD  . MET A 1 124 ? -40.321 0.621  4.934   1.00 86.19  ? 215 MET A SD  1 
ATOM   811  C  CE  . MET A 1 124 ? -41.318 -0.817 4.536   1.00 81.95  ? 215 MET A CE  1 
ATOM   812  N  N   . ASN A 1 125 ? -43.676 -0.624 8.896   1.00 62.20  ? 216 ASN A N   1 
ATOM   813  C  CA  . ASN A 1 125 ? -44.806 -1.482 9.187   1.00 62.87  ? 216 ASN A CA  1 
ATOM   814  C  C   . ASN A 1 125 ? -46.115 -0.760 8.881   1.00 66.14  ? 216 ASN A C   1 
ATOM   815  O  O   . ASN A 1 125 ? -46.299 0.389  9.290   1.00 71.42  ? 216 ASN A O   1 
ATOM   816  C  CB  . ASN A 1 125 ? -44.759 -1.872 10.668  1.00 61.93  ? 216 ASN A CB  1 
ATOM   817  C  CG  . ASN A 1 125 ? -45.853 -2.832 11.050  1.00 63.66  ? 216 ASN A CG  1 
ATOM   818  O  OD1 . ASN A 1 125 ? -46.495 -3.429 10.185  1.00 69.05  ? 216 ASN A OD1 1 
ATOM   819  N  ND2 . ASN A 1 125 ? -46.079 -2.988 12.347  1.00 57.09  ? 216 ASN A ND2 1 
ATOM   820  N  N   . PRO A 1 126 ? -47.027 -1.410 8.143   1.00 66.49  ? 217 PRO A N   1 
ATOM   821  C  CA  . PRO A 1 126 ? -48.397 -0.888 8.191   1.00 69.58  ? 217 PRO A CA  1 
ATOM   822  C  C   . PRO A 1 126 ? -48.867 -1.167 9.608   1.00 73.67  ? 217 PRO A C   1 
ATOM   823  O  O   . PRO A 1 126 ? -48.020 -1.491 10.443  1.00 75.41  ? 217 PRO A O   1 
ATOM   824  C  CB  . PRO A 1 126 ? -49.149 -1.761 7.187   1.00 70.50  ? 217 PRO A CB  1 
ATOM   825  C  CG  . PRO A 1 126 ? -48.077 -2.324 6.294   1.00 72.73  ? 217 PRO A CG  1 
ATOM   826  C  CD  . PRO A 1 126 ? -46.889 -2.522 7.192   1.00 75.06  ? 217 PRO A CD  1 
ATOM   827  N  N   . ASN A 1 127 ? -50.151 -1.064 9.915   1.00 69.24  ? 218 ASN A N   1 
ATOM   828  C  CA  . ASN A 1 127 ? -50.528 -1.241 11.315  1.00 74.69  ? 218 ASN A CA  1 
ATOM   829  C  C   . ASN A 1 127 ? -49.802 -0.232 12.210  1.00 68.89  ? 218 ASN A C   1 
ATOM   830  O  O   . ASN A 1 127 ? -49.236 -0.611 13.241  1.00 66.80  ? 218 ASN A O   1 
ATOM   831  C  CB  . ASN A 1 127 ? -50.158 -2.651 11.802  1.00 75.17  ? 218 ASN A CB  1 
ATOM   832  C  CG  . ASN A 1 127 ? -51.338 -3.603 11.825  1.00 81.27  ? 218 ASN A CG  1 
ATOM   833  O  OD1 . ASN A 1 127 ? -52.242 -3.520 10.987  1.00 84.85  ? 218 ASN A OD1 1 
ATOM   834  N  ND2 . ASN A 1 127 ? -51.332 -4.522 12.788  1.00 70.50  ? 218 ASN A ND2 1 
ATOM   835  N  N   . ARG A 1 128 ? -49.789 1.037  11.814  1.00 56.89  ? 219 ARG A N   1 
ATOM   836  C  CA  . ARG A 1 128 ? -49.252 2.069  12.686  1.00 60.35  ? 219 ARG A CA  1 
ATOM   837  C  C   . ARG A 1 128 ? -50.232 2.374  13.802  1.00 58.13  ? 219 ARG A C   1 
ATOM   838  O  O   . ARG A 1 128 ? -51.313 2.917  13.567  1.00 54.42  ? 219 ARG A O   1 
ATOM   839  C  CB  . ARG A 1 128 ? -48.947 3.339  11.916  1.00 55.98  ? 219 ARG A CB  1 
ATOM   840  C  CG  . ARG A 1 128 ? -47.868 3.174  10.905  1.00 56.99  ? 219 ARG A CG  1 
ATOM   841  C  CD  . ARG A 1 128 ? -48.272 3.865  9.645   1.00 49.31  ? 219 ARG A CD  1 
ATOM   842  N  NE  . ARG A 1 128 ? -47.196 3.861  8.676   1.00 55.45  ? 219 ARG A NE  1 
ATOM   843  C  CZ  . ARG A 1 128 ? -47.345 4.278  7.428   1.00 60.46  ? 219 ARG A CZ  1 
ATOM   844  N  NH1 . ARG A 1 128 ? -48.531 4.712  7.035   1.00 59.66  ? 219 ARG A NH1 1 
ATOM   845  N  NH2 . ARG A 1 128 ? -46.326 4.255  6.576   1.00 52.80  ? 219 ARG A NH2 1 
ATOM   846  N  N   . PRO A 1 129 ? -49.845 2.035  15.032  1.00 58.41  ? 220 PRO A N   1 
ATOM   847  C  CA  . PRO A 1 129 ? -50.723 2.236  16.187  1.00 60.44  ? 220 PRO A CA  1 
ATOM   848  C  C   . PRO A 1 129 ? -50.940 3.725  16.438  1.00 59.25  ? 220 PRO A C   1 
ATOM   849  O  O   . PRO A 1 129 ? -51.889 4.095  17.133  1.00 63.93  ? 220 PRO A O   1 
ATOM   850  C  CB  . PRO A 1 129 ? -49.931 1.612  17.350  1.00 62.37  ? 220 PRO A CB  1 
ATOM   851  C  CG  . PRO A 1 129 ? -48.772 0.854  16.703  1.00 65.80  ? 220 PRO A CG  1 
ATOM   852  C  CD  . PRO A 1 129 ? -48.507 1.557  15.415  1.00 57.84  ? 220 PRO A CD  1 
ATOM   853  N  N   . LYS A 1 130 ? -50.063 4.563  15.887  1.00 52.34  ? 221 LYS A N   1 
ATOM   854  C  CA  . LYS A 1 130 ? -50.174 6.008  16.052  1.00 51.11  ? 221 LYS A CA  1 
ATOM   855  C  C   . LYS A 1 130 ? -49.466 6.776  14.931  1.00 50.61  ? 221 LYS A C   1 
ATOM   856  O  O   . LYS A 1 130 ? -48.682 6.209  14.177  1.00 50.99  ? 221 LYS A O   1 
ATOM   857  C  CB  . LYS A 1 130 ? -49.638 6.430  17.425  1.00 53.40  ? 221 LYS A CB  1 
ATOM   858  C  CG  . LYS A 1 130 ? -48.164 6.141  17.631  1.00 53.69  ? 221 LYS A CG  1 
ATOM   859  C  CD  . LYS A 1 130 ? -47.817 6.057  19.110  1.00 58.57  ? 221 LYS A CD  1 
ATOM   860  C  CE  . LYS A 1 130 ? -48.482 7.170  19.906  1.00 62.30  ? 221 LYS A CE  1 
ATOM   861  N  NZ  . LYS A 1 130 ? -47.970 7.198  21.313  1.00 65.31  ? 221 LYS A NZ  1 
ATOM   862  N  N   . VAL A 1 131 ? -49.753 8.073  14.835  1.00 50.61  ? 222 VAL A N   1 
ATOM   863  C  CA  . VAL A 1 131 ? -49.246 8.922  13.759  1.00 42.38  ? 222 VAL A CA  1 
ATOM   864  C  C   . VAL A 1 131 ? -48.010 9.695  14.210  1.00 42.86  ? 222 VAL A C   1 
ATOM   865  O  O   . VAL A 1 131 ? -48.085 10.549 15.103  1.00 36.34  ? 222 VAL A O   1 
ATOM   866  C  CB  . VAL A 1 131 ? -50.340 9.908  13.284  1.00 41.70  ? 222 VAL A CB  1 
ATOM   867  C  CG1 . VAL A 1 131 ? -49.764 10.957 12.316  1.00 40.40  ? 222 VAL A CG1 1 
ATOM   868  C  CG2 . VAL A 1 131 ? -51.488 9.147  12.664  1.00 29.83  ? 222 VAL A CG2 1 
ATOM   869  N  N   . LEU A 1 132 ? -46.874 9.400  13.586  1.00 42.85  ? 223 LEU A N   1 
ATOM   870  C  CA  . LEU A 1 132 ? -45.603 9.959  14.036  1.00 43.72  ? 223 LEU A CA  1 
ATOM   871  C  C   . LEU A 1 132 ? -44.832 10.652 12.915  1.00 40.69  ? 223 LEU A C   1 
ATOM   872  O  O   . LEU A 1 132 ? -44.598 10.068 11.873  1.00 42.52  ? 223 LEU A O   1 
ATOM   873  C  CB  . LEU A 1 132 ? -44.742 8.864  14.654  1.00 46.68  ? 223 LEU A CB  1 
ATOM   874  C  CG  . LEU A 1 132 ? -45.267 8.138  15.888  1.00 43.61  ? 223 LEU A CG  1 
ATOM   875  C  CD1 . LEU A 1 132 ? -44.353 6.985  16.222  1.00 45.29  ? 223 LEU A CD1 1 
ATOM   876  C  CD2 . LEU A 1 132 ? -45.366 9.080  17.062  1.00 45.13  ? 223 LEU A CD2 1 
ATOM   877  N  N   . ASN A 1 133 ? -44.408 11.885 13.170  1.00 39.79  ? 224 ASN A N   1 
ATOM   878  C  CA  . ASN A 1 133 ? -43.741 12.726 12.188  1.00 37.46  ? 224 ASN A CA  1 
ATOM   879  C  C   . ASN A 1 133 ? -42.275 13.017 12.505  1.00 38.06  ? 224 ASN A C   1 
ATOM   880  O  O   . ASN A 1 133 ? -41.907 13.152 13.667  1.00 39.65  ? 224 ASN A O   1 
ATOM   881  C  CB  . ASN A 1 133 ? -44.487 14.051 12.115  1.00 39.89  ? 224 ASN A CB  1 
ATOM   882  C  CG  . ASN A 1 133 ? -44.407 14.695 10.748  1.00 39.96  ? 224 ASN A CG  1 
ATOM   883  O  OD1 . ASN A 1 133 ? -43.872 14.121 9.795   1.00 34.83  ? 224 ASN A OD1 1 
ATOM   884  N  ND2 . ASN A 1 133 ? -44.963 15.892 10.642  1.00 41.73  ? 224 ASN A ND2 1 
ATOM   885  N  N   . VAL A 1 134 ? -41.444 13.116 11.468  1.00 39.36  ? 225 VAL A N   1 
ATOM   886  C  CA  . VAL A 1 134 ? -40.050 13.560 11.603  1.00 34.23  ? 225 VAL A CA  1 
ATOM   887  C  C   . VAL A 1 134 ? -39.812 14.778 10.704  1.00 37.57  ? 225 VAL A C   1 
ATOM   888  O  O   . VAL A 1 134 ? -39.777 14.661 9.477   1.00 41.11  ? 225 VAL A O   1 
ATOM   889  C  CB  . VAL A 1 134 ? -39.032 12.443 11.227  1.00 38.80  ? 225 VAL A CB  1 
ATOM   890  C  CG1 . VAL A 1 134 ? -37.610 12.977 11.266  1.00 38.96  ? 225 VAL A CG1 1 
ATOM   891  C  CG2 . VAL A 1 134 ? -39.163 11.233 12.141  1.00 35.90  ? 225 VAL A CG2 1 
ATOM   892  N  N   . ILE A 1 135 ? -39.659 15.954 11.304  1.00 39.59  ? 226 ILE A N   1 
ATOM   893  C  CA  . ILE A 1 135 ? -39.513 17.178 10.525  1.00 39.26  ? 226 ILE A CA  1 
ATOM   894  C  C   . ILE A 1 135 ? -38.233 17.950 10.822  1.00 43.80  ? 226 ILE A C   1 
ATOM   895  O  O   . ILE A 1 135 ? -37.980 18.984 10.202  1.00 47.15  ? 226 ILE A O   1 
ATOM   896  C  CB  . ILE A 1 135 ? -40.674 18.129 10.777  1.00 37.79  ? 226 ILE A CB  1 
ATOM   897  C  CG1 . ILE A 1 135 ? -40.471 18.837 12.111  1.00 43.04  ? 226 ILE A CG1 1 
ATOM   898  C  CG2 . ILE A 1 135 ? -41.992 17.387 10.747  1.00 36.66  ? 226 ILE A CG2 1 
ATOM   899  C  CD1 . ILE A 1 135 ? -41.730 19.504 12.655  1.00 42.56  ? 226 ILE A CD1 1 
ATOM   900  N  N   . SER A 1 136 ? -37.424 17.456 11.755  1.00 43.47  ? 227 SER A N   1 
ATOM   901  C  CA  . SER A 1 136 ? -36.273 18.216 12.234  1.00 42.86  ? 227 SER A CA  1 
ATOM   902  C  C   . SER A 1 136 ? -34.941 17.504 12.087  1.00 44.22  ? 227 SER A C   1 
ATOM   903  O  O   . SER A 1 136 ? -33.954 17.922 12.687  1.00 48.92  ? 227 SER A O   1 
ATOM   904  C  CB  . SER A 1 136 ? -36.462 18.610 13.702  1.00 49.70  ? 227 SER A CB  1 
ATOM   905  O  OG  . SER A 1 136 ? -37.439 19.634 13.844  1.00 62.20  ? 227 SER A OG  1 
ATOM   906  N  N   . LEU A 1 137 ? -34.900 16.440 11.297  1.00 40.14  ? 228 LEU A N   1 
ATOM   907  C  CA  . LEU A 1 137 ? -33.691 15.629 11.204  1.00 37.82  ? 228 LEU A CA  1 
ATOM   908  C  C   . LEU A 1 137 ? -32.621 16.240 10.286  1.00 40.05  ? 228 LEU A C   1 
ATOM   909  O  O   . LEU A 1 137 ? -32.541 15.931 9.095   1.00 36.53  ? 228 LEU A O   1 
ATOM   910  C  CB  . LEU A 1 137 ? -34.034 14.187 10.800  1.00 37.22  ? 228 LEU A CB  1 
ATOM   911  C  CG  . LEU A 1 137 ? -32.950 13.337 10.131  1.00 41.80  ? 228 LEU A CG  1 
ATOM   912  C  CD1 . LEU A 1 137 ? -31.669 13.300 10.934  1.00 38.98  ? 228 LEU A CD1 1 
ATOM   913  C  CD2 . LEU A 1 137 ? -33.455 11.934 9.893   1.00 46.15  ? 228 LEU A CD2 1 
ATOM   914  N  N   . GLU A 1 138 ? -31.799 17.105 10.870  1.00 39.45  ? 229 GLU A N   1 
ATOM   915  C  CA  . GLU A 1 138 ? -30.689 17.737 10.176  1.00 39.72  ? 229 GLU A CA  1 
ATOM   916  C  C   . GLU A 1 138 ? -29.526 16.759 9.998   1.00 43.30  ? 229 GLU A C   1 
ATOM   917  O  O   . GLU A 1 138 ? -29.062 16.168 10.975  1.00 44.19  ? 229 GLU A O   1 
ATOM   918  C  CB  . GLU A 1 138 ? -30.231 18.965 10.952  1.00 37.06  ? 229 GLU A CB  1 
ATOM   919  C  CG  . GLU A 1 138 ? -29.853 20.142 10.068  1.00 44.53  ? 229 GLU A CG  1 
ATOM   920  C  CD  . GLU A 1 138 ? -28.509 19.951 9.382   1.00 47.56  ? 229 GLU A CD  1 
ATOM   921  O  OE1 . GLU A 1 138 ? -28.197 20.751 8.470   1.00 43.58  ? 229 GLU A OE1 1 
ATOM   922  O  OE2 . GLU A 1 138 ? -27.768 19.009 9.765   1.00 47.74  ? 229 GLU A OE2 1 
ATOM   923  N  N   . PHE A 1 139 ? -29.048 16.607 8.758   1.00 40.02  ? 230 PHE A N   1 
ATOM   924  C  CA  . PHE A 1 139 ? -28.090 15.553 8.425   1.00 39.58  ? 230 PHE A CA  1 
ATOM   925  C  C   . PHE A 1 139 ? -26.805 16.023 7.740   1.00 41.28  ? 230 PHE A C   1 
ATOM   926  O  O   . PHE A 1 139 ? -26.183 15.265 7.013   1.00 39.02  ? 230 PHE A O   1 
ATOM   927  C  CB  . PHE A 1 139 ? -28.759 14.475 7.575   1.00 36.09  ? 230 PHE A CB  1 
ATOM   928  C  CG  . PHE A 1 139 ? -29.242 14.972 6.234   1.00 44.37  ? 230 PHE A CG  1 
ATOM   929  C  CD1 . PHE A 1 139 ? -28.424 14.890 5.107   1.00 41.95  ? 230 PHE A CD1 1 
ATOM   930  C  CD2 . PHE A 1 139 ? -30.515 15.520 6.095   1.00 40.52  ? 230 PHE A CD2 1 
ATOM   931  C  CE1 . PHE A 1 139 ? -28.855 15.340 3.881   1.00 37.94  ? 230 PHE A CE1 1 
ATOM   932  C  CE2 . PHE A 1 139 ? -30.957 15.975 4.860   1.00 42.15  ? 230 PHE A CE2 1 
ATOM   933  C  CZ  . PHE A 1 139 ? -30.122 15.884 3.753   1.00 41.35  ? 230 PHE A CZ  1 
ATOM   934  N  N   . SER A 1 140 ? -26.395 17.261 7.990   1.00 45.90  ? 231 SER A N   1 
ATOM   935  C  CA  . SER A 1 140 ? -25.160 17.792 7.412   1.00 43.06  ? 231 SER A CA  1 
ATOM   936  C  C   . SER A 1 140 ? -23.945 16.934 7.735   1.00 48.44  ? 231 SER A C   1 
ATOM   937  O  O   . SER A 1 140 ? -23.133 16.625 6.862   1.00 53.75  ? 231 SER A O   1 
ATOM   938  C  CB  . SER A 1 140 ? -24.920 19.210 7.902   1.00 42.54  ? 231 SER A CB  1 
ATOM   939  O  OG  . SER A 1 140 ? -25.872 20.088 7.340   1.00 50.19  ? 231 SER A OG  1 
ATOM   940  N  N   . ASP A 1 141 ? -23.827 16.560 9.003   1.00 49.48  ? 232 ASP A N   1 
ATOM   941  C  CA  . ASP A 1 141 ? -22.716 15.762 9.489   1.00 48.83  ? 232 ASP A CA  1 
ATOM   942  C  C   . ASP A 1 141 ? -23.057 14.275 9.465   1.00 48.49  ? 232 ASP A C   1 
ATOM   943  O  O   . ASP A 1 141 ? -23.187 13.648 10.511  1.00 49.75  ? 232 ASP A O   1 
ATOM   944  C  CB  . ASP A 1 141 ? -22.373 16.188 10.912  1.00 48.49  ? 232 ASP A CB  1 
ATOM   945  C  CG  . ASP A 1 141 ? -23.589 16.162 11.835  1.00 63.94  ? 232 ASP A CG  1 
ATOM   946  O  OD1 . ASP A 1 141 ? -23.416 15.888 13.050  1.00 67.01  ? 232 ASP A OD1 1 
ATOM   947  O  OD2 . ASP A 1 141 ? -24.722 16.402 11.342  1.00 57.36  ? 232 ASP A OD2 1 
ATOM   948  N  N   . THR A 1 142 ? -23.201 13.715 8.268   1.00 44.13  ? 233 THR A N   1 
ATOM   949  C  CA  . THR A 1 142 ? -23.522 12.303 8.100   1.00 46.81  ? 233 THR A CA  1 
ATOM   950  C  C   . THR A 1 142 ? -23.132 11.859 6.698   1.00 57.73  ? 233 THR A C   1 
ATOM   951  O  O   . THR A 1 142 ? -22.962 12.690 5.798   1.00 58.87  ? 233 THR A O   1 
ATOM   952  C  CB  . THR A 1 142 ? -25.033 12.050 8.213   1.00 50.85  ? 233 THR A CB  1 
ATOM   953  O  OG1 . THR A 1 142 ? -25.692 12.703 7.122   1.00 53.10  ? 233 THR A OG1 1 
ATOM   954  C  CG2 . THR A 1 142 ? -25.602 12.565 9.526   1.00 43.80  ? 233 THR A CG2 1 
ATOM   955  N  N   . LYS A 1 143 ? -23.017 10.551 6.497   1.00 60.86  ? 234 LYS A N   1 
ATOM   956  C  CA  . LYS A 1 143 ? -22.782 10.040 5.152   1.00 60.36  ? 234 LYS A CA  1 
ATOM   957  C  C   . LYS A 1 143 ? -23.784 10.653 4.171   1.00 58.46  ? 234 LYS A C   1 
ATOM   958  O  O   . LYS A 1 143 ? -23.448 10.880 3.006   1.00 59.53  ? 234 LYS A O   1 
ATOM   959  C  CB  . LYS A 1 143 ? -22.882 8.506  5.101   1.00 62.50  ? 234 LYS A CB  1 
ATOM   960  C  CG  . LYS A 1 143 ? -21.567 7.724  5.255   1.00 66.45  ? 234 LYS A CG  1 
ATOM   961  C  CD  . LYS A 1 143 ? -21.811 6.187  5.226   1.00 74.92  ? 234 LYS A CD  1 
ATOM   962  C  CE  . LYS A 1 143 ? -22.314 5.699  3.842   1.00 80.61  ? 234 LYS A CE  1 
ATOM   963  N  NZ  . LYS A 1 143 ? -22.932 4.323  3.822   1.00 71.52  ? 234 LYS A NZ  1 
ATOM   964  N  N   . MET A 1 144 ? -25.006 10.926 4.635   1.00 51.72  ? 235 MET A N   1 
ATOM   965  C  CA  . MET A 1 144 ? -26.077 11.342 3.717   1.00 51.68  ? 235 MET A CA  1 
ATOM   966  C  C   . MET A 1 144 ? -25.890 12.730 3.093   1.00 53.38  ? 235 MET A C   1 
ATOM   967  O  O   . MET A 1 144 ? -26.381 12.994 2.002   1.00 53.29  ? 235 MET A O   1 
ATOM   968  C  CB  . MET A 1 144 ? -27.451 11.254 4.377   1.00 47.80  ? 235 MET A CB  1 
ATOM   969  C  CG  . MET A 1 144 ? -28.595 11.380 3.386   1.00 49.53  ? 235 MET A CG  1 
ATOM   970  S  SD  . MET A 1 144 ? -30.124 10.542 3.880   1.00 54.50  ? 235 MET A SD  1 
ATOM   971  C  CE  . MET A 1 144 ? -30.879 11.800 4.889   1.00 47.57  ? 235 MET A CE  1 
ATOM   972  N  N   . SER A 1 145 ? -25.173 13.607 3.782   1.00 52.36  ? 236 SER A N   1 
ATOM   973  C  CA  . SER A 1 145 ? -24.961 14.968 3.307   1.00 48.41  ? 236 SER A CA  1 
ATOM   974  C  C   . SER A 1 145 ? -24.380 15.036 1.903   1.00 53.23  ? 236 SER A C   1 
ATOM   975  O  O   . SER A 1 145 ? -24.711 15.946 1.140   1.00 51.63  ? 236 SER A O   1 
ATOM   976  C  CB  . SER A 1 145 ? -24.031 15.723 4.253   1.00 49.37  ? 236 SER A CB  1 
ATOM   977  O  OG  . SER A 1 145 ? -23.747 17.008 3.734   1.00 48.13  ? 236 SER A OG  1 
ATOM   978  N  N   . GLU A 1 146 ? -23.493 14.098 1.574   1.00 50.82  ? 237 GLU A N   1 
ATOM   979  C  CA  . GLU A 1 146 ? -22.831 14.113 0.275   1.00 55.84  ? 237 GLU A CA  1 
ATOM   980  C  C   . GLU A 1 146 ? -23.867 14.030 -0.840  1.00 51.99  ? 237 GLU A C   1 
ATOM   981  O  O   . GLU A 1 146 ? -23.640 14.504 -1.950  1.00 52.64  ? 237 GLU A O   1 
ATOM   982  C  CB  . GLU A 1 146 ? -21.811 12.968 0.147   1.00 59.88  ? 237 GLU A CB  1 
ATOM   983  C  CG  . GLU A 1 146 ? -20.594 13.057 1.089   1.00 72.21  ? 237 GLU A CG  1 
ATOM   984  C  CD  . GLU A 1 146 ? -19.813 11.736 1.184   1.00 81.37  ? 237 GLU A CD  1 
ATOM   985  O  OE1 . GLU A 1 146 ? -19.997 10.874 0.291   1.00 79.93  ? 237 GLU A OE1 1 
ATOM   986  O  OE2 . GLU A 1 146 ? -19.029 11.557 2.152   1.00 72.87  ? 237 GLU A OE2 1 
ATOM   987  N  N   . LEU A 1 147 ? -25.012 13.438 -0.523  1.00 50.65  ? 238 LEU A N   1 
ATOM   988  C  CA  . LEU A 1 147 ? -26.029 13.144 -1.519  1.00 51.62  ? 238 LEU A CA  1 
ATOM   989  C  C   . LEU A 1 147 ? -26.957 14.316 -1.808  1.00 52.61  ? 238 LEU A C   1 
ATOM   990  O  O   . LEU A 1 147 ? -27.865 14.200 -2.639  1.00 50.07  ? 238 LEU A O   1 
ATOM   991  C  CB  . LEU A 1 147 ? -26.874 11.956 -1.071  1.00 51.98  ? 238 LEU A CB  1 
ATOM   992  C  CG  . LEU A 1 147 ? -26.169 10.654 -0.723  1.00 48.02  ? 238 LEU A CG  1 
ATOM   993  C  CD1 . LEU A 1 147 ? -27.228 9.618  -0.388  1.00 47.56  ? 238 LEU A CD1 1 
ATOM   994  C  CD2 . LEU A 1 147 ? -25.299 10.196 -1.879  1.00 41.28  ? 238 LEU A CD2 1 
ATOM   995  N  N   . VAL A 1 148 ? -26.741 15.435 -1.123  1.00 52.84  ? 239 VAL A N   1 
ATOM   996  C  CA  . VAL A 1 148 ? -27.656 16.572 -1.231  1.00 52.82  ? 239 VAL A CA  1 
ATOM   997  C  C   . VAL A 1 148 ? -26.973 17.935 -1.381  1.00 49.51  ? 239 VAL A C   1 
ATOM   998  O  O   . VAL A 1 148 ? -26.153 18.321 -0.552  1.00 54.51  ? 239 VAL A O   1 
ATOM   999  C  CB  . VAL A 1 148 ? -28.601 16.636 -0.007  1.00 48.28  ? 239 VAL A CB  1 
ATOM   1000 C  CG1 . VAL A 1 148 ? -29.378 17.959 0.007   1.00 44.56  ? 239 VAL A CG1 1 
ATOM   1001 C  CG2 . VAL A 1 148 ? -29.540 15.429 0.015   1.00 42.71  ? 239 VAL A CG2 1 
ATOM   1002 N  N   . GLU A 1 149 ? -27.323 18.669 -2.430  1.00 43.58  ? 240 GLU A N   1 
ATOM   1003 C  CA  . GLU A 1 149 ? -26.936 20.076 -2.523  1.00 45.88  ? 240 GLU A CA  1 
ATOM   1004 C  C   . GLU A 1 149 ? -28.191 20.960 -2.557  1.00 44.37  ? 240 GLU A C   1 
ATOM   1005 O  O   . GLU A 1 149 ? -29.078 20.739 -3.374  1.00 44.92  ? 240 GLU A O   1 
ATOM   1006 C  CB  . GLU A 1 149 ? -26.028 20.334 -3.733  1.00 35.59  ? 240 GLU A CB  1 
ATOM   1007 N  N   . VAL A 1 150 ? -28.258 21.942 -1.656  1.00 41.71  ? 241 VAL A N   1 
ATOM   1008 C  CA  . VAL A 1 150 ? -29.413 22.837 -1.539  1.00 41.43  ? 241 VAL A CA  1 
ATOM   1009 C  C   . VAL A 1 150 ? -29.512 23.833 -2.694  1.00 41.22  ? 241 VAL A C   1 
ATOM   1010 O  O   . VAL A 1 150 ? -28.507 24.172 -3.302  1.00 42.46  ? 241 VAL A O   1 
ATOM   1011 C  CB  . VAL A 1 150 ? -29.379 23.648 -0.214  1.00 44.29  ? 241 VAL A CB  1 
ATOM   1012 C  CG1 . VAL A 1 150 ? -29.129 22.725 0.987   1.00 43.47  ? 241 VAL A CG1 1 
ATOM   1013 C  CG2 . VAL A 1 150 ? -28.330 24.752 -0.283  1.00 36.27  ? 241 VAL A CG2 1 
ATOM   1014 N  N   . PRO A 1 151 ? -30.733 24.327 -2.978  1.00 41.43  ? 242 PRO A N   1 
ATOM   1015 C  CA  . PRO A 1 151 ? -30.938 25.312 -4.045  1.00 38.47  ? 242 PRO A CA  1 
ATOM   1016 C  C   . PRO A 1 151 ? -29.910 26.435 -3.996  1.00 40.45  ? 242 PRO A C   1 
ATOM   1017 O  O   . PRO A 1 151 ? -29.738 27.057 -2.945  1.00 39.81  ? 242 PRO A O   1 
ATOM   1018 C  CB  . PRO A 1 151 ? -32.322 25.871 -3.729  1.00 33.84  ? 242 PRO A CB  1 
ATOM   1019 C  CG  . PRO A 1 151 ? -33.027 24.736 -3.084  1.00 37.05  ? 242 PRO A CG  1 
ATOM   1020 C  CD  . PRO A 1 151 ? -31.988 24.024 -2.267  1.00 38.82  ? 242 PRO A CD  1 
ATOM   1021 N  N   . ASP A 1 152 ? -29.248 26.690 -5.122  1.00 41.61  ? 243 ASP A N   1 
ATOM   1022 C  CA  . ASP A 1 152 ? -28.256 27.756 -5.219  1.00 41.91  ? 243 ASP A CA  1 
ATOM   1023 C  C   . ASP A 1 152 ? -28.761 29.067 -4.625  1.00 39.58  ? 243 ASP A C   1 
ATOM   1024 O  O   . ASP A 1 152 ? -28.021 29.794 -3.952  1.00 35.76  ? 243 ASP A O   1 
ATOM   1025 C  CB  . ASP A 1 152 ? -27.844 27.965 -6.676  1.00 42.03  ? 243 ASP A CB  1 
ATOM   1026 C  CG  . ASP A 1 152 ? -26.919 26.860 -7.194  1.00 55.72  ? 243 ASP A CG  1 
ATOM   1027 O  OD1 . ASP A 1 152 ? -26.032 26.409 -6.422  1.00 56.85  ? 243 ASP A OD1 1 
ATOM   1028 O  OD2 . ASP A 1 152 ? -27.084 26.452 -8.374  1.00 54.13  ? 243 ASP A OD2 1 
ATOM   1029 N  N   . ILE A 1 153 ? -30.029 29.358 -4.876  1.00 36.68  ? 244 ILE A N   1 
ATOM   1030 C  CA  . ILE A 1 153 ? -30.649 30.573 -4.371  1.00 36.10  ? 244 ILE A CA  1 
ATOM   1031 C  C   . ILE A 1 153 ? -30.612 30.665 -2.819  1.00 36.14  ? 244 ILE A C   1 
ATOM   1032 O  O   . ILE A 1 153 ? -30.276 31.716 -2.267  1.00 35.16  ? 244 ILE A O   1 
ATOM   1033 C  CB  . ILE A 1 153 ? -32.073 30.730 -4.961  1.00 34.78  ? 244 ILE A CB  1 
ATOM   1034 C  CG1 . ILE A 1 153 ? -32.693 32.071 -4.573  1.00 35.57  ? 244 ILE A CG1 1 
ATOM   1035 C  CG2 . ILE A 1 153 ? -32.948 29.562 -4.547  1.00 34.92  ? 244 ILE A CG2 1 
ATOM   1036 C  CD1 . ILE A 1 153 ? -31.817 33.248 -4.877  1.00 34.53  ? 244 ILE A CD1 1 
ATOM   1037 N  N   . ALA A 1 154 ? -30.919 29.572 -2.118  1.00 36.95  ? 245 ALA A N   1 
ATOM   1038 C  CA  . ALA A 1 154 ? -30.738 29.551 -0.653  1.00 36.71  ? 245 ALA A CA  1 
ATOM   1039 C  C   . ALA A 1 154 ? -29.290 29.823 -0.240  1.00 39.18  ? 245 ALA A C   1 
ATOM   1040 O  O   . ALA A 1 154 ? -29.049 30.528 0.735   1.00 42.27  ? 245 ALA A O   1 
ATOM   1041 C  CB  . ALA A 1 154 ? -31.217 28.249 -0.042  1.00 29.21  ? 245 ALA A CB  1 
ATOM   1042 N  N   . LYS A 1 155 ? -28.327 29.260 -0.965  1.00 36.50  ? 246 LYS A N   1 
ATOM   1043 C  CA  . LYS A 1 155 ? -26.927 29.524 -0.650  1.00 39.41  ? 246 LYS A CA  1 
ATOM   1044 C  C   . LYS A 1 155 ? -26.493 30.948 -0.977  1.00 40.52  ? 246 LYS A C   1 
ATOM   1045 O  O   . LYS A 1 155 ? -25.586 31.479 -0.339  1.00 44.74  ? 246 LYS A O   1 
ATOM   1046 C  CB  . LYS A 1 155 ? -25.990 28.513 -1.314  1.00 38.60  ? 246 LYS A CB  1 
ATOM   1047 C  CG  . LYS A 1 155 ? -26.009 27.168 -0.646  1.00 39.83  ? 246 LYS A CG  1 
ATOM   1048 C  CD  . LYS A 1 155 ? -24.945 26.244 -1.182  1.00 42.30  ? 246 LYS A CD  1 
ATOM   1049 C  CE  . LYS A 1 155 ? -25.301 25.713 -2.562  1.00 53.35  ? 246 LYS A CE  1 
ATOM   1050 N  NZ  . LYS A 1 155 ? -24.477 24.504 -2.887  1.00 56.62  ? 246 LYS A NZ  1 
ATOM   1051 N  N   . LYS A 1 156 ? -27.139 31.572 -1.955  1.00 39.15  ? 247 LYS A N   1 
ATOM   1052 C  CA  . LYS A 1 156 ? -26.733 32.911 -2.376  1.00 39.07  ? 247 LYS A CA  1 
ATOM   1053 C  C   . LYS A 1 156 ? -27.223 33.942 -1.376  1.00 40.80  ? 247 LYS A C   1 
ATOM   1054 O  O   . LYS A 1 156 ? -26.532 34.920 -1.079  1.00 41.74  ? 247 LYS A O   1 
ATOM   1055 C  CB  . LYS A 1 156 ? -27.274 33.246 -3.771  1.00 36.06  ? 247 LYS A CB  1 
ATOM   1056 C  CG  . LYS A 1 156 ? -26.335 34.103 -4.590  1.00 46.87  ? 247 LYS A CG  1 
ATOM   1057 C  CD  . LYS A 1 156 ? -25.455 33.225 -5.513  1.00 58.39  ? 247 LYS A CD  1 
ATOM   1058 C  CE  . LYS A 1 156 ? -24.087 33.864 -5.836  1.00 56.59  ? 247 LYS A CE  1 
ATOM   1059 N  NZ  . LYS A 1 156 ? -24.150 35.335 -6.122  1.00 58.17  ? 247 LYS A NZ  1 
ATOM   1060 N  N   . LEU A 1 157 ? -28.428 33.726 -0.865  1.00 37.19  ? 248 LEU A N   1 
ATOM   1061 C  CA  . LEU A 1 157 ? -29.025 34.661 0.075   1.00 35.24  ? 248 LEU A CA  1 
ATOM   1062 C  C   . LEU A 1 157 ? -28.580 34.474 1.528   1.00 35.14  ? 248 LEU A C   1 
ATOM   1063 O  O   . LEU A 1 157 ? -28.558 35.426 2.292   1.00 38.20  ? 248 LEU A O   1 
ATOM   1064 C  CB  . LEU A 1 157 ? -30.549 34.601 -0.029  1.00 39.92  ? 248 LEU A CB  1 
ATOM   1065 C  CG  . LEU A 1 157 ? -31.130 35.159 -1.338  1.00 38.87  ? 248 LEU A CG  1 
ATOM   1066 C  CD1 . LEU A 1 157 ? -32.607 34.809 -1.480  1.00 33.70  ? 248 LEU A CD1 1 
ATOM   1067 C  CD2 . LEU A 1 157 ? -30.920 36.670 -1.425  1.00 40.46  ? 248 LEU A CD2 1 
ATOM   1068 N  N   . SER A 1 158 ? -28.197 33.259 1.890   1.00 36.17  ? 249 SER A N   1 
ATOM   1069 C  CA  . SER A 1 158 ? -28.007 32.874 3.292   1.00 37.34  ? 249 SER A CA  1 
ATOM   1070 C  C   . SER A 1 158 ? -26.923 33.632 4.049   1.00 36.01  ? 249 SER A C   1 
ATOM   1071 O  O   . SER A 1 158 ? -25.775 33.673 3.627   1.00 40.52  ? 249 SER A O   1 
ATOM   1072 C  CB  . SER A 1 158 ? -27.744 31.367 3.382   1.00 37.19  ? 249 SER A CB  1 
ATOM   1073 O  OG  . SER A 1 158 ? -26.855 31.070 4.439   1.00 37.09  ? 249 SER A OG  1 
ATOM   1074 N  N   . TRP A 1 159 ? -27.295 34.207 5.185   1.00 34.80  ? 250 TRP A N   1 
ATOM   1075 C  CA  . TRP A 1 159 ? -26.340 34.841 6.090   1.00 33.94  ? 250 TRP A CA  1 
ATOM   1076 C  C   . TRP A 1 159 ? -25.173 33.931 6.536   1.00 34.72  ? 250 TRP A C   1 
ATOM   1077 O  O   . TRP A 1 159 ? -24.059 34.395 6.805   1.00 34.81  ? 250 TRP A O   1 
ATOM   1078 C  CB  . TRP A 1 159 ? -27.074 35.368 7.322   1.00 30.94  ? 250 TRP A CB  1 
ATOM   1079 C  CG  . TRP A 1 159 ? -27.829 36.619 7.075   1.00 35.73  ? 250 TRP A CG  1 
ATOM   1080 C  CD1 . TRP A 1 159 ? -27.987 37.248 5.882   1.00 35.35  ? 250 TRP A CD1 1 
ATOM   1081 C  CD2 . TRP A 1 159 ? -28.529 37.414 8.049   1.00 35.02  ? 250 TRP A CD2 1 
ATOM   1082 N  NE1 . TRP A 1 159 ? -28.741 38.383 6.051   1.00 37.33  ? 250 TRP A NE1 1 
ATOM   1083 C  CE2 . TRP A 1 159 ? -29.081 38.509 7.370   1.00 30.59  ? 250 TRP A CE2 1 
ATOM   1084 C  CE3 . TRP A 1 159 ? -28.741 37.299 9.431   1.00 37.21  ? 250 TRP A CE3 1 
ATOM   1085 C  CZ2 . TRP A 1 159 ? -29.836 39.486 8.016   1.00 33.86  ? 250 TRP A CZ2 1 
ATOM   1086 C  CZ3 . TRP A 1 159 ? -29.487 38.272 10.076  1.00 32.12  ? 250 TRP A CZ3 1 
ATOM   1087 C  CH2 . TRP A 1 159 ? -30.029 39.349 9.367   1.00 34.97  ? 250 TRP A CH2 1 
ATOM   1088 N  N   . VAL A 1 160 ? -25.421 32.639 6.651   1.00 33.60  ? 251 VAL A N   1 
ATOM   1089 C  CA  . VAL A 1 160 ? -24.356 31.746 7.093   1.00 38.38  ? 251 VAL A CA  1 
ATOM   1090 C  C   . VAL A 1 160 ? -23.320 31.603 5.985   1.00 38.38  ? 251 VAL A C   1 
ATOM   1091 O  O   . VAL A 1 160 ? -22.120 31.595 6.245   1.00 40.62  ? 251 VAL A O   1 
ATOM   1092 C  CB  . VAL A 1 160 ? -24.890 30.348 7.488   1.00 35.01  ? 251 VAL A CB  1 
ATOM   1093 C  CG1 . VAL A 1 160 ? -23.751 29.420 7.773   1.00 31.27  ? 251 VAL A CG1 1 
ATOM   1094 C  CG2 . VAL A 1 160 ? -25.790 30.452 8.676   1.00 33.96  ? 251 VAL A CG2 1 
ATOM   1095 N  N   . GLU A 1 161 ? -23.807 31.491 4.749   1.00 39.28  ? 252 GLU A N   1 
ATOM   1096 C  CA  . GLU A 1 161 ? -22.964 31.367 3.562   1.00 42.34  ? 252 GLU A CA  1 
ATOM   1097 C  C   . GLU A 1 161 ? -22.195 32.644 3.248   1.00 42.64  ? 252 GLU A C   1 
ATOM   1098 O  O   . GLU A 1 161 ? -21.108 32.606 2.685   1.00 45.60  ? 252 GLU A O   1 
ATOM   1099 C  CB  . GLU A 1 161 ? -23.837 31.011 2.367   1.00 43.90  ? 252 GLU A CB  1 
ATOM   1100 C  CG  . GLU A 1 161 ? -24.412 29.635 2.467   1.00 45.99  ? 252 GLU A CG  1 
ATOM   1101 C  CD  . GLU A 1 161 ? -23.326 28.601 2.343   1.00 52.60  ? 252 GLU A CD  1 
ATOM   1102 O  OE1 . GLU A 1 161 ? -22.358 28.864 1.593   1.00 50.94  ? 252 GLU A OE1 1 
ATOM   1103 O  OE2 . GLU A 1 161 ? -23.427 27.545 3.006   1.00 56.65  ? 252 GLU A OE2 1 
ATOM   1104 N  N   . ASN A 1 162 ? -22.767 33.778 3.612   1.00 37.56  ? 253 ASN A N   1 
ATOM   1105 C  CA  . ASN A 1 162 ? -22.202 35.048 3.223   1.00 38.73  ? 253 ASN A CA  1 
ATOM   1106 C  C   . ASN A 1 162 ? -21.426 35.808 4.283   1.00 40.52  ? 253 ASN A C   1 
ATOM   1107 O  O   . ASN A 1 162 ? -20.460 36.503 3.961   1.00 38.64  ? 253 ASN A O   1 
ATOM   1108 C  CB  . ASN A 1 162 ? -23.304 35.935 2.651   1.00 44.45  ? 253 ASN A CB  1 
ATOM   1109 C  CG  . ASN A 1 162 ? -23.812 35.431 1.310   1.00 42.69  ? 253 ASN A CG  1 
ATOM   1110 O  OD1 . ASN A 1 162 ? -23.182 34.585 0.677   1.00 44.85  ? 253 ASN A OD1 1 
ATOM   1111 N  ND2 . ASN A 1 162 ? -24.944 35.965 0.866   1.00 45.24  ? 253 ASN A ND2 1 
ATOM   1112 N  N   . TYR A 1 163 ? -21.833 35.693 5.545   1.00 40.78  ? 254 TYR A N   1 
ATOM   1113 C  CA  . TYR A 1 163 ? -21.280 36.594 6.549   1.00 37.96  ? 254 TYR A CA  1 
ATOM   1114 C  C   . TYR A 1 163 ? -20.729 35.941 7.804   1.00 37.32  ? 254 TYR A C   1 
ATOM   1115 O  O   . TYR A 1 163 ? -20.431 36.634 8.763   1.00 36.68  ? 254 TYR A O   1 
ATOM   1116 C  CB  . TYR A 1 163 ? -22.303 37.660 6.943   1.00 37.48  ? 254 TYR A CB  1 
ATOM   1117 C  CG  . TYR A 1 163 ? -22.987 38.316 5.778   1.00 38.35  ? 254 TYR A CG  1 
ATOM   1118 C  CD1 . TYR A 1 163 ? -22.254 38.933 4.776   1.00 43.05  ? 254 TYR A CD1 1 
ATOM   1119 C  CD2 . TYR A 1 163 ? -24.372 38.312 5.670   1.00 40.82  ? 254 TYR A CD2 1 
ATOM   1120 C  CE1 . TYR A 1 163 ? -22.884 39.532 3.692   1.00 41.89  ? 254 TYR A CE1 1 
ATOM   1121 C  CE2 . TYR A 1 163 ? -25.010 38.902 4.592   1.00 40.98  ? 254 TYR A CE2 1 
ATOM   1122 C  CZ  . TYR A 1 163 ? -24.257 39.515 3.609   1.00 41.27  ? 254 TYR A CZ  1 
