data_3U7U
# 
_entry.id   3U7U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3U7U         
RCSB  RCSB068415   
WWPDB D_1000068415 
# 
_pdbx_database_status.entry_id                        3U7U 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-10-14 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, P.'            1 
'Cleveland IV, T.E.' 2 
'Bouyain, S.'        3 
'Longo, P.A.'        4 
'Leahy, D.J.'        5 
# 
_citation.id                        primary 
_citation.title                     'A single ligand is sufficient to activate EGFR dimers.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            109 
_citation.page_first                10861 
_citation.page_last                 10866 
_citation.year                      2012 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22699492 
_citation.pdbx_database_id_DOI      10.1073/pnas.1201114109 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Liu, P.'         1 ? 
primary 'Cleveland, T.E.' 2 ? 
primary 'Bouyain, S.'     3 ? 
primary 'Byrne, P.O.'     4 ? 
primary 'Longo, P.A.'     5 ? 
primary 'Leahy, D.J.'     6 ? 
# 
_cell.entry_id           3U7U 
_cell.length_a           85.730 
_cell.length_b           223.510 
_cell.length_c           146.920 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.72 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3U7U 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Receptor tyrosine-protein kinase erbB-4' 68735.508 6   2.7.10.1 ? 'Extracellular region (UNP Residues 26-640)' 
? 
2 polymer     man 'Neuregulin 1'                            6196.122  6   ?        ? 'EGF-like domain (UNP Residues 230-284)'     
? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose  221.208   26  ?        ? ?                                            
? 
4 water       nat water                                     18.015    291 ?        ? ?                                            
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Proto-oncogene-like protein c-ErbB-4, Tyrosine kinase-type cell surface receptor HER4, p180erbB4, ERBB4 intracellular domain, 4ICD, E4ICD, s80HER4
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;QSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRII
RGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSG
CGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQT
FVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSA
QTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGG
RVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNH
LCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENDSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKD
GPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTG
;
;QSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRII
RGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSG
CGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQT
FVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSA
QTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGG
RVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNH
LCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENDSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKD
GPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTG
;
A,B,C,D,E,F ? 
2 'polypeptide(L)' no no GTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASF 
GTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASF G,H,I,J,K,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   SER n 
1 3   VAL n 
1 4   CYS n 
1 5   ALA n 
1 6   GLY n 
1 7   THR n 
1 8   GLU n 
1 9   ASN n 
1 10  LYS n 
1 11  LEU n 
1 12  SER n 
1 13  SER n 
1 14  LEU n 
1 15  SER n 
1 16  ASP n 
1 17  LEU n 
1 18  GLU n 
1 19  GLN n 
1 20  GLN n 
1 21  TYR n 
1 22  ARG n 
1 23  ALA n 
1 24  LEU n 
1 25  ARG n 
1 26  LYS n 
1 27  TYR n 
1 28  TYR n 
1 29  GLU n 
1 30  ASN n 
1 31  CYS n 
1 32  GLU n 
1 33  VAL n 
1 34  VAL n 
1 35  MET n 
1 36  GLY n 
1 37  ASN n 
1 38  LEU n 
1 39  GLU n 
1 40  ILE n 
1 41  THR n 
1 42  SER n 
1 43  ILE n 
1 44  GLU n 
1 45  HIS n 
1 46  ASN n 
1 47  ARG n 
1 48  ASP n 
1 49  LEU n 
1 50  SER n 
1 51  PHE n 
1 52  LEU n 
1 53  ARG n 
1 54  SER n 
1 55  VAL n 
1 56  ARG n 
1 57  GLU n 
1 58  VAL n 
1 59  THR n 
1 60  GLY n 
1 61  TYR n 
1 62  VAL n 
1 63  LEU n 
1 64  VAL n 
1 65  ALA n 
1 66  LEU n 
1 67  ASN n 
1 68  GLN n 
1 69  PHE n 
1 70  ARG n 
1 71  TYR n 
1 72  LEU n 
1 73  PRO n 
1 74  LEU n 
1 75  GLU n 
1 76  ASN n 
1 77  LEU n 
1 78  ARG n 
1 79  ILE n 
1 80  ILE n 
1 81  ARG n 
1 82  GLY n 
1 83  THR n 
1 84  LYS n 
1 85  LEU n 
1 86  TYR n 
1 87  GLU n 
1 88  ASP n 
1 89  ARG n 
1 90  TYR n 
1 91  ALA n 
1 92  LEU n 
1 93  ALA n 
1 94  ILE n 
1 95  PHE n 
1 96  LEU n 
1 97  ASN n 
1 98  TYR n 
1 99  ARG n 
1 100 LYS n 
1 101 ASP n 
1 102 GLY n 
1 103 ASN n 
1 104 PHE n 
1 105 GLY n 
1 106 LEU n 
1 107 GLN n 
1 108 GLU n 
1 109 LEU n 
1 110 GLY n 
1 111 LEU n 
1 112 LYS n 
1 113 ASN n 
1 114 LEU n 
1 115 THR n 
1 116 GLU n 
1 117 ILE n 
1 118 LEU n 
1 119 ASN n 
1 120 GLY n 
1 121 GLY n 
1 122 VAL n 
1 123 TYR n 
1 124 VAL n 
1 125 ASP n 
1 126 GLN n 
1 127 ASN n 
1 128 LYS n 
1 129 PHE n 
1 130 LEU n 
1 131 CYS n 
1 132 TYR n 
1 133 ALA n 
1 134 ASP n 
1 135 THR n 
1 136 ILE n 
1 137 HIS n 
1 138 TRP n 
1 139 GLN n 
1 140 ASP n 
1 141 ILE n 
1 142 VAL n 
1 143 ARG n 
1 144 ASN n 
1 145 PRO n 
1 146 TRP n 
1 147 PRO n 
1 148 SER n 
1 149 ASN n 
1 150 LEU n 
1 151 THR n 
1 152 LEU n 
1 153 VAL n 
1 154 SER n 
1 155 THR n 
1 156 ASN n 
1 157 GLY n 
1 158 SER n 
1 159 SER n 
1 160 GLY n 
1 161 CYS n 
1 162 GLY n 
1 163 ARG n 
1 164 CYS n 
1 165 HIS n 
1 166 LYS n 
1 167 SER n 
1 168 CYS n 
1 169 THR n 
1 170 GLY n 
1 171 ARG n 
1 172 CYS n 
1 173 TRP n 
1 174 GLY n 
1 175 PRO n 
1 176 THR n 
1 177 GLU n 
1 178 ASN n 
1 179 HIS n 
1 180 CYS n 
1 181 GLN n 
1 182 THR n 
1 183 LEU n 
1 184 THR n 
1 185 ARG n 
1 186 THR n 
1 187 VAL n 
1 188 CYS n 
1 189 ALA n 
1 190 GLU n 
1 191 GLN n 
1 192 CYS n 
1 193 ASP n 
1 194 GLY n 
1 195 ARG n 
1 196 CYS n 
1 197 TYR n 
1 198 GLY n 
1 199 PRO n 
1 200 TYR n 
1 201 VAL n 
1 202 SER n 
1 203 ASP n 
1 204 CYS n 
1 205 CYS n 
1 206 HIS n 
1 207 ARG n 
1 208 GLU n 
1 209 CYS n 
1 210 ALA n 
1 211 GLY n 
1 212 GLY n 
1 213 CYS n 
1 214 SER n 
1 215 GLY n 
1 216 PRO n 
1 217 LYS n 
1 218 ASP n 
1 219 THR n 
1 220 ASP n 
1 221 CYS n 
1 222 PHE n 
1 223 ALA n 
1 224 CYS n 
1 225 MET n 
1 226 ASN n 
1 227 PHE n 
1 228 ASN n 
1 229 ASP n 
1 230 SER n 
1 231 GLY n 
1 232 ALA n 
1 233 CYS n 
1 234 VAL n 
1 235 THR n 
1 236 GLN n 
1 237 CYS n 
1 238 PRO n 
1 239 GLN n 
1 240 THR n 
1 241 PHE n 
1 242 VAL n 
1 243 TYR n 
1 244 ASN n 
1 245 PRO n 
1 246 THR n 
1 247 THR n 
1 248 PHE n 
1 249 GLN n 
1 250 LEU n 
1 251 GLU n 
1 252 HIS n 
1 253 ASN n 
1 254 PHE n 
1 255 ASN n 
1 256 ALA n 
1 257 LYS n 
1 258 TYR n 
1 259 THR n 
1 260 TYR n 
1 261 GLY n 
1 262 ALA n 
1 263 PHE n 
1 264 CYS n 
1 265 VAL n 
1 266 LYS n 
1 267 LYS n 
1 268 CYS n 
1 269 PRO n 
1 270 HIS n 
1 271 ASN n 
1 272 PHE n 
1 273 VAL n 
1 274 VAL n 
1 275 ASP n 
1 276 SER n 
1 277 SER n 
1 278 SER n 
1 279 CYS n 
1 280 VAL n 
1 281 ARG n 
1 282 ALA n 
1 283 CYS n 
1 284 PRO n 
1 285 SER n 
1 286 SER n 
1 287 LYS n 
1 288 MET n 
1 289 GLU n 
1 290 VAL n 
1 291 GLU n 
1 292 GLU n 
1 293 ASN n 
1 294 GLY n 
1 295 ILE n 
1 296 LYS n 
1 297 MET n 
1 298 CYS n 
1 299 LYS n 
1 300 PRO n 
1 301 CYS n 
1 302 THR n 
1 303 ASP n 
1 304 ILE n 
1 305 CYS n 
1 306 PRO n 
1 307 LYS n 
1 308 ALA n 
1 309 CYS n 
1 310 ASP n 
1 311 GLY n 
1 312 ILE n 
1 313 GLY n 
1 314 THR n 
1 315 GLY n 
1 316 SER n 
1 317 LEU n 
1 318 MET n 
1 319 SER n 
1 320 ALA n 
1 321 GLN n 
1 322 THR n 
1 323 VAL n 
1 324 ASP n 
1 325 SER n 
1 326 SER n 
1 327 ASN n 
1 328 ILE n 
1 329 ASP n 
1 330 LYS n 
1 331 PHE n 
1 332 ILE n 
1 333 ASN n 
1 334 CYS n 
1 335 THR n 
1 336 LYS n 
1 337 ILE n 
1 338 ASN n 
1 339 GLY n 
1 340 ASN n 
1 341 LEU n 
1 342 ILE n 
1 343 PHE n 
1 344 LEU n 
1 345 VAL n 
1 346 THR n 
1 347 GLY n 
1 348 ILE n 
1 349 HIS n 
1 350 GLY n 
1 351 ASP n 
1 352 PRO n 
1 353 TYR n 
1 354 ASN n 
1 355 ALA n 
1 356 ILE n 
1 357 GLU n 
1 358 ALA n 
1 359 ILE n 
1 360 ASP n 
1 361 PRO n 
1 362 GLU n 
1 363 LYS n 
1 364 LEU n 
1 365 ASN n 
1 366 VAL n 
1 367 PHE n 
1 368 ARG n 
1 369 THR n 
1 370 VAL n 
1 371 ARG n 
1 372 GLU n 
1 373 ILE n 
1 374 THR n 
1 375 GLY n 
1 376 PHE n 
1 377 LEU n 
1 378 ASN n 
1 379 ILE n 
1 380 GLN n 
1 381 SER n 
1 382 TRP n 
1 383 PRO n 
1 384 PRO n 
1 385 ASN n 
1 386 MET n 
1 387 THR n 
1 388 ASP n 
1 389 PHE n 
1 390 SER n 
1 391 VAL n 
1 392 PHE n 
1 393 SER n 
1 394 ASN n 
1 395 LEU n 
1 396 VAL n 
1 397 THR n 
1 398 ILE n 
1 399 GLY n 
1 400 GLY n 
1 401 ARG n 
1 402 VAL n 
1 403 LEU n 
1 404 TYR n 
1 405 SER n 
1 406 GLY n 
1 407 LEU n 
1 408 SER n 
1 409 LEU n 
1 410 LEU n 
1 411 ILE n 
1 412 LEU n 
1 413 LYS n 
1 414 GLN n 
1 415 GLN n 
1 416 GLY n 
1 417 ILE n 
1 418 THR n 
1 419 SER n 
1 420 LEU n 
1 421 GLN n 
1 422 PHE n 
1 423 GLN n 
1 424 SER n 
1 425 LEU n 
1 426 LYS n 
1 427 GLU n 
1 428 ILE n 
1 429 SER n 
1 430 ALA n 
1 431 GLY n 
1 432 ASN n 
1 433 ILE n 
1 434 TYR n 
1 435 ILE n 
1 436 THR n 
1 437 ASP n 
1 438 ASN n 
1 439 SER n 
1 440 ASN n 
1 441 LEU n 
1 442 CYS n 
1 443 TYR n 
1 444 TYR n 
1 445 HIS n 
1 446 THR n 
1 447 ILE n 
1 448 ASN n 
1 449 TRP n 
1 450 THR n 
1 451 THR n 
1 452 LEU n 
1 453 PHE n 
1 454 SER n 
1 455 THR n 
1 456 ILE n 
1 457 ASN n 
1 458 GLN n 
1 459 ARG n 
1 460 ILE n 
1 461 VAL n 
1 462 ILE n 
1 463 ARG n 
1 464 ASP n 
1 465 ASN n 
1 466 ARG n 
1 467 LYS n 
1 468 ALA n 
1 469 GLU n 
1 470 ASN n 
1 471 CYS n 
1 472 THR n 
1 473 ALA n 
1 474 GLU n 
1 475 GLY n 
1 476 MET n 
1 477 VAL n 
1 478 CYS n 
1 479 ASN n 
1 480 HIS n 
1 481 LEU n 
1 482 CYS n 
1 483 SER n 
1 484 SER n 
1 485 ASP n 
1 486 GLY n 
1 487 CYS n 
1 488 TRP n 
1 489 GLY n 
1 490 PRO n 
1 491 GLY n 
1 492 PRO n 
1 493 ASP n 
1 494 GLN n 
1 495 CYS n 
1 496 LEU n 
1 497 SER n 
1 498 CYS n 
1 499 ARG n 
1 500 ARG n 
1 501 PHE n 
1 502 SER n 
1 503 ARG n 
1 504 GLY n 
1 505 ARG n 
1 506 ILE n 
1 507 CYS n 
1 508 ILE n 
1 509 GLU n 
1 510 SER n 
1 511 CYS n 
1 512 ASN n 
1 513 LEU n 
1 514 TYR n 
1 515 ASP n 
1 516 GLY n 
1 517 GLU n 
1 518 PHE n 
1 519 ARG n 
1 520 GLU n 
1 521 PHE n 
1 522 GLU n 
1 523 ASN n 
1 524 ASP n 
1 525 SER n 
1 526 ILE n 
1 527 CYS n 
1 528 VAL n 
1 529 GLU n 
1 530 CYS n 
1 531 ASP n 
1 532 PRO n 
1 533 GLN n 
1 534 CYS n 
1 535 GLU n 
1 536 LYS n 
1 537 MET n 
1 538 GLU n 
1 539 ASP n 
1 540 GLY n 
1 541 LEU n 
1 542 LEU n 
1 543 THR n 
1 544 CYS n 
1 545 HIS n 
1 546 GLY n 
1 547 PRO n 
1 548 GLY n 
1 549 PRO n 
1 550 ASP n 
1 551 ASN n 
1 552 CYS n 
1 553 THR n 
1 554 LYS n 
1 555 CYS n 
1 556 SER n 
1 557 HIS n 
1 558 PHE n 
1 559 LYS n 
1 560 ASP n 
1 561 GLY n 
1 562 PRO n 
1 563 ASN n 
1 564 CYS n 
1 565 VAL n 
1 566 GLU n 
1 567 LYS n 
1 568 CYS n 
1 569 PRO n 
1 570 ASP n 
1 571 GLY n 
1 572 LEU n 
1 573 GLN n 
1 574 GLY n 
1 575 ALA n 
1 576 ASN n 
1 577 SER n 
1 578 PHE n 
1 579 ILE n 
1 580 PHE n 
1 581 LYS n 
1 582 TYR n 
1 583 ALA n 
1 584 ASP n 
1 585 PRO n 
1 586 ASP n 
1 587 ARG n 
1 588 GLU n 
1 589 CYS n 
1 590 HIS n 
1 591 PRO n 
1 592 CYS n 
1 593 HIS n 
1 594 PRO n 
1 595 ASN n 
1 596 CYS n 
1 597 THR n 
1 598 GLN n 
1 599 GLY n 
1 600 CYS n 
1 601 ASN n 
1 602 GLY n 
1 603 PRO n 
1 604 THR n 
1 605 SER n 
1 606 HIS n 
1 607 ASP n 
1 608 CYS n 
1 609 ILE n 
1 610 TYR n 
1 611 TYR n 
1 612 PRO n 
1 613 TRP n 
1 614 THR n 
1 615 GLY n 
2 1   GLY n 
2 2   THR n 
2 3   SER n 
2 4   HIS n 
2 5   LEU n 
2 6   VAL n 
2 7   LYS n 
2 8   CYS n 
2 9   ALA n 
2 10  GLU n 
2 11  LYS n 
2 12  GLU n 
2 13  LYS n 
2 14  THR n 
2 15  PHE n 
2 16  CYS n 
2 17  VAL n 
2 18  ASN n 
2 19  GLY n 
2 20  GLY n 
2 21  GLU n 
2 22  CYS n 
2 23  PHE n 
2 24  MET n 
2 25  VAL n 
2 26  LYS n 
2 27  ASP n 
2 28  LEU n 
2 29  SER n 
2 30  ASN n 
2 31  PRO n 
2 32  SER n 
2 33  ARG n 
2 34  TYR n 
2 35  LEU n 
2 36  CYS n 
2 37  LYS n 
2 38  CYS n 
2 39  PRO n 
2 40  ASN n 
2 41  GLU n 
2 42  PHE n 
2 43  THR n 
2 44  GLY n 
2 45  ASP n 
2 46  ARG n 
2 47  CYS n 
2 48  GLN n 
2 49  ASN n 
2 50  TYR n 
2 51  VAL n 
2 52  MET n 
2 53  ALA n 
2 54  SER n 
2 55  PHE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'ERBB4, HER4' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Cricetulus griseus' 10029 ? ? ? ? ? ? 
'Lec 3.2.8.1' ? ? ? ? ? ? ? ?       ? ? ? pSGHV0 ? ? 
2 1 sample ? ? ? human ? NRG1          ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli'   562   ? ? ? ? ? ? ? ? 
? ? ? ? ? ? plasmid ? ? ? pET32  ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ERBB4_HUMAN  Q15303 1 
;QSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRII
RGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSG
CGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQT
FVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSA
QTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGG
RVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNH
LCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKD
GPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTG
;
26  ? 
2 UNP Q96IB3_HUMAN Q96IB3 2 GTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASF 230 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3U7U A 1 ? 615 ? Q15303 26  ? 640 ? 1 615 
2  1 3U7U B 1 ? 615 ? Q15303 26  ? 640 ? 1 615 
3  1 3U7U C 1 ? 615 ? Q15303 26  ? 640 ? 1 615 
4  1 3U7U D 1 ? 615 ? Q15303 26  ? 640 ? 1 615 
5  1 3U7U E 1 ? 615 ? Q15303 26  ? 640 ? 1 615 
6  1 3U7U F 1 ? 615 ? Q15303 26  ? 640 ? 1 615 
7  2 3U7U G 1 ? 55  ? Q96IB3 230 ? 284 ? 1 55  
8  2 3U7U H 1 ? 55  ? Q96IB3 230 ? 284 ? 1 55  
9  2 3U7U I 1 ? 55  ? Q96IB3 230 ? 284 ? 1 55  
10 2 3U7U J 1 ? 55  ? Q96IB3 230 ? 284 ? 1 55  
11 2 3U7U K 1 ? 55  ? Q96IB3 230 ? 284 ? 1 55  
12 2 3U7U L 1 ? 55  ? Q96IB3 230 ? 284 ? 1 55  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3U7U ASP A 524 ? UNP Q15303 GLY 549 conflict 524 1 
2 3U7U ASP B 524 ? UNP Q15303 GLY 549 conflict 524 2 
3 3U7U ASP C 524 ? UNP Q15303 GLY 549 conflict 524 3 
4 3U7U ASP D 524 ? UNP Q15303 GLY 549 conflict 524 4 
5 3U7U ASP E 524 ? UNP Q15303 GLY 549 conflict 524 5 
6 3U7U ASP F 524 ? UNP Q15303 GLY 549 conflict 524 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3U7U 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.09 
_exptl_crystal.density_percent_sol   60.14 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'PEG6000, Mg(OAc)2, MES pH6.0, Hampton Silver Bullet, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-08-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98011 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-D 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98011 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3U7U 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            3.030 
_reflns.number_obs                   104051 
_reflns.number_all                   104051 
_reflns.percent_possible_obs         98.900 
_reflns.pdbx_Rmerge_I_obs            0.116 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.800 
_reflns.B_iso_Wilson_estimate        93.35 
_reflns.pdbx_redundancy              3.700 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
1 1  3.030 3.080  87.000  0.685 ? ? 2.700 ? ? ? ? ? ? 
1 2  3.080 3.140  94.400  0.634 ? ? 3.000 ? ? ? ? ? ? 
1 3  3.140 3.200  98.000  0.554 ? ? 3.400 ? ? ? ? ? ? 
1 4  3.200 3.260  99.500  0.510 ? ? 3.600 ? ? ? ? ? ? 
1 5  3.260 3.330  99.900  0.441 ? ? 3.800 ? ? ? ? ? ? 
1 6  3.330 3.410  99.800  0.365 ? ? 3.800 ? ? ? ? ? ? 
1 7  3.410 3.500  99.800  0.326 ? ? 3.800 ? ? ? ? ? ? 
1 8  3.500 3.590  99.900  0.236 ? ? 3.900 ? ? ? ? ? ? 
1 9  3.590 3.700  99.900  0.216 ? ? 3.800 ? ? ? ? ? ? 
1 10 3.700 3.820  99.900  0.167 ? ? 3.900 ? ? ? ? ? ? 
1 11 3.820 3.950  99.900  0.155 ? ? 3.800 ? ? ? ? ? ? 
1 12 3.950 4.110  99.900  0.119 ? ? 3.900 ? ? ? ? ? ? 
1 13 4.110 4.300  100.000 0.103 ? ? 3.900 ? ? ? ? ? ? 
1 14 4.300 4.530  100.000 0.087 ? ? 3.900 ? ? ? ? ? ? 
1 15 4.530 4.810  100.000 0.076 ? ? 3.900 ? ? ? ? ? ? 
1 16 4.810 5.180  100.000 0.073 ? ? 3.900 ? ? ? ? ? ? 
1 17 5.180 5.700  99.900  0.078 ? ? 3.900 ? ? ? ? ? ? 
1 18 5.700 6.520  100.000 0.080 ? ? 3.900 ? ? ? ? ? ? 
1 19 6.520 8.210  100.000 0.066 ? ? 3.900 ? ? ? ? ? ? 
1 20 8.210 50.000 99.100  0.069 ? ? 3.800 ? ? ? ? ? ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3U7U 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     103996 
_refine.ls_number_reflns_all                     103996 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.63 
_refine.ls_d_res_high                            3.03 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1914 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1895 
_refine.ls_R_factor_R_free                       0.2272 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  5198 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            1.000 
_refine.occupancy_max                            1.000 
_refine.correlation_coeff_Fo_to_Fc               0.9316 
_refine.correlation_coeff_Fo_to_Fc_free          0.9044 
_refine.B_iso_mean                               91.00 
_refine.aniso_B[1][1]                            4.2937 
_refine.aniso_B[2][2]                            7.8176 
_refine.aniso_B[3][3]                            -12.1114 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -3.5897 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTREIS 1MOX AND 2AHX' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3U7U 
_refine_analyze.Luzzati_coordinate_error_obs    0.544 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        29872 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         364 
_refine_hist.number_atoms_solvent             291 
_refine_hist.number_atoms_total               30527 
_refine_hist.d_res_high                       3.03 
_refine_hist.d_res_low                        49.63 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010  ? 2.00  31022 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.26   ? 2.00  42091 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?      ? 2.00  10587 'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?      ? ?     ?     'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?      ? ?     ?     'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?      ? 2.00  872   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?      ? 5.00  4525  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?      ? 20.00 31022 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?      ? ?     ?     'X-RAY DIFFRACTION' ?            
t_omega_torsion           3.130  ? ?     ?     'X-RAY DIFFRACTION' ?            
t_other_torsion           19.870 ? ?     ?     'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?      ? ?     ?     'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?      ? 5.000 4174  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?      ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_distance        ?      ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_angle           ?      ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?      ? ?     ?     'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?      ? 4.000 33541 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.03 
_refine_ls_shell.d_res_low                        3.11 
_refine_ls_shell.number_reflns_R_work             6316 
_refine_ls_shell.R_factor_R_work                  0.2609 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3040 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.64 
_refine_ls_shell.number_reflns_R_free             307 
_refine_ls_shell.number_reflns_all                6623 
_refine_ls_shell.R_factor_all                     0.2629 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3U7U 
_struct.title                     
'Crystal structure of extracellular region of human epidermal growth factor receptor 4 in complex with neuregulin-1 beta' 
_struct.pdbx_descriptor           'Receptor tyrosine-protein kinase erbB-4 (E.C.2.7.10.1), Neuregulin 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3U7U 
_struct_keywords.text            'signaling protein, TRANSFERASE-TRANSFERASE REGULATOR COMPLEX, Glycosylation' 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE REGULATOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 3 ? 
JA N N 3 ? 
KA N N 3 ? 
LA N N 3 ? 
MA N N 4 ? 
NA N N 4 ? 
OA N N 4 ? 
PA N N 4 ? 
QA N N 4 ? 
RA N N 4 ? 
SA N N 4 ? 
TA N N 4 ? 
UA N N 4 ? 
VA N N 4 ? 
WA N N 4 ? 
XA N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 16  ? GLU A 29  ? ASP A 16  GLU A 29  1 ? 14 
HELX_P HELX_P2  2  LEU A 49  ? VAL A 55  ? LEU A 49  VAL A 55  5 ? 7  
HELX_P HELX_P3  3  LEU A 85  ? ASP A 88  ? LEU A 85  ASP A 88  5 ? 4  
HELX_P HELX_P4  4  TYR A 132 ? ILE A 136 ? TYR A 132 ILE A 136 5 ? 5  
HELX_P HELX_P5  5  HIS A 137 ? VAL A 142 ? HIS A 137 VAL A 142 1 ? 6  
HELX_P HELX_P6  6  HIS A 165 ? THR A 169 ? HIS A 165 THR A 169 5 ? 5  
HELX_P HELX_P7  7  TYR A 200 ? CYS A 204 ? TYR A 200 CYS A 204 5 ? 5  
HELX_P HELX_P8  8  THR A 314 ? MET A 318 ? THR A 314 MET A 318 5 ? 5  
HELX_P HELX_P9  9  ASN A 327 ? ILE A 332 ? ASN A 327 ILE A 332 5 ? 6  
HELX_P HELX_P10 10 LEU A 344 ? HIS A 349 ? LEU A 344 HIS A 349 1 ? 6  
HELX_P HELX_P11 11 ASP A 351 ? ALA A 355 ? ASP A 351 ALA A 355 5 ? 5  
HELX_P HELX_P12 12 ASP A 360 ? VAL A 370 ? ASP A 360 VAL A 370 5 ? 11 
HELX_P HELX_P13 13 PHE A 389 ? SER A 393 ? PHE A 389 SER A 393 5 ? 5  
HELX_P HELX_P14 14 TYR A 443 ? ILE A 447 ? TYR A 443 ILE A 447 5 ? 5  
HELX_P HELX_P15 15 ASN A 448 ? PHE A 453 ? ASN A 448 PHE A 453 5 ? 6  
HELX_P HELX_P16 16 LYS A 467 ? GLU A 474 ? LYS A 467 GLU A 474 1 ? 8  
HELX_P HELX_P17 17 ASP B 16  ? GLU B 29  ? ASP B 16  GLU B 29  1 ? 14 
HELX_P HELX_P18 18 LEU B 49  ? VAL B 55  ? LEU B 49  VAL B 55  5 ? 7  
HELX_P HELX_P19 19 LEU B 85  ? ASP B 88  ? LEU B 85  ASP B 88  5 ? 4  
HELX_P HELX_P20 20 TYR B 132 ? ILE B 136 ? TYR B 132 ILE B 136 5 ? 5  
HELX_P HELX_P21 21 HIS B 137 ? VAL B 142 ? HIS B 137 VAL B 142 1 ? 6  
HELX_P HELX_P22 22 HIS B 165 ? THR B 169 ? HIS B 165 THR B 169 5 ? 5  
HELX_P HELX_P23 23 TYR B 200 ? CYS B 204 ? TYR B 200 CYS B 204 5 ? 5  
HELX_P HELX_P24 24 THR B 314 ? MET B 318 ? THR B 314 MET B 318 5 ? 5  
HELX_P HELX_P25 25 ASN B 327 ? ILE B 332 ? ASN B 327 ILE B 332 5 ? 6  
HELX_P HELX_P26 26 LEU B 344 ? HIS B 349 ? LEU B 344 HIS B 349 1 ? 6  
HELX_P HELX_P27 27 ASP B 351 ? ALA B 355 ? ASP B 351 ALA B 355 5 ? 5  
HELX_P HELX_P28 28 ASP B 360 ? VAL B 370 ? ASP B 360 VAL B 370 5 ? 11 
HELX_P HELX_P29 29 PHE B 389 ? SER B 393 ? PHE B 389 SER B 393 5 ? 5  
HELX_P HELX_P30 30 ASN B 448 ? PHE B 453 ? ASN B 448 PHE B 453 5 ? 6  
HELX_P HELX_P31 31 LYS B 467 ? GLU B 474 ? LYS B 467 GLU B 474 1 ? 8  
HELX_P HELX_P32 32 GLY B 491 ? CYS B 495 ? GLY B 491 CYS B 495 5 ? 5  
HELX_P HELX_P33 33 ASP C 16  ? GLU C 29  ? ASP C 16  GLU C 29  1 ? 14 
HELX_P HELX_P34 34 LEU C 49  ? VAL C 55  ? LEU C 49  VAL C 55  5 ? 7  
HELX_P HELX_P35 35 LEU C 85  ? ASP C 88  ? LEU C 85  ASP C 88  5 ? 4  
HELX_P HELX_P36 36 HIS C 137 ? VAL C 142 ? HIS C 137 VAL C 142 1 ? 6  
HELX_P HELX_P37 37 HIS C 165 ? THR C 169 ? HIS C 165 THR C 169 5 ? 5  
HELX_P HELX_P38 38 TYR C 200 ? CYS C 204 ? TYR C 200 CYS C 204 5 ? 5  
HELX_P HELX_P39 39 THR C 314 ? MET C 318 ? THR C 314 MET C 318 5 ? 5  
HELX_P HELX_P40 40 ASN C 327 ? ILE C 332 ? ASN C 327 ILE C 332 5 ? 6  
HELX_P HELX_P41 41 LEU C 344 ? HIS C 349 ? LEU C 344 HIS C 349 1 ? 6  
HELX_P HELX_P42 42 ASP C 351 ? ALA C 355 ? ASP C 351 ALA C 355 5 ? 5  
HELX_P HELX_P43 43 ASP C 360 ? VAL C 370 ? ASP C 360 VAL C 370 5 ? 11 
HELX_P HELX_P44 44 PHE C 389 ? SER C 393 ? PHE C 389 SER C 393 5 ? 5  
HELX_P HELX_P45 45 TYR C 443 ? ILE C 447 ? TYR C 443 ILE C 447 5 ? 5  
HELX_P HELX_P46 46 ASN C 448 ? PHE C 453 ? ASN C 448 PHE C 453 5 ? 6  
HELX_P HELX_P47 47 LYS C 467 ? GLU C 474 ? LYS C 467 GLU C 474 1 ? 8  
HELX_P HELX_P48 48 ASP D 16  ? GLU D 29  ? ASP D 16  GLU D 29  1 ? 14 
HELX_P HELX_P49 49 LEU D 49  ? VAL D 55  ? LEU D 49  VAL D 55  5 ? 7  
HELX_P HELX_P50 50 LEU D 85  ? ASP D 88  ? LEU D 85  ASP D 88  5 ? 4  
HELX_P HELX_P51 51 TYR D 132 ? ILE D 136 ? TYR D 132 ILE D 136 5 ? 5  
HELX_P HELX_P52 52 HIS D 137 ? VAL D 142 ? HIS D 137 VAL D 142 1 ? 6  
HELX_P HELX_P53 53 HIS D 165 ? THR D 169 ? HIS D 165 THR D 169 5 ? 5  
HELX_P HELX_P54 54 TYR D 200 ? CYS D 204 ? TYR D 200 CYS D 204 5 ? 5  
HELX_P HELX_P55 55 THR D 314 ? MET D 318 ? THR D 314 MET D 318 5 ? 5  
HELX_P HELX_P56 56 ASN D 327 ? ILE D 332 ? ASN D 327 ILE D 332 5 ? 6  
HELX_P HELX_P57 57 LEU D 344 ? HIS D 349 ? LEU D 344 HIS D 349 1 ? 6  
HELX_P HELX_P58 58 ASP D 351 ? ALA D 355 ? ASP D 351 ALA D 355 5 ? 5  
HELX_P HELX_P59 59 ASP D 360 ? VAL D 370 ? ASP D 360 VAL D 370 5 ? 11 
HELX_P HELX_P60 60 PHE D 389 ? SER D 393 ? PHE D 389 SER D 393 5 ? 5  
HELX_P HELX_P61 61 ASN D 448 ? PHE D 453 ? ASN D 448 PHE D 453 5 ? 6  
HELX_P HELX_P62 62 LYS D 467 ? GLU D 474 ? LYS D 467 GLU D 474 1 ? 8  
HELX_P HELX_P63 63 GLY D 548 ? CYS D 552 ? GLY D 548 CYS D 552 5 ? 5  
HELX_P HELX_P64 64 ASP E 16  ? GLU E 29  ? ASP E 16  GLU E 29  1 ? 14 
HELX_P HELX_P65 65 LEU E 49  ? VAL E 55  ? LEU E 49  VAL E 55  5 ? 7  
HELX_P HELX_P66 66 LEU E 85  ? ASP E 88  ? LEU E 85  ASP E 88  5 ? 4  
HELX_P HELX_P67 67 TYR E 132 ? ILE E 136 ? TYR E 132 ILE E 136 5 ? 5  
HELX_P HELX_P68 68 HIS E 137 ? VAL E 142 ? HIS E 137 VAL E 142 1 ? 6  
HELX_P HELX_P69 69 HIS E 165 ? THR E 169 ? HIS E 165 THR E 169 5 ? 5  
HELX_P HELX_P70 70 TYR E 200 ? CYS E 204 ? TYR E 200 CYS E 204 5 ? 5  
HELX_P HELX_P71 71 THR E 314 ? MET E 318 ? THR E 314 MET E 318 5 ? 5  
HELX_P HELX_P72 72 ASN E 327 ? ILE E 332 ? ASN E 327 ILE E 332 5 ? 6  
HELX_P HELX_P73 73 LEU E 344 ? HIS E 349 ? LEU E 344 HIS E 349 1 ? 6  
HELX_P HELX_P74 74 ASP E 351 ? ALA E 355 ? ASP E 351 ALA E 355 5 ? 5  
HELX_P HELX_P75 75 ASP E 360 ? VAL E 370 ? ASP E 360 VAL E 370 5 ? 11 
HELX_P HELX_P76 76 PHE E 389 ? SER E 393 ? PHE E 389 SER E 393 5 ? 5  
HELX_P HELX_P77 77 ASN E 448 ? LEU E 452 ? ASN E 448 LEU E 452 5 ? 5  
HELX_P HELX_P78 78 LYS E 467 ? GLU E 474 ? LYS E 467 GLU E 474 1 ? 8  
HELX_P HELX_P79 79 ASP F 16  ? GLU F 29  ? ASP F 16  GLU F 29  1 ? 14 
HELX_P HELX_P80 80 LEU F 49  ? VAL F 55  ? LEU F 49  VAL F 55  5 ? 7  
HELX_P HELX_P81 81 LEU F 85  ? ASP F 88  ? LEU F 85  ASP F 88  5 ? 4  
HELX_P HELX_P82 82 TYR F 132 ? ILE F 136 ? TYR F 132 ILE F 136 5 ? 5  
HELX_P HELX_P83 83 HIS F 137 ? VAL F 142 ? HIS F 137 VAL F 142 1 ? 6  
HELX_P HELX_P84 84 HIS F 165 ? THR F 169 ? HIS F 165 THR F 169 5 ? 5  
HELX_P HELX_P85 85 TYR F 200 ? CYS F 204 ? TYR F 200 CYS F 204 5 ? 5  
HELX_P HELX_P86 86 THR F 314 ? MET F 318 ? THR F 314 MET F 318 5 ? 5  
HELX_P HELX_P87 87 ASN F 327 ? ILE F 332 ? ASN F 327 ILE F 332 5 ? 6  
HELX_P HELX_P88 88 LEU F 344 ? HIS F 349 ? LEU F 344 HIS F 349 1 ? 6  
HELX_P HELX_P89 89 ASP F 351 ? ALA F 355 ? ASP F 351 ALA F 355 5 ? 5  
HELX_P HELX_P90 90 ASP F 360 ? VAL F 370 ? ASP F 360 VAL F 370 5 ? 11 
HELX_P HELX_P91 91 PHE F 389 ? SER F 393 ? PHE F 389 SER F 393 5 ? 5  
HELX_P HELX_P92 92 TYR F 443 ? ILE F 447 ? TYR F 443 ILE F 447 5 ? 5  
HELX_P HELX_P93 93 ASN F 448 ? PHE F 453 ? ASN F 448 PHE F 453 5 ? 6  
HELX_P HELX_P94 94 LYS F 467 ? GLU F 474 ? LYS F 467 GLU F 474 1 ? 8  
HELX_P HELX_P95 95 GLY F 548 ? CYS F 552 ? GLY F 548 CYS F 552 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1   disulf ?   ? A CYS 4   SG  ? ? ? 1_555 A  CYS 31  SG ? ? A CYS 4   A CYS 31   1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf2   disulf ?   ? A CYS 131 SG  ? ? ? 1_555 A  CYS 161 SG ? ? A CYS 131 A CYS 161  1_555 ? ? ? ? ? ? ? 2.055 ? ? 
disulf3   disulf ?   ? A CYS 164 SG  ? ? ? 1_555 A  CYS 172 SG ? ? A CYS 164 A CYS 172  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf4   disulf ?   ? A CYS 168 SG  ? ? ? 1_555 A  CYS 180 SG ? ? A CYS 168 A CYS 180  1_555 ? ? ? ? ? ? ? 2.053 ? ? 
disulf5   disulf ?   ? A CYS 188 SG  ? ? ? 1_555 A  CYS 196 SG ? ? A CYS 188 A CYS 196  1_555 ? ? ? ? ? ? ? 2.052 ? ? 
disulf6   disulf ?   ? A CYS 192 SG  ? ? ? 1_555 A  CYS 204 SG ? ? A CYS 192 A CYS 204  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf7   disulf ?   ? A CYS 205 SG  ? ? ? 1_555 A  CYS 213 SG ? ? A CYS 205 A CYS 213  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf8   disulf ?   ? A CYS 209 SG  ? ? ? 1_555 A  CYS 221 SG ? ? A CYS 209 A CYS 221  1_555 ? ? ? ? ? ? ? 2.049 ? ? 
disulf9   disulf ?   ? A CYS 224 SG  ? ? ? 1_555 A  CYS 233 SG ? ? A CYS 224 A CYS 233  1_555 ? ? ? ? ? ? ? 2.046 ? ? 
disulf10  disulf ?   ? A CYS 237 SG  ? ? ? 1_555 A  CYS 264 SG ? ? A CYS 237 A CYS 264  1_555 ? ? ? ? ? ? ? 2.051 ? ? 
disulf11  disulf ?   ? A CYS 268 SG  ? ? ? 1_555 A  CYS 279 SG ? ? A CYS 268 A CYS 279  1_555 ? ? ? ? ? ? ? 2.049 ? ? 
disulf12  disulf ?   ? A CYS 283 SG  ? ? ? 1_555 A  CYS 298 SG ? ? A CYS 283 A CYS 298  1_555 ? ? ? ? ? ? ? 2.058 ? ? 
disulf13  disulf ?   ? A CYS 301 SG  ? ? ? 1_555 A  CYS 305 SG ? ? A CYS 301 A CYS 305  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf14  disulf ?   ? A CYS 309 SG  ? ? ? 1_555 A  CYS 334 SG ? ? A CYS 309 A CYS 334  1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf15  disulf ?   ? A CYS 442 SG  ? ? ? 1_555 A  CYS 471 SG ? ? A CYS 442 A CYS 471  1_555 ? ? ? ? ? ? ? 2.059 ? ? 
disulf16  disulf ?   ? A CYS 478 SG  ? ? ? 1_555 A  CYS 487 SG ? ? A CYS 478 A CYS 487  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf17  disulf ?   ? A CYS 482 SG  ? ? ? 1_555 A  CYS 495 SG ? ? A CYS 482 A CYS 495  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf18  disulf ?   ? A CYS 498 SG  ? ? ? 1_555 A  CYS 507 SG ? ? A CYS 498 A CYS 507  1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf19  disulf ?   ? A CYS 511 SG  ? ? ? 1_555 A  CYS 527 SG ? ? A CYS 511 A CYS 527  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf20  disulf ?   ? A CYS 530 SG  ? ? ? 1_555 A  CYS 544 SG ? ? A CYS 530 A CYS 544  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf21  disulf ?   ? A CYS 534 SG  ? ? ? 1_555 A  CYS 552 SG ? ? A CYS 534 A CYS 552  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf22  disulf ?   ? B CYS 4   SG  ? ? ? 1_555 B  CYS 31  SG ? ? B CYS 4   B CYS 31   1_555 ? ? ? ? ? ? ? 2.054 ? ? 
disulf23  disulf ?   ? B CYS 131 SG  ? ? ? 1_555 B  CYS 161 SG ? ? B CYS 131 B CYS 161  1_555 ? ? ? ? ? ? ? 2.056 ? ? 
disulf24  disulf ?   ? B CYS 164 SG  ? ? ? 1_555 B  CYS 172 SG ? ? B CYS 164 B CYS 172  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf25  disulf ?   ? B CYS 168 SG  ? ? ? 1_555 B  CYS 180 SG ? ? B CYS 168 B CYS 180  1_555 ? ? ? ? ? ? ? 2.065 ? ? 
disulf26  disulf ?   ? B CYS 188 SG  ? ? ? 1_555 B  CYS 196 SG ? ? B CYS 188 B CYS 196  1_555 ? ? ? ? ? ? ? 2.055 ? ? 
disulf27  disulf ?   ? B CYS 192 SG  ? ? ? 1_555 B  CYS 204 SG ? ? B CYS 192 B CYS 204  1_555 ? ? ? ? ? ? ? 2.048 ? ? 
disulf28  disulf ?   ? B CYS 205 SG  ? ? ? 1_555 B  CYS 213 SG ? ? B CYS 205 B CYS 213  1_555 ? ? ? ? ? ? ? 2.047 ? ? 
disulf29  disulf ?   ? B CYS 209 SG  ? ? ? 1_555 B  CYS 221 SG ? ? B CYS 209 B CYS 221  1_555 ? ? ? ? ? ? ? 2.021 ? ? 
disulf30  disulf ?   ? B CYS 224 SG  ? ? ? 1_555 B  CYS 233 SG ? ? B CYS 224 B CYS 233  1_555 ? ? ? ? ? ? ? 2.053 ? ? 
disulf31  disulf ?   ? B CYS 237 SG  ? ? ? 1_555 B  CYS 264 SG ? ? B CYS 237 B CYS 264  1_555 ? ? ? ? ? ? ? 2.053 ? ? 
disulf32  disulf ?   ? B CYS 268 SG  ? ? ? 1_555 B  CYS 279 SG ? ? B CYS 268 B CYS 279  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf33  disulf ?   ? B CYS 283 SG  ? ? ? 1_555 B  CYS 298 SG ? ? B CYS 283 B CYS 298  1_555 ? ? ? ? ? ? ? 2.060 ? ? 
disulf34  disulf ?   ? B CYS 301 SG  ? ? ? 1_555 B  CYS 305 SG ? ? B CYS 301 B CYS 305  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf35  disulf ?   ? B CYS 309 SG  ? ? ? 1_555 B  CYS 334 SG ? ? B CYS 309 B CYS 334  1_555 ? ? ? ? ? ? ? 2.025 ? ? 
disulf36  disulf ?   ? B CYS 442 SG  ? ? ? 1_555 B  CYS 471 SG ? ? B CYS 442 B CYS 471  1_555 ? ? ? ? ? ? ? 2.059 ? ? 
disulf37  disulf ?   ? B CYS 478 SG  ? ? ? 1_555 B  CYS 487 SG ? ? B CYS 478 B CYS 487  1_555 ? ? ? ? ? ? ? 2.064 ? ? 
disulf38  disulf ?   ? B CYS 482 SG  ? ? ? 1_555 B  CYS 495 SG ? ? B CYS 482 B CYS 495  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf39  disulf ?   ? B CYS 498 SG  ? ? ? 1_555 B  CYS 507 SG ? ? B CYS 498 B CYS 507  1_555 ? ? ? ? ? ? ? 2.050 ? ? 
disulf40  disulf ?   ? B CYS 511 SG  ? ? ? 1_555 B  CYS 527 SG ? ? B CYS 511 B CYS 527  1_555 ? ? ? ? ? ? ? 2.064 ? ? 
disulf41  disulf ?   ? B CYS 530 SG  ? ? ? 1_555 B  CYS 544 SG ? ? B CYS 530 B CYS 544  1_555 ? ? ? ? ? ? ? 2.054 ? ? 
disulf42  disulf ?   ? B CYS 534 SG  ? ? ? 1_555 B  CYS 552 SG ? ? B CYS 534 B CYS 552  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf43  disulf ?   ? B CYS 555 SG  ? ? ? 1_555 B  CYS 564 SG ? ? B CYS 555 B CYS 564  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf44  disulf ?   ? B CYS 568 SG  ? ? ? 1_555 B  CYS 589 SG ? ? B CYS 568 B CYS 589  1_555 ? ? ? ? ? ? ? 2.058 ? ? 
disulf45  disulf ?   ? B CYS 592 SG  ? ? ? 1_555 B  CYS 600 SG ? ? B CYS 592 B CYS 600  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf46  disulf ?   ? B CYS 596 SG  ? ? ? 1_555 B  CYS 608 SG ? ? B CYS 596 B CYS 608  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf47  disulf ?   ? C CYS 4   SG  ? ? ? 1_555 C  CYS 31  SG ? ? C CYS 4   C CYS 31   1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf48  disulf ?   ? C CYS 131 SG  ? ? ? 1_555 C  CYS 161 SG ? ? C CYS 131 C CYS 161  1_555 ? ? ? ? ? ? ? 2.051 ? ? 
disulf49  disulf ?   ? C CYS 164 SG  ? ? ? 1_555 C  CYS 172 SG ? ? C CYS 164 C CYS 172  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf50  disulf ?   ? C CYS 168 SG  ? ? ? 1_555 C  CYS 180 SG ? ? C CYS 168 C CYS 180  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf51  disulf ?   ? C CYS 188 SG  ? ? ? 1_555 C  CYS 196 SG ? ? C CYS 188 C CYS 196  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf52  disulf ?   ? C CYS 192 SG  ? ? ? 1_555 C  CYS 204 SG ? ? C CYS 192 C CYS 204  1_555 ? ? ? ? ? ? ? 2.027 ? ? 
disulf53  disulf ?   ? C CYS 205 SG  ? ? ? 1_555 C  CYS 213 SG ? ? C CYS 205 C CYS 213  1_555 ? ? ? ? ? ? ? 2.025 ? ? 
disulf54  disulf ?   ? C CYS 209 SG  ? ? ? 1_555 C  CYS 221 SG ? ? C CYS 209 C CYS 221  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf55  disulf ?   ? C CYS 224 SG  ? ? ? 1_555 C  CYS 233 SG ? ? C CYS 224 C CYS 233  1_555 ? ? ? ? ? ? ? 2.046 ? ? 
disulf56  disulf ?   ? C CYS 237 SG  ? ? ? 1_555 C  CYS 264 SG ? ? C CYS 237 C CYS 264  1_555 ? ? ? ? ? ? ? 2.057 ? ? 
disulf57  disulf ?   ? C CYS 268 SG  ? ? ? 1_555 C  CYS 279 SG ? ? C CYS 268 C CYS 279  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf58  disulf ?   ? C CYS 283 SG  ? ? ? 1_555 C  CYS 298 SG ? ? C CYS 283 C CYS 298  1_555 ? ? ? ? ? ? ? 2.051 ? ? 
disulf59  disulf ?   ? C CYS 301 SG  ? ? ? 1_555 C  CYS 305 SG ? ? C CYS 301 C CYS 305  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf60  disulf ?   ? C CYS 309 SG  ? ? ? 1_555 C  CYS 334 SG ? ? C CYS 309 C CYS 334  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf61  disulf ?   ? C CYS 442 SG  ? ? ? 1_555 C  CYS 471 SG ? ? C CYS 442 C CYS 471  1_555 ? ? ? ? ? ? ? 2.051 ? ? 
disulf62  disulf ?   ? C CYS 478 SG  ? ? ? 1_555 C  CYS 487 SG ? ? C CYS 478 C CYS 487  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf63  disulf ?   ? C CYS 482 SG  ? ? ? 1_555 C  CYS 495 SG ? ? C CYS 482 C CYS 495  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf64  disulf ?   ? C CYS 498 SG  ? ? ? 1_555 C  CYS 507 SG ? ? C CYS 498 C CYS 507  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf65  disulf ?   ? C CYS 511 SG  ? ? ? 1_555 C  CYS 527 SG ? ? C CYS 511 C CYS 527  1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf66  disulf ?   ? C CYS 530 SG  ? ? ? 1_555 C  CYS 544 SG ? ? C CYS 530 C CYS 544  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf67  disulf ?   ? C CYS 534 SG  ? ? ? 1_555 C  CYS 552 SG ? ? C CYS 534 C CYS 552  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf68  disulf ?   ? C CYS 555 SG  ? ? ? 1_555 C  CYS 564 SG ? ? C CYS 555 C CYS 564  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf69  disulf ?   ? C CYS 568 SG  ? ? ? 1_555 C  CYS 589 SG ? ? C CYS 568 C CYS 589  1_555 ? ? ? ? ? ? ? 2.049 ? ? 
disulf70  disulf ?   ? C CYS 592 SG  ? ? ? 1_555 C  CYS 600 SG ? ? C CYS 592 C CYS 600  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf71  disulf ?   ? C CYS 596 SG  ? ? ? 1_555 C  CYS 608 SG ? ? C CYS 596 C CYS 608  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf72  disulf ?   ? D CYS 4   SG  ? ? ? 1_555 D  CYS 31  SG ? ? D CYS 4   D CYS 31   1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf73  disulf ?   ? D CYS 131 SG  ? ? ? 1_555 D  CYS 161 SG ? ? D CYS 131 D CYS 161  1_555 ? ? ? ? ? ? ? 2.046 ? ? 
disulf74  disulf ?   ? D CYS 164 SG  ? ? ? 1_555 D  CYS 172 SG ? ? D CYS 164 D CYS 172  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf75  disulf ?   ? D CYS 168 SG  ? ? ? 1_555 D  CYS 180 SG ? ? D CYS 168 D CYS 180  1_555 ? ? ? ? ? ? ? 2.053 ? ? 
disulf76  disulf ?   ? D CYS 188 SG  ? ? ? 1_555 D  CYS 196 SG ? ? D CYS 188 D CYS 196  1_555 ? ? ? ? ? ? ? 2.057 ? ? 
disulf77  disulf ?   ? D CYS 192 SG  ? ? ? 1_555 D  CYS 204 SG ? ? D CYS 192 D CYS 204  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf78  disulf ?   ? D CYS 205 SG  ? ? ? 1_555 D  CYS 213 SG ? ? D CYS 205 D CYS 213  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf79  disulf ?   ? D CYS 209 SG  ? ? ? 1_555 D  CYS 221 SG ? ? D CYS 209 D CYS 221  1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf80  disulf ?   ? D CYS 224 SG  ? ? ? 1_555 D  CYS 233 SG ? ? D CYS 224 D CYS 233  1_555 ? ? ? ? ? ? ? 2.046 ? ? 
disulf81  disulf ?   ? D CYS 237 SG  ? ? ? 1_555 D  CYS 264 SG ? ? D CYS 237 D CYS 264  1_555 ? ? ? ? ? ? ? 2.065 ? ? 
disulf82  disulf ?   ? D CYS 268 SG  ? ? ? 1_555 D  CYS 279 SG ? ? D CYS 268 D CYS 279  1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf83  disulf ?   ? D CYS 283 SG  ? ? ? 1_555 D  CYS 298 SG ? ? D CYS 283 D CYS 298  1_555 ? ? ? ? ? ? ? 2.064 ? ? 
disulf84  disulf ?   ? D CYS 301 SG  ? ? ? 1_555 D  CYS 305 SG ? ? D CYS 301 D CYS 305  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf85  disulf ?   ? D CYS 309 SG  ? ? ? 1_555 D  CYS 334 SG ? ? D CYS 309 D CYS 334  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf86  disulf ?   ? D CYS 442 SG  ? ? ? 1_555 D  CYS 471 SG ? ? D CYS 442 D CYS 471  1_555 ? ? ? ? ? ? ? 2.049 ? ? 
disulf87  disulf ?   ? D CYS 478 SG  ? ? ? 1_555 D  CYS 487 SG ? ? D CYS 478 D CYS 487  1_555 ? ? ? ? ? ? ? 2.047 ? ? 
disulf88  disulf ?   ? D CYS 482 SG  ? ? ? 1_555 D  CYS 495 SG ? ? D CYS 482 D CYS 495  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf89  disulf ?   ? D CYS 498 SG  ? ? ? 1_555 D  CYS 507 SG ? ? D CYS 498 D CYS 507  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf90  disulf ?   ? D CYS 511 SG  ? ? ? 1_555 D  CYS 527 SG ? ? D CYS 511 D CYS 527  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf91  disulf ?   ? D CYS 530 SG  ? ? ? 1_555 D  CYS 544 SG ? ? D CYS 530 D CYS 544  1_555 ? ? ? ? ? ? ? 2.048 ? ? 
disulf92  disulf ?   ? D CYS 534 SG  ? ? ? 1_555 D  CYS 552 SG ? ? D CYS 534 D CYS 552  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf93  disulf ?   ? D CYS 555 SG  ? ? ? 1_555 D  CYS 564 SG ? ? D CYS 555 D CYS 564  1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf94  disulf ?   ? D CYS 568 SG  ? ? ? 1_555 D  CYS 589 SG ? ? D CYS 568 D CYS 589  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf95  disulf ?   ? D CYS 592 SG  ? ? ? 1_555 D  CYS 600 SG ? ? D CYS 592 D CYS 600  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf96  disulf ?   ? D CYS 596 SG  ? ? ? 1_555 D  CYS 608 SG ? ? D CYS 596 D CYS 608  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf97  disulf ?   ? E CYS 4   SG  ? ? ? 1_555 E  CYS 31  SG ? ? E CYS 4   E CYS 31   1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf98  disulf ?   ? E CYS 131 SG  ? ? ? 1_555 E  CYS 161 SG ? ? E CYS 131 E CYS 161  1_555 ? ? ? ? ? ? ? 2.048 ? ? 
disulf99  disulf ?   ? E CYS 164 SG  ? ? ? 1_555 E  CYS 172 SG ? ? E CYS 164 E CYS 172  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf100 disulf ?   ? E CYS 168 SG  ? ? ? 1_555 E  CYS 180 SG ? ? E CYS 168 E CYS 180  1_555 ? ? ? ? ? ? ? 2.046 ? ? 
disulf101 disulf ?   ? E CYS 188 SG  ? ? ? 1_555 E  CYS 196 SG ? ? E CYS 188 E CYS 196  1_555 ? ? ? ? ? ? ? 2.054 ? ? 
disulf102 disulf ?   ? E CYS 192 SG  ? ? ? 1_555 E  CYS 204 SG ? ? E CYS 192 E CYS 204  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf103 disulf ?   ? E CYS 205 SG  ? ? ? 1_555 E  CYS 213 SG ? ? E CYS 205 E CYS 213  1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf104 disulf ?   ? E CYS 209 SG  ? ? ? 1_555 E  CYS 221 SG ? ? E CYS 209 E CYS 221  1_555 ? ? ? ? ? ? ? 2.019 ? ? 
disulf105 disulf ?   ? E CYS 224 SG  ? ? ? 1_555 E  CYS 233 SG ? ? E CYS 224 E CYS 233  1_555 ? ? ? ? ? ? ? 2.056 ? ? 
disulf106 disulf ?   ? E CYS 237 SG  ? ? ? 1_555 E  CYS 264 SG ? ? E CYS 237 E CYS 264  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf107 disulf ?   ? E CYS 268 SG  ? ? ? 1_555 E  CYS 279 SG ? ? E CYS 268 E CYS 279  1_555 ? ? ? ? ? ? ? 2.050 ? ? 
disulf108 disulf ?   ? E CYS 283 SG  ? ? ? 1_555 E  CYS 298 SG ? ? E CYS 283 E CYS 298  1_555 ? ? ? ? ? ? ? 2.060 ? ? 
disulf109 disulf ?   ? E CYS 301 SG  ? ? ? 1_555 E  CYS 305 SG ? ? E CYS 301 E CYS 305  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf110 disulf ?   ? E CYS 309 SG  ? ? ? 1_555 E  CYS 334 SG ? ? E CYS 309 E CYS 334  1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf111 disulf ?   ? E CYS 442 SG  ? ? ? 1_555 E  CYS 471 SG ? ? E CYS 442 E CYS 471  1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf112 disulf ?   ? E CYS 478 SG  ? ? ? 1_555 E  CYS 487 SG ? ? E CYS 478 E CYS 487  1_555 ? ? ? ? ? ? ? 2.048 ? ? 
disulf113 disulf ?   ? E CYS 482 SG  ? ? ? 1_555 E  CYS 495 SG ? ? E CYS 482 E CYS 495  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf114 disulf ?   ? E CYS 498 SG  ? ? ? 1_555 E  CYS 507 SG ? ? E CYS 498 E CYS 507  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf115 disulf ?   ? E CYS 511 SG  ? ? ? 1_555 E  CYS 527 SG ? ? E CYS 511 E CYS 527  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf116 disulf ?   ? E CYS 530 SG  ? ? ? 1_555 E  CYS 544 SG ? ? E CYS 530 E CYS 544  1_555 ? ? ? ? ? ? ? 2.047 ? ? 
disulf117 disulf ?   ? E CYS 534 SG  ? ? ? 1_555 E  CYS 552 SG ? ? E CYS 534 E CYS 552  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf118 disulf ?   ? E CYS 555 SG  ? ? ? 1_555 E  CYS 564 SG ? ? E CYS 555 E CYS 564  1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf119 disulf ?   ? E CYS 568 SG  ? ? ? 1_555 E  CYS 589 SG ? ? E CYS 568 E CYS 589  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf120 disulf ?   ? E CYS 592 SG  ? ? ? 1_555 E  CYS 600 SG ? ? E CYS 592 E CYS 600  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf121 disulf ?   ? E CYS 596 SG  ? ? ? 1_555 E  CYS 608 SG ? ? E CYS 596 E CYS 608  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf122 disulf ?   ? F CYS 4   SG  ? ? ? 1_555 F  CYS 31  SG ? ? F CYS 4   F CYS 31   1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf123 disulf ?   ? F CYS 131 SG  ? ? ? 1_555 F  CYS 161 SG ? ? F CYS 131 F CYS 161  1_555 ? ? ? ? ? ? ? 2.057 ? ? 
disulf124 disulf ?   ? F CYS 164 SG  ? ? ? 1_555 F  CYS 172 SG ? ? F CYS 164 F CYS 172  1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf125 disulf ?   ? F CYS 168 SG  ? ? ? 1_555 F  CYS 180 SG ? ? F CYS 168 F CYS 180  1_555 ? ? ? ? ? ? ? 2.051 ? ? 
disulf126 disulf ?   ? F CYS 188 SG  ? ? ? 1_555 F  CYS 196 SG ? ? F CYS 188 F CYS 196  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf127 disulf ?   ? F CYS 192 SG  ? ? ? 1_555 F  CYS 204 SG ? ? F CYS 192 F CYS 204  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf128 disulf ?   ? F CYS 205 SG  ? ? ? 1_555 F  CYS 213 SG ? ? F CYS 205 F CYS 213  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf129 disulf ?   ? F CYS 209 SG  ? ? ? 1_555 F  CYS 221 SG ? ? F CYS 209 F CYS 221  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf130 disulf ?   ? F CYS 224 SG  ? ? ? 1_555 F  CYS 233 SG ? ? F CYS 224 F CYS 233  1_555 ? ? ? ? ? ? ? 2.061 ? ? 
disulf131 disulf ?   ? F CYS 237 SG  ? ? ? 1_555 F  CYS 264 SG ? ? F CYS 237 F CYS 264  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf132 disulf ?   ? F CYS 268 SG  ? ? ? 1_555 F  CYS 279 SG ? ? F CYS 268 F CYS 279  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf133 disulf ?   ? F CYS 283 SG  ? ? ? 1_555 F  CYS 298 SG ? ? F CYS 283 F CYS 298  1_555 ? ? ? ? ? ? ? 2.053 ? ? 
disulf134 disulf ?   ? F CYS 301 SG  ? ? ? 1_555 F  CYS 305 SG ? ? F CYS 301 F CYS 305  1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf135 disulf ?   ? F CYS 309 SG  ? ? ? 1_555 F  CYS 334 SG ? ? F CYS 309 F CYS 334  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf136 disulf ?   ? F CYS 442 SG  ? ? ? 1_555 F  CYS 471 SG ? ? F CYS 442 F CYS 471  1_555 ? ? ? ? ? ? ? 2.067 ? ? 
disulf137 disulf ?   ? F CYS 478 SG  ? ? ? 1_555 F  CYS 487 SG ? ? F CYS 478 F CYS 487  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf138 disulf ?   ? F CYS 482 SG  ? ? ? 1_555 F  CYS 495 SG ? ? F CYS 482 F CYS 495  1_555 ? ? ? ? ? ? ? 2.047 ? ? 
disulf139 disulf ?   ? F CYS 498 SG  ? ? ? 1_555 F  CYS 507 SG ? ? F CYS 498 F CYS 507  1_555 ? ? ? ? ? ? ? 2.049 ? ? 
disulf140 disulf ?   ? F CYS 511 SG  ? ? ? 1_555 F  CYS 527 SG ? ? F CYS 511 F CYS 527  1_555 ? ? ? ? ? ? ? 2.057 ? ? 
disulf141 disulf ?   ? F CYS 530 SG  ? ? ? 1_555 F  CYS 544 SG ? ? F CYS 530 F CYS 544  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf142 disulf ?   ? F CYS 534 SG  ? ? ? 1_555 F  CYS 552 SG ? ? F CYS 534 F CYS 552  1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf143 disulf ?   ? F CYS 555 SG  ? ? ? 1_555 F  CYS 564 SG ? ? F CYS 555 F CYS 564  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf144 disulf ?   ? F CYS 568 SG  ? ? ? 1_555 F  CYS 589 SG ? ? F CYS 568 F CYS 589  1_555 ? ? ? ? ? ? ? 2.046 ? ? 
disulf145 disulf ?   ? F CYS 592 SG  ? ? ? 1_555 F  CYS 600 SG ? ? F CYS 592 F CYS 600  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf146 disulf ?   ? F CYS 596 SG  ? ? ? 1_555 F  CYS 608 SG ? ? F CYS 596 F CYS 608  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf147 disulf ?   ? G CYS 8   SG  ? ? ? 1_555 G  CYS 22  SG ? ? G CYS 8   G CYS 22   1_555 ? ? ? ? ? ? ? 2.053 ? ? 
disulf148 disulf ?   ? G CYS 16  SG  ? ? ? 1_555 G  CYS 36  SG ? ? G CYS 16  G CYS 36   1_555 ? ? ? ? ? ? ? 2.049 ? ? 
disulf149 disulf ?   ? G CYS 38  SG  ? ? ? 1_555 G  CYS 47  SG ? ? G CYS 38  G CYS 47   1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf150 disulf ?   ? H CYS 8   SG  ? ? ? 1_555 H  CYS 22  SG ? ? H CYS 8   H CYS 22   1_555 ? ? ? ? ? ? ? 2.067 ? ? 
disulf151 disulf ?   ? H CYS 16  SG  ? ? ? 1_555 H  CYS 36  SG ? ? H CYS 16  H CYS 36   1_555 ? ? ? ? ? ? ? 2.041 ? ? 
disulf152 disulf ?   ? H CYS 38  SG  ? ? ? 1_555 H  CYS 47  SG ? ? H CYS 38  H CYS 47   1_555 ? ? ? ? ? ? ? 2.054 ? ? 
disulf153 disulf ?   ? I CYS 8   SG  ? ? ? 1_555 I  CYS 22  SG ? ? I CYS 8   I CYS 22   1_555 ? ? ? ? ? ? ? 2.054 ? ? 
disulf154 disulf ?   ? I CYS 16  SG  ? ? ? 1_555 I  CYS 36  SG ? ? I CYS 16  I CYS 36   1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf155 disulf ?   ? I CYS 38  SG  ? ? ? 1_555 I  CYS 47  SG ? ? I CYS 38  I CYS 47   1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf156 disulf ?   ? J CYS 8   SG  ? ? ? 1_555 J  CYS 22  SG ? ? J CYS 8   J CYS 22   1_555 ? ? ? ? ? ? ? 2.058 ? ? 
disulf157 disulf ?   ? J CYS 16  SG  ? ? ? 1_555 J  CYS 36  SG ? ? J CYS 16  J CYS 36   1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf158 disulf ?   ? J CYS 38  SG  ? ? ? 1_555 J  CYS 47  SG ? ? J CYS 38  J CYS 47   1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf159 disulf ?   ? K CYS 8   SG  ? ? ? 1_555 K  CYS 22  SG ? ? K CYS 8   K CYS 22   1_555 ? ? ? ? ? ? ? 2.048 ? ? 
disulf160 disulf ?   ? K CYS 16  SG  ? ? ? 1_555 K  CYS 36  SG ? ? K CYS 16  K CYS 36   1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf161 disulf ?   ? K CYS 38  SG  ? ? ? 1_555 K  CYS 47  SG ? ? K CYS 38  K CYS 47   1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf162 disulf ?   ? L CYS 8   SG  ? ? ? 1_555 L  CYS 22  SG ? ? L CYS 8   L CYS 22   1_555 ? ? ? ? ? ? ? 2.058 ? ? 
disulf163 disulf ?   ? L CYS 16  SG  ? ? ? 1_555 L  CYS 36  SG ? ? L CYS 16  L CYS 36   1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf164 disulf ?   ? L CYS 38  SG  ? ? ? 1_555 L  CYS 47  SG ? ? L CYS 38  L CYS 47   1_555 ? ? ? ? ? ? ? 2.062 ? ? 
covale1   covale one ? A ASN 113 ND2 ? ? ? 1_555 M  NAG .   C1 ? ? A ASN 113 A NAG 1001 1_555 ? ? ? ? ? ? ? 1.437 ? 
N-Glycosylation 
covale2   covale one ? A ASN 228 ND2 ? ? ? 1_555 N  NAG .   C1 ? ? A ASN 228 A NAG 1002 1_555 ? ? ? ? ? ? ? 1.466 ? 
N-Glycosylation 
covale3   covale one ? A ASN 333 ND2 ? ? ? 1_555 O  NAG .   C1 ? ? A ASN 333 A NAG 1003 1_555 ? ? ? ? ? ? ? 1.475 ? 
N-Glycosylation 
covale4   covale one ? A ASN 448 ND2 ? ? ? 1_555 P  NAG .   C1 ? ? A ASN 448 A NAG 1004 1_555 ? ? ? ? ? ? ? 1.459 ? 
N-Glycosylation 
covale5   covale one ? B ASN 113 ND2 ? ? ? 1_555 Q  NAG .   C1 ? ? B ASN 113 B NAG 1001 1_555 ? ? ? ? ? ? ? 1.437 ? 
N-Glycosylation 
covale6   covale one ? B ASN 228 ND2 ? ? ? 1_555 R  NAG .   C1 ? ? B ASN 228 B NAG 1002 1_555 ? ? ? ? ? ? ? 1.477 ? 
N-Glycosylation 
covale7   covale one ? B ASN 385 ND2 ? ? ? 1_555 S  NAG .   C1 ? ? B ASN 385 B NAG 1003 1_555 ? ? ? ? ? ? ? 1.450 ? 
N-Glycosylation 
covale8   covale one ? B ASN 448 ND2 ? ? ? 1_555 T  NAG .   C1 ? ? B ASN 448 B NAG 1004 1_555 ? ? ? ? ? ? ? 1.451 ? 
N-Glycosylation 
covale9   covale one ? B ASN 470 ND2 ? ? ? 1_555 U  NAG .   C1 ? ? B ASN 470 B NAG 1005 1_555 ? ? ? ? ? ? ? 1.487 ? 
N-Glycosylation 
covale10  covale one ? B ASN 523 ND2 ? ? ? 1_555 V  NAG .   C1 ? ? B ASN 523 B NAG 1006 1_555 ? ? ? ? ? ? ? 1.446 ? 
N-Glycosylation 
covale11  covale one ? C ASN 113 ND2 ? ? ? 1_555 W  NAG .   C1 ? ? C ASN 113 C NAG 1001 1_555 ? ? ? ? ? ? ? 1.467 ? 
N-Glycosylation 
covale12  covale one ? C ASN 228 ND2 ? ? ? 1_555 X  NAG .   C1 ? ? C ASN 228 C NAG 1002 1_555 ? ? ? ? ? ? ? 1.469 ? 
N-Glycosylation 
covale13  covale one ? D ASN 113 ND2 ? ? ? 1_555 Y  NAG .   C1 ? ? D ASN 113 D NAG 1001 1_555 ? ? ? ? ? ? ? 1.439 ? 
N-Glycosylation 
covale14  covale one ? D ASN 228 ND2 ? ? ? 1_555 Z  NAG .   C1 ? ? D ASN 228 D NAG 1002 1_555 ? ? ? ? ? ? ? 1.441 ? 
N-Glycosylation 
covale15  covale one ? D ASN 333 ND2 ? ? ? 1_555 AA NAG .   C1 ? ? D ASN 333 D NAG 1003 1_555 ? ? ? ? ? ? ? 1.470 ? 
N-Glycosylation 
covale16  covale one ? D ASN 385 ND2 ? ? ? 1_555 BA NAG .   C1 ? ? D ASN 385 D NAG 1004 1_555 ? ? ? ? ? ? ? 1.419 ? 
N-Glycosylation 
covale17  covale one ? D ASN 448 ND2 ? ? ? 1_555 CA NAG .   C1 ? ? D ASN 448 D NAG 1005 1_555 ? ? ? ? ? ? ? 1.440 ? 
N-Glycosylation 
covale18  covale one ? E ASN 113 ND2 ? ? ? 1_555 DA NAG .   C1 ? ? E ASN 113 E NAG 1001 1_555 ? ? ? ? ? ? ? 1.463 ? 
N-Glycosylation 
covale19  covale one ? E ASN 228 ND2 ? ? ? 1_555 EA NAG .   C1 ? ? E ASN 228 E NAG 1002 1_555 ? ? ? ? ? ? ? 1.488 ? 
N-Glycosylation 
covale20  covale one ? E ASN 448 ND2 ? ? ? 1_555 FA NAG .   C1 ? ? E ASN 448 E NAG 1003 1_555 ? ? ? ? ? ? ? 1.497 ? 
N-Glycosylation 
covale21  covale one ? F ASN 113 ND2 ? ? ? 1_555 GA NAG .   C1 ? ? F ASN 113 F NAG 1001 1_555 ? ? ? ? ? ? ? 1.450 ? 
N-Glycosylation 
covale22  covale one ? F ASN 228 ND2 ? ? ? 1_555 HA NAG .   C1 ? ? F ASN 228 F NAG 1002 1_555 ? ? ? ? ? ? ? 1.498 ? 
N-Glycosylation 
covale23  covale one ? F ASN 333 ND2 ? ? ? 1_555 IA NAG .   C1 ? ? F ASN 333 F NAG 1003 1_555 ? ? ? ? ? ? ? 1.494 ? 
N-Glycosylation 
covale24  covale one ? F ASN 448 ND2 ? ? ? 1_555 JA NAG .   C1 ? ? F ASN 448 F NAG 1004 1_555 ? ? ? ? ? ? ? 1.498 ? 
N-Glycosylation 
covale25  covale one ? F ASN 470 ND2 ? ? ? 1_555 KA NAG .   C1 ? ? F ASN 470 F NAG 1005 1_555 ? ? ? ? ? ? ? 1.431 ? 
N-Glycosylation 
covale26  covale one ? F ASN 523 ND2 ? ? ? 1_555 LA NAG .   C1 ? ? F ASN 523 F NAG 1006 1_555 ? ? ? ? ? ? ? 1.490 ? 
N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 5 ? 
B  ? 4 ? 
C  ? 5 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 2 ? 
G  ? 2 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 5 ? 
L  ? 5 ? 
M  ? 2 ? 
N  ? 2 ? 
O  ? 5 ? 
P  ? 4 ? 
Q  ? 5 ? 
R  ? 2 ? 
S  ? 2 ? 
T  ? 2 ? 
U  ? 2 ? 
V  ? 2 ? 
W  ? 2 ? 
X  ? 2 ? 
Y  ? 5 ? 
Z  ? 5 ? 
AA ? 2 ? 
AB ? 2 ? 
AC ? 2 ? 
AD ? 2 ? 
AE ? 5 ? 
AF ? 4 ? 
AG ? 5 ? 
AH ? 2 ? 
AI ? 2 ? 
AJ ? 2 ? 
AK ? 2 ? 
AL ? 2 ? 
AM ? 2 ? 
AN ? 2 ? 
AO ? 5 ? 
AP ? 5 ? 
AQ ? 2 ? 
AR ? 2 ? 
AS ? 2 ? 
AT ? 2 ? 
AU ? 5 ? 
AV ? 4 ? 
AW ? 5 ? 
AX ? 2 ? 
AY ? 2 ? 
AZ ? 2 ? 
BA ? 2 ? 
BB ? 2 ? 
BC ? 2 ? 
BD ? 2 ? 
BE ? 5 ? 
BF ? 5 ? 
BG ? 2 ? 
BH ? 2 ? 
BI ? 2 ? 
BJ ? 2 ? 
BK ? 5 ? 
BL ? 4 ? 
BM ? 5 ? 
BN ? 2 ? 
BO ? 2 ? 
BP ? 2 ? 
BQ ? 2 ? 
BR ? 2 ? 
BS ? 2 ? 
BT ? 2 ? 
BU ? 5 ? 
BV ? 5 ? 
BW ? 2 ? 
BX ? 2 ? 
BY ? 2 ? 
BZ ? 2 ? 
CA ? 5 ? 
CB ? 4 ? 
CC ? 5 ? 
CD ? 2 ? 
CE ? 2 ? 
CF ? 2 ? 
CG ? 2 ? 
CH ? 2 ? 
CI ? 4 ? 
CJ ? 5 ? 
CK ? 5 ? 
CL ? 2 ? 
CM ? 2 ? 
CN ? 2 ? 
CO ? 2 ? 
CP ? 2 ? 
CQ ? 2 ? 
CR ? 2 ? 
CS ? 2 ? 
CT ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? parallel      
A  2 3 ? parallel      
A  3 4 ? parallel      
A  4 5 ? parallel      
B  1 2 ? parallel      
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? parallel      
C  2 3 ? parallel      
C  3 4 ? parallel      
C  4 5 ? parallel      
D  1 2 ? parallel      
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? parallel      
K  2 3 ? parallel      
K  3 4 ? parallel      
K  4 5 ? parallel      
L  1 2 ? parallel      
L  2 3 ? parallel      
L  3 4 ? parallel      
L  4 5 ? parallel      
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
O  1 2 ? parallel      
O  2 3 ? parallel      
O  3 4 ? parallel      
O  4 5 ? parallel      
P  1 2 ? parallel      
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
Q  1 2 ? parallel      
Q  2 3 ? parallel      
Q  3 4 ? parallel      
Q  4 5 ? parallel      
R  1 2 ? parallel      
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
Y  1 2 ? parallel      
Y  2 3 ? parallel      
Y  3 4 ? parallel      
Y  4 5 ? parallel      
Z  1 2 ? parallel      
Z  2 3 ? parallel      
Z  3 4 ? parallel      
Z  4 5 ? parallel      
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? parallel      
AE 2 3 ? parallel      
AE 3 4 ? parallel      
AE 4 5 ? parallel      
AF 1 2 ? parallel      
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AG 1 2 ? parallel      
AG 2 3 ? parallel      
AG 3 4 ? parallel      
AG 4 5 ? parallel      
AH 1 2 ? parallel      
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AO 1 2 ? parallel      
AO 2 3 ? parallel      
AO 3 4 ? parallel      
AO 4 5 ? parallel      
AP 1 2 ? parallel      
AP 2 3 ? parallel      
AP 3 4 ? parallel      
AP 4 5 ? parallel      
AQ 1 2 ? anti-parallel 
AR 1 2 ? anti-parallel 
AS 1 2 ? anti-parallel 
AT 1 2 ? anti-parallel 
AU 1 2 ? parallel      
AU 2 3 ? parallel      
AU 3 4 ? parallel      
AU 4 5 ? parallel      
AV 1 2 ? parallel      
AV 2 3 ? anti-parallel 
AV 3 4 ? anti-parallel 
AW 1 2 ? parallel      
AW 2 3 ? parallel      
AW 3 4 ? parallel      
AW 4 5 ? parallel      
AX 1 2 ? parallel      
AY 1 2 ? anti-parallel 
AZ 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BD 1 2 ? anti-parallel 
BE 1 2 ? parallel      
BE 2 3 ? parallel      
BE 3 4 ? parallel      
BE 4 5 ? parallel      
BF 1 2 ? parallel      
BF 2 3 ? parallel      
BF 3 4 ? parallel      
BF 4 5 ? parallel      
BG 1 2 ? anti-parallel 
BH 1 2 ? anti-parallel 
BI 1 2 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BK 1 2 ? parallel      
BK 2 3 ? parallel      
BK 3 4 ? parallel      
BK 4 5 ? parallel      
BL 1 2 ? parallel      
BL 2 3 ? anti-parallel 
BL 3 4 ? anti-parallel 
BM 1 2 ? parallel      
BM 2 3 ? parallel      
BM 3 4 ? parallel      
BM 4 5 ? parallel      
BN 1 2 ? parallel      
BO 1 2 ? anti-parallel 
BP 1 2 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BR 1 2 ? anti-parallel 
BS 1 2 ? anti-parallel 
BT 1 2 ? anti-parallel 
BU 1 2 ? parallel      
BU 2 3 ? parallel      
BU 3 4 ? parallel      
BU 4 5 ? parallel      
BV 1 2 ? parallel      
BV 2 3 ? parallel      
BV 3 4 ? parallel      
BV 4 5 ? parallel      
BW 1 2 ? anti-parallel 
BX 1 2 ? anti-parallel 
BY 1 2 ? anti-parallel 
BZ 1 2 ? anti-parallel 
CA 1 2 ? parallel      
CA 2 3 ? parallel      
CA 3 4 ? parallel      
CA 4 5 ? parallel      
CB 1 2 ? parallel      
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CC 1 2 ? parallel      
CC 2 3 ? parallel      
CC 3 4 ? parallel      
CC 4 5 ? parallel      
CD 1 2 ? parallel      
CE 1 2 ? anti-parallel 
CF 1 2 ? anti-parallel 
CG 1 2 ? anti-parallel 
CH 1 2 ? anti-parallel 
CI 1 2 ? anti-parallel 
CI 2 3 ? parallel      
CI 3 4 ? anti-parallel 
CJ 1 2 ? parallel      
CJ 2 3 ? parallel      
CJ 3 4 ? parallel      
CJ 4 5 ? parallel      
CK 1 2 ? parallel      
CK 2 3 ? parallel      
CK 3 4 ? parallel      
CK 4 5 ? parallel      
CL 1 2 ? anti-parallel 
CM 1 2 ? anti-parallel 
CN 1 2 ? anti-parallel 
CO 1 2 ? anti-parallel 
CP 1 2 ? anti-parallel 
CQ 1 2 ? anti-parallel 
CR 1 2 ? anti-parallel 
CS 1 2 ? anti-parallel 
CT 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 3   ? CYS A 4   ? VAL A 3   CYS A 4   
A  2 VAL A 33  ? VAL A 34  ? VAL A 33  VAL A 34  
A  3 GLU A 57  ? VAL A 58  ? GLU A 57  VAL A 58  
A  4 ILE A 79  ? ILE A 80  ? ILE A 79  ILE A 80  
A  5 GLU A 116 ? ILE A 117 ? GLU A 116 ILE A 117 
B  1 SER A 13  ? LEU A 14  ? SER A 13  LEU A 14  
B  2 TYR G 34  ? CYS G 38  ? TYR G 34  CYS G 38  
B  3 GLU G 21  ? VAL G 25  ? GLU G 21  VAL G 25  
B  4 LEU G 5   ? LYS G 7   ? LEU G 5   LYS G 7   
C  1 LEU A 38  ? THR A 41  ? LEU A 38  THR A 41  
C  2 VAL A 62  ? ALA A 65  ? VAL A 62  ALA A 65  
C  3 TYR A 90  ? PHE A 95  ? TYR A 90  PHE A 95  
C  4 GLY A 121 ? ASP A 125 ? GLY A 121 ASP A 125 
C  5 THR A 151 ? SER A 154 ? THR A 151 SER A 154 
D  1 TYR A 71  ? LEU A 72  ? TYR A 71  LEU A 72  
D  2 GLU A 108 ? LEU A 109 ? GLU A 108 LEU A 109 
E  1 CYS A 209 ? CYS A 213 ? CYS A 209 CYS A 213 
E  2 CYS A 221 ? CYS A 224 ? CYS A 221 CYS A 224 
F  1 PHE A 227 ? ASP A 229 ? PHE A 227 ASP A 229 
F  2 ALA A 232 ? VAL A 234 ? ALA A 232 VAL A 234 
G  1 PHE A 241 ? ASN A 244 ? PHE A 241 ASN A 244 
G  2 GLN A 249 ? HIS A 252 ? GLN A 249 HIS A 252 
H  1 TYR A 258 ? TYR A 260 ? TYR A 258 TYR A 260 
H  2 PHE A 263 ? VAL A 265 ? PHE A 263 VAL A 265 
I  1 VAL A 273 ? ASP A 275 ? VAL A 273 ASP A 275 
I  2 SER A 278 ? VAL A 280 ? SER A 278 VAL A 280 
J  1 LYS A 287 ? GLU A 292 ? LYS A 287 GLU A 292 
J  2 ILE A 295 ? PRO A 300 ? ILE A 295 PRO A 300 
K  1 ALA A 308 ? ASP A 310 ? ALA A 308 ASP A 310 
K  2 LYS A 336 ? ASN A 338 ? LYS A 336 ASN A 338 
K  3 GLU A 372 ? ILE A 373 ? GLU A 372 ILE A 373 
K  4 THR A 397 ? ILE A 398 ? THR A 397 ILE A 398 
K  5 GLU A 427 ? ILE A 428 ? GLU A 427 ILE A 428 
L  1 LEU A 341 ? PHE A 343 ? LEU A 341 PHE A 343 
L  2 LEU A 377 ? ILE A 379 ? LEU A 377 ILE A 379 
L  3 LEU A 407 ? LEU A 412 ? LEU A 407 LEU A 412 
L  4 ASN A 432 ? THR A 436 ? ASN A 432 THR A 436 
L  5 ILE A 460 ? ARG A 463 ? ILE A 460 ARG A 463 
M  1 PHE A 501 ? ARG A 503 ? PHE A 501 ARG A 503 
M  2 ILE A 506 ? ILE A 508 ? ILE A 506 ILE A 508 
N  1 GLU A 520 ? GLU A 522 ? GLU A 520 GLU A 522 
N  2 CYS A 527 ? GLU A 529 ? CYS A 527 GLU A 529 
O  1 VAL B 3   ? CYS B 4   ? VAL B 3   CYS B 4   
O  2 VAL B 33  ? VAL B 34  ? VAL B 33  VAL B 34  
O  3 GLU B 57  ? VAL B 58  ? GLU B 57  VAL B 58  
O  4 ILE B 79  ? ILE B 80  ? ILE B 79  ILE B 80  
O  5 GLU B 116 ? ILE B 117 ? GLU B 116 ILE B 117 
P  1 SER B 13  ? LEU B 14  ? SER B 13  LEU B 14  
P  2 ARG H 33  ? CYS H 38  ? ARG H 33  CYS H 38  
P  3 GLU H 21  ? VAL H 25  ? GLU H 21  VAL H 25  
P  4 LEU H 5   ? LYS H 7   ? LEU H 5   LYS H 7   
Q  1 LEU B 38  ? THR B 41  ? LEU B 38  THR B 41  
Q  2 VAL B 62  ? ALA B 65  ? VAL B 62  ALA B 65  
Q  3 TYR B 90  ? PHE B 95  ? TYR B 90  PHE B 95  
Q  4 GLY B 121 ? ASP B 125 ? GLY B 121 ASP B 125 
Q  5 THR B 151 ? VAL B 153 ? THR B 151 VAL B 153 
R  1 TYR B 71  ? LEU B 72  ? TYR B 71  LEU B 72  
R  2 GLU B 108 ? LEU B 109 ? GLU B 108 LEU B 109 
S  1 CYS B 209 ? CYS B 213 ? CYS B 209 CYS B 213 
S  2 CYS B 221 ? CYS B 224 ? CYS B 221 CYS B 224 
T  1 PHE B 227 ? ASP B 229 ? PHE B 227 ASP B 229 
T  2 ALA B 232 ? VAL B 234 ? ALA B 232 VAL B 234 
U  1 PHE B 241 ? ASN B 244 ? PHE B 241 ASN B 244 
U  2 GLN B 249 ? HIS B 252 ? GLN B 249 HIS B 252 
V  1 TYR B 258 ? TYR B 260 ? TYR B 258 TYR B 260 
V  2 PHE B 263 ? VAL B 265 ? PHE B 263 VAL B 265 
W  1 VAL B 273 ? ASP B 275 ? VAL B 273 ASP B 275 
W  2 SER B 278 ? VAL B 280 ? SER B 278 VAL B 280 
X  1 LYS B 287 ? GLU B 292 ? LYS B 287 GLU B 292 
X  2 ILE B 295 ? PRO B 300 ? ILE B 295 PRO B 300 
Y  1 ALA B 308 ? ASP B 310 ? ALA B 308 ASP B 310 
Y  2 LYS B 336 ? ASN B 338 ? LYS B 336 ASN B 338 
Y  3 GLU B 372 ? ILE B 373 ? GLU B 372 ILE B 373 
Y  4 THR B 397 ? ILE B 398 ? THR B 397 ILE B 398 
Y  5 GLU B 427 ? ILE B 428 ? GLU B 427 ILE B 428 
Z  1 LEU B 341 ? PHE B 343 ? LEU B 341 PHE B 343 
Z  2 LEU B 377 ? ILE B 379 ? LEU B 377 ILE B 379 
Z  3 LEU B 407 ? LEU B 412 ? LEU B 407 LEU B 412 
Z  4 ASN B 432 ? THR B 436 ? ASN B 432 THR B 436 
Z  5 ILE B 460 ? ARG B 463 ? ILE B 460 ARG B 463 
AA 1 PHE B 501 ? ARG B 503 ? PHE B 501 ARG B 503 
AA 2 ILE B 506 ? ILE B 508 ? ILE B 506 ILE B 508 
AB 1 GLU B 520 ? GLU B 522 ? GLU B 520 GLU B 522 
AB 2 CYS B 527 ? GLU B 529 ? CYS B 527 GLU B 529 
AC 1 PHE B 558 ? ASP B 560 ? PHE B 558 ASP B 560 
AC 2 ASN B 563 ? VAL B 565 ? ASN B 563 VAL B 565 
AD 1 LYS B 581 ? ALA B 583 ? LYS B 581 ALA B 583 
AD 2 CYS B 589 ? PRO B 591 ? CYS B 589 PRO B 591 
AE 1 VAL C 3   ? CYS C 4   ? VAL C 3   CYS C 4   
AE 2 VAL C 33  ? VAL C 34  ? VAL C 33  VAL C 34  
AE 3 GLU C 57  ? VAL C 58  ? GLU C 57  VAL C 58  
AE 4 ILE C 79  ? ILE C 80  ? ILE C 79  ILE C 80  
AE 5 GLU C 116 ? ILE C 117 ? GLU C 116 ILE C 117 
AF 1 SER C 13  ? LEU C 14  ? SER C 13  LEU C 14  
AF 2 ARG I 33  ? CYS I 38  ? ARG I 33  CYS I 38  
AF 3 GLU I 21  ? VAL I 25  ? GLU I 21  VAL I 25  
AF 4 LEU I 5   ? LYS I 7   ? LEU I 5   LYS I 7   
AG 1 LEU C 38  ? THR C 41  ? LEU C 38  THR C 41  
AG 2 VAL C 62  ? ALA C 65  ? VAL C 62  ALA C 65  
AG 3 TYR C 90  ? PHE C 95  ? TYR C 90  PHE C 95  
AG 4 GLY C 121 ? ASP C 125 ? GLY C 121 ASP C 125 
AG 5 THR C 151 ? SER C 154 ? THR C 151 SER C 154 
AH 1 TYR C 71  ? LEU C 72  ? TYR C 71  LEU C 72  
AH 2 GLU C 108 ? LEU C 109 ? GLU C 108 LEU C 109 
AI 1 CYS C 209 ? CYS C 213 ? CYS C 209 CYS C 213 
AI 2 CYS C 221 ? CYS C 224 ? CYS C 221 CYS C 224 
AJ 1 PHE C 227 ? ASP C 229 ? PHE C 227 ASP C 229 
AJ 2 ALA C 232 ? VAL C 234 ? ALA C 232 VAL C 234 
AK 1 PHE C 241 ? ASN C 244 ? PHE C 241 ASN C 244 
AK 2 GLN C 249 ? HIS C 252 ? GLN C 249 HIS C 252 
AL 1 TYR C 258 ? TYR C 260 ? TYR C 258 TYR C 260 
AL 2 PHE C 263 ? VAL C 265 ? PHE C 263 VAL C 265 
AM 1 VAL C 273 ? ASP C 275 ? VAL C 273 ASP C 275 
AM 2 SER C 278 ? VAL C 280 ? SER C 278 VAL C 280 
AN 1 LYS C 287 ? GLU C 292 ? LYS C 287 GLU C 292 
AN 2 ILE C 295 ? PRO C 300 ? ILE C 295 PRO C 300 
AO 1 ALA C 308 ? ASP C 310 ? ALA C 308 ASP C 310 
AO 2 LYS C 336 ? ASN C 338 ? LYS C 336 ASN C 338 
AO 3 GLU C 372 ? ILE C 373 ? GLU C 372 ILE C 373 
AO 4 THR C 397 ? ILE C 398 ? THR C 397 ILE C 398 
AO 5 GLU C 427 ? ILE C 428 ? GLU C 427 ILE C 428 
AP 1 LEU C 341 ? PHE C 343 ? LEU C 341 PHE C 343 
AP 2 LEU C 377 ? ILE C 379 ? LEU C 377 ILE C 379 
AP 3 LEU C 407 ? LEU C 412 ? LEU C 407 LEU C 412 
AP 4 ASN C 432 ? THR C 436 ? ASN C 432 THR C 436 
AP 5 ILE C 460 ? ARG C 463 ? ILE C 460 ARG C 463 
AQ 1 PHE C 501 ? ARG C 503 ? PHE C 501 ARG C 503 
AQ 2 ILE C 506 ? ILE C 508 ? ILE C 506 ILE C 508 
AR 1 GLU C 520 ? ASN C 523 ? GLU C 520 ASN C 523 
AR 2 ILE C 526 ? GLU C 529 ? ILE C 526 GLU C 529 
AS 1 PHE C 558 ? ASP C 560 ? PHE C 558 ASP C 560 
AS 2 ASN C 563 ? VAL C 565 ? ASN C 563 VAL C 565 
AT 1 LYS C 581 ? ALA C 583 ? LYS C 581 ALA C 583 
AT 2 CYS C 589 ? PRO C 591 ? CYS C 589 PRO C 591 
AU 1 VAL D 3   ? CYS D 4   ? VAL D 3   CYS D 4   
AU 2 VAL D 33  ? VAL D 34  ? VAL D 33  VAL D 34  
AU 3 GLU D 57  ? VAL D 58  ? GLU D 57  VAL D 58  
AU 4 ILE D 79  ? ILE D 80  ? ILE D 79  ILE D 80  
AU 5 GLU D 116 ? ILE D 117 ? GLU D 116 ILE D 117 
AV 1 SER D 13  ? LEU D 14  ? SER D 13  LEU D 14  
AV 2 TYR J 34  ? CYS J 38  ? TYR J 34  CYS J 38  
AV 3 GLU J 21  ? VAL J 25  ? GLU J 21  VAL J 25  
AV 4 LEU J 5   ? LYS J 7   ? LEU J 5   LYS J 7   
AW 1 LEU D 38  ? THR D 41  ? LEU D 38  THR D 41  
AW 2 VAL D 62  ? ALA D 65  ? VAL D 62  ALA D 65  
AW 3 TYR D 90  ? PHE D 95  ? TYR D 90  PHE D 95  
AW 4 GLY D 121 ? ASP D 125 ? GLY D 121 ASP D 125 
AW 5 THR D 151 ? SER D 154 ? THR D 151 SER D 154 
AX 1 TYR D 71  ? LEU D 72  ? TYR D 71  LEU D 72  
AX 2 GLU D 108 ? LEU D 109 ? GLU D 108 LEU D 109 
AY 1 CYS D 209 ? CYS D 213 ? CYS D 209 CYS D 213 
AY 2 CYS D 221 ? CYS D 224 ? CYS D 221 CYS D 224 
AZ 1 PHE D 227 ? ASP D 229 ? PHE D 227 ASP D 229 
AZ 2 ALA D 232 ? VAL D 234 ? ALA D 232 VAL D 234 
BA 1 PHE D 241 ? ASN D 244 ? PHE D 241 ASN D 244 
BA 2 GLN D 249 ? HIS D 252 ? GLN D 249 HIS D 252 
BB 1 TYR D 258 ? TYR D 260 ? TYR D 258 TYR D 260 
BB 2 PHE D 263 ? VAL D 265 ? PHE D 263 VAL D 265 
BC 1 VAL D 273 ? ASP D 275 ? VAL D 273 ASP D 275 
BC 2 SER D 278 ? VAL D 280 ? SER D 278 VAL D 280 
BD 1 LYS D 287 ? GLU D 292 ? LYS D 287 GLU D 292 
BD 2 ILE D 295 ? PRO D 300 ? ILE D 295 PRO D 300 
BE 1 ALA D 308 ? ASP D 310 ? ALA D 308 ASP D 310 
BE 2 LYS D 336 ? ASN D 338 ? LYS D 336 ASN D 338 
BE 3 GLU D 372 ? ILE D 373 ? GLU D 372 ILE D 373 
BE 4 THR D 397 ? ILE D 398 ? THR D 397 ILE D 398 
BE 5 GLU D 427 ? ILE D 428 ? GLU D 427 ILE D 428 
BF 1 LEU D 341 ? PHE D 343 ? LEU D 341 PHE D 343 
BF 2 LEU D 377 ? ILE D 379 ? LEU D 377 ILE D 379 
BF 3 LEU D 407 ? LEU D 412 ? LEU D 407 LEU D 412 
BF 4 ASN D 432 ? THR D 436 ? ASN D 432 THR D 436 
BF 5 ILE D 460 ? ARG D 463 ? ILE D 460 ARG D 463 
BG 1 PHE D 501 ? ARG D 503 ? PHE D 501 ARG D 503 
BG 2 ILE D 506 ? ILE D 508 ? ILE D 506 ILE D 508 
BH 1 GLU D 520 ? GLU D 522 ? GLU D 520 GLU D 522 
BH 2 CYS D 527 ? GLU D 529 ? CYS D 527 GLU D 529 
BI 1 PHE D 558 ? ASP D 560 ? PHE D 558 ASP D 560 
BI 2 ASN D 563 ? VAL D 565 ? ASN D 563 VAL D 565 
BJ 1 LYS D 581 ? ALA D 583 ? LYS D 581 ALA D 583 
BJ 2 CYS D 589 ? PRO D 591 ? CYS D 589 PRO D 591 
BK 1 VAL E 3   ? CYS E 4   ? VAL E 3   CYS E 4   
BK 2 VAL E 33  ? VAL E 34  ? VAL E 33  VAL E 34  
BK 3 GLU E 57  ? VAL E 58  ? GLU E 57  VAL E 58  
BK 4 ILE E 79  ? ILE E 80  ? ILE E 79  ILE E 80  
BK 5 GLU E 116 ? ILE E 117 ? GLU E 116 ILE E 117 
BL 1 SER E 13  ? LEU E 14  ? SER E 13  LEU E 14  
BL 2 ARG K 33  ? CYS K 38  ? ARG K 33  CYS K 38  
BL 3 GLU K 21  ? VAL K 25  ? GLU K 21  VAL K 25  
BL 4 LEU K 5   ? LYS K 7   ? LEU K 5   LYS K 7   
BM 1 LEU E 38  ? THR E 41  ? LEU E 38  THR E 41  
BM 2 VAL E 62  ? ALA E 65  ? VAL E 62  ALA E 65  
BM 3 TYR E 90  ? PHE E 95  ? TYR E 90  PHE E 95  
BM 4 GLY E 121 ? ASP E 125 ? GLY E 121 ASP E 125 
BM 5 THR E 151 ? SER E 154 ? THR E 151 SER E 154 
BN 1 TYR E 71  ? LEU E 72  ? TYR E 71  LEU E 72  
BN 2 GLU E 108 ? LEU E 109 ? GLU E 108 LEU E 109 
BO 1 CYS E 209 ? CYS E 213 ? CYS E 209 CYS E 213 
BO 2 CYS E 221 ? CYS E 224 ? CYS E 221 CYS E 224 
BP 1 PHE E 227 ? ASP E 229 ? PHE E 227 ASP E 229 
BP 2 ALA E 232 ? VAL E 234 ? ALA E 232 VAL E 234 
BQ 1 PHE E 241 ? ASN E 244 ? PHE E 241 ASN E 244 
BQ 2 GLN E 249 ? HIS E 252 ? GLN E 249 HIS E 252 
BR 1 TYR E 258 ? TYR E 260 ? TYR E 258 TYR E 260 
BR 2 PHE E 263 ? VAL E 265 ? PHE E 263 VAL E 265 
BS 1 VAL E 273 ? ASP E 275 ? VAL E 273 ASP E 275 
BS 2 SER E 278 ? VAL E 280 ? SER E 278 VAL E 280 
BT 1 LYS E 287 ? GLU E 292 ? LYS E 287 GLU E 292 
BT 2 ILE E 295 ? PRO E 300 ? ILE E 295 PRO E 300 
BU 1 ALA E 308 ? ASP E 310 ? ALA E 308 ASP E 310 
BU 2 LYS E 336 ? ASN E 338 ? LYS E 336 ASN E 338 
BU 3 GLU E 372 ? ILE E 373 ? GLU E 372 ILE E 373 
BU 4 THR E 397 ? ILE E 398 ? THR E 397 ILE E 398 
BU 5 GLU E 427 ? ILE E 428 ? GLU E 427 ILE E 428 
BV 1 LEU E 341 ? PHE E 343 ? LEU E 341 PHE E 343 
BV 2 LEU E 377 ? ILE E 379 ? LEU E 377 ILE E 379 
BV 3 LEU E 407 ? LEU E 412 ? LEU E 407 LEU E 412 
BV 4 ASN E 432 ? THR E 436 ? ASN E 432 THR E 436 
BV 5 ILE E 460 ? ARG E 463 ? ILE E 460 ARG E 463 
BW 1 PHE E 501 ? ARG E 503 ? PHE E 501 ARG E 503 
BW 2 ILE E 506 ? ILE E 508 ? ILE E 506 ILE E 508 
BX 1 GLU E 520 ? GLU E 522 ? GLU E 520 GLU E 522 
BX 2 CYS E 527 ? GLU E 529 ? CYS E 527 GLU E 529 
BY 1 PHE E 558 ? ASP E 560 ? PHE E 558 ASP E 560 
BY 2 ASN E 563 ? VAL E 565 ? ASN E 563 VAL E 565 
BZ 1 LYS E 581 ? ALA E 583 ? LYS E 581 ALA E 583 
BZ 2 CYS E 589 ? PRO E 591 ? CYS E 589 PRO E 591 
CA 1 VAL F 3   ? CYS F 4   ? VAL F 3   CYS F 4   
CA 2 VAL F 33  ? VAL F 34  ? VAL F 33  VAL F 34  
CA 3 GLU F 57  ? VAL F 58  ? GLU F 57  VAL F 58  
CA 4 ILE F 79  ? ILE F 80  ? ILE F 79  ILE F 80  
CA 5 GLU F 116 ? ILE F 117 ? GLU F 116 ILE F 117 
CB 1 SER F 13  ? LEU F 14  ? SER F 13  LEU F 14  
CB 2 ARG L 33  ? CYS L 38  ? ARG L 33  CYS L 38  
CB 3 GLU L 21  ? VAL L 25  ? GLU L 21  VAL L 25  
CB 4 LEU L 5   ? LYS L 7   ? LEU L 5   LYS L 7   
CC 1 LEU F 38  ? THR F 41  ? LEU F 38  THR F 41  
CC 2 VAL F 62  ? ALA F 65  ? VAL F 62  ALA F 65  
CC 3 TYR F 90  ? PHE F 95  ? TYR F 90  PHE F 95  
CC 4 GLY F 121 ? ASP F 125 ? GLY F 121 ASP F 125 
CC 5 THR F 151 ? SER F 154 ? THR F 151 SER F 154 
CD 1 TYR F 71  ? LEU F 72  ? TYR F 71  LEU F 72  
CD 2 GLU F 108 ? LEU F 109 ? GLU F 108 LEU F 109 
CE 1 CYS F 209 ? CYS F 213 ? CYS F 209 CYS F 213 
CE 2 CYS F 221 ? CYS F 224 ? CYS F 221 CYS F 224 
CF 1 PHE F 227 ? ASP F 229 ? PHE F 227 ASP F 229 
CF 2 ALA F 232 ? VAL F 234 ? ALA F 232 VAL F 234 
CG 1 PHE F 241 ? ASN F 244 ? PHE F 241 ASN F 244 
CG 2 GLN F 249 ? HIS F 252 ? GLN F 249 HIS F 252 
CH 1 TYR F 258 ? TYR F 260 ? TYR F 258 TYR F 260 
CH 2 PHE F 263 ? VAL F 265 ? PHE F 263 VAL F 265 
CI 1 SER F 278 ? VAL F 280 ? SER F 278 VAL F 280 
CI 2 VAL F 273 ? ASP F 275 ? VAL F 273 ASP F 275 
CI 3 ILE F 295 ? PRO F 300 ? ILE F 295 PRO F 300 
CI 4 LYS F 287 ? GLU F 292 ? LYS F 287 GLU F 292 
CJ 1 ALA F 308 ? ASP F 310 ? ALA F 308 ASP F 310 
CJ 2 LYS F 336 ? ASN F 338 ? LYS F 336 ASN F 338 
CJ 3 GLU F 372 ? ILE F 373 ? GLU F 372 ILE F 373 
CJ 4 THR F 397 ? ILE F 398 ? THR F 397 ILE F 398 
CJ 5 GLU F 427 ? ILE F 428 ? GLU F 427 ILE F 428 
CK 1 LEU F 341 ? PHE F 343 ? LEU F 341 PHE F 343 
CK 2 LEU F 377 ? ILE F 379 ? LEU F 377 ILE F 379 
CK 3 LEU F 407 ? LEU F 412 ? LEU F 407 LEU F 412 
CK 4 ASN F 432 ? THR F 436 ? ASN F 432 THR F 436 
CK 5 ILE F 460 ? ARG F 463 ? ILE F 460 ARG F 463 
CL 1 PHE F 501 ? ARG F 503 ? PHE F 501 ARG F 503 
CL 2 ILE F 506 ? ILE F 508 ? ILE F 506 ILE F 508 
CM 1 GLU F 520 ? GLU F 522 ? GLU F 520 GLU F 522 
CM 2 CYS F 527 ? GLU F 529 ? CYS F 527 GLU F 529 
CN 1 PHE F 558 ? ASP F 560 ? PHE F 558 ASP F 560 
CN 2 ASN F 563 ? VAL F 565 ? ASN F 563 VAL F 565 
CO 1 PHE G 42  ? THR G 43  ? PHE G 42  THR G 43  
CO 2 ASN G 49  ? TYR G 50  ? ASN G 49  TYR G 50  
CP 1 PHE H 42  ? THR H 43  ? PHE H 42  THR H 43  
CP 2 ASN H 49  ? TYR H 50  ? ASN H 49  TYR H 50  
CQ 1 PHE I 42  ? THR I 43  ? PHE I 42  THR I 43  
CQ 2 ASN I 49  ? TYR I 50  ? ASN I 49  TYR I 50  
CR 1 PHE J 42  ? THR J 43  ? PHE J 42  THR J 43  
CR 2 ASN J 49  ? TYR J 50  ? ASN J 49  TYR J 50  
CS 1 PHE K 42  ? THR K 43  ? PHE K 42  THR K 43  
CS 2 ASN K 49  ? TYR K 50  ? ASN K 49  TYR K 50  
CT 1 PHE L 42  ? THR L 43  ? PHE L 42  THR L 43  
CT 2 ASN L 49  ? TYR L 50  ? ASN L 49  TYR L 50  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N CYS A 4   ? N CYS A 4   O VAL A 33  ? O VAL A 33  
A  2 3 N VAL A 34  ? N VAL A 34  O GLU A 57  ? O GLU A 57  
A  3 4 N VAL A 58  ? N VAL A 58  O ILE A 79  ? O ILE A 79  
A  4 5 N ILE A 80  ? N ILE A 80  O GLU A 116 ? O GLU A 116 
B  1 2 N SER A 13  ? N SER A 13  O CYS G 38  ? O CYS G 38  