ATOM   1123 O  OH  . TYR A 1 163 ? -24.883 40.109 2.540   1.00 46.40  ? 254 TYR A OH  1 
ATOM   1124 N  N   . TRP A 1 164 ? -20.595 34.622 7.811   1.00 39.35  ? 255 TRP A N   1 
ATOM   1125 C  CA  . TRP A 1 164 ? -20.107 33.951 9.014   1.00 40.00  ? 255 TRP A CA  1 
ATOM   1126 C  C   . TRP A 1 164 ? -18.590 33.746 8.962   1.00 43.24  ? 255 TRP A C   1 
ATOM   1127 O  O   . TRP A 1 164 ? -18.095 32.894 8.203   1.00 40.04  ? 255 TRP A O   1 
ATOM   1128 C  CB  . TRP A 1 164 ? -20.828 32.608 9.259   1.00 39.34  ? 255 TRP A CB  1 
ATOM   1129 C  CG  . TRP A 1 164 ? -20.719 32.131 10.705  1.00 47.67  ? 255 TRP A CG  1 
ATOM   1130 C  CD1 . TRP A 1 164 ? -19.635 31.544 11.298  1.00 47.78  ? 255 TRP A CD1 1 
ATOM   1131 C  CD2 . TRP A 1 164 ? -21.724 32.232 11.728  1.00 43.21  ? 255 TRP A CD2 1 
ATOM   1132 N  NE1 . TRP A 1 164 ? -19.907 31.271 12.616  1.00 46.34  ? 255 TRP A NE1 1 
ATOM   1133 C  CE2 . TRP A 1 164 ? -21.180 31.683 12.903  1.00 42.29  ? 255 TRP A CE2 1 
ATOM   1134 C  CE3 . TRP A 1 164 ? -23.031 32.724 11.758  1.00 38.52  ? 255 TRP A CE3 1 
ATOM   1135 C  CZ2 . TRP A 1 164 ? -21.895 31.612 14.089  1.00 45.16  ? 255 TRP A CZ2 1 
ATOM   1136 C  CZ3 . TRP A 1 164 ? -23.737 32.647 12.922  1.00 39.15  ? 255 TRP A CZ3 1 
ATOM   1137 C  CH2 . TRP A 1 164 ? -23.171 32.099 14.079  1.00 46.87  ? 255 TRP A CH2 1 
ATOM   1138 N  N   . PRO A 1 165 ? -17.848 34.512 9.785   1.00 41.37  ? 256 PRO A N   1 
ATOM   1139 C  CA  . PRO A 1 165 ? -16.381 34.411 9.795   1.00 43.96  ? 256 PRO A CA  1 
ATOM   1140 C  C   . PRO A 1 165 ? -15.894 33.004 10.082  1.00 46.48  ? 256 PRO A C   1 
ATOM   1141 O  O   . PRO A 1 165 ? -16.509 32.289 10.881  1.00 49.32  ? 256 PRO A O   1 
ATOM   1142 C  CB  . PRO A 1 165 ? -15.970 35.354 10.921  1.00 35.44  ? 256 PRO A CB  1 
ATOM   1143 C  CG  . PRO A 1 165 ? -17.076 36.367 10.962  1.00 40.77  ? 256 PRO A CG  1 
ATOM   1144 C  CD  . PRO A 1 165 ? -18.326 35.555 10.705  1.00 39.00  ? 256 PRO A CD  1 
ATOM   1145 N  N   . ASP A 1 166 ? -14.815 32.616 9.405   1.00 42.05  ? 257 ASP A N   1 
ATOM   1146 C  CA  . ASP A 1 166 ? -14.135 31.355 9.654   1.00 41.33  ? 257 ASP A CA  1 
ATOM   1147 C  C   . ASP A 1 166 ? -13.420 31.306 11.026  1.00 49.29  ? 257 ASP A C   1 
ATOM   1148 O  O   . ASP A 1 166 ? -12.794 30.296 11.379  1.00 44.72  ? 257 ASP A O   1 
ATOM   1149 C  CB  . ASP A 1 166 ? -13.115 31.112 8.554   1.00 37.96  ? 257 ASP A CB  1 
ATOM   1150 C  CG  . ASP A 1 166 ? -12.155 32.269 8.391   1.00 39.80  ? 257 ASP A CG  1 
ATOM   1151 O  OD1 . ASP A 1 166 ? -12.126 33.166 9.265   1.00 43.78  ? 257 ASP A OD1 1 
ATOM   1152 O  OD2 . ASP A 1 166 ? -11.418 32.282 7.390   1.00 38.74  ? 257 ASP A OD2 1 
ATOM   1153 N  N   . ASP A 1 167 ? -13.509 32.391 11.791  1.00 40.58  ? 258 ASP A N   1 
ATOM   1154 C  CA  . ASP A 1 167 ? -12.755 32.485 13.025  1.00 46.18  ? 258 ASP A CA  1 
ATOM   1155 C  C   . ASP A 1 167 ? -13.560 33.049 14.215  1.00 53.86  ? 258 ASP A C   1 
ATOM   1156 O  O   . ASP A 1 167 ? -13.038 33.829 15.022  1.00 47.83  ? 258 ASP A O   1 
ATOM   1157 C  CB  . ASP A 1 167 ? -11.486 33.310 12.796  1.00 47.67  ? 258 ASP A CB  1 
ATOM   1158 C  CG  . ASP A 1 167 ? -11.775 34.792 12.600  1.00 54.28  ? 258 ASP A CG  1 
ATOM   1159 O  OD1 . ASP A 1 167 ? -12.724 35.136 11.853  1.00 54.40  ? 258 ASP A OD1 1 
ATOM   1160 O  OD2 . ASP A 1 167 ? -11.053 35.615 13.211  1.00 56.71  ? 258 ASP A OD2 1 
ATOM   1161 N  N   . SER A 1 168 ? -14.823 32.652 14.339  1.00 52.58  ? 259 SER A N   1 
ATOM   1162 C  CA  . SER A 1 168 ? -15.584 33.064 15.509  1.00 53.06  ? 259 SER A CA  1 
ATOM   1163 C  C   . SER A 1 168 ? -15.621 31.936 16.531  1.00 55.75  ? 259 SER A C   1 
ATOM   1164 O  O   . SER A 1 168 ? -15.216 30.802 16.238  1.00 54.09  ? 259 SER A O   1 
ATOM   1165 C  CB  . SER A 1 168 ? -17.000 33.494 15.140  1.00 53.30  ? 259 SER A CB  1 
ATOM   1166 O  OG  . SER A 1 168 ? -17.526 34.313 16.175  1.00 56.03  ? 259 SER A OG  1 
ATOM   1167 N  N   . VAL A 1 169 ? -16.096 32.240 17.734  1.00 51.71  ? 260 VAL A N   1 
ATOM   1168 C  CA  . VAL A 1 169 ? -16.185 31.207 18.763  1.00 54.60  ? 260 VAL A CA  1 
ATOM   1169 C  C   . VAL A 1 169 ? -17.491 30.468 18.633  1.00 53.90  ? 260 VAL A C   1 
ATOM   1170 O  O   . VAL A 1 169 ? -17.581 29.264 18.909  1.00 52.48  ? 260 VAL A O   1 
ATOM   1171 C  CB  . VAL A 1 169 ? -16.069 31.781 20.164  1.00 47.86  ? 260 VAL A CB  1 
ATOM   1172 C  CG1 . VAL A 1 169 ? -14.630 31.723 20.605  1.00 47.44  ? 260 VAL A CG1 1 
ATOM   1173 C  CG2 . VAL A 1 169 ? -16.619 33.213 20.200  1.00 49.99  ? 260 VAL A CG2 1 
ATOM   1174 N  N   . PHE A 1 170 ? -18.502 31.206 18.193  1.00 49.75  ? 261 PHE A N   1 
ATOM   1175 C  CA  . PHE A 1 170 ? -19.799 30.622 17.973  1.00 47.49  ? 261 PHE A CA  1 
ATOM   1176 C  C   . PHE A 1 170 ? -19.665 29.562 16.889  1.00 46.73  ? 261 PHE A C   1 
ATOM   1177 O  O   . PHE A 1 170 ? -19.153 29.838 15.802  1.00 46.07  ? 261 PHE A O   1 
ATOM   1178 C  CB  . PHE A 1 170 ? -20.809 31.694 17.548  1.00 44.80  ? 261 PHE A CB  1 
ATOM   1179 C  CG  . PHE A 1 170 ? -20.683 33.002 18.294  1.00 44.01  ? 261 PHE A CG  1 
ATOM   1180 C  CD1 . PHE A 1 170 ? -21.024 33.099 19.632  1.00 47.31  ? 261 PHE A CD1 1 
ATOM   1181 C  CD2 . PHE A 1 170 ? -20.259 34.146 17.644  1.00 46.34  ? 261 PHE A CD2 1 
ATOM   1182 C  CE1 . PHE A 1 170 ? -20.926 34.306 20.306  1.00 45.07  ? 261 PHE A CE1 1 
ATOM   1183 C  CE2 . PHE A 1 170 ? -20.164 35.353 18.314  1.00 47.00  ? 261 PHE A CE2 1 
ATOM   1184 C  CZ  . PHE A 1 170 ? -20.500 35.432 19.647  1.00 43.13  ? 261 PHE A CZ  1 
ATOM   1185 N  N   . PRO A 1 171 ? -20.140 28.347 17.177  1.00 46.99  ? 262 PRO A N   1 
ATOM   1186 C  CA  . PRO A 1 171 ? -20.195 27.327 16.127  1.00 45.55  ? 262 PRO A CA  1 
ATOM   1187 C  C   . PRO A 1 171 ? -21.164 27.768 15.030  1.00 48.99  ? 262 PRO A C   1 
ATOM   1188 O  O   . PRO A 1 171 ? -22.135 28.483 15.303  1.00 49.88  ? 262 PRO A O   1 
ATOM   1189 C  CB  . PRO A 1 171 ? -20.749 26.102 16.852  1.00 45.41  ? 262 PRO A CB  1 
ATOM   1190 C  CG  . PRO A 1 171 ? -21.564 26.659 17.979  1.00 47.44  ? 262 PRO A CG  1 
ATOM   1191 C  CD  . PRO A 1 171 ? -21.023 28.036 18.314  1.00 44.66  ? 262 PRO A CD  1 
ATOM   1192 N  N   . LYS A 1 172 ? -20.901 27.353 13.798  1.00 45.83  ? 263 LYS A N   1 
ATOM   1193 C  CA  . LYS A 1 172 ? -21.764 27.708 12.689  1.00 45.08  ? 263 LYS A CA  1 
ATOM   1194 C  C   . LYS A 1 172 ? -23.076 26.933 12.816  1.00 49.20  ? 263 LYS A C   1 
ATOM   1195 O  O   . LYS A 1 172 ? -23.048 25.730 13.070  1.00 46.77  ? 263 LYS A O   1 
ATOM   1196 C  CB  . LYS A 1 172 ? -21.048 27.375 11.382  1.00 50.86  ? 263 LYS A CB  1 
ATOM   1197 C  CG  . LYS A 1 172 ? -21.846 27.625 10.126  1.00 50.01  ? 263 LYS A CG  1 
ATOM   1198 C  CD  . LYS A 1 172 ? -20.964 27.520 8.894   1.00 44.65  ? 263 LYS A CD  1 
ATOM   1199 C  CE  . LYS A 1 172 ? -20.016 28.706 8.792   1.00 42.81  ? 263 LYS A CE  1 
ATOM   1200 N  NZ  . LYS A 1 172 ? -19.843 29.161 7.355   1.00 58.17  ? 263 LYS A NZ  1 
ATOM   1201 N  N   . PRO A 1 173 ? -24.229 27.617 12.645  1.00 49.43  ? 264 PRO A N   1 
ATOM   1202 C  CA  . PRO A 1 173 ? -25.532 26.948 12.746  1.00 45.38  ? 264 PRO A CA  1 
ATOM   1203 C  C   . PRO A 1 173 ? -25.672 25.986 11.592  1.00 52.11  ? 264 PRO A C   1 
ATOM   1204 O  O   . PRO A 1 173 ? -25.432 26.386 10.453  1.00 51.35  ? 264 PRO A O   1 
ATOM   1205 C  CB  . PRO A 1 173 ? -26.550 28.082 12.545  1.00 37.18  ? 264 PRO A CB  1 
ATOM   1206 C  CG  . PRO A 1 173 ? -25.771 29.350 12.512  1.00 39.54  ? 264 PRO A CG  1 
ATOM   1207 C  CD  . PRO A 1 173 ? -24.360 29.003 12.169  1.00 46.08  ? 264 PRO A CD  1 
ATOM   1208 N  N   . PHE A 1 174 ? -26.044 24.743 11.862  1.00 49.95  ? 265 PHE A N   1 
ATOM   1209 C  CA  . PHE A 1 174 ? -26.345 23.822 10.777  1.00 46.79  ? 265 PHE A CA  1 
ATOM   1210 C  C   . PHE A 1 174 ? -27.830 23.534 10.706  1.00 50.05  ? 265 PHE A C   1 
ATOM   1211 O  O   . PHE A 1 174 ? -28.376 22.741 11.485  1.00 45.47  ? 265 PHE A O   1 
ATOM   1212 C  CB  . PHE A 1 174 ? -25.506 22.543 10.856  1.00 52.09  ? 265 PHE A CB  1 
ATOM   1213 C  CG  . PHE A 1 174 ? -24.169 22.674 10.179  1.00 61.59  ? 265 PHE A CG  1 
ATOM   1214 C  CD1 . PHE A 1 174 ? -24.050 22.489 8.799   1.00 63.29  ? 265 PHE A CD1 1 
ATOM   1215 C  CD2 . PHE A 1 174 ? -23.037 23.026 10.907  1.00 60.63  ? 265 PHE A CD2 1 
ATOM   1216 C  CE1 . PHE A 1 174 ? -22.822 22.627 8.163   1.00 65.75  ? 265 PHE A CE1 1 
ATOM   1217 C  CE2 . PHE A 1 174 ? -21.805 23.165 10.281  1.00 57.65  ? 265 PHE A CE2 1 
ATOM   1218 C  CZ  . PHE A 1 174 ? -21.694 22.966 8.911   1.00 67.57  ? 265 PHE A CZ  1 
ATOM   1219 N  N   . VAL A 1 175 ? -28.469 24.203 9.753   1.00 46.93  ? 266 VAL A N   1 
ATOM   1220 C  CA  . VAL A 1 175 ? -29.909 24.161 9.602   1.00 44.14  ? 266 VAL A CA  1 
ATOM   1221 C  C   . VAL A 1 175 ? -30.249 24.268 8.137   1.00 41.90  ? 266 VAL A C   1 
ATOM   1222 O  O   . VAL A 1 175 ? -31.289 24.801 7.777   1.00 43.28  ? 266 VAL A O   1 
ATOM   1223 C  CB  . VAL A 1 175 ? -30.553 25.347 10.324  1.00 44.26  ? 266 VAL A CB  1 
ATOM   1224 C  CG1 . VAL A 1 175 ? -30.309 25.253 11.803  1.00 37.76  ? 266 VAL A CG1 1 
ATOM   1225 C  CG2 . VAL A 1 175 ? -29.989 26.649 9.787   1.00 43.16  ? 266 VAL A CG2 1 
ATOM   1226 N  N   . GLN A 1 176 ? -29.361 23.771 7.285   1.00 43.28  ? 267 GLN A N   1 
ATOM   1227 C  CA  . GLN A 1 176 ? -29.542 23.929 5.850   1.00 39.76  ? 267 GLN A CA  1 
ATOM   1228 C  C   . GLN A 1 176 ? -30.052 22.657 5.188   1.00 40.01  ? 267 GLN A C   1 
ATOM   1229 O  O   . GLN A 1 176 ? -30.700 22.707 4.138   1.00 44.23  ? 267 GLN A O   1 
ATOM   1230 C  CB  . GLN A 1 176 ? -28.242 24.386 5.177   1.00 41.79  ? 267 GLN A CB  1 
ATOM   1231 C  CG  . GLN A 1 176 ? -27.686 25.695 5.726   1.00 52.09  ? 267 GLN A CG  1 
ATOM   1232 C  CD  . GLN A 1 176 ? -26.894 25.498 7.024   1.00 56.42  ? 267 GLN A CD  1 
ATOM   1233 O  OE1 . GLN A 1 176 ? -26.234 24.466 7.210   1.00 54.45  ? 267 GLN A OE1 1 
ATOM   1234 N  NE2 . GLN A 1 176 ? -26.966 26.482 7.929   1.00 48.77  ? 267 GLN A NE2 1 
ATOM   1235 N  N   . LYS A 1 177 ? -29.747 21.517 5.785   1.00 34.57  ? 268 LYS A N   1 
ATOM   1236 C  CA  . LYS A 1 177 ? -30.157 20.242 5.222   1.00 40.40  ? 268 LYS A CA  1 
ATOM   1237 C  C   . LYS A 1 177 ? -30.993 19.440 6.213   1.00 41.33  ? 268 LYS A C   1 
ATOM   1238 O  O   . LYS A 1 177 ? -30.457 18.845 7.142   1.00 40.55  ? 268 LYS A O   1 
ATOM   1239 C  CB  . LYS A 1 177 ? -28.930 19.432 4.807   1.00 40.11  ? 268 LYS A CB  1 
ATOM   1240 C  CG  . LYS A 1 177 ? -28.126 20.038 3.680   1.00 39.04  ? 268 LYS A CG  1 
ATOM   1241 C  CD  . LYS A 1 177 ? -26.978 19.127 3.297   1.00 41.07  ? 268 LYS A CD  1 
ATOM   1242 C  CE  . LYS A 1 177 ? -26.182 19.702 2.138   1.00 40.46  ? 268 LYS A CE  1 
ATOM   1243 N  NZ  . LYS A 1 177 ? -25.014 18.863 1.737   1.00 44.73  ? 268 LYS A NZ  1 
ATOM   1244 N  N   . TYR A 1 178 ? -32.308 19.435 6.014   1.00 41.25  ? 269 TYR A N   1 
ATOM   1245 C  CA  . TYR A 1 178 ? -33.213 18.615 6.809   1.00 33.44  ? 269 TYR A CA  1 
ATOM   1246 C  C   . TYR A 1 178 ? -33.807 17.520 5.963   1.00 36.45  ? 269 TYR A C   1 
ATOM   1247 O  O   . TYR A 1 178 ? -34.094 17.722 4.777   1.00 41.74  ? 269 TYR A O   1 
ATOM   1248 C  CB  . TYR A 1 178 ? -34.347 19.459 7.367   1.00 36.02  ? 269 TYR A CB  1 
ATOM   1249 C  CG  . TYR A 1 178 ? -33.932 20.338 8.510   1.00 41.01  ? 269 TYR A CG  1 
ATOM   1250 C  CD1 . TYR A 1 178 ? -33.761 21.704 8.332   1.00 35.46  ? 269 TYR A CD1 1 
ATOM   1251 C  CD2 . TYR A 1 178 ? -33.681 19.798 9.763   1.00 36.22  ? 269 TYR A CD2 1 
ATOM   1252 C  CE1 . TYR A 1 178 ? -33.373 22.506 9.366   1.00 35.46  ? 269 TYR A CE1 1 
ATOM   1253 C  CE2 . TYR A 1 178 ? -33.289 20.587 10.792  1.00 38.67  ? 269 TYR A CE2 1 
ATOM   1254 C  CZ  . TYR A 1 178 ? -33.139 21.948 10.599  1.00 39.81  ? 269 TYR A CZ  1 
ATOM   1255 O  OH  . TYR A 1 178 ? -32.745 22.752 11.655  1.00 45.85  ? 269 TYR A OH  1 
ATOM   1256 N  N   . CYS A 1 179 ? -33.989 16.356 6.567   1.00 39.12  ? 270 CYS A N   1 
ATOM   1257 C  CA  . CYS A 1 179 ? -34.720 15.278 5.925   1.00 37.55  ? 270 CYS A CA  1 
ATOM   1258 C  C   . CYS A 1 179 ? -36.014 15.071 6.671   1.00 33.23  ? 270 CYS A C   1 
ATOM   1259 O  O   . CYS A 1 179 ? -35.997 14.931 7.875   1.00 39.15  ? 270 CYS A O   1 
ATOM   1260 C  CB  . CYS A 1 179 ? -33.919 13.998 5.965   1.00 37.67  ? 270 CYS A CB  1 
ATOM   1261 S  SG  . CYS A 1 179 ? -34.870 12.581 5.442   1.00 40.22  ? 270 CYS A SG  1 
ATOM   1262 N  N   . LEU A 1 180 ? -37.132 15.072 5.957   1.00 36.35  ? 271 LEU A N   1 
ATOM   1263 C  CA  . LEU A 1 180 ? -38.445 14.966 6.578   1.00 36.59  ? 271 LEU A CA  1 
ATOM   1264 C  C   . LEU A 1 180 ? -39.121 13.696 6.153   1.00 38.56  ? 271 LEU A C   1 
ATOM   1265 O  O   . LEU A 1 180 ? -39.366 13.499 4.971   1.00 40.55  ? 271 LEU A O   1 
ATOM   1266 C  CB  . LEU A 1 180 ? -39.348 16.111 6.141   1.00 34.12  ? 271 LEU A CB  1 
ATOM   1267 C  CG  . LEU A 1 180 ? -38.937 17.524 6.513   1.00 40.40  ? 271 LEU A CG  1 
ATOM   1268 C  CD1 . LEU A 1 180 ? -37.907 18.081 5.521   1.00 33.69  ? 271 LEU A CD1 1 
ATOM   1269 C  CD2 . LEU A 1 180 ? -40.185 18.387 6.577   1.00 36.01  ? 271 LEU A CD2 1 
ATOM   1270 N  N   . MET A 1 181 ? -39.448 12.838 7.107   1.00 37.81  ? 272 MET A N   1 
ATOM   1271 C  CA  . MET A 1 181 ? -40.255 11.676 6.794   1.00 38.96  ? 272 MET A CA  1 
ATOM   1272 C  C   . MET A 1 181 ? -41.492 11.822 7.625   1.00 38.25  ? 272 MET A C   1 
ATOM   1273 O  O   . MET A 1 181 ? -41.404 12.258 8.761   1.00 39.76  ? 272 MET A O   1 
ATOM   1274 C  CB  . MET A 1 181 ? -39.512 10.392 7.148   1.00 39.81  ? 272 MET A CB  1 
ATOM   1275 C  CG  . MET A 1 181 ? -38.259 10.183 6.319   1.00 39.89  ? 272 MET A CG  1 
ATOM   1276 S  SD  . MET A 1 181 ? -37.039 9.161  7.170   1.00 44.67  ? 272 MET A SD  1 
ATOM   1277 C  CE  . MET A 1 181 ? -37.073 9.928  8.787   1.00 41.27  ? 272 MET A CE  1 
ATOM   1278 N  N   . GLY A 1 182 ? -42.646 11.484 7.063   1.00 37.92  ? 273 GLY A N   1 
ATOM   1279 C  CA  . GLY A 1 182 ? -43.897 11.619 7.790   1.00 41.08  ? 273 GLY A CA  1 
ATOM   1280 C  C   . GLY A 1 182 ? -44.977 10.699 7.260   1.00 42.05  ? 273 GLY A C   1 
ATOM   1281 O  O   . GLY A 1 182 ? -45.069 10.486 6.055   1.00 40.20  ? 273 GLY A O   1 
ATOM   1282 N  N   . VAL A 1 183 ? -45.799 10.144 8.145   1.00 42.72  ? 274 VAL A N   1 
ATOM   1283 C  CA  . VAL A 1 183 ? -46.855 9.253  7.678   1.00 45.00  ? 274 VAL A CA  1 
ATOM   1284 C  C   . VAL A 1 183 ? -48.110 10.037 7.338   1.00 41.56  ? 274 VAL A C   1 
ATOM   1285 O  O   . VAL A 1 183 ? -48.243 11.209 7.678   1.00 38.95  ? 274 VAL A O   1 
ATOM   1286 C  CB  . VAL A 1 183 ? -47.187 8.121  8.675   1.00 42.24  ? 274 VAL A CB  1 
ATOM   1287 C  CG1 . VAL A 1 183 ? -45.960 7.264  8.935   1.00 42.93  ? 274 VAL A CG1 1 
ATOM   1288 C  CG2 . VAL A 1 183 ? -47.756 8.695  9.942   1.00 39.32  ? 274 VAL A CG2 1 
ATOM   1289 N  N   . GLN A 1 184 ? -49.022 9.384  6.638   1.00 43.43  ? 275 GLN A N   1 
ATOM   1290 C  CA  . GLN A 1 184 ? -50.265 10.027 6.276   1.00 43.28  ? 275 GLN A CA  1 
ATOM   1291 C  C   . GLN A 1 184 ? -50.913 10.565 7.549   1.00 43.30  ? 275 GLN A C   1 
ATOM   1292 O  O   . GLN A 1 184 ? -50.960 9.896  8.588   1.00 39.14  ? 275 GLN A O   1 
ATOM   1293 C  CB  . GLN A 1 184 ? -51.172 9.037  5.550   1.00 42.34  ? 275 GLN A CB  1 
ATOM   1294 C  CG  . GLN A 1 184 ? -52.450 9.605  4.989   1.00 42.69  ? 275 GLN A CG  1 
ATOM   1295 C  CD  . GLN A 1 184 ? -53.173 8.600  4.090   1.00 48.47  ? 275 GLN A CD  1 
ATOM   1296 O  OE1 . GLN A 1 184 ? -53.980 7.799  4.560   1.00 53.67  ? 275 GLN A OE1 1 
ATOM   1297 N  NE2 . GLN A 1 184 ? -52.876 8.634  2.796   1.00 47.58  ? 275 GLN A NE2 1 
ATOM   1298 N  N   . ASP A 1 185 ? -51.378 11.801 7.454   1.00 42.07  ? 276 ASP A N   1 
ATOM   1299 C  CA  . ASP A 1 185 ? -52.083 12.467 8.533   1.00 37.40  ? 276 ASP A CA  1 
ATOM   1300 C  C   . ASP A 1 185 ? -51.173 13.069 9.590   1.00 33.27  ? 276 ASP A C   1 
ATOM   1301 O  O   . ASP A 1 185 ? -51.650 13.627 10.568  1.00 40.17  ? 276 ASP A O   1 
ATOM   1302 C  CB  . ASP A 1 185 ? -53.182 11.575 9.117   1.00 37.76  ? 276 ASP A CB  1 
ATOM   1303 C  CG  . ASP A 1 185 ? -54.440 11.559 8.246   1.00 45.42  ? 276 ASP A CG  1 
ATOM   1304 O  OD1 . ASP A 1 185 ? -54.387 12.069 7.107   1.00 42.58  ? 276 ASP A OD1 1 
ATOM   1305 O  OD2 . ASP A 1 185 ? -55.483 11.040 8.691   1.00 49.64  ? 276 ASP A OD2 1 
ATOM   1306 N  N   . SER A 1 186 ? -49.867 12.995 9.381   1.00 33.96  ? 277 SER A N   1 
ATOM   1307 C  CA  . SER A 1 186 ? -48.970 13.829 10.171  1.00 37.81  ? 277 SER A CA  1 
ATOM   1308 C  C   . SER A 1 186 ? -49.398 15.270 9.954   1.00 38.10  ? 277 SER A C   1 
ATOM   1309 O  O   . SER A 1 186 ? -49.735 15.667 8.838   1.00 39.42  ? 277 SER A O   1 
ATOM   1310 C  CB  . SER A 1 186 ? -47.506 13.669 9.761   1.00 37.96  ? 277 SER A CB  1 
ATOM   1311 O  OG  . SER A 1 186 ? -47.083 12.319 9.820   1.00 40.52  ? 277 SER A OG  1 
ATOM   1312 N  N   . TYR A 1 187 ? -49.392 16.058 11.014  1.00 32.18  ? 278 TYR A N   1 
ATOM   1313 C  CA  . TYR A 1 187 ? -49.820 17.431 10.900  1.00 35.44  ? 278 TYR A CA  1 
ATOM   1314 C  C   . TYR A 1 187 ? -48.969 18.306 11.795  1.00 35.87  ? 278 TYR A C   1 
ATOM   1315 O  O   . TYR A 1 187 ? -48.763 17.978 12.952  1.00 37.87  ? 278 TYR A O   1 
ATOM   1316 C  CB  . TYR A 1 187 ? -51.298 17.553 11.292  1.00 37.03  ? 278 TYR A CB  1 
ATOM   1317 C  CG  . TYR A 1 187 ? -51.767 18.984 11.470  1.00 33.37  ? 278 TYR A CG  1 
ATOM   1318 C  CD1 . TYR A 1 187 ? -51.903 19.837 10.377  1.00 34.42  ? 278 TYR A CD1 1 
ATOM   1319 C  CD2 . TYR A 1 187 ? -52.065 19.481 12.721  1.00 33.86  ? 278 TYR A CD2 1 
ATOM   1320 C  CE1 . TYR A 1 187 ? -52.326 21.144 10.533  1.00 32.89  ? 278 TYR A CE1 1 
ATOM   1321 C  CE2 . TYR A 1 187 ? -52.489 20.791 12.891  1.00 37.72  ? 278 TYR A CE2 1 
ATOM   1322 C  CZ  . TYR A 1 187 ? -52.621 21.614 11.796  1.00 34.65  ? 278 TYR A CZ  1 
ATOM   1323 O  OH  . TYR A 1 187 ? -53.047 22.904 11.969  1.00 31.58  ? 278 TYR A OH  1 
ATOM   1324 N  N   . THR A 1 188 ? -48.462 19.414 11.265  1.00 33.81  ? 279 THR A N   1 
ATOM   1325 C  CA  . THR A 1 188 ? -47.804 20.391 12.112  1.00 31.36  ? 279 THR A CA  1 
ATOM   1326 C  C   . THR A 1 188 ? -48.647 21.649 12.198  1.00 35.90  ? 279 THR A C   1 
ATOM   1327 O  O   . THR A 1 188 ? -49.131 22.153 11.189  1.00 37.85  ? 279 THR A O   1 
ATOM   1328 C  CB  . THR A 1 188 ? -46.412 20.726 11.613  1.00 34.25  ? 279 THR A CB  1 
ATOM   1329 O  OG1 . THR A 1 188 ? -45.618 19.536 11.608  1.00 36.18  ? 279 THR A OG1 1 
ATOM   1330 C  CG2 . THR A 1 188 ? -45.769 21.750 12.522  1.00 33.23  ? 279 THR A CG2 1 
ATOM   1331 N  N   . ASP A 1 189 ? -48.826 22.154 13.407  1.00 34.74  ? 280 ASP A N   1 
ATOM   1332 C  CA  . ASP A 1 189 ? -49.694 23.298 13.625  1.00 37.01  ? 280 ASP A CA  1 
ATOM   1333 C  C   . ASP A 1 189 ? -49.030 24.623 13.230  1.00 33.86  ? 280 ASP A C   1 
ATOM   1334 O  O   . ASP A 1 189 ? -47.825 24.694 13.035  1.00 33.15  ? 280 ASP A O   1 
ATOM   1335 C  CB  . ASP A 1 189 ? -50.152 23.349 15.089  1.00 33.25  ? 280 ASP A CB  1 
ATOM   1336 C  CG  . ASP A 1 189 ? -51.605 23.748 15.222  1.00 38.69  ? 280 ASP A CG  1 
ATOM   1337 O  OD1 . ASP A 1 189 ? -52.201 24.110 14.178  1.00 38.74  ? 280 ASP A OD1 1 
ATOM   1338 O  OD2 . ASP A 1 189 ? -52.146 23.715 16.358  1.00 36.39  ? 280 ASP A OD2 1 
ATOM   1339 N  N   . PHE A 1 190 ? -49.840 25.670 13.139  1.00 33.39  ? 281 PHE A N   1 
ATOM   1340 C  CA  . PHE A 1 190 ? -49.388 26.974 12.685  1.00 33.98  ? 281 PHE A CA  1 
ATOM   1341 C  C   . PHE A 1 190 ? -48.224 27.537 13.492  1.00 32.56  ? 281 PHE A C   1 
ATOM   1342 O  O   . PHE A 1 190 ? -48.352 27.795 14.684  1.00 33.24  ? 281 PHE A O   1 
ATOM   1343 C  CB  . PHE A 1 190 ? -50.572 27.952 12.673  1.00 29.34  ? 281 PHE A CB  1 
ATOM   1344 C  CG  . PHE A 1 190 ? -51.554 27.663 11.601  1.00 34.12  ? 281 PHE A CG  1 
ATOM   1345 C  CD1 . PHE A 1 190 ? -51.287 28.033 10.283  1.00 33.99  ? 281 PHE A CD1 1 
ATOM   1346 C  CD2 . PHE A 1 190 ? -52.715 26.979 11.879  1.00 31.77  ? 281 PHE A CD2 1 
ATOM   1347 C  CE1 . PHE A 1 190 ? -52.175 27.744 9.282   1.00 30.02  ? 281 PHE A CE1 1 
ATOM   1348 C  CE2 . PHE A 1 190 ? -53.616 26.679 10.873  1.00 28.33  ? 281 PHE A CE2 1 
ATOM   1349 C  CZ  . PHE A 1 190 ? -53.347 27.067 9.577   1.00 32.94  ? 281 PHE A CZ  1 
ATOM   1350 N  N   . HIS A 1 191 ? -47.099 27.758 12.830  1.00 29.73  ? 282 HIS A N   1 
ATOM   1351 C  CA  . HIS A 1 191 ? -45.953 28.357 13.496  1.00 36.05  ? 282 HIS A CA  1 
ATOM   1352 C  C   . HIS A 1 191 ? -45.241 29.282 12.533  1.00 33.21  ? 282 HIS A C   1 
ATOM   1353 O  O   . HIS A 1 191 ? -45.538 29.289 11.353  1.00 29.07  ? 282 HIS A O   1 
ATOM   1354 C  CB  . HIS A 1 191 ? -44.992 27.265 13.903  1.00 31.54  ? 282 HIS A CB  1 
ATOM   1355 C  CG  . HIS A 1 191 ? -44.569 26.420 12.752  1.00 34.83  ? 282 HIS A CG  1 
ATOM   1356 N  ND1 . HIS A 1 191 ? -45.365 25.425 12.237  1.00 34.24  ? 282 HIS A ND1 1 
ATOM   1357 C  CD2 . HIS A 1 191 ? -43.461 26.458 11.979  1.00 36.79  ? 282 HIS A CD2 1 
ATOM   1358 C  CE1 . HIS A 1 191 ? -44.755 24.861 11.213  1.00 32.74  ? 282 HIS A CE1 1 
ATOM   1359 N  NE2 . HIS A 1 191 ? -43.595 25.469 11.039  1.00 35.62  ? 282 HIS A NE2 1 
ATOM   1360 N  N   . ILE A 1 192 ? -44.296 30.054 13.047  1.00 30.42  ? 283 ILE A N   1 
ATOM   1361 C  CA  . ILE A 1 192 ? -43.426 30.842 12.202  1.00 31.10  ? 283 ILE A CA  1 
ATOM   1362 C  C   . ILE A 1 192 ? -42.061 30.233 12.368  1.00 32.27  ? 283 ILE A C   1 
ATOM   1363 O  O   . ILE A 1 192 ? -41.664 29.910 13.468  1.00 38.16  ? 283 ILE A O   1 
ATOM   1364 C  CB  . ILE A 1 192 ? -43.398 32.303 12.645  1.00 34.80  ? 283 ILE A CB  1 
ATOM   1365 C  CG1 . ILE A 1 192 ? -44.760 32.944 12.397  1.00 37.03  ? 283 ILE A CG1 1 
ATOM   1366 C  CG2 . ILE A 1 192 ? -42.364 33.074 11.881  1.00 32.45  ? 283 ILE A CG2 1 
ATOM   1367 C  CD1 . ILE A 1 192 ? -44.895 34.309 12.972  1.00 36.69  ? 283 ILE A CD1 1 
ATOM   1368 N  N   . ASP A 1 193 ? -41.333 30.049 11.284  1.00 32.03  ? 284 ASP A N   1 
ATOM   1369 C  CA  . ASP A 1 193 ? -40.097 29.326 11.419  1.00 30.79  ? 284 ASP A CA  1 
ATOM   1370 C  C   . ASP A 1 193 ? -39.150 30.041 12.364  1.00 38.14  ? 284 ASP A C   1 
ATOM   1371 O  O   . ASP A 1 193 ? -39.183 31.268 12.495  1.00 36.66  ? 284 ASP A O   1 
ATOM   1372 C  CB  . ASP A 1 193 ? -39.477 29.039 10.066  1.00 27.54  ? 284 ASP A CB  1 
ATOM   1373 C  CG  . ASP A 1 193 ? -40.208 27.948 9.348   1.00 32.82  ? 284 ASP A CG  1 
ATOM   1374 O  OD1 . ASP A 1 193 ? -40.923 27.212 10.038  1.00 34.39  ? 284 ASP A OD1 1 
ATOM   1375 O  OD2 . ASP A 1 193 ? -40.097 27.820 8.114   1.00 37.80  ? 284 ASP A OD2 1 
ATOM   1376 N  N   . PHE A 1 194 ? -38.325 29.259 13.049  1.00 36.85  ? 285 PHE A N   1 
ATOM   1377 C  CA  . PHE A 1 194 ? -37.389 29.818 14.004  1.00 37.18  ? 285 PHE A CA  1 
ATOM   1378 C  C   . PHE A 1 194 ? -36.562 30.985 13.454  1.00 34.28  ? 285 PHE A C   1 
ATOM   1379 O  O   . PHE A 1 194 ? -36.002 30.918 12.357  1.00 35.06  ? 285 PHE A O   1 
ATOM   1380 C  CB  . PHE A 1 194 ? -36.497 28.721 14.554  1.00 37.79  ? 285 PHE A CB  1 
ATOM   1381 C  CG  . PHE A 1 194 ? -35.625 28.083 13.532  1.00 41.22  ? 285 PHE A CG  1 
ATOM   1382 C  CD1 . PHE A 1 194 ? -34.395 28.635 13.213  1.00 40.15  ? 285 PHE A CD1 1 
ATOM   1383 C  CD2 . PHE A 1 194 ? -36.016 26.916 12.909  1.00 40.02  ? 285 PHE A CD2 1 
ATOM   1384 C  CE1 . PHE A 1 194 ? -33.580 28.041 12.283  1.00 37.74  ? 285 PHE A CE1 1 
ATOM   1385 C  CE2 . PHE A 1 194 ? -35.206 26.320 11.985  1.00 40.13  ? 285 PHE A CE2 1 
ATOM   1386 C  CZ  . PHE A 1 194 ? -33.985 26.883 11.673  1.00 42.08  ? 285 PHE A CZ  1 
ATOM   1387 N  N   . GLY A 1 195 ? -36.509 32.063 14.228  1.00 36.31  ? 286 GLY A N   1 
ATOM   1388 C  CA  . GLY A 1 195 ? -35.712 33.229 13.884  1.00 36.70  ? 286 GLY A CA  1 
ATOM   1389 C  C   . GLY A 1 195 ? -36.268 34.004 12.707  1.00 38.11  ? 286 GLY A C   1 
ATOM   1390 O  O   . GLY A 1 195 ? -35.660 34.959 12.220  1.00 38.70  ? 286 GLY A O   1 
ATOM   1391 N  N   . GLY A 1 196 ? -37.430 33.590 12.233  1.00 34.55  ? 287 GLY A N   1 
ATOM   1392 C  CA  . GLY A 1 196 ? -38.002 34.238 11.079  1.00 37.30  ? 287 GLY A CA  1 
ATOM   1393 C  C   . GLY A 1 196 ? -37.304 33.847 9.796   1.00 34.97  ? 287 GLY A C   1 
ATOM   1394 O  O   . GLY A 1 196 ? -37.358 34.595 8.841   1.00 35.94  ? 287 GLY A O   1 
ATOM   1395 N  N   . THR A 1 197 ? -36.666 32.679 9.771   1.00 32.76  ? 288 THR A N   1 
ATOM   1396 C  CA  . THR A 1 197 ? -35.996 32.207 8.564   1.00 32.40  ? 288 THR A CA  1 
ATOM   1397 C  C   . THR A 1 197 ? -36.964 31.835 7.458   1.00 33.62  ? 288 THR A C   1 
ATOM   1398 O  O   . THR A 1 197 ? -38.108 31.435 7.707   1.00 33.71  ? 288 THR A O   1 
ATOM   1399 C  CB  . THR A 1 197 ? -35.117 30.969 8.819   1.00 32.66  ? 288 THR A CB  1 
ATOM   1400 O  OG1 . THR A 1 197 ? -35.807 30.068 9.681   1.00 38.22  ? 288 THR A OG1 1 
ATOM   1401 C  CG2 . THR A 1 197 ? -33.820 31.351 9.463   1.00 33.41  ? 288 THR A CG2 1 
ATOM   1402 N  N   . SER A 1 198 ? -36.479 31.969 6.229   1.00 34.12  ? 289 SER A N   1 
ATOM   1403 C  CA  . SER A 1 198 ? -37.184 31.499 5.048   1.00 31.63  ? 289 SER A CA  1 
ATOM   1404 C  C   . SER A 1 198 ? -36.861 30.021 4.906   1.00 31.50  ? 289 SER A C   1 
ATOM   1405 O  O   . SER A 1 198 ? -35.936 29.538 5.539   1.00 30.50  ? 289 SER A O   1 
ATOM   1406 C  CB  . SER A 1 198 ? -36.671 32.240 3.817   1.00 31.19  ? 289 SER A CB  1 
ATOM   1407 O  OG  . SER A 1 198 ? -36.719 33.638 4.018   1.00 31.55  ? 289 SER A OG  1 
ATOM   1408 N  N   . VAL A 1 199 ? -37.601 29.305 4.067   1.00 29.28  ? 290 VAL A N   1 
ATOM   1409 C  CA  . VAL A 1 199 ? -37.299 27.906 3.831   1.00 29.63  ? 290 VAL A CA  1 
ATOM   1410 C  C   . VAL A 1 199 ? -37.484 27.523 2.386   1.00 32.83  ? 290 VAL A C   1 
ATOM   1411 O  O   . VAL A 1 199 ? -38.165 28.205 1.625   1.00 30.71  ? 290 VAL A O   1 
ATOM   1412 C  CB  . VAL A 1 199 ? -38.201 26.957 4.655   1.00 32.41  ? 290 VAL A CB  1 
ATOM   1413 C  CG1 . VAL A 1 199 ? -37.711 26.848 6.078   1.00 38.48  ? 290 VAL A CG1 1 
ATOM   1414 C  CG2 . VAL A 1 199 ? -39.643 27.408 4.611   1.00 28.58  ? 290 VAL A CG2 1 
ATOM   1415 N  N   . TRP A 1 200 ? -36.883 26.402 2.019   1.00 34.09  ? 291 TRP A N   1 
ATOM   1416 C  CA  . TRP A 1 200 ? -37.306 25.706 0.827   1.00 34.72  ? 291 TRP A CA  1 
ATOM   1417 C  C   . TRP A 1 200 ? -37.746 24.310 1.240   1.00 34.89  ? 291 TRP A C   1 
ATOM   1418 O  O   . TRP A 1 200 ? -37.256 23.755 2.212   1.00 33.61  ? 291 TRP A O   1 
ATOM   1419 C  CB  . TRP A 1 200 ? -36.180 25.642 -0.195  1.00 33.14  ? 291 TRP A CB  1 
ATOM   1420 C  CG  . TRP A 1 200 ? -34.993 24.984 0.335   1.00 33.94  ? 291 TRP A CG  1 
ATOM   1421 C  CD1 . TRP A 1 200 ? -34.000 25.558 1.070   1.00 37.21  ? 291 TRP A CD1 1 
ATOM   1422 C  CD2 . TRP A 1 200 ? -34.646 23.609 0.184   1.00 34.07  ? 291 TRP A CD2 1 
ATOM   1423 N  NE1 . TRP A 1 200 ? -33.056 24.619 1.395   1.00 39.41  ? 291 TRP A NE1 1 
ATOM   1424 C  CE2 . TRP A 1 200 ? -33.431 23.411 0.861   1.00 36.86  ? 291 TRP A CE2 1 
ATOM   1425 C  CE3 . TRP A 1 200 ? -35.247 22.523 -0.455  1.00 37.12  ? 291 TRP A CE3 1 
ATOM   1426 C  CZ2 . TRP A 1 200 ? -32.799 22.169 0.916   1.00 33.70  ? 291 TRP A CZ2 1 
ATOM   1427 C  CZ3 . TRP A 1 200 ? -34.618 21.290 -0.398  1.00 38.38  ? 291 TRP A CZ3 1 
ATOM   1428 C  CH2 . TRP A 1 200 ? -33.408 21.124 0.289   1.00 35.45  ? 291 TRP A CH2 1 
ATOM   1429 N  N   . TYR A 1 201 ? -38.692 23.750 0.508   1.00 35.91  ? 292 TYR A N   1 
ATOM   1430 C  CA  . TYR A 1 201 ? -39.075 22.378 0.735   1.00 37.74  ? 292 TYR A CA  1 
ATOM   1431 C  C   . TYR A 1 201 ? -39.215 21.694 -0.605  1.00 36.01  ? 292 TYR A C   1 
ATOM   1432 O  O   . TYR A 1 201 ? -39.715 22.287 -1.553  1.00 37.59  ? 292 TYR A O   1 
ATOM   1433 C  CB  . TYR A 1 201 ? -40.365 22.289 1.555   1.00 33.63  ? 292 TYR A CB  1 
ATOM   1434 C  CG  . TYR A 1 201 ? -40.143 22.465 3.042   1.00 39.35  ? 292 TYR A CG  1 
ATOM   1435 C  CD1 . TYR A 1 201 ? -40.492 23.647 3.693   1.00 39.85  ? 292 TYR A CD1 1 