B  2 3 O LEU G 35  ? O LEU G 35  N PHE G 23  ? N PHE G 23  
B  3 4 O MET G 24  ? O MET G 24  N VAL G 6   ? N VAL G 6   
C  1 2 N ILE A 40  ? N ILE A 40  O LEU A 63  ? O LEU A 63  
C  2 3 N VAL A 64  ? N VAL A 64  O ALA A 93  ? O ALA A 93  
C  3 4 N LEU A 92  ? N LEU A 92  O TYR A 123 ? O TYR A 123 
C  4 5 N VAL A 124 ? N VAL A 124 O SER A 154 ? O SER A 154 
D  1 2 N LEU A 72  ? N LEU A 72  O GLU A 108 ? O GLU A 108 
E  1 2 N ALA A 210 ? N ALA A 210 O ALA A 223 ? O ALA A 223 
F  1 2 N ASP A 229 ? N ASP A 229 O ALA A 232 ? O ALA A 232 
G  1 2 N ASN A 244 ? N ASN A 244 O GLN A 249 ? O GLN A 249 
H  1 2 N TYR A 258 ? N TYR A 258 O VAL A 265 ? O VAL A 265 
I  1 2 N VAL A 273 ? N VAL A 273 O VAL A 280 ? O VAL A 280 
J  1 2 N MET A 288 ? N MET A 288 O LYS A 299 ? O LYS A 299 
K  1 2 N CYS A 309 ? N CYS A 309 O ASN A 338 ? O ASN A 338 
K  2 3 N ILE A 337 ? N ILE A 337 O GLU A 372 ? O GLU A 372 
K  3 4 N ILE A 373 ? N ILE A 373 O THR A 397 ? O THR A 397 
K  4 5 N ILE A 398 ? N ILE A 398 O GLU A 427 ? O GLU A 427 
L  1 2 N LEU A 341 ? N LEU A 341 O ASN A 378 ? O ASN A 378 
L  2 3 N ILE A 379 ? N ILE A 379 O LEU A 410 ? O LEU A 410 
L  3 4 N LEU A 409 ? N LEU A 409 O TYR A 434 ? O TYR A 434 
L  4 5 N ILE A 433 ? N ILE A 433 O VAL A 461 ? O VAL A 461 
M  1 2 N ARG A 503 ? N ARG A 503 O ILE A 506 ? O ILE A 506 
N  1 2 N PHE A 521 ? N PHE A 521 O VAL A 528 ? O VAL A 528 
O  1 2 N CYS B 4   ? N CYS B 4   O VAL B 33  ? O VAL B 33  
O  2 3 N VAL B 34  ? N VAL B 34  O GLU B 57  ? O GLU B 57  
O  3 4 N VAL B 58  ? N VAL B 58  O ILE B 79  ? O ILE B 79  
O  4 5 N ILE B 80  ? N ILE B 80  O GLU B 116 ? O GLU B 116 
P  1 2 N SER B 13  ? N SER B 13  O CYS H 38  ? O CYS H 38  
P  2 3 O LEU H 35  ? O LEU H 35  N PHE H 23  ? N PHE H 23  
P  3 4 O MET H 24  ? O MET H 24  N VAL H 6   ? N VAL H 6   
Q  1 2 N ILE B 40  ? N ILE B 40  O LEU B 63  ? O LEU B 63  
Q  2 3 N VAL B 64  ? N VAL B 64  O ALA B 93  ? O ALA B 93  
Q  3 4 N LEU B 92  ? N LEU B 92  O TYR B 123 ? O TYR B 123 
Q  4 5 N VAL B 124 ? N VAL B 124 O LEU B 152 ? O LEU B 152 
R  1 2 N LEU B 72  ? N LEU B 72  O GLU B 108 ? O GLU B 108 
S  1 2 N ALA B 210 ? N ALA B 210 O ALA B 223 ? O ALA B 223 
T  1 2 N ASP B 229 ? N ASP B 229 O ALA B 232 ? O ALA B 232 
U  1 2 N ASN B 244 ? N ASN B 244 O GLN B 249 ? O GLN B 249 
V  1 2 N TYR B 258 ? N TYR B 258 O VAL B 265 ? O VAL B 265 
W  1 2 N VAL B 273 ? N VAL B 273 O VAL B 280 ? O VAL B 280 
X  1 2 N MET B 288 ? N MET B 288 O LYS B 299 ? O LYS B 299 
Y  1 2 N CYS B 309 ? N CYS B 309 O ASN B 338 ? O ASN B 338 
Y  2 3 N ILE B 337 ? N ILE B 337 O GLU B 372 ? O GLU B 372 
Y  3 4 N ILE B 373 ? N ILE B 373 O THR B 397 ? O THR B 397 
Y  4 5 N ILE B 398 ? N ILE B 398 O GLU B 427 ? O GLU B 427 
Z  1 2 N LEU B 341 ? N LEU B 341 O ASN B 378 ? O ASN B 378 
Z  2 3 N ILE B 379 ? N ILE B 379 O LEU B 410 ? O LEU B 410 
Z  3 4 N LEU B 409 ? N LEU B 409 O TYR B 434 ? O TYR B 434 
Z  4 5 N ILE B 433 ? N ILE B 433 O VAL B 461 ? O VAL B 461 
AA 1 2 N PHE B 501 ? N PHE B 501 O ILE B 508 ? O ILE B 508 
AB 1 2 N PHE B 521 ? N PHE B 521 O VAL B 528 ? O VAL B 528 
AC 1 2 N PHE B 558 ? N PHE B 558 O VAL B 565 ? O VAL B 565 
AD 1 2 N TYR B 582 ? N TYR B 582 O HIS B 590 ? O HIS B 590 
AE 1 2 N CYS C 4   ? N CYS C 4   O VAL C 33  ? O VAL C 33  
AE 2 3 N VAL C 34  ? N VAL C 34  O GLU C 57  ? O GLU C 57  
AE 3 4 N VAL C 58  ? N VAL C 58  O ILE C 79  ? O ILE C 79  
AE 4 5 N ILE C 80  ? N ILE C 80  O GLU C 116 ? O GLU C 116 
AF 1 2 N SER C 13  ? N SER C 13  O CYS I 38  ? O CYS I 38  
AF 2 3 O LEU I 35  ? O LEU I 35  N PHE I 23  ? N PHE I 23  
AF 3 4 O MET I 24  ? O MET I 24  N VAL I 6   ? N VAL I 6   
AG 1 2 N ILE C 40  ? N ILE C 40  O LEU C 63  ? O LEU C 63  
AG 2 3 N VAL C 64  ? N VAL C 64  O ALA C 93  ? O ALA C 93  
AG 3 4 N LEU C 92  ? N LEU C 92  O TYR C 123 ? O TYR C 123 
AG 4 5 N VAL C 124 ? N VAL C 124 O SER C 154 ? O SER C 154 
AH 1 2 N LEU C 72  ? N LEU C 72  O GLU C 108 ? O GLU C 108 
AI 1 2 N ALA C 210 ? N ALA C 210 O ALA C 223 ? O ALA C 223 
AJ 1 2 N ASP C 229 ? N ASP C 229 O ALA C 232 ? O ALA C 232 
AK 1 2 N VAL C 242 ? N VAL C 242 O GLU C 251 ? O GLU C 251 
AL 1 2 N TYR C 258 ? N TYR C 258 O VAL C 265 ? O VAL C 265 
AM 1 2 N VAL C 273 ? N VAL C 273 O VAL C 280 ? O VAL C 280 
AN 1 2 N MET C 288 ? N MET C 288 O LYS C 299 ? O LYS C 299 
AO 1 2 N CYS C 309 ? N CYS C 309 O ASN C 338 ? O ASN C 338 
AO 2 3 N ILE C 337 ? N ILE C 337 O GLU C 372 ? O GLU C 372 
AO 3 4 N ILE C 373 ? N ILE C 373 O THR C 397 ? O THR C 397 
AO 4 5 N ILE C 398 ? N ILE C 398 O GLU C 427 ? O GLU C 427 
AP 1 2 N LEU C 341 ? N LEU C 341 O ASN C 378 ? O ASN C 378 
AP 2 3 N ILE C 379 ? N ILE C 379 O LEU C 410 ? O LEU C 410 
AP 3 4 N SER C 408 ? N SER C 408 O ASN C 432 ? O ASN C 432 
AP 4 5 N ILE C 433 ? N ILE C 433 O VAL C 461 ? O VAL C 461 
AQ 1 2 N ARG C 503 ? N ARG C 503 O ILE C 506 ? O ILE C 506 
AR 1 2 N ASN C 523 ? N ASN C 523 O ILE C 526 ? O ILE C 526 
AS 1 2 N PHE C 558 ? N PHE C 558 O VAL C 565 ? O VAL C 565 
AT 1 2 N TYR C 582 ? N TYR C 582 O HIS C 590 ? O HIS C 590 
AU 1 2 N CYS D 4   ? N CYS D 4   O VAL D 33  ? O VAL D 33  
AU 2 3 N VAL D 34  ? N VAL D 34  O GLU D 57  ? O GLU D 57  
AU 3 4 N VAL D 58  ? N VAL D 58  O ILE D 79  ? O ILE D 79  
AU 4 5 N ILE D 80  ? N ILE D 80  O GLU D 116 ? O GLU D 116 
AV 1 2 N SER D 13  ? N SER D 13  O CYS J 38  ? O CYS J 38  
AV 2 3 O LEU J 35  ? O LEU J 35  N PHE J 23  ? N PHE J 23  
AV 3 4 O MET J 24  ? O MET J 24  N VAL J 6   ? N VAL J 6   
AW 1 2 N ILE D 40  ? N ILE D 40  O LEU D 63  ? O LEU D 63  
AW 2 3 N VAL D 64  ? N VAL D 64  O ALA D 93  ? O ALA D 93  
AW 3 4 N LEU D 92  ? N LEU D 92  O TYR D 123 ? O TYR D 123 
AW 4 5 N VAL D 124 ? N VAL D 124 O SER D 154 ? O SER D 154 
AX 1 2 N LEU D 72  ? N LEU D 72  O GLU D 108 ? O GLU D 108 
AY 1 2 N ALA D 210 ? N ALA D 210 O ALA D 223 ? O ALA D 223 
AZ 1 2 N ASP D 229 ? N ASP D 229 O ALA D 232 ? O ALA D 232 
BA 1 2 N ASN D 244 ? N ASN D 244 O GLN D 249 ? O GLN D 249 
BB 1 2 N TYR D 258 ? N TYR D 258 O VAL D 265 ? O VAL D 265 
BC 1 2 N VAL D 273 ? N VAL D 273 O VAL D 280 ? O VAL D 280 
BD 1 2 N MET D 288 ? N MET D 288 O LYS D 299 ? O LYS D 299 
BE 1 2 N CYS D 309 ? N CYS D 309 O ASN D 338 ? O ASN D 338 
BE 2 3 N ILE D 337 ? N ILE D 337 O GLU D 372 ? O GLU D 372 
BE 3 4 N ILE D 373 ? N ILE D 373 O THR D 397 ? O THR D 397 
BE 4 5 N ILE D 398 ? N ILE D 398 O GLU D 427 ? O GLU D 427 
BF 1 2 N LEU D 341 ? N LEU D 341 O ASN D 378 ? O ASN D 378 
BF 2 3 N ILE D 379 ? N ILE D 379 O LEU D 410 ? O LEU D 410 
BF 3 4 N SER D 408 ? N SER D 408 O ASN D 432 ? O ASN D 432 
BF 4 5 N ILE D 433 ? N ILE D 433 O VAL D 461 ? O VAL D 461 
BG 1 2 N PHE D 501 ? N PHE D 501 O ILE D 508 ? O ILE D 508 
BH 1 2 N PHE D 521 ? N PHE D 521 O VAL D 528 ? O VAL D 528 
BI 1 2 N PHE D 558 ? N PHE D 558 O VAL D 565 ? O VAL D 565 
BJ 1 2 N TYR D 582 ? N TYR D 582 O HIS D 590 ? O HIS D 590 
BK 1 2 N CYS E 4   ? N CYS E 4   O VAL E 33  ? O VAL E 33  
BK 2 3 N VAL E 34  ? N VAL E 34  O GLU E 57  ? O GLU E 57  
BK 3 4 N VAL E 58  ? N VAL E 58  O ILE E 79  ? O ILE E 79  
BK 4 5 N ILE E 80  ? N ILE E 80  O GLU E 116 ? O GLU E 116 
BL 1 2 N SER E 13  ? N SER E 13  O CYS K 38  ? O CYS K 38  
BL 2 3 O LEU K 35  ? O LEU K 35  N PHE K 23  ? N PHE K 23  
BL 3 4 O MET K 24  ? O MET K 24  N VAL K 6   ? N VAL K 6   
BM 1 2 N ILE E 40  ? N ILE E 40  O LEU E 63  ? O LEU E 63  
BM 2 3 N VAL E 64  ? N VAL E 64  O ALA E 93  ? O ALA E 93  
BM 3 4 N LEU E 92  ? N LEU E 92  O TYR E 123 ? O TYR E 123 
BM 4 5 N VAL E 124 ? N VAL E 124 O SER E 154 ? O SER E 154 
BN 1 2 N LEU E 72  ? N LEU E 72  O GLU E 108 ? O GLU E 108 
BO 1 2 N ALA E 210 ? N ALA E 210 O ALA E 223 ? O ALA E 223 
BP 1 2 N ASP E 229 ? N ASP E 229 O ALA E 232 ? O ALA E 232 
BQ 1 2 N ASN E 244 ? N ASN E 244 O GLN E 249 ? O GLN E 249 
BR 1 2 N TYR E 258 ? N TYR E 258 O VAL E 265 ? O VAL E 265 
BS 1 2 N VAL E 273 ? N VAL E 273 O VAL E 280 ? O VAL E 280 
BT 1 2 N MET E 288 ? N MET E 288 O LYS E 299 ? O LYS E 299 
BU 1 2 N CYS E 309 ? N CYS E 309 O ASN E 338 ? O ASN E 338 
BU 2 3 N ILE E 337 ? N ILE E 337 O GLU E 372 ? O GLU E 372 
BU 3 4 N ILE E 373 ? N ILE E 373 O THR E 397 ? O THR E 397 
BU 4 5 N ILE E 398 ? N ILE E 398 O GLU E 427 ? O GLU E 427 
BV 1 2 N PHE E 343 ? N PHE E 343 O ASN E 378 ? O ASN E 378 
BV 2 3 N ILE E 379 ? N ILE E 379 O LEU E 410 ? O LEU E 410 
BV 3 4 N LEU E 409 ? N LEU E 409 O TYR E 434 ? O TYR E 434 
BV 4 5 N ILE E 433 ? N ILE E 433 O VAL E 461 ? O VAL E 461 
BW 1 2 N ARG E 503 ? N ARG E 503 O ILE E 506 ? O ILE E 506 
BX 1 2 N PHE E 521 ? N PHE E 521 O VAL E 528 ? O VAL E 528 
BY 1 2 N PHE E 558 ? N PHE E 558 O VAL E 565 ? O VAL E 565 
BZ 1 2 N TYR E 582 ? N TYR E 582 O HIS E 590 ? O HIS E 590 
CA 1 2 N CYS F 4   ? N CYS F 4   O VAL F 33  ? O VAL F 33  
CA 2 3 N VAL F 34  ? N VAL F 34  O GLU F 57  ? O GLU F 57  
CA 3 4 N VAL F 58  ? N VAL F 58  O ILE F 79  ? O ILE F 79  
CA 4 5 N ILE F 80  ? N ILE F 80  O GLU F 116 ? O GLU F 116 
CB 1 2 N SER F 13  ? N SER F 13  O CYS L 38  ? O CYS L 38  
CB 2 3 O ARG L 33  ? O ARG L 33  N VAL L 25  ? N VAL L 25  
CB 3 4 O MET L 24  ? O MET L 24  N VAL L 6   ? N VAL L 6   
CC 1 2 N ILE F 40  ? N ILE F 40  O LEU F 63  ? O LEU F 63  
CC 2 3 N VAL F 64  ? N VAL F 64  O ALA F 93  ? O ALA F 93  
CC 3 4 N LEU F 92  ? N LEU F 92  O TYR F 123 ? O TYR F 123 
CC 4 5 N VAL F 124 ? N VAL F 124 O SER F 154 ? O SER F 154 
CD 1 2 N LEU F 72  ? N LEU F 72  O GLU F 108 ? O GLU F 108 
CE 1 2 N ALA F 210 ? N ALA F 210 O ALA F 223 ? O ALA F 223 
CF 1 2 N ASP F 229 ? N ASP F 229 O ALA F 232 ? O ALA F 232 
CG 1 2 N ASN F 244 ? N ASN F 244 O GLN F 249 ? O GLN F 249 
CH 1 2 N TYR F 258 ? N TYR F 258 O VAL F 265 ? O VAL F 265 
CI 1 2 O VAL F 280 ? O VAL F 280 N VAL F 273 ? N VAL F 273 
CI 2 3 N VAL F 274 ? N VAL F 274 O LYS F 296 ? O LYS F 296 
CI 3 4 O LYS F 299 ? O LYS F 299 N MET F 288 ? N MET F 288 
CJ 1 2 N CYS F 309 ? N CYS F 309 O ASN F 338 ? O ASN F 338 
CJ 2 3 N ILE F 337 ? N ILE F 337 O GLU F 372 ? O GLU F 372 
CJ 3 4 N ILE F 373 ? N ILE F 373 O THR F 397 ? O THR F 397 
CJ 4 5 N ILE F 398 ? N ILE F 398 O GLU F 427 ? O GLU F 427 
CK 1 2 N LEU F 341 ? N LEU F 341 O ASN F 378 ? O ASN F 378 
CK 2 3 N ILE F 379 ? N ILE F 379 O LEU F 410 ? O LEU F 410 
CK 3 4 N LEU F 409 ? N LEU F 409 O TYR F 434 ? O TYR F 434 
CK 4 5 N ILE F 433 ? N ILE F 433 O VAL F 461 ? O VAL F 461 
CL 1 2 N PHE F 501 ? N PHE F 501 O ILE F 508 ? O ILE F 508 
CM 1 2 N PHE F 521 ? N PHE F 521 O VAL F 528 ? O VAL F 528 
CN 1 2 N PHE F 558 ? N PHE F 558 O VAL F 565 ? O VAL F 565 
CO 1 2 N THR G 43  ? N THR G 43  O ASN G 49  ? O ASN G 49  
CP 1 2 N THR H 43  ? N THR H 43  O ASN H 49  ? O ASN H 49  
CQ 1 2 N THR I 43  ? N THR I 43  O ASN I 49  ? O ASN I 49  
CR 1 2 N THR J 43  ? N THR J 43  O ASN J 49  ? O ASN J 49  
CS 1 2 N THR K 43  ? N THR K 43  O ASN K 49  ? O ASN K 49  
CT 1 2 N THR L 43  ? N THR L 43  O ASN L 49  ? O ASN L 49  
# 
_atom_sites.entry_id                    3U7U 
_atom_sites.fract_transf_matrix[1][1]   0.011665 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001998 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004474 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006906 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . GLN A  1 1   ? -8.580  -29.274 16.026  1.00 84.46  ? 1    GLN A N   1 
ATOM   2     C CA  . GLN A  1 1   ? -9.709  -29.811 16.799  1.00 85.91  ? 1    GLN A CA  1 
ATOM   3     C C   . GLN A  1 1   ? -10.338 -31.184 16.340  1.00 88.77  ? 1    GLN A C   1 
ATOM   4     O O   . GLN A  1 1   ? -11.244 -31.725 17.018  1.00 89.12  ? 1    GLN A O   1 
ATOM   5     C CB  . GLN A  1 1   ? -10.778 -28.728 17.122  1.00 88.68  ? 1    GLN A CB  1 
ATOM   6     C CG  . GLN A  1 1   ? -10.597 -28.055 18.508  1.00 109.82 ? 1    GLN A CG  1 
ATOM   7     C CD  . GLN A  1 1   ? -10.962 -28.938 19.693  1.00 122.76 ? 1    GLN A CD  1 
ATOM   8     O OE1 . GLN A  1 1   ? -10.150 -29.183 20.609  1.00 110.01 ? 1    GLN A OE1 1 
ATOM   9     N NE2 . GLN A  1 1   ? -12.204 -29.413 19.712  1.00 120.81 ? 1    GLN A NE2 1 
ATOM   10    N N   . SER A  1 2   ? -9.879  -31.706 15.174  1.00 80.98  ? 2    SER A N   1 
ATOM   11    C CA  . SER A  1 2   ? -10.212 -33.031 14.661  1.00 78.60  ? 2    SER A CA  1 
ATOM   12    C C   . SER A  1 2   ? -8.844  -33.677 14.537  1.00 80.44  ? 2    SER A C   1 
ATOM   13    O O   . SER A  1 2   ? -8.012  -33.313 13.701  1.00 81.44  ? 2    SER A O   1 
ATOM   14    C CB  . SER A  1 2   ? -10.977 -32.982 13.350  1.00 80.83  ? 2    SER A CB  1 
ATOM   15    O OG  . SER A  1 2   ? -10.183 -32.511 12.281  1.00 88.15  ? 2    SER A OG  1 
ATOM   16    N N   . VAL A  1 3   ? -8.565  -34.510 15.514  1.00 72.70  ? 3    VAL A N   1 
ATOM   17    C CA  . VAL A  1 3   ? -7.307  -35.185 15.736  1.00 69.49  ? 3    VAL A CA  1 
ATOM   18    C C   . VAL A  1 3   ? -7.370  -36.652 15.273  1.00 74.81  ? 3    VAL A C   1 
ATOM   19    O O   . VAL A  1 3   ? -8.404  -37.300 15.407  1.00 74.31  ? 3    VAL A O   1 
ATOM   20    C CB  . VAL A  1 3   ? -7.033  -35.021 17.251  1.00 69.67  ? 3    VAL A CB  1 
ATOM   21    C CG1 . VAL A  1 3   ? -6.060  -36.037 17.798  1.00 69.26  ? 3    VAL A CG1 1 
ATOM   22    C CG2 . VAL A  1 3   ? -6.554  -33.624 17.560  1.00 68.66  ? 3    VAL A CG2 1 
ATOM   23    N N   . CYS A  1 4   ? -6.254  -37.167 14.740  1.00 72.51  ? 4    CYS A N   1 
ATOM   24    C CA  . CYS A  1 4   ? -6.105  -38.565 14.352  1.00 73.65  ? 4    CYS A CA  1 
ATOM   25    C C   . CYS A  1 4   ? -4.751  -39.069 14.777  1.00 76.03  ? 4    CYS A C   1 
ATOM   26    O O   . CYS A  1 4   ? -3.898  -38.268 15.140  1.00 75.62  ? 4    CYS A O   1 
ATOM   27    C CB  . CYS A  1 4   ? -6.335  -38.762 12.863  1.00 76.67  ? 4    CYS A CB  1 
ATOM   28    S SG  . CYS A  1 4   ? -5.143  -37.895 11.819  1.00 82.14  ? 4    CYS A SG  1 
ATOM   29    N N   . ALA A  1 5   ? -4.546  -40.390 14.746  1.00 73.49  ? 5    ALA A N   1 
ATOM   30    C CA  . ALA A  1 5   ? -3.307  -40.987 15.237  1.00 73.61  ? 5    ALA A CA  1 
ATOM   31    C C   . ALA A  1 5   ? -2.167  -41.115 14.224  1.00 77.35  ? 5    ALA A C   1 
ATOM   32    O O   . ALA A  1 5   ? -0.990  -40.961 14.589  1.00 77.12  ? 5    ALA A O   1 
ATOM   33    C CB  . ALA A  1 5   ? -3.607  -42.331 15.888  1.00 74.50  ? 5    ALA A CB  1 
ATOM   34    N N   . GLY A  1 6   ? -2.516  -41.459 12.989  1.00 72.29  ? 6    GLY A N   1 
ATOM   35    C CA  . GLY A  1 6   ? -1.528  -41.690 11.951  1.00 72.09  ? 6    GLY A CA  1 
ATOM   36    C C   . GLY A  1 6   ? -0.731  -42.964 12.181  1.00 75.28  ? 6    GLY A C   1 
ATOM   37    O O   . GLY A  1 6   ? -0.596  -43.436 13.317  1.00 73.47  ? 6    GLY A O   1 
ATOM   38    N N   . THR A  1 7   ? -0.167  -43.506 11.089  1.00 72.68  ? 7    THR A N   1 
ATOM   39    C CA  . THR A  1 7   ? 0.651   -44.721 11.070  1.00 72.49  ? 7    THR A CA  1 
ATOM   40    C C   . THR A  1 7   ? 2.104   -44.590 11.566  1.00 73.61  ? 7    THR A C   1 
ATOM   41    O O   . THR A  1 7   ? 2.563   -43.497 11.929  1.00 71.88  ? 7    THR A O   1 
ATOM   42    C CB  . THR A  1 7   ? 0.536   -45.409 9.714   1.00 85.01  ? 7    THR A CB  1 
ATOM   43    O OG1 . THR A  1 7   ? 0.834   -44.475 8.666   1.00 81.87  ? 7    THR A OG1 1 
ATOM   44    C CG2 . THR A  1 7   ? -0.830  -46.060 9.505   1.00 87.21  ? 7    THR A CG2 1 
ATOM   45    N N   . GLU A  1 8   ? 2.790   -45.757 11.629  1.00 70.42  ? 8    GLU A N   1 
ATOM   46    C CA  . GLU A  1 8   ? 4.194   -45.988 12.029  1.00 70.63  ? 8    GLU A CA  1 
ATOM   47    C C   . GLU A  1 8   ? 4.754   -47.162 11.187  1.00 72.93  ? 8    GLU A C   1 
ATOM   48    O O   . GLU A  1 8   ? 5.529   -47.999 11.680  1.00 73.10  ? 8    GLU A O   1 
ATOM   49    C CB  . GLU A  1 8   ? 4.277   -46.318 13.533  1.00 71.63  ? 8    GLU A CB  1 
ATOM   50    C CG  . GLU A  1 8   ? 4.445   -45.107 14.422  1.00 88.39  ? 8    GLU A CG  1 
ATOM   51    C CD  . GLU A  1 8   ? 4.703   -45.370 15.899  1.00 127.50 ? 8    GLU A CD  1 
ATOM   52    O OE1 . GLU A  1 8   ? 4.223   -46.398 16.432  1.00 116.55 ? 8    GLU A OE1 1 
ATOM   53    O OE2 . GLU A  1 8   ? 5.349   -44.509 16.540  1.00 135.26 ? 8    GLU A OE2 1 
ATOM   54    N N   . ASN A  1 9   ? 4.333   -47.220 9.912   1.00 67.23  ? 9    ASN A N   1 
ATOM   55    C CA  . ASN A  1 9   ? 4.685   -48.297 8.988   1.00 67.68  ? 9    ASN A CA  1 
ATOM   56    C C   . ASN A  1 9   ? 5.980   -48.079 8.242   1.00 69.60  ? 9    ASN A C   1 
ATOM   57    O O   . ASN A  1 9   ? 6.560   -49.053 7.775   1.00 70.37  ? 9    ASN A O   1 
ATOM   58    C CB  . ASN A  1 9   ? 3.547   -48.519 7.970   1.00 65.81  ? 9    ASN A CB  1 
ATOM   59    C CG  . ASN A  1 9   ? 2.181   -48.714 8.566   1.00 83.75  ? 9    ASN A CG  1 
ATOM   60    O OD1 . ASN A  1 9   ? 2.009   -49.182 9.705   1.00 77.28  ? 9    ASN A OD1 1 
ATOM   61    N ND2 . ASN A  1 9   ? 1.174   -48.340 7.803   1.00 78.73  ? 9    ASN A ND2 1 
ATOM   62    N N   . LYS A  1 10  ? 6.403   -46.803 8.089   1.00 63.59  ? 10   LYS A N   1 
ATOM   63    C CA  . LYS A  1 10  ? 7.551   -46.367 7.300   1.00 63.90  ? 10   LYS A CA  1 
ATOM   64    C C   . LYS A  1 10  ? 7.269   -46.713 5.815   1.00 70.32  ? 10   LYS A C   1 
ATOM   65    O O   . LYS A  1 10  ? 6.221   -46.331 5.294   1.00 69.17  ? 10   LYS A O   1 
ATOM   66    C CB  . LYS A  1 10  ? 8.869   -46.950 7.831   1.00 68.12  ? 10   LYS A CB  1 
ATOM   67    C CG  . LYS A  1 10  ? 9.235   -46.489 9.236   1.00 86.49  ? 10   LYS A CG  1 
ATOM   68    C CD  . LYS A  1 10  ? 9.587   -47.677 10.122  1.00 97.70  ? 10   LYS A CD  1 
ATOM   69    C CE  . LYS A  1 10  ? 9.534   -47.365 11.590  1.00 109.72 ? 10   LYS A CE  1 
ATOM   70    N NZ  . LYS A  1 10  ? 9.668   -48.609 12.399  1.00 121.97 ? 10   LYS A NZ  1 
ATOM   71    N N   . LEU A  1 11  ? 8.154   -47.465 5.152   1.00 71.13  ? 11   LEU A N   1 
ATOM   72    C CA  . LEU A  1 11  ? 7.978   -47.829 3.746   1.00 72.58  ? 11   LEU A CA  1 
ATOM   73    C C   . LEU A  1 11  ? 7.067   -49.041 3.511   1.00 82.49  ? 11   LEU A C   1 
ATOM   74    O O   . LEU A  1 11  ? 6.628   -49.271 2.377   1.00 83.54  ? 11   LEU A O   1 
ATOM   75    C CB  . LEU A  1 11  ? 9.336   -47.953 3.046   1.00 73.47  ? 11   LEU A CB  1 
ATOM   76    C CG  . LEU A  1 11  ? 10.166  -46.669 2.999   1.00 76.05  ? 11   LEU A CG  1 
ATOM   77    C CD1 . LEU A  1 11  ? 11.448  -46.900 2.313   1.00 77.78  ? 11   LEU A CD1 1 
ATOM   78    C CD2 . LEU A  1 11  ? 9.417   -45.544 2.285   1.00 77.47  ? 11   LEU A CD2 1 
ATOM   79    N N   . SER A  1 12  ? 6.729   -49.773 4.601   1.00 81.41  ? 12   SER A N   1 
ATOM   80    C CA  . SER A  1 12  ? 5.839   -50.930 4.572   1.00 82.69  ? 12   SER A CA  1 
ATOM   81    C C   . SER A  1 12  ? 4.447   -50.493 4.193   1.00 89.38  ? 12   SER A C   1 
ATOM   82    O O   . SER A  1 12  ? 4.048   -49.368 4.506   1.00 87.97  ? 12   SER A O   1 
ATOM   83    C CB  . SER A  1 12  ? 5.822   -51.643 5.915   1.00 85.60  ? 12   SER A CB  1 
ATOM   84    O OG  . SER A  1 12  ? 7.138   -52.074 6.209   1.00 97.78  ? 12   SER A OG  1 
ATOM   85    N N   . SER A  1 13  ? 3.738   -51.362 3.461   1.00 89.37  ? 13   SER A N   1 
ATOM   86    C CA  . SER A  1 13  ? 2.400   -51.104 2.933   1.00 89.83  ? 13   SER A CA  1 
ATOM   87    C C   . SER A  1 13  ? 1.598   -52.409 2.726   1.00 94.79  ? 13   SER A C   1 
ATOM   88    O O   . SER A  1 13  ? 2.092   -53.487 3.067   1.00 95.64  ? 13   SER A O   1 
ATOM   89    C CB  . SER A  1 13  ? 2.506   -50.312 1.627   1.00 96.02  ? 13   SER A CB  1 
ATOM   90    O OG  . SER A  1 13  ? 3.529   -50.766 0.753   1.00 107.42 ? 13   SER A OG  1 
ATOM   91    N N   . LEU A  1 14  ? 0.361   -52.307 2.211   1.00 90.28  ? 14   LEU A N   1 
ATOM   92    C CA  . LEU A  1 14  ? -0.435  -53.488 1.939   1.00 91.87  ? 14   LEU A CA  1 
ATOM   93    C C   . LEU A  1 14  ? -0.156  -53.919 0.516   1.00 100.57 ? 14   LEU A C   1 
ATOM   94    O O   . LEU A  1 14  ? 0.095   -53.063 -0.340  1.00 101.39 ? 14   LEU A O   1 
ATOM   95    C CB  . LEU A  1 14  ? -1.926  -53.204 2.100   1.00 91.00  ? 14   LEU A CB  1 
ATOM   96    C CG  . LEU A  1 14  ? -2.422  -52.854 3.495   1.00 93.58  ? 14   LEU A CG  1 
ATOM   97    C CD1 . LEU A  1 14  ? -3.785  -52.244 3.416   1.00 92.34  ? 14   LEU A CD1 1 
ATOM   98    C CD2 . LEU A  1 14  ? -2.450  -54.072 4.400   1.00 96.45  ? 14   LEU A CD2 1 
ATOM   99    N N   . SER A  1 15  ? -0.185  -55.247 0.263   1.00 99.20  ? 15   SER A N   1 
ATOM   100   C CA  . SER A  1 15  ? 0.031   -55.839 -1.057  1.00 101.35 ? 15   SER A CA  1 
ATOM   101   C C   . SER A  1 15  ? -1.052  -55.345 -2.028  1.00 104.53 ? 15   SER A C   1 
ATOM   102   O O   . SER A  1 15  ? -0.730  -54.983 -3.165  1.00 106.30 ? 15   SER A O   1 
ATOM   103   C CB  . SER A  1 15  ? -0.006  -57.361 -0.975  1.00 107.43 ? 15   SER A CB  1 
ATOM   104   O OG  . SER A  1 15  ? 0.936   -57.859 -0.043  1.00 119.87 ? 15   SER A OG  1 
ATOM   105   N N   . ASP A  1 16  ? -2.330  -55.306 -1.571  1.00 97.70  ? 16   ASP A N   1 
ATOM   106   C CA  . ASP A  1 16  ? -3.443  -54.821 -2.387  1.00 96.78  ? 16   ASP A CA  1 
ATOM   107   C C   . ASP A  1 16  ? -3.330  -53.309 -2.437  1.00 96.20  ? 16   ASP A C   1 
ATOM   108   O O   . ASP A  1 16  ? -3.486  -52.641 -1.419  1.00 94.11  ? 16   ASP A O   1 
ATOM   109   C CB  . ASP A  1 16  ? -4.806  -55.284 -1.818  1.00 98.57  ? 16   ASP A CB  1 
ATOM   110   C CG  . ASP A  1 16  ? -6.050  -54.984 -2.666  1.00 118.99 ? 16   ASP A CG  1 
ATOM   111   O OD1 . ASP A  1 16  ? -7.074  -55.698 -2.505  1.00 120.86 ? 16   ASP A OD1 1 
ATOM   112   O OD2 . ASP A  1 16  ? -6.014  -54.023 -3.464  1.00 129.78 ? 16   ASP A OD2 1 
ATOM   113   N N   . LEU A  1 17  ? -2.998  -52.777 -3.613  1.00 92.20  ? 17   LEU A N   1 
ATOM   114   C CA  . LEU A  1 17  ? -2.815  -51.341 -3.807  1.00 90.25  ? 17   LEU A CA  1 
ATOM   115   C C   . LEU A  1 17  ? -4.066  -50.496 -3.605  1.00 91.74  ? 17   LEU A C   1 
ATOM   116   O O   . LEU A  1 17  ? -3.938  -49.334 -3.192  1.00 90.21  ? 17   LEU A O   1 
ATOM   117   C CB  . LEU A  1 17  ? -2.104  -51.015 -5.121  1.00 92.35  ? 17   LEU A CB  1 
ATOM   118   C CG  . LEU A  1 17  ? -0.647  -51.477 -5.261  1.00 98.41  ? 17   LEU A CG  1 
ATOM   119   C CD1 . LEU A  1 17  ? -0.043  -50.891 -6.509  1.00 100.05 ? 17   LEU A CD1 1 
ATOM   120   C CD2 . LEU A  1 17  ? 0.216   -51.112 -4.017  1.00 98.88  ? 17   LEU A CD2 1 
ATOM   121   N N   . GLU A  1 18  ? -5.268  -51.077 -3.861  1.00 87.43  ? 18   GLU A N   1 
ATOM   122   C CA  . GLU A  1 18  ? -6.550  -50.415 -3.611  1.00 86.13  ? 18   GLU A CA  1 
ATOM   123   C C   . GLU A  1 18  ? -6.752  -50.414 -2.093  1.00 89.57  ? 18   GLU A C   1 
ATOM   124   O O   . GLU A  1 18  ? -7.169  -49.392 -1.535  1.00 87.97  ? 18   GLU A O   1 
ATOM   125   C CB  . GLU A  1 18  ? -7.702  -51.137 -4.317  1.00 89.08  ? 18   GLU A CB  1 
ATOM   126   C CG  . GLU A  1 18  ? -9.098  -50.602 -4.017  1.00 97.48  ? 18   GLU A CG  1 
ATOM   127   C CD  . GLU A  1 18  ? -9.676  -49.641 -5.035  1.00 122.85 ? 18   GLU A CD  1 
ATOM   128   O OE1 . GLU A  1 18  ? -9.686  -49.977 -6.243  1.00 126.66 ? 18   GLU A OE1 1 
ATOM   129   O OE2 . GLU A  1 18  ? -10.164 -48.567 -4.617  1.00 117.72 ? 18   GLU A OE2 1 
ATOM   130   N N   . GLN A  1 19  ? -6.393  -51.535 -1.417  1.00 86.16  ? 19   GLN A N   1 
ATOM   131   C CA  . GLN A  1 19  ? -6.487  -51.634 0.044   1.00 83.52  ? 19   GLN A CA  1 
ATOM   132   C C   . GLN A  1 19  ? -5.530  -50.672 0.734   1.00 83.46  ? 19   GLN A C   1 
ATOM   133   O O   . GLN A  1 19  ? -5.862  -50.145 1.789   1.00 80.83  ? 19   GLN A O   1 
ATOM   134   C CB  . GLN A  1 19  ? -6.282  -53.073 0.529   1.00 85.53  ? 19   GLN A CB  1 
ATOM   135   C CG  . GLN A  1 19  ? -7.318  -53.505 1.561   1.00 102.29 ? 19   GLN A CG  1 
ATOM   136   C CD  . GLN A  1 19  ? -8.755  -53.383 1.103   1.00 127.41 ? 19   GLN A CD  1 
ATOM   137   O OE1 . GLN A  1 19  ? -9.119  -53.750 -0.026  1.00 131.21 ? 19   GLN A OE1 1 
ATOM   138   N NE2 . GLN A  1 19  ? -9.602  -52.873 1.983   1.00 113.56 ? 19   GLN A NE2 1 
ATOM   139   N N   . GLN A  1 20  ? -4.367  -50.419 0.112   1.00 80.25  ? 20   GLN A N   1 
ATOM   140   C CA  . GLN A  1 20  ? -3.369  -49.467 0.589   1.00 78.70  ? 20   GLN A CA  1 
ATOM   141   C C   . GLN A  1 20  ? -3.959  -48.050 0.495   1.00 83.26  ? 20   GLN A C   1 
ATOM   142   O O   . GLN A  1 20  ? -3.886  -47.294 1.475   1.00 81.18  ? 20   GLN A O   1 
ATOM   143   C CB  . GLN A  1 20  ? -2.056  -49.591 -0.213  1.00 80.83  ? 20   GLN A CB  1 
ATOM   144   C CG  . GLN A  1 20  ? -0.987  -48.525 0.094   1.00 88.65  ? 20   GLN A CG  1 
ATOM   145   C CD  . GLN A  1 20  ? -0.440  -48.522 1.516   1.00 104.36 ? 20   GLN A CD  1 
ATOM   146   O OE1 . GLN A  1 20  ? -0.748  -49.378 2.356   1.00 96.47  ? 20   GLN A OE1 1 
ATOM   147   N NE2 . GLN A  1 20  ? 0.441   -47.568 1.804   1.00 93.98  ? 20   GLN A NE2 1 
ATOM   148   N N   . TYR A  1 21  ? -4.583  -47.714 -0.672  1.00 80.53  ? 21   TYR A N   1 
ATOM   149   C CA  . TYR A  1 21  ? -5.218  -46.414 -0.895  1.00 79.13  ? 21   TYR A CA  1 
ATOM   150   C C   . TYR A  1 21  ? -6.381  -46.215 0.062   1.00 84.21  ? 21   TYR A C   1 
ATOM   151   O O   . TYR A  1 21  ? -6.476  -45.174 0.717   1.00 83.48  ? 21   TYR A O   1 
ATOM   152   C CB  . TYR A  1 21  ? -5.697  -46.254 -2.341  1.00 81.03  ? 21   TYR A CB  1 
ATOM   153   C CG  . TYR A  1 21  ? -6.543  -45.013 -2.539  1.00 81.30  ? 21   TYR A CG  1 
ATOM   154   C CD1 . TYR A  1 21  ? -5.975  -43.743 -2.505  1.00 82.57  ? 21   TYR A CD1 1 
ATOM   155   C CD2 . TYR A  1 21  ? -7.914  -45.105 -2.732  1.00 81.90  ? 21   TYR A CD2 1 
ATOM   156   C CE1 . TYR A  1 21  ? -6.748  -42.597 -2.676  1.00 82.16  ? 21   TYR A CE1 1 
ATOM   157   C CE2 . TYR A  1 21  ? -8.696  -43.966 -2.906  1.00 82.06  ? 21   TYR A CE2 1 
ATOM   158   C CZ  . TYR A  1 21  ? -8.108  -42.714 -2.880  1.00 84.34  ? 21   TYR A CZ  1 
ATOM   159   O OH  . TYR A  1 21  ? -8.862  -41.580 -3.043  1.00 79.28  ? 21   TYR A OH  1 
ATOM   160   N N   . ARG A  1 22  ? -7.268  -47.221 0.140   1.00 80.73  ? 22   ARG A N   1 
ATOM   161   C CA  . ARG A  1 22  ? -8.412  -47.202 1.033   1.00 78.14  ? 22   ARG A CA  1 
ATOM   162   C C   . ARG A  1 22  ? -7.982  -46.990 2.484   1.00 77.63  ? 22   ARG A C   1 
ATOM   163   O O   . ARG A  1 22  ? -8.652  -46.243 3.188   1.00 77.21  ? 22   ARG A O   1 
ATOM   164   C CB  . ARG A  1 22  ? -9.288  -48.453 0.843   1.00 79.34  ? 22   ARG A CB  1 
ATOM   165   C CG  . ARG A  1 22  ? -10.400 -48.230 -0.201  1.00 89.26  ? 22   ARG A CG  1 
ATOM   166   C CD  . ARG A  1 22  ? -10.884 -49.497 -0.845  1.00 94.53  ? 22   ARG A CD  1 
ATOM   167   N NE  . ARG A  1 22  ? -11.572 -50.331 0.129   1.00 99.12  ? 22   ARG A NE  1 
ATOM   168   C CZ  . ARG A  1 22  ? -12.214 -51.449 -0.162  1.00 117.37 ? 22   ARG A CZ  1 
ATOM   169   N NH1 . ARG A  1 22  ? -12.237 -51.905 -1.410  1.00 100.46 ? 22   ARG A NH1 1 
ATOM   170   N NH2 . ARG A  1 22  ? -12.835 -52.130 0.792   1.00 111.30 ? 22   ARG A NH2 1 
ATOM   171   N N   . ALA A  1 23  ? -6.827  -47.563 2.900   1.00 71.45  ? 23   ALA A N   1 
ATOM   172   C CA  . ALA A  1 23  ? -6.284  -47.404 4.252   1.00 68.58  ? 23   ALA A CA  1 
ATOM   173   C C   . ALA A  1 23  ? -5.846  -45.960 4.509   1.00 73.44  ? 23   ALA A C   1 
ATOM   174   O O   . ALA A  1 23  ? -6.175  -45.407 5.574   1.00 71.59  ? 23   ALA A O   1 
ATOM   175   C CB  . ALA A  1 23  ? -5.125  -48.346 4.468   1.00 69.15  ? 23   ALA A CB  1 
ATOM   176   N N   . LEU A  1 24  ? -5.141  -45.328 3.515   1.00 70.44  ? 24   LEU A N   1 
ATOM   177   C CA  . LEU A  1 24  ? -4.697  -43.929 3.596   1.00 67.71  ? 24   LEU A CA  1 
ATOM   178   C C   . LEU A  1 24  ? -5.907  -43.048 3.870   1.00 72.02  ? 24   LEU A C   1 
ATOM   179   O O   . LEU A  1 24  ? -5.924  -42.308 4.860   1.00 70.38  ? 24   LEU A O   1 
ATOM   180   C CB  . LEU A  1 24  ? -3.968  -43.486 2.316   1.00 67.84  ? 24   LEU A CB  1 
ATOM   181   C CG  . LEU A  1 24  ? -3.351  -42.093 2.331   1.00 69.72  ? 24   LEU A CG  1 
ATOM   182   C CD1 . LEU A  1 24  ? -2.028  -42.087 3.074   1.00 68.79  ? 24   LEU A CD1 1 
ATOM   183   C CD2 . LEU A  1 24  ? -3.161  -41.563 0.936   1.00 71.03  ? 24   LEU A CD2 1 
ATOM   184   N N   . ARG A  1 25  ? -6.954  -43.211 3.046   1.00 71.21  ? 25   ARG A N   1 
ATOM   185   C CA  . ARG A  1 25  ? -8.233  -42.502 3.180   1.00 70.81  ? 25   ARG A CA  1 
ATOM   186   C C   . ARG A  1 25  ? -8.849  -42.729 4.571   1.00 73.70  ? 25   ARG A C   1 
ATOM   187   O O   . ARG A  1 25  ? -9.221  -41.754 5.222   1.00 74.29  ? 25   ARG A O   1 
ATOM   188   C CB  . ARG A  1 25  ? -9.207  -42.905 2.060   1.00 70.07  ? 25   ARG A CB  1 
ATOM   189   C CG  . ARG A  1 25  ? -10.190 -41.810 1.716   1.00 72.60  ? 25   ARG A CG  1 
ATOM   190   C CD  . ARG A  1 25  ? -11.030 -42.134 0.486   1.00 86.46  ? 25   ARG A CD  1 
ATOM   191   N NE  . ARG A  1 25  ? -10.931 -41.181 -0.631  1.00 109.16 ? 25   ARG A NE  1 
ATOM   192   C CZ  . ARG A  1 25  ? -11.537 -39.992 -0.698  1.00 133.36 ? 25   ARG A CZ  1 
ATOM   193   N NH1 . ARG A  1 25  ? -12.252 -39.543 0.326   1.00 119.00 ? 25   ARG A NH1 1 
ATOM   194   N NH2 . ARG A  1 25  ? -11.389 -39.226 -1.770  1.00 126.43 ? 25   ARG A NH2 1 
ATOM   195   N N   . LYS A  1 26  ? -8.867  -43.990 5.053   1.00 68.39  ? 26   LYS A N   1 
ATOM   196   C CA  . LYS A  1 26  ? -9.412  -44.361 6.359   1.00 66.88  ? 26   LYS A CA  1 
ATOM   197   C C   . LYS A  1 26  ? -8.723  -43.609 7.478   1.00 72.68  ? 26   LYS A C   1 
ATOM   198   O O   . LYS A  1 26  ? -9.400  -42.975 8.290   1.00 70.97  ? 26   LYS A O   1 
ATOM   199   C CB  . LYS A  1 26  ? -9.339  -45.887 6.573   1.00 67.86  ? 26   LYS A CB  1 
ATOM   200   C CG  . LYS A  1 26  ? -9.624  -46.375 7.998   1.00 66.15  ? 26   LYS A CG  1 
ATOM   201   C CD  . LYS A  1 26  ? -9.086  -47.809 8.172   1.00 77.86  ? 26   LYS A CD  1 
ATOM   202   C CE  . LYS A  1 26  ? -8.908  -48.300 9.596   1.00 74.43  ? 26   LYS A CE  1 
ATOM   203   N NZ  . LYS A  1 26  ? -8.123  -49.570 9.618   1.00 84.50  ? 26   LYS A NZ  1 
ATOM   204   N N   . TYR A  1 27  ? -7.384  -43.650 7.486   1.00 72.40  ? 27   TYR A N   1 
ATOM   205   C CA  . TYR A  1 27  ? -6.562  -43.038 8.527   1.00 72.18  ? 27   TYR A CA  1 
ATOM   206   C C   . TYR A  1 27  ? -6.548  -41.528 8.607   1.00 75.09  ? 27   TYR A C   1 
ATOM   207   O O   . TYR A  1 27  ? -6.436  -40.998 9.715   1.00 73.71  ? 27   TYR A O   1 
ATOM   208   C CB  . TYR A  1 27  ? -5.116  -43.551 8.435   1.00 74.19  ? 27   TYR A CB  1 
ATOM   209   C CG  . TYR A  1 27  ? -4.907  -44.867 9.144   1.00 75.99  ? 27   TYR A CG  1 
ATOM   210   C CD1 . TYR A  1 27  ? -5.268  -46.066 8.547   1.00 79.44  ? 27   TYR A CD1 1 
ATOM   211   C CD2 . TYR A  1 27  ? -4.383  -44.913 10.427  1.00 75.75  ? 27   TYR A CD2 1 
ATOM   212   C CE1 . TYR A  1 27  ? -5.102  -47.283 9.204   1.00 81.97  ? 27   TYR A CE1 1 
ATOM   213   C CE2 . TYR A  1 27  ? -4.195  -46.127 11.090  1.00 77.23  ? 27   TYR A CE2 1 
ATOM   214   C CZ  . TYR A  1 27  ? -4.549  -47.314 10.470  1.00 88.78  ? 27   TYR A CZ  1 
ATOM   215   O OH  . TYR A  1 27  ? -4.419  -48.536 11.100  1.00 93.93  ? 27   TYR A OH  1 
ATOM   216   N N   . TYR A  1 28  ? -6.591  -40.837 7.449   1.00 70.82  ? 28   TYR A N   1 
ATOM   217   C CA  . TYR A  1 28  ? -6.362  -39.395 7.394   1.00 68.81  ? 28   TYR A CA  1 
ATOM   218   C C   . TYR A  1 28  ? -7.455  -38.478 6.906   1.00 73.05  ? 28   TYR A C   1 
ATOM   219   O O   . TYR A  1 28  ? -7.239  -37.252 6.902   1.00 72.95  ? 28   TYR A O   1 
ATOM   220   C CB  . TYR A  1 28  ? -5.077  -39.113 6.584   1.00 68.95  ? 28   TYR A CB  1 
ATOM   221   C CG  . TYR A  1 28  ? -3.826  -39.784 7.110   1.00 67.21  ? 28   TYR A CG  1 
ATOM   222   C CD1 . TYR A  1 28  ? -3.194  -40.784 6.383   1.00 69.76  ? 28   TYR A CD1 1 
ATOM   223   C CD2 . TYR A  1 28  ? -3.245  -39.380 8.313   1.00 65.86  ? 28   TYR A CD2 1 
ATOM   224   C CE1 . TYR A  1 28  ? -2.010  -41.365 6.834   1.00 71.66  ? 28   TYR A CE1 1 
ATOM   225   C CE2 . TYR A  1 28  ? -2.068  -39.958 8.780   1.00 66.76  ? 28   TYR A CE2 1 
ATOM   226   C CZ  . TYR A  1 28  ? -1.453  -40.948 8.036   1.00 75.02  ? 28   TYR A CZ  1 
ATOM   227   O OH  . TYR A  1 28  ? -0.305  -41.519 8.506   1.00 72.05  ? 28   TYR A OH  1 
ATOM   228   N N   . GLU A  1 29  ? -8.587  -39.021 6.440   1.00 68.35  ? 29   GLU A N   1 
ATOM   229   C CA  . GLU A  1 29  ? -9.614  -38.120 5.956   1.00 67.30  ? 29   GLU A CA  1 
ATOM   230   C C   . GLU A  1 29  ? -10.346 -37.416 7.097   1.00 72.13  ? 29   GLU A C   1 
ATOM   231   O O   . GLU A  1 29  ? -10.577 -38.025 8.140   1.00 70.95  ? 29   GLU A O   1 
ATOM   232   C CB  . GLU A  1 29  ? -10.466 -38.750 4.862   1.00 69.33  ? 29   GLU A CB  1 
ATOM   233   C CG  . GLU A  1 29  ? -11.945 -38.768 5.100   1.00 77.45  ? 29   GLU A CG  1 
ATOM   234   C CD  . GLU A  1 29  ? -12.651 -39.699 4.157   1.00 102.93 ? 29   GLU A CD  1 
ATOM   235   O OE1 . GLU A  1 29  ? -13.164 -40.732 4.646   1.00 96.74  ? 29   GLU A OE1 1 
ATOM   236   O OE2 . GLU A  1 29  ? -12.690 -39.401 2.942   1.00 102.78 ? 29   GLU A OE2 1 
ATOM   237   N N   . ASN A  1 30  ? -10.593 -36.096 6.925   1.00 70.48  ? 30   ASN A N   1 
ATOM   238   C CA  . ASN A  1 30  ? -11.216 -35.164 7.884   1.00 70.18  ? 30   ASN A CA  1 
ATOM   239   C C   . ASN A  1 30  ? -10.359 -34.925 9.143   1.00 76.73  ? 30   ASN A C   1 
ATOM   240   O O   . ASN A  1 30  ? -10.831 -34.388 10.149  1.00 75.82  ? 30   ASN A O   1 
ATOM   241   C CB  . ASN A  1 30  ? -12.664 -35.530 8.203   1.00 65.51  ? 30   ASN A CB  1 
ATOM   242   C CG  . ASN A  1 30  ? -13.501 -35.755 6.980   1.00 81.63  ? 30   ASN A CG  1 
ATOM   243   O OD1 . ASN A  1 30  ? -13.532 -34.939 6.046   1.00 78.11  ? 30   ASN A OD1 1 
ATOM   244   N ND2 . ASN A  1 30  ? -14.191 -36.878 6.960   1.00 72.16  ? 30   ASN A ND2 1 
ATOM   245   N N   . CYS A  1 31  ? -9.079  -35.270 9.050   1.00 75.58  ? 31   CYS A N   1 
ATOM   246   C CA  . CYS A  1 31  ? -8.147  -35.058 10.127  1.00 75.25  ? 31   CYS A CA  1 
ATOM   247   C C   . CYS A  1 31  ? -7.401  -33.734 9.908   1.00 75.52  ? 31   CYS A C   1 
ATOM   248   O O   . CYS A  1 31  ? -6.900  -33.493 8.813   1.00 75.48  ? 31   CYS A O   1 
ATOM   249   C CB  . CYS A  1 31  ? -7.191  -36.235 10.238  1.00 77.21  ? 31   CYS A CB  1 
ATOM   250   S SG  . CYS A  1 31  ? -5.980  -36.046 11.565  1.00 81.50  ? 31   CYS A SG  1 
ATOM   251   N N   . GLU A  1 32  ? -7.349  -32.875 10.938  1.00 68.59  ? 32   GLU A N   1 
ATOM   252   C CA  . GLU A  1 32  ? -6.686  -31.577 10.893  1.00 67.47  ? 32   GLU A CA  1 
ATOM   253   C C   . GLU A  1 32  ? -5.328  -31.683 11.532  1.00 69.87  ? 32   GLU A C   1 
ATOM   254   O O   . GLU A  1 32  ? -4.350  -31.151 10.992  1.00 70.56  ? 32   GLU A O   1 
ATOM   255   C CB  . GLU A  1 32  ? -7.509  -30.512 11.623  1.00 68.58  ? 32   GLU A CB  1 
ATOM   256   C CG  . GLU A  1 32  ? -8.659  -29.944 10.813  1.00 81.22  ? 32   GLU A CG  1 
ATOM   257   C CD  . GLU A  1 32  ? -9.635  -29.139 11.645  1.00 108.81 ? 32   GLU A CD  1 
ATOM   258   O OE1 . GLU A  1 32  ? -9.487  -27.895 11.702  1.00 121.32 ? 32   GLU A OE1 1 
ATOM   259   O OE2 . GLU A  1 32  ? -10.534 -29.756 12.261  1.00 101.48 ? 32   GLU A OE2 1 
ATOM   260   N N   . VAL A  1 33  ? -5.260  -32.363 12.688  1.00 63.89  ? 33   VAL A N   1 
ATOM   261   C CA  . VAL A  1 33  ? -4.004  -32.561 13.419  1.00 61.71  ? 33   VAL A CA  1 
ATOM   262   C C   . VAL A  1 33  ? -3.643  -34.038 13.447  1.00 64.63  ? 33   VAL A C   1 
ATOM   263   O O   . VAL A  1 33  ? -4.324  -34.830 14.114  1.00 63.38  ? 33   VAL A O   1 
ATOM   264   C CB  . VAL A  1 33  ? -4.062  -31.995 14.857  1.00 63.59  ? 33   VAL A CB  1 
ATOM   265   C CG1 . VAL A  1 33  ? -2.774  -32.299 15.615  1.00 62.48  ? 33   VAL A CG1 1 
ATOM   266   C CG2 . VAL A  1 33  ? -4.350  -30.501 14.846  1.00 63.55  ? 33   VAL A CG2 1 
ATOM   267   N N   . VAL A  1 34  ? -2.563  -34.410 12.744  1.00 60.93  ? 34   VAL A N   1 
ATOM   268   C CA  . VAL A  1 34  ? -2.099  -35.789 12.785  1.00 59.95  ? 34   VAL A CA  1 
ATOM   269   C C   . VAL A  1 34  ? -1.216  -35.859 13.990  1.00 63.48  ? 34   VAL A C   1 
ATOM   270   O O   . VAL A  1 34  ? -0.235  -35.120 14.102  1.00 62.30  ? 34   VAL A O   1 
ATOM   271   C CB  . VAL A  1 34  ? -1.422  -36.296 11.508  1.00 64.01  ? 34   VAL A CB  1 
ATOM   272   C CG1 . VAL A  1 34  ? -1.118  -37.781 11.642  1.00 64.29  ? 34   VAL A CG1 1 
ATOM   273   C CG2 . VAL A  1 34  ? -2.303  -36.038 10.287  1.00 64.20  ? 34   VAL A CG2 1 
ATOM   274   N N   . MET A  1 35  ? -1.621  -36.678 14.935  1.00 62.12  ? 35   MET A N   1 
ATOM   275   C CA  . MET A  1 35  ? -0.919  -36.808 16.193  1.00 63.70  ? 35   MET A CA  1 
ATOM   276   C C   . MET A  1 35  ? 0.007   -37.966 16.132  1.00 71.53  ? 35   MET A C   1 
ATOM   277   O O   . MET A  1 35  ? -0.149  -38.951 16.867  1.00 73.73  ? 35   MET A O   1 
ATOM   278   C CB  . MET A  1 35  ? -1.914  -36.933 17.307  1.00 66.15  ? 35   MET A CB  1 
ATOM   279   C CG  . MET A  1 35  ? -2.700  -35.701 17.436  1.00 71.51  ? 35   MET A CG  1 
ATOM   280   S SD  . MET A  1 35  ? -2.677  -35.037 19.095  1.00 78.10  ? 35   MET A SD  1 
ATOM   281   C CE  . MET A  1 35  ? -0.810  -35.027 19.436  1.00 76.27  ? 35   MET A CE  1 
ATOM   282   N N   . GLY A  1 36  ? 0.958   -37.838 15.217  1.00 66.64  ? 36   GLY A N   1 
ATOM   283   C CA  . GLY A  1 36  ? 1.916   -38.865 14.882  1.00 66.57  ? 36   GLY A CA  1 
ATOM   284   C C   . GLY A  1 36  ? 2.440   -38.623 13.492  1.00 69.58  ? 36   GLY A C   1 
ATOM   285   O O   . GLY A  1 36  ? 2.761   -37.482 13.158  1.00 69.61  ? 36   GLY A O   1 
ATOM   286   N N   . ASN A  1 37  ? 2.528   -39.677 12.673  1.00 65.27  ? 37   ASN A N   1 
ATOM   287   C CA  . ASN A  1 37  ? 3.110   -39.530 11.345  1.00 65.38  ? 37   ASN A CA  1 
ATOM   288   C C   . ASN A  1 37  ? 2.142   -39.598 10.203  1.00 68.22  ? 37   ASN A C   1 
ATOM   289   O O   . ASN A  1 37  ? 1.161   -40.346 10.250  1.00 67.23  ? 37   ASN A O   1 
ATOM   290   C CB  . ASN A  1 37  ? 4.249   -40.514 11.132  1.00 69.15  ? 37   ASN A CB  1 
ATOM   291   C CG  . ASN A  1 37  ? 5.162   -40.683 12.323  1.00 96.18  ? 37   ASN A CG  1 
ATOM   292   O OD1 . ASN A  1 37  ? 5.605   -39.717 12.953  1.00 88.34  ? 37   ASN A OD1 1 
ATOM   293   N ND2 . ASN A  1 37  ? 5.470   -41.926 12.649  1.00 91.50  ? 37   ASN A ND2 1 
ATOM   294   N N   . LEU A  1 38  ? 2.420   -38.795 9.166   1.00 64.62  ? 38   LEU A N   1 
ATOM   295   C CA  . LEU A  1 38  ? 1.640   -38.779 7.941   1.00 64.87  ? 38   LEU A CA  1 
ATOM   296   C C   . LEU A  1 38  ? 2.509   -39.509 6.941   1.00 71.41  ? 38   LEU A C   1 
ATOM   297   O O   . LEU A  1 38  ? 3.532   -38.970 6.501   1.00 72.88  ? 38   LEU A O   1 
ATOM   298   C CB  . LEU A  1 38  ? 1.327   -37.343 7.480   1.00 63.96  ? 38   LEU A CB  1 
ATOM   299   C CG  . LEU A  1 38  ? 0.676   -37.175 6.092   1.00 67.76  ? 38   LEU A CG  1 
ATOM   300   C CD1 . LEU A  1 38  ? -0.717  -37.752 6.059   1.00 67.25  ? 38   LEU A CD1 1 
ATOM   301   C CD2 . LEU A  1 38  ? 0.669   -35.716 5.677   1.00 65.41  ? 38   LEU A CD2 1 
ATOM   302   N N   . GLU A  1 39  ? 2.133   -40.772 6.652   1.00 66.72  ? 39   GLU A N   1 
ATOM   303   C CA  . GLU A  1 39  ? 2.827   -41.685 5.747   1.00 66.31  ? 39   GLU A CA  1 
ATOM   304   C C   . GLU A  1 39  ? 1.977   -41.938 4.511   1.00 69.06  ? 39   GLU A C   1 
ATOM   305   O O   . GLU A  1 39  ? 0.875   -42.482 4.618   1.00 69.01  ? 39   GLU A O   1 
ATOM   306   C CB  . GLU A  1 39  ? 3.150   -42.994 6.471   1.00 67.59  ? 39   GLU A CB  1 
ATOM   307   C CG  . GLU A  1 39  ? 4.226   -42.829 7.527   1.00 76.32  ? 39   GLU A CG  1 
ATOM   308   C CD  . GLU A  1 39  ? 4.479   -44.017 8.434   1.00 88.23  ? 39   GLU A CD  1 
ATOM   309   O OE1 . GLU A  1 39  ? 5.638   -44.174 8.881   1.00 78.03  ? 39   GLU A OE1 1 
ATOM   310   O OE2 . GLU A  1 39  ? 3.518   -44.759 8.743   1.00 65.78  ? 39   GLU A OE2 1 
ATOM   311   N N   . ILE A  1 40  ? 2.469   -41.483 3.350   1.00 64.20  ? 40   ILE A N   1 
ATOM   312   C CA  . ILE A  1 40  ? 1.816   -41.617 2.045   1.00 64.15  ? 40   ILE A CA  1 
ATOM   313   C C   . ILE A  1 40  ? 2.806   -42.389 1.179   1.00 74.16  ? 40   ILE A C   1 
ATOM   314   O O   . ILE A  1 40  ? 3.778   -41.816 0.671   1.00 74.64  ? 40   ILE A O   1 
ATOM   315   C CB  . ILE A  1 40  ? 1.451   -40.221 1.454   1.00 65.41  ? 40   ILE A CB  1 
ATOM   316   C CG1 . ILE A  1 40  ? 0.626   -39.367 2.451   1.00 62.35  ? 40   ILE A CG1 1 
ATOM   317   C CG2 . ILE A  1 40  ? 0.754   -40.341 0.097   1.00 66.65  ? 40   ILE A CG2 1 
ATOM   318   C CD1 . ILE A  1 40  ? 0.814   -37.847 2.312   1.00 65.76  ? 40   ILE A CD1 1 
ATOM   319   N N   . THR A  1 41  ? 2.609   -43.718 1.096   1.00 74.96  ? 41   THR A N   1 
ATOM   320   C CA  . THR A  1 41  ? 3.504   -44.618 0.353   1.00 77.70  ? 41   THR A CA  1 
ATOM   321   C C   . THR A  1 41  ? 2.739   -45.560 -0.544  1.00 83.32  ? 41   THR A C   1 
ATOM   322   O O   . THR A  1 41  ? 1.664   -46.037 -0.153  1.00 81.01  ? 41   THR A O   1 
ATOM   323   C CB  . THR A  1 41  ? 4.481   -45.402 1.282   1.00 86.24  ? 41   THR A CB  1 
ATOM   324   O OG1 . THR A  1 41  ? 3.769   -46.150 2.270   1.00 85.65  ? 41   THR A OG1 1 
ATOM   325   C CG2 . THR A  1 41  ? 5.506   -44.509 1.950   1.00 85.36  ? 41   THR A CG2 1 
ATOM   326   N N   . SER A  1 42  ? 3.322   -45.846 -1.738  1.00 82.64  ? 42   SER A N   1 
ATOM   327   C CA  . SER A  1 42  ? 2.823   -46.778 -2.751  1.00 84.92  ? 42   SER A CA  1 
ATOM   328   C C   . SER A  1 42  ? 1.407   -46.468 -3.268  1.00 90.07  ? 42   SER A C   1 
ATOM   329   O O   . SER A  1 42  ? 0.568   -47.374 -3.386  1.00 91.14  ? 42   SER A O   1 
ATOM   330   C CB  . SER A  1 42  ? 2.962   -48.228 -2.274  1.00 89.96  ? 42   SER A CB  1 
ATOM   331   O OG  . SER A  1 42  ? 4.283   -48.529 -1.848  1.00 100.50 ? 42   SER A OG  1 
ATOM   332   N N   . ILE A  1 43  ? 1.144   -45.187 -3.586  1.00 85.48  ? 43   ILE A N   1 
ATOM   333   C CA  . ILE A  1 43  ? -0.160  -44.764 -4.106  1.00 84.78  ? 43   ILE A CA  1 
ATOM   334   C C   . ILE A  1 43  ? -0.074  -44.554 -5.617  1.00 94.65  ? 43   ILE A C   1 
ATOM   335   O O   . ILE A  1 43  ? 0.820   -43.852 -6.094  1.00 96.04  ? 43   ILE A O   1 
ATOM   336   C CB  . ILE A  1 43  ? -0.788  -43.597 -3.285  1.00 84.39  ? 43   ILE A CB  1 
ATOM   337   C CG1 . ILE A  1 43  ? -1.378  -44.126 -1.959  1.00 81.77  ? 43   ILE A CG1 1 
ATOM   338   C CG2 . ILE A  1 43  ? -1.859  -42.841 -4.051  1.00 84.77  ? 43   ILE A CG2 1 
ATOM   339   C CD1 . ILE A  1 43  ? -0.603  -43.824 -0.798  1.00 79.43  ? 43   ILE A CD1 1 
ATOM   340   N N   . GLU A  1 44  ? -0.979  -45.223 -6.364  1.00 93.72  ? 44   GLU A N   1 
ATOM   341   C CA  . GLU A  1 44  ? -1.075  -45.228 -7.833  1.00 96.06  ? 44   GLU A CA  1 
ATOM   342   C C   . GLU A  1 44  ? -1.371  -43.861 -8.439  1.00 101.41 ? 44   GLU A C   1 
ATOM   343   O O   . GLU A  1 44  ? -1.928  -42.991 -7.774  1.00 99.05  ? 44   GLU A O   1 
ATOM   344   C CB  . GLU A  1 44  ? -2.131  -46.242 -8.296  1.00 98.60  ? 44   GLU A CB  1 
ATOM   345   C CG  . GLU A  1 44  ? -1.784  -47.701 -8.027  1.00 111.86 ? 44   GLU A CG  1 
ATOM   346   C CD  . GLU A  1 44  ? -2.980  -48.596 -7.745  1.00 143.72 ? 44   GLU A CD  1 
ATOM   347   O OE1 . GLU A  1 44  ? -3.187  -49.563 -8.514  1.00 117.52 ? 44   GLU A OE1 1 
ATOM   348   O OE2 . GLU A  1 44  ? -3.711  -48.331 -6.760  1.00 157.07 ? 44   GLU A OE2 1 
ATOM   349   N N   . HIS A  1 45  ? -1.036  -43.702 -9.720  1.00 102.45 ? 45   HIS A N   1 
ATOM   350   C CA  . HIS A  1 45  ? -1.212  -42.484 -10.504 1.00 104.80 ? 45   HIS A CA  1 
ATOM   351   C C   . HIS A  1 45  ? -2.641  -41.889 -10.533 1.00 107.16 ? 45   HIS A C   1 
ATOM   352   O O   . HIS A  1 45  ? -2.795  -40.679 -10.346 1.00 105.96 ? 45   HIS A O   1 
ATOM   353   C CB  . HIS A  1 45  ? -0.679  -42.708 -11.924 1.00 110.11 ? 45   HIS A CB  1 
ATOM   354   C CG  . HIS A  1 45  ? -0.991  -41.586 -12.854 1.00 116.04 ? 45   HIS A CG  1 
ATOM   355   N ND1 . HIS A  1 45  ? -2.037  -41.671 -13.763 1.00 120.13 ? 45   HIS A ND1 1 
ATOM   356   C CD2 . HIS A  1 45  ? -0.428  -40.359 -12.941 1.00 118.49 ? 45   HIS A CD2 1 
ATOM   357   C CE1 . HIS A  1 45  ? -2.052  -40.508 -14.398 1.00 120.78 ? 45   HIS A CE1 1 
ATOM   358   N NE2 . HIS A  1 45  ? -1.102  -39.685 -13.938 1.00 120.12 ? 45   HIS A NE2 1 
ATOM   359   N N   . ASN A  1 46  ? -3.658  -42.716 -10.806 1.00 103.47 ? 46   ASN A N   1 
ATOM   360   C CA  . ASN A  1 46  ? -5.049  -42.271 -10.913 1.00 103.40 ? 46   ASN A CA  1 
ATOM   361   C C   . ASN A  1 46  ? -5.681  -41.594 -9.665  1.00 103.57 ? 46   ASN A C   1 
ATOM   362   O O   . ASN A  1 46  ? -6.434  -40.626 -9.815  1.00 103.76 ? 46   ASN A O   1 
ATOM   363   C CB  . ASN A  1 46  ? -5.968  -43.393 -11.505 1.00 110.25 ? 46   ASN A CB  1 
ATOM   364   C CG  . ASN A  1 46  ? -6.379  -44.580 -10.607 1.00 130.09 ? 46   ASN A CG  1 
ATOM   365   O OD1 . ASN A  1 46  ? -5.850  -45.701 -10.720 1.00 122.69 ? 46   ASN A OD1 1 
ATOM   366   N ND2 . ASN A  1 46  ? -7.439  -44.413 -9.807  1.00 116.35 ? 46   ASN A ND2 1 
ATOM   367   N N   . ARG A  1 47  ? -5.357  -42.117 -8.455  1.00 95.39  ? 47   ARG A N   1 
ATOM   368   C CA  . ARG A  1 47  ? -5.868  -41.799 -7.109  1.00 90.84  ? 47   ARG A CA  1 
ATOM   369   C C   . ARG A  1 47  ? -6.174  -40.361 -6.708  1.00 91.67  ? 47   ARG A C   1 
ATOM   370   O O   . ARG A  1 47  ? -5.372  -39.462 -6.965  1.00 91.46  ? 47   ARG A O   1 
ATOM   371   C CB  . ARG A  1 47  ? -5.006  -42.467 -6.037  1.00 86.81  ? 47   ARG A CB  1 
ATOM   372   C CG  . ARG A  1 47  ? -4.811  -43.971 -6.217  1.00 89.11  ? 47   ARG A CG  1 
ATOM   373   C CD  . ARG A  1 47  ? -6.121  -44.683 -6.090  1.00 93.68  ? 47   ARG A CD  1 
ATOM   374   N NE  . ARG A  1 47  ? -5.974  -46.127 -6.162  1.00 102.61 ? 47   ARG A NE  1 
ATOM   375   C CZ  . ARG A  1 47  ? -6.998  -46.956 -6.320  1.00 120.57 ? 47   ARG A CZ  1 
ATOM   376   N NH1 . ARG A  1 47  ? -8.233  -46.481 -6.443  1.00 108.99 ? 47   ARG A NH1 1 
ATOM   377   N NH2 . ARG A  1 47  ? -6.797  -48.265 -6.364  1.00 110.17 ? 47   ARG A NH2 1 
ATOM   378   N N   . ASP A  1 48  ? -7.315  -40.169 -6.003  1.00 85.27  ? 48   ASP A N   1 
ATOM   379   C CA  . ASP A  1 48  ? -7.771  -38.867 -5.505  1.00 83.07  ? 48   ASP A CA  1 
ATOM   380   C C   . ASP A  1 48  ? -7.235  -38.601 -4.104  1.00 83.64  ? 48   ASP A C   1 
ATOM   381   O O   . ASP A  1 48  ? -7.539  -39.358 -3.176  1.00 84.03  ? 48   ASP A O   1 
ATOM   382   C CB  . ASP A  1 48  ? -9.306  -38.764 -5.517  1.00 84.97  ? 48   ASP A CB  1 
ATOM   383   C CG  . ASP A  1 48  ? -9.857  -37.522 -4.831  1.00 97.08  ? 48   ASP A CG  1 
ATOM   384   O OD1 . ASP A  1 48  ? -9.393  -36.403 -5.158  1.00 97.23  ? 48   ASP A OD1 1 
ATOM   385   O OD2 . ASP A  1 48  ? -10.749 -37.669 -3.966  1.00 107.21 ? 48   ASP A OD2 1 
ATOM   386   N N   . LEU A  1 49  ? -6.473  -37.508 -3.940  1.00 76.01  ? 49   LEU A N   1 
ATOM   387   C CA  . LEU A  1 49  ? -5.893  -37.171 -2.641  1.00 72.38  ? 49   LEU A CA  1 
ATOM   388   C C   . LEU A  1 49  ? -6.394  -35.854 -2.023  1.00 74.84  ? 49   LEU A C   1 
ATOM   389   O O   . LEU A  1 49  ? -5.850  -35.385 -1.019  1.00 71.54  ? 49   LEU A O   1 
ATOM   390   C CB  . LEU A  1 49  ? -4.359  -37.219 -2.712  1.00 71.87  ? 49   LEU A CB  1 
ATOM   391   C CG  . LEU A  1 49  ? -3.713  -38.521 -3.168  1.00 76.13  ? 49   LEU A CG  1 
ATOM   392   C CD1 . LEU A  1 49  ? -2.294  -38.352 -3.203  1.00 75.23  ? 49   LEU A CD1 1 
ATOM   393   C CD2 . LEU A  1 49  ? -4.000  -39.680 -2.235  1.00 77.77  ? 49   LEU A CD2 1 
ATOM   394   N N   . SER A  1 50  ? -7.470  -35.293 -2.590  1.00 73.48  ? 50   SER A N   1 
ATOM   395   C CA  . SER A  1 50  ? -8.093  -34.054 -2.141  1.00 72.72  ? 50   SER A CA  1 
ATOM   396   C C   . SER A  1 50  ? -8.361  -34.036 -0.621  1.00 75.49  ? 50   SER A C   1 
ATOM   397   O O   . SER A  1 50  ? -8.276  -32.976 -0.010  1.00 74.62  ? 50   SER A O   1 
ATOM   398   C CB  . SER A  1 50  ? -9.383  -33.843 -2.902  1.00 78.69  ? 50   SER A CB  1 
ATOM   399   O OG  . SER A  1 50  ? -10.234 -34.948 -2.639  1.00 96.18  ? 50   SER A OG  1 
ATOM   400   N N   . PHE A  1 51  ? -8.648  -35.210 -0.009  1.00 71.85  ? 51   PHE A N   1 
ATOM   401   C CA  . PHE A  1 51  ? -8.917  -35.359 1.431   1.00 69.43  ? 51   PHE A CA  1 
ATOM   402   C C   . PHE A  1 51  ? -7.749  -34.912 2.332   1.00 70.61  ? 51   PHE A C   1 
ATOM   403   O O   . PHE A  1 51  ? -7.969  -34.601 3.506   1.00 68.64  ? 51   PHE A O   1 
ATOM   404   C CB  . PHE A  1 51  ? -9.369  -36.794 1.777   1.00 71.19  ? 51   PHE A CB  1 
ATOM   405   C CG  . PHE A  1 51  ? -8.344  -37.875 1.543   1.00 73.41  ? 51   PHE A CG  1 
ATOM   406   C CD1 . PHE A  1 51  ? -7.520  -38.316 2.578   1.00 75.98  ? 51   PHE A CD1 1 
ATOM   407   C CD2 . PHE A  1 51  ? -8.214  -38.465 0.295   1.00 77.74  ? 51   PHE A CD2 1 
ATOM   408   C CE1 . PHE A  1 51  ? -6.556  -39.302 2.353   1.00 78.09  ? 51   PHE A CE1 1 
ATOM   409   C CE2 . PHE A  1 51  ? -7.262  -39.458 0.075   1.00 82.33  ? 51   PHE A CE2 1 
ATOM   410   C CZ  . PHE A  1 51  ? -6.436  -39.870 1.105   1.00 79.61  ? 51   PHE A CZ  1 
ATOM   411   N N   . LEU A  1 52  ? -6.515  -34.872 1.770   1.00 65.52  ? 52   LEU A N   1 
ATOM   412   C CA  . LEU A  1 52  ? -5.312  -34.448 2.476   1.00 62.55  ? 52   LEU A CA  1 
ATOM   413   C C   . LEU A  1 52  ? -5.313  -32.946 2.727   1.00 66.89  ? 52   LEU A C   1 
ATOM   414   O O   . LEU A  1 52  ? -4.525  -32.460 3.546   1.00 66.62  ? 52   LEU A O   1 
ATOM   415   C CB  . LEU A  1 52  ? -4.042  -34.868 1.714   1.00 62.69  ? 52   LEU A CB  1 
ATOM   416   C CG  . LEU A  1 52  ? -3.751  -36.360 1.601   1.00 65.72  ? 52   LEU A CG  1 
ATOM   417   C CD1 . LEU A  1 52  ? -2.616  -36.589 0.669   1.00 65.84  ? 52   LEU A CD1 1 
ATOM   418   C CD2 . LEU A  1 52  ? -3.415  -36.978 2.947   1.00 66.18  ? 52   LEU A CD2 1 
ATOM   419   N N   . ARG A  1 53  ? -6.223  -32.208 2.062   1.00 64.40  ? 53   ARG A N   1 
ATOM   420   C CA  . ARG A  1 53  ? -6.347  -30.765 2.262   1.00 64.31  ? 53   ARG A CA  1 
ATOM   421   C C   . ARG A  1 53  ? -6.846  -30.449 3.671   1.00 69.01  ? 53   ARG A C   1 
ATOM   422   O O   . ARG A  1 53  ? -6.731  -29.310 4.125   1.00 68.88  ? 53   ARG A O   1 
ATOM   423   C CB  . ARG A  1 53  ? -7.238  -30.135 1.203   1.00 61.73  ? 53   ARG A CB  1 
ATOM   424   C CG  . ARG A  1 53  ? -6.563  -30.019 -0.134  1.00 68.97  ? 53   ARG A CG  1 
ATOM   425   C CD  . ARG A  1 53  ? -7.583  -29.807 -1.217  1.00 85.34  ? 53   ARG A CD  1 
ATOM   426   N NE  . ARG A  1 53  ? -6.938  -29.588 -2.509  1.00 110.65 ? 53   ARG A NE  1 
ATOM   427   C CZ  . ARG A  1 53  ? -7.511  -29.813 -3.689  1.00 141.27 ? 53   ARG A CZ  1 
ATOM   428   N NH1 . ARG A  1 53  ? -8.751  -30.291 -3.756  1.00 134.04 ? 53   ARG A NH1 1 
ATOM   429   N NH2 . ARG A  1 53  ? -6.846  -29.574 -4.810  1.00 135.30 ? 53   ARG A NH2 1 
ATOM   430   N N   . SER A  1 54  ? -7.374  -31.471 4.362   1.00 64.82  ? 54   SER A N   1 
ATOM   431   C CA  . SER A  1 54  ? -7.846  -31.339 5.730   1.00 63.72  ? 54   SER A CA  1 
ATOM   432   C C   . SER A  1 54  ? -6.692  -31.080 6.731   1.00 64.82  ? 54   SER A C   1 
ATOM   433   O O   . SER A  1 54  ? -6.901  -30.409 7.749   1.00 63.12  ? 54   SER A O   1 
ATOM   434   C CB  . SER A  1 54  ? -8.625  -32.587 6.136   1.00 68.38  ? 54   SER A CB  1 
ATOM   435   O OG  . SER A  1 54  ? -7.772  -33.712 6.295   1.00 80.36  ? 54   SER A OG  1 
ATOM   436   N N   . VAL A  1 55  ? -5.489  -31.634 6.436   1.00 60.05  ? 55   VAL A N   1 
ATOM   437   C CA  . VAL A  1 55  ? -4.298  -31.585 7.299   1.00 57.98  ? 55   VAL A CA  1 
ATOM   438   C C   . VAL A  1 55  ? -3.689  -30.198 7.388   1.00 64.94  ? 55   VAL A C   1 
ATOM   439   O O   . VAL A  1 55  ? -3.300  -29.618 6.357   1.00 66.53  ? 55   VAL A O   1 
ATOM   440   C CB  . VAL A  1 55  ? -3.238  -32.678 6.995   1.00 58.93  ? 55   VAL A CB  1 
ATOM   441   C CG1 . VAL A  1 55  ? -2.126  -32.627 8.018   1.00 57.56  ? 55   VAL A CG1 1 
ATOM   442   C CG2 . VAL A  1 55  ? -3.851  -34.068 6.991   1.00 58.09  ? 55   VAL A CG2 1 
ATOM   443   N N   . ARG A  1 56  ? -3.604  -29.701 8.650   1.00 59.39  ? 56   ARG A N   1 
ATOM   444   C CA  . ARG A  1 56  ? -3.064  -28.417 9.093   1.00 58.26  ? 56   ARG A CA  1 
ATOM   445   C C   . ARG A  1 56  ? -1.719  -28.633 9.833   1.00 60.83  ? 56   ARG A C   1 
ATOM   446   O O   . ARG A  1 56  ? -0.806  -27.810 9.740   1.00 61.92  ? 56   ARG A O   1 
ATOM   447   C CB  . ARG A  1 56  ? -4.015  -27.843 10.137  1.00 57.83  ? 56   ARG A CB  1 
ATOM   448   C CG  . ARG A  1 56  ? -4.903  -26.677 9.763   1.00 75.06  ? 56   ARG A CG  1 
ATOM   449   C CD  . ARG A  1 56  ? -5.414  -25.980 11.050  1.00 102.47 ? 56   ARG A CD  1 
ATOM   450   N NE  . ARG A  1 56  ? -6.172  -26.833 11.997  1.00 111.68 ? 56   ARG A NE  1 
ATOM   451   C CZ  . ARG A  1 56  ? -5.865  -27.018 13.288  1.00 117.92 ? 56   ARG A CZ  1 
ATOM   452   N NH1 . ARG A  1 56  ? -4.790  -26.440 13.815  1.00 94.92  ? 56   ARG A NH1 1 
ATOM   453   N NH2 . ARG A  1 56  ? -6.625  -27.791 14.053  1.00 106.89 ? 56   ARG A NH2 1 
ATOM   454   N N   . GLU A  1 57  ? -1.624  -29.710 10.611  1.00 55.88  ? 57   GLU A N   1 
ATOM   455   C CA  . GLU A  1 57  ? -0.467  -29.978 11.464  1.00 55.65  ? 57   GLU A CA  1 
ATOM   456   C C   . GLU A  1 57  ? -0.129  -31.475 11.578  1.00 61.17  ? 57   GLU A C   1 
ATOM   457   O O   . GLU A  1 57  ? -1.047  -32.311 11.586  1.00 64.58  ? 57   GLU A O   1 
ATOM   458   C CB  . GLU A  1 57  ? -0.786  -29.396 12.855  1.00 55.90  ? 57   GLU A CB  1 
ATOM   459   C CG  . GLU A  1 57  ? 0.063   -29.895 14.008  1.00 64.11  ? 57   GLU A CG  1 
ATOM   460   C CD  . GLU A  1 57  ? -0.136  -29.167 15.319  1.00 91.49  ? 57   GLU A CD  1 
ATOM   461   O OE1 . GLU A  1 57  ? 0.598   -29.508 16.277  1.00 71.57  ? 57   GLU A OE1 1 
ATOM   462   O OE2 . GLU A  1 57  ? -1.010  -28.265 15.391  1.00 92.42  ? 57   GLU A OE2 1 
ATOM   463   N N   . VAL A  1 58  ? 1.179   -31.808 11.697  1.00 53.86  ? 58   VAL A N   1 
ATOM   464   C CA  . VAL A  1 58  ? 1.696   -33.164 11.870  1.00 52.91  ? 58   VAL A CA  1 
ATOM   465   C C   . VAL A  1 58  ? 2.709   -33.134 13.005  1.00 56.90  ? 58   VAL A C   1 
ATOM   466   O O   . VAL A  1 58  ? 3.728   -32.444 12.914  1.00 55.91  ? 58   VAL A O   1 
ATOM   467   C CB  . VAL A  1 58  ? 2.284   -33.754 10.564  1.00 58.26  ? 58   VAL A CB  1 
ATOM   468   C CG1 . VAL A  1 58  ? 2.985   -35.087 10.811  1.00 58.61  ? 58   VAL A CG1 1 
ATOM   469   C CG2 . VAL A  1 58  ? 1.212   -33.895 9.484   1.00 58.83  ? 58   VAL A CG2 1 
ATOM   470   N N   . THR A  1 59  ? 2.395   -33.865 14.088  1.00 54.77  ? 59   THR A N   1 
ATOM   471   C CA  . THR A  1 59  ? 3.178   -34.027 15.323  1.00 54.02  ? 59   THR A CA  1 
ATOM   472   C C   . THR A  1 59  ? 4.564   -34.653 15.110  1.00 56.90  ? 59   THR A C   1 
ATOM   473   O O   . THR A  1 59  ? 5.547   -34.184 15.692  1.00 55.64  ? 59   THR A O   1 
ATOM   474   C CB  . THR A  1 59  ? 2.298   -34.812 16.284  1.00 63.96  ? 59   THR A CB  1 
ATOM   475   O OG1 . THR A  1 59  ? 1.283   -33.911 16.658  1.00 62.42  ? 59   THR A OG1 1 
ATOM   476   C CG2 . THR A  1 59  ? 3.026   -35.325 17.533  1.00 68.26  ? 59   THR A CG2 1 
ATOM   477   N N   . GLY A  1 60  ? 4.603   -35.710 14.305  1.00 54.82  ? 60   GLY A N   1 
ATOM   478   C CA  . GLY A  1 60  ? 5.816   -36.464 14.019  1.00 57.17  ? 60   GLY A CA  1 
ATOM   479   C C   . GLY A  1 60  ? 6.420   -36.087 12.692  1.00 63.81  ? 60   GLY A C   1 
ATOM   480   O O   . GLY A  1 60  ? 6.786   -34.924 12.500  1.00 64.72  ? 60   GLY A O   1 
ATOM   481   N N   . TYR A  1 61  ? 6.504   -37.052 11.756  1.00 59.65  ? 61   TYR A N   1 
ATOM   482   C CA  . TYR A  1 61  ? 7.079   -36.781 10.444  1.00 59.26  ? 61   TYR A CA  1 
ATOM   483   C C   . TYR A  1 61  ? 6.119   -36.990 9.285   1.00 62.01  ? 61   TYR A C   1 
ATOM   484   O O   . TYR A  1 61  ? 5.058   -37.582 9.449   1.00 61.49  ? 61   TYR A O   1 
ATOM   485   C CB  . TYR A  1 61  ? 8.365   -37.584 10.231  1.00 61.07  ? 61   TYR A CB  1 
ATOM   486   C CG  . TYR A  1 61  ? 8.156   -39.082 10.188  1.00 63.14  ? 61   TYR A CG  1 
ATOM   487   C CD1 . TYR A  1 61  ? 7.711   -39.715 9.026   1.00 65.44  ? 61   TYR A CD1 1 
ATOM   488   C CD2 . TYR A  1 61  ? 8.469   -39.877 11.281  1.00 64.11  ? 61   TYR A CD2 1 
ATOM   489   C CE1 . TYR A  1 61  ? 7.561   -41.100 8.969   1.00 66.21  ? 61   TYR A CE1 1 
ATOM   490   C CE2 . TYR A  1 61  ? 8.357   -41.263 11.223  1.00 65.79  ? 61   TYR A CE2 1 
ATOM   491   C CZ  . TYR A  1 61  ? 7.880   -41.867 10.075  1.00 71.95  ? 61   TYR A CZ  1 
ATOM   492   O OH  . TYR A  1 61  ? 7.725   -43.224 10.065  1.00 73.63  ? 61   TYR A OH  1 
ATOM   493   N N   . VAL A  1 62  ? 6.534   -36.521 8.100   1.00 58.59  ? 62   VAL A N   1 
ATOM   494   C CA  . VAL A  1 62  ? 5.825   -36.636 6.839   1.00 58.35  ? 62   VAL A CA  1 
ATOM   495   C C   . VAL A  1 62  ? 6.730   -37.415 5.889   1.00 65.22  ? 62   VAL A C   1 
ATOM   496   O O   . VAL A  1 62  ? 7.814   -36.942 5.511   1.00 65.26  ? 62   VAL A O   1 
ATOM   497   C CB  . VAL A  1 62  ? 5.366   -35.273 6.258   1.00 61.03  ? 62   VAL A CB  1 
ATOM   498   C CG1 . VAL A  1 62  ? 4.723   -35.442 4.885   1.00 61.40  ? 62   VAL A CG1 1 
ATOM   499   C CG2 . VAL A  1 62  ? 4.406   -34.566 7.211   1.00 59.47  ? 62   VAL A CG2 1 
ATOM   500   N N   . LEU A  1 63  ? 6.277   -38.634 5.539   1.00 62.55  ? 63   LEU A N   1 
ATOM   501   C CA  . LEU A  1 63  ? 6.928   -39.548 4.608   1.00 63.43  ? 63   LEU A CA  1 
ATOM   502   C C   . LEU A  1 63  ? 6.045   -39.678 3.342   1.00 71.44  ? 63   LEU A C   1 
ATOM   503   O O   . LEU A  1 63  ? 4.875   -40.070 3.421   1.00 71.05  ? 63   LEU A O   1 
ATOM   504   C CB  . LEU A  1 63  ? 7.158   -40.910 5.276   1.00 62.65  ? 63   LEU A CB  1 
ATOM   505   C CG  . LEU A  1 63  ? 7.806   -42.015 4.455   1.00 68.50  ? 63   LEU A CG  1 
ATOM   506   C CD1 . LEU A  1 63  ? 9.219   -41.652 4.015   1.00 69.98  ? 63   LEU A CD1 1 
ATOM   507   C CD2 . LEU A  1 63  ? 7.887   -43.255 5.257   1.00 71.07  ? 63   LEU A CD2 1 
ATOM   508   N N   . VAL A  1 64  ? 6.602   -39.270 2.189   1.00 69.69  ? 64   VAL A N   1 
ATOM   509   C CA  . VAL A  1 64  ? 5.945   -39.314 0.887   1.00 69.86  ? 64   VAL A CA  1 
ATOM   510   C C   . VAL A  1 64  ? 6.921   -40.033 -0.027  1.00 73.83  ? 64   VAL A C   1 
ATOM   511   O O   . VAL A  1 64  ? 7.858   -39.425 -0.547  1.00 74.46  ? 64   VAL A O   1 
ATOM   512   C CB  . VAL A  1 64  ? 5.549   -37.908 0.350   1.00 73.63  ? 64   VAL A CB  1 
ATOM   513   C CG1 . VAL A  1 64  ? 4.741   -38.024 -0.936  1.00 74.89  ? 64   VAL A CG1 1 
ATOM   514   C CG2 . VAL A  1 64  ? 4.774   -37.108 1.388   1.00 71.15  ? 64   VAL A CG2 1 
ATOM   515   N N   . ALA A  1 65  ? 6.746   -41.344 -0.156  1.00 70.51  ? 65   ALA A N   1 
ATOM   516   C CA  . ALA A  1 65  ? 7.650   -42.161 -0.961  1.00 72.91  ? 65   ALA A CA  1 
ATOM   517   C C   . ALA A  1 65  ? 6.929   -43.191 -1.838  1.00 80.01  ? 65   ALA A C   1 
ATOM   518   O O   . ALA A  1 65  ? 5.780   -43.534 -1.579  1.00 80.00  ? 65   ALA A O   1 
ATOM   519   C CB  . ALA A  1 65  ? 8.672   -42.852 -0.063  1.00 73.34  ? 65   ALA A CB  1 
ATOM   520   N N   . LEU A  1 66  ? 7.610   -43.662 -2.895  1.00 77.86  ? 66   LEU A N   1 
ATOM   521   C CA  . LEU A  1 66  ? 7.165   -44.718 -3.806  1.00 78.39  ? 66   LEU A CA  1 
ATOM   522   C C   . LEU A  1 66  ? 5.773   -44.551 -4.397  1.00 86.51  ? 66   LEU A C   1 
ATOM   523   O O   . LEU A  1 66  ? 5.118   -45.542 -4.701  1.00 88.52  ? 66   LEU A O   1 
ATOM   524   C CB  . LEU A  1 66  ? 7.361   -46.096 -3.139  1.00 77.24  ? 66   LEU A CB  1 
ATOM   525   C CG  . LEU A  1 66  ? 8.793   -46.386 -2.643  1.00 80.56  ? 66   LEU A CG  1 
ATOM   526   C CD1 . LEU A  1 66  ? 8.806   -47.450 -1.569  1.00 79.18  ? 66   LEU A CD1 1 
ATOM   527   C CD2 . LEU A  1 66  ? 9.758   -46.699 -3.802  1.00 82.86  ? 66   LEU A CD2 1 
ATOM   528   N N   . ASN A  1 67  ? 5.340   -43.300 -4.614  1.00 84.03  ? 67   ASN A N   1 
ATOM   529   C CA  . ASN A  1 67  ? 4.021   -42.985 -5.171  1.00 84.38  ? 67   ASN A CA  1 
ATOM   530   C C   . ASN A  1 67  ? 4.124   -42.604 -6.634  1.00 93.34  ? 67   ASN A C   1 
ATOM   531   O O   . ASN A  1 67  ? 5.215   -42.281 -7.092  1.00 95.52  ? 67   ASN A O   1 
ATOM   532   C CB  . ASN A  1 67  ? 3.377   -41.860 -4.389  1.00 79.84  ? 67   ASN A CB  1 
ATOM   533   C CG  . ASN A  1 67  ? 3.212   -42.159 -2.927  1.00 98.54  ? 67   ASN A CG  1 
ATOM   534   O OD1 . ASN A  1 67  ? 2.470   -43.058 -2.534  1.00 94.06  ? 67   ASN A OD1 1 
ATOM   535   N ND2 . ASN A  1 67  ? 3.897   -41.399 -2.086  1.00 88.32  ? 67   ASN A ND2 1 
ATOM   536   N N   . GLN A  1 68  ? 2.997   -42.651 -7.371  1.00 90.59  ? 68   GLN A N   1 
ATOM   537   C CA  . GLN A  1 68  ? 2.980   -42.324 -8.798  1.00 92.98  ? 68   GLN A CA  1 
ATOM   538   C C   . GLN A  1 68  ? 2.066   -41.129 -9.167  1.00 98.56  ? 68   GLN A C   1 
ATOM   539   O O   . GLN A  1 68  ? 2.061   -40.711 -10.339 1.00 101.48 ? 68   GLN A O   1 
ATOM   540   C CB  . GLN A  1 68  ? 2.651   -43.567 -9.651  1.00 96.27  ? 68   GLN A CB  1 
ATOM   541   C CG  . GLN A  1 68  ? 3.780   -44.585 -9.757  1.00 114.37 ? 68   GLN A CG  1 
ATOM   542   C CD  . GLN A  1 68  ? 3.495   -45.826 -8.947  1.00 141.15 ? 68   GLN A CD  1 
ATOM   543   O OE1 . GLN A  1 68  ? 3.084   -46.865 -9.479  1.00 143.05 ? 68   GLN A OE1 1 
ATOM   544   N NE2 . GLN A  1 68  ? 3.720   -45.757 -7.640  1.00 128.52 ? 68   GLN A NE2 1 
ATOM   545   N N   . PHE A  1 69  ? 1.307   -40.574 -8.185  1.00 91.50  ? 69   PHE A N   1 
ATOM   546   C CA  . PHE A  1 69  ? 0.397   -39.446 -8.424  1.00 90.51  ? 69   PHE A CA  1 
ATOM   547   C C   . PHE A  1 69  ? 1.143   -38.151 -8.745  1.00 92.86  ? 69   PHE A C   1 
ATOM   548   O O   . PHE A  1 69  ? 2.231   -37.929 -8.217  1.00 92.42  ? 69   PHE A O   1 
ATOM   549   C CB  . PHE A  1 69  ? -0.582  -39.255 -7.259  1.00 90.21  ? 69   PHE A CB  1 
ATOM   550   C CG  . PHE A  1 69  ? 0.067   -39.045 -5.914  1.00 90.11  ? 69   PHE A CG  1 
ATOM   551   C CD1 . PHE A  1 69  ? 0.484   -37.781 -5.514  1.00 91.85  ? 69   PHE A CD1 1 
ATOM   552   C CD2 . PHE A  1 69  ? 0.246   -40.110 -5.035  1.00 91.86  ? 69   PHE A CD2 1 
ATOM   553   C CE1 . PHE A  1 69  ? 1.092   -37.593 -4.269  1.00 90.67  ? 69   PHE A CE1 1 
ATOM   554   C CE2 . PHE A  1 69  ? 0.819   -39.913 -3.773  1.00 92.07  ? 69   PHE A CE2 1 
ATOM   555   C CZ  . PHE A  1 69  ? 1.258   -38.662 -3.410  1.00 88.84  ? 69   PHE A CZ  1 
ATOM   556   N N   . ARG A  1 70  ? 0.548   -37.307 -9.601  1.00 88.93  ? 70   ARG A N   1 
ATOM   557   C CA  . ARG A  1 70  ? 1.111   -36.049 -10.114 1.00 89.31  ? 70   ARG A CA  1 
ATOM   558   C C   . ARG A  1 70  ? 1.357   -34.961 -9.068  1.00 89.45  ? 70   ARG A C   1 
ATOM   559   O O   . ARG A  1 70  ? 2.368   -34.255 -9.154  1.00 89.25  ? 70   ARG A O   1 
ATOM   560   C CB  . ARG A  1 70  ? 0.170   -35.474 -11.200 1.00 92.35  ? 70   ARG A CB  1 
ATOM   561   C CG  . ARG A  1 70  ? 0.810   -34.488 -12.148 1.00 104.02 ? 70   ARG A CG  1 
ATOM   562   C CD  . ARG A  1 70  ? -0.144  -33.402 -12.609 1.00 113.63 ? 70   ARG A CD  1 
ATOM   563   N NE  . ARG A  1 70  ? 0.568   -32.129 -12.554 1.00 122.05 ? 70   ARG A NE  1 
ATOM   564   C CZ  . ARG A  1 70  ? 0.210   -31.075 -11.825 1.00 132.69 ? 70   ARG A CZ  1 
ATOM   565   N NH1 . ARG A  1 70  ? -0.929  -31.085 -11.138 1.00 115.05 ? 70   ARG A NH1 1 
ATOM   566   N NH2 . ARG A  1 70  ? 0.936   -29.970 -11.851 1.00 117.86 ? 70   ARG A NH2 1 
ATOM   567   N N   . TYR A  1 71  ? 0.396   -34.773 -8.134  1.00 81.64  ? 71   TYR A N   1 
ATOM   568   C CA  . TYR A  1 71  ? 0.428   -33.664 -7.194  1.00 78.26  ? 71   TYR A CA  1 
ATOM   569   C C   . TYR A  1 71  ? 0.049   -34.039 -5.773  1.00 81.40  ? 71   TYR A C   1 
ATOM   570   O O   . TYR A  1 71  ? -0.887  -34.811 -5.576  1.00 80.61  ? 71   TYR A O   1 
ATOM   571   C CB  . TYR A  1 71  ? -0.495  -32.581 -7.755  1.00 78.68  ? 71   TYR A CB  1 
ATOM   572   C CG  . TYR A  1 71  ? -0.797  -31.409 -6.854  1.00 77.36  ? 71   TYR A CG  1 
ATOM   573   C CD1 . TYR A  1 71  ? 0.072   -30.319 -6.778  1.00 79.69  ? 71   TYR A CD1 1 
ATOM   574   C CD2 . TYR A  1 71  ? -2.004  -31.328 -6.168  1.00 75.57  ? 71   TYR A CD2 1 
ATOM   575   C CE1 . TYR A  1 71  ? -0.233  -29.202 -5.999  1.00 78.52  ? 71   TYR A CE1 1 
ATOM   576   C CE2 . TYR A  1 71  ? -2.324  -30.212 -5.394  1.00 74.62  ? 71   TYR A CE2 1 
ATOM   577   C CZ  . TYR A  1 71  ? -1.431  -29.156 -5.310  1.00 81.78  ? 71   TYR A CZ  1 
ATOM   578   O OH  . TYR A  1 71  ? -1.709  -28.069 -4.534  1.00 82.19  ? 71   TYR A OH  1 
ATOM   579   N N   . LEU A  1 72  ? 0.774   -33.450 -4.777  1.00 77.86  ? 72   LEU A N   1 
ATOM   580   C CA  . LEU A  1 72  ? 0.592   -33.663 -3.332  1.00 75.29  ? 72   LEU A CA  1 
ATOM   581   C C   . LEU A  1 72  ? -0.238  -32.530 -2.741  1.00 77.15  ? 72   LEU A C   1 
ATOM   582   O O   . LEU A  1 72  ? 0.283   -31.431 -2.560  1.00 75.29  ? 72   LEU A O   1 
ATOM   583   C CB  . LEU A  1 72  ? 1.958   -33.755 -2.651  1.00 75.12  ? 72   LEU A CB  1 
ATOM   584   C CG  . LEU A  1 72  ? 1.957   -34.041 -1.158  1.00 78.27  ? 72   LEU A CG  1 
ATOM   585   C CD1 . LEU A  1 72  ? 1.287   -35.401 -0.824  1.00 77.64  ? 72   LEU A CD1 1 
ATOM   586   C CD2 . LEU A  1 72  ? 3.370   -33.958 -0.623  1.00 80.76  ? 72   LEU A CD2 1 
ATOM   587   N N   . PRO A  1 73  ? -1.545  -32.762 -2.469  1.00 74.49  ? 73   PRO A N   1 
ATOM   588   C CA  . PRO A  1 73  ? -2.414  -31.659 -2.028  1.00 73.65  ? 73   PRO A CA  1 
ATOM   589   C C   . PRO A  1 73  ? -2.459  -31.372 -0.535  1.00 77.25  ? 73   PRO A C   1 
ATOM   590   O O   . PRO A  1 73  ? -3.547  -31.328 0.055   1.00 78.62  ? 73   PRO A O   1 
ATOM   591   C CB  . PRO A  1 73  ? -3.782  -32.045 -2.604  1.00 75.77  ? 73   PRO A CB  1 
ATOM   592   C CG  . PRO A  1 73  ? -3.751  -33.515 -2.677  1.00 79.96  ? 73   PRO A CG  1 
ATOM   593   C CD  . PRO A  1 73  ? -2.328  -33.995 -2.682  1.00 76.20  ? 73   PRO A CD  1 
ATOM   594   N N   . LEU A  1 74  ? -1.296  -31.118 0.069   1.00 70.95  ? 74   LEU A N   1 
ATOM   595   C CA  . LEU A  1 74  ? -1.215  -30.786 1.492   1.00 68.37  ? 74   LEU A CA  1 
ATOM   596   C C   . LEU A  1 74  ? -1.242  -29.239 1.672   1.00 73.11  ? 74   LEU A C   1 
ATOM   597   O O   . LEU A  1 74  ? -0.508  -28.661 2.497   1.00 72.87  ? 74   LEU A O   1 
ATOM   598   C CB  . LEU A  1 74  ? 0.058   -31.415 2.092   1.00 67.28  ? 74   LEU A CB  1 
ATOM   599   C CG  . LEU A  1 74  ? 0.032   -32.911 2.293   1.00 70.21  ? 74   LEU A CG  1 
ATOM   600   C CD1 . LEU A  1 74  ? 1.420   -33.431 2.586   1.00 68.94  ? 74   LEU A CD1 1 
ATOM   601   C CD2 . LEU A  1 74  ? -0.954  -33.300 3.383   1.00 70.17  ? 74   LEU A CD2 1 
ATOM   602   N N   . GLU A  1 75  ? -2.087  -28.583 0.852   1.00 68.60  ? 75   GLU A N   1 
ATOM   603   C CA  . GLU A  1 75  ? -2.278  -27.133 0.731   1.00 67.41  ? 75   GLU A CA  1 
ATOM   604   C C   . GLU A  1 75  ? -2.593  -26.383 2.046   1.00 66.94  ? 75   GLU A C   1 
ATOM   605   O O   . GLU A  1 75  ? -2.435  -25.155 2.091   1.00 66.57  ? 75   GLU A O   1 
ATOM   606   C CB  . GLU A  1 75  ? -3.339  -26.818 -0.342  1.00 69.94  ? 75   GLU A CB  1 
ATOM   607   C CG  . GLU A  1 75  ? -3.236  -27.633 -1.616  1.00 72.75  ? 75   GLU A CG  1 
ATOM   608   C CD  . GLU A  1 75  ? -4.458  -27.539 -2.503  1.00 101.37 ? 75   GLU A CD  1 
ATOM   609   O OE1 . GLU A  1 75  ? -4.461  -28.188 -3.574  1.00 101.46 ? 75   GLU A OE1 1 
ATOM   610   O OE2 . GLU A  1 75  ? -5.434  -26.855 -2.112  1.00 106.24 ? 75   GLU A OE2 1 
ATOM   611   N N   . ASN A  1 76  ? -3.042  -27.099 3.097   1.00 60.65  ? 76   ASN A N   1 
ATOM   612   C CA  . ASN A  1 76  ? -3.313  -26.468 4.394   1.00 59.03  ? 76   ASN A CA  1 
ATOM   613   C C   . ASN A  1 76  ? -2.273  -26.776 5.501   1.00 58.72  ? 76   ASN A C   1 
ATOM   614   O O   . ASN A  1 76  ? -2.293  -26.119 6.550   1.00 54.72  ? 76   ASN A O   1 
ATOM   615   C CB  . ASN A  1 76  ? -4.753  -26.704 4.860   1.00 62.50  ? 76   ASN A CB  1 
ATOM   616   C CG  . ASN A  1 76  ? -5.762  -25.991 4.019   1.00 83.00  ? 76   ASN A CG  1 
ATOM   617   O OD1 . ASN A  1 76  ? -5.791  -24.764 3.944   1.00 69.45  ? 76   ASN A OD1 1 
ATOM   618   N ND2 . ASN A  1 76  ? -6.553  -26.758 3.299   1.00 88.32  ? 76   ASN A ND2 1 
ATOM   619   N N   . LEU A  1 77  ? -1.343  -27.743 5.233   1.00 55.29  ? 77   LEU A N   1 
ATOM   620   C CA  . LEU A  1 77  ? -0.258  -28.130 6.146   1.00 52.82  ? 77   LEU A CA  1 
ATOM   621   C C   . LEU A  1 77  ? 0.639   -26.932 6.452   1.00 60.80  ? 77   LEU A C   1 
ATOM   622   O O   . LEU A  1 77  ? 1.206   -26.356 5.536   1.00 63.87  ? 77   LEU A O   1 
ATOM   623   C CB  . LEU A  1 77  ? 0.563   -29.320 5.595   1.00 51.13  ? 77   LEU A CB  1 
ATOM   624   C CG  . LEU A  1 77  ? 1.705   -29.825 6.488   1.00 50.60  ? 77   LEU A CG  1 
ATOM   625   C CD1 . LEU A  1 77  ? 1.186   -30.466 7.799   1.00 47.31  ? 77   LEU A CD1 1 
ATOM   626   C CD2 . LEU A  1 77  ? 2.621   -30.773 5.724   1.00 49.22  ? 77   LEU A CD2 1 
ATOM   627   N N   . ARG A  1 78  ? 0.746   -26.556 7.722   1.00 56.64  ? 78   ARG A N   1 
ATOM   628   C CA  . ARG A  1 78  ? 1.522   -25.397 8.153   1.00 57.31  ? 78   ARG A CA  1 
ATOM   629   C C   . ARG A  1 78  ? 2.757   -25.814 8.930   1.00 64.37  ? 78   ARG A C   1 
ATOM   630   O O   . ARG A  1 78  ? 3.841   -25.238 8.771   1.00 64.71  ? 78   ARG A O   1 
ATOM   631   C CB  . ARG A  1 78  ? 0.615   -24.506 9.034   1.00 55.39  ? 78   ARG A CB  1 
ATOM   632   C CG  . ARG A  1 78  ? 1.298   -23.399 9.861   1.00 63.88  ? 78   ARG A CG  1 
ATOM   633   C CD  . ARG A  1 78  ? 1.668   -22.135 9.086   1.00 68.29  ? 78   ARG A CD  1 
ATOM   634   N NE  . ARG A  1 78  ? 0.551   -21.602 8.306   1.00 60.49  ? 78   ARG A NE  1 
ATOM   635   C CZ  . ARG A  1 78  ? 0.685   -20.834 7.235   1.00 65.68  ? 78   ARG A CZ  1 
ATOM   636   N NH1 . ARG A  1 78  ? 1.888   -20.459 6.824   1.00 42.72  ? 78   ARG A NH1 1 
ATOM   637   N NH2 . ARG A  1 78  ? -0.383  -20.413 6.581   1.00 59.98  ? 78   ARG A NH2 1 
ATOM   638   N N   . ILE A  1 79  ? 2.570   -26.787 9.822   1.00 60.96  ? 79   ILE A N   1 
ATOM   639   C CA  . ILE A  1 79  ? 3.626   -27.200 10.728  1.00 59.84  ? 79   ILE A CA  1 
ATOM   640   C C   . ILE A  1 79  ? 3.826   -28.711 10.750  1.00 63.57  ? 79   ILE A C   1 
ATOM   641   O O   . ILE A  1 79  ? 2.853   -29.463 10.683  1.00 63.37  ? 79   ILE A O   1 
ATOM   642   C CB  . ILE A  1 79  ? 3.343   -26.578 12.153  1.00 60.57  ? 79   ILE A CB  1 
ATOM   643   C CG1 . ILE A  1 79  ? 4.383   -26.967 13.212  1.00 60.29  ? 79   ILE A CG1 1 
ATOM   644   C CG2 . ILE A  1 79  ? 1.938   -26.865 12.640  1.00 57.96  ? 79   ILE A CG2 1 
ATOM   645   C CD1 . ILE A  1 79  ? 4.278   -26.188 14.433  1.00 65.25  ? 79   ILE A CD1 1 
ATOM   646   N N   . ILE A  1 80  ? 5.110   -29.130 10.801  1.00 59.24  ? 80   ILE A N   1 
ATOM   647   C CA  . ILE A  1 80  ? 5.594   -30.492 11.033  1.00 57.49  ? 80   ILE A CA  1 
ATOM   648   C C   . ILE A  1 80  ? 6.466   -30.324 12.278  1.00 60.31  ? 80   ILE A C   1 
ATOM   649   O O   . ILE A  1 80  ? 7.478   -29.621 12.220  1.00 61.20  ? 80   ILE A O   1 
ATOM   650   C CB  . ILE A  1 80  ? 6.370   -31.125 9.863   1.00 60.95  ? 80   ILE A CB  1 
ATOM   651   C CG1 . ILE A  1 80  ? 5.540   -31.143 8.558   1.00 61.48  ? 80   ILE A CG1 1 
ATOM   652   C CG2 . ILE A  1 80  ? 6.834   -32.540 10.269  1.00 60.78  ? 80   ILE A CG2 1 
ATOM   653   C CD1 . ILE A  1 80  ? 6.360   -31.381 7.328   1.00 68.24  ? 80   ILE A CD1 1 
ATOM   654   N N   . ARG A  1 81  ? 6.032   -30.866 13.419  1.00 54.88  ? 81   ARG A N   1 
ATOM   655   C CA  . ARG A  1 81  ? 6.762   -30.685 14.682  1.00 52.96  ? 81   ARG A CA  1 
ATOM   656   C C   . ARG A  1 81  ? 8.020   -31.504 14.805  1.00 60.11  ? 81   ARG A C   1 
ATOM   657   O O   . ARG A  1 81  ? 8.967   -31.089 15.493  1.00 61.00  ? 81   ARG A O   1 
ATOM   658   C CB  . ARG A  1 81  ? 5.862   -30.922 15.882  1.00 46.22  ? 81   ARG A CB  1 
ATOM   659   C CG  . ARG A  1 81  ? 4.595   -30.114 15.827  1.00 33.56  ? 81   ARG A CG  1 
ATOM   660   C CD  . ARG A  1 81  ? 4.301   -29.582 17.177  1.00 19.96  ? 81   ARG A CD  1 
ATOM   661   N NE  . ARG A  1 81  ? 3.086   -28.782 17.142  1.00 43.37  ? 81   ARG A NE  1 
ATOM   662   C CZ  . ARG A  1 81  ? 3.014   -27.539 17.597  1.00 57.43  ? 81   ARG A CZ  1 
ATOM   663   N NH1 . ARG A  1 81  ? 4.072   -26.970 18.161  1.00 37.91  ? 81   ARG A NH1 1 
ATOM   664   N NH2 . ARG A  1 81  ? 1.884   -26.857 17.501  1.00 50.66  ? 81   ARG A NH2 1 
ATOM   665   N N   . GLY A  1 82  ? 8.021   -32.656 14.140  1.00 57.64  ? 82   GLY A N   1 
ATOM   666   C CA  . GLY A  1 82  ? 9.152   -33.571 14.128  1.00 58.24  ? 82   GLY A CA  1 
ATOM   667   C C   . GLY A  1 82  ? 9.482   -34.149 15.481  1.00 62.89  ? 82   GLY A C   1 
ATOM   668   O O   . GLY A  1 82  ? 10.667  -34.310 15.787  1.00 63.61  ? 82   GLY A O   1 
ATOM   669   N N   . THR A  1 83  ? 8.435   -34.462 16.314  1.00 58.51  ? 83   THR A N   1 
ATOM   670   C CA  . THR A  1 83  ? 8.628   -35.046 17.648  1.00 57.96  ? 83   THR A CA  1 
ATOM   671   C C   . THR A  1 83  ? 9.255   -36.431 17.517  1.00 67.58  ? 83   THR A C   1 
ATOM   672   O O   . THR A  1 83  ? 10.049  -36.832 18.377  1.00 70.74  ? 83   THR A O   1 
ATOM   673   C CB  . THR A  1 83  ? 7.389   -35.011 18.500  1.00 57.33  ? 83   THR A CB  1 
ATOM   674   O OG1 . THR A  1 83  ? 6.399   -35.850 17.939  1.00 57.31  ? 83   THR A OG1 1 
ATOM   675   C CG2 . THR A  1 83  ? 6.851   -33.610 18.684  1.00 55.75  ? 83   THR A CG2 1 
ATOM   676   N N   . LYS A  1 84  ? 8.968   -37.115 16.391  1.00 63.08  ? 84   LYS A N   1 
ATOM   677   C CA  . LYS A  1 84  ? 9.543   -38.396 16.004  1.00 62.90  ? 84   LYS A CA  1 
ATOM   678   C C   . LYS A  1 84  ? 9.940   -38.207 14.548  1.00 68.50  ? 84   LYS A C   1 
ATOM   679   O O   . LYS A  1 84  ? 9.156   -37.660 13.765  1.00 70.50  ? 84   LYS A O   1 
ATOM   680   C CB  . LYS A  1 84  ? 8.521   -39.531 16.165  1.00 64.41  ? 84   LYS A CB  1 
ATOM   681   C CG  . LYS A  1 84  ? 8.365   -40.082 17.598  1.00 79.75  ? 84   LYS A CG  1 
ATOM   682   C CD  . LYS A  1 84  ? 7.357   -41.251 17.629  1.00 97.70  ? 84   LYS A CD  1 
ATOM   683   C CE  . LYS A  1 84  ? 6.373   -41.352 18.798  1.00 109.85 ? 84   LYS A CE  1 
ATOM   684   N NZ  . LYS A  1 84  ? 5.233   -42.294 18.509  1.00 114.73 ? 84   LYS A NZ  1 
ATOM   685   N N   . LEU A  1 85  ? 11.152  -38.613 14.183  1.00 65.21  ? 85   LEU A N   1 
ATOM   686   C CA  . LEU A  1 85  ? 11.677  -38.411 12.825  1.00 66.20  ? 85   LEU A CA  1 
ATOM   687   C C   . LEU A  1 85  ? 11.899  -39.673 12.006  1.00 72.04  ? 85   LEU A C   1 
ATOM   688   O O   . LEU A  1 85  ? 12.315  -40.699 12.556  1.00 73.37  ? 85   LEU A O   1 
ATOM   689   C CB  . LEU A  1 85  ? 13.007  -37.626 12.889  1.00 66.55  ? 85   LEU A CB  1 
ATOM   690   C CG  . LEU A  1 85  ? 12.966  -36.281 13.603  1.00 68.94  ? 85   LEU A CG  1 
ATOM   691   C CD1 . LEU A  1 85  ? 14.331  -35.769 13.841  1.00 68.61  ? 85   LEU A CD1 1 
ATOM   692   C CD2 . LEU A  1 85  ? 12.119  -35.289 12.861  1.00 70.68  ? 85   LEU A CD2 1 
ATOM   693   N N   . TYR A  1 86  ? 11.703  -39.569 10.668  1.00 67.46  ? 86   TYR A N   1 
ATOM   694   C CA  . TYR A  1 86  ? 12.001  -40.674 9.765   1.00 67.64  ? 86   TYR A CA  1 
ATOM   695   C C   . TYR A  1 86  ? 13.512  -40.851 9.760   1.00 72.32  ? 86   TYR A C   1 
ATOM   696   O O   . TYR A  1 86  ? 14.250  -39.857 9.673   1.00 71.63  ? 86   TYR A O   1 
ATOM   697   C CB  . TYR A  1 86  ? 11.477  -40.430 8.340   1.00 68.03  ? 86   TYR A CB  1 
ATOM   698   C CG  . TYR A  1 86  ? 11.760  -41.596 7.410   1.00 70.43  ? 86   TYR A CG  1 
ATOM   699   C CD1 . TYR A  1 86  ? 11.079  -42.802 7.544   1.00 73.03  ? 86   TYR A CD1 1 
ATOM   700   C CD2 . TYR A  1 86  ? 12.702  -41.492 6.391   1.00 71.59  ? 86   TYR A CD2 1 
ATOM   701   C CE1 . TYR A  1 86  ? 11.337  -43.879 6.693   1.00 75.61  ? 86   TYR A CE1 1 
ATOM   702   C CE2 . TYR A  1 86  ? 12.947  -42.555 5.515   1.00 73.23  ? 86   TYR A CE2 1 
ATOM   703   C CZ  . TYR A  1 86  ? 12.275  -43.751 5.683   1.00 77.05  ? 86   TYR A CZ  1 
ATOM   704   O OH  . TYR A  1 86  ? 12.530  -44.818 4.862   1.00 73.40  ? 86   TYR A OH  1 
ATOM   705   N N   . GLU A  1 87  ? 13.970  -42.106 9.938   1.00 70.29  ? 87   GLU A N   1 
ATOM   706   C CA  . GLU A  1 87  ? 15.402  -42.467 10.007  1.00 71.58  ? 87   GLU A CA  1 
ATOM   707   C C   . GLU A  1 87  ? 16.107  -41.654 11.095  1.00 77.79  ? 87   GLU A C   1 
ATOM   708   O O   . GLU A  1 87  ? 17.314  -41.396 11.024  1.00 78.02  ? 87   GLU A O   1 
ATOM   709   C CB  . GLU A  1 87  ? 16.095  -42.361 8.637   1.00 73.70  ? 87   GLU A CB  1 
ATOM   710   C CG  . GLU A  1 87  ? 15.720  -43.522 7.742   1.00 82.29  ? 87   GLU A CG  1 
ATOM   711   C CD  . GLU A  1 87  ? 16.283  -43.547 6.332   1.00 110.96 ? 87   GLU A CD  1 
ATOM   712   O OE1 . GLU A  1 87  ? 16.848  -42.524 5.874   1.00 114.30 ? 87   GLU A OE1 1 
ATOM   713   O OE2 . GLU A  1 87  ? 16.126  -44.599 5.670   1.00 99.87  ? 87   GLU A OE2 1 
ATOM   714   N N   . ASP A  1 88  ? 15.317  -41.245 12.117  1.00 75.16  ? 88   ASP A N   1 
ATOM   715   C CA  . ASP A  1 88  ? 15.746  -40.434 13.260  1.00 74.93  ? 88   ASP A CA  1 
ATOM   716   C C   . ASP A  1 88  ? 16.465  -39.142 12.854  1.00 78.82  ? 88   ASP A C   1 
ATOM   717   O O   . ASP A  1 88  ? 17.201  -38.572 13.659  1.00 78.59  ? 88   ASP A O   1 
ATOM   718   C CB  . ASP A  1 88  ? 16.522  -41.273 14.302  1.00 78.00  ? 88   ASP A CB  1 
ATOM   719   C CG  . ASP A  1 88  ? 15.684  -42.365 14.964  1.00 95.61  ? 88   ASP A CG  1 
ATOM   720   O OD1 . ASP A  1 88  ? 14.426  -42.259 14.938  1.00 96.74  ? 88   ASP A OD1 1 
ATOM   721   O OD2 . ASP A  1 88  ? 16.281  -43.329 15.503  1.00 105.17 ? 88   ASP A OD2 1 
ATOM   722   N N   . ARG A  1 89  ? 16.190  -38.655 11.618  1.00 74.96  ? 89   ARG A N   1 
ATOM   723   C CA  . ARG A  1 89  ? 16.775  -37.435 11.068  1.00 74.75  ? 89   ARG A CA  1 
ATOM   724   C C   . ARG A  1 89  ? 15.845  -36.535 10.254  1.00 75.44  ? 89   ARG A C   1 
ATOM   725   O O   . ARG A  1 89  ? 16.031  -35.314 10.292  1.00 73.73  ? 89   ARG A O   1 
ATOM   726   C CB  . ARG A  1 89  ? 18.101  -37.703 10.330  1.00 79.74  ? 89   ARG A CB  1 
ATOM   727   C CG  . ARG A  1 89  ? 18.021  -38.678 9.168   1.00 102.65 ? 89   ARG A CG  1 
ATOM   728   C CD  . ARG A  1 89  ? 19.342  -39.421 8.976   1.00 125.13 ? 89   ARG A CD  1 
ATOM   729   N NE  . ARG A  1 89  ? 19.219  -40.467 7.959   1.00 141.53 ? 89   ARG A NE  1 
ATOM   730   C CZ  . ARG A  1 89  ? 20.018  -40.595 6.906   1.00 159.49 ? 89   ARG A CZ  1 
ATOM   731   N NH1 . ARG A  1 89  ? 21.039  -39.767 6.736   1.00 152.18 ? 89   ARG A NH1 1 
ATOM   732   N NH2 . ARG A  1 89  ? 19.814  -41.567 6.024   1.00 144.90 ? 89   ARG A NH2 1 
ATOM   733   N N   . TYR A  1 90  ? 14.860  -37.105 9.517   1.00 70.00  ? 90   TYR A N   1 
ATOM   734   C CA  . TYR A  1 90  ? 13.992  -36.257 8.694   1.00 67.34  ? 90   TYR A CA  1 
ATOM   735   C C   . TYR A  1 90  ? 12.591  -36.043 9.183   1.00 65.71  ? 90   TYR A C   1 
ATOM   736   O O   . TYR A  1 90  ? 11.873  -37.003 9.460   1.00 65.78  ? 90   TYR A O   1 
ATOM   737   C CB  . TYR A  1 90  ? 13.963  -36.705 7.243   1.00 69.80  ? 90   TYR A CB  1 
ATOM   738   C CG  . TYR A  1 90  ? 15.315  -37.052 6.676   1.00 74.90  ? 90   TYR A CG  1 
ATOM   739   C CD1 . TYR A  1 90  ? 15.590  -38.336 6.219   1.00 78.80  ? 90   TYR A CD1 1 
ATOM   740   C CD2 . TYR A  1 90  ? 16.327  -36.100 6.601   1.00 77.09  ? 90   TYR A CD2 1 
ATOM   741   C CE1 . TYR A  1 90  ? 16.833  -38.662 5.681   1.00 83.28  ? 90   TYR A CE1 1 
ATOM   742   C CE2 . TYR A  1 90  ? 17.582  -36.419 6.077   1.00 80.35  ? 90   TYR A CE2 1 
ATOM   743   C CZ  . TYR A  1 90  ? 17.826  -37.700 5.612   1.00 88.78  ? 90   TYR A CZ  1 
ATOM   744   O OH  . TYR A  1 90  ? 19.037  -38.021 5.068   1.00 90.22  ? 90   TYR A OH  1 
ATOM   745   N N   . ALA A  1 91  ? 12.186  -34.768 9.227   1.00 58.13  ? 91   ALA A N   1 
ATOM   746   C CA  . ALA A  1 91  ? 10.830  -34.345 9.553   1.00 55.28  ? 91   ALA A CA  1 
ATOM   747   C C   . ALA A  1 91  ? 9.975   -34.429 8.272   1.00 60.81  ? 91   ALA A C   1 
ATOM   748   O O   . ALA A  1 91  ? 8.786   -34.678 8.362   1.00 59.43  ? 91   ALA A O   1 
ATOM   749   C CB  . ALA A  1 91  ? 10.849  -32.928 10.072  1.00 54.47  ? 91   ALA A CB  1 
ATOM   750   N N   . LEU A  1 92  ? 10.599  -34.221 7.080   1.00 60.16  ? 92   LEU A N   1 
ATOM   751   C CA  . LEU A  1 92  ? 9.975   -34.304 5.764   1.00 60.98  ? 92   LEU A CA  1 
ATOM   752   C C   . LEU A  1 92  ? 10.862  -35.110 4.847   1.00 69.94  ? 92   LEU A C   1 
ATOM   753   O O   . LEU A  1 92  ? 12.021  -34.757 4.636   1.00 69.95  ? 92   LEU A O   1 
ATOM   754   C CB  . LEU A  1 92  ? 9.722   -32.910 5.178   1.00 60.81  ? 92   LEU A CB  1 
ATOM   755   C CG  . LEU A  1 92  ? 9.011   -32.830 3.831   1.00 65.57  ? 92   LEU A CG  1 
ATOM   756   C CD1 . LEU A  1 92  ? 7.603   -33.320 3.932   1.00 63.67  ? 92   LEU A CD1 1 
ATOM   757   C CD2 . LEU A  1 92  ? 9.007   -31.406 3.322   1.00 68.13  ? 92   LEU A CD2 1 
ATOM   758   N N   . ALA A  1 93  ? 10.322  -36.214 4.318   1.00 69.79  ? 93   ALA A N   1 
ATOM   759   C CA  . ALA A  1 93  ? 11.045  -37.117 3.414   1.00 71.53  ? 93   ALA A CA  1 
ATOM   760   C C   . ALA A  1 93  ? 10.170  -37.427 2.191   1.00 77.68  ? 93   ALA A C   1 
ATOM   761   O O   . ALA A  1 93  ? 9.121   -38.072 2.318   1.00 77.33  ? 93   ALA A O   1 
ATOM   762   C CB  . ALA A  1 93  ? 11.450  -38.401 4.135   1.00 71.90  ? 93   ALA A CB  1 
ATOM   763   N N   . ILE A  1 94  ? 10.574  -36.883 1.023   1.00 74.21  ? 94   ILE A N   1 
ATOM   764   C CA  . ILE A  1 94  ? 9.889   -37.049 -0.255  1.00 74.13  ? 94   ILE A CA  1 
ATOM   765   C C   . ILE A  1 94  ? 10.899  -37.645 -1.213  1.00 80.16  ? 94   ILE A C   1 
ATOM   766   O O   . ILE A  1 94  ? 11.811  -36.947 -1.647  1.00 81.07  ? 94   ILE A O   1 
ATOM   767   C CB  . ILE A  1 94  ? 9.243   -35.720 -0.784  1.00 76.30  ? 94   ILE A CB  1 
ATOM   768   C CG1 . ILE A  1 94  ? 8.300   -35.082 0.250   1.00 73.60  ? 94   ILE A CG1 1 
ATOM   769   C CG2 . ILE A  1 94  ? 8.493   -35.947 -2.095  1.00 79.13  ? 94   ILE A CG2 1 
ATOM   770   C CD1 . ILE A  1 94  ? 8.136   -33.570 0.116   1.00 72.08  ? 94   ILE A CD1 1 
ATOM   771   N N   . PHE A  1 95  ? 10.768  -38.948 -1.510  1.00 77.56  ? 95   PHE A N   1 
ATOM   772   C CA  . PHE A  1 95  ? 11.706  -39.643 -2.407  1.00 79.55  ? 95   PHE A CA  1 
ATOM   773   C C   . PHE A  1 95  ? 11.081  -40.767 -3.195  1.00 84.31  ? 95   PHE A C   1 
ATOM   774   O O   . PHE A  1 95  ? 10.121  -41.381 -2.723  1.00 83.21  ? 95   PHE A O   1 
ATOM   775   C CB  . PHE A  1 95  ? 12.962  -40.139 -1.656  1.00 81.29  ? 95   PHE A CB  1 
ATOM   776   C CG  . PHE A  1 95  ? 12.710  -41.131 -0.543  1.00 81.03  ? 95   PHE A CG  1 
ATOM   777   C CD1 . PHE A  1 95  ? 12.832  -42.496 -0.766  1.00 84.86  ? 95   PHE A CD1 1 
ATOM   778   C CD2 . PHE A  1 95  ? 12.366  -40.700 0.735   1.00 80.43  ? 95   PHE A CD2 1 
ATOM   779   C CE1 . PHE A  1 95  ? 12.614  -43.413 0.269   1.00 84.39  ? 95   PHE A CE1 1 
ATOM   780   C CE2 . PHE A  1 95  ? 12.142  -41.620 1.766   1.00 81.98  ? 95   PHE A CE2 1 
ATOM   781   C CZ  . PHE A  1 95  ? 12.272  -42.967 1.528   1.00 81.01  ? 95   PHE A CZ  1 
ATOM   782   N N   . LEU A  1 96  ? 11.644  -41.045 -4.394  1.00 81.96  ? 96   LEU A N   1 
ATOM   783   C CA  . LEU A  1 96  ? 11.227  -42.120 -5.315  1.00 82.94  ? 96   LEU A CA  1 
ATOM   784   C C   . LEU A  1 96  ? 9.768   -42.078 -5.733  1.00 88.02  ? 96   LEU A C   1 
ATOM   785   O O   . LEU A  1 96  ? 9.142   -43.119 -5.938  1.00 87.65  ? 96   LEU A O   1 
ATOM   786   C CB  . LEU A  1 96  ? 11.617  -43.511 -4.779  1.00 82.77  ? 96   LEU A CB  1 
ATOM   787   C CG  . LEU A  1 96  ? 13.096  -43.733 -4.486  1.00 87.16  ? 96   LEU A CG  1 
ATOM   788   C CD1 . LEU A  1 96  ? 13.285  -44.987 -3.707  1.00 86.92  ? 96   LEU A CD1 1 
ATOM   789   C CD2 . LEU A  1 96  ? 13.905  -43.785 -5.748  1.00 91.14  ? 96   LEU A CD2 1 
ATOM   790   N N   . ASN A  1 97  ? 9.235   -40.865 -5.892  1.00 87.01  ? 97   ASN A N   1 
ATOM   791   C CA  . ASN A  1 97  ? 7.835   -40.655 -6.273  1.00 87.25  ? 97   ASN A CA  1 
ATOM   792   C C   . ASN A  1 97  ? 7.652   -40.569 -7.794  1.00 95.53  ? 97   ASN A C   1 
ATOM   793   O O   . ASN A  1 97  ? 7.254   -39.538 -8.342  1.00 94.33  ? 97   ASN A O   1 
ATOM   794   C CB  . ASN A  1 97  ? 7.183   -39.508 -5.499  1.00 81.66  ? 97   ASN A CB  1 
ATOM   795   C CG  . ASN A  1 97  ? 7.214   -39.736 -4.013  1.00 97.87  ? 97   ASN A CG  1 
ATOM   796   O OD1 . ASN A  1 97  ? 6.399   -40.479 -3.466  1.00 95.76  ? 97   ASN A OD1 1 
ATOM   797   N ND2 . ASN A  1 97  ? 8.187   -39.149 -3.333  1.00 82.26  ? 97   ASN A ND2 1 
ATOM   798   N N   . TYR A  1 98  ? 7.968   -41.694 -8.458  1.00 96.21  ? 98   TYR A N   1 
ATOM   799   C CA  . TYR A  1 98  ? 7.830   -41.934 -9.890  1.00 100.10 ? 98   TYR A CA  1 
ATOM   800   C C   . TYR A  1 98  ? 7.958   -43.430 -10.163 1.00 108.34 ? 98   TYR A C   1 
ATOM   801   O O   . TYR A  1 98  ? 8.499   -44.145 -9.314  1.00 107.80 ? 98   TYR A O   1 
ATOM   802   C CB  . TYR A  1 98  ? 8.875   -41.127 -10.701 1.00 103.53 ? 98   TYR A CB  1 
ATOM   803   C CG  . TYR A  1 98  ? 10.313  -41.590 -10.574 1.00 106.84 ? 98   TYR A CG  1 
ATOM   804   C CD1 . TYR A  1 98  ? 10.890  -42.411 -11.537 1.00 110.75 ? 98   TYR A CD1 1 
ATOM   805   C CD2 . TYR A  1 98  ? 11.114  -41.161 -9.521  1.00 106.82 ? 98   TYR A CD2 1 
ATOM   806   C CE1 . TYR A  1 98  ? 12.216  -42.831 -11.431 1.00 111.88 ? 98   TYR A CE1 1 
ATOM   807   C CE2 . TYR A  1 98  ? 12.441  -41.573 -9.406  1.00 109.01 ? 98   TYR A CE2 1 
ATOM   808   C CZ  . TYR A  1 98  ? 12.991  -42.404 -10.365 1.00 117.40 ? 98   TYR A CZ  1 
ATOM   809   O OH  . TYR A  1 98  ? 14.305  -42.794 -10.252 1.00 120.44 ? 98   TYR A OH  1 
ATOM   810   N N   . ARG A  1 99  ? 7.489   -43.907 -11.340 1.00 108.61 ? 99   ARG A N   1 
ATOM   811   C CA  . ARG A  1 99  ? 7.679   -45.313 -11.731 1.00 111.03 ? 99   ARG A CA  1 
ATOM   812   C C   . ARG A  1 99  ? 8.967   -45.444 -12.564 1.00 117.94 ? 99   ARG A C   1 
ATOM   813   O O   . ARG A  1 99  ? 9.150   -44.686 -13.525 1.00 118.55 ? 99   ARG A O   1 
ATOM   814   C CB  . ARG A  1 99  ? 6.439   -45.939 -12.411 1.00 113.02 ? 99   ARG A CB  1 
ATOM   815   C CG  . ARG A  1 99  ? 5.961   -45.297 -13.718 1.00 128.84 ? 99   ARG A CG  1 
ATOM   816   C CD  . ARG A  1 99  ? 4.673   -45.927 -14.233 1.00 146.12 ? 99   ARG A CD  1 
ATOM   817   N NE  . ARG A  1 99  ? 4.868   -47.279 -14.762 1.00 164.21 ? 99   ARG A NE  1 
ATOM   818   C CZ  . ARG A  1 99  ? 4.521   -48.397 -14.128 1.00 184.81 ? 99   ARG A CZ  1 
ATOM   819   N NH1 . ARG A  1 99  ? 3.958   -48.340 -12.924 1.00 169.79 ? 99   ARG A NH1 1 
ATOM   820   N NH2 . ARG A  1 99  ? 4.735   -49.580 -14.691 1.00 176.62 ? 99   ARG A NH2 1 
ATOM   821   N N   . LYS A  1 100 ? 9.875   -46.368 -12.162 1.00 115.72 ? 100  LYS A N   1 
ATOM   822   C CA  . LYS A  1 100 ? 11.179  -46.605 -12.810 1.00 118.29 ? 100  LYS A CA  1 
ATOM   823   C C   . LYS A  1 100 ? 11.118  -46.741 -14.337 1.00 128.90 ? 100  LYS A C   1 
ATOM   824   O O   . LYS A  1 100 ? 12.082  -46.372 -15.022 1.00 130.60 ? 100  LYS A O   1 
ATOM   825   C CB  . LYS A  1 100 ? 11.933  -47.767 -12.155 1.00 119.92 ? 100  LYS A CB  1 
ATOM   826   C CG  . LYS A  1 100 ? 13.437  -47.534 -12.141 1.00 128.90 ? 100  LYS A CG  1 
ATOM   827   C CD  . LYS A  1 100 ? 14.173  -48.441 -11.183 1.00 133.88 ? 100  LYS A CD  1 
ATOM   828   C CE  . LYS A  1 100 ? 15.666  -48.290 -11.309 1.00 134.62 ? 100  LYS A CE  1 
ATOM   829   N NZ  . LYS A  1 100 ? 16.162  -48.931 -12.554 1.00 147.16 ? 100  LYS A NZ  1 
ATOM   830   N N   . ASP A  1 101 ? 9.955   -47.220 -14.864 1.00 128.65 ? 101  ASP A N   1 
ATOM   831   C CA  . ASP A  1 101 ? 9.629   -47.348 -16.295 1.00 132.43 ? 101  ASP A CA  1 
ATOM   832   C C   . ASP A  1 101 ? 9.785   -45.970 -16.976 1.00 137.17 ? 101  ASP A C   1 
ATOM   833   O O   . ASP A  1 101 ? 10.366  -45.888 -18.065 1.00 139.71 ? 101  ASP A O   1 
ATOM   834   C CB  . ASP A  1 101 ? 8.182   -47.864 -16.484 1.00 134.70 ? 101  ASP A CB  1 
ATOM   835   C CG  . ASP A  1 101 ? 7.982   -49.366 -16.330 1.00 150.99 ? 101  ASP A CG  1 
ATOM   836   O OD1 . ASP A  1 101 ? 8.104   -49.871 -15.188 1.00 151.72 ? 101  ASP A OD1 1 
ATOM   837   O OD2 . ASP A  1 101 ? 7.606   -50.021 -17.330 1.00 157.69 ? 101  ASP A OD2 1 
ATOM   838   N N   . GLY A  1 102 ? 9.293   -44.916 -16.300 1.00 130.68 ? 102  GLY A N   1 
ATOM   839   C CA  . GLY A  1 102 ? 9.408   -43.526 -16.732 1.00 130.15 ? 102  GLY A CA  1 
ATOM   840   C C   . GLY A  1 102 ? 8.157   -42.845 -17.251 1.00 132.11 ? 102  GLY A C   1 
ATOM   841   O O   . GLY A  1 102 ? 8.246   -41.772 -17.856 1.00 133.04 ? 102  GLY A O   1 
ATOM   842   N N   . ASN A  1 103 ? 6.992   -43.445 -17.024 1.00 125.85 ? 103  ASN A N   1 
ATOM   843   C CA  . ASN A  1 103 ? 5.735   -42.879 -17.487 1.00 125.14 ? 103  ASN A CA  1 
ATOM   844   C C   . ASN A  1 103 ? 5.371   -41.639 -16.647 1.00 124.51 ? 103  ASN A C   1 
ATOM   845   O O   . ASN A  1 103 ? 5.605   -40.511 -17.093 1.00 124.32 ? 103  ASN A O   1 
ATOM   846   C CB  . ASN A  1 103 ? 4.625   -43.956 -17.443 1.00 128.89 ? 103  ASN A CB  1 
ATOM   847   C CG  . ASN A  1 103 ? 3.638   -43.972 -18.602 1.00 152.41 ? 103  ASN A CG  1 
ATOM   848   O OD1 . ASN A  1 103 ? 3.762   -43.243 -19.596 1.00 145.26 ? 103  ASN A OD1 1 
ATOM   849   N ND2 . ASN A  1 103 ? 2.637   -44.835 -18.505 1.00 144.71 ? 103  ASN A ND2 1 
ATOM   850   N N   . PHE A  1 104 ? 4.857   -41.860 -15.416 1.00 116.88 ? 104  PHE A N   1 
ATOM   851   C CA  . PHE A  1 104 ? 4.409   -40.813 -14.506 1.00 113.28 ? 104  PHE A CA  1 
ATOM   852   C C   . PHE A  1 104 ? 5.206   -40.719 -13.209 1.00 110.73 ? 104  PHE A C   1 
ATOM   853   O O   . PHE A  1 104 ? 6.071   -41.553 -12.919 1.00 109.93 ? 104  PHE A O   1 
ATOM   854   C CB  . PHE A  1 104 ? 2.927   -41.011 -14.130 1.00 114.40 ? 104  PHE A CB  1 
ATOM   855   C CG  . PHE A  1 104 ? 2.078   -41.903 -14.994 1.00 118.55 ? 104  PHE A CG  1 
ATOM   856   C CD1 . PHE A  1 104 ? 1.457   -41.404 -16.131 1.00 124.61 ? 104  PHE A CD1 1 
ATOM   857   C CD2 . PHE A  1 104 ? 1.822   -43.218 -14.621 1.00 121.35 ? 104  PHE A CD2 1 
ATOM   858   C CE1 . PHE A  1 104 ? 0.627   -42.217 -16.909 1.00 127.96 ? 104  PHE A CE1 1 
ATOM   859   C CE2 . PHE A  1 104 ? 0.983   -44.031 -15.395 1.00 126.77 ? 104  PHE A CE2 1 
ATOM   860   C CZ  . PHE A  1 104 ? 0.389   -43.525 -16.533 1.00 127.06 ? 104  PHE A CZ  1 
ATOM   861   N N   . GLY A  1 105 ? 4.809   -39.735 -12.406 1.00 102.29 ? 105  GLY A N   1 
ATOM   862   C CA  . GLY A  1 105 ? 5.363   -39.443 -11.098 1.00 98.36  ? 105  GLY A CA  1 
ATOM   863   C C   . GLY A  1 105 ? 4.988   -38.062 -10.619 1.00 97.64  ? 105  GLY A C   1 
ATOM   864   O O   . GLY A  1 105 ? 4.416   -37.270 -11.371 1.00 97.15  ? 105  GLY A O   1 
ATOM   865   N N   . LEU A  1 106 ? 5.315   -37.778 -9.352  1.00 91.79  ? 106  LEU A N   1 
ATOM   866   C CA  . LEU A  1 106 ? 5.062   -36.499 -8.686  1.00 89.36  ? 106  LEU A CA  1 
ATOM   867   C C   . LEU A  1 106 ? 5.805   -35.349 -9.393  1.00 94.64  ? 106  LEU A C   1 
ATOM   868   O O   . LEU A  1 106 ? 7.014   -35.409 -9.625  1.00 94.43  ? 106  LEU A O   1 
ATOM   869   C CB  . LEU A  1 106 ? 5.399   -36.595 -7.187  1.00 86.49  ? 106  LEU A CB  1 
ATOM   870   C CG  . LEU A  1 106 ? 5.297   -35.314 -6.378  1.00 88.61  ? 106  LEU A CG  1 
ATOM   871   C CD1 . LEU A  1 106 ? 3.860   -35.038 -5.960  1.00 87.47  ? 106  LEU A CD1 1 
ATOM   872   C CD2 . LEU A  1 106 ? 6.206   -35.377 -5.164  1.00 87.83  ? 106  LEU A CD2 1 
ATOM   873   N N   . GLN A  1 107 ? 5.029   -34.333 -9.776  1.00 90.89  ? 107  GLN A N   1 
ATOM   874   C CA  . GLN A  1 107 ? 5.474   -33.161 -10.525 1.00 90.49  ? 107  GLN A CA  1 
ATOM   875   C C   . GLN A  1 107 ? 5.447   -31.874 -9.729  1.00 90.57  ? 107  GLN A C   1 
ATOM   876   O O   . GLN A  1 107 ? 6.219   -30.971 -10.041 1.00 90.95  ? 107  GLN A O   1 
ATOM   877   C CB  . GLN A  1 107 ? 4.575   -32.982 -11.743 1.00 93.32  ? 107  GLN A CB  1 
ATOM   878   C CG  . GLN A  1 107 ? 4.977   -33.835 -12.922 1.00 103.59 ? 107  GLN A CG  1 
ATOM   879   C CD  . GLN A  1 107 ? 3.816   -34.017 -13.849 1.00 114.89 ? 107  GLN A CD  1 
ATOM   880   O OE1 . GLN A  1 107 ? 3.446   -35.148 -14.176 1.00 115.03 ? 107  GLN A OE1 1 
ATOM   881   N NE2 . GLN A  1 107 ? 3.177   -32.915 -14.244 1.00 96.49  ? 107  GLN A NE2 1 
ATOM   882   N N   . GLU A  1 108 ? 4.518   -31.760 -8.756  1.00 83.98  ? 108  GLU A N   1 
ATOM   883   C CA  . GLU A  1 108 ? 4.327   -30.560 -7.952  1.00 82.21  ? 108  GLU A CA  1 
ATOM   884   C C   . GLU A  1 108 ? 3.959   -30.895 -6.508  1.00 85.06  ? 108  GLU A C   1 
ATOM   885   O O   . GLU A  1 108 ? 3.182   -31.830 -6.262  1.00 85.74  ? 108  GLU A O   1 
ATOM   886   C CB  . GLU A  1 108 ? 3.206   -29.707 -8.573  1.00 84.29  ? 108  GLU A CB  1 
ATOM   887   C CG  . GLU A  1 108 ? 3.185   -28.251 -8.125  1.00 97.50  ? 108  GLU A CG  1 
ATOM   888   C CD  . GLU A  1 108 ? 2.003   -27.421 -8.597  1.00 119.88 ? 108  GLU A CD  1 
ATOM   889   O OE1 . GLU A  1 108 ? 1.381   -26.750 -7.744  1.00 108.83 ? 108  GLU A OE1 1 
ATOM   890   O OE2 . GLU A  1 108 ? 1.716   -27.414 -9.817  1.00 117.17 ? 108  GLU A OE2 1 
ATOM   891   N N   . LEU A  1 109 ? 4.493   -30.092 -5.556  1.00 78.08  ? 109  LEU A N   1 
ATOM   892   C CA  . LEU A  1 109 ? 4.188   -30.189 -4.130  1.00 74.36  ? 109  LEU A CA  1 
ATOM   893   C C   . LEU A  1 109 ? 3.279   -29.003 -3.754  1.00 77.74  ? 109  LEU A C   1 
ATOM   894   O O   . LEU A  1 109 ? 3.644   -27.847 -4.002  1.00 78.97  ? 109  LEU A O   1 
ATOM   895   C CB  . LEU A  1 109 ? 5.463   -30.114 -3.277  1.00 73.07  ? 109  LEU A CB  1 
ATOM   896   C CG  . LEU A  1 109 ? 6.617   -31.049 -3.580  1.00 78.14  ? 109  LEU A CG  1 
ATOM   897   C CD1 . LEU A  1 109 ? 7.825   -30.632 -2.799  1.00 76.61  ? 109  LEU A CD1 1 
ATOM   898   C CD2 . LEU A  1 109 ? 6.290   -32.468 -3.198  1.00 81.38  ? 109  LEU A CD2 1 
ATOM   899   N N   . GLY A  1 110 ? 2.119   -29.284 -3.170  1.00 71.74  ? 110  GLY A N   1 
ATOM   900   C CA  . GLY A  1 110 ? 1.206   -28.242 -2.719  1.00 70.09  ? 110  GLY A CA  1 
ATOM   901   C C   . GLY A  1 110 ? 1.440   -28.021 -1.244  1.00 72.10  ? 110  GLY A C   1 
ATOM   902   O O   . GLY A  1 110 ? 0.680   -28.521 -0.417  1.00 72.07  ? 110  GLY A O   1 
ATOM   903   N N   . LEU A  1 111 ? 2.547   -27.349 -0.902  1.00 66.47  ? 111  LEU A N   1 
ATOM   904   C CA  . LEU A  1 111 ? 2.949   -27.073 0.475   1.00 63.14  ? 111  LEU A CA  1 
ATOM   905   C C   . LEU A  1 111 ? 3.161   -25.568 0.641   1.00 67.38  ? 111  LEU A C   1 
ATOM   906   O O   . LEU A  1 111 ? 4.074   -25.153 1.377   1.00 67.85  ? 111  LEU A O   1 
ATOM   907   C CB  . LEU A  1 111 ? 4.271   -27.810 0.796   1.00 62.39  ? 111  LEU A CB  1 
ATOM   908   C CG  . LEU A  1 111 ? 4.283   -29.325 0.773   1.00 64.83  ? 111  LEU A CG  1 
ATOM   909   C CD1 . LEU A  1 111 ? 5.672   -29.832 0.571   1.00 65.04  ? 111  LEU A CD1 1 
ATOM   910   C CD2 . LEU A  1 111 ? 3.710   -29.889 2.031   1.00 63.06  ? 111  LEU A CD2 1 
ATOM   911   N N   . LYS A  1 112 ? 2.321   -24.748 -0.022  1.00 62.32  ? 112  LYS A N   1 
ATOM   912   C CA  . LYS A  1 112 ? 2.467   -23.281 0.018   1.00 61.82  ? 112  LYS A CA  1 
ATOM   913   C C   . LYS A  1 112 ? 2.357   -22.622 1.455   1.00 63.21  ? 112  LYS A C   1 
ATOM   914   O O   . LYS A  1 112 ? 2.709   -21.438 1.650   1.00 61.41  ? 112  LYS A O   1 
ATOM   915   C CB  . LYS A  1 112 ? 1.523   -22.617 -1.004  1.00 63.81  ? 112  LYS A CB  1 
ATOM   916   C CG  . LYS A  1 112 ? 2.034   -21.259 -1.473  1.00 77.57  ? 112  LYS A CG  1 
ATOM   917   C CD  . LYS A  1 112 ? 0.909   -20.340 -1.909  1.00 90.57  ? 112  LYS A CD  1 
ATOM   918   C CE  . LYS A  1 112 ? 1.389   -18.917 -2.088  1.00 104.06 ? 112  LYS A CE  1 
ATOM   919   N NZ  . LYS A  1 112 ? 0.320   -18.034 -2.629  1.00 110.47 ? 112  LYS A NZ  1 
ATOM   920   N N   . ASN A  1 113 ? 1.866   -23.412 2.436   1.00 57.33  ? 113  ASN A N   1 
ATOM   921   C CA  . ASN A  1 113 ? 1.596   -22.965 3.795   1.00 55.76  ? 113  ASN A CA  1 
ATOM   922   C C   . ASN A  1 113 ? 2.560   -23.600 4.785   1.00 61.09  ? 113  ASN A C   1 
ATOM   923   O O   . ASN A  1 113 ? 2.541   -23.246 5.982   1.00 60.21  ? 113  ASN A O   1 
ATOM   924   C CB  . ASN A  1 113 ? 0.142   -23.297 4.166   1.00 50.97  ? 113  ASN A CB  1 
ATOM   925   C CG  . ASN A  1 113 ? -0.885  -22.195 3.945   1.00 74.36  ? 113  ASN A CG  1 
ATOM   926   O OD1 . ASN A  1 113 ? -0.860  -21.428 2.975   1.00 66.37  ? 113  ASN A OD1 1 
ATOM   927   N ND2 . ASN A  1 113 ? -1.854  -22.137 4.849   1.00 69.82  ? 113  ASN A ND2 1 
ATOM   928   N N   . LEU A  1 114 ? 3.380   -24.571 4.296   1.00 56.73  ? 114  LEU A N   1 
ATOM   929   C CA  . LEU A  1 114 ? 4.346   -25.231 5.152   1.00 55.00  ? 114  LEU A CA  1 
ATOM   930   C C   . LEU A  1 114 ? 5.493   -24.234 5.379   1.00 59.26  ? 114  LEU A C   1 
ATOM   931   O O   . LEU A  1 114 ? 6.328   -23.999 4.497   1.00 60.56  ? 114  LEU A O   1 
ATOM   932   C CB  . LEU A  1 114 ? 4.814   -26.569 4.576   1.00 55.41  ? 114  LEU A CB  1 
ATOM   933   C CG  . LEU A  1 114 ? 5.955   -27.196 5.359   1.00 59.75  ? 114  LEU A CG  1 
ATOM   934   C CD1 . LEU A  1 114 ? 5.468   -27.891 6.631   1.00 58.57  ? 114  LEU A CD1 1 
ATOM   935   C CD2 . LEU A  1 114 ? 6.799   -28.039 4.492   1.00 63.14  ? 114  LEU A CD2 1 
ATOM   936   N N   . THR A  1 115 ? 5.440   -23.573 6.534   1.00 54.54  ? 115  THR A N   1 
ATOM   937   C CA  . THR A  1 115 ? 6.364   -22.521 6.910   1.00 55.05  ? 115  THR A CA  1 
ATOM   938   C C   . THR A  1 115 ? 7.124   -22.855 8.155   1.00 58.87  ? 115  THR A C   1 
ATOM   939   O O   . THR A  1 115 ? 7.926   -22.034 8.598   1.00 60.09  ? 115  THR A O   1 
ATOM   940   C CB  . THR A  1 115 ? 5.628   -21.166 7.076   1.00 63.23  ? 115  THR A CB  1 
ATOM   941   O OG1 . THR A  1 115 ? 4.668   -21.253 8.126   1.00 59.83  ? 115  THR A OG1 1 
ATOM   942   C CG2 . THR A  1 115 ? 4.997   -20.655 5.781   1.00 59.59  ? 115  THR A CG2 1 
ATOM   943   N N   . GLU A  1 116 ? 6.908   -24.057 8.710   1.00 53.80  ? 116  GLU A N   1 
ATOM   944   C CA  . GLU A  1 116 ? 7.552   -24.488 9.955   1.00 52.13  ? 116  GLU A CA  1 
ATOM   945   C C   . GLU A  1 116 ? 7.811   -25.994 9.991   1.00 55.66  ? 116  GLU A C   1 
ATOM   946   O O   . GLU A  1 116 ? 6.897   -26.796 9.759   1.00 57.61  ? 116  GLU A O   1 
ATOM   947   C CB  . GLU A  1 116 ? 6.630   -24.133 11.138  1.00 51.71  ? 116  GLU A CB  1 
ATOM   948   C CG  . GLU A  1 116 ? 7.288   -24.154 12.493  1.00 52.31  ? 116  GLU A CG  1 
ATOM   949   C CD  . GLU A  1 116 ? 8.104   -22.911 12.745  1.00 69.04  ? 116  GLU A CD  1 
ATOM   950   O OE1 . GLU A  1 116 ? 7.497   -21.824 12.885  1.00 64.03  ? 116  GLU A OE1 1 
ATOM   951   O OE2 . GLU A  1 116 ? 9.349   -23.024 12.809  1.00 66.03  ? 116  GLU A OE2 1 
ATOM   952   N N   . ILE A  1 117 ? 9.030   -26.358 10.357  1.00 49.09  ? 117  ILE A N   1 
ATOM   953   C CA  . ILE A  1 117 ? 9.496   -27.724 10.590  1.00 48.30  ? 117  ILE A CA  1 
ATOM   954   C C   . ILE A  1 117 ? 10.322  -27.535 11.866  1.00 53.00  ? 117  ILE A C   1 
ATOM   955   O O   . ILE A  1 117 ? 11.483  -27.096 11.797  1.00 53.77  ? 117  ILE A O   1 
ATOM   956   C CB  . ILE A  1 117 ? 10.271  -28.347 9.351   1.00 51.42  ? 117  ILE A CB  1 
ATOM   957   C CG1 . ILE A  1 117 ? 9.296   -28.709 8.206   1.00 50.34  ? 117  ILE A CG1 1 
ATOM   958   C CG2 . ILE A  1 117 ? 11.137  -29.565 9.734   1.00 50.25  ? 117  ILE A CG2 1 
ATOM   959   C CD1 . ILE A  1 117 ? 9.873   -28.707 6.851   1.00 49.55  ? 117  ILE A CD1 1 
ATOM   960   N N   . LEU A  1 118 ? 9.666   -27.752 13.034  1.00 48.75  ? 118  LEU A N   1 
ATOM   961   C CA  . LEU A  1 118 ? 10.225  -27.500 14.380  1.00 48.54  ? 118  LEU A CA  1 
ATOM   962   C C   . LEU A  1 118 ? 11.512  -28.234 14.730  1.00 60.34  ? 118  LEU A C   1 
ATOM   963   O O   . LEU A  1 118 ? 12.450  -27.643 15.277  1.00 63.44  ? 118  LEU A O   1 
ATOM   964   C CB  . LEU A  1 118 ? 9.192   -27.701 15.473  1.00 46.13  ? 118  LEU A CB  1 
ATOM   965   C CG  . LEU A  1 118 ? 8.076   -26.662 15.510  1.00 48.89  ? 118  LEU A CG  1 
ATOM   966   C CD1 . LEU A  1 118 ? 7.174   -26.874 16.685  1.00 45.06  ? 118  LEU A CD1 1 
ATOM   967   C CD2 . LEU A  1 118 ? 8.656   -25.321 15.635  1.00 56.19  ? 118  LEU A CD2 1 
ATOM   968   N N   . ASN A  1 119 ? 11.555  -29.514 14.402  1.00 56.75  ? 119  ASN A N   1 
ATOM   969   C CA  . ASN A  1 119 ? 12.692  -30.361 14.668  1.00 55.92  ? 119  ASN A CA  1 
ATOM   970   C C   . ASN A  1 119 ? 12.853  -31.328 13.505  1.00 58.39  ? 119  ASN A C   1 
ATOM   971   O O   . ASN A  1 119 ? 11.865  -31.781 12.934  1.00 58.33  ? 119  ASN A O   1 
ATOM   972   C CB  . ASN A  1 119 ? 12.455  -31.088 15.997  1.00 56.23  ? 119  ASN A CB  1 
ATOM   973   C CG  . ASN A  1 119 ? 13.546  -32.042 16.432  1.00 78.81  ? 119  ASN A CG  1 
ATOM   974   O OD1 . ASN A  1 119 ? 13.324  -33.264 16.471  1.00 70.72  ? 119  ASN A OD1 1 
ATOM   975   N ND2 . ASN A  1 119 ? 14.743  -31.518 16.769  1.00 70.62  ? 119  ASN A ND2 1 
ATOM   976   N N   . GLY A  1 120 ? 14.091  -31.621 13.163  1.00 55.46  ? 120  GLY A N   1 
ATOM   977   C CA  . GLY A  1 120 ? 14.425  -32.553 12.097  1.00 57.41  ? 120  GLY A CA  1 
ATOM   978   C C   . GLY A  1 120 ? 14.790  -31.854 10.817  1.00 64.45  ? 120  GLY A C   1 
ATOM   979   O O   . GLY A  1 120 ? 14.709  -30.630 10.746  1.00 65.50  ? 120  GLY A O   1 
ATOM   980   N N   . GLY A  1 121 ? 15.193  -32.631 9.823   1.00 61.22  ? 121  GLY A N   1 
ATOM   981   C CA  . GLY A  1 121 ? 15.599  -32.118 8.523   1.00 62.03  ? 121  GLY A CA  1 
ATOM   982   C C   . GLY A  1 121 ? 14.644  -32.451 7.397   1.00 66.03  ? 121  GLY A C   1 
ATOM   983   O O   . GLY A  1 121 ? 13.570  -33.024 7.624   1.00 63.66  ? 121  GLY A O   1 
ATOM   984   N N   . VAL A  1 122 ? 15.054  -32.081 6.159   1.00 64.00  ? 122  VAL A N   1 
ATOM   985   C CA  . VAL A  1 122 ? 14.283  -32.262 4.929   1.00 64.67  ? 122  VAL A CA  1 
ATOM   986   C C   . VAL A  1 122 ? 15.057  -33.135 3.969   1.00 74.39  ? 122  VAL A C   1 
ATOM   987   O O   . VAL A  1 122 ? 16.198  -32.823 3.657   1.00 78.35  ? 122  VAL A O   1 
ATOM   988   C CB  . VAL A  1 122 ? 13.931  -30.889 4.274   1.00 68.50  ? 122  VAL A CB  1 
ATOM   989   C CG1 . VAL A  1 122 ? 13.229  -31.058 2.930   1.00 69.08  ? 122  VAL A CG1 1 
ATOM   990   C CG2 . VAL A  1 122 ? 13.090  -30.023 5.201   1.00 66.64  ? 122  VAL A CG2 1 
ATOM   991   N N   . TYR A  1 123 ? 14.445  -34.210 3.477   1.00 71.95  ? 123  TYR A N   1 
ATOM   992   C CA  . TYR A  1 123 ? 15.064  -35.083 2.489   1.00 73.68  ? 123  TYR A CA  1 
ATOM   993   C C   . TYR A  1 123 ? 14.125  -35.187 1.282   1.00 80.89  ? 123  TYR A C   1 
ATOM   994   O O   . TYR A  1 123 ? 13.132  -35.922 1.318   1.00 82.20  ? 123  TYR A O   1 
ATOM   995   C CB  . TYR A  1 123 ? 15.425  -36.459 3.083   1.00 73.99  ? 123  TYR A CB  1 
ATOM   996   C CG  . TYR A  1 123 ? 15.929  -37.462 2.066   1.00 78.13  ? 123  TYR A CG  1 
ATOM   997   C CD1 . TYR A  1 123 ? 17.238  -37.415 1.598   1.00 81.80  ? 123  TYR A CD1 1 
ATOM   998   C CD2 . TYR A  1 123 ? 15.114  -38.492 1.613   1.00 79.68  ? 123  TYR A CD2 1 
ATOM   999   C CE1 . TYR A  1 123 ? 17.706  -38.340 0.669   1.00 84.87  ? 123  TYR A CE1 1 
ATOM   1000  C CE2 . TYR A  1 123 ? 15.575  -39.430 0.693   1.00 83.57  ? 123  TYR A CE2 1 
ATOM   1001  C CZ  . TYR A  1 123 ? 16.869  -39.348 0.213   1.00 94.57  ? 123  TYR A CZ  1 
ATOM   1002  O OH  . TYR A  1 123 ? 17.297  -40.279 -0.717  1.00 100.51 ? 123  TYR A OH  1 
ATOM   1003  N N   . VAL A  1 124 ? 14.408  -34.401 0.237   1.00 76.32  ? 124  VAL A N   1 
ATOM   1004  C CA  . VAL A  1 124 ? 13.639  -34.419 -1.000  1.00 75.96  ? 124  VAL A CA  1 
ATOM   1005  C C   . VAL A  1 124 ? 14.645  -34.811 -2.055  1.00 83.83  ? 124  VAL A C   1 
ATOM   1006  O O   . VAL A  1 124 ? 15.534  -34.025 -2.366  1.00 84.61  ? 124  VAL A O   1 
ATOM   1007  C CB  . VAL A  1 124 ? 12.918  -33.081 -1.296  1.00 78.33  ? 124  VAL A CB  1 
ATOM   1008  C CG1 . VAL A  1 124 ? 12.145  -33.149 -2.614  1.00 78.80  ? 124  VAL A CG1 1 
ATOM   1009  C CG2 . VAL A  1 124 ? 11.985  -32.701 -0.146  1.00 75.71  ? 124  VAL A CG2 1 
ATOM   1010  N N   . ASP A  1 125 ? 14.574  -36.063 -2.532  1.00 82.22  ? 125  ASP A N   1 
ATOM   1011  C CA  . ASP A  1 125 ? 15.539  -36.591 -3.501  1.00 84.44  ? 125  ASP A CA  1 
ATOM   1012  C C   . ASP A  1 125 ? 14.909  -37.679 -4.360  1.00 88.67  ? 125  ASP A C   1 
ATOM   1013  O O   . ASP A  1 125 ? 13.852  -38.197 -4.007  1.00 86.96  ? 125  ASP A O   1 
ATOM   1014  C CB  . ASP A  1 125 ? 16.758  -37.151 -2.731  1.00 86.98  ? 125  ASP A CB  1 
ATOM   1015  C CG  . ASP A  1 125 ? 17.932  -37.687 -3.538  1.00 105.57 ? 125  ASP A CG  1 
ATOM   1016  O OD1 . ASP A  1 125 ? 18.151  -37.203 -4.668  1.00 108.70 ? 125  ASP A OD1 1 
ATOM   1017  O OD2 . ASP A  1 125 ? 18.647  -38.576 -3.025  1.00 114.63 ? 125  ASP A OD2 1 
ATOM   1018  N N   . GLN A  1 126 ? 15.557  -38.015 -5.496  1.00 87.24  ? 126  GLN A N   1 
ATOM   1019  C CA  . GLN A  1 126 ? 15.164  -39.094 -6.401  1.00 88.10  ? 126  GLN A CA  1 
ATOM   1020  C C   . GLN A  1 126 ? 13.700  -38.966 -6.878  1.00 89.65  ? 126  GLN A C   1 
ATOM   1021  O O   . GLN A  1 126 ? 12.985  -39.964 -6.874  1.00 89.18  ? 126  GLN A O   1 
ATOM   1022  C CB  . GLN A  1 126 ? 15.382  -40.473 -5.717  1.00 89.47  ? 126  GLN A CB  1 
ATOM   1023  C CG  . GLN A  1 126 ? 16.765  -40.731 -5.117  1.00 104.25 ? 126  GLN A CG  1 
ATOM   1024  C CD  . GLN A  1 126 ? 17.767  -41.237 -6.136  1.00 145.55 ? 126  GLN A CD  1 
ATOM   1025  O OE1 . GLN A  1 126 ? 18.989  -41.209 -5.898  1.00 147.31 ? 126  GLN A OE1 1 
ATOM   1026  N NE2 . GLN A  1 126 ? 17.287  -41.715 -7.297  1.00 141.23 ? 126  GLN A NE2 1 
ATOM   1027  N N   . ASN A  1 127 ? 13.243  -37.750 -7.248  1.00 83.72  ? 127  ASN A N   1 
ATOM   1028  C CA  . ASN A  1 127 ? 11.873  -37.549 -7.741  1.00 82.12  ? 127  ASN A CA  1 
ATOM   1029  C C   . ASN A  1 127 ? 11.938  -37.057 -9.189  1.00 89.14  ? 127  ASN A C   1 
ATOM   1030  O O   . ASN A  1 127 ? 11.656  -35.887 -9.464  1.00 88.58  ? 127  ASN A O   1 
ATOM   1031  C CB  . ASN A  1 127 ? 11.045  -36.581 -6.843  1.00 76.24  ? 127  ASN A CB  1 
ATOM   1032  C CG  . ASN A  1 127 ? 10.887  -36.977 -5.391  1.00 86.73  ? 127  ASN A CG  1 
ATOM   1033  O OD1 . ASN A  1 127 ? 11.323  -36.264 -4.479  1.00 84.89  ? 127  ASN A OD1 1 
ATOM   1034  N ND2 . ASN A  1 127 ? 10.239  -38.097 -5.131  1.00 67.42  ? 127  ASN A ND2 1 
ATOM   1035  N N   . LYS A  1 128 ? 12.300  -37.971 -10.116 1.00 89.58  ? 128  LYS A N   1 
ATOM   1036  C CA  . LYS A  1 128 ? 12.492  -37.766 -11.570 1.00 92.91  ? 128  LYS A CA  1 
ATOM   1037  C C   . LYS A  1 128 ? 11.661  -36.656 -12.252 1.00 98.64  ? 128  LYS A C   1 
ATOM   1038  O O   . LYS A  1 128 ? 12.189  -35.959 -13.127 1.00 100.17 ? 128  LYS A O   1 
ATOM   1039  C CB  . LYS A  1 128 ? 12.339  -39.098 -12.338 1.00 96.84  ? 128  LYS A CB  1 
ATOM   1040  C CG  . LYS A  1 128 ? 13.069  -39.156 -13.681 1.00 112.22 ? 128  LYS A CG  1 
ATOM   1041  C CD  . LYS A  1 128 ? 12.873  -40.500 -14.365 1.00 120.83 ? 128  LYS A CD  1 
ATOM   1042  C CE  . LYS A  1 128 ? 14.022  -40.921 -15.240 1.00 127.67 ? 128  LYS A CE  1 
ATOM   1043  N NZ  . LYS A  1 128 ? 14.048  -42.402 -15.384 1.00 138.87 ? 128  LYS A NZ  1 
ATOM   1044  N N   . PHE A  1 129 ? 10.386  -36.484 -11.865 1.00 93.77  ? 129  PHE A N   1 
ATOM   1045  C CA  . PHE A  1 129 ? 9.545   -35.512 -12.550 1.00 94.38  ? 129  PHE A CA  1 
ATOM   1046  C C   . PHE A  1 129 ? 9.075   -34.351 -11.702 1.00 97.54  ? 129  PHE A C   1 
ATOM   1047  O O   . PHE A  1 129 ? 8.203   -33.606 -12.149 1.00 98.64  ? 129  PHE A O   1 
ATOM   1048  C CB  . PHE A  1 129 ? 8.376   -36.225 -13.254 1.00 97.09  ? 129  PHE A CB  1 
ATOM   1049  C CG  . PHE A  1 129 ? 8.789   -37.484 -13.983 1.00 101.09 ? 129  PHE A CG  1 
ATOM   1050  C CD1 . PHE A  1 129 ? 8.540   -38.737 -13.436 1.00 103.44 ? 129  PHE A CD1 1 
ATOM   1051  C CD2 . PHE A  1 129 ? 9.481   -37.415 -15.192 1.00 106.39 ? 129  PHE A CD2 1 
ATOM   1052  C CE1 . PHE A  1 129 ? 8.964   -39.901 -14.093 1.00 106.91 ? 129  PHE A CE1 1 
ATOM   1053  C CE2 . PHE A  1 129 ? 9.889   -38.582 -15.856 1.00 111.22 ? 129  PHE A CE2 1 
ATOM   1054  C CZ  . PHE A  1 129 ? 9.613   -39.816 -15.311 1.00 108.60 ? 129  PHE A CZ  1 
ATOM   1055  N N   . LEU A  1 130 ? 9.665   -34.159 -10.510 1.00 91.94  ? 130  LEU A N   1 
ATOM   1056  C CA  . LEU A  1 130 ? 9.276   -33.067 -9.613  1.00 89.66  ? 130  LEU A CA  1 
ATOM   1057  C C   . LEU A  1 130 ? 9.940   -31.759 -9.976  1.00 98.15  ? 130  LEU A C   1 
ATOM   1058  O O   . LEU A  1 130 ? 11.157  -31.699 -10.053 1.00 99.15  ? 130  LEU A O   1 
ATOM   1059  C CB  . LEU A  1 130 ? 9.524   -33.441 -8.137  1.00 86.44  ? 130  LEU A CB  1 
ATOM   1060  C CG  . LEU A  1 130 ? 9.321   -32.366 -7.070  1.00 86.85  ? 130  LEU A CG  1 
ATOM   1061  C CD1 . LEU A  1 130 ? 7.906   -31.844 -7.044  1.00 84.85  ? 130  LEU A CD1 1 
ATOM   1062  C CD2 . LEU A  1 130 ? 9.672   -32.902 -5.732  1.00 87.34  ? 130  LEU A CD2 1 
ATOM   1063  N N   . CYS A  1 131 ? 9.142   -30.709 -10.165 1.00 97.77  ? 131  CYS A N   1 
ATOM   1064  C CA  . CYS A  1 131 ? 9.635   -29.383 -10.510 1.00 100.55 ? 131  CYS A CA  1 
ATOM   1065  C C   . CYS A  1 131 ? 9.424   -28.399 -9.372  1.00 98.33  ? 131  CYS A C   1 
ATOM   1066  O O   . CYS A  1 131 ? 8.642   -28.657 -8.458  1.00 94.77  ? 131  CYS A O   1 
ATOM   1067  C CB  . CYS A  1 131 ? 8.987   -28.878 -11.796 1.00 105.18 ? 131  CYS A CB  1 
ATOM   1068  S SG  . CYS A  1 131 ? 9.513   -29.739 -13.303 1.00 114.05 ? 131  CYS A SG  1 
ATOM   1069  N N   . TYR A  1 132 ? 10.118  -27.247 -9.452  1.00 94.00  ? 132  TYR A N   1 
ATOM   1070  C CA  . TYR A  1 132 ? 10.027  -26.113 -8.531  1.00 91.62  ? 132  TYR A CA  1 
ATOM   1071  C C   . TYR A  1 132 ? 10.564  -26.322 -7.128  1.00 93.76  ? 132  TYR A C   1 
ATOM   1072  O O   . TYR A  1 132 ? 11.051  -25.364 -6.528  1.00 93.03  ? 132  TYR A O   1 
ATOM   1073  C CB  . TYR A  1 132 ? 8.614   -25.505 -8.515  1.00 91.34  ? 132  TYR A CB  1 
ATOM   1074  C CG  . TYR A  1 132 ? 8.067   -25.254 -9.902  1.00 94.04  ? 132  TYR A CG  1 
ATOM   1075  C CD1 . TYR A  1 132 ? 7.134   -26.116 -10.471 1.00 96.03  ? 132  TYR A CD1 1 
ATOM   1076  C CD2 . TYR A  1 132 ? 8.525   -24.187 -10.669 1.00 96.14  ? 132  TYR A CD2 1 
ATOM   1077  C CE1 . TYR A  1 132 ? 6.652   -25.907 -11.759 1.00 98.71  ? 132  TYR A CE1 1 
ATOM   1078  C CE2 . TYR A  1 132 ? 8.048   -23.965 -11.954 1.00 99.23  ? 132  TYR A CE2 1 
ATOM   1079  C CZ  . TYR A  1 132 ? 7.115   -24.830 -12.498 1.00 109.33 ? 132  TYR A CZ  1 
ATOM   1080  O OH  . TYR A  1 132 ? 6.670   -24.603 -13.773 1.00 115.66 ? 132  TYR A OH  1 
ATOM   1081  N N   . ALA A  1 133 ? 10.494  -27.559 -6.609  1.00 89.05  ? 133  ALA A N   1 
ATOM   1082  C CA  . ALA A  1 133 ? 10.972  -27.917 -5.275  1.00 86.98  ? 133  ALA A CA  1 
ATOM   1083  C C   . ALA A  1 133 ? 12.434  -27.518 -5.047  1.00 92.31  ? 133  ALA A C   1 
ATOM   1084  O O   . ALA A  1 133 ? 12.821  -27.194 -3.921  1.00 92.12  ? 133  ALA A O   1 
ATOM   1085  C CB  . ALA A  1 133 ? 10.791  -29.400 -5.047  1.00 87.33  ? 133  ALA A CB  1 
ATOM   1086  N N   . ASP A  1 134 ? 13.226  -27.501 -6.118  1.00 89.37  ? 134  ASP A N   1 
ATOM   1087  C CA  . ASP A  1 134 ? 14.625  -27.103 -6.103  1.00 90.01  ? 134  ASP A CA  1 
ATOM   1088  C C   . ASP A  1 134 ? 14.800  -25.635 -5.715  1.00 89.86  ? 134  ASP A C   1 
ATOM   1089  O O   . ASP A  1 134 ? 15.823  -25.279 -5.111  1.00 90.59  ? 134  ASP A O   1 
ATOM   1090  C CB  . ASP A  1 134 ? 15.273  -27.386 -7.466  1.00 95.94  ? 134  ASP A CB  1 
ATOM   1091  C CG  . ASP A  1 134 ? 14.506  -26.876 -8.693  1.00 116.50 ? 134  ASP A CG  1 
ATOM   1092  O OD1 . ASP A  1 134 ? 13.287  -27.177 -8.809  1.00 118.04 ? 134  ASP A OD1 1 
ATOM   1093  O OD2 . ASP A  1 134 ? 15.140  -26.243 -9.569  1.00 126.21 ? 134  ASP A OD2 1 
ATOM   1094  N N   . THR A  1 135 ? 13.797  -24.790 -6.063  1.00 81.64  ? 135  THR A N   1 
ATOM   1095  C CA  . THR A  1 135 ? 13.811  -23.347 -5.783  1.00 79.19  ? 135  THR A CA  1 
ATOM   1096  C C   . THR A  1 135 ? 13.538  -22.964 -4.328  1.00 78.33  ? 135  THR A C   1 
ATOM   1097  O O   . THR A  1 135 ? 13.837  -21.840 -3.929  1.00 77.21  ? 135  THR A O   1 
ATOM   1098  C CB  . THR A  1 135 ? 12.947  -22.548 -6.771  1.00 81.00  ? 135  THR A CB  1 
ATOM   1099  O OG1 . THR A  1 135 ? 11.563  -22.728 -6.503  1.00 77.18  ? 135  THR A OG1 1 
ATOM   1100  C CG2 . THR A  1 135 ? 13.272  -22.843 -8.219  1.00 83.63  ? 135  THR A CG2 1 
ATOM   1101  N N   . ILE A  1 136 ? 12.973  -23.895 -3.545  1.00 72.63  ? 136  ILE A N   1 
ATOM   1102  C CA  . ILE A  1 136 ? 12.586  -23.700 -2.139  1.00 69.09  ? 136  ILE A CA  1 
ATOM   1103  C C   . ILE A  1 136 ? 13.756  -23.463 -1.165  1.00 72.63  ? 136  ILE A C   1 
ATOM   1104  O O   . ILE A  1 136 ? 14.740  -24.206 -1.152  1.00 73.07  ? 136  ILE A O   1 
ATOM   1105  C CB  . ILE A  1 136 ? 11.609  -24.814 -1.672  1.00 68.96  ? 136  ILE A CB  1 
ATOM   1106  C CG1 . ILE A  1 136 ? 10.339  -24.862 -2.564  1.00 69.78  ? 136  ILE A CG1 1 
ATOM   1107  C CG2 . ILE A  1 136 ? 11.288  -24.716 -0.178  1.00 64.67  ? 136  ILE A CG2 1 
ATOM   1108  C CD1 . ILE A  1 136 ? 9.524   -23.544 -2.679  1.00 82.72  ? 136  ILE A CD1 1 
ATOM   1109  N N   . HIS A  1 137 ? 13.621  -22.416 -0.360  1.00 67.12  ? 137  HIS A N   1 
ATOM   1110  C CA  . HIS A  1 137 ? 14.581  -22.056 0.651   1.00 66.26  ? 137  HIS A CA  1 
ATOM   1111  C C   . HIS A  1 137 ? 14.155  -22.766 1.914   1.00 69.61  ? 137  HIS A C   1 
ATOM   1112  O O   . HIS A  1 137 ? 13.399  -22.208 2.718   1.00 68.74  ? 137  HIS A O   1 
ATOM   1113  C CB  . HIS A  1 137 ? 14.574  -20.540 0.837   1.00 67.39  ? 137  HIS A CB  1 
ATOM   1114  C CG  . HIS A  1 137 ? 15.644  -20.054 1.740   1.00 71.13  ? 137  HIS A CG  1 
ATOM   1115  N ND1 . HIS A  1 137 ? 16.978  -20.227 1.425   1.00 74.95  ? 137  HIS A ND1 1 
ATOM   1116  C CD2 . HIS A  1 137 ? 15.545  -19.405 2.922   1.00 71.85  ? 137  HIS A CD2 1 
ATOM   1117  C CE1 . HIS A  1 137 ? 17.649  -19.705 2.433   1.00 74.26  ? 137  HIS A CE1 1 
ATOM   1118  N NE2 . HIS A  1 137 ? 16.821  -19.196 3.360   1.00 72.83  ? 137  HIS A NE2 1 
ATOM   1119  N N   . TRP A  1 138 ? 14.577  -24.029 2.060   1.00 67.16  ? 138  TRP A N   1 
ATOM   1120  C CA  . TRP A  1 138 ? 14.208  -24.882 3.206   1.00 65.60  ? 138  TRP A CA  1 
ATOM   1121  C C   . TRP A  1 138 ? 14.747  -24.357 4.499   1.00 67.61  ? 138  TRP A C   1 
ATOM   1122  O O   . TRP A  1 138 ? 14.110  -24.543 5.544   1.00 65.20  ? 138  TRP A O   1 
ATOM   1123  C CB  . TRP A  1 138 ? 14.663  -26.337 3.002   1.00 65.35  ? 138  TRP A CB  1 
ATOM   1124  C CG  . TRP A  1 138 ? 14.019  -26.998 1.833   1.00 67.25  ? 138  TRP A CG  1 
ATOM   1125  C CD1 . TRP A  1 138 ? 14.535  -27.115 0.581   1.00 72.25  ? 138  TRP A CD1 1 
ATOM   1126  C CD2 . TRP A  1 138 ? 12.683  -27.510 1.768   1.00 66.20  ? 138  TRP A CD2 1 
ATOM   1127  N NE1 . TRP A  1 138 ? 13.612  -27.691 -0.258  1.00 72.38  ? 138  TRP A NE1 1 
ATOM   1128  C CE2 . TRP A  1 138 ? 12.469  -27.957 0.450   1.00 71.52  ? 138  TRP A CE2 1 
ATOM   1129  C CE3 . TRP A  1 138 ? 11.639  -27.618 2.691   1.00 65.92  ? 138  TRP A CE3 1 
ATOM   1130  C CZ2 . TRP A  1 138 ? 11.273  -28.544 0.045   1.00 70.15  ? 138  TRP A CZ2 1 
ATOM   1131  C CZ3 . TRP A  1 138 ? 10.444  -28.187 2.284   1.00 67.30  ? 138  TRP A CZ3 1 
ATOM   1132  C CH2 . TRP A  1 138 ? 10.275  -28.652 0.979   1.00 69.32  ? 138  TRP A CH2 1 
ATOM   1133  N N   . GLN A  1 139 ? 15.941  -23.729 4.427   1.00 64.80  ? 139  GLN A N   1 
ATOM   1134  C CA  . GLN A  1 139 ? 16.620  -23.086 5.542   1.00 64.39  ? 139  GLN A CA  1 
ATOM   1135  C C   . GLN A  1 139 ? 15.627  -22.127 6.290   1.00 68.13  ? 139  GLN A C   1 
ATOM   1136  O O   . GLN A  1 139 ? 15.674  -22.077 7.518   1.00 67.45  ? 139  GLN A O   1 
ATOM   1137  C CB  . GLN A  1 139 ? 17.937  -22.432 5.030   1.00 67.79  ? 139  GLN A CB  1 
ATOM   1138  C CG  . GLN A  1 139 ? 18.416  -21.146 5.717   1.00 91.98  ? 139  GLN A CG  1 
ATOM   1139  C CD  . GLN A  1 139 ? 19.133  -21.354 7.030   1.00 114.52 ? 139  GLN A CD  1 
ATOM   1140  O OE1 . GLN A  1 139 ? 20.299  -21.777 7.061   1.00 117.58 ? 139  GLN A OE1 1 
ATOM   1141  N NE2 . GLN A  1 139 ? 18.486  -20.973 8.137   1.00 93.19  ? 139  GLN A NE2 1 
ATOM   1142  N N   . ASP A  1 140 ? 14.679  -21.456 5.557   1.00 64.49  ? 140  ASP A N   1 
ATOM   1143  C CA  . ASP A  1 140 ? 13.667  -20.576 6.147   1.00 62.98  ? 140  ASP A CA  1 
ATOM   1144  C C   . ASP A  1 140 ? 12.615  -21.353 6.894   1.00 67.46  ? 140  ASP A C   1 
ATOM   1145  O O   . ASP A  1 140 ? 12.098  -20.845 7.888   1.00 68.17  ? 140  ASP A O   1 
ATOM   1146  C CB  . ASP A  1 140 ? 12.974  -19.667 5.099   1.00 65.59  ? 140  ASP A CB  1 
ATOM   1147  C CG  . ASP A  1 140 ? 12.112  -18.531 5.690   1.00 72.13  ? 140  ASP A CG  1 
ATOM   1148  O OD1 . ASP A  1 140 ? 10.952  -18.820 6.142   1.00 74.19  ? 140  ASP A OD1 1 
ATOM   1149  O OD2 . ASP A  1 140 ? 12.569  -17.345 5.657   1.00 68.64  ? 140  ASP A OD2 1 
ATOM   1150  N N   . ILE A  1 141 ? 12.232  -22.537 6.392   1.00 63.77  ? 141  ILE A N   1 
ATOM   1151  C CA  . ILE A  1 141 ? 11.164  -23.379 6.970   1.00 61.41  ? 141  ILE A CA  1 
ATOM   1152  C C   . ILE A  1 141 ? 11.622  -24.151 8.230   1.00 65.54  ? 141  ILE A C   1 
ATOM   1153  O O   . ILE A  1 141 ? 10.857  -24.265 9.188   1.00 61.31  ? 141  ILE A O   1 
ATOM   1154  C CB  . ILE A  1 141 ? 10.582  -24.298 5.874   1.00 64.48  ? 141  ILE A CB  1 
ATOM   1155  C CG1 . ILE A  1 141 ? 10.125  -23.479 4.646   1.00 65.20  ? 141  ILE A CG1 1 
ATOM   1156  C CG2 . ILE A  1 141 ? 9.465   -25.152 6.420   1.00 65.42  ? 141  ILE A CG2 1 
ATOM   1157  C CD1 . ILE A  1 141 ? 9.680   -24.284 3.411   1.00 70.95  ? 141  ILE A CD1 1 
ATOM   1158  N N   . VAL A  1 142 ? 12.873  -24.656 8.231   1.00 67.85  ? 142  VAL A N   1 
ATOM   1159  C CA  . VAL A  1 142 ? 13.435  -25.380 9.377   1.00 69.18  ? 142  VAL A CA  1 
ATOM   1160  C C   . VAL A  1 142 ? 13.841  -24.406 10.472  1.00 81.07  ? 142  VAL A C   1 
ATOM   1161  O O   . VAL A  1 142 ? 14.686  -23.552 10.227  1.00 82.34  ? 142  VAL A O   1 
ATOM   1162  C CB  . VAL A  1 142 ? 14.607  -26.309 9.006   1.00 72.76  ? 142  VAL A CB  1 
ATOM   1163  C CG1 . VAL A  1 142 ? 14.943  -27.210 10.191  1.00 72.00  ? 142  VAL A CG1 1 
ATOM   1164  C CG2 . VAL A  1 142 ? 14.306  -27.137 7.754   1.00 72.86  ? 142  VAL A CG2 1 
ATOM   1165  N N   . ARG A  1 143 ? 13.250  -24.523 11.667  1.00 82.72  ? 143  ARG A N   1 
ATOM   1166  C CA  . ARG A  1 143 ? 13.547  -23.615 12.781  1.00 85.43  ? 143  ARG A CA  1 
ATOM   1167  C C   . ARG A  1 143 ? 14.922  -23.867 13.479  1.00 100.99 ? 143  ARG A C   1 
ATOM   1168  O O   . ARG A  1 143 ? 15.530  -22.895 13.953  1.00 102.23 ? 143  ARG A O   1 
ATOM   1169  C CB  . ARG A  1 143 ? 12.303  -23.445 13.706  1.00 80.65  ? 143  ARG A CB  1 
ATOM   1170  C CG  . ARG A  1 143 ? 12.447  -22.969 15.161  1.00 81.98  ? 143  ARG A CG  1 
ATOM   1171  C CD  . ARG A  1 143 ? 11.823  -21.609 15.583  1.00 82.17  ? 143  ARG A CD  1 
ATOM   1172  N NE  . ARG A  1 143 ? 10.470  -21.275 15.100  1.00 78.26  ? 143  ARG A NE  1 
ATOM   1173  C CZ  . ARG A  1 143 ? 9.731   -20.255 15.566  1.00 93.81  ? 143  ARG A CZ  1 
ATOM   1174  N NH1 . ARG A  1 143 ? 10.180  -19.495 16.561  1.00 72.25  ? 143  ARG A NH1 1 
ATOM   1175  N NH2 . ARG A  1 143 ? 8.529   -20.004 15.054  1.00 84.65  ? 143  ARG A NH2 1 
ATOM   1176  N N   . ASN A  1 144 ? 15.474  -25.117 13.467  1.00 103.85 ? 144  ASN A N   1 
ATOM   1177  C CA  . ASN A  1 144 ? 16.763  -25.329 14.157  1.00 106.81 ? 144  ASN A CA  1 
ATOM   1178  C C   . ASN A  1 144 ? 17.764  -26.342 13.590  1.00 116.85 ? 144  ASN A C   1 
ATOM   1179  O O   . ASN A  1 144 ? 17.362  -27.453 13.206  1.00 115.63 ? 144  ASN A O   1 
ATOM   1180  C CB  . ASN A  1 144 ? 16.571  -25.577 15.686  1.00 109.39 ? 144  ASN A CB  1 
ATOM   1181  C CG  . ASN A  1 144 ? 16.916  -24.403 16.607  1.00 132.10 ? 144  ASN A CG  1 
ATOM   1182  O OD1 . ASN A  1 144 ? 17.770  -23.550 16.311  1.00 125.24 ? 144  ASN A OD1 1 
ATOM   1183  N ND2 . ASN A  1 144 ? 16.273  -24.357 17.775  1.00 120.30 ? 144  ASN A ND2 1 
ATOM   1184  N N   . PRO A  1 145 ? 19.096  -25.998 13.686  1.00 118.89 ? 145  PRO A N   1 
ATOM   1185  C CA  . PRO A  1 145 ? 20.153  -26.921 13.243  1.00 126.44 ? 145  PRO A CA  1 
ATOM   1186  C C   . PRO A  1 145 ? 20.672  -27.806 14.391  1.00 170.15 ? 145  PRO A C   1 
ATOM   1187  O O   . PRO A  1 145 ? 21.383  -27.359 15.295  1.00 137.34 ? 145  PRO A O   1 
ATOM   1188  C CB  . PRO A  1 145 ? 21.256  -25.972 12.728  1.00 128.83 ? 145  PRO A CB  1 
ATOM   1189  C CG  . PRO A  1 145 ? 20.811  -24.560 13.117  1.00 130.44 ? 145  PRO A CG  1 
ATOM   1190  C CD  . PRO A  1 145 ? 19.710  -24.723 14.114  1.00 122.97 ? 145  PRO A CD  1 
ATOM   1191  N N   . SER A  1 148 ? 20.437  -30.118 12.409  1.00 114.97 ? 148  SER A N   1 
ATOM   1192  C CA  . SER A  1 148 ? 19.874  -30.651 11.171  1.00 114.79 ? 148  SER A CA  1 
ATOM   1193  C C   . SER A  1 148 ? 20.819  -30.522 9.923   1.00 122.37 ? 148  SER A C   1 
ATOM   1194  O O   . SER A  1 148 ? 20.390  -30.018 8.878   1.00 122.52 ? 148  SER A O   1 
ATOM   1195  C CB  . SER A  1 148 ? 18.481  -30.068 10.908  1.00 113.00 ? 148  SER A CB  1 
ATOM   1196  O OG  . SER A  1 148 ? 18.510  -28.725 10.450  1.00 109.12 ? 148  SER A OG  1 
ATOM   1197  N N   . ASN A  1 149 ? 22.073  -31.047 10.021  1.00 120.39 ? 149  ASN A N   1 
ATOM   1198  C CA  . ASN A  1 149 ? 23.100  -31.061 8.961   1.00 122.11 ? 149  ASN A CA  1 
ATOM   1199  C C   . ASN A  1 149 ? 22.640  -31.773 7.646   1.00 127.92 ? 149  ASN A C   1 
ATOM   1200  O O   . ASN A  1 149 ? 23.490  -32.190 6.835   1.00 129.62 ? 149  ASN A O   1 
ATOM   1201  C CB  . ASN A  1 149 ? 24.405  -31.691 9.518   1.00 119.81 ? 149  ASN A CB  1 
ATOM   1202  C CG  . ASN A  1 149 ? 25.582  -30.747 9.639   1.00 123.52 ? 149  ASN A CG  1 
ATOM   1203  O OD1 . ASN A  1 149 ? 26.289  -30.496 8.663   1.00 109.12 ? 149  ASN A OD1 1 
ATOM   1204  N ND2 . ASN A  1 149 ? 25.873  -30.260 10.848  1.00 111.33 ? 149  ASN A ND2 1 
ATOM   1205  N N   . LEU A  1 150 ? 21.289  -31.895 7.446   1.00 123.09 ? 150  LEU A N   1 
ATOM   1206  C CA  . LEU A  1 150 ? 20.614  -32.545 6.308   1.00 123.67 ? 150  LEU A CA  1 
ATOM   1207  C C   . LEU A  1 150 ? 19.346  -31.754 5.872   1.00 124.37 ? 150  LEU A C   1 
ATOM   1208  O O   . LEU A  1 150 ? 18.244  -32.032 6.354   1.00 122.23 ? 150  LEU A O   1 
ATOM   1209  C CB  . LEU A  1 150 ? 20.244  -34.012 6.661   1.00 123.99 ? 150  LEU A CB  1 
ATOM   1210  C CG  . LEU A  1 150 ? 21.358  -34.940 7.208   1.00 130.35 ? 150  LEU A CG  1 
ATOM   1211  C CD1 . LEU A  1 150 ? 21.078  -35.347 8.662   1.00 129.27 ? 150  LEU A CD1 1 
ATOM   1212  C CD2 . LEU A  1 150 ? 21.554  -36.157 6.322   1.00 133.91 ? 150  LEU A CD2 1 
ATOM   1213  N N   . THR A  1 151 ? 19.517  -30.767 4.964   1.00 120.49 ? 151  THR A N   1 
ATOM   1214  C CA  . THR A  1 151 ? 18.459  -29.886 4.415   1.00 118.63 ? 151  THR A CA  1 
ATOM   1215  C C   . THR A  1 151 ? 18.758  -29.647 2.897   1.00 126.16 ? 151  THR A C   1 
ATOM   1216  O O   . THR A  1 151 ? 19.258  -28.578 2.527   1.00 127.74 ? 151  THR A O   1 
ATOM   1217  C CB  . THR A  1 151 ? 18.337  -28.593 5.305   1.00 113.69 ? 151  THR A CB  1 
ATOM   1218  O OG1 . THR A  1 151 ? 17.830  -28.947 6.581   1.00 110.19 ? 151  THR A OG1 1 
ATOM   1219  C CG2 . THR A  1 151 ? 17.432  -27.538 4.734   1.00 107.70 ? 151  THR A CG2 1 
ATOM   1220  N N   . LEU A  1 152 ? 18.509  -30.666 2.028   1.00 123.27 ? 152  LEU A N   1 
ATOM   1221  C CA  . LEU A  1 152 ? 18.816  -30.549 0.587   1.00 124.72 ? 152  LEU A CA  1 
ATOM   1222  C C   . LEU A  1 152 ? 17.792  -31.159 -0.375  1.00 126.19 ? 152  LEU A C   1 
ATOM   1223  O O   . LEU A  1 152 ? 17.152  -32.154 -0.027  1.00 124.38 ? 152  LEU A O   1 
ATOM   1224  C CB  . LEU A  1 152 ? 20.232  -31.101 0.273   1.00 127.10 ? 152  LEU A CB  1 
ATOM   1225  C CG  . LEU A  1 152 ? 21.449  -30.226 0.664   1.00 132.69 ? 152  LEU A CG  1 
ATOM   1226  C CD1 . LEU A  1 152 ? 22.674  -31.075 0.955   1.00 134.63 ? 152  LEU A CD1 1 
ATOM   1227  C CD2 . LEU A  1 152 ? 21.767  -29.191 -0.405  1.00 136.80 ? 152  LEU A CD2 1 
ATOM   1228  N N   . VAL A  1 153 ? 17.690  -30.568 -1.605  1.00 122.66 ? 153  VAL A N   1 
ATOM   1229  C CA  . VAL A  1 153 ? 16.818  -30.982 -2.731  1.00 122.60 ? 153  VAL A CA  1 
ATOM   1230  C C   . VAL A  1 153 ? 17.628  -31.417 -3.983  1.00 127.32 ? 153  VAL A C   1 
ATOM   1231  O O   . VAL A  1 153 ? 18.420  -30.630 -4.495  1.00 128.17 ? 153  VAL A O   1 
ATOM   1232  C CB  . VAL A  1 153 ? 15.652  -29.981 -3.063  1.00 125.05 ? 153  VAL A CB  1 
ATOM   1233  C CG1 . VAL A  1 153 ? 16.099  -28.520 -3.072  1.00 124.96 ? 153  VAL A CG1 1 
ATOM   1234  C CG2 . VAL A  1 153 ? 14.901  -30.354 -4.343  1.00 125.92 ? 153  VAL A CG2 1 
ATOM   1235  N N   . SER A  1 154 ? 17.418  -32.663 -4.467  1.00 123.77 ? 154  SER A N   1 
ATOM   1236  C CA  . SER A  1 154 ? 18.113  -33.212 -5.636  1.00 152.98 ? 154  SER A CA  1 
ATOM   1237  C C   . SER A  1 154 ? 17.133  -33.699 -6.740  1.00 183.99 ? 154  SER A C   1 
ATOM   1238  O O   . SER A  1 154 ? 17.001  -34.891 -7.050  1.00 144.28 ? 154  SER A O   1 
ATOM   1239  C CB  . SER A  1 154 ? 19.108  -34.288 -5.207  1.00 157.52 ? 154  SER A CB  1 
ATOM   1240  O OG  . SER A  1 154 ? 19.828  -34.832 -6.302  1.00 170.40 ? 154  SER A OG  1 
ATOM   1241  N N   . SER A  1 159 ? 15.617  -31.487 -14.320 1.00 126.37 ? 159  SER A N   1 
ATOM   1242  C CA  . SER A  1 159 ? 15.848  -30.707 -15.540 1.00 128.71 ? 159  SER A CA  1 
ATOM   1243  C C   . SER A  1 159 ? 14.627  -30.712 -16.479 1.00 131.85 ? 159  SER A C   1 
ATOM   1244  O O   . SER A  1 159 ? 13.770  -31.601 -16.381 1.00 130.60 ? 159  SER A O   1 
ATOM   1245  C CB  . SER A  1 159 ? 17.146  -31.116 -16.249 1.00 135.94 ? 159  SER A CB  1 
ATOM   1246  O OG  . SER A  1 159 ? 17.019  -32.199 -17.160 1.00 146.99 ? 159  SER A OG  1 
ATOM   1247  N N   . GLY A  1 160 ? 14.560  -29.703 -17.352 1.00 128.55 ? 160  GLY A N   1 
ATOM   1248  C CA  . GLY A  1 160 ? 13.442  -29.482 -18.263 1.00 128.72 ? 160  GLY A CA  1 
ATOM   1249  C C   . GLY A  1 160 ? 12.221  -28.983 -17.514 1.00 128.89 ? 160  GLY A C   1 
ATOM   1250  O O   . GLY A  1 160 ? 11.091  -29.404 -17.791 1.00 128.19 ? 160  GLY A O   1 
ATOM   1251  N N   . CYS A  1 161 ? 12.456  -28.105 -16.519 1.00 122.01 ? 161  CYS A N   1 
ATOM   1252  C CA  . CYS A  1 161 ? 11.421  -27.535 -15.665 1.00 117.94 ? 161  CYS A CA  1 
ATOM   1253  C C   . CYS A  1 161 ? 11.228  -26.069 -15.957 1.00 121.74 ? 161  CYS A C   1 
ATOM   1254  O O   . CYS A  1 161 ? 12.206  -25.354 -16.232 1.00 121.69 ? 161  CYS A O   1 
ATOM   1255  C CB  . CYS A  1 161 ? 11.738  -27.770 -14.191 1.00 114.64 ? 161  CYS A CB  1 
ATOM   1256  S SG  . CYS A  1 161 ? 11.525  -29.490 -13.639 1.00 116.66 ? 161  CYS A SG  1 
ATOM   1257  N N   . GLY A  1 162 ? 9.961   -25.645 -15.861 1.00 117.15 ? 162  GLY A N   1 
ATOM   1258  C CA  . GLY A  1 162 ? 9.541   -24.267 -16.079 1.00 116.84 ? 162  GLY A CA  1 
ATOM   1259  C C   . GLY A  1 162 ? 10.124  -23.337 -15.040 1.00 117.06 ? 162  GLY A C   1 
ATOM   1260  O O   . GLY A  1 162 ? 10.399  -23.767 -13.921 1.00 114.92 ? 162  GLY A O   1 
ATOM   1261  N N   . ARG A  1 163 ? 10.367  -22.073 -15.406 1.00 112.89 ? 163  ARG A N   1 
ATOM   1262  C CA  . ARG A  1 163 ? 10.906  -21.107 -14.452 1.00 110.54 ? 163  ARG A CA  1 
ATOM   1263  C C   . ARG A  1 163 ? 9.803   -20.598 -13.508 1.00 111.49 ? 163  ARG A C   1 
ATOM   1264  O O   . ARG A  1 163 ? 8.605   -20.756 -13.806 1.00 110.57 ? 163  ARG A O   1 
ATOM   1265  C CB  . ARG A  1 163 ? 11.599  -19.946 -15.170 1.00 110.91 ? 163  ARG A CB  1 
ATOM   1266  C CG  . ARG A  1 163 ? 12.997  -20.274 -15.655 1.00 118.06 ? 163  ARG A CG  1 
ATOM   1267  C CD  . ARG A  1 163 ? 13.719  -19.015 -16.052 1.00 132.83 ? 163  ARG A CD  1 
ATOM   1268  N NE  . ARG A  1 163 ? 14.900  -19.283 -16.878 1.00 151.07 ? 163  ARG A NE  1 
ATOM   1269  C CZ  . ARG A  1 163 ? 14.942  -19.146 -18.204 1.00 172.25 ? 163  ARG A CZ  1 
ATOM   1270  N NH1 . ARG A  1 163 ? 13.863  -18.756 -18.874 1.00 164.03 ? 163  ARG A NH1 1 
ATOM   1271  N NH2 . ARG A  1 163 ? 16.063  -19.402 -18.869 1.00 158.87 ? 163  ARG A NH2 1 
ATOM   1272  N N   . CYS A  1 164 ? 10.215  -20.026 -12.347 1.00 105.97 ? 164  CYS A N   1 
ATOM   1273  C CA  . CYS A  1 164 ? 9.294   -19.431 -11.371 1.00 103.62 ? 164  CYS A CA  1 
ATOM   1274  C C   . CYS A  1 164 ? 8.734   -18.157 -11.996 1.00 111.25 ? 164  CYS A C   1 
ATOM   1275  O O   . CYS A  1 164 ? 9.412   -17.528 -12.818 1.00 113.98 ? 164  CYS A O   1 
ATOM   1276  C CB  . CYS A  1 164 ? 10.003  -19.104 -10.057 1.00 101.02 ? 164  CYS A CB  1 
ATOM   1277  S SG  . CYS A  1 164 ? 10.046  -20.453 -8.837  1.00 101.80 ? 164  CYS A SG  1 
ATOM   1278  N N   . HIS A  1 165 ? 7.530   -17.745 -11.564 1.00 106.48 ? 165  HIS A N   1 
ATOM   1279  C CA  . HIS A  1 165 ? 6.913   -16.500 -12.004 1.00 107.31 ? 165  HIS A CA  1 
ATOM   1280  C C   . HIS A  1 165 ? 7.800   -15.307 -11.572 1.00 110.89 ? 165  HIS A C   1 
ATOM   1281  O O   . HIS A  1 165 ? 8.574   -15.429 -10.611 1.00 108.77 ? 165  HIS A O   1 
ATOM   1282  C CB  . HIS A  1 165 ? 5.515   -16.392 -11.396 1.00 106.56 ? 165  HIS A CB  1 
ATOM   1283  C CG  . HIS A  1 165 ? 4.693   -15.284 -11.958 1.00 111.45 ? 165  HIS A CG  1 
ATOM   1284  N ND1 . HIS A  1 165 ? 3.778   -15.511 -12.957 1.00 114.78 ? 165  HIS A ND1 1 
ATOM   1285  C CD2 . HIS A  1 165 ? 4.671   -13.974 -11.633 1.00 113.64 ? 165  HIS A CD2 1 
ATOM   1286  C CE1 . HIS A  1 165 ? 3.233   -14.334 -13.218 1.00 115.58 ? 165  HIS A CE1 1 
ATOM   1287  N NE2 . HIS A  1 165 ? 3.738   -13.382 -12.442 1.00 115.24 ? 165  HIS A NE2 1 
ATOM   1288  N N   . LYS A  1 166 ? 7.723   -14.183 -12.316 1.00 109.43 ? 166  LYS A N   1 
ATOM   1289  C CA  . LYS A  1 166 ? 8.506   -12.971 -12.036 1.00 109.81 ? 166  LYS A CA  1 
ATOM   1290  C C   . LYS A  1 166 ? 8.311   -12.500 -10.587 1.00 109.81 ? 166  LYS A C   1 
ATOM   1291  O O   . LYS A  1 166 ? 9.293   -12.245 -9.890  1.00 107.74 ? 166  LYS A O   1 
ATOM   1292  C CB  . LYS A  1 166 ? 8.160   -11.840 -13.033 1.00 115.11 ? 166  LYS A CB  1 
ATOM   1293  C CG  . LYS A  1 166 ? 9.123   -10.637 -12.977 1.00 124.96 ? 166  LYS A CG  1 
ATOM   1294  C CD  . LYS A  1 166 ? 8.430   -9.284  -13.271 1.00 131.53 ? 166  LYS A CD  1 
ATOM   1295  C CE  . LYS A  1 166 ? 9.327   -8.076  -13.064 1.00 133.81 ? 166  LYS A CE  1 
ATOM   1296  N NZ  . LYS A  1 166 ? 8.593   -6.947  -12.422 1.00 139.72 ? 166  LYS A NZ  1 
ATOM   1297  N N   . SER A  1 167 ? 7.049   -12.429 -10.135 1.00 104.91 ? 167  SER A N   1 
ATOM   1298  C CA  . SER A  1 167 ? 6.697   -11.983 -8.792  1.00 102.62 ? 167  SER A CA  1 
ATOM   1299  C C   . SER A  1 167 ? 7.260   -12.863 -7.663  1.00 104.55 ? 167  SER A C   1 
ATOM   1300  O O   . SER A  1 167 ? 7.469   -12.367 -6.556  1.00 103.40 ? 167  SER A O   1 
ATOM   1301  C CB  . SER A  1 167 ? 5.184   -11.836 -8.661  1.00 105.64 ? 167  SER A CB  1 
ATOM   1302  O OG  . SER A  1 167 ? 4.518   -13.079 -8.804  1.00 114.19 ? 167  SER A OG  1 
ATOM   1303  N N   . CYS A  1 168 ? 7.536   -14.147 -7.956  1.00 100.08 ? 168  CYS A N   1 
ATOM   1304  C CA  . CYS A  1 168 ? 8.026   -15.127 -6.995  1.00 97.45  ? 168  CYS A CA  1 
ATOM   1305  C C   . CYS A  1 168 ? 9.420   -14.935 -6.464  1.00 96.78  ? 168  CYS A C   1 
ATOM   1306  O O   . CYS A  1 168 ? 9.746   -15.495 -5.414  1.00 95.95  ? 168  CYS A O   1 
ATOM   1307  C CB  . CYS A  1 168 ? 7.801   -16.545 -7.497  1.00 98.87  ? 168  CYS A CB  1 
ATOM   1308  S SG  . CYS A  1 168 ? 6.059   -17.028 -7.572  1.00 103.05 ? 168  CYS A SG  1 
ATOM   1309  N N   . THR A  1 169 ? 10.240  -14.150 -7.153  1.00 90.76  ? 169  THR A N   1 
ATOM   1310  C CA  . THR A  1 169 ? 11.616  -13.886 -6.730  1.00 89.00  ? 169  THR A CA  1 
ATOM   1311  C C   . THR A  1 169 ? 12.469  -15.176 -6.740  1.00 89.33  ? 169  THR A C   1 
ATOM   1312  O O   . THR A  1 169 ? 13.335  -15.385 -5.895  1.00 87.73  ? 169  THR A O   1 
ATOM   1313  C CB  . THR A  1 169 ? 11.627  -12.920 -5.534  1.00 92.60  ? 169  THR A CB  1 
ATOM   1314  O OG1 . THR A  1 169 ? 11.056  -11.696 -5.987  1.00 93.30  ? 169  THR A OG1 1 
ATOM   1315  C CG2 . THR A  1 169 ? 13.013  -12.650 -4.974  1.00 91.49  ? 169  THR A CG2 1 
ATOM   1316  N N   . GLY A  1 170 ? 12.177  -16.029 -7.717  1.00 85.02  ? 170  GLY A N   1 
ATOM   1317  C CA  . GLY A  1 170 ? 12.891  -17.269 -7.967  1.00 84.73  ? 170  GLY A CA  1 
ATOM   1318  C C   . GLY A  1 170 ? 12.678  -18.386 -6.981  1.00 87.51  ? 170  GLY A C   1 
ATOM   1319  O O   . GLY A  1 170 ? 13.407  -19.369 -7.046  1.00 89.92  ? 170  GLY A O   1 
ATOM   1320  N N   . ARG A  1 171 ? 11.694  -18.263 -6.073  1.00 81.05  ? 171  ARG A N   1 
ATOM   1321  C CA  . ARG A  1 171 ? 11.346  -19.277 -5.067  1.00 78.62  ? 171  ARG A CA  1 
ATOM   1322  C C   . ARG A  1 171 ? 9.841   -19.543 -5.102  1.00 85.06  ? 171  ARG A C   1 
ATOM   1323  O O   . ARG A  1 171 ? 9.045   -18.691 -4.687  1.00 82.58  ? 171  ARG A O   1 
ATOM   1324  C CB  . ARG A  1 171 ? 11.773  -18.840 -3.659  1.00 73.00  ? 171  ARG A CB  1 
ATOM   1325  C CG  . ARG A  1 171 ? 13.250  -18.624 -3.509  1.00 70.81  ? 171  ARG A CG  1 
ATOM   1326  C CD  . ARG A  1 171 ? 13.677  -18.764 -2.078  1.00 72.91  ? 171  ARG A CD  1 
ATOM   1327  N NE  . ARG A  1 171 ? 15.069  -18.356 -1.880  1.00 87.03  ? 171  ARG A NE  1 
ATOM   1328  C CZ  . ARG A  1 171 ? 16.132  -19.121 -2.130  1.00 106.00 ? 171  ARG A CZ  1 
ATOM   1329  N NH1 . ARG A  1 171 ? 15.980  -20.351 -2.608  1.00 89.57  ? 171  ARG A NH1 1 
ATOM   1330  N NH2 . ARG A  1 171 ? 17.351  -18.659 -1.913  1.00 101.20 ? 171  ARG A NH2 1 
ATOM   1331  N N   . CYS A  1 172 ? 9.459   -20.728 -5.602  1.00 86.25  ? 172  CYS A N   1 
ATOM   1332  C CA  . CYS A  1 172 ? 8.063   -21.110 -5.776  1.00 87.73  ? 172  CYS A CA  1 
ATOM   1333  C C   . CYS A  1 172 ? 7.850   -22.626 -5.736  1.00 89.74  ? 172  CYS A C   1 
ATOM   1334  O O   . CYS A  1 172 ? 8.803   -23.388 -5.905  1.00 89.45  ? 172  CYS A O   1 
ATOM   1335  C CB  . CYS A  1 172 ? 7.514   -20.501 -7.066  1.00 92.02  ? 172  CYS A CB  1 
ATOM   1336  S SG  . CYS A  1 172 ? 8.185   -21.231 -8.586  1.00 99.80  ? 172  CYS A SG  1 
ATOM   1337  N N   . TRP A  1 173 ? 6.583   -23.050 -5.525  1.00 84.83  ? 173  TRP A N   1 
ATOM   1338  C CA  . TRP A  1 173 ? 6.151   -24.444 -5.473  1.00 83.88  ? 173  TRP A CA  1 
ATOM   1339  C C   . TRP A  1 173 ? 5.602   -24.907 -6.819  1.00 90.33  ? 173  TRP A C   1 
ATOM   1340  O O   . TRP A  1 173 ? 5.570   -26.116 -7.086  1.00 91.36  ? 173  TRP A O   1 
ATOM   1341  C CB  . TRP A  1 173 ? 5.071   -24.613 -4.421  1.00 80.49  ? 173  TRP A CB  1 
ATOM   1342  C CG  . TRP A  1 173 ? 5.529   -24.304 -3.033  1.00 79.99  ? 173  TRP A CG  1 
ATOM   1343  C CD1 . TRP A  1 173 ? 5.277   -23.167 -2.322  1.00 82.18  ? 173  TRP A CD1 1 
ATOM   1344  C CD2 . TRP A  1 173 ? 6.288   -25.161 -2.169  1.00 78.93  ? 173  TRP A CD2 1 
ATOM   1345  N NE1 . TRP A  1 173 ? 5.821   -23.267 -1.061  1.00 80.49  ? 173  TRP A NE1 1 
ATOM   1346  C CE2 . TRP A  1 173 ? 6.460   -24.477 -0.944  1.00 81.83  ? 173  TRP A CE2 1 
ATOM   1347  C CE3 . TRP A  1 173 ? 6.853   -26.441 -2.312  1.00 80.23  ? 173  TRP A CE3 1 
ATOM   1348  C CZ2 . TRP A  1 173 ? 7.178   -25.028 0.128   1.00 79.72  ? 173  TRP A CZ2 1 
ATOM   1349  C CZ3 . TRP A  1 173 ? 7.551   -26.988 -1.246  1.00 80.21  ? 173  TRP A CZ3 1 
ATOM   1350  C CH2 . TRP A  1 173 ? 7.720   -26.281 -0.049  1.00 79.33  ? 173  TRP A CH2 1 
ATOM   1351  N N   . GLY A  1 174 ? 5.167   -23.939 -7.637  1.00 86.64  ? 174  GLY A N   1 
ATOM   1352  C CA  . GLY A  1 174 ? 4.581   -24.160 -8.954  1.00 87.24  ? 174  GLY A CA  1 
ATOM   1353  C C   . GLY A  1 174 ? 4.797   -23.017 -9.928  1.00 91.71  ? 174  GLY A C   1 
ATOM   1354  O O   . GLY A  1 174 ? 5.457   -22.026 -9.597  1.00 89.76  ? 174  GLY A O   1 
ATOM   1355  N N   . PRO A  1 175 ? 4.182   -23.105 -11.136 1.00 91.20  ? 175  PRO A N   1 
ATOM   1356  C CA  . PRO A  1 175 ? 4.435   -22.092 -12.188 1.00 92.90  ? 175  PRO A CA  1 
ATOM   1357  C C   . PRO A  1 175 ? 3.794   -20.708 -12.083 1.00 97.30  ? 175  PRO A C   1 
ATOM   1358  O O   . PRO A  1 175 ? 4.366   -19.743 -12.599 1.00 98.65  ? 175  PRO A O   1 
ATOM   1359  C CB  . PRO A  1 175 ? 3.982   -22.804 -13.456 1.00 96.30  ? 175  PRO A CB  1 
ATOM   1360  C CG  . PRO A  1 175 ? 2.914   -23.714 -12.998 1.00 99.43  ? 175  PRO A CG  1 
ATOM   1361  C CD  . PRO A  1 175 ? 3.379   -24.226 -11.669 1.00 93.11  ? 175  PRO A CD  1 
ATOM   1362  N N   . THR A  1 176 ? 2.600   -20.621 -11.474 1.00 92.12  ? 176  THR A N   1 
ATOM   1363  C CA  . THR A  1 176 ? 1.828   -19.385 -11.355 1.00 92.28  ? 176  THR A CA  1 
ATOM   1364  C C   . THR A  1 176 ? 2.396   -18.357 -10.362 1.00 95.83  ? 176  THR A C   1 
ATOM   1365  O O   . THR A  1 176 ? 3.336   -18.643 -9.623  1.00 93.96  ? 176  THR A O   1 
ATOM   1366  C CB  . THR A  1 176 ? 0.340   -19.693 -11.073 1.00 99.74  ? 176  THR A CB  1 
ATOM   1367  O OG1 . THR A  1 176 ? 0.131   -19.759 -9.662  1.00 96.96  ? 176  THR A OG1 1 
ATOM   1368  C CG2 . THR A  1 176 ? -0.169  -20.966 -11.769 1.00 97.17  ? 176  THR A CG2 1 
ATOM   1369  N N   . GLU A  1 177 ? 1.777   -17.165 -10.335 1.00 94.46  ? 177  GLU A N   1 
ATOM   1370  C CA  . GLU A  1 177 ? 2.084   -16.043 -9.443  1.00 94.27  ? 177  GLU A CA  1 
ATOM   1371  C C   . GLU A  1 177 ? 1.483   -16.289 -8.052  1.00 97.09  ? 177  GLU A C   1 
ATOM   1372  O O   . GLU A  1 177 ? 1.761   -15.534 -7.124  1.00 95.72  ? 177  GLU A O   1 
ATOM   1373  C CB  . GLU A  1 177 ? 1.535   -14.724 -10.029 1.00 98.00  ? 177  GLU A CB  1 
ATOM   1374  C CG  . GLU A  1 177 ? 0.009   -14.680 -10.118 1.00 116.52 ? 177  GLU A CG  1 
ATOM   1375  C CD  . GLU A  1 177 ? -0.613  -13.653 -11.045 1.00 150.12 ? 177  GLU A CD  1 
ATOM   1376  O OE1 . GLU A  1 177 ? -1.631  -13.045 -10.639 1.00 139.41 ? 177  GLU A OE1 1 
ATOM   1377  O OE2 . GLU A  1 177 ? -0.126  -13.494 -12.189 1.00 153.86 ? 177  GLU A OE2 1 
ATOM   1378  N N   . ASN A  1 178 ? 0.632   -17.315 -7.919  1.00 94.39  ? 178  ASN A N   1 
ATOM   1379  C CA  . ASN A  1 178 ? -0.023  -17.648 -6.653  1.00 92.76  ? 178  ASN A CA  1 
ATOM   1380  C C   . ASN A  1 178 ? 0.696   -18.824 -5.997  1.00 95.49  ? 178  ASN A C   1 
ATOM   1381  O O   . ASN A  1 178 ? 0.201   -19.384 -5.020  1.00 93.24  ? 178  ASN A O   1 
ATOM   1382  C CB  . ASN A  1 178 ? -1.526  -17.970 -6.885  1.00 95.34  ? 178  ASN A CB  1 
ATOM   1383  C CG  . ASN A  1 178 ? -2.266  -16.920 -7.693  1.00 124.21 ? 178  ASN A CG  1 
ATOM   1384  O OD1 . ASN A  1 178 ? -2.632  -15.855 -7.197  1.00 125.41 ? 178  ASN A OD1 1 
ATOM   1385  N ND2 . ASN A  1 178 ? -2.489  -17.187 -8.966  1.00 114.40 ? 178  ASN A ND2 1 
ATOM   1386  N N   . HIS A  1 179 ? 1.853   -19.204 -6.558  1.00 93.58  ? 179  HIS A N   1 
ATOM   1387  C CA  . HIS A  1 179 ? 2.659   -20.342 -6.124  1.00 92.79  ? 179  HIS A CA  1 
ATOM   1388  C C   . HIS A  1 179 ? 3.931   -19.948 -5.401  1.00 95.04  ? 179  HIS A C   1 
ATOM   1389  O O   . HIS A  1 179 ? 4.749   -20.822 -5.097  1.00 94.59  ? 179  HIS A O   1 
ATOM   1390  C CB  . HIS A  1 179 ? 3.009   -21.217 -7.337  1.00 95.87  ? 179  HIS A CB  1 
ATOM   1391  C CG  . HIS A  1 179 ? 1.868   -22.007 -7.899  1.00 100.22 ? 179  HIS A CG  1 
ATOM   1392  N ND1 . HIS A  1 179 ? 0.814   -22.434 -7.106  1.00 100.66 ? 179  HIS A ND1 1 
ATOM   1393  C CD2 . HIS A  1 179 ? 1.688   -22.480 -9.149  1.00 104.46 ? 179  HIS A CD2 1 
ATOM   1394  C CE1 . HIS A  1 179 ? 0.019   -23.119 -7.908  1.00 101.47 ? 179  HIS A CE1 1 
ATOM   1395  N NE2 . HIS A  1 179 ? 0.515   -23.186 -9.144  1.00 104.13 ? 179  HIS A NE2 1 
ATOM   1396  N N   . CYS A  1 180 ? 4.098   -18.653 -5.117  1.00 90.61  ? 180  CYS A N   1 
ATOM   1397  C CA  . CYS A  1 180 ? 5.298   -18.149 -4.473  1.00 89.97  ? 180  CYS A CA  1 
ATOM   1398  C C   . CYS A  1 180 ? 5.498   -18.677 -3.068  1.00 86.12  ? 180  CYS A C   1 
ATOM   1399  O O   . CYS A  1 180 ? 4.525   -18.820 -2.320  1.00 84.30  ? 180  CYS A O   1 
ATOM   1400  C CB  . CYS A  1 180 ? 5.336   -16.627 -4.512  1.00 92.84  ? 180  CYS A CB  1 
ATOM   1401  S SG  . CYS A  1 180 ? 5.078   -15.906 -6.160  1.00 101.00 ? 180  CYS A SG  1 
ATOM   1402  N N   . GLN A  1 181 ? 6.761   -18.978 -2.717  1.00 77.85  ? 181  GLN A N   1 
ATOM   1403  C CA  . GLN A  1 181 ? 7.106   -19.469 -1.392  1.00 74.48  ? 181  GLN A CA  1 
ATOM   1404  C C   . GLN A  1 181 ? 7.057   -18.307 -0.419  1.00 74.37  ? 181  GLN A C   1 
ATOM   1405  O O   . GLN A  1 181 ? 7.768   -17.326 -0.603  1.00 74.04  ? 181  GLN A O   1 
ATOM   1406  C CB  . GLN A  1 181 ? 8.502   -20.126 -1.386  1.00 76.43  ? 181  GLN A CB  1 
ATOM   1407  C CG  . GLN A  1 181 ? 8.945   -20.641 -0.004  1.00 88.68  ? 181  GLN A CG  1 
ATOM   1408  C CD  . GLN A  1 181 ? 10.415  -20.990 0.114   1.00 97.35  ? 181  GLN A CD  1 
ATOM   1409  O OE1 . GLN A  1 181 ? 11.207  -20.833 -0.814  1.00 92.85  ? 181  GLN A OE1 1 
ATOM   1410  N NE2 . GLN A  1 181 ? 10.827  -21.423 1.294   1.00 85.74  ? 181  GLN A NE2 1 
ATOM   1411  N N   . THR A  1 182 ? 6.221   -18.415 0.616   1.00 68.70  ? 182  THR A N   1 
ATOM   1412  C CA  . THR A  1 182 ? 6.117   -17.365 1.629   1.00 67.24  ? 182  THR A CA  1 
ATOM   1413  C C   . THR A  1 182 ? 7.269   -17.480 2.633   1.00 70.16  ? 182  THR A C   1 
ATOM   1414  O O   . THR A  1 182 ? 7.268   -18.370 3.490   1.00 71.02  ? 182  THR A O   1 
ATOM   1415  C CB  . THR A  1 182 ? 4.726   -17.356 2.282   1.00 70.35  ? 182  THR A CB  1 
ATOM   1416  O OG1 . THR A  1 182 ? 3.705   -17.296 1.279   1.00 71.09  ? 182  THR A OG1 1 
ATOM   1417  C CG2 . THR A  1 182 ? 4.561   -16.216 3.255   1.00 67.31  ? 182  THR A CG2 1 
ATOM   1418  N N   . LEU A  1 183 ? 8.270   -16.609 2.503   1.00 63.76  ? 183  LEU A N   1 
ATOM   1419  C CA  . LEU A  1 183 ? 9.396   -16.617 3.429   1.00 61.57  ? 183  LEU A CA  1 
ATOM   1420  C C   . LEU A  1 183 ? 8.983   -15.968 4.751   1.00 63.84  ? 183  LEU A C   1 
ATOM   1421  O O   . LEU A  1 183 ? 8.417   -14.888 4.741   1.00 66.59  ? 183  LEU A O   1 
ATOM   1422  C CB  . LEU A  1 183 ? 10.605  -15.897 2.804   1.00 63.17  ? 183  LEU A CB  1 
ATOM   1423  C CG  . LEU A  1 183 ? 11.340  -16.533 1.594   1.00 69.03  ? 183  LEU A CG  1 
ATOM   1424  C CD1 . LEU A  1 183 ? 12.784  -16.174 1.632   1.00 70.29  ? 183  LEU A CD1 1 
ATOM   1425  C CD2 . LEU A  1 183 ? 11.318  -18.049 1.615   1.00 71.96  ? 183  LEU A CD2 1 
ATOM   1426  N N   . THR A  1 184 ? 9.127   -16.658 5.878   1.00 57.70  ? 184  THR A N   1 
ATOM   1427  C CA  . THR A  1 184 ? 8.666   -16.055 7.147   1.00 55.62  ? 184  THR A CA  1 
ATOM   1428  C C   . THR A  1 184 ? 9.764   -15.857 8.199   1.00 59.08  ? 184  THR A C   1 
ATOM   1429  O O   . THR A  1 184 ? 9.450   -15.490 9.331   1.00 57.45  ? 184  THR A O   1 
ATOM   1430  C CB  . THR A  1 184 ? 7.443   -16.802 7.734   1.00 50.73  ? 184  THR A CB  1 
ATOM   1431  O OG1 . THR A  1 184 ? 7.866   -18.074 8.212   1.00 43.65  ? 184  THR A OG1 1 
ATOM   1432  C CG2 . THR A  1 184 ? 6.284   -16.946 6.739   1.00 45.39  ? 184  THR A CG2 1 
ATOM   1433  N N   . ARG A  1 185 ? 11.040  -16.064 7.838   1.00 56.20  ? 185  ARG A N   1 
ATOM   1434  C CA  . ARG A  1 185 ? 12.081  -15.957 8.840   1.00 55.41  ? 185  ARG A CA  1 
ATOM   1435  C C   . ARG A  1 185 ? 13.283  -15.141 8.394   1.00 61.96  ? 185  ARG A C   1 