ATOM   1436 C  CD2 . TYR A 1 201 ? -39.564 21.448 3.799   1.00 41.09  ? 292 TYR A CD2 1 
ATOM   1437 C  CE1 . TYR A 1 201 ? -40.275 23.809 5.064   1.00 38.62  ? 292 TYR A CE1 1 
ATOM   1438 C  CE2 . TYR A 1 201 ? -39.346 21.594 5.169   1.00 39.65  ? 292 TYR A CE2 1 
ATOM   1439 C  CZ  . TYR A 1 201 ? -39.704 22.775 5.803   1.00 44.57  ? 292 TYR A CZ  1 
ATOM   1440 O  OH  . TYR A 1 201 ? -39.485 22.912 7.171   1.00 44.68  ? 292 TYR A OH  1 
ATOM   1441 N  N   . HIS A 1 202 ? -38.735 20.456 -0.672  1.00 37.29  ? 293 HIS A N   1 
ATOM   1442 C  CA  . HIS A 1 202 ? -38.855 19.616 -1.854  1.00 33.70  ? 293 HIS A CA  1 
ATOM   1443 C  C   . HIS A 1 202 ? -39.425 18.263 -1.463  1.00 33.82  ? 293 HIS A C   1 
ATOM   1444 O  O   . HIS A 1 202 ? -38.867 17.570 -0.623  1.00 34.34  ? 293 HIS A O   1 
ATOM   1445 C  CB  . HIS A 1 202 ? -37.489 19.408 -2.504  1.00 33.75  ? 293 HIS A CB  1 
ATOM   1446 C  CG  . HIS A 1 202 ? -37.547 18.656 -3.799  1.00 37.54  ? 293 HIS A CG  1 
ATOM   1447 N  ND1 . HIS A 1 202 ? -37.558 19.284 -5.026  1.00 36.21  ? 293 HIS A ND1 1 
ATOM   1448 C  CD2 . HIS A 1 202 ? -37.620 17.328 -4.057  1.00 37.93  ? 293 HIS A CD2 1 
ATOM   1449 C  CE1 . HIS A 1 202 ? -37.625 18.374 -5.981  1.00 40.69  ? 293 HIS A CE1 1 
ATOM   1450 N  NE2 . HIS A 1 202 ? -37.661 17.179 -5.420  1.00 38.37  ? 293 HIS A NE2 1 
ATOM   1451 N  N   . VAL A 1 203 ? -40.540 17.892 -2.071  1.00 33.40  ? 294 VAL A N   1 
ATOM   1452 C  CA  . VAL A 1 203 ? -41.137 16.586 -1.834  1.00 34.61  ? 294 VAL A CA  1 
ATOM   1453 C  C   . VAL A 1 203 ? -40.516 15.535 -2.744  1.00 37.09  ? 294 VAL A C   1 
ATOM   1454 O  O   . VAL A 1 203 ? -40.620 15.632 -3.970  1.00 42.20  ? 294 VAL A O   1 
ATOM   1455 C  CB  . VAL A 1 203 ? -42.634 16.633 -2.120  1.00 32.82  ? 294 VAL A CB  1 
ATOM   1456 C  CG1 . VAL A 1 203 ? -43.304 15.355 -1.662  1.00 36.30  ? 294 VAL A CG1 1 
ATOM   1457 C  CG2 . VAL A 1 203 ? -43.244 17.813 -1.428  1.00 35.91  ? 294 VAL A CG2 1 
ATOM   1458 N  N   . LEU A 1 204 ? -39.881 14.522 -2.169  1.00 36.80  ? 295 LEU A N   1 
ATOM   1459 C  CA  . LEU A 1 204 ? -39.231 13.504 -3.003  1.00 39.56  ? 295 LEU A CA  1 
ATOM   1460 C  C   . LEU A 1 204 ? -40.250 12.479 -3.469  1.00 39.24  ? 295 LEU A C   1 
ATOM   1461 O  O   . LEU A 1 204 ? -40.297 12.143 -4.650  1.00 45.27  ? 295 LEU A O   1 
ATOM   1462 C  CB  . LEU A 1 204 ? -38.091 12.818 -2.268  1.00 39.17  ? 295 LEU A CB  1 
ATOM   1463 C  CG  . LEU A 1 204 ? -37.206 11.937 -3.136  1.00 40.21  ? 295 LEU A CG  1 
ATOM   1464 C  CD1 . LEU A 1 204 ? -36.384 12.819 -4.047  1.00 41.12  ? 295 LEU A CD1 1 
ATOM   1465 C  CD2 . LEU A 1 204 ? -36.305 11.089 -2.250  1.00 41.23  ? 295 LEU A CD2 1 
ATOM   1466 N  N   . TRP A 1 205 ? -41.051 11.985 -2.530  1.00 34.97  ? 296 TRP A N   1 
ATOM   1467 C  CA  . TRP A 1 205 ? -42.308 11.306 -2.838  1.00 36.63  ? 296 TRP A CA  1 
ATOM   1468 C  C   . TRP A 1 205 ? -43.346 11.615 -1.777  1.00 35.72  ? 296 TRP A C   1 
ATOM   1469 O  O   . TRP A 1 205 ? -43.034 12.189 -0.738  1.00 38.99  ? 296 TRP A O   1 
ATOM   1470 C  CB  . TRP A 1 205 ? -42.134 9.796  -2.980  1.00 40.89  ? 296 TRP A CB  1 
ATOM   1471 C  CG  . TRP A 1 205 ? -41.199 9.177  -1.995  1.00 40.37  ? 296 TRP A CG  1 
ATOM   1472 C  CD1 . TRP A 1 205 ? -39.863 8.947  -2.172  1.00 38.61  ? 296 TRP A CD1 1 
ATOM   1473 C  CD2 . TRP A 1 205 ? -41.527 8.670  -0.700  1.00 33.45  ? 296 TRP A CD2 1 
ATOM   1474 N  NE1 . TRP A 1 205 ? -39.344 8.338  -1.067  1.00 45.07  ? 296 TRP A NE1 1 
ATOM   1475 C  CE2 . TRP A 1 205 ? -40.342 8.158  -0.143  1.00 40.75  ? 296 TRP A CE2 1 
ATOM   1476 C  CE3 . TRP A 1 205 ? -42.703 8.602  0.046   1.00 39.78  ? 296 TRP A CE3 1 
ATOM   1477 C  CZ2 . TRP A 1 205 ? -40.294 7.600  1.138   1.00 37.78  ? 296 TRP A CZ2 1 
ATOM   1478 C  CZ3 . TRP A 1 205 ? -42.656 8.035  1.324   1.00 39.04  ? 296 TRP A CZ3 1 
ATOM   1479 C  CH2 . TRP A 1 205 ? -41.461 7.546  1.851   1.00 37.74  ? 296 TRP A CH2 1 
ATOM   1480 N  N   . GLY A 1 206 ? -44.586 11.230 -2.034  1.00 33.45  ? 297 GLY A N   1 
ATOM   1481 C  CA  . GLY A 1 206 ? -45.672 11.583 -1.144  1.00 34.36  ? 297 GLY A CA  1 
ATOM   1482 C  C   . GLY A 1 206 ? -46.202 12.969 -1.452  1.00 36.32  ? 297 GLY A C   1 
ATOM   1483 O  O   . GLY A 1 206 ? -46.082 13.477 -2.556  1.00 40.20  ? 297 GLY A O   1 
ATOM   1484 N  N   . GLU A 1 207 ? -46.794 13.607 -0.469  1.00 38.13  ? 298 GLU A N   1 
ATOM   1485 C  CA  . GLU A 1 207 ? -47.445 14.860 -0.744  1.00 38.65  ? 298 GLU A CA  1 
ATOM   1486 C  C   . GLU A 1 207 ? -47.604 15.581 0.562   1.00 39.74  ? 298 GLU A C   1 
ATOM   1487 O  O   . GLU A 1 207 ? -48.025 14.981 1.556   1.00 45.19  ? 298 GLU A O   1 
ATOM   1488 C  CB  . GLU A 1 207 ? -48.814 14.594 -1.368  1.00 43.02  ? 298 GLU A CB  1 
ATOM   1489 C  CG  . GLU A 1 207 ? -49.494 15.820 -1.955  1.00 43.25  ? 298 GLU A CG  1 
ATOM   1490 C  CD  . GLU A 1 207 ? -50.860 15.509 -2.544  1.00 48.68  ? 298 GLU A CD  1 
ATOM   1491 O  OE1 . GLU A 1 207 ? -51.850 15.550 -1.779  1.00 46.37  ? 298 GLU A OE1 1 
ATOM   1492 O  OE2 . GLU A 1 207 ? -50.945 15.228 -3.770  1.00 53.67  ? 298 GLU A OE2 1 
ATOM   1493 N  N   . LYS A 1 208 ? -47.231 16.855 0.572   1.00 37.36  ? 299 LYS A N   1 
ATOM   1494 C  CA  . LYS A 1 208 ? -47.430 17.715 1.738   1.00 38.82  ? 299 LYS A CA  1 
ATOM   1495 C  C   . LYS A 1 208 ? -48.359 18.824 1.319   1.00 37.49  ? 299 LYS A C   1 
ATOM   1496 O  O   . LYS A 1 208 ? -48.366 19.207 0.156   1.00 42.40  ? 299 LYS A O   1 
ATOM   1497 C  CB  . LYS A 1 208 ? -46.112 18.326 2.206   1.00 35.81  ? 299 LYS A CB  1 
ATOM   1498 C  CG  . LYS A 1 208 ? -45.147 17.331 2.793   1.00 36.00  ? 299 LYS A CG  1 
ATOM   1499 C  CD  . LYS A 1 208 ? -44.046 18.021 3.595   1.00 38.95  ? 299 LYS A CD  1 
ATOM   1500 C  CE  . LYS A 1 208 ? -43.579 17.103 4.695   1.00 36.78  ? 299 LYS A CE  1 
ATOM   1501 N  NZ  . LYS A 1 208 ? -44.782 16.567 5.406   1.00 40.74  ? 299 LYS A NZ  1 
ATOM   1502 N  N   . ILE A 1 209 ? -49.147 19.338 2.248   1.00 33.13  ? 300 ILE A N   1 
ATOM   1503 C  CA  . ILE A 1 209 ? -50.056 20.426 1.935   1.00 31.15  ? 300 ILE A CA  1 
ATOM   1504 C  C   . ILE A 1 209 ? -49.828 21.555 2.923   1.00 34.99  ? 300 ILE A C   1 
ATOM   1505 O  O   . ILE A 1 209 ? -50.049 21.390 4.115   1.00 35.81  ? 300 ILE A O   1 
ATOM   1506 C  CB  . ILE A 1 209 ? -51.509 19.951 2.036   1.00 34.87  ? 300 ILE A CB  1 
ATOM   1507 C  CG1 . ILE A 1 209 ? -51.751 18.766 1.102   1.00 36.58  ? 300 ILE A CG1 1 
ATOM   1508 C  CG2 . ILE A 1 209 ? -52.479 21.080 1.736   1.00 35.61  ? 300 ILE A CG2 1 
ATOM   1509 C  CD1 . ILE A 1 209 ? -53.113 18.118 1.292   1.00 36.38  ? 300 ILE A CD1 1 
ATOM   1510 N  N   . PHE A 1 210 ? -49.370 22.704 2.451   1.00 35.53  ? 301 PHE A N   1 
ATOM   1511 C  CA  . PHE A 1 210 ? -49.126 23.811 3.373   1.00 31.87  ? 301 PHE A CA  1 
ATOM   1512 C  C   . PHE A 1 210 ? -50.338 24.706 3.471   1.00 34.65  ? 301 PHE A C   1 
ATOM   1513 O  O   . PHE A 1 210 ? -51.006 24.976 2.481   1.00 36.73  ? 301 PHE A O   1 
ATOM   1514 C  CB  . PHE A 1 210 ? -47.944 24.659 2.921   1.00 33.02  ? 301 PHE A CB  1 
ATOM   1515 C  CG  . PHE A 1 210 ? -46.621 23.985 3.070   1.00 32.02  ? 301 PHE A CG  1 
ATOM   1516 C  CD1 . PHE A 1 210 ? -45.629 24.554 3.855   1.00 32.76  ? 301 PHE A CD1 1 
ATOM   1517 C  CD2 . PHE A 1 210 ? -46.365 22.791 2.426   1.00 29.60  ? 301 PHE A CD2 1 
ATOM   1518 C  CE1 . PHE A 1 210 ? -44.409 23.948 3.994   1.00 31.53  ? 301 PHE A CE1 1 
ATOM   1519 C  CE2 . PHE A 1 210 ? -45.156 22.179 2.550   1.00 31.08  ? 301 PHE A CE2 1 
ATOM   1520 C  CZ  . PHE A 1 210 ? -44.171 22.755 3.340   1.00 40.41  ? 301 PHE A CZ  1 
ATOM   1521 N  N   . TYR A 1 211 ? -50.611 25.180 4.673   1.00 33.35  ? 302 TYR A N   1 
ATOM   1522 C  CA  . TYR A 1 211 ? -51.644 26.168 4.864   1.00 31.98  ? 302 TYR A CA  1 
ATOM   1523 C  C   . TYR A 1 211 ? -50.924 27.424 5.240   1.00 34.19  ? 302 TYR A C   1 
ATOM   1524 O  O   . TYR A 1 211 ? -50.221 27.442 6.243   1.00 37.60  ? 302 TYR A O   1 
ATOM   1525 C  CB  . TYR A 1 211 ? -52.587 25.719 5.961   1.00 34.68  ? 302 TYR A CB  1 
ATOM   1526 C  CG  . TYR A 1 211 ? -53.176 24.384 5.631   1.00 34.18  ? 302 TYR A CG  1 
ATOM   1527 C  CD1 . TYR A 1 211 ? -54.410 24.281 5.006   1.00 38.20  ? 302 TYR A CD1 1 
ATOM   1528 C  CD2 . TYR A 1 211 ? -52.474 23.227 5.891   1.00 32.94  ? 302 TYR A CD2 1 
ATOM   1529 C  CE1 . TYR A 1 211 ? -54.939 23.046 4.681   1.00 40.19  ? 302 TYR A CE1 1 
ATOM   1530 C  CE2 . TYR A 1 211 ? -52.987 21.998 5.576   1.00 36.55  ? 302 TYR A CE2 1 
ATOM   1531 C  CZ  . TYR A 1 211 ? -54.218 21.904 4.972   1.00 39.42  ? 302 TYR A CZ  1 
ATOM   1532 O  OH  . TYR A 1 211 ? -54.716 20.660 4.661   1.00 37.06  ? 302 TYR A OH  1 
ATOM   1533 N  N   . LEU A 1 212 ? -51.071 28.466 4.425   1.00 33.41  ? 303 LEU A N   1 
ATOM   1534 C  CA  . LEU A 1 212 ? -50.222 29.641 4.545   1.00 30.81  ? 303 LEU A CA  1 
ATOM   1535 C  C   . LEU A 1 212 ? -50.986 30.904 4.851   1.00 31.83  ? 303 LEU A C   1 
ATOM   1536 O  O   . LEU A 1 212 ? -52.044 31.168 4.295   1.00 33.74  ? 303 LEU A O   1 
ATOM   1537 C  CB  . LEU A 1 212 ? -49.427 29.835 3.275   1.00 27.56  ? 303 LEU A CB  1 
ATOM   1538 C  CG  . LEU A 1 212 ? -48.592 28.626 2.890   1.00 33.15  ? 303 LEU A CG  1 
ATOM   1539 C  CD1 . LEU A 1 212 ? -48.595 28.471 1.359   1.00 38.36  ? 303 LEU A CD1 1 
ATOM   1540 C  CD2 . LEU A 1 212 ? -47.179 28.755 3.441   1.00 24.84  ? 303 LEU A CD2 1 
ATOM   1541 N  N   . ILE A 1 213 ? -50.415 31.697 5.735   1.00 31.67  ? 304 ILE A N   1 
ATOM   1542 C  CA  . ILE A 1 213 ? -51.063 32.884 6.229   1.00 32.26  ? 304 ILE A CA  1 
ATOM   1543 C  C   . ILE A 1 213 ? -50.088 34.038 6.130   1.00 32.13  ? 304 ILE A C   1 
ATOM   1544 O  O   . ILE A 1 213 ? -49.006 34.001 6.695   1.00 35.78  ? 304 ILE A O   1 
ATOM   1545 C  CB  . ILE A 1 213 ? -51.561 32.677 7.687   1.00 27.50  ? 304 ILE A CB  1 
ATOM   1546 C  CG1 . ILE A 1 213 ? -52.700 31.664 7.683   1.00 30.65  ? 304 ILE A CG1 1 
ATOM   1547 C  CG2 . ILE A 1 213 ? -52.045 33.977 8.284   1.00 28.21  ? 304 ILE A CG2 1 
ATOM   1548 C  CD1 . ILE A 1 213 ? -53.170 31.238 9.027   1.00 34.14  ? 304 ILE A CD1 1 
ATOM   1549 N  N   . LYS A 1 214 ? -50.476 35.054 5.382   1.00 34.61  ? 305 LYS A N   1 
ATOM   1550 C  CA  . LYS A 1 214 ? -49.691 36.265 5.236   1.00 34.73  ? 305 LYS A CA  1 
ATOM   1551 C  C   . LYS A 1 214 ? -49.381 36.945 6.580   1.00 30.93  ? 305 LYS A C   1 
ATOM   1552 O  O   . LYS A 1 214 ? -50.252 37.085 7.428   1.00 32.27  ? 305 LYS A O   1 
ATOM   1553 C  CB  . LYS A 1 214 ? -50.458 37.221 4.310   1.00 39.19  ? 305 LYS A CB  1 
ATOM   1554 C  CG  . LYS A 1 214 ? -49.717 38.491 3.935   1.00 46.45  ? 305 LYS A CG  1 
ATOM   1555 C  CD  . LYS A 1 214 ? -50.476 39.315 2.892   1.00 50.86  ? 305 LYS A CD  1 
ATOM   1556 C  CE  . LYS A 1 214 ? -49.681 40.577 2.547   1.00 61.55  ? 305 LYS A CE  1 
ATOM   1557 N  NZ  . LYS A 1 214 ? -50.334 41.438 1.531   1.00 66.62  ? 305 LYS A NZ  1 
ATOM   1558 N  N   . PRO A 1 215 ? -48.133 37.395 6.764   1.00 35.07  ? 306 PRO A N   1 
ATOM   1559 C  CA  . PRO A 1 215 ? -47.679 38.126 7.956   1.00 33.25  ? 306 PRO A CA  1 
ATOM   1560 C  C   . PRO A 1 215 ? -48.139 39.575 7.995   1.00 34.25  ? 306 PRO A C   1 
ATOM   1561 O  O   . PRO A 1 215 ? -47.302 40.454 8.178   1.00 36.83  ? 306 PRO A O   1 
ATOM   1562 C  CB  . PRO A 1 215 ? -46.149 38.146 7.810   1.00 33.14  ? 306 PRO A CB  1 
ATOM   1563 C  CG  . PRO A 1 215 ? -45.815 37.268 6.694   1.00 33.01  ? 306 PRO A CG  1 
ATOM   1564 C  CD  . PRO A 1 215 ? -47.032 37.159 5.819   1.00 37.81  ? 306 PRO A CD  1 
ATOM   1565 N  N   . THR A 1 216 ? -49.426 39.839 7.820   1.00 36.06  ? 307 THR A N   1 
ATOM   1566 C  CA  . THR A 1 216 ? -49.927 41.196 8.003   1.00 35.64  ? 307 THR A CA  1 
ATOM   1567 C  C   . THR A 1 216 ? -49.782 41.504 9.484   1.00 37.35  ? 307 THR A C   1 
ATOM   1568 O  O   . THR A 1 216 ? -49.445 40.625 10.269  1.00 38.90  ? 307 THR A O   1 
ATOM   1569 C  CB  . THR A 1 216 ? -51.391 41.284 7.640   1.00 38.21  ? 307 THR A CB  1 
ATOM   1570 O  OG1 . THR A 1 216 ? -52.142 40.456 8.538   1.00 41.81  ? 307 THR A OG1 1 
ATOM   1571 C  CG2 . THR A 1 216 ? -51.611 40.814 6.202   1.00 28.26  ? 307 THR A CG2 1 
ATOM   1572 N  N   . ASP A 1 217 ? -50.036 42.729 9.898   1.00 38.18  ? 308 ASP A N   1 
ATOM   1573 C  CA  . ASP A 1 217 ? -49.924 43.002 11.326  1.00 38.01  ? 308 ASP A CA  1 
ATOM   1574 C  C   . ASP A 1 217 ? -51.096 42.393 12.093  1.00 40.17  ? 308 ASP A C   1 
ATOM   1575 O  O   . ASP A 1 217 ? -50.924 41.861 13.199  1.00 37.89  ? 308 ASP A O   1 
ATOM   1576 C  CB  . ASP A 1 217 ? -49.762 44.493 11.578  1.00 34.00  ? 308 ASP A CB  1 
ATOM   1577 C  CG  . ASP A 1 217 ? -48.462 45.024 11.002  1.00 46.37  ? 308 ASP A CG  1 
ATOM   1578 O  OD1 . ASP A 1 217 ? -48.093 46.188 11.277  1.00 44.42  ? 308 ASP A OD1 1 
ATOM   1579 O  OD2 . ASP A 1 217 ? -47.799 44.250 10.273  1.00 52.61  ? 308 ASP A OD2 1 
ATOM   1580 N  N   . GLU A 1 218 ? -52.277 42.439 11.477  1.00 38.45  ? 309 GLU A N   1 
ATOM   1581 C  CA  . GLU A 1 218 ? -53.462 41.812 12.042  1.00 40.46  ? 309 GLU A CA  1 
ATOM   1582 C  C   . GLU A 1 218 ? -53.112 40.374 12.386  1.00 42.00  ? 309 GLU A C   1 
ATOM   1583 O  O   . GLU A 1 218 ? -53.288 39.918 13.522  1.00 39.45  ? 309 GLU A O   1 
ATOM   1584 C  CB  . GLU A 1 218 ? -54.617 41.844 11.041  1.00 38.68  ? 309 GLU A CB  1 
ATOM   1585 C  CG  . GLU A 1 218 ? -55.980 41.538 11.639  1.00 48.88  ? 309 GLU A CG  1 
ATOM   1586 C  CD  . GLU A 1 218 ? -57.125 41.717 10.633  1.00 56.90  ? 309 GLU A CD  1 
ATOM   1587 O  OE1 . GLU A 1 218 ? -57.054 41.109 9.547   1.00 54.59  ? 309 GLU A OE1 1 
ATOM   1588 O  OE2 . GLU A 1 218 ? -58.093 42.462 10.927  1.00 57.57  ? 309 GLU A OE2 1 
ATOM   1589 N  N   . ASN A 1 219 ? -52.575 39.665 11.403  1.00 39.59  ? 310 ASN A N   1 
ATOM   1590 C  CA  . ASN A 1 219 ? -52.283 38.260 11.601  1.00 41.11  ? 310 ASN A CA  1 
ATOM   1591 C  C   . ASN A 1 219 ? -51.158 37.964 12.614  1.00 43.45  ? 310 ASN A C   1 
ATOM   1592 O  O   . ASN A 1 219 ? -51.346 37.144 13.524  1.00 40.28  ? 310 ASN A O   1 
ATOM   1593 C  CB  . ASN A 1 219 ? -52.088 37.564 10.260  1.00 36.10  ? 310 ASN A CB  1 
ATOM   1594 C  CG  . ASN A 1 219 ? -53.332 37.621 9.403   1.00 37.00  ? 310 ASN A CG  1 
ATOM   1595 O  OD1 . ASN A 1 219 ? -54.405 37.976 9.878   1.00 36.41  ? 310 ASN A OD1 1 
ATOM   1596 N  ND2 . ASN A 1 219 ? -53.196 37.266 8.132   1.00 36.72  ? 310 ASN A ND2 1 
ATOM   1597 N  N   . LEU A 1 220 ? -50.012 38.628 12.486  1.00 36.80  ? 311 LEU A N   1 
ATOM   1598 C  CA  . LEU A 1 220 ? -48.940 38.396 13.447  1.00 37.27  ? 311 LEU A CA  1 
ATOM   1599 C  C   . LEU A 1 220 ? -49.467 38.548 14.855  1.00 39.19  ? 311 LEU A C   1 
ATOM   1600 O  O   . LEU A 1 220 ? -49.375 37.626 15.654  1.00 41.17  ? 311 LEU A O   1 
ATOM   1601 C  CB  . LEU A 1 220 ? -47.770 39.348 13.240  1.00 37.27  ? 311 LEU A CB  1 
ATOM   1602 C  CG  . LEU A 1 220 ? -46.931 39.031 12.016  1.00 37.96  ? 311 LEU A CG  1 
ATOM   1603 C  CD1 . LEU A 1 220 ? -45.971 40.161 11.754  1.00 39.12  ? 311 LEU A CD1 1 
ATOM   1604 C  CD2 . LEU A 1 220 ? -46.221 37.707 12.206  1.00 35.38  ? 311 LEU A CD2 1 
ATOM   1605 N  N   . ALA A 1 221 ? -50.022 39.716 15.152  1.00 41.10  ? 312 ALA A N   1 
ATOM   1606 C  CA  . ALA A 1 221 ? -50.601 39.972 16.463  1.00 32.07  ? 312 ALA A CA  1 
ATOM   1607 C  C   . ALA A 1 221 ? -51.546 38.847 16.880  1.00 38.04  ? 312 ALA A C   1 
ATOM   1608 O  O   . ALA A 1 221 ? -51.427 38.303 17.985  1.00 43.83  ? 312 ALA A O   1 
ATOM   1609 C  CB  . ALA A 1 221 ? -51.315 41.320 16.484  1.00 28.46  ? 312 ALA A CB  1 
ATOM   1610 N  N   . ARG A 1 222 ? -52.479 38.480 16.003  1.00 40.47  ? 313 ARG A N   1 
ATOM   1611 C  CA  . ARG A 1 222 ? -53.415 37.403 16.329  1.00 39.37  ? 313 ARG A CA  1 
ATOM   1612 C  C   . ARG A 1 222 ? -52.674 36.090 16.600  1.00 41.44  ? 313 ARG A C   1 
ATOM   1613 O  O   . ARG A 1 222 ? -53.159 35.238 17.335  1.00 43.28  ? 313 ARG A O   1 
ATOM   1614 C  CB  . ARG A 1 222 ? -54.488 37.228 15.245  1.00 33.83  ? 313 ARG A CB  1 
ATOM   1615 C  CG  . ARG A 1 222 ? -55.458 38.403 15.153  1.00 41.76  ? 313 ARG A CG  1 
ATOM   1616 C  CD  . ARG A 1 222 ? -56.573 38.186 14.130  1.00 41.66  ? 313 ARG A CD  1 
ATOM   1617 N  NE  . ARG A 1 222 ? -57.315 39.418 13.872  1.00 45.92  ? 313 ARG A NE  1 
ATOM   1618 C  CZ  . ARG A 1 222 ? -58.298 39.545 12.979  1.00 53.90  ? 313 ARG A CZ  1 
ATOM   1619 N  NH1 . ARG A 1 222 ? -58.684 38.513 12.240  1.00 51.20  ? 313 ARG A NH1 1 
ATOM   1620 N  NH2 . ARG A 1 222 ? -58.902 40.717 12.820  1.00 55.67  ? 313 ARG A NH2 1 
ATOM   1621 N  N   . TYR A 1 223 ? -51.491 35.937 16.019  1.00 39.76  ? 314 TYR A N   1 
ATOM   1622 C  CA  . TYR A 1 223 ? -50.755 34.689 16.148  1.00 38.30  ? 314 TYR A CA  1 
ATOM   1623 C  C   . TYR A 1 223 ? -50.040 34.649 17.482  1.00 37.79  ? 314 TYR A C   1 
ATOM   1624 O  O   . TYR A 1 223 ? -49.978 33.607 18.149  1.00 37.49  ? 314 TYR A O   1 
ATOM   1625 C  CB  . TYR A 1 223 ? -49.766 34.530 14.993  1.00 36.50  ? 314 TYR A CB  1 
ATOM   1626 C  CG  . TYR A 1 223 ? -48.733 33.464 15.213  1.00 33.28  ? 314 TYR A CG  1 
ATOM   1627 C  CD1 . TYR A 1 223 ? -48.991 32.143 14.879  1.00 34.72  ? 314 TYR A CD1 1 
ATOM   1628 C  CD2 . TYR A 1 223 ? -47.491 33.781 15.750  1.00 34.02  ? 314 TYR A CD2 1 
ATOM   1629 C  CE1 . TYR A 1 223 ? -48.039 31.158 15.078  1.00 36.37  ? 314 TYR A CE1 1 
ATOM   1630 C  CE2 . TYR A 1 223 ? -46.537 32.817 15.954  1.00 35.62  ? 314 TYR A CE2 1 
ATOM   1631 C  CZ  . TYR A 1 223 ? -46.810 31.503 15.617  1.00 38.48  ? 314 TYR A CZ  1 
ATOM   1632 O  OH  . TYR A 1 223 ? -45.849 30.535 15.818  1.00 39.90  ? 314 TYR A OH  1 
ATOM   1633 N  N   . GLU A 1 224 ? -49.497 35.790 17.877  1.00 35.13  ? 315 GLU A N   1 
ATOM   1634 C  CA  . GLU A 1 224 ? -48.879 35.872 19.177  1.00 40.61  ? 315 GLU A CA  1 
ATOM   1635 C  C   . GLU A 1 224 ? -49.923 35.607 20.273  1.00 41.22  ? 315 GLU A C   1 
ATOM   1636 O  O   . GLU A 1 224 ? -49.647 34.909 21.237  1.00 36.10  ? 315 GLU A O   1 
ATOM   1637 C  CB  . GLU A 1 224 ? -48.204 37.219 19.378  1.00 41.66  ? 315 GLU A CB  1 
ATOM   1638 C  CG  . GLU A 1 224 ? -47.453 37.308 20.699  1.00 38.73  ? 315 GLU A CG  1 
ATOM   1639 C  CD  . GLU A 1 224 ? -46.612 38.550 20.783  1.00 38.37  ? 315 GLU A CD  1 
ATOM   1640 O  OE1 . GLU A 1 224 ? -45.912 38.722 21.793  1.00 42.20  ? 315 GLU A OE1 1 
ATOM   1641 O  OE2 . GLU A 1 224 ? -46.645 39.358 19.832  1.00 45.43  ? 315 GLU A OE2 1 
ATOM   1642 N  N   . SER A 1 225 ? -51.121 36.153 20.104  1.00 38.85  ? 316 SER A N   1 
ATOM   1643 C  CA  . SER A 1 225 ? -52.200 35.918 21.047  1.00 37.34  ? 316 SER A CA  1 
ATOM   1644 C  C   . SER A 1 225 ? -52.542 34.445 21.144  1.00 39.67  ? 316 SER A C   1 
ATOM   1645 O  O   . SER A 1 225 ? -52.574 33.865 22.230  1.00 45.18  ? 316 SER A O   1 
ATOM   1646 C  CB  . SER A 1 225 ? -53.450 36.696 20.644  1.00 38.32  ? 316 SER A CB  1 
ATOM   1647 O  OG  . SER A 1 225 ? -53.595 37.838 21.457  1.00 43.38  ? 316 SER A OG  1 
ATOM   1648 N  N   . TRP A 1 226 ? -52.821 33.844 20.002  1.00 37.68  ? 317 TRP A N   1 
ATOM   1649 C  CA  . TRP A 1 226 ? -53.227 32.451 19.952  1.00 36.55  ? 317 TRP A CA  1 
ATOM   1650 C  C   . TRP A 1 226 ? -52.113 31.577 20.500  1.00 36.34  ? 317 TRP A C   1 
ATOM   1651 O  O   . TRP A 1 226 ? -52.363 30.547 21.099  1.00 36.55  ? 317 TRP A O   1 
ATOM   1652 C  CB  . TRP A 1 226 ? -53.540 32.100 18.503  1.00 34.53  ? 317 TRP A CB  1 
ATOM   1653 C  CG  . TRP A 1 226 ? -53.695 30.652 18.147  1.00 33.77  ? 317 TRP A CG  1 
ATOM   1654 C  CD1 . TRP A 1 226 ? -54.833 29.897 18.236  1.00 31.84  ? 317 TRP A CD1 1 
ATOM   1655 C  CD2 . TRP A 1 226 ? -52.699 29.808 17.566  1.00 34.24  ? 317 TRP A CD2 1 
ATOM   1656 N  NE1 . TRP A 1 226 ? -54.600 28.632 17.763  1.00 32.73  ? 317 TRP A NE1 1 
ATOM   1657 C  CE2 . TRP A 1 226 ? -53.296 28.547 17.350  1.00 34.75  ? 317 TRP A CE2 1 
ATOM   1658 C  CE3 . TRP A 1 226 ? -51.355 29.992 17.216  1.00 35.86  ? 317 TRP A CE3 1 
ATOM   1659 C  CZ2 . TRP A 1 226 ? -52.595 27.467 16.800  1.00 36.86  ? 317 TRP A CZ2 1 
ATOM   1660 C  CZ3 . TRP A 1 226 ? -50.656 28.918 16.660  1.00 35.64  ? 317 TRP A CZ3 1 
ATOM   1661 C  CH2 . TRP A 1 226 ? -51.277 27.669 16.468  1.00 35.26  ? 317 TRP A CH2 1 
ATOM   1662 N  N   . SER A 1 227 ? -50.874 32.000 20.291  1.00 38.96  ? 318 SER A N   1 
ATOM   1663 C  CA  . SER A 1 227 ? -49.725 31.195 20.683  1.00 39.64  ? 318 SER A CA  1 
ATOM   1664 C  C   . SER A 1 227 ? -49.622 31.063 22.199  1.00 39.60  ? 318 SER A C   1 
ATOM   1665 O  O   . SER A 1 227 ? -49.115 30.068 22.714  1.00 40.25  ? 318 SER A O   1 
ATOM   1666 C  CB  . SER A 1 227 ? -48.446 31.809 20.126  1.00 37.87  ? 318 SER A CB  1 
ATOM   1667 O  OG  . SER A 1 227 ? -47.709 30.842 19.423  1.00 40.39  ? 318 SER A OG  1 
ATOM   1668 N  N   . SER A 1 228 ? -50.119 32.077 22.898  1.00 37.95  ? 319 SER A N   1 
ATOM   1669 C  CA  . SER A 1 228 ? -50.048 32.144 24.345  1.00 42.98  ? 319 SER A CA  1 
ATOM   1670 C  C   . SER A 1 228 ? -51.436 32.074 24.995  1.00 43.81  ? 319 SER A C   1 
ATOM   1671 O  O   . SER A 1 228 ? -51.650 32.552 26.106  1.00 49.78  ? 319 SER A O   1 
ATOM   1672 C  CB  . SER A 1 228 ? -49.281 33.401 24.776  1.00 47.61  ? 319 SER A CB  1 
ATOM   1673 O  OG  . SER A 1 228 ? -49.741 34.561 24.105  1.00 43.31  ? 319 SER A OG  1 
ATOM   1674 N  N   . SER A 1 229 ? -52.376 31.488 24.273  1.00 39.51  ? 320 SER A N   1 
ATOM   1675 C  CA  . SER A 1 229 ? -53.680 31.174 24.800  1.00 39.87  ? 320 SER A CA  1 
ATOM   1676 C  C   . SER A 1 229 ? -53.612 29.700 25.160  1.00 52.03  ? 320 SER A C   1 
ATOM   1677 O  O   . SER A 1 229 ? -52.934 28.918 24.483  1.00 54.13  ? 320 SER A O   1 
ATOM   1678 C  CB  . SER A 1 229 ? -54.754 31.407 23.732  1.00 46.82  ? 320 SER A CB  1 
ATOM   1679 O  OG  . SER A 1 229 ? -54.778 30.382 22.737  1.00 49.62  ? 320 SER A OG  1 
ATOM   1680 N  N   . VAL A 1 230 ? -54.302 29.305 26.222  1.00 53.33  ? 321 VAL A N   1 
ATOM   1681 C  CA  . VAL A 1 230 ? -54.237 27.915 26.648  1.00 58.16  ? 321 VAL A CA  1 
ATOM   1682 C  C   . VAL A 1 230 ? -55.150 27.063 25.765  1.00 60.09  ? 321 VAL A C   1 
ATOM   1683 O  O   . VAL A 1 230 ? -55.020 25.829 25.712  1.00 57.00  ? 321 VAL A O   1 
ATOM   1684 C  CB  . VAL A 1 230 ? -54.622 27.753 28.132  1.00 59.19  ? 321 VAL A CB  1 
ATOM   1685 C  CG1 . VAL A 1 230 ? -56.127 27.962 28.319  1.00 51.33  ? 321 VAL A CG1 1 
ATOM   1686 C  CG2 . VAL A 1 230 ? -54.158 26.386 28.650  1.00 47.44  ? 321 VAL A CG2 1 
ATOM   1687 N  N   . THR A 1 231 ? -56.064 27.737 25.064  1.00 57.67  ? 322 THR A N   1 
ATOM   1688 C  CA  . THR A 1 231 ? -56.952 27.072 24.116  1.00 55.54  ? 322 THR A CA  1 
ATOM   1689 C  C   . THR A 1 231 ? -56.300 26.814 22.756  1.00 48.00  ? 322 THR A C   1 
ATOM   1690 O  O   . THR A 1 231 ? -56.943 26.270 21.869  1.00 48.11  ? 322 THR A O   1 
ATOM   1691 C  CB  . THR A 1 231 ? -58.292 27.830 23.925  1.00 53.61  ? 322 THR A CB  1 
ATOM   1692 O  OG1 . THR A 1 231 ? -58.064 29.242 23.954  1.00 56.63  ? 322 THR A OG1 1 
ATOM   1693 C  CG2 . THR A 1 231 ? -59.270 27.469 25.032  1.00 55.47  ? 322 THR A CG2 1 
ATOM   1694 N  N   . GLN A 1 232 ? -55.029 27.180 22.605  1.00 44.42  ? 323 GLN A N   1 
ATOM   1695 C  CA  . GLN A 1 232 ? -54.332 27.009 21.328  1.00 43.09  ? 323 GLN A CA  1 
ATOM   1696 C  C   . GLN A 1 232 ? -54.627 25.714 20.552  1.00 40.86  ? 323 GLN A C   1 
ATOM   1697 O  O   . GLN A 1 232 ? -54.866 25.757 19.353  1.00 44.18  ? 323 GLN A O   1 
ATOM   1698 C  CB  . GLN A 1 232 ? -52.819 27.169 21.474  1.00 42.61  ? 323 GLN A CB  1 
ATOM   1699 C  CG  . GLN A 1 232 ? -52.061 26.412 20.397  1.00 38.01  ? 323 GLN A CG  1 
ATOM   1700 C  CD  . GLN A 1 232 ? -50.582 26.779 20.298  1.00 47.06  ? 323 GLN A CD  1 
ATOM   1701 O  OE1 . GLN A 1 232 ? -50.156 27.840 20.748  1.00 49.47  ? 323 GLN A OE1 1 
ATOM   1702 N  NE2 . GLN A 1 232 ? -49.795 25.895 19.691  1.00 52.71  ? 323 GLN A NE2 1 
ATOM   1703 N  N   . SER A 1 233 ? -54.611 24.565 21.204  1.00 42.29  ? 324 SER A N   1 
ATOM   1704 C  CA  . SER A 1 233 ? -54.730 23.316 20.456  1.00 40.29  ? 324 SER A CA  1 
ATOM   1705 C  C   . SER A 1 233 ? -56.186 22.925 20.135  1.00 44.10  ? 324 SER A C   1 
ATOM   1706 O  O   . SER A 1 233 ? -56.436 21.928 19.443  1.00 42.49  ? 324 SER A O   1 
ATOM   1707 C  CB  . SER A 1 233 ? -54.003 22.185 21.193  1.00 48.63  ? 324 SER A CB  1 
ATOM   1708 O  OG  . SER A 1 233 ? -54.600 21.942 22.457  1.00 52.50  ? 324 SER A OG  1 
ATOM   1709 N  N   . GLU A 1 234 ? -57.133 23.715 20.641  1.00 44.68  ? 325 GLU A N   1 
ATOM   1710 C  CA  . GLU A 1 234 ? -58.564 23.492 20.431  1.00 44.76  ? 325 GLU A CA  1 
ATOM   1711 C  C   . GLU A 1 234 ? -59.123 24.519 19.455  1.00 45.19  ? 325 GLU A C   1 
ATOM   1712 O  O   . GLU A 1 234 ? -60.290 24.447 19.060  1.00 44.15  ? 325 GLU A O   1 
ATOM   1713 C  CB  . GLU A 1 234 ? -59.334 23.623 21.747  1.00 50.62  ? 325 GLU A CB  1 
ATOM   1714 C  CG  . GLU A 1 234 ? -58.962 22.624 22.837  1.00 57.68  ? 325 GLU A CG  1 
ATOM   1715 C  CD  . GLU A 1 234 ? -59.314 23.133 24.223  1.00 62.58  ? 325 GLU A CD  1 
ATOM   1716 O  OE1 . GLU A 1 234 ? -58.398 23.207 25.075  1.00 68.70  ? 325 GLU A OE1 1 
ATOM   1717 O  OE2 . GLU A 1 234 ? -60.498 23.473 24.459  1.00 67.25  ? 325 GLU A OE2 1 
ATOM   1718 N  N   . VAL A 1 235 ? -58.284 25.487 19.099  1.00 41.33  ? 326 VAL A N   1 
ATOM   1719 C  CA  . VAL A 1 235 ? -58.642 26.550 18.165  1.00 37.99  ? 326 VAL A CA  1 
ATOM   1720 C  C   . VAL A 1 235 ? -57.779 26.466 16.917  1.00 37.82  ? 326 VAL A C   1 
ATOM   1721 O  O   . VAL A 1 235 ? -56.547 26.546 16.993  1.00 36.23  ? 326 VAL A O   1 
ATOM   1722 C  CB  . VAL A 1 235 ? -58.426 27.935 18.784  1.00 36.78  ? 326 VAL A CB  1 
ATOM   1723 C  CG1 . VAL A 1 235 ? -58.398 28.999 17.709  1.00 32.12  ? 326 VAL A CG1 1 
ATOM   1724 C  CG2 . VAL A 1 235 ? -59.495 28.230 19.816  1.00 38.86  ? 326 VAL A CG2 1 
ATOM   1725 N  N   . PHE A 1 236 ? -58.437 26.295 15.773  1.00 39.12  ? 327 PHE A N   1 
ATOM   1726 C  CA  . PHE A 1 236 ? -57.770 26.250 14.487  1.00 37.92  ? 327 PHE A CA  1 
ATOM   1727 C  C   . PHE A 1 236 ? -57.473 27.674 14.036  1.00 42.54  ? 327 PHE A C   1 
ATOM   1728 O  O   . PHE A 1 236 ? -58.385 28.436 13.697  1.00 42.88  ? 327 PHE A O   1 
ATOM   1729 C  CB  . PHE A 1 236 ? -58.637 25.532 13.465  1.00 37.83  ? 327 PHE A CB  1 
ATOM   1730 C  CG  . PHE A 1 236 ? -58.018 25.454 12.099  1.00 42.39  ? 327 PHE A CG  1 
ATOM   1731 C  CD1 . PHE A 1 236 ? -57.008 24.544 11.832  1.00 38.08  ? 327 PHE A CD1 1 
ATOM   1732 C  CD2 . PHE A 1 236 ? -58.450 26.282 11.078  1.00 43.41  ? 327 PHE A CD2 1 
ATOM   1733 C  CE1 . PHE A 1 236 ? -56.427 24.470 10.589  1.00 36.84  ? 327 PHE A CE1 1 
ATOM   1734 C  CE2 . PHE A 1 236 ? -57.878 26.205 9.817   1.00 44.13  ? 327 PHE A CE2 1 
ATOM   1735 C  CZ  . PHE A 1 236 ? -56.866 25.295 9.573   1.00 41.30  ? 327 PHE A CZ  1 
ATOM   1736 N  N   . PHE A 1 237 ? -56.191 28.032 14.051  1.00 38.49  ? 328 PHE A N   1 
ATOM   1737 C  CA  . PHE A 1 237 ? -55.783 29.407 13.811  1.00 37.29  ? 328 PHE A CA  1 
ATOM   1738 C  C   . PHE A 1 237 ? -56.134 29.918 12.413  1.00 39.00  ? 328 PHE A C   1 
ATOM   1739 O  O   . PHE A 1 237 ? -56.172 31.122 12.171  1.00 40.98  ? 328 PHE A O   1 
ATOM   1740 C  CB  . PHE A 1 237 ? -54.301 29.586 14.095  1.00 34.89  ? 328 PHE A CB  1 
ATOM   1741 C  CG  . PHE A 1 237 ? -53.814 30.966 13.837  1.00 36.10  ? 328 PHE A CG  1 
ATOM   1742 C  CD1 . PHE A 1 237 ? -53.989 31.960 14.789  1.00 32.63  ? 328 PHE A CD1 1 
ATOM   1743 C  CD2 . PHE A 1 237 ? -53.197 31.283 12.618  1.00 35.88  ? 328 PHE A CD2 1 
ATOM   1744 C  CE1 . PHE A 1 237 ? -53.539 33.259 14.553  1.00 36.10  ? 328 PHE A CE1 1 
ATOM   1745 C  CE2 . PHE A 1 237 ? -52.743 32.570 12.364  1.00 33.89  ? 328 PHE A CE2 1 
ATOM   1746 C  CZ  . PHE A 1 237 ? -52.912 33.566 13.341  1.00 39.21  ? 328 PHE A CZ  1 
ATOM   1747 N  N   . GLY A 1 238 ? -56.401 29.005 11.492  1.00 41.81  ? 329 GLY A N   1 
ATOM   1748 C  CA  . GLY A 1 238 ? -56.886 29.394 10.176  1.00 45.17  ? 329 GLY A CA  1 