ATOM   1436  O O   . ARG A  1 185 ? 13.700  -14.233 9.119   1.00 64.23  ? 185  ARG A O   1 
ATOM   1437  C CB  . ARG A  1 185 ? 12.465  -17.354 9.363   1.00 52.64  ? 185  ARG A CB  1 
ATOM   1438  C CG  . ARG A  1 185 ? 13.221  -17.319 10.668  1.00 65.91  ? 185  ARG A CG  1 
ATOM   1439  C CD  . ARG A  1 185 ? 13.347  -18.687 11.286  1.00 93.19  ? 185  ARG A CD  1 
ATOM   1440  N NE  . ARG A  1 185 ? 13.551  -18.549 12.726  1.00 111.73 ? 185  ARG A NE  1 
ATOM   1441  C CZ  . ARG A  1 185 ? 14.290  -19.369 13.458  1.00 122.68 ? 185  ARG A CZ  1 
ATOM   1442  N NH1 . ARG A  1 185 ? 14.917  -20.397 12.890  1.00 113.69 ? 185  ARG A NH1 1 
ATOM   1443  N NH2 . ARG A  1 185 ? 14.416  -19.168 14.764  1.00 95.23  ? 185  ARG A NH2 1 
ATOM   1444  N N   . THR A  1 186 ? 13.830  -15.444 7.219   1.00 56.66  ? 186  THR A N   1 
ATOM   1445  C CA  . THR A  1 186 ? 15.029  -14.783 6.703   1.00 57.64  ? 186  THR A CA  1 
ATOM   1446  C C   . THR A  1 186 ? 14.766  -13.337 6.278   1.00 61.57  ? 186  THR A C   1 
ATOM   1447  O O   . THR A  1 186 ? 15.668  -12.508 6.296   1.00 61.97  ? 186  THR A O   1 
ATOM   1448  C CB  . THR A  1 186 ? 15.630  -15.628 5.566   1.00 64.28  ? 186  THR A CB  1 
ATOM   1449  O OG1 . THR A  1 186 ? 14.790  -15.530 4.401   1.00 65.40  ? 186  THR A OG1 1 
ATOM   1450  C CG2 . THR A  1 186 ? 15.844  -17.097 5.983   1.00 56.33  ? 186  THR A CG2 1 
ATOM   1451  N N   . VAL A  1 187 ? 13.517  -13.057 5.898   1.00 56.79  ? 187  VAL A N   1 
ATOM   1452  C CA  . VAL A  1 187 ? 13.005  -11.774 5.411   1.00 55.96  ? 187  VAL A CA  1 
ATOM   1453  C C   . VAL A  1 187 ? 12.596  -10.798 6.527   1.00 65.78  ? 187  VAL A C   1 
ATOM   1454  O O   . VAL A  1 187 ? 12.128  -9.695  6.256   1.00 68.18  ? 187  VAL A O   1 
ATOM   1455  C CB  . VAL A  1 187 ? 11.837  -12.044 4.450   1.00 56.12  ? 187  VAL A CB  1 
ATOM   1456  C CG1 . VAL A  1 187 ? 12.291  -12.900 3.289   1.00 55.74  ? 187  VAL A CG1 1 
ATOM   1457  C CG2 . VAL A  1 187 ? 10.672  -12.697 5.173   1.00 53.74  ? 187  VAL A CG2 1 
ATOM   1458  N N   . CYS A  1 188 ? 12.769  -11.191 7.764   1.00 65.08  ? 188  CYS A N   1 
ATOM   1459  C CA  . CYS A  1 188 ? 12.366  -10.364 8.875   1.00 67.51  ? 188  CYS A CA  1 
ATOM   1460  C C   . CYS A  1 188 ? 13.322  -9.239  9.204   1.00 71.96  ? 188  CYS A C   1 
ATOM   1461  O O   . CYS A  1 188 ? 14.501  -9.294  8.849   1.00 71.18  ? 188  CYS A O   1 
ATOM   1462  C CB  . CYS A  1 188 ? 12.086  -11.245 10.088  1.00 68.55  ? 188  CYS A CB  1 
ATOM   1463  S SG  . CYS A  1 188 ? 10.872  -12.552 9.773   1.00 72.82  ? 188  CYS A SG  1 
ATOM   1464  N N   . ALA A  1 189 ? 12.796  -8.222  9.911   1.00 69.71  ? 189  ALA A N   1 
ATOM   1465  C CA  . ALA A  1 189 ? 13.539  -7.078  10.434  1.00 70.30  ? 189  ALA A CA  1 
ATOM   1466  C C   . ALA A  1 189 ? 14.616  -7.619  11.378  1.00 73.41  ? 189  ALA A C   1 
ATOM   1467  O O   . ALA A  1 189 ? 14.390  -8.635  12.047  1.00 70.08  ? 189  ALA A O   1 
ATOM   1468  C CB  . ALA A  1 189 ? 12.597  -6.154  11.195  1.00 70.44  ? 189  ALA A CB  1 
ATOM   1469  N N   . GLU A  1 190 ? 15.792  -6.975  11.428  1.00 73.43  ? 190  GLU A N   1 
ATOM   1470  C CA  . GLU A  1 190 ? 16.845  -7.493  12.303  1.00 73.83  ? 190  GLU A CA  1 
ATOM   1471  C C   . GLU A  1 190 ? 16.464  -7.637  13.781  1.00 82.21  ? 190  GLU A C   1 
ATOM   1472  O O   . GLU A  1 190 ? 17.142  -8.353  14.517  1.00 83.07  ? 190  GLU A O   1 
ATOM   1473  C CB  . GLU A  1 190 ? 18.199  -6.823  12.076  1.00 76.02  ? 190  GLU A CB  1 
ATOM   1474  C CG  . GLU A  1 190 ? 18.919  -7.337  10.839  1.00 84.89  ? 190  GLU A CG  1 
ATOM   1475  C CD  . GLU A  1 190 ? 19.071  -8.843  10.654  1.00 106.28 ? 190  GLU A CD  1 
ATOM   1476  O OE1 . GLU A  1 190 ? 19.529  -9.527  11.600  1.00 112.71 ? 190  GLU A OE1 1 
ATOM   1477  O OE2 . GLU A  1 190 ? 18.740  -9.335  9.548   1.00 85.97  ? 190  GLU A OE2 1 
ATOM   1478  N N   . GLN A  1 191 ? 15.325  -7.042  14.180  1.00 80.59  ? 191  GLN A N   1 
ATOM   1479  C CA  . GLN A  1 191 ? 14.825  -7.097  15.545  1.00 80.06  ? 191  GLN A CA  1 
ATOM   1480  C C   . GLN A  1 191 ? 13.840  -8.202  15.856  1.00 84.52  ? 191  GLN A C   1 
ATOM   1481  O O   . GLN A  1 191 ? 13.601  -8.448  17.042  1.00 84.64  ? 191  GLN A O   1 
ATOM   1482  C CB  . GLN A  1 191 ? 14.328  -5.738  16.007  1.00 82.33  ? 191  GLN A CB  1 
ATOM   1483  C CG  . GLN A  1 191 ? 15.426  -4.929  16.697  1.00 102.39 ? 191  GLN A CG  1 
ATOM   1484  C CD  . GLN A  1 191 ? 15.561  -3.524  16.150  1.00 112.32 ? 191  GLN A CD  1 
ATOM   1485  O OE1 . GLN A  1 191 ? 15.521  -3.296  14.910  1.00 100.02 ? 191  GLN A OE1 1 
ATOM   1486  N NE2 . GLN A  1 191 ? 15.778  -2.571  17.078  1.00 98.25  ? 191  GLN A NE2 1 
ATOM   1487  N N   . CYS A  1 192 ? 13.296  -8.902  14.826  1.00 81.13  ? 192  CYS A N   1 
ATOM   1488  C CA  . CYS A  1 192 ? 12.411  -10.063 15.050  1.00 79.14  ? 192  CYS A CA  1 
ATOM   1489  C C   . CYS A  1 192 ? 13.312  -11.198 15.479  1.00 81.88  ? 192  CYS A C   1 
ATOM   1490  O O   . CYS A  1 192 ? 14.394  -11.387 14.904  1.00 80.83  ? 192  CYS A O   1 
ATOM   1491  C CB  . CYS A  1 192 ? 11.620  -10.474 13.805  1.00 79.12  ? 192  CYS A CB  1 
ATOM   1492  S SG  . CYS A  1 192 ? 10.859  -9.112  12.870  1.00 83.72  ? 192  CYS A SG  1 
ATOM   1493  N N   . ASP A  1 193 ? 12.863  -11.963 16.470  1.00 78.43  ? 193  ASP A N   1 
ATOM   1494  C CA  . ASP A  1 193 ? 13.638  -13.112 16.926  1.00 78.65  ? 193  ASP A CA  1 
ATOM   1495  C C   . ASP A  1 193 ? 13.008  -14.411 16.418  1.00 77.17  ? 193  ASP A C   1 
ATOM   1496  O O   . ASP A  1 193 ? 13.677  -15.439 16.279  1.00 77.60  ? 193  ASP A O   1 
ATOM   1497  C CB  . ASP A  1 193 ? 13.824  -13.079 18.459  1.00 81.65  ? 193  ASP A CB  1 
ATOM   1498  C CG  . ASP A  1 193 ? 14.935  -12.142 18.939  1.00 100.37 ? 193  ASP A CG  1 
ATOM   1499  O OD1 . ASP A  1 193 ? 15.978  -12.022 18.224  1.00 102.04 ? 193  ASP A OD1 1 
ATOM   1500  O OD2 . ASP A  1 193 ? 14.776  -11.541 20.032  1.00 109.57 ? 193  ASP A OD2 1 
ATOM   1501  N N   . GLY A  1 194 ? 11.729  -14.316 16.109  1.00 69.14  ? 194  GLY A N   1 
ATOM   1502  C CA  . GLY A  1 194 ? 10.944  -15.406 15.572  1.00 66.54  ? 194  GLY A CA  1 
ATOM   1503  C C   . GLY A  1 194 ? 10.627  -15.190 14.114  1.00 67.26  ? 194  GLY A C   1 
ATOM   1504  O O   . GLY A  1 194 ? 11.517  -14.897 13.312  1.00 68.12  ? 194  GLY A O   1 
ATOM   1505  N N   . ARG A  1 195 ? 9.362   -15.330 13.768  1.00 61.12  ? 195  ARG A N   1 
ATOM   1506  C CA  . ARG A  1 195 ? 8.925   -15.164 12.399  1.00 61.33  ? 195  ARG A CA  1 
ATOM   1507  C C   . ARG A  1 195 ? 8.283   -13.800 12.230  1.00 68.05  ? 195  ARG A C   1 
ATOM   1508  O O   . ARG A  1 195 ? 8.354   -12.984 13.166  1.00 68.21  ? 195  ARG A O   1 
ATOM   1509  C CB  . ARG A  1 195 ? 8.022   -16.328 11.982  1.00 58.22  ? 195  ARG A CB  1 
ATOM   1510  C CG  . ARG A  1 195 ? 8.811   -17.620 11.935  1.00 54.79  ? 195  ARG A CG  1 
ATOM   1511  C CD  . ARG A  1 195 ? 8.100   -18.800 11.325  1.00 43.19  ? 195  ARG A CD  1 
ATOM   1512  N NE  . ARG A  1 195 ? 8.995   -19.956 11.310  1.00 41.80  ? 195  ARG A NE  1 
ATOM   1513  C CZ  . ARG A  1 195 ? 9.703   -20.366 10.263  1.00 59.71  ? 195  ARG A CZ  1 
ATOM   1514  N NH1 . ARG A  1 195 ? 9.602   -19.741 9.094   1.00 66.41  ? 195  ARG A NH1 1 
ATOM   1515  N NH2 . ARG A  1 195 ? 10.456  -21.449 10.352  1.00 36.87  ? 195  ARG A NH2 1 
ATOM   1516  N N   . CYS A  1 196 ? 7.713   -13.526 11.032  1.00 66.15  ? 196  CYS A N   1 
ATOM   1517  C CA  . CYS A  1 196 ? 7.106   -12.229 10.689  1.00 67.61  ? 196  CYS A CA  1 
ATOM   1518  C C   . CYS A  1 196 ? 6.141   -12.347 9.515   1.00 74.43  ? 196  CYS A C   1 
ATOM   1519  O O   . CYS A  1 196 ? 6.263   -13.284 8.721   1.00 74.57  ? 196  CYS A O   1 
ATOM   1520  C CB  . CYS A  1 196 ? 8.197   -11.200 10.391  1.00 68.67  ? 196  CYS A CB  1 
ATOM   1521  S SG  . CYS A  1 196 ? 9.232   -11.620 8.965   1.00 73.47  ? 196  CYS A SG  1 
ATOM   1522  N N   . TYR A  1 197 ? 5.231   -11.361 9.373   1.00 73.45  ? 197  TYR A N   1 
ATOM   1523  C CA  . TYR A  1 197 ? 4.245   -11.273 8.272   1.00 75.77  ? 197  TYR A CA  1 
ATOM   1524  C C   . TYR A  1 197 ? 4.574   -10.124 7.307   1.00 82.88  ? 197  TYR A C   1 
ATOM   1525  O O   . TYR A  1 197 ? 3.767   -9.852  6.423   1.00 85.29  ? 197  TYR A O   1 
ATOM   1526  C CB  . TYR A  1 197 ? 2.758   -11.208 8.763   1.00 76.58  ? 197  TYR A CB  1 
ATOM   1527  C CG  . TYR A  1 197 ? 2.494   -10.118 9.779   1.00 79.92  ? 197  TYR A CG  1 
ATOM   1528  C CD1 . TYR A  1 197 ? 2.026   -8.871  9.388   1.00 82.76  ? 197  TYR A CD1 1 
ATOM   1529  C CD2 . TYR A  1 197 ? 2.750   -10.321 11.133  1.00 81.27  ? 197  TYR A CD2 1 
ATOM   1530  C CE1 . TYR A  1 197 ? 1.807   -7.850  10.322  1.00 83.18  ? 197  TYR A CE1 1 
ATOM   1531  C CE2 . TYR A  1 197 ? 2.571   -9.298  12.071  1.00 83.09  ? 197  TYR A CE2 1 
ATOM   1532  C CZ  . TYR A  1 197 ? 2.074   -8.072  11.665  1.00 89.54  ? 197  TYR A CZ  1 
ATOM   1533  O OH  . TYR A  1 197 ? 1.891   -7.085  12.604  1.00 89.36  ? 197  TYR A OH  1 
ATOM   1534  N N   . GLY A  1 198 ? 5.750   -9.499  7.473   1.00 78.49  ? 198  GLY A N   1 
ATOM   1535  C CA  . GLY A  1 198 ? 6.265   -8.391  6.669   1.00 79.70  ? 198  GLY A CA  1 
ATOM   1536  C C   . GLY A  1 198 ? 7.703   -8.050  7.027   1.00 84.84  ? 198  GLY A C   1 
ATOM   1537  O O   . GLY A  1 198 ? 8.280   -8.701  7.900   1.00 83.76  ? 198  GLY A O   1 
ATOM   1538  N N   . PRO A  1 199 ? 8.324   -7.004  6.433   1.00 83.98  ? 199  PRO A N   1 
ATOM   1539  C CA  . PRO A  1 199 ? 9.743   -6.728  6.720   1.00 84.10  ? 199  PRO A CA  1 
ATOM   1540  C C   . PRO A  1 199 ? 10.097  -5.653  7.763   1.00 89.28  ? 199  PRO A C   1 
ATOM   1541  O O   . PRO A  1 199 ? 11.286  -5.517  8.078   1.00 89.08  ? 199  PRO A O   1 
ATOM   1542  C CB  . PRO A  1 199 ? 10.306  -6.387  5.341   1.00 87.44  ? 199  PRO A CB  1 
ATOM   1543  C CG  . PRO A  1 199 ? 9.112   -5.953  4.526   1.00 93.22  ? 199  PRO A CG  1 
ATOM   1544  C CD  . PRO A  1 199 ? 7.856   -6.138  5.343   1.00 87.69  ? 199  PRO A CD  1 
ATOM   1545  N N   . TYR A  1 200 ? 9.110   -4.921  8.322   1.00 85.92  ? 200  TYR A N   1 
ATOM   1546  C CA  . TYR A  1 200 ? 9.369   -3.868  9.325   1.00 85.88  ? 200  TYR A CA  1 
ATOM   1547  C C   . TYR A  1 200 ? 9.229   -4.378  10.747  1.00 83.78  ? 200  TYR A C   1 
ATOM   1548  O O   . TYR A  1 200 ? 8.723   -5.481  10.930  1.00 81.52  ? 200  TYR A O   1 
ATOM   1549  C CB  . TYR A  1 200 ? 8.507   -2.630  9.055   1.00 90.03  ? 200  TYR A CB  1 
ATOM   1550  C CG  . TYR A  1 200 ? 8.331   -2.359  7.571   1.00 95.36  ? 200  TYR A CG  1 
ATOM   1551  C CD1 . TYR A  1 200 ? 7.183   -2.777  6.898   1.00 97.87  ? 200  TYR A CD1 1 
ATOM   1552  C CD2 . TYR A  1 200 ? 9.342   -1.752  6.825   1.00 97.94  ? 200  TYR A CD2 1 
ATOM   1553  C CE1 . TYR A  1 200 ? 7.028   -2.569  5.527   1.00 101.60 ? 200  TYR A CE1 1 
ATOM   1554  C CE2 . TYR A  1 200 ? 9.197   -1.535  5.451   1.00 100.91 ? 200  TYR A CE2 1 
ATOM   1555  C CZ  . TYR A  1 200 ? 8.034   -1.942  4.808   1.00 110.78 ? 200  TYR A CZ  1 
ATOM   1556  O OH  . TYR A  1 200 ? 7.856   -1.721  3.461   1.00 115.15 ? 200  TYR A OH  1 
ATOM   1557  N N   . VAL A  1 201 ? 9.706   -3.624  11.751  1.00 78.61  ? 201  VAL A N   1 
ATOM   1558  C CA  . VAL A  1 201 ? 9.653   -4.084  13.169  1.00 76.20  ? 201  VAL A CA  1 
ATOM   1559  C C   . VAL A  1 201 ? 8.191   -4.284  13.673  1.00 77.76  ? 201  VAL A C   1 
ATOM   1560  O O   . VAL A  1 201 ? 7.935   -5.078  14.592  1.00 76.02  ? 201  VAL A O   1 
ATOM   1561  C CB  . VAL A  1 201 ? 10.548  -3.262  14.177  1.00 79.45  ? 201  VAL A CB  1 
ATOM   1562  C CG1 . VAL A  1 201 ? 11.073  -4.125  15.328  1.00 76.46  ? 201  VAL A CG1 1 
ATOM   1563  C CG2 . VAL A  1 201 ? 11.699  -2.547  13.472  1.00 81.01  ? 201  VAL A CG2 1 
ATOM   1564  N N   . SER A  1 202 ? 7.241   -3.594  13.018  1.00 73.56  ? 202  SER A N   1 
ATOM   1565  C CA  . SER A  1 202 ? 5.799   -3.657  13.273  1.00 71.14  ? 202  SER A CA  1 
ATOM   1566  C C   . SER A  1 202 ? 5.311   -5.056  12.962  1.00 70.87  ? 202  SER A C   1 
ATOM   1567  O O   . SER A  1 202 ? 4.458   -5.588  13.683  1.00 71.45  ? 202  SER A O   1 
ATOM   1568  C CB  . SER A  1 202 ? 5.049   -2.671  12.373  1.00 77.49  ? 202  SER A CB  1 
ATOM   1569  O OG  . SER A  1 202 ? 5.806   -1.533  11.979  1.00 90.59  ? 202  SER A OG  1 
ATOM   1570  N N   . ASP A  1 203 ? 5.907   -5.674  11.920  1.00 70.49  ? 203  ASP A N   1 
ATOM   1571  C CA  . ASP A  1 203 ? 5.529   -6.989  11.394  1.00 63.30  ? 203  ASP A CA  1 
ATOM   1572  C C   . ASP A  1 203 ? 6.084   -8.292  12.056  1.00 70.95  ? 203  ASP A C   1 
ATOM   1573  O O   . ASP A  1 203 ? 5.793   -9.390  11.558  1.00 65.77  ? 203  ASP A O   1 
ATOM   1574  C CB  . ASP A  1 203 ? 5.901   -7.029  9.910   1.00 57.56  ? 203  ASP A CB  1 
ATOM   1575  C CG  . ASP A  1 203 ? 5.070   -6.074  9.076   1.00 69.09  ? 203  ASP A CG  1 
ATOM   1576  O OD1 . ASP A  1 203 ? 4.030   -5.597  9.576   1.00 71.41  ? 203  ASP A OD1 1 
ATOM   1577  O OD2 . ASP A  1 203 ? 5.379   -5.743  7.911   1.00 74.75  ? 203  ASP A OD2 1 
ATOM   1578  N N   . CYS A  1 204 ? 6.819   -8.188  13.188  1.00 69.60  ? 204  CYS A N   1 
ATOM   1579  C CA  . CYS A  1 204 ? 7.309   -9.396  13.858  1.00 70.83  ? 204  CYS A CA  1 
ATOM   1580  C C   . CYS A  1 204 ? 6.208   -10.135 14.585  1.00 70.27  ? 204  CYS A C   1 
ATOM   1581  O O   . CYS A  1 204 ? 5.356   -9.524  15.221  1.00 69.54  ? 204  CYS A O   1 
ATOM   1582  C CB  . CYS A  1 204 ? 8.456   -9.110  14.819  1.00 74.45  ? 204  CYS A CB  1 
ATOM   1583  S SG  . CYS A  1 204 ? 9.742   -8.020  14.176  1.00 82.35  ? 204  CYS A SG  1 
ATOM   1584  N N   . CYS A  1 205 ? 6.313   -11.456 14.581  1.00 64.01  ? 205  CYS A N   1 
ATOM   1585  C CA  . CYS A  1 205 ? 5.435   -12.345 15.295  1.00 62.55  ? 205  CYS A CA  1 
ATOM   1586  C C   . CYS A  1 205 ? 5.892   -12.403 16.731  1.00 69.41  ? 205  CYS A C   1 
ATOM   1587  O O   . CYS A  1 205 ? 7.083   -12.181 17.005  1.00 73.73  ? 205  CYS A O   1 
ATOM   1588  C CB  . CYS A  1 205 ? 5.486   -13.729 14.662  1.00 62.23  ? 205  CYS A CB  1 
ATOM   1589  S SG  . CYS A  1 205 ? 4.581   -13.872 13.109  1.00 67.53  ? 205  CYS A SG  1 
ATOM   1590  N N   . HIS A  1 206 ? 4.993   -12.814 17.637  1.00 63.10  ? 206  HIS A N   1 
ATOM   1591  C CA  . HIS A  1 206 ? 5.339   -13.056 19.022  1.00 62.35  ? 206  HIS A CA  1 
ATOM   1592  C C   . HIS A  1 206 ? 6.311   -14.231 19.004  1.00 66.21  ? 206  HIS A C   1 
ATOM   1593  O O   . HIS A  1 206 ? 6.189   -15.102 18.140  1.00 65.44  ? 206  HIS A O   1 
ATOM   1594  C CB  . HIS A  1 206 ? 4.094   -13.447 19.817  1.00 62.55  ? 206  HIS A CB  1 
ATOM   1595  C CG  . HIS A  1 206 ? 4.372   -13.632 21.271  1.00 64.81  ? 206  HIS A CG  1 
ATOM   1596  N ND1 . HIS A  1 206 ? 4.111   -12.637 22.178  1.00 66.43  ? 206  HIS A ND1 1 
ATOM   1597  C CD2 . HIS A  1 206 ? 4.934   -14.676 21.916  1.00 65.74  ? 206  HIS A CD2 1 
ATOM   1598  C CE1 . HIS A  1 206 ? 4.496   -13.111 23.345  1.00 65.50  ? 206  HIS A CE1 1 
ATOM   1599  N NE2 . HIS A  1 206 ? 5.005   -14.337 23.228  1.00 65.46  ? 206  HIS A NE2 1 
ATOM   1600  N N   . ARG A  1 207 ? 7.271   -14.254 19.940  1.00 63.56  ? 207  ARG A N   1 
ATOM   1601  C CA  . ARG A  1 207 ? 8.269   -15.312 20.014  1.00 63.32  ? 207  ARG A CA  1 
ATOM   1602  C C   . ARG A  1 207 ? 7.686   -16.723 20.152  1.00 64.56  ? 207  ARG A C   1 
ATOM   1603  O O   . ARG A  1 207 ? 8.308   -17.672 19.694  1.00 66.10  ? 207  ARG A O   1 
ATOM   1604  C CB  . ARG A  1 207 ? 9.388   -14.942 21.008  1.00 66.95  ? 207  ARG A CB  1 
ATOM   1605  C CG  . ARG A  1 207 ? 10.147  -16.089 21.683  1.00 89.27  ? 207  ARG A CG  1 
ATOM   1606  C CD  . ARG A  1 207 ? 10.554  -15.768 23.125  1.00 116.05 ? 207  ARG A CD  1 
ATOM   1607  N NE  . ARG A  1 207 ? 9.472   -15.163 23.923  1.00 131.15 ? 207  ARG A NE  1 
ATOM   1608  C CZ  . ARG A  1 207 ? 8.567   -15.846 24.621  1.00 139.83 ? 207  ARG A CZ  1 
ATOM   1609  N NH1 . ARG A  1 207 ? 8.593   -17.174 24.637  1.00 125.83 ? 207  ARG A NH1 1 
ATOM   1610  N NH2 . ARG A  1 207 ? 7.630   -15.206 25.311  1.00 118.23 ? 207  ARG A NH2 1 
ATOM   1611  N N   . GLU A  1 208 ? 6.463   -16.845 20.642  1.00 58.85  ? 208  GLU A N   1 
ATOM   1612  C CA  . GLU A  1 208 ? 5.775   -18.120 20.819  1.00 58.40  ? 208  GLU A CA  1 
ATOM   1613  C C   . GLU A  1 208 ? 5.004   -18.630 19.615  1.00 61.72  ? 208  GLU A C   1 
ATOM   1614  O O   . GLU A  1 208 ? 4.428   -19.712 19.699  1.00 62.56  ? 208  GLU A O   1 
ATOM   1615  C CB  . GLU A  1 208 ? 4.863   -18.069 22.063  1.00 59.79  ? 208  GLU A CB  1 
ATOM   1616  C CG  . GLU A  1 208 ? 5.623   -18.252 23.373  1.00 68.79  ? 208  GLU A CG  1 
ATOM   1617  C CD  . GLU A  1 208 ? 6.176   -19.653 23.568  1.00 78.42  ? 208  GLU A CD  1 
ATOM   1618  O OE1 . GLU A  1 208 ? 5.384   -20.621 23.489  1.00 72.42  ? 208  GLU A OE1 1 
ATOM   1619  O OE2 . GLU A  1 208 ? 7.404   -19.786 23.777  1.00 57.52  ? 208  GLU A OE2 1 
ATOM   1620  N N   . CYS A  1 209 ? 4.960   -17.864 18.509  1.00 57.74  ? 209  CYS A N   1 
ATOM   1621  C CA  . CYS A  1 209 ? 4.246   -18.269 17.283  1.00 56.94  ? 209  CYS A CA  1 
ATOM   1622  C C   . CYS A  1 209 ? 5.072   -19.226 16.495  1.00 66.69  ? 209  CYS A C   1 
ATOM   1623  O O   . CYS A  1 209 ? 6.277   -19.001 16.271  1.00 68.41  ? 209  CYS A O   1 
ATOM   1624  C CB  . CYS A  1 209 ? 3.838   -17.080 16.418  1.00 56.24  ? 209  CYS A CB  1 
ATOM   1625  S SG  . CYS A  1 209 ? 2.608   -15.984 17.165  1.00 59.41  ? 209  CYS A SG  1 
ATOM   1626  N N   . ALA A  1 210 ? 4.426   -20.294 16.056  1.00 64.95  ? 210  ALA A N   1 
ATOM   1627  C CA  . ALA A  1 210 ? 5.043   -21.287 15.186  1.00 65.19  ? 210  ALA A CA  1 
ATOM   1628  C C   . ALA A  1 210 ? 4.283   -21.129 13.876  1.00 69.75  ? 210  ALA A C   1 
ATOM   1629  O O   . ALA A  1 210 ? 3.073   -20.878 13.920  1.00 70.89  ? 210  ALA A O   1 
ATOM   1630  C CB  . ALA A  1 210 ? 4.852   -22.682 15.757  1.00 64.71  ? 210  ALA A CB  1 
ATOM   1631  N N   . GLY A  1 211 ? 4.991   -21.163 12.751  1.00 65.22  ? 211  GLY A N   1 
ATOM   1632  C CA  . GLY A  1 211 ? 4.388   -21.034 11.428  1.00 65.59  ? 211  GLY A CA  1 
ATOM   1633  C C   . GLY A  1 211 ? 4.439   -19.618 10.920  1.00 70.54  ? 211  GLY A C   1 
ATOM   1634  O O   . GLY A  1 211 ? 5.126   -19.316 9.941   1.00 73.02  ? 211  GLY A O   1 
ATOM   1635  N N   . GLY A  1 212 ? 3.736   -18.757 11.623  1.00 64.28  ? 212  GLY A N   1 
ATOM   1636  C CA  . GLY A  1 212 ? 3.660   -17.337 11.348  1.00 64.18  ? 212  GLY A CA  1 
ATOM   1637  C C   . GLY A  1 212 ? 2.567   -16.753 12.207  1.00 67.04  ? 212  GLY A C   1 
ATOM   1638  O O   . GLY A  1 212 ? 2.099   -17.392 13.164  1.00 65.95  ? 212  GLY A O   1 
ATOM   1639  N N   . CYS A  1 213 ? 2.135   -15.546 11.851  1.00 62.58  ? 213  CYS A N   1 
ATOM   1640  C CA  . CYS A  1 213 ? 1.060   -14.863 12.543  1.00 61.24  ? 213  CYS A CA  1 
ATOM   1641  C C   . CYS A  1 213 ? 0.326   -13.898 11.631  1.00 62.02  ? 213  CYS A C   1 
ATOM   1642  O O   . CYS A  1 213 ? 0.696   -13.683 10.482  1.00 64.45  ? 213  CYS A O   1 
ATOM   1643  C CB  . CYS A  1 213 ? 1.605   -14.153 13.776  1.00 62.19  ? 213  CYS A CB  1 
ATOM   1644  S SG  . CYS A  1 213 ? 2.834   -12.878 13.393  1.00 67.75  ? 213  CYS A SG  1 
ATOM   1645  N N   . SER A  1 214 ? -0.705  -13.287 12.168  1.00 55.24  ? 214  SER A N   1 
ATOM   1646  C CA  . SER A  1 214 ? -1.536  -12.277 11.487  1.00 54.13  ? 214  SER A CA  1 
ATOM   1647  C C   . SER A  1 214 ? -1.457  -10.951 12.228  1.00 60.93  ? 214  SER A C   1 
ATOM   1648  O O   . SER A  1 214 ? -2.159  -10.011 11.854  1.00 64.89  ? 214  SER A O   1 
ATOM   1649  C CB  . SER A  1 214 ? -2.984  -12.721 11.457  1.00 47.78  ? 214  SER A CB  1 
ATOM   1650  O OG  . SER A  1 214 ? -3.300  -13.171 12.758  1.00 38.14  ? 214  SER A OG  1 
ATOM   1651  N N   . GLY A  1 215 ? -0.615  -10.892 13.265  1.00 53.08  ? 215  GLY A N   1 
ATOM   1652  C CA  . GLY A  1 215 ? -0.457  -9.727  14.107  1.00 52.00  ? 215  GLY A CA  1 
ATOM   1653  C C   . GLY A  1 215 ? 0.571   -9.966  15.180  1.00 57.24  ? 215  GLY A C   1 
ATOM   1654  O O   . GLY A  1 215 ? 1.127   -11.067 15.274  1.00 55.53  ? 215  GLY A O   1 
ATOM   1655  N N   . PRO A  1 216 ? 0.855   -8.932  16.007  1.00 56.01  ? 216  PRO A N   1 
ATOM   1656  C CA  . PRO A  1 216 ? 1.940   -9.046  16.983  1.00 55.24  ? 216  PRO A CA  1 
ATOM   1657  C C   . PRO A  1 216 ? 1.703   -9.849  18.260  1.00 58.56  ? 216  PRO A C   1 
ATOM   1658  O O   . PRO A  1 216 ? 2.684   -10.294 18.883  1.00 56.66  ? 216  PRO A O   1 
ATOM   1659  C CB  . PRO A  1 216 ? 2.255   -7.592  17.289  1.00 57.88  ? 216  PRO A CB  1 
ATOM   1660  C CG  . PRO A  1 216 ? 0.985   -6.906  17.154  1.00 62.56  ? 216  PRO A CG  1 
ATOM   1661  C CD  . PRO A  1 216 ? 0.317   -7.558  15.993  1.00 58.88  ? 216  PRO A CD  1 
ATOM   1662  N N   . LYS A  1 217 ? 0.423   -10.011 18.661  1.00 55.86  ? 217  LYS A N   1 
ATOM   1663  C CA  . LYS A  1 217 ? 0.053   -10.682 19.910  1.00 55.04  ? 217  LYS A CA  1 
ATOM   1664  C C   . LYS A  1 217 ? 0.250   -12.199 19.900  1.00 60.78  ? 217  LYS A C   1 
ATOM   1665  O O   . LYS A  1 217 ? 0.349   -12.786 18.826  1.00 59.41  ? 217  LYS A O   1 
ATOM   1666  C CB  . LYS A  1 217 ? -1.349  -10.261 20.340  1.00 56.78  ? 217  LYS A CB  1 
ATOM   1667  C CG  . LYS A  1 217 ? -1.507  -8.745  20.536  1.00 72.29  ? 217  LYS A CG  1 
ATOM   1668  C CD  . LYS A  1 217 ? -2.974  -8.376  20.703  1.00 93.33  ? 217  LYS A CD  1 
ATOM   1669  C CE  . LYS A  1 217 ? -3.190  -6.946  21.153  1.00 116.31 ? 217  LYS A CE  1 
ATOM   1670  N NZ  . LYS A  1 217 ? -4.641  -6.634  21.347  1.00 127.55 ? 217  LYS A NZ  1 
ATOM   1671  N N   . ASP A  1 218 ? 0.368   -12.827 21.107  1.00 59.65  ? 218  ASP A N   1 
ATOM   1672  C CA  . ASP A  1 218 ? 0.528   -14.286 21.278  1.00 58.31  ? 218  ASP A CA  1 
ATOM   1673  C C   . ASP A  1 218 ? -0.786  -15.052 20.951  1.00 61.69  ? 218  ASP A C   1 
ATOM   1674  O O   . ASP A  1 218 ? -0.831  -16.299 20.935  1.00 60.30  ? 218  ASP A O   1 
ATOM   1675  C CB  . ASP A  1 218 ? 1.105   -14.659 22.663  1.00 59.12  ? 218  ASP A CB  1 
ATOM   1676  C CG  . ASP A  1 218 ? 0.343   -14.216 23.906  1.00 69.98  ? 218  ASP A CG  1 
ATOM   1677  O OD1 . ASP A  1 218 ? -0.877  -13.963 23.806  1.00 68.59  ? 218  ASP A OD1 1 
ATOM   1678  O OD2 . ASP A  1 218 ? 0.959   -14.180 24.995  1.00 80.59  ? 218  ASP A OD2 1 
ATOM   1679  N N   . THR A  1 219 ? -1.831  -14.285 20.637  1.00 57.86  ? 219  THR A N   1 
ATOM   1680  C CA  . THR A  1 219 ? -3.117  -14.827 20.264  1.00 58.68  ? 219  THR A CA  1 
ATOM   1681  C C   . THR A  1 219 ? -3.284  -14.779 18.725  1.00 69.05  ? 219  THR A C   1 
ATOM   1682  O O   . THR A  1 219 ? -4.279  -15.277 18.185  1.00 72.23  ? 219  THR A O   1 
ATOM   1683  C CB  . THR A  1 219 ? -4.194  -14.090 21.036  1.00 62.29  ? 219  THR A CB  1 
ATOM   1684  O OG1 . THR A  1 219 ? -3.952  -12.695 20.930  1.00 61.72  ? 219  THR A OG1 1 
ATOM   1685  C CG2 . THR A  1 219 ? -4.214  -14.474 22.509  1.00 61.10  ? 219  THR A CG2 1 
ATOM   1686  N N   . ASP A  1 220 ? -2.291  -14.185 18.023  1.00 64.87  ? 220  ASP A N   1 
ATOM   1687  C CA  . ASP A  1 220 ? -2.272  -14.004 16.565  1.00 64.13  ? 220  ASP A CA  1 
ATOM   1688  C C   . ASP A  1 220 ? -1.485  -15.073 15.813  1.00 65.84  ? 220  ASP A C   1 
ATOM   1689  O O   . ASP A  1 220 ? -1.289  -14.909 14.608  1.00 66.69  ? 220  ASP A O   1 
ATOM   1690  C CB  . ASP A  1 220 ? -1.710  -12.612 16.210  1.00 66.27  ? 220  ASP A CB  1 
ATOM   1691  C CG  . ASP A  1 220 ? -2.555  -11.463 16.715  1.00 73.67  ? 220  ASP A CG  1 
ATOM   1692  O OD1 . ASP A  1 220 ? -3.803  -11.638 16.808  1.00 73.25  ? 220  ASP A OD1 1 
ATOM   1693  O OD2 . ASP A  1 220 ? -1.973  -10.379 17.017  1.00 76.21  ? 220  ASP A OD2 1 
ATOM   1694  N N   . CYS A  1 221 ? -1.061  -16.168 16.501  1.00 58.04  ? 221  CYS A N   1 
ATOM   1695  C CA  . CYS A  1 221 ? -0.234  -17.242 15.924  1.00 55.95  ? 221  CYS A CA  1 
ATOM   1696  C C   . CYS A  1 221 ? -0.970  -18.129 14.970  1.00 57.18  ? 221  CYS A C   1 
ATOM   1697  O O   . CYS A  1 221 ? -2.150  -18.376 15.187  1.00 56.00  ? 221  CYS A O   1 
ATOM   1698  C CB  . CYS A  1 221 ? 0.398   -18.082 17.034  1.00 54.68  ? 221  CYS A CB  1 
ATOM   1699  S SG  . CYS A  1 221 ? 1.318   -17.137 18.263  1.00 58.09  ? 221  CYS A SG  1 
ATOM   1700  N N   . PHE A  1 222 ? -0.253  -18.743 14.010  1.00 54.22  ? 222  PHE A N   1 
ATOM   1701  C CA  . PHE A  1 222 ? -0.854  -19.760 13.135  1.00 54.29  ? 222  PHE A CA  1 
ATOM   1702  C C   . PHE A  1 222 ? -0.838  -21.082 13.888  1.00 57.07  ? 222  PHE A C   1 
ATOM   1703  O O   . PHE A  1 222 ? -1.754  -21.892 13.726  1.00 56.67  ? 222  PHE A O   1 
ATOM   1704  C CB  . PHE A  1 222 ? -0.074  -19.925 11.836  1.00 56.66  ? 222  PHE A CB  1 
ATOM   1705  C CG  . PHE A  1 222 ? -0.124  -18.743 10.909  1.00 58.56  ? 222  PHE A CG  1 
ATOM   1706  C CD1 . PHE A  1 222 ? 0.849   -18.566 9.933   1.00 62.25  ? 222  PHE A CD1 1 
ATOM   1707  C CD2 . PHE A  1 222 ? -1.153  -17.815 10.995  1.00 59.96  ? 222  PHE A CD2 1 
ATOM   1708  C CE1 . PHE A  1 222 ? 0.825   -17.451 9.102   1.00 64.43  ? 222  PHE A CE1 1 
ATOM   1709  C CE2 . PHE A  1 222 ? -1.186  -16.707 10.154  1.00 64.28  ? 222  PHE A CE2 1 
ATOM   1710  C CZ  . PHE A  1 222 ? -0.200  -16.532 9.212   1.00 63.80  ? 222  PHE A CZ  1 
ATOM   1711  N N   . ALA A  1 223 ? 0.223   -21.294 14.704  1.00 52.07  ? 223  ALA A N   1 
ATOM   1712  C CA  . ALA A  1 223 ? 0.387   -22.469 15.550  1.00 51.79  ? 223  ALA A CA  1 
ATOM   1713  C C   . ALA A  1 223 ? 1.180   -22.098 16.795  1.00 58.27  ? 223  ALA A C   1 
ATOM   1714  O O   . ALA A  1 223 ? 1.857   -21.057 16.788  1.00 58.75  ? 223  ALA A O   1 
ATOM   1715  C CB  . ALA A  1 223 ? 1.094   -23.554 14.783  1.00 52.75  ? 223  ALA A CB  1 
ATOM   1716  N N   . CYS A  1 224 ? 1.088   -22.917 17.869  1.00 55.39  ? 224  CYS A N   1 
ATOM   1717  C CA  . CYS A  1 224 ? 1.843   -22.596 19.078  1.00 57.51  ? 224  CYS A CA  1 
ATOM   1718  C C   . CYS A  1 224 ? 3.179   -23.304 19.094  1.00 59.91  ? 224  CYS A C   1 
ATOM   1719  O O   . CYS A  1 224 ? 3.275   -24.442 18.663  1.00 59.65  ? 224  CYS A O   1 
ATOM   1720  C CB  . CYS A  1 224 ? 1.038   -22.896 20.340  1.00 59.61  ? 224  CYS A CB  1 
ATOM   1721  S SG  . CYS A  1 224 ? -0.367  -21.766 20.637  1.00 65.19  ? 224  CYS A SG  1 
ATOM   1722  N N   . MET A  1 225 ? 4.208   -22.647 19.588  1.00 55.95  ? 225  MET A N   1 
ATOM   1723  C CA  . MET A  1 225 ? 5.527   -23.250 19.704  1.00 56.49  ? 225  MET A CA  1 
ATOM   1724  C C   . MET A  1 225 ? 5.526   -24.292 20.811  1.00 62.17  ? 225  MET A C   1 
ATOM   1725  O O   . MET A  1 225 ? 6.208   -25.303 20.703  1.00 63.27  ? 225  MET A O   1 
ATOM   1726  C CB  . MET A  1 225 ? 6.556   -22.180 20.073  1.00 59.44  ? 225  MET A CB  1 
ATOM   1727  C CG  . MET A  1 225 ? 7.093   -21.439 18.897  1.00 64.33  ? 225  MET A CG  1 
ATOM   1728  S SD  . MET A  1 225 ? 8.082   -22.527 17.876  1.00 69.36  ? 225  MET A SD  1 
ATOM   1729  C CE  . MET A  1 225 ? 9.556   -22.669 18.845  1.00 65.75  ? 225  MET A CE  1 
ATOM   1730  N N   . ASN A  1 226 ? 4.774   -24.026 21.889  1.00 58.71  ? 226  ASN A N   1 
ATOM   1731  C CA  . ASN A  1 226 ? 4.734   -24.862 23.070  1.00 57.87  ? 226  ASN A CA  1 
ATOM   1732  C C   . ASN A  1 226 ? 3.368   -25.260 23.507  1.00 62.01  ? 226  ASN A C   1 
ATOM   1733  O O   . ASN A  1 226 ? 2.976   -26.381 23.198  1.00 65.95  ? 226  ASN A O   1 
ATOM   1734  C CB  . ASN A  1 226 ? 5.490   -24.206 24.215  1.00 58.97  ? 226  ASN A CB  1 
ATOM   1735  C CG  . ASN A  1 226 ? 6.954   -24.198 23.956  1.00 78.75  ? 226  ASN A CG  1 
ATOM   1736  O OD1 . ASN A  1 226 ? 7.619   -25.225 24.053  1.00 71.08  ? 226  ASN A OD1 1 
ATOM   1737  N ND2 . ASN A  1 226 ? 7.456   -23.079 23.490  1.00 76.88  ? 226  ASN A ND2 1 
ATOM   1738  N N   . PHE A  1 227 ? 2.664   -24.392 24.273  1.00 53.42  ? 227  PHE A N   1 
ATOM   1739  C CA  . PHE A  1 227 ? 1.352   -24.678 24.850  1.00 50.33  ? 227  PHE A CA  1 
ATOM   1740  C C   . PHE A  1 227 ? 0.342   -23.646 24.495  1.00 54.57  ? 227  PHE A C   1 
ATOM   1741  O O   . PHE A  1 227 ? 0.668   -22.472 24.321  1.00 54.90  ? 227  PHE A O   1 
ATOM   1742  C CB  . PHE A  1 227 ? 1.427   -24.781 26.391  1.00 51.20  ? 227  PHE A CB  1 
ATOM   1743  C CG  . PHE A  1 227 ? 2.365   -25.851 26.900  1.00 52.69  ? 227  PHE A CG  1 
ATOM   1744  C CD1 . PHE A  1 227 ? 3.633   -25.529 27.352  1.00 53.87  ? 227  PHE A CD1 1 
ATOM   1745  C CD2 . PHE A  1 227 ? 1.996   -27.187 26.891  1.00 55.67  ? 227  PHE A CD2 1 
ATOM   1746  C CE1 . PHE A  1 227 ? 4.505   -26.519 27.785  1.00 54.05  ? 227  PHE A CE1 1 
ATOM   1747  C CE2 . PHE A  1 227 ? 2.895   -28.174 27.300  1.00 57.36  ? 227  PHE A CE2 1 
ATOM   1748  C CZ  . PHE A  1 227 ? 4.130   -27.832 27.762  1.00 53.55  ? 227  PHE A CZ  1 
ATOM   1749  N N   . ASN A  1 228 ? -0.915  -24.073 24.442  1.00 50.24  ? 228  ASN A N   1 
ATOM   1750  C CA  . ASN A  1 228 ? -2.014  -23.190 24.151  1.00 49.86  ? 228  ASN A CA  1 
ATOM   1751  C C   . ASN A  1 228 ? -2.790  -23.004 25.442  1.00 55.81  ? 228  ASN A C   1 
ATOM   1752  O O   . ASN A  1 228 ? -3.262  -23.975 26.019  1.00 55.29  ? 228  ASN A O   1 
ATOM   1753  C CB  . ASN A  1 228 ? -2.861  -23.787 23.025  1.00 48.79  ? 228  ASN A CB  1 
ATOM   1754  C CG  . ASN A  1 228 ? -4.006  -22.934 22.560  1.00 74.25  ? 228  ASN A CG  1 
ATOM   1755  O OD1 . ASN A  1 228 ? -4.631  -22.196 23.334  1.00 71.33  ? 228  ASN A OD1 1 
ATOM   1756  N ND2 . ASN A  1 228 ? -4.328  -23.045 21.285  1.00 68.97  ? 228  ASN A ND2 1 
ATOM   1757  N N   . ASP A  1 229 ? -2.873  -21.767 25.924  1.00 55.33  ? 229  ASP A N   1 
ATOM   1758  C CA  . ASP A  1 229 ? -3.617  -21.419 27.137  1.00 56.03  ? 229  ASP A CA  1 
ATOM   1759  C C   . ASP A  1 229 ? -4.725  -20.458 26.762  1.00 59.37  ? 229  ASP A C   1 
ATOM   1760  O O   . ASP A  1 229 ? -4.507  -19.238 26.720  1.00 59.59  ? 229  ASP A O   1 
ATOM   1761  C CB  . ASP A  1 229 ? -2.697  -20.787 28.206  1.00 58.88  ? 229  ASP A CB  1 
ATOM   1762  C CG  . ASP A  1 229 ? -3.381  -20.323 29.506  1.00 77.15  ? 229  ASP A CG  1 
ATOM   1763  O OD1 . ASP A  1 229 ? -4.557  -20.732 29.760  1.00 76.76  ? 229  ASP A OD1 1 
ATOM   1764  O OD2 . ASP A  1 229 ? -2.741  -19.568 30.274  1.00 87.99  ? 229  ASP A OD2 1 
ATOM   1765  N N   . SER A  1 230 ? -5.903  -21.012 26.485  1.00 55.54  ? 230  SER A N   1 
ATOM   1766  C CA  . SER A  1 230 ? -7.090  -20.249 26.095  1.00 57.03  ? 230  SER A CA  1 
ATOM   1767  C C   . SER A  1 230 ? -6.816  -19.272 24.937  1.00 59.87  ? 230  SER A C   1 
ATOM   1768  O O   . SER A  1 230 ? -7.114  -18.067 25.008  1.00 60.99  ? 230  SER A O   1 
ATOM   1769  C CB  . SER A  1 230 ? -7.715  -19.557 27.301  1.00 64.13  ? 230  SER A CB  1 
ATOM   1770  O OG  . SER A  1 230 ? -7.901  -20.495 28.346  1.00 80.02  ? 230  SER A OG  1 
ATOM   1771  N N   . GLY A  1 231 ? -6.207  -19.816 23.901  1.00 54.00  ? 231  GLY A N   1 
ATOM   1772  C CA  . GLY A  1 231 ? -5.932  -19.094 22.676  1.00 54.37  ? 231  GLY A CA  1 
ATOM   1773  C C   . GLY A  1 231 ? -4.619  -18.374 22.616  1.00 58.98  ? 231  GLY A C   1 
ATOM   1774  O O   . GLY A  1 231 ? -4.213  -17.946 21.525  1.00 59.73  ? 231  GLY A O   1 
ATOM   1775  N N   . ALA A  1 232 ? -3.959  -18.245 23.784  1.00 55.04  ? 232  ALA A N   1 
ATOM   1776  C CA  . ALA A  1 232 ? -2.656  -17.609 23.934  1.00 54.91  ? 232  ALA A CA  1 
ATOM   1777  C C   . ALA A  1 232 ? -1.545  -18.644 23.877  1.00 60.05  ? 232  ALA A C   1 
ATOM   1778  O O   . ALA A  1 232 ? -1.598  -19.638 24.612  1.00 60.03  ? 232  ALA A O   1 
ATOM   1779  C CB  . ALA A  1 232 ? -2.595  -16.881 25.255  1.00 55.34  ? 232  ALA A CB  1 
ATOM   1780  N N   . CYS A  1 233 ? -0.546  -18.402 23.014  1.00 57.33  ? 233  CYS A N   1 
ATOM   1781  C CA  . CYS A  1 233 ? 0.612   -19.285 22.952  1.00 59.24  ? 233  CYS A CA  1 
ATOM   1782  C C   . CYS A  1 233 ? 1.597   -18.889 24.087  1.00 61.35  ? 233  CYS A C   1 
ATOM   1783  O O   . CYS A  1 233 ? 2.092   -17.757 24.152  1.00 61.98  ? 233  CYS A O   1 
ATOM   1784  C CB  . CYS A  1 233 ? 1.268   -19.302 21.564  1.00 61.61  ? 233  CYS A CB  1 
ATOM   1785  S SG  . CYS A  1 233 ? 0.158   -19.835 20.211  1.00 66.31  ? 233  CYS A SG  1 
ATOM   1786  N N   . VAL A  1 234 ? 1.779   -19.819 25.037  1.00 55.40  ? 234  VAL A N   1 
ATOM   1787  C CA  . VAL A  1 234 ? 2.600   -19.680 26.247  1.00 53.69  ? 234  VAL A CA  1 
ATOM   1788  C C   . VAL A  1 234 ? 3.766   -20.693 26.257  1.00 57.87  ? 234  VAL A C   1 
ATOM   1789  O O   . VAL A  1 234 ? 3.683   -21.748 25.604  1.00 56.72  ? 234  VAL A O   1 
ATOM   1790  C CB  . VAL A  1 234 ? 1.700   -19.763 27.522  1.00 56.13  ? 234  VAL A CB  1 
ATOM   1791  C CG1 . VAL A  1 234 ? 0.575   -18.744 27.452  1.00 56.20  ? 234  VAL A CG1 1 
ATOM   1792  C CG2 . VAL A  1 234 ? 1.112   -21.158 27.730  1.00 54.96  ? 234  VAL A CG2 1 
ATOM   1793  N N   . THR A  1 235 ? 4.851   -20.372 26.984  1.00 55.13  ? 235  THR A N   1 
ATOM   1794  C CA  . THR A  1 235 ? 5.997   -21.290 27.066  1.00 55.14  ? 235  THR A CA  1 
ATOM   1795  C C   . THR A  1 235 ? 5.697   -22.375 28.075  1.00 60.13  ? 235  THR A C   1 
ATOM   1796  O O   . THR A  1 235 ? 6.245   -23.473 27.975  1.00 61.35  ? 235  THR A O   1 
ATOM   1797  C CB  . THR A  1 235 ? 7.281   -20.570 27.514  1.00 62.16  ? 235  THR A CB  1 
ATOM   1798  O OG1 . THR A  1 235 ? 7.338   -19.266 26.952  1.00 65.91  ? 235  THR A OG1 1 
ATOM   1799  C CG2 . THR A  1 235 ? 8.533   -21.339 27.143  1.00 62.27  ? 235  THR A CG2 1 
ATOM   1800  N N   . GLN A  1 236 ? 4.865   -22.038 29.078  1.00 55.86  ? 236  GLN A N   1 
ATOM   1801  C CA  . GLN A  1 236 ? 4.477   -22.861 30.224  1.00 55.40  ? 236  GLN A CA  1 
ATOM   1802  C C   . GLN A  1 236 ? 3.143   -22.409 30.764  1.00 61.28  ? 236  GLN A C   1 
ATOM   1803  O O   . GLN A  1 236 ? 2.762   -21.236 30.603  1.00 62.96  ? 236  GLN A O   1 
ATOM   1804  C CB  . GLN A  1 236 ? 5.564   -22.795 31.344  1.00 57.00  ? 236  GLN A CB  1 
ATOM   1805  C CG  . GLN A  1 236 ? 5.804   -21.443 32.004  1.00 71.63  ? 236  GLN A CG  1 
ATOM   1806  C CD  . GLN A  1 236 ? 6.626   -20.526 31.127  1.00 108.68 ? 236  GLN A CD  1 
ATOM   1807  O OE1 . GLN A  1 236 ? 7.831   -20.745 30.913  1.00 108.98 ? 236  GLN A OE1 1 
ATOM   1808  N NE2 . GLN A  1 236 ? 5.985   -19.489 30.580  1.00 100.50 ? 236  GLN A NE2 1 
ATOM   1809  N N   . CYS A  1 237 ? 2.447   -23.303 31.454  1.00 57.67  ? 237  CYS A N   1 
ATOM   1810  C CA  . CYS A  1 237 ? 1.141   -22.915 32.010  1.00 58.06  ? 237  CYS A CA  1 
ATOM   1811  C C   . CYS A  1 237 ? 1.283   -22.138 33.306  1.00 61.13  ? 237  CYS A C   1 
ATOM   1812  O O   . CYS A  1 237 ? 2.306   -22.290 33.972  1.00 62.84  ? 237  CYS A O   1 
ATOM   1813  C CB  . CYS A  1 237 ? 0.243   -24.136 32.187  1.00 58.65  ? 237  CYS A CB  1 
ATOM   1814  S SG  . CYS A  1 237 ? -0.131  -24.999 30.630  1.00 62.40  ? 237  CYS A SG  1 
ATOM   1815  N N   . PRO A  1 238 ? 0.288   -21.317 33.710  1.00 55.37  ? 238  PRO A N   1 
ATOM   1816  C CA  . PRO A  1 238 ? 0.385   -20.640 35.022  1.00 56.10  ? 238  PRO A CA  1 
ATOM   1817  C C   . PRO A  1 238 ? 0.528   -21.678 36.143  1.00 62.41  ? 238  PRO A C   1 
ATOM   1818  O O   . PRO A  1 238 ? -0.314  -22.580 36.256  1.00 61.77  ? 238  PRO A O   1 
ATOM   1819  C CB  . PRO A  1 238 ? -0.944  -19.898 35.141  1.00 57.50  ? 238  PRO A CB  1 
ATOM   1820  C CG  . PRO A  1 238 ? -1.504  -19.891 33.795  1.00 60.25  ? 238  PRO A CG  1 
ATOM   1821  C CD  . PRO A  1 238 ? -0.998  -21.037 33.050  1.00 54.94  ? 238  PRO A CD  1 
ATOM   1822  N N   . GLN A  1 239 ? 1.637   -21.617 36.905  1.00 60.56  ? 239  GLN A N   1 
ATOM   1823  C CA  . GLN A  1 239 ? 1.927   -22.613 37.956  1.00 60.89  ? 239  GLN A CA  1 
ATOM   1824  C C   . GLN A  1 239 ? 1.073   -22.347 39.187  1.00 64.76  ? 239  GLN A C   1 
ATOM   1825  O O   . GLN A  1 239 ? 0.520   -21.246 39.332  1.00 61.04  ? 239  GLN A O   1 
ATOM   1826  C CB  . GLN A  1 239 ? 3.434   -22.716 38.310  1.00 63.01  ? 239  GLN A CB  1 
ATOM   1827  C CG  . GLN A  1 239 ? 4.418   -22.578 37.131  1.00 97.47  ? 239  GLN A CG  1 
ATOM   1828  C CD  . GLN A  1 239 ? 4.543   -21.175 36.521  1.00 134.61 ? 239  GLN A CD  1 
ATOM   1829  O OE1 . GLN A  1 239 ? 4.016   -20.166 37.027  1.00 129.47 ? 239  GLN A OE1 1 
ATOM   1830  N NE2 . GLN A  1 239 ? 5.217   -21.089 35.381  1.00 132.87 ? 239  GLN A NE2 1 
ATOM   1831  N N   . THR A  1 240 ? 0.939   -23.381 40.054  1.00 64.13  ? 240  THR A N   1 
ATOM   1832  C CA  . THR A  1 240 ? 0.114   -23.323 41.278  1.00 64.06  ? 240  THR A CA  1 
ATOM   1833  C C   . THR A  1 240 ? 0.717   -22.408 42.294  1.00 65.14  ? 240  THR A C   1 
ATOM   1834  O O   . THR A  1 240 ? -0.012  -21.811 43.072  1.00 66.53  ? 240  THR A O   1 
ATOM   1835  C CB  . THR A  1 240 ? -0.252  -24.717 41.810  1.00 73.08  ? 240  THR A CB  1 
ATOM   1836  O OG1 . THR A  1 240 ? 0.918   -25.538 41.798  1.00 78.37  ? 240  THR A OG1 1 
ATOM   1837  C CG2 . THR A  1 240 ? -1.369  -25.378 40.980  1.00 66.34  ? 240  THR A CG2 1 
ATOM   1838  N N   . PHE A  1 241 ? 2.049   -22.277 42.257  1.00 58.22  ? 241  PHE A N   1 
ATOM   1839  C CA  . PHE A  1 241 ? 2.806   -21.407 43.131  1.00 56.39  ? 241  PHE A CA  1 
ATOM   1840  C C   . PHE A  1 241 ? 3.463   -20.295 42.392  1.00 55.79  ? 241  PHE A C   1 
ATOM   1841  O O   . PHE A  1 241 ? 3.841   -20.440 41.238  1.00 56.37  ? 241  PHE A O   1 
ATOM   1842  C CB  . PHE A  1 241 ? 3.791   -22.189 43.995  1.00 58.69  ? 241  PHE A CB  1 
ATOM   1843  C CG  . PHE A  1 241 ? 3.027   -22.965 45.030  1.00 60.74  ? 241  PHE A CG  1 
ATOM   1844  C CD1 . PHE A  1 241 ? 3.009   -24.343 45.005  1.00 63.36  ? 241  PHE A CD1 1 
ATOM   1845  C CD2 . PHE A  1 241 ? 2.239   -22.310 45.975  1.00 63.78  ? 241  PHE A CD2 1 
ATOM   1846  C CE1 . PHE A  1 241 ? 2.275   -25.056 45.938  1.00 64.72  ? 241  PHE A CE1 1 
ATOM   1847  C CE2 . PHE A  1 241 ? 1.481   -23.028 46.896  1.00 66.34  ? 241  PHE A CE2 1 
ATOM   1848  C CZ  . PHE A  1 241 ? 1.508   -24.391 46.873  1.00 64.26  ? 241  PHE A CZ  1 
ATOM   1849  N N   . VAL A  1 242 ? 3.581   -19.166 43.051  1.00 48.25  ? 242  VAL A N   1 
ATOM   1850  C CA  . VAL A  1 242 ? 4.149   -17.963 42.491  1.00 45.77  ? 242  VAL A CA  1 
ATOM   1851  C C   . VAL A  1 242 ? 5.079   -17.321 43.528  1.00 50.71  ? 242  VAL A C   1 
ATOM   1852  O O   . VAL A  1 242 ? 4.690   -17.161 44.678  1.00 53.28  ? 242  VAL A O   1 
ATOM   1853  C CB  . VAL A  1 242 ? 2.966   -17.088 42.028  1.00 48.13  ? 242  VAL A CB  1 
ATOM   1854  C CG1 . VAL A  1 242 ? 3.202   -15.612 42.230  1.00 48.93  ? 242  VAL A CG1 1 
ATOM   1855  C CG2 . VAL A  1 242 ? 2.653   -17.377 40.584  1.00 47.04  ? 242  VAL A CG2 1 
ATOM   1856  N N   . TYR A  1 243 ? 6.301   -16.978 43.152  1.00 44.70  ? 243  TYR A N   1 
ATOM   1857  C CA  . TYR A  1 243 ? 7.206   -16.393 44.123  1.00 45.16  ? 243  TYR A CA  1 
ATOM   1858  C C   . TYR A  1 243 ? 6.906   -14.923 44.377  1.00 48.72  ? 243  TYR A C   1 
ATOM   1859  O O   . TYR A  1 243 ? 6.781   -14.162 43.427  1.00 50.73  ? 243  TYR A O   1 
ATOM   1860  C CB  . TYR A  1 243 ? 8.629   -16.552 43.605  1.00 47.06  ? 243  TYR A CB  1 
ATOM   1861  C CG  . TYR A  1 243 ? 9.724   -16.204 44.581  1.00 49.79  ? 243  TYR A CG  1 
ATOM   1862  C CD1 . TYR A  1 243 ? 10.234  -17.158 45.449  1.00 52.65  ? 243  TYR A CD1 1 
ATOM   1863  C CD2 . TYR A  1 243 ? 10.326  -14.951 44.566  1.00 50.43  ? 243  TYR A CD2 1 
ATOM   1864  C CE1 . TYR A  1 243 ? 11.272  -16.855 46.325  1.00 54.11  ? 243  TYR A CE1 1 
ATOM   1865  C CE2 . TYR A  1 243 ? 11.389  -14.650 45.410  1.00 51.97  ? 243  TYR A CE2 1 
ATOM   1866  C CZ  . TYR A  1 243 ? 11.852  -15.604 46.291  1.00 56.18  ? 243  TYR A CZ  1 
ATOM   1867  O OH  . TYR A  1 243 ? 12.891  -15.330 47.121  1.00 60.05  ? 243  TYR A OH  1 
ATOM   1868  N N   . ASN A  1 244 ? 6.825   -14.509 45.637  1.00 44.22  ? 244  ASN A N   1 
ATOM   1869  C CA  . ASN A  1 244 ? 6.634   -13.093 45.916  1.00 45.40  ? 244  ASN A CA  1 
ATOM   1870  C C   . ASN A  1 244 ? 8.028   -12.543 46.183  1.00 53.94  ? 244  ASN A C   1 
ATOM   1871  O O   . ASN A  1 244 ? 8.655   -12.989 47.138  1.00 56.23  ? 244  ASN A O   1 
ATOM   1872  C CB  . ASN A  1 244 ? 5.686   -12.848 47.095  1.00 43.45  ? 244  ASN A CB  1 
ATOM   1873  C CG  . ASN A  1 244 ? 5.583   -11.406 47.595  1.00 74.01  ? 244  ASN A CG  1 
ATOM   1874  O OD1 . ASN A  1 244 ? 6.535   -10.611 47.571  1.00 67.43  ? 244  ASN A OD1 1 
ATOM   1875  N ND2 . ASN A  1 244 ? 4.445   -11.072 48.195  1.00 73.43  ? 244  ASN A ND2 1 
ATOM   1876  N N   . PRO A  1 245 ? 8.513   -11.562 45.382  1.00 51.37  ? 245  PRO A N   1 
ATOM   1877  C CA  . PRO A  1 245 ? 9.890   -11.038 45.566  1.00 52.47  ? 245  PRO A CA  1 
ATOM   1878  C C   . PRO A  1 245 ? 10.169  -10.267 46.833  1.00 58.10  ? 245  PRO A C   1 
ATOM   1879  O O   . PRO A  1 245 ? 11.325  -10.159 47.215  1.00 58.22  ? 245  PRO A O   1 
ATOM   1880  C CB  . PRO A  1 245 ? 10.087  -10.115 44.369  1.00 54.35  ? 245  PRO A CB  1 
ATOM   1881  C CG  . PRO A  1 245 ? 9.028   -10.517 43.390  1.00 57.97  ? 245  PRO A CG  1 
ATOM   1882  C CD  . PRO A  1 245 ? 7.878   -10.990 44.183  1.00 52.62  ? 245  PRO A CD  1 
ATOM   1883  N N   . THR A  1 246 ? 9.140   -9.678  47.441  1.00 56.47  ? 246  THR A N   1 
ATOM   1884  C CA  . THR A  1 246 ? 9.306   -8.870  48.655  1.00 58.17  ? 246  THR A CA  1 
ATOM   1885  C C   . THR A  1 246 ? 9.264   -9.690  49.924  1.00 62.24  ? 246  THR A C   1 
ATOM   1886  O O   . THR A  1 246 ? 9.939   -9.317  50.881  1.00 65.44  ? 246  THR A O   1 
ATOM   1887  C CB  . THR A  1 246 ? 8.412   -7.590  48.651  1.00 64.40  ? 246  THR A CB  1 
ATOM   1888  O OG1 . THR A  1 246 ? 7.125   -7.928  48.150  1.00 67.62  ? 246  THR A OG1 1 
ATOM   1889  C CG2 . THR A  1 246 ? 8.986   -6.472  47.754  1.00 62.29  ? 246  THR A CG2 1 
ATOM   1890  N N   . THR A  1 247 ? 8.498   -10.804 49.932  1.00 54.75  ? 247  THR A N   1 
ATOM   1891  C CA  . THR A  1 247 ? 8.370   -11.696 51.089  1.00 54.32  ? 247  THR A CA  1 
ATOM   1892  C C   . THR A  1 247 ? 9.410   -12.834 51.078  1.00 57.59  ? 247  THR A C   1 
ATOM   1893  O O   . THR A  1 247 ? 9.710   -13.410 52.140  1.00 62.20  ? 247  THR A O   1 
ATOM   1894  C CB  . THR A  1 247 ? 6.970   -12.358 51.159  1.00 58.08  ? 247  THR A CB  1 
ATOM   1895  O OG1 . THR A  1 247 ? 6.838   -13.428 50.212  1.00 58.55  ? 247  THR A OG1 1 
ATOM   1896  C CG2 . THR A  1 247 ? 5.845   -11.393 51.054  1.00 51.23  ? 247  THR A CG2 1 
ATOM   1897  N N   . PHE A  1 248 ? 9.904   -13.191 49.884  1.00 46.90  ? 248  PHE A N   1 
ATOM   1898  C CA  . PHE A  1 248 ? 10.811  -14.316 49.644  1.00 44.07  ? 248  PHE A CA  1 
ATOM   1899  C C   . PHE A  1 248 ? 10.132  -15.653 49.985  1.00 49.26  ? 248  PHE A C   1 
ATOM   1900  O O   . PHE A  1 248 ? 10.716  -16.533 50.636  1.00 50.37  ? 248  PHE A O   1 
ATOM   1901  C CB  . PHE A  1 248 ? 12.148  -14.171 50.352  1.00 45.27  ? 248  PHE A CB  1 
ATOM   1902  C CG  . PHE A  1 248 ? 12.980  -13.030 49.860  1.00 45.42  ? 248  PHE A CG  1 
ATOM   1903  C CD1 . PHE A  1 248 ? 14.028  -13.245 48.973  1.00 46.30  ? 248  PHE A CD1 1 
ATOM   1904  C CD2 . PHE A  1 248 ? 12.763  -11.738 50.326  1.00 47.06  ? 248  PHE A CD2 1 
ATOM   1905  C CE1 . PHE A  1 248 ? 14.837  -12.183 48.546  1.00 46.64  ? 248  PHE A CE1 1 
ATOM   1906  C CE2 . PHE A  1 248 ? 13.586  -10.680 49.911  1.00 48.69  ? 248  PHE A CE2 1 
ATOM   1907  C CZ  . PHE A  1 248 ? 14.613  -10.910 49.018  1.00 45.24  ? 248  PHE A CZ  1 
ATOM   1908  N N   . GLN A  1 249 ? 8.873   -15.786 49.545  1.00 44.13  ? 249  GLN A N   1 
ATOM   1909  C CA  . GLN A  1 249 ? 8.069   -16.985 49.774  1.00 42.70  ? 249  GLN A CA  1 
ATOM   1910  C C   . GLN A  1 249 ? 7.200   -17.299 48.594  1.00 47.74  ? 249  GLN A C   1 
ATOM   1911  O O   . GLN A  1 249 ? 6.807   -16.403 47.862  1.00 46.64  ? 249  GLN A O   1 
ATOM   1912  C CB  . GLN A  1 249 ? 7.161   -16.859 51.019  1.00 43.60  ? 249  GLN A CB  1 
ATOM   1913  C CG  . GLN A  1 249 ? 7.870   -16.598 52.349  1.00 48.33  ? 249  GLN A CG  1 
ATOM   1914  C CD  . GLN A  1 249 ? 8.781   -17.694 52.872  1.00 59.36  ? 249  GLN A CD  1 
ATOM   1915  O OE1 . GLN A  1 249 ? 9.583   -17.434 53.776  1.00 56.96  ? 249  GLN A OE1 1 
ATOM   1916  N NE2 . GLN A  1 249 ? 8.654   -18.940 52.367  1.00 34.70  ? 249  GLN A NE2 1 
ATOM   1917  N N   . LEU A  1 250 ? 6.885   -18.578 48.418  1.00 47.45  ? 250  LEU A N   1 
ATOM   1918  C CA  . LEU A  1 250 ? 5.971   -19.016 47.395  1.00 48.06  ? 250  LEU A CA  1 
ATOM   1919  C C   . LEU A  1 250 ? 4.561   -18.743 47.933  1.00 58.02  ? 250  LEU A C   1 
ATOM   1920  O O   . LEU A  1 250 ? 4.316   -18.863 49.132  1.00 59.53  ? 250  LEU A O   1 
ATOM   1921  C CB  . LEU A  1 250 ? 6.138   -20.509 47.111  1.00 47.78  ? 250  LEU A CB  1 
ATOM   1922  C CG  . LEU A  1 250 ? 7.406   -20.912 46.403  1.00 53.08  ? 250  LEU A CG  1 
ATOM   1923  C CD1 . LEU A  1 250 ? 7.561   -22.394 46.415  1.00 52.56  ? 250  LEU A CD1 1 
ATOM   1924  C CD2 . LEU A  1 250 ? 7.372   -20.452 44.971  1.00 59.80  ? 250  LEU A CD2 1 
ATOM   1925  N N   . GLU A  1 251 ? 3.664   -18.314 47.046  1.00 56.27  ? 251  GLU A N   1 
ATOM   1926  C CA  . GLU A  1 251 ? 2.284   -17.979 47.327  1.00 56.92  ? 251  GLU A CA  1 
ATOM   1927  C C   . GLU A  1 251 ? 1.419   -18.745 46.372  1.00 66.50  ? 251  GLU A C   1 
ATOM   1928  O O   . GLU A  1 251 ? 1.876   -19.132 45.308  1.00 64.62  ? 251  GLU A O   1 
ATOM   1929  C CB  . GLU A  1 251 ? 2.046   -16.480 47.154  1.00 57.89  ? 251  GLU A CB  1 
ATOM   1930  C CG  . GLU A  1 251 ? 2.689   -15.635 48.237  1.00 68.97  ? 251  GLU A CG  1 
ATOM   1931  C CD  . GLU A  1 251 ? 2.449   -14.133 48.144  1.00 94.24  ? 251  GLU A CD  1 
ATOM   1932  O OE1 . GLU A  1 251 ? 2.924   -13.400 49.044  1.00 99.96  ? 251  GLU A OE1 1 
ATOM   1933  O OE2 . GLU A  1 251 ? 1.783   -13.687 47.179  1.00 80.19  ? 251  GLU A OE2 1 
ATOM   1934  N N   . HIS A  1 252 ? 0.161   -18.946 46.732  1.00 69.98  ? 252  HIS A N   1 
ATOM   1935  C CA  . HIS A  1 252 ? -0.780  -19.623 45.876  1.00 71.47  ? 252  HIS A CA  1 
ATOM   1936  C C   . HIS A  1 252 ? -1.185  -18.769 44.727  1.00 73.85  ? 252  HIS A C   1 
ATOM   1937  O O   . HIS A  1 252 ? -1.508  -17.600 44.907  1.00 75.34  ? 252  HIS A O   1 
ATOM   1938  C CB  . HIS A  1 252 ? -2.024  -19.974 46.659  1.00 75.37  ? 252  HIS A CB  1 
ATOM   1939  C CG  . HIS A  1 252 ? -2.095  -21.424 46.913  1.00 81.33  ? 252  HIS A CG  1 
ATOM   1940  N ND1 . HIS A  1 252 ? -1.751  -21.946 48.146  1.00 85.68  ? 252  HIS A ND1 1 
ATOM   1941  C CD2 . HIS A  1 252 ? -2.387  -22.437 46.055  1.00 84.48  ? 252  HIS A CD2 1 
ATOM   1942  C CE1 . HIS A  1 252 ? -1.872  -23.261 48.017  1.00 86.20  ? 252  HIS A CE1 1 
ATOM   1943  N NE2 . HIS A  1 252 ? -2.248  -23.605 46.770  1.00 85.45  ? 252  HIS A NE2 1 
ATOM   1944  N N   . ASN A  1 253 ? -1.160  -19.338 43.549  1.00 68.44  ? 253  ASN A N   1 
ATOM   1945  C CA  . ASN A  1 253 ? -1.655  -18.680 42.360  1.00 68.40  ? 253  ASN A CA  1 
ATOM   1946  C C   . ASN A  1 253 ? -3.004  -19.313 42.153  1.00 76.63  ? 253  ASN A C   1 
ATOM   1947  O O   . ASN A  1 253 ? -3.134  -20.544 42.110  1.00 74.28  ? 253  ASN A O   1 
ATOM   1948  C CB  . ASN A  1 253 ? -0.753  -18.894 41.165  1.00 67.28  ? 253  ASN A CB  1 
ATOM   1949  C CG  . ASN A  1 253 ? -1.248  -18.270 39.879  1.00 77.46  ? 253  ASN A CG  1 
ATOM   1950  O OD1 . ASN A  1 253 ? -2.328  -17.683 39.802  1.00 77.90  ? 253  ASN A OD1 1 
ATOM   1951  N ND2 . ASN A  1 253 ? -0.461  -18.393 38.823  1.00 62.64  ? 253  ASN A ND2 1 
ATOM   1952  N N   . PHE A  1 254 ? -4.027  -18.482 42.139  1.00 79.62  ? 254  PHE A N   1 
ATOM   1953  C CA  . PHE A  1 254 ? -5.367  -19.031 42.014  1.00 81.70  ? 254  PHE A CA  1 
ATOM   1954  C C   . PHE A  1 254 ? -5.891  -19.072 40.579  1.00 83.62  ? 254  PHE A C   1 
ATOM   1955  O O   . PHE A  1 254 ? -6.915  -19.691 40.297  1.00 82.07  ? 254  PHE A O   1 
ATOM   1956  C CB  . PHE A  1 254 ? -6.317  -18.425 43.058  1.00 85.91  ? 254  PHE A CB  1 
ATOM   1957  C CG  . PHE A  1 254 ? -6.138  -18.959 44.478  1.00 89.21  ? 254  PHE A CG  1 
ATOM   1958  C CD1 . PHE A  1 254 ? -6.069  -18.088 45.564  1.00 94.11  ? 254  PHE A CD1 1 
ATOM   1959  C CD2 . PHE A  1 254 ? -6.093  -20.337 44.731  1.00 90.92  ? 254  PHE A CD2 1 
ATOM   1960  C CE1 . PHE A  1 254 ? -5.970  -18.585 46.878  1.00 96.00  ? 254  PHE A CE1 1 
ATOM   1961  C CE2 . PHE A  1 254 ? -5.964  -20.828 46.041  1.00 94.21  ? 254  PHE A CE2 1 
ATOM   1962  C CZ  . PHE A  1 254 ? -5.916  -19.951 47.105  1.00 93.88  ? 254  PHE A CZ  1 
ATOM   1963  N N   . ASN A  1 255 ? -5.099  -18.499 39.672  1.00 79.83  ? 255  ASN A N   1 
ATOM   1964  C CA  . ASN A  1 255 ? -5.314  -18.465 38.231  1.00 79.16  ? 255  ASN A CA  1 
ATOM   1965  C C   . ASN A  1 255 ? -4.443  -19.554 37.585  1.00 79.00  ? 255  ASN A C   1 
ATOM   1966  O O   . ASN A  1 255 ? -4.174  -19.524 36.374  1.00 79.20  ? 255  ASN A O   1 
ATOM   1967  C CB  . ASN A  1 255 ? -4.908  -17.086 37.686  1.00 87.16  ? 255  ASN A CB  1 
ATOM   1968  C CG  . ASN A  1 255 ? -5.430  -15.946 38.510  1.00 122.17 ? 255  ASN A CG  1 
ATOM   1969  O OD1 . ASN A  1 255 ? -6.616  -15.910 38.884  1.00 124.08 ? 255  ASN A OD1 1 
ATOM   1970  N ND2 . ASN A  1 255 ? -4.533  -15.026 38.854  1.00 111.37 ? 255  ASN A ND2 1 
ATOM   1971  N N   . ALA A  1 256 ? -3.969  -20.490 38.412  1.00 71.16  ? 256  ALA A N   1 
ATOM   1972  C CA  . ALA A  1 256 ? -3.145  -21.579 37.961  1.00 68.41  ? 256  ALA A CA  1 
ATOM   1973  C C   . ALA A  1 256 ? -4.011  -22.486 37.137  1.00 67.27  ? 256  ALA A C   1 
ATOM   1974  O O   . ALA A  1 256 ? -5.199  -22.634 37.420  1.00 68.35  ? 256  ALA A O   1 
ATOM   1975  C CB  . ALA A  1 256 ? -2.604  -22.332 39.157  1.00 69.73  ? 256  ALA A CB  1 
ATOM   1976  N N   . LYS A  1 257 ? -3.413  -23.077 36.112  1.00 58.69  ? 257  LYS A N   1 
ATOM   1977  C CA  . LYS A  1 257 ? -4.027  -24.018 35.195  1.00 56.10  ? 257  LYS A CA  1 
ATOM   1978  C C   . LYS A  1 257 ? -3.132  -25.241 35.146  1.00 63.13  ? 257  LYS A C   1 
ATOM   1979  O O   . LYS A  1 257 ? -1.966  -25.164 35.569  1.00 65.91  ? 257  LYS A O   1 
ATOM   1980  C CB  . LYS A  1 257 ? -4.106  -23.391 33.816  1.00 56.56  ? 257  LYS A CB  1 
ATOM   1981  C CG  . LYS A  1 257 ? -5.264  -22.419 33.664  1.00 59.77  ? 257  LYS A CG  1 
ATOM   1982  C CD  . LYS A  1 257 ? -6.031  -22.797 32.445  1.00 67.48  ? 257  LYS A CD  1 
ATOM   1983  C CE  . LYS A  1 257 ? -6.824  -21.674 31.867  1.00 83.21  ? 257  LYS A CE  1 
ATOM   1984  N NZ  . LYS A  1 257 ? -7.351  -22.062 30.534  1.00 99.68  ? 257  LYS A NZ  1 
ATOM   1985  N N   . TYR A  1 258 ? -3.652  -26.370 34.625  1.00 57.98  ? 258  TYR A N   1 
ATOM   1986  C CA  . TYR A  1 258 ? -2.889  -27.610 34.511  1.00 56.71  ? 258  TYR A CA  1 
ATOM   1987  C C   . TYR A  1 258 ? -2.406  -27.836 33.126  1.00 55.85  ? 258  TYR A C   1 
ATOM   1988  O O   . TYR A  1 258 ? -3.132  -27.556 32.187  1.00 56.28  ? 258  TYR A O   1 
ATOM   1989  C CB  . TYR A  1 258 ? -3.738  -28.789 34.921  1.00 60.19  ? 258  TYR A CB  1 
ATOM   1990  C CG  . TYR A  1 258 ? -4.233  -28.658 36.333  1.00 66.43  ? 258  TYR A CG  1 
ATOM   1991  C CD1 . TYR A  1 258 ? -5.525  -28.213 36.600  1.00 68.44  ? 258  TYR A CD1 1 
ATOM   1992  C CD2 . TYR A  1 258 ? -3.399  -28.942 37.411  1.00 69.45  ? 258  TYR A CD2 1 
ATOM   1993  C CE1 . TYR A  1 258 ? -5.985  -28.088 37.906  1.00 71.40  ? 258  TYR A CE1 1 
ATOM   1994  C CE2 . TYR A  1 258 ? -3.838  -28.789 38.722  1.00 71.80  ? 258  TYR A CE2 1 
ATOM   1995  C CZ  . TYR A  1 258 ? -5.133  -28.367 38.964  1.00 82.57  ? 258  TYR A CZ  1 
ATOM   1996  O OH  . TYR A  1 258 ? -5.573  -28.263 40.258  1.00 91.33  ? 258  TYR A OH  1 
ATOM   1997  N N   . THR A  1 259 ? -1.194  -28.353 32.982  1.00 50.23  ? 259  THR A N   1 
ATOM   1998  C CA  . THR A  1 259 ? -0.638  -28.688 31.684  1.00 49.75  ? 259  THR A CA  1 
ATOM   1999  C C   . THR A  1 259 ? -1.139  -30.061 31.305  1.00 53.30  ? 259  THR A C   1 
ATOM   2000  O O   . THR A  1 259 ? -0.891  -31.030 32.022  1.00 53.70  ? 259  THR A O   1 
ATOM   2001  C CB  . THR A  1 259 ? 0.906   -28.725 31.692  1.00 64.53  ? 259  THR A CB  1 
ATOM   2002  O OG1 . THR A  1 259 ? 1.427   -27.862 32.694  1.00 73.58  ? 259  THR A OG1 1 
ATOM   2003  C CG2 . THR A  1 259 ? 1.500   -28.370 30.351  1.00 59.21  ? 259  THR A CG2 1 
ATOM   2004  N N   . TYR A  1 260 ? -1.838  -30.150 30.181  1.00 49.82  ? 260  TYR A N   1 
ATOM   2005  C CA  . TYR A  1 260 ? -2.306  -31.415 29.637  1.00 49.92  ? 260  TYR A CA  1 
ATOM   2006  C C   . TYR A  1 260 ? -1.960  -31.431 28.163  1.00 51.33  ? 260  TYR A C   1 
ATOM   2007  O O   . TYR A  1 260 ? -2.531  -30.648 27.395  1.00 52.44  ? 260  TYR A O   1 
ATOM   2008  C CB  . TYR A  1 260 ? -3.805  -31.611 29.879  1.00 52.57  ? 260  TYR A CB  1 
ATOM   2009  C CG  . TYR A  1 260 ? -4.328  -32.928 29.339  1.00 55.94  ? 260  TYR A CG  1 
ATOM   2010  C CD1 . TYR A  1 260 ? -3.687  -34.129 29.633  1.00 59.45  ? 260  TYR A CD1 1 
ATOM   2011  C CD2 . TYR A  1 260 ? -5.463  -32.974 28.537  1.00 55.40  ? 260  TYR A CD2 1 
ATOM   2012  C CE1 . TYR A  1 260 ? -4.176  -35.342 29.157  1.00 62.29  ? 260  TYR A CE1 1 
ATOM   2013  C CE2 . TYR A  1 260 ? -5.934  -34.177 28.017  1.00 56.16  ? 260  TYR A CE2 1 
ATOM   2014  C CZ  . TYR A  1 260 ? -5.294  -35.360 28.338  1.00 68.77  ? 260  TYR A CZ  1 
ATOM   2015  O OH  . TYR A  1 260 ? -5.749  -36.563 27.853  1.00 73.90  ? 260  TYR A OH  1 
ATOM   2016  N N   . GLY A  1 261 ? -0.975  -32.248 27.793  1.00 44.71  ? 261  GLY A N   1 
ATOM   2017  C CA  . GLY A  1 261 ? -0.535  -32.311 26.416  1.00 44.79  ? 261  GLY A CA  1 
ATOM   2018  C C   . GLY A  1 261 ? 0.016   -30.974 26.007  1.00 52.67  ? 261  GLY A C   1 
ATOM   2019  O O   . GLY A  1 261 ? 0.906   -30.465 26.683  1.00 54.32  ? 261  GLY A O   1 
ATOM   2020  N N   . ALA A  1 262 ? -0.547  -30.360 24.956  1.00 49.65  ? 262  ALA A N   1 
ATOM   2021  C CA  . ALA A  1 262 ? -0.053  -29.052 24.517  1.00 50.06  ? 262  ALA A CA  1 
ATOM   2022  C C   . ALA A  1 262 ? -0.995  -27.951 24.990  1.00 52.48  ? 262  ALA A C   1 
ATOM   2023  O O   . ALA A  1 262 ? -1.195  -26.945 24.279  1.00 51.96  ? 262  ALA A O   1 
ATOM   2024  C CB  . ALA A  1 262 ? 0.031   -29.042 23.009  1.00 51.63  ? 262  ALA A CB  1 
ATOM   2025  N N   . PHE A  1 263 ? -1.629  -28.162 26.167  1.00 47.10  ? 263  PHE A N   1 
ATOM   2026  C CA  . PHE A  1 263 ? -2.668  -27.259 26.636  1.00 45.77  ? 263  PHE A CA  1 
ATOM   2027  C C   . PHE A  1 263 ? -2.639  -26.935 28.090  1.00 54.83  ? 263  PHE A C   1 
ATOM   2028  O O   . PHE A  1 263 ? -2.206  -27.755 28.893  1.00 56.16  ? 263  PHE A O   1 
ATOM   2029  C CB  . PHE A  1 263 ? -4.039  -27.842 26.313  1.00 45.64  ? 263  PHE A CB  1 
ATOM   2030  C CG  . PHE A  1 263 ? -4.358  -27.870 24.852  1.00 46.60  ? 263  PHE A CG  1 
ATOM   2031  C CD1 . PHE A  1 263 ? -4.063  -28.989 24.081  1.00 49.03  ? 263  PHE A CD1 1 
ATOM   2032  C CD2 . PHE A  1 263 ? -4.957  -26.783 24.238  1.00 49.34  ? 263  PHE A CD2 1 
ATOM   2033  C CE1 . PHE A  1 263 ? -4.323  -28.999 22.711  1.00 49.89  ? 263  PHE A CE1 1 
ATOM   2034  C CE2 . PHE A  1 263 ? -5.246  -26.803 22.870  1.00 52.59  ? 263  PHE A CE2 1 
ATOM   2035  C CZ  . PHE A  1 263 ? -4.920  -27.909 22.114  1.00 49.92  ? 263  PHE A CZ  1 
ATOM   2036  N N   . CYS A  1 264 ? -3.160  -25.748 28.432  1.00 52.96  ? 264  CYS A N   1 
ATOM   2037  C CA  . CYS A  1 264 ? -3.366  -25.302 29.789  1.00 54.16  ? 264  CYS A CA  1 
ATOM   2038  C C   . CYS A  1 264 ? -4.836  -25.449 30.009  1.00 56.37  ? 264  CYS A C   1 
ATOM   2039  O O   . CYS A  1 264 ? -5.677  -24.882 29.278  1.00 56.69  ? 264  CYS A O   1 
ATOM   2040  C CB  . CYS A  1 264 ? -2.883  -23.878 29.987  1.00 56.63  ? 264  CYS A CB  1 
ATOM   2041  S SG  . CYS A  1 264 ? -1.163  -23.641 29.491  1.00 62.06  ? 264  CYS A SG  1 
ATOM   2042  N N   . VAL A  1 265 ? -5.145  -26.358 30.922  1.00 51.35  ? 265  VAL A N   1 
ATOM   2043  C CA  . VAL A  1 265 ? -6.515  -26.757 31.196  1.00 50.64  ? 265  VAL A CA  1 
ATOM   2044  C C   . VAL A  1 265 ? -7.016  -26.415 32.589  1.00 52.74  ? 265  VAL A C   1 
ATOM   2045  O O   . VAL A  1 265 ? -6.232  -26.425 33.536  1.00 51.96  ? 265  VAL A O   1 
ATOM   2046  C CB  . VAL A  1 265 ? -6.762  -28.229 30.772  1.00 52.67  ? 265  VAL A CB  1 
ATOM   2047  C CG1 . VAL A  1 265 ? -6.538  -28.401 29.272  1.00 51.16  ? 265  VAL A CG1 1 
ATOM   2048  C CG2 . VAL A  1 265 ? -5.901  -29.206 31.577  1.00 52.18  ? 265  VAL A CG2 1 
ATOM   2049  N N   . LYS A  1 266 ? -8.320  -26.135 32.707  1.00 48.75  ? 266  LYS A N   1 
ATOM   2050  C CA  . LYS A  1 266 ? -8.944  -25.807 33.979  1.00 50.51  ? 266  LYS A CA  1 
ATOM   2051  C C   . LYS A  1 266 ? -9.047  -27.040 34.901  1.00 60.78  ? 266  LYS A C   1 
ATOM   2052  O O   . LYS A  1 266 ? -9.229  -26.871 36.106  1.00 63.62  ? 266  LYS A O   1 
ATOM   2053  C CB  . LYS A  1 266 ? -10.358 -25.230 33.775  1.00 53.22  ? 266  LYS A CB  1 
ATOM   2054  C CG  . LYS A  1 266 ? -10.527 -24.052 32.827  1.00 42.72  ? 266  LYS A CG  1 
ATOM   2055  C CD  . LYS A  1 266 ? -12.007 -23.853 32.583  1.00 41.93  ? 266  LYS A CD  1 
ATOM   2056  C CE  . LYS A  1 266 ? -12.415 -23.656 31.138  1.00 62.64  ? 266  LYS A CE  1 
ATOM   2057  N NZ  . LYS A  1 266 ? -12.489 -22.216 30.749  1.00 78.54  ? 266  LYS A NZ  1 
ATOM   2058  N N   . LYS A  1 267 ? -8.920  -28.266 34.350  1.00 58.06  ? 267  LYS A N   1 
ATOM   2059  C CA  . LYS A  1 267 ? -9.095  -29.520 35.083  1.00 58.07  ? 267  LYS A CA  1 
ATOM   2060  C C   . LYS A  1 267 ? -8.310  -30.670 34.411  1.00 65.84  ? 267  LYS A C   1 
ATOM   2061  O O   . LYS A  1 267 ? -8.283  -30.747 33.180  1.00 66.75  ? 267  LYS A O   1 
ATOM   2062  C CB  . LYS A  1 267 ? -10.611 -29.816 34.981  1.00 60.12  ? 267  LYS A CB  1 
ATOM   2063  C CG  . LYS A  1 267 ? -11.187 -30.966 35.786  1.00 68.24  ? 267  LYS A CG  1 
ATOM   2064  C CD  . LYS A  1 267 ? -12.461 -31.517 35.100  1.00 75.17  ? 267  LYS A CD  1 
ATOM   2065  C CE  . LYS A  1 267 ? -12.243 -32.614 34.040  1.00 86.10  ? 267  LYS A CE  1 
ATOM   2066  N NZ  . LYS A  1 267 ? -12.485 -34.001 34.547  1.00 99.58  ? 267  LYS A NZ  1 
ATOM   2067  N N   . CYS A  1 268 ? -7.753  -31.612 35.190  1.00 64.15  ? 268  CYS A N   1 
ATOM   2068  C CA  . CYS A  1 268 ? -7.133  -32.786 34.568  1.00 64.60  ? 268  CYS A CA  1 
ATOM   2069  C C   . CYS A  1 268 ? -8.226  -33.809 34.237  1.00 66.43  ? 268  CYS A C   1 
ATOM   2070  O O   . CYS A  1 268 ? -9.141  -33.977 35.048  1.00 64.60  ? 268  CYS A O   1 
ATOM   2071  C CB  . CYS A  1 268 ? -6.087  -33.428 35.476  1.00 66.68  ? 268  CYS A CB  1 
ATOM   2072  S SG  . CYS A  1 268 ? -4.469  -32.603 35.497  1.00 71.43  ? 268  CYS A SG  1 
ATOM   2073  N N   . PRO A  1 269 ? -8.086  -34.637 33.169  1.00 63.92  ? 269  PRO A N   1 
ATOM   2074  C CA  . PRO A  1 269 ? -9.025  -35.751 33.002  1.00 64.21  ? 269  PRO A CA  1 
ATOM   2075  C C   . PRO A  1 269 ? -9.019  -36.591 34.298  1.00 72.69  ? 269  PRO A C   1 
ATOM   2076  O O   . PRO A  1 269 ? -7.974  -36.704 34.963  1.00 72.79  ? 269  PRO A O   1 
ATOM   2077  C CB  . PRO A  1 269 ? -8.426  -36.553 31.843  1.00 65.23  ? 269  PRO A CB  1 
ATOM   2078  C CG  . PRO A  1 269 ? -7.540  -35.644 31.152  1.00 69.73  ? 269  PRO A CG  1 
ATOM   2079  C CD  . PRO A  1 269 ? -6.996  -34.712 32.172  1.00 65.66  ? 269  PRO A CD  1 
ATOM   2080  N N   . HIS A  1 270 ? -10.186 -37.126 34.687  1.00 71.85  ? 270  HIS A N   1 
ATOM   2081  C CA  . HIS A  1 270 ? -10.337 -37.900 35.915  1.00 73.70  ? 270  HIS A CA  1 
ATOM   2082  C C   . HIS A  1 270 ? -9.387  -39.088 36.082  1.00 74.12  ? 270  HIS A C   1 
ATOM   2083  O O   . HIS A  1 270 ? -8.969  -39.383 37.216  1.00 74.86  ? 270  HIS A O   1 
ATOM   2084  C CB  . HIS A  1 270 ? -11.782 -38.368 36.111  1.00 77.41  ? 270  HIS A CB  1 
ATOM   2085  C CG  . HIS A  1 270 ? -12.139 -38.542 37.563  1.00 83.65  ? 270  HIS A CG  1 
ATOM   2086  N ND1 . HIS A  1 270 ? -11.980 -39.767 38.207  1.00 87.17  ? 270  HIS A ND1 1 
ATOM   2087  C CD2 . HIS A  1 270 ? -12.585 -37.626 38.466  1.00 86.55  ? 270  HIS A CD2 1 
ATOM   2088  C CE1 . HIS A  1 270 ? -12.342 -39.557 39.469  1.00 87.55  ? 270  HIS A CE1 1 
ATOM   2089  N NE2 . HIS A  1 270 ? -12.708 -38.283 39.673  1.00 87.49  ? 270  HIS A NE2 1 
ATOM   2090  N N   . ASN A  1 271 ? -9.049  -39.769 34.964  1.00 66.30  ? 271  ASN A N   1 
ATOM   2091  C CA  . ASN A  1 271 ? -8.169  -40.952 34.960  1.00 64.72  ? 271  ASN A CA  1 
ATOM   2092  C C   . ASN A  1 271 ? -6.661  -40.631 35.097  1.00 67.84  ? 271  ASN A C   1 
ATOM   2093  O O   . ASN A  1 271 ? -5.871  -41.525 35.431  1.00 69.55  ? 271  ASN A O   1 
ATOM   2094  C CB  . ASN A  1 271 ? -8.444  -41.844 33.743  1.00 54.77  ? 271  ASN A CB  1 
ATOM   2095  C CG  . ASN A  1 271 ? -8.232  -41.140 32.440  1.00 77.48  ? 271  ASN A CG  1 
ATOM   2096  O OD1 . ASN A  1 271 ? -8.578  -39.957 32.275  1.00 69.64  ? 271  ASN A OD1 1 
ATOM   2097  N ND2 . ASN A  1 271 ? -7.651  -41.846 31.481  1.00 75.84  ? 271  ASN A ND2 1 
ATOM   2098  N N   . PHE A  1 272 ? -6.279  -39.368 34.859  1.00 60.20  ? 272  PHE A N   1 
ATOM   2099  C CA  . PHE A  1 272 ? -4.905  -38.905 34.932  1.00 58.94  ? 272  PHE A CA  1 
ATOM   2100  C C   . PHE A  1 272 ? -4.542  -38.461 36.352  1.00 61.05  ? 272  PHE A C   1 
ATOM   2101  O O   . PHE A  1 272 ? -5.439  -38.096 37.138  1.00 60.02  ? 272  PHE A O   1 
ATOM   2102  C CB  . PHE A  1 272 ? -4.688  -37.751 33.935  1.00 60.02  ? 272  PHE A CB  1 
ATOM   2103  C CG  . PHE A  1 272 ? -4.292  -38.145 32.533  1.00 60.81  ? 272  PHE A CG  1 
ATOM   2104  C CD1 . PHE A  1 272 ? -5.197  -38.773 31.688  1.00 63.78  ? 272  PHE A CD1 1 
ATOM   2105  C CD2 . PHE A  1 272 ? -3.038  -37.828 32.034  1.00 62.28  ? 272  PHE A CD2 1 
ATOM   2106  C CE1 . PHE A  1 272 ? -4.836  -39.125 30.387  1.00 64.76  ? 272  PHE A CE1 1 
ATOM   2107  C CE2 . PHE A  1 272 ? -2.681  -38.167 30.729  1.00 65.18  ? 272  PHE A CE2 1 
ATOM   2108  C CZ  . PHE A  1 272 ? -3.581  -38.820 29.916  1.00 63.75  ? 272  PHE A CZ  1 
ATOM   2109  N N   . VAL A  1 273 ? -3.208  -38.462 36.667  1.00 54.67  ? 273  VAL A N   1 
ATOM   2110  C CA  . VAL A  1 273 ? -2.717  -38.037 37.974  1.00 53.25  ? 273  VAL A CA  1 
ATOM   2111  C C   . VAL A  1 273 ? -2.190  -36.634 37.891  1.00 56.71  ? 273  VAL A C   1 
ATOM   2112  O O   . VAL A  1 273 ? -1.777  -36.216 36.821  1.00 55.24  ? 273  VAL A O   1 
ATOM   2113  C CB  . VAL A  1 273 ? -1.805  -39.055 38.735  1.00 56.93  ? 273  VAL A CB  1 
ATOM   2114  C CG1 . VAL A  1 273 ? -2.142  -40.480 38.363  1.00 57.06  ? 273  VAL A CG1 1 
ATOM   2115  C CG2 . VAL A  1 273 ? -0.337  -38.805 38.514  1.00 56.64  ? 273  VAL A CG2 1 
ATOM   2116  N N   . VAL A  1 274 ? -2.274  -35.881 38.990  1.00 56.05  ? 274  VAL A N   1 
ATOM   2117  C CA  . VAL A  1 274 ? -1.844  -34.479 39.088  1.00 56.29  ? 274  VAL A CA  1 
ATOM   2118  C C   . VAL A  1 274 ? -0.531  -34.447 39.862  1.00 71.21  ? 274  VAL A C   1 
ATOM   2119  O O   . VAL A  1 274 ? -0.471  -34.936 40.995  1.00 74.75  ? 274  VAL A O   1 
ATOM   2120  C CB  . VAL A  1 274 ? -2.929  -33.544 39.736  1.00 56.25  ? 274  VAL A CB  1 
ATOM   2121  C CG1 . VAL A  1 274 ? -2.535  -32.090 39.608  1.00 55.43  ? 274  VAL A CG1 1 
ATOM   2122  C CG2 . VAL A  1 274 ? -4.306  -33.760 39.125  1.00 54.26  ? 274  VAL A CG2 1 
ATOM   2123  N N   . ASP A  1 275 ? 0.530   -33.929 39.224  1.00 71.84  ? 275  ASP A N   1 
ATOM   2124  C CA  . ASP A  1 275 ? 1.885   -33.748 39.789  1.00 73.11  ? 275  ASP A CA  1 
ATOM   2125  C C   . ASP A  1 275 ? 2.284   -32.350 39.344  1.00 76.82  ? 275  ASP A C   1 
ATOM   2126  O O   . ASP A  1 275 ? 2.219   -32.051 38.143  1.00 76.96  ? 275  ASP A O   1 
ATOM   2127  C CB  . ASP A  1 275 ? 2.875   -34.821 39.266  1.00 75.69  ? 275  ASP A CB  1 
ATOM   2128  C CG  . ASP A  1 275 ? 4.089   -35.074 40.160  1.00 92.56  ? 275  ASP A CG  1 
ATOM   2129  O OD1 . ASP A  1 275 ? 4.036   -34.697 41.369  1.00 95.50  ? 275  ASP A OD1 1 
ATOM   2130  O OD2 . ASP A  1 275 ? 5.084   -35.689 39.664  1.00 97.35  ? 275  ASP A OD2 1 
ATOM   2131  N N   . SER A  1 276 ? 2.629   -31.474 40.306  1.00 72.60  ? 276  SER A N   1 
ATOM   2132  C CA  . SER A  1 276 ? 2.906   -30.040 40.085  1.00 71.37  ? 276  SER A CA  1 
ATOM   2133  C C   . SER A  1 276 ? 1.612   -29.409 39.632  1.00 74.09  ? 276  SER A C   1 
ATOM   2134  O O   . SER A  1 276 ? 0.562   -29.602 40.272  1.00 74.30  ? 276  SER A O   1 
ATOM   2135  C CB  . SER A  1 276 ? 4.015   -29.798 39.058  1.00 73.87  ? 276  SER A CB  1 
ATOM   2136  O OG  . SER A  1 276 ? 5.252   -30.286 39.551  1.00 85.43  ? 276  SER A OG  1 
ATOM   2137  N N   . SER A  1 277 ? 1.663   -28.693 38.518  1.00 69.79  ? 277  SER A N   1 
ATOM   2138  C CA  . SER A  1 277 ? 0.462   -28.079 37.936  1.00 69.58  ? 277  SER A CA  1 
ATOM   2139  C C   . SER A  1 277 ? 0.279   -28.734 36.547  1.00 69.29  ? 277  SER A C   1 
ATOM   2140  O O   . SER A  1 277 ? 0.048   -28.031 35.558  1.00 69.08  ? 277  SER A O   1 
ATOM   2141  C CB  . SER A  1 277 ? 0.659   -26.566 37.826  1.00 75.20  ? 277  SER A CB  1 
ATOM   2142  O OG  . SER A  1 277 ? 1.285   -26.035 38.988  1.00 87.05  ? 277  SER A OG  1 
ATOM   2143  N N   . SER A  1 278 ? 0.455   -30.087 36.494  1.00 61.37  ? 278  SER A N   1 
ATOM   2144  C CA  . SER A  1 278 ? 0.505   -30.903 35.287  1.00 59.65  ? 278  SER A CA  1 
ATOM   2145  C C   . SER A  1 278 ? -0.257  -32.236 35.391  1.00 65.29  ? 278  SER A C   1 
ATOM   2146  O O   . SER A  1 278 ? -0.272  -32.860 36.455  1.00 66.00  ? 278  SER A O   1 
ATOM   2147  C CB  . SER A  1 278 ? 1.958   -31.196 34.932  1.00 61.78  ? 278  SER A CB  1 
ATOM   2148  O OG  . SER A  1 278 ? 2.809   -30.066 35.055  1.00 68.14  ? 278  SER A OG  1 
ATOM   2149  N N   . CYS A  1 279 ? -0.885  -32.659 34.261  1.00 61.17  ? 279  CYS A N   1 
ATOM   2150  C CA  . CYS A  1 279 ? -1.656  -33.875 34.085  1.00 61.91  ? 279  CYS A CA  1 
ATOM   2151  C C   . CYS A  1 279 ? -0.737  -34.932 33.521  1.00 64.19  ? 279  CYS A C   1 
ATOM   2152  O O   . CYS A  1 279 ? -0.459  -34.965 32.318  1.00 64.02  ? 279  CYS A O   1 
ATOM   2153  C CB  . CYS A  1 279 ? -2.829  -33.625 33.155  1.00 64.13  ? 279  CYS A CB  1 
ATOM   2154  S SG  . CYS A  1 279 ? -3.829  -32.189 33.595  1.00 70.28  ? 279  CYS A SG  1 
ATOM   2155  N N   . VAL A  1 280 ? -0.236  -35.781 34.396  1.00 59.23  ? 280  VAL A N   1 
ATOM   2156  C CA  . VAL A  1 280 ? 0.683   -36.839 34.017  1.00 58.11  ? 280  VAL A CA  1 
ATOM   2157  C C   . VAL A  1 280 ? 0.019   -38.196 33.941  1.00 65.94  ? 280  VAL A C   1 
ATOM   2158  O O   . VAL A  1 280 ? -1.151  -38.350 34.339  1.00 67.41  ? 280  VAL A O   1 
ATOM   2159  C CB  . VAL A  1 280 ? 1.993   -36.829 34.816  1.00 59.88  ? 280  VAL A CB  1 
ATOM   2160  C CG1 . VAL A  1 280 ? 2.825   -35.624 34.439  1.00 59.08  ? 280  VAL A CG1 1 
ATOM   2161  C CG2 . VAL A  1 280 ? 1.738   -36.854 36.310  1.00 59.68  ? 280  VAL A CG2 1 
ATOM   2162  N N   . ARG A  1 281 ? 0.747   -39.162 33.380  1.00 61.92  ? 281  ARG A N   1 
ATOM   2163  C CA  . ARG A  1 281 ? 0.276   -40.516 33.185  1.00 62.43  ? 281  ARG A CA  1 
ATOM   2164  C C   . ARG A  1 281 ? 0.768   -41.426 34.295  1.00 70.30  ? 281  ARG A C   1 
ATOM   2165  O O   . ARG A  1 281 ? 0.114   -42.428 34.605  1.00 71.72  ? 281  ARG A O   1 
ATOM   2166  C CB  . ARG A  1 281 ? 0.807   -41.032 31.857  1.00 62.71  ? 281  ARG A CB  1 
ATOM   2167  C CG  . ARG A  1 281 ? 0.163   -40.412 30.661  1.00 66.34  ? 281  ARG A CG  1 
ATOM   2168  C CD  . ARG A  1 281 ? 0.744   -41.025 29.434  1.00 70.82  ? 281  ARG A CD  1 
ATOM   2169  N NE  . ARG A  1 281 ? -0.104  -40.748 28.284  1.00 80.58  ? 281  ARG A NE  1 
ATOM   2170  C CZ  . ARG A  1 281 ? 0.316   -40.782 27.025  1.00 90.06  ? 281  ARG A CZ  1 
ATOM   2171  N NH1 . ARG A  1 281 ? 1.588   -41.082 26.746  1.00 58.42  ? 281  ARG A NH1 1 
ATOM   2172  N NH2 . ARG A  1 281 ? -0.522  -40.497 26.033  1.00 77.19  ? 281  ARG A NH2 1 
ATOM   2173  N N   . ALA A  1 282 ? 1.943   -41.115 34.867  1.00 68.04  ? 282  ALA A N   1 
ATOM   2174  C CA  . ALA A  1 282 ? 2.516   -41.934 35.919  1.00 69.88  ? 282  ALA A CA  1 
ATOM   2175  C C   . ALA A  1 282 ? 3.203   -41.119 36.959  1.00 75.98  ? 282  ALA A C   1 
ATOM   2176  O O   . ALA A  1 282 ? 3.735   -40.059 36.643  1.00 74.33  ? 282  ALA A O   1 
ATOM   2177  C CB  . ALA A  1 282 ? 3.515   -42.882 35.317  1.00 72.01  ? 282  ALA A CB  1 
ATOM   2178  N N   . CYS A  1 283 ? 3.259   -41.638 38.189  1.00 76.84  ? 283  CYS A N   1 
ATOM   2179  C CA  . CYS A  1 283 ? 3.983   -40.983 39.254  1.00 79.68  ? 283  CYS A CA  1 
ATOM   2180  C C   . CYS A  1 283 ? 5.452   -41.281 39.126  1.00 84.14  ? 283  CYS A C   1 
ATOM   2181  O O   . CYS A  1 283 ? 5.808   -42.390 38.701  1.00 83.37  ? 283  CYS A O   1 
ATOM   2182  C CB  . CYS A  1 283 ? 3.470   -41.438 40.608  1.00 83.03  ? 283  CYS A CB  1 
ATOM   2183  S SG  . CYS A  1 283 ? 1.995   -40.570 41.151  1.00 87.91  ? 283  CYS A SG  1 
ATOM   2184  N N   . PRO A  1 284 ? 6.331   -40.352 39.564  1.00 82.22  ? 284  PRO A N   1 
ATOM   2185  C CA  . PRO A  1 284 ? 7.765   -40.671 39.579  1.00 84.50  ? 284  PRO A CA  1 
ATOM   2186  C C   . PRO A  1 284 ? 8.019   -41.837 40.541  1.00 92.36  ? 284  PRO A C   1 
ATOM   2187  O O   . PRO A  1 284 ? 7.304   -41.968 41.531  1.00 93.40  ? 284  PRO A O   1 
ATOM   2188  C CB  . PRO A  1 284 ? 8.402   -39.385 40.107  1.00 86.29  ? 284  PRO A CB  1 
ATOM   2189  C CG  . PRO A  1 284 ? 7.361   -38.300 39.888  1.00 88.29  ? 284  PRO A CG  1 
ATOM   2190  C CD  . PRO A  1 284 ? 6.075   -39.004 40.114  1.00 83.07  ? 284  PRO A CD  1 
ATOM   2191  N N   . SER A  1 285 ? 8.994   -42.705 40.231  1.00 90.94  ? 285  SER A N   1 
ATOM   2192  C CA  . SER A  1 285 ? 9.367   -43.892 41.024  1.00 93.47  ? 285  SER A CA  1 
ATOM   2193  C C   . SER A  1 285 ? 9.415   -43.646 42.548  1.00 96.78  ? 285  SER A C   1 
ATOM   2194  O O   . SER A  1 285 ? 9.063   -44.541 43.324  1.00 97.80  ? 285  SER A O   1 
ATOM   2195  C CB  . SER A  1 285 ? 10.724  -44.406 40.557  1.00 102.30 ? 285  SER A CB  1 
ATOM   2196  O OG  . SER A  1 285 ? 11.695  -43.371 40.631  1.00 119.39 ? 285  SER A OG  1 
ATOM   2197  N N   . SER A  1 286 ? 9.855   -42.418 42.944  1.00 90.38  ? 286  SER A N   1 
ATOM   2198  C CA  . SER A  1 286 ? 10.009  -41.874 44.297  1.00 88.96  ? 286  SER A CA  1 
ATOM   2199  C C   . SER A  1 286 ? 8.677   -41.505 44.991  1.00 86.88  ? 286  SER A C   1 
ATOM   2200  O O   . SER A  1 286 ? 8.622   -41.481 46.225  1.00 86.30  ? 286  SER A O   1 
ATOM   2201  C CB  . SER A  1 286 ? 10.916  -40.648 44.243  1.00 93.18  ? 286  SER A CB  1 
ATOM   2202  O OG  . SER A  1 286 ? 10.596  -39.808 43.139  1.00 100.46 ? 286  SER A OG  1 
ATOM   2203  N N   . LYS A  1 287 ? 7.624   -41.183 44.202  1.00 79.62  ? 287  LYS A N   1 
ATOM   2204  C CA  . LYS A  1 287 ? 6.292   -40.805 44.707  1.00 77.16  ? 287  LYS A CA  1 
ATOM   2205  C C   . LYS A  1 287 ? 5.254   -41.929 44.474  1.00 81.47  ? 287  LYS A C   1 
ATOM   2206  O O   . LYS A  1 287 ? 5.507   -42.879 43.720  1.00 79.90  ? 287  LYS A O   1 
ATOM   2207  C CB  . LYS A  1 287 ? 5.812   -39.488 44.074  1.00 75.71  ? 287  LYS A CB  1 
ATOM   2208  C CG  . LYS A  1 287 ? 6.767   -38.306 44.211  1.00 79.79  ? 287  LYS A CG  1 
ATOM   2209  C CD  . LYS A  1 287 ? 6.163   -37.030 43.597  1.00 85.84  ? 287  LYS A CD  1 
ATOM   2210  C CE  . LYS A  1 287 ? 7.110   -35.866 43.468  1.00 88.65  ? 287  LYS A CE  1 
ATOM   2211  N NZ  . LYS A  1 287 ? 6.401   -34.626 43.027  1.00 93.79  ? 287  LYS A NZ  1 
ATOM   2212  N N   . MET A  1 288 ? 4.084   -41.809 45.129  1.00 80.02  ? 288  MET A N   1 
ATOM   2213  C CA  . MET A  1 288 ? 2.983   -42.773 45.027  1.00 80.71  ? 288  MET A CA  1 
ATOM   2214  C C   . MET A  1 288 ? 1.638   -42.108 44.791  1.00 78.53  ? 288  MET A C   1 
ATOM   2215  O O   . MET A  1 288 ? 1.362   -41.052 45.357  1.00 76.93  ? 288  MET A O   1 
ATOM   2216  C CB  . MET A  1 288 ? 2.926   -43.678 46.269  1.00 86.40  ? 288  MET A CB  1 
ATOM   2217  C CG  . MET A  1 288 ? 2.615   -42.938 47.593  1.00 92.01  ? 288  MET A CG  1 
ATOM   2218  S SD  . MET A  1 288 ? 1.936   -44.006 48.913  1.00 98.58  ? 288  MET A SD  1 
ATOM   2219  C CE  . MET A  1 288 ? 0.685   -44.987 47.957  1.00 94.10  ? 288  MET A CE  1 
ATOM   2220  N N   . GLU A  1 289 ? 0.806   -42.734 43.953  1.00 72.33  ? 289  GLU A N   1 
ATOM   2221  C CA  . GLU A  1 289 ? -0.530  -42.265 43.570  1.00 69.08  ? 289  GLU A CA  1 
ATOM   2222  C C   . GLU A  1 289 ? -1.487  -42.348 44.760  1.00 71.08  ? 289  GLU A C   1 
ATOM   2223  O O   . GLU A  1 289 ? -1.552  -43.396 45.421  1.00 71.85  ? 289  GLU A O   1 
ATOM   2224  C CB  . GLU A  1 289 ? -1.036  -43.144 42.439  1.00 69.67  ? 289  GLU A CB  1 
ATOM   2225  C CG  . GLU A  1 289 ? -1.970  -42.460 41.477  1.00 76.29  ? 289  GLU A CG  1 
ATOM   2226  C CD  . GLU A  1 289 ? -2.283  -43.347 40.286  1.00 98.80  ? 289  GLU A CD  1 
ATOM   2227  O OE1 . GLU A  1 289 ? -1.339  -43.671 39.521  1.00 70.56  ? 289  GLU A OE1 1 
ATOM   2228  O OE2 . GLU A  1 289 ? -3.472  -43.713 40.117  1.00 98.31  ? 289  GLU A OE2 1 
ATOM   2229  N N   . VAL A  1 290 ? -2.171  -41.232 45.076  1.00 64.80  ? 290  VAL A N   1 
ATOM   2230  C CA  . VAL A  1 290 ? -3.122  -41.145 46.200  1.00 64.52  ? 290  VAL A CA  1 
ATOM   2231  C C   . VAL A  1 290 ? -4.376  -40.355 45.770  1.00 67.53  ? 290  VAL A C   1 
ATOM   2232  O O   . VAL A  1 290 ? -4.257  -39.430 44.968  1.00 65.54  ? 290  VAL A O   1 
ATOM   2233  C CB  . VAL A  1 290 ? -2.515  -40.600 47.530  1.00 68.93  ? 290  VAL A CB  1 
ATOM   2234  C CG1 . VAL A  1 290 ? -1.152  -41.196 47.850  1.00 69.66  ? 290  VAL A CG1 1 
ATOM   2235  C CG2 . VAL A  1 290 ? -2.426  -39.092 47.524  1.00 68.19  ? 290  VAL A CG2 1 
ATOM   2236  N N   . GLU A  1 291 ? -5.572  -40.725 46.274  1.00 65.62  ? 291  GLU A N   1 
ATOM   2237  C CA  . GLU A  1 291 ? -6.794  -40.006 45.905  1.00 65.01  ? 291  GLU A CA  1 
ATOM   2238  C C   . GLU A  1 291 ? -7.225  -39.070 47.005  1.00 72.31  ? 291  GLU A C   1 
ATOM   2239  O O   . GLU A  1 291 ? -7.305  -39.491 48.163  1.00 74.23  ? 291  GLU A O   1 
ATOM   2240  C CB  . GLU A  1 291 ? -7.934  -40.941 45.510  1.00 66.32  ? 291  GLU A CB  1 
ATOM   2241  C CG  . GLU A  1 291 ? -8.649  -40.487 44.250  1.00 79.21  ? 291  GLU A CG  1 
ATOM   2242  C CD  . GLU A  1 291 ? -9.853  -41.301 43.802  1.00 129.43 ? 291  GLU A CD  1 
ATOM   2243  O OE1 . GLU A  1 291 ? -9.902  -41.692 42.612  1.00 134.07 ? 291  GLU A OE1 1 
ATOM   2244  O OE2 . GLU A  1 291 ? -10.775 -41.503 44.626  1.00 141.89 ? 291  GLU A OE2 1 
ATOM   2245  N N   . GLU A  1 292 ? -7.460  -37.789 46.653  1.00 68.67  ? 292  GLU A N   1 
ATOM   2246  C CA  . GLU A  1 292 ? -7.902  -36.772 47.588  1.00 69.89  ? 292  GLU A CA  1 
ATOM   2247  C C   . GLU A  1 292 ? -9.079  -36.070 46.950  1.00 73.49  ? 292  GLU A C   1 
ATOM   2248  O O   . GLU A  1 292 ? -8.909  -35.313 45.995  1.00 73.08  ? 292  GLU A O   1 
ATOM   2249  C CB  . GLU A  1 292 ? -6.770  -35.798 47.912  1.00 72.25  ? 292  GLU A CB  1 
ATOM   2250  C CG  . GLU A  1 292 ? -5.815  -36.280 48.998  1.00 91.21  ? 292  GLU A CG  1 
ATOM   2251  C CD  . GLU A  1 292 ? -4.618  -35.388 49.320  1.00 122.30 ? 292  GLU A CD  1 
ATOM   2252  O OE1 . GLU A  1 292 ? -3.612  -35.935 49.830  1.00 124.28 ? 292  GLU A OE1 1 
ATOM   2253  O OE2 . GLU A  1 292 ? -4.689  -34.151 49.106  1.00 110.30 ? 292  GLU A OE2 1 
ATOM   2254  N N   . ASN A  1 293 ? -10.287 -36.380 47.439  1.00 70.53  ? 293  ASN A N   1 
ATOM   2255  C CA  . ASN A  1 293 ? -11.553 -35.844 46.935  1.00 69.73  ? 293  ASN A CA  1 
ATOM   2256  C C   . ASN A  1 293 ? -11.732 -36.142 45.443  1.00 73.96  ? 293  ASN A C   1 
ATOM   2257  O O   . ASN A  1 293 ? -12.043 -35.257 44.644  1.00 73.68  ? 293  ASN A O   1 
ATOM   2258  C CB  . ASN A  1 293 ? -11.746 -34.355 47.315  1.00 66.65  ? 293  ASN A CB  1 
ATOM   2259  C CG  . ASN A  1 293 ? -11.681 -34.067 48.813  1.00 81.58  ? 293  ASN A CG  1 
ATOM   2260  O OD1 . ASN A  1 293 ? -12.209 -34.811 49.663  1.00 84.64  ? 293  ASN A OD1 1 
ATOM   2261  N ND2 . ASN A  1 293 ? -11.065 -32.953 49.175  1.00 62.19  ? 293  ASN A ND2 1 
ATOM   2262  N N   . GLY A  1 294 ? -11.486 -37.403 45.091  1.00 71.53  ? 294  GLY A N   1 
ATOM   2263  C CA  . GLY A  1 294 ? -11.601 -37.926 43.729  1.00 71.16  ? 294  GLY A CA  1 
ATOM   2264  C C   . GLY A  1 294 ? -10.437 -37.636 42.794  1.00 75.09  ? 294  GLY A C   1 
ATOM   2265  O O   . GLY A  1 294 ? -10.404 -38.143 41.657  1.00 73.91  ? 294  GLY A O   1 
ATOM   2266  N N   . ILE A  1 295 ? -9.455  -36.836 43.284  1.00 71.29  ? 295  ILE A N   1 
ATOM   2267  C CA  . ILE A  1 295 ? -8.295  -36.403 42.509  1.00 69.43  ? 295  ILE A CA  1 
ATOM   2268  C C   . ILE A  1 295 ? -7.066  -37.219 42.793  1.00 73.19  ? 295  ILE A C   1 
ATOM   2269  O O   . ILE A  1 295 ? -6.602  -37.224 43.930  1.00 73.52  ? 295  ILE A O   1 
ATOM   2270  C CB  . ILE A  1 295 ? -8.083  -34.879 42.661  1.00 71.60  ? 295  ILE A CB  1 
ATOM   2271  C CG1 . ILE A  1 295 ? -9.350  -34.154 42.154  1.00 72.63  ? 295  ILE A CG1 1 
ATOM   2272  C CG2 . ILE A  1 295 ? -6.813  -34.413 41.935  1.00 68.82  ? 295  ILE A CG2 1 
ATOM   2273  C CD1 . ILE A  1 295 ? -9.314  -32.681 42.139  1.00 92.30  ? 295  ILE A CD1 1 
ATOM   2274  N N   . LYS A  1 296 ? -6.545  -37.912 41.753  1.00 69.53  ? 296  LYS A N   1 
ATOM   2275  C CA  . LYS A  1 296 ? -5.341  -38.736 41.838  1.00 70.43  ? 296  LYS A CA  1 
ATOM   2276  C C   . LYS A  1 296 ? -4.126  -37.804 41.887  1.00 75.43  ? 296  LYS A C   1 
ATOM   2277  O O   . LYS A  1 296 ? -4.064  -36.853 41.120  1.00 73.65  ? 296  LYS A O   1 
ATOM   2278  C CB  . LYS A  1 296 ? -5.273  -39.703 40.644  1.00 73.67  ? 296  LYS A CB  1 
ATOM   2279  C CG  . LYS A  1 296 ? -6.477  -40.645 40.568  1.00 96.83  ? 296  LYS A CG  1 
ATOM   2280  C CD  . LYS A  1 296 ? -6.462  -41.567 39.369  1.00 111.35 ? 296  LYS A CD  1 
ATOM   2281  C CE  . LYS A  1 296 ? -7.876  -41.967 39.009  1.00 128.55 ? 296  LYS A CE  1 
ATOM   2282  N NZ  . LYS A  1 296 ? -7.917  -43.016 37.947  1.00 140.73 ? 296  LYS A NZ  1 
ATOM   2283  N N   . MET A  1 297 ? -3.210  -38.015 42.833  1.00 76.17  ? 297  MET A N   1 
ATOM   2284  C CA  . MET A  1 297 ? -2.051  -37.129 43.003  1.00 78.28  ? 297  MET A CA  1 
ATOM   2285  C C   . MET A  1 297 ? -0.820  -37.877 43.357  1.00 83.79  ? 297  MET A C   1 
ATOM   2286  O O   . MET A  1 297 ? -0.914  -38.929 43.984  1.00 84.23  ? 297  MET A O   1 
ATOM   2287  C CB  . MET A  1 297 ? -2.285  -36.139 44.143  1.00 82.43  ? 297  MET A CB  1 
ATOM   2288  C CG  . MET A  1 297 ? -3.733  -35.754 44.350  1.00 88.16  ? 297  MET A CG  1 
ATOM   2289  S SD  . MET A  1 297 ? -3.894  -34.333 45.433  1.00 94.70  ? 297  MET A SD  1 
ATOM   2290  C CE  . MET A  1 297 ? -3.188  -32.994 44.305  1.00 90.09  ? 297  MET A CE  1 
ATOM   2291  N N   . CYS A  1 298 ? 0.346   -37.303 43.045  1.00 81.87  ? 298  CYS A N   1 
ATOM   2292  C CA  . CYS A  1 298 ? 1.609   -37.919 43.449  1.00 83.82  ? 298  CYS A CA  1 
ATOM   2293  C C   . CYS A  1 298 ? 2.039   -37.330 44.774  1.00 90.93  ? 298  CYS A C   1 
ATOM   2294  O O   . CYS A  1 298 ? 2.191   -36.116 44.887  1.00 90.96  ? 298  CYS A O   1 
ATOM   2295  C CB  . CYS A  1 298 ? 2.688   -37.755 42.387  1.00 83.77  ? 298  CYS A CB  1 
ATOM   2296  S SG  . CYS A  1 298 ? 2.311   -38.565 40.810  1.00 87.10  ? 298  CYS A SG  1 
ATOM   2297  N N   . LYS A  1 299 ? 2.176   -38.179 45.786  1.00 90.33  ? 299  LYS A N   1 
ATOM   2298  C CA  . LYS A  1 299 ? 2.594   -37.795 47.135  1.00 92.26  ? 299  LYS A CA  1 
ATOM   2299  C C   . LYS A  1 299 ? 3.776   -38.694 47.519  1.00 101.76 ? 299  LYS A C   1 
ATOM   2300  O O   . LYS A  1 299 ? 3.876   -39.798 46.969  1.00 101.57 ? 299  LYS A O   1 
ATOM   2301  C CB  . LYS A  1 299 ? 1.423   -37.931 48.132  1.00 94.53  ? 299  LYS A CB  1 
ATOM   2302  C CG  . LYS A  1 299 ? 0.306   -36.920 47.886  1.00 103.06 ? 299  LYS A CG  1 
ATOM   2303  C CD  . LYS A  1 299 ? 0.252   -35.812 48.907  1.00 114.00 ? 299  LYS A CD  1 
ATOM   2304  C CE  . LYS A  1 299 ? -0.706  -34.725 48.480  1.00 125.07 ? 299  LYS A CE  1 
ATOM   2305  N NZ  . LYS A  1 299 ? -0.826  -33.639 49.493  1.00 135.10 ? 299  LYS A NZ  1 
ATOM   2306  N N   . PRO A  1 300 ? 4.702   -38.264 48.414  1.00 102.38 ? 300  PRO A N   1 
ATOM   2307  C CA  . PRO A  1 300 ? 5.838   -39.141 48.770  1.00 105.25 ? 300  PRO A CA  1 
ATOM   2308  C C   . PRO A  1 300 ? 5.401   -40.447 49.419  1.00 117.67 ? 300  PRO A C   1 
ATOM   2309  O O   . PRO A  1 300 ? 4.357   -40.497 50.071  1.00 116.21 ? 300  PRO A O   1 
ATOM   2310  C CB  . PRO A  1 300 ? 6.652   -38.296 49.744  1.00 107.33 ? 300  PRO A CB  1 
ATOM   2311  C CG  . PRO A  1 300 ? 6.184   -36.900 49.533  1.00 109.63 ? 300  PRO A CG  1 
ATOM   2312  C CD  . PRO A  1 300 ? 4.758   -36.993 49.159  1.00 103.82 ? 300  PRO A CD  1 
ATOM   2313  N N   . CYS A  1 301 ? 6.190   -41.509 49.213  1.00 122.96 ? 301  CYS A N   1 
ATOM   2314  C CA  . CYS A  1 301 ? 5.906   -42.841 49.745  1.00 127.84 ? 301  CYS A CA  1 
ATOM   2315  C C   . CYS A  1 301 ? 6.017   -42.888 51.268  1.00 138.67 ? 301  CYS A C   1 
ATOM   2316  O O   . CYS A  1 301 ? 6.912   -42.254 51.833  1.00 139.42 ? 301  CYS A O   1 
ATOM   2317  C CB  . CYS A  1 301 ? 6.806   -43.881 49.086  1.00 130.10 ? 301  CYS A CB  1 
ATOM   2318  S SG  . CYS A  1 301 ? 6.648   -43.956 47.281  1.00 132.85 ? 301  CYS A SG  1 
ATOM   2319  N N   . THR A  1 302 ? 5.095   -43.638 51.927  1.00 139.45 ? 302  THR A N   1 
ATOM   2320  C CA  . THR A  1 302 ? 5.028   -43.845 53.389  1.00 142.53 ? 302  THR A CA  1 
ATOM   2321  C C   . THR A  1 302 ? 6.423   -44.243 53.886  1.00 149.16 ? 302  THR A C   1 
ATOM   2322  O O   . THR A  1 302 ? 7.013   -43.541 54.710  1.00 149.57 ? 302  THR A O   1 
ATOM   2323  C CB  . THR A  1 302 ? 3.950   -44.915 53.740  1.00 154.67 ? 302  THR A CB  1 
ATOM   2324  O OG1 . THR A  1 302 ? 2.700   -44.567 53.139  1.00 153.55 ? 302  THR A OG1 1 
ATOM   2325  C CG2 . THR A  1 302 ? 3.777   -45.119 55.247  1.00 155.20 ? 302  THR A CG2 1 
ATOM   2326  N N   . ASP A  1 303 ? 6.956   -45.334 53.317  1.00 146.95 ? 303  ASP A N   1 
ATOM   2327  C CA  . ASP A  1 303 ? 8.288   -45.864 53.568  1.00 149.04 ? 303  ASP A CA  1 
ATOM   2328  C C   . ASP A  1 303 ? 8.749   -46.510 52.260  1.00 150.95 ? 303  ASP A C   1 
ATOM   2329  O O   . ASP A  1 303 ? 9.711   -46.046 51.636  1.00 150.45 ? 303  ASP A O   1 
ATOM   2330  C CB  . ASP A  1 303 ? 8.273   -46.884 54.729  1.00 153.84 ? 303  ASP A CB  1 
ATOM   2331  C CG  . ASP A  1 303 ? 8.131   -46.261 56.109  1.00 165.95 ? 303  ASP A CG  1 
ATOM   2332  O OD1 . ASP A  1 303 ? 9.168   -45.880 56.700  1.00 166.60 ? 303  ASP A OD1 1 
ATOM   2333  O OD2 . ASP A  1 303 ? 6.985   -46.169 56.604  1.00 173.54 ? 303  ASP A OD2 1 
ATOM   2334  N N   . ILE A  1 304 ? 8.006   -47.540 51.818  1.00 145.44 ? 304  ILE A N   1 
ATOM   2335  C CA  . ILE A  1 304 ? 8.281   -48.288 50.597  1.00 143.70 ? 304  ILE A CA  1 
ATOM   2336  C C   . ILE A  1 304 ? 7.150   -48.071 49.576  1.00 142.99 ? 304  ILE A C   1 
ATOM   2337  O O   . ILE A  1 304 ? 5.965   -48.228 49.899  1.00 142.30 ? 304  ILE A O   1 
ATOM   2338  C CB  . ILE A  1 304 ? 8.607   -49.786 50.914  1.00 148.72 ? 304  ILE A CB  1 
ATOM   2339  C CG1 . ILE A  1 304 ? 9.931   -49.907 51.717  1.00 151.25 ? 304  ILE A CG1 1 
ATOM   2340  C CG2 . ILE A  1 304 ? 8.668   -50.660 49.654  1.00 148.68 ? 304  ILE A CG2 1 
ATOM   2341  C CD1 . ILE A  1 304 ? 9.782   -50.094 53.230  1.00 159.20 ? 304  ILE A CD1 1 
ATOM   2342  N N   . CYS A  1 305 ? 7.544   -47.670 48.351  1.00 135.59 ? 305  CYS A N   1 
ATOM   2343  C CA  . CYS A  1 305 ? 6.666   -47.398 47.215  1.00 131.78 ? 305  CYS A CA  1 
ATOM   2344  C C   . CYS A  1 305 ? 6.042   -48.669 46.686  1.00 132.28 ? 305  CYS A C   1 
ATOM   2345  O O   . CYS A  1 305 ? 6.743   -49.682 46.582  1.00 133.53 ? 305  CYS A O   1 
ATOM   2346  C CB  . CYS A  1 305 ? 7.427   -46.670 46.113  1.00 131.03 ? 305  CYS A CB  1 
ATOM   2347  S SG  . CYS A  1 305 ? 8.201   -45.125 46.648  1.00 134.74 ? 305  CYS A SG  1 
ATOM   2348  N N   . PRO A  1 306 ? 4.760   -48.625 46.252  1.00 124.47 ? 306  PRO A N   1 
ATOM   2349  C CA  . PRO A  1 306 ? 4.129   -49.838 45.691  1.00 123.51 ? 306  PRO A CA  1 
ATOM   2350  C C   . PRO A  1 306 ? 4.843   -50.379 44.446  1.00 123.75 ? 306  PRO A C   1 
ATOM   2351  O O   . PRO A  1 306 ? 5.581   -49.630 43.792  1.00 121.34 ? 306  PRO A O   1 
ATOM   2352  C CB  . PRO A  1 306 ? 2.693   -49.389 45.404  1.00 123.37 ? 306  PRO A CB  1 
ATOM   2353  C CG  . PRO A  1 306 ? 2.486   -48.215 46.314  1.00 127.39 ? 306  PRO A CG  1 
ATOM   2354  C CD  . PRO A  1 306 ? 3.799   -47.508 46.299  1.00 123.44 ? 306  PRO A CD  1 
ATOM   2355  N N   . LYS A  1 307 ? 4.669   -51.689 44.149  1.00 119.54 ? 307  LYS A N   1 
ATOM   2356  C CA  . LYS A  1 307 ? 5.328   -52.318 43.000  1.00 118.62 ? 307  LYS A CA  1 
ATOM   2357  C C   . LYS A  1 307 ? 4.657   -51.951 41.680  1.00 117.62 ? 307  LYS A C   1 
ATOM   2358  O O   . LYS A  1 307 ? 3.776   -52.682 41.203  1.00 117.69 ? 307  LYS A O   1 
ATOM   2359  C CB  . LYS A  1 307 ? 5.524   -53.854 43.183  1.00 123.04 ? 307  LYS A CB  1 
ATOM   2360  C CG  . LYS A  1 307 ? 6.347   -54.550 42.071  1.00 129.83 ? 307  LYS A CG  1 
ATOM   2361  C CD  . LYS A  1 307 ? 7.867   -54.423 42.229  1.00 130.94 ? 307  LYS A CD  1 
ATOM   2362  C CE  . LYS A  1 307 ? 8.628   -54.876 41.000  1.00 131.66 ? 307  LYS A CE  1 
ATOM   2363  N NZ  . LYS A  1 307 ? 8.633   -56.356 40.837  1.00 137.52 ? 307  LYS A NZ  1 
ATOM   2364  N N   . ALA A  1 308 ? 5.074   -50.795 41.103  1.00 109.83 ? 308  ALA A N   1 
ATOM   2365  C CA  . ALA A  1 308 ? 4.596   -50.282 39.813  1.00 106.72 ? 308  ALA A CA  1 
ATOM   2366  C C   . ALA A  1 308 ? 5.631   -50.634 38.761  1.00 109.66 ? 308  ALA A C   1 
ATOM   2367  O O   . ALA A  1 308 ? 6.821   -50.438 38.978  1.00 110.81 ? 308  ALA A O   1 
ATOM   2368  C CB  . ALA A  1 308 ? 4.376   -48.784 39.870  1.00 105.54 ? 308  ALA A CB  1 
ATOM   2369  N N   . CYS A  1 309 ? 5.193   -51.214 37.651  1.00 104.61 ? 309  CYS A N   1 
ATOM   2370  C CA  . CYS A  1 309 ? 6.101   -51.704 36.630  1.00 105.03 ? 309  CYS A CA  1 
ATOM   2371  C C   . CYS A  1 309 ? 5.930   -51.059 35.322  1.00 104.27 ? 309  CYS A C   1 
ATOM   2372  O O   . CYS A  1 309 ? 4.816   -50.708 34.945  1.00 102.89 ? 309  CYS A O   1 
ATOM   2373  C CB  . CYS A  1 309 ? 5.992   -53.217 36.518  1.00 108.14 ? 309  CYS A CB  1 
ATOM   2374  S SG  . CYS A  1 309 ? 6.150   -54.060 38.108  1.00 115.01 ? 309  CYS A SG  1 
ATOM   2375  N N   . ASP A  1 310 ? 7.038   -50.937 34.595  1.00 98.69  ? 310  ASP A N   1 
ATOM   2376  C CA  . ASP A  1 310 ? 7.030   -50.368 33.263  1.00 96.09  ? 310  ASP A CA  1 
ATOM   2377  C C   . ASP A  1 310 ? 6.217   -51.271 32.342  1.00 96.26  ? 310  ASP A C   1 
ATOM   2378  O O   . ASP A  1 310 ? 6.376   -52.497 32.362  1.00 99.29  ? 310  ASP A O   1 
ATOM   2379  C CB  . ASP A  1 310 ? 8.467   -50.196 32.736  1.00 99.04  ? 310  ASP A CB  1 
ATOM   2380  C CG  . ASP A  1 310 ? 9.218   -48.997 33.275  1.00 110.69 ? 310  ASP A CG  1 
ATOM   2381  O OD1 . ASP A  1 310 ? 8.552   -48.026 33.731  1.00 110.10 ? 310  ASP A OD1 1 
ATOM   2382  O OD2 . ASP A  1 310 ? 10.466  -49.010 33.215  1.00 117.57 ? 310  ASP A OD2 1 
ATOM   2383  N N   . GLY A  1 311 ? 5.297   -50.660 31.616  1.00 86.07  ? 311  GLY A N   1 
ATOM   2384  C CA  . GLY A  1 311 ? 4.463   -51.363 30.665  1.00 84.04  ? 311  GLY A CA  1 
ATOM   2385  C C   . GLY A  1 311 ? 5.150   -51.433 29.330  1.00 85.71  ? 311  GLY A C   1 
ATOM   2386  O O   . GLY A  1 311 ? 6.246   -50.894 29.162  1.00 84.85  ? 311  GLY A O   1 
ATOM   2387  N N   . ILE A  1 312 ? 4.513   -52.095 28.370  1.00 82.07  ? 312  ILE A N   1 
ATOM   2388  C CA  . ILE A  1 312 ? 5.052   -52.231 27.021  1.00 81.75  ? 312  ILE A CA  1 
ATOM   2389  C C   . ILE A  1 312 ? 5.027   -50.840 26.340  1.00 87.44  ? 312  ILE A C   1 
ATOM   2390  O O   . ILE A  1 312 ? 3.949   -50.231 26.180  1.00 86.37  ? 312  ILE A O   1 
ATOM   2391  C CB  . ILE A  1 312 ? 4.317   -53.351 26.232  1.00 83.96  ? 312  ILE A CB  1 
ATOM   2392  C CG1 . ILE A  1 312 ? 4.279   -54.704 26.989  1.00 84.83  ? 312  ILE A CG1 1 
ATOM   2393  C CG2 . ILE A  1 312 ? 4.857   -53.503 24.833  1.00 84.69  ? 312  ILE A CG2 1 
ATOM   2394  C CD1 . ILE A  1 312 ? 5.623   -55.307 27.439  1.00 89.21  ? 312  ILE A CD1 1 
ATOM   2395  N N   . GLY A  1 313 ? 6.238   -50.338 26.056  1.00 84.73  ? 313  GLY A N   1 
ATOM   2396  C CA  . GLY A  1 313 ? 6.499   -49.042 25.433  1.00 83.55  ? 313  GLY A CA  1 
ATOM   2397  C C   . GLY A  1 313 ? 6.796   -47.914 26.410  1.00 86.91  ? 313  GLY A C   1 
ATOM   2398  O O   . GLY A  1 313 ? 6.741   -46.737 26.030  1.00 85.25  ? 313  GLY A O   1 
ATOM   2399  N N   . THR A  1 314 ? 7.138   -48.267 27.670  1.00 85.01  ? 314  THR A N   1 
ATOM   2400  C CA  . THR A  1 314 ? 7.447   -47.322 28.757  1.00 85.24  ? 314  THR A CA  1 
ATOM   2401  C C   . THR A  1 314 ? 8.789   -47.662 29.455  1.00 91.70  ? 314  THR A C   1 
ATOM   2402  O O   . THR A  1 314 ? 9.040   -48.837 29.746  1.00 93.00  ? 314  THR A O   1 
ATOM   2403  C CB  . THR A  1 314 ? 6.252   -47.277 29.735  1.00 92.98  ? 314  THR A CB  1 
ATOM   2404  O OG1 . THR A  1 314 ? 5.195   -46.520 29.126  1.00 97.55  ? 314  THR A OG1 1 
ATOM   2405  C CG2 . THR A  1 314 ? 6.603   -46.689 31.102  1.00 85.81  ? 314  THR A CG2 1 
ATOM   2406  N N   . GLY A  1 315 ? 9.602   -46.625 29.719  1.00 87.22  ? 315  GLY A N   1 
ATOM   2407  C CA  . GLY A  1 315 ? 10.878  -46.710 30.420  1.00 88.38  ? 315  GLY A CA  1 
ATOM   2408  C C   . GLY A  1 315 ? 11.776  -47.843 29.976  1.00 94.31  ? 315  GLY A C   1 
ATOM   2409  O O   . GLY A  1 315 ? 12.224  -47.856 28.828  1.00 95.38  ? 315  GLY A O   1 
ATOM   2410  N N   . SER A  1 316 ? 12.010  -48.828 30.872  1.00 90.20  ? 316  SER A N   1 
ATOM   2411  C CA  . SER A  1 316 ? 12.835  -50.012 30.595  1.00 91.07  ? 316  SER A CA  1 
ATOM   2412  C C   . SER A  1 316 ? 12.326  -50.841 29.401  1.00 95.16  ? 316  SER A C   1 
ATOM   2413  O O   . SER A  1 316 ? 13.082  -51.610 28.814  1.00 97.02  ? 316  SER A O   1 
ATOM   2414  C CB  . SER A  1 316 ? 12.941  -50.894 31.836  1.00 94.34  ? 316  SER A CB  1 
ATOM   2415  O OG  . SER A  1 316 ? 11.668  -51.147 32.409  1.00 98.57  ? 316  SER A OG  1 
ATOM   2416  N N   . LEU A  1 317 ? 11.047  -50.689 29.051  1.00 90.21  ? 317  LEU A N   1 
ATOM   2417  C CA  . LEU A  1 317 ? 10.437  -51.429 27.963  1.00 89.74  ? 317  LEU A CA  1 
ATOM   2418  C C   . LEU A  1 317 ? 9.950   -50.527 26.836  1.00 95.17  ? 317  LEU A C   1 
ATOM   2419  O O   . LEU A  1 317 ? 9.110   -50.945 26.051  1.00 94.45  ? 317  LEU A O   1 
ATOM   2420  C CB  . LEU A  1 317 ? 9.326   -52.334 28.505  1.00 88.84  ? 317  LEU A CB  1 
ATOM   2421  C CG  . LEU A  1 317 ? 9.798   -53.422 29.458  1.00 94.33  ? 317  LEU A CG  1 
ATOM   2422  C CD1 . LEU A  1 317 ? 8.698   -53.861 30.353  1.00 93.39  ? 317  LEU A CD1 1 
ATOM   2423  C CD2 . LEU A  1 317 ? 10.387  -54.599 28.714  1.00 98.97  ? 317  LEU A CD2 1 
ATOM   2424  N N   . MET A  1 318 ? 10.531  -49.319 26.714  1.00 93.97  ? 318  MET A N   1 
ATOM   2425  C CA  . MET A  1 318 ? 10.244  -48.328 25.673  1.00 94.20  ? 318  MET A CA  1 
ATOM   2426  C C   . MET A  1 318 ? 10.261  -48.952 24.278  1.00 96.79  ? 318  MET A C   1 
ATOM   2427  O O   . MET A  1 318 ? 9.358   -48.698 23.479  1.00 94.48  ? 318  MET A O   1 
ATOM   2428  C CB  . MET A  1 318 ? 11.298  -47.217 25.725  1.00 98.16  ? 318  MET A CB  1 
ATOM   2429  C CG  . MET A  1 318 ? 10.922  -46.006 24.929  1.00 103.16 ? 318  MET A CG  1 
ATOM   2430  S SD  . MET A  1 318 ? 10.410  -44.667 26.020  1.00 108.64 ? 318  MET A SD  1 
ATOM   2431  C CE  . MET A  1 318 ? 12.081  -44.187 26.719  1.00 106.81 ? 318  MET A CE  1 
ATOM   2432  N N   . SER A  1 319 ? 11.324  -49.743 23.998  1.00 94.83  ? 319  SER A N   1 
ATOM   2433  C CA  . SER A  1 319 ? 11.590  -50.462 22.752  1.00 95.25  ? 319  SER A CA  1 
ATOM   2434  C C   . SER A  1 319 ? 10.512  -51.506 22.407  1.00 96.40  ? 319  SER A C   1 
ATOM   2435  O O   . SER A  1 319 ? 10.189  -51.671 21.224  1.00 97.01  ? 319  SER A O   1 
ATOM   2436  C CB  . SER A  1 319 ? 12.944  -51.156 22.835  1.00 102.15 ? 319  SER A CB  1 
ATOM   2437  O OG  . SER A  1 319 ? 12.953  -52.177 23.823  1.00 114.66 ? 319  SER A OG  1 
ATOM   2438  N N   . ALA A  1 320 ? 9.989   -52.229 23.433  1.00 89.41  ? 320  ALA A N   1 
ATOM   2439  C CA  . ALA A  1 320 ? 8.988   -53.291 23.291  1.00 87.82  ? 320  ALA A CA  1 
ATOM   2440  C C   . ALA A  1 320 ? 7.666   -52.920 22.574  1.00 87.61  ? 320  ALA A C   1 
ATOM   2441  O O   . ALA A  1 320 ? 7.151   -51.784 22.662  1.00 84.41  ? 320  ALA A O   1 
ATOM   2442  C CB  . ALA A  1 320 ? 8.711   -53.952 24.631  1.00 88.52  ? 320  ALA A CB  1 
ATOM   2443  N N   . GLN A  1 321 ? 7.151   -53.907 21.831  1.00 82.15  ? 321  GLN A N   1 
ATOM   2444  C CA  . GLN A  1 321 ? 5.898   -53.805 21.109  1.00 79.44  ? 321  GLN A CA  1 
ATOM   2445  C C   . GLN A  1 321 ? 4.902   -54.828 21.685  1.00 82.57  ? 321  GLN A C   1 
ATOM   2446  O O   . GLN A  1 321 ? 3.694   -54.635 21.572  1.00 80.82  ? 321  GLN A O   1 
ATOM   2447  C CB  . GLN A  1 321 ? 6.116   -54.011 19.603  1.00 81.06  ? 321  GLN A CB  1 
ATOM   2448  C CG  . GLN A  1 321 ? 6.946   -52.912 18.923  1.00 81.64  ? 321  GLN A CG  1 
ATOM   2449  C CD  . GLN A  1 321 ? 6.633   -52.801 17.443  1.00 104.39 ? 321  GLN A CD  1 
ATOM   2450  O OE1 . GLN A  1 321 ? 5.470   -52.674 17.029  1.00 105.19 ? 321  GLN A OE1 1 
ATOM   2451  N NE2 . GLN A  1 321 ? 7.658   -52.851 16.609  1.00 95.34  ? 321  GLN A NE2 1 
ATOM   2452  N N   . THR A  1 322 ? 5.421   -55.868 22.375  1.00 79.77  ? 322  THR A N   1 
ATOM   2453  C CA  . THR A  1 322 ? 4.650   -56.957 22.974  1.00 79.70  ? 322  THR A CA  1 
ATOM   2454  C C   . THR A  1 322 ? 5.352   -57.609 24.174  1.00 85.56  ? 322  THR A C   1 
ATOM   2455  O O   . THR A  1 322 ? 6.583   -57.522 24.318  1.00 85.80  ? 322  THR A O   1 
ATOM   2456  C CB  . THR A  1 322 ? 4.373   -58.066 21.904  1.00 82.41  ? 322  THR A CB  1 
ATOM   2457  O OG1 . THR A  1 322 ? 3.510   -59.067 22.447  1.00 82.13  ? 322  THR A OG1 1 
ATOM   2458  C CG2 . THR A  1 322 ? 5.643   -58.733 21.363  1.00 75.68  ? 322  THR A CG2 1 
ATOM   2459  N N   . VAL A  1 323 ? 4.560   -58.331 24.993  1.00 81.87  ? 323  VAL A N   1 
ATOM   2460  C CA  . VAL A  1 323 ? 5.087   -59.143 26.079  1.00 82.76  ? 323  VAL A CA  1 
ATOM   2461  C C   . VAL A  1 323 ? 5.650   -60.353 25.341  1.00 89.64  ? 323  VAL A C   1 
ATOM   2462  O O   . VAL A  1 323 ? 5.034   -60.813 24.376  1.00 90.13  ? 323  VAL A O   1 
ATOM   2463  C CB  . VAL A  1 323 ? 3.997   -59.567 27.097  1.00 86.13  ? 323  VAL A CB  1 
ATOM   2464  C CG1 . VAL A  1 323 ? 4.520   -60.625 28.076  1.00 88.19  ? 323  VAL A CG1 1 
ATOM   2465  C CG2 . VAL A  1 323 ? 3.448   -58.362 27.851  1.00 83.68  ? 323  VAL A CG2 1 
ATOM   2466  N N   . ASP A  1 324 ? 6.833   -60.819 25.734  1.00 88.04  ? 324  ASP A N   1 
ATOM   2467  C CA  . ASP A  1 324 ? 7.474   -61.987 25.114  1.00 90.14  ? 324  ASP A CA  1 
ATOM   2468  C C   . ASP A  1 324 ? 8.332   -62.710 26.135  1.00 95.30  ? 324  ASP A C   1 
ATOM   2469  O O   . ASP A  1 324 ? 8.412   -62.264 27.282  1.00 93.61  ? 324  ASP A O   1 
ATOM   2470  C CB  . ASP A  1 324 ? 8.285   -61.600 23.847  1.00 91.97  ? 324  ASP A CB  1 
ATOM   2471  C CG  . ASP A  1 324 ? 9.284   -60.468 24.018  1.00 96.52  ? 324  ASP A CG  1 
ATOM   2472  O OD1 . ASP A  1 324 ? 10.060  -60.503 24.991  1.00 99.17  ? 324  ASP A OD1 1 
ATOM   2473  O OD2 . ASP A  1 324 ? 9.326   -59.580 23.145  1.00 95.82  ? 324  ASP A OD2 1 
ATOM   2474  N N   . SER A  1 325 ? 8.976   -63.812 25.725  1.00 95.19  ? 325  SER A N   1 
ATOM   2475  C CA  . SER A  1 325 ? 9.849   -64.600 26.602  1.00 98.38  ? 325  SER A CA  1 
ATOM   2476  C C   . SER A  1 325 ? 11.029  -63.787 27.168  1.00 103.29 ? 325  SER A C   1 
ATOM   2477  O O   . SER A  1 325 ? 11.472  -64.064 28.292  1.00 104.85 ? 325  SER A O   1 
ATOM   2478  C CB  . SER A  1 325 ? 10.345  -65.857 25.894  1.00 105.10 ? 325  SER A CB  1 
ATOM   2479  O OG  . SER A  1 325 ? 10.862  -65.534 24.613  1.00 114.53 ? 325  SER A OG  1 
ATOM   2480  N N   . SER A  1 326 ? 11.483  -62.747 26.420  1.00 97.15  ? 326  SER A N   1 
ATOM   2481  C CA  . SER A  1 326 ? 12.589  -61.873 26.812  1.00 96.16  ? 326  SER A CA  1 
ATOM   2482  C C   . SER A  1 326 ? 12.219  -60.860 27.898  1.00 97.93  ? 326  SER A C   1 
ATOM   2483  O O   . SER A  1 326 ? 13.119  -60.265 28.500  1.00 98.94  ? 326  SER A O   1 
ATOM   2484  C CB  . SER A  1 326 ? 13.167  -61.160 25.591  1.00 98.24  ? 326  SER A CB  1 
ATOM   2485  O OG  . SER A  1 326 ? 12.603  -59.875 25.380  1.00 102.48 ? 326  SER A OG  1 
ATOM   2486  N N   . ASN A  1 327 ? 10.910  -60.638 28.138  1.00 90.72  ? 327  ASN A N   1 
ATOM   2487  C CA  . ASN A  1 327 ? 10.466  -59.643 29.112  1.00 86.93  ? 327  ASN A CA  1 
ATOM   2488  C C   . ASN A  1 327 ? 9.371   -60.071 30.076  1.00 88.28  ? 327  ASN A C   1 
ATOM   2489  O O   . ASN A  1 327 ? 9.089   -59.323 31.009  1.00 86.35  ? 327  ASN A O   1 
ATOM   2490  C CB  . ASN A  1 327 ? 10.145  -58.307 28.432  1.00 81.50  ? 327  ASN A CB  1 
ATOM   2491  C CG  . ASN A  1 327 ? 9.043   -58.354 27.406  1.00 89.14  ? 327  ASN A CG  1 
ATOM   2492  O OD1 . ASN A  1 327 ? 7.997   -59.008 27.580  1.00 79.68  ? 327  ASN A OD1 1 
ATOM   2493  N ND2 . ASN A  1 327 ? 9.234   -57.596 26.336  1.00 76.50  ? 327  ASN A ND2 1 
ATOM   2494  N N   . ILE A  1 328 ? 8.767   -61.261 29.873  1.00 85.93  ? 328  ILE A N   1 
ATOM   2495  C CA  . ILE A  1 328 ? 7.727   -61.822 30.746  1.00 86.16  ? 328  ILE A CA  1 
ATOM   2496  C C   . ILE A  1 328 ? 8.170   -61.834 32.223  1.00 94.50  ? 328  ILE A C   1 
ATOM   2497  O O   . ILE A  1 328 ? 7.358   -61.583 33.117  1.00 92.87  ? 328  ILE A O   1 
ATOM   2498  C CB  . ILE A  1 328 ? 7.213   -63.209 30.238  1.00 90.40  ? 328  ILE A CB  1 
ATOM   2499  C CG1 . ILE A  1 328 ? 6.071   -63.798 31.095  1.00 89.91  ? 328  ILE A CG1 1 
ATOM   2500  C CG2 . ILE A  1 328 ? 8.332   -64.223 30.089  1.00 95.62  ? 328  ILE A CG2 1 
ATOM   2501  C CD1 . ILE A  1 328 ? 4.708   -63.323 30.769  1.00 84.39  ? 328  ILE A CD1 1 
ATOM   2502  N N   . ASP A  1 329 ? 9.467   -62.063 32.466  1.00 96.74  ? 329  ASP A N   1 
ATOM   2503  C CA  . ASP A  1 329 ? 10.025  -62.071 33.813  1.00 99.49  ? 329  ASP A CA  1 
ATOM   2504  C C   . ASP A  1 329 ? 10.212  -60.687 34.473  1.00 103.88 ? 329  ASP A C   1 
ATOM   2505  O O   . ASP A  1 329 ? 10.399  -60.614 35.686  1.00 105.21 ? 329  ASP A O   1 
ATOM   2506  C CB  . ASP A  1 329 ? 11.252  -62.981 33.908  1.00 105.24 ? 329  ASP A CB  1 
ATOM   2507  C CG  . ASP A  1 329 ? 10.893  -64.461 33.904  1.00 127.54 ? 329  ASP A CG  1 
ATOM   2508  O OD1 . ASP A  1 329 ? 9.686   -64.790 34.104  1.00 128.55 ? 329  ASP A OD1 1 
ATOM   2509  O OD2 . ASP A  1 329 ? 11.816  -65.296 33.734  1.00 139.13 ? 329  ASP A OD2 1 
ATOM   2510  N N   . LYS A  1 330 ? 10.069  -59.590 33.703  1.00 97.90  ? 330  LYS A N   1 
ATOM   2511  C CA  . LYS A  1 330 ? 10.154  -58.233 34.244  1.00 95.14  ? 330  LYS A CA  1 
ATOM   2512  C C   . LYS A  1 330 ? 8.847   -57.867 34.967  1.00 96.43  ? 330  LYS A C   1 
ATOM   2513  O O   . LYS A  1 330 ? 8.725   -56.765 35.518  1.00 94.51  ? 330  LYS A O   1 
ATOM   2514  C CB  . LYS A  1 330 ? 10.482  -57.224 33.133  1.00 96.01  ? 330  LYS A CB  1 
ATOM   2515  C CG  . LYS A  1 330 ? 11.950  -57.256 32.730  1.00 121.33 ? 330  LYS A CG  1 
ATOM   2516  C CD  . LYS A  1 330 ? 12.270  -56.377 31.516  1.00 134.21 ? 330  LYS A CD  1 
ATOM   2517  C CE  . LYS A  1 330 ? 13.467  -56.887 30.724  1.00 147.43 ? 330  LYS A CE  1 
ATOM   2518  N NZ  . LYS A  1 330 ? 14.754  -56.824 31.483  1.00 156.72 ? 330  LYS A NZ  1 
ATOM   2519  N N   . PHE A  1 331 ? 7.882   -58.805 34.981  1.00 93.04  ? 331  PHE A N   1 
ATOM   2520  C CA  . PHE A  1 331 ? 6.567   -58.618 35.589  1.00 91.86  ? 331  PHE A CA  1 
ATOM   2521  C C   . PHE A  1 331 ? 6.335   -59.403 36.893  1.00 100.69 ? 331  PHE A C   1 
ATOM   2522  O O   . PHE A  1 331 ? 5.206   -59.381 37.406  1.00 100.34 ? 331  PHE A O   1 
ATOM   2523  C CB  . PHE A  1 331 ? 5.428   -58.851 34.561  1.00 91.72  ? 331  PHE A CB  1 
ATOM   2524  C CG  . PHE A  1 331 ? 5.463   -57.913 33.380  1.00 90.40  ? 331  PHE A CG  1 
ATOM   2525  C CD1 . PHE A  1 331 ? 5.975   -58.330 32.153  1.00 92.96  ? 331  PHE A CD1 1 
ATOM   2526  C CD2 . PHE A  1 331 ? 5.027   -56.597 33.502  1.00 89.92  ? 331  PHE A CD2 1 
ATOM   2527  C CE1 . PHE A  1 331 ? 6.026   -57.452 31.062  1.00 92.11  ? 331  PHE A CE1 1 
ATOM   2528  C CE2 . PHE A  1 331 ? 5.087   -55.714 32.414  1.00 90.88  ? 331  PHE A CE2 1 
ATOM   2529  C CZ  . PHE A  1 331 ? 5.578   -56.149 31.199  1.00 89.47  ? 331  PHE A CZ  1 
ATOM   2530  N N   . ILE A  1 332 ? 7.387   -60.054 37.455  1.00 100.63 ? 332  ILE A N   1 
ATOM   2531  C CA  . ILE A  1 332 ? 7.235   -60.782 38.720  1.00 103.44 ? 332  ILE A CA  1 
ATOM   2532  C C   . ILE A  1 332 ? 6.874   -59.809 39.852  1.00 110.39 ? 332  ILE A C   1 
ATOM   2533  O O   . ILE A  1 332 ? 7.564   -58.798 40.059  1.00 109.19 ? 332  ILE A O   1 
ATOM   2534  C CB  . ILE A  1 332 ? 8.440   -61.682 39.146  1.00 109.30 ? 332  ILE A CB  1 
ATOM   2535  C CG1 . ILE A  1 332 ? 9.296   -62.253 37.979  1.00 110.48 ? 332  ILE A CG1 1 
ATOM   2536  C CG2 . ILE A  1 332 ? 8.017   -62.753 40.164  1.00 111.78 ? 332  ILE A CG2 1 
ATOM   2537  C CD1 . ILE A  1 332 ? 8.697   -63.306 37.054  1.00 114.89 ? 332  ILE A CD1 1 
ATOM   2538  N N   . ASN A  1 333 ? 5.764   -60.125 40.555  1.00 109.57 ? 333  ASN A N   1 
ATOM   2539  C CA  . ASN A  1 333 ? 5.218   -59.397 41.703  1.00 109.72 ? 333  ASN A CA  1 
ATOM   2540  C C   . ASN A  1 333 ? 4.656   -57.993 41.444  1.00 113.17 ? 333  ASN A C   1 
ATOM   2541  O O   . ASN A  1 333 ? 4.468   -57.244 42.401  1.00 112.05 ? 333  ASN A O   1 
ATOM   2542  C CB  . ASN A  1 333 ? 6.192   -59.413 42.891  1.00 113.06 ? 333  ASN A CB  1 
ATOM   2543  C CG  . ASN A  1 333 ? 6.487   -60.791 43.463  1.00 134.56 ? 333  ASN A CG  1 
ATOM   2544  O OD1 . ASN A  1 333 ? 5.745   -61.771 43.276  1.00 111.35 ? 333  ASN A OD1 1 
ATOM   2545  N ND2 . ASN A  1 333 ? 7.585   -60.890 44.206  1.00 141.02 ? 333  ASN A ND2 1 
ATOM   2546  N N   . CYS A  1 334 ? 4.325   -57.658 40.180  1.00 110.56 ? 334  CYS A N   1 
ATOM   2547  C CA  . CYS A  1 334 ? 3.746   -56.353 39.835  1.00 109.14 ? 334  CYS A CA  1 
ATOM   2548  C C   . CYS A  1 334 ? 2.316   -56.280 40.245  1.00 107.35 ? 334  CYS A C   1 
ATOM   2549  O O   . CYS A  1 334 ? 1.545   -57.186 39.934  1.00 107.09 ? 334  CYS A O   1 
ATOM   2550  C CB  . CYS A  1 334 ? 3.892   -56.048 38.350  1.00 110.46 ? 334  CYS A CB  1 
ATOM   2551  S SG  . CYS A  1 334 ? 5.604   -55.986 37.777  1.00 116.96 ? 334  CYS A SG  1 
ATOM   2552  N N   . THR A  1 335 ? 1.949   -55.188 40.916  1.00 99.11  ? 335  THR A N   1 
ATOM   2553  C CA  . THR A  1 335 ? 0.568   -54.944 41.332  1.00 95.68  ? 335  THR A CA  1 
ATOM   2554  C C   . THR A  1 335 ? -0.050  -53.882 40.433  1.00 93.13  ? 335  THR A C   1 
ATOM   2555  O O   . THR A  1 335 ? -1.269  -53.867 40.252  1.00 93.89  ? 335  THR A O   1 
ATOM   2556  C CB  . THR A  1 335 ? 0.496   -54.582 42.812  1.00 100.50 ? 335  THR A CB  1 
ATOM   2557  O OG1 . THR A  1 335 ? 1.508   -53.619 43.124  1.00 99.00  ? 335  THR A OG1 1 
ATOM   2558  C CG2 . THR A  1 335 ? 0.653   -55.786 43.695  1.00 103.39 ? 335  THR A CG2 1 
ATOM   2559  N N   . LYS A  1 336 ? 0.802   -53.007 39.852  1.00 83.22  ? 336  LYS A N   1 
ATOM   2560  C CA  . LYS A  1 336 ? 0.405   -51.923 38.962  1.00 79.36  ? 336  LYS A CA  1 
ATOM   2561  C C   . LYS A  1 336 ? 1.287   -51.937 37.742  1.00 79.08  ? 336  LYS A C   1 
ATOM   2562  O O   . LYS A  1 336 ? 2.478   -52.182 37.880  1.00 79.00  ? 336  LYS A O   1 
ATOM   2563  C CB  . LYS A  1 336 ? 0.566   -50.573 39.680  1.00 81.12  ? 336  LYS A CB  1 
ATOM   2564  C CG  . LYS A  1 336 ? -0.191  -49.390 39.035  1.00 80.06  ? 336  LYS A CG  1 
ATOM   2565  C CD  . LYS A  1 336 ? 0.082   -48.090 39.794  1.00 74.52  ? 336  LYS A CD  1 
ATOM   2566  C CE  . LYS A  1 336 ? -1.000  -47.057 39.663  1.00 74.60  ? 336  LYS A CE  1 
ATOM   2567  N NZ  . LYS A  1 336 ? -1.545  -46.612 40.986  1.00 72.97  ? 336  LYS A NZ  1 
ATOM   2568  N N   . ILE A  1 337 ? 0.717   -51.684 36.550  1.00 73.43  ? 337  ILE A N   1 
ATOM   2569  C CA  . ILE A  1 337 ? 1.493   -51.611 35.316  1.00 72.73  ? 337  ILE A CA  1 
ATOM   2570  C C   . ILE A  1 337 ? 1.455   -50.172 34.837  1.00 75.62  ? 337  ILE A C   1 
ATOM   2571  O O   . ILE A  1 337 ? 0.387   -49.697 34.442  1.00 74.42  ? 337  ILE A O   1 
ATOM   2572  C CB  . ILE A  1 337 ? 1.047   -52.626 34.206  1.00 75.61  ? 337  ILE A CB  1 
ATOM   2573  C CG1 . ILE A  1 337 ? 1.083   -54.101 34.661  1.00 77.35  ? 337  ILE A CG1 1 
ATOM   2574  C CG2 . ILE A  1 337 ? 1.820   -52.422 32.894  1.00 75.36  ? 337  ILE A CG2 1 
ATOM   2575  C CD1 . ILE A  1 337 ? 2.452   -54.661 35.126  1.00 88.95  ? 337  ILE A CD1 1 
ATOM   2576  N N   . ASN A  1 338 ? 2.604   -49.473 34.887  1.00 71.88  ? 338  ASN A N   1 
ATOM   2577  C CA  . ASN A  1 338 ? 2.670   -48.105 34.392  1.00 70.42  ? 338  ASN A CA  1 
ATOM   2578  C C   . ASN A  1 338 ? 2.839   -48.126 32.913  1.00 75.11  ? 338  ASN A C   1 
ATOM   2579  O O   . ASN A  1 338 ? 3.961   -48.156 32.398  1.00 78.09  ? 338  ASN A O   1 
ATOM   2580  C CB  . ASN A  1 338 ? 3.692   -47.232 35.115  1.00 70.11  ? 338  ASN A CB  1 
ATOM   2581  C CG  . ASN A  1 338 ? 2.968   -46.367 36.109  1.00 103.78 ? 338  ASN A CG  1 
ATOM   2582  O OD1 . ASN A  1 338 ? 1.941   -45.708 35.795  1.00 96.62  ? 338  ASN A OD1 1 
ATOM   2583  N ND2 . ASN A  1 338 ? 3.395   -46.468 37.359  1.00 99.78  ? 338  ASN A ND2 1 
ATOM   2584  N N   . GLY A  1 339 ? 1.719   -48.256 32.241  1.00 68.98  ? 339  GLY A N   1 
ATOM   2585  C CA  . GLY A  1 339 ? 1.717   -48.332 30.797  1.00 68.50  ? 339  GLY A CA  1 
ATOM   2586  C C   . GLY A  1 339 ? 0.747   -49.366 30.330  1.00 72.98  ? 339  GLY A C   1 
ATOM   2587  O O   . GLY A  1 339 ? -0.237  -49.650 31.009  1.00 73.23  ? 339  GLY A O   1 
ATOM   2588  N N   . ASN A  1 340 ? 1.062   -49.956 29.199  1.00 70.20  ? 340  ASN A N   1 
ATOM   2589  C CA  . ASN A  1 340 ? 0.223   -50.948 28.554  1.00 70.54  ? 340  ASN A CA  1 
ATOM   2590  C C   . ASN A  1 340 ? 0.702   -52.387 28.697  1.00 77.05  ? 340  ASN A C   1 
ATOM   2591  O O   . ASN A  1 340 ? 1.842   -52.632 29.065  1.00 78.71  ? 340  ASN A O   1 
ATOM   2592  C CB  . ASN A  1 340 ? 0.116   -50.607 27.062  1.00 69.11  ? 340  ASN A CB  1 
ATOM   2593  C CG  . ASN A  1 340 ? -0.112  -49.155 26.787  1.00 75.08  ? 340  ASN A CG  1 
ATOM   2594  O OD1 . ASN A  1 340 ? -0.738  -48.452 27.572  1.00 64.34  ? 340  ASN A OD1 1 
ATOM   2595  N ND2 . ASN A  1 340 ? 0.435   -48.666 25.691  1.00 62.72  ? 340  ASN A ND2 1 
ATOM   2596  N N   . LEU A  1 341 ? -0.187  -53.338 28.368  1.00 73.85  ? 341  LEU A N   1 
ATOM   2597  C CA  . LEU A  1 341 ? 0.083   -54.763 28.245  1.00 74.65  ? 341  LEU A CA  1 
ATOM   2598  C C   . LEU A  1 341 ? -0.455  -55.145 26.905  1.00 77.06  ? 341  LEU A C   1 
ATOM   2599  O O   . LEU A  1 341 ? -1.651  -54.979 26.620  1.00 74.79  ? 341  LEU A O   1 
ATOM   2600  C CB  . LEU A  1 341 ? -0.524  -55.625 29.340  1.00 75.51  ? 341  LEU A CB  1 
ATOM   2601  C CG  . LEU A  1 341 ? 0.271   -55.717 30.629  1.00 81.98  ? 341  LEU A CG  1 
ATOM   2602  C CD1 . LEU A  1 341 ? -0.418  -56.640 31.592  1.00 84.29  ? 341  LEU A CD1 1 
ATOM   2603  C CD2 . LEU A  1 341 ? 1.690   -56.211 30.387  1.00 85.70  ? 341  LEU A CD2 1 
ATOM   2604  N N   . ILE A  1 342 ? 0.465   -55.538 26.041  1.00 74.05  ? 342  ILE A N   1 
ATOM   2605  C CA  . ILE A  1 342 ? 0.163   -55.925 24.676  1.00 73.96  ? 342  ILE A CA  1 
ATOM   2606  C C   . ILE A  1 342 ? 0.700   -57.328 24.438  1.00 79.86  ? 342  ILE A C   1 
ATOM   2607  O O   . ILE A  1 342 ? 1.848   -57.626 24.792  1.00 81.50  ? 342  ILE A O   1 
ATOM   2608  C CB  . ILE A  1 342 ? 0.746   -54.893 23.671  1.00 75.93  ? 342  ILE A CB  1 
ATOM   2609  C CG1 . ILE A  1 342 ? 0.255   -53.463 23.976  1.00 73.60  ? 342  ILE A CG1 1 
ATOM   2610  C CG2 . ILE A  1 342 ? 0.452   -55.289 22.214  1.00 76.72  ? 342  ILE A CG2 1 
ATOM   2611  C CD1 . ILE A  1 342 ? 1.310   -52.460 23.988  1.00 74.99  ? 342  ILE A CD1 1 
ATOM   2612  N N   . PHE A  1 343 ? -0.139  -58.179 23.838  1.00 75.51  ? 343  PHE A N   1 
ATOM   2613  C CA  . PHE A  1 343 ? 0.194   -59.545 23.459  1.00 76.16  ? 343  PHE A CA  1 
ATOM   2614  C C   . PHE A  1 343 ? -0.045  -59.638 21.975  1.00 81.71  ? 343  PHE A C   1 
ATOM   2615  O O   . PHE A  1 343 ? -1.198  -59.602 21.533  1.00 80.39  ? 343  PHE A O   1 
ATOM   2616  C CB  . PHE A  1 343 ? -0.660  -60.549 24.235  1.00 77.60  ? 343  PHE A CB  1 
ATOM   2617  C CG  . PHE A  1 343 ? -0.498  -60.404 25.726  1.00 78.43  ? 343  PHE A CG  1 
ATOM   2618  C CD1 . PHE A  1 343 ? -1.341  -59.581 26.454  1.00 79.65  ? 343  PHE A CD1 1 
ATOM   2619  C CD2 . PHE A  1 343 ? 0.506   -61.088 26.406  1.00 81.81  ? 343  PHE A CD2 1 
ATOM   2620  C CE1 . PHE A  1 343 ? -1.185  -59.448 27.839  1.00 80.52  ? 343  PHE A CE1 1 
ATOM   2621  C CE2 . PHE A  1 343 ? 0.657   -60.960 27.791  1.00 83.62  ? 343  PHE A CE2 1 
ATOM   2622  C CZ  . PHE A  1 343 ? -0.188  -60.142 28.497  1.00 80.12  ? 343  PHE A CZ  1 
ATOM   2623  N N   . LEU A  1 344 ? 1.047   -59.610 21.201  1.00 80.74  ? 344  LEU A N   1 
ATOM   2624  C CA  . LEU A  1 344 ? 0.996   -59.703 19.743  1.00 82.60  ? 344  LEU A CA  1 
ATOM   2625  C C   . LEU A  1 344 ? 1.271   -61.137 19.320  1.00 93.05  ? 344  LEU A C   1 
ATOM   2626  O O   . LEU A  1 344 ? 1.738   -61.935 20.139  1.00 94.51  ? 344  LEU A O   1 
ATOM   2627  C CB  . LEU A  1 344 ? 2.021   -58.766 19.078  1.00 81.86  ? 344  LEU A CB  1 
ATOM   2628  C CG  . LEU A  1 344 ? 1.820   -57.267 19.235  1.00 83.35  ? 344  LEU A CG  1 
ATOM   2629  C CD1 . LEU A  1 344 ? 2.995   -56.529 18.648  1.00 83.35  ? 344  LEU A CD1 1 
ATOM   2630  C CD2 . LEU A  1 344 ? 0.533   -56.790 18.578  1.00 83.67  ? 344  LEU A CD2 1 
ATOM   2631  N N   . VAL A  1 345 ? 0.979   -61.474 18.049  1.00 91.97  ? 345  VAL A N   1 
ATOM   2632  C CA  . VAL A  1 345 ? 1.223   -62.819 17.517  1.00 94.43  ? 345  VAL A CA  1 
ATOM   2633  C C   . VAL A  1 345 ? 2.695   -63.240 17.763  1.00 98.58  ? 345  VAL A C   1 
ATOM   2634  O O   . VAL A  1 345 ? 2.946   -64.297 18.349  1.00 101.46 ? 345  VAL A O   1 
ATOM   2635  C CB  . VAL A  1 345 ? 0.774   -62.952 16.041  1.00 98.93  ? 345  VAL A CB  1 
ATOM   2636  C CG1 . VAL A  1 345 ? 0.995   -64.374 15.534  1.00 101.22 ? 345  VAL A CG1 1 
ATOM   2637  C CG2 . VAL A  1 345 ? -0.690  -62.538 15.874  1.00 97.13  ? 345  VAL A CG2 1 
ATOM   2638  N N   . THR A  1 346 ? 3.639   -62.353 17.425  1.00 91.17  ? 346  THR A N   1 
ATOM   2639  C CA  . THR A  1 346 ? 5.074   -62.544 17.610  1.00 91.18  ? 346  THR A CA  1 
ATOM   2640  C C   . THR A  1 346 ? 5.551   -62.586 19.067  1.00 93.81  ? 346  THR A C   1 
ATOM   2641  O O   . THR A  1 346 ? 6.703   -62.920 19.324  1.00 95.64  ? 346  THR A O   1 
ATOM   2642  C CB  . THR A  1 346 ? 5.844   -61.565 16.752  1.00 96.69  ? 346  THR A CB  1 
ATOM   2643  O OG1 . THR A  1 346 ? 5.003   -60.456 16.416  1.00 97.68  ? 346  THR A OG1 1 
ATOM   2644  C CG2 . THR A  1 346 ? 6.353   -62.210 15.497  1.00 94.84  ? 346  THR A CG2 1 
ATOM   2645  N N   . GLY A  1 347 ? 4.684   -62.239 20.004  1.00 87.86  ? 347  GLY A N   1 
ATOM   2646  C CA  . GLY A  1 347 ? 4.998   -62.312 21.423  1.00 87.56  ? 347  GLY A CA  1 
ATOM   2647  C C   . GLY A  1 347 ? 4.723   -63.709 21.942  1.00 93.26  ? 347  GLY A C   1 
ATOM   2648  O O   . GLY A  1 347 ? 5.599   -64.348 22.539  1.00 95.83  ? 347  GLY A O   1 
ATOM   2649  N N   . ILE A  1 348 ? 3.501   -64.204 21.661  1.00 87.25  ? 348  ILE A N   1 
ATOM   2650  C CA  . ILE A  1 348 ? 2.995   -65.512 22.068  1.00 87.67  ? 348  ILE A CA  1 
ATOM   2651  C C   . ILE A  1 348 ? 3.678   -66.656 21.304  1.00 96.80  ? 348  ILE A C   1 
ATOM   2652  O O   . ILE A  1 348 ? 4.115   -67.647 21.912  1.00 98.54  ? 348  ILE A O   1 
ATOM   2653  C CB  . ILE A  1 348 ? 1.425   -65.534 21.995  1.00 87.97  ? 348  ILE A CB  1 
ATOM   2654  C CG1 . ILE A  1 348 ? 0.768   -64.482 22.947  1.00 84.66  ? 348  ILE A CG1 1 
ATOM   2655  C CG2 . ILE A  1 348 ? 0.816   -66.932 22.195  1.00 89.78  ? 348  ILE A CG2 1 
ATOM   2656  C CD1 . ILE A  1 348 ? 0.879   -64.700 24.498  1.00 80.10  ? 348  ILE A CD1 1 
ATOM   2657  N N   . HIS A  1 349 ? 3.784   -66.505 19.979  1.00 94.86  ? 349  HIS A N   1 
ATOM   2658  C CA  . HIS A  1 349 ? 4.342   -67.520 19.087  1.00 97.48  ? 349  HIS A CA  1 
ATOM   2659  C C   . HIS A  1 349 ? 5.807   -67.297 18.680  1.00 101.99 ? 349  HIS A C   1 
ATOM   2660  O O   . HIS A  1 349 ? 6.330   -68.010 17.836  1.00 103.78 ? 349  HIS A O   1 
ATOM   2661  C CB  . HIS A  1 349 ? 3.395   -67.725 17.891  1.00 98.51  ? 349  HIS A CB  1 
ATOM   2662  C CG  . HIS A  1 349 ? 2.005   -68.108 18.321  1.00 101.80 ? 349  HIS A CG  1 
ATOM   2663  N ND1 . HIS A  1 349 ? 1.651   -69.435 18.526  1.00 106.15 ? 349  HIS A ND1 1 
ATOM   2664  C CD2 . HIS A  1 349 ? 0.947   -67.323 18.642  1.00 101.35 ? 349  HIS A CD2 1 
ATOM   2665  C CE1 . HIS A  1 349 ? 0.387   -69.415 18.933  1.00 104.41 ? 349  HIS A CE1 1 
ATOM   2666  N NE2 . HIS A  1 349 ? -0.078  -68.168 19.027  1.00 101.90 ? 349  HIS A NE2 1 
ATOM   2667  N N   . GLY A  1 350 ? 6.469   -66.348 19.325  1.00 97.45  ? 350  GLY A N   1 
ATOM   2668  C CA  . GLY A  1 350 ? 7.877   -66.040 19.092  1.00 97.93  ? 350  GLY A CA  1 
ATOM   2669  C C   . GLY A  1 350 ? 8.197   -65.285 17.820  1.00 100.83 ? 350  GLY A C   1 
ATOM   2670  O O   . GLY A  1 350 ? 7.469   -65.389 16.826  1.00 100.03 ? 350  GLY A O   1 
ATOM   2671  N N   . ASP A  1 351 ? 9.297   -64.496 17.867  1.00 97.61  ? 351  ASP A N   1 
ATOM   2672  C CA  . ASP A  1 351 ? 9.836   -63.718 16.747  1.00 98.01  ? 351  ASP A CA  1 
ATOM   2673  C C   . ASP A  1 351 ? 11.211  -64.303 16.355  1.00 106.68 ? 351  ASP A C   1 
ATOM   2674  O O   . ASP A  1 351 ? 12.249  -63.873 16.880  1.00 106.99 ? 351  ASP A O   1 
ATOM   2675  C CB  . ASP A  1 351 ? 9.930   -62.215 17.085  1.00 97.48  ? 351  ASP A CB  1 
ATOM   2676  C CG  . ASP A  1 351 ? 10.421  -61.309 15.948  1.00 112.35 ? 351  ASP A CG  1 
ATOM   2677  O OD1 . ASP A  1 351 ? 10.572  -61.808 14.794  1.00 118.16 ? 351  ASP A OD1 1 
ATOM   2678  O OD2 . ASP A  1 351 ? 10.649  -60.105 16.204  1.00 111.94 ? 351  ASP A OD2 1 
ATOM   2679  N N   . PRO A  1 352 ? 11.213  -65.305 15.443  1.00 105.95 ? 352  PRO A N   1 
ATOM   2680  C CA  . PRO A  1 352 ? 12.468  -65.955 15.045  1.00 108.53 ? 352  PRO A CA  1 
ATOM   2681  C C   . PRO A  1 352 ? 13.567  -65.019 14.558  1.00 112.71 ? 352  PRO A C   1 
ATOM   2682  O O   . PRO A  1 352 ? 14.703  -65.187 14.984  1.00 113.28 ? 352  PRO A O   1 
ATOM   2683  C CB  . PRO A  1 352 ? 12.018  -66.915 13.941  1.00 112.01 ? 352  PRO A CB  1 
ATOM   2684  C CG  . PRO A  1 352 ? 10.635  -67.255 14.299  1.00 115.21 ? 352  PRO A CG  1 
ATOM   2685  C CD  . PRO A  1 352 ? 10.066  -65.938 14.763  1.00 107.79 ? 352  PRO A CD  1 
ATOM   2686  N N   . TYR A  1 353 ? 13.234  -64.027 13.702  1.00 108.74 ? 353  TYR A N   1 
ATOM   2687  C CA  . TYR A  1 353 ? 14.208  -63.080 13.153  1.00 109.02 ? 353  TYR A CA  1 
ATOM   2688  C C   . TYR A  1 353 ? 15.040  -62.392 14.231  1.00 114.06 ? 353  TYR A C   1 
ATOM   2689  O O   . TYR A  1 353 ? 16.246  -62.230 14.046  1.00 115.51 ? 353  TYR A O   1 
ATOM   2690  C CB  . TYR A  1 353 ? 13.530  -62.041 12.261  1.00 108.17 ? 353  TYR A CB  1 
ATOM   2691  C CG  . TYR A  1 353 ? 14.490  -61.082 11.580  1.00 109.97 ? 353  TYR A CG  1 
ATOM   2692  C CD1 . TYR A  1 353 ? 15.172  -61.448 10.419  1.00 114.07 ? 353  TYR A CD1 1 
ATOM   2693  C CD2 . TYR A  1 353 ? 14.691  -59.794 12.076  1.00 108.34 ? 353  TYR A CD2 1 
ATOM   2694  C CE1 . TYR A  1 353 ? 16.039  -60.555 9.776   1.00 114.84 ? 353  TYR A CE1 1 
ATOM   2695  C CE2 . TYR A  1 353 ? 15.568  -58.902 11.456  1.00 109.11 ? 353  TYR A CE2 1 
ATOM   2696  C CZ  . TYR A  1 353 ? 16.231  -59.279 10.301  1.00 118.55 ? 353  TYR A CZ  1 
ATOM   2697  O OH  . TYR A  1 353 ? 17.049  -58.351 9.692   1.00 118.36 ? 353  TYR A OH  1 
ATOM   2698  N N   . ASN A  1 354 ? 14.406  -61.984 15.347  1.00 109.10 ? 354  ASN A N   1 
ATOM   2699  C CA  . ASN A  1 354 ? 15.119  -61.331 16.441  1.00 108.21 ? 354  ASN A CA  1 
ATOM   2700  C C   . ASN A  1 354 ? 15.491  -62.323 17.554  1.00 112.91 ? 354  ASN A C   1 
ATOM   2701  O O   . ASN A  1 354 ? 15.807  -61.915 18.678  1.00 112.58 ? 354  ASN A O   1 
ATOM   2702  C CB  . ASN A  1 354 ? 14.348  -60.129 16.946  1.00 107.56 ? 354  ASN A CB  1 
ATOM   2703  C CG  . ASN A  1 354 ? 14.314  -58.997 15.950  1.00 144.80 ? 354  ASN A CG  1 
ATOM   2704  O OD1 . ASN A  1 354 ? 13.363  -58.849 15.172  1.00 144.37 ? 354  ASN A OD1 1 
ATOM   2705  N ND2 . ASN A  1 354 ? 15.356  -58.175 15.944  1.00 138.01 ? 354  ASN A ND2 1 
ATOM   2706  N N   . ALA A  1 355 ? 15.514  -63.633 17.200  1.00 109.60 ? 355  ALA A N   1 
ATOM   2707  C CA  . ALA A  1 355 ? 15.853  -64.755 18.071  1.00 110.47 ? 355  ALA A CA  1 
ATOM   2708  C C   . ALA A  1 355 ? 15.129  -64.733 19.425  1.00 110.09 ? 355  ALA A C   1 
ATOM   2709  O O   . ALA A  1 355 ? 15.755  -64.791 20.487  1.00 110.01 ? 355  ALA A O   1 
ATOM   2710  C CB  . ALA A  1 355 ? 17.357  -64.851 18.245  1.00 113.70 ? 355  ALA A CB  1 
ATOM   2711  N N   . ILE A  1 356 ? 13.798  -64.621 19.370  1.00 103.26 ? 356  ILE A N   1 
ATOM   2712  C CA  . ILE A  1 356 ? 12.954  -64.660 20.552  1.00 101.43 ? 356  ILE A CA  1 
ATOM   2713  C C   . ILE A  1 356 ? 12.057  -65.877 20.451  1.00 107.28 ? 356  ILE A C   1 
ATOM   2714  O O   . ILE A  1 356 ? 11.305  -66.011 19.487  1.00 106.04 ? 356  ILE A O   1 
ATOM   2715  C CB  . ILE A  1 356 ? 12.195  -63.342 20.814  1.00 100.75 ? 356  ILE A CB  1 
ATOM   2716  C CG1 . ILE A  1 356 ? 13.187  -62.220 21.161  1.00 100.05 ? 356  ILE A CG1 1 
ATOM   2717  C CG2 . ILE A  1 356 ? 11.182  -63.509 21.958  1.00 99.68  ? 356  ILE A CG2 1 
ATOM   2718  C CD1 . ILE A  1 356 ? 13.010  -61.000 20.388  1.00 106.70 ? 356  ILE A CD1 1 
ATOM   2719  N N   . GLU A  1 357 ? 12.190  -66.791 21.424  1.00 106.69 ? 357  GLU A N   1 
ATOM   2720  C CA  . GLU A  1 357 ? 11.430  -68.043 21.488  1.00 107.88 ? 357  GLU A CA  1 
ATOM   2721  C C   . GLU A  1 357 ? 10.006  -67.747 21.926  1.00 107.56 ? 357  GLU A C   1 
ATOM   2722  O O   . GLU A  1 357 ? 9.784   -66.780 22.653  1.00 104.14 ? 357  GLU A O   1 
ATOM   2723  C CB  . GLU A  1 357 ? 12.088  -69.032 22.475  1.00 111.98 ? 357  GLU A CB  1 
ATOM   2724  C CG  . GLU A  1 357 ? 13.546  -69.371 22.180  1.00 127.26 ? 357  GLU A CG  1 
ATOM   2725  C CD  . GLU A  1 357 ? 13.810  -70.266 20.982  1.00 160.79 ? 357  GLU A CD  1 
ATOM   2726  O OE1 . GLU A  1 357 ? 13.318  -71.418 20.979  1.00 175.62 ? 357  GLU A OE1 1 
ATOM   2727  O OE2 . GLU A  1 357 ? 14.572  -69.843 20.082  1.00 149.86 ? 357  GLU A OE2 1 
ATOM   2728  N N   . ALA A  1 358 ? 9.046   -68.584 21.502  1.00 104.34 ? 358  ALA A N   1 
ATOM   2729  C CA  . ALA A  1 358 ? 7.645   -68.436 21.889  1.00 102.16 ? 358  ALA A CA  1 
ATOM   2730  C C   . ALA A  1 358 ? 7.515   -68.501 23.406  1.00 106.37 ? 358  ALA A C   1 
ATOM   2731  O O   . ALA A  1 358 ? 8.263   -69.209 24.074  1.00 106.43 ? 358  ALA A O   1 
ATOM   2732  C CB  . ALA A  1 358 ? 6.796   -69.511 21.238  1.00 104.09 ? 358  ALA A CB  1 
ATOM   2733  N N   . ILE A  1 359 ? 6.616   -67.698 23.948  1.00 103.39 ? 359  ILE A N   1 
ATOM   2734  C CA  . ILE A  1 359 ? 6.388   -67.626 25.385  1.00 103.61 ? 359  ILE A CA  1 
ATOM   2735  C C   . ILE A  1 359 ? 5.900   -68.976 25.980  1.00 111.18 ? 359  ILE A C   1 
ATOM   2736  O O   . ILE A  1 359 ? 5.151   -69.715 25.321  1.00 111.32 ? 359  ILE A O   1 
ATOM   2737  C CB  . ILE A  1 359 ? 5.443   -66.428 25.690  1.00 103.19 ? 359  ILE A CB  1 
ATOM   2738  C CG1 . ILE A  1 359 ? 5.674   -65.855 27.084  1.00 102.79 ? 359  ILE A CG1 1 
ATOM   2739  C CG2 . ILE A  1 359 ? 3.970   -66.757 25.438  1.00 103.20 ? 359  ILE A CG2 1 
ATOM   2740  C CD1 . ILE A  1 359 ? 5.308   -64.391 27.195  1.00 111.42 ? 359  ILE A CD1 1 
ATOM   2741  N N   . ASP A  1 360 ? 6.360   -69.288 27.215  1.00 109.23 ? 360  ASP A N   1 
ATOM   2742  C CA  . ASP A  1 360 ? 5.947   -70.463 27.974  1.00 110.92 ? 360  ASP A CA  1 
ATOM   2743  C C   . ASP A  1 360 ? 4.577   -70.120 28.564  1.00 112.15 ? 360  ASP A C   1 
ATOM   2744  O O   . ASP A  1 360 ? 4.487   -69.210 29.387  1.00 109.26 ? 360  ASP A O   1 
ATOM   2745  C CB  . ASP A  1 360 ? 6.960   -70.782 29.091  1.00 115.36 ? 360  ASP A CB  1 
ATOM   2746  C CG  . ASP A  1 360 ? 6.653   -72.005 29.964  1.00 134.72 ? 360  ASP A CG  1 
ATOM   2747  O OD1 . ASP A  1 360 ? 5.683   -72.748 29.647  1.00 136.84 ? 360  ASP A OD1 1 
ATOM   2748  O OD2 . ASP A  1 360 ? 7.402   -72.240 30.941  1.00 142.92 ? 360  ASP A OD2 1 
ATOM   2749  N N   . PRO A  1 361 ? 3.493   -70.804 28.134  1.00 110.05 ? 361  PRO A N   1 
ATOM   2750  C CA  . PRO A  1 361 ? 2.150   -70.466 28.646  1.00 108.45 ? 361  PRO A CA  1 
ATOM   2751  C C   . PRO A  1 361 ? 2.013   -70.411 30.168  1.00 111.38 ? 361  PRO A C   1 
ATOM   2752  O O   . PRO A  1 361 ? 1.252   -69.591 30.661  1.00 109.43 ? 361  PRO A O   1 
ATOM   2753  C CB  . PRO A  1 361 ? 1.246   -71.527 28.010  1.00 111.36 ? 361  PRO A CB  1 
ATOM   2754  C CG  . PRO A  1 361 ? 1.964   -71.924 26.788  1.00 116.94 ? 361  PRO A CG  1 
ATOM   2755  C CD  . PRO A  1 361 ? 3.417   -71.896 27.148  1.00 113.63 ? 361  PRO A CD  1 
ATOM   2756  N N   . GLU A  1 362 ? 2.787   -71.216 30.899  1.00 108.97 ? 362  GLU A N   1 
ATOM   2757  C CA  . GLU A  1 362 ? 2.782   -71.216 32.356  1.00 109.18 ? 362  GLU A CA  1 
ATOM   2758  C C   . GLU A  1 362 ? 3.253   -69.886 32.902  1.00 108.07 ? 362  GLU A C   1 
ATOM   2759  O O   . GLU A  1 362 ? 2.682   -69.413 33.883  1.00 106.89 ? 362  GLU A O   1 
ATOM   2760  C CB  . GLU A  1 362 ? 3.674   -72.341 32.924  1.00 114.73 ? 362  GLU A CB  1 
ATOM   2761  C CG  . GLU A  1 362 ? 3.120   -72.975 34.188  1.00 132.69 ? 362  GLU A CG  1 
ATOM   2762  C CD  . GLU A  1 362 ? 1.932   -73.875 33.918  1.00 170.30 ? 362  GLU A CD  1 
ATOM   2763  O OE1 . GLU A  1 362 ? 2.166   -75.030 33.499  1.00 175.42 ? 362  GLU A OE1 1 
ATOM   2764  O OE2 . GLU A  1 362 ? 0.774   -73.430 34.102  1.00 168.23 ? 362  GLU A OE2 1 
ATOM   2765  N N   . LYS A  1 363 ? 4.268   -69.267 32.254  1.00 101.54 ? 363  LYS A N   1 
ATOM   2766  C CA  . LYS A  1 363 ? 4.833   -67.972 32.658  1.00 98.30  ? 363  LYS A CA  1 
ATOM   2767  C C   . LYS A  1 363 ? 3.817   -66.822 32.663  1.00 97.87  ? 363  LYS A C   1 
ATOM   2768  O O   . LYS A  1 363 ? 4.019   -65.846 33.377  1.00 97.24  ? 363  LYS A O   1 
ATOM   2769  C CB  . LYS A  1 363 ? 6.093   -67.623 31.849  1.00 100.53 ? 363  LYS A CB  1 
ATOM   2770  C CG  . LYS A  1 363 ? 7.262   -68.585 32.105  1.00 113.34 ? 363  LYS A CG  1 
ATOM   2771  C CD  . LYS A  1 363 ? 8.584   -67.867 32.371  1.00 119.00 ? 363  LYS A CD  1 
ATOM   2772  C CE  . LYS A  1 363 ? 9.439   -67.743 31.136  1.00 121.36 ? 363  LYS A CE  1 
ATOM   2773  N NZ  . LYS A  1 363 ? 10.626  -66.884 31.376  1.00 123.38 ? 363  LYS A NZ  1 
ATOM   2774  N N   . LEU A  1 364 ? 2.689   -66.965 31.945  1.00 92.14  ? 364  LEU A N   1 
ATOM   2775  C CA  . LEU A  1 364 ? 1.633   -65.952 31.927  1.00 88.89  ? 364  LEU A CA  1 
ATOM   2776  C C   . LEU A  1 364 ? 0.961   -65.772 33.290  1.00 94.18  ? 364  LEU A C   1 
ATOM   2777  O O   . LEU A  1 364 ? 0.254   -64.778 33.499  1.00 92.74  ? 364  LEU A O   1 
ATOM   2778  C CB  . LEU A  1 364 ? 0.599   -66.223 30.831  1.00 87.72  ? 364  LEU A CB  1 
ATOM   2779  C CG  . LEU A  1 364 ? 1.048   -65.933 29.397  1.00 91.44  ? 364  LEU A CG  1 
ATOM   2780  C CD1 . LEU A  1 364 ? 0.048   -66.457 28.415  1.00 91.68  ? 364  LEU A CD1 1 
ATOM   2781  C CD2 . LEU A  1 364 ? 1.249   -64.452 29.153  1.00 90.45  ? 364  LEU A CD2 1 
ATOM   2782  N N   . ASN A  1 365 ? 1.241   -66.691 34.241  1.00 92.41  ? 365  ASN A N   1 
ATOM   2783  C CA  . ASN A  1 365 ? 0.716   -66.615 35.602  1.00 91.77  ? 365  ASN A CA  1 
ATOM   2784  C C   . ASN A  1 365 ? 1.330   -65.483 36.438  1.00 93.43  ? 365  ASN A C   1 
ATOM   2785  O O   . ASN A  1 365 ? 0.799   -65.186 37.512  1.00 92.85  ? 365  ASN A O   1 
ATOM   2786  C CB  . ASN A  1 365 ? 0.794   -67.957 36.308  1.00 94.11  ? 365  ASN A CB  1 
ATOM   2787  C CG  . ASN A  1 365 ? -0.179  -68.970 35.761  1.00 119.83 ? 365  ASN A CG  1 
ATOM   2788  O OD1 . ASN A  1 365 ? -1.407  -68.825 35.866  1.00 115.24 ? 365  ASN A OD1 1 
ATOM   2789  N ND2 . ASN A  1 365 ? 0.353   -70.029 35.173  1.00 111.58 ? 365  ASN A ND2 1 
ATOM   2790  N N   . VAL A  1 366 ? 2.396   -64.809 35.922  1.00 88.40  ? 366  VAL A N   1 
ATOM   2791  C CA  . VAL A  1 366 ? 3.035   -63.659 36.588  1.00 87.90  ? 366  VAL A CA  1 
ATOM   2792  C C   . VAL A  1 366 ? 2.037   -62.524 36.815  1.00 90.44  ? 366  VAL A C   1 
ATOM   2793  O O   . VAL A  1 366 ? 2.166   -61.768 37.780  1.00 89.25  ? 366  VAL A O   1 
ATOM   2794  C CB  . VAL A  1 366 ? 4.314   -63.121 35.879  1.00 92.14  ? 366  VAL A CB  1 
ATOM   2795  C CG1 . VAL A  1 366 ? 5.442   -64.136 35.932  1.00 95.31  ? 366  VAL A CG1 1 
ATOM   2796  C CG2 . VAL A  1 366 ? 4.039   -62.683 34.443  1.00 90.18  ? 366  VAL A CG2 1 
ATOM   2797  N N   . PHE A  1 367 ? 1.038   -62.426 35.914  1.00 86.61  ? 367  PHE A N   1 
ATOM   2798  C CA  . PHE A  1 367 ? 0.001   -61.399 35.890  1.00 83.56  ? 367  PHE A CA  1 
ATOM   2799  C C   . PHE A  1 367 ? -1.086  -61.542 36.951  1.00 86.36  ? 367  PHE A C   1 
ATOM   2800  O O   . PHE A  1 367 ? -1.901  -60.620 37.120  1.00 85.17  ? 367  PHE A O   1 
ATOM   2801  C CB  . PHE A  1 367 ? -0.585  -61.277 34.476  1.00 83.61  ? 367  PHE A CB  1 
ATOM   2802  C CG  . PHE A  1 367 ? 0.445   -60.883 33.445  1.00 84.25  ? 367  PHE A CG  1 
ATOM   2803  C CD1 . PHE A  1 367 ? 0.794   -61.755 32.423  1.00 87.11  ? 367  PHE A CD1 1 
ATOM   2804  C CD2 . PHE A  1 367 ? 1.086   -59.642 33.511  1.00 85.53  ? 367  PHE A CD2 1 
ATOM   2805  C CE1 . PHE A  1 367 ? 1.744   -61.390 31.469  1.00 88.00  ? 367  PHE A CE1 1 
ATOM   2806  C CE2 . PHE A  1 367 ? 2.054   -59.283 32.564  1.00 88.11  ? 367  PHE A CE2 1 
ATOM   2807  C CZ  . PHE A  1 367 ? 2.378   -60.162 31.551  1.00 86.94  ? 367  PHE A CZ  1 
ATOM   2808  N N   . ARG A  1 368 ? -1.085  -62.664 37.694  1.00 82.02  ? 368  ARG A N   1 
ATOM   2809  C CA  . ARG A  1 368 ? -2.073  -62.875 38.740  1.00 81.26  ? 368  ARG A CA  1 
ATOM   2810  C C   . ARG A  1 368 ? -1.961  -61.870 39.888  1.00 85.89  ? 368  ARG A C   1 
ATOM   2811  O O   . ARG A  1 368 ? -2.914  -61.709 40.654  1.00 85.35  ? 368  ARG A O   1 
ATOM   2812  C CB  . ARG A  1 368 ? -2.093  -64.323 39.220  1.00 80.46  ? 368  ARG A CB  1 
ATOM   2813  C CG  . ARG A  1 368 ? -2.746  -65.264 38.221  1.00 87.28  ? 368  ARG A CG  1 
ATOM   2814  C CD  . ARG A  1 368 ? -2.636  -66.710 38.650  1.00 92.25  ? 368  ARG A CD  1 
ATOM   2815  N NE  . ARG A  1 368 ? -3.162  -67.634 37.650  1.00 91.71  ? 368  ARG A NE  1 
ATOM   2816  C CZ  . ARG A  1 368 ? -4.428  -68.042 37.598  1.00 106.71 ? 368  ARG A CZ  1 
ATOM   2817  N NH1 . ARG A  1 368 ? -5.315  -67.597 38.484  1.00 89.01  ? 368  ARG A NH1 1 
ATOM   2818  N NH2 . ARG A  1 368 ? -4.820  -68.890 36.652  1.00 94.92  ? 368  ARG A NH2 1 
ATOM   2819  N N   . THR A  1 369 ? -0.827  -61.152 39.969  1.00 82.68  ? 369  THR A N   1 
ATOM   2820  C CA  . THR A  1 369 ? -0.602  -60.139 40.999  1.00 82.40  ? 369  THR A CA  1 
ATOM   2821  C C   . THR A  1 369 ? -1.107  -58.764 40.564  1.00 85.21  ? 369  THR A C   1 
ATOM   2822  O O   . THR A  1 369 ? -1.382  -57.918 41.424  1.00 83.82  ? 369  THR A O   1 
ATOM   2823  C CB  . THR A  1 369 ? 0.869   -60.095 41.406  1.00 87.37  ? 369  THR A CB  1 
ATOM   2824  O OG1 . THR A  1 369 ? 1.665   -59.896 40.238  1.00 92.01  ? 369  THR A OG1 1 
ATOM   2825  C CG2 . THR A  1 369 ? 1.298   -61.345 42.143  1.00 80.23  ? 369  THR A CG2 1 
ATOM   2826  N N   . VAL A  1 370 ? -1.244  -58.557 39.227  1.00 81.28  ? 370  VAL A N   1 
ATOM   2827  C CA  . VAL A  1 370 ? -1.664  -57.294 38.618  1.00 78.44  ? 370  VAL A CA  1 
ATOM   2828  C C   . VAL A  1 370 ? -3.094  -56.920 38.976  1.00 82.31  ? 370  VAL A C   1 
ATOM   2829  O O   . VAL A  1 370 ? -4.031  -57.665 38.651  1.00 82.22  ? 370  VAL A O   1 
ATOM   2830  C CB  . VAL A  1 370 ? -1.394  -57.230 37.092  1.00 80.85  ? 370  VAL A CB  1 
ATOM   2831  C CG1 . VAL A  1 370 ? -1.848  -55.893 36.512  1.00 78.72  ? 370  VAL A CG1 1 
ATOM   2832  C CG2 . VAL A  1 370 ? 0.078   -57.465 36.778  1.00 81.12  ? 370  VAL A CG2 1 
ATOM   2833  N N   . ARG A  1 371 ? -3.242  -55.746 39.643  1.00 77.74  ? 371  ARG A N   1 
ATOM   2834  C CA  . ARG A  1 371 ? -4.522  -55.168 40.068  1.00 76.08  ? 371  ARG A CA  1 
ATOM   2835  C C   . ARG A  1 371 ? -4.933  -53.980 39.193  1.00 75.39  ? 371  ARG A C   1 
ATOM   2836  O O   . ARG A  1 371 ? -6.133  -53.694 39.083  1.00 71.70  ? 371  ARG A O   1 
ATOM   2837  C CB  . ARG A  1 371 ? -4.457  -54.721 41.530  1.00 76.74  ? 371  ARG A CB  1 
ATOM   2838  C CG  . ARG A  1 371 ? -4.644  -55.836 42.539  1.00 95.17  ? 371  ARG A CG  1 
ATOM   2839  C CD  . ARG A  1 371 ? -4.623  -55.269 43.952  1.00 118.96 ? 371  ARG A CD  1 
ATOM   2840  N NE  . ARG A  1 371 ? -3.254  -55.082 44.454  1.00 137.56 ? 371  ARG A NE  1 
ATOM   2841  C CZ  . ARG A  1 371 ? -2.925  -54.312 45.489  1.00 152.00 ? 371  ARG A CZ  1 
ATOM   2842  N NH1 . ARG A  1 371 ? -3.854  -53.605 46.125  1.00 138.75 ? 371  ARG A NH1 1 
ATOM   2843  N NH2 . ARG A  1 371 ? -1.660  -54.220 45.878  1.00 137.51 ? 371  ARG A NH2 1 
ATOM   2844  N N   . GLU A  1 372 ? -3.936  -53.283 38.597  1.00 72.36  ? 372  GLU A N   1 
ATOM   2845  C CA  . GLU A  1 372 ? -4.167  -52.096 37.766  1.00 71.91  ? 372  GLU A CA  1 
ATOM   2846  C C   . GLU A  1 372 ? -3.248  -52.059 36.553  1.00 74.08  ? 372  GLU A C   1 
ATOM   2847  O O   . GLU A  1 372 ? -2.061  -52.404 36.670  1.00 75.01  ? 372  GLU A O   1 
ATOM   2848  C CB  . GLU A  1 372 ? -3.969  -50.785 38.595  1.00 73.02  ? 372  GLU A CB  1 
ATOM   2849  C CG  . GLU A  1 372 ? -4.508  -49.524 37.916  1.00 82.04  ? 372  GLU A CG  1 
ATOM   2850  C CD  . GLU A  1 372 ? -4.488  -48.189 38.645  1.00 110.25 ? 372  GLU A CD  1 
ATOM   2851  O OE1 . GLU A  1 372 ? -4.097  -48.164 39.837  1.00 116.35 ? 372  GLU A OE1 1 
ATOM   2852  O OE2 . GLU A  1 372 ? -4.895  -47.171 38.028  1.00 96.97  ? 372  GLU A OE2 1 
ATOM   2853  N N   . ILE A  1 373 ? -3.810  -51.607 35.400  1.00 65.71  ? 373  ILE A N   1 
ATOM   2854  C CA  . ILE A  1 373 ? -3.108  -51.349 34.143  1.00 64.04  ? 373  ILE A CA  1 
ATOM   2855  C C   . ILE A  1 373 ? -3.509  -49.912 33.833  1.00 70.59  ? 373  ILE A C   1 
ATOM   2856  O O   . ILE A  1 373 ? -4.680  -49.672 33.551  1.00 70.89  ? 373  ILE A O   1 
ATOM   2857  C CB  . ILE A  1 373 ? -3.486  -52.330 33.002  1.00 65.90  ? 373  ILE A CB  1 
ATOM   2858  C CG1 . ILE A  1 373 ? -2.997  -53.751 33.304  1.00 67.70  ? 373  ILE A CG1 1 
ATOM   2859  C CG2 . ILE A  1 373 ? -2.922  -51.854 31.669  1.00 63.65  ? 373  ILE A CG2 1 
ATOM   2860  C CD1 . ILE A  1 373 ? -3.647  -54.848 32.484  1.00 69.89  ? 373  ILE A CD1 1 
ATOM   2861  N N   . THR A  1 374 ? -2.576  -48.944 33.985  1.00 67.53  ? 374  THR A N   1 
ATOM   2862  C CA  . THR A  1 374 ? -2.825  -47.508 33.765  1.00 65.22  ? 374  THR A CA  1 
ATOM   2863  C C   . THR A  1 374 ? -3.160  -47.129 32.300  1.00 67.48  ? 374  THR A C   1 
ATOM   2864  O O   . THR A  1 374 ? -4.014  -46.253 32.067  1.00 66.02  ? 374  THR A O   1 
ATOM   2865  C CB  . THR A  1 374 ? -1.748  -46.622 34.428  1.00 69.14  ? 374  THR A CB  1 
ATOM   2866  O OG1 . THR A  1 374 ? -0.511  -46.685 33.709  1.00 68.94  ? 374  THR A OG1 1 
ATOM   2867  C CG2 . THR A  1 374 ? -1.554  -46.930 35.898  1.00 65.71  ? 374  THR A CG2 1 
ATOM   2868  N N   . GLY A  1 375 ? -2.498  -47.782 31.343  1.00 62.67  ? 375  GLY A N   1 
ATOM   2869  C CA  . GLY A  1 375 ? -2.756  -47.547 29.931  1.00 61.37  ? 375  GLY A CA  1 
ATOM   2870  C C   . GLY A  1 375 ? -3.852  -48.455 29.413  1.00 63.57  ? 375  GLY A C   1 
ATOM   2871  O O   . GLY A  1 375 ? -4.976  -48.437 29.938  1.00 61.59  ? 375  GLY A O   1 
ATOM   2872  N N   . PHE A  1 376 ? -3.522  -49.280 28.390  1.00 60.91  ? 376  PHE A N   1 
ATOM   2873  C CA  . PHE A  1 376 ? -4.476  -50.217 27.782  1.00 61.59  ? 376  PHE A CA  1 
ATOM   2874  C C   . PHE A  1 376 ? -4.047  -51.690 27.790  1.00 68.16  ? 376  PHE A C   1 
ATOM   2875  O O   . PHE A  1 376 ? -2.865  -51.990 27.943  1.00 69.90  ? 376  PHE A O   1 
ATOM   2876  C CB  . PHE A  1 376 ? -4.885  -49.777 26.366  1.00 62.48  ? 376  PHE A CB  1 
ATOM   2877  C CG  . PHE A  1 376 ? -3.766  -49.750 25.355  1.00 63.57  ? 376  PHE A CG  1 
ATOM   2878  C CD1 . PHE A  1 376 ? -3.362  -50.910 24.712  1.00 67.71  ? 376  PHE A CD1 1 
ATOM   2879  C CD2 . PHE A  1 376 ? -3.152  -48.558 25.011  1.00 64.49  ? 376  PHE A CD2 1 
ATOM   2880  C CE1 . PHE A  1 376 ? -2.337  -50.880 23.768  1.00 69.58  ? 376  PHE A CE1 1 
ATOM   2881  C CE2 . PHE A  1 376 ? -2.156  -48.525 24.045  1.00 67.87  ? 376  PHE A CE2 1 
ATOM   2882  C CZ  . PHE A  1 376 ? -1.743  -49.687 23.438  1.00 67.52  ? 376  PHE A CZ  1 
ATOM   2883  N N   . LEU A  1 377 ? -5.030  -52.597 27.602  1.00 64.23  ? 377  LEU A N   1 
ATOM   2884  C CA  . LEU A  1 377 ? -4.844  -54.034 27.496  1.00 65.27  ? 377  LEU A CA  1 
ATOM   2885  C C   . LEU A  1 377 ? -5.209  -54.457 26.060  1.00 68.41  ? 377  LEU A C   1 
ATOM   2886  O O   . LEU A  1 377 ? -6.354  -54.312 25.627  1.00 66.61  ? 377  LEU A O   1 
ATOM   2887  C CB  . LEU A  1 377 ? -5.695  -54.768 28.536  1.00 65.90  ? 377  LEU A CB  1 
ATOM   2888  C CG  . LEU A  1 377 ? -5.514  -56.288 28.629  1.00 72.72  ? 377  LEU A CG  1 
ATOM   2889  C CD1 . LEU A  1 377 ? -4.047  -56.688 28.833  1.00 73.73  ? 377  LEU A CD1 1 
ATOM   2890  C CD2 . LEU A  1 377 ? -6.365  -56.849 29.734  1.00 75.63  ? 377  LEU A CD2 1 
ATOM   2891  N N   . ASN A  1 378 ? -4.200  -54.928 25.317  1.00 64.42  ? 378  ASN A N   1 
ATOM   2892  C CA  . ASN A  1 378 ? -4.339  -55.322 23.924  1.00 62.70  ? 378  ASN A CA  1 
ATOM   2893  C C   . ASN A  1 378 ? -3.972  -56.802 23.734  1.00 68.07  ? 378  ASN A C   1 
ATOM   2894  O O   . ASN A  1 378 ? -2.788  -57.171 23.729  1.00 68.23  ? 378  ASN A O   1 
ATOM   2895  C CB  . ASN A  1 378 ? -3.496  -54.384 23.044  1.00 57.33  ? 378  ASN A CB  1 
ATOM   2896  C CG  . ASN A  1 378 ? -3.494  -54.666 21.559  1.00 79.79  ? 378  ASN A CG  1 
ATOM   2897  O OD1 . ASN A  1 378 ? -4.363  -55.356 21.018  1.00 85.86  ? 378  ASN A OD1 1 
ATOM   2898  N ND2 . ASN A  1 378 ? -2.529  -54.101 20.850  1.00 66.62  ? 378  ASN A ND2 1 
ATOM   2899  N N   . ILE A  1 379 ? -5.005  -57.653 23.593  1.00 64.27  ? 379  ILE A N   1 
ATOM   2900  C CA  . ILE A  1 379 ? -4.814  -59.090 23.385  1.00 65.07  ? 379  ILE A CA  1 
ATOM   2901  C C   . ILE A  1 379 ? -5.126  -59.451 21.923  1.00 74.85  ? 379  ILE A C   1 
ATOM   2902  O O   . ILE A  1 379 ? -6.298  -59.569 21.530  1.00 76.32  ? 379  ILE A O   1 
ATOM   2903  C CB  . ILE A  1 379 ? -5.564  -59.959 24.418  1.00 67.08  ? 379  ILE A CB  1 
ATOM   2904  C CG1 . ILE A  1 379 ? -5.136  -59.595 25.849  1.00 66.74  ? 379  ILE A CG1 1 
ATOM   2905  C CG2 . ILE A  1 379 ? -5.330  -61.447 24.143  1.00 68.04  ? 379  ILE A CG2 1 
ATOM   2906  C CD1 . ILE A  1 379 ? -6.266  -59.578 26.858  1.00 70.67  ? 379  ILE A CD1 1 
ATOM   2907  N N   . GLN A  1 380 ? -4.055  -59.588 21.117  1.00 71.96  ? 380  GLN A N   1 
ATOM   2908  C CA  . GLN A  1 380 ? -4.130  -59.951 19.700  1.00 71.59  ? 380  GLN A CA  1 
ATOM   2909  C C   . GLN A  1 380 ? -3.677  -61.406 19.513  1.00 76.22  ? 380  GLN A C   1 
ATOM   2910  O O   . GLN A  1 380 ? -3.812  -61.960 18.424  1.00 76.71  ? 380  GLN A O   1 
ATOM   2911  C CB  . GLN A  1 380 ? -3.233  -59.021 18.872  1.00 71.96  ? 380  GLN A CB  1 
ATOM   2912  C CG  . GLN A  1 380 ? -3.715  -57.594 18.786  1.00 71.41  ? 380  GLN A CG  1 
ATOM   2913  C CD  . GLN A  1 380 ? -3.076  -56.841 17.652  1.00 90.18  ? 380  GLN A CD  1 
ATOM   2914  O OE1 . GLN A  1 380 ? -2.399  -57.407 16.788  1.00 86.46  ? 380  GLN A OE1 1 
ATOM   2915  N NE2 . GLN A  1 380 ? -3.319  -55.545 17.600  1.00 85.94  ? 380  GLN A NE2 1 
ATOM   2916  N N   . SER A  1 381 ? -3.094  -62.005 20.562  1.00 72.98  ? 381  SER A N   1 
ATOM   2917  C CA  . SER A  1 381 ? -2.602  -63.376 20.548  1.00 75.26  ? 381  SER A CA  1 
ATOM   2918  C C   . SER A  1 381 ? -2.632  -63.947 21.933  1.00 80.98  ? 381  SER A C   1 
ATOM   2919  O O   . SER A  1 381 ? -2.475  -63.214 22.903  1.00 80.83  ? 381  SER A O   1 
ATOM   2920  C CB  . SER A  1 381 ? -1.193  -63.444 19.985  1.00 79.76  ? 381  SER A CB  1 
ATOM   2921  O OG  . SER A  1 381 ? -0.817  -64.784 19.722  1.00 94.60  ? 381  SER A OG  1 
ATOM   2922  N N   . TRP A  1 382 ? -2.849  -65.256 22.027  1.00 79.95  ? 382  TRP A N   1 
ATOM   2923  C CA  . TRP A  1 382 ? -2.957  -65.980 23.286  1.00 81.28  ? 382  TRP A CA  1 
ATOM   2924  C C   . TRP A  1 382 ? -2.670  -67.463 23.035  1.00 87.52  ? 382  TRP A C   1 
ATOM   2925  O O   . TRP A  1 382 ? -3.071  -67.985 21.977  1.00 87.45  ? 382  TRP A O   1 
ATOM   2926  C CB  . TRP A  1 382 ? -4.378  -65.795 23.866  1.00 79.31  ? 382  TRP A CB  1 
ATOM   2927  C CG  . TRP A  1 382 ? -4.509  -65.943 25.351  1.00 80.76  ? 382  TRP A CG  1 
ATOM   2928  C CD1 . TRP A  1 382 ? -5.337  -66.803 26.015  1.00 84.83  ? 382  TRP A CD1 1 
ATOM   2929  C CD2 . TRP A  1 382 ? -3.858  -65.148 26.358  1.00 79.82  ? 382  TRP A CD2 1 
ATOM   2930  N NE1 . TRP A  1 382 ? -5.224  -66.612 27.375  1.00 84.73  ? 382  TRP A NE1 1 
ATOM   2931  C CE2 . TRP A  1 382 ? -4.312  -65.612 27.614  1.00 84.81  ? 382  TRP A CE2 1 
ATOM   2932  C CE3 . TRP A  1 382 ? -2.916  -64.099 26.321  1.00 80.09  ? 382  TRP A CE3 1 
ATOM   2933  C CZ2 . TRP A  1 382 ? -3.874  -65.053 28.822  1.00 83.55  ? 382  TRP A CZ2 1 
ATOM   2934  C CZ3 . TRP A  1 382 ? -2.461  -63.565 27.518  1.00 81.46  ? 382  TRP A CZ3 1 
ATOM   2935  C CH2 . TRP A  1 382 ? -2.946  -64.030 28.750  1.00 82.78  ? 382  TRP A CH2 1 
ATOM   2936  N N   . PRO A  1 383 ? -1.970  -68.154 23.982  1.00 85.34  ? 383  PRO A N   1 
ATOM   2937  C CA  . PRO A  1 383 ? -1.701  -69.586 23.795  1.00 87.99  ? 383  PRO A CA  1 
ATOM   2938  C C   . PRO A  1 383 ? -2.989  -70.346 23.480  1.00 92.14  ? 383  PRO A C   1 
ATOM   2939  O O   . PRO A  1 383 ? -4.038  -70.067 24.081  1.00 89.53  ? 383  PRO A O   1 
ATOM   2940  C CB  . PRO A  1 383 ? -1.083  -70.007 25.125  1.00 91.13  ? 383  PRO A CB  1 
ATOM   2941  C CG  . PRO A  1 383 ? -0.442  -68.764 25.619  1.00 93.92  ? 383  PRO A CG  1 
ATOM   2942  C CD  . PRO A  1 383 ? -1.418  -67.684 25.267  1.00 86.50  ? 383  PRO A CD  1 
ATOM   2943  N N   . PRO A  1 384 ? -2.939  -71.236 22.458  1.00 91.00  ? 384  PRO A N   1 
ATOM   2944  C CA  . PRO A  1 384 ? -4.162  -71.926 22.015  1.00 91.37  ? 384  PRO A CA  1 
ATOM   2945  C C   . PRO A  1 384 ? -4.850  -72.819 23.044  1.00 97.18  ? 384  PRO A C   1 
ATOM   2946  O O   . PRO A  1 384 ? -6.082  -72.925 23.040  1.00 94.64  ? 384  PRO A O   1 
ATOM   2947  C CB  . PRO A  1 384 ? -3.696  -72.696 20.779  1.00 94.79  ? 384  PRO A CB  1 
ATOM   2948  C CG  . PRO A  1 384 ? -2.444  -71.997 20.337  1.00 98.47  ? 384  PRO A CG  1 
ATOM   2949  C CD  . PRO A  1 384 ? -1.788  -71.612 21.611  1.00 93.63  ? 384  PRO A CD  1 
ATOM   2950  N N   . ASN A  1 385 ? -4.060  -73.436 23.938  1.00 97.82  ? 385  ASN A N   1 
ATOM   2951  C CA  . ASN A  1 385 ? -4.548  -74.334 24.992  1.00 99.61  ? 385  ASN A CA  1 
ATOM   2952  C C   . ASN A  1 385 ? -5.260  -73.594 26.158  1.00 101.18 ? 385  ASN A C   1 
ATOM   2953  O O   . ASN A  1 385 ? -5.887  -74.237 27.006  1.00 100.81 ? 385  ASN A O   1 
ATOM   2954  C CB  . ASN A  1 385 ? -3.398  -75.221 25.488  1.00 105.41 ? 385  ASN A CB  1 
ATOM   2955  C CG  . ASN A  1 385 ? -2.263  -74.467 26.154  1.00 142.62 ? 385  ASN A CG  1 
ATOM   2956  O OD1 . ASN A  1 385 ? -1.665  -73.515 25.601  1.00 121.89 ? 385  ASN A OD1 1 
ATOM   2957  N ND2 . ASN A  1 385 ? -1.956  -74.924 27.364  1.00 151.74 ? 385  ASN A ND2 1 
ATOM   2958  N N   . MET A  1 386 ? -5.171  -72.247 26.176  1.00 96.07  ? 386  MET A N   1 
ATOM   2959  C CA  . MET A  1 386 ? -5.750  -71.370 27.194  1.00 94.15  ? 386  MET A CA  1 
ATOM   2960  C C   . MET A  1 386 ? -7.090  -70.794 26.735  1.00 95.26  ? 386  MET A C   1 
ATOM   2961  O O   . MET A  1 386 ? -7.149  -70.050 25.748  1.00 92.72  ? 386  MET A O   1 
ATOM   2962  C CB  . MET A  1 386 ? -4.758  -70.265 27.548  1.00 95.47  ? 386  MET A CB  1 
ATOM   2963  C CG  . MET A  1 386 ? -3.558  -70.778 28.290  1.00 101.83 ? 386  MET A CG  1 
ATOM   2964  S SD  . MET A  1 386 ? -2.310  -69.520 28.591  1.00 106.07 ? 386  MET A SD  1 
ATOM   2965  C CE  . MET A  1 386 ? -3.162  -68.499 29.844  1.00 101.53 ? 386  MET A CE  1 
ATOM   2966  N N   . THR A  1 387 ? -8.160  -71.148 27.463  1.00 92.33  ? 387  THR A N   1 
ATOM   2967  C CA  . THR A  1 387 ? -9.554  -70.794 27.161  1.00 91.76  ? 387  THR A CA  1 
ATOM   2968  C C   . THR A  1 387 ? -10.088 -69.466 27.718  1.00 96.17  ? 387  THR A C   1 
ATOM   2969  O O   . THR A  1 387 ? -11.224 -69.070 27.395  1.00 95.36  ? 387  THR A O   1 
ATOM   2970  C CB  . THR A  1 387 ? -10.469 -71.918 27.620  1.00 96.69  ? 387  THR A CB  1 
ATOM   2971  O OG1 . THR A  1 387 ? -10.262 -72.128 29.028  1.00 96.33  ? 387  THR A OG1 1 
ATOM   2972  C CG2 . THR A  1 387 ? -10.272 -73.188 26.813  1.00 93.25  ? 387  THR A CG2 1 
ATOM   2973  N N   . ASP A  1 388 ? -9.309  -68.811 28.595  1.00 92.57  ? 388  ASP A N   1 
ATOM   2974  C CA  . ASP A  1 388 ? -9.721  -67.566 29.242  1.00 90.18  ? 388  ASP A CA  1 
ATOM   2975  C C   . ASP A  1 388 ? -8.531  -66.780 29.784  1.00 89.30  ? 388  ASP A C   1 
ATOM   2976  O O   . ASP A  1 388 ? -7.386  -67.255 29.754  1.00 89.32  ? 388  ASP A O   1 
ATOM   2977  C CB  . ASP A  1 388 ? -10.738 -67.858 30.368  1.00 93.81  ? 388  ASP A CB  1 
ATOM   2978  C CG  . ASP A  1 388 ? -10.270 -68.902 31.366  1.00 117.27 ? 388  ASP A CG  1 
ATOM   2979  O OD1 . ASP A  1 388 ? -10.729 -70.070 31.272  1.00 121.40 ? 388  ASP A OD1 1 
ATOM   2980  O OD2 . ASP A  1 388 ? -9.431  -68.565 32.218  1.00 126.54 ? 388  ASP A OD2 1 
ATOM   2981  N N   . PHE A  1 389 ? -8.818  -65.580 30.294  1.00 81.46  ? 389  PHE A N   1 
ATOM   2982  C CA  . PHE A  1 389 ? -7.828  -64.679 30.844  1.00 79.16  ? 389  PHE A CA  1 
ATOM   2983  C C   . PHE A  1 389 ? -7.859  -64.671 32.369  1.00 86.13  ? 389  PHE A C   1 
ATOM   2984  O O   . PHE A  1 389 ? -7.779  -63.598 32.986  1.00 86.06  ? 389  PHE A O   1 
ATOM   2985  C CB  . PHE A  1 389 ? -8.047  -63.271 30.285  1.00 77.43  ? 389  PHE A CB  1 
ATOM   2986  C CG  . PHE A  1 389 ? -8.159  -63.228 28.787  1.00 77.26  ? 389  PHE A CG  1 
ATOM   2987  C CD1 . PHE A  1 389 ? -9.384  -63.001 28.173  1.00 79.84  ? 389  PHE A CD1 1 
ATOM   2988  C CD2 . PHE A  1 389 ? -7.044  -63.443 27.984  1.00 77.63  ? 389  PHE A CD2 1 
ATOM   2989  C CE1 . PHE A  1 389 ? -9.485  -62.958 26.778  1.00 79.90  ? 389  PHE A CE1 1 
ATOM   2990  C CE2 . PHE A  1 389 ? -7.147  -63.413 26.596  1.00 79.42  ? 389  PHE A CE2 1 