ATOM   1749 C  C   . GLY A 1 238 ? -58.202 30.171 10.228  1.00 49.54  ? 329 GLY A C   1 
ATOM   1750 O  O   . GLY A 1 238 ? -58.442 31.054 9.402   1.00 53.39  ? 329 GLY A O   1 
ATOM   1751 N  N   . ASP A 1 239 ? -59.053 29.844 11.197  1.00 45.85  ? 330 ASP A N   1 
ATOM   1752 C  CA  . ASP A 1 239 ? -60.341 30.509 11.351  1.00 47.63  ? 330 ASP A CA  1 
ATOM   1753 C  C   . ASP A 1 239 ? -60.183 31.945 11.819  1.00 48.23  ? 330 ASP A C   1 
ATOM   1754 O  O   . ASP A 1 239 ? -61.132 32.718 11.757  1.00 52.12  ? 330 ASP A O   1 
ATOM   1755 C  CB  . ASP A 1 239 ? -61.216 29.779 12.377  1.00 50.73  ? 330 ASP A CB  1 
ATOM   1756 C  CG  . ASP A 1 239 ? -61.632 28.398 11.921  1.00 54.55  ? 330 ASP A CG  1 
ATOM   1757 O  OD1 . ASP A 1 239 ? -61.857 27.533 12.802  1.00 58.42  ? 330 ASP A OD1 1 
ATOM   1758 O  OD2 . ASP A 1 239 ? -61.732 28.182 10.691  1.00 54.48  ? 330 ASP A OD2 1 
ATOM   1759 N  N   . LYS A 1 240 ? -58.995 32.298 12.296  1.00 45.05  ? 331 LYS A N   1 
ATOM   1760 C  CA  . LYS A 1 240 ? -58.804 33.573 12.985  1.00 45.24  ? 331 LYS A CA  1 
ATOM   1761 C  C   . LYS A 1 240 ? -58.319 34.688 12.069  1.00 47.46  ? 331 LYS A C   1 
ATOM   1762 O  O   . LYS A 1 240 ? -58.121 35.817 12.517  1.00 46.06  ? 331 LYS A O   1 
ATOM   1763 C  CB  . LYS A 1 240 ? -57.823 33.415 14.153  1.00 43.61  ? 331 LYS A CB  1 
ATOM   1764 C  CG  . LYS A 1 240 ? -58.333 32.532 15.281  1.00 46.22  ? 331 LYS A CG  1 
ATOM   1765 C  CD  . LYS A 1 240 ? -59.560 33.139 15.941  1.00 47.07  ? 331 LYS A CD  1 
ATOM   1766 C  CE  . LYS A 1 240 ? -59.701 32.664 17.378  1.00 59.51  ? 331 LYS A CE  1 
ATOM   1767 N  NZ  . LYS A 1 240 ? -60.491 33.620 18.202  1.00 65.35  ? 331 LYS A NZ  1 
ATOM   1768 N  N   . VAL A 1 241 ? -58.113 34.362 10.797  1.00 43.43  ? 332 VAL A N   1 
ATOM   1769 C  CA  . VAL A 1 241 ? -57.615 35.321 9.823   1.00 41.99  ? 332 VAL A CA  1 
ATOM   1770 C  C   . VAL A 1 241 ? -58.484 35.244 8.571   1.00 44.99  ? 332 VAL A C   1 
ATOM   1771 O  O   . VAL A 1 241 ? -59.153 34.231 8.340   1.00 46.66  ? 332 VAL A O   1 
ATOM   1772 C  CB  . VAL A 1 241 ? -56.139 35.029 9.453   1.00 41.51  ? 332 VAL A CB  1 
ATOM   1773 C  CG1 . VAL A 1 241 ? -55.249 35.135 10.675  1.00 35.05  ? 332 VAL A CG1 1 
ATOM   1774 C  CG2 . VAL A 1 241 ? -56.002 33.645 8.811   1.00 38.24  ? 332 VAL A CG2 1 
ATOM   1775 N  N   . ASP A 1 242 ? -58.463 36.298 7.755   1.00 46.91  ? 333 ASP A N   1 
ATOM   1776 C  CA  . ASP A 1 242 ? -59.319 36.367 6.567   1.00 41.53  ? 333 ASP A CA  1 
ATOM   1777 C  C   . ASP A 1 242 ? -58.913 35.351 5.522   1.00 42.68  ? 333 ASP A C   1 
ATOM   1778 O  O   . ASP A 1 242 ? -59.764 34.709 4.902   1.00 44.37  ? 333 ASP A O   1 
ATOM   1779 C  CB  . ASP A 1 242 ? -59.289 37.754 5.939   1.00 41.35  ? 333 ASP A CB  1 
ATOM   1780 C  CG  . ASP A 1 242 ? -59.630 38.849 6.921   1.00 52.77  ? 333 ASP A CG  1 
ATOM   1781 O  OD1 . ASP A 1 242 ? -58.872 39.844 6.940   1.00 53.29  ? 333 ASP A OD1 1 
ATOM   1782 O  OD2 . ASP A 1 242 ? -60.643 38.720 7.660   1.00 54.61  ? 333 ASP A OD2 1 
ATOM   1783 N  N   . LYS A 1 243 ? -57.613 35.200 5.306   1.00 40.77  ? 334 LYS A N   1 
ATOM   1784 C  CA  . LYS A 1 243 ? -57.192 34.238 4.302   1.00 41.05  ? 334 LYS A CA  1 
ATOM   1785 C  C   . LYS A 1 243 ? -56.126 33.247 4.758   1.00 34.87  ? 334 LYS A C   1 
ATOM   1786 O  O   . LYS A 1 243 ? -55.040 33.623 5.197   1.00 34.92  ? 334 LYS A O   1 
ATOM   1787 C  CB  . LYS A 1 243 ? -56.843 34.932 2.978   1.00 38.14  ? 334 LYS A CB  1 
ATOM   1788 C  CG  . LYS A 1 243 ? -58.055 35.617 2.346   1.00 41.01  ? 334 LYS A CG  1 
ATOM   1789 C  CD  . LYS A 1 243 ? -58.270 35.195 0.881   1.00 48.64  ? 334 LYS A CD  1 
ATOM   1790 C  CE  . LYS A 1 243 ? -59.710 35.443 0.412   1.00 51.52  ? 334 LYS A CE  1 
ATOM   1791 N  NZ  . LYS A 1 243 ? -60.717 34.436 0.922   1.00 45.89  ? 334 LYS A NZ  1 
ATOM   1792 N  N   . CYS A 1 244 ? -56.480 31.972 4.654   1.00 32.89  ? 335 CYS A N   1 
ATOM   1793 C  CA  . CYS A 1 244 ? -55.573 30.880 4.937   1.00 34.07  ? 335 CYS A CA  1 
ATOM   1794 C  C   . CYS A 1 244 ? -55.380 30.035 3.688   1.00 28.43  ? 335 CYS A C   1 
ATOM   1795 O  O   . CYS A 1 244 ? -56.196 29.182 3.398   1.00 31.13  ? 335 CYS A O   1 
ATOM   1796 C  CB  . CYS A 1 244 ? -56.139 30.005 6.060   1.00 32.59  ? 335 CYS A CB  1 
ATOM   1797 S  SG  . CYS A 1 244 ? -55.074 28.602 6.471   1.00 32.27  ? 335 CYS A SG  1 
ATOM   1798 N  N   . TYR A 1 245 ? -54.282 30.243 2.976   1.00 34.09  ? 336 TYR A N   1 
ATOM   1799 C  CA  . TYR A 1 245 ? -54.107 29.649 1.636   1.00 36.43  ? 336 TYR A CA  1 
ATOM   1800 C  C   . TYR A 1 245 ? -53.628 28.205 1.632   1.00 30.92  ? 336 TYR A C   1 
ATOM   1801 O  O   . TYR A 1 245 ? -52.672 27.860 2.311   1.00 32.47  ? 336 TYR A O   1 
ATOM   1802 C  CB  . TYR A 1 245 ? -53.142 30.486 0.804   1.00 30.97  ? 336 TYR A CB  1 
ATOM   1803 C  CG  . TYR A 1 245 ? -53.633 31.879 0.557   1.00 36.04  ? 336 TYR A CG  1 
ATOM   1804 C  CD1 . TYR A 1 245 ? -54.660 32.118 -0.345  1.00 37.87  ? 336 TYR A CD1 1 
ATOM   1805 C  CD2 . TYR A 1 245 ? -53.078 32.959 1.230   1.00 36.87  ? 336 TYR A CD2 1 
ATOM   1806 C  CE1 . TYR A 1 245 ? -55.115 33.391 -0.579  1.00 38.18  ? 336 TYR A CE1 1 
ATOM   1807 C  CE2 . TYR A 1 245 ? -53.524 34.236 1.007   1.00 38.30  ? 336 TYR A CE2 1 
ATOM   1808 C  CZ  . TYR A 1 245 ? -54.541 34.449 0.096   1.00 42.53  ? 336 TYR A CZ  1 
ATOM   1809 O  OH  . TYR A 1 245 ? -54.998 35.729 -0.131  1.00 49.52  ? 336 TYR A OH  1 
ATOM   1810 N  N   . LYS A 1 246 ? -54.299 27.368 0.855   1.00 28.08  ? 337 LYS A N   1 
ATOM   1811 C  CA  . LYS A 1 246 ? -53.903 25.978 0.725   1.00 30.06  ? 337 LYS A CA  1 
ATOM   1812 C  C   . LYS A 1 246 ? -52.972 25.782 -0.469  1.00 34.76  ? 337 LYS A C   1 
ATOM   1813 O  O   . LYS A 1 246 ? -53.274 26.181 -1.603  1.00 34.92  ? 337 LYS A O   1 
ATOM   1814 C  CB  . LYS A 1 246 ? -55.138 25.098 0.629   1.00 31.77  ? 337 LYS A CB  1 
ATOM   1815 C  CG  . LYS A 1 246 ? -54.900 23.663 0.214   1.00 31.03  ? 337 LYS A CG  1 
ATOM   1816 C  CD  . LYS A 1 246 ? -56.188 22.889 0.452   1.00 35.62  ? 337 LYS A CD  1 
ATOM   1817 C  CE  . LYS A 1 246 ? -56.242 21.590 -0.311  1.00 38.46  ? 337 LYS A CE  1 
ATOM   1818 N  NZ  . LYS A 1 246 ? -57.639 21.044 -0.301  1.00 43.24  ? 337 LYS A NZ  1 
ATOM   1819 N  N   . CYS A 1 247 ? -51.816 25.196 -0.198  1.00 34.93  ? 338 CYS A N   1 
ATOM   1820 C  CA  . CYS A 1 247 ? -50.824 24.949 -1.231  1.00 33.61  ? 338 CYS A CA  1 
ATOM   1821 C  C   . CYS A 1 247 ? -50.382 23.495 -1.181  1.00 37.31  ? 338 CYS A C   1 
ATOM   1822 O  O   . CYS A 1 247 ? -49.754 23.050 -0.206  1.00 39.56  ? 338 CYS A O   1 
ATOM   1823 C  CB  . CYS A 1 247 ? -49.619 25.872 -1.050  1.00 33.33  ? 338 CYS A CB  1 
ATOM   1824 S  SG  . CYS A 1 247 ? -48.319 25.561 -2.249  1.00 36.04  ? 338 CYS A SG  1 
ATOM   1825 N  N   . VAL A 1 248 ? -50.729 22.752 -2.223  1.00 34.59  ? 339 VAL A N   1 
ATOM   1826 C  CA  . VAL A 1 248 ? -50.410 21.340 -2.296  1.00 32.68  ? 339 VAL A CA  1 
ATOM   1827 C  C   . VAL A 1 248 ? -49.065 21.142 -2.962  1.00 38.54  ? 339 VAL A C   1 
ATOM   1828 O  O   . VAL A 1 248 ? -48.929 21.381 -4.161  1.00 39.91  ? 339 VAL A O   1 
ATOM   1829 C  CB  . VAL A 1 248 ? -51.447 20.616 -3.139  1.00 34.55  ? 339 VAL A CB  1 
ATOM   1830 C  CG1 . VAL A 1 248 ? -51.123 19.122 -3.239  1.00 38.87  ? 339 VAL A CG1 1 
ATOM   1831 C  CG2 . VAL A 1 248 ? -52.827 20.860 -2.578  1.00 32.20  ? 339 VAL A CG2 1 
ATOM   1832 N  N   . VAL A 1 249 ? -48.072 20.691 -2.205  1.00 32.47  ? 340 VAL A N   1 
ATOM   1833 C  CA  . VAL A 1 249 ? -46.766 20.422 -2.790  1.00 33.78  ? 340 VAL A CA  1 
ATOM   1834 C  C   . VAL A 1 249 ? -46.616 18.957 -3.196  1.00 37.44  ? 340 VAL A C   1 
ATOM   1835 O  O   . VAL A 1 249 ? -46.475 18.092 -2.340  1.00 41.83  ? 340 VAL A O   1 
ATOM   1836 C  CB  . VAL A 1 249 ? -45.644 20.775 -1.833  1.00 34.50  ? 340 VAL A CB  1 
ATOM   1837 C  CG1 . VAL A 1 249 ? -44.320 20.548 -2.518  1.00 41.60  ? 340 VAL A CG1 1 
ATOM   1838 C  CG2 . VAL A 1 249 ? -45.776 22.218 -1.403  1.00 34.39  ? 340 VAL A CG2 1 
ATOM   1839 N  N   . LYS A 1 250 ? -46.636 18.682 -4.499  1.00 38.85  ? 341 LYS A N   1 
ATOM   1840 C  CA  . LYS A 1 250 ? -46.558 17.308 -4.993  1.00 35.58  ? 341 LYS A CA  1 
ATOM   1841 C  C   . LYS A 1 250 ? -45.141 16.862 -5.301  1.00 36.05  ? 341 LYS A C   1 
ATOM   1842 O  O   . LYS A 1 250 ? -44.217 17.671 -5.343  1.00 37.85  ? 341 LYS A O   1 
ATOM   1843 C  CB  . LYS A 1 250 ? -47.394 17.154 -6.249  1.00 35.65  ? 341 LYS A CB  1 
ATOM   1844 C  CG  . LYS A 1 250 ? -48.882 17.259 -6.023  1.00 44.59  ? 341 LYS A CG  1 
ATOM   1845 C  CD  . LYS A 1 250 ? -49.600 17.620 -7.317  1.00 42.71  ? 341 LYS A CD  1 
ATOM   1846 C  CE  . LYS A 1 250 ? -51.082 17.860 -7.059  1.00 57.36  ? 341 LYS A CE  1 
ATOM   1847 N  NZ  . LYS A 1 250 ? -51.717 18.650 -8.152  1.00 61.51  ? 341 LYS A NZ  1 
ATOM   1848 N  N   . GLN A 1 251 ? -44.987 15.566 -5.543  1.00 34.91  ? 342 GLN A N   1 
ATOM   1849 C  CA  . GLN A 1 251 ? -43.686 14.973 -5.860  1.00 41.15  ? 342 GLN A CA  1 
ATOM   1850 C  C   . GLN A 1 251 ? -42.883 15.769 -6.890  1.00 41.62  ? 342 GLN A C   1 
ATOM   1851 O  O   . GLN A 1 251 ? -43.333 15.981 -8.015  1.00 38.25  ? 342 GLN A O   1 
ATOM   1852 C  CB  . GLN A 1 251 ? -43.868 13.545 -6.374  1.00 40.83  ? 342 GLN A CB  1 
ATOM   1853 C  CG  . GLN A 1 251 ? -42.573 12.846 -6.728  1.00 41.69  ? 342 GLN A CG  1 
ATOM   1854 C  CD  . GLN A 1 251 ? -42.799 11.461 -7.313  1.00 53.71  ? 342 GLN A CD  1 
ATOM   1855 O  OE1 . GLN A 1 251 ? -43.676 11.268 -8.163  1.00 58.99  ? 342 GLN A OE1 1 
ATOM   1856 N  NE2 . GLN A 1 251 ? -42.009 10.487 -6.861  1.00 49.35  ? 342 GLN A NE2 1 
ATOM   1857 N  N   . GLY A 1 252 ? -41.692 16.207 -6.500  1.00 40.61  ? 343 GLY A N   1 
ATOM   1858 C  CA  . GLY A 1 252 ? -40.797 16.853 -7.434  1.00 38.16  ? 343 GLY A CA  1 
ATOM   1859 C  C   . GLY A 1 252 ? -40.912 18.364 -7.490  1.00 42.32  ? 343 GLY A C   1 
ATOM   1860 O  O   . GLY A 1 252 ? -40.081 19.003 -8.128  1.00 42.07  ? 343 GLY A O   1 
ATOM   1861 N  N   . HIS A 1 253 ? -41.927 18.943 -6.848  1.00 37.34  ? 344 HIS A N   1 
ATOM   1862 C  CA  . HIS A 1 253 ? -42.066 20.400 -6.822  1.00 36.69  ? 344 HIS A CA  1 
ATOM   1863 C  C   . HIS A 1 253 ? -41.191 21.007 -5.737  1.00 38.61  ? 344 HIS A C   1 
ATOM   1864 O  O   . HIS A 1 253 ? -40.691 20.289 -4.872  1.00 39.91  ? 344 HIS A O   1 
ATOM   1865 C  CB  . HIS A 1 253 ? -43.521 20.803 -6.595  1.00 38.67  ? 344 HIS A CB  1 
ATOM   1866 C  CG  . HIS A 1 253 ? -44.403 20.527 -7.763  1.00 41.74  ? 344 HIS A CG  1 
ATOM   1867 N  ND1 . HIS A 1 253 ? -44.375 19.332 -8.445  1.00 44.58  ? 344 HIS A ND1 1 
ATOM   1868 C  CD2 . HIS A 1 253 ? -45.320 21.301 -8.388  1.00 47.51  ? 344 HIS A CD2 1 
ATOM   1869 C  CE1 . HIS A 1 253 ? -45.245 19.377 -9.442  1.00 40.77  ? 344 HIS A CE1 1 
ATOM   1870 N  NE2 . HIS A 1 253 ? -45.832 20.558 -9.426  1.00 43.13  ? 344 HIS A NE2 1 
ATOM   1871 N  N   . THR A 1 254 ? -41.010 22.323 -5.767  1.00 33.59  ? 345 THR A N   1 
ATOM   1872 C  CA  . THR A 1 254 ? -40.190 22.966 -4.744  1.00 35.86  ? 345 THR A CA  1 
ATOM   1873 C  C   . THR A 1 254 ? -40.809 24.245 -4.181  1.00 36.99  ? 345 THR A C   1 
ATOM   1874 O  O   . THR A 1 254 ? -40.896 25.259 -4.869  1.00 37.57  ? 345 THR A O   1 
ATOM   1875 C  CB  . THR A 1 254 ? -38.759 23.221 -5.253  1.00 36.86  ? 345 THR A CB  1 
ATOM   1876 O  OG1 . THR A 1 254 ? -38.082 21.969 -5.375  1.00 39.28  ? 345 THR A OG1 1 
ATOM   1877 C  CG2 . THR A 1 254 ? -37.985 24.071 -4.284  1.00 34.65  ? 345 THR A CG2 1 
ATOM   1878 N  N   . LEU A 1 255 ? -41.257 24.196 -2.930  1.00 34.40  ? 346 LEU A N   1 
ATOM   1879 C  CA  . LEU A 1 255 ? -41.835 25.386 -2.333  1.00 35.24  ? 346 LEU A CA  1 
ATOM   1880 C  C   . LEU A 1 255 ? -40.777 26.229 -1.649  1.00 32.22  ? 346 LEU A C   1 
ATOM   1881 O  O   . LEU A 1 255 ? -39.883 25.691 -1.024  1.00 35.41  ? 346 LEU A O   1 
ATOM   1882 C  CB  . LEU A 1 255 ? -42.934 25.027 -1.342  1.00 37.11  ? 346 LEU A CB  1 
ATOM   1883 C  CG  . LEU A 1 255 ? -43.614 26.277 -0.775  1.00 36.60  ? 346 LEU A CG  1 
ATOM   1884 C  CD1 . LEU A 1 255 ? -43.941 27.256 -1.897  1.00 32.84  ? 346 LEU A CD1 1 
ATOM   1885 C  CD2 . LEU A 1 255 ? -44.860 25.913 0.003   1.00 31.62  ? 346 LEU A CD2 1 
ATOM   1886 N  N   . PHE A 1 256 ? -40.877 27.546 -1.789  1.00 29.04  ? 347 PHE A N   1 
ATOM   1887 C  CA  . PHE A 1 256 ? -40.013 28.473 -1.072  1.00 31.23  ? 347 PHE A CA  1 
ATOM   1888 C  C   . PHE A 1 256 ? -40.883 29.394 -0.262  1.00 34.30  ? 347 PHE A C   1 
ATOM   1889 O  O   . PHE A 1 256 ? -41.681 30.134 -0.827  1.00 39.11  ? 347 PHE A O   1 
ATOM   1890 C  CB  . PHE A 1 256 ? -39.212 29.334 -2.029  1.00 30.18  ? 347 PHE A CB  1 
ATOM   1891 C  CG  . PHE A 1 256 ? -38.057 28.630 -2.657  1.00 33.60  ? 347 PHE A CG  1 
ATOM   1892 C  CD1 . PHE A 1 256 ? -38.230 27.884 -3.811  1.00 33.32  ? 347 PHE A CD1 1 
ATOM   1893 C  CD2 . PHE A 1 256 ? -36.791 28.719 -2.104  1.00 30.99  ? 347 PHE A CD2 1 
ATOM   1894 C  CE1 . PHE A 1 256 ? -37.163 27.225 -4.403  1.00 33.95  ? 347 PHE A CE1 1 
ATOM   1895 C  CE2 . PHE A 1 256 ? -35.721 28.072 -2.694  1.00 33.04  ? 347 PHE A CE2 1 
ATOM   1896 C  CZ  . PHE A 1 256 ? -35.908 27.324 -3.844  1.00 35.33  ? 347 PHE A CZ  1 
ATOM   1897 N  N   . VAL A 1 257 ? -40.742 29.357 1.058   1.00 31.91  ? 348 VAL A N   1 
ATOM   1898 C  CA  . VAL A 1 257 ? -41.539 30.217 1.913   1.00 28.81  ? 348 VAL A CA  1 
ATOM   1899 C  C   . VAL A 1 257 ? -40.678 31.294 2.539   1.00 31.23  ? 348 VAL A C   1 
ATOM   1900 O  O   . VAL A 1 257 ? -39.685 30.990 3.201   1.00 29.70  ? 348 VAL A O   1 
ATOM   1901 C  CB  . VAL A 1 257 ? -42.233 29.430 3.022   1.00 31.69  ? 348 VAL A CB  1 
ATOM   1902 C  CG1 . VAL A 1 257 ? -43.065 30.363 3.869   1.00 30.47  ? 348 VAL A CG1 1 
ATOM   1903 C  CG2 . VAL A 1 257 ? -43.101 28.339 2.444   1.00 30.44  ? 348 VAL A CG2 1 
ATOM   1904 N  N   . PRO A 1 258 ? -41.074 32.559 2.350   1.00 28.68  ? 349 PRO A N   1 
ATOM   1905 C  CA  . PRO A 1 258 ? -40.364 33.751 2.818   1.00 28.27  ? 349 PRO A CA  1 
ATOM   1906 C  C   . PRO A 1 258 ? -40.655 34.139 4.280   1.00 34.52  ? 349 PRO A C   1 
ATOM   1907 O  O   . PRO A 1 258 ? -41.571 33.614 4.935   1.00 29.12  ? 349 PRO A O   1 
ATOM   1908 C  CB  . PRO A 1 258 ? -40.901 34.838 1.903   1.00 31.55  ? 349 PRO A CB  1 
ATOM   1909 C  CG  . PRO A 1 258 ? -42.310 34.414 1.628   1.00 30.57  ? 349 PRO A CG  1 
ATOM   1910 C  CD  . PRO A 1 258 ? -42.371 32.908 1.757   1.00 30.57  ? 349 PRO A CD  1 
ATOM   1911 N  N   . THR A 1 259 ? -39.853 35.091 4.755   1.00 31.32  ? 350 THR A N   1 
ATOM   1912 C  CA  . THR A 1 259 ? -39.816 35.534 6.132   1.00 26.79  ? 350 THR A CA  1 
ATOM   1913 C  C   . THR A 1 259 ? -41.175 35.757 6.775   1.00 31.73  ? 350 THR A C   1 
ATOM   1914 O  O   . THR A 1 259 ? -42.029 36.425 6.211   1.00 29.45  ? 350 THR A O   1 
ATOM   1915 C  CB  . THR A 1 259 ? -39.087 36.855 6.197   1.00 29.99  ? 350 THR A CB  1 
ATOM   1916 O  OG1 . THR A 1 259 ? -37.843 36.731 5.504   1.00 30.84  ? 350 THR A OG1 1 
ATOM   1917 C  CG2 . THR A 1 259 ? -38.851 37.264 7.638   1.00 32.90  ? 350 THR A CG2 1 
ATOM   1918 N  N   . GLY A 1 260 ? -41.357 35.191 7.969   1.00 34.24  ? 351 GLY A N   1 
ATOM   1919 C  CA  . GLY A 1 260 ? -42.513 35.470 8.803   1.00 28.99  ? 351 GLY A CA  1 
ATOM   1920 C  C   . GLY A 1 260 ? -43.822 34.791 8.450   1.00 30.99  ? 351 GLY A C   1 
ATOM   1921 O  O   . GLY A 1 260 ? -44.854 35.078 9.038   1.00 32.49  ? 351 GLY A O   1 
ATOM   1922 N  N   . TRP A 1 261 ? -43.809 33.886 7.491   1.00 35.36  ? 352 TRP A N   1 
ATOM   1923 C  CA  . TRP A 1 261 ? -45.077 33.372 7.007   1.00 34.77  ? 352 TRP A CA  1 
ATOM   1924 C  C   . TRP A 1 261 ? -45.603 32.315 7.956   1.00 37.59  ? 352 TRP A C   1 
ATOM   1925 O  O   . TRP A 1 261 ? -44.903 31.362 8.288   1.00 36.59  ? 352 TRP A O   1 
ATOM   1926 C  CB  . TRP A 1 261 ? -44.974 32.875 5.565   1.00 29.72  ? 352 TRP A CB  1 
ATOM   1927 C  CG  . TRP A 1 261 ? -45.266 33.966 4.584   1.00 35.80  ? 352 TRP A CG  1 
ATOM   1928 C  CD1 . TRP A 1 261 ? -44.460 35.028 4.268   1.00 33.88  ? 352 TRP A CD1 1 
ATOM   1929 C  CD2 . TRP A 1 261 ? -46.459 34.121 3.799   1.00 34.00  ? 352 TRP A CD2 1 
ATOM   1930 N  NE1 . TRP A 1 261 ? -45.077 35.829 3.337   1.00 31.82  ? 352 TRP A NE1 1 
ATOM   1931 C  CE2 . TRP A 1 261 ? -46.305 35.299 3.034   1.00 32.18  ? 352 TRP A CE2 1 
ATOM   1932 C  CE3 . TRP A 1 261 ? -47.637 33.376 3.664   1.00 31.72  ? 352 TRP A CE3 1 
ATOM   1933 C  CZ2 . TRP A 1 261 ? -47.280 35.744 2.141   1.00 33.77  ? 352 TRP A CZ2 1 
ATOM   1934 C  CZ3 . TRP A 1 261 ? -48.615 33.827 2.789   1.00 36.65  ? 352 TRP A CZ3 1 
ATOM   1935 C  CH2 . TRP A 1 261 ? -48.427 35.002 2.035   1.00 37.25  ? 352 TRP A CH2 1 
ATOM   1936 N  N   . ILE A 1 262 ? -46.834 32.518 8.416   1.00 35.36  ? 353 ILE A N   1 
ATOM   1937 C  CA  . ILE A 1 262 ? -47.469 31.594 9.331   1.00 32.97  ? 353 ILE A CA  1 
ATOM   1938 C  C   . ILE A 1 262 ? -48.027 30.413 8.546   1.00 33.88  ? 353 ILE A C   1 
ATOM   1939 O  O   . ILE A 1 262 ? -48.838 30.593 7.640   1.00 38.25  ? 353 ILE A O   1 
ATOM   1940 C  CB  . ILE A 1 262 ? -48.602 32.292 10.093  1.00 32.41  ? 353 ILE A CB  1 
ATOM   1941 C  CG1 . ILE A 1 262 ? -48.056 33.444 10.938  1.00 30.97  ? 353 ILE A CG1 1 
ATOM   1942 C  CG2 . ILE A 1 262 ? -49.299 31.307 10.970  1.00 31.96  ? 353 ILE A CG2 1 
ATOM   1943 C  CD1 . ILE A 1 262 ? -49.063 34.520 11.193  1.00 31.32  ? 353 ILE A CD1 1 
ATOM   1944 N  N   . HIS A 1 263 ? -47.597 29.204 8.879   1.00 31.51  ? 354 HIS A N   1 
ATOM   1945 C  CA  . HIS A 1 263 ? -48.025 28.039 8.120   1.00 29.29  ? 354 HIS A CA  1 
ATOM   1946 C  C   . HIS A 1 263 ? -48.159 26.767 8.937   1.00 32.09  ? 354 HIS A C   1 
ATOM   1947 O  O   . HIS A 1 263 ? -47.387 26.517 9.855   1.00 29.50  ? 354 HIS A O   1 
ATOM   1948 C  CB  . HIS A 1 263 ? -47.028 27.777 7.025   1.00 31.48  ? 354 HIS A CB  1 
ATOM   1949 C  CG  . HIS A 1 263 ? -45.645 27.555 7.531   1.00 30.19  ? 354 HIS A CG  1 
ATOM   1950 N  ND1 . HIS A 1 263 ? -44.854 28.582 7.994   1.00 30.94  ? 354 HIS A ND1 1 
ATOM   1951 C  CD2 . HIS A 1 263 ? -44.907 26.428 7.652   1.00 32.01  ? 354 HIS A CD2 1 
ATOM   1952 C  CE1 . HIS A 1 263 ? -43.683 28.100 8.366   1.00 32.62  ? 354 HIS A CE1 1 
ATOM   1953 N  NE2 . HIS A 1 263 ? -43.686 26.795 8.158   1.00 36.19  ? 354 HIS A NE2 1 
ATOM   1954 N  N   . ALA A 1 264 ? -49.153 25.966 8.567   1.00 35.87  ? 355 ALA A N   1 
ATOM   1955 C  CA  . ALA A 1 264 ? -49.367 24.630 9.108   1.00 33.50  ? 355 ALA A CA  1 
ATOM   1956 C  C   . ALA A 1 264 ? -49.058 23.689 7.963   1.00 29.67  ? 355 ALA A C   1 
ATOM   1957 O  O   . ALA A 1 264 ? -48.940 24.140 6.845   1.00 32.84  ? 355 ALA A O   1 
ATOM   1958 C  CB  . ALA A 1 264 ? -50.821 24.471 9.569   1.00 31.45  ? 355 ALA A CB  1 
ATOM   1959 N  N   . VAL A 1 265 ? -48.921 22.394 8.224   1.00 30.94  ? 356 VAL A N   1 
ATOM   1960 C  CA  . VAL A 1 265 ? -48.573 21.439 7.175   1.00 26.46  ? 356 VAL A CA  1 
ATOM   1961 C  C   . VAL A 1 265 ? -49.300 20.133 7.408   1.00 31.64  ? 356 VAL A C   1 
ATOM   1962 O  O   . VAL A 1 265 ? -49.404 19.675 8.539   1.00 36.56  ? 356 VAL A O   1 
ATOM   1963 C  CB  . VAL A 1 265 ? -47.071 21.154 7.151   1.00 27.06  ? 356 VAL A CB  1 
ATOM   1964 C  CG1 . VAL A 1 265 ? -46.753 20.067 6.139   1.00 30.59  ? 356 VAL A CG1 1 
ATOM   1965 C  CG2 . VAL A 1 265 ? -46.277 22.425 6.874   1.00 26.42  ? 356 VAL A CG2 1 
ATOM   1966 N  N   . LEU A 1 266 ? -49.823 19.535 6.346   1.00 31.03  ? 357 LEU A N   1 
ATOM   1967 C  CA  . LEU A 1 266 ? -50.463 18.239 6.460   1.00 32.26  ? 357 LEU A CA  1 
ATOM   1968 C  C   . LEU A 1 266 ? -49.734 17.252 5.575   1.00 36.19  ? 357 LEU A C   1 
ATOM   1969 O  O   . LEU A 1 266 ? -49.472 17.521 4.412   1.00 41.33  ? 357 LEU A O   1 
ATOM   1970 C  CB  . LEU A 1 266 ? -51.943 18.312 6.082   1.00 35.07  ? 357 LEU A CB  1 
ATOM   1971 C  CG  . LEU A 1 266 ? -52.709 16.994 5.902   1.00 35.99  ? 357 LEU A CG  1 
ATOM   1972 C  CD1 . LEU A 1 266 ? -52.914 16.302 7.232   1.00 37.64  ? 357 LEU A CD1 1 
ATOM   1973 C  CD2 . LEU A 1 266 ? -54.044 17.242 5.264   1.00 35.03  ? 357 LEU A CD2 1 
ATOM   1974 N  N   . THR A 1 267 ? -49.384 16.108 6.134   1.00 38.68  ? 358 THR A N   1 
ATOM   1975 C  CA  . THR A 1 267 ? -48.735 15.074 5.359   1.00 40.28  ? 358 THR A CA  1 
ATOM   1976 C  C   . THR A 1 267 ? -49.859 14.166 4.871   1.00 44.44  ? 358 THR A C   1 
ATOM   1977 O  O   . THR A 1 267 ? -50.297 13.260 5.579   1.00 44.14  ? 358 THR A O   1 
ATOM   1978 C  CB  . THR A 1 267 ? -47.688 14.325 6.216   1.00 40.69  ? 358 THR A CB  1 
ATOM   1979 O  OG1 . THR A 1 267 ? -46.848 15.284 6.861   1.00 36.96  ? 358 THR A OG1 1 
ATOM   1980 C  CG2 . THR A 1 267 ? -46.805 13.445 5.358   1.00 42.00  ? 358 THR A CG2 1 
ATOM   1981 N  N   . SER A 1 268 ? -50.346 14.443 3.666   1.00 42.20  ? 359 SER A N   1 
ATOM   1982 C  CA  . SER A 1 268 ? -51.551 13.809 3.170   1.00 39.66  ? 359 SER A CA  1 
ATOM   1983 C  C   . SER A 1 268 ? -51.262 12.406 2.691   1.00 43.84  ? 359 SER A C   1 
ATOM   1984 O  O   . SER A 1 268 ? -52.164 11.596 2.538   1.00 46.93  ? 359 SER A O   1 
ATOM   1985 C  CB  . SER A 1 268 ? -52.168 14.633 2.038   1.00 47.62  ? 359 SER A CB  1 
ATOM   1986 O  OG  . SER A 1 268 ? -51.226 14.920 1.022   1.00 44.92  ? 359 SER A OG  1 
ATOM   1987 N  N   . GLN A 1 269 ? -49.993 12.128 2.439   1.00 46.39  ? 360 GLN A N   1 
ATOM   1988 C  CA  . GLN A 1 269 ? -49.570 10.803 2.009   1.00 46.23  ? 360 GLN A CA  1 
ATOM   1989 C  C   . GLN A 1 269 ? -48.228 10.553 2.657   1.00 45.13  ? 360 GLN A C   1 
ATOM   1990 O  O   . GLN A 1 269 ? -47.522 11.501 2.988   1.00 44.63  ? 360 GLN A O   1 
ATOM   1991 C  CB  . GLN A 1 269 ? -49.413 10.746 0.490   1.00 41.45  ? 360 GLN A CB  1 
ATOM   1992 C  CG  . GLN A 1 269 ? -50.681 11.032 -0.299  1.00 51.50  ? 360 GLN A CG  1 
ATOM   1993 C  CD  . GLN A 1 269 ? -50.471 10.973 -1.822  1.00 60.43  ? 360 GLN A CD  1 
ATOM   1994 O  OE1 . GLN A 1 269 ? -49.466 10.435 -2.320  1.00 52.15  ? 360 GLN A OE1 1 
ATOM   1995 N  NE2 . GLN A 1 269 ? -51.425 11.534 -2.565  1.00 60.64  ? 360 GLN A NE2 1 
ATOM   1996 N  N   . ASP A 1 270 ? -47.873 9.288  2.849   1.00 44.27  ? 361 ASP A N   1 
ATOM   1997 C  CA  . ASP A 1 270 ? -46.535 8.976  3.331   1.00 43.06  ? 361 ASP A CA  1 
ATOM   1998 C  C   . ASP A 1 270 ? -45.525 9.752  2.486   1.00 41.40  ? 361 ASP A C   1 
ATOM   1999 O  O   . ASP A 1 270 ? -45.499 9.634  1.267   1.00 41.23  ? 361 ASP A O   1 
ATOM   2000 C  CB  . ASP A 1 270 ? -46.264 7.471  3.288   1.00 43.50  ? 361 ASP A CB  1 
ATOM   2001 C  CG  . ASP A 1 270 ? -47.159 6.688  4.244   1.00 48.62  ? 361 ASP A CG  1 
ATOM   2002 O  OD1 . ASP A 1 270 ? -47.290 5.453  4.061   1.00 56.70  ? 361 ASP A OD1 1 
ATOM   2003 O  OD2 . ASP A 1 270 ? -47.739 7.308  5.166   1.00 43.03  ? 361 ASP A OD2 1 
ATOM   2004 N  N   . CYS A 1 271 ? -44.708 10.561 3.140   1.00 40.43  ? 362 CYS A N   1 
ATOM   2005 C  CA  . CYS A 1 271 ? -43.880 11.506 2.423   1.00 39.56  ? 362 CYS A CA  1 
ATOM   2006 C  C   . CYS A 1 271 ? -42.425 11.552 2.905   1.00 37.46  ? 362 CYS A C   1 
ATOM   2007 O  O   . CYS A 1 271 ? -42.134 11.385 4.081   1.00 36.46  ? 362 CYS A O   1 
ATOM   2008 C  CB  . CYS A 1 271 ? -44.509 12.898 2.528   1.00 38.02  ? 362 CYS A CB  1 
ATOM   2009 S  SG  . CYS A 1 271 ? -43.535 14.198 1.765   1.00 40.88  ? 362 CYS A SG  1 
ATOM   2010 N  N   . MET A 1 272 ? -41.518 11.785 1.968   1.00 38.72  ? 363 MET A N   1 
ATOM   2011 C  CA  . MET A 1 272 ? -40.154 12.146 2.286   1.00 36.42  ? 363 MET A CA  1 
ATOM   2012 C  C   . MET A 1 272 ? -39.895 13.457 1.582   1.00 36.57  ? 363 MET A C   1 
ATOM   2013 O  O   . MET A 1 272 ? -40.119 13.581 0.382   1.00 37.18  ? 363 MET A O   1 
ATOM   2014 C  CB  . MET A 1 272 ? -39.154 11.106 1.778   1.00 36.48  ? 363 MET A CB  1 
ATOM   2015 C  CG  . MET A 1 272 ? -37.739 11.410 2.241   1.00 38.40  ? 363 MET A CG  1 
ATOM   2016 S  SD  . MET A 1 272 ? -36.471 10.271 1.668   1.00 46.09  ? 363 MET A SD  1 
ATOM   2017 C  CE  . MET A 1 272 ? -37.345 8.718  1.854   1.00 47.28  ? 363 MET A CE  1 
ATOM   2018 N  N   . ALA A 1 273 ? -39.415 14.437 2.327   1.00 36.66  ? 364 ALA A N   1 
ATOM   2019 C  CA  . ALA A 1 273 ? -39.126 15.737 1.757   1.00 38.97  ? 364 ALA A CA  1 
ATOM   2020 C  C   . ALA A 1 273 ? -37.736 16.189 2.181   1.00 39.21  ? 364 ALA A C   1 
ATOM   2021 O  O   . ALA A 1 273 ? -37.126 15.609 3.073   1.00 40.39  ? 364 ALA A O   1 
ATOM   2022 C  CB  . ALA A 1 273 ? -40.183 16.746 2.186   1.00 34.51  ? 364 ALA A CB  1 
ATOM   2023 N  N   . PHE A 1 274 ? -37.229 17.223 1.534   1.00 35.23  ? 365 PHE A N   1 
ATOM   2024 C  CA  . PHE A 1 274 ? -35.976 17.817 1.961   1.00 38.30  ? 365 PHE A CA  1 
ATOM   2025 C  C   . PHE A 1 274 ? -36.182 19.312 2.042   1.00 36.31  ? 365 PHE A C   1 
ATOM   2026 O  O   . PHE A 1 274 ? -37.028 19.865 1.353   1.00 34.22  ? 365 PHE A O   1 
ATOM   2027 C  CB  . PHE A 1 274 ? -34.831 17.443 1.012   1.00 35.14  ? 365 PHE A CB  1 
ATOM   2028 C  CG  . PHE A 1 274 ? -34.550 15.976 0.983   1.00 34.24  ? 365 PHE A CG  1 
ATOM   2029 C  CD1 . PHE A 1 274 ? -35.352 15.121 0.257   1.00 42.10  ? 365 PHE A CD1 1 
ATOM   2030 C  CD2 . PHE A 1 274 ? -33.516 15.444 1.712   1.00 41.19  ? 365 PHE A CD2 1 
ATOM   2031 C  CE1 . PHE A 1 274 ? -35.108 13.765 0.243   1.00 41.72  ? 365 PHE A CE1 1 
ATOM   2032 C  CE2 . PHE A 1 274 ? -33.275 14.089 1.706   1.00 41.52  ? 365 PHE A CE2 1 
ATOM   2033 C  CZ  . PHE A 1 274 ? -34.072 13.251 0.969   1.00 38.93  ? 365 PHE A CZ  1 
ATOM   2034 N  N   . GLY A 1 275 ? -35.428 19.957 2.919   1.00 39.25  ? 366 GLY A N   1 
ATOM   2035 C  CA  . GLY A 1 275 ? -35.595 21.375 3.134   1.00 38.40  ? 366 GLY A CA  1 
ATOM   2036 C  C   . GLY A 1 275 ? -34.432 21.980 3.878   1.00 35.09  ? 366 GLY A C   1 
ATOM   2037 O  O   . GLY A 1 275 ? -33.469 21.293 4.210   1.00 36.19  ? 366 GLY A O   1 
ATOM   2038 N  N   . GLY A 1 276 ? -34.535 23.275 4.133   1.00 29.23  ? 367 GLY A N   1 
ATOM   2039 C  CA  . GLY A 1 276 ? -33.452 24.027 4.710   1.00 32.20  ? 367 GLY A CA  1 
ATOM   2040 C  C   . GLY A 1 276 ? -33.915 25.422 5.028   1.00 33.04  ? 367 GLY A C   1 
ATOM   2041 O  O   . GLY A 1 276 ? -34.830 25.953 4.399   1.00 32.74  ? 367 GLY A O   1 
ATOM   2042 N  N   . ASN A 1 277 ? -33.274 26.013 6.023   1.00 31.71  ? 368 ASN A N   1 
ATOM   2043 C  CA  . ASN A 1 277 ? -33.646 27.331 6.511   1.00 34.15  ? 368 ASN A CA  1 
ATOM   2044 C  C   . ASN A 1 277 ? -32.515 28.327 6.311   1.00 34.00  ? 368 ASN A C   1 
ATOM   2045 O  O   . ASN A 1 277 ? -31.348 27.958 6.311   1.00 39.70  ? 368 ASN A O   1 
ATOM   2046 C  CB  . ASN A 1 277 ? -34.021 27.240 7.988   1.00 35.71  ? 368 ASN A CB  1 
ATOM   2047 C  CG  . ASN A 1 277 ? -35.321 26.499 8.207   1.00 37.90  ? 368 ASN A CG  1 
ATOM   2048 O  OD1 . ASN A 1 277 ? -35.441 25.307 7.897   1.00 35.42  ? 368 ASN A OD1 1 
ATOM   2049 N  ND2 . ASN A 1 277 ? -36.311 27.206 8.746   1.00 37.65  ? 368 ASN A ND2 1 
ATOM   2050 N  N   . PHE A 1 278 ? -32.850 29.591 6.119   1.00 31.54  ? 369 PHE A N   1 
ATOM   2051 C  CA  . PHE A 1 278 ? -31.808 30.581 5.903   1.00 32.09  ? 369 PHE A CA  1 
ATOM   2052 C  C   . PHE A 1 278 ? -32.333 31.988 6.144   1.00 34.07  ? 369 PHE A C   1 
ATOM   2053 O  O   . PHE A 1 278 ? -33.505 32.285 5.885   1.00 32.50  ? 369 PHE A O   1 
ATOM   2054 C  CB  . PHE A 1 278 ? -31.238 30.462 4.481   1.00 38.27  ? 369 PHE A CB  1 
ATOM   2055 C  CG  . PHE A 1 278 ? -32.253 30.691 3.398   1.00 31.55  ? 369 PHE A CG  1 
ATOM   2056 C  CD1 . PHE A 1 278 ? -32.419 31.933 2.845   1.00 33.12  ? 369 PHE A CD1 1 
ATOM   2057 C  CD2 . PHE A 1 278 ? -33.057 29.664 2.959   1.00 32.33  ? 369 PHE A CD2 1 
ATOM   2058 C  CE1 . PHE A 1 278 ? -33.359 32.144 1.866   1.00 35.22  ? 369 PHE A CE1 1 
ATOM   2059 C  CE2 . PHE A 1 278 ? -34.002 29.877 1.991   1.00 30.48  ? 369 PHE A CE2 1 
ATOM   2060 C  CZ  . PHE A 1 278 ? -34.148 31.113 1.445   1.00 31.13  ? 369 PHE A CZ  1 
ATOM   2061 N  N   . LEU A 1 279 ? -31.454 32.840 6.664   1.00 33.61  ? 370 LEU A N   1 
ATOM   2062 C  CA  . LEU A 1 279 ? -31.728 34.261 6.796   1.00 33.38  ? 370 LEU A CA  1 
ATOM   2063 C  C   . LEU A 1 279 ? -31.062 35.002 5.638   1.00 34.43  ? 370 LEU A C   1 
ATOM   2064 O  O   . LEU A 1 279 ? -30.093 34.518 5.040   1.00 34.32  ? 370 LEU A O   1 
ATOM   2065 C  CB  . LEU A 1 279 ? -31.196 34.780 8.132   1.00 35.80  ? 370 LEU A CB  1 
ATOM   2066 C  CG  . LEU A 1 279 ? -31.723 34.045 9.374   1.00 37.97  ? 370 LEU A CG  1 
ATOM   2067 C  CD1 . LEU A 1 279 ? -30.771 34.210 10.572  1.00 30.99  ? 370 LEU A CD1 1 
ATOM   2068 C  CD2 . LEU A 1 279 ? -33.146 34.481 9.716   1.00 29.49  ? 370 LEU A CD2 1 
ATOM   2069 N  N   . HIS A 1 280 ? -31.578 36.178 5.320   1.00 30.00  ? 371 HIS A N   1 
ATOM   2070 C  CA  . HIS A 1 280 ? -31.032 36.940 4.218   1.00 34.34  ? 371 HIS A CA  1 
ATOM   2071 C  C   . HIS A 1 280 ? -31.332 38.401 4.434   1.00 32.79  ? 371 HIS A C   1 
ATOM   2072 O  O   . HIS A 1 280 ? -31.932 38.763 5.433   1.00 35.73  ? 371 HIS A O   1 
ATOM   2073 C  CB  . HIS A 1 280 ? -31.658 36.479 2.903   1.00 32.96  ? 371 HIS A CB  1 
ATOM   2074 C  CG  . HIS A 1 280 ? -33.145 36.561 2.909   1.00 31.87  ? 371 HIS A CG  1 
ATOM   2075 N  ND1 . HIS A 1 280 ? -33.951 35.459 3.104   1.00 38.45  ? 371 HIS A ND1 1 
ATOM   2076 C  CD2 . HIS A 1 280 ? -33.976 37.621 2.808   1.00 29.25  ? 371 HIS A CD2 1 
ATOM   2077 C  CE1 . HIS A 1 280 ? -35.217 35.835 3.092   1.00 33.86  ? 371 HIS A CE1 1 
ATOM   2078 N  NE2 . HIS A 1 280 ? -35.259 37.142 2.914   1.00 33.60  ? 371 HIS A NE2 1 
ATOM   2079 N  N   . ASN A 1 281 ? -30.952 39.226 3.465   1.00 33.08  ? 372 ASN A N   1 
ATOM   2080 C  CA  . ASN A 1 281 ? -30.985 40.668 3.617   1.00 31.54  ? 372 ASN A CA  1 
ATOM   2081 C  C   . ASN A 1 281 ? -32.279 41.361 3.216   1.00 36.28  ? 372 ASN A C   1 
ATOM   2082 O  O   . ASN A 1 281 ? -32.447 42.550 3.467   1.00 41.48  ? 372 ASN A O   1 
ATOM   2083 C  CB  . ASN A 1 281 ? -29.848 41.259 2.805   1.00 35.49  ? 372 ASN A CB  1 
ATOM   2084 C  CG  . ASN A 1 281 ? -28.501 40.952 3.395   1.00 40.44  ? 372 ASN A CG  1 
ATOM   2085 O  OD1 . ASN A 1 281 ? -28.380 40.730 4.599   1.00 36.52  ? 372 ASN A OD1 1 
ATOM   2086 N  ND2 . ASN A 1 281 ? -27.470 40.957 2.556   1.00 35.46  ? 372 ASN A ND2 1 
ATOM   2087 N  N   . LEU A 1 282 ? -33.189 40.630 2.586   1.00 34.84  ? 373 LEU A N   1 
ATOM   2088 C  CA  . LEU A 1 282 ? -34.369 41.246 1.991   1.00 31.82  ? 373 LEU A CA  1 
ATOM   2089 C  C   . LEU A 1 282 ? -35.429 41.723 3.007   1.00 36.29  ? 373 LEU A C   1 
ATOM   2090 O  O   . LEU A 1 282 ? -35.946 42.830 2.894   1.00 40.11  ? 373 LEU A O   1 
ATOM   2091 C  CB  . LEU A 1 282 ? -34.965 40.330 0.907   1.00 37.08  ? 373 LEU A CB  1 
ATOM   2092 C  CG  . LEU A 1 282 ? -34.018 39.950 -0.251  1.00 36.53  ? 373 LEU A CG  1 
ATOM   2093 C  CD1 . LEU A 1 282 ? -34.595 38.879 -1.159  1.00 34.77  ? 373 LEU A CD1 1 
ATOM   2094 C  CD2 . LEU A 1 282 ? -33.603 41.147 -1.080  1.00 39.46  ? 373 LEU A CD2 1 
ATOM   2095 N  N   . ASN A 1 283 ? -35.738 40.905 4.005   1.00 36.58  ? 374 ASN A N   1 
ATOM   2096 C  CA  . ASN A 1 283 ? -36.746 41.263 5.000   1.00 32.84  ? 374 ASN A CA  1 
ATOM   2097 C  C   . ASN A 1 283 ? -36.172 41.230 6.405   1.00 38.66  ? 374 ASN A C   1 
ATOM   2098 O  O   . ASN A 1 283 ? -36.664 40.519 7.282   1.00 37.45  ? 374 ASN A O   1 
ATOM   2099 C  CB  . ASN A 1 283 ? -37.933 40.312 4.915   1.00 34.89  ? 374 ASN A CB  1 
ATOM   2100 C  CG  . ASN A 1 283 ? -38.378 40.071 3.488   1.00 40.41  ? 374 ASN A CG  1 
ATOM   2101 O  OD1 . ASN A 1 283 ? -38.366 40.988 2.672   1.00 43.20  ? 374 ASN A OD1 1 
ATOM   2102 N  ND2 . ASN A 1 283 ? -38.749 38.828 3.172   1.00 33.44  ? 374 ASN A ND2 1 
ATOM   2103 N  N   . ILE A 1 284 ? -35.110 41.993 6.609   1.00 40.43  ? 375 ILE A N   1 
ATOM   2104 C  CA  . ILE A 1 284 ? -34.435 42.035 7.897   1.00 35.39  ? 375 ILE A CA  1 
ATOM   2105 C  C   . ILE A 1 284 ? -35.390 42.477 8.995   1.00 38.79  ? 375 ILE A C   1 
ATOM   2106 O  O   . ILE A 1 284 ? -35.328 41.982 10.123  1.00 41.76  ? 375 ILE A O   1 
ATOM   2107 C  CB  . ILE A 1 284 ? -33.238 42.990 7.828   1.00 36.26  ? 375 ILE A CB  1 
ATOM   2108 C  CG1 . ILE A 1 284 ? -32.153 42.382 6.924   1.00 38.86  ? 375 ILE A CG1 1 
ATOM   2109 C  CG2 . ILE A 1 284 ? -32.717 43.298 9.211   1.00 31.00  ? 375 ILE A CG2 1 
ATOM   2110 C  CD1 . ILE A 1 284 ? -31.251 43.399 6.267   1.00 37.56  ? 375 ILE A CD1 1 
ATOM   2111 N  N   . GLY A 1 285 ? -36.276 43.408 8.662   1.00 36.45  ? 376 GLY A N   1 
ATOM   2112 C  CA  . GLY A 1 285 ? -37.246 43.906 9.618   1.00 31.30  ? 376 GLY A CA  1 
ATOM   2113 C  C   . GLY A 1 285 ? -38.176 42.820 10.111  1.00 34.27  ? 376 GLY A C   1 
ATOM   2114 O  O   . GLY A 1 285 ? -38.339 42.631 11.318  1.00 47.11  ? 376 GLY A O   1 
ATOM   2115 N  N   . MET A 1 286 ? -38.784 42.091 9.192   1.00 30.55  ? 377 MET A N   1 
ATOM   2116 C  CA  . MET A 1 286 ? -39.644 40.990 9.571   1.00 33.60  ? 377 MET A CA  1 
ATOM   2117 C  C   . MET A 1 286 ? -38.871 39.895 10.332  1.00 36.27  ? 377 MET A C   1 
ATOM   2118 O  O   . MET A 1 286 ? -39.429 39.232 11.201  1.00 35.44  ? 377 MET A O   1 
ATOM   2119 C  CB  . MET A 1 286 ? -40.339 40.418 8.337   1.00 35.34  ? 377 MET A CB  1 
ATOM   2120 C  CG  . MET A 1 286 ? -41.400 39.369 8.627   1.00 35.47  ? 377 MET A CG  1 
ATOM   2121 S  SD  . MET A 1 286 ? -42.687 40.028 9.686   1.00 40.48  ? 377 MET A SD  1 
ATOM   2122 C  CE  . MET A 1 286 ? -43.778 40.815 8.496   1.00 32.06  ? 377 MET A CE  1 
ATOM   2123 N  N   . GLN A 1 287 ? -37.593 39.708 10.013  1.00 35.88  ? 378 GLN A N   1 
ATOM   2124 C  CA  . GLN A 1 287 ? -36.775 38.709 10.710  1.00 34.54  ? 378 GLN A CA  1 
ATOM   2125 C  C   . GLN A 1 287 ? -36.593 39.074 12.179  1.00 38.94  ? 378 GLN A C   1 
ATOM   2126 O  O   . GLN A 1 287 ? -36.690 38.217 13.067  1.00 39.62  ? 378 GLN A O   1 
ATOM   2127 C  CB  . GLN A 1 287 ? -35.414 38.502 10.022  1.00 30.35  ? 378 GLN A CB  1 
ATOM   2128 C  CG  . GLN A 1 287 ? -35.509 37.679 8.735   1.00 31.54  ? 378 GLN A CG  1 
ATOM   2129 C  CD  . GLN A 1 287 ? -34.184 37.531 7.995   1.00 33.19  ? 378 GLN A CD  1 
ATOM   2130 O  OE1 . GLN A 1 287 ? -34.120 36.840 6.978   1.00 36.74  ? 378 GLN A OE1 1 
ATOM   2131 N  NE2 . GLN A 1 287 ? -33.130 38.177 8.493   1.00 29.72  ? 378 GLN A NE2 1 
ATOM   2132 N  N   . LEU A 1 288 ? -36.342 40.352 12.431  1.00 38.12  ? 379 LEU A N   1 
ATOM   2133 C  CA  . LEU A 1 288 ? -36.178 40.831 13.787  1.00 35.51  ? 379 LEU A CA  1 
ATOM   2134 C  C   . LEU A 1 288 ? -37.490 40.734 14.543  1.00 37.84  ? 379 LEU A C   1 
ATOM   2135 O  O   . LEU A 1 288 ? -37.517 40.222 15.660  1.00 39.22  ? 379 LEU A O   1 
ATOM   2136 C  CB  . LEU A 1 288 ? -35.632 42.260 13.792  1.00 37.12  ? 379 LEU A CB  1 
ATOM   2137 C  CG  . LEU A 1 288 ? -34.157 42.252 13.388  1.00 33.59  ? 379 LEU A CG  1 
ATOM   2138 C  CD1 . LEU A 1 288 ? -33.631 43.618 12.961  1.00 32.67  ? 379 LEU A CD1 1 
ATOM   2139 C  CD2 . LEU A 1 288 ? -33.353 41.679 14.521  1.00 36.07  ? 379 LEU A CD2 1 
ATOM   2140 N  N   . ARG A 1 289 ? -38.577 41.213 13.935  1.00 38.91  ? 380 ARG A N   1 
ATOM   2141 C  CA  . ARG A 1 289 ? -39.893 41.172 14.582  1.00 36.16  ? 380 ARG A CA  1 
ATOM   2142 C  C   . ARG A 1 289 ? -40.150 39.759 15.050  1.00 37.85  ? 380 ARG A C   1 
ATOM   2143 O  O   . ARG A 1 289 ? -40.642 39.544 16.149  1.00 44.76  ? 380 ARG A O   1 
ATOM   2144 C  CB  . ARG A 1 289 ? -41.030 41.566 13.629  1.00 40.80  ? 380 ARG A CB  1 
ATOM   2145 C  CG  . ARG A 1 289 ? -40.997 42.972 13.056  1.00 40.10  ? 380 ARG A CG  1 
ATOM   2146 C  CD  . ARG A 1 289 ? -42.362 43.638 13.218  1.00 48.18  ? 380 ARG A CD  1 
ATOM   2147 N  NE  . ARG A 1 289 ? -43.261 43.453 12.076  1.00 49.86  ? 380 ARG A NE  1 
ATOM   2148 C  CZ  . ARG A 1 289 ? -44.593 43.532 12.136  1.00 51.44  ? 380 ARG A CZ  1 
ATOM   2149 N  NH1 . ARG A 1 289 ? -45.219 43.772 13.289  1.00 49.41  ? 380 ARG A NH1 1 
ATOM   2150 N  NH2 . ARG A 1 289 ? -45.308 43.360 11.037  1.00 45.49  ? 380 ARG A NH2 1 
ATOM   2151 N  N   . CYS A 1 290 ? -39.819 38.790 14.206  1.00 31.95  ? 381 CYS A N   1 
ATOM   2152 C  CA  . CYS A 1 290 ? -40.110 37.406 14.505  1.00 32.79  ? 381 CYS A CA  1 
ATOM   2153 C  C   . CYS A 1 290 ? -39.235 36.893 15.624  1.00 41.75  ? 381 CYS A C   1 
ATOM   2154 O  O   . CYS A 1 290 ? -39.680 36.118 16.468  1.00 46.50  ? 381 CYS A O   1 
ATOM   2155 C  CB  . CYS A 1 290 ? -39.916 36.537 13.276  1.00 38.72  ? 381 CYS A CB  1 
ATOM   2156 S  SG  . CYS A 1 290 ? -41.271 36.632 12.111  1.00 33.45  ? 381 CYS A SG  1 
ATOM   2157 N  N   . TYR A 1 291 ? -37.982 37.315 15.633  1.00 38.59  ? 382 TYR A N   1 
ATOM   2158 C  CA  . TYR A 1 291 ? -37.079 36.888 16.684  1.00 36.81  ? 382 TYR A CA  1 
ATOM   2159 C  C   . TYR A 1 291 ? -37.568 37.433 18.023  1.00 40.99  ? 382 TYR A C   1 
ATOM   2160 O  O   . TYR A 1 291 ? -37.703 36.690 18.990  1.00 43.90  ? 382 TYR A O   1 
ATOM   2161 C  CB  . TYR A 1 291 ? -35.657 37.346 16.371  1.00 34.79  ? 382 TYR A CB  1 
ATOM   2162 C  CG  . TYR A 1 291 ? -34.665 37.102 17.465  1.00 36.57  ? 382 TYR A CG  1 
ATOM   2163 C  CD1 . TYR A 1 291 ? -34.106 35.843 17.654  1.00 41.33  ? 382 TYR A CD1 1 
ATOM   2164 C  CD2 . TYR A 1 291 ? -34.266 38.137 18.305  1.00 33.91  ? 382 TYR A CD2 1 
ATOM   2165 C  CE1 . TYR A 1 291 ? -33.186 35.614 18.668  1.00 40.75  ? 382 TYR A CE1 1 
ATOM   2166 C  CE2 . TYR A 1 291 ? -33.351 37.926 19.307  1.00 35.79  ? 382 TYR A CE2 1 
ATOM   2167 C  CZ  . TYR A 1 291 ? -32.816 36.662 19.493  1.00 43.36  ? 382 TYR A CZ  1 
ATOM   2168 O  OH  . TYR A 1 291 ? -31.900 36.448 20.504  1.00 41.77  ? 382 TYR A OH  1 
ATOM   2169 N  N   . GLU A 1 292 ? -37.860 38.728 18.068  1.00 42.00  ? 383 GLU A N   1 
ATOM   2170 C  CA  . GLU A 1 292 ? -38.287 39.372 19.298  1.00 37.26  ? 383 GLU A CA  1 
ATOM   2171 C  C   . GLU A 1 292 ? -39.628 38.830 19.759  1.00 42.20  ? 383 GLU A C   1 
ATOM   2172 O  O   . GLU A 1 292 ? -39.971 38.886 20.935  1.00 45.43  ? 383 GLU A O   1 
ATOM   2173 C  CB  . GLU A 1 292 ? -38.362 40.878 19.109  1.00 37.41  ? 383 GLU A CB  1 
ATOM   2174 C  CG  . GLU A 1 292 ? -37.021 41.520 18.810  1.00 45.40  ? 383 GLU A CG  1 
ATOM   2175 C  CD  . GLU A 1 292 ? -37.171 42.931 18.277  1.00 56.41  ? 383 GLU A CD  1 
ATOM   2176 O  OE1 . GLU A 1 292 ? -38.331 43.336 18.038  1.00 60.24  ? 383 GLU A OE1 1 
ATOM   2177 O  OE2 . GLU A 1 292 ? -36.142 43.630 18.094  1.00 55.25  ? 383 GLU A OE2 1 
ATOM   2178 N  N   . MET A 1 293 ? -40.398 38.297 18.831  1.00 41.33  ? 384 MET A N   1 
ATOM   2179 C  CA  . MET A 1 293 ? -41.647 37.705 19.232  1.00 43.11  ? 384 MET A CA  1 
ATOM   2180 C  C   . MET A 1 293 ? -41.404 36.328 19.830  1.00 41.99  ? 384 MET A C   1 
ATOM   2181 O  O   . MET A 1 293 ? -42.078 35.917 20.767  1.00 43.83  ? 384 MET A O   1 
ATOM   2182 C  CB  . MET A 1 293 ? -42.615 37.599 18.064  1.00 38.84  ? 384 MET A CB  1 
ATOM   2183 C  CG  . MET A 1 293 ? -43.906 36.936 18.489  1.00 40.20  ? 384 MET A CG  1 
ATOM   2184 S  SD  . MET A 1 293 ? -44.860 36.333 17.116  1.00 43.14  ? 384 MET A SD  1 
ATOM   2185 C  CE  . MET A 1 293 ? -45.561 37.882 16.525  1.00 37.58  ? 384 MET A CE  1 
ATOM   2186 N  N   . GLU A 1 294 ? -40.456 35.603 19.264  1.00 41.00  ? 385 GLU A N   1 
ATOM   2187 C  CA  . GLU A 1 294 ? -40.157 34.270 19.752  1.00 43.22  ? 385 GLU A CA  1 
ATOM   2188 C  C   . GLU A 1 294 ? -39.430 34.354 21.094  1.00 45.93  ? 385 GLU A C   1 
ATOM   2189 O  O   . GLU A 1 294 ? -39.428 33.403 21.874  1.00 44.19  ? 385 GLU A O   1 
ATOM   2190 C  CB  . GLU A 1 294 ? -39.347 33.483 18.720  1.00 41.11  ? 385 GLU A CB  1 
ATOM   2191 C  CG  . GLU A 1 294 ? -40.149 33.091 17.495  1.00 41.31  ? 385 GLU A CG  1 
ATOM   2192 C  CD  . GLU A 1 294 ? -39.281 32.518 16.377  1.00 46.10  ? 385 GLU A CD  1 
ATOM   2193 O  OE1 . GLU A 1 294 ? -38.120 32.135 16.655  1.00 46.99  ? 385 GLU A OE1 1 
ATOM   2194 O  OE2 . GLU A 1 294 ? -39.759 32.459 15.217  1.00 42.91  ? 385 GLU A OE2 1 
ATOM   2195 N  N   . LYS A 1 295 ? -38.814 35.499 21.365  1.00 45.63  ? 386 LYS A N   1 
ATOM   2196 C  CA  . LYS A 1 295 ? -38.279 35.722 22.694  1.00 46.64  ? 386 LYS A CA  1 
ATOM   2197 C  C   . LYS A 1 295 ? -39.450 35.847 23.663  1.00 46.29  ? 386 LYS A C   1 
ATOM   2198 O  O   . LYS A 1 295 ? -39.492 35.158 24.675  1.00 49.02  ? 386 LYS A O   1 
ATOM   2199 C  CB  . LYS A 1 295 ? -37.372 36.954 22.742  1.00 44.66  ? 386 LYS A CB  1 
ATOM   2200 C  CG  . LYS A 1 295 ? -35.902 36.623 22.498  1.00 45.68  ? 386 LYS A CG  1 
ATOM   2201 C  CD  . LYS A 1 295 ? -35.704 35.103 22.426  1.00 50.94  ? 386 LYS A CD  1 
ATOM   2202 C  CE  . LYS A 1 295 ? -34.221 34.693 22.325  1.00 53.91  ? 386 LYS A CE  1 
ATOM   2203 N  NZ  . LYS A 1 295 ? -33.389 34.967 23.544  1.00 52.84  ? 386 LYS A NZ  1 
ATOM   2204 N  N   . ARG A 1 296 ? -40.410 36.707 23.333  1.00 41.62  ? 387 ARG A N   1 
ATOM   2205 C  CA  . ARG A 1 296 ? -41.577 36.902 24.179  1.00 40.52  ? 387 ARG A CA  1 
ATOM   2206 C  C   . ARG A 1 296 ? -42.320 35.604 24.450  1.00 45.20  ? 387 ARG A C   1 
ATOM   2207 O  O   . ARG A 1 296 ? -42.874 35.412 25.527  1.00 50.98  ? 387 ARG A O   1 
ATOM   2208 C  CB  . ARG A 1 296 ? -42.539 37.924 23.567  1.00 41.93  ? 387 ARG A CB  1 
ATOM   2209 C  CG  . ARG A 1 296 ? -42.014 39.340 23.582  1.00 38.48  ? 387 ARG A CG  1 
ATOM   2210 C  CD  . ARG A 1 296 ? -43.088 40.342 23.194  1.00 35.89  ? 387 ARG A CD  1 
ATOM   2211 N  NE  . ARG A 1 296 ? -43.598 40.172 21.837  1.00 35.85  ? 387 ARG A NE  1 
ATOM   2212 C  CZ  . ARG A 1 296 ? -43.035 40.671 20.734  1.00 36.11  ? 387 ARG A CZ  1 
ATOM   2213 N  NH1 . ARG A 1 296 ? -41.906 41.361 20.800  1.00 28.40  ? 387 ARG A NH1 1 
ATOM   2214 N  NH2 . ARG A 1 296 ? -43.606 40.464 19.549  1.00 35.88  ? 387 ARG A NH2 1 
ATOM   2215 N  N   . LEU A 1 297 ? -42.345 34.709 23.477  1.00 43.37  ? 388 LEU A N   1 
ATOM   2216 C  CA  . LEU A 1 297 ? -43.127 33.493 23.632  1.00 46.12  ? 388 LEU A CA  1 
ATOM   2217 C  C   . LEU A 1 297 ? -42.292 32.383 24.241  1.00 46.67  ? 388 LEU A C   1 
ATOM   2218 O  O   . LEU A 1 297 ? -42.797 31.294 24.488  1.00 51.26  ? 388 LEU A O   1 
ATOM   2219 C  CB  . LEU A 1 297 ? -43.698 33.035 22.283  1.00 48.37  ? 388 LEU A CB  1 
ATOM   2220 C  CG  . LEU A 1 297 ? -44.778 33.897 21.628  1.00 43.36  ? 388 LEU A CG  1 
ATOM   2221 C  CD1 . LEU A 1 297 ? -45.327 33.208 20.373  1.00 37.22  ? 388 LEU A CD1 1 
ATOM   2222 C  CD2 . LEU A 1 297 ? -45.886 34.163 22.623  1.00 38.04  ? 388 LEU A CD2 1 
ATOM   2223 N  N   . LYS A 1 298 ? -41.009 32.658 24.459  1.00 46.64  ? 389 LYS A N   1 
ATOM   2224 C  CA  . LYS A 1 298 ? -40.056 31.645 24.923  1.00 48.14  ? 389 LYS A CA  1 
ATOM   2225 C  C   . LYS A 1 298 ? -40.086 30.356 24.080  1.00 46.91  ? 389 LYS A C   1 
ATOM   2226 O  O   . LYS A 1 298 ? -40.272 29.275 24.611  1.00 55.42  ? 389 LYS A O   1 
ATOM   2227 C  CB  . LYS A 1 298 ? -40.277 31.311 26.416  1.00 51.75  ? 389 LYS A CB  1 
ATOM   2228 C  CG  . LYS A 1 298 ? -39.722 32.332 27.433  1.00 49.86  ? 389 LYS A CG  1 
ATOM   2229 C  CD  . LYS A 1 298 ? -40.602 33.583 27.571  1.00 55.69  ? 389 LYS A CD  1 
ATOM   2230 C  CE  . LYS A 1 298 ? -40.516 34.245 28.972  1.00 65.03  ? 389 LYS A CE  1 
ATOM   2231 N  NZ  . LYS A 1 298 ? -39.206 34.897 29.320  1.00 59.90  ? 389 LYS A NZ  1 
ATOM   2232 N  N   . THR A 1 299 ? -39.887 30.459 22.772  1.00 52.64  ? 390 THR A N   1 
ATOM   2233 C  CA  . THR A 1 299 ? -39.985 29.271 21.917  1.00 56.30  ? 390 THR A CA  1 
ATOM   2234 C  C   . THR A 1 299 ? -38.735 28.414 21.964  1.00 52.08  ? 390 THR A C   1 
ATOM   2235 O  O   . THR A 1 299 ? -37.636 28.901 21.732  1.00 53.87  ? 390 THR A O   1 
ATOM   2236 C  CB  . THR A 1 299 ? -40.260 29.618 20.435  1.00 52.09  ? 390 THR A CB  1 
ATOM   2237 O  OG1 . THR A 1 299 ? -41.013 30.833 20.349  1.00 51.07  ? 390 THR A OG1 1 
ATOM   2238 C  CG2 . THR A 1 299 ? -41.034 28.485 19.750  1.00 53.43  ? 390 THR A CG2 1 
ATOM   2239 N  N   . PRO A 1 300 ? -38.904 27.122 22.249  1.00 56.70  ? 391 PRO A N   1 
ATOM   2240 C  CA  . PRO A 1 300 ? -37.766 26.194 22.189  1.00 56.51  ? 391 PRO A CA  1 
ATOM   2241 C  C   . PRO A 1 300 ? -37.158 26.083 20.779  1.00 59.04  ? 391 PRO A C   1 
ATOM   2242 O  O   . PRO A 1 300 ? -35.958 25.811 20.666  1.00 59.43  ? 391 PRO A O   1 
ATOM   2243 C  CB  . PRO A 1 300 ? -38.363 24.856 22.629  1.00 54.21  ? 391 PRO A CB  1 
ATOM   2244 C  CG  . PRO A 1 300 ? -39.848 25.004 22.541  1.00 52.55  ? 391 PRO A CG  1 
ATOM   2245 C  CD  . PRO A 1 300 ? -40.195 26.453 22.486  1.00 57.14  ? 391 PRO A CD  1 
ATOM   2246 N  N   . ASP A 1 301 ? -37.977 26.287 19.742  1.00 57.07  ? 392 ASP A N   1 
ATOM   2247 C  CA  . ASP A 1 301 ? -37.526 26.329 18.341  1.00 58.71  ? 392 ASP A CA  1 
ATOM   2248 C  C   . ASP A 1 301 ? -36.224 27.118 18.200  1.00 53.97  ? 392 ASP A C   1 
ATOM   2249 O  O   . ASP A 1 301 ? -35.287 26.699 17.520  1.00 50.04  ? 392 ASP A O   1 
ATOM   2250 C  CB  . ASP A 1 301 ? -38.593 26.989 17.439  1.00 57.72  ? 392 ASP A CB  1 
ATOM   2251 C  CG  . ASP A 1 301 ? -39.882 26.157 17.305  1.00 66.83  ? 392 ASP A CG  1 
ATOM   2252 O  OD1 . ASP A 1 301 ? -40.243 25.391 18.234  1.00 69.00  ? 392 ASP A OD1 1 
ATOM   2253 O  OD2 . ASP A 1 301 ? -40.551 26.294 16.255  1.00 66.82  ? 392 ASP A OD2 1 
ATOM   2254 N  N   . LEU A 1 302 ? -36.192 28.270 18.856  1.00 52.95  ? 393 LEU A N   1 
ATOM   2255 C  CA  . LEU A 1 302 ? -35.074 29.203 18.800  1.00 52.84  ? 393 LEU A CA  1 
ATOM   2256 C  C   . LEU A 1 302 ? -33.713 28.615 19.195  1.00 53.99  ? 393 LEU A C   1 
ATOM   2257 O  O   . LEU A 1 302 ? -32.677 29.261 19.016  1.00 55.68  ? 393 LEU A O   1 
ATOM   2258 C  CB  . LEU A 1 302 ? -35.391 30.396 19.697  1.00 49.17  ? 393 LEU A CB  1 
ATOM   2259 C  CG  . LEU A 1 302 ? -35.032 31.781 19.168  1.00 51.70  ? 393 LEU A CG  1 
ATOM   2260 C  CD1 . LEU A 1 302 ? -35.166 31.878 17.644  1.00 41.56  ? 393 LEU A CD1 1 
ATOM   2261 C  CD2 . LEU A 1 302 ? -35.925 32.783 19.869  1.00 53.79  ? 393 LEU A CD2 1 
ATOM   2262 N  N   . PHE A 1 303 ? -33.713 27.403 19.739  1.00 56.71  ? 394 PHE A N   1 
ATOM   2263 C  CA  . PHE A 1 303 ? -32.469 26.736 20.117  1.00 52.81  ? 394 PHE A CA  1 
ATOM   2264 C  C   . PHE A 1 303 ? -31.791 26.087 18.902  1.00 55.01  ? 394 PHE A C   1 
ATOM   2265 O  O   . PHE A 1 303 ? -30.708 25.506 19.017  1.00 51.32  ? 394 PHE A O   1 
ATOM   2266 C  CB  . PHE A 1 303 ? -32.729 25.698 21.208  1.00 45.60  ? 394 PHE A CB  1 
ATOM   2267 N  N   . LYS A 1 304 ? -32.434 26.191 17.739  1.00 53.21  ? 395 LYS A N   1 
ATOM   2268 C  CA  . LYS A 1 304 ? -31.858 25.672 16.500  1.00 54.16  ? 395 LYS A CA  1 
ATOM   2269 C  C   . LYS A 1 304 ? -30.954 26.730 15.871  1.00 55.85  ? 395 LYS A C   1 
ATOM   2270 O  O   . LYS A 1 304 ? -30.018 26.403 15.115  1.00 47.82  ? 395 LYS A O   1 
ATOM   2271 C  CB  . LYS A 1 304 ? -32.946 25.236 15.508  1.00 51.55  ? 395 LYS A CB  1 
ATOM   2272 C  CG  . LYS A 1 304 ? -33.726 23.974 15.892  1.00 50.69  ? 395 LYS A CG  1 
ATOM   2273 C  CD  . LYS A 1 304 ? -34.615 23.529 14.724  1.00 58.48  ? 395 LYS A CD  1 
ATOM   2274 C  CE  . LYS A 1 304 ? -35.531 22.353 15.070  1.00 58.53  ? 395 LYS A CE  1 
ATOM   2275 N  NZ  . LYS A 1 304 ? -36.704 22.738 15.911  1.00 60.15  ? 395 LYS A NZ  1 
ATOM   2276 N  N   . PHE A 1 305 ? -31.239 27.996 16.188  1.00 47.19  ? 396 PHE A N   1 
ATOM   2277 C  CA  . PHE A 1 305 ? -30.405 29.101 15.730  1.00 47.59  ? 396 PHE A CA  1 
ATOM   2278 C  C   . PHE A 1 305 ? -30.020 29.962 16.908  1.00 46.51  ? 396 PHE A C   1 
ATOM   2279 O  O   . PHE A 1 305 ? -30.481 31.098 17.023  1.00 45.75  ? 396 PHE A O   1 
ATOM   2280 C  CB  . PHE A 1 305 ? -31.113 29.951 14.678  1.00 45.76  ? 396 PHE A CB  1 
ATOM   2281 C  CG  . PHE A 1 305 ? -30.179 30.529 13.649  1.00 44.12  ? 396 PHE A CG  1 
ATOM   2282 C  CD1 . PHE A 1 305 ? -30.337 30.235 12.306  1.00 45.14  ? 396 PHE A CD1 1 
ATOM   2283 C  CD2 . PHE A 1 305 ? -29.126 31.345 14.032  1.00 41.44  ? 396 PHE A CD2 1 
ATOM   2284 C  CE1 . PHE A 1 305 ? -29.468 30.750 11.364  1.00 40.49  ? 396 PHE A CE1 1 
ATOM   2285 C  CE2 . PHE A 1 305 ? -28.261 31.866 13.103  1.00 39.81  ? 396 PHE A CE2 1 
ATOM   2286 C  CZ  . PHE A 1 305 ? -28.431 31.567 11.764  1.00 44.41  ? 396 PHE A CZ  1 
ATOM   2287 N  N   . PRO A 1 306 ? -29.143 29.422 17.771  1.00 49.28  ? 397 PRO A N   1 
ATOM   2288 C  CA  . PRO A 1 306 ? -28.815 29.929 19.110  1.00 45.80  ? 397 PRO A CA  1 
ATOM   2289 C  C   . PRO A 1 306 ? -28.157 31.282 19.020  1.00 45.29  ? 397 PRO A C   1 
ATOM   2290 O  O   . PRO A 1 306 ? -28.365 32.116 19.899  1.00 41.84  ? 397 PRO A O   1 
ATOM   2291 C  CB  . PRO A 1 306 ? -27.788 28.919 19.640  1.00 45.64  ? 397 PRO A CB  1 
ATOM   2292 C  CG  . PRO A 1 306 ? -27.817 27.767 18.701  1.00 48.02  ? 397 PRO A CG  1 
ATOM   2293 C  CD  . PRO A 1 306 ? -28.272 28.305 17.379  1.00 45.18  ? 397 PRO A CD  1 
ATOM   2294 N  N   . PHE A 1 307 ? -27.371 31.490 17.965  1.00 43.94  ? 398 PHE A N   1 
ATOM   2295 C  CA  . PHE A 1 307 ? -26.614 32.725 17.817  1.00 44.19  ? 398 PHE A CA  1 
ATOM   2296 C  C   . PHE A 1 307 ? -27.143 33.629 16.715  1.00 39.71  ? 398 PHE A C   1 
ATOM   2297 O  O   . PHE A 1 307 ? -26.381 34.219 15.966  1.00 37.84  ? 398 PHE A O   1 
ATOM   2298 C  CB  . PHE A 1 307 ? -25.142 32.418 17.581  1.00 45.06  ? 398 PHE A CB  1 
ATOM   2299 C  CG  . PHE A 1 307 ? -24.571 31.484 18.580  1.00 40.67  ? 398 PHE A CG  1 
ATOM   2300 C  CD1 . PHE A 1 307 ? -24.191 31.937 19.828  1.00 43.72  ? 398 PHE A CD1 1 
ATOM   2301 C  CD2 . PHE A 1 307 ? -24.431 30.146 18.283  1.00 42.10  ? 398 PHE A CD2 1 
ATOM   2302 C  CE1 . PHE A 1 307 ? -23.672 31.067 20.763  1.00 40.27  ? 398 PHE A CE1 1 
ATOM   2303 C  CE2 . PHE A 1 307 ? -23.912 29.273 19.207  1.00 46.15  ? 398 PHE A CE2 1 
ATOM   2304 C  CZ  . PHE A 1 307 ? -23.532 29.731 20.452  1.00 38.48  ? 398 PHE A CZ  1 
ATOM   2305 N  N   . PHE A 1 308 ? -28.457 33.735 16.638  1.00 37.14  ? 399 PHE A N   1 
ATOM   2306 C  CA  . PHE A 1 308 ? -29.106 34.693 15.776  1.00 34.97  ? 399 PHE A CA  1 
ATOM   2307 C  C   . PHE A 1 308 ? -28.514 36.077 15.957  1.00 34.56  ? 399 PHE A C   1 
ATOM   2308 O  O   . PHE A 1 308 ? -28.212 36.780 14.998  1.00 36.78  ? 399 PHE A O   1 
ATOM   2309 C  CB  . PHE A 1 308 ? -30.574 34.732 16.144  1.00 38.86  ? 399 PHE A CB  1 
ATOM   2310 C  CG  . PHE A 1 308 ? -31.366 35.774 15.410  1.00 40.57  ? 399 PHE A CG  1 
ATOM   2311 C  CD1 . PHE A 1 308 ? -32.009 35.465 14.224  1.00 30.44  ? 399 PHE A CD1 1 
ATOM   2312 C  CD2 . PHE A 1 308 ? -31.507 37.050 15.931  1.00 40.09  ? 399 PHE A CD2 1 
ATOM   2313 C  CE1 . PHE A 1 308 ? -32.767 36.400 13.568  1.00 32.32  ? 399 PHE A CE1 1 
ATOM   2314 C  CE2 . PHE A 1 308 ? -32.262 37.996 15.262  1.00 35.00  ? 399 PHE A CE2 1 
ATOM   2315 C  CZ  . PHE A 1 308 ? -32.896 37.665 14.081  1.00 35.04  ? 399 PHE A CZ  1 
ATOM   2316 N  N   . GLU A 1 309 ? -28.356 36.487 17.198  1.00 36.60  ? 400 GLU A N   1 
ATOM   2317 C  CA  . GLU A 1 309 ? -27.900 37.841 17.441  1.00 42.26  ? 400 GLU A CA  1 
ATOM   2318 C  C   . GLU A 1 309 ? -26.499 38.078 16.900  1.00 40.27  ? 400 GLU A C   1 
ATOM   2319 O  O   . GLU A 1 309 ? -26.218 39.128 16.320  1.00 38.06  ? 400 GLU A O   1 
ATOM   2320 C  CB  . GLU A 1 309 ? -28.019 38.187 18.925  1.00 43.02  ? 400 GLU A CB  1 
ATOM   2321 C  CG  . GLU A 1 309 ? -29.468 38.282 19.347  1.00 40.88  ? 400 GLU A CG  1 
ATOM   2322 C  CD  . GLU A 1 309 ? -29.666 38.744 20.773  1.00 47.22  ? 400 GLU A CD  1 
ATOM   2323 O  OE1 . GLU A 1 309 ? -28.698 39.238 21.392  1.00 51.56  ? 400 GLU A OE1 1 
ATOM   2324 O  OE2 . GLU A 1 309 ? -30.810 38.618 21.273  1.00 45.70  ? 400 GLU A OE2 1 
ATOM   2325 N  N   . ALA A 1 310 ? -25.631 37.090 17.075  1.00 39.59  ? 401 ALA A N   1 
ATOM   2326 C  CA  . ALA A 1 310 ? -24.264 37.203 16.600  1.00 39.34  ? 401 ALA A CA  1 
ATOM   2327 C  C   . ALA A 1 310 ? -24.234 37.490 15.096  1.00 40.76  ? 401 ALA A C   1 
ATOM   2328 O  O   . ALA A 1 310 ? -23.563 38.416 14.643  1.00 40.17  ? 401 ALA A O   1 
ATOM   2329 C  CB  . ALA A 1 310 ? -23.502 35.944 16.909  1.00 38.60  ? 401 ALA A CB  1 
ATOM   2330 N  N   . ILE A 1 311 ? -24.964 36.690 14.329  1.00 38.46  ? 402 ILE A N   1 
ATOM   2331 C  CA  . ILE A 1 311 ? -25.004 36.859 12.883  1.00 38.72  ? 402 ILE A CA  1 
ATOM   2332 C  C   . ILE A 1 311 ? -25.509 38.264 12.534  1.00 38.87  ? 402 ILE A C   1 
ATOM   2333 O  O   . ILE A 1 311 ? -24.978 38.907 11.632  1.00 40.90  ? 402 ILE A O   1 
ATOM   2334 C  CB  . ILE A 1 311 ? -25.811 35.720 12.183  1.00 36.98  ? 402 ILE A CB  1 
ATOM   2335 C  CG1 . ILE A 1 311 ? -25.494 35.670 10.699  1.00 32.37  ? 402 ILE A CG1 1 
ATOM   2336 C  CG2 . ILE A 1 311 ? -27.296 35.890 12.375  1.00 37.03  ? 402 ILE A CG2 1 
ATOM   2337 C  CD1 . ILE A 1 311 ? -24.047 35.865 10.411  1.00 36.33  ? 402 ILE A CD1 1 
ATOM   2338 N  N   . CYS A 1 312 ? -26.492 38.751 13.290  1.00 35.60  ? 403 CYS A N   1 
ATOM   2339 C  CA  . CYS A 1 312 ? -27.024 40.102 13.108  1.00 36.22  ? 403 CYS A CA  1 
ATOM   2340 C  C   . CYS A 1 312 ? -25.958 41.178 13.230  1.00 41.62  ? 403 CYS A C   1 
ATOM   2341 O  O   . CYS A 1 312 ? -25.991 42.183 12.524  1.00 43.18  ? 403 CYS A O   1 
ATOM   2342 C  CB  . CYS A 1 312 ? -28.126 40.391 14.123  1.00 38.20  ? 403 CYS A CB  1 
ATOM   2343 S  SG  . CYS A 1 312 ? -29.740 39.754 13.665  1.00 34.04  ? 403 CYS A SG  1 
ATOM   2344 N  N   . TRP A 1 313 ? -25.032 40.989 14.157  1.00 45.03  ? 404 TRP A N   1 
ATOM   2345 C  CA  . TRP A 1 313 ? -23.923 41.918 14.305  1.00 44.70  ? 404 TRP A CA  1 
ATOM   2346 C  C   . TRP A 1 313 ? -23.043 41.848 13.063  1.00 40.04  ? 404 TRP A C   1 
ATOM   2347 O  O   . TRP A 1 313 ? -22.633 42.867 12.505  1.00 37.94  ? 404 TRP A O   1 
ATOM   2348 C  CB  . TRP A 1 313 ? -23.103 41.583 15.560  1.00 43.05  ? 404 TRP A CB  1 
ATOM   2349 C  CG  . TRP A 1 313 ? -23.784 41.955 16.848  1.00 47.02  ? 404 TRP A CG  1 
ATOM   2350 C  CD1 . TRP A 1 313 ? -24.463 41.123 17.695  1.00 45.63  ? 404 TRP A CD1 1 
ATOM   2351 C  CD2 . TRP A 1 313 ? -23.859 43.260 17.430  1.00 48.19  ? 404 TRP A CD2 1 
ATOM   2352 N  NE1 . TRP A 1 313 ? -24.953 41.830 18.761  1.00 38.02  ? 404 TRP A NE1 1 
ATOM   2353 C  CE2 . TRP A 1 313 ? -24.596 43.144 18.625  1.00 40.44  ? 404 TRP A CE2 1 
ATOM   2354 C  CE3 . TRP A 1 313 ? -23.370 44.519 17.057  1.00 46.38  ? 404 TRP A CE3 1 
ATOM   2355 C  CZ2 . TRP A 1 313 ? -24.855 44.234 19.452  1.00 45.01  ? 404 TRP A CZ2 1 
ATOM   2356 C  CZ3 . TRP A 1 313 ? -23.632 45.605 17.882  1.00 47.02  ? 404 TRP A CZ3 1 
ATOM   2357 C  CH2 . TRP A 1 313 ? -24.370 45.454 19.064  1.00 46.12  ? 404 TRP A CH2 1 
ATOM   2358 N  N   . PHE A 1 314 ? -22.753 40.629 12.637  1.00 38.09  ? 405 PHE A N   1 
ATOM   2359 C  CA  . PHE A 1 314 ? -21.848 40.428 11.520  1.00 40.55  ? 405 PHE A CA  1 
ATOM   2360 C  C   . PHE A 1 314 ? -22.454 41.069 10.283  1.00 45.91  ? 405 PHE A C   1 
ATOM   2361 O  O   . PHE A 1 314 ? -21.754 41.677 9.467   1.00 43.12  ? 405 PHE A O   1 
ATOM   2362 C  CB  . PHE A 1 314 ? -21.629 38.940 11.280  1.00 40.92  ? 405 PHE A CB  1 
ATOM   2363 C  CG  . PHE A 1 314 ? -20.723 38.284 12.289  1.00 44.75  ? 405 PHE A CG  1 
ATOM   2364 C  CD1 . PHE A 1 314 ? -20.855 36.924 12.580  1.00 44.03  ? 405 PHE A CD1 1 
ATOM   2365 C  CD2 . PHE A 1 314 ? -19.733 39.014 12.942  1.00 43.92  ? 405 PHE A CD2 1 
ATOM   2366 C  CE1 . PHE A 1 314 ? -20.009 36.297 13.495  1.00 43.27  ? 405 PHE A CE1 1 
ATOM   2367 C  CE2 . PHE A 1 314 ? -18.877 38.394 13.857  1.00 46.03  ? 405 PHE A CE2 1 
ATOM   2368 C  CZ  . PHE A 1 314 ? -19.019 37.032 14.133  1.00 45.06  ? 405 PHE A CZ  1 
ATOM   2369 N  N   . VAL A 1 315 ? -23.772 40.928 10.168  1.00 44.39  ? 406 VAL A N   1 
ATOM   2370 C  CA  . VAL A 1 315 ? -24.520 41.488 9.066   1.00 34.99  ? 406 VAL A CA  1 
ATOM   2371 C  C   . VAL A 1 315 ? -24.533 43.011 9.066   1.00 36.54  ? 406 VAL A C   1 
ATOM   2372 O  O   . VAL A 1 315 ? -24.483 43.627 8.019   1.00 45.72  ? 406 VAL A O   1 
ATOM   2373 C  CB  . VAL A 1 315 ? -25.952 40.970 9.062   1.00 37.73  ? 406 VAL A CB  1 