ATOM   2991  C CZ  . PHE A  1 389 ? -8.365  -63.171 26.002  1.00 77.58  ? 389  PHE A CZ  1 
ATOM   2992  N N   . SER A  1 390 ? -7.948  -65.870 32.982  1.00 84.14  ? 390  SER A N   1 
ATOM   2993  C CA  . SER A  1 390 ? -7.954  -66.037 34.435  1.00 84.30  ? 390  SER A CA  1 
ATOM   2994  C C   . SER A  1 390 ? -6.627  -65.591 35.069  1.00 87.87  ? 390  SER A C   1 
ATOM   2995  O O   . SER A  1 390 ? -6.611  -65.294 36.265  1.00 88.01  ? 390  SER A O   1 
ATOM   2996  C CB  . SER A  1 390 ? -8.277  -67.474 34.811  1.00 90.24  ? 390  SER A CB  1 
ATOM   2997  O OG  . SER A  1 390 ? -7.465  -68.366 34.067  1.00 99.61  ? 390  SER A OG  1 
ATOM   2998  N N   . VAL A  1 391 ? -5.529  -65.473 34.265  1.00 82.60  ? 391  VAL A N   1 
ATOM   2999  C CA  . VAL A  1 391 ? -4.255  -64.940 34.749  1.00 81.70  ? 391  VAL A CA  1 
ATOM   3000  C C   . VAL A  1 391 ? -4.468  -63.467 35.208  1.00 85.75  ? 391  VAL A C   1 
ATOM   3001  O O   . VAL A  1 391 ? -3.708  -62.955 36.029  1.00 86.35  ? 391  VAL A O   1 
ATOM   3002  C CB  . VAL A  1 391 ? -3.086  -65.088 33.738  1.00 85.39  ? 391  VAL A CB  1 
ATOM   3003  C CG1 . VAL A  1 391 ? -2.770  -66.549 33.473  1.00 87.72  ? 391  VAL A CG1 1 
ATOM   3004  C CG2 . VAL A  1 391 ? -3.340  -64.342 32.428  1.00 83.30  ? 391  VAL A CG2 1 
ATOM   3005  N N   . PHE A  1 392 ? -5.534  -62.807 34.683  1.00 80.17  ? 392  PHE A N   1 
ATOM   3006  C CA  . PHE A  1 392 ? -5.918  -61.435 35.007  1.00 76.88  ? 392  PHE A CA  1 
ATOM   3007  C C   . PHE A  1 392 ? -7.077  -61.413 35.994  1.00 83.83  ? 392  PHE A C   1 
ATOM   3008  O O   . PHE A  1 392 ? -7.859  -60.454 36.010  1.00 83.32  ? 392  PHE A O   1 
ATOM   3009  C CB  . PHE A  1 392 ? -6.251  -60.655 33.724  1.00 75.21  ? 392  PHE A CB  1 
ATOM   3010  C CG  . PHE A  1 392 ? -5.041  -60.355 32.888  1.00 74.53  ? 392  PHE A CG  1 
ATOM   3011  C CD1 . PHE A  1 392 ? -4.868  -60.956 31.655  1.00 77.77  ? 392  PHE A CD1 1 
ATOM   3012  C CD2 . PHE A  1 392 ? -4.056  -59.489 33.349  1.00 74.51  ? 392  PHE A CD2 1 
ATOM   3013  C CE1 . PHE A  1 392 ? -3.740  -60.676 30.879  1.00 79.09  ? 392  PHE A CE1 1 
ATOM   3014  C CE2 . PHE A  1 392 ? -2.931  -59.203 32.576  1.00 77.24  ? 392  PHE A CE2 1 
ATOM   3015  C CZ  . PHE A  1 392 ? -2.781  -59.791 31.344  1.00 76.92  ? 392  PHE A CZ  1 
ATOM   3016  N N   . SER A  1 393 ? -7.157  -62.465 36.844  1.00 82.94  ? 393  SER A N   1 
ATOM   3017  C CA  . SER A  1 393 ? -8.213  -62.656 37.845  1.00 83.90  ? 393  SER A CA  1 
ATOM   3018  C C   . SER A  1 393 ? -8.223  -61.601 38.961  1.00 86.41  ? 393  SER A C   1 
ATOM   3019  O O   . SER A  1 393 ? -9.227  -61.467 39.664  1.00 84.97  ? 393  SER A O   1 
ATOM   3020  C CB  . SER A  1 393 ? -8.130  -64.056 38.444  1.00 91.15  ? 393  SER A CB  1 
ATOM   3021  O OG  . SER A  1 393 ? -9.363  -64.461 39.015  1.00 105.52 ? 393  SER A OG  1 
ATOM   3022  N N   . ASN A  1 394 ? -7.116  -60.859 39.115  1.00 82.70  ? 394  ASN A N   1 
ATOM   3023  C CA  . ASN A  1 394 ? -6.990  -59.837 40.132  1.00 82.48  ? 394  ASN A CA  1 
ATOM   3024  C C   . ASN A  1 394 ? -7.070  -58.396 39.608  1.00 84.47  ? 394  ASN A C   1 
ATOM   3025  O O   . ASN A  1 394 ? -7.149  -57.467 40.422  1.00 84.13  ? 394  ASN A O   1 
ATOM   3026  C CB  . ASN A  1 394 ? -5.722  -60.058 40.924  1.00 87.51  ? 394  ASN A CB  1 
ATOM   3027  C CG  . ASN A  1 394 ? -5.824  -61.130 41.985  1.00 115.86 ? 394  ASN A CG  1 
ATOM   3028  O OD1 . ASN A  1 394 ? -6.563  -62.112 41.864  1.00 109.65 ? 394  ASN A OD1 1 
ATOM   3029  N ND2 . ASN A  1 394 ? -5.035  -60.985 43.040  1.00 109.19 ? 394  ASN A ND2 1 
ATOM   3030  N N   . LEU A  1 395 ? -7.065  -58.215 38.263  1.00 77.66  ? 395  LEU A N   1 
ATOM   3031  C CA  . LEU A  1 395 ? -7.158  -56.931 37.559  1.00 74.11  ? 395  LEU A CA  1 
ATOM   3032  C C   . LEU A  1 395 ? -8.476  -56.240 37.874  1.00 77.43  ? 395  LEU A C   1 
ATOM   3033  O O   . LEU A  1 395 ? -9.539  -56.772 37.555  1.00 77.54  ? 395  LEU A O   1 
ATOM   3034  C CB  . LEU A  1 395 ? -7.022  -57.160 36.046  1.00 73.28  ? 395  LEU A CB  1 
ATOM   3035  C CG  . LEU A  1 395 ? -7.110  -55.945 35.137  1.00 75.53  ? 395  LEU A CG  1 
ATOM   3036  C CD1 . LEU A  1 395 ? -5.971  -54.976 35.398  1.00 75.26  ? 395  LEU A CD1 1 
ATOM   3037  C CD2 . LEU A  1 395 ? -7.090  -56.363 33.703  1.00 77.43  ? 395  LEU A CD2 1 
ATOM   3038  N N   . VAL A  1 396 ? -8.405  -55.061 38.512  1.00 72.83  ? 396  VAL A N   1 
ATOM   3039  C CA  . VAL A  1 396 ? -9.591  -54.297 38.918  1.00 71.66  ? 396  VAL A CA  1 
ATOM   3040  C C   . VAL A  1 396 ? -9.839  -53.109 37.995  1.00 74.62  ? 396  VAL A C   1 
ATOM   3041  O O   . VAL A  1 396 ? -10.992 -52.813 37.664  1.00 74.28  ? 396  VAL A O   1 
ATOM   3042  C CB  . VAL A  1 396 ? -9.458  -53.832 40.387  1.00 75.62  ? 396  VAL A CB  1 
ATOM   3043  C CG1 . VAL A  1 396 ? -10.638 -52.971 40.808  1.00 74.39  ? 396  VAL A CG1 1 
ATOM   3044  C CG2 . VAL A  1 396 ? -9.308  -55.014 41.331  1.00 77.73  ? 396  VAL A CG2 1 
ATOM   3045  N N   . THR A  1 397 ? -8.752  -52.417 37.610  1.00 70.26  ? 397  THR A N   1 
ATOM   3046  C CA  . THR A  1 397 ? -8.814  -51.207 36.812  1.00 68.61  ? 397  THR A CA  1 
ATOM   3047  C C   . THR A  1 397 ? -7.955  -51.226 35.568  1.00 72.30  ? 397  THR A C   1 
ATOM   3048  O O   . THR A  1 397 ? -6.822  -51.712 35.581  1.00 73.94  ? 397  THR A O   1 
ATOM   3049  C CB  . THR A  1 397 ? -8.426  -49.996 37.711  1.00 79.64  ? 397  THR A CB  1 
ATOM   3050  O OG1 . THR A  1 397 ? -9.439  -49.791 38.688  1.00 82.33  ? 397  THR A OG1 1 
ATOM   3051  C CG2 . THR A  1 397 ? -8.221  -48.690 36.933  1.00 77.56  ? 397  THR A CG2 1 
ATOM   3052  N N   . ILE A  1 398 ? -8.495  -50.629 34.512  1.00 66.63  ? 398  ILE A N   1 
ATOM   3053  C CA  . ILE A  1 398 ? -7.833  -50.273 33.268  1.00 64.97  ? 398  ILE A CA  1 
ATOM   3054  C C   . ILE A  1 398 ? -8.091  -48.734 33.207  1.00 68.15  ? 398  ILE A C   1 
ATOM   3055  O O   . ILE A  1 398 ? -9.235  -48.292 33.122  1.00 68.89  ? 398  ILE A O   1 
ATOM   3056  C CB  . ILE A  1 398 ? -8.303  -51.076 32.007  1.00 67.24  ? 398  ILE A CB  1 
ATOM   3057  C CG1 . ILE A  1 398 ? -7.988  -52.568 32.154  1.00 66.78  ? 398  ILE A CG1 1 
ATOM   3058  C CG2 . ILE A  1 398 ? -7.634  -50.502 30.747  1.00 68.22  ? 398  ILE A CG2 1 
ATOM   3059  C CD1 . ILE A  1 398 ? -8.582  -53.428 31.179  1.00 65.84  ? 398  ILE A CD1 1 
ATOM   3060  N N   . GLY A  1 399 ? -7.051  -47.947 33.391  1.00 63.29  ? 399  GLY A N   1 
ATOM   3061  C CA  . GLY A  1 399 ? -7.160  -46.493 33.420  1.00 61.59  ? 399  GLY A CA  1 
ATOM   3062  C C   . GLY A  1 399 ? -7.428  -45.822 32.093  1.00 65.41  ? 399  GLY A C   1 
ATOM   3063  O O   . GLY A  1 399 ? -8.089  -44.794 32.058  1.00 65.54  ? 399  GLY A O   1 
ATOM   3064  N N   . GLY A  1 400 ? -6.896  -46.363 31.006  1.00 63.05  ? 400  GLY A N   1 
ATOM   3065  C CA  . GLY A  1 400 ? -7.073  -45.776 29.681  1.00 61.94  ? 400  GLY A CA  1 
ATOM   3066  C C   . GLY A  1 400 ? -6.395  -44.427 29.566  1.00 64.57  ? 400  GLY A C   1 
ATOM   3067  O O   . GLY A  1 400 ? -6.883  -43.551 28.849  1.00 64.65  ? 400  GLY A O   1 
ATOM   3068  N N   . ARG A  1 401 ? -5.275  -44.238 30.305  1.00 60.17  ? 401  ARG A N   1 
ATOM   3069  C CA  . ARG A  1 401 ? -4.478  -43.001 30.293  1.00 58.81  ? 401  ARG A CA  1 
ATOM   3070  C C   . ARG A  1 401 ? -3.689  -42.911 28.986  1.00 61.90  ? 401  ARG A C   1 
ATOM   3071  O O   . ARG A  1 401 ? -3.120  -41.857 28.668  1.00 61.78  ? 401  ARG A O   1 
ATOM   3072  C CB  . ARG A  1 401 ? -3.531  -42.947 31.494  1.00 57.31  ? 401  ARG A CB  1 
ATOM   3073  C CG  . ARG A  1 401 ? -4.252  -42.962 32.816  1.00 57.28  ? 401  ARG A CG  1 
ATOM   3074  C CD  . ARG A  1 401 ? -3.281  -42.927 33.960  1.00 52.73  ? 401  ARG A CD  1 
ATOM   3075  N NE  . ARG A  1 401 ? -3.948  -43.392 35.170  1.00 64.22  ? 401  ARG A NE  1 
ATOM   3076  C CZ  . ARG A  1 401 ? -3.335  -43.597 36.327  1.00 82.30  ? 401  ARG A CZ  1 
ATOM   3077  N NH1 . ARG A  1 401 ? -2.041  -43.348 36.451  1.00 61.58  ? 401  ARG A NH1 1 
ATOM   3078  N NH2 . ARG A  1 401 ? -4.012  -44.053 37.371  1.00 84.11  ? 401  ARG A NH2 1 
ATOM   3079  N N   . VAL A  1 402 ? -3.605  -44.056 28.276  1.00 57.74  ? 402  VAL A N   1 
ATOM   3080  C CA  . VAL A  1 402 ? -3.031  -44.232 26.948  1.00 58.53  ? 402  VAL A CA  1 
ATOM   3081  C C   . VAL A  1 402 ? -4.075  -45.067 26.194  1.00 64.65  ? 402  VAL A C   1 
ATOM   3082  O O   . VAL A  1 402 ? -4.609  -46.002 26.783  1.00 66.79  ? 402  VAL A O   1 
ATOM   3083  C CB  . VAL A  1 402 ? -1.657  -44.942 26.893  1.00 63.62  ? 402  VAL A CB  1 
ATOM   3084  C CG1 . VAL A  1 402 ? -1.014  -44.737 25.532  1.00 63.66  ? 402  VAL A CG1 1 
ATOM   3085  C CG2 . VAL A  1 402 ? -0.718  -44.471 27.985  1.00 63.93  ? 402  VAL A CG2 1 
ATOM   3086  N N   . LEU A  1 403 ? -4.378  -44.739 24.918  1.00 58.76  ? 403  LEU A N   1 
ATOM   3087  C CA  . LEU A  1 403 ? -5.348  -45.496 24.125  1.00 57.67  ? 403  LEU A CA  1 
ATOM   3088  C C   . LEU A  1 403 ? -4.765  -45.964 22.786  1.00 68.86  ? 403  LEU A C   1 
ATOM   3089  O O   . LEU A  1 403 ? -3.896  -45.291 22.219  1.00 70.47  ? 403  LEU A O   1 
ATOM   3090  C CB  . LEU A  1 403 ? -6.633  -44.683 23.899  1.00 55.24  ? 403  LEU A CB  1 
ATOM   3091  C CG  . LEU A  1 403 ? -7.341  -44.193 25.156  1.00 56.71  ? 403  LEU A CG  1 
ATOM   3092  C CD1 . LEU A  1 403 ? -8.458  -43.325 24.836  1.00 53.08  ? 403  LEU A CD1 1 
ATOM   3093  C CD2 . LEU A  1 403 ? -7.804  -45.330 26.005  1.00 62.53  ? 403  LEU A CD2 1 
ATOM   3094  N N   . TYR A  1 404 ? -5.216  -47.137 22.303  1.00 67.86  ? 404  TYR A N   1 
ATOM   3095  C CA  . TYR A  1 404 ? -4.822  -47.660 21.005  1.00 68.83  ? 404  TYR A CA  1 
ATOM   3096  C C   . TYR A  1 404 ? -6.051  -47.435 20.167  1.00 70.80  ? 404  TYR A C   1 
ATOM   3097  O O   . TYR A  1 404 ? -7.051  -48.117 20.364  1.00 69.59  ? 404  TYR A O   1 
ATOM   3098  C CB  . TYR A  1 404 ? -4.464  -49.146 21.091  1.00 72.71  ? 404  TYR A CB  1 
ATOM   3099  C CG  . TYR A  1 404 ? -4.047  -49.811 19.788  1.00 78.19  ? 404  TYR A CG  1 
ATOM   3100  C CD1 . TYR A  1 404 ? -2.774  -50.343 19.634  1.00 81.97  ? 404  TYR A CD1 1 
ATOM   3101  C CD2 . TYR A  1 404 ? -4.972  -50.052 18.777  1.00 80.14  ? 404  TYR A CD2 1 
ATOM   3102  C CE1 . TYR A  1 404 ? -2.407  -51.030 18.472  1.00 84.99  ? 404  TYR A CE1 1 
ATOM   3103  C CE2 . TYR A  1 404 ? -4.613  -50.717 17.605  1.00 82.79  ? 404  TYR A CE2 1 
ATOM   3104  C CZ  . TYR A  1 404 ? -3.332  -51.213 17.457  1.00 90.47  ? 404  TYR A CZ  1 
ATOM   3105  O OH  . TYR A  1 404 ? -3.015  -51.866 16.285  1.00 91.78  ? 404  TYR A OH  1 
ATOM   3106  N N   . SER A  1 405 ? -6.005  -46.418 19.295  1.00 67.65  ? 405  SER A N   1 
ATOM   3107  C CA  . SER A  1 405 ? -7.107  -46.022 18.408  1.00 67.19  ? 405  SER A CA  1 
ATOM   3108  C C   . SER A  1 405 ? -8.396  -45.788 19.198  1.00 69.75  ? 405  SER A C   1 
ATOM   3109  O O   . SER A  1 405 ? -9.489  -46.203 18.792  1.00 70.03  ? 405  SER A O   1 
ATOM   3110  C CB  . SER A  1 405 ? -7.306  -47.046 17.296  1.00 73.09  ? 405  SER A CB  1 
ATOM   3111  O OG  . SER A  1 405 ? -6.119  -47.180 16.534  1.00 92.00  ? 405  SER A OG  1 
ATOM   3112  N N   . GLY A  1 406 ? -8.244  -45.124 20.335  1.00 64.09  ? 406  GLY A N   1 
ATOM   3113  C CA  . GLY A  1 406 ? -9.356  -44.786 21.208  1.00 62.42  ? 406  GLY A CA  1 
ATOM   3114  C C   . GLY A  1 406 ? -9.843  -45.917 22.073  1.00 63.92  ? 406  GLY A C   1 
ATOM   3115  O O   . GLY A  1 406 ? -10.812 -45.725 22.821  1.00 66.06  ? 406  GLY A O   1 
ATOM   3116  N N   . LEU A  1 407 ? -9.180  -47.087 21.985  1.00 56.17  ? 407  LEU A N   1 
ATOM   3117  C CA  . LEU A  1 407 ? -9.558  -48.256 22.755  1.00 56.17  ? 407  LEU A CA  1 
ATOM   3118  C C   . LEU A  1 407 ? -8.697  -48.485 23.984  1.00 62.39  ? 407  LEU A C   1 
ATOM   3119  O O   . LEU A  1 407 ? -7.472  -48.308 23.933  1.00 62.81  ? 407  LEU A O   1 
ATOM   3120  C CB  . LEU A  1 407 ? -9.536  -49.515 21.884  1.00 56.91  ? 407  LEU A CB  1 
ATOM   3121  C CG  . LEU A  1 407 ? -10.125 -49.430 20.488  1.00 60.04  ? 407  LEU A CG  1 
ATOM   3122  C CD1 . LEU A  1 407 ? -9.660  -50.568 19.638  1.00 59.58  ? 407  LEU A CD1 1 
ATOM   3123  C CD2 . LEU A  1 407 ? -11.622 -49.359 20.530  1.00 62.45  ? 407  LEU A CD2 1 
ATOM   3124  N N   . SER A  1 408 ? -9.330  -48.943 25.080  1.00 59.57  ? 408  SER A N   1 
ATOM   3125  C CA  . SER A  1 408 ? -8.615  -49.280 26.319  1.00 59.83  ? 408  SER A CA  1 
ATOM   3126  C C   . SER A  1 408 ? -8.591  -50.793 26.575  1.00 64.62  ? 408  SER A C   1 
ATOM   3127  O O   . SER A  1 408 ? -7.824  -51.245 27.423  1.00 65.26  ? 408  SER A O   1 
ATOM   3128  C CB  . SER A  1 408 ? -9.174  -48.518 27.519  1.00 61.90  ? 408  SER A CB  1 
ATOM   3129  O OG  . SER A  1 408 ? -10.579 -48.652 27.649  1.00 63.46  ? 408  SER A OG  1 
ATOM   3130  N N   . LEU A  1 409 ? -9.431  -51.565 25.842  1.00 60.58  ? 409  LEU A N   1 
ATOM   3131  C CA  . LEU A  1 409 ? -9.535  -53.028 25.918  1.00 60.84  ? 409  LEU A CA  1 
ATOM   3132  C C   . LEU A  1 409 ? -9.776  -53.621 24.525  1.00 68.55  ? 409  LEU A C   1 
ATOM   3133  O O   . LEU A  1 409 ? -10.702 -53.225 23.804  1.00 69.14  ? 409  LEU A O   1 
ATOM   3134  C CB  . LEU A  1 409 ? -10.614 -53.495 26.903  1.00 60.09  ? 409  LEU A CB  1 
ATOM   3135  C CG  . LEU A  1 409 ? -10.608 -54.985 27.223  1.00 64.86  ? 409  LEU A CG  1 
ATOM   3136  C CD1 . LEU A  1 409 ? -9.305  -55.397 27.864  1.00 65.74  ? 409  LEU A CD1 1 
ATOM   3137  C CD2 . LEU A  1 409 ? -11.754 -55.353 28.115  1.00 64.80  ? 409  LEU A CD2 1 
ATOM   3138  N N   . LEU A  1 410 ? -8.925  -54.573 24.172  1.00 66.55  ? 410  LEU A N   1 
ATOM   3139  C CA  . LEU A  1 410 ? -8.897  -55.245 22.892  1.00 67.70  ? 410  LEU A CA  1 
ATOM   3140  C C   . LEU A  1 410 ? -8.771  -56.707 23.121  1.00 73.36  ? 410  LEU A C   1 
ATOM   3141  O O   . LEU A  1 410 ? -7.773  -57.157 23.708  1.00 75.91  ? 410  LEU A O   1 
ATOM   3142  C CB  . LEU A  1 410 ? -7.592  -54.875 22.179  1.00 68.38  ? 410  LEU A CB  1 
ATOM   3143  C CG  . LEU A  1 410 ? -7.498  -53.720 21.240  1.00 73.03  ? 410  LEU A CG  1 
ATOM   3144  C CD1 . LEU A  1 410 ? -8.329  -53.942 19.989  1.00 74.79  ? 410  LEU A CD1 1 
ATOM   3145  C CD2 . LEU A  1 410 ? -7.573  -52.372 21.960  1.00 72.00  ? 410  LEU A CD2 1 
ATOM   3146  N N   . ILE A  1 411 ? -9.705  -57.467 22.606  1.00 67.70  ? 411  ILE A N   1 
ATOM   3147  C CA  . ILE A  1 411 ? -9.594  -58.908 22.633  1.00 68.07  ? 411  ILE A CA  1 
ATOM   3148  C C   . ILE A  1 411 ? -10.057 -59.267 21.248  1.00 72.32  ? 411  ILE A C   1 
ATOM   3149  O O   . ILE A  1 411 ? -11.232 -59.063 20.929  1.00 72.16  ? 411  ILE A O   1 
ATOM   3150  C CB  . ILE A  1 411 ? -10.391 -59.600 23.770  1.00 70.97  ? 411  ILE A CB  1 
ATOM   3151  C CG1 . ILE A  1 411 ? -9.912  -59.151 25.164  1.00 69.95  ? 411  ILE A CG1 1 
ATOM   3152  C CG2 . ILE A  1 411 ? -10.258 -61.116 23.648  1.00 73.71  ? 411  ILE A CG2 1 
ATOM   3153  C CD1 . ILE A  1 411 ? -10.982 -58.869 26.114  1.00 69.38  ? 411  ILE A CD1 1 
ATOM   3154  N N   . LEU A  1 412 ? -9.125  -59.683 20.381  1.00 68.46  ? 412  LEU A N   1 
ATOM   3155  C CA  . LEU A  1 412 ? -9.507  -60.009 19.007  1.00 68.25  ? 412  LEU A CA  1 
ATOM   3156  C C   . LEU A  1 412 ? -8.848  -61.233 18.386  1.00 73.50  ? 412  LEU A C   1 
ATOM   3157  O O   . LEU A  1 412 ? -7.723  -61.603 18.753  1.00 73.25  ? 412  LEU A O   1 
ATOM   3158  C CB  . LEU A  1 412 ? -9.458  -58.779 18.065  1.00 66.66  ? 412  LEU A CB  1 
ATOM   3159  C CG  . LEU A  1 412 ? -8.081  -58.317 17.577  1.00 71.29  ? 412  LEU A CG  1 
ATOM   3160  C CD1 . LEU A  1 412 ? -8.177  -57.741 16.192  1.00 71.36  ? 412  LEU A CD1 1 
ATOM   3161  C CD2 . LEU A  1 412 ? -7.458  -57.311 18.538  1.00 74.04  ? 412  LEU A CD2 1 
ATOM   3162  N N   . LYS A  1 413 ? -9.579  -61.858 17.433  1.00 70.21  ? 413  LYS A N   1 
ATOM   3163  C CA  . LYS A  1 413 ? -9.144  -63.004 16.619  1.00 71.03  ? 413  LYS A CA  1 
ATOM   3164  C C   . LYS A  1 413 ? -8.778  -64.246 17.417  1.00 75.42  ? 413  LYS A C   1 
ATOM   3165  O O   . LYS A  1 413 ? -8.288  -65.213 16.831  1.00 79.09  ? 413  LYS A O   1 
ATOM   3166  C CB  . LYS A  1 413 ? -8.008  -62.607 15.637  1.00 72.40  ? 413  LYS A CB  1 
ATOM   3167  C CG  . LYS A  1 413 ? -8.316  -61.380 14.776  1.00 81.50  ? 413  LYS A CG  1 
ATOM   3168  C CD  . LYS A  1 413 ? -8.879  -61.727 13.396  1.00 85.91  ? 413  LYS A CD  1 
ATOM   3169  C CE  . LYS A  1 413 ? -9.154  -60.482 12.583  1.00 84.10  ? 413  LYS A CE  1 
ATOM   3170  N NZ  . LYS A  1 413 ? -9.157  -60.753 11.123  1.00 94.38  ? 413  LYS A NZ  1 
ATOM   3171  N N   . GLN A  1 414 ? -9.075  -64.257 18.729  1.00 69.25  ? 414  GLN A N   1 
ATOM   3172  C CA  . GLN A  1 414 ? -8.751  -65.386 19.601  1.00 70.64  ? 414  GLN A CA  1 
ATOM   3173  C C   . GLN A  1 414 ? -9.714  -66.561 19.537  1.00 75.13  ? 414  GLN A C   1 
ATOM   3174  O O   . GLN A  1 414 ? -10.810 -66.487 20.082  1.00 72.74  ? 414  GLN A O   1 
ATOM   3175  C CB  . GLN A  1 414 ? -8.405  -64.927 21.034  1.00 70.97  ? 414  GLN A CB  1 
ATOM   3176  C CG  . GLN A  1 414 ? -7.175  -64.007 21.112  1.00 84.60  ? 414  GLN A CG  1 
ATOM   3177  C CD  . GLN A  1 414 ? -6.021  -64.544 20.300  1.00 107.23 ? 414  GLN A CD  1 
ATOM   3178  O OE1 . GLN A  1 414 ? -5.401  -65.547 20.657  1.00 106.22 ? 414  GLN A OE1 1 
ATOM   3179  N NE2 . GLN A  1 414 ? -5.781  -63.957 19.135  1.00 99.41  ? 414  GLN A NE2 1 
ATOM   3180  N N   . GLN A  1 415 ? -9.306  -67.644 18.854  1.00 75.81  ? 415  GLN A N   1 
ATOM   3181  C CA  . GLN A  1 415 ? -10.168 -68.827 18.679  1.00 78.80  ? 415  GLN A CA  1 
ATOM   3182  C C   . GLN A  1 415 ? -10.276 -69.715 19.913  1.00 85.01  ? 415  GLN A C   1 
ATOM   3183  O O   . GLN A  1 415 ? -11.346 -70.273 20.167  1.00 85.14  ? 415  GLN A O   1 
ATOM   3184  C CB  . GLN A  1 415 ? -9.742  -69.670 17.467  1.00 82.32  ? 415  GLN A CB  1 
ATOM   3185  C CG  . GLN A  1 415 ? -9.743  -68.926 16.142  1.00 100.58 ? 415  GLN A CG  1 
ATOM   3186  C CD  . GLN A  1 415 ? -11.121 -68.539 15.693  1.00 119.45 ? 415  GLN A CD  1 
ATOM   3187  O OE1 . GLN A  1 415 ? -11.943 -69.392 15.325  1.00 116.78 ? 415  GLN A OE1 1 
ATOM   3188  N NE2 . GLN A  1 415 ? -11.389 -67.234 15.696  1.00 109.85 ? 415  GLN A NE2 1 
ATOM   3189  N N   . GLY A  1 416 ? -9.174  -69.833 20.655  1.00 82.04  ? 416  GLY A N   1 
ATOM   3190  C CA  . GLY A  1 416 ? -9.082  -70.684 21.834  1.00 82.83  ? 416  GLY A CA  1 
ATOM   3191  C C   . GLY A  1 416 ? -9.883  -70.277 23.049  1.00 84.78  ? 416  GLY A C   1 
ATOM   3192  O O   . GLY A  1 416 ? -10.158 -71.126 23.902  1.00 86.44  ? 416  GLY A O   1 
ATOM   3193  N N   . ILE A  1 417 ? -10.244 -68.989 23.149  1.00 78.09  ? 417  ILE A N   1 
ATOM   3194  C CA  . ILE A  1 417 ? -11.003 -68.465 24.280  1.00 77.03  ? 417  ILE A CA  1 
ATOM   3195  C C   . ILE A  1 417 ? -12.501 -68.753 24.204  1.00 82.88  ? 417  ILE A C   1 
ATOM   3196  O O   . ILE A  1 417 ? -13.130 -68.537 23.164  1.00 81.96  ? 417  ILE A O   1 
ATOM   3197  C CB  . ILE A  1 417 ? -10.676 -66.992 24.653  1.00 77.98  ? 417  ILE A CB  1 
ATOM   3198  C CG1 . ILE A  1 417 ? -10.915 -66.034 23.479  1.00 77.26  ? 417  ILE A CG1 1 
ATOM   3199  C CG2 . ILE A  1 417 ? -9.262  -66.853 25.223  1.00 78.23  ? 417  ILE A CG2 1 
ATOM   3200  C CD1 . ILE A  1 417 ? -11.631 -64.833 23.829  1.00 86.07  ? 417  ILE A CD1 1 
ATOM   3201  N N   . THR A  1 418 ? -13.063 -69.255 25.318  1.00 81.20  ? 418  THR A N   1 
ATOM   3202  C CA  . THR A  1 418 ? -14.483 -69.609 25.430  1.00 81.61  ? 418  THR A CA  1 
ATOM   3203  C C   . THR A  1 418 ? -15.229 -68.783 26.496  1.00 85.73  ? 418  THR A C   1 
ATOM   3204  O O   . THR A  1 418 ? -16.466 -68.732 26.485  1.00 86.57  ? 418  THR A O   1 
ATOM   3205  C CB  . THR A  1 418 ? -14.649 -71.120 25.582  1.00 90.24  ? 418  THR A CB  1 
ATOM   3206  O OG1 . THR A  1 418 ? -13.935 -71.545 26.742  1.00 96.54  ? 418  THR A OG1 1 
ATOM   3207  C CG2 . THR A  1 418 ? -14.174 -71.894 24.351  1.00 86.57  ? 418  THR A CG2 1 
ATOM   3208  N N   . SER A  1 419 ? -14.466 -68.154 27.414  1.00 80.16  ? 419  SER A N   1 
ATOM   3209  C CA  . SER A  1 419 ? -14.941 -67.259 28.464  1.00 78.13  ? 419  SER A CA  1 
ATOM   3210  C C   . SER A  1 419 ? -13.828 -66.230 28.703  1.00 81.49  ? 419  SER A C   1 
ATOM   3211  O O   . SER A  1 419 ? -12.711 -66.398 28.188  1.00 81.97  ? 419  SER A O   1 
ATOM   3212  C CB  . SER A  1 419 ? -15.320 -68.014 29.738  1.00 82.07  ? 419  SER A CB  1 
ATOM   3213  O OG  . SER A  1 419 ? -14.206 -68.590 30.397  1.00 91.37  ? 419  SER A OG  1 
ATOM   3214  N N   . LEU A  1 420 ? -14.152 -65.129 29.402  1.00 75.54  ? 420  LEU A N   1 
ATOM   3215  C CA  . LEU A  1 420 ? -13.194 -64.062 29.642  1.00 73.60  ? 420  LEU A CA  1 
ATOM   3216  C C   . LEU A  1 420 ? -12.497 -64.248 30.972  1.00 80.11  ? 420  LEU A C   1 
ATOM   3217  O O   . LEU A  1 420 ? -11.266 -64.351 30.995  1.00 80.62  ? 420  LEU A O   1 
ATOM   3218  C CB  . LEU A  1 420 ? -13.877 -62.689 29.551  1.00 71.44  ? 420  LEU A CB  1 
ATOM   3219  C CG  . LEU A  1 420 ? -14.231 -62.178 28.158  1.00 73.97  ? 420  LEU A CG  1 
ATOM   3220  C CD1 . LEU A  1 420 ? -15.009 -60.919 28.264  1.00 72.16  ? 420  LEU A CD1 1 
ATOM   3221  C CD2 . LEU A  1 420 ? -12.981 -61.948 27.307  1.00 75.23  ? 420  LEU A CD2 1 
ATOM   3222  N N   . GLN A  1 421 ? -13.285 -64.321 32.077  1.00 77.40  ? 421  GLN A N   1 
ATOM   3223  C CA  . GLN A  1 421 ? -12.833 -64.546 33.454  1.00 77.90  ? 421  GLN A CA  1 
ATOM   3224  C C   . GLN A  1 421 ? -12.021 -63.411 34.093  1.00 81.98  ? 421  GLN A C   1 
ATOM   3225  O O   . GLN A  1 421 ? -11.083 -63.636 34.875  1.00 83.81  ? 421  GLN A O   1 
ATOM   3226  C CB  . GLN A  1 421 ? -12.275 -65.969 33.670  1.00 81.45  ? 421  GLN A CB  1 
ATOM   3227  C CG  . GLN A  1 421 ? -13.280 -67.021 33.179  1.00 103.30 ? 421  GLN A CG  1 
ATOM   3228  C CD  . GLN A  1 421 ? -13.229 -68.389 33.813  1.00 128.19 ? 421  GLN A CD  1 
ATOM   3229  O OE1 . GLN A  1 421 ? -14.049 -69.258 33.491  1.00 124.08 ? 421  GLN A OE1 1 
ATOM   3230  N NE2 . GLN A  1 421 ? -12.302 -68.619 34.738  1.00 124.60 ? 421  GLN A NE2 1 
ATOM   3231  N N   . PHE A  1 422 ? -12.455 -62.171 33.813  1.00 75.74  ? 422  PHE A N   1 
ATOM   3232  C CA  . PHE A  1 422 ? -11.866 -60.958 34.383  1.00 73.46  ? 422  PHE A CA  1 
ATOM   3233  C C   . PHE A  1 422 ? -12.517 -60.671 35.736  1.00 79.39  ? 422  PHE A C   1 
ATOM   3234  O O   . PHE A  1 422 ? -12.711 -59.509 36.089  1.00 76.95  ? 422  PHE A O   1 
ATOM   3235  C CB  . PHE A  1 422 ? -12.008 -59.750 33.424  1.00 72.06  ? 422  PHE A CB  1 
ATOM   3236  C CG  . PHE A  1 422 ? -11.091 -59.780 32.225  1.00 71.24  ? 422  PHE A CG  1 
ATOM   3237  C CD1 . PHE A  1 422 ? -11.609 -59.881 30.937  1.00 71.75  ? 422  PHE A CD1 1 
ATOM   3238  C CD2 . PHE A  1 422 ? -9.704  -59.729 32.386  1.00 71.38  ? 422  PHE A CD2 1 
ATOM   3239  C CE1 . PHE A  1 422 ? -10.755 -59.941 29.832  1.00 71.86  ? 422  PHE A CE1 1 
ATOM   3240  C CE2 . PHE A  1 422 ? -8.855  -59.799 31.283  1.00 72.93  ? 422  PHE A CE2 1 
ATOM   3241  C CZ  . PHE A  1 422 ? -9.385  -59.901 30.013  1.00 70.40  ? 422  PHE A CZ  1 
ATOM   3242  N N   . GLN A  1 423 ? -12.826 -61.753 36.491  1.00 79.09  ? 423  GLN A N   1 
ATOM   3243  C CA  . GLN A  1 423 ? -13.427 -61.838 37.826  1.00 79.90  ? 423  GLN A CA  1 
ATOM   3244  C C   . GLN A  1 423 ? -13.377 -60.560 38.703  1.00 84.66  ? 423  GLN A C   1 
ATOM   3245  O O   . GLN A  1 423 ? -14.433 -60.043 39.083  1.00 85.03  ? 423  GLN A O   1 
ATOM   3246  C CB  . GLN A  1 423 ? -12.812 -63.029 38.561  1.00 83.00  ? 423  GLN A CB  1 
ATOM   3247  C CG  . GLN A  1 423 ? -13.559 -63.436 39.808  1.00 95.39  ? 423  GLN A CG  1 
ATOM   3248  C CD  . GLN A  1 423 ? -12.850 -64.549 40.515  1.00 111.27 ? 423  GLN A CD  1 
ATOM   3249  O OE1 . GLN A  1 423 ? -11.654 -64.473 40.821  1.00 102.34 ? 423  GLN A OE1 1 
ATOM   3250  N NE2 . GLN A  1 423 ? -13.585 -65.598 40.821  1.00 111.17 ? 423  GLN A NE2 1 
ATOM   3251  N N   . SER A  1 424 ? -12.170 -60.050 39.008  1.00 80.82  ? 424  SER A N   1 
ATOM   3252  C CA  . SER A  1 424 ? -12.035 -58.848 39.838  1.00 79.71  ? 424  SER A CA  1 
ATOM   3253  C C   . SER A  1 424 ? -12.342 -57.515 39.142  1.00 80.01  ? 424  SER A C   1 
ATOM   3254  O O   . SER A  1 424 ? -12.500 -56.530 39.867  1.00 80.16  ? 424  SER A O   1 
ATOM   3255  C CB  . SER A  1 424 ? -10.672 -58.789 40.537  1.00 84.15  ? 424  SER A CB  1 
ATOM   3256  O OG  . SER A  1 424 ? -10.537 -59.768 41.557  1.00 94.29  ? 424  SER A OG  1 
ATOM   3257  N N   . LEU A  1 425 ? -12.408 -57.468 37.770  1.00 73.17  ? 425  LEU A N   1 
ATOM   3258  C CA  . LEU A  1 425 ? -12.651 -56.245 36.956  1.00 70.29  ? 425  LEU A CA  1 
ATOM   3259  C C   . LEU A  1 425 ? -13.889 -55.473 37.344  1.00 73.50  ? 425  LEU A C   1 
ATOM   3260  O O   . LEU A  1 425 ? -15.003 -56.032 37.402  1.00 74.70  ? 425  LEU A O   1 
ATOM   3261  C CB  . LEU A  1 425 ? -12.639 -56.504 35.423  1.00 69.09  ? 425  LEU A CB  1 
ATOM   3262  C CG  . LEU A  1 425 ? -12.439 -55.300 34.492  1.00 68.93  ? 425  LEU A CG  1 
ATOM   3263  C CD1 . LEU A  1 425 ? -11.073 -54.698 34.680  1.00 68.82  ? 425  LEU A CD1 1 
ATOM   3264  C CD2 . LEU A  1 425 ? -12.557 -55.709 33.049  1.00 65.00  ? 425  LEU A CD2 1 
ATOM   3265  N N   . LYS A  1 426 ? -13.678 -54.182 37.605  1.00 67.83  ? 426  LYS A N   1 
ATOM   3266  C CA  . LYS A  1 426 ? -14.727 -53.283 38.057  1.00 67.72  ? 426  LYS A CA  1 
ATOM   3267  C C   . LYS A  1 426 ? -14.698 -51.913 37.337  1.00 72.61  ? 426  LYS A C   1 
ATOM   3268  O O   . LYS A  1 426 ? -15.734 -51.237 37.272  1.00 71.80  ? 426  LYS A O   1 
ATOM   3269  C CB  . LYS A  1 426 ? -14.632 -53.079 39.591  1.00 69.79  ? 426  LYS A CB  1 
ATOM   3270  C CG  . LYS A  1 426 ? -14.972 -54.294 40.452  1.00 80.31  ? 426  LYS A CG  1 
ATOM   3271  C CD  . LYS A  1 426 ? -16.458 -54.354 40.905  1.00 94.67  ? 426  LYS A CD  1 
ATOM   3272  C CE  . LYS A  1 426 ? -16.970 -55.763 41.178  1.00 114.75 ? 426  LYS A CE  1 
ATOM   3273  N NZ  . LYS A  1 426 ? -17.291 -56.537 39.932  1.00 120.23 ? 426  LYS A NZ  1 
ATOM   3274  N N   . GLU A  1 427 ? -13.526 -51.508 36.800  1.00 69.63  ? 427  GLU A N   1 
ATOM   3275  C CA  . GLU A  1 427 ? -13.378 -50.199 36.171  1.00 69.05  ? 427  GLU A CA  1 
ATOM   3276  C C   . GLU A  1 427 ? -12.518 -50.105 34.899  1.00 71.70  ? 427  GLU A C   1 
ATOM   3277  O O   . GLU A  1 427 ? -11.371 -50.548 34.890  1.00 73.11  ? 427  GLU A O   1 
ATOM   3278  C CB  . GLU A  1 427 ? -12.801 -49.253 37.213  1.00 71.03  ? 427  GLU A CB  1 
ATOM   3279  C CG  . GLU A  1 427 ? -13.058 -47.783 36.940  1.00 90.92  ? 427  GLU A CG  1 
ATOM   3280  C CD  . GLU A  1 427 ? -12.511 -46.845 38.002  1.00 118.91 ? 427  GLU A CD  1 
ATOM   3281  O OE1 . GLU A  1 427 ? -12.033 -47.332 39.057  1.00 109.72 ? 427  GLU A OE1 1 
ATOM   3282  O OE2 . GLU A  1 427 ? -12.562 -45.614 37.771  1.00 111.33 ? 427  GLU A OE2 1 
ATOM   3283  N N   . ILE A  1 428 ? -13.076 -49.481 33.852  1.00 65.53  ? 428  ILE A N   1 
ATOM   3284  C CA  . ILE A  1 428 ? -12.445 -49.131 32.570  1.00 64.44  ? 428  ILE A CA  1 
ATOM   3285  C C   . ILE A  1 428 ? -12.722 -47.595 32.450  1.00 66.49  ? 428  ILE A C   1 
ATOM   3286  O O   . ILE A  1 428 ? -13.759 -47.168 31.903  1.00 65.78  ? 428  ILE A O   1 
ATOM   3287  C CB  . ILE A  1 428 ? -12.982 -49.986 31.375  1.00 67.95  ? 428  ILE A CB  1 
ATOM   3288  C CG1 . ILE A  1 428 ? -12.629 -51.480 31.580  1.00 69.90  ? 428  ILE A CG1 1 
ATOM   3289  C CG2 . ILE A  1 428 ? -12.421 -49.494 30.037  1.00 66.61  ? 428  ILE A CG2 1 
ATOM   3290  C CD1 . ILE A  1 428 ? -13.532 -52.481 30.934  1.00 73.38  ? 428  ILE A CD1 1 
ATOM   3291  N N   . SER A  1 429 ? -11.826 -46.791 33.080  1.00 59.82  ? 429  SER A N   1 
ATOM   3292  C CA  . SER A  1 429 ? -11.937 -45.349 33.232  1.00 58.22  ? 429  SER A CA  1 
ATOM   3293  C C   . SER A  1 429 ? -12.091 -44.547 31.959  1.00 64.16  ? 429  SER A C   1 
ATOM   3294  O O   . SER A  1 429 ? -12.848 -43.565 31.932  1.00 66.07  ? 429  SER A O   1 
ATOM   3295  C CB  . SER A  1 429 ? -10.778 -44.804 34.050  1.00 60.85  ? 429  SER A CB  1 
ATOM   3296  O OG  . SER A  1 429 ? -10.541 -45.536 35.238  1.00 69.55  ? 429  SER A OG  1 
ATOM   3297  N N   . ALA A  1 430 ? -11.327 -44.897 30.931  1.00 59.57  ? 430  ALA A N   1 
ATOM   3298  C CA  . ALA A  1 430 ? -11.366 -44.180 29.669  1.00 58.50  ? 430  ALA A CA  1 
ATOM   3299  C C   . ALA A  1 430 ? -11.272 -45.174 28.547  1.00 64.25  ? 430  ALA A C   1 
ATOM   3300  O O   . ALA A  1 430 ? -11.040 -46.356 28.796  1.00 65.92  ? 430  ALA A O   1 
ATOM   3301  C CB  . ALA A  1 430 ? -10.215 -43.206 29.601  1.00 58.49  ? 430  ALA A CB  1 
ATOM   3302  N N   . GLY A  1 431 ? -11.504 -44.711 27.328  1.00 60.33  ? 431  GLY A N   1 
ATOM   3303  C CA  . GLY A  1 431 ? -11.427 -45.553 26.137  1.00 60.41  ? 431  GLY A CA  1 
ATOM   3304  C C   . GLY A  1 431 ? -12.608 -46.466 25.889  1.00 63.85  ? 431  GLY A C   1 
ATOM   3305  O O   . GLY A  1 431 ? -13.461 -46.669 26.755  1.00 62.00  ? 431  GLY A O   1 
ATOM   3306  N N   . ASN A  1 432 ? -12.652 -47.015 24.683  1.00 61.55  ? 432  ASN A N   1 
ATOM   3307  C CA  . ASN A  1 432 ? -13.677 -47.942 24.259  1.00 62.73  ? 432  ASN A CA  1 
ATOM   3308  C C   . ASN A  1 432 ? -13.188 -49.392 24.283  1.00 69.54  ? 432  ASN A C   1 
ATOM   3309  O O   . ASN A  1 432 ? -11.985 -49.668 24.343  1.00 69.31  ? 432  ASN A O   1 
ATOM   3310  C CB  . ASN A  1 432 ? -14.140 -47.569 22.871  1.00 66.04  ? 432  ASN A CB  1 
ATOM   3311  C CG  . ASN A  1 432 ? -14.618 -46.157 22.735  1.00 83.88  ? 432  ASN A CG  1 
ATOM   3312  O OD1 . ASN A  1 432 ? -15.328 -45.619 23.594  1.00 78.33  ? 432  ASN A OD1 1 
ATOM   3313  N ND2 . ASN A  1 432 ? -14.259 -45.547 21.622  1.00 75.88  ? 432  ASN A ND2 1 
ATOM   3314  N N   . ILE A  1 433 ? -14.136 -50.314 24.219  1.00 69.01  ? 433  ILE A N   1 
ATOM   3315  C CA  . ILE A  1 433 ? -13.874 -51.746 24.223  1.00 70.46  ? 433  ILE A CA  1 
ATOM   3316  C C   . ILE A  1 433 ? -14.090 -52.325 22.832  1.00 73.59  ? 433  ILE A C   1 
ATOM   3317  O O   . ILE A  1 433 ? -15.042 -51.970 22.147  1.00 70.79  ? 433  ILE A O   1 
ATOM   3318  C CB  . ILE A  1 433 ? -14.726 -52.432 25.301  1.00 74.57  ? 433  ILE A CB  1 
ATOM   3319  C CG1 . ILE A  1 433 ? -14.313 -51.926 26.678  1.00 74.46  ? 433  ILE A CG1 1 
ATOM   3320  C CG2 . ILE A  1 433 ? -14.590 -53.952 25.230  1.00 77.92  ? 433  ILE A CG2 1 
ATOM   3321  C CD1 . ILE A  1 433 ? -15.250 -52.316 27.710  1.00 87.38  ? 433  ILE A CD1 1 
ATOM   3322  N N   . TYR A  1 434 ? -13.190 -53.217 22.431  1.00 72.35  ? 434  TYR A N   1 
ATOM   3323  C CA  . TYR A  1 434 ? -13.224 -53.844 21.129  1.00 73.99  ? 434  TYR A CA  1 
ATOM   3324  C C   . TYR A  1 434 ? -12.999 -55.353 21.297  1.00 79.12  ? 434  TYR A C   1 
ATOM   3325  O O   . TYR A  1 434 ? -11.866 -55.809 21.456  1.00 79.70  ? 434  TYR A O   1 
ATOM   3326  C CB  . TYR A  1 434 ? -12.148 -53.187 20.264  1.00 75.40  ? 434  TYR A CB  1 
ATOM   3327  C CG  . TYR A  1 434 ? -12.144 -53.597 18.812  1.00 79.45  ? 434  TYR A CG  1 
ATOM   3328  C CD1 . TYR A  1 434 ? -12.973 -52.969 17.888  1.00 80.36  ? 434  TYR A CD1 1 
ATOM   3329  C CD2 . TYR A  1 434 ? -11.230 -54.534 18.335  1.00 82.31  ? 434  TYR A CD2 1 
ATOM   3330  C CE1 . TYR A  1 434 ? -12.936 -53.308 16.535  1.00 81.01  ? 434  TYR A CE1 1 
ATOM   3331  C CE2 . TYR A  1 434 ? -11.174 -54.869 16.982  1.00 84.60  ? 434  TYR A CE2 1 
ATOM   3332  C CZ  . TYR A  1 434 ? -12.029 -54.255 16.087  1.00 91.33  ? 434  TYR A CZ  1 
ATOM   3333  O OH  . TYR A  1 434 ? -11.979 -54.616 14.764  1.00 99.19  ? 434  TYR A OH  1 
ATOM   3334  N N   . ILE A  1 435 ? -14.098 -56.117 21.321  1.00 74.96  ? 435  ILE A N   1 
ATOM   3335  C CA  . ILE A  1 435 ? -14.072 -57.566 21.473  1.00 74.99  ? 435  ILE A CA  1 
ATOM   3336  C C   . ILE A  1 435 ? -14.665 -58.151 20.211  1.00 80.39  ? 435  ILE A C   1 
ATOM   3337  O O   . ILE A  1 435 ? -15.890 -58.164 20.057  1.00 79.71  ? 435  ILE A O   1 
ATOM   3338  C CB  . ILE A  1 435 ? -14.773 -58.044 22.779  1.00 77.12  ? 435  ILE A CB  1 
ATOM   3339  C CG1 . ILE A  1 435 ? -14.061 -57.444 24.011  1.00 75.57  ? 435  ILE A CG1 1 
ATOM   3340  C CG2 . ILE A  1 435 ? -14.796 -59.578 22.849  1.00 78.49  ? 435  ILE A CG2 1 
ATOM   3341  C CD1 . ILE A  1 435 ? -14.728 -57.586 25.255  1.00 76.03  ? 435  ILE A CD1 1 
ATOM   3342  N N   . THR A  1 436 ? -13.793 -58.569 19.270  1.00 77.61  ? 436  THR A N   1 
ATOM   3343  C CA  . THR A  1 436 ? -14.241 -59.092 17.976  1.00 78.10  ? 436  THR A CA  1 
ATOM   3344  C C   . THR A  1 436 ? -13.523 -60.356 17.527  1.00 83.02  ? 436  THR A C   1 
ATOM   3345  O O   . THR A  1 436 ? -12.389 -60.605 17.941  1.00 83.19  ? 436  THR A O   1 
ATOM   3346  C CB  . THR A  1 436 ? -14.060 -58.038 16.859  1.00 83.05  ? 436  THR A CB  1 
ATOM   3347  O OG1 . THR A  1 436 ? -12.664 -57.803 16.641  1.00 78.64  ? 436  THR A OG1 1 
ATOM   3348  C CG2 . THR A  1 436 ? -14.805 -56.736 17.125  1.00 82.19  ? 436  THR A CG2 1 
ATOM   3349  N N   . ASP A  1 437 ? -14.175 -61.113 16.608  1.00 79.10  ? 437  ASP A N   1 
ATOM   3350  C CA  . ASP A  1 437 ? -13.648 -62.292 15.920  1.00 79.92  ? 437  ASP A CA  1 
ATOM   3351  C C   . ASP A  1 437 ? -13.120 -63.434 16.809  1.00 82.22  ? 437  ASP A C   1 
ATOM   3352  O O   . ASP A  1 437 ? -12.345 -64.274 16.345  1.00 83.08  ? 437  ASP A O   1 
ATOM   3353  C CB  . ASP A  1 437 ? -12.644 -61.871 14.824  1.00 82.76  ? 437  ASP A CB  1 
ATOM   3354  C CG  . ASP A  1 437 ? -13.101 -60.682 13.972  1.00 101.74 ? 437  ASP A CG  1 
ATOM   3355  O OD1 . ASP A  1 437 ? -14.050 -60.853 13.158  1.00 102.61 ? 437  ASP A OD1 1 
ATOM   3356  O OD2 . ASP A  1 437 ? -12.504 -59.578 14.115  1.00 112.06 ? 437  ASP A OD2 1 
ATOM   3357  N N   . ASN A  1 438 ? -13.588 -63.499 18.066  1.00 76.60  ? 438  ASN A N   1 
ATOM   3358  C CA  . ASN A  1 438 ? -13.250 -64.566 19.013  1.00 76.78  ? 438  ASN A CA  1 
ATOM   3359  C C   . ASN A  1 438 ? -14.379 -65.575 18.918  1.00 79.68  ? 438  ASN A C   1 
ATOM   3360  O O   . ASN A  1 438 ? -15.253 -65.639 19.776  1.00 79.63  ? 438  ASN A O   1 
ATOM   3361  C CB  . ASN A  1 438 ? -13.111 -64.004 20.433  1.00 78.52  ? 438  ASN A CB  1 
ATOM   3362  C CG  . ASN A  1 438 ? -12.208 -62.805 20.511  1.00 96.18  ? 438  ASN A CG  1 
ATOM   3363  O OD1 . ASN A  1 438 ? -10.996 -62.894 20.284  1.00 91.17  ? 438  ASN A OD1 1 
ATOM   3364  N ND2 . ASN A  1 438 ? -12.799 -61.646 20.754  1.00 82.85  ? 438  ASN A ND2 1 
ATOM   3365  N N   . SER A  1 439 ? -14.380 -66.322 17.821  1.00 76.16  ? 439  SER A N   1 
ATOM   3366  C CA  . SER A  1 439 ? -15.420 -67.266 17.386  1.00 76.83  ? 439  SER A CA  1 
ATOM   3367  C C   . SER A  1 439 ? -16.074 -68.176 18.404  1.00 79.68  ? 439  SER A C   1 
ATOM   3368  O O   . SER A  1 439 ? -17.216 -68.590 18.199  1.00 78.62  ? 439  SER A O   1 
ATOM   3369  C CB  . SER A  1 439 ? -14.941 -68.064 16.182  1.00 82.45  ? 439  SER A CB  1 
ATOM   3370  O OG  . SER A  1 439 ? -14.632 -67.174 15.122  1.00 94.66  ? 439  SER A OG  1 
ATOM   3371  N N   . ASN A  1 440 ? -15.369 -68.465 19.506  1.00 77.57  ? 440  ASN A N   1 
ATOM   3372  C CA  . ASN A  1 440 ? -15.842 -69.387 20.538  1.00 78.79  ? 440  ASN A CA  1 
ATOM   3373  C C   . ASN A  1 440 ? -16.088 -68.751 21.897  1.00 81.44  ? 440  ASN A C   1 
ATOM   3374  O O   . ASN A  1 440 ? -16.526 -69.457 22.813  1.00 83.65  ? 440  ASN A O   1 
ATOM   3375  C CB  . ASN A  1 440 ? -14.912 -70.595 20.635  1.00 79.27  ? 440  ASN A CB  1 
ATOM   3376  C CG  . ASN A  1 440 ? -14.725 -71.291 19.311  1.00 87.51  ? 440  ASN A CG  1 
ATOM   3377  O OD1 . ASN A  1 440 ? -15.671 -71.816 18.717  1.00 74.89  ? 440  ASN A OD1 1 
ATOM   3378  N ND2 . ASN A  1 440 ? -13.508 -71.251 18.793  1.00 79.86  ? 440  ASN A ND2 1 
ATOM   3379  N N   . LEU A  1 441 ? -15.866 -67.425 22.018  1.00 73.33  ? 441  LEU A N   1 
ATOM   3380  C CA  . LEU A  1 441 ? -16.123 -66.663 23.239  1.00 71.72  ? 441  LEU A CA  1 
ATOM   3381  C C   . LEU A  1 441 ? -17.621 -66.633 23.522  1.00 77.71  ? 441  LEU A C   1 
ATOM   3382  O O   . LEU A  1 441 ? -18.405 -66.436 22.588  1.00 75.25  ? 441  LEU A O   1 
ATOM   3383  C CB  . LEU A  1 441 ? -15.559 -65.250 23.125  1.00 69.59  ? 441  LEU A CB  1 
ATOM   3384  C CG  . LEU A  1 441 ? -15.671 -64.397 24.366  1.00 73.03  ? 441  LEU A CG  1 
ATOM   3385  C CD1 . LEU A  1 441 ? -14.947 -65.041 25.534  1.00 74.79  ? 441  LEU A CD1 1 
ATOM   3386  C CD2 . LEU A  1 441 ? -15.126 -63.034 24.115  1.00 72.08  ? 441  LEU A CD2 1 
ATOM   3387  N N   . CYS A  1 442 ? -18.017 -66.824 24.807  1.00 78.96  ? 442  CYS A N   1 
ATOM   3388  C CA  . CYS A  1 442 ? -19.418 -67.003 25.168  1.00 81.33  ? 442  CYS A CA  1 
ATOM   3389  C C   . CYS A  1 442 ? -20.064 -66.192 26.271  1.00 84.50  ? 442  CYS A C   1 
ATOM   3390  O O   . CYS A  1 442 ? -21.278 -66.378 26.475  1.00 87.34  ? 442  CYS A O   1 
ATOM   3391  C CB  . CYS A  1 442 ? -19.714 -68.489 25.360  1.00 85.26  ? 442  CYS A CB  1 
ATOM   3392  S SG  . CYS A  1 442 ? -20.710 -69.232 24.042  1.00 91.75  ? 442  CYS A SG  1 
ATOM   3393  N N   . TYR A  1 443 ? -19.339 -65.398 27.053  1.00 75.51  ? 443  TYR A N   1 
ATOM   3394  C CA  . TYR A  1 443 ? -20.133 -64.787 28.129  1.00 73.54  ? 443  TYR A CA  1 
ATOM   3395  C C   . TYR A  1 443 ? -20.322 -63.283 28.012  1.00 74.63  ? 443  TYR A C   1 
ATOM   3396  O O   . TYR A  1 443 ? -21.175 -62.682 28.676  1.00 71.27  ? 443  TYR A O   1 
ATOM   3397  C CB  . TYR A  1 443 ? -19.648 -65.257 29.512  1.00 75.12  ? 443  TYR A CB  1 
ATOM   3398  C CG  . TYR A  1 443 ? -19.825 -66.744 29.747  1.00 79.22  ? 443  TYR A CG  1 
ATOM   3399  C CD1 . TYR A  1 443 ? -18.931 -67.672 29.207  1.00 82.62  ? 443  TYR A CD1 1 
ATOM   3400  C CD2 . TYR A  1 443 ? -20.854 -67.225 30.552  1.00 80.97  ? 443  TYR A CD2 1 
ATOM   3401  C CE1 . TYR A  1 443 ? -19.108 -69.045 29.395  1.00 85.90  ? 443  TYR A CE1 1 
ATOM   3402  C CE2 . TYR A  1 443 ? -21.025 -68.596 30.773  1.00 84.03  ? 443  TYR A CE2 1 
ATOM   3403  C CZ  . TYR A  1 443 ? -20.158 -69.504 30.180  1.00 93.38  ? 443  TYR A CZ  1 
ATOM   3404  O OH  . TYR A  1 443 ? -20.337 -70.859 30.373  1.00 95.21  ? 443  TYR A OH  1 
ATOM   3405  N N   . TYR A  1 444 ? -19.525 -62.699 27.100  1.00 71.95  ? 444  TYR A N   1 
ATOM   3406  C CA  . TYR A  1 444 ? -19.395 -61.291 26.726  1.00 68.92  ? 444  TYR A CA  1 
ATOM   3407  C C   . TYR A  1 444 ? -20.739 -60.561 26.541  1.00 74.49  ? 444  TYR A C   1 
ATOM   3408  O O   . TYR A  1 444 ? -20.855 -59.397 26.923  1.00 73.46  ? 444  TYR A O   1 
ATOM   3409  C CB  . TYR A  1 444 ? -18.521 -61.205 25.453  1.00 67.66  ? 444  TYR A CB  1 
ATOM   3410  C CG  . TYR A  1 444 ? -19.235 -61.685 24.213  1.00 69.34  ? 444  TYR A CG  1 
ATOM   3411  C CD1 . TYR A  1 444 ? -19.830 -60.782 23.336  1.00 70.74  ? 444  TYR A CD1 1 
ATOM   3412  C CD2 . TYR A  1 444 ? -19.405 -63.043 23.964  1.00 72.45  ? 444  TYR A CD2 1 
ATOM   3413  C CE1 . TYR A  1 444 ? -20.564 -61.214 22.234  1.00 73.21  ? 444  TYR A CE1 1 
ATOM   3414  C CE2 . TYR A  1 444 ? -20.124 -63.492 22.851  1.00 75.04  ? 444  TYR A CE2 1 
ATOM   3415  C CZ  . TYR A  1 444 ? -20.704 -62.569 21.990  1.00 83.17  ? 444  TYR A CZ  1 
ATOM   3416  O OH  . TYR A  1 444 ? -21.392 -62.964 20.872  1.00 85.07  ? 444  TYR A OH  1 
ATOM   3417  N N   . HIS A  1 445 ? -21.744 -61.257 25.968  1.00 73.16  ? 445  HIS A N   1 
ATOM   3418  C CA  . HIS A  1 445 ? -23.062 -60.720 25.635  1.00 73.22  ? 445  HIS A CA  1 
ATOM   3419  C C   . HIS A  1 445 ? -23.985 -60.465 26.814  1.00 77.72  ? 445  HIS A C   1 
ATOM   3420  O O   . HIS A  1 445 ? -25.015 -59.806 26.631  1.00 78.65  ? 445  HIS A O   1 
ATOM   3421  C CB  . HIS A  1 445 ? -23.744 -61.588 24.574  1.00 75.96  ? 445  HIS A CB  1 
ATOM   3422  C CG  . HIS A  1 445 ? -24.091 -62.966 25.047  1.00 81.67  ? 445  HIS A CG  1 
ATOM   3423  N ND1 . HIS A  1 445 ? -25.281 -63.227 25.716  1.00 84.59  ? 445  HIS A ND1 1 
ATOM   3424  C CD2 . HIS A  1 445 ? -23.397 -64.122 24.921  1.00 85.22  ? 445  HIS A CD2 1 
ATOM   3425  C CE1 . HIS A  1 445 ? -25.267 -64.526 25.980  1.00 85.96  ? 445  HIS A CE1 1 
ATOM   3426  N NE2 . HIS A  1 445 ? -24.156 -65.109 25.523  1.00 86.64  ? 445  HIS A NE2 1 
ATOM   3427  N N   . THR A  1 446 ? -23.626 -60.966 28.015  1.00 73.79  ? 446  THR A N   1 
ATOM   3428  C CA  . THR A  1 446 ? -24.404 -60.810 29.254  1.00 73.74  ? 446  THR A CA  1 
ATOM   3429  C C   . THR A  1 446 ? -23.936 -59.610 30.055  1.00 78.92  ? 446  THR A C   1 
ATOM   3430  O O   . THR A  1 446 ? -24.690 -59.087 30.874  1.00 79.90  ? 446  THR A O   1 
ATOM   3431  C CB  . THR A  1 446 ? -24.276 -62.053 30.132  1.00 73.72  ? 446  THR A CB  1 
ATOM   3432  O OG1 . THR A  1 446 ? -22.899 -62.211 30.488  1.00 73.50  ? 446  THR A OG1 1 
ATOM   3433  C CG2 . THR A  1 446 ? -24.822 -63.310 29.452  1.00 69.75  ? 446  THR A CG2 1 
ATOM   3434  N N   . ILE A  1 447 ? -22.674 -59.207 29.854  1.00 74.92  ? 447  ILE A N   1 
ATOM   3435  C CA  . ILE A  1 447 ? -22.053 -58.103 30.575  1.00 73.39  ? 447  ILE A CA  1 
ATOM   3436  C C   . ILE A  1 447 ? -22.641 -56.759 30.166  1.00 78.94  ? 447  ILE A C   1 
ATOM   3437  O O   . ILE A  1 447 ? -22.743 -56.460 28.961  1.00 79.24  ? 447  ILE A O   1 
ATOM   3438  C CB  . ILE A  1 447 ? -20.499 -58.163 30.473  1.00 75.10  ? 447  ILE A CB  1 
ATOM   3439  C CG1 . ILE A  1 447 ? -19.974 -59.423 31.168  1.00 77.11  ? 447  ILE A CG1 1 
ATOM   3440  C CG2 . ILE A  1 447 ? -19.819 -56.914 31.051  1.00 73.25  ? 447  ILE A CG2 1 
ATOM   3441  C CD1 . ILE A  1 447 ? -18.837 -60.106 30.432  1.00 87.41  ? 447  ILE A CD1 1 
ATOM   3442  N N   . ASN A  1 448 ? -23.055 -55.968 31.196  1.00 74.73  ? 448  ASN A N   1 
ATOM   3443  C CA  . ASN A  1 448 ? -23.517 -54.587 31.080  1.00 72.91  ? 448  ASN A CA  1 
ATOM   3444  C C   . ASN A  1 448 ? -22.245 -53.772 31.254  1.00 73.60  ? 448  ASN A C   1 
ATOM   3445  O O   . ASN A  1 448 ? -21.984 -53.220 32.335  1.00 72.14  ? 448  ASN A O   1 
ATOM   3446  C CB  . ASN A  1 448 ? -24.528 -54.217 32.184  1.00 74.99  ? 448  ASN A CB  1 
ATOM   3447  C CG  . ASN A  1 448 ? -25.142 -52.840 32.028  1.00 107.43 ? 448  ASN A CG  1 
ATOM   3448  O OD1 . ASN A  1 448 ? -24.763 -52.034 31.161  1.00 94.04  ? 448  ASN A OD1 1 
ATOM   3449  N ND2 . ASN A  1 448 ? -26.130 -52.554 32.858  1.00 115.99 ? 448  ASN A ND2 1 
ATOM   3450  N N   . TRP A  1 449 ? -21.436 -53.739 30.191  1.00 68.29  ? 449  TRP A N   1 
ATOM   3451  C CA  . TRP A  1 449 ? -20.172 -53.025 30.120  1.00 67.12  ? 449  TRP A CA  1 
ATOM   3452  C C   . TRP A  1 449 ? -20.278 -51.595 30.651  1.00 72.59  ? 449  TRP A C   1 
ATOM   3453  O O   . TRP A  1 449 ? -19.331 -51.096 31.249  1.00 72.82  ? 449  TRP A O   1 
ATOM   3454  C CB  . TRP A  1 449 ? -19.665 -53.021 28.682  1.00 65.57  ? 449  TRP A CB  1 
ATOM   3455  C CG  . TRP A  1 449 ? -19.370 -54.399 28.160  1.00 67.74  ? 449  TRP A CG  1 
ATOM   3456  C CD1 . TRP A  1 449 ? -20.197 -55.186 27.421  1.00 71.83  ? 449  TRP A CD1 1 
ATOM   3457  C CD2 . TRP A  1 449 ? -18.174 -55.157 28.366  1.00 67.71  ? 449  TRP A CD2 1 
ATOM   3458  N NE1 . TRP A  1 449 ? -19.596 -56.393 27.165  1.00 71.84  ? 449  TRP A NE1 1 
ATOM   3459  C CE2 . TRP A  1 449 ? -18.352 -56.401 27.730  1.00 72.53  ? 449  TRP A CE2 1 
ATOM   3460  C CE3 . TRP A  1 449 ? -16.979 -54.921 29.061  1.00 68.70  ? 449  TRP A CE3 1 
ATOM   3461  C CZ2 . TRP A  1 449 ? -17.376 -57.399 27.753  1.00 72.86  ? 449  TRP A CZ2 1 
ATOM   3462  C CZ3 . TRP A  1 449 ? -15.998 -55.900 29.064  1.00 70.83  ? 449  TRP A CZ3 1 
ATOM   3463  C CH2 . TRP A  1 449 ? -16.202 -57.123 28.418  1.00 72.76  ? 449  TRP A CH2 1 
ATOM   3464  N N   . THR A  1 450 ? -21.447 -50.967 30.474  1.00 69.95  ? 450  THR A N   1 
ATOM   3465  C CA  . THR A  1 450 ? -21.770 -49.618 30.920  1.00 69.62  ? 450  THR A CA  1 
ATOM   3466  C C   . THR A  1 450 ? -21.433 -49.381 32.399  1.00 75.60  ? 450  THR A C   1 
ATOM   3467  O O   . THR A  1 450 ? -20.950 -48.296 32.757  1.00 76.93  ? 450  THR A O   1 
ATOM   3468  C CB  . THR A  1 450 ? -23.201 -49.283 30.477  1.00 76.48  ? 450  THR A CB  1 
ATOM   3469  O OG1 . THR A  1 450 ? -23.115 -48.495 29.293  1.00 78.88  ? 450  THR A OG1 1 
ATOM   3470  C CG2 . THR A  1 450 ? -24.029 -48.568 31.540  1.00 71.50  ? 450  THR A CG2 1 
ATOM   3471  N N   . THR A  1 451 ? -21.642 -50.406 33.242  1.00 71.59  ? 451  THR A N   1 
ATOM   3472  C CA  . THR A  1 451 ? -21.364 -50.326 34.670  1.00 71.68  ? 451  THR A CA  1 
ATOM   3473  C C   . THR A  1 451 ? -19.875 -50.124 34.953  1.00 75.84  ? 451  THR A C   1 
ATOM   3474  O O   . THR A  1 451 ? -19.531 -49.592 36.016  1.00 76.20  ? 451  THR A O   1 
ATOM   3475  C CB  . THR A  1 451 ? -21.884 -51.560 35.391  1.00 84.62  ? 451  THR A CB  1 
ATOM   3476  O OG1 . THR A  1 451 ? -21.065 -52.687 35.065  1.00 86.35  ? 451  THR A OG1 1 
ATOM   3477  C CG2 . THR A  1 451 ? -23.352 -51.839 35.095  1.00 83.96  ? 451  THR A CG2 1 
ATOM   3478  N N   . LEU A  1 452 ? -18.995 -50.548 34.003  1.00 70.86  ? 452  LEU A N   1 
ATOM   3479  C CA  . LEU A  1 452 ? -17.542 -50.439 34.120  1.00 69.04  ? 452  LEU A CA  1 
ATOM   3480  C C   . LEU A  1 452 ? -17.012 -49.085 33.676  1.00 73.16  ? 452  LEU A C   1 
ATOM   3481  O O   . LEU A  1 452 ? -15.949 -48.664 34.139  1.00 75.94  ? 452  LEU A O   1 
ATOM   3482  C CB  . LEU A  1 452 ? -16.832 -51.572 33.369  1.00 69.07  ? 452  LEU A CB  1 
ATOM   3483  C CG  . LEU A  1 452 ? -17.326 -53.005 33.619  1.00 74.60  ? 452  LEU A CG  1 
ATOM   3484  C CD1 . LEU A  1 452 ? -16.723 -53.953 32.628  1.00 74.89  ? 452  LEU A CD1 1 
ATOM   3485  C CD2 . LEU A  1 452 ? -16.993 -53.492 35.009  1.00 77.68  ? 452  LEU A CD2 1 
ATOM   3486  N N   . PHE A  1 453 ? -17.747 -48.390 32.809  1.00 67.32  ? 453  PHE A N   1 
ATOM   3487  C CA  . PHE A  1 453 ? -17.351 -47.086 32.287  1.00 66.01  ? 453  PHE A CA  1 
ATOM   3488  C C   . PHE A  1 453 ? -17.521 -45.937 33.269  1.00 73.62  ? 453  PHE A C   1 
ATOM   3489  O O   . PHE A  1 453 ? -18.401 -45.982 34.132  1.00 75.08  ? 453  PHE A O   1 
ATOM   3490  C CB  . PHE A  1 453 ? -18.127 -46.782 31.009  1.00 67.19  ? 453  PHE A CB  1 
ATOM   3491  C CG  . PHE A  1 453 ? -17.885 -47.735 29.868  1.00 69.23  ? 453  PHE A CG  1 
ATOM   3492  C CD1 . PHE A  1 453 ? -18.883 -47.994 28.937  1.00 72.83  ? 453  PHE A CD1 1 
ATOM   3493  C CD2 . PHE A  1 453 ? -16.647 -48.351 29.699  1.00 71.40  ? 453  PHE A CD2 1 
ATOM   3494  C CE1 . PHE A  1 453 ? -18.649 -48.851 27.857  1.00 74.22  ? 453  PHE A CE1 1 
ATOM   3495  C CE2 . PHE A  1 453 ? -16.414 -49.205 28.620  1.00 74.45  ? 453  PHE A CE2 1 
ATOM   3496  C CZ  . PHE A  1 453 ? -17.417 -49.448 27.706  1.00 73.23  ? 453  PHE A CZ  1 
ATOM   3497  N N   . SER A  1 454 ? -16.698 -44.887 33.099  1.00 71.46  ? 454  SER A N   1 
ATOM   3498  C CA  . SER A  1 454 ? -16.714 -43.641 33.868  1.00 72.51  ? 454  SER A CA  1 
ATOM   3499  C C   . SER A  1 454 ? -17.402 -42.525 33.046  1.00 81.39  ? 454  SER A C   1 
ATOM   3500  O O   . SER A  1 454 ? -18.335 -41.887 33.542  1.00 83.59  ? 454  SER A O   1 
ATOM   3501  C CB  . SER A  1 454 ? -15.299 -43.246 34.282  1.00 75.56  ? 454  SER A CB  1 
ATOM   3502  O OG  . SER A  1 454 ? -14.701 -44.274 35.057  1.00 86.70  ? 454  SER A OG  1 
ATOM   3503  N N   . THR A  1 455 ? -17.003 -42.356 31.770  1.00 78.96  ? 455  THR A N   1 
ATOM   3504  C CA  . THR A  1 455 ? -17.584 -41.374 30.842  1.00 79.02  ? 455  THR A CA  1 
ATOM   3505  C C   . THR A  1 455 ? -18.809 -41.973 30.122  1.00 84.40  ? 455  THR A C   1 
ATOM   3506  O O   . THR A  1 455 ? -18.966 -43.195 30.061  1.00 84.13  ? 455  THR A O   1 
ATOM   3507  C CB  . THR A  1 455 ? -16.521 -40.876 29.809  1.00 87.58  ? 455  THR A CB  1 
ATOM   3508  O OG1 . THR A  1 455 ? -15.169 -41.148 30.235  1.00 85.18  ? 455  THR A OG1 1 
ATOM   3509  C CG2 . THR A  1 455 ? -16.696 -39.405 29.450  1.00 85.27  ? 455  THR A CG2 1 
ATOM   3510  N N   . ILE A  1 456 ? -19.671 -41.113 29.568  1.00 82.87  ? 456  ILE A N   1 
ATOM   3511  C CA  . ILE A  1 456 ? -20.824 -41.581 28.779  1.00 83.91  ? 456  ILE A CA  1 
ATOM   3512  C C   . ILE A  1 456 ? -20.440 -41.664 27.276  1.00 87.31  ? 456  ILE A C   1 
ATOM   3513  O O   . ILE A  1 456 ? -21.230 -42.117 26.445  1.00 87.97  ? 456  ILE A O   1 
ATOM   3514  C CB  . ILE A  1 456 ? -22.157 -40.810 29.054  1.00 87.55  ? 456  ILE A CB  1 
ATOM   3515  C CG1 . ILE A  1 456 ? -22.155 -39.385 28.464  1.00 87.77  ? 456  ILE A CG1 1 
ATOM   3516  C CG2 . ILE A  1 456 ? -22.496 -40.807 30.530  1.00 88.13  ? 456  ILE A CG2 1 
ATOM   3517  C CD1 . ILE A  1 456 ? -23.058 -39.246 27.263  1.00 98.09  ? 456  ILE A CD1 1 
ATOM   3518  N N   . ASN A  1 457 ? -19.204 -41.233 26.962  1.00 81.89  ? 457  ASN A N   1 
ATOM   3519  C CA  . ASN A  1 457 ? -18.581 -41.228 25.639  1.00 80.44  ? 457  ASN A CA  1 
ATOM   3520  C C   . ASN A  1 457 ? -17.962 -42.604 25.333  1.00 79.77  ? 457  ASN A C   1 
ATOM   3521  O O   . ASN A  1 457 ? -17.493 -42.858 24.214  1.00 79.28  ? 457  ASN A O   1 
ATOM   3522  C CB  . ASN A  1 457 ? -17.487 -40.152 25.627  1.00 84.30  ? 457  ASN A CB  1 
ATOM   3523  C CG  . ASN A  1 457 ? -18.002 -38.735 25.782  1.00 130.95 ? 457  ASN A CG  1 
ATOM   3524  O OD1 . ASN A  1 457 ? -19.167 -38.414 25.481  1.00 128.91 ? 457  ASN A OD1 1 
ATOM   3525  N ND2 . ASN A  1 457 ? -17.134 -37.843 26.242  1.00 127.30 ? 457  ASN A ND2 1 
ATOM   3526  N N   . GLN A  1 458 ? -17.982 -43.491 26.339  1.00 72.01  ? 458  GLN A N   1 
ATOM   3527  C CA  . GLN A  1 458 ? -17.396 -44.809 26.250  1.00 69.75  ? 458  GLN A CA  1 
ATOM   3528  C C   . GLN A  1 458 ? -18.331 -45.754 25.555  1.00 74.19  ? 458  GLN A C   1 
ATOM   3529  O O   . GLN A  1 458 ? -19.466 -45.969 25.999  1.00 74.25  ? 458  GLN A O   1 
ATOM   3530  C CB  . GLN A  1 458 ? -16.971 -45.313 27.621  1.00 69.77  ? 458  GLN A CB  1 
ATOM   3531  C CG  . GLN A  1 458 ? -16.125 -44.317 28.370  1.00 53.86  ? 458  GLN A CG  1 
ATOM   3532  C CD  . GLN A  1 458 ? -15.213 -44.951 29.358  1.00 69.11  ? 458  GLN A CD  1 
ATOM   3533  O OE1 . GLN A  1 458 ? -14.282 -45.671 29.010  1.00 65.64  ? 458  GLN A OE1 1 
ATOM   3534  N NE2 . GLN A  1 458 ? -15.410 -44.641 30.611  1.00 59.63  ? 458  GLN A NE2 1 
ATOM   3535  N N   . ARG A  1 459 ? -17.850 -46.275 24.409  1.00 70.44  ? 459  ARG A N   1 
ATOM   3536  C CA  . ARG A  1 459 ? -18.570 -47.201 23.552  1.00 70.32  ? 459  ARG A CA  1 
ATOM   3537  C C   . ARG A  1 459 ? -18.019 -48.621 23.703  1.00 73.54  ? 459  ARG A C   1 
ATOM   3538  O O   . ARG A  1 459 ? -16.953 -48.841 24.266  1.00 71.49  ? 459  ARG A O   1 
ATOM   3539  C CB  . ARG A  1 459 ? -18.411 -46.810 22.087  1.00 70.32  ? 459  ARG A CB  1 
ATOM   3540  C CG  . ARG A  1 459 ? -19.025 -45.497 21.641  1.00 86.27  ? 459  ARG A CG  1 
ATOM   3541  C CD  . ARG A  1 459 ? -19.018 -45.383 20.111  1.00 106.58 ? 459  ARG A CD  1 
ATOM   3542  N NE  . ARG A  1 459 ? -17.707 -45.666 19.491  1.00 111.84 ? 459  ARG A NE  1 
ATOM   3543  C CZ  . ARG A  1 459 ? -17.522 -46.472 18.445  1.00 118.84 ? 459  ARG A CZ  1 
ATOM   3544  N NH1 . ARG A  1 459 ? -18.555 -47.086 17.878  1.00 100.81 ? 459  ARG A NH1 1 
ATOM   3545  N NH2 . ARG A  1 459 ? -16.302 -46.674 17.965  1.00 104.24 ? 459  ARG A NH2 1 
ATOM   3546  N N   . ILE A  1 460 ? -18.744 -49.567 23.128  1.00 71.26  ? 460  ILE A N   1 
ATOM   3547  C CA  . ILE A  1 460 ? -18.421 -50.974 23.094  1.00 71.18  ? 460  ILE A CA  1 
ATOM   3548  C C   . ILE A  1 460 ? -18.637 -51.492 21.651  1.00 72.60  ? 460  ILE A C   1 
ATOM   3549  O O   . ILE A  1 460 ? -19.672 -51.242 21.050  1.00 70.58  ? 460  ILE A O   1 
ATOM   3550  C CB  . ILE A  1 460 ? -19.213 -51.732 24.194  1.00 75.38  ? 460  ILE A CB  1 
ATOM   3551  C CG1 . ILE A  1 460 ? -19.097 -53.251 24.047  1.00 78.05  ? 460  ILE A CG1 1 
ATOM   3552  C CG2 . ILE A  1 460 ? -20.660 -51.298 24.269  1.00 76.63  ? 460  ILE A CG2 1 
ATOM   3553  C CD1 . ILE A  1 460 ? -18.002 -53.836 24.851  1.00 95.13  ? 460  ILE A CD1 1 
ATOM   3554  N N   . VAL A  1 461 ? -17.616 -52.159 21.089  1.00 69.92  ? 461  VAL A N   1 
ATOM   3555  C CA  . VAL A  1 461 ? -17.615 -52.742 19.740  1.00 69.64  ? 461  VAL A CA  1 
ATOM   3556  C C   . VAL A  1 461 ? -17.500 -54.274 19.897  1.00 74.34  ? 461  VAL A C   1 
ATOM   3557  O O   . VAL A  1 461 ? -16.394 -54.809 20.041  1.00 73.10  ? 461  VAL A O   1 
ATOM   3558  C CB  . VAL A  1 461 ? -16.477 -52.160 18.843  1.00 72.48  ? 461  VAL A CB  1 
ATOM   3559  C CG1 . VAL A  1 461 ? -16.509 -52.764 17.445  1.00 73.72  ? 461  VAL A CG1 1 
ATOM   3560  C CG2 . VAL A  1 461 ? -16.519 -50.634 18.773  1.00 70.72  ? 461  VAL A CG2 1 
ATOM   3561  N N   . ILE A  1 462 ? -18.648 -54.965 19.937  1.00 72.81  ? 462  ILE A N   1 
ATOM   3562  C CA  . ILE A  1 462 ? -18.675 -56.427 20.032  1.00 74.71  ? 462  ILE A CA  1 
ATOM   3563  C C   . ILE A  1 462 ? -19.200 -57.001 18.729  1.00 80.05  ? 462  ILE A C   1 
ATOM   3564  O O   . ILE A  1 462 ? -20.323 -56.683 18.324  1.00 82.52  ? 462  ILE A O   1 
ATOM   3565  C CB  . ILE A  1 462 ? -19.264 -57.040 21.337  1.00 78.91  ? 462  ILE A CB  1 
ATOM   3566  C CG1 . ILE A  1 462 ? -20.752 -56.716 21.520  1.00 81.53  ? 462  ILE A CG1 1 
ATOM   3567  C CG2 . ILE A  1 462 ? -18.455 -56.589 22.562  1.00 78.00  ? 462  ILE A CG2 1 
ATOM   3568  C CD1 . ILE A  1 462 ? -21.524 -57.561 22.618  1.00 99.94  ? 462  ILE A CD1 1 
ATOM   3569  N N   . ARG A  1 463 ? -18.341 -57.724 18.005  1.00 74.60  ? 463  ARG A N   1 
ATOM   3570  C CA  . ARG A  1 463 ? -18.667 -58.250 16.686  1.00 74.97  ? 463  ARG A CA  1 
ATOM   3571  C C   . ARG A  1 463 ? -18.020 -59.618 16.452  1.00 80.59  ? 463  ARG A C   1 
ATOM   3572  O O   . ARG A  1 463 ? -16.880 -59.839 16.868  1.00 80.51  ? 463  ARG A O   1 
ATOM   3573  C CB  . ARG A  1 463 ? -18.196 -57.233 15.620  1.00 71.63  ? 463  ARG A CB  1 
ATOM   3574  C CG  . ARG A  1 463 ? -18.302 -57.683 14.176  1.00 82.69  ? 463  ARG A CG  1 
ATOM   3575  C CD  . ARG A  1 463 ? -17.649 -56.728 13.201  1.00 96.75  ? 463  ARG A CD  1 
ATOM   3576  N NE  . ARG A  1 463 ? -16.189 -56.850 13.176  1.00 103.45 ? 463  ARG A NE  1 
ATOM   3577  C CZ  . ARG A  1 463 ? -15.357 -55.869 13.508  1.00 107.96 ? 463  ARG A CZ  1 
ATOM   3578  N NH1 . ARG A  1 463 ? -15.830 -54.692 13.904  1.00 79.97  ? 463  ARG A NH1 1 
ATOM   3579  N NH2 . ARG A  1 463 ? -14.045 -56.055 13.442  1.00 99.57  ? 463  ARG A NH2 1 
ATOM   3580  N N   . ASP A  1 464 ? -18.744 -60.514 15.755  1.00 76.95  ? 464  ASP A N   1 
ATOM   3581  C CA  . ASP A  1 464 ? -18.280 -61.823 15.309  1.00 78.43  ? 464  ASP A CA  1 
ATOM   3582  C C   . ASP A  1 464 ? -17.675 -62.769 16.361  1.00 82.53  ? 464  ASP A C   1 
ATOM   3583  O O   . ASP A  1 464 ? -16.740 -63.530 16.071  1.00 82.80  ? 464  ASP A O   1 
ATOM   3584  C CB  . ASP A  1 464 ? -17.388 -61.706 14.053  1.00 81.36  ? 464  ASP A CB  1 
ATOM   3585  C CG  . ASP A  1 464 ? -17.996 -60.991 12.847  1.00 95.85  ? 464  ASP A CG  1 
ATOM   3586  O OD1 . ASP A  1 464 ? -19.185 -61.254 12.525  1.00 95.99  ? 464  ASP A OD1 1 
ATOM   3587  O OD2 . ASP A  1 464 ? -17.263 -60.205 12.190  1.00 105.99 ? 464  ASP A OD2 1 
ATOM   3588  N N   . ASN A  1 465 ? -18.246 -62.754 17.568  1.00 77.73  ? 465  ASN A N   1 
ATOM   3589  C CA  . ASN A  1 465 ? -17.894 -63.707 18.612  1.00 77.56  ? 465  ASN A CA  1 
ATOM   3590  C C   . ASN A  1 465 ? -19.002 -64.787 18.517  1.00 83.84  ? 465  ASN A C   1 
ATOM   3591  O O   . ASN A  1 465 ? -19.805 -64.719 17.578  1.00 83.67  ? 465  ASN A O   1 
ATOM   3592  C CB  . ASN A  1 465 ? -17.846 -63.015 19.970  1.00 73.57  ? 465  ASN A CB  1 
ATOM   3593  C CG  . ASN A  1 465 ? -16.890 -61.852 20.015  1.00 90.18  ? 465  ASN A CG  1 
ATOM   3594  O OD1 . ASN A  1 465 ? -15.680 -62.001 19.823  1.00 87.05  ? 465  ASN A OD1 1 
ATOM   3595  N ND2 . ASN A  1 465 ? -17.409 -60.662 20.265  1.00 78.37  ? 465  ASN A ND2 1 
ATOM   3596  N N   . ARG A  1 466 ? -19.064 -65.785 19.420  1.00 82.36  ? 466  ARG A N   1 
ATOM   3597  C CA  . ARG A  1 466 ? -20.135 -66.780 19.274  1.00 84.55  ? 466  ARG A CA  1 
ATOM   3598  C C   . ARG A  1 466 ? -21.514 -66.164 19.544  1.00 88.43  ? 466  ARG A C   1 
ATOM   3599  O O   . ARG A  1 466 ? -21.708 -65.530 20.589  1.00 86.89  ? 466  ARG A O   1 
ATOM   3600  C CB  . ARG A  1 466 ? -19.903 -68.036 20.118  1.00 86.62  ? 466  ARG A CB  1 
ATOM   3601  C CG  . ARG A  1 466 ? -20.887 -69.147 19.800  1.00 99.84  ? 466  ARG A CG  1 
ATOM   3602  C CD  . ARG A  1 466 ? -20.583 -70.398 20.577  1.00 110.94 ? 466  ARG A CD  1 
ATOM   3603  N NE  . ARG A  1 466 ? -19.399 -71.072 20.061  1.00 120.75 ? 466  ARG A NE  1 
ATOM   3604  C CZ  . ARG A  1 466 ? -19.426 -72.239 19.434  1.00 145.64 ? 466  ARG A CZ  1 
ATOM   3605  N NH1 . ARG A  1 466 ? -20.576 -72.874 19.246  1.00 141.63 ? 466  ARG A NH1 1 
ATOM   3606  N NH2 . ARG A  1 466 ? -18.302 -72.789 18.998  1.00 138.16 ? 466  ARG A NH2 1 
ATOM   3607  N N   . LYS A  1 467 ? -22.455 -66.334 18.578  1.00 85.41  ? 467  LYS A N   1 
ATOM   3608  C CA  . LYS A  1 467 ? -23.819 -65.800 18.652  1.00 84.24  ? 467  LYS A CA  1 
ATOM   3609  C C   . LYS A  1 467 ? -24.466 -66.104 20.002  1.00 87.73  ? 467  LYS A C   1 
ATOM   3610  O O   . LYS A  1 467 ? -24.405 -67.243 20.472  1.00 87.46  ? 467  LYS A O   1 
ATOM   3611  C CB  . LYS A  1 467 ? -24.689 -66.302 17.479  1.00 86.86  ? 467  LYS A CB  1 
ATOM   3612  C CG  . LYS A  1 467 ? -25.675 -65.250 16.975  1.00 93.71  ? 467  LYS A CG  1 
ATOM   3613  C CD  . LYS A  1 467 ? -26.726 -65.804 16.021  1.00 107.50 ? 467  LYS A CD  1 
ATOM   3614  C CE  . LYS A  1 467 ? -27.802 -64.792 15.665  1.00 116.63 ? 467  LYS A CE  1 
ATOM   3615  N NZ  . LYS A  1 467 ? -28.902 -65.388 14.850  1.00 120.30 ? 467  LYS A NZ  1 
ATOM   3616  N N   . ALA A  1 468 ? -25.019 -65.064 20.650  1.00 83.83  ? 468  ALA A N   1 
ATOM   3617  C CA  . ALA A  1 468 ? -25.675 -65.165 21.959  1.00 84.72  ? 468  ALA A CA  1 
ATOM   3618  C C   . ALA A  1 468 ? -26.707 -66.295 22.040  1.00 91.97  ? 468  ALA A C   1 
ATOM   3619  O O   . ALA A  1 468 ? -26.846 -66.922 23.084  1.00 92.83  ? 468  ALA A O   1 
ATOM   3620  C CB  . ALA A  1 468 ? -26.329 -63.843 22.314  1.00 84.36  ? 468  ALA A CB  1 
ATOM   3621  N N   . GLU A  1 469 ? -27.409 -66.556 20.928  1.00 90.15  ? 469  GLU A N   1 
ATOM   3622  C CA  . GLU A  1 469 ? -28.437 -67.590 20.782  1.00 92.27  ? 469  GLU A CA  1 
ATOM   3623  C C   . GLU A  1 469 ? -27.786 -68.967 20.912  1.00 97.95  ? 469  GLU A C   1 
ATOM   3624  O O   . GLU A  1 469 ? -28.300 -69.829 21.636  1.00 99.56  ? 469  GLU A O   1 
ATOM   3625  C CB  . GLU A  1 469 ? -29.156 -67.447 19.411  1.00 94.53  ? 469  GLU A CB  1 
ATOM   3626  C CG  . GLU A  1 469 ? -30.051 -66.217 19.245  1.00 107.84 ? 469  GLU A CG  1 
ATOM   3627  C CD  . GLU A  1 469 ? -29.475 -64.828 19.505  1.00 136.07 ? 469  GLU A CD  1 
ATOM   3628  O OE1 . GLU A  1 469 ? -28.415 -64.489 18.927  1.00 118.80 ? 469  GLU A OE1 1 
ATOM   3629  O OE2 . GLU A  1 469 ? -30.086 -64.082 20.307  1.00 139.71 ? 469  GLU A OE2 1 
ATOM   3630  N N   . ASN A  1 470 ? -26.630 -69.147 20.224  1.00 93.34  ? 470  ASN A N   1 
ATOM   3631  C CA  . ASN A  1 470 ? -25.806 -70.361 20.181  1.00 93.44  ? 470  ASN A CA  1 
ATOM   3632  C C   . ASN A  1 470 ? -25.234 -70.664 21.562  1.00 94.12  ? 470  ASN A C   1 
ATOM   3633  O O   . ASN A  1 470 ? -25.182 -71.823 21.948  1.00 93.45  ? 470  ASN A O   1 
ATOM   3634  C CB  . ASN A  1 470 ? -24.680 -70.165 19.177  1.00 94.78  ? 470  ASN A CB  1 
ATOM   3635  C CG  . ASN A  1 470 ? -24.115 -71.426 18.629  1.00 131.97 ? 470  ASN A CG  1 
ATOM   3636  O OD1 . ASN A  1 470 ? -23.247 -72.056 19.230  1.00 126.94 ? 470  ASN A OD1 1 
ATOM   3637  N ND2 . ASN A  1 470 ? -24.591 -71.785 17.457  1.00 134.06 ? 470  ASN A ND2 1 
ATOM   3638  N N   . CYS A  1 471 ? -24.818 -69.621 22.309  1.00 89.39  ? 471  CYS A N   1 
ATOM   3639  C CA  . CYS A  1 471 ? -24.273 -69.756 23.657  1.00 89.12  ? 471  CYS A CA  1 
ATOM   3640  C C   . CYS A  1 471 ? -25.337 -70.327 24.583  1.00 94.33  ? 471  CYS A C   1 
ATOM   3641  O O   . CYS A  1 471 ? -25.136 -71.384 25.189  1.00 96.28  ? 471  CYS A O   1 
ATOM   3642  C CB  . CYS A  1 471 ? -23.739 -68.419 24.171  1.00 87.46  ? 471  CYS A CB  1 
ATOM   3643  S SG  . CYS A  1 471 ? -22.163 -67.907 23.432  1.00 90.48  ? 471  CYS A SG  1 
ATOM   3644  N N   . THR A  1 472 ? -26.492 -69.642 24.623  1.00 89.70  ? 472  THR A N   1 
ATOM   3645  C CA  . THR A  1 472 ? -27.696 -69.947 25.402  1.00 89.95  ? 472  THR A CA  1 
ATOM   3646  C C   . THR A  1 472 ? -28.187 -71.403 25.165  1.00 95.78  ? 472  THR A C   1 
ATOM   3647  O O   . THR A  1 472 ? -28.392 -72.139 26.135  1.00 95.30  ? 472  THR A O   1 
ATOM   3648  C CB  . THR A  1 472 ? -28.731 -68.834 25.142  1.00 88.28  ? 472  THR A CB  1 
ATOM   3649  O OG1 . THR A  1 472 ? -28.085 -67.575 25.321  1.00 79.53  ? 472  THR A OG1 1 
ATOM   3650  C CG2 . THR A  1 472 ? -29.918 -68.903 26.072  1.00 87.47  ? 472  THR A CG2 1 
ATOM   3651  N N   . ALA A  1 473 ? -28.297 -71.814 23.878  1.00 94.19  ? 473  ALA A N   1 
ATOM   3652  C CA  . ALA A  1 473 ? -28.686 -73.159 23.437  1.00 96.85  ? 473  ALA A CA  1 
ATOM   3653  C C   . ALA A  1 473 ? -27.674 -74.234 23.864  1.00 103.91 ? 473  ALA A C   1 
ATOM   3654  O O   . ALA A  1 473 ? -28.080 -75.377 24.076  1.00 105.51 ? 473  ALA A O   1 
ATOM   3655  C CB  . ALA A  1 473 ? -28.866 -73.183 21.934  1.00 97.85  ? 473  ALA A CB  1 
ATOM   3656  N N   . GLU A  1 474 ? -26.369 -73.871 24.006  1.00 101.04 ? 474  GLU A N   1 
ATOM   3657  C CA  . GLU A  1 474 ? -25.317 -74.786 24.466  1.00 102.48 ? 474  GLU A CA  1 
ATOM   3658  C C   . GLU A  1 474 ? -25.097 -74.706 25.985  1.00 105.96 ? 474  GLU A C   1 
ATOM   3659  O O   . GLU A  1 474 ? -24.162 -75.320 26.512  1.00 106.33 ? 474  GLU A O   1 
ATOM   3660  C CB  . GLU A  1 474 ? -24.017 -74.585 23.683  1.00 103.46 ? 474  GLU A CB  1 
ATOM   3661  C CG  . GLU A  1 474 ? -23.925 -75.457 22.438  1.00 119.38 ? 474  GLU A CG  1 
ATOM   3662  C CD  . GLU A  1 474 ? -22.567 -75.474 21.761  1.00 150.42 ? 474  GLU A CD  1 
ATOM   3663  O OE1 . GLU A  1 474 ? -21.543 -75.566 22.479  1.00 156.10 ? 474  GLU A OE1 1 
ATOM   3664  O OE2 . GLU A  1 474 ? -22.527 -75.425 20.508  1.00 142.25 ? 474  GLU A OE2 1 
ATOM   3665  N N   . GLY A  1 475 ? -25.981 -73.977 26.664  1.00 101.86 ? 475  GLY A N   1 
ATOM   3666  C CA  . GLY A  1 475 ? -25.980 -73.835 28.115  1.00 102.40 ? 475  GLY A CA  1 
ATOM   3667  C C   . GLY A  1 475 ? -24.932 -72.923 28.717  1.00 107.75 ? 475  GLY A C   1 
ATOM   3668  O O   . GLY A  1 475 ? -24.746 -72.944 29.936  1.00 107.85 ? 475  GLY A O   1 
ATOM   3669  N N   . MET A  1 476 ? -24.253 -72.090 27.892  1.00 104.78 ? 476  MET A N   1 
ATOM   3670  C CA  . MET A  1 476 ? -23.237 -71.150 28.387  1.00 103.75 ? 476  MET A CA  1 
ATOM   3671  C C   . MET A  1 476 ? -23.962 -69.941 28.917  1.00 106.38 ? 476  MET A C   1 
ATOM   3672  O O   . MET A  1 476 ? -23.988 -68.886 28.268  1.00 103.85 ? 476  MET A O   1 
ATOM   3673  C CB  . MET A  1 476 ? -22.223 -70.737 27.299  1.00 105.65 ? 476  MET A CB  1 
ATOM   3674  C CG  . MET A  1 476 ? -21.930 -71.810 26.295  1.00 112.02 ? 476  MET A CG  1 
ATOM   3675  S SD  . MET A  1 476 ? -20.814 -73.032 26.979  1.00 119.47 ? 476  MET A SD  1 
ATOM   3676  C CE  . MET A  1 476 ? -20.801 -74.236 25.624  1.00 118.46 ? 476  MET A CE  1 
ATOM   3677  N N   . VAL A  1 477 ? -24.606 -70.117 30.082  1.00 104.95 ? 477  VAL A N   1 
ATOM   3678  C CA  . VAL A  1 477 ? -25.364 -69.054 30.736  1.00 104.68 ? 477  VAL A CA  1 
ATOM   3679  C C   . VAL A  1 477 ? -24.767 -68.723 32.096  1.00 110.99 ? 477  VAL A C   1 
ATOM   3680  O O   . VAL A  1 477 ? -24.003 -69.530 32.648  1.00 111.90 ? 477  VAL A O   1 
ATOM   3681  C CB  . VAL A  1 477 ? -26.894 -69.318 30.818  1.00 109.46 ? 477  VAL A CB  1 
ATOM   3682  C CG1 . VAL A  1 477 ? -27.471 -69.734 29.465  1.00 110.11 ? 477  VAL A CG1 1 
ATOM   3683  C CG2 . VAL A  1 477 ? -27.239 -70.329 31.910  1.00 111.08 ? 477  VAL A CG2 1 
ATOM   3684  N N   . CYS A  1 478 ? -25.136 -67.543 32.634  1.00 107.26 ? 478  CYS A N   1 
ATOM   3685  C CA  . CYS A  1 478 ? -24.693 -67.100 33.941  1.00 107.62 ? 478  CYS A CA  1 
ATOM   3686  C C   . CYS A  1 478 ? -25.390 -67.901 35.023  1.00 114.90 ? 478  CYS A C   1 
ATOM   3687  O O   . CYS A  1 478 ? -26.534 -68.341 34.845  1.00 115.16 ? 478  CYS A O   1 
ATOM   3688  C CB  . CYS A  1 478 ? -24.930 -65.604 34.120  1.00 106.49 ? 478  CYS A CB  1 
ATOM   3689  S SG  . CYS A  1 478 ? -23.919 -64.551 33.044  1.00 108.46 ? 478  CYS A SG  1 
ATOM   3690  N N   . ASN A  1 479 ? -24.693 -68.077 36.151  1.00 113.13 ? 479  ASN A N   1 
ATOM   3691  C CA  . ASN A  1 479 ? -25.189 -68.741 37.353  1.00 115.46 ? 479  ASN A CA  1 
ATOM   3692  C C   . ASN A  1 479 ? -26.412 -67.957 37.863  1.00 122.70 ? 479  ASN A C   1 
ATOM   3693  O O   . ASN A  1 479 ? -26.447 -66.733 37.704  1.00 120.37 ? 479  ASN A O   1 
ATOM   3694  C CB  . ASN A  1 479 ? -24.083 -68.732 38.399  1.00 112.92 ? 479  ASN A CB  1 
ATOM   3695  C CG  . ASN A  1 479 ? -24.346 -69.608 39.591  1.00 121.73 ? 479  ASN A CG  1 
ATOM   3696  O OD1 . ASN A  1 479 ? -24.993 -69.198 40.559  1.00 106.26 ? 479  ASN A OD1 1 
ATOM   3697  N ND2 . ASN A  1 479 ? -23.813 -70.823 39.564  1.00 114.53 ? 479  ASN A ND2 1 
ATOM   3698  N N   . HIS A  1 480 ? -27.420 -68.646 38.443  1.00 124.25 ? 480  HIS A N   1 
ATOM   3699  C CA  . HIS A  1 480 ? -28.647 -67.994 38.929  1.00 125.57 ? 480  HIS A CA  1 
ATOM   3700  C C   . HIS A  1 480 ? -28.408 -66.913 39.993  1.00 128.68 ? 480  HIS A C   1 
ATOM   3701  O O   . HIS A  1 480 ? -29.198 -65.976 40.098  1.00 127.23 ? 480  HIS A O   1 
ATOM   3702  C CB  . HIS A  1 480 ? -29.689 -69.027 39.393  1.00 129.79 ? 480  HIS A CB  1 
ATOM   3703  C CG  . HIS A  1 480 ? -29.366 -69.672 40.708  1.00 135.59 ? 480  HIS A CG  1 
ATOM   3704  N ND1 . HIS A  1 480 ? -28.429 -70.689 40.800  1.00 138.68 ? 480  HIS A ND1 1 
ATOM   3705  C CD2 . HIS A  1 480 ? -29.861 -69.417 41.945  1.00 138.48 ? 480  HIS A CD2 1 
ATOM   3706  C CE1 . HIS A  1 480 ? -28.384 -71.017 42.084  1.00 139.52 ? 480  HIS A CE1 1 
ATOM   3707  N NE2 . HIS A  1 480 ? -29.227 -70.278 42.812  1.00 139.77 ? 480  HIS A NE2 1 
ATOM   3708  N N   . LEU A  1 481 ? -27.305 -67.031 40.753  1.00 126.35 ? 481  LEU A N   1 
ATOM   3709  C CA  . LEU A  1 481 ? -26.942 -66.077 41.803  1.00 125.73 ? 481  LEU A CA  1 
ATOM   3710  C C   . LEU A  1 481 ? -26.313 -64.770 41.285  1.00 126.95 ? 481  LEU A C   1 
ATOM   3711  O O   . LEU A  1 481 ? -26.048 -63.875 42.093  1.00 126.15 ? 481  LEU A O   1 
ATOM   3712  C CB  . LEU A  1 481 ? -26.092 -66.752 42.898  1.00 127.18 ? 481  LEU A CB  1 
ATOM   3713  C CG  . LEU A  1 481 ? -26.840 -67.768 43.764  1.00 134.87 ? 481  LEU A CG  1 
ATOM   3714  C CD1 . LEU A  1 481 ? -25.887 -68.720 44.444  1.00 136.57 ? 481  LEU A CD1 1 
ATOM   3715  C CD2 . LEU A  1 481 ? -27.722 -67.077 44.787  1.00 138.66 ? 481  LEU A CD2 1 
ATOM   3716  N N   . CYS A  1 482 ? -26.105 -64.649 39.937  1.00 121.51 ? 482  CYS A N   1 
ATOM   3717  C CA  . CYS A  1 482 ? -25.577 -63.442 39.269  1.00 118.65 ? 482  CYS A CA  1 
ATOM   3718  C C   . CYS A  1 482 ? -26.715 -62.443 39.128  1.00 119.65 ? 482  CYS A C   1 
ATOM   3719  O O   . CYS A  1 482 ? -27.847 -62.849 38.883  1.00 120.61 ? 482  CYS A O   1 
ATOM   3720  C CB  . CYS A  1 482 ? -24.991 -63.766 37.893  1.00 118.53 ? 482  CYS A CB  1 
ATOM   3721  S SG  . CYS A  1 482 ? -23.424 -64.688 37.898  1.00 123.07 ? 482  CYS A SG  1 
ATOM   3722  N N   . SER A  1 483 ? -26.406 -61.148 39.169  1.00 113.16 ? 483  SER A N   1 
ATOM   3723  C CA  . SER A  1 483 ? -27.403 -60.095 38.971  1.00 112.32 ? 483  SER A CA  1 
ATOM   3724  C C   . SER A  1 483 ? -27.719 -59.975 37.480  1.00 116.84 ? 483  SER A C   1 
ATOM   3725  O O   . SER A  1 483 ? -27.159 -60.730 36.689  1.00 116.46 ? 483  SER A O   1 
ATOM   3726  C CB  . SER A  1 483 ? -26.848 -58.769 39.474  1.00 113.28 ? 483  SER A CB  1 
ATOM   3727  O OG  . SER A  1 483 ? -25.680 -58.449 38.738  1.00 118.21 ? 483  SER A OG  1 
ATOM   3728  N N   . SER A  1 484 ? -28.566 -59.005 37.080  1.00 114.12 ? 484  SER A N   1 
ATOM   3729  C CA  . SER A  1 484 ? -28.870 -58.764 35.661  1.00 113.66 ? 484  SER A CA  1 
ATOM   3730  C C   . SER A  1 484 ? -27.673 -58.107 34.910  1.00 115.98 ? 484  SER A C   1 
ATOM   3731  O O   . SER A  1 484 ? -27.734 -57.913 33.688  1.00 115.67 ? 484  SER A O   1 
ATOM   3732  C CB  . SER A  1 484 ? -30.139 -57.929 35.511  1.00 117.24 ? 484  SER A CB  1 
ATOM   3733  O OG  . SER A  1 484 ? -30.038 -56.671 36.157  1.00 123.84 ? 484  SER A OG  1 
ATOM   3734  N N   . ASP A  1 485 ? -26.578 -57.802 35.644  1.00 110.66 ? 485  ASP A N   1 
ATOM   3735  C CA  . ASP A  1 485 ? -25.359 -57.196 35.094  1.00 107.95 ? 485  ASP A CA  1 
ATOM   3736  C C   . ASP A  1 485 ? -24.443 -58.152 34.319  1.00 108.70 ? 485  ASP A C   1 
ATOM   3737  O O   . ASP A  1 485 ? -23.577 -57.676 33.578  1.00 107.18 ? 485  ASP A O   1 
ATOM   3738  C CB  . ASP A  1 485 ? -24.585 -56.419 36.168  1.00 108.83 ? 485  ASP A CB  1 
ATOM   3739  C CG  . ASP A  1 485 ? -25.101 -55.012 36.413  1.00 116.78 ? 485  ASP A CG  1 
ATOM   3740  O OD1 . ASP A  1 485 ? -25.985 -54.546 35.629  1.00 116.02 ? 485  ASP A OD1 1 
ATOM   3741  O OD2 . ASP A  1 485 ? -24.615 -54.363 37.369  1.00 123.36 ? 485  ASP A OD2 1 
ATOM   3742  N N   . GLY A  1 486 ? -24.631 -59.464 34.504  1.00 103.45 ? 486  GLY A N   1 
ATOM   3743  C CA  . GLY A  1 486 ? -23.879 -60.500 33.807  1.00 101.99 ? 486  GLY A CA  1 
ATOM   3744  C C   . GLY A  1 486 ? -22.837 -61.209 34.637  1.00 103.52 ? 486  GLY A C   1 
ATOM   3745  O O   . GLY A  1 486 ? -22.792 -61.058 35.862  1.00 103.26 ? 486  GLY A O   1 
ATOM   3746  N N   . CYS A  1 487 ? -21.988 -61.989 33.943  1.00 99.07  ? 487  CYS A N   1 
ATOM   3747  C CA  . CYS A  1 487 ? -20.897 -62.808 34.479  1.00 99.11  ? 487  CYS A CA  1 
ATOM   3748  C C   . CYS A  1 487 ? -19.733 -62.870 33.489  1.00 97.87  ? 487  CYS A C   1 
ATOM   3749  O O   . CYS A  1 487 ? -19.948 -62.726 32.284  1.00 97.19  ? 487  CYS A O   1 
ATOM   3750  C CB  . CYS A  1 487 ? -21.412 -64.204 34.778  1.00 102.56 ? 487  CYS A CB  1 
ATOM   3751  S SG  . CYS A  1 487 ? -21.965 -65.089 33.307  1.00 108.18 ? 487  CYS A SG  1 
ATOM   3752  N N   . TRP A  1 488 ? -18.518 -63.146 33.988  1.00 91.04  ? 488  TRP A N   1 
ATOM   3753  C CA  . TRP A  1 488 ? -17.294 -63.230 33.177  1.00 89.09  ? 488  TRP A CA  1 
ATOM   3754  C C   . TRP A  1 488 ? -17.082 -64.584 32.533  1.00 91.89  ? 488  TRP A C   1 
ATOM   3755  O O   . TRP A  1 488 ? -16.289 -64.700 31.597  1.00 91.17  ? 488  TRP A O   1 
ATOM   3756  C CB  . TRP A  1 488 ? -16.058 -62.851 34.014  1.00 87.42  ? 488  TRP A CB  1 
ATOM   3757  C CG  . TRP A  1 488 ? -16.043 -61.413 34.439  1.00 86.53  ? 488  TRP A CG  1 
ATOM   3758  C CD1 . TRP A  1 488 ? -16.274 -60.923 35.691  1.00 89.37  ? 488  TRP A CD1 1 
ATOM   3759  C CD2 . TRP A  1 488 ? -15.861 -60.274 33.587  1.00 84.37  ? 488  TRP A CD2 1 
ATOM   3760  N NE1 . TRP A  1 488 ? -16.223 -59.546 35.678  1.00 87.30  ? 488  TRP A NE1 1 
ATOM   3761  C CE2 . TRP A  1 488 ? -15.973 -59.122 34.398  1.00 87.47  ? 488  TRP A CE2 1 
ATOM   3762  C CE3 . TRP A  1 488 ? -15.571 -60.118 32.220  1.00 84.48  ? 488  TRP A CE3 1 
ATOM   3763  C CZ2 . TRP A  1 488 ? -15.805 -57.831 33.887  1.00 84.83  ? 488  TRP A CZ2 1 
ATOM   3764  C CZ3 . TRP A  1 488 ? -15.416 -58.843 31.713  1.00 84.19  ? 488  TRP A CZ3 1 
ATOM   3765  C CH2 . TRP A  1 488 ? -15.545 -57.714 32.538  1.00 83.88  ? 488  TRP A CH2 1 
ATOM   3766  N N   . GLY A  1 489 ? -17.773 -65.586 33.065  1.00 88.80  ? 489  GLY A N   1 
ATOM   3767  C CA  . GLY A  1 489 ? -17.697 -66.986 32.667  1.00 90.10  ? 489  GLY A CA  1 
ATOM   3768  C C   . GLY A  1 489 ? -18.619 -67.843 33.517  1.00 95.07  ? 489  GLY A C   1 
ATOM   3769  O O   . GLY A  1 489 ? -19.533 -67.309 34.155  1.00 93.08  ? 489  GLY A O   1 
ATOM   3770  N N   . PRO A  1 490 ? -18.434 -69.181 33.565  1.00 94.79  ? 490  PRO A N   1 
ATOM   3771  C CA  . PRO A  1 490 ? -19.361 -70.001 34.363  1.00 96.93  ? 490  PRO A CA  1 
ATOM   3772  C C   . PRO A  1 490 ? -19.052 -70.022 35.852  1.00 105.60 ? 490  PRO A C   1 
ATOM   3773  O O   . PRO A  1 490 ? -17.903 -69.816 36.267  1.00 105.45 ? 490  PRO A O   1 
ATOM   3774  C CB  . PRO A  1 490 ? -19.247 -71.383 33.726  1.00 99.87  ? 490  PRO A CB  1 
ATOM   3775  C CG  . PRO A  1 490 ? -17.892 -71.414 33.127  1.00 103.36 ? 490  PRO A CG  1 
ATOM   3776  C CD  . PRO A  1 490 ? -17.407 -70.014 32.903  1.00 96.60  ? 490  PRO A CD  1 
ATOM   3777  N N   . GLY A  1 491 ? -20.079 -70.278 36.647  1.00 105.34 ? 491  GLY A N   1 
ATOM   3778  C CA  . GLY A  1 491 ? -19.903 -70.376 38.086  1.00 107.41 ? 491  GLY A CA  1 
ATOM   3779  C C   . GLY A  1 491 ? -20.343 -69.159 38.861  1.00 112.42 ? 491  GLY A C   1 
ATOM   3780  O O   . GLY A  1 491 ? -20.576 -68.090 38.282  1.00 110.99 ? 491  GLY A O   1 
ATOM   3781  N N   . PRO A  1 492 ? -20.484 -69.319 40.190  1.00 110.85 ? 492  PRO A N   1 
ATOM   3782  C CA  . PRO A  1 492 ? -20.941 -68.189 41.015  1.00 110.11 ? 492  PRO A CA  1 
ATOM   3783  C C   . PRO A  1 492 ? -19.854 -67.161 41.337  1.00 114.18 ? 492  PRO A C   1 
ATOM   3784  O O   . PRO A  1 492 ? -20.174 -66.002 41.617  1.00 112.88 ? 492  PRO A O   1 
ATOM   3785  C CB  . PRO A  1 492 ? -21.519 -68.863 42.264  1.00 113.91 ? 492  PRO A CB  1 
ATOM   3786  C CG  . PRO A  1 492 ? -21.206 -70.348 42.133  1.00 120.35 ? 492  PRO A CG  1 
ATOM   3787  C CD  . PRO A  1 492 ? -20.257 -70.528 41.004  1.00 114.87 ? 492  PRO A CD  1 
ATOM   3788  N N   . ASP A  1 493 ? -18.570 -67.578 41.274  1.00 111.44 ? 493  ASP A N   1 
ATOM   3789  C CA  . ASP A  1 493 ? -17.402 -66.733 41.531  1.00 109.83 ? 493  ASP A CA  1 
ATOM   3790  C C   . ASP A  1 493 ? -17.188 -65.688 40.419  1.00 111.77 ? 493  ASP A C   1 
ATOM   3791  O O   . ASP A  1 493 ? -16.605 -64.628 40.664  1.00 110.03 ? 493  ASP A O   1 
ATOM   3792  C CB  . ASP A  1 493 ? -16.142 -67.609 41.741  1.00 112.63 ? 493  ASP A CB  1 
ATOM   3793  C CG  . ASP A  1 493 ? -15.783 -68.553 40.602  1.00 119.26 ? 493  ASP A CG  1 
ATOM   3794  O OD1 . ASP A  1 493 ? -16.677 -69.314 40.150  1.00 122.07 ? 493  ASP A OD1 1 
ATOM   3795  O OD2 . ASP A  1 493 ? -14.596 -68.586 40.214  1.00 119.31 ? 493  ASP A OD2 1 
ATOM   3796  N N   . GLN A  1 494 ? -17.724 -65.970 39.224  1.00 107.97 ? 494  GLN A N   1 
ATOM   3797  C CA  . GLN A  1 494 ? -17.573 -65.145 38.042  1.00 106.03 ? 494  GLN A CA  1 
ATOM   3798  C C   . GLN A  1 494 ? -18.638 -64.071 37.814  1.00 112.37 ? 494  GLN A C   1 
ATOM   3799  O O   . GLN A  1 494 ? -18.695 -63.550 36.703  1.00 110.68 ? 494  GLN A O   1 
ATOM   3800  C CB  . GLN A  1 494 ? -17.403 -66.035 36.797  1.00 107.41 ? 494  GLN A CB  1 
ATOM   3801  C CG  . GLN A  1 494 ? -16.170 -66.943 36.825  1.00 110.65 ? 494  GLN A CG  1 
ATOM   3802  C CD  . GLN A  1 494 ? -14.870 -66.193 36.881  1.00 121.64 ? 494  GLN A CD  1 
ATOM   3803  O OE1 . GLN A  1 494 ? -14.597 -65.313 36.070  1.00 114.85 ? 494  GLN A OE1 1 
ATOM   3804  N NE2 . GLN A  1 494 ? -14.031 -66.537 37.833  1.00 116.02 ? 494  GLN A NE2 1 
ATOM   3805  N N   . CYS A  1 495 ? -19.445 -63.682 38.833  1.00 112.55 ? 495  CYS A N   1 
ATOM   3806  C CA  . CYS A  1 495 ? -20.470 -62.634 38.608  1.00 112.61 ? 495  CYS A CA  1 
ATOM   3807  C C   . CYS A  1 495 ? -19.908 -61.232 38.614  1.00 112.49 ? 495  CYS A C   1 
ATOM   3808  O O   . CYS A  1 495 ? -18.834 -60.991 39.173  1.00 110.92 ? 495  CYS A O   1 
ATOM   3809  C CB  . CYS A  1 495 ? -21.655 -62.747 39.566  1.00 115.59 ? 495  CYS A CB  1 
ATOM   3810  S SG  . CYS A  1 495 ? -22.416 -64.389 39.646  1.00 123.06 ? 495  CYS A SG  1 
ATOM   3811  N N   . LEU A  1 496 ? -20.673 -60.301 38.019  1.00 108.05 ? 496  LEU A N   1 
ATOM   3812  C CA  . LEU A  1 496 ? -20.390 -58.862 37.970  1.00 106.45 ? 496  LEU A CA  1 
ATOM   3813  C C   . LEU A  1 496 ? -20.919 -58.210 39.286  1.00 115.52 ? 496  LEU A C   1 
ATOM   3814  O O   . LEU A  1 496 ? -20.363 -57.204 39.750  1.00 114.87 ? 496  LEU A O   1 
ATOM   3815  C CB  . LEU A  1 496 ? -21.062 -58.221 36.724  1.00 104.49 ? 496  LEU A CB  1 
ATOM   3816  C CG  . LEU A  1 496 ? -20.251 -57.965 35.428  1.00 106.09 ? 496  LEU A CG  1 
ATOM   3817  C CD1 . LEU A  1 496 ? -19.297 -56.820 35.568  1.00 104.54 ? 496  LEU A CD1 1 
ATOM   3818  C CD2 . LEU A  1 496 ? -19.574 -59.197 34.909  1.00 107.78 ? 496  LEU A CD2 1 
ATOM   3819  N N   . SER A  1 497 ? -21.995 -58.810 39.873  1.00 115.72 ? 497  SER A N   1 
ATOM   3820  C CA  . SER A  1 497 ? -22.675 -58.469 41.138  1.00 117.07 ? 497  SER A CA  1 
ATOM   3821  C C   . SER A  1 497 ? -23.590 -59.628 41.521  1.00 125.25 ? 497  SER A C   1 
ATOM   3822  O O   . SER A  1 497 ? -24.027 -60.359 40.629  1.00 124.96 ? 497  SER A O   1 
ATOM   3823  C CB  . SER A  1 497 ? -23.465 -57.163 41.036  1.00 119.05 ? 497  SER A CB  1 
ATOM   3824  O OG  . SER A  1 497 ? -24.017 -56.928 39.752  1.00 126.33 ? 497  SER A OG  1 
ATOM   3825  N N   . CYS A  1 498 ? -23.851 -59.826 42.835  1.00 125.93 ? 498  CYS A N   1 
ATOM   3826  C CA  . CYS A  1 498 ? -24.703 -60.932 43.305  1.00 129.21 ? 498  CYS A CA  1 
ATOM   3827  C C   . CYS A  1 498 ? -26.162 -60.562 43.438  1.00 133.46 ? 498  CYS A C   1 
ATOM   3828  O O   . CYS A  1 498 ? -26.500 -59.428 43.781  1.00 131.97 ? 498  CYS A O   1 
ATOM   3829  C CB  . CYS A  1 498 ? -24.179 -61.573 44.588  1.00 131.88 ? 498  CYS A CB  1 
ATOM   3830  S SG  . CYS A  1 498 ? -22.407 -61.925 44.573  1.00 135.86 ? 498  CYS A SG  1 
ATOM   3831  N N   . ARG A  1 499 ? -27.024 -61.553 43.186  1.00 131.72 ? 499  ARG A N   1 
ATOM   3832  C CA  . ARG A  1 499 ? -28.473 -61.453 43.282  1.00 132.50 ? 499  ARG A CA  1 
ATOM   3833  C C   . ARG A  1 499 ? -28.855 -61.414 44.771  1.00 138.13 ? 499  ARG A C   1 
ATOM   3834  O O   . ARG A  1 499 ? -29.783 -60.697 45.146  1.00 137.56 ? 499  ARG A O   1 
ATOM   3835  C CB  . ARG A  1 499 ? -29.117 -62.636 42.539  1.00 133.38 ? 499  ARG A CB  1 
ATOM   3836  C CG  . ARG A  1 499 ? -30.593 -62.483 42.257  1.00 143.06 ? 499  ARG A CG  1 
ATOM   3837  C CD  . ARG A  1 499 ? -30.957 -63.179 40.971  1.00 152.01 ? 499  ARG A CD  1 
ATOM   3838  N NE  . ARG A  1 499 ? -31.153 -62.209 39.899  1.00 154.30 ? 499  ARG A NE  1 
ATOM   3839  C CZ  . ARG A  1 499 ? -30.982 -62.473 38.611  1.00 165.27 ? 499  ARG A CZ  1 
ATOM   3840  N NH1 . ARG A  1 499 ? -30.586 -63.681 38.219  1.00 154.38 ? 499  ARG A NH1 1 
ATOM   3841  N NH2 . ARG A  1 499 ? -31.189 -61.529 37.703  1.00 146.13 ? 499  ARG A NH2 1 
ATOM   3842  N N   . ARG A  1 500 ? -28.081 -62.116 45.617  1.00 136.06 ? 500  ARG A N   1 
ATOM   3843  C CA  . ARG A  1 500 ? -28.282 -62.131 47.059  1.00 137.54 ? 500  ARG A CA  1 
ATOM   3844  C C   . ARG A  1 500 ? -26.970 -61.837 47.815  1.00 141.43 ? 500  ARG A C   1 
ATOM   3845  O O   . ARG A  1 500 ? -26.446 -60.732 47.682  1.00 138.64 ? 500  ARG A O   1 
ATOM   3846  C CB  . ARG A  1 500 ? -28.972 -63.434 47.509  1.00 140.20 ? 500  ARG A CB  1 
ATOM   3847  C CG  . ARG A  1 500 ? -30.488 -63.328 47.564  1.00 145.94 ? 500  ARG A CG  1 
ATOM   3848  C CD  . ARG A  1 500 ? -31.047 -64.417 48.443  1.00 151.50 ? 500  ARG A CD  1 
ATOM   3849  N NE  . ARG A  1 500 ? -31.492 -65.565 47.657  1.00 156.74 ? 500  ARG A NE  1 
ATOM   3850  C CZ  . ARG A  1 500 ? -31.946 -66.702 48.175  1.00 168.64 ? 500  ARG A CZ  1 
ATOM   3851  N NH1 . ARG A  1 500 ? -31.994 -66.869 49.492  1.00 153.55 ? 500  ARG A NH1 1 
ATOM   3852  N NH2 . ARG A  1 500 ? -32.352 -67.685 47.380  1.00 152.25 ? 500  ARG A NH2 1 
ATOM   3853  N N   . PHE A  1 501 ? -26.445 -62.817 48.589  1.00 141.20 ? 501  PHE A N   1 
ATOM   3854  C CA  . PHE A  1 501 ? -25.221 -62.716 49.408  1.00 141.53 ? 501  PHE A CA  1 
ATOM   3855  C C   . PHE A  1 501 ? -23.938 -63.148 48.682  1.00 142.98 ? 501  PHE A C   1 
ATOM   3856  O O   . PHE A  1 501 ? -24.012 -63.709 47.588  1.00 142.24 ? 501  PHE A O   1 
ATOM   3857  C CB  . PHE A  1 501 ? -25.375 -63.486 50.747  1.00 146.55 ? 501  PHE A CB  1 
ATOM   3858  C CG  . PHE A  1 501 ? -26.439 -62.922 51.658  1.00 149.55 ? 501  PHE A CG  1 
ATOM   3859  C CD1 . PHE A  1 501 ? -27.708 -63.480 51.698  1.00 154.36 ? 501  PHE A CD1 1 
ATOM   3860  C CD2 . PHE A  1 501 ? -26.181 -61.810 52.453  1.00 151.22 ? 501  PHE A CD2 1 
ATOM   3861  C CE1 . PHE A  1 501 ? -28.701 -62.938 52.517  1.00 156.44 ? 501  PHE A CE1 1 
ATOM   3862  C CE2 . PHE A  1 501 ? -27.178 -61.259 53.259  1.00 155.11 ? 501  PHE A CE2 1 
ATOM   3863  C CZ  . PHE A  1 501 ? -28.428 -61.831 53.294  1.00 154.92 ? 501  PHE A CZ  1 
ATOM   3864  N N   . SER A  1 502 ? -22.764 -62.882 49.306  1.00 138.26 ? 502  SER A N   1 
ATOM   3865  C CA  . SER A  1 502 ? -21.431 -63.206 48.778  1.00 136.91 ? 502  SER A CA  1 
ATOM   3866  C C   . SER A  1 502 ? -20.410 -63.569 49.860  1.00 140.44 ? 502  SER A C   1 
ATOM   3867  O O   . SER A  1 502 ? -20.224 -62.802 50.810  1.00 140.59 ? 502  SER A O   1 
ATOM   3868  C CB  . SER A  1 502 ? -20.886 -62.050 47.935  1.00 137.63 ? 502  SER A CB  1 
ATOM   3869  O OG  . SER A  1 502 ? -20.557 -60.894 48.689  1.00 141.65 ? 502  SER A OG  1 
ATOM   3870  N N   . ARG A  1 503 ? -19.730 -64.718 49.695  1.00 136.12 ? 503  ARG A N   1 
ATOM   3871  C CA  . ARG A  1 503 ? -18.667 -65.157 50.599  1.00 136.44 ? 503  ARG A CA  1 
ATOM   3872  C C   . ARG A  1 503 ? -17.343 -65.094 49.853  1.00 138.09 ? 503  ARG A C   1 
ATOM   3873  O O   . ARG A  1 503 ? -16.973 -66.020 49.131  1.00 138.31 ? 503  ARG A O   1 
ATOM   3874  C CB  . ARG A  1 503 ? -18.959 -66.533 51.220  1.00 138.88 ? 503  ARG A CB  1 
ATOM   3875  C CG  . ARG A  1 503 ? -17.795 -67.129 52.029  1.00 149.15 ? 503  ARG A CG  1 
ATOM   3876  C CD  . ARG A  1 503 ? -18.173 -68.267 52.963  1.00 157.33 ? 503  ARG A CD  1 
ATOM   3877  N NE  . ARG A  1 503 ? -19.062 -69.254 52.349  1.00 160.17 ? 503  ARG A NE  1 
ATOM   3878  C CZ  . ARG A  1 503 ? -20.328 -69.429 52.712  1.00 175.38 ? 503  ARG A CZ  1 
ATOM   3879  N NH1 . ARG A  1 503 ? -20.854 -68.690 53.680  1.00 165.37 ? 503  ARG A NH1 1 
ATOM   3880  N NH2 . ARG A  1 503 ? -21.076 -70.344 52.114  1.00 162.37 ? 503  ARG A NH2 1 
ATOM   3881  N N   . GLY A  1 504 ? -16.669 -63.966 50.004  1.00 132.66 ? 504  GLY A N   1 
ATOM   3882  C CA  . GLY A  1 504 ? -15.422 -63.702 49.309  1.00 131.31 ? 504  GLY A CA  1 
ATOM   3883  C C   . GLY A  1 504 ? -15.729 -63.350 47.868  1.00 133.61 ? 504  GLY A C   1 
ATOM   3884  O O   . GLY A  1 504 ? -16.475 -62.396 47.606  1.00 132.38 ? 504  GLY A O   1 
ATOM   3885  N N   . ARG A  1 505 ? -15.213 -64.159 46.929  1.00 129.07 ? 505  ARG A N   1 
ATOM   3886  C CA  . ARG A  1 505 ? -15.427 -63.955 45.497  1.00 126.20 ? 505  ARG A CA  1 
ATOM   3887  C C   . ARG A  1 505 ? -16.644 -64.715 44.957  1.00 130.49 ? 505  ARG A C   1 
ATOM   3888  O O   . ARG A  1 505 ? -17.032 -64.478 43.816  1.00 128.97 ? 505  ARG A O   1 
ATOM   3889  C CB  . ARG A  1 505 ? -14.155 -64.316 44.706  1.00 122.84 ? 505  ARG A CB  1 
ATOM   3890  C CG  . ARG A  1 505 ? -12.980 -63.402 45.021  1.00 116.35 ? 505  ARG A CG  1 
ATOM   3891  C CD  . ARG A  1 505 ? -11.748 -63.721 44.215  1.00 106.23 ? 505  ARG A CD  1 
ATOM   3892  N NE  . ARG A  1 505 ? -10.716 -62.720 44.466  1.00 110.63 ? 505  ARG A NE  1 
ATOM   3893  C CZ  . ARG A  1 505 ? -9.700  -62.458 43.652  1.00 126.33 ? 505  ARG A CZ  1 
ATOM   3894  N NH1 . ARG A  1 505 ? -9.556  -63.134 42.519  1.00 118.44 ? 505  ARG A NH1 1 
ATOM   3895  N NH2 . ARG A  1 505 ? -8.815  -61.521 43.967  1.00 109.60 ? 505  ARG A NH2 1 
ATOM   3896  N N   . ILE A  1 506 ? -17.262 -65.592 45.772  1.00 129.00 ? 506  ILE A N   1 
ATOM   3897  C CA  . ILE A  1 506 ? -18.393 -66.444 45.383  1.00 130.13 ? 506  ILE A CA  1 
ATOM   3898  C C   . ILE A  1 506 ? -19.738 -65.958 45.947  1.00 136.31 ? 506  ILE A C   1 
ATOM   3899  O O   . ILE A  1 506 ? -19.838 -65.723 47.144  1.00 135.83 ? 506  ILE A O   1 
ATOM   3900  C CB  . ILE A  1 506 ? -18.116 -67.936 45.783  1.00 135.40 ? 506  ILE A CB  1 
ATOM   3901  C CG1 . ILE A  1 506 ? -16.620 -68.302 45.749  1.00 135.64 ? 506  ILE A CG1 1 
ATOM   3902  C CG2 . ILE A  1 506 ? -18.924 -68.915 44.938  1.00 136.92 ? 506  ILE A CG2 1 
ATOM   3903  C CD1 . ILE A  1 506 ? -16.001 -68.434 47.078  1.00 141.13 ? 506  ILE A CD1 1 
ATOM   3904  N N   . CYS A  1 507 ? -20.776 -65.855 45.092  1.00 136.00 ? 507  CYS A N   1 
ATOM   3905  C CA  . CYS A  1 507 ? -22.145 -65.470 45.483  1.00 138.13 ? 507  CYS A CA  1 
ATOM   3906  C C   . CYS A  1 507 ? -22.873 -66.701 46.048  1.00 151.58 ? 507  CYS A C   1 
ATOM   3907  O O   . CYS A  1 507 ? -22.877 -67.741 45.386  1.00 152.24 ? 507  CYS A O   1 
ATOM   3908  C CB  . CYS A  1 507 ? -22.929 -64.893 44.302  1.00 136.39 ? 507  CYS A CB  1 
ATOM   3909  S SG  . CYS A  1 507 ? -22.104 -63.552 43.401  1.00 136.97 ? 507  CYS A SG  1 
ATOM   3910  N N   . ILE A  1 508 ? -23.512 -66.588 47.240  1.00 154.49 ? 508  ILE A N   1 
ATOM   3911  C CA  . ILE A  1 508 ? -24.311 -67.672 47.856  1.00 159.12 ? 508  ILE A CA  1 
ATOM   3912  C C   . ILE A  1 508 ? -25.691 -67.131 48.323  1.00 169.74 ? 508  ILE A C   1 
ATOM   3913  O O   . ILE A  1 508 ? -25.888 -65.915 48.390  1.00 167.02 ? 508  ILE A O   1 
ATOM   3914  C CB  . ILE A  1 508 ? -23.549 -68.568 48.913  1.00 164.14 ? 508  ILE A CB  1 
ATOM   3915  C CG1 . ILE A  1 508 ? -22.242 -69.148 48.350  1.00 164.33 ? 508  ILE A CG1 1 
ATOM   3916  C CG2 . ILE A  1 508 ? -24.403 -69.738 49.442  1.00 167.19 ? 508  ILE A CG2 1 
ATOM   3917  C CD1 . ILE A  1 508 ? -21.030 -68.453 48.794  1.00 170.13 ? 508  ILE A CD1 1 
ATOM   3918  N N   . GLU A  1 509 ? -26.650 -68.042 48.587  1.00 174.51 ? 509  GLU A N   1 
ATOM   3919  C CA  . GLU A  1 509 ? -28.021 -67.738 49.004  1.00 177.92 ? 509  GLU A CA  1 
ATOM   3920  C C   . GLU A  1 509 ? -28.121 -67.112 50.411  1.00 188.87 ? 509  GLU A C   1 
ATOM   3921  O O   . GLU A  1 509 ? -28.832 -66.115 50.557  1.00 188.10 ? 509  GLU A O   1 
ATOM   3922  C CB  . GLU A  1 509 ? -28.954 -68.954 48.814  1.00 181.50 ? 509  GLU A CB  1 
ATOM   3923  C CG  . GLU A  1 509 ? -28.861 -69.602 47.431  1.00 192.48 ? 509  GLU A CG  1 
ATOM   3924  C CD  . GLU A  1 509 ? -30.148 -69.885 46.671  1.00 215.04 ? 509  GLU A CD  1 
ATOM   3925  O OE1 . GLU A  1 509 ? -31.127 -70.356 47.296  1.00 221.33 ? 509  GLU A OE1 1 
ATOM   3926  O OE2 . GLU A  1 509 ? -30.163 -69.676 45.436  1.00 202.24 ? 509  GLU A OE2 1 
ATOM   3927  N N   . SER A  1 510 ? -27.409 -67.672 51.433  1.00 191.58 ? 510  SER A N   1 
ATOM   3928  C CA  . SER A  1 510 ? -27.381 -67.113 52.798  1.00 194.65 ? 510  SER A CA  1 
ATOM   3929  C C   . SER A  1 510 ? -26.060 -67.372 53.521  1.00 204.84 ? 510  SER A C   1 
ATOM   3930  O O   . SER A  1 510 ? -25.368 -68.341 53.197  1.00 204.72 ? 510  SER A O   1 
ATOM   3931  C CB  . SER A  1 510 ? -28.534 -67.649 53.640  1.00 201.35 ? 510  SER A CB  1 
ATOM   3932  O OG  . SER A  1 510 ? -28.371 -69.030 53.921  1.00 214.52 ? 510  SER A OG  1 
ATOM   3933  N N   . CYS A  1 511 ? -25.741 -66.540 54.538  1.00 207.20 ? 511  CYS A N   1 
ATOM   3934  C CA  . CYS A  1 511 ? -24.532 -66.688 55.356  1.00 210.61 ? 511  CYS A CA  1 
ATOM   3935  C C   . CYS A  1 511 ? -24.667 -67.887 56.313  1.00 227.15 ? 511  CYS A C   1 
ATOM   3936  O O   . CYS A  1 511 ? -25.772 -68.405 56.512  1.00 228.00 ? 511  CYS A O   1 
ATOM   3937  C CB  . CYS A  1 511 ? -24.221 -65.401 56.124  1.00 209.62 ? 511  CYS A CB  1 
ATOM   3938  S SG  . CYS A  1 511 ? -24.162 -63.897 55.107  1.00 209.64 ? 511  CYS A SG  1 
ATOM   3939  N N   . ASN A  1 512 ? -23.542 -68.314 56.918  1.00 231.39 ? 512  ASN A N   1 
ATOM   3940  C CA  . ASN A  1 512 ? -23.526 -69.396 57.905  1.00 234.22 ? 512  ASN A CA  1 
ATOM   3941  C C   . ASN A  1 512 ? -23.919 -68.808 59.268  1.00 240.71 ? 512  ASN A C   1 
ATOM   3942  O O   . ASN A  1 512 ? -23.089 -68.700 60.173  1.00 241.08 ? 512  ASN A O   1 
ATOM   3943  C CB  . ASN A  1 512 ? -22.149 -70.065 57.957  1.00 236.52 ? 512  ASN A CB  1 
ATOM   3944  C CG  . ASN A  1 512 ? -21.851 -70.967 56.785  1.00 249.11 ? 512  ASN A CG  1 
ATOM   3945  O OD1 . ASN A  1 512 ? -22.739 -71.381 56.025  1.00 241.87 ? 512  ASN A OD1 1 
ATOM   3946  N ND2 . ASN A  1 512 ? -20.585 -71.316 56.635  1.00 245.07 ? 512  ASN A ND2 1 
ATOM   3947  N N   . LEU A  1 513 ? -25.192 -68.393 59.393  1.00 240.03 ? 513  LEU A N   1 
ATOM   3948  C CA  . LEU A  1 513 ? -25.729 -67.755 60.598  1.00 240.76 ? 513  LEU A CA  1 
ATOM   3949  C C   . LEU A  1 513 ? -26.044 -68.741 61.727  1.00 245.35 ? 513  LEU A C   1 
ATOM   3950  O O   . LEU A  1 513 ? -25.708 -68.477 62.888  1.00 245.27 ? 513  LEU A O   1 
ATOM   3951  C CB  . LEU A  1 513 ? -26.983 -66.919 60.257  1.00 240.59 ? 513  LEU A CB  1 
ATOM   3952  C CG  . LEU A  1 513 ? -26.818 -65.753 59.274  1.00 242.96 ? 513  LEU A CG  1 
ATOM   3953  C CD1 . LEU A  1 513 ? -28.117 -65.471 58.554  1.00 243.08 ? 513  LEU A CD1 1 
ATOM   3954  C CD2 . LEU A  1 513 ? -26.320 -64.497 59.974  1.00 243.75 ? 513  LEU A CD2 1 
ATOM   3955  N N   . TYR A  1 514 ? -26.690 -69.869 61.384  1.00 243.89 ? 514  TYR A N   1 
ATOM   3956  C CA  . TYR A  1 514 ? -27.133 -70.875 62.346  1.00 244.67 ? 514  TYR A CA  1 
ATOM   3957  C C   . TYR A  1 514 ? -26.468 -72.244 62.167  1.00 247.79 ? 514  TYR A C   1 
ATOM   3958  O O   . TYR A  1 514 ? -26.495 -73.057 63.096  1.00 248.24 ? 514  TYR A O   1 
ATOM   3959  C CB  . TYR A  1 514 ? -28.669 -70.977 62.322  1.00 245.91 ? 514  TYR A CB  1 
ATOM   3960  C CG  . TYR A  1 514 ? -29.366 -69.643 62.503  1.00 247.01 ? 514  TYR A CG  1 
ATOM   3961  C CD1 . TYR A  1 514 ? -29.804 -68.907 61.406  1.00 247.99 ? 514  TYR A CD1 1 
ATOM   3962  C CD2 . TYR A  1 514 ? -29.567 -69.104 63.771  1.00 247.69 ? 514  TYR A CD2 1 
ATOM   3963  C CE1 . TYR A  1 514 ? -30.422 -67.667 61.566  1.00 248.18 ? 514  TYR A CE1 1 
ATOM   3964  C CE2 . TYR A  1 514 ? -30.200 -67.874 63.944  1.00 248.04 ? 514  TYR A CE2 1 
ATOM   3965  C CZ  . TYR A  1 514 ? -30.625 -67.158 62.838  1.00 252.09 ? 514  TYR A CZ  1 
ATOM   3966  O OH  . TYR A  1 514 ? -31.246 -65.943 63.007  1.00 251.90 ? 514  TYR A OH  1 
ATOM   3967  N N   . ASP A  1 515 ? -25.877 -72.507 60.982  1.00 244.82 ? 515  ASP A N   1 
ATOM   3968  C CA  . ASP A  1 515 ? -25.169 -73.761 60.698  1.00 244.81 ? 515  ASP A CA  1 
ATOM   3969  C C   . ASP A  1 515 ? -23.996 -73.580 59.731  1.00 246.54 ? 515  ASP A C   1 
ATOM   3970  O O   . ASP A  1 515 ? -24.063 -72.752 58.819  1.00 245.69 ? 515  ASP A O   1 
ATOM   3971  C CB  . ASP A  1 515 ? -26.115 -74.874 60.231  1.00 246.38 ? 515  ASP A CB  1 
ATOM   3972  C CG  . ASP A  1 515 ? -25.482 -76.241 60.367  1.00 252.28 ? 515  ASP A CG  1 
ATOM   3973  O OD1 . ASP A  1 515 ? -24.834 -76.690 59.402  1.00 252.30 ? 515  ASP A OD1 1 
ATOM   3974  O OD2 . ASP A  1 515 ? -25.545 -76.814 61.473  1.00 256.26 ? 515  ASP A OD2 1 
ATOM   3975  N N   . GLY A  1 516 ? -22.945 -74.370 59.946  1.00 244.00 ? 516  GLY A N   1 
ATOM   3976  C CA  . GLY A  1 516 ? -21.715 -74.320 59.168  1.00 243.34 ? 516  GLY A CA  1 
ATOM   3977  C C   . GLY A  1 516 ? -20.465 -74.277 60.024  1.00 245.57 ? 516  GLY A C   1 
ATOM   3978  O O   . GLY A  1 516 ? -20.480 -73.723 61.129  1.00 245.22 ? 516  GLY A O   1 
ATOM   3979  N N   . GLU A  1 517 ? -19.364 -74.859 59.490  1.00 242.80 ? 517  GLU A N   1 
ATOM   3980  C CA  . GLU A  1 517 ? -18.028 -74.965 60.101  1.00 242.63 ? 517  GLU A CA  1 
ATOM   3981  C C   . GLU A  1 517 ? -17.535 -73.642 60.690  1.00 244.51 ? 517  GLU A C   1 
ATOM   3982  O O   . GLU A  1 517 ? -16.992 -73.633 61.796  1.00 244.56 ? 517  GLU A O   1 
ATOM   3983  C CB  . GLU A  1 517 ? -17.009 -75.528 59.088  1.00 243.37 ? 517  GLU A CB  1 
ATOM   3984  C CG  . GLU A  1 517 ? -15.676 -75.935 59.700  1.00 248.35 ? 517  GLU A CG  1 
ATOM   3985  C CD  . GLU A  1 517 ? -14.643 -76.516 58.754  1.00 254.37 ? 517  GLU A CD  1 
ATOM   3986  O OE1 . GLU A  1 517 ? -15.027 -77.292 57.850  1.00 246.68 ? 517  GLU A OE1 1 
ATOM   3987  O OE2 . GLU A  1 517 ? -13.437 -76.256 58.965  1.00 248.74 ? 517  GLU A OE2 1 
ATOM   3988  N N   . PHE A  1 518 ? -17.728 -72.537 59.954  1.00 241.09 ? 518  PHE A N   1 
ATOM   3989  C CA  . PHE A  1 518 ? -17.353 -71.199 60.392  1.00 240.42 ? 518  PHE A CA  1 
ATOM   3990  C C   . PHE A  1 518 ? -18.577 -70.317 60.318  1.00 242.09 ? 518  PHE A C   1 
ATOM   3991  O O   . PHE A  1 518 ? -19.095 -70.072 59.228  1.00 241.50 ? 518  PHE A O   1 
ATOM   3992  C CB  . PHE A  1 518 ? -16.210 -70.626 59.540  1.00 241.04 ? 518  PHE A CB  1 
ATOM   3993  C CG  . PHE A  1 518 ? -14.925 -71.412 59.637  1.00 242.57 ? 518  PHE A CG  1 
ATOM   3994  C CD1 . PHE A  1 518 ? -14.627 -72.404 58.711  1.00 244.83 ? 518  PHE A CD1 1 
ATOM   3995  C CD2 . PHE A  1 518 ? -14.021 -71.177 60.668  1.00 244.16 ? 518  PHE A CD2 1 
ATOM   3996  C CE1 . PHE A  1 518 ? -13.442 -73.135 58.805  1.00 245.79 ? 518  PHE A CE1 1 
ATOM   3997  C CE2 . PHE A  1 518 ? -12.837 -71.916 60.765  1.00 246.44 ? 518  PHE A CE2 1 
ATOM   3998  C CZ  . PHE A  1 518 ? -12.556 -72.889 59.832  1.00 245.31 ? 518  PHE A CZ  1 
ATOM   3999  N N   . ARG A  1 519 ? -19.067 -69.875 61.482  1.00 239.09 ? 519  ARG A N   1 
ATOM   4000  C CA  . ARG A  1 519 ? -20.246 -69.019 61.553  1.00 238.20 ? 519  ARG A CA  1 
ATOM   4001  C C   . ARG A  1 519 ? -19.932 -67.611 61.073  1.00 237.25 ? 519  ARG A C   1 
ATOM   4002  O O   . ARG A  1 519 ? -18.775 -67.182 61.124  1.00 237.43 ? 519  ARG A O   1 
ATOM   4003  C CB  . ARG A  1 519 ? -20.908 -69.042 62.940  1.00 240.38 ? 519  ARG A CB  1 
ATOM   4004  C CG  . ARG A  1 519 ? -21.308 -70.439 63.421  1.00 250.87 ? 519  ARG A CG  1 
ATOM   4005  C CD  . ARG A  1 519 ? -22.597 -70.968 62.807  1.00 260.41 ? 519  ARG A CD  1 
ATOM   4006  N NE  . ARG A  1 519 ? -22.630 -72.434 62.815  1.00 269.99 ? 519  ARG A NE  1 
ATOM   4007  C CZ  . ARG A  1 519 ? -23.042 -73.180 63.839  1.00 282.81 ? 519  ARG A CZ  1 
ATOM   4008  N NH1 . ARG A  1 519 ? -23.462 -72.607 64.960  1.00 276.15 ? 519  ARG A NH1 1 
ATOM   4009  N NH2 . ARG A  1 519 ? -23.033 -74.504 63.749  1.00 275.61 ? 519  ARG A NH2 1 
ATOM   4010  N N   . GLU A  1 520 ? -20.945 -66.936 60.511  1.00 231.35 ? 520  GLU A N   1 
ATOM   4011  C CA  . GLU A  1 520 ? -20.816 -65.605 59.924  1.00 228.66 ? 520  GLU A CA  1 
ATOM   4012  C C   . GLU A  1 520 ? -21.990 -64.695 60.251  1.00 226.11 ? 520  GLU A C   1 
ATOM   4013  O O   . GLU A  1 520 ? -23.105 -65.163 60.472  1.00 227.01 ? 520  GLU A O   1 
ATOM   4014  C CB  . GLU A  1 520 ? -20.730 -65.718 58.389  1.00 228.28 ? 520  GLU A CB  1 
ATOM   4015  C CG  . GLU A  1 520 ? -19.480 -66.386 57.839  1.00 237.79 ? 520  GLU A CG  1 
ATOM   4016  C CD  . GLU A  1 520 ? -19.474 -66.588 56.336  1.00 252.35 ? 520  GLU A CD  1 
ATOM   4017  O OE1 . GLU A  1 520 ? -18.496 -66.156 55.684  1.00 245.56 ? 520  GLU A OE1 1 
ATOM   4018  O OE2 . GLU A  1 520 ? -20.450 -67.169 55.808  1.00 246.98 ? 520  GLU A OE2 1 
ATOM   4019  N N   . PHE A  1 521 ? -21.741 -63.390 60.223  1.00 216.31 ? 521  PHE A N   1 
ATOM   4020  C CA  . PHE A  1 521 ? -22.748 -62.351 60.374  1.00 212.63 ? 521  PHE A CA  1 
ATOM   4021  C C   . PHE A  1 521 ? -22.843 -61.679 59.003  1.00 211.98 ? 521  PHE A C   1 
ATOM   4022  O O   . PHE A  1 521 ? -21.884 -61.752 58.227  1.00 209.42 ? 521  PHE A O   1 
ATOM   4023  C CB  . PHE A  1 521 ? -22.350 -61.343 61.474  1.00 214.54 ? 521  PHE A CB  1 
ATOM   4024  C CG  . PHE A  1 521 ? -21.217 -60.399 61.140  1.00 212.97 ? 521  PHE A CG  1 
ATOM   4025  C CD1 . PHE A  1 521 ? -21.472 -59.156 60.569  1.00 213.76 ? 521  PHE A CD1 1 
ATOM   4026  C CD2 . PHE A  1 521 ? -19.899 -60.739 61.427  1.00 214.70 ? 521  PHE A CD2 1 
ATOM   4027  C CE1 . PHE A  1 521 ? -20.427 -58.285 60.254  1.00 212.19 ? 521  PHE A CE1 1 
ATOM   4028  C CE2 . PHE A  1 521 ? -18.854 -59.860 61.128  1.00 215.77 ? 521  PHE A CE2 1 
ATOM   4029  C CZ  . PHE A  1 521 ? -19.125 -58.641 60.540  1.00 211.98 ? 521  PHE A CZ  1 
ATOM   4030  N N   . GLU A  1 522 ? -23.979 -61.036 58.698  1.00 206.35 ? 522  GLU A N   1 
ATOM   4031  C CA  . GLU A  1 522 ? -24.132 -60.353 57.413  1.00 202.92 ? 522  GLU A CA  1 
ATOM   4032  C C   . GLU A  1 522 ? -23.831 -58.869 57.457  1.00 204.91 ? 522  GLU A C   1 
ATOM   4033  O O   . GLU A  1 522 ? -24.572 -58.100 58.067  1.00 204.50 ? 522  GLU A O   1 
ATOM   4034  C CB  . GLU A  1 522 ? -25.444 -60.687 56.668  1.00 204.18 ? 522  GLU A CB  1 
ATOM   4035  C CG  . GLU A  1 522 ? -26.714 -60.685 57.502  1.00 216.68 ? 522  GLU A CG  1 
ATOM   4036  C CD  . GLU A  1 522 ? -27.845 -61.506 56.911  1.00 246.47 ? 522  GLU A CD  1 
ATOM   4037  O OE1 . GLU A  1 522 ? -27.617 -62.692 56.576  1.00 238.37 ? 522  GLU A OE1 1 
ATOM   4038  O OE2 . GLU A  1 522 ? -28.970 -60.969 56.804  1.00 241.33 ? 522  GLU A OE2 1 
ATOM   4039  N N   . ASN A  1 523 ? -22.720 -58.479 56.811  1.00 200.28 ? 523  ASN A N   1 
ATOM   4040  C CA  . ASN A  1 523 ? -22.263 -57.095 56.665  1.00 198.64 ? 523  ASN A CA  1 
ATOM   4041  C C   . ASN A  1 523 ? -22.947 -56.526 55.404  1.00 201.95 ? 523  ASN A C   1 
ATOM   4042  O O   . ASN A  1 523 ? -22.279 -55.975 54.518  1.00 199.85 ? 523  ASN A O   1 
ATOM   4043  C CB  . ASN A  1 523 ? -20.715 -57.061 56.557  1.00 197.87 ? 523  ASN A CB  1 
ATOM   4044  C CG  . ASN A  1 523 ? -20.076 -55.696 56.345  1.00 214.92 ? 523  ASN A CG  1 
ATOM   4045  O OD1 . ASN A  1 523 ? -20.669 -54.636 56.591  1.00 208.28 ? 523  ASN A OD1 1 
ATOM   4046  N ND2 . ASN A  1 523 ? -18.848 -55.695 55.855  1.00 204.73 ? 523  ASN A ND2 1 
ATOM   4047  N N   . ASP A  1 524 ? -24.296 -56.677 55.335  1.00 199.73 ? 524  ASP A N   1 
ATOM   4048  C CA  . ASP A  1 524 ? -25.154 -56.279 54.216  1.00 198.29 ? 524  ASP A CA  1 
ATOM   4049  C C   . ASP A  1 524 ? -24.638 -56.907 52.911  1.00 200.38 ? 524  ASP A C   1 
ATOM   4050  O O   . ASP A  1 524 ? -23.794 -56.323 52.220  1.00 198.21 ? 524  ASP A O   1 
ATOM   4051  C CB  . ASP A  1 524 ? -25.321 -54.744 54.129  1.00 198.89 ? 524  ASP A CB  1 
ATOM   4052  C CG  . ASP A  1 524 ? -26.078 -54.099 55.286  1.00 210.95 ? 524  ASP A CG  1 
ATOM   4053  O OD1 . ASP A  1 524 ? -27.010 -54.744 55.830  1.00 213.18 ? 524  ASP A OD1 1 
ATOM   4054  O OD2 . ASP A  1 524 ? -25.773 -52.932 55.616  1.00 216.49 ? 524  ASP A OD2 1 
ATOM   4055  N N   . SER A  1 525 ? -25.096 -58.147 52.633  1.00 197.35 ? 525  SER A N   1 
ATOM   4056  C CA  . SER A  1 525 ? -24.725 -58.982 51.480  1.00 195.94 ? 525  SER A CA  1 
ATOM   4057  C C   . SER A  1 525 ? -23.337 -59.626 51.537  1.00 198.99 ? 525  SER A C   1 
ATOM   4058  O O   . SER A  1 525 ? -23.120 -60.617 50.848  1.00 198.75 ? 525  SER A O   1 
ATOM   4059  C CB  . SER A  1 525 ? -25.030 -58.322 50.135  1.00 197.22 ? 525  SER A CB  1 
ATOM   4060  O OG  . SER A  1 525 ? -24.009 -57.424 49.735  1.00 203.53 ? 525  SER A OG  1 
ATOM   4061  N N   . ILE A  1 526 ? -22.401 -59.089 52.345  1.00 194.81 ? 526  ILE A N   1 
ATOM   4062  C CA  . ILE A  1 526 ? -21.073 -59.690 52.491  1.00 194.53 ? 526  ILE A CA  1 
ATOM   4063  C C   . ILE A  1 526 ? -21.074 -60.571 53.734  1.00 200.97 ? 526  ILE A C   1 
ATOM   4064  O O   . ILE A  1 526 ? -21.383 -60.086 54.822  1.00 201.38 ? 526  ILE A O   1 
ATOM   4065  C CB  . ILE A  1 526 ? -19.904 -58.658 52.506  1.00 195.81 ? 526  ILE A CB  1 
ATOM   4066  C CG1 . ILE A  1 526 ? -20.014 -57.576 51.390  1.00 193.79 ? 526  ILE A CG1 1 
ATOM   4067  C CG2 . ILE A  1 526 ? -18.535 -59.357 52.526  1.00 196.51 ? 526  ILE A CG2 1 
ATOM   4068  C CD1 . ILE A  1 526 ? -19.695 -57.935 49.889  1.00 200.49 ? 526  ILE A CD1 1 
ATOM   4069  N N   . CYS A  1 527 ? -20.754 -61.865 53.574  1.00 199.53 ? 527  CYS A N   1 
ATOM   4070  C CA  . CYS A  1 527 ? -20.718 -62.805 54.692  1.00 202.77 ? 527  CYS A CA  1 
ATOM   4071  C C   . CYS A  1 527 ? -19.329 -62.832 55.304  1.00 211.78 ? 527  CYS A C   1 
ATOM   4072  O O   . CYS A  1 527 ? -18.378 -63.333 54.701  1.00 210.46 ? 527  CYS A O   1 
ATOM   4073  C CB  . CYS A  1 527 ? -21.197 -64.197 54.284  1.00 203.96 ? 527  CYS A CB  1 
ATOM   4074  S SG  . CYS A  1 527 ? -22.864 -64.234 53.576  1.00 207.40 ? 527  CYS A SG  1 
ATOM   4075  N N   . VAL A  1 528 ? -19.218 -62.245 56.498  1.00 214.46 ? 528  VAL A N   1 
ATOM   4076  C CA  . VAL A  1 528 ? -17.970 -62.117 57.251  1.00 217.56 ? 528  VAL A CA  1 
ATOM   4077  C C   . VAL A  1 528 ? -17.996 -63.072 58.432  1.00 234.73 ? 528  VAL A C   1 
ATOM   4078  O O   . VAL A  1 528 ? -18.970 -63.082 59.190  1.00 236.02 ? 528  VAL A O   1 
ATOM   4079  C CB  . VAL A  1 528 ? -17.724 -60.649 57.705  1.00 218.41 ? 528  VAL A CB  1 
ATOM   4080  C CG1 . VAL A  1 528 ? -16.385 -60.504 58.427  1.00 218.09 ? 528  VAL A CG1 1 
ATOM   4081  C CG2 . VAL A  1 528 ? -17.802 -59.682 56.527  1.00 214.80 ? 528  VAL A CG2 1 
ATOM   4082  N N   . GLU A  1 529 ? -16.912 -63.856 58.590  1.00 239.59 ? 529  GLU A N   1 
ATOM   4083  C CA  . GLU A  1 529 ? -16.739 -64.827 59.667  1.00 242.68 ? 529  GLU A CA  1 
ATOM   4084  C C   . GLU A  1 529 ? -16.639 -64.164 61.033  1.00 250.20 ? 529  GLU A C   1 
ATOM   4085  O O   . GLU A  1 529 ? -15.993 -63.120 61.171  1.00 249.82 ? 529  GLU A O   1 
ATOM   4086  C CB  . GLU A  1 529 ? -15.511 -65.713 59.411  1.00 243.73 ? 529  GLU A CB  1 
ATOM   4087  C CG  . GLU A  1 529 ? -15.784 -66.894 58.495  1.00 250.41 ? 529  GLU A CG  1 
ATOM   4088  C CD  . GLU A  1 529 ? -14.610 -67.809 58.196  1.00 257.38 ? 529  GLU A CD  1 
ATOM   4089  O OE1 . GLU A  1 529 ? -13.633 -67.815 58.979  1.00 247.68 ? 529  GLU A OE1 1 
ATOM   4090  O OE2 . GLU A  1 529 ? -14.695 -68.565 57.202  1.00 252.95 ? 529  GLU A OE2 1 
ATOM   4091  N N   . CYS A  1 530 ? -17.282 -64.779 62.043  1.00 251.43 ? 530  CYS A N   1 
ATOM   4092  C CA  . CYS A  1 530 ? -17.258 -64.311 63.429  1.00 252.81 ? 530  CYS A CA  1 
ATOM   4093  C C   . CYS A  1 530 ? -15.837 -64.467 63.982  1.00 256.55 ? 530  CYS A C   1 
ATOM   4094  O O   . CYS A  1 530 ? -15.111 -65.365 63.545  1.00 256.44 ? 530  CYS A O   1 
ATOM   4095  C CB  . CYS A  1 530 ? -18.269 -65.083 64.273  1.00 254.42 ? 530  CYS A CB  1 
ATOM   4096  S SG  . CYS A  1 530 ? -20.002 -64.773 63.841  1.00 257.13 ? 530  CYS A SG  1 
ATOM   4097  N N   . ASP A  1 531 ? -15.447 -63.589 64.933  1.00 254.57 ? 531  ASP A N   1 
ATOM   4098  C CA  . ASP A  1 531 ? -14.141 -63.585 65.606  1.00 254.78 ? 531  ASP A CA  1 
ATOM   4099  C C   . ASP A  1 531 ? -13.793 -65.005 66.141  1.00 258.71 ? 531  ASP A C   1 
ATOM   4100  O O   . ASP A  1 531 ? -14.693 -65.666 66.668  1.00 258.91 ? 531  ASP A O   1 
ATOM   4101  C CB  . ASP A  1 531 ? -14.171 -62.565 66.755  1.00 255.89 ? 531  ASP A CB  1 
ATOM   4102  C CG  . ASP A  1 531 ? -12.813 -62.039 67.150  1.00 260.56 ? 531  ASP A CG  1 
ATOM   4103  O OD1 . ASP A  1 531 ? -12.350 -61.064 66.523  1.00 259.97 ? 531  ASP A OD1 1 
ATOM   4104  O OD2 . ASP A  1 531 ? -12.226 -62.582 68.108  1.00 264.28 ? 531  ASP A OD2 1 
ATOM   4105  N N   . PRO A  1 532 ? -12.540 -65.520 65.990  1.00 256.70 ? 532  PRO A N   1 
ATOM   4106  C CA  . PRO A  1 532 ? -12.234 -66.885 66.479  1.00 257.47 ? 532  PRO A CA  1 
ATOM   4107  C C   . PRO A  1 532 ? -12.553 -67.137 67.954  1.00 261.62 ? 532  PRO A C   1 
ATOM   4108  O O   . PRO A  1 532 ? -12.725 -68.289 68.355  1.00 261.83 ? 532  PRO A O   1 
ATOM   4109  C CB  . PRO A  1 532 ? -10.737 -67.040 66.196  1.00 258.59 ? 532  PRO A CB  1 
ATOM   4110  C CG  . PRO A  1 532 ? -10.451 -66.070 65.119  1.00 260.80 ? 532  PRO A CG  1 
ATOM   4111  C CD  . PRO A  1 532 ? -11.347 -64.900 65.382  1.00 257.35 ? 532  PRO A CD  1 
ATOM   4112  N N   . GLN A  1 533 ? -12.650 -66.055 68.745  1.00 259.85 ? 533  GLN A N   1 
ATOM   4113  C CA  . GLN A  1 533 ? -12.977 -66.095 70.167  1.00 260.64 ? 533  GLN A CA  1 
ATOM   4114  C C   . GLN A  1 533 ? -14.476 -66.325 70.440  1.00 263.81 ? 533  GLN A C   1 
ATOM   4115  O O   . GLN A  1 533 ? -14.816 -66.733 71.553  1.00 264.29 ? 533  GLN A O   1 
ATOM   4116  C CB  . GLN A  1 533 ? -12.462 -64.834 70.892  1.00 261.36 ? 533  GLN A CB  1 
ATOM   4117  C CG  . GLN A  1 533 ? -10.975 -64.856 71.250  1.00 271.16 ? 533  GLN A CG  1 
ATOM   4118  C CD  . GLN A  1 533 ? -10.622 -66.000 72.164  1.00 285.94 ? 533  GLN A CD  1 
ATOM   4119  O OE1 . GLN A  1 533 ? -11.130 -66.114 73.282  1.00 283.60 ? 533  GLN A OE1 1 
ATOM   4120  N NE2 . GLN A  1 533 ? -9.826  -66.923 71.661  1.00 281.64 ? 533  GLN A NE2 1 
ATOM   4121  N N   . CYS A  1 534 ? -15.368 -66.056 69.444  1.00 260.79 ? 534  CYS A N   1 
ATOM   4122  C CA  . CYS A  1 534 ? -16.820 -66.270 69.576  1.00 260.67 ? 534  CYS A CA  1 
ATOM   4123  C C   . CYS A  1 534 ? -17.074 -67.788 69.615  1.00 264.12 ? 534  CYS A C   1 
ATOM   4124  O O   . CYS A  1 534 ? -16.480 -68.526 68.825  1.00 263.69 ? 534  CYS A O   1 
ATOM   4125  C CB  . CYS A  1 534 ? -17.597 -65.615 68.432  1.00 260.25 ? 534  CYS A CB  1 
ATOM   4126  S SG  . CYS A  1 534 ? -17.621 -63.789 68.417  1.00 262.03 ? 534  CYS A SG  1 
ATOM   4127  N N   . GLU A  1 535 ? -17.933 -68.249 70.539  1.00 262.63 ? 535  GLU A N   1 
ATOM   4128  C CA  . GLU A  1 535 ? -18.264 -69.669 70.680  1.00 263.26 ? 535  GLU A CA  1 
ATOM   4129  C C   . GLU A  1 535 ? -19.398 -70.033 69.723  1.00 265.39 ? 535  GLU A C   1 
ATOM   4130  O O   . GLU A  1 535 ? -20.395 -69.309 69.658  1.00 264.81 ? 535  GLU A O   1 
ATOM   4131  C CB  . GLU A  1 535 ? -18.631 -70.005 72.132  1.00 264.97 ? 535  GLU A CB  1 
ATOM   4132  C CG  . GLU A  1 535 ? -18.719 -71.496 72.415  1.00 273.26 ? 535  GLU A CG  1 
ATOM   4133  C CD  . GLU A  1 535 ? -18.955 -71.837 73.871  1.00 287.15 ? 535  GLU A CD  1 
ATOM   4134  O OE1 . GLU A  1 535 ? -18.029 -71.641 74.690  1.00 285.35 ? 535  GLU A OE1 1 
ATOM   4135  O OE2 . GLU A  1 535 ? -20.062 -72.327 74.189  1.00 284.25 ? 535  GLU A OE2 1 
ATOM   4136  N N   . LYS A  1 536 ? -19.232 -71.154 68.982  1.00 262.95 ? 536  LYS A N   1 
ATOM   4137  C CA  . LYS A  1 536 ? -20.189 -71.683 68.000  1.00 262.61 ? 536  LYS A CA  1 
ATOM   4138  C C   . LYS A  1 536 ? -21.548 -71.990 68.636  1.00 265.30 ? 536  LYS A C   1 
ATOM   4139  O O   . LYS A  1 536 ? -21.762 -73.074 69.187  1.00 265.58 ? 536  LYS A O   1 
ATOM   4140  C CB  . LYS A  1 536 ? -19.626 -72.925 67.281  1.00 264.62 ? 536  LYS A CB  1 
ATOM   4141  C CG  . LYS A  1 536 ? -18.667 -72.628 66.128  1.00 272.07 ? 536  LYS A CG  1 
ATOM   4142  C CD  . LYS A  1 536 ? -19.119 -73.243 64.792  1.00 278.03 ? 536  LYS A CD  1 
ATOM   4143  C CE  . LYS A  1 536 ? -18.834 -74.720 64.626  1.00 286.76 ? 536  LYS A CE  1 
ATOM   4144  N NZ  . LYS A  1 536 ? -19.842 -75.370 63.747  1.00 289.81 ? 536  LYS A NZ  1 
ATOM   4145  N N   . MET A  1 537 ? -22.456 -71.007 68.565  1.00 262.25 ? 537  MET A N   1 
ATOM   4146  C CA  . MET A  1 537 ? -23.807 -71.081 69.123  1.00 262.36 ? 537  MET A CA  1 
ATOM   4147  C C   . MET A  1 537 ? -24.717 -72.011 68.327  1.00 264.54 ? 537  MET A C   1 
ATOM   4148  O O   . MET A  1 537 ? -24.954 -71.779 67.138  1.00 263.81 ? 537  MET A O   1 
ATOM   4149  C CB  . MET A  1 537 ? -24.436 -69.678 69.240  1.00 263.39 ? 537  MET A CB  1 
ATOM   4150  C CG  . MET A  1 537 ? -23.697 -68.731 70.183  1.00 265.87 ? 537  MET A CG  1 
ATOM   4151  S SD  . MET A  1 537 ? -23.292 -69.386 71.827  1.00 269.39 ? 537  MET A SD  1 
ATOM   4152  C CE  . MET A  1 537 ? -24.947 -69.578 72.512  1.00 267.51 ? 537  MET A CE  1 
ATOM   4153  N N   . GLU A  1 538 ? -25.225 -73.063 68.989  1.00 262.28 ? 538  GLU A N   1 
ATOM   4154  C CA  . GLU A  1 538 ? -26.132 -74.039 68.381  1.00 262.11 ? 538  GLU A CA  1 
ATOM   4155  C C   . GLU A  1 538 ? -27.582 -73.733 68.789  1.00 264.73 ? 538  GLU A C   1 
ATOM   4156  O O   . GLU A  1 538 ? -27.811 -72.796 69.557  1.00 264.32 ? 538  GLU A O   1 
ATOM   4157  C CB  . GLU A  1 538 ? -25.726 -75.480 68.758  1.00 263.66 ? 538  GLU A CB  1 
ATOM   4158  C CG  . GLU A  1 538 ? -24.283 -75.856 68.439  1.00 269.02 ? 538  GLU A CG  1 
ATOM   4159  C CD  . GLU A  1 538 ? -23.860 -75.930 66.982  1.00 278.90 ? 538  GLU A CD  1 
ATOM   4160  O OE1 . GLU A  1 538 ? -24.728 -76.149 66.106  1.00 274.65 ? 538  GLU A OE1 1 
ATOM   4161  O OE2 . GLU A  1 538 ? -22.642 -75.808 66.722  1.00 272.44 ? 538  GLU A OE2 1 
ATOM   4162  N N   . ASP A  1 539 ? -28.553 -74.510 68.257  1.00 262.39 ? 539  ASP A N   1 
ATOM   4163  C CA  . ASP A  1 539 ? -29.993 -74.396 68.514  1.00 262.40 ? 539  ASP A CA  1 
ATOM   4164  C C   . ASP A  1 539 ? -30.580 -73.025 68.128  1.00 263.83 ? 539  ASP A C   1 
ATOM   4165  O O   . ASP A  1 539 ? -31.113 -72.304 68.973  1.00 263.59 ? 539  ASP A O   1 
ATOM   4166  C CB  . ASP A  1 539 ? -30.371 -74.829 69.953  1.00 264.44 ? 539  ASP A CB  1 
ATOM   4167  C CG  . ASP A  1 539 ? -29.876 -76.204 70.364  1.00 272.05 ? 539  ASP A CG  1 
ATOM   4168  O OD1 . ASP A  1 539 ? -29.059 -76.281 71.303  1.00 272.62 ? 539  ASP A OD1 1 
ATOM   4169  O OD2 . ASP A  1 539 ? -30.341 -77.206 69.775  1.00 276.33 ? 539  ASP A OD2 1 
ATOM   4170  N N   . GLY A  1 540 ? -30.459 -72.692 66.845  1.00 260.49 ? 540  GLY A N   1 
ATOM   4171  C CA  . GLY A  1 540 ? -30.975 -71.462 66.248  1.00 259.63 ? 540  GLY A CA  1 
ATOM   4172  C C   . GLY A  1 540 ? -30.484 -70.151 66.831  1.00 261.33 ? 540  GLY A C   1 
ATOM   4173  O O   . GLY A  1 540 ? -31.198 -69.146 66.765  1.00 260.68 ? 540  GLY A O   1 
ATOM   4174  N N   . LEU A  1 541 ? -29.254 -70.136 67.366  1.00 258.61 ? 541  LEU A N   1 
ATOM   4175  C CA  . LEU A  1 541 ? -28.659 -68.938 67.955  1.00 257.95 ? 541  LEU A CA  1 
ATOM   4176  C C   . LEU A  1 541 ? -27.557 -68.360 67.080  1.00 259.60 ? 541  LEU A C   1 
ATOM   4177  O O   . LEU A  1 541 ? -26.824 -69.111 66.436  1.00 259.16 ? 541  LEU A O   1 
ATOM   4178  C CB  . LEU A  1 541 ? -28.108 -69.247 69.354  1.00 258.53 ? 541  LEU A CB  1 
ATOM   4179  C CG  . LEU A  1 541 ? -29.127 -69.348 70.479  1.00 262.34 ? 541  LEU A CG  1 
ATOM   4180  C CD1 . LEU A  1 541 ? -28.624 -70.253 71.579  1.00 263.15 ? 541  LEU A CD1 1 
ATOM   4181  C CD2 . LEU A  1 541 ? -29.474 -67.972 71.034  1.00 263.58 ? 541  LEU A CD2 1 
ATOM   4182  N N   . LEU A  1 542 ? -27.429 -67.025 67.064  1.00 256.52 ? 542  LEU A N   1 
ATOM   4183  C CA  . LEU A  1 542 ? -26.375 -66.358 66.298  1.00 255.70 ? 542  LEU A CA  1 
ATOM   4184  C C   . LEU A  1 542 ? -25.074 -66.380 67.112  1.00 259.17 ? 542  LEU A C   1 
ATOM   4185  O O   . LEU A  1 542 ? -25.110 -66.124 68.316  1.00 259.29 ? 542  LEU A O   1 
ATOM   4186  C CB  . LEU A  1 542 ? -26.767 -64.910 65.935  1.00 255.01 ? 542  LEU A CB  1 
ATOM   4187  C CG  . LEU A  1 542 ? -27.942 -64.715 64.965  1.00 257.68 ? 542  LEU A CG  1 
ATOM   4188  C CD1 . LEU A  1 542 ? -28.327 -63.257 64.872  1.00 257.29 ? 542  LEU A CD1 1 
ATOM   4189  C CD2 . LEU A  1 542 ? -27.621 -65.246 63.577  1.00 258.50 ? 542  LEU A CD2 1 
ATOM   4190  N N   . THR A  1 543 ? -23.939 -66.723 66.465  1.00 256.88 ? 543  THR A N   1 
ATOM   4191  C CA  . THR A  1 543 ? -22.607 -66.794 67.091  1.00 256.88 ? 543  THR A CA  1 
ATOM   4192  C C   . THR A  1 543 ? -22.058 -65.386 67.402  1.00 259.22 ? 543  THR A C   1 
ATOM   4193  O O   . THR A  1 543 ? -21.383 -65.186 68.419  1.00 259.26 ? 543  THR A O   1 
ATOM   4194  C CB  . THR A  1 543 ? -21.686 -67.706 66.253  1.00 261.89 ? 543  THR A CB  1 
ATOM   4195  O OG1 . THR A  1 543 ? -22.190 -69.040 66.326  1.00 261.95 ? 543  THR A OG1 1 
ATOM   4196  C CG2 . THR A  1 543 ? -20.234 -67.695 66.717  1.00 260.69 ? 543  THR A CG2 1 
ATOM   4197  N N   . CYS A  1 544 ? -22.353 -64.424 66.516  1.00 256.02 ? 544  CYS A N   1 
ATOM   4198  C CA  . CYS A  1 544 ? -21.963 -63.024 66.658  1.00 255.32 ? 544  CYS A CA  1 
ATOM   4199  C C   . CYS A  1 544 ? -23.003 -62.094 66.025  1.00 257.94 ? 544  CYS A C   1 
ATOM   4200  O O   . CYS A  1 544 ? -23.872 -62.551 65.279  1.00 257.64 ? 544  CYS A O   1 
ATOM   4201  C CB  . CYS A  1 544 ? -20.547 -62.769 66.133  1.00 255.06 ? 544  CYS A CB  1 
ATOM   4202  S SG  . CYS A  1 544 ? -20.372 -62.824 64.326  1.00 256.83 ? 544  CYS A SG  1 
ATOM   4203  N N   . HIS A  1 545 ? -22.943 -60.807 66.371  1.00 255.58 ? 545  HIS A N   1 
ATOM   4204  C CA  . HIS A  1 545 ? -23.833 -59.762 65.864  1.00 255.27 ? 545  HIS A CA  1 
ATOM   4205  C C   . HIS A  1 545 ? -23.001 -58.577 65.338  1.00 257.79 ? 545  HIS A C   1 
ATOM   4206  O O   . HIS A  1 545 ? -23.444 -57.423 65.375  1.00 257.21 ? 545  HIS A O   1 
ATOM   4207  C CB  . HIS A  1 545 ? -24.847 -59.333 66.945  1.00 256.17 ? 545  HIS A CB  1 
ATOM   4208  C CG  . HIS A  1 545 ? -24.230 -59.112 68.289  1.00 258.70 ? 545  HIS A CG  1 
ATOM   4209  N ND1 . HIS A  1 545 ? -23.597 -57.925 68.605  1.00 259.62 ? 545  HIS A ND1 1 
ATOM   4210  C CD2 . HIS A  1 545 ? -24.142 -59.951 69.347  1.00 260.31 ? 545  HIS A CD2 1 
ATOM   4211  C CE1 . HIS A  1 545 ? -23.159 -58.072 69.844  1.00 259.53 ? 545  HIS A CE1 1 
ATOM   4212  N NE2 . HIS A  1 545 ? -23.462 -59.276 70.331  1.00 260.23 ? 545  HIS A NE2 1 
ATOM   4213  N N   . GLY A  1 546 ? -21.803 -58.897 64.844  1.00 255.59 ? 546  GLY A N   1 
ATOM   4214  C CA  . GLY A  1 546 ? -20.862 -57.932 64.293  1.00 255.14 ? 546  GLY A CA  1 
ATOM   4215  C C   . GLY A  1 546 ? -19.413 -58.391 64.307  1.00 257.98 ? 546  GLY A C   1 
ATOM   4216  O O   . GLY A  1 546 ? -19.119 -59.533 64.690  1.00 257.92 ? 546  GLY A O   1 
ATOM   4217  N N   . PRO A  1 547 ? -18.474 -57.498 63.901  1.00 255.40 ? 547  PRO A N   1 
ATOM   4218  C CA  . PRO A  1 547 ? -17.057 -57.886 63.868  1.00 255.39 ? 547  PRO A CA  1 
ATOM   4219  C C   . PRO A  1 547 ? -16.280 -57.609 65.154  1.00 258.83 ? 547  PRO A C   1 
ATOM   4220  O O   . PRO A  1 547 ? -16.585 -56.667 65.895  1.00 258.57 ? 547  PRO A O   1 
ATOM   4221  C CB  . PRO A  1 547 ? -16.503 -57.077 62.693  1.00 255.92 ? 547  PRO A CB  1 
ATOM   4222  C CG  . PRO A  1 547 ? -17.410 -55.876 62.582  1.00 258.77 ? 547  PRO A CG  1 
ATOM   4223  C CD  . PRO A  1 547 ? -18.657 -56.121 63.395  1.00 256.11 ? 547  PRO A CD  1 
ATOM   4224  N N   . GLY A  1 548 ? -15.255 -58.425 65.379  1.00 257.03 ? 548  GLY A N   1 
ATOM   4225  C CA  . GLY A  1 548 ? -14.383 -58.316 66.540  1.00 257.37 ? 548  GLY A CA  1 
ATOM   4226  C C   . GLY A  1 548 ? -14.850 -59.123 67.737  1.00 260.94 ? 548  GLY A C   1 
ATOM   4227  O O   . GLY A  1 548 ? -15.966 -59.657 67.729  1.00 260.87 ? 548  GLY A O   1 
ATOM   4228  N N   . PRO A  1 549 ? -14.014 -59.219 68.801  1.00 258.96 ? 549  PRO A N   1 
ATOM   4229  C CA  . PRO A  1 549 ? -14.415 -59.999 69.988  1.00 259.40 ? 549  PRO A CA  1 
ATOM   4230  C C   . PRO A  1 549 ? -15.440 -59.305 70.885  1.00 261.75 ? 549  PRO A C   1 
ATOM   4231  O O   . PRO A  1 549 ? -16.049 -59.967 71.733  1.00 261.85 ? 549  PRO A O   1 
ATOM   4232  C CB  . PRO A  1 549 ? -13.091 -60.255 70.723  1.00 261.01 ? 549  PRO A CB  1 
ATOM   4233  C CG  . PRO A  1 549 ? -12.012 -59.631 69.875  1.00 263.72 ? 549  PRO A CG  1 
ATOM   4234  C CD  . PRO A  1 549 ? -12.667 -58.646 68.976  1.00 260.02 ? 549  PRO A CD  1 
ATOM   4235  N N   . ASP A  1 550 ? -15.624 -57.977 70.705  1.00 258.51 ? 550  ASP A N   1 
ATOM   4236  C CA  . ASP A  1 550 ? -16.593 -57.182 71.461  1.00 258.20 ? 550  ASP A CA  1 
ATOM   4237  C C   . ASP A  1 550 ? -18.030 -57.547 71.076  1.00 260.87 ? 550  ASP A C   1 
ATOM   4238  O O   . ASP A  1 550 ? -18.898 -57.592 71.949  1.00 261.00 ? 550  ASP A O   1 
ATOM   4239  C CB  . ASP A  1 550 ? -16.329 -55.666 71.324  1.00 258.61 ? 550  ASP A CB  1 
ATOM   4240  C CG  . ASP A  1 550 ? -16.154 -55.156 69.906  1.00 260.44 ? 550  ASP A CG  1 
ATOM   4241  O OD1 . ASP A  1 550 ? -15.047 -55.319 69.350  1.00 260.04 ? 550  ASP A OD1 1 
ATOM   4242  O OD2 . ASP A  1 550 ? -17.102 -54.536 69.378  1.00 261.92 ? 550  ASP A OD2 1 
ATOM   4243  N N   . ASN A  1 551 ? -18.254 -57.876 69.786  1.00 257.97 ? 551  ASN A N   1 
ATOM   4244  C CA  . ASN A  1 551 ? -19.559 -58.246 69.235  1.00 257.67 ? 551  ASN A CA  1 
ATOM   4245  C C   . ASN A  1 551 ? -19.875 -59.766 69.259  1.00 260.67 ? 551  ASN A C   1 
ATOM   4246  O O   . ASN A  1 551 ? -20.615 -60.253 68.399  1.00 260.30 ? 551  ASN A O   1 
ATOM   4247  C CB  . ASN A  1 551 ? -19.744 -57.629 67.839  1.00 256.66 ? 551  ASN A CB  1 
ATOM   4248  C CG  . ASN A  1 551 ? -20.026 -56.143 67.844  1.00 265.85 ? 551  ASN A CG  1 
ATOM   4249  O OD1 . ASN A  1 551 ? -21.056 -55.678 68.346  1.00 261.40 ? 551  ASN A OD1 1 
ATOM   4250  N ND2 . ASN A  1 551 ? -19.136 -55.365 67.244  1.00 259.33 ? 551  ASN A ND2 1 
ATOM   4251  N N   . CYS A  1 552 ? -19.347 -60.501 70.266  1.00 258.69 ? 552  CYS A N   1 
ATOM   4252  C CA  . CYS A  1 552 ? -19.586 -61.943 70.447  1.00 258.97 ? 552  CYS A CA  1 
ATOM   4253  C C   . CYS A  1 552 ? -20.909 -62.183 71.178  1.00 261.50 ? 552  CYS A C   1 
ATOM   4254  O O   . CYS A  1 552 ? -21.424 -61.274 71.830  1.00 261.07 ? 552  CYS A O   1 
ATOM   4255  C CB  . CYS A  1 552 ? -18.431 -62.598 71.205  1.00 260.00 ? 552  CYS A CB  1 
ATOM   4256  S SG  . CYS A  1 552 ? -16.984 -63.031 70.198  1.00 262.33 ? 552  CYS A SG  1 
ATOM   4257  N N   . THR A  1 553 ? -21.430 -63.421 71.105  1.00 259.26 ? 553  THR A N   1 
ATOM   4258  C CA  . THR A  1 553 ? -22.631 -63.839 71.829  1.00 259.53 ? 553  THR A CA  1 
ATOM   4259  C C   . THR A  1 553 ? -22.169 -64.462 73.157  1.00 263.05 ? 553  THR A C   1 
ATOM   4260  O O   . THR A  1 553 ? -22.657 -64.085 74.223  1.00 263.08 ? 553  THR A O   1 
ATOM   4261  C CB  . THR A  1 553 ? -23.504 -64.749 70.949  1.00 263.62 ? 553  THR A CB  1 
ATOM   4262  O OG1 . THR A  1 553 ? -24.083 -63.954 69.916  1.00 261.81 ? 553  THR A OG1 1 
ATOM   4263  C CG2 . THR A  1 553 ? -24.615 -65.441 71.724  1.00 263.14 ? 553  THR A CG2 1 
ATOM   4264  N N   . LYS A  1 554 ? -21.208 -65.396 73.073  1.00 260.95 ? 554  LYS A N   1 
ATOM   4265  C CA  . LYS A  1 554 ? -20.584 -66.091 74.196  1.00 261.45 ? 554  LYS A CA  1 
ATOM   4266  C C   . LYS A  1 554 ? -19.099 -66.250 73.858  1.00 264.12 ? 554  LYS A C   1 
ATOM   4267  O O   . LYS A  1 554 ? -18.768 -66.467 72.693  1.00 263.45 ? 554  LYS A O   1 
ATOM   4268  C CB  . LYS A  1 554 ? -21.244 -67.467 74.408  1.00 263.59 ? 554  LYS A CB  1 
ATOM   4269  C CG  . LYS A  1 554 ? -20.887 -68.136 75.731  1.00 270.63 ? 554  LYS A CG  1 
ATOM   4270  C CD  . LYS A  1 554 ? -21.297 -69.600 75.748  1.00 276.49 ? 554  LYS A CD  1 
ATOM   4271  C CE  . LYS A  1 554 ? -20.911 -70.311 77.025  1.00 284.22 ? 554  LYS A CE  1 
ATOM   4272  N NZ  . LYS A  1 554 ? -21.816 -69.980 78.158  1.00 288.07 ? 554  LYS A NZ  1 
ATOM   4273  N N   . CYS A  1 555 ? -18.211 -66.118 74.858  1.00 262.08 ? 555  CYS A N   1 
ATOM   4274  C CA  . CYS A  1 555 ? -16.768 -66.266 74.656  1.00 261.82 ? 555  CYS A CA  1 
ATOM   4275  C C   . CYS A  1 555 ? -16.370 -67.728 74.776  1.00 265.31 ? 555  CYS A C   1 
ATOM   4276  O O   . CYS A  1 555 ? -16.855 -68.420 75.669  1.00 265.75 ? 555  CYS A O   1 
ATOM   4277  C CB  . CYS A  1 555 ? -15.987 -65.391 75.630  1.00 262.27 ? 555  CYS A CB  1 
ATOM   4278  S SG  . CYS A  1 555 ? -16.355 -63.625 75.493  1.00 263.93 ? 555  CYS A SG  1 
ATOM   4279  N N   . SER A  1 556 ? -15.499 -68.200 73.875  1.00 262.66 ? 556  SER A N   1 
ATOM   4280  C CA  . SER A  1 556 ? -15.038 -69.589 73.855  1.00 279.43 ? 556  SER A CA  1 
ATOM   4281  C C   . SER A  1 556 ? -14.053 -69.876 74.981  1.00 291.94 ? 556  SER A C   1 
ATOM   4282  O O   . SER A  1 556 ? -14.046 -70.977 75.531  1.00 275.71 ? 556  SER A O   1 
ATOM   4283  C CB  . SER A  1 556 ? -14.407 -69.921 72.509  1.00 281.48 ? 556  SER A CB  1 
ATOM   4284  O OG  . SER A  1 556 ? -14.668 -71.263 72.139  1.00 286.97 ? 556  SER A OG  1 
ATOM   4285  N N   . GLN B  1 1   ? 21.646  -0.938  40.863  1.00 83.60  ? 1    GLN B N   1 
ATOM   4286  C CA  . GLN B  1 1   ? 22.547  -1.905  41.488  1.00 84.07  ? 1    GLN B CA  1 
ATOM   4287  C C   . GLN B  1 1   ? 22.769  -1.669  43.016  1.00 85.97  ? 1    GLN B C   1 
ATOM   4288  O O   . GLN B  1 1   ? 22.536  -2.620  43.775  1.00 84.83  ? 1    GLN B O   1 
ATOM   4289  C CB  . GLN B  1 1   ? 23.882  -2.038  40.698  1.00 86.99  ? 1    GLN B CB  1 
ATOM   4290  C CG  . GLN B  1 1   ? 24.062  -3.361  39.922  1.00 121.49 ? 1    GLN B CG  1 
ATOM   4291  C CD  . GLN B  1 1   ? 24.010  -3.213  38.398  1.00 152.76 ? 1    GLN B CD  1 
ATOM   4292  O OE1 . GLN B  1 1   ? 24.891  -2.609  37.755  1.00 149.15 ? 1    GLN B OE1 1 
ATOM   4293  N NE2 . GLN B  1 1   ? 22.995  -3.813  37.779  1.00 146.69 ? 1    GLN B NE2 1 
ATOM   4294  N N   . SER B  1 2   ? 23.217  -0.420  43.465  1.00 79.95  ? 2    SER B N   1 
ATOM   4295  C CA  . SER B  1 2   ? 23.418  -0.063  44.897  1.00 77.53  ? 2    SER B CA  1 
ATOM   4296  C C   . SER B  1 2   ? 22.060  0.089   45.584  1.00 78.41  ? 2    SER B C   1 
ATOM   4297  O O   . SER B  1 2   ? 21.178  0.824   45.124  1.00 78.50  ? 2    SER B O   1 
ATOM   4298  C CB  . SER B  1 2   ? 24.270  1.184   45.074  1.00 80.35  ? 2    SER B CB  1 
ATOM   4299  O OG  . SER B  1 2   ? 23.822  2.249   44.258  1.00 89.82  ? 2    SER B OG  1 
ATOM   4300  N N   . VAL B  1 3   ? 21.878  -0.688  46.635  1.00 71.19  ? 3    VAL B N   1 
ATOM   4301  C CA  . VAL B  1 3   ? 20.629  -0.857  47.337  1.00 69.16  ? 3    VAL B CA  1 
ATOM   4302  C C   . VAL B  1 3   ? 20.669  -0.300  48.760  1.00 71.56  ? 3    VAL B C   1 
ATOM   4303  O O   . VAL B  1 3   ? 21.706  -0.344  49.406  1.00 71.08  ? 3    VAL B O   1 
ATOM   4304  C CB  . VAL B  1 3   ? 20.331  -2.381  47.283  1.00 71.83  ? 3    VAL B CB  1 
ATOM   4305  C CG1 . VAL B  1 3   ? 19.313  -2.839  48.316  1.00 71.94  ? 3    VAL B CG1 1 
ATOM   4306  C CG2 . VAL B  1 3   ? 19.891  -2.793  45.896  1.00 71.44  ? 3    VAL B CG2 1 
ATOM   4307  N N   . CYS B  1 4   ? 19.528  0.234   49.235  1.00 66.82  ? 4    CYS B N   1 
ATOM   4308  C CA  . CYS B  1 4   ? 19.356  0.718   50.599  1.00 66.50  ? 4    CYS B CA  1 
ATOM   4309  C C   . CYS B  1 4   ? 17.989  0.345   51.122  1.00 63.17  ? 4    CYS B C   1 
ATOM   4310  O O   . CYS B  1 4   ? 17.132  -0.060  50.340  1.00 61.25  ? 4    CYS B O   1 
ATOM   4311  C CB  . CYS B  1 4   ? 19.608  2.209   50.701  1.00 69.25  ? 4    CYS B CB  1 
ATOM   4312  S SG  . CYS B  1 4   ? 18.444  3.194   49.752  1.00 74.82  ? 4    CYS B SG  1 
ATOM   4313  N N   . ALA B  1 5   ? 17.788  0.445   52.439  1.00 57.51  ? 5    ALA B N   1 
ATOM   4314  C CA  . ALA B  1 5   ? 16.534  0.025   53.046  1.00 57.60  ? 5    ALA B CA  1 
ATOM   4315  C C   . ALA B  1 5   ? 15.447  1.067   53.109  1.00 63.88  ? 5    ALA B C   1 
ATOM   4316  O O   . ALA B  1 5   ? 14.269  0.727   52.964  1.00 65.42  ? 5    ALA B O   1 
ATOM   4317  C CB  . ALA B  1 5   ? 16.772  -0.563  54.425  1.00 58.03  ? 5    ALA B CB  1 
ATOM   4318  N N   . GLY B  1 6   ? 15.813  2.302   53.401  1.00 59.13  ? 6    GLY B N   1 
ATOM   4319  C CA  . GLY B  1 6   ? 14.823  3.352   53.544  1.00 59.54  ? 6    GLY B CA  1 
ATOM   4320  C C   . GLY B  1 6   ? 13.997  3.228   54.817  1.00 62.70  ? 6    GLY B C   1 
ATOM   4321  O O   . GLY B  1 6   ? 13.886  2.151   55.408  1.00 61.99  ? 6    GLY B O   1 
ATOM   4322  N N   . THR B  1 7   ? 13.347  4.321   55.191  1.00 57.26  ? 7    THR B N   1 
ATOM   4323  C CA  . THR B  1 7   ? 12.577  4.396   56.405  1.00 55.91  ? 7    THR B CA  1 
ATOM   4324  C C   . THR B  1 7   ? 11.139  3.904   56.344  1.00 56.80  ? 7    THR B C   1 
ATOM   4325  O O   . THR B  1 7   ? 10.678  3.409   55.302  1.00 54.68  ? 7    THR B O   1 
ATOM   4326  C CB  . THR B  1 7   ? 12.807  5.736   57.046  1.00 64.46  ? 7    THR B CB  1 
ATOM   4327  O OG1 . THR B  1 7   ? 12.410  6.776   56.119  1.00 68.95  ? 7    THR B OG1 1 
ATOM   4328  C CG2 . THR B  1 7   ? 14.259  5.897   57.495  1.00 59.16  ? 7    THR B CG2 1 
ATOM   4329  N N   . GLU B  1 8   ? 10.480  3.965   57.529  1.00 51.94  ? 8    GLU B N   1 
ATOM   4330  C CA  . GLU B  1 8   ? 9.099   3.590   57.808  1.00 51.62  ? 8    GLU B CA  1 
ATOM   4331  C C   . GLU B  1 8   ? 8.530   4.531   58.950  1.00 57.49  ? 8    GLU B C   1 
ATOM   4332  O O   . GLU B  1 8   ? 7.765   4.100   59.833  1.00 57.45  ? 8    GLU B O   1 
ATOM   4333  C CB  . GLU B  1 8   ? 9.049   2.110   58.226  1.00 51.65  ? 8    GLU B CB  1 
ATOM   4334  C CG  . GLU B  1 8   ? 8.790   1.141   57.093  1.00 57.20  ? 8    GLU B CG  1 
ATOM   4335  C CD  . GLU B  1 8   ? 8.290   -0.232  57.507  1.00 86.91  ? 8    GLU B CD  1 
ATOM   4336  O OE1 . GLU B  1 8   ? 8.905   -0.812  58.429  1.00 80.33  ? 8    GLU B OE1 1 
ATOM   4337  O OE2 . GLU B  1 8   ? 7.314   -0.741  56.898  1.00 91.83  ? 8    GLU B OE2 1 
ATOM   4338  N N   . ASN B  1 9   ? 8.927   5.818   58.905  1.00 53.15  ? 9    ASN B N   1 
ATOM   4339  C CA  . ASN B  1 9   ? 8.581   6.808   59.900  1.00 54.17  ? 9    ASN B CA  1 
ATOM   4340  C C   . ASN B  1 9   ? 7.285   7.536   59.613  1.00 62.23  ? 9    ASN B C   1 
ATOM   4341  O O   . ASN B  1 9   ? 6.661   8.056   60.553  1.00 65.00  ? 9    ASN B O   1 
ATOM   4342  C CB  . ASN B  1 9   ? 9.697   7.826   60.044  1.00 52.10  ? 9    ASN B CB  1 
ATOM   4343  C CG  . ASN B  1 9   ? 11.042  7.235   60.362  1.00 83.88  ? 9    ASN B CG  1 
ATOM   4344  O OD1 . ASN B  1 9   ? 11.171  6.150   60.959  1.00 71.30  ? 9    ASN B OD1 1 
ATOM   4345  N ND2 . ASN B  1 9   ? 12.080  7.946   59.948  1.00 83.49  ? 9    ASN B ND2 1 
ATOM   4346  N N   . LYS B  1 10  ? 6.878   7.590   58.324  1.00 56.00  ? 10   LYS B N   1 
ATOM   4347  C CA  . LYS B  1 10  ? 5.709   8.326   57.843  1.00 54.90  ? 10   LYS B CA  1 
ATOM   4348  C C   . LYS B  1 10  ? 5.986   9.842   58.070  1.00 62.42  ? 10   LYS B C   1 
ATOM   4349  O O   . LYS B  1 10  ? 7.053   10.337  57.660  1.00 63.34  ? 10   LYS B O   1 
ATOM   4350  C CB  . LYS B  1 10  ? 4.412   7.826   58.494  1.00 56.26  ? 10   LYS B CB  1 
ATOM   4351  C CG  . LYS B  1 10  ? 4.043   6.412   58.096  1.00 70.81  ? 10   LYS B CG  1 
ATOM   4352  C CD  . LYS B  1 10  ? 3.710   5.544   59.308  1.00 78.78  ? 10   LYS B CD  1 
ATOM   4353  C CE  . LYS B  1 10  ? 3.763   4.077   58.938  1.00 86.18  ? 10   LYS B CE  1 
ATOM   4354  N NZ  . LYS B  1 10  ? 3.653   3.189   60.123  1.00 100.29 ? 10   LYS B NZ  1 
ATOM   4355  N N   . LEU B  1 11  ? 5.087   10.555  58.764  1.00 60.11  ? 11   LEU B N   1 
ATOM   4356  C CA  . LEU B  1 11  ? 5.261   11.976  59.028  1.00 60.83  ? 11   LEU B CA  1 
ATOM   4357  C C   . LEU B  1 11  ? 6.168   12.310  60.227  1.00 69.09  ? 11   LEU B C   1 
ATOM   4358  O O   . LEU B  1 11  ? 6.598   13.475  60.390  1.00 70.62  ? 11   LEU B O   1 
ATOM   4359  C CB  . LEU B  1 11  ? 3.911   12.684  59.091  1.00 61.46  ? 11   LEU B CB  1 
ATOM   4360  C CG  . LEU B  1 11  ? 3.092   12.644  57.810  1.00 64.40  ? 11   LEU B CG  1 
ATOM   4361  C CD1 . LEU B  1 11  ? 1.801   13.367  57.981  1.00 64.57  ? 11   LEU B CD1 1 
ATOM   4362  C CD2 . LEU B  1 11  ? 3.848   13.249  56.654  1.00 66.86  ? 11   LEU B CD2 1 
ATOM   4363  N N   . SER B  1 12  ? 6.517   11.272  61.027  1.00 65.66  ? 12   SER B N   1 
ATOM   4364  C CA  . SER B  1 12  ? 7.418   11.396  62.171  1.00 65.71  ? 12   SER B CA  1 
ATOM   4365  C C   . SER B  1 12  ? 8.809   11.746  61.690  1.00 69.15  ? 12   SER B C   1 
ATOM   4366  O O   . SER B  1 12  ? 9.186   11.391  60.570  1.00 67.46  ? 12   SER B O   1 
ATOM   4367  C CB  . SER B  1 12  ? 7.419   10.129  63.011  1.00 69.56  ? 12   SER B CB  1 
ATOM   4368  O OG  . SER B  1 12  ? 6.095   9.839   63.432  1.00 80.39  ? 12   SER B OG  1 
ATOM   4369  N N   . SER B  1 13  ? 9.521   12.537  62.498  1.00 68.09  ? 13   SER B N   1 
ATOM   4370  C CA  . SER B  1 13  ? 10.838  13.107  62.205  1.00 67.98  ? 13   SER B CA  1 
ATOM   4371  C C   . SER B  1 13  ? 11.593  13.473  63.495  1.00 72.33  ? 13   SER B C   1 
ATOM   4372  O O   . SER B  1 13  ? 11.067  13.283  64.592  1.00 72.30  ? 13   SER B O   1 
ATOM   4373  C CB  . SER B  1 13  ? 10.696  14.352  61.317  1.00 71.78  ? 13   SER B CB  1 
ATOM   4374  O OG  . SER B  1 13  ? 9.673   15.256  61.710  1.00 76.73  ? 13   SER B OG  1 
ATOM   4375  N N   . LEU B  1 14  ? 12.833  13.965  63.361  1.00 68.65  ? 14   LEU B N   1 
ATOM   4376  C CA  . LEU B  1 14  ? 13.627  14.364  64.510  1.00 68.98  ? 14   LEU B CA  1 
ATOM   4377  C C   . LEU B  1 14  ? 13.332  15.828  64.790  1.00 79.56  ? 14   LEU B C   1 
ATOM   4378  O O   . LEU B  1 14  ? 13.089  16.599  63.845  1.00 81.78  ? 14   LEU B O   1 
ATOM   4379  C CB  . LEU B  1 14  ? 15.122  14.175  64.234  1.00 67.39  ? 14   LEU B CB  1 
ATOM   4380  C CG  . LEU B  1 14  ? 15.622  12.767  63.995  1.00 68.95  ? 14   LEU B CG  1 
ATOM   4381  C CD1 . LEU B  1 14  ? 16.959  12.812  63.424  1.00 67.87  ? 14   LEU B CD1 1 
ATOM   4382  C CD2 . LEU B  1 14  ? 15.667  11.964  65.255  1.00 71.30  ? 14   LEU B CD2 1 
ATOM   4383  N N   . SER B  1 15  ? 13.332  16.217  66.087  1.00 77.20  ? 15   SER B N   1 
ATOM   4384  C CA  . SER B  1 15  ? 13.095  17.600  66.521  1.00 78.45  ? 15   SER B CA  1 
ATOM   4385  C C   . SER B  1 15  ? 14.201  18.502  65.967  1.00 83.01  ? 15   SER B C   1 
ATOM   4386  O O   . SER B  1 15  ? 13.900  19.606  65.498  1.00 84.54  ? 15   SER B O   1 
ATOM   4387  C CB  . SER B  1 15  ? 13.073  17.694  68.041  1.00 84.09  ? 15   SER B CB  1 
ATOM   4388  O OG  . SER B  1 15  ? 12.143  16.792  68.619  1.00 97.10  ? 15   SER B OG  1 
ATOM   4389  N N   . ASP B  1 16  ? 15.480  18.019  65.986  1.00 77.52  ? 16   ASP B N   1 
ATOM   4390  C CA  . ASP B  1 16  ? 16.613  18.766  65.441  1.00 76.95  ? 16   ASP B CA  1 
ATOM   4391  C C   . ASP B  1 16  ? 16.510  18.692  63.926  1.00 78.35  ? 16   ASP B C   1 
ATOM   4392  O O   . ASP B  1 16  ? 16.667  17.621  63.347  1.00 76.87  ? 16   ASP B O   1 
ATOM   4393  C CB  . ASP B  1 16  ? 17.964  18.227  65.963  1.00 78.72  ? 16   ASP B CB  1 
ATOM   4394  C CG  . ASP B  1 16  ? 19.212  19.042  65.605  1.00 99.48  ? 16   ASP B CG  1 
ATOM   4395  O OD1 . ASP B  1 16  ? 20.224  18.943  66.346  1.00 102.71 ? 16   ASP B OD1 1 
ATOM   4396  O OD2 . ASP B  1 16  ? 19.185  19.767  64.577  1.00 108.22 ? 16   ASP B OD2 1 
ATOM   4397  N N   . LEU B  1 17  ? 16.193  19.826  63.291  1.00 74.81  ? 17   LEU B N   1 
ATOM   4398  C CA  . LEU B  1 17  ? 16.021  19.889  61.841  1.00 72.74  ? 17   LEU B CA  1 
ATOM   4399  C C   . LEU B  1 17  ? 17.272  19.604  61.032  1.00 74.95  ? 17   LEU B C   1 
ATOM   4400  O O   . LEU B  1 17  ? 17.145  19.062  59.926  1.00 73.75  ? 17   LEU B O   1 
ATOM   4401  C CB  . LEU B  1 17  ? 15.313  21.171  61.393  1.00 73.40  ? 17   LEU B CB  1 
ATOM   4402  C CG  . LEU B  1 17  ? 13.843  21.351  61.822  1.00 77.34  ? 17   LEU B CG  1 
ATOM   4403  C CD1 . LEU B  1 17  ? 13.222  22.494  61.080  1.00 76.44  ? 17   LEU B CD1 1 
ATOM   4404  C CD2 . LEU B  1 17  ? 12.997  20.073  61.591  1.00 79.30  ? 17   LEU B CD2 1 
ATOM   4405  N N   . GLU B  1 18  ? 18.476  19.924  61.592  1.00 70.48  ? 18   GLU B N   1 
ATOM   4406  C CA  . GLU B  1 18  ? 19.760  19.608  60.961  1.00 69.16  ? 18   GLU B CA  1 
ATOM   4407  C C   . GLU B  1 18  ? 19.961  18.093  61.101  1.00 71.95  ? 18   GLU B C   1 
ATOM   4408  O O   . GLU B  1 18  ? 20.395  17.452  60.140  1.00 71.67  ? 18   GLU B O   1 
ATOM   4409  C CB  . GLU B  1 18  ? 20.904  20.371  61.618  1.00 71.82  ? 18   GLU B CB  1 
ATOM   4410  C CG  . GLU B  1 18  ? 22.295  20.020  61.104  1.00 87.07  ? 18   GLU B CG  1 
ATOM   4411  C CD  . GLU B  1 18  ? 22.907  20.937  60.058  1.00 108.33 ? 18   GLU B CD  1 
ATOM   4412  O OE1 . GLU B  1 18  ? 22.960  22.167  60.294  1.00 86.74  ? 18   GLU B OE1 1 
ATOM   4413  O OE2 . GLU B  1 18  ? 23.424  20.410  59.046  1.00 103.84 ? 18   GLU B OE2 1 
ATOM   4414  N N   . GLN B  1 19  ? 19.582  17.512  62.269  1.00 66.37  ? 19   GLN B N   1 
ATOM   4415  C CA  . GLN B  1 19  ? 19.679  16.069  62.500  1.00 63.48  ? 19   GLN B CA  1 
ATOM   4416  C C   . GLN B  1 19  ? 18.733  15.294  61.600  1.00 65.69  ? 19   GLN B C   1 
ATOM   4417  O O   . GLN B  1 19  ? 19.066  14.188  61.166  1.00 62.96  ? 19   GLN B O   1 
ATOM   4418  C CB  . GLN B  1 19  ? 19.465  15.722  63.970  1.00 64.32  ? 19   GLN B CB  1 
ATOM   4419  C CG  . GLN B  1 19  ? 20.482  14.711  64.502  1.00 83.50  ? 19   GLN B CG  1 
ATOM   4420  C CD  . GLN B  1 19  ? 21.923  15.139  64.353  1.00 103.64 ? 19   GLN B CD  1 
ATOM   4421  O OE1 . GLN B  1 19  ? 22.296  16.295  64.637  1.00 105.38 ? 19   GLN B OE1 1 
ATOM   4422  N NE2 . GLN B  1 19  ? 22.758  14.207  63.885  1.00 86.27  ? 19   GLN B NE2 1 
ATOM   4423  N N   . GLN B  1 20  ? 17.577  15.907  61.278  1.00 63.59  ? 20   GLN B N   1 
ATOM   4424  C CA  . GLN B  1 20  ? 16.592  15.335  60.372  1.00 63.11  ? 20   GLN B CA  1 
ATOM   4425  C C   . GLN B  1 20  ? 17.191  15.294  58.956  1.00 69.30  ? 20   GLN B C   1 
ATOM   4426  O O   . GLN B  1 20  ? 17.144  14.238  58.297  1.00 67.72  ? 20   GLN B O   1 
ATOM   4427  C CB  . GLN B  1 20  ? 15.277  16.140  60.417  1.00 64.55  ? 20   GLN B CB  1 
ATOM   4428  C CG  . GLN B  1 20  ? 14.217  15.723  59.394  1.00 62.98  ? 20   GLN B CG  1 
ATOM   4429  C CD  . GLN B  1 20  ? 13.680  14.311  59.518  1.00 80.30  ? 20   GLN B CD  1 
ATOM   4430  O OE1 . GLN B  1 20  ? 13.995  13.552  60.444  1.00 78.14  ? 20   GLN B OE1 1 
ATOM   4431  N NE2 . GLN B  1 20  ? 12.821  13.936  58.584  1.00 68.17  ? 20   GLN B NE2 1 
ATOM   4432  N N   . TYR B  1 21  ? 17.799  16.432  58.516  1.00 67.55  ? 21   TYR B N   1 
ATOM   4433  C CA  . TYR B  1 21  ? 18.447  16.541  57.205  1.00 67.02  ? 21   TYR B CA  1 
ATOM   4434  C C   . TYR B  1 21  ? 19.608  15.580  57.096  1.00 69.45  ? 21   TYR B C   1 
ATOM   4435  O O   . TYR B  1 21  ? 19.704  14.850  56.115  1.00 68.27  ? 21   TYR B O   1 
ATOM   4436  C CB  . TYR B  1 21  ? 18.928  17.966  56.932  1.00 70.22  ? 21   TYR B CB  1 
ATOM   4437  C CG  . TYR B  1 21  ? 19.782  18.061  55.688  1.00 73.75  ? 21   TYR B CG  1 
ATOM   4438  C CD1 . TYR B  1 21  ? 19.219  17.931  54.419  1.00 76.04  ? 21   TYR B CD1 1 
ATOM   4439  C CD2 . TYR B  1 21  ? 21.156  18.260  55.775  1.00 74.64  ? 21   TYR B CD2 1 
ATOM   4440  C CE1 . TYR B  1 21  ? 20.000  18.018  53.269  1.00 77.18  ? 21   TYR B CE1 1 
ATOM   4441  C CE2 . TYR B  1 21  ? 21.946  18.343  54.632  1.00 75.39  ? 21   TYR B CE2 1 
ATOM   4442  C CZ  . TYR B  1 21  ? 21.363  18.227  53.381  1.00 83.55  ? 21   TYR B CZ  1 
ATOM   4443  O OH  . TYR B  1 21  ? 22.134  18.317  52.252  1.00 86.83  ? 21   TYR B OH  1 
ATOM   4444  N N   . ARG B  1 22  ? 20.494  15.592  58.105  1.00 66.22  ? 22   ARG B N   1 
ATOM   4445  C CA  . ARG B  1 22  ? 21.641  14.705  58.176  1.00 65.07  ? 22   ARG B CA  1 
ATOM   4446  C C   . ARG B  1 22  ? 21.229  13.246  58.080  1.00 65.93  ? 22   ARG B C   1 
ATOM   4447  O O   . ARG B  1 22  ? 21.900  12.487  57.392  1.00 66.70  ? 22   ARG B O   1 
ATOM   4448  C CB  . ARG B  1 22  ? 22.489  14.997  59.419  1.00 66.63  ? 22   ARG B CB  1 
ATOM   4449  C CG  . ARG B  1 22  ? 23.622  16.002  59.127  1.00 78.08  ? 22   ARG B CG  1 
ATOM   4450  C CD  . ARG B  1 22  ? 24.134  16.760  60.352  1.00 91.09  ? 22   ARG B CD  1 
ATOM   4451  N NE  . ARG B  1 22  ? 24.738  15.884  61.366  1.00 100.83 ? 22   ARG B NE  1 
ATOM   4452  C CZ  . ARG B  1 22  ? 26.012  15.486  61.396  1.00 116.13 ? 22   ARG B CZ  1 
ATOM   4453  N NH1 . ARG B  1 22  ? 26.856  15.856  60.439  1.00 101.49 ? 22   ARG B NH1 1 
ATOM   4454  N NH2 . ARG B  1 22  ? 26.438  14.679  62.361  1.00 108.44 ? 22   ARG B NH2 1 
ATOM   4455  N N   . ALA B  1 23  ? 20.090  12.876  58.676  1.00 59.81  ? 23   ALA B N   1 
ATOM   4456  C CA  . ALA B  1 23  ? 19.561  11.514  58.629  1.00 57.24  ? 23   ALA B CA  1 
ATOM   4457  C C   . ALA B  1 23  ? 19.126  11.130  57.208  1.00 59.27  ? 23   ALA B C   1 
ATOM   4458  O O   . ALA B  1 23  ? 19.484  10.043  56.748  1.00 57.02  ? 23   ALA B O   1 
ATOM   4459  C CB  . ALA B  1 23  ? 18.397  11.377  59.607  1.00 58.11  ? 23   ALA B CB  1 
ATOM   4460  N N   . LEU B  1 24  ? 18.373  12.037  56.506  1.00 55.82  ? 24   LEU B N   1 
ATOM   4461  C CA  . LEU B  1 24  ? 17.937  11.833  55.118  1.00 54.04  ? 24   LEU B CA  1 
ATOM   4462  C C   . LEU B  1 24  ? 19.157  11.504  54.258  1.00 57.48  ? 24   LEU B C   1 
ATOM   4463  O O   . LEU B  1 24  ? 19.183  10.467  53.612  1.00 56.84  ? 24   LEU B O   1 
ATOM   4464  C CB  . LEU B  1 24  ? 17.213  13.077  54.567  1.00 54.62  ? 24   LEU B CB  1 
ATOM   4465  C CG  . LEU B  1 24  ? 16.604  12.955  53.150  1.00 58.54  ? 24   LEU B CG  1 
ATOM   4466  C CD1 . LEU B  1 24  ? 15.258  12.244  53.181  1.00 58.17  ? 24   LEU B CD1 1 
ATOM   4467  C CD2 . LEU B  1 24  ? 16.402  14.309  52.512  1.00 62.27  ? 24   LEU B CD2 1 
ATOM   4468  N N   . ARG B  1 25  ? 20.193  12.350  54.329  1.00 55.28  ? 25   ARG B N   1 
ATOM   4469  C CA  . ARG B  1 25  ? 21.467  12.176  53.635  1.00 54.15  ? 25   ARG B CA  1 
ATOM   4470  C C   . ARG B  1 25  ? 22.100  10.816  53.982  1.00 56.68  ? 25   ARG B C   1 
ATOM   4471  O O   . ARG B  1 25  ? 22.496  10.105  53.070  1.00 58.01  ? 25   ARG B O   1 
ATOM   4472  C CB  . ARG B  1 25  ? 22.425  13.339  53.958  1.00 53.89  ? 25   ARG B CB  1 
ATOM   4473  C CG  . ARG B  1 25  ? 23.443  13.568  52.858  1.00 65.96  ? 25   ARG B CG  1 
ATOM   4474  C CD  . ARG B  1 25  ? 24.244  14.849  53.006  1.00 83.78  ? 25   ARG B CD  1 
ATOM   4475  N NE  . ARG B  1 25  ? 25.087  15.032  51.821  1.00 102.74 ? 25   ARG B NE  1 
ATOM   4476  C CZ  . ARG B  1 25  ? 24.812  15.847  50.801  1.00 120.15 ? 25   ARG B CZ  1 
ATOM   4477  N NH1 . ARG B  1 25  ? 23.737  16.623  50.832  1.00 95.49  ? 25   ARG B NH1 1 
ATOM   4478  N NH2 . ARG B  1 25  ? 25.635  15.923  49.763  1.00 116.63 ? 25   ARG B NH2 1 
ATOM   4479  N N   . LYS B  1 26  ? 22.126  10.432  55.277  1.00 50.94  ? 26   LYS B N   1 
ATOM   4480  C CA  . LYS B  1 26  ? 22.696  9.171   55.746  1.00 49.83  ? 26   LYS B CA  1 
ATOM   4481  C C   . LYS B  1 26  ? 21.997  7.978   55.104  1.00 54.49  ? 26   LYS B C   1 
ATOM   4482  O O   . LYS B  1 26  ? 22.655  7.124   54.534  1.00 53.11  ? 26   LYS B O   1 
ATOM   4483  C CB  . LYS B  1 26  ? 22.655  9.094   57.284  1.00 52.31  ? 26   LYS B CB  1 
ATOM   4484  C CG  . LYS B  1 26  ? 22.933  7.719   57.920  1.00 58.01  ? 26   LYS B CG  1 
ATOM   4485  C CD  . LYS B  1 26  ? 22.394  7.701   59.374  1.00 73.43  ? 26   LYS B CD  1 
ATOM   4486  C CE  . LYS B  1 26  ? 22.189  6.343   60.016  1.00 84.13  ? 26   LYS B CE  1 
ATOM   4487  N NZ  . LYS B  1 26  ? 21.364  6.438   61.270  1.00 83.84  ? 26   LYS B NZ  1 
ATOM   4488  N N   . TYR B  1 27  ? 20.675  7.959   55.147  1.00 53.82  ? 27   TYR B N   1 
ATOM   4489  C CA  . TYR B  1 27  ? 19.860  6.872   54.620  1.00 54.03  ? 27   TYR B CA  1 
ATOM   4490  C C   . TYR B  1 27  ? 19.832  6.691   53.123  1.00 58.12  ? 27   TYR B C   1 
ATOM   4491  O O   . TYR B  1 27  ? 19.715  5.557   52.683  1.00 57.96  ? 27   TYR B O   1 
ATOM   4492  C CB  . TYR B  1 27  ? 18.417  7.000   55.121  1.00 56.94  ? 27   TYR B CB  1 
ATOM   4493  C CG  . TYR B  1 27  ? 18.218  6.402   56.493  1.00 61.66  ? 27   TYR B CG  1 
ATOM   4494  C CD1 . TYR B  1 27  ? 18.539  7.121   57.641  1.00 64.71  ? 27   TYR B CD1 1 
ATOM   4495  C CD2 . TYR B  1 27  ? 17.738  5.105   56.647  1.00 62.84  ? 27   TYR B CD2 1 
ATOM   4496  C CE1 . TYR B  1 27  ? 18.362  6.575   58.911  1.00 67.46  ? 27   TYR B CE1 1 
ATOM   4497  C CE2 . TYR B  1 27  ? 17.554  4.547   57.914  1.00 64.38  ? 27   TYR B CE2 1 
ATOM   4498  C CZ  . TYR B  1 27  ? 17.862  5.290   59.045  1.00 74.69  ? 27   TYR B CZ  1 
ATOM   4499  O OH  . TYR B  1 27  ? 17.729  4.750   60.305  1.00 77.43  ? 27   TYR B OH  1 
ATOM   4500  N N   . TYR B  1 28  ? 19.878  7.772   52.340  1.00 54.70  ? 28   TYR B N   1 
ATOM   4501  C CA  . TYR B  1 28  ? 19.656  7.676   50.909  1.00 55.14  ? 28   TYR B CA  1 
ATOM   4502  C C   . TYR B  1 28  ? 20.763  8.101   49.950  1.00 64.72  ? 28   TYR B C   1 
ATOM   4503  O O   . TYR B  1 28  ? 20.559  8.030   48.725  1.00 65.95  ? 28   TYR B O   1 
ATOM   4504  C CB  . TYR B  1 28  ? 18.367  8.457   50.556  1.00 55.78  ? 28   TYR B CB  1 
ATOM   4505  C CG  . TYR B  1 28  ? 17.118  8.001   51.262  1.00 55.39  ? 28   TYR B CG  1 
ATOM   4506  C CD1 . TYR B  1 28  ? 16.479  8.820   52.186  1.00 57.79  ? 28   TYR B CD1 1 
ATOM   4507  C CD2 . TYR B  1 28  ? 16.536  6.777   50.964  1.00 55.31  ? 28   TYR B CD2 1 
ATOM   4508  C CE1 . TYR B  1 28  ? 15.292  8.426   52.805  1.00 58.57  ? 28   TYR B CE1 1 
ATOM   4509  C CE2 . TYR B  1 28  ? 15.363  6.360   51.599  1.00 56.16  ? 28   TYR B CE2 1 
ATOM   4510  C CZ  . TYR B  1 28  ? 14.747  7.189   52.516  1.00 61.57  ? 28   TYR B CZ  1 
ATOM   4511  O OH  . TYR B  1 28  ? 13.596  6.778   53.124  1.00 61.99  ? 28   TYR B OH  1 
ATOM   4512  N N   . GLU B  1 29  ? 21.882  8.621   50.448  1.00 63.22  ? 29   GLU B N   1 
ATOM   4513  C CA  . GLU B  1 29  ? 22.900  9.060   49.499  1.00 63.09  ? 29   GLU B CA  1 
ATOM   4514  C C   . GLU B  1 29  ? 23.645  7.893   48.879  1.00 65.01  ? 29   GLU B C   1 
ATOM   4515  O O   . GLU B  1 29  ? 23.868  6.902   49.557  1.00 64.11  ? 29   GLU B O   1 
ATOM   4516  C CB  . GLU B  1 29  ? 23.746  10.202  50.046  1.00 65.33  ? 29   GLU B CB  1 
ATOM   4517  C CG  . GLU B  1 29  ? 25.224  9.937   50.198  1.00 79.39  ? 29   GLU B CG  1 
ATOM   4518  C CD  . GLU B  1 29  ? 25.910  11.070  50.934  1.00 108.65 ? 29   GLU B CD  1 
ATOM   4519  O OE1 . GLU B  1 29  ? 26.053  12.179  50.356  1.00 98.92  ? 29   GLU B OE1 1 
ATOM   4520  O OE2 . GLU B  1 29  ? 26.229  10.864  52.129  1.00 98.97  ? 29   GLU B OE2 1 
ATOM   4521  N N   . ASN B  1 30  ? 23.883  7.962   47.560  1.00 62.21  ? 30   ASN B N   1 
ATOM   4522  C CA  . ASN B  1 30  ? 24.527  6.930   46.726  1.00 63.34  ? 30   ASN B CA  1 
ATOM   4523  C C   . ASN B  1 30  ? 23.691  5.648   46.573  1.00 70.66  ? 30   ASN B C   1 
ATOM   4524  O O   . ASN B  1 30  ? 24.159  4.615   46.086  1.00 71.35  ? 30   ASN B O   1 
ATOM   4525  C CB  . ASN B  1 30  ? 25.991  6.656   47.115  1.00 62.13  ? 30   ASN B CB  1 
ATOM   4526  C CG  . ASN B  1 30  ? 26.822  7.897   47.240  1.00 69.29  ? 30   ASN B CG  1 
ATOM   4527  O OD1 . ASN B  1 30  ? 26.840  8.764   46.371  1.00 63.54  ? 30   ASN B OD1 1 
ATOM   4528  N ND2 . ASN B  1 30  ? 27.506  8.028   48.350  1.00 61.44  ? 30   ASN B ND2 1 
ATOM   4529  N N   . CYS B  1 31  ? 22.425  5.754   46.904  1.00 69.00  ? 31   CYS B N   1 
ATOM   4530  C CA  . CYS B  1 31  ? 21.492  4.654   46.776  1.00 68.36  ? 31   CYS B CA  1 
ATOM   4531  C C   . CYS B  1 31  ? 20.771  4.757   45.419  1.00 66.87  ? 31   CYS B C   1 
ATOM   4532  O O   . CYS B  1 31  ? 20.264  5.825   45.068  1.00 67.20  ? 31   CYS B O   1 
ATOM   4533  C CB  . CYS B  1 31  ? 20.515  4.662   47.949  1.00 69.89  ? 31   CYS B CB  1 
ATOM   4534  S SG  . CYS B  1 31  ? 19.330  3.308   47.902  1.00 74.57  ? 31   CYS B SG  1 
ATOM   4535  N N   . GLU B  1 32  ? 20.765  3.664   44.648  1.00 58.50  ? 32   GLU B N   1 
ATOM   4536  C CA  . GLU B  1 32  ? 20.089  3.599   43.354  1.00 57.07  ? 32   GLU B CA  1 
ATOM   4537  C C   . GLU B  1 32  ? 18.692  2.990   43.482  1.00 58.16  ? 32   GLU B C   1 
ATOM   4538  O O   . GLU B  1 32  ? 17.757  3.493   42.859  1.00 58.39  ? 32   GLU B O   1 
ATOM   4539  C CB  . GLU B  1 32  ? 20.914  2.795   42.369  1.00 58.38  ? 32   GLU B CB  1 
ATOM   4540  C CG  . GLU B  1 32  ? 21.833  3.644   41.505  1.00 74.59  ? 32   GLU B CG  1 
ATOM   4541  C CD  . GLU B  1 32  ? 23.223  3.077   41.291  1.00 103.09 ? 32   GLU B CD  1 
ATOM   4542  O OE1 . GLU B  1 32  ? 23.342  1.846   41.082  1.00 88.48  ? 32   GLU B OE1 1 
ATOM   4543  O OE2 . GLU B  1 32  ? 24.198  3.864   41.357  1.00 105.73 ? 32   GLU B OE2 1 
ATOM   4544  N N   . VAL B  1 33  ? 18.549  1.936   44.314  1.00 51.47  ? 33   VAL B N   1 
ATOM   4545  C CA  . VAL B  1 33  ? 17.284  1.242   44.565  1.00 48.94  ? 33   VAL B CA  1 