ATOM   2374 C  CG1 . VAL A 1 315 ? -26.783 41.740 8.052   1.00 35.28  ? 406 VAL A CG1 1 
ATOM   2375 C  CG2 . VAL A 1 315 ? -25.978 39.468 8.759   1.00 36.10  ? 406 VAL A CG2 1 
ATOM   2376 N  N   . ALA A 1 316 ? -24.595 43.629 10.230  1.00 41.90  ? 407 ALA A N   1 
ATOM   2377 C  CA  . ALA A 1 316 ? -24.658 45.088 10.291  1.00 43.27  ? 407 ALA A CA  1 
ATOM   2378 C  C   . ALA A 1 316 ? -23.314 45.701 9.926   1.00 43.37  ? 407 ALA A C   1 
ATOM   2379 O  O   . ALA A 1 316 ? -23.250 46.808 9.412   1.00 47.66  ? 407 ALA A O   1 
ATOM   2380 C  CB  . ALA A 1 316 ? -25.114 45.562 11.665  1.00 43.18  ? 407 ALA A CB  1 
ATOM   2381 N  N   . LYS A 1 317 ? -22.242 44.978 10.209  1.00 41.28  ? 408 LYS A N   1 
ATOM   2382 C  CA  . LYS A 1 317 ? -20.923 45.347 9.731   1.00 42.92  ? 408 LYS A CA  1 
ATOM   2383 C  C   . LYS A 1 317 ? -20.924 45.439 8.191   1.00 46.26  ? 408 LYS A C   1 
ATOM   2384 O  O   . LYS A 1 317 ? -20.662 46.497 7.592   1.00 43.39  ? 408 LYS A O   1 
ATOM   2385 C  CB  . LYS A 1 317 ? -19.917 44.287 10.174  1.00 46.43  ? 408 LYS A CB  1 
ATOM   2386 C  CG  . LYS A 1 317 ? -18.576 44.822 10.590  1.00 48.29  ? 408 LYS A CG  1 
ATOM   2387 C  CD  . LYS A 1 317 ? -18.428 44.757 12.095  1.00 50.64  ? 408 LYS A CD  1 
ATOM   2388 C  CE  . LYS A 1 317 ? -16.959 44.734 12.526  1.00 56.40  ? 408 LYS A CE  1 
ATOM   2389 N  NZ  . LYS A 1 317 ? -16.303 43.410 12.286  1.00 60.37  ? 408 LYS A NZ  1 
ATOM   2390 N  N   . ASN A 1 318 ? -21.223 44.318 7.549   1.00 42.60  ? 409 ASN A N   1 
ATOM   2391 C  CA  . ASN A 1 318 ? -21.249 44.277 6.102   1.00 38.79  ? 409 ASN A CA  1 
ATOM   2392 C  C   . ASN A 1 318 ? -22.235 45.262 5.502   1.00 40.71  ? 409 ASN A C   1 
ATOM   2393 O  O   . ASN A 1 318 ? -21.903 45.982 4.569   1.00 44.45  ? 409 ASN A O   1 
ATOM   2394 C  CB  . ASN A 1 318 ? -21.520 42.865 5.629   1.00 37.53  ? 409 ASN A CB  1 
ATOM   2395 C  CG  . ASN A 1 318 ? -20.402 41.923 6.008   1.00 44.31  ? 409 ASN A CG  1 
ATOM   2396 O  OD1 . ASN A 1 318 ? -19.373 41.883 5.345   1.00 43.07  ? 409 ASN A OD1 1 
ATOM   2397 N  ND2 . ASN A 1 318 ? -20.579 41.183 7.106   1.00 43.52  ? 409 ASN A ND2 1 
ATOM   2398 N  N   . LEU A 1 319 ? -23.443 45.322 6.037   1.00 39.09  ? 410 LEU A N   1 
ATOM   2399 C  CA  . LEU A 1 319 ? -24.401 46.275 5.495   1.00 40.17  ? 410 LEU A CA  1 
ATOM   2400 C  C   . LEU A 1 319 ? -23.936 47.726 5.663   1.00 44.92  ? 410 LEU A C   1 
ATOM   2401 O  O   . LEU A 1 319 ? -24.111 48.533 4.748   1.00 43.25  ? 410 LEU A O   1 
ATOM   2402 C  CB  . LEU A 1 319 ? -25.800 46.062 6.062   1.00 40.56  ? 410 LEU A CB  1 
ATOM   2403 C  CG  . LEU A 1 319 ? -26.445 44.697 5.798   1.00 42.59  ? 410 LEU A CG  1 
ATOM   2404 C  CD1 . LEU A 1 319 ? -27.865 44.721 6.336   1.00 43.37  ? 410 LEU A CD1 1 
ATOM   2405 C  CD2 . LEU A 1 319 ? -26.440 44.300 4.318   1.00 35.49  ? 410 LEU A CD2 1 
ATOM   2406 N  N   . LEU A 1 320 ? -23.334 48.059 6.808   1.00 41.87  ? 411 LEU A N   1 
ATOM   2407 C  CA  . LEU A 1 320 ? -22.748 49.388 6.988   1.00 40.60  ? 411 LEU A CA  1 
ATOM   2408 C  C   . LEU A 1 320 ? -21.747 49.699 5.892   1.00 44.66  ? 411 LEU A C   1 
ATOM   2409 O  O   . LEU A 1 320 ? -21.832 50.743 5.259   1.00 49.75  ? 411 LEU A O   1 
ATOM   2410 C  CB  . LEU A 1 320 ? -22.050 49.526 8.344   1.00 48.10  ? 411 LEU A CB  1 
ATOM   2411 C  CG  . LEU A 1 320 ? -21.205 50.794 8.561   1.00 44.96  ? 411 LEU A CG  1 
ATOM   2412 C  CD1 . LEU A 1 320 ? -22.030 52.043 8.392   1.00 46.33  ? 411 LEU A CD1 1 
ATOM   2413 C  CD2 . LEU A 1 320 ? -20.558 50.792 9.930   1.00 44.35  ? 411 LEU A CD2 1 
ATOM   2414 N  N   . GLU A 1 321 ? -20.802 48.786 5.670   1.00 46.21  ? 412 GLU A N   1 
ATOM   2415 C  CA  . GLU A 1 321 ? -19.757 48.966 4.657   1.00 43.21  ? 412 GLU A CA  1 
ATOM   2416 C  C   . GLU A 1 321 ? -20.303 49.285 3.254   1.00 46.53  ? 412 GLU A C   1 
ATOM   2417 O  O   . GLU A 1 321 ? -19.756 50.131 2.538   1.00 44.93  ? 412 GLU A O   1 
ATOM   2418 C  CB  . GLU A 1 321 ? -18.836 47.741 4.621   1.00 40.21  ? 412 GLU A CB  1 
ATOM   2419 C  CG  . GLU A 1 321 ? -17.750 47.772 3.537   1.00 46.51  ? 412 GLU A CG  1 
ATOM   2420 C  CD  . GLU A 1 321 ? -16.925 49.067 3.514   1.00 49.51  ? 412 GLU A CD  1 
ATOM   2421 O  OE1 . GLU A 1 321 ? -16.472 49.532 4.593   1.00 48.96  ? 412 GLU A OE1 1 
ATOM   2422 O  OE2 . GLU A 1 321 ? -16.733 49.618 2.403   1.00 47.33  ? 412 GLU A OE2 1 
ATOM   2423 N  N   . THR A 1 322 ? -21.382 48.608 2.875   1.00 44.21  ? 413 THR A N   1 
ATOM   2424 C  CA  . THR A 1 322 ? -22.015 48.825 1.588   1.00 40.38  ? 413 THR A CA  1 
ATOM   2425 C  C   . THR A 1 322 ? -22.632 50.219 1.506   1.00 42.29  ? 413 THR A C   1 
ATOM   2426 O  O   . THR A 1 322 ? -22.530 50.892 0.489   1.00 44.51  ? 413 THR A O   1 
ATOM   2427 C  CB  . THR A 1 322 ? -23.082 47.749 1.317   1.00 37.59  ? 413 THR A CB  1 
ATOM   2428 O  OG1 . THR A 1 322 ? -22.437 46.492 1.114   1.00 42.53  ? 413 THR A OG1 1 
ATOM   2429 C  CG2 . THR A 1 322 ? -23.900 48.086 0.096   1.00 38.90  ? 413 THR A CG2 1 
ATOM   2430 N  N   . LEU A 1 323 ? -23.277 50.654 2.578   1.00 41.77  ? 414 LEU A N   1 
ATOM   2431 C  CA  . LEU A 1 323 ? -23.911 51.967 2.583   1.00 46.22  ? 414 LEU A CA  1 
ATOM   2432 C  C   . LEU A 1 323 ? -22.866 53.075 2.644   1.00 52.33  ? 414 LEU A C   1 
ATOM   2433 O  O   . LEU A 1 323 ? -23.098 54.183 2.169   1.00 51.34  ? 414 LEU A O   1 
ATOM   2434 C  CB  . LEU A 1 323 ? -24.852 52.116 3.774   1.00 48.78  ? 414 LEU A CB  1 
ATOM   2435 C  CG  . LEU A 1 323 ? -26.126 51.287 3.833   1.00 51.12  ? 414 LEU A CG  1 
ATOM   2436 C  CD1 . LEU A 1 323 ? -26.872 51.618 5.115   1.00 50.11  ? 414 LEU A CD1 1 
ATOM   2437 C  CD2 . LEU A 1 323 ? -26.997 51.550 2.621   1.00 50.54  ? 414 LEU A CD2 1 
ATOM   2438 N  N   . LYS A 1 324 ? -21.731 52.780 3.269   1.00 49.81  ? 415 LYS A N   1 
ATOM   2439 C  CA  . LYS A 1 324 ? -20.622 53.716 3.315   1.00 49.97  ? 415 LYS A CA  1 
ATOM   2440 C  C   . LYS A 1 324 ? -20.097 53.920 1.891   1.00 51.52  ? 415 LYS A C   1 
ATOM   2441 O  O   . LYS A 1 324 ? -19.817 55.047 1.485   1.00 54.74  ? 415 LYS A O   1 
ATOM   2442 C  CB  . LYS A 1 324 ? -19.520 53.189 4.243   1.00 52.93  ? 415 LYS A CB  1 
ATOM   2443 C  CG  . LYS A 1 324 ? -18.382 54.163 4.511   1.00 58.95  ? 415 LYS A CG  1 
ATOM   2444 C  CD  . LYS A 1 324 ? -17.311 53.548 5.425   1.00 57.61  ? 415 LYS A CD  1 
ATOM   2445 C  CE  . LYS A 1 324 ? -17.887 53.043 6.775   1.00 64.37  ? 415 LYS A CE  1 
ATOM   2446 N  NZ  . LYS A 1 324 ? -18.457 54.096 7.684   1.00 56.92  ? 415 LYS A NZ  1 
ATOM   2447 N  N   . GLU A 1 325 ? -19.991 52.835 1.126   1.00 43.65  ? 416 GLU A N   1 
ATOM   2448 C  CA  . GLU A 1 325 ? -19.503 52.931 -0.252  1.00 47.52  ? 416 GLU A CA  1 
ATOM   2449 C  C   . GLU A 1 325 ? -20.473 53.671 -1.166  1.00 50.39  ? 416 GLU A C   1 
ATOM   2450 O  O   . GLU A 1 325 ? -20.060 54.414 -2.053  1.00 54.78  ? 416 GLU A O   1 
ATOM   2451 C  CB  . GLU A 1 325 ? -19.209 51.553 -0.845  1.00 40.50  ? 416 GLU A CB  1 
ATOM   2452 C  CG  . GLU A 1 325 ? -18.023 50.849 -0.249  1.00 40.63  ? 416 GLU A CG  1 
ATOM   2453 C  CD  . GLU A 1 325 ? -17.946 49.400 -0.692  1.00 45.87  ? 416 GLU A CD  1 
ATOM   2454 O  OE1 . GLU A 1 325 ? -18.568 49.060 -1.723  1.00 44.88  ? 416 GLU A OE1 1 
ATOM   2455 O  OE2 . GLU A 1 325 ? -17.281 48.598 -0.006  1.00 44.42  ? 416 GLU A OE2 1 
ATOM   2456 N  N   . LEU A 1 326 ? -21.765 53.448 -0.975  1.00 48.21  ? 417 LEU A N   1 
ATOM   2457 C  CA  . LEU A 1 326 ? -22.744 54.159 -1.767  1.00 47.20  ? 417 LEU A CA  1 
ATOM   2458 C  C   . LEU A 1 326 ? -22.757 55.656 -1.415  1.00 51.49  ? 417 LEU A C   1 
ATOM   2459 O  O   . LEU A 1 326 ? -22.865 56.495 -2.296  1.00 52.84  ? 417 LEU A O   1 
ATOM   2460 C  CB  . LEU A 1 326 ? -24.128 53.532 -1.614  1.00 46.97  ? 417 LEU A CB  1 
ATOM   2461 C  CG  . LEU A 1 326 ? -24.300 52.134 -2.213  1.00 48.64  ? 417 LEU A CG  1 
ATOM   2462 C  CD1 . LEU A 1 326 ? -25.636 51.517 -1.824  1.00 44.44  ? 417 LEU A CD1 1 
ATOM   2463 C  CD2 . LEU A 1 326 ? -24.145 52.168 -3.728  1.00 44.74  ? 417 LEU A CD2 1 
ATOM   2464 N  N   . ARG A 1 327 ? -22.632 56.005 -0.140  1.00 48.16  ? 418 ARG A N   1 
ATOM   2465 C  CA  . ARG A 1 327 ? -22.702 57.416 0.221   1.00 53.09  ? 418 ARG A CA  1 
ATOM   2466 C  C   . ARG A 1 327 ? -21.466 58.157 -0.267  1.00 53.35  ? 418 ARG A C   1 
ATOM   2467 O  O   . ARG A 1 327 ? -21.567 59.269 -0.774  1.00 47.22  ? 418 ARG A O   1 
ATOM   2468 C  CB  . ARG A 1 327 ? -22.903 57.617 1.730   1.00 47.25  ? 418 ARG A CB  1 
ATOM   2469 N  N   . GLU A 1 328 ? -20.304 57.529 -0.113  1.00 57.10  ? 419 GLU A N   1 
ATOM   2470 C  CA  . GLU A 1 328 ? -19.039 58.139 -0.526  1.00 58.75  ? 419 GLU A CA  1 
ATOM   2471 C  C   . GLU A 1 328 ? -18.970 58.388 -2.027  1.00 55.11  ? 419 GLU A C   1 
ATOM   2472 O  O   . GLU A 1 328 ? -18.052 59.042 -2.506  1.00 56.60  ? 419 GLU A O   1 
ATOM   2473 C  CB  . GLU A 1 328 ? -17.844 57.280 -0.113  1.00 57.42  ? 419 GLU A CB  1 
ATOM   2474 C  CG  . GLU A 1 328 ? -17.477 57.374 1.354   1.00 64.90  ? 419 GLU A CG  1 
ATOM   2475 C  CD  . GLU A 1 328 ? -16.274 56.508 1.713   1.00 74.65  ? 419 GLU A CD  1 
ATOM   2476 O  OE1 . GLU A 1 328 ? -15.452 56.200 0.805   1.00 69.03  ? 419 GLU A OE1 1 
ATOM   2477 O  OE2 . GLU A 1 328 ? -16.167 56.134 2.908   1.00 68.23  ? 419 GLU A OE2 1 
ATOM   2478 N  N   . ASP A 1 329 ? -19.939 57.871 -2.768  1.00 50.82  ? 420 ASP A N   1 
ATOM   2479 C  CA  . ASP A 1 329 ? -19.920 58.031 -4.214  1.00 49.43  ? 420 ASP A CA  1 
ATOM   2480 C  C   . ASP A 1 329 ? -21.174 58.704 -4.756  1.00 49.41  ? 420 ASP A C   1 
ATOM   2481 O  O   . ASP A 1 329 ? -21.415 58.668 -5.955  1.00 58.88  ? 420 ASP A O   1 
ATOM   2482 C  CB  . ASP A 1 329 ? -19.728 56.671 -4.889  1.00 50.81  ? 420 ASP A CB  1 
ATOM   2483 C  CG  . ASP A 1 329 ? -18.623 56.685 -5.923  1.00 51.00  ? 420 ASP A CG  1 
ATOM   2484 O  OD1 . ASP A 1 329 ? -17.677 57.476 -5.761  1.00 52.22  ? 420 ASP A OD1 1 
ATOM   2485 O  OD2 . ASP A 1 329 ? -18.695 55.912 -6.899  1.00 54.41  ? 420 ASP A OD2 1 
ATOM   2486 N  N   . GLY A 1 330 ? -21.978 59.296 -3.875  1.00 55.36  ? 421 GLY A N   1 
ATOM   2487 C  CA  . GLY A 1 330 ? -23.203 59.983 -4.268  1.00 51.81  ? 421 GLY A CA  1 
ATOM   2488 C  C   . GLY A 1 330 ? -24.416 59.146 -4.668  1.00 54.12  ? 421 GLY A C   1 
ATOM   2489 O  O   . GLY A 1 330 ? -25.461 59.708 -5.004  1.00 50.62  ? 421 GLY A O   1 
ATOM   2490 N  N   . PHE A 1 331 ? -24.288 57.816 -4.630  1.00 55.29  ? 422 PHE A N   1 
ATOM   2491 C  CA  . PHE A 1 331 ? -25.380 56.905 -5.002  1.00 55.30  ? 422 PHE A CA  1 
ATOM   2492 C  C   . PHE A 1 331 ? -26.468 56.734 -3.925  1.00 60.06  ? 422 PHE A C   1 
ATOM   2493 O  O   . PHE A 1 331 ? -26.229 56.928 -2.720  1.00 52.28  ? 422 PHE A O   1 
ATOM   2494 C  CB  . PHE A 1 331 ? -24.839 55.519 -5.365  1.00 55.54  ? 422 PHE A CB  1 
ATOM   2495 C  CG  . PHE A 1 331 ? -23.964 55.495 -6.591  1.00 58.25  ? 422 PHE A CG  1 
ATOM   2496 C  CD1 . PHE A 1 331 ? -24.446 55.923 -7.815  1.00 56.80  ? 422 PHE A CD1 1 
ATOM   2497 C  CD2 . PHE A 1 331 ? -22.665 55.006 -6.521  1.00 55.52  ? 422 PHE A CD2 1 
ATOM   2498 C  CE1 . PHE A 1 331 ? -23.641 55.890 -8.941  1.00 58.82  ? 422 PHE A CE1 1 
ATOM   2499 C  CE2 . PHE A 1 331 ? -21.858 54.972 -7.637  1.00 55.43  ? 422 PHE A CE2 1 
ATOM   2500 C  CZ  . PHE A 1 331 ? -22.343 55.415 -8.850  1.00 56.08  ? 422 PHE A CZ  1 
ATOM   2501 N  N   . GLN A 1 332 ? -27.663 56.356 -4.376  1.00 60.28  ? 423 GLN A N   1 
ATOM   2502 C  CA  . GLN A 1 332 ? -28.793 56.119 -3.481  1.00 62.69  ? 423 GLN A CA  1 
ATOM   2503 C  C   . GLN A 1 332 ? -28.989 54.621 -3.307  1.00 59.95  ? 423 GLN A C   1 
ATOM   2504 O  O   . GLN A 1 332 ? -29.068 53.885 -4.293  1.00 62.78  ? 423 GLN A O   1 
ATOM   2505 C  CB  . GLN A 1 332 ? -30.076 56.746 -4.046  1.00 66.67  ? 423 GLN A CB  1 
ATOM   2506 C  CG  . GLN A 1 332 ? -31.177 56.985 -3.008  1.00 74.97  ? 423 GLN A CG  1 
ATOM   2507 C  CD  . GLN A 1 332 ? -30.879 58.166 -2.089  1.00 80.85  ? 423 GLN A CD  1 
ATOM   2508 O  OE1 . GLN A 1 332 ? -30.402 59.213 -2.536  1.00 85.68  ? 423 GLN A OE1 1 
ATOM   2509 N  NE2 . GLN A 1 332 ? -31.160 57.999 -0.801  1.00 80.19  ? 423 GLN A NE2 1 
ATOM   2510 N  N   . PRO A 1 333 ? -29.077 54.163 -2.052  1.00 52.51  ? 424 PRO A N   1 
ATOM   2511 C  CA  . PRO A 1 333 ? -29.212 52.739 -1.746  1.00 50.43  ? 424 PRO A CA  1 
ATOM   2512 C  C   . PRO A 1 333 ? -30.632 52.276 -1.969  1.00 52.16  ? 424 PRO A C   1 
ATOM   2513 O  O   . PRO A 1 333 ? -31.561 53.065 -1.800  1.00 50.71  ? 424 PRO A O   1 
ATOM   2514 C  CB  . PRO A 1 333 ? -28.897 52.669 -0.253  1.00 50.11  ? 424 PRO A CB  1 
ATOM   2515 C  CG  . PRO A 1 333 ? -28.359 54.026 0.117   1.00 54.98  ? 424 PRO A CG  1 
ATOM   2516 C  CD  . PRO A 1 333 ? -28.987 54.974 -0.835  1.00 59.49  ? 424 PRO A CD  1 
ATOM   2517 N  N   . GLN A 1 334 ? -30.798 51.014 -2.341  1.00 45.71  ? 425 GLN A N   1 
ATOM   2518 C  CA  . GLN A 1 334 ? -32.128 50.465 -2.517  1.00 44.58  ? 425 GLN A CA  1 
ATOM   2519 C  C   . GLN A 1 334 ? -32.964 50.579 -1.248  1.00 46.82  ? 425 GLN A C   1 
ATOM   2520 O  O   . GLN A 1 334 ? -32.439 50.643 -0.141  1.00 50.90  ? 425 GLN A O   1 
ATOM   2521 C  CB  . GLN A 1 334 ? -32.046 49.011 -2.951  1.00 48.48  ? 425 GLN A CB  1 
ATOM   2522 C  CG  . GLN A 1 334 ? -31.640 48.802 -4.391  1.00 48.94  ? 425 GLN A CG  1 
ATOM   2523 C  CD  . GLN A 1 334 ? -31.952 47.399 -4.844  1.00 58.78  ? 425 GLN A CD  1 
ATOM   2524 O  OE1 . GLN A 1 334 ? -31.063 46.546 -4.910  1.00 61.78  ? 425 GLN A OE1 1 
ATOM   2525 N  NE2 . GLN A 1 334 ? -33.228 47.136 -5.129  1.00 54.29  ? 425 GLN A NE2 1 
ATOM   2526 N  N   . THR A 1 335 ? -34.277 50.590 -1.413  1.00 48.43  ? 426 THR A N   1 
ATOM   2527 C  CA  . THR A 1 335 ? -35.180 50.714 -0.284  1.00 48.31  ? 426 THR A CA  1 
ATOM   2528 C  C   . THR A 1 335 ? -34.969 49.628 0.766   1.00 52.04  ? 426 THR A C   1 
ATOM   2529 O  O   . THR A 1 335 ? -34.912 49.917 1.960   1.00 51.58  ? 426 THR A O   1 
ATOM   2530 C  CB  . THR A 1 335 ? -36.637 50.658 -0.737  1.00 52.60  ? 426 THR A CB  1 
ATOM   2531 O  OG1 . THR A 1 335 ? -36.835 51.590 -1.806  1.00 57.15  ? 426 THR A OG1 1 
ATOM   2532 C  CG2 . THR A 1 335 ? -37.570 50.997 0.425   1.00 53.91  ? 426 THR A CG2 1 
ATOM   2533 N  N   . TYR A 1 336 ? -34.862 48.381 0.327   1.00 48.40  ? 427 TYR A N   1 
ATOM   2534 C  CA  . TYR A 1 336 ? -34.853 47.268 1.269   1.00 48.56  ? 427 TYR A CA  1 
ATOM   2535 C  C   . TYR A 1 336 ? -33.634 47.305 2.182   1.00 49.05  ? 427 TYR A C   1 
ATOM   2536 O  O   . TYR A 1 336 ? -33.646 46.764 3.294   1.00 45.79  ? 427 TYR A O   1 
ATOM   2537 C  CB  . TYR A 1 336 ? -34.946 45.932 0.535   1.00 49.58  ? 427 TYR A CB  1 
ATOM   2538 C  CG  . TYR A 1 336 ? -33.626 45.401 0.071   1.00 45.90  ? 427 TYR A CG  1 
ATOM   2539 C  CD1 . TYR A 1 336 ? -33.281 45.422 -1.266  1.00 48.12  ? 427 TYR A CD1 1 
ATOM   2540 C  CD2 . TYR A 1 336 ? -32.721 44.877 0.976   1.00 47.93  ? 427 TYR A CD2 1 
ATOM   2541 C  CE1 . TYR A 1 336 ? -32.064 44.932 -1.695  1.00 48.93  ? 427 TYR A CE1 1 
ATOM   2542 C  CE2 . TYR A 1 336 ? -31.504 44.390 0.568   1.00 53.75  ? 427 TYR A CE2 1 
ATOM   2543 C  CZ  . TYR A 1 336 ? -31.177 44.412 -0.773  1.00 56.01  ? 427 TYR A CZ  1 
ATOM   2544 O  OH  . TYR A 1 336 ? -29.955 43.913 -1.177  1.00 58.97  ? 427 TYR A OH  1 
ATOM   2545 N  N   . LEU A 1 337 ? -32.585 47.964 1.713   1.00 50.48  ? 428 LEU A N   1 
ATOM   2546 C  CA  . LEU A 1 337 ? -31.360 48.091 2.489   1.00 46.83  ? 428 LEU A CA  1 
ATOM   2547 C  C   . LEU A 1 337 ? -31.472 49.188 3.543   1.00 48.51  ? 428 LEU A C   1 
ATOM   2548 O  O   . LEU A 1 337 ? -30.887 49.102 4.625   1.00 47.49  ? 428 LEU A O   1 
ATOM   2549 C  CB  . LEU A 1 337 ? -30.211 48.414 1.557   1.00 50.26  ? 428 LEU A CB  1 
ATOM   2550 C  CG  . LEU A 1 337 ? -28.844 47.961 2.023   1.00 52.21  ? 428 LEU A CG  1 
ATOM   2551 C  CD1 . LEU A 1 337 ? -28.867 46.458 2.100   1.00 58.00  ? 428 LEU A CD1 1 
ATOM   2552 C  CD2 . LEU A 1 337 ? -27.808 48.439 1.030   1.00 52.60  ? 428 LEU A CD2 1 
ATOM   2553 N  N   . VAL A 1 338 ? -32.211 50.238 3.223   1.00 48.99  ? 429 VAL A N   1 
ATOM   2554 C  CA  . VAL A 1 338 ? -32.428 51.296 4.191   1.00 48.04  ? 429 VAL A CA  1 
ATOM   2555 C  C   . VAL A 1 338 ? -33.333 50.749 5.288   1.00 45.41  ? 429 VAL A C   1 
ATOM   2556 O  O   . VAL A 1 338 ? -33.011 50.846 6.469   1.00 48.76  ? 429 VAL A O   1 
ATOM   2557 C  CB  . VAL A 1 338 ? -33.007 52.571 3.524   1.00 46.60  ? 429 VAL A CB  1 
ATOM   2558 C  CG1 . VAL A 1 338 ? -33.466 53.571 4.556   1.00 43.17  ? 429 VAL A CG1 1 
ATOM   2559 C  CG2 . VAL A 1 338 ? -31.968 53.192 2.647   1.00 46.35  ? 429 VAL A CG2 1 
ATOM   2560 N  N   . GLN A 1 339 ? -34.444 50.138 4.889   1.00 45.76  ? 430 GLN A N   1 
ATOM   2561 C  CA  . GLN A 1 339 ? -35.387 49.550 5.837   1.00 47.63  ? 430 GLN A CA  1 
ATOM   2562 C  C   . GLN A 1 339 ? -34.687 48.567 6.766   1.00 45.70  ? 430 GLN A C   1 
ATOM   2563 O  O   . GLN A 1 339 ? -34.768 48.683 7.989   1.00 45.19  ? 430 GLN A O   1 
ATOM   2564 C  CB  . GLN A 1 339 ? -36.529 48.845 5.101   1.00 49.19  ? 430 GLN A CB  1 
ATOM   2565 C  CG  . GLN A 1 339 ? -37.371 49.760 4.218   1.00 53.48  ? 430 GLN A CG  1 
ATOM   2566 C  CD  . GLN A 1 339 ? -38.342 48.992 3.321   1.00 59.05  ? 430 GLN A CD  1 
ATOM   2567 O  OE1 . GLN A 1 339 ? -39.222 49.586 2.685   1.00 60.00  ? 430 GLN A OE1 1 
ATOM   2568 N  NE2 . GLN A 1 339 ? -38.184 47.668 3.267   1.00 55.79  ? 430 GLN A NE2 1 
ATOM   2569 N  N   . GLY A 1 340 ? -33.996 47.603 6.174   1.00 46.65  ? 431 GLY A N   1 
ATOM   2570 C  CA  . GLY A 1 340 ? -33.258 46.612 6.934   1.00 42.99  ? 431 GLY A CA  1 
ATOM   2571 C  C   . GLY A 1 340 ? -32.227 47.196 7.878   1.00 41.13  ? 431 GLY A C   1 
ATOM   2572 O  O   . GLY A 1 340 ? -32.098 46.749 9.017   1.00 43.71  ? 431 GLY A O   1 
ATOM   2573 N  N   . VAL A 1 341 ? -31.480 48.189 7.424   1.00 41.81  ? 432 VAL A N   1 
ATOM   2574 C  CA  . VAL A 1 341 ? -30.454 48.761 8.287   1.00 43.96  ? 432 VAL A CA  1 
ATOM   2575 C  C   . VAL A 1 341 ? -31.078 49.496 9.461   1.00 43.41  ? 432 VAL A C   1 
ATOM   2576 O  O   . VAL A 1 341 ? -30.696 49.269 10.608  1.00 40.89  ? 432 VAL A O   1 
ATOM   2577 C  CB  . VAL A 1 341 ? -29.500 49.681 7.533   1.00 48.82  ? 432 VAL A CB  1 
ATOM   2578 C  CG1 . VAL A 1 341 ? -28.666 50.482 8.508   1.00 47.89  ? 432 VAL A CG1 1 
ATOM   2579 C  CG2 . VAL A 1 341 ? -28.614 48.859 6.616   1.00 51.96  ? 432 VAL A CG2 1 
ATOM   2580 N  N   . LYS A 1 342 ? -32.049 50.359 9.179   1.00 42.51  ? 433 LYS A N   1 
ATOM   2581 C  CA  . LYS A 1 342 ? -32.819 50.995 10.243  1.00 44.65  ? 433 LYS A CA  1 
ATOM   2582 C  C   . LYS A 1 342 ? -33.297 49.961 11.260  1.00 40.71  ? 433 LYS A C   1 
ATOM   2583 O  O   . LYS A 1 342 ? -33.248 50.186 12.468  1.00 43.22  ? 433 LYS A O   1 
ATOM   2584 C  CB  . LYS A 1 342 ? -34.020 51.754 9.676   1.00 46.28  ? 433 LYS A CB  1 
ATOM   2585 C  CG  . LYS A 1 342 ? -33.689 53.120 9.114   1.00 51.17  ? 433 LYS A CG  1 
ATOM   2586 C  CD  . LYS A 1 342 ? -34.948 53.952 8.954   1.00 58.87  ? 433 LYS A CD  1 
ATOM   2587 C  CE  . LYS A 1 342 ? -35.123 54.438 7.528   1.00 65.96  ? 433 LYS A CE  1 
ATOM   2588 N  NZ  . LYS A 1 342 ? -36.373 55.233 7.366   1.00 78.31  ? 433 LYS A NZ  1 
ATOM   2589 N  N   . ALA A 1 343 ? -33.746 48.821 10.756  1.00 39.95  ? 434 ALA A N   1 
ATOM   2590 C  CA  . ALA A 1 343 ? -34.266 47.764 11.601  1.00 37.82  ? 434 ALA A CA  1 
ATOM   2591 C  C   . ALA A 1 343 ? -33.172 47.130 12.456  1.00 44.68  ? 434 ALA A C   1 
ATOM   2592 O  O   . ALA A 1 343 ? -33.374 46.920 13.655  1.00 45.35  ? 434 ALA A O   1 
ATOM   2593 C  CB  . ALA A 1 343 ? -34.969 46.725 10.770  1.00 40.49  ? 434 ALA A CB  1 
ATOM   2594 N  N   . LEU A 1 344 ? -32.021 46.833 11.851  1.00 40.75  ? 435 LEU A N   1 
ATOM   2595 C  CA  . LEU A 1 344 ? -30.880 46.297 12.595  1.00 39.20  ? 435 LEU A CA  1 
ATOM   2596 C  C   . LEU A 1 344 ? -30.462 47.247 13.696  1.00 44.62  ? 435 LEU A C   1 
ATOM   2597 O  O   . LEU A 1 344 ? -30.126 46.842 14.816  1.00 44.44  ? 435 LEU A O   1 
ATOM   2598 C  CB  . LEU A 1 344 ? -29.687 46.116 11.676  1.00 39.31  ? 435 LEU A CB  1 
ATOM   2599 C  CG  . LEU A 1 344 ? -29.474 44.736 11.083  1.00 42.40  ? 435 LEU A CG  1 
ATOM   2600 C  CD1 . LEU A 1 344 ? -28.230 44.753 10.191  1.00 40.92  ? 435 LEU A CD1 1 
ATOM   2601 C  CD2 . LEU A 1 344 ? -29.347 43.705 12.194  1.00 40.29  ? 435 LEU A CD2 1 
ATOM   2602 N  N   . HIS A 1 345 ? -30.457 48.525 13.345  1.00 45.75  ? 436 HIS A N   1 
ATOM   2603 C  CA  . HIS A 1 345 ? -30.031 49.572 14.243  1.00 43.36  ? 436 HIS A CA  1 
ATOM   2604 C  C   . HIS A 1 345 ? -30.942 49.576 15.474  1.00 44.05  ? 436 HIS A C   1 
ATOM   2605 O  O   . HIS A 1 345 ? -30.480 49.595 16.616  1.00 42.18  ? 436 HIS A O   1 
ATOM   2606 C  CB  . HIS A 1 345 ? -30.055 50.913 13.498  1.00 43.92  ? 436 HIS A CB  1 
ATOM   2607 C  CG  . HIS A 1 345 ? -29.902 52.101 14.387  1.00 52.94  ? 436 HIS A CG  1 
ATOM   2608 N  ND1 . HIS A 1 345 ? -28.742 52.366 15.083  1.00 54.18  ? 436 HIS A ND1 1 
ATOM   2609 C  CD2 . HIS A 1 345 ? -30.772 53.085 14.712  1.00 53.74  ? 436 HIS A CD2 1 
ATOM   2610 C  CE1 . HIS A 1 345 ? -28.903 53.466 15.795  1.00 53.19  ? 436 HIS A CE1 1 
ATOM   2611 N  NE2 . HIS A 1 345 ? -30.124 53.923 15.586  1.00 53.15  ? 436 HIS A NE2 1 
ATOM   2612 N  N   . THR A 1 346 ? -32.242 49.535 15.239  1.00 40.81  ? 437 THR A N   1 
ATOM   2613 C  CA  . THR A 1 346 ? -33.175 49.553 16.346  1.00 42.61  ? 437 THR A CA  1 
ATOM   2614 C  C   . THR A 1 346 ? -32.923 48.390 17.297  1.00 46.70  ? 437 THR A C   1 
ATOM   2615 O  O   . THR A 1 346 ? -33.002 48.544 18.518  1.00 49.05  ? 437 THR A O   1 
ATOM   2616 C  CB  . THR A 1 346 ? -34.607 49.477 15.860  1.00 44.71  ? 437 THR A CB  1 
ATOM   2617 O  OG1 . THR A 1 346 ? -34.880 50.605 15.021  1.00 56.49  ? 437 THR A OG1 1 
ATOM   2618 C  CG2 . THR A 1 346 ? -35.553 49.481 17.041  1.00 44.23  ? 437 THR A CG2 1 
ATOM   2619 N  N   . ALA A 1 347 ? -32.607 47.233 16.731  1.00 43.50  ? 438 ALA A N   1 
ATOM   2620 C  CA  . ALA A 1 347 ? -32.427 46.027 17.519  1.00 42.81  ? 438 ALA A CA  1 
ATOM   2621 C  C   . ALA A 1 347 ? -31.059 45.954 18.190  1.00 43.09  ? 438 ALA A C   1 
ATOM   2622 O  O   . ALA A 1 347 ? -30.955 45.444 19.291  1.00 43.49  ? 438 ALA A O   1 
ATOM   2623 C  CB  . ALA A 1 347 ? -32.695 44.785 16.681  1.00 34.56  ? 438 ALA A CB  1 
ATOM   2624 N  N   . LEU A 1 348 ? -30.007 46.453 17.549  1.00 42.89  ? 439 LEU A N   1 
ATOM   2625 C  CA  . LEU A 1 348 ? -28.710 46.470 18.221  1.00 40.81  ? 439 LEU A CA  1 
ATOM   2626 C  C   . LEU A 1 348 ? -28.787 47.420 19.405  1.00 48.00  ? 439 LEU A C   1 
ATOM   2627 O  O   . LEU A 1 348 ? -28.319 47.116 20.506  1.00 53.26  ? 439 LEU A O   1 
ATOM   2628 C  CB  . LEU A 1 348 ? -27.591 46.891 17.283  1.00 41.15  ? 439 LEU A CB  1 
ATOM   2629 C  CG  . LEU A 1 348 ? -26.901 45.770 16.497  1.00 44.14  ? 439 LEU A CG  1 
ATOM   2630 C  CD1 . LEU A 1 348 ? -27.902 44.843 15.859  1.00 42.11  ? 439 LEU A CD1 1 
ATOM   2631 C  CD2 . LEU A 1 348 ? -25.987 46.349 15.434  1.00 41.38  ? 439 LEU A CD2 1 
ATOM   2632 N  N   . LYS A 1 349 ? -29.409 48.568 19.179  1.00 44.75  ? 440 LYS A N   1 
ATOM   2633 C  CA  . LYS A 1 349 ? -29.563 49.569 20.221  1.00 48.16  ? 440 LYS A CA  1 
ATOM   2634 C  C   . LYS A 1 349 ? -30.321 48.994 21.419  1.00 49.13  ? 440 LYS A C   1 
ATOM   2635 O  O   . LYS A 1 349 ? -29.950 49.216 22.564  1.00 50.25  ? 440 LYS A O   1 
ATOM   2636 C  CB  . LYS A 1 349 ? -30.302 50.786 19.662  1.00 51.76  ? 440 LYS A CB  1 
ATOM   2637 C  CG  . LYS A 1 349 ? -30.199 52.028 20.515  1.00 52.61  ? 440 LYS A CG  1 
ATOM   2638 C  CD  . LYS A 1 349 ? -30.684 53.245 19.738  1.00 64.24  ? 440 LYS A CD  1 
ATOM   2639 C  CE  . LYS A 1 349 ? -30.600 54.516 20.588  1.00 71.90  ? 440 LYS A CE  1 
ATOM   2640 N  NZ  . LYS A 1 349 ? -31.546 54.487 21.741  1.00 62.04  ? 440 LYS A NZ  1 
ATOM   2641 N  N   . LEU A 1 350 ? -31.391 48.260 21.139  1.00 51.48  ? 441 LEU A N   1 
ATOM   2642 C  CA  . LEU A 1 350 ? -32.196 47.631 22.173  1.00 46.76  ? 441 LEU A CA  1 
ATOM   2643 C  C   . LEU A 1 350 ? -31.353 46.661 22.984  1.00 48.72  ? 441 LEU A C   1 
ATOM   2644 O  O   . LEU A 1 350 ? -31.292 46.742 24.204  1.00 53.26  ? 441 LEU A O   1 
ATOM   2645 C  CB  . LEU A 1 350 ? -33.371 46.884 21.545  1.00 49.57  ? 441 LEU A CB  1 
ATOM   2646 C  CG  . LEU A 1 350 ? -34.298 46.193 22.536  1.00 51.05  ? 441 LEU A CG  1 
ATOM   2647 C  CD1 . LEU A 1 350 ? -34.964 47.249 23.389  1.00 49.88  ? 441 LEU A CD1 1 
ATOM   2648 C  CD2 . LEU A 1 350 ? -35.328 45.364 21.810  1.00 46.03  ? 441 LEU A CD2 1 
ATOM   2649 N  N   . TRP A 1 351 ? -30.680 45.751 22.300  1.00 49.55  ? 442 TRP A N   1 
ATOM   2650 C  CA  . TRP A 1 351 ? -29.884 44.741 22.985  1.00 50.28  ? 442 TRP A CA  1 
ATOM   2651 C  C   . TRP A 1 351 ? -28.734 45.328 23.812  1.00 53.97  ? 442 TRP A C   1 
ATOM   2652 O  O   . TRP A 1 351 ? -28.098 44.615 24.589  1.00 54.67  ? 442 TRP A O   1 
ATOM   2653 C  CB  . TRP A 1 351 ? -29.348 43.724 21.981  1.00 44.84  ? 442 TRP A CB  1 
ATOM   2654 C  CG  . TRP A 1 351 ? -30.410 43.084 21.151  1.00 43.25  ? 442 TRP A CG  1 
ATOM   2655 C  CD1 . TRP A 1 351 ? -31.750 43.036 21.417  1.00 42.02  ? 442 TRP A CD1 1 
ATOM   2656 C  CD2 . TRP A 1 351 ? -30.227 42.414 19.896  1.00 47.98  ? 442 TRP A CD2 1 
ATOM   2657 N  NE1 . TRP A 1 351 ? -32.410 42.370 20.409  1.00 43.06  ? 442 TRP A NE1 1 
ATOM   2658 C  CE2 . TRP A 1 351 ? -31.496 41.974 19.468  1.00 42.24  ? 442 TRP A CE2 1 
ATOM   2659 C  CE3 . TRP A 1 351 ? -29.112 42.143 19.093  1.00 45.49  ? 442 TRP A CE3 1 
ATOM   2660 C  CZ2 . TRP A 1 351 ? -31.676 41.279 18.286  1.00 39.28  ? 442 TRP A CZ2 1 
ATOM   2661 C  CZ3 . TRP A 1 351 ? -29.295 41.448 17.921  1.00 41.19  ? 442 TRP A CZ3 1 
ATOM   2662 C  CH2 . TRP A 1 351 ? -30.564 41.024 17.528  1.00 41.84  ? 442 TRP A CH2 1 
ATOM   2663 N  N   . MET A 1 352 ? -28.474 46.622 23.652  1.00 53.72  ? 443 MET A N   1 
ATOM   2664 C  CA  . MET A 1 352 ? -27.354 47.263 24.344  1.00 55.33  ? 443 MET A CA  1 
ATOM   2665 C  C   . MET A 1 352 ? -27.761 48.077 25.573  1.00 55.13  ? 443 MET A C   1 
ATOM   2666 O  O   . MET A 1 352 ? -26.919 48.377 26.419  1.00 53.04  ? 443 MET A O   1 
ATOM   2667 C  CB  . MET A 1 352 ? -26.551 48.133 23.377  1.00 52.18  ? 443 MET A CB  1 
ATOM   2668 C  CG  . MET A 1 352 ? -25.791 47.329 22.362  1.00 52.02  ? 443 MET A CG  1 
ATOM   2669 S  SD  . MET A 1 352 ? -24.553 46.327 23.191  1.00 65.95  ? 443 MET A SD  1 
ATOM   2670 C  CE  . MET A 1 352 ? -23.496 47.638 23.810  1.00 57.49  ? 443 MET A CE  1 
ATOM   2671 N  N   . LYS A 1 353 ? -29.040 48.442 25.660  1.00 54.71  ? 444 LYS A N   1 
ATOM   2672 C  CA  . LYS A 1 353 ? -29.564 49.127 26.838  1.00 58.27  ? 444 LYS A CA  1 
ATOM   2673 C  C   . LYS A 1 353 ? -28.990 48.512 28.110  1.00 64.39  ? 444 LYS A C   1 
ATOM   2674 O  O   . LYS A 1 353 ? -28.963 47.284 28.258  1.00 61.69  ? 444 LYS A O   1 
ATOM   2675 C  CB  . LYS A 1 353 ? -31.089 49.061 26.869  1.00 58.72  ? 444 LYS A CB  1 
ATOM   2676 C  CG  . LYS A 1 353 ? -31.758 49.984 25.866  1.00 56.22  ? 444 LYS A CG  1 
ATOM   2677 C  CD  . LYS A 1 353 ? -33.283 49.899 25.948  1.00 55.72  ? 444 LYS A CD  1 
ATOM   2678 C  CE  . LYS A 1 353 ? -33.834 50.442 27.260  1.00 58.72  ? 444 LYS A CE  1 
ATOM   2679 N  NZ  . LYS A 1 353 ? -35.322 50.317 27.327  1.00 57.81  ? 444 LYS A NZ  1 
ATOM   2680 N  N   . LYS A 1 354 ? -28.535 49.374 29.020  1.00 68.13  ? 445 LYS A N   1 
ATOM   2681 C  CA  . LYS A 1 354 ? -27.828 48.949 30.227  1.00 60.88  ? 445 LYS A CA  1 
ATOM   2682 C  C   . LYS A 1 354 ? -28.576 47.861 30.998  1.00 63.82  ? 445 LYS A C   1 
ATOM   2683 O  O   . LYS A 1 354 ? -27.956 46.948 31.553  1.00 63.16  ? 445 LYS A O   1 
ATOM   2684 C  CB  . LYS A 1 354 ? -27.553 50.155 31.129  1.00 62.07  ? 445 LYS A CB  1 
ATOM   2685 N  N   . GLU A 1 355 ? -29.904 47.955 31.015  1.00 62.08  ? 446 GLU A N   1 
ATOM   2686 C  CA  . GLU A 1 355 ? -30.746 47.001 31.744  1.00 69.84  ? 446 GLU A CA  1 
ATOM   2687 C  C   . GLU A 1 355 ? -30.840 45.614 31.089  1.00 66.64  ? 446 GLU A C   1 
ATOM   2688 O  O   . GLU A 1 355 ? -30.935 44.595 31.777  1.00 68.28  ? 446 GLU A O   1 
ATOM   2689 C  CB  . GLU A 1 355 ? -32.158 47.568 31.927  1.00 74.20  ? 446 GLU A CB  1 
ATOM   2690 C  CG  . GLU A 1 355 ? -32.200 49.013 32.400  1.00 74.85  ? 446 GLU A CG  1 
ATOM   2691 C  CD  . GLU A 1 355 ? -32.490 49.985 31.268  1.00 72.63  ? 446 GLU A CD  1 
ATOM   2692 O  OE1 . GLU A 1 355 ? -33.387 49.692 30.446  1.00 74.77  ? 446 GLU A OE1 1 
ATOM   2693 O  OE2 . GLU A 1 355 ? -31.820 51.038 31.199  1.00 71.14  ? 446 GLU A OE2 1 
ATOM   2694 N  N   . LEU A 1 356 ? -30.824 45.587 29.760  1.00 68.01  ? 447 LEU A N   1 
ATOM   2695 C  CA  . LEU A 1 356 ? -30.971 44.347 29.006  1.00 63.87  ? 447 LEU A CA  1 
ATOM   2696 C  C   . LEU A 1 356 ? -29.622 43.761 28.647  1.00 60.87  ? 447 LEU A C   1 
ATOM   2697 O  O   . LEU A 1 356 ? -29.530 42.588 28.291  1.00 59.98  ? 447 LEU A O   1 
ATOM   2698 C  CB  . LEU A 1 356 ? -31.744 44.594 27.706  1.00 58.36  ? 447 LEU A CB  1 
ATOM   2699 C  CG  . LEU A 1 356 ? -33.058 45.369 27.799  1.00 64.28  ? 447 LEU A CG  1 
ATOM   2700 C  CD1 . LEU A 1 356 ? -33.702 45.474 26.418  1.00 61.27  ? 447 LEU A CD1 1 
ATOM   2701 C  CD2 . LEU A 1 356 ? -34.006 44.715 28.806  1.00 50.12  ? 447 LEU A CD2 1 
ATOM   2702 N  N   . VAL A 1 357 ? -28.577 44.578 28.737  1.00 58.06  ? 448 VAL A N   1 
ATOM   2703 C  CA  . VAL A 1 357 ? -27.290 44.214 28.155  1.00 56.25  ? 448 VAL A CA  1 
ATOM   2704 C  C   . VAL A 1 357 ? -26.638 42.958 28.756  1.00 57.87  ? 448 VAL A C   1 
ATOM   2705 O  O   . VAL A 1 357 ? -25.810 42.324 28.096  1.00 54.38  ? 448 VAL A O   1 
ATOM   2706 C  CB  . VAL A 1 357 ? -26.295 45.394 28.172  1.00 55.45  ? 448 VAL A CB  1 
ATOM   2707 C  CG1 . VAL A 1 357 ? -25.580 45.474 29.511  1.00 60.08  ? 448 VAL A CG1 1 
ATOM   2708 C  CG2 . VAL A 1 357 ? -25.285 45.242 27.052  1.00 54.50  ? 448 VAL A CG2 1 
ATOM   2709 N  N   . SER A 1 358 ? -27.013 42.583 29.982  1.00 59.74  ? 449 SER A N   1 
ATOM   2710 C  CA  . SER A 1 358 ? -26.374 41.432 30.653  1.00 65.48  ? 449 SER A CA  1 
ATOM   2711 C  C   . SER A 1 358 ? -26.610 40.087 29.948  1.00 64.15  ? 449 SER A C   1 
ATOM   2712 O  O   . SER A 1 358 ? -25.825 39.150 30.098  1.00 67.16  ? 449 SER A O   1 
ATOM   2713 C  CB  . SER A 1 358 ? -26.782 41.324 32.130  1.00 61.25  ? 449 SER A CB  1 
ATOM   2714 O  OG  . SER A 1 358 ? -28.047 40.699 32.283  1.00 60.31  ? 449 SER A OG  1 
ATOM   2715 N  N   . GLU A 1 359 ? -27.682 40.000 29.172  1.00 57.62  ? 450 GLU A N   1 
ATOM   2716 C  CA  . GLU A 1 359 ? -28.052 38.744 28.535  1.00 62.90  ? 450 GLU A CA  1 
ATOM   2717 C  C   . GLU A 1 359 ? -27.857 38.754 27.013  1.00 58.24  ? 450 GLU A C   1 
ATOM   2718 O  O   . GLU A 1 359 ? -28.164 37.779 26.332  1.00 53.90  ? 450 GLU A O   1 
ATOM   2719 C  CB  . GLU A 1 359 ? -29.507 38.440 28.848  1.00 66.03  ? 450 GLU A CB  1 
ATOM   2720 C  CG  . GLU A 1 359 ? -30.439 39.432 28.213  1.00 63.34  ? 450 GLU A CG  1 
ATOM   2721 C  CD  . GLU A 1 359 ? -31.881 39.128 28.507  1.00 74.88  ? 450 GLU A CD  1 
ATOM   2722 O  OE1 . GLU A 1 359 ? -32.199 38.896 29.697  1.00 83.14  ? 450 GLU A OE1 1 
ATOM   2723 O  OE2 . GLU A 1 359 ? -32.689 39.114 27.548  1.00 70.44  ? 450 GLU A OE2 1 
ATOM   2724 N  N   . HIS A 1 360 ? -27.356 39.861 26.483  1.00 53.36  ? 451 HIS A N   1 
ATOM   2725 C  CA  . HIS A 1 360 ? -27.118 39.967 25.057  1.00 51.68  ? 451 HIS A CA  1 
ATOM   2726 C  C   . HIS A 1 360 ? -25.628 40.013 24.791  1.00 53.16  ? 451 HIS A C   1 
ATOM   2727 O  O   . HIS A 1 360 ? -25.174 39.708 23.688  1.00 54.41  ? 451 HIS A O   1 
ATOM   2728 C  CB  . HIS A 1 360 ? -27.762 41.232 24.504  1.00 49.38  ? 451 HIS A CB  1 
ATOM   2729 C  CG  . HIS A 1 360 ? -29.254 41.220 24.553  1.00 48.16  ? 451 HIS A CG  1 
ATOM   2730 N  ND1 . HIS A 1 360 ? -30.012 40.297 23.868  1.00 50.18  ? 451 HIS A ND1 1 
ATOM   2731 C  CD2 . HIS A 1 360 ? -30.131 42.024 25.197  1.00 48.64  ? 451 HIS A CD2 1 
ATOM   2732 C  CE1 . HIS A 1 360 ? -31.293 40.531 24.089  1.00 48.39  ? 451 HIS A CE1 1 
ATOM   2733 N  NE2 . HIS A 1 360 ? -31.392 41.573 24.893  1.00 48.17  ? 451 HIS A NE2 1 
ATOM   2734 N  N   . ALA A 1 361 ? -24.878 40.394 25.819  1.00 52.96  ? 452 ALA A N   1 
ATOM   2735 C  CA  . ALA A 1 361 ? -23.455 40.666 25.698  1.00 44.22  ? 452 ALA A CA  1 
ATOM   2736 C  C   . ALA A 1 361 ? -22.666 39.475 25.201  1.00 48.19  ? 452 ALA A C   1 
ATOM   2737 O  O   . ALA A 1 361 ? -21.636 39.642 24.545  1.00 50.93  ? 452 ALA A O   1 
ATOM   2738 C  CB  . ALA A 1 361 ? -22.892 41.145 27.026  1.00 52.08  ? 452 ALA A CB  1 
ATOM   2739 N  N   . PHE A 1 362 ? -23.118 38.268 25.518  1.00 47.99  ? 453 PHE A N   1 
ATOM   2740 C  CA  . PHE A 1 362 ? -22.342 37.102 25.098  1.00 49.16  ? 453 PHE A CA  1 
ATOM   2741 C  C   . PHE A 1 362 ? -22.435 36.817 23.593  1.00 47.53  ? 453 PHE A C   1 
ATOM   2742 O  O   . PHE A 1 362 ? -21.553 36.154 23.041  1.00 49.13  ? 453 PHE A O   1 
ATOM   2743 C  CB  . PHE A 1 362 ? -22.661 35.859 25.938  1.00 47.07  ? 453 PHE A CB  1 
ATOM   2744 C  CG  . PHE A 1 362 ? -23.977 35.224 25.618  1.00 46.27  ? 453 PHE A CG  1 
ATOM   2745 C  CD1 . PHE A 1 362 ? -25.150 35.689 26.206  1.00 53.21  ? 453 PHE A CD1 1 
ATOM   2746 C  CD2 . PHE A 1 362 ? -24.045 34.144 24.749  1.00 43.72  ? 453 PHE A CD2 1 
ATOM   2747 C  CE1 . PHE A 1 362 ? -26.377 35.097 25.923  1.00 50.21  ? 453 PHE A CE1 1 
ATOM   2748 C  CE2 . PHE A 1 362 ? -25.264 33.547 24.458  1.00 46.90  ? 453 PHE A CE2 1 
ATOM   2749 C  CZ  . PHE A 1 362 ? -26.432 34.025 25.047  1.00 49.68  ? 453 PHE A CZ  1 
ATOM   2750 N  N   . GLU A 1 363 ? -23.487 37.327 22.942  1.00 47.19  ? 454 GLU A N   1 
ATOM   2751 C  CA  . GLU A 1 363 ? -23.666 37.181 21.487  1.00 48.65  ? 454 GLU A CA  1 
ATOM   2752 C  C   . GLU A 1 363 ? -22.826 38.196 20.718  1.00 53.21  ? 454 GLU A C   1 
ATOM   2753 O  O   . GLU A 1 363 ? -22.612 38.045 19.510  1.00 52.38  ? 454 GLU A O   1 
ATOM   2754 C  CB  . GLU A 1 363 ? -25.130 37.356 21.081  1.00 44.32  ? 454 GLU A CB  1 
ATOM   2755 C  CG  . GLU A 1 363 ? -26.100 36.477 21.832  1.00 49.87  ? 454 GLU A CG  1 
ATOM   2756 C  CD  . GLU A 1 363 ? -26.609 35.323 20.994  1.00 49.17  ? 454 GLU A CD  1 
ATOM   2757 O  OE1 . GLU A 1 363 ? -25.784 34.558 20.463  1.00 52.61  ? 454 GLU A OE1 1 
ATOM   2758 O  OE2 . GLU A 1 363 ? -27.838 35.184 20.857  1.00 49.90  ? 454 GLU A OE2 1 
ATOM   2759 N  N   . ILE A 1 364 ? -22.375 39.241 21.415  1.00 50.87  ? 455 ILE A N   1 
ATOM   2760 C  CA  . ILE A 1 364 ? -21.508 40.261 20.816  1.00 51.95  ? 455 ILE A CA  1 
ATOM   2761 C  C   . ILE A 1 364 ? -20.133 39.696 20.425  1.00 47.83  ? 455 ILE A C   1 
ATOM   2762 O  O   . ILE A 1 364 ? -19.279 39.472 21.287  1.00 47.87  ? 455 ILE A O   1 
ATOM   2763 C  CB  . ILE A 1 364 ? -21.338 41.481 21.759  1.00 49.03  ? 455 ILE A CB  1 
ATOM   2764 C  CG1 . ILE A 1 364 ? -22.661 42.228 21.916  1.00 49.46  ? 455 ILE A CG1 1 
ATOM   2765 C  CG2 . ILE A 1 364 ? -20.286 42.428 21.235  1.00 51.11  ? 455 ILE A CG2 1 
ATOM   2766 C  CD1 . ILE A 1 364 ? -22.537 43.556 22.658  1.00 47.53  ? 455 ILE A CD1 1 
ATOM   2767 N  N   . PRO A 1 365 ? -19.914 39.480 19.118  1.00 48.90  ? 456 PRO A N   1 
ATOM   2768 C  CA  . PRO A 1 365 ? -18.706 38.830 18.583  1.00 54.87  ? 456 PRO A CA  1 
ATOM   2769 C  C   . PRO A 1 365 ? -17.454 39.556 19.038  1.00 54.91  ? 456 PRO A C   1 
ATOM   2770 O  O   . PRO A 1 365 ? -17.541 40.733 19.386  1.00 54.86  ? 456 PRO A O   1 
ATOM   2771 C  CB  . PRO A 1 365 ? -18.857 38.988 17.061  1.00 50.48  ? 456 PRO A CB  1 
ATOM   2772 C  CG  . PRO A 1 365 ? -20.305 39.238 16.836  1.00 49.46  ? 456 PRO A CG  1 
ATOM   2773 C  CD  . PRO A 1 365 ? -20.774 40.004 18.046  1.00 50.55  ? 456 PRO A CD  1 
ATOM   2774 N  N   . ASP A 1 366 ? -16.304 38.892 19.032  1.00 57.31  ? 457 ASP A N   1 
ATOM   2775 C  CA  . ASP A 1 366 ? -15.116 39.556 19.549  1.00 60.92  ? 457 ASP A CA  1 
ATOM   2776 C  C   . ASP A 1 366 ? -14.701 40.761 18.715  1.00 67.20  ? 457 ASP A C   1 
ATOM   2777 O  O   . ASP A 1 366 ? -14.269 41.779 19.261  1.00 67.92  ? 457 ASP A O   1 
ATOM   2778 C  CB  . ASP A 1 366 ? -13.965 38.582 19.754  1.00 63.33  ? 457 ASP A CB  1 
ATOM   2779 C  CG  . ASP A 1 366 ? -13.700 38.316 21.229  1.00 78.74  ? 457 ASP A CG  1 
ATOM   2780 O  OD1 . ASP A 1 366 ? -14.039 39.195 22.059  1.00 79.31  ? 457 ASP A OD1 1 
ATOM   2781 O  OD2 . ASP A 1 366 ? -13.169 37.231 21.561  1.00 87.80  ? 457 ASP A OD2 1 
ATOM   2782 N  N   . ASN A 1 367 ? -14.865 40.658 17.399  1.00 68.62  ? 458 ASN A N   1 
ATOM   2783 C  CA  . ASN A 1 367 ? -14.493 41.749 16.502  1.00 66.93  ? 458 ASN A CA  1 
ATOM   2784 C  C   . ASN A 1 367 ? -15.309 43.026 16.647  1.00 66.63  ? 458 ASN A C   1 
ATOM   2785 O  O   . ASN A 1 367 ? -14.752 44.119 16.754  1.00 70.37  ? 458 ASN A O   1 
ATOM   2786 C  CB  . ASN A 1 367 ? -14.525 41.292 15.048  1.00 64.63  ? 458 ASN A CB  1 
ATOM   2787 C  CG  . ASN A 1 367 ? -13.277 40.557 14.657  1.00 78.05  ? 458 ASN A CG  1 
ATOM   2788 O  OD1 . ASN A 1 367 ? -13.293 39.701 13.764  1.00 78.41  ? 458 ASN A OD1 1 
ATOM   2789 N  ND2 . ASN A 1 367 ? -12.172 40.875 15.336  1.00 71.39  ? 458 ASN A ND2 1 
ATOM   2790 N  N   . VAL A 1 368 ? -16.628 42.899 16.633  1.00 58.69  ? 459 VAL A N   1 
ATOM   2791 C  CA  . VAL A 1 368 ? -17.452 44.086 16.545  1.00 53.57  ? 459 VAL A CA  1 
ATOM   2792 C  C   . VAL A 1 368 ? -17.297 44.963 17.776  1.00 61.20  ? 459 VAL A C   1 
ATOM   2793 O  O   . VAL A 1 368 ? -17.000 44.486 18.875  1.00 67.94  ? 459 VAL A O   1 
ATOM   2794 C  CB  . VAL A 1 368 ? -18.926 43.766 16.247  1.00 50.24  ? 459 VAL A CB  1 
ATOM   2795 C  CG1 . VAL A 1 368 ? -19.072 42.323 15.819  1.00 49.40  ? 459 VAL A CG1 1 
ATOM   2796 C  CG2 . VAL A 1 368 ? -19.802 44.080 17.439  1.00 56.55  ? 459 VAL A CG2 1 
ATOM   2797 N  N   . ARG A 1 369 ? -17.454 46.262 17.566  1.00 59.24  ? 460 ARG A N   1 
ATOM   2798 C  CA  . ARG A 1 369 ? -17.421 47.223 18.645  1.00 60.02  ? 460 ARG A CA  1 
ATOM   2799 C  C   . ARG A 1 369 ? -18.814 47.821 18.754  1.00 64.73  ? 460 ARG A C   1 
ATOM   2800 O  O   . ARG A 1 369 ? -19.168 48.750 18.025  1.00 64.59  ? 460 ARG A O   1 
ATOM   2801 C  CB  . ARG A 1 369 ? -16.383 48.296 18.361  1.00 67.33  ? 460 ARG A CB  1 
ATOM   2802 C  CG  . ARG A 1 369 ? -15.074 47.740 17.827  1.00 77.56  ? 460 ARG A CG  1 
ATOM   2803 C  CD  . ARG A 1 369 ? -14.240 48.849 17.218  1.00 79.41  ? 460 ARG A CD  1 
ATOM   2804 N  NE  . ARG A 1 369 ? -14.180 50.000 18.112  1.00 84.59  ? 460 ARG A NE  1 
ATOM   2805 C  CZ  . ARG A 1 369 ? -13.882 51.233 17.720  1.00 85.95  ? 460 ARG A CZ  1 
ATOM   2806 N  NH1 . ARG A 1 369 ? -13.617 51.478 16.441  1.00 80.47  ? 460 ARG A NH1 1 
ATOM   2807 N  NH2 . ARG A 1 369 ? -13.853 52.219 18.611  1.00 85.95  ? 460 ARG A NH2 1 
ATOM   2808 N  N   . PRO A 1 370 ? -19.612 47.266 19.670  1.00 62.35  ? 461 PRO A N   1 
ATOM   2809 C  CA  . PRO A 1 370 ? -21.034 47.539 19.891  1.00 55.94  ? 461 PRO A CA  1 
ATOM   2810 C  C   . PRO A 1 370 ? -21.411 49.011 19.764  1.00 55.95  ? 461 PRO A C   1 
ATOM   2811 O  O   . PRO A 1 370 ? -22.150 49.368 18.851  1.00 60.62  ? 461 PRO A O   1 
ATOM   2812 C  CB  . PRO A 1 370 ? -21.246 47.068 21.330  1.00 60.15  ? 461 PRO A CB  1 
ATOM   2813 C  CG  . PRO A 1 370 ? -20.264 45.958 21.499  1.00 58.31  ? 461 PRO A CG  1 
ATOM   2814 C  CD  . PRO A 1 370 ? -19.062 46.326 20.666  1.00 56.52  ? 461 PRO A CD  1 
ATOM   2815 N  N   . GLY A 1 371 ? -20.922 49.844 20.678  1.00 58.77  ? 462 GLY A N   1 
ATOM   2816 C  CA  . GLY A 1 371 ? -21.331 51.236 20.758  1.00 56.47  ? 462 GLY A CA  1 
ATOM   2817 C  C   . GLY A 1 371 ? -20.915 52.053 19.553  1.00 60.57  ? 462 GLY A C   1 
ATOM   2818 O  O   . GLY A 1 371 ? -21.629 52.972 19.145  1.00 56.67  ? 462 GLY A O   1 
ATOM   2819 N  N   . HIS A 1 372 ? -19.757 51.714 18.990  1.00 61.14  ? 463 HIS A N   1 
ATOM   2820 C  CA  . HIS A 1 372 ? -19.236 52.372 17.796  1.00 61.82  ? 463 HIS A CA  1 
ATOM   2821 C  C   . HIS A 1 372 ? -20.106 52.048 16.582  1.00 61.80  ? 463 HIS A C   1 
ATOM   2822 O  O   . HIS A 1 372 ? -20.690 52.941 15.964  1.00 57.37  ? 463 HIS A O   1 
ATOM   2823 C  CB  . HIS A 1 372 ? -17.793 51.926 17.549  1.00 67.87  ? 463 HIS A CB  1 
ATOM   2824 C  CG  . HIS A 1 372 ? -17.089 52.699 16.478  1.00 71.87  ? 463 HIS A CG  1 
ATOM   2825 N  ND1 . HIS A 1 372 ? -16.797 52.161 15.243  1.00 73.46  ? 463 HIS A ND1 1 
ATOM   2826 C  CD2 . HIS A 1 372 ? -16.612 53.967 16.460  1.00 72.03  ? 463 HIS A CD2 1 
ATOM   2827 C  CE1 . HIS A 1 372 ? -16.173 53.065 14.509  1.00 77.24  ? 463 HIS A CE1 1 
ATOM   2828 N  NE2 . HIS A 1 372 ? -16.047 54.169 15.224  1.00 80.24  ? 463 HIS A NE2 1 
ATOM   2829 N  N   . LEU A 1 373 ? -20.185 50.760 16.252  1.00 62.91  ? 464 LEU A N   1 
ATOM   2830 C  CA  . LEU A 1 373 ? -21.052 50.283 15.182  1.00 57.78  ? 464 LEU A CA  1 
ATOM   2831 C  C   . LEU A 1 373 ? -22.413 50.983 15.220  1.00 57.87  ? 464 LEU A C   1 
ATOM   2832 O  O   . LEU A 1 373 ? -22.834 51.609 14.253  1.00 54.78  ? 464 LEU A O   1 
ATOM   2833 C  CB  . LEU A 1 373 ? -21.241 48.769 15.288  1.00 46.26  ? 464 LEU A CB  1 
ATOM   2834 C  CG  . LEU A 1 373 ? -22.013 48.142 14.124  1.00 54.82  ? 464 LEU A CG  1 
ATOM   2835 C  CD1 . LEU A 1 373 ? -21.249 48.282 12.805  1.00 50.85  ? 464 LEU A CD1 1 
ATOM   2836 C  CD2 . LEU A 1 373 ? -22.333 46.677 14.387  1.00 51.78  ? 464 LEU A CD2 1 
ATOM   2837 N  N   . ILE A 1 374 ? -23.095 50.887 16.353  1.00 58.16  ? 465 ILE A N   1 
ATOM   2838 C  CA  . ILE A 1 374 ? -24.417 51.486 16.485  1.00 59.19  ? 465 ILE A CA  1 
ATOM   2839 C  C   . ILE A 1 374 ? -24.445 52.971 16.121  1.00 62.71  ? 465 ILE A C   1 
ATOM   2840 O  O   . ILE A 1 374 ? -25.442 53.462 15.582  1.00 64.89  ? 465 ILE A O   1 
ATOM   2841 C  CB  . ILE A 1 374 ? -24.975 51.312 17.898  1.00 50.47  ? 465 ILE A CB  1 
ATOM   2842 C  CG1 . ILE A 1 374 ? -25.090 49.824 18.234  1.00 50.38  ? 465 ILE A CG1 1 
ATOM   2843 C  CG2 . ILE A 1 374 ? -26.315 52.012 18.013  1.00 46.32  ? 465 ILE A CG2 1 
ATOM   2844 C  CD1 . ILE A 1 374 ? -25.791 49.544 19.546  1.00 51.24  ? 465 ILE A CD1 1 
ATOM   2845 N  N   . LYS A 1 375 ? -23.359 53.681 16.422  1.00 62.46  ? 466 LYS A N   1 
ATOM   2846 C  CA  . LYS A 1 375 ? -23.244 55.096 16.075  1.00 63.14  ? 466 LYS A CA  1 
ATOM   2847 C  C   . LYS A 1 375 ? -23.039 55.279 14.567  1.00 64.66  ? 466 LYS A C   1 
ATOM   2848 O  O   . LYS A 1 375 ? -23.687 56.119 13.934  1.00 61.99  ? 466 LYS A O   1 
ATOM   2849 C  CB  . LYS A 1 375 ? -22.103 55.759 16.853  1.00 59.70  ? 466 LYS A CB  1 
ATOM   2850 N  N   . GLU A 1 376 ? -22.138 54.486 13.998  1.00 58.95  ? 467 GLU A N   1 
ATOM   2851 C  CA  . GLU A 1 376 ? -21.878 54.547 12.573  1.00 57.40  ? 467 GLU A CA  1 
ATOM   2852 C  C   . GLU A 1 376 ? -23.149 54.283 11.793  1.00 57.38  ? 467 GLU A C   1 
ATOM   2853 O  O   . GLU A 1 376 ? -23.377 54.893 10.755  1.00 65.31  ? 467 GLU A O   1 
ATOM   2854 C  CB  . GLU A 1 376 ? -20.789 53.556 12.181  1.00 60.48  ? 467 GLU A CB  1 
ATOM   2855 C  CG  . GLU A 1 376 ? -19.456 53.811 12.879  1.00 67.83  ? 467 GLU A CG  1 
ATOM   2856 C  CD  . GLU A 1 376 ? -18.878 55.183 12.556  1.00 77.43  ? 467 GLU A CD  1 
ATOM   2857 O  OE1 . GLU A 1 376 ? -18.877 55.566 11.359  1.00 77.62  ? 467 GLU A OE1 1 
ATOM   2858 O  OE2 . GLU A 1 376 ? -18.432 55.877 13.499  1.00 75.64  ? 467 GLU A OE2 1 
ATOM   2859 N  N   . LEU A 1 377 ? -23.981 53.379 12.295  1.00 57.03  ? 468 LEU A N   1 
ATOM   2860 C  CA  . LEU A 1 377 ? -25.298 53.142 11.704  1.00 59.99  ? 468 LEU A CA  1 
ATOM   2861 C  C   . LEU A 1 377 ? -26.211 54.355 11.889  1.00 63.17  ? 468 LEU A C   1 
ATOM   2862 O  O   . LEU A 1 377 ? -26.824 54.828 10.931  1.00 66.44  ? 468 LEU A O   1 
ATOM   2863 C  CB  . LEU A 1 377 ? -25.972 51.901 12.303  1.00 59.26  ? 468 LEU A CB  1 
ATOM   2864 C  CG  . LEU A 1 377 ? -25.332 50.536 12.063  1.00 54.53  ? 468 LEU A CG  1 
ATOM   2865 C  CD1 . LEU A 1 377 ? -26.173 49.439 12.688  1.00 51.93  ? 468 LEU A CD1 1 
ATOM   2866 C  CD2 . LEU A 1 377 ? -25.151 50.297 10.586  1.00 51.24  ? 468 LEU A CD2 1 
ATOM   2867 N  N   . SER A 1 378 ? -26.307 54.852 13.120  1.00 60.63  ? 469 SER A N   1 
ATOM   2868 C  CA  . SER A 1 378 ? -27.110 56.040 13.393  1.00 65.19  ? 469 SER A CA  1 
ATOM   2869 C  C   . SER A 1 378 ? -26.765 57.180 12.423  1.00 69.70  ? 469 SER A C   1 
ATOM   2870 O  O   . SER A 1 378 ? -27.656 57.774 11.809  1.00 66.48  ? 469 SER A O   1 
ATOM   2871 C  CB  . SER A 1 378 ? -26.933 56.498 14.844  1.00 60.34  ? 469 SER A CB  1 
ATOM   2872 N  N   . LYS A 1 379 ? -25.471 57.467 12.274  1.00 68.47  ? 470 LYS A N   1 
ATOM   2873 C  CA  . LYS A 1 379 ? -25.031 58.600 11.460  1.00 69.77  ? 470 LYS A CA  1 
ATOM   2874 C  C   . LYS A 1 379 ? -25.264 58.384 9.966   1.00 72.35  ? 470 LYS A C   1 
ATOM   2875 O  O   . LYS A 1 379 ? -25.598 59.329 9.254   1.00 73.50  ? 470 LYS A O   1 
ATOM   2876 C  CB  . LYS A 1 379 ? -23.569 59.001 11.754  1.00 70.25  ? 470 LYS A CB  1 
ATOM   2877 C  CG  . LYS A 1 379 ? -22.508 57.931 11.475  1.00 72.69  ? 470 LYS A CG  1 
ATOM   2878 C  CD  . LYS A 1 379 ? -21.070 58.474 11.676  1.00 77.76  ? 470 LYS A CD  1 
ATOM   2879 C  CE  . LYS A 1 379 ? -20.744 58.791 13.151  1.00 76.35  ? 470 LYS A CE  1 
ATOM   2880 N  NZ  . LYS A 1 379 ? -19.352 59.339 13.370  1.00 71.48  ? 470 LYS A NZ  1 
ATOM   2881 N  N   . VAL A 1 380 ? -25.090 57.149 9.500   1.00 70.12  ? 471 VAL A N   1 
ATOM   2882 C  CA  . VAL A 1 380 ? -25.403 56.794 8.115   1.00 65.16  ? 471 VAL A CA  1 
ATOM   2883 C  C   . VAL A 1 380 ? -26.894 56.971 7.825   1.00 64.70  ? 471 VAL A C   1 
ATOM   2884 O  O   . VAL A 1 380 ? -27.268 57.553 6.819   1.00 71.64  ? 471 VAL A O   1 
ATOM   2885 C  CB  . VAL A 1 380 ? -24.971 55.344 7.783   1.00 62.81  ? 471 VAL A CB  1 
ATOM   2886 C  CG1 . VAL A 1 380 ? -25.991 54.665 6.906   1.00 58.39  ? 471 VAL A CG1 1 
ATOM   2887 C  CG2 . VAL A 1 380 ? -23.613 55.325 7.119   1.00 59.38  ? 471 VAL A CG2 1 
ATOM   2888 N  N   . ILE A 1 381 ? -27.743 56.478 8.716   1.00 67.12  ? 472 ILE A N   1 
ATOM   2889 C  CA  . ILE A 1 381 ? -29.191 56.605 8.550   1.00 72.20  ? 472 ILE A CA  1 
ATOM   2890 C  C   . ILE A 1 381 ? -29.690 58.060 8.594   1.00 78.80  ? 472 ILE A C   1 
ATOM   2891 O  O   . ILE A 1 381 ? -30.763 58.368 8.074   1.00 81.83  ? 472 ILE A O   1 
ATOM   2892 C  CB  . ILE A 1 381 ? -29.943 55.739 9.579   1.00 69.08  ? 472 ILE A CB  1 
ATOM   2893 C  CG1 . ILE A 1 381 ? -29.598 54.270 9.349   1.00 63.29  ? 472 ILE A CG1 1 
ATOM   2894 C  CG2 . ILE A 1 381 ? -31.446 55.955 9.480   1.00 66.51  ? 472 ILE A CG2 1 
ATOM   2895 C  CD1 . ILE A 1 381 ? -30.306 53.325 10.276  1.00 61.61  ? 472 ILE A CD1 1 
ATOM   2896 N  N   . ARG A 1 382 ? -28.923 58.945 9.229   1.00 78.92  ? 473 ARG A N   1 
ATOM   2897 C  CA  . ARG A 1 382 ? -29.114 60.384 9.056   1.00 77.20  ? 473 ARG A CA  1 
ATOM   2898 C  C   . ARG A 1 382 ? -28.329 60.766 7.803   1.00 76.86  ? 473 ARG A C   1 
ATOM   2899 O  O   . ARG A 1 382 ? -27.182 60.360 7.646   1.00 80.63  ? 473 ARG A O   1 
ATOM   2900 C  CB  . ARG A 1 382 ? -28.616 61.151 10.277  1.00 74.22  ? 473 ARG A CB  1 
ATOM   2901 N  N   . ALA A 1 383 ? -28.940 61.554 6.926   1.00 78.99  ? 474 ALA A N   1 
ATOM   2902 C  CA  . ALA A 1 383 ? -28.590 61.542 5.505   1.00 87.03  ? 474 ALA A CA  1 
ATOM   2903 C  C   . ALA A 1 383 ? -29.274 60.282 5.010   1.00 87.28  ? 474 ALA A C   1 
ATOM   2904 O  O   . ALA A 1 383 ? -29.530 59.380 5.800   1.00 86.68  ? 474 ALA A O   1 
ATOM   2905 C  CB  . ALA A 1 383 ? -27.084 61.474 5.276   1.00 81.26  ? 474 ALA A CB  1 
ATOM   2906 N  N   . ILE A 1 384 ? -29.583 60.204 3.723   1.00 88.16  ? 475 ILE A N   1 
ATOM   2907 C  CA  . ILE A 1 384 ? -30.564 59.226 3.278   1.00 92.27  ? 475 ILE A CA  1 
ATOM   2908 C  C   . ILE A 1 384 ? -31.908 59.794 3.731   1.00 96.66  ? 475 ILE A C   1 
ATOM   2909 O  O   . ILE A 1 384 ? -32.794 60.063 2.918   1.00 102.08 ? 475 ILE A O   1 
ATOM   2910 C  CB  . ILE A 1 384 ? -30.319 57.825 3.903   1.00 83.41  ? 475 ILE A CB  1 
ATOM   2911 C  CG1 . ILE A 1 384 ? -28.876 57.373 3.648   1.00 76.29  ? 475 ILE A CG1 1 
ATOM   2912 C  CG2 . ILE A 1 384 ? -31.330 56.806 3.382   1.00 76.15  ? 475 ILE A CG2 1 
ATOM   2913 C  CD1 . ILE A 1 384 ? -28.632 55.911 3.896   1.00 64.27  ? 475 ILE A CD1 1 
ATOM   2914 N  N   . GLU A 1 385 ? -32.045 59.984 5.039   1.00 88.79  ? 476 GLU A N   1 
ATOM   2915 C  CA  . GLU A 1 385 ? -33.083 60.843 5.589   1.00 93.02  ? 476 GLU A CA  1 
ATOM   2916 C  C   . GLU A 1 385 ? -32.476 62.235 5.727   1.00 99.04  ? 476 GLU A C   1 
ATOM   2917 O  O   . GLU A 1 385 ? -31.411 62.393 6.328   1.00 97.10  ? 476 GLU A O   1 
ATOM   2918 C  CB  . GLU A 1 385 ? -33.525 60.340 6.959   1.00 94.76  ? 476 GLU A CB  1 
ATOM   2919 C  CG  . GLU A 1 385 ? -34.086 58.932 6.965   1.00 91.88  ? 476 GLU A CG  1 
ATOM   2920 C  CD  . GLU A 1 385 ? -34.174 58.358 8.364   1.00 89.54  ? 476 GLU A CD  1 
ATOM   2921 O  OE1 . GLU A 1 385 ? -33.607 58.965 9.302   1.00 91.22  ? 476 GLU A OE1 1 
ATOM   2922 O  OE2 . GLU A 1 385 ? -34.812 57.297 8.528   1.00 91.05  ? 476 GLU A OE2 1 
ATOM   2923 N  N   . GLU A 1 386 ? -33.161 63.235 5.176   1.00 102.41 ? 477 GLU A N   1 
ATOM   2924 C  CA  . GLU A 1 386 ? -32.630 64.594 5.046   1.00 104.24 ? 477 GLU A CA  1 
ATOM   2925 C  C   . GLU A 1 386 ? -31.852 64.717 3.735   1.00 99.33  ? 477 GLU A C   1 
ATOM   2926 O  O   . GLU A 1 386 ? -32.219 65.509 2.868   1.00 102.95 ? 477 GLU A O   1 
ATOM   2927 C  CB  . GLU A 1 386 ? -31.773 65.011 6.251   1.00 96.83  ? 477 GLU A CB  1 
ATOM   2928 N  N   . GLU A 1 387 ? -30.794 63.924 3.579   1.00 96.68  ? 478 GLU A N   1 
ATOM   2929 C  CA  . GLU A 1 387 ? -30.109 63.837 2.287   1.00 102.58 ? 478 GLU A CA  1 
ATOM   2930 C  C   . GLU A 1 387 ? -31.066 63.247 1.251   1.00 99.67  ? 478 GLU A C   1 
ATOM   2931 O  O   . GLU A 1 387 ? -30.691 62.993 0.104   1.00 98.54  ? 478 GLU A O   1 
ATOM   2932 C  CB  . GLU A 1 387 ? -28.835 62.993 2.387   1.00 99.85  ? 478 GLU A CB  1 
ATOM   2933 N  N   . ASN A 1 388 ? -32.306 63.040 1.689   1.00 99.12  ? 479 ASN A N   1 
ATOM   2934 C  CA  . ASN A 1 388 ? -33.392 62.529 0.865   1.00 98.66  ? 479 ASN A CA  1 
ATOM   2935 C  C   . ASN A 1 388 ? -34.687 62.511 1.671   1.00 95.42  ? 479 ASN A C   1 
ATOM   2936 O  O   . ASN A 1 388 ? -35.739 62.922 1.187   1.00 93.05  ? 479 ASN A O   1 
ATOM   2937 C  CB  . ASN A 1 388 ? -33.063 61.129 0.336   1.00 102.26 ? 479 ASN A CB  1 
ATOM   2938 C  CG  . ASN A 1 388 ? -34.303 60.342 -0.070  1.00 104.65 ? 479 ASN A CG  1 
ATOM   2939 O  OD1 . ASN A 1 388 ? -35.257 60.219 0.703   1.00 103.51 ? 479 ASN A OD1 1 
ATOM   2940 N  ND2 . ASN A 1 388 ? -34.291 59.801 -1.288  1.00 99.55  ? 479 ASN A ND2 1 
HETATM 2941 C  C1  . AKG B 2 .   ? -41.331 22.770 9.718   1.00 46.08  ? 701 AKG A C1  1 
HETATM 2942 O  O1  . AKG B 2 .   ? -40.856 23.850 10.172  1.00 42.23  ? 701 AKG A O1  1 
HETATM 2943 O  O2  . AKG B 2 .   ? -40.930 21.677 10.209  1.00 44.82  ? 701 AKG A O2  1 
HETATM 2944 C  C2  . AKG B 2 .   ? -42.372 22.757 8.630   1.00 46.10  ? 701 AKG A C2  1 
HETATM 2945 O  O5  . AKG B 2 .   ? -43.170 23.687 8.514   1.00 39.56  ? 701 AKG A O5  1 
HETATM 2946 C  C3  . AKG B 2 .   ? -42.726 21.445 8.004   1.00 39.03  ? 701 AKG A C3  1 
HETATM 2947 C  C4  . AKG B 2 .   ? -43.733 20.796 8.895   1.00 38.11  ? 701 AKG A C4  1 
HETATM 2948 C  C5  . AKG B 2 .   ? -44.151 19.451 8.390   1.00 38.92  ? 701 AKG A C5  1 
HETATM 2949 O  O3  . AKG B 2 .   ? -43.886 19.092 7.214   1.00 36.85  ? 701 AKG A O3  1 
HETATM 2950 O  O4  . AKG B 2 .   ? -44.880 18.713 9.111   1.00 39.14  ? 701 AKG A O4  1 
HETATM 2951 NI NI  . NI  C 3 .   ? -42.160 25.463 9.309   1.00 40.30  ? 702 NI  A NI  1 
HETATM 2952 CL CL  . CL  D 4 .   ? -28.705 31.703 7.068   1.00 35.45  ? 703 CL  A CL  1 
HETATM 2953 S  S   . SO4 E 5 .   ? -61.267 42.660 9.381   1.00 93.03  ? 704 SO4 A S   1 
HETATM 2954 O  O1  . SO4 E 5 .   ? -60.453 43.645 8.666   1.00 72.46  ? 704 SO4 A O1  1 
HETATM 2955 O  O2  . SO4 E 5 .   ? -61.057 41.342 8.779   1.00 73.00  ? 704 SO4 A O2  1 
HETATM 2956 O  O3  . SO4 E 5 .   ? -60.897 42.624 10.802  1.00 77.30  ? 704 SO4 A O3  1 
HETATM 2957 O  O4  . SO4 E 5 .   ? -62.687 43.005 9.267   1.00 88.61  ? 704 SO4 A O4  1 
HETATM 2958 C  C1  . EDO F 6 .   ? -39.518 45.382 -3.482  1.00 62.95  ? 705 EDO A C1  1 
HETATM 2959 O  O1  . EDO F 6 .   ? -40.834 45.657 -4.006  1.00 56.55  ? 705 EDO A O1  1 
HETATM 2960 C  C2  . EDO F 6 .   ? -39.213 46.171 -2.203  1.00 61.12  ? 705 EDO A C2  1 
HETATM 2961 O  O2  . EDO F 6 .   ? -39.939 45.645 -1.076  1.00 65.38  ? 705 EDO A O2  1 
HETATM 2962 C  C1  . EDO G 6 .   ? -30.865 20.598 -13.468 1.00 58.19  ? 706 EDO A C1  1 
HETATM 2963 O  O1  . EDO G 6 .   ? -30.376 21.338 -14.598 1.00 62.81  ? 706 EDO A O1  1 
HETATM 2964 C  C2  . EDO G 6 .   ? -29.741 20.357 -12.461 1.00 63.24  ? 706 EDO A C2  1 
HETATM 2965 O  O2  . EDO G 6 .   ? -29.476 21.555 -11.710 1.00 57.50  ? 706 EDO A O2  1 
HETATM 2966 N  N1  . E67 H 7 .   ? -45.805 23.965 21.406  1.00 89.00  ? 707 E67 A N1  1 
HETATM 2967 C  C2  . E67 H 7 .   ? -44.790 24.799 21.035  1.00 87.35  ? 707 E67 A C2  1 
HETATM 2968 N  N3  . E67 H 7 .   ? -44.142 24.613 19.899  1.00 84.39  ? 707 E67 A N3  1 
HETATM 2969 C  C4  . E67 H 7 .   ? -44.489 23.608 19.076  1.00 79.27  ? 707 E67 A C4  1 
HETATM 2970 C  C5  . E67 H 7 .   ? -45.540 22.740 19.419  1.00 83.60  ? 707 E67 A C5  1 
HETATM 2971 C  C6  . E67 H 7 .   ? -46.209 22.950 20.639  1.00 90.15  ? 707 E67 A C6  1 
HETATM 2972 C  CAA . E67 H 7 .   ? -44.173 22.390 17.038  1.00 78.13  ? 707 E67 A CAA 1 
HETATM 2973 C  CAB . E67 H 7 .   ? -45.220 21.515 17.351  1.00 79.68  ? 707 E67 A CAB 1 
HETATM 2974 C  CAC . E67 H 7 .   ? -45.907 21.679 18.547  1.00 73.20  ? 707 E67 A CAC 1 
HETATM 2975 C  CAF . E67 H 7 .   ? -43.811 23.442 17.906  1.00 78.26  ? 707 E67 A CAF 1 
HETATM 2976 O  OAK . E67 H 7 .   ? -43.467 22.316 15.852  1.00 71.84  ? 707 E67 A OAK 1 
HETATM 2977 O  OAL . E67 H 7 .   ? -45.573 20.492 16.467  1.00 65.24  ? 707 E67 A OAL 1 
HETATM 2978 C  CAM . E67 H 7 .   ? -46.841 20.461 15.932  1.00 46.70  ? 707 E67 A CAM 1 
HETATM 2979 N  NAN . E67 H 7 .   ? -47.292 22.099 21.080  1.00 90.15  ? 707 E67 A NAN 1 
HETATM 2980 N  NAU . E67 H 7 .   ? -44.344 25.840 21.964  1.00 82.22  ? 707 E67 A NAU 1 
HETATM 2981 C  CAV . E67 H 7 .   ? -43.842 26.321 23.260  1.00 77.67  ? 707 E67 A CAV 1 
HETATM 2982 C  CAW . E67 H 7 .   ? -43.607 25.215 24.305  1.00 77.27  ? 707 E67 A CAW 1 
HETATM 2983 C  CAX . E67 H 7 .   ? -42.862 23.978 23.921  1.00 78.90  ? 707 E67 A CAX 1 
HETATM 2984 N  NAY . E67 H 7 .   ? -43.444 23.017 22.999  1.00 80.00  ? 707 E67 A NAY 1 
HETATM 2985 C  CAZ . E67 H 7 .   ? -43.794 21.769 23.712  1.00 77.81  ? 707 E67 A CAZ 1 
HETATM 2986 C  CBA . E67 H 7 .   ? -42.532 22.698 21.949  1.00 76.63  ? 707 E67 A CBA 1 
HETATM 2987 C  CBB . E67 H 7 .   ? -43.429 23.497 15.088  1.00 63.49  ? 707 E67 A CBB 1 
HETATM 2988 C  CBC . E67 H 7 .   ? -42.056 24.154 14.746  1.00 57.28  ? 707 E67 A CBC 1 
HETATM 2989 C  CBD . E67 H 7 .   ? -41.055 23.385 13.886  1.00 56.98  ? 707 E67 A CBD 1 
HETATM 2990 C  CBE . E67 H 7 .   ? -39.897 24.227 13.366  1.00 59.86  ? 707 E67 A CBE 1 
HETATM 2991 C  CBF . E67 H 7 .   ? -40.088 25.741 13.453  1.00 51.24  ? 707 E67 A CBF 1 
HETATM 2992 N  NBG . E67 H 7 .   ? -38.999 26.623 13.024  1.00 43.92  ? 707 E67 A NBG 1 
HETATM 2993 O  O   . HOH I 8 .   ? -40.801 25.408 7.496   1.00 38.84  ? 801 HOH A O   1 
HETATM 2994 O  O   . HOH I 8 .   ? -40.542 32.952 8.968   1.00 29.34  ? 802 HOH A O   1 
HETATM 2995 O  O   . HOH I 8 .   ? -26.295 29.697 15.727  1.00 40.88  ? 804 HOH A O   1 
HETATM 2996 O  O   . HOH I 8 .   ? -26.812 29.224 24.140  0.50 42.20  ? 809 HOH A O   1 
HETATM 2997 O  O   . HOH I 8 .   ? -61.620 28.026 4.137   1.00 50.86  ? 810 HOH A O   1 
HETATM 2998 O  O   . HOH I 8 .   ? -42.387 30.777 8.772   1.00 30.91  ? 811 HOH A O   1 
HETATM 2999 O  O   . HOH I 8 .   ? -41.395 38.022 -5.627  1.00 45.91  ? 818 HOH A O   1 
HETATM 3000 O  O   . HOH I 8 .   ? -60.973 36.902 10.514  1.00 46.62  ? 821 HOH A O   1 
HETATM 3001 O  O   . HOH I 8 .   ? -40.104 4.822  -1.969  1.00 48.22  ? 823 HOH A O   1 
HETATM 3002 O  O   . HOH I 8 .   ? -55.228 42.597 16.322  1.00 38.57  ? 824 HOH A O   1 
HETATM 3003 O  O   . HOH I 8 .   ? -59.776 20.372 1.670   1.00 45.07  ? 826 HOH A O   1 
HETATM 3004 O  O   . HOH I 8 .   ? -54.770 24.566 17.221  1.00 36.63  ? 829 HOH A O   1 
HETATM 3005 O  O   . HOH I 8 .   ? -47.088 13.259 -5.435  1.00 36.98  ? 831 HOH A O   1 
HETATM 3006 O  O   . HOH I 8 .   ? -28.740 48.915 -2.935  1.00 41.99  ? 832 HOH A O   1 
HETATM 3007 O  O   . HOH I 8 .   ? -33.561 14.948 14.922  1.00 38.05  ? 833 HOH A O   1 
HETATM 3008 O  O   . HOH I 8 .   ? -52.301 23.883 -4.699  1.00 33.53  ? 834 HOH A O   1 
HETATM 3009 O  O   . HOH I 8 .   ? -43.512 42.635 -8.654  1.00 45.64  ? 835 HOH A O   1 
HETATM 3010 O  O   . HOH I 8 .   ? -57.257 10.508 17.242  1.00 43.73  ? 836 HOH A O   1 
HETATM 3011 O  O   . HOH I 8 .   ? -38.503 13.991 -6.943  1.00 40.67  ? 837 HOH A O   1 
HETATM 3012 O  O   . HOH I 8 .   ? -57.001 32.687 19.436  1.00 35.93  ? 838 HOH A O   1 
HETATM 3013 O  O   . HOH I 8 .   ? -41.984 36.222 -3.357  1.00 30.86  ? 840 HOH A O   1 
HETATM 3014 O  O   . HOH I 8 .   ? -39.050 21.446 -8.102  1.00 39.69  ? 842 HOH A O   1 
HETATM 3015 O  O   . HOH I 8 .   ? -47.291 17.508 8.176   1.00 42.73  ? 843 HOH A O   1 
HETATM 3016 O  O   . HOH I 8 .   ? -35.699 4.117  19.988  1.00 43.99  ? 844 HOH A O   1 
HETATM 3017 O  O   . HOH I 8 .   ? -60.651 27.547 7.438   1.00 51.05  ? 846 HOH A O   1 
HETATM 3018 O  O   . HOH I 8 .   ? -55.902 23.253 24.322  1.00 63.69  ? 848 HOH A O   1 
HETATM 3019 O  O   . HOH I 8 .   ? -26.247 40.580 21.007  1.00 48.43  ? 855 HOH A O   1 
HETATM 3020 O  O   . HOH I 8 .   ? -42.265 41.184 17.206  1.00 38.38  ? 856 HOH A O   1 
HETATM 3021 O  O   . HOH I 8 .   ? -57.336 27.900 -8.385  1.00 38.10  ? 857 HOH A O   1 
HETATM 3022 O  O   . HOH I 8 .   ? -16.775 29.981 13.564  1.00 45.09  ? 859 HOH A O   1 
HETATM 3023 O  O   . HOH I 8 .   ? -16.281 36.257 17.665  1.00 52.84  ? 861 HOH A O   1 
HETATM 3024 O  O   . HOH I 8 .   ? -39.130 15.860 13.997  1.00 47.18  ? 863 HOH A O   1 
HETATM 3025 O  O   . HOH I 8 .   ? -35.985 35.142 6.023   1.00 34.57  ? 864 HOH A O   1 
HETATM 3026 O  O   . HOH I 8 .   ? -56.857 20.296 2.965   1.00 39.50  ? 865 HOH A O   1 
HETATM 3027 O  O   . HOH I 8 .   ? -29.773 34.826 19.758  1.00 40.63  ? 866 HOH A O   1 
HETATM 3028 O  O   . HOH I 8 .   ? -56.783 38.350 8.589   1.00 44.64  ? 867 HOH A O   1 
HETATM 3029 O  O   . HOH I 8 .   ? -49.842 7.169  2.416   1.00 46.02  ? 868 HOH A O   1 
HETATM 3030 O  O   . HOH I 8 .   ? -31.858 27.859 -6.795  1.00 44.01  ? 869 HOH A O   1 
HETATM 3031 O  O   . HOH I 8 .   ? -28.880 34.169 -8.026  1.00 32.84  ? 870 HOH A O   1 
HETATM 3032 O  O   . HOH I 8 .   ? -42.076 14.790 7.513   1.00 45.89  ? 871 HOH A O   1 
HETATM 3033 O  O   . HOH I 8 .   ? -52.762 44.451 9.731   1.00 37.07  ? 872 HOH A O   1 
HETATM 3034 O  O   . HOH I 8 .   ? -41.319 48.158 -2.606  1.00 46.25  ? 873 HOH A O   1 
HETATM 3035 O  O   . HOH I 8 .   ? -59.821 21.117 12.465  1.00 52.36  ? 874 HOH A O   1 
HETATM 3036 O  O   . HOH I 8 .   ? -15.892 36.662 24.871  1.00 62.89  ? 876 HOH A O   1 
HETATM 3037 O  O   . HOH I 8 .   ? -18.524 35.521 23.907  1.00 49.05  ? 877 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   92  ?   ?   ?   A . n 
A 1 2   LEU 2   93  ?   ?   ?   A . n 
A 1 3   MET 3   94  ?   ?   ?   A . n 
A 1 4   LYS 4   95  ?   ?   ?   A . n 
A 1 5   LYS 5   96  ?   ?   ?   A . n 
A 1 6   ARG 6   97  ?   ?   ?   A . n 
A 1 7   ARG 7   98  ?   ?   ?   A . n 
A 1 8   ASN 8   99  ?   ?   ?   A . n 
A 1 9   TRP 9   100 ?   ?   ?   A . n 
A 1 10  HIS 10  101 ?   ?   ?   A . n 
A 1 11  ARG 11  102 ?   ?   ?   A . n 
A 1 12  HIS 12  103 ?   ?   ?   A . n 
A 1 13  ASP 13  104 ?   ?   ?   A . n 
A 1 14  TYR 14  105 ?   ?   ?   A . n 
A 1 15  THR 15  106 ?   ?   ?   A . n 
A 1 16  GLU 16  107 ?   ?   ?   A . n 
A 1 17  ILE 17  108 ?   ?   ?   A . n 
A 1 18  ASP 18  109 ?   ?   ?   A . n 
A 1 19  ASP 19  110 ?   ?   ?   A . n 
A 1 20  GLY 20  111 ?   ?   ?   A . n 
A 1 21  SER 21  112 ?   ?   ?   A . n 
A 1 22  LYS 22  113 ?   ?   ?   A . n 
A 1 23  PRO 23  114 114 PRO PRO A . n 
A 1 24  VAL 24  115 115 VAL VAL A . n 
A 1 25  GLN 25  116 116 GLN GLN A . n 
A 1 26  ALA 26  117 117 ALA ALA A . n 
A 1 27  GLY 27  118 118 GLY GLY A . n 
A 1 28  THR 28  119 119 THR THR A . n 
A 1 29  ARG 29  120 120 ARG ARG A . n 
A 1 30  THR 30  121 121 THR THR A . n 
A 1 31  PHE 31  122 122 PHE PHE A . n 
A 1 32  ILE 32  123 123 ILE ILE A . n 
A 1 33  LYS 33  124 124 LYS LYS A . n 
A 1 34  GLU 34  125 125 GLU GLU A . n 
A 1 35  LEU 35  126 126 LEU LEU A . n 
A 1 36  ARG 36  127 127 ARG ARG A . n 
A 1 37  SER 37  128 128 SER SER A . n 
A 1 38  ARG 38  129 129 ARG ARG A . n 
A 1 39  VAL 39  130 130 VAL VAL A . n 
A 1 40  PHE 40  131 131 PHE PHE A . n 
A 1 41  PRO 41  132 132 PRO PRO A . n 
A 1 42  SER 42  133 133 SER SER A . n 
A 1 43  ALA 43  134 134 ALA ALA A . n 
A 1 44  ASP 44  135 135 ASP ASP A . n 
A 1 45  GLU 45  136 136 GLU GLU A . n 
A 1 46  ILE 46  137 137 ILE ILE A . n 
A 1 47  ILE 47  138 138 ILE ILE A . n 
A 1 48  ILE 48  139 139 ILE ILE A . n 
A 1 49  LYS 49  140 140 LYS LYS A . n 
A 1 50  MET 50  141 141 MET MET A . n 
A 1 51  HIS 51  142 142 HIS HIS A . n 
A 1 52  GLY 52  143 143 GLY GLY A . n 
A 1 53  SER 53  144 144 SER SER A . n 
A 1 54  GLN 54  145 145 GLN GLN A . n 
A 1 55  LEU 55  146 146 LEU LEU A . n 
A 1 56  THR 56  147 147 THR THR A . n 
A 1 57  GLN 57  148 148 GLN GLN A . n 
A 1 58  ARG 58  149 149 ARG ARG A . n 
A 1 59  TYR 59  150 150 TYR TYR A . n 
A 1 60  LEU 60  151 151 LEU LEU A . n 
A 1 61  GLU 61  152 152 GLU GLU A . n 
A 1 62  LYS 62  153 153 LYS LYS A . n 
A 1 63  HIS 63  154 154 HIS HIS A . n 
A 1 64  GLY 64  155 155 GLY GLY A . n 
A 1 65  PHE 65  156 156 PHE PHE A . n 
A 1 66  ASP 66  157 157 ASP ASP A . n 
A 1 67  VAL 67  158 158 VAL VAL A . n 
A 1 68  PRO 68  159 159 PRO PRO A . n 
A 1 69  ILE 69  160 160 ILE ILE A . n 
A 1 70  MET 70  161 161 MET MET A . n 
A 1 71  VAL 71  162 162 VAL VAL A . n 
A 1 72  PRO 72  163 163 PRO PRO A . n 
A 1 73  LYS 73  164 164 LYS LYS A . n 
A 1 74  LEU 74  165 165 LEU LEU A . n 
A 1 75  ASP 75  166 166 ASP ASP A . n 
A 1 76  ASP 76  167 167 ASP ASP A . n 
A 1 77  LEU 77  168 168 LEU LEU A . n 
A 1 78  GLY 78  169 169 GLY GLY A . n 
A 1 79  LEU 79  170 170 LEU LEU A . n 
A 1 80  ARG 80  171 171 ARG ARG A . n 
A 1 81  LEU 81  172 172 LEU LEU A . n 
A 1 82  PRO 82  173 173 PRO PRO A . n 
A 1 83  SER 83  174 174 SER SER A . n 
A 1 84  PRO 84  175 175 PRO PRO A . n 
A 1 85  THR 85  176 176 THR THR A . n 
A 1 86  PHE 86  177 177 PHE PHE A . n 
A 1 87  SER 87  178 178 SER SER A . n 
A 1 88  VAL 88  179 179 VAL VAL A . n 
A 1 89  MET 89  180 180 MET MET A . n 
A 1 90  ASP 90  181 181 ASP ASP A . n 
A 1 91  VAL 91  182 182 VAL VAL A . n 
A 1 92  GLU 92  183 183 GLU GLU A . n 
A 1 93  ARG 93  184 184 ARG ARG A . n 
A 1 94  TYR 94  185 185 TYR TYR A . n 
A 1 95  VAL 95  186 186 VAL VAL A . n 
A 1 96  GLY 96  187 187 GLY GLY A . n 
A 1 97  GLY 97  188 188 GLY GLY A . n 
A 1 98  ASP 98  189 189 ASP ASP A . n 
A 1 99  LYS 99  190 190 LYS LYS A . n 
A 1 100 VAL 100 191 191 VAL VAL A . n 
A 1 101 ILE 101 192 192 ILE ILE A . n 
A 1 102 ASP 102 193 193 ASP ASP A . n 
A 1 103 VAL 103 194 194 VAL VAL A . n 
A 1 104 ILE 104 195 195 ILE ILE A . n 
A 1 105 ASP 105 196 196 ASP ASP A . n 
A 1 106 VAL 106 197 197 VAL VAL A . n 
A 1 107 ALA 107 198 198 ALA ALA A . n 
A 1 108 ARG 108 199 199 ARG ARG A . n 
A 1 109 GLN 109 200 200 GLN GLN A . n 
A 1 110 ALA 110 201 201 ALA ALA A . n 
A 1 111 ASP 111 202 202 ASP ASP A . n 
A 1 112 SER 112 203 203 SER SER A . n 
A 1 113 LYS 113 204 204 LYS LYS A . n 
A 1 114 MET 114 205 205 MET MET A . n 
A 1 115 THR 115 206 206 THR THR A . n 
A 1 116 LEU 116 207 207 LEU LEU A . n 
A 1 117 HIS 117 208 208 HIS HIS A . n 
A 1 118 ASN 118 209 209 ASN ASN A . n 
A 1 119 TYR 119 210 210 TYR TYR A . n 
A 1 120 VAL 120 211 211 VAL VAL A . n 
A 1 121 LYS 121 212 212 LYS LYS A . n 
A 1 122 TYR 122 213 213 TYR TYR A . n 
A 1 123 PHE 123 214 214 PHE PHE A . n 
A 1 124 MET 124 215 215 MET MET A . n 
A 1 125 ASN 125 216 216 ASN ASN A . n 
A 1 126 PRO 126 217 217 PRO PRO A . n 
A 1 127 ASN 127 218 218 ASN ASN A . n 
A 1 128 ARG 128 219 219 ARG ARG A . n 
A 1 129 PRO 129 220 220 PRO PRO A . n 
A 1 130 LYS 130 221 221 LYS LYS A . n 
A 1 131 VAL 131 222 222 VAL VAL A . n 
A 1 132 LEU 132 223 223 LEU LEU A . n 
A 1 133 ASN 133 224 224 ASN ASN A . n 
A 1 134 VAL 134 225 225 VAL VAL A . n 
A 1 135 ILE 135 226 226 ILE ILE A . n 
A 1 136 SER 136 227 227 SER SER A . n 
A 1 137 LEU 137 228 228 LEU LEU A . n 
A 1 138 GLU 138 229 229 GLU GLU A . n 
A 1 139 PHE 139 230 230 PHE PHE A . n 
A 1 140 SER 140 231 231 SER SER A . n 
A 1 141 ASP 141 232 232 ASP ASP A . n 
A 1 142 THR 142 233 233 THR THR A . n 
A 1 143 LYS 143 234 234 LYS LYS A . n 
A 1 144 MET 144 235 235 MET MET A . n 
A 1 145 SER 145 236 236 SER SER A . n 
A 1 146 GLU 146 237 237 GLU GLU A . n 
A 1 147 LEU 147 238 238 LEU LEU A . n 
A 1 148 VAL 148 239 239 VAL VAL A . n 
A 1 149 GLU 149 240 240 GLU GLU A . n 
A 1 150 VAL 150 241 241 VAL VAL A . n 
A 1 151 PRO 151 242 242 PRO PRO A . n 
A 1 152 ASP 152 243 243 ASP ASP A . n 
A 1 153 ILE 153 244 244 ILE ILE A . n 
A 1 154 ALA 154 245 245 ALA ALA A . n 
A 1 155 LYS 155 246 246 LYS LYS A . n 
A 1 156 LYS 156 247 247 LYS LYS A . n 
A 1 157 LEU 157 248 248 LEU LEU A . n 
A 1 158 SER 158 249 249 SER SER A . n 
A 1 159 TRP 159 250 250 TRP TRP A . n 
A 1 160 VAL 160 251 251 VAL VAL A . n 
A 1 161 GLU 161 252 252 GLU GLU A . n 
A 1 162 ASN 162 253 253 ASN ASN A . n 
A 1 163 TYR 163 254 254 TYR TYR A . n 
A 1 164 TRP 164 255 255 TRP TRP A . n 
A 1 165 PRO 165 256 256 PRO PRO A . n 
A 1 166 ASP 166 257 257 ASP ASP A . n 
A 1 167 ASP 167 258 258 ASP ASP A . n 
A 1 168 SER 168 259 259 SER SER A . n 
A 1 169 VAL 169 260 260 VAL VAL A . n 
A 1 170 PHE 170 261 261 PHE PHE A . n 
A 1 171 PRO 171 262 262 PRO PRO A . n 
A 1 172 LYS 172 263 263 LYS LYS A . n 
A 1 173 PRO 173 264 264 PRO PRO A . n 
A 1 174 PHE 174 265 265 PHE PHE A . n 
A 1 175 VAL 175 266 266 VAL VAL A . n 
A 1 176 GLN 176 267 267 GLN GLN A . n 
A 1 177 LYS 177 268 268 LYS LYS A . n 
A 1 178 TYR 178 269 269 TYR TYR A . n 
A 1 179 CYS 179 270 270 CYS CYS A . n 
A 1 180 LEU 180 271 271 LEU LEU A . n 
A 1 181 MET 181 272 272 MET MET A . n 
A 1 182 GLY 182 273 273 GLY GLY A . n 
A 1 183 VAL 183 274 274 VAL VAL A . n 
A 1 184 GLN 184 275 275 GLN GLN A . n 
A 1 185 ASP 185 276 276 ASP ASP A . n 
A 1 186 SER 186 277 277 SER SER A . n 
A 1 187 TYR 187 278 278 TYR TYR A . n 
A 1 188 THR 188 279 279 THR THR A . n 
A 1 189 ASP 189 280 280 ASP ASP A . n 
A 1 190 PHE 190 281 281 PHE PHE A . n 
A 1 191 HIS 191 282 282 HIS HIS A . n 
A 1 192 ILE 192 283 283 ILE ILE A . n 
A 1 193 ASP 193 284 284 ASP ASP A . n 
A 1 194 PHE 194 285 285 PHE PHE A . n 
A 1 195 GLY 195 286 286 GLY GLY A . n 
A 1 196 GLY 196 287 287 GLY GLY A . n 
A 1 197 THR 197 288 288 THR THR A . n 
A 1 198 SER 198 289 289 SER SER A . n 
A 1 199 VAL 199 290 290 VAL VAL A . n 
A 1 200 TRP 200 291 291 TRP TRP A . n 
A 1 201 TYR 201 292 292 TYR TYR A . n 
A 1 202 HIS 202 293 293 HIS HIS A . n 
A 1 203 VAL 203 294 294 VAL VAL A . n 
A 1 204 LEU 204 295 295 LEU LEU A . n 
A 1 205 TRP 205 296 296 TRP TRP A . n 
A 1 206 GLY 206 297 297 GLY GLY A . n 
A 1 207 GLU 207 298 298 GLU GLU A . n 
A 1 208 LYS 208 299 299 LYS LYS A . n 
A 1 209 ILE 209 300 300 ILE ILE A . n 
A 1 210 PHE 210 301 301 PHE PHE A . n 
A 1 211 TYR 211 302 302 TYR TYR A . n 
A 1 212 LEU 212 303 303 LEU LEU A . n 
A 1 213 ILE 213 304 304 ILE ILE A . n 
A 1 214 LYS 214 305 305 LYS LYS A . n 
A 1 215 PRO 215 306 306 PRO PRO A . n 
A 1 216 THR 216 307 307 THR THR A . n 
A 1 217 ASP 217 308 308 ASP ASP A . n 
A 1 218 GLU 218 309 309 GLU GLU A . n 
A 1 219 ASN 219 310 310 ASN ASN A . n 
A 1 220 LEU 220 311 311 LEU LEU A . n 
A 1 221 ALA 221 312 312 ALA ALA A . n 
A 1 222 ARG 222 313 313 ARG ARG A . n 
A 1 223 TYR 223 314 314 TYR TYR A . n 
A 1 224 GLU 224 315 315 GLU GLU A . n 
A 1 225 SER 225 316 316 SER SER A . n 
A 1 226 TRP 226 317 317 TRP TRP A . n 
A 1 227 SER 227 318 318 SER SER A . n 
A 1 228 SER 228 319 319 SER SER A . n 
A 1 229 SER 229 320 320 SER SER A . n 
A 1 230 VAL 230 321 321 VAL VAL A . n 
A 1 231 THR 231 322 322 THR THR A . n 
A 1 232 GLN 232 323 323 GLN GLN A . n 
A 1 233 SER 233 324 324 SER SER A . n 
A 1 234 GLU 234 325 325 GLU GLU A . n 
A 1 235 VAL 235 326 326 VAL VAL A . n 
A 1 236 PHE 236 327 327 PHE PHE A . n 
A 1 237 PHE 237 328 328 PHE PHE A . n 
A 1 238 GLY 238 329 329 GLY GLY A . n 
A 1 239 ASP 239 330 330 ASP ASP A . n 
A 1 240 LYS 240 331 331 LYS LYS A . n 
A 1 241 VAL 241 332 332 VAL VAL A . n 
A 1 242 ASP 242 333 333 ASP ASP A . n 
A 1 243 LYS 243 334 334 LYS LYS A . n 
A 1 244 CYS 244 335 335 CYS CYS A . n 
A 1 245 TYR 245 336 336 TYR TYR A . n 
A 1 246 LYS 246 337 337 LYS LYS A . n 
A 1 247 CYS 247 338 338 CYS CYS A . n 
A 1 248 VAL 248 339 339 VAL VAL A . n 
A 1 249 VAL 249 340 340 VAL VAL A . n 
A 1 250 LYS 250 341 341 LYS LYS A . n 
A 1 251 GLN 251 342 342 GLN GLN A . n 
A 1 252 GLY 252 343 343 GLY GLY A . n 
A 1 253 HIS 253 344 344 HIS HIS A . n 
A 1 254 THR 254 345 345 THR THR A . n 
A 1 255 LEU 255 346 346 LEU LEU A . n 
A 1 256 PHE 256 347 347 PHE PHE A . n 
A 1 257 VAL 257 348 348 VAL VAL A . n 
A 1 258 PRO 258 349 349 PRO PRO A . n 
A 1 259 THR 259 350 350 THR THR A . n 
A 1 260 GLY 260 351 351 GLY GLY A . n 
A 1 261 TRP 261 352 352 TRP TRP A . n 
A 1 262 ILE 262 353 353 ILE ILE A . n 
A 1 263 HIS 263 354 354 HIS HIS A . n 
A 1 264 ALA 264 355 355 ALA ALA A . n 
A 1 265 VAL 265 356 356 VAL VAL A . n 
A 1 266 LEU 266 357 357 LEU LEU A . n 
A 1 267 THR 267 358 358 THR THR A . n 
A 1 268 SER 268 359 359 SER SER A . n 
A 1 269 GLN 269 360 360 GLN GLN A . n 
A 1 270 ASP 270 361 361 ASP ASP A . n 
A 1 271 CYS 271 362 362 CYS CYS A . n 
A 1 272 MET 272 363 363 MET MET A . n 
A 1 273 ALA 273 364 364 ALA ALA A . n 
A 1 274 PHE 274 365 365 PHE PHE A . n 
A 1 275 GLY 275 366 366 GLY GLY A . n 
A 1 276 GLY 276 367 367 GLY GLY A . n 
A 1 277 ASN 277 368 368 ASN ASN A . n 
A 1 278 PHE 278 369 369 PHE PHE A . n 
A 1 279 LEU 279 370 370 LEU LEU A . n 
A 1 280 HIS 280 371 371 HIS HIS A . n 
A 1 281 ASN 281 372 372 ASN ASN A . n 
A 1 282 LEU 282 373 373 LEU LEU A . n 
A 1 283 ASN 283 374 374 ASN ASN A . n 
A 1 284 ILE 284 375 375 ILE ILE A . n 
A 1 285 GLY 285 376 376 GLY GLY A . n 
A 1 286 MET 286 377 377 MET MET A . n 
A 1 287 GLN 287 378 378 GLN GLN A . n 
A 1 288 LEU 288 379 379 LEU LEU A . n 
A 1 289 ARG 289 380 380 ARG ARG A . n 
A 1 290 CYS 290 381 381 CYS CYS A . n 
A 1 291 TYR 291 382 382 TYR TYR A . n 
A 1 292 GLU 292 383 383 GLU GLU A . n 
A 1 293 MET 293 384 384 MET MET A . n 
A 1 294 GLU 294 385 385 GLU GLU A . n 
A 1 295 LYS 295 386 386 LYS LYS A . n 
A 1 296 ARG 296 387 387 ARG ARG A . n 
A 1 297 LEU 297 388 388 LEU LEU A . n 
A 1 298 LYS 298 389 389 LYS LYS A . n 
A 1 299 THR 299 390 390 THR THR A . n 
A 1 300 PRO 300 391 391 PRO PRO A . n 
A 1 301 ASP 301 392 392 ASP ASP A . n 
A 1 302 LEU 302 393 393 LEU LEU A . n 
A 1 303 PHE 303 394 394 PHE PHE A . n 
A 1 304 LYS 304 395 395 LYS LYS A . n 
A 1 305 PHE 305 396 396 PHE PHE A . n 
A 1 306 PRO 306 397 397 PRO PRO A . n 
A 1 307 PHE 307 398 398 PHE PHE A . n 
A 1 308 PHE 308 399 399 PHE PHE A . n 
A 1 309 GLU 309 400 400 GLU GLU A . n 
A 1 310 ALA 310 401 401 ALA ALA A . n 
A 1 311 ILE 311 402 402 ILE ILE A . n 
A 1 312 CYS 312 403 403 CYS CYS A . n 
A 1 313 TRP 313 404 404 TRP TRP A . n 
A 1 314 PHE 314 405 405 PHE PHE A . n 
A 1 315 VAL 315 406 406 VAL VAL A . n 
A 1 316 ALA 316 407 407 ALA ALA A . n 
A 1 317 LYS 317 408 408 LYS LYS A . n 
A 1 318 ASN 318 409 409 ASN ASN A . n 
A 1 319 LEU 319 410 410 LEU LEU A . n 
A 1 320 LEU 320 411 411 LEU LEU A . n 
A 1 321 GLU 321 412 412 GLU GLU A . n 
A 1 322 THR 322 413 413 THR THR A . n 
A 1 323 LEU 323 414 414 LEU LEU A . n 
A 1 324 LYS 324 415 415 LYS LYS A . n 
A 1 325 GLU 325 416 416 GLU GLU A . n 
A 1 326 LEU 326 417 417 LEU LEU A . n 
A 1 327 ARG 327 418 418 ARG ARG A . n 
A 1 328 GLU 328 419 419 GLU GLU A . n 
A 1 329 ASP 329 420 420 ASP ASP A . n 
A 1 330 GLY 330 421 421 GLY GLY A . n 
A 1 331 PHE 331 422 422 PHE PHE A . n 
A 1 332 GLN 332 423 423 GLN GLN A . n 
A 1 333 PRO 333 424 424 PRO PRO A . n 
A 1 334 GLN 334 425 425 GLN GLN A . n 
A 1 335 THR 335 426 426 THR THR A . n 
A 1 336 TYR 336 427 427 TYR TYR A . n 
A 1 337 LEU 337 428 428 LEU LEU A . n 
A 1 338 VAL 338 429 429 VAL VAL A . n 
A 1 339 GLN 339 430 430 GLN GLN A . n 
A 1 340 GLY 340 431 431 GLY GLY A . n 
A 1 341 VAL 341 432 432 VAL VAL A . n 
A 1 342 LYS 342 433 433 LYS LYS A . n 
A 1 343 ALA 343 434 434 ALA ALA A . n 
A 1 344 LEU 344 435 435 LEU LEU A . n 
A 1 345 HIS 345 436 436 HIS HIS A . n 
A 1 346 THR 346 437 437 THR THR A . n 
A 1 347 ALA 347 438 438 ALA ALA A . n 
A 1 348 LEU 348 439 439 LEU LEU A . n 
A 1 349 LYS 349 440 440 LYS LYS A . n 
A 1 350 LEU 350 441 441 LEU LEU A . n 
A 1 351 TRP 351 442 442 TRP TRP A . n 
A 1 352 MET 352 443 443 MET MET A . n 
A 1 353 LYS 353 444 444 LYS LYS A . n 
A 1 354 LYS 354 445 445 LYS LYS A . n 
A 1 355 GLU 355 446 446 GLU GLU A . n 
A 1 356 LEU 356 447 447 LEU LEU A . n 
A 1 357 VAL 357 448 448 VAL VAL A . n 
A 1 358 SER 358 449 449 SER SER A . n 
A 1 359 GLU 359 450 450 GLU GLU A . n 
A 1 360 HIS 360 451 451 HIS HIS A . n 
A 1 361 ALA 361 452 452 ALA ALA A . n 
A 1 362 PHE 362 453 453 PHE PHE A . n 
A 1 363 GLU 363 454 454 GLU GLU A . n 
A 1 364 ILE 364 455 455 ILE ILE A . n 
A 1 365 PRO 365 456 456 PRO PRO A . n 
A 1 366 ASP 366 457 457 ASP ASP A . n 
A 1 367 ASN 367 458 458 ASN ASN A . n 
A 1 368 VAL 368 459 459 VAL VAL A . n 
A 1 369 ARG 369 460 460 ARG ARG A . n 
A 1 370 PRO 370 461 461 PRO PRO A . n 
A 1 371 GLY 371 462 462 GLY GLY A . n 
A 1 372 HIS 372 463 463 HIS HIS A . n 
A 1 373 LEU 373 464 464 LEU LEU A . n 
A 1 374 ILE 374 465 465 ILE ILE A . n 
A 1 375 LYS 375 466 466 LYS LYS A . n 
A 1 376 GLU 376 467 467 GLU GLU A . n 
A 1 377 LEU 377 468 468 LEU LEU A . n 
A 1 378 SER 378 469 469 SER SER A . n 
A 1 379 LYS 379 470 470 LYS LYS A . n 
A 1 380 VAL 380 471 471 VAL VAL A . n 
A 1 381 ILE 381 472 472 ILE ILE A . n 
A 1 382 ARG 382 473 473 ARG ARG A . n 
A 1 383 ALA 383 474 474 ALA ALA A . n 
A 1 384 ILE 384 475 475 ILE ILE A . n 
A 1 385 GLU 385 476 476 GLU GLU A . n 
A 1 386 GLU 386 477 477 GLU GLU A . n 
A 1 387 GLU 387 478 478 GLU GLU A . n 
A 1 388 ASN 388 479 479 ASN ASN A . n 
A 1 389 GLY 389 480 ?   ?   ?   A . n 
A 1 390 LYS 390 481 ?   ?   ?   A . n 
A 1 391 PRO 391 482 ?   ?   ?   A . n 
A 1 392 VAL 392 483 ?   ?   ?   A . n 
A 1 393 LYS 393 484 ?   ?   ?   A . n 
A 1 394 SER 394 485 ?   ?   ?   A . n 
A 1 395 GLN 395 486 ?   ?   ?   A . n 
A 1 396 GLY 396 487 ?   ?   ?   A . n 
A 1 397 ILE 397 488 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 AKG 1  701 701 AKG AKG A . 
C 3 NI  1  702 702 NI  NI  A . 
D 4 CL  1  703 703 CL  CL  A . 
E 5 SO4 1  704 704 SO4 SO4 A . 
F 6 EDO 1  705 705 EDO EDO A . 
G 6 EDO 1  706 706 EDO EDO A . 
H 7 E67 1  707 707 E67 E67 A . 
I 8 HOH 1  801 801 HOH HOH A . 
I 8 HOH 2  802 802 HOH HOH A . 
I 8 HOH 3  804 804 HOH HOH A . 
I 8 HOH 4  809 809 HOH HOH A . 
I 8 HOH 5  810 810 HOH HOH A . 
I 8 HOH 6  811 811 HOH HOH A . 
I 8 HOH 7  818 818 HOH HOH A . 
I 8 HOH 8  821 821 HOH HOH A . 
I 8 HOH 9  823 823 HOH HOH A . 
I 8 HOH 10 824 824 HOH HOH A . 
I 8 HOH 11 826 826 HOH HOH A . 
I 8 HOH 12 829 829 HOH HOH A . 
I 8 HOH 13 831 831 HOH HOH A . 
I 8 HOH 14 832 832 HOH HOH A . 
I 8 HOH 15 833 833 HOH HOH A . 
I 8 HOH 16 834 834 HOH HOH A . 
I 8 HOH 17 835 835 HOH HOH A . 
I 8 HOH 18 836 836 HOH HOH A . 
I 8 HOH 19 837 837 HOH HOH A . 
I 8 HOH 20 838 838 HOH HOH A . 
I 8 HOH 21 840 840 HOH HOH A . 
I 8 HOH 22 842 842 HOH HOH A . 
I 8 HOH 23 843 843 HOH HOH A . 
I 8 HOH 24 844 844 HOH HOH A . 
I 8 HOH 25 846 846 HOH HOH A . 
I 8 HOH 26 848 848 HOH HOH A . 
I 8 HOH 27 855 855 HOH HOH A . 
I 8 HOH 28 856 856 HOH HOH A . 
I 8 HOH 29 857 857 HOH HOH A . 
I 8 HOH 30 859 859 HOH HOH A . 
I 8 HOH 31 861 861 HOH HOH A . 
I 8 HOH 32 863 863 HOH HOH A . 
I 8 HOH 33 864 864 HOH HOH A . 
I 8 HOH 34 865 865 HOH HOH A . 
I 8 HOH 35 866 866 HOH HOH A . 
I 8 HOH 36 867 867 HOH HOH A . 
I 8 HOH 37 868 868 HOH HOH A . 
I 8 HOH 38 869 869 HOH HOH A . 
I 8 HOH 39 870 870 HOH HOH A . 
I 8 HOH 40 871 871 HOH HOH A . 
I 8 HOH 41 872 872 HOH HOH A . 
I 8 HOH 42 873 873 HOH HOH A . 
I 8 HOH 43 874 874 HOH HOH A . 
I 8 HOH 44 876 876 HOH HOH A . 
I 8 HOH 45 877 877 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     809 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   I 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O5  ? B AKG .   ? A AKG 701 ? 1_555 NI ? C NI . ? A NI 702 ? 1_555 O1  ? B AKG .   ? A AKG 701 ? 1_555 79.9  ? 
2  O5  ? B AKG .   ? A AKG 701 ? 1_555 NI ? C NI . ? A NI 702 ? 1_555 NE2 ? A HIS 191 ? A HIS 282 ? 1_555 89.3  ? 
3  O1  ? B AKG .   ? A AKG 701 ? 1_555 NI ? C NI . ? A NI 702 ? 1_555 NE2 ? A HIS 191 ? A HIS 282 ? 1_555 94.4  ? 
4  O5  ? B AKG .   ? A AKG 701 ? 1_555 NI ? C NI . ? A NI 702 ? 1_555 OD1 ? A ASP 193 ? A ASP 284 ? 1_555 174.2 ? 
5  O1  ? B AKG .   ? A AKG 701 ? 1_555 NI ? C NI . ? A NI 702 ? 1_555 OD1 ? A ASP 193 ? A ASP 284 ? 1_555 96.5  ? 
6  NE2 ? A HIS 191 ? A HIS 282 ? 1_555 NI ? C NI . ? A NI 702 ? 1_555 OD1 ? A ASP 193 ? A ASP 284 ? 1_555 95.7  ? 
7  O5  ? B AKG .   ? A AKG 701 ? 1_555 NI ? C NI . ? A NI 702 ? 1_555 O   ? I HOH .   ? A HOH 801 ? 1_555 88.1  ? 
8  O1  ? B AKG .   ? A AKG 701 ? 1_555 NI ? C NI . ? A NI 702 ? 1_555 O   ? I HOH .   ? A HOH 801 ? 1_555 86.7  ? 
9  NE2 ? A HIS 191 ? A HIS 282 ? 1_555 NI ? C NI . ? A NI 702 ? 1_555 O   ? I HOH .   ? A HOH 801 ? 1_555 176.9 ? 
10 OD1 ? A ASP 193 ? A ASP 284 ? 1_555 NI ? C NI . ? A NI 702 ? 1_555 O   ? I HOH .   ? A HOH 801 ? 1_555 87.1  ? 
11 O5  ? B AKG .   ? A AKG 701 ? 1_555 NI ? C NI . ? A NI 702 ? 1_555 NE2 ? A HIS 263 ? A HIS 354 ? 1_555 89.0  ? 
12 O1  ? B AKG .   ? A AKG 701 ? 1_555 NI ? C NI . ? A NI 702 ? 1_555 NE2 ? A HIS 263 ? A HIS 354 ? 1_555 168.7 ? 
13 NE2 ? A HIS 191 ? A HIS 282 ? 1_555 NI ? C NI . ? A NI 702 ? 1_555 NE2 ? A HIS 263 ? A HIS 354 ? 1_555 87.7  ? 
14 OD1 ? A ASP 193 ? A ASP 284 ? 1_555 NI ? C NI . ? A NI 702 ? 1_555 NE2 ? A HIS 263 ? A HIS 354 ? 1_555 94.3  ? 
15 O   ? I HOH .   ? A HOH 801 ? 1_555 NI ? C NI . ? A NI 702 ? 1_555 NE2 ? A HIS 263 ? A HIS 354 ? 1_555 90.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-01-25 
2 'Structure model' 1 1 2012-02-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHENIX   'model building'  .                            ? 2 
PHENIX   refinement        '(phenix.refine: 1.6.1_336)' ? 3 
HKL-2000 'data reduction'  .                            ? 4 
HKL-2000 'data scaling'    .                            ? 5 
PHENIX   phasing           .                            ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 173 ? ? -46.72  155.58  
2  1 PRO A 175 ? ? -57.58  1.56    
3  1 PRO A 217 ? ? -67.83  -166.49 
4  1 VAL A 266 ? ? -146.81 30.22   
5  1 ASP A 276 ? ? 81.49   3.84    
6  1 PHE A 398 ? ? -109.00 41.71   
7  1 ALA A 474 ? ? 77.23   155.78  
8  1 ILE A 475 ? ? 74.19   -59.83  
9  1 GLU A 477 ? ? 87.83   -60.93  
10 1 GLU A 478 ? ? -64.05  4.87    
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 124 ? CG  ? A LYS 33  CG  
2  1 Y 1 A LYS 124 ? CD  ? A LYS 33  CD  
3  1 Y 1 A LYS 124 ? CE  ? A LYS 33  CE  
4  1 Y 1 A LYS 124 ? NZ  ? A LYS 33  NZ  
5  1 Y 1 A LYS 153 ? CG  ? A LYS 62  CG  
6  1 Y 1 A LYS 153 ? CD  ? A LYS 62  CD  
7  1 Y 1 A LYS 153 ? CE  ? A LYS 62  CE  
8  1 Y 1 A LYS 153 ? NZ  ? A LYS 62  NZ  
9  1 Y 1 A GLU 240 ? CG  ? A GLU 149 CG  
10 1 Y 1 A GLU 240 ? CD  ? A GLU 149 CD  
11 1 Y 1 A GLU 240 ? OE1 ? A GLU 149 OE1 
12 1 Y 1 A GLU 240 ? OE2 ? A GLU 149 OE2 
13 1 Y 1 A PHE 394 ? CG  ? A PHE 303 CG  
14 1 Y 1 A PHE 394 ? CD1 ? A PHE 303 CD1 
15 1 Y 1 A PHE 394 ? CD2 ? A PHE 303 CD2 
16 1 Y 1 A PHE 394 ? CE1 ? A PHE 303 CE1 
17 1 Y 1 A PHE 394 ? CE2 ? A PHE 303 CE2 
18 1 Y 1 A PHE 394 ? CZ  ? A PHE 303 CZ  
19 1 Y 1 A ARG 418 ? CG  ? A ARG 327 CG  
20 1 Y 1 A ARG 418 ? CD  ? A ARG 327 CD  
21 1 Y 1 A ARG 418 ? NE  ? A ARG 327 NE  
22 1 Y 1 A ARG 418 ? CZ  ? A ARG 327 CZ  
23 1 Y 1 A ARG 418 ? NH1 ? A ARG 327 NH1 
24 1 Y 1 A ARG 418 ? NH2 ? A ARG 327 NH2 
25 1 Y 1 A LYS 445 ? CG  ? A LYS 354 CG  
26 1 Y 1 A LYS 445 ? CD  ? A LYS 354 CD  
27 1 Y 1 A LYS 445 ? CE  ? A LYS 354 CE  
28 1 Y 1 A LYS 445 ? NZ  ? A LYS 354 NZ  
29 1 Y 1 A LYS 466 ? CG  ? A LYS 375 CG  
30 1 Y 1 A LYS 466 ? CD  ? A LYS 375 CD  
31 1 Y 1 A LYS 466 ? CE  ? A LYS 375 CE  
32 1 Y 1 A LYS 466 ? NZ  ? A LYS 375 NZ  
33 1 Y 1 A SER 469 ? OG  ? A SER 378 OG  
34 1 Y 1 A ARG 473 ? CG  ? A ARG 382 CG  
35 1 Y 1 A ARG 473 ? CD  ? A ARG 382 CD  
36 1 Y 1 A ARG 473 ? NE  ? A ARG 382 NE  
37 1 Y 1 A ARG 473 ? CZ  ? A ARG 382 CZ  
38 1 Y 1 A ARG 473 ? NH1 ? A ARG 382 NH1 
39 1 Y 1 A ARG 473 ? NH2 ? A ARG 382 NH2 
40 1 Y 1 A GLU 477 ? CG  ? A GLU 386 CG  
41 1 Y 1 A GLU 477 ? CD  ? A GLU 386 CD  
42 1 Y 1 A GLU 477 ? OE1 ? A GLU 386 OE1 
43 1 Y 1 A GLU 477 ? OE2 ? A GLU 386 OE2 
44 1 Y 1 A GLU 478 ? CG  ? A GLU 387 CG  
45 1 Y 1 A GLU 478 ? CD  ? A GLU 387 CD  
46 1 Y 1 A GLU 478 ? OE1 ? A GLU 387 OE1 
47 1 Y 1 A GLU 478 ? OE2 ? A GLU 387 OE2 
48 1 N 1 A E67 707 ? CAO ? H E67 1   CAO 
49 1 N 1 A E67 707 ? CAP ? H E67 1   CAP 
50 1 N 1 A E67 707 ? CAQ ? H E67 1   CAQ 
51 1 N 1 A E67 707 ? NAR ? H E67 1   NAR 
52 1 N 1 A E67 707 ? CAS ? H E67 1   CAS 
53 1 N 1 A E67 707 ? CAT ? H E67 1   CAT 
54 1 N 1 A E67 707 ? CBH ? H E67 1   CBH 
55 1 N 1 A E67 707 ? CBI ? H E67 1   CBI 
56 1 N 1 A E67 707 ? CBJ ? H E67 1   CBJ 
57 1 N 1 A E67 707 ? CBK ? H E67 1   CBK 
58 1 N 1 A E67 707 ? CBL ? H E67 1   CBL 
59 1 N 1 A E67 707 ? CBM ? H E67 1   CBM 
60 1 N 1 A E67 707 ? CBN ? H E67 1   CBN 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 92  ? A SER 1   
2  1 Y 1 A LEU 93  ? A LEU 2   
3  1 Y 1 A MET 94  ? A MET 3   
4  1 Y 1 A LYS 95  ? A LYS 4   
5  1 Y 1 A LYS 96  ? A LYS 5   
6  1 Y 1 A ARG 97  ? A ARG 6   
7  1 Y 1 A ARG 98  ? A ARG 7   
8  1 Y 1 A ASN 99  ? A ASN 8   
9  1 Y 1 A TRP 100 ? A TRP 9   
10 1 Y 1 A HIS 101 ? A HIS 10  
11 1 Y 1 A ARG 102 ? A ARG 11  
12 1 Y 1 A HIS 103 ? A HIS 12  
13 1 Y 1 A ASP 104 ? A ASP 13  
14 1 Y 1 A TYR 105 ? A TYR 14  
15 1 Y 1 A THR 106 ? A THR 15  
16 1 Y 1 A GLU 107 ? A GLU 16  
17 1 Y 1 A ILE 108 ? A ILE 17  
18 1 Y 1 A ASP 109 ? A ASP 18  
19 1 Y 1 A ASP 110 ? A ASP 19  
20 1 Y 1 A GLY 111 ? A GLY 20  
21 1 Y 1 A SER 112 ? A SER 21  
22 1 Y 1 A LYS 113 ? A LYS 22  
23 1 Y 1 A GLY 480 ? A GLY 389 
24 1 Y 1 A LYS 481 ? A LYS 390 
25 1 Y 1 A PRO 482 ? A PRO 391 
26 1 Y 1 A VAL 483 ? A VAL 392 
27 1 Y 1 A LYS 484 ? A LYS 393 
28 1 Y 1 A SER 485 ? A SER 394 
29 1 Y 1 A GLN 486 ? A GLN 395 
30 1 Y 1 A GLY 487 ? A GLY 396 
31 1 Y 1 A ILE 488 ? A ILE 397 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-OXOGLUTARIC ACID'                                                                                                   AKG 
3 'NICKEL (II) ION'                                                                                                      NI  
4 'CHLORIDE ION'                                                                                                         CL  
5 'SULFATE ION'                                                                                                          SO4 
6 1,2-ETHANEDIOL                                                                                                         EDO 
7 '7-[(5-aminopentyl)oxy]-N~4~-(1-benzylpiperidin-4-yl)-N~2~-[3-(dimethylamino)propyl]-6-methoxyquinazoline-2,4-diamine' E67 
8 water                                                                                                                  HOH 
#