ATOM   4546  C C   . VAL B  1 33  ? 16.952  1.359   46.032  1.00 49.07  ? 33   VAL B C   1 
ATOM   4547  O O   . VAL B  1 33  ? 17.606  0.732   46.856  1.00 49.85  ? 33   VAL B O   1 
ATOM   4548  C CB  . VAL B  1 33  ? 17.321  -0.269  44.117  1.00 51.61  ? 33   VAL B CB  1 
ATOM   4549  C CG1 . VAL B  1 33  ? 16.033  -0.990  44.474  1.00 50.92  ? 33   VAL B CG1 1 
ATOM   4550  C CG2 . VAL B  1 33  ? 17.574  -0.405  42.637  1.00 51.49  ? 33   VAL B CG2 1 
ATOM   4551  N N   . VAL B  1 34  ? 15.938  2.121   46.375  1.00 44.36  ? 34   VAL B N   1 
ATOM   4552  C CA  . VAL B  1 34  ? 15.443  2.214   47.757  1.00 43.20  ? 34   VAL B CA  1 
ATOM   4553  C C   . VAL B  1 34  ? 14.522  1.020   47.879  1.00 48.35  ? 34   VAL B C   1 
ATOM   4554  O O   . VAL B  1 34  ? 13.534  0.936   47.150  1.00 44.67  ? 34   VAL B O   1 
ATOM   4555  C CB  . VAL B  1 34  ? 14.684  3.523   48.065  1.00 46.54  ? 34   VAL B CB  1 
ATOM   4556  C CG1 . VAL B  1 34  ? 14.142  3.518   49.490  1.00 46.73  ? 34   VAL B CG1 1 
ATOM   4557  C CG2 . VAL B  1 34  ? 15.541  4.752   47.809  1.00 46.27  ? 34   VAL B CG2 1 
ATOM   4558  N N   . MET B  1 35  ? 14.892  0.073   48.746  1.00 51.62  ? 35   MET B N   1 
ATOM   4559  C CA  . MET B  1 35  ? 14.172  -1.179  48.964  1.00 55.12  ? 35   MET B CA  1 
ATOM   4560  C C   . MET B  1 35  ? 13.256  -1.049  50.128  1.00 60.66  ? 35   MET B C   1 
ATOM   4561  O O   . MET B  1 35  ? 13.424  -1.705  51.160  1.00 61.94  ? 35   MET B O   1 
ATOM   4562  C CB  . MET B  1 35  ? 15.149  -2.306  49.168  1.00 58.37  ? 35   MET B CB  1 
ATOM   4563  C CG  . MET B  1 35  ? 15.950  -2.552  47.940  1.00 64.03  ? 35   MET B CG  1 
ATOM   4564  S SD  . MET B  1 35  ? 15.892  -4.272  47.420  1.00 69.83  ? 35   MET B SD  1 
ATOM   4565  C CE  . MET B  1 35  ? 14.023  -4.593  47.539  1.00 67.31  ? 35   MET B CE  1 
ATOM   4566  N N   . GLY B  1 36  ? 12.303  -0.156  49.956  1.00 54.84  ? 36   GLY B N   1 
ATOM   4567  C CA  . GLY B  1 36  ? 11.371  0.213   50.991  1.00 54.55  ? 36   GLY B CA  1 
ATOM   4568  C C   . GLY B  1 36  ? 10.814  1.556   50.628  1.00 59.82  ? 36   GLY B C   1 
ATOM   4569  O O   . GLY B  1 36  ? 10.422  1.757   49.481  1.00 62.11  ? 36   GLY B O   1 
ATOM   4570  N N   . ASN B  1 37  ? 10.777  2.486   51.573  1.00 54.57  ? 37   ASN B N   1 
ATOM   4571  C CA  . ASN B  1 37  ? 10.180  3.784   51.298  1.00 53.41  ? 37   ASN B CA  1 
ATOM   4572  C C   . ASN B  1 37  ? 11.143  4.937   51.305  1.00 56.93  ? 37   ASN B C   1 
ATOM   4573  O O   . ASN B  1 37  ? 12.089  4.975   52.101  1.00 57.32  ? 37   ASN B O   1 
ATOM   4574  C CB  . ASN B  1 37  ? 9.040   4.065   52.256  1.00 48.76  ? 37   ASN B CB  1 
ATOM   4575  C CG  . ASN B  1 37  ? 8.145   2.892   52.522  1.00 61.24  ? 37   ASN B CG  1 
ATOM   4576  O OD1 . ASN B  1 37  ? 7.702   2.194   51.611  1.00 60.55  ? 37   ASN B OD1 1 
ATOM   4577  N ND2 . ASN B  1 37  ? 7.834   2.665   53.785  1.00 55.54  ? 37   ASN B ND2 1 
ATOM   4578  N N   . LEU B  1 38  ? 10.877  5.900   50.422  1.00 51.38  ? 38   LEU B N   1 
ATOM   4579  C CA  . LEU B  1 38  ? 11.638  7.131   50.318  1.00 49.42  ? 38   LEU B CA  1 
ATOM   4580  C C   . LEU B  1 38  ? 10.764  8.169   50.949  1.00 54.16  ? 38   LEU B C   1 
ATOM   4581  O O   . LEU B  1 38  ? 9.739   8.548   50.372  1.00 54.28  ? 38   LEU B O   1 
ATOM   4582  C CB  . LEU B  1 38  ? 11.958  7.475   48.858  1.00 47.93  ? 38   LEU B CB  1 
ATOM   4583  C CG  . LEU B  1 38  ? 12.625  8.817   48.578  1.00 49.04  ? 38   LEU B CG  1 
ATOM   4584  C CD1 . LEU B  1 38  ? 14.024  8.869   49.145  1.00 46.84  ? 38   LEU B CD1 1 
ATOM   4585  C CD2 . LEU B  1 38  ? 12.624  9.111   47.083  1.00 46.86  ? 38   LEU B CD2 1 
ATOM   4586  N N   . GLU B  1 39  ? 11.140  8.577   52.175  1.00 51.49  ? 39   GLU B N   1 
ATOM   4587  C CA  . GLU B  1 39  ? 10.433  9.549   53.014  1.00 51.34  ? 39   GLU B CA  1 
ATOM   4588  C C   . GLU B  1 39  ? 11.282  10.789  53.165  1.00 56.81  ? 39   GLU B C   1 
ATOM   4589  O O   . GLU B  1 39  ? 12.397  10.721  53.704  1.00 58.13  ? 39   GLU B O   1 
ATOM   4590  C CB  . GLU B  1 39  ? 10.113  8.927   54.386  1.00 52.26  ? 39   GLU B CB  1 
ATOM   4591  C CG  . GLU B  1 39  ? 9.045   7.847   54.313  1.00 56.11  ? 39   GLU B CG  1 
ATOM   4592  C CD  . GLU B  1 39  ? 8.798   7.047   55.571  1.00 73.40  ? 39   GLU B CD  1 
ATOM   4593  O OE1 . GLU B  1 39  ? 7.646   6.592   55.744  1.00 60.24  ? 39   GLU B OE1 1 
ATOM   4594  O OE2 . GLU B  1 39  ? 9.750   6.836   56.357  1.00 68.87  ? 39   GLU B OE2 1 
ATOM   4595  N N   . ILE B  1 40  ? 10.776  11.907  52.623  1.00 52.18  ? 40   ILE B N   1 
ATOM   4596  C CA  . ILE B  1 40  ? 11.411  13.233  52.640  1.00 51.89  ? 40   ILE B CA  1 
ATOM   4597  C C   . ILE B  1 40  ? 10.408  14.161  53.354  1.00 58.27  ? 40   ILE B C   1 
ATOM   4598  O O   . ILE B  1 40  ? 9.420   14.614  52.758  1.00 56.93  ? 40   ILE B O   1 
ATOM   4599  C CB  . ILE B  1 40  ? 11.757  13.706  51.196  1.00 54.35  ? 40   ILE B CB  1 
ATOM   4600  C CG1 . ILE B  1 40  ? 12.589  12.647  50.428  1.00 53.52  ? 40   ILE B CG1 1 
ATOM   4601  C CG2 . ILE B  1 40  ? 12.472  15.059  51.208  1.00 55.04  ? 40   ILE B CG2 1 
ATOM   4602  C CD1 . ILE B  1 40  ? 12.396  12.675  48.925  1.00 58.23  ? 40   ILE B CD1 1 
ATOM   4603  N N   . THR B  1 41  ? 10.608  14.343  54.672  1.00 57.52  ? 41   THR B N   1 
ATOM   4604  C CA  . THR B  1 41  ? 9.718   15.131  55.528  1.00 58.75  ? 41   THR B CA  1 
ATOM   4605  C C   . THR B  1 41  ? 10.482  16.088  56.395  1.00 66.06  ? 41   THR B C   1 
ATOM   4606  O O   . THR B  1 41  ? 11.541  15.740  56.901  1.00 65.14  ? 41   THR B O   1 
ATOM   4607  C CB  . THR B  1 41  ? 8.748   14.263  56.388  1.00 66.02  ? 41   THR B CB  1 
ATOM   4608  O OG1 . THR B  1 41  ? 9.451   13.322  57.203  1.00 75.56  ? 41   THR B OG1 1 
ATOM   4609  C CG2 . THR B  1 41  ? 7.731   13.527  55.563  1.00 63.39  ? 41   THR B CG2 1 
ATOM   4610  N N   . SER B  1 42  ? 9.910   17.293  56.598  1.00 66.18  ? 42   SER B N   1 
ATOM   4611  C CA  . SER B  1 42  ? 10.423  18.373  57.444  1.00 67.17  ? 42   SER B CA  1 
ATOM   4612  C C   . SER B  1 42  ? 11.828  18.871  57.075  1.00 69.90  ? 42   SER B C   1 
ATOM   4613  O O   . SER B  1 42  ? 12.663  19.070  57.954  1.00 69.86  ? 42   SER B O   1 
ATOM   4614  C CB  . SER B  1 42  ? 10.280  18.021  58.928  1.00 73.12  ? 42   SER B CB  1 
ATOM   4615  O OG  . SER B  1 42  ? 8.946   17.664  59.275  1.00 89.60  ? 42   SER B OG  1 
ATOM   4616  N N   . ILE B  1 43  ? 12.084  19.083  55.776  1.00 66.64  ? 43   ILE B N   1 
ATOM   4617  C CA  . ILE B  1 43  ? 13.377  19.583  55.308  1.00 67.67  ? 43   ILE B CA  1 
ATOM   4618  C C   . ILE B  1 43  ? 13.290  21.074  54.975  1.00 76.47  ? 43   ILE B C   1 
ATOM   4619  O O   . ILE B  1 43  ? 12.389  21.497  54.249  1.00 75.76  ? 43   ILE B O   1 
ATOM   4620  C CB  . ILE B  1 43  ? 14.029  18.670  54.212  1.00 69.29  ? 43   ILE B CB  1 
ATOM   4621  C CG1 . ILE B  1 43  ? 14.617  17.387  54.850  1.00 68.06  ? 43   ILE B CG1 1 
ATOM   4622  C CG2 . ILE B  1 43  ? 15.112  19.382  53.388  1.00 69.16  ? 43   ILE B CG2 1 
ATOM   4623  C CD1 . ILE B  1 43  ? 13.829  16.201  54.651  1.00 72.87  ? 43   ILE B CD1 1 
ATOM   4624  N N   . GLU B  1 44  ? 14.207  21.866  55.564  1.00 76.85  ? 44   GLU B N   1 
ATOM   4625  C CA  . GLU B  1 44  ? 14.307  23.331  55.440  1.00 78.98  ? 44   GLU B CA  1 
ATOM   4626  C C   . GLU B  1 44  ? 14.599  23.833  54.041  1.00 83.75  ? 44   GLU B C   1 
ATOM   4627  O O   . GLU B  1 44  ? 15.173  23.106  53.237  1.00 83.11  ? 44   GLU B O   1 
ATOM   4628  C CB  . GLU B  1 44  ? 15.374  23.873  56.404  1.00 81.33  ? 44   GLU B CB  1 
ATOM   4629  C CG  . GLU B  1 44  ? 15.015  23.742  57.876  1.00 89.65  ? 44   GLU B CG  1 
ATOM   4630  C CD  . GLU B  1 44  ? 16.207  23.548  58.784  1.00 102.06 ? 44   GLU B CD  1 
ATOM   4631  O OE1 . GLU B  1 44  ? 16.400  24.407  59.671  1.00 83.41  ? 44   GLU B OE1 1 
ATOM   4632  O OE2 . GLU B  1 44  ? 16.949  22.552  58.608  1.00 100.67 ? 44   GLU B OE2 1 
ATOM   4633  N N   . HIS B  1 45  ? 14.251  25.098  53.780  1.00 82.55  ? 45   HIS B N   1 
ATOM   4634  C CA  . HIS B  1 45  ? 14.438  25.776  52.507  1.00 84.38  ? 45   HIS B CA  1 
ATOM   4635  C C   . HIS B  1 45  ? 15.879  25.772  51.902  1.00 90.03  ? 45   HIS B C   1 
ATOM   4636  O O   . HIS B  1 45  ? 16.044  25.504  50.701  1.00 89.55  ? 45   HIS B O   1 
ATOM   4637  C CB  . HIS B  1 45  ? 13.927  27.196  52.626  1.00 87.75  ? 45   HIS B CB  1 
ATOM   4638  C CG  . HIS B  1 45  ? 14.224  28.031  51.419  1.00 92.79  ? 45   HIS B CG  1 
ATOM   4639  N ND1 . HIS B  1 45  ? 15.261  28.957  51.415  1.00 95.98  ? 45   HIS B ND1 1 
ATOM   4640  C CD2 . HIS B  1 45  ? 13.640  28.021  50.198  1.00 94.64  ? 45   HIS B CD2 1 
ATOM   4641  C CE1 . HIS B  1 45  ? 15.251  29.494  50.206  1.00 95.79  ? 45   HIS B CE1 1 
ATOM   4642  N NE2 . HIS B  1 45  ? 14.290  28.966  49.440  1.00 95.36  ? 45   HIS B NE2 1 
ATOM   4643  N N   . ASN B  1 46  ? 16.890  26.113  52.711  1.00 87.13  ? 46   ASN B N   1 
ATOM   4644  C CA  . ASN B  1 46  ? 18.282  26.196  52.268  1.00 87.56  ? 46   ASN B CA  1 
ATOM   4645  C C   . ASN B  1 46  ? 18.929  24.903  51.700  1.00 89.55  ? 46   ASN B C   1 
ATOM   4646  O O   . ASN B  1 46  ? 19.701  24.984  50.737  1.00 90.65  ? 46   ASN B O   1 
ATOM   4647  C CB  . ASN B  1 46  ? 19.186  26.900  53.337  1.00 94.82  ? 46   ASN B CB  1 
ATOM   4648  C CG  . ASN B  1 46  ? 19.580  26.109  54.602  1.00 120.45 ? 46   ASN B CG  1 
ATOM   4649  O OD1 . ASN B  1 46  ? 19.032  26.310  55.701  1.00 105.80 ? 46   ASN B OD1 1 
ATOM   4650  N ND2 . ASN B  1 46  ? 20.647  25.307  54.515  1.00 113.84 ? 46   ASN B ND2 1 
ATOM   4651  N N   . ARG B  1 47  ? 18.608  23.735  52.314  1.00 81.34  ? 47   ARG B N   1 
ATOM   4652  C CA  . ARG B  1 47  ? 19.130  22.376  52.108  1.00 77.49  ? 47   ARG B CA  1 
ATOM   4653  C C   . ARG B  1 47  ? 19.457  21.869  50.710  1.00 79.29  ? 47   ARG B C   1 
ATOM   4654  O O   . ARG B  1 47  ? 18.675  22.064  49.784  1.00 78.85  ? 47   ARG B O   1 
ATOM   4655  C CB  . ARG B  1 47  ? 18.265  21.352  52.848  1.00 74.45  ? 47   ARG B CB  1 
ATOM   4656  C CG  . ARG B  1 47  ? 18.058  21.640  54.329  1.00 81.32  ? 47   ARG B CG  1 
ATOM   4657  C CD  . ARG B  1 47  ? 19.369  21.602  55.051  1.00 81.94  ? 47   ARG B CD  1 
ATOM   4658  N NE  . ARG B  1 47  ? 19.211  21.800  56.480  1.00 85.03  ? 47   ARG B NE  1 
ATOM   4659  C CZ  . ARG B  1 47  ? 20.232  22.027  57.288  1.00 98.63  ? 47   ARG B CZ  1 
ATOM   4660  N NH1 . ARG B  1 47  ? 21.464  22.113  56.800  1.00 87.64  ? 47   ARG B NH1 1 
ATOM   4661  N NH2 . ARG B  1 47  ? 20.034  22.180  58.591  1.00 85.31  ? 47   ARG B NH2 1 
ATOM   4662  N N   . ASP B  1 48  ? 20.593  21.139  50.586  1.00 74.44  ? 48   ASP B N   1 
ATOM   4663  C CA  . ASP B  1 48  ? 21.056  20.527  49.332  1.00 72.38  ? 48   ASP B CA  1 
ATOM   4664  C C   . ASP B  1 48  ? 20.508  19.105  49.178  1.00 72.30  ? 48   ASP B C   1 
ATOM   4665  O O   . ASP B  1 48  ? 20.777  18.232  50.005  1.00 69.32  ? 48   ASP B O   1 
ATOM   4666  C CB  . ASP B  1 48  ? 22.593  20.531  49.232  1.00 74.13  ? 48   ASP B CB  1 
ATOM   4667  C CG  . ASP B  1 48  ? 23.143  19.766  48.039  1.00 82.94  ? 48   ASP B CG  1 
ATOM   4668  O OD1 . ASP B  1 48  ? 22.666  20.005  46.905  1.00 84.73  ? 48   ASP B OD1 1 
ATOM   4669  O OD2 . ASP B  1 48  ? 24.033  18.919  48.241  1.00 89.07  ? 48   ASP B OD2 1 
ATOM   4670  N N   . LEU B  1 49  ? 19.751  18.872  48.101  1.00 68.86  ? 49   LEU B N   1 
ATOM   4671  C CA  . LEU B  1 49  ? 19.145  17.557  47.866  1.00 66.99  ? 49   LEU B CA  1 
ATOM   4672  C C   . LEU B  1 49  ? 19.635  16.836  46.600  1.00 70.42  ? 49   LEU B C   1 
ATOM   4673  O O   . LEU B  1 49  ? 19.075  15.806  46.209  1.00 68.16  ? 49   LEU B O   1 
ATOM   4674  C CB  . LEU B  1 49  ? 17.606  17.641  47.915  1.00 65.79  ? 49   LEU B CB  1 
ATOM   4675  C CG  . LEU B  1 49  ? 16.976  18.209  49.172  1.00 68.13  ? 49   LEU B CG  1 
ATOM   4676  C CD1 . LEU B  1 49  ? 15.561  18.233  48.999  1.00 68.19  ? 49   LEU B CD1 1 
ATOM   4677  C CD2 . LEU B  1 49  ? 17.250  17.372  50.387  1.00 67.29  ? 49   LEU B CD2 1 
ATOM   4678  N N   . SER B  1 50  ? 20.719  17.351  46.003  1.00 67.37  ? 50   SER B N   1 
ATOM   4679  C CA  . SER B  1 50  ? 21.345  16.804  44.813  1.00 66.39  ? 50   SER B CA  1 
ATOM   4680  C C   . SER B  1 50  ? 21.582  15.283  44.918  1.00 67.85  ? 50   SER B C   1 
ATOM   4681  O O   . SER B  1 50  ? 21.484  14.592  43.909  1.00 67.26  ? 50   SER B O   1 
ATOM   4682  C CB  . SER B  1 50  ? 22.663  17.516  44.566  1.00 72.17  ? 50   SER B CB  1 
ATOM   4683  O OG  . SER B  1 50  ? 23.511  17.297  45.686  1.00 86.25  ? 50   SER B OG  1 
ATOM   4684  N N   . PHE B  1 51  ? 21.866  14.761  46.131  1.00 62.56  ? 51   PHE B N   1 
ATOM   4685  C CA  . PHE B  1 51  ? 22.129  13.328  46.384  1.00 60.04  ? 51   PHE B CA  1 
ATOM   4686  C C   . PHE B  1 51  ? 20.976  12.425  46.001  1.00 62.99  ? 51   PHE B C   1 
ATOM   4687  O O   . PHE B  1 51  ? 21.203  11.239  45.779  1.00 64.44  ? 51   PHE B O   1 
ATOM   4688  C CB  . PHE B  1 51  ? 22.589  13.071  47.837  1.00 61.55  ? 51   PHE B CB  1 
ATOM   4689  C CG  . PHE B  1 51  ? 21.577  13.404  48.903  1.00 64.38  ? 51   PHE B CG  1 
ATOM   4690  C CD1 . PHE B  1 51  ? 20.757  12.416  49.434  1.00 68.23  ? 51   PHE B CD1 1 
ATOM   4691  C CD2 . PHE B  1 51  ? 21.442  14.711  49.383  1.00 67.83  ? 51   PHE B CD2 1 
ATOM   4692  C CE1 . PHE B  1 51  ? 19.795  12.733  50.398  1.00 69.71  ? 51   PHE B CE1 1 
ATOM   4693  C CE2 . PHE B  1 51  ? 20.490  15.022  50.355  1.00 70.79  ? 51   PHE B CE2 1 
ATOM   4694  C CZ  . PHE B  1 51  ? 19.678  14.030  50.861  1.00 68.85  ? 51   PHE B CZ  1 
ATOM   4695  N N   . LEU B  1 52  ? 19.733  12.981  45.921  1.00 56.36  ? 52   LEU B N   1 
ATOM   4696  C CA  . LEU B  1 52  ? 18.524  12.247  45.553  1.00 53.21  ? 52   LEU B CA  1 
ATOM   4697  C C   . LEU B  1 52  ? 18.520  11.872  44.085  1.00 59.93  ? 52   LEU B C   1 
ATOM   4698  O O   . LEU B  1 52  ? 17.735  11.014  43.663  1.00 61.58  ? 52   LEU B O   1 
ATOM   4699  C CB  . LEU B  1 52  ? 17.275  13.024  45.911  1.00 52.59  ? 52   LEU B CB  1 
ATOM   4700  C CG  . LEU B  1 52  ? 16.994  13.241  47.396  1.00 57.33  ? 52   LEU B CG  1 
ATOM   4701  C CD1 . LEU B  1 52  ? 15.849  14.223  47.579  1.00 58.59  ? 52   LEU B CD1 1 
ATOM   4702  C CD2 . LEU B  1 52  ? 16.654  11.935  48.113  1.00 57.21  ? 52   LEU B CD2 1 
ATOM   4703  N N   . ARG B  1 53  ? 19.445  12.455  43.303  1.00 56.47  ? 53   ARG B N   1 
ATOM   4704  C CA  . ARG B  1 53  ? 19.584  12.148  41.877  1.00 54.87  ? 53   ARG B CA  1 
ATOM   4705  C C   . ARG B  1 53  ? 20.093  10.732  41.658  1.00 59.03  ? 53   ARG B C   1 
ATOM   4706  O O   . ARG B  1 53  ? 19.972  10.228  40.550  1.00 59.88  ? 53   ARG B O   1 
ATOM   4707  C CB  . ARG B  1 53  ? 20.465  13.167  41.175  1.00 50.10  ? 53   ARG B CB  1 
ATOM   4708  C CG  . ARG B  1 53  ? 19.781  14.509  40.983  1.00 56.06  ? 53   ARG B CG  1 
ATOM   4709  C CD  . ARG B  1 53  ? 20.780  15.588  40.715  1.00 76.84  ? 53   ARG B CD  1 
ATOM   4710  N NE  . ARG B  1 53  ? 20.122  16.846  40.396  1.00 95.78  ? 53   ARG B NE  1 
ATOM   4711  C CZ  . ARG B  1 53  ? 20.703  18.033  40.499  1.00 120.62 ? 53   ARG B CZ  1 
ATOM   4712  N NH1 . ARG B  1 53  ? 21.957  18.131  40.933  1.00 117.56 ? 53   ARG B NH1 1 
ATOM   4713  N NH2 . ARG B  1 53  ? 20.033  19.134  40.182  1.00 108.07 ? 53   ARG B NH2 1 
ATOM   4714  N N   . SER B  1 54  ? 20.612  10.071  42.711  1.00 54.33  ? 54   SER B N   1 
ATOM   4715  C CA  . SER B  1 54  ? 21.106  8.700   42.619  1.00 53.54  ? 54   SER B CA  1 
ATOM   4716  C C   . SER B  1 54  ? 19.964  7.706   42.486  1.00 56.91  ? 54   SER B C   1 
ATOM   4717  O O   . SER B  1 54  ? 20.162  6.645   41.885  1.00 55.35  ? 54   SER B O   1 
ATOM   4718  C CB  . SER B  1 54  ? 21.956  8.350   43.842  1.00 57.80  ? 54   SER B CB  1 
ATOM   4719  O OG  . SER B  1 54  ? 21.220  8.317   45.057  1.00 64.95  ? 54   SER B OG  1 
ATOM   4720  N N   . VAL B  1 55  ? 18.777  8.048   43.071  1.00 53.80  ? 55   VAL B N   1 
ATOM   4721  C CA  . VAL B  1 55  ? 17.600  7.176   43.103  1.00 53.09  ? 55   VAL B CA  1 
ATOM   4722  C C   . VAL B  1 55  ? 16.978  6.978   41.724  1.00 57.15  ? 55   VAL B C   1 
ATOM   4723  O O   . VAL B  1 55  ? 16.560  7.963   41.081  1.00 57.91  ? 55   VAL B O   1 
ATOM   4724  C CB  . VAL B  1 55  ? 16.540  7.561   44.172  1.00 55.96  ? 55   VAL B CB  1 
ATOM   4725  C CG1 . VAL B  1 55  ? 15.411  6.534   44.196  1.00 55.39  ? 55   VAL B CG1 1 
ATOM   4726  C CG2 . VAL B  1 55  ? 17.163  7.680   45.555  1.00 55.05  ? 55   VAL B CG2 1 
ATOM   4727  N N   . ARG B  1 56  ? 16.924  5.684   41.303  1.00 50.17  ? 56   ARG B N   1 
ATOM   4728  C CA  . ARG B  1 56  ? 16.350  5.168   40.061  1.00 48.60  ? 56   ARG B CA  1 
ATOM   4729  C C   . ARG B  1 56  ? 15.033  4.370   40.309  1.00 51.61  ? 56   ARG B C   1 
ATOM   4730  O O   . ARG B  1 56  ? 14.175  4.304   39.423  1.00 52.97  ? 56   ARG B O   1 
ATOM   4731  C CB  . ARG B  1 56  ? 17.364  4.261   39.359  1.00 46.24  ? 56   ARG B CB  1 
ATOM   4732  C CG  . ARG B  1 56  ? 18.234  5.013   38.356  1.00 70.73  ? 56   ARG B CG  1 
ATOM   4733  C CD  . ARG B  1 56  ? 19.664  5.228   38.850  1.00 98.56  ? 56   ARG B CD  1 
ATOM   4734  N NE  . ARG B  1 56  ? 20.364  6.285   38.110  1.00 110.03 ? 56   ARG B NE  1 
ATOM   4735  C CZ  . ARG B  1 56  ? 21.466  6.899   38.536  1.00 124.47 ? 56   ARG B CZ  1 
ATOM   4736  N NH1 . ARG B  1 56  ? 21.999  6.587   39.710  1.00 103.30 ? 56   ARG B NH1 1 
ATOM   4737  N NH2 . ARG B  1 56  ? 22.038  7.838   37.794  1.00 120.73 ? 56   ARG B NH2 1 
ATOM   4738  N N   . GLU B  1 57  ? 14.882  3.756   41.501  1.00 45.21  ? 57   GLU B N   1 
ATOM   4739  C CA  . GLU B  1 57  ? 13.747  2.900   41.825  1.00 44.91  ? 57   GLU B CA  1 
ATOM   4740  C C   . GLU B  1 57  ? 13.418  2.891   43.309  1.00 48.76  ? 57   GLU B C   1 
ATOM   4741  O O   . GLU B  1 57  ? 14.333  2.970   44.117  1.00 47.96  ? 57   GLU B O   1 
ATOM   4742  C CB  . GLU B  1 57  ? 14.063  1.473   41.343  1.00 46.55  ? 57   GLU B CB  1 
ATOM   4743  C CG  . GLU B  1 57  ? 13.206  0.349   41.918  1.00 62.00  ? 57   GLU B CG  1 
ATOM   4744  C CD  . GLU B  1 57  ? 13.423  -1.023  41.307  1.00 91.04  ? 57   GLU B CD  1 
ATOM   4745  O OE1 . GLU B  1 57  ? 12.690  -1.952  41.719  1.00 79.85  ? 57   GLU B OE1 1 
ATOM   4746  O OE2 . GLU B  1 57  ? 14.295  -1.171  40.414  1.00 86.47  ? 57   GLU B OE2 1 
ATOM   4747  N N   . VAL B  1 58  ? 12.107  2.778   43.662  1.00 45.99  ? 58   VAL B N   1 
ATOM   4748  C CA  . VAL B  1 58  ? 11.592  2.720   45.030  1.00 46.10  ? 58   VAL B CA  1 
ATOM   4749  C C   . VAL B  1 58  ? 10.554  1.594   45.072  1.00 56.44  ? 58   VAL B C   1 
ATOM   4750  O O   . VAL B  1 58  ? 9.528   1.634   44.372  1.00 57.24  ? 58   VAL B O   1 
ATOM   4751  C CB  . VAL B  1 58  ? 11.008  4.075   45.527  1.00 49.77  ? 58   VAL B CB  1 
ATOM   4752  C CG1 . VAL B  1 58  ? 10.303  3.940   46.880  1.00 48.75  ? 58   VAL B CG1 1 
ATOM   4753  C CG2 . VAL B  1 58  ? 12.073  5.177   45.582  1.00 49.86  ? 58   VAL B CG2 1 
ATOM   4754  N N   . THR B  1 59  ? 10.858  0.568   45.885  1.00 54.64  ? 59   THR B N   1 
ATOM   4755  C CA  . THR B  1 59  ? 10.085  -0.656  46.149  1.00 53.00  ? 59   THR B CA  1 
ATOM   4756  C C   . THR B  1 59  ? 8.698   -0.390  46.764  1.00 57.11  ? 59   THR B C   1 
ATOM   4757  O O   . THR B  1 59  ? 7.712   -1.023  46.359  1.00 56.52  ? 59   THR B O   1 
ATOM   4758  C CB  . THR B  1 59  ? 10.961  -1.497  47.026  1.00 55.96  ? 59   THR B CB  1 
ATOM   4759  O OG1 . THR B  1 59  ? 11.987  -1.943  46.163  1.00 62.36  ? 59   THR B OG1 1 
ATOM   4760  C CG2 . THR B  1 59  ? 10.231  -2.653  47.714  1.00 57.45  ? 59   THR B CG2 1 
ATOM   4761  N N   . GLY B  1 60  ? 8.657   0.514   47.751  1.00 52.65  ? 60   GLY B N   1 
ATOM   4762  C CA  . GLY B  1 60  ? 7.457   0.861   48.494  1.00 52.58  ? 60   GLY B CA  1 
ATOM   4763  C C   . GLY B  1 60  ? 6.864   2.144   47.987  1.00 56.95  ? 60   GLY B C   1 
ATOM   4764  O O   . GLY B  1 60  ? 6.514   2.228   46.806  1.00 58.28  ? 60   GLY B O   1 
ATOM   4765  N N   . TYR B  1 61  ? 6.774   3.162   48.862  1.00 50.80  ? 61   TYR B N   1 
ATOM   4766  C CA  . TYR B  1 61  ? 6.201   4.442   48.486  1.00 49.46  ? 61   TYR B CA  1 
ATOM   4767  C C   . TYR B  1 61  ? 7.162   5.605   48.599  1.00 52.29  ? 61   TYR B C   1 
ATOM   4768  O O   . TYR B  1 61  ? 8.217   5.487   49.206  1.00 52.46  ? 61   TYR B O   1 
ATOM   4769  C CB  . TYR B  1 61  ? 4.921   4.717   49.286  1.00 50.84  ? 61   TYR B CB  1 
ATOM   4770  C CG  . TYR B  1 61  ? 5.143   4.880   50.779  1.00 52.31  ? 61   TYR B CG  1 
ATOM   4771  C CD1 . TYR B  1 61  ? 5.589   6.091   51.318  1.00 53.04  ? 61   TYR B CD1 1 
ATOM   4772  C CD2 . TYR B  1 61  ? 4.840   3.853   51.658  1.00 53.17  ? 61   TYR B CD2 1 
ATOM   4773  C CE1 . TYR B  1 61  ? 5.769   6.249   52.690  1.00 50.36  ? 61   TYR B CE1 1 
ATOM   4774  C CE2 . TYR B  1 61  ? 4.964   4.021   53.035  1.00 54.30  ? 61   TYR B CE2 1 
ATOM   4775  C CZ  . TYR B  1 61  ? 5.453   5.208   53.545  1.00 59.80  ? 61   TYR B CZ  1 
ATOM   4776  O OH  . TYR B  1 61  ? 5.601   5.308   54.908  1.00 65.44  ? 61   TYR B OH  1 
ATOM   4777  N N   . VAL B  1 62  ? 6.746   6.745   48.056  1.00 48.42  ? 62   VAL B N   1 
ATOM   4778  C CA  . VAL B  1 62  ? 7.465   8.015   48.080  1.00 48.14  ? 62   VAL B CA  1 
ATOM   4779  C C   . VAL B  1 62  ? 6.566   9.037   48.785  1.00 52.36  ? 62   VAL B C   1 
ATOM   4780  O O   . VAL B  1 62  ? 5.479   9.400   48.277  1.00 51.38  ? 62   VAL B O   1 
ATOM   4781  C CB  . VAL B  1 62  ? 7.933   8.490   46.668  1.00 50.83  ? 62   VAL B CB  1 
ATOM   4782  C CG1 . VAL B  1 62  ? 8.580   9.879   46.728  1.00 49.80  ? 62   VAL B CG1 1 
ATOM   4783  C CG2 . VAL B  1 62  ? 8.874   7.466   46.026  1.00 49.53  ? 62   VAL B CG2 1 
ATOM   4784  N N   . LEU B  1 63  ? 7.032   9.476   49.974  1.00 48.43  ? 63   LEU B N   1 
ATOM   4785  C CA  . LEU B  1 63  ? 6.359   10.472  50.797  1.00 49.59  ? 63   LEU B CA  1 
ATOM   4786  C C   . LEU B  1 63  ? 7.195   11.744  50.832  1.00 56.34  ? 63   LEU B C   1 
ATOM   4787  O O   . LEU B  1 63  ? 8.360   11.691  51.234  1.00 57.22  ? 63   LEU B O   1 
ATOM   4788  C CB  . LEU B  1 63  ? 6.105   9.916   52.212  1.00 48.99  ? 63   LEU B CB  1 
ATOM   4789  C CG  . LEU B  1 63  ? 5.459   10.831  53.269  1.00 52.85  ? 63   LEU B CG  1 
ATOM   4790  C CD1 . LEU B  1 63  ? 4.074   11.231  52.886  1.00 54.45  ? 63   LEU B CD1 1 
ATOM   4791  C CD2 . LEU B  1 63  ? 5.381   10.127  54.576  1.00 50.84  ? 63   LEU B CD2 1 
ATOM   4792  N N   . VAL B  1 64  ? 6.619   12.864  50.341  1.00 52.71  ? 64   VAL B N   1 
ATOM   4793  C CA  . VAL B  1 64  ? 7.256   14.184  50.272  1.00 52.44  ? 64   VAL B CA  1 
ATOM   4794  C C   . VAL B  1 64  ? 6.287   15.146  50.916  1.00 57.26  ? 64   VAL B C   1 
ATOM   4795  O O   . VAL B  1 64  ? 5.341   15.615  50.266  1.00 56.55  ? 64   VAL B O   1 
ATOM   4796  C CB  . VAL B  1 64  ? 7.635   14.616  48.830  1.00 55.33  ? 64   VAL B CB  1 
ATOM   4797  C CG1 . VAL B  1 64  ? 8.411   15.936  48.849  1.00 55.76  ? 64   VAL B CG1 1 
ATOM   4798  C CG2 . VAL B  1 64  ? 8.441   13.524  48.106  1.00 53.67  ? 64   VAL B CG2 1 
ATOM   4799  N N   . ALA B  1 65  ? 6.481   15.389  52.218  1.00 54.19  ? 65   ALA B N   1 
ATOM   4800  C CA  . ALA B  1 65  ? 5.566   16.241  52.992  1.00 54.90  ? 65   ALA B CA  1 
ATOM   4801  C C   . ALA B  1 65  ? 6.274   17.176  53.953  1.00 61.91  ? 65   ALA B C   1 
ATOM   4802  O O   . ALA B  1 65  ? 7.445   16.966  54.278  1.00 64.14  ? 65   ALA B O   1 
ATOM   4803  C CB  . ALA B  1 65  ? 4.564   15.384  53.755  1.00 54.95  ? 65   ALA B CB  1 
ATOM   4804  N N   . LEU B  1 66  ? 5.573   18.238  54.377  1.00 57.56  ? 66   LEU B N   1 
ATOM   4805  C CA  . LEU B  1 66  ? 6.038   19.220  55.349  1.00 57.75  ? 66   LEU B CA  1 
ATOM   4806  C C   . LEU B  1 66  ? 7.463   19.813  55.129  1.00 67.66  ? 66   LEU B C   1 
ATOM   4807  O O   . LEU B  1 66  ? 8.127   20.202  56.085  1.00 67.97  ? 66   LEU B O   1 
ATOM   4808  C CB  . LEU B  1 66  ? 5.860   18.637  56.755  1.00 56.31  ? 66   LEU B CB  1 
ATOM   4809  C CG  . LEU B  1 66  ? 4.438   18.180  57.089  1.00 58.46  ? 66   LEU B CG  1 
ATOM   4810  C CD1 . LEU B  1 66  ? 4.433   17.241  58.248  1.00 57.12  ? 66   LEU B CD1 1 
ATOM   4811  C CD2 . LEU B  1 66  ? 3.491   19.363  57.335  1.00 57.74  ? 66   LEU B CD2 1 
ATOM   4812  N N   . ASN B  1 67  ? 7.901   19.917  53.862  1.00 66.96  ? 67   ASN B N   1 
ATOM   4813  C CA  . ASN B  1 67  ? 9.203   20.459  53.473  1.00 67.56  ? 67   ASN B CA  1 
ATOM   4814  C C   . ASN B  1 67  ? 9.073   21.880  52.961  1.00 75.03  ? 67   ASN B C   1 
ATOM   4815  O O   . ASN B  1 67  ? 7.973   22.278  52.606  1.00 75.39  ? 67   ASN B O   1 
ATOM   4816  C CB  . ASN B  1 67  ? 9.824   19.608  52.390  1.00 64.37  ? 67   ASN B CB  1 
ATOM   4817  C CG  . ASN B  1 67  ? 10.016  18.176  52.768  1.00 69.46  ? 67   ASN B CG  1 
ATOM   4818  O OD1 . ASN B  1 67  ? 10.762  17.831  53.692  1.00 59.25  ? 67   ASN B OD1 1 
ATOM   4819  N ND2 . ASN B  1 67  ? 9.394   17.311  52.003  1.00 60.80  ? 67   ASN B ND2 1 
ATOM   4820  N N   . GLN B  1 68  ? 10.195  22.644  52.911  1.00 73.18  ? 68   GLN B N   1 
ATOM   4821  C CA  . GLN B  1 68  ? 10.197  24.044  52.457  1.00 74.29  ? 68   GLN B CA  1 
ATOM   4822  C C   . GLN B  1 68  ? 11.159  24.344  51.287  1.00 79.16  ? 68   GLN B C   1 
ATOM   4823  O O   . GLN B  1 68  ? 11.181  25.483  50.793  1.00 80.27  ? 68   GLN B O   1 
ATOM   4824  C CB  . GLN B  1 68  ? 10.412  25.018  53.629  1.00 76.60  ? 68   GLN B CB  1 
ATOM   4825  C CG  . GLN B  1 68  ? 9.218   25.139  54.559  1.00 92.42  ? 68   GLN B CG  1 
ATOM   4826  C CD  . GLN B  1 68  ? 9.584   24.747  55.967  1.00 128.30 ? 68   GLN B CD  1 
ATOM   4827  O OE1 . GLN B  1 68  ? 9.873   23.574  56.263  1.00 127.50 ? 68   GLN B OE1 1 
ATOM   4828  N NE2 . GLN B  1 68  ? 9.564   25.718  56.874  1.00 123.64 ? 68   GLN B NE2 1 
ATOM   4829  N N   . PHE B  1 69  ? 11.915  23.321  50.814  1.00 74.05  ? 69   PHE B N   1 
ATOM   4830  C CA  . PHE B  1 69  ? 12.835  23.459  49.679  1.00 72.99  ? 69   PHE B CA  1 
ATOM   4831  C C   . PHE B  1 69  ? 12.071  23.661  48.368  1.00 75.99  ? 69   PHE B C   1 
ATOM   4832  O O   . PHE B  1 69  ? 10.991  23.100  48.188  1.00 75.54  ? 69   PHE B O   1 
ATOM   4833  C CB  . PHE B  1 69  ? 13.810  22.280  49.580  1.00 73.44  ? 69   PHE B CB  1 
ATOM   4834  C CG  . PHE B  1 69  ? 13.163  20.923  49.480  1.00 74.21  ? 69   PHE B CG  1 
ATOM   4835  C CD1 . PHE B  1 69  ? 12.735  20.425  48.255  1.00 77.13  ? 69   PHE B CD1 1 
ATOM   4836  C CD2 . PHE B  1 69  ? 13.001  20.130  50.606  1.00 76.72  ? 69   PHE B CD2 1 
ATOM   4837  C CE1 . PHE B  1 69  ? 12.136  19.166  48.163  1.00 77.48  ? 69   PHE B CE1 1 
ATOM   4838  C CE2 . PHE B  1 69  ? 12.423  18.858  50.510  1.00 78.82  ? 69   PHE B CE2 1 
ATOM   4839  C CZ  . PHE B  1 69  ? 11.976  18.392  49.293  1.00 76.50  ? 69   PHE B CZ  1 
ATOM   4840  N N   . ARG B  1 70  ? 12.652  24.458  47.463  1.00 71.79  ? 70   ARG B N   1 
ATOM   4841  C CA  . ARG B  1 70  ? 12.110  24.862  46.173  1.00 71.02  ? 70   ARG B CA  1 
ATOM   4842  C C   . ARG B  1 70  ? 11.856  23.741  45.189  1.00 70.96  ? 70   ARG B C   1 
ATOM   4843  O O   . ARG B  1 70  ? 10.833  23.770  44.505  1.00 72.43  ? 70   ARG B O   1 
ATOM   4844  C CB  . ARG B  1 70  ? 13.073  25.876  45.511  1.00 74.89  ? 70   ARG B CB  1 
ATOM   4845  C CG  . ARG B  1 70  ? 12.432  26.738  44.413  1.00 93.19  ? 70   ARG B CG  1 
ATOM   4846  C CD  . ARG B  1 70  ? 13.415  27.223  43.352  1.00 98.26  ? 70   ARG B CD  1 
ATOM   4847  N NE  . ARG B  1 70  ? 13.663  26.248  42.279  1.00 101.73 ? 70   ARG B NE  1 
ATOM   4848  C CZ  . ARG B  1 70  ? 12.966  26.162  41.148  1.00 114.96 ? 70   ARG B CZ  1 
ATOM   4849  N NH1 . ARG B  1 70  ? 11.929  26.965  40.934  1.00 97.45  ? 70   ARG B NH1 1 
ATOM   4850  N NH2 . ARG B  1 70  ? 13.284  25.252  40.234  1.00 105.03 ? 70   ARG B NH2 1 
ATOM   4851  N N   . TYR B  1 71  ? 12.808  22.810  45.047  1.00 62.16  ? 71   TYR B N   1 
ATOM   4852  C CA  . TYR B  1 71  ? 12.733  21.792  44.026  1.00 59.98  ? 71   TYR B CA  1 
ATOM   4853  C C   . TYR B  1 71  ? 13.130  20.386  44.516  1.00 66.27  ? 71   TYR B C   1 
ATOM   4854  O O   . TYR B  1 71  ? 14.094  20.252  45.295  1.00 67.99  ? 71   TYR B O   1 
ATOM   4855  C CB  . TYR B  1 71  ? 13.629  22.274  42.891  1.00 60.07  ? 71   TYR B CB  1 
ATOM   4856  C CG  . TYR B  1 71  ? 13.944  21.284  41.795  1.00 58.86  ? 71   TYR B CG  1 
ATOM   4857  C CD1 . TYR B  1 71  ? 13.088  21.127  40.709  1.00 60.89  ? 71   TYR B CD1 1 
ATOM   4858  C CD2 . TYR B  1 71  ? 15.163  20.602  41.771  1.00 57.04  ? 71   TYR B CD2 1 
ATOM   4859  C CE1 . TYR B  1 71  ? 13.408  20.276  39.655  1.00 60.84  ? 71   TYR B CE1 1 
ATOM   4860  C CE2 . TYR B  1 71  ? 15.493  19.748  40.725  1.00 56.64  ? 71   TYR B CE2 1 
ATOM   4861  C CZ  . TYR B  1 71  ? 14.614  19.590  39.664  1.00 62.80  ? 71   TYR B CZ  1 
ATOM   4862  O OH  . TYR B  1 71  ? 14.914  18.742  38.625  1.00 57.82  ? 71   TYR B OH  1 
ATOM   4863  N N   . LEU B  1 72  ? 12.399  19.339  44.016  1.00 59.54  ? 72   LEU B N   1 
ATOM   4864  C CA  . LEU B  1 72  ? 12.599  17.921  44.323  1.00 56.56  ? 72   LEU B CA  1 
ATOM   4865  C C   . LEU B  1 72  ? 13.450  17.266  43.229  1.00 60.40  ? 72   LEU B C   1 
ATOM   4866  O O   . LEU B  1 72  ? 12.939  16.984  42.144  1.00 58.33  ? 72   LEU B O   1 
ATOM   4867  C CB  . LEU B  1 72  ? 11.248  17.215  44.470  1.00 55.65  ? 72   LEU B CB  1 
ATOM   4868  C CG  . LEU B  1 72  ? 11.271  15.743  44.848  1.00 58.87  ? 72   LEU B CG  1 
ATOM   4869  C CD1 . LEU B  1 72  ? 11.899  15.531  46.216  1.00 59.39  ? 72   LEU B CD1 1 
ATOM   4870  C CD2 . LEU B  1 72  ? 9.886   15.162  44.803  1.00 59.62  ? 72   LEU B CD2 1 
ATOM   4871  N N   . PRO B  1 73  ? 14.760  17.034  43.486  1.00 58.37  ? 73   PRO B N   1 
ATOM   4872  C CA  . PRO B  1 73  ? 15.628  16.502  42.426  1.00 58.25  ? 73   PRO B CA  1 
ATOM   4873  C C   . PRO B  1 73  ? 15.673  14.991  42.243  1.00 62.10  ? 73   PRO B C   1 
ATOM   4874  O O   . PRO B  1 73  ? 16.760  14.402  42.278  1.00 62.41  ? 73   PRO B O   1 
ATOM   4875  C CB  . PRO B  1 73  ? 16.990  17.093  42.777  1.00 60.30  ? 73   PRO B CB  1 
ATOM   4876  C CG  . PRO B  1 73  ? 16.954  17.291  44.253  1.00 63.97  ? 73   PRO B CG  1 
ATOM   4877  C CD  . PRO B  1 73  ? 15.539  17.354  44.703  1.00 59.87  ? 73   PRO B CD  1 
ATOM   4878  N N   . LEU B  1 74  ? 14.515  14.370  41.965  1.00 57.56  ? 74   LEU B N   1 
ATOM   4879  C CA  . LEU B  1 74  ? 14.449  12.920  41.749  1.00 56.05  ? 74   LEU B CA  1 
ATOM   4880  C C   . LEU B  1 74  ? 14.517  12.600  40.268  1.00 63.35  ? 74   LEU B C   1 
ATOM   4881  O O   . LEU B  1 74  ? 13.836  11.708  39.741  1.00 63.87  ? 74   LEU B O   1 
ATOM   4882  C CB  . LEU B  1 74  ? 13.167  12.393  42.363  1.00 54.79  ? 74   LEU B CB  1 
ATOM   4883  C CG  . LEU B  1 74  ? 13.226  12.204  43.836  1.00 56.52  ? 74   LEU B CG  1 
ATOM   4884  C CD1 . LEU B  1 74  ? 11.937  11.661  44.324  1.00 55.29  ? 74   LEU B CD1 1 
ATOM   4885  C CD2 . LEU B  1 74  ? 14.374  11.312  44.204  1.00 54.97  ? 74   LEU B CD2 1 
ATOM   4886  N N   . GLU B  1 75  ? 15.350  13.372  39.593  1.00 61.16  ? 75   GLU B N   1 
ATOM   4887  C CA  . GLU B  1 75  ? 15.573  13.395  38.147  1.00 61.31  ? 75   GLU B CA  1 
ATOM   4888  C C   . GLU B  1 75  ? 15.826  12.047  37.513  1.00 65.01  ? 75   GLU B C   1 
ATOM   4889  O O   . GLU B  1 75  ? 15.555  11.910  36.327  1.00 65.41  ? 75   GLU B O   1 
ATOM   4890  C CB  . GLU B  1 75  ? 16.685  14.388  37.810  1.00 63.04  ? 75   GLU B CB  1 
ATOM   4891  C CG  . GLU B  1 75  ? 16.490  15.699  38.556  1.00 70.37  ? 75   GLU B CG  1 
ATOM   4892  C CD  . GLU B  1 75  ? 17.516  16.780  38.333  1.00 90.48  ? 75   GLU B CD  1 
ATOM   4893  O OE1 . GLU B  1 75  ? 17.265  17.903  38.822  1.00 67.45  ? 75   GLU B OE1 1 
ATOM   4894  O OE2 . GLU B  1 75  ? 18.575  16.506  37.718  1.00 95.95  ? 75   GLU B OE2 1 
ATOM   4895  N N   . ASN B  1 76  ? 16.303  11.046  38.298  1.00 58.89  ? 76   ASN B N   1 
ATOM   4896  C CA  . ASN B  1 76  ? 16.561  9.732   37.763  1.00 56.33  ? 76   ASN B CA  1 
ATOM   4897  C C   . ASN B  1 76  ? 15.544  8.651   38.157  1.00 57.79  ? 76   ASN B C   1 
ATOM   4898  O O   . ASN B  1 76  ? 15.529  7.569   37.528  1.00 56.50  ? 76   ASN B O   1 
ATOM   4899  C CB  . ASN B  1 76  ? 18.007  9.343   37.976  1.00 55.04  ? 76   ASN B CB  1 
ATOM   4900  C CG  . ASN B  1 76  ? 18.948  10.061  37.054  1.00 72.64  ? 76   ASN B CG  1 
ATOM   4901  O OD1 . ASN B  1 76  ? 18.748  10.156  35.827  1.00 69.62  ? 76   ASN B OD1 1 
ATOM   4902  N ND2 . ASN B  1 76  ? 20.018  10.557  37.624  1.00 66.46  ? 76   ASN B ND2 1 
ATOM   4903  N N   . LEU B  1 77  ? 14.641  8.966   39.146  1.00 52.61  ? 77   LEU B N   1 
ATOM   4904  C CA  . LEU B  1 77  ? 13.547  8.058   39.575  1.00 49.28  ? 77   LEU B CA  1 
ATOM   4905  C C   . LEU B  1 77  ? 12.653  7.686   38.384  1.00 53.31  ? 77   LEU B C   1 
ATOM   4906  O O   . LEU B  1 77  ? 12.039  8.573   37.777  1.00 53.15  ? 77   LEU B O   1 
ATOM   4907  C CB  . LEU B  1 77  ? 12.700  8.652   40.724  1.00 47.24  ? 77   LEU B CB  1 
ATOM   4908  C CG  . LEU B  1 77  ? 11.559  7.767   41.245  1.00 48.05  ? 77   LEU B CG  1 
ATOM   4909  C CD1 . LEU B  1 77  ? 12.058  6.520   41.935  1.00 45.24  ? 77   LEU B CD1 1 
ATOM   4910  C CD2 . LEU B  1 77  ? 10.681  8.532   42.175  1.00 50.29  ? 77   LEU B CD2 1 
ATOM   4911  N N   . ARG B  1 78  ? 12.590  6.374   38.069  1.00 49.47  ? 78   ARG B N   1 
ATOM   4912  C CA  . ARG B  1 78  ? 11.820  5.816   36.952  1.00 49.15  ? 78   ARG B CA  1 
ATOM   4913  C C   . ARG B  1 78  ? 10.555  5.087   37.414  1.00 54.57  ? 78   ARG B C   1 
ATOM   4914  O O   . ARG B  1 78  ? 9.469   5.284   36.843  1.00 55.11  ? 78   ARG B O   1 
ATOM   4915  C CB  . ARG B  1 78  ? 12.724  4.851   36.183  1.00 45.65  ? 78   ARG B CB  1 
ATOM   4916  C CG  . ARG B  1 78  ? 12.084  3.996   35.100  1.00 49.87  ? 78   ARG B CG  1 
ATOM   4917  C CD  . ARG B  1 78  ? 11.720  4.714   33.813  1.00 52.55  ? 78   ARG B CD  1 
ATOM   4918  N NE  . ARG B  1 78  ? 12.809  5.479   33.224  1.00 37.73  ? 78   ARG B NE  1 
ATOM   4919  C CZ  . ARG B  1 78  ? 12.615  6.386   32.279  1.00 55.93  ? 78   ARG B CZ  1 
ATOM   4920  N NH1 . ARG B  1 78  ? 11.390  6.611   31.809  1.00 33.92  ? 78   ARG B NH1 1 
ATOM   4921  N NH2 . ARG B  1 78  ? 13.644  7.071   31.784  1.00 51.14  ? 78   ARG B NH2 1 
ATOM   4922  N N   . ILE B  1 79  ? 10.707  4.238   38.443  1.00 49.86  ? 79   ILE B N   1 
ATOM   4923  C CA  . ILE B  1 79  ? 9.622   3.400   38.943  1.00 49.13  ? 79   ILE B CA  1 
ATOM   4924  C C   . ILE B  1 79  ? 9.415   3.502   40.459  1.00 52.56  ? 79   ILE B C   1 
ATOM   4925  O O   . ILE B  1 79  ? 10.383  3.642   41.220  1.00 52.28  ? 79   ILE B O   1 
ATOM   4926  C CB  . ILE B  1 79  ? 9.893   1.922   38.470  1.00 51.40  ? 79   ILE B CB  1 
ATOM   4927  C CG1 . ILE B  1 79  ? 8.817   0.909   38.907  1.00 51.53  ? 79   ILE B CG1 1 
ATOM   4928  C CG2 . ILE B  1 79  ? 11.267  1.427   38.874  1.00 50.91  ? 79   ILE B CG2 1 
ATOM   4929  C CD1 . ILE B  1 79  ? 8.891   -0.413  38.164  1.00 49.89  ? 79   ILE B CD1 1 
ATOM   4930  N N   . ILE B  1 80  ? 8.135   3.447   40.876  1.00 47.24  ? 80   ILE B N   1 
ATOM   4931  C CA  . ILE B  1 80  ? 7.685   3.319   42.258  1.00 46.21  ? 80   ILE B CA  1 
ATOM   4932  C C   . ILE B  1 80  ? 6.825   2.034   42.177  1.00 50.47  ? 80   ILE B C   1 
ATOM   4933  O O   . ILE B  1 80  ? 5.828   2.005   41.436  1.00 49.26  ? 80   ILE B O   1 
ATOM   4934  C CB  . ILE B  1 80  ? 6.907   4.539   42.828  1.00 49.10  ? 80   ILE B CB  1 
ATOM   4935  C CG1 . ILE B  1 80  ? 7.710   5.834   42.772  1.00 47.83  ? 80   ILE B CG1 1 
ATOM   4936  C CG2 . ILE B  1 80  ? 6.464   4.251   44.255  1.00 51.01  ? 80   ILE B CG2 1 
ATOM   4937  C CD1 . ILE B  1 80  ? 6.884   7.065   42.921  1.00 48.61  ? 80   ILE B CD1 1 
ATOM   4938  N N   . ARG B  1 81  ? 7.263   0.956   42.848  1.00 47.22  ? 81   ARG B N   1 
ATOM   4939  C CA  . ARG B  1 81  ? 6.541   -0.328  42.782  1.00 46.98  ? 81   ARG B CA  1 
ATOM   4940  C C   . ARG B  1 81  ? 5.290   -0.384  43.618  1.00 50.80  ? 81   ARG B C   1 
ATOM   4941  O O   . ARG B  1 81  ? 4.373   -1.135  43.296  1.00 50.76  ? 81   ARG B O   1 
ATOM   4942  C CB  . ARG B  1 81  ? 7.447   -1.500  43.123  1.00 44.34  ? 81   ARG B CB  1 
ATOM   4943  C CG  . ARG B  1 81  ? 8.710   -1.498  42.321  1.00 43.35  ? 81   ARG B CG  1 
ATOM   4944  C CD  . ARG B  1 81  ? 9.054   -2.898  41.930  1.00 39.86  ? 81   ARG B CD  1 
ATOM   4945  N NE  . ARG B  1 81  ? 10.230  -2.886  41.066  1.00 42.07  ? 81   ARG B NE  1 
ATOM   4946  C CZ  . ARG B  1 81  ? 10.273  -3.427  39.854  1.00 54.05  ? 81   ARG B CZ  1 
ATOM   4947  N NH1 . ARG B  1 81  ? 9.209   -4.073  39.364  1.00 44.17  ? 81   ARG B NH1 1 
ATOM   4948  N NH2 . ARG B  1 81  ? 11.379  -3.347  39.128  1.00 32.74  ? 81   ARG B NH2 1 
ATOM   4949  N N   . GLY B  1 82  ? 5.281   0.378   44.696  1.00 48.23  ? 82   GLY B N   1 
ATOM   4950  C CA  . GLY B  1 82  ? 4.149   0.458   45.600  1.00 49.47  ? 82   GLY B CA  1 
ATOM   4951  C C   . GLY B  1 82  ? 3.816   -0.838  46.305  1.00 55.57  ? 82   GLY B C   1 
ATOM   4952  O O   . GLY B  1 82  ? 2.636   -1.129  46.508  1.00 56.32  ? 82   GLY B O   1 
ATOM   4953  N N   . THR B  1 83  ? 4.851   -1.636  46.679  1.00 51.19  ? 83   THR B N   1 
ATOM   4954  C CA  . THR B  1 83  ? 4.659   -2.916  47.388  1.00 49.42  ? 83   THR B CA  1 
ATOM   4955  C C   . THR B  1 83  ? 4.055   -2.654  48.737  1.00 54.92  ? 83   THR B C   1 
ATOM   4956  O O   . THR B  1 83  ? 3.280   -3.470  49.209  1.00 56.54  ? 83   THR B O   1 
ATOM   4957  C CB  . THR B  1 83  ? 5.924   -3.779  47.438  1.00 46.50  ? 83   THR B CB  1 
ATOM   4958  O OG1 . THR B  1 83  ? 6.922   -3.105  48.191  1.00 53.43  ? 83   THR B OG1 1 
ATOM   4959  C CG2 . THR B  1 83  ? 6.475   -4.104  46.062  1.00 38.08  ? 83   THR B CG2 1 
ATOM   4960  N N   . LYS B  1 84  ? 4.353   -1.485  49.322  1.00 52.82  ? 84   LYS B N   1 
ATOM   4961  C CA  . LYS B  1 84  ? 3.784   -0.959  50.574  1.00 53.78  ? 84   LYS B CA  1 
ATOM   4962  C C   . LYS B  1 84  ? 3.356   0.475   50.260  1.00 57.92  ? 84   LYS B C   1 
ATOM   4963  O O   . LYS B  1 84  ? 4.112   1.230   49.633  1.00 59.03  ? 84   LYS B O   1 
ATOM   4964  C CB  . LYS B  1 84  ? 4.780   -1.018  51.740  1.00 56.39  ? 84   LYS B CB  1 
ATOM   4965  C CG  . LYS B  1 84  ? 4.897   -2.403  52.392  1.00 82.94  ? 84   LYS B CG  1 
ATOM   4966  C CD  . LYS B  1 84  ? 6.037   -2.422  53.441  1.00 98.00  ? 84   LYS B CD  1 
ATOM   4967  C CE  . LYS B  1 84  ? 6.120   -3.678  54.291  1.00 96.54  ? 84   LYS B CE  1 
ATOM   4968  N NZ  . LYS B  1 84  ? 6.845   -3.437  55.585  1.00 83.15  ? 84   LYS B NZ  1 
ATOM   4969  N N   . LEU B  1 85  ? 2.128   0.830   50.641  1.00 52.53  ? 85   LEU B N   1 
ATOM   4970  C CA  . LEU B  1 85  ? 1.565   2.146   50.323  1.00 51.94  ? 85   LEU B CA  1 
ATOM   4971  C C   . LEU B  1 85  ? 1.350   3.095   51.509  1.00 56.77  ? 85   LEU B C   1 
ATOM   4972  O O   . LEU B  1 85  ? 0.929   2.631   52.573  1.00 60.50  ? 85   LEU B O   1 
ATOM   4973  C CB  . LEU B  1 85  ? 0.233   1.961   49.559  1.00 51.37  ? 85   LEU B CB  1 
ATOM   4974  C CG  . LEU B  1 85  ? 0.323   1.158   48.267  1.00 52.26  ? 85   LEU B CG  1 
ATOM   4975  C CD1 . LEU B  1 85  ? -1.019  0.964   47.684  1.00 50.62  ? 85   LEU B CD1 1 
ATOM   4976  C CD2 . LEU B  1 85  ? 1.342   1.755   47.295  1.00 50.95  ? 85   LEU B CD2 1 
ATOM   4977  N N   . TYR B  1 86  ? 1.594   4.420   51.317  1.00 48.82  ? 86   TYR B N   1 
ATOM   4978  C CA  . TYR B  1 86  ? 1.317   5.385   52.357  1.00 48.63  ? 86   TYR B CA  1 
ATOM   4979  C C   . TYR B  1 86  ? -0.204  5.402   52.536  1.00 57.55  ? 86   TYR B C   1 
ATOM   4980  O O   . TYR B  1 86  ? -0.944  5.402   51.540  1.00 58.36  ? 86   TYR B O   1 
ATOM   4981  C CB  . TYR B  1 86  ? 1.842   6.784   52.013  1.00 48.22  ? 86   TYR B CB  1 
ATOM   4982  C CG  . TYR B  1 86  ? 1.557   7.803   53.104  1.00 49.16  ? 86   TYR B CG  1 
ATOM   4983  C CD1 . TYR B  1 86  ? 2.231   7.761   54.320  1.00 50.40  ? 86   TYR B CD1 1 
ATOM   4984  C CD2 . TYR B  1 86  ? 0.613   8.814   52.916  1.00 50.44  ? 86   TYR B CD2 1 
ATOM   4985  C CE1 . TYR B  1 86  ? 1.985   8.707   55.317  1.00 52.29  ? 86   TYR B CE1 1 
ATOM   4986  C CE2 . TYR B  1 86  ? 0.376   9.784   53.898  1.00 51.68  ? 86   TYR B CE2 1 
ATOM   4987  C CZ  . TYR B  1 86  ? 1.051   9.716   55.106  1.00 56.59  ? 86   TYR B CZ  1 
ATOM   4988  O OH  . TYR B  1 86  ? 0.771   10.618  56.111  1.00 51.39  ? 86   TYR B OH  1 
ATOM   4989  N N   . GLU B  1 87  ? -0.665  5.336   53.804  1.00 54.72  ? 87   GLU B N   1 
ATOM   4990  C CA  . GLU B  1 87  ? -2.083  5.303   54.163  1.00 55.47  ? 87   GLU B CA  1 
ATOM   4991  C C   . GLU B  1 87  ? -2.798  4.165   53.450  1.00 62.79  ? 87   GLU B C   1 
ATOM   4992  O O   . GLU B  1 87  ? -4.005  4.224   53.195  1.00 63.39  ? 87   GLU B O   1 
ATOM   4993  C CB  . GLU B  1 87  ? -2.765  6.669   53.955  1.00 56.61  ? 87   GLU B CB  1 
ATOM   4994  C CG  . GLU B  1 87  ? -2.391  7.641   55.051  1.00 59.06  ? 87   GLU B CG  1 
ATOM   4995  C CD  . GLU B  1 87  ? -2.952  9.048   54.966  1.00 98.19  ? 87   GLU B CD  1 
ATOM   4996  O OE1 . GLU B  1 87  ? -3.515  9.428   53.911  1.00 96.19  ? 87   GLU B OE1 1 
ATOM   4997  O OE2 . GLU B  1 87  ? -2.798  9.786   55.966  1.00 103.76 ? 87   GLU B OE2 1 
ATOM   4998  N N   . ASP B  1 88  ? -2.026  3.116   53.128  1.00 60.02  ? 88   ASP B N   1 
ATOM   4999  C CA  . ASP B  1 88  ? -2.502  1.922   52.438  1.00 60.64  ? 88   ASP B CA  1 
ATOM   5000  C C   . ASP B  1 88  ? -3.187  2.205   51.106  1.00 64.73  ? 88   ASP B C   1 
ATOM   5001  O O   . ASP B  1 88  ? -3.878  1.329   50.588  1.00 65.32  ? 88   ASP B O   1 
ATOM   5002  C CB  . ASP B  1 88  ? -3.299  0.979   53.378  1.00 63.43  ? 88   ASP B CB  1 
ATOM   5003  C CG  . ASP B  1 88  ? -2.412  0.357   54.468  1.00 86.05  ? 88   ASP B CG  1 
ATOM   5004  O OD1 . ASP B  1 88  ? -1.150  0.270   54.255  1.00 84.91  ? 88   ASP B OD1 1 
ATOM   5005  O OD2 . ASP B  1 88  ? -2.963  -0.032  55.537  1.00 99.21  ? 88   ASP B OD2 1 
ATOM   5006  N N   . ARG B  1 89  ? -2.912  3.405   50.520  1.00 59.28  ? 89   ARG B N   1 
ATOM   5007  C CA  . ARG B  1 89  ? -3.476  3.841   49.252  1.00 58.23  ? 89   ARG B CA  1 
ATOM   5008  C C   . ARG B  1 89  ? -2.540  4.564   48.281  1.00 58.92  ? 89   ARG B C   1 
ATOM   5009  O O   . ARG B  1 89  ? -2.729  4.420   47.074  1.00 59.06  ? 89   ARG B O   1 
ATOM   5010  C CB  . ARG B  1 89  ? -4.783  4.611   49.460  1.00 60.56  ? 89   ARG B CB  1 
ATOM   5011  C CG  . ARG B  1 89  ? -4.698  5.834   50.347  1.00 76.98  ? 89   ARG B CG  1 
ATOM   5012  C CD  . ARG B  1 89  ? -6.021  6.098   51.062  1.00 100.77 ? 89   ARG B CD  1 
ATOM   5013  N NE  . ARG B  1 89  ? -5.888  7.210   52.010  1.00 119.25 ? 89   ARG B NE  1 
ATOM   5014  C CZ  . ARG B  1 89  ? -6.677  8.280   52.041  1.00 137.74 ? 89   ARG B CZ  1 
ATOM   5015  N NH1 . ARG B  1 89  ? -7.700  8.386   51.199  1.00 130.76 ? 89   ARG B NH1 1 
ATOM   5016  N NH2 . ARG B  1 89  ? -6.453  9.251   52.919  1.00 120.45 ? 89   ARG B NH2 1 
ATOM   5017  N N   . TYR B  1 90  ? -1.542  5.324   48.774  1.00 52.24  ? 90   TYR B N   1 
ATOM   5018  C CA  . TYR B  1 90  ? -0.666  6.090   47.887  1.00 50.51  ? 90   TYR B CA  1 
ATOM   5019  C C   . TYR B  1 90  ? 0.718   5.557   47.672  1.00 52.78  ? 90   TYR B C   1 
ATOM   5020  O O   . TYR B  1 90  ? 1.456   5.282   48.625  1.00 52.86  ? 90   TYR B O   1 
ATOM   5021  C CB  . TYR B  1 90  ? -0.571  7.546   48.328  1.00 52.85  ? 90   TYR B CB  1 
ATOM   5022  C CG  . TYR B  1 90  ? -1.916  8.175   48.654  1.00 57.39  ? 90   TYR B CG  1 
ATOM   5023  C CD1 . TYR B  1 90  ? -2.120  8.847   49.854  1.00 59.90  ? 90   TYR B CD1 1 
ATOM   5024  C CD2 . TYR B  1 90  ? -2.977  8.118   47.749  1.00 57.83  ? 90   TYR B CD2 1 
ATOM   5025  C CE1 . TYR B  1 90  ? -3.354  9.411   50.163  1.00 62.44  ? 90   TYR B CE1 1 
ATOM   5026  C CE2 . TYR B  1 90  ? -4.213  8.677   48.048  1.00 59.09  ? 90   TYR B CE2 1 
ATOM   5027  C CZ  . TYR B  1 90  ? -4.402  9.321   49.258  1.00 68.80  ? 90   TYR B CZ  1 
ATOM   5028  O OH  . TYR B  1 90  ? -5.621  9.908   49.548  1.00 72.20  ? 90   TYR B OH  1 
ATOM   5029  N N   . ALA B  1 91  ? 1.104   5.486   46.396  1.00 47.35  ? 91   ALA B N   1 
ATOM   5030  C CA  . ALA B  1 91  ? 2.453   5.135   45.973  1.00 45.00  ? 91   ALA B CA  1 
ATOM   5031  C C   . ALA B  1 91  ? 3.271   6.411   46.029  1.00 47.45  ? 91   ALA B C   1 
ATOM   5032  O O   . ALA B  1 91  ? 4.416   6.386   46.451  1.00 45.36  ? 91   ALA B O   1 
ATOM   5033  C CB  . ALA B  1 91  ? 2.447   4.583   44.562  1.00 45.24  ? 91   ALA B CB  1 
ATOM   5034  N N   . LEU B  1 92  ? 2.654   7.543   45.671  1.00 47.45  ? 92   LEU B N   1 
ATOM   5035  C CA  . LEU B  1 92  ? 3.267   8.873   45.687  1.00 49.12  ? 92   LEU B CA  1 
ATOM   5036  C C   . LEU B  1 92  ? 2.382   9.853   46.448  1.00 53.95  ? 92   LEU B C   1 
ATOM   5037  O O   . LEU B  1 92  ? 1.220   10.025  46.111  1.00 51.72  ? 92   LEU B O   1 
ATOM   5038  C CB  . LEU B  1 92  ? 3.526   9.350   44.253  1.00 49.55  ? 92   LEU B CB  1 
ATOM   5039  C CG  . LEU B  1 92  ? 4.232   10.681  44.089  1.00 54.91  ? 92   LEU B CG  1 
ATOM   5040  C CD1 . LEU B  1 92  ? 5.634   10.625  44.592  1.00 53.47  ? 92   LEU B CD1 1 
ATOM   5041  C CD2 . LEU B  1 92  ? 4.238   11.096  42.646  1.00 58.83  ? 92   LEU B CD2 1 
ATOM   5042  N N   . ALA B  1 93  ? 2.937   10.459  47.498  1.00 54.59  ? 93   ALA B N   1 
ATOM   5043  C CA  . ALA B  1 93  ? 2.215   11.420  48.325  1.00 57.40  ? 93   ALA B CA  1 
ATOM   5044  C C   . ALA B  1 93  ? 3.062   12.676  48.535  1.00 63.06  ? 93   ALA B C   1 
ATOM   5045  O O   . ALA B  1 93  ? 4.123   12.612  49.182  1.00 62.91  ? 93   ALA B O   1 
ATOM   5046  C CB  . ALA B  1 93  ? 1.846   10.794  49.658  1.00 58.43  ? 93   ALA B CB  1 
ATOM   5047  N N   . ILE B  1 94  ? 2.629   13.794  47.907  1.00 57.83  ? 94   ILE B N   1 
ATOM   5048  C CA  . ILE B  1 94  ? 3.309   15.082  47.976  1.00 57.32  ? 94   ILE B CA  1 
ATOM   5049  C C   . ILE B  1 94  ? 2.302   16.085  48.502  1.00 63.19  ? 94   ILE B C   1 
ATOM   5050  O O   . ILE B  1 94  ? 1.390   16.462  47.772  1.00 64.73  ? 94   ILE B O   1 
ATOM   5051  C CB  . ILE B  1 94  ? 3.940   15.510  46.616  1.00 59.52  ? 94   ILE B CB  1 
ATOM   5052  C CG1 . ILE B  1 94  ? 4.887   14.431  46.051  1.00 57.17  ? 94   ILE B CG1 1 
ATOM   5053  C CG2 . ILE B  1 94  ? 4.671   16.854  46.751  1.00 61.36  ? 94   ILE B CG2 1 
ATOM   5054  C CD1 . ILE B  1 94  ? 5.038   14.429  44.537  1.00 51.67  ? 94   ILE B CD1 1 
ATOM   5055  N N   . PHE B  1 95  ? 2.431   16.491  49.778  1.00 58.35  ? 95   PHE B N   1 
ATOM   5056  C CA  . PHE B  1 95  ? 1.484   17.431  50.405  1.00 58.14  ? 95   PHE B CA  1 
ATOM   5057  C C   . PHE B  1 95  ? 2.118   18.308  51.467  1.00 66.26  ? 95   PHE B C   1 
ATOM   5058  O O   . PHE B  1 95  ? 3.099   17.903  52.081  1.00 65.93  ? 95   PHE B O   1 
ATOM   5059  C CB  . PHE B  1 95  ? 0.236   16.711  50.959  1.00 58.43  ? 95   PHE B CB  1 
ATOM   5060  C CG  . PHE B  1 95  ? 0.504   15.682  52.035  1.00 57.72  ? 95   PHE B CG  1 
ATOM   5061  C CD1 . PHE B  1 95  ? 0.416   16.020  53.384  1.00 58.64  ? 95   PHE B CD1 1 
ATOM   5062  C CD2 . PHE B  1 95  ? 0.857   14.377  51.701  1.00 57.61  ? 95   PHE B CD2 1 
ATOM   5063  C CE1 . PHE B  1 95  ? 0.652   15.074  54.378  1.00 57.31  ? 95   PHE B CE1 1 
ATOM   5064  C CE2 . PHE B  1 95  ? 1.110   13.431  52.697  1.00 59.07  ? 95   PHE B CE2 1 
ATOM   5065  C CZ  . PHE B  1 95  ? 0.995   13.785  54.027  1.00 56.88  ? 95   PHE B CZ  1 
ATOM   5066  N N   . LEU B  1 96  ? 1.545   19.514  51.680  1.00 65.58  ? 96   LEU B N   1 
ATOM   5067  C CA  . LEU B  1 96  ? 1.969   20.517  52.667  1.00 65.70  ? 96   LEU B CA  1 
ATOM   5068  C C   . LEU B  1 96  ? 3.444   20.924  52.561  1.00 70.30  ? 96   LEU B C   1 
ATOM   5069  O O   . LEU B  1 96  ? 4.093   21.208  53.575  1.00 70.47  ? 96   LEU B O   1 
ATOM   5070  C CB  . LEU B  1 96  ? 1.588   20.087  54.097  1.00 65.43  ? 96   LEU B CB  1 
ATOM   5071  C CG  . LEU B  1 96  ? 0.128   19.812  54.355  1.00 68.98  ? 96   LEU B CG  1 
ATOM   5072  C CD1 . LEU B  1 96  ? -0.047  19.127  55.667  1.00 68.52  ? 96   LEU B CD1 1 
ATOM   5073  C CD2 . LEU B  1 96  ? -0.664  21.061  54.335  1.00 70.53  ? 96   LEU B CD2 1 
ATOM   5074  N N   . ASN B  1 97  ? 3.966   20.963  51.333  1.00 67.48  ? 97   ASN B N   1 
ATOM   5075  C CA  . ASN B  1 97  ? 5.351   21.357  51.121  1.00 68.28  ? 97   ASN B CA  1 
ATOM   5076  C C   . ASN B  1 97  ? 5.524   22.888  50.955  1.00 76.06  ? 97   ASN B C   1 
ATOM   5077  O O   . ASN B  1 97  ? 5.908   23.387  49.894  1.00 75.81  ? 97   ASN B O   1 
ATOM   5078  C CB  . ASN B  1 97  ? 6.016   20.535  50.030  1.00 65.07  ? 97   ASN B CB  1 
ATOM   5079  C CG  . ASN B  1 97  ? 6.129   19.109  50.401  1.00 78.19  ? 97   ASN B CG  1 
ATOM   5080  O OD1 . ASN B  1 97  ? 7.052   18.723  51.093  1.00 73.41  ? 97   ASN B OD1 1 
ATOM   5081  N ND2 . ASN B  1 97  ? 5.172   18.304  49.987  1.00 72.56  ? 97   ASN B ND2 1 
ATOM   5082  N N   . TYR B  1 98  ? 5.241   23.615  52.044  1.00 75.14  ? 98   TYR B N   1 
ATOM   5083  C CA  . TYR B  1 98  ? 5.364   25.065  52.172  1.00 77.19  ? 98   TYR B CA  1 
ATOM   5084  C C   . TYR B  1 98  ? 5.223   25.448  53.635  1.00 85.50  ? 98   TYR B C   1 
ATOM   5085  O O   . TYR B  1 98  ? 4.672   24.659  54.413  1.00 83.82  ? 98   TYR B O   1 
ATOM   5086  C CB  . TYR B  1 98  ? 4.310   25.812  51.294  1.00 78.31  ? 98   TYR B CB  1 
ATOM   5087  C CG  . TYR B  1 98  ? 2.871   25.720  51.766  1.00 77.38  ? 98   TYR B CG  1 
ATOM   5088  C CD1 . TYR B  1 98  ? 2.295   26.742  52.518  1.00 80.21  ? 98   TYR B CD1 1 
ATOM   5089  C CD2 . TYR B  1 98  ? 2.071   24.642  51.414  1.00 76.28  ? 98   TYR B CD2 1 
ATOM   5090  C CE1 . TYR B  1 98  ? 0.972   26.660  52.960  1.00 79.93  ? 98   TYR B CE1 1 
ATOM   5091  C CE2 . TYR B  1 98  ? 0.750   24.549  51.848  1.00 77.45  ? 98   TYR B CE2 1 
ATOM   5092  C CZ  . TYR B  1 98  ? 0.203   25.560  52.624  1.00 82.65  ? 98   TYR B CZ  1 
ATOM   5093  O OH  . TYR B  1 98  ? -1.100  25.464  53.047  1.00 79.45  ? 98   TYR B OH  1 
ATOM   5094  N N   . ARG B  1 99  ? 5.684   26.663  54.008  1.00 87.46  ? 99   ARG B N   1 
ATOM   5095  C CA  . ARG B  1 99  ? 5.500   27.164  55.381  1.00 90.53  ? 99   ARG B CA  1 
ATOM   5096  C C   . ARG B  1 99  ? 4.223   28.012  55.452  1.00 96.80  ? 99   ARG B C   1 
ATOM   5097  O O   . ARG B  1 99  ? 4.058   28.903  54.617  1.00 97.93  ? 99   ARG B O   1 
ATOM   5098  C CB  . ARG B  1 99  ? 6.754   27.878  55.950  1.00 94.64  ? 99   ARG B CB  1 
ATOM   5099  C CG  . ARG B  1 99  ? 7.259   29.113  55.198  1.00 111.57 ? 99   ARG B CG  1 
ATOM   5100  C CD  . ARG B  1 99  ? 8.561   29.645  55.782  1.00 129.58 ? 99   ARG B CD  1 
ATOM   5101  N NE  . ARG B  1 99  ? 8.374   30.271  57.097  1.00 149.50 ? 99   ARG B NE  1 
ATOM   5102  C CZ  . ARG B  1 99  ? 8.710   29.716  58.263  1.00 168.19 ? 99   ARG B CZ  1 
ATOM   5103  N NH1 . ARG B  1 99  ? 9.266   28.508  58.298  1.00 153.50 ? 99   ARG B NH1 1 
ATOM   5104  N NH2 . ARG B  1 99  ? 8.493   30.364  59.400  1.00 158.14 ? 99   ARG B NH2 1 
ATOM   5105  N N   . LYS B  1 100 ? 3.299   27.696  56.395  1.00 93.89  ? 100  LYS B N   1 
ATOM   5106  C CA  . LYS B  1 100 ? 2.000   28.370  56.554  1.00 96.01  ? 100  LYS B CA  1 
ATOM   5107  C C   . LYS B  1 100 ? 2.096   29.917  56.573  1.00 108.14 ? 100  LYS B C   1 
ATOM   5108  O O   . LYS B  1 100 ? 1.149   30.587  56.148  1.00 109.40 ? 100  LYS B O   1 
ATOM   5109  C CB  . LYS B  1 100 ? 1.258   27.838  57.779  1.00 97.27  ? 100  LYS B CB  1 
ATOM   5110  C CG  . LYS B  1 100 ? -0.244  27.787  57.605  1.00 102.33 ? 100  LYS B CG  1 
ATOM   5111  C CD  . LYS B  1 100 ? -0.953  27.451  58.919  1.00 112.85 ? 100  LYS B CD  1 
ATOM   5112  C CE  . LYS B  1 100 ? -2.285  26.774  58.706  1.00 123.75 ? 100  LYS B CE  1 
ATOM   5113  N NZ  . LYS B  1 100 ? -2.134  25.304  58.501  1.00 135.39 ? 100  LYS B NZ  1 
ATOM   5114  N N   . ASP B  1 101 ? 3.264   30.464  57.025  1.00 108.42 ? 101  ASP B N   1 
ATOM   5115  C CA  . ASP B  1 101 ? 3.621   31.891  57.045  1.00 111.06 ? 101  ASP B CA  1 
ATOM   5116  C C   . ASP B  1 101 ? 3.481   32.458  55.620  1.00 116.11 ? 101  ASP B C   1 
ATOM   5117  O O   . ASP B  1 101 ? 2.935   33.550  55.452  1.00 117.70 ? 101  ASP B O   1 
ATOM   5118  C CB  . ASP B  1 101 ? 5.074   32.087  57.548  1.00 113.74 ? 101  ASP B CB  1 
ATOM   5119  C CG  . ASP B  1 101 ? 5.281   32.051  59.060  1.00 127.71 ? 101  ASP B CG  1 
ATOM   5120  O OD1 . ASP B  1 101 ? 5.144   30.956  59.657  1.00 127.54 ? 101  ASP B OD1 1 
ATOM   5121  O OD2 . ASP B  1 101 ? 5.678   33.092  59.628  1.00 136.09 ? 101  ASP B OD2 1 
ATOM   5122  N N   . GLY B  1 102 ? 3.951   31.693  54.622  1.00 111.62 ? 102  GLY B N   1 
ATOM   5123  C CA  . GLY B  1 102 ? 3.819   32.007  53.199  1.00 111.15 ? 102  GLY B CA  1 
ATOM   5124  C C   . GLY B  1 102 ? 5.066   32.450  52.470  1.00 113.06 ? 102  GLY B C   1 
ATOM   5125  O O   . GLY B  1 102 ? 4.980   32.972  51.352  1.00 112.51 ? 102  GLY B O   1 
ATOM   5126  N N   . ASN B  1 103 ? 6.222   32.257  53.089  1.00 108.95 ? 103  ASN B N   1 
ATOM   5127  C CA  . ASN B  1 103 ? 7.482   32.661  52.488  1.00 109.63 ? 103  ASN B CA  1 
ATOM   5128  C C   . ASN B  1 103 ? 7.836   31.730  51.294  1.00 111.76 ? 103  ASN B C   1 
ATOM   5129  O O   . ASN B  1 103 ? 7.596   32.076  50.129  1.00 110.26 ? 103  ASN B O   1 
ATOM   5130  C CB  . ASN B  1 103 ? 8.601   32.692  53.572  1.00 113.65 ? 103  ASN B CB  1 
ATOM   5131  C CG  . ASN B  1 103 ? 9.580   33.850  53.519  1.00 141.17 ? 103  ASN B CG  1 
ATOM   5132  O OD1 . ASN B  1 103 ? 9.445   34.806  52.735  1.00 138.43 ? 103  ASN B OD1 1 
ATOM   5133  N ND2 . ASN B  1 103 ? 10.583  33.800  54.395  1.00 130.32 ? 103  ASN B ND2 1 
ATOM   5134  N N   . PHE B  1 104 ? 8.346   30.528  51.615  1.00 107.18 ? 104  PHE B N   1 
ATOM   5135  C CA  . PHE B  1 104 ? 8.786   29.530  50.654  1.00 104.73 ? 104  PHE B CA  1 
ATOM   5136  C C   . PHE B  1 104 ? 7.985   28.237  50.685  1.00 101.29 ? 104  PHE B C   1 
ATOM   5137  O O   . PHE B  1 104 ? 7.134   28.019  51.552  1.00 100.48 ? 104  PHE B O   1 
ATOM   5138  C CB  . PHE B  1 104 ? 10.272  29.176  50.874  1.00 106.73 ? 104  PHE B CB  1 
ATOM   5139  C CG  . PHE B  1 104 ? 11.127  30.118  51.683  1.00 110.25 ? 104  PHE B CG  1 
ATOM   5140  C CD1 . PHE B  1 104 ? 11.728  31.223  51.086  1.00 115.29 ? 104  PHE B CD1 1 
ATOM   5141  C CD2 . PHE B  1 104 ? 11.409  29.851  53.015  1.00 112.99 ? 104  PHE B CD2 1 
ATOM   5142  C CE1 . PHE B  1 104 ? 12.565  32.064  51.820  1.00 117.91 ? 104  PHE B CE1 1 
ATOM   5143  C CE2 . PHE B  1 104 ? 12.259  30.681  53.745  1.00 117.76 ? 104  PHE B CE2 1 
ATOM   5144  C CZ  . PHE B  1 104 ? 12.831  31.784  53.143  1.00 117.36 ? 104  PHE B CZ  1 
ATOM   5145  N N   . GLY B  1 105 ? 8.353   27.358  49.766  1.00 92.50  ? 105  GLY B N   1 
ATOM   5146  C CA  . GLY B  1 105 ? 7.769   26.045  49.601  1.00 88.70  ? 105  GLY B CA  1 
ATOM   5147  C C   . GLY B  1 105 ? 8.251   25.381  48.342  1.00 84.80  ? 105  GLY B C   1 
ATOM   5148  O O   . GLY B  1 105 ? 9.142   25.887  47.648  1.00 84.06  ? 105  GLY B O   1 
ATOM   5149  N N   . LEU B  1 106 ? 7.663   24.236  48.058  1.00 76.19  ? 106  LEU B N   1 
ATOM   5150  C CA  . LEU B  1 106 ? 7.987   23.470  46.875  1.00 73.43  ? 106  LEU B CA  1 
ATOM   5151  C C   . LEU B  1 106 ? 7.343   24.123  45.661  1.00 78.30  ? 106  LEU B C   1 
ATOM   5152  O O   . LEU B  1 106 ? 6.152   24.439  45.693  1.00 77.40  ? 106  LEU B O   1 
ATOM   5153  C CB  . LEU B  1 106 ? 7.541   22.018  47.060  1.00 71.09  ? 106  LEU B CB  1 
ATOM   5154  C CG  . LEU B  1 106 ? 8.002   21.018  46.025  1.00 72.02  ? 106  LEU B CG  1 
ATOM   5155  C CD1 . LEU B  1 106 ? 9.510   20.807  46.065  1.00 70.13  ? 106  LEU B CD1 1 
ATOM   5156  C CD2 . LEU B  1 106 ? 7.283   19.735  46.218  1.00 71.72  ? 106  LEU B CD2 1 
ATOM   5157  N N   . GLN B  1 107 ? 8.154   24.370  44.612  1.00 76.00  ? 107  GLN B N   1 
ATOM   5158  C CA  . GLN B  1 107 ? 7.718   25.033  43.384  1.00 76.72  ? 107  GLN B CA  1 
ATOM   5159  C C   . GLN B  1 107 ? 7.702   24.139  42.156  1.00 78.39  ? 107  GLN B C   1 
ATOM   5160  O O   . GLN B  1 107 ? 6.887   24.370  41.261  1.00 79.86  ? 107  GLN B O   1 
ATOM   5161  C CB  . GLN B  1 107 ? 8.619   26.232  43.102  1.00 79.14  ? 107  GLN B CB  1 
ATOM   5162  C CG  . GLN B  1 107 ? 8.220   27.495  43.842  1.00 93.03  ? 107  GLN B CG  1 
ATOM   5163  C CD  . GLN B  1 107 ? 9.406   28.415  43.972  1.00 107.59 ? 107  GLN B CD  1 
ATOM   5164  O OE1 . GLN B  1 107 ? 9.805   28.782  45.083  1.00 105.57 ? 107  GLN B OE1 1 
ATOM   5165  N NE2 . GLN B  1 107 ? 10.048  28.751  42.851  1.00 90.37  ? 107  GLN B NE2 1 
ATOM   5166  N N   . GLU B  1 108 ? 8.626   23.162  42.090  1.00 70.89  ? 108  GLU B N   1 
ATOM   5167  C CA  . GLU B  1 108 ? 8.795   22.269  40.949  1.00 69.29  ? 108  GLU B CA  1 
ATOM   5168  C C   . GLU B  1 108 ? 9.195   20.862  41.386  1.00 71.25  ? 108  GLU B C   1 
ATOM   5169  O O   . GLU B  1 108 ? 9.994   20.705  42.314  1.00 71.85  ? 108  GLU B O   1 
ATOM   5170  C CB  . GLU B  1 108 ? 9.891   22.839  40.029  1.00 71.14  ? 108  GLU B CB  1 
ATOM   5171  C CG  . GLU B  1 108 ? 9.920   22.275  38.620  1.00 81.97  ? 108  GLU B CG  1 
ATOM   5172  C CD  . GLU B  1 108 ? 11.089  22.701  37.755  1.00 102.26 ? 108  GLU B CD  1 
ATOM   5173  O OE1 . GLU B  1 108 ? 11.730  21.814  37.152  1.00 114.39 ? 108  GLU B OE1 1 
ATOM   5174  O OE2 . GLU B  1 108 ? 11.345  23.921  37.652  1.00 92.57  ? 108  GLU B OE2 1 
ATOM   5175  N N   . LEU B  1 109 ? 8.672   19.841  40.674  1.00 63.36  ? 109  LEU B N   1 
ATOM   5176  C CA  . LEU B  1 109 ? 9.007   18.430  40.855  1.00 58.95  ? 109  LEU B CA  1 
ATOM   5177  C C   . LEU B  1 109 ? 9.927   17.972  39.686  1.00 62.26  ? 109  LEU B C   1 
ATOM   5178  O O   . LEU B  1 109 ? 9.570   18.094  38.513  1.00 61.82  ? 109  LEU B O   1 
ATOM   5179  C CB  . LEU B  1 109 ? 7.738   17.575  40.847  1.00 57.58  ? 109  LEU B CB  1 
ATOM   5180  C CG  . LEU B  1 109 ? 6.584   17.931  41.764  1.00 59.92  ? 109  LEU B CG  1 
ATOM   5181  C CD1 . LEU B  1 109 ? 5.359   17.103  41.391  1.00 56.90  ? 109  LEU B CD1 1 
ATOM   5182  C CD2 . LEU B  1 109 ? 6.944   17.677  43.215  1.00 63.61  ? 109  LEU B CD2 1 
ATOM   5183  N N   . GLY B  1 110 ? 11.110  17.488  40.019  1.00 59.41  ? 110  GLY B N   1 
ATOM   5184  C CA  . GLY B  1 110 ? 12.061  16.958  39.046  1.00 59.31  ? 110  GLY B CA  1 
ATOM   5185  C C   . GLY B  1 110 ? 11.815  15.478  38.901  1.00 64.52  ? 110  GLY B C   1 
ATOM   5186  O O   . GLY B  1 110 ? 12.581  14.669  39.429  1.00 65.05  ? 110  GLY B O   1 
ATOM   5187  N N   . LEU B  1 111 ? 10.664  15.120  38.285  1.00 60.23  ? 111  LEU B N   1 
ATOM   5188  C CA  . LEU B  1 111 ? 10.197  13.731  38.102  1.00 56.81  ? 111  LEU B CA  1 
ATOM   5189  C C   . LEU B  1 111 ? 10.057  13.331  36.621  1.00 62.71  ? 111  LEU B C   1 
ATOM   5190  O O   . LEU B  1 111 ? 9.326   12.384  36.334  1.00 64.57  ? 111  LEU B O   1 
ATOM   5191  C CB  . LEU B  1 111 ? 8.857   13.527  38.845  1.00 54.52  ? 111  LEU B CB  1 
ATOM   5192  C CG  . LEU B  1 111 ? 8.900   13.677  40.352  1.00 55.83  ? 111  LEU B CG  1 
ATOM   5193  C CD1 . LEU B  1 111 ? 7.529   13.708  40.933  1.00 54.27  ? 111  LEU B CD1 1 
ATOM   5194  C CD2 . LEU B  1 111 ? 9.713   12.587  40.981  1.00 57.54  ? 111  LEU B CD2 1 
ATOM   5195  N N   . LYS B  1 112 ? 10.773  14.021  35.690  1.00 57.52  ? 112  LYS B N   1 
ATOM   5196  C CA  . LYS B  1 112 ? 10.717  13.775  34.239  1.00 57.03  ? 112  LYS B CA  1 
ATOM   5197  C C   . LYS B  1 112 ? 10.963  12.309  33.834  1.00 60.31  ? 112  LYS B C   1 
ATOM   5198  O O   . LYS B  1 112 ? 10.598  11.930  32.707  1.00 60.49  ? 112  LYS B O   1 
ATOM   5199  C CB  . LYS B  1 112 ? 11.677  14.711  33.469  1.00 59.85  ? 112  LYS B CB  1 
ATOM   5200  C CG  . LYS B  1 112 ? 11.221  15.014  32.037  1.00 75.12  ? 112  LYS B CG  1 
ATOM   5201  C CD  . LYS B  1 112 ? 12.358  15.300  31.054  1.00 84.64  ? 112  LYS B CD  1 
ATOM   5202  C CE  . LYS B  1 112 ? 11.827  15.277  29.634  1.00 103.83 ? 112  LYS B CE  1 
ATOM   5203  N NZ  . LYS B  1 112 ? 12.683  16.032  28.685  1.00 118.06 ? 112  LYS B NZ  1 
ATOM   5204  N N   . ASN B  1 113 ? 11.586  11.495  34.733  1.00 54.03  ? 113  ASN B N   1 
ATOM   5205  C CA  . ASN B  1 113 ? 11.866  10.113  34.406  1.00 52.52  ? 113  ASN B CA  1 
ATOM   5206  C C   . ASN B  1 113 ? 10.846  9.164   35.006  1.00 58.61  ? 113  ASN B C   1 
ATOM   5207  O O   . ASN B  1 113 ? 10.839  7.976   34.645  1.00 60.78  ? 113  ASN B O   1 
ATOM   5208  C CB  . ASN B  1 113 ? 13.290  9.746   34.771  1.00 48.72  ? 113  ASN B CB  1 
ATOM   5209  C CG  . ASN B  1 113 ? 14.275  9.736   33.618  1.00 63.55  ? 113  ASN B CG  1 
ATOM   5210  O OD1 . ASN B  1 113 ? 14.160  10.516  32.660  1.00 55.53  ? 113  ASN B OD1 1 
ATOM   5211  N ND2 . ASN B  1 113 ? 15.295  8.866   33.721  1.00 59.12  ? 113  ASN B ND2 1 
ATOM   5212  N N   . LEU B  1 114 ? 9.983   9.668   35.915  1.00 52.63  ? 114  LEU B N   1 
ATOM   5213  C CA  . LEU B  1 114 ? 8.953   8.844   36.552  1.00 52.04  ? 114  LEU B CA  1 
ATOM   5214  C C   . LEU B  1 114 ? 7.834   8.590   35.584  1.00 59.12  ? 114  LEU B C   1 
ATOM   5215  O O   . LEU B  1 114 ? 6.968   9.450   35.360  1.00 61.13  ? 114  LEU B O   1 
ATOM   5216  C CB  . LEU B  1 114 ? 8.415   9.466   37.834  1.00 51.94  ? 114  LEU B CB  1 
ATOM   5217  C CG  . LEU B  1 114 ? 7.364   8.678   38.581  1.00 55.39  ? 114  LEU B CG  1 
ATOM   5218  C CD1 . LEU B  1 114 ? 7.963   7.389   39.223  1.00 53.64  ? 114  LEU B CD1 1 
ATOM   5219  C CD2 . LEU B  1 114 ? 6.698   9.567   39.592  1.00 58.93  ? 114  LEU B CD2 1 
ATOM   5220  N N   . THR B  1 115 ? 7.862   7.384   35.014  1.00 54.70  ? 115  THR B N   1 
ATOM   5221  C CA  . THR B  1 115 ? 6.929   6.914   34.007  1.00 54.13  ? 115  THR B CA  1 
ATOM   5222  C C   . THR B  1 115 ? 6.196   5.704   34.496  1.00 59.33  ? 115  THR B C   1 
ATOM   5223  O O   . THR B  1 115 ? 5.233   5.288   33.846  1.00 61.41  ? 115  THR B O   1 
ATOM   5224  C CB  . THR B  1 115 ? 7.656   6.663   32.665  1.00 55.86  ? 115  THR B CB  1 
ATOM   5225  O OG1 . THR B  1 115 ? 8.716   5.739   32.873  1.00 58.01  ? 115  THR B OG1 1 
ATOM   5226  C CG2 . THR B  1 115 ? 8.230   7.934   32.062  1.00 50.72  ? 115  THR B CG2 1 
ATOM   5227  N N   . GLU B  1 116 ? 6.614   5.142   35.653  1.00 54.33  ? 116  GLU B N   1 
ATOM   5228  C CA  . GLU B  1 116 ? 5.987   3.935   36.178  1.00 52.62  ? 116  GLU B CA  1 
ATOM   5229  C C   . GLU B  1 116 ? 5.672   3.934   37.650  1.00 54.86  ? 116  GLU B C   1 
ATOM   5230  O O   . GLU B  1 116 ? 6.596   4.037   38.461  1.00 56.10  ? 116  GLU B O   1 
ATOM   5231  C CB  . GLU B  1 116 ? 6.878   2.722   35.862  1.00 52.88  ? 116  GLU B CB  1 
ATOM   5232  C CG  . GLU B  1 116 ? 6.173   1.383   36.011  1.00 60.76  ? 116  GLU B CG  1 
ATOM   5233  C CD  . GLU B  1 116 ? 5.255   1.024   34.863  1.00 73.65  ? 116  GLU B CD  1 
ATOM   5234  O OE1 . GLU B  1 116 ? 5.751   0.523   33.832  1.00 89.26  ? 116  GLU B OE1 1 
ATOM   5235  O OE2 . GLU B  1 116 ? 4.035   1.247   34.989  1.00 57.27  ? 116  GLU B OE2 1 
ATOM   5236  N N   . ILE B  1 117 ? 4.395   3.708   37.992  1.00 48.54  ? 117  ILE B N   1 
ATOM   5237  C CA  . ILE B  1 117 ? 3.892   3.452   39.356  1.00 48.34  ? 117  ILE B CA  1 
ATOM   5238  C C   . ILE B  1 117 ? 3.105   2.146   39.182  1.00 56.16  ? 117  ILE B C   1 
ATOM   5239  O O   . ILE B  1 117 ? 2.078   2.143   38.478  1.00 57.79  ? 117  ILE B O   1 
ATOM   5240  C CB  . ILE B  1 117 ? 3.058   4.614   40.011  1.00 50.87  ? 117  ILE B CB  1 
ATOM   5241  C CG1 . ILE B  1 117 ? 3.975   5.654   40.677  1.00 49.78  ? 117  ILE B CG1 1 
ATOM   5242  C CG2 . ILE B  1 117 ? 2.048   4.095   41.030  1.00 50.03  ? 117  ILE B CG2 1 
ATOM   5243  C CD1 . ILE B  1 117 ? 3.480   7.060   40.574  1.00 38.09  ? 117  ILE B CD1 1 
ATOM   5244  N N   . LEU B  1 118 ? 3.618   1.028   39.753  1.00 51.95  ? 118  LEU B N   1 
ATOM   5245  C CA  . LEU B  1 118 ? 3.047   -0.321  39.571  1.00 51.30  ? 118  LEU B CA  1 
ATOM   5246  C C   . LEU B  1 118 ? 1.784   -0.606  40.324  1.00 58.68  ? 118  LEU B C   1 
ATOM   5247  O O   . LEU B  1 118 ? 0.853   -1.223  39.806  1.00 59.64  ? 118  LEU B O   1 
ATOM   5248  C CB  . LEU B  1 118 ? 4.091   -1.396  39.879  1.00 50.10  ? 118  LEU B CB  1 
ATOM   5249  C CG  . LEU B  1 118 ? 5.196   -1.573  38.854  1.00 53.66  ? 118  LEU B CG  1 
ATOM   5250  C CD1 . LEU B  1 118 ? 6.051   -2.712  39.218  1.00 52.76  ? 118  LEU B CD1 1 
ATOM   5251  C CD2 . LEU B  1 118 ? 4.624   -1.790  37.480  1.00 55.97  ? 118  LEU B CD2 1 
ATOM   5252  N N   . ASN B  1 119 ? 1.759   -0.171  41.564  1.00 56.28  ? 119  ASN B N   1 
ATOM   5253  C CA  . ASN B  1 119 ? 0.629   -0.380  42.446  1.00 55.69  ? 119  ASN B CA  1 
ATOM   5254  C C   . ASN B  1 119 ? 0.457   0.870   43.322  1.00 59.32  ? 119  ASN B C   1 
ATOM   5255  O O   . ASN B  1 119 ? 1.443   1.488   43.737  1.00 59.02  ? 119  ASN B O   1 
ATOM   5256  C CB  . ASN B  1 119 ? 0.886   -1.651  43.277  1.00 49.92  ? 119  ASN B CB  1 
ATOM   5257  C CG  . ASN B  1 119 ? -0.203  -2.012  44.240  1.00 77.40  ? 119  ASN B CG  1 
ATOM   5258  O OD1 . ASN B  1 119 ? 0.019   -1.970  45.450  1.00 66.17  ? 119  ASN B OD1 1 
ATOM   5259  N ND2 . ASN B  1 119 ? -1.393  -2.415  43.728  1.00 75.29  ? 119  ASN B ND2 1 
ATOM   5260  N N   . GLY B  1 120 ? -0.784  1.234   43.580  1.00 55.53  ? 120  GLY B N   1 
ATOM   5261  C CA  . GLY B  1 120 ? -1.088  2.373   44.435  1.00 56.22  ? 120  GLY B CA  1 
ATOM   5262  C C   . GLY B  1 120 ? -1.453  3.601   43.646  1.00 62.14  ? 120  GLY B C   1 
ATOM   5263  O O   . GLY B  1 120 ? -1.354  3.575   42.414  1.00 65.84  ? 120  GLY B O   1 
ATOM   5264  N N   . GLY B  1 121 ? -1.884  4.649   44.351  1.00 54.92  ? 121  GLY B N   1 
ATOM   5265  C CA  . GLY B  1 121 ? -2.309  5.901   43.740  1.00 54.89  ? 121  GLY B CA  1 
ATOM   5266  C C   . GLY B  1 121 ? -1.379  7.063   43.986  1.00 58.57  ? 121  GLY B C   1 
ATOM   5267  O O   . GLY B  1 121 ? -0.318  6.896   44.587  1.00 58.63  ? 121  GLY B O   1 
ATOM   5268  N N   . VAL B  1 122 ? -1.797  8.256   43.534  1.00 54.47  ? 122  VAL B N   1 
ATOM   5269  C CA  . VAL B  1 122 ? -1.055  9.512   43.639  1.00 53.65  ? 122  VAL B CA  1 
ATOM   5270  C C   . VAL B  1 122 ? -1.866  10.536  44.441  1.00 60.07  ? 122  VAL B C   1 
ATOM   5271  O O   . VAL B  1 122 ? -3.007  10.835  44.084  1.00 60.71  ? 122  VAL B O   1 
ATOM   5272  C CB  . VAL B  1 122 ? -0.703  10.058  42.224  1.00 56.45  ? 122  VAL B CB  1 
ATOM   5273  C CG1 . VAL B  1 122 ? -0.016  11.418  42.296  1.00 56.10  ? 122  VAL B CG1 1 
ATOM   5274  C CG2 . VAL B  1 122 ? 0.148   9.067   41.443  1.00 55.25  ? 122  VAL B CG2 1 
ATOM   5275  N N   . TYR B  1 123 ? -1.262  11.100  45.488  1.00 57.69  ? 123  TYR B N   1 
ATOM   5276  C CA  . TYR B  1 123 ? -1.871  12.154  46.294  1.00 58.50  ? 123  TYR B CA  1 
ATOM   5277  C C   . TYR B  1 123 ? -0.946  13.365  46.312  1.00 64.23  ? 123  TYR B C   1 
ATOM   5278  O O   . TYR B  1 123 ? 0.055   13.389  47.049  1.00 64.63  ? 123  TYR B O   1 
ATOM   5279  C CB  . TYR B  1 123 ? -2.199  11.662  47.712  1.00 59.82  ? 123  TYR B CB  1 
ATOM   5280  C CG  . TYR B  1 123 ? -2.714  12.736  48.649  1.00 63.49  ? 123  TYR B CG  1 
ATOM   5281  C CD1 . TYR B  1 123 ? -4.034  13.184  48.576  1.00 65.97  ? 123  TYR B CD1 1 
ATOM   5282  C CD2 . TYR B  1 123 ? -1.895  13.282  49.632  1.00 64.90  ? 123  TYR B CD2 1 
ATOM   5283  C CE1 . TYR B  1 123 ? -4.505  14.187  49.426  1.00 67.96  ? 123  TYR B CE1 1 
ATOM   5284  C CE2 . TYR B  1 123 ? -2.359  14.281  50.490  1.00 67.03  ? 123  TYR B CE2 1 
ATOM   5285  C CZ  . TYR B  1 123 ? -3.660  14.738  50.380  1.00 75.25  ? 123  TYR B CZ  1 
ATOM   5286  O OH  . TYR B  1 123 ? -4.090  15.749  51.218  1.00 78.75  ? 123  TYR B OH  1 
ATOM   5287  N N   . VAL B  1 124 ? -1.245  14.346  45.445  1.00 60.46  ? 124  VAL B N   1 
ATOM   5288  C CA  . VAL B  1 124 ? -0.481  15.588  45.351  1.00 59.47  ? 124  VAL B CA  1 
ATOM   5289  C C   . VAL B  1 124 ? -1.471  16.657  45.670  1.00 67.31  ? 124  VAL B C   1 
ATOM   5290  O O   . VAL B  1 124 ? -2.356  16.887  44.870  1.00 67.87  ? 124  VAL B O   1 
ATOM   5291  C CB  . VAL B  1 124 ? 0.230   15.776  43.991  1.00 61.11  ? 124  VAL B CB  1 
ATOM   5292  C CG1 . VAL B  1 124 ? 1.007   17.086  43.955  1.00 61.43  ? 124  VAL B CG1 1 
ATOM   5293  C CG2 . VAL B  1 124 ? 1.173   14.611  43.703  1.00 59.19  ? 124  VAL B CG2 1 
ATOM   5294  N N   . ASP B  1 125 ? -1.401  17.237  46.877  1.00 67.70  ? 125  ASP B N   1 
ATOM   5295  C CA  . ASP B  1 125 ? -2.366  18.249  47.334  1.00 70.73  ? 125  ASP B CA  1 
ATOM   5296  C C   . ASP B  1 125 ? -1.737  19.209  48.347  1.00 73.25  ? 125  ASP B C   1 
ATOM   5297  O O   . ASP B  1 125 ? -0.685  18.896  48.909  1.00 72.49  ? 125  ASP B O   1 
ATOM   5298  C CB  . ASP B  1 125 ? -3.581  17.517  47.981  1.00 74.90  ? 125  ASP B CB  1 
ATOM   5299  C CG  . ASP B  1 125 ? -4.747  18.360  48.507  1.00 100.01 ? 125  ASP B CG  1 
ATOM   5300  O OD1 . ASP B  1 125 ? -4.993  19.453  47.950  1.00 103.96 ? 125  ASP B OD1 1 
ATOM   5301  O OD2 . ASP B  1 125 ? -5.417  17.917  49.478  1.00 109.66 ? 125  ASP B OD2 1 
ATOM   5302  N N   . GLN B  1 126 ? -2.397  20.367  48.600  1.00 67.88  ? 126  GLN B N   1 
ATOM   5303  C CA  . GLN B  1 126 ? -1.994  21.339  49.619  1.00 66.96  ? 126  GLN B CA  1 
ATOM   5304  C C   . GLN B  1 126 ? -0.542  21.813  49.468  1.00 67.93  ? 126  GLN B C   1 
ATOM   5305  O O   . GLN B  1 126 ? 0.162   21.903  50.470  1.00 66.85  ? 126  GLN B O   1 
ATOM   5306  C CB  . GLN B  1 126 ? -2.191  20.744  51.041  1.00 68.08  ? 126  GLN B CB  1 
ATOM   5307  C CG  . GLN B  1 126 ? -3.571  20.181  51.368  1.00 72.53  ? 126  GLN B CG  1 
ATOM   5308  C CD  . GLN B  1 126 ? -4.548  21.238  51.840  1.00 103.61 ? 126  GLN B CD  1 
ATOM   5309  O OE1 . GLN B  1 126 ? -5.769  21.004  51.874  1.00 109.09 ? 126  GLN B OE1 1 
ATOM   5310  N NE2 . GLN B  1 126 ? -4.051  22.429  52.218  1.00 88.05  ? 126  GLN B NE2 1 
ATOM   5311  N N   . ASN B  1 127 ? -0.069  22.056  48.243  1.00 62.85  ? 127  ASN B N   1 
ATOM   5312  C CA  . ASN B  1 127 ? 1.284   22.568  48.008  1.00 61.11  ? 127  ASN B CA  1 
ATOM   5313  C C   . ASN B  1 127 ? 1.087   23.940  47.383  1.00 66.83  ? 127  ASN B C   1 
ATOM   5314  O O   . ASN B  1 127 ? 0.976   24.045  46.158  1.00 68.10  ? 127  ASN B O   1 
ATOM   5315  C CB  . ASN B  1 127 ? 2.077   21.646  47.093  1.00 54.22  ? 127  ASN B CB  1 
ATOM   5316  C CG  . ASN B  1 127 ? 2.221   20.248  47.614  1.00 71.72  ? 127  ASN B CG  1 
ATOM   5317  O OD1 . ASN B  1 127 ? 1.562   19.316  47.139  1.00 65.53  ? 127  ASN B OD1 1 
ATOM   5318  N ND2 . ASN B  1 127 ? 3.120   20.062  48.567  1.00 59.39  ? 127  ASN B ND2 1 
ATOM   5319  N N   . LYS B  1 128 ? 0.957   24.980  48.237  1.00 63.21  ? 128  LYS B N   1 
ATOM   5320  C CA  . LYS B  1 128 ? 0.689   26.396  47.892  1.00 64.06  ? 128  LYS B CA  1 
ATOM   5321  C C   . LYS B  1 128 ? 1.511   26.980  46.736  1.00 69.38  ? 128  LYS B C   1 
ATOM   5322  O O   . LYS B  1 128 ? 0.964   27.703  45.912  1.00 68.41  ? 128  LYS B O   1 
ATOM   5323  C CB  . LYS B  1 128 ? 0.827   27.281  49.138  1.00 66.44  ? 128  LYS B CB  1 
ATOM   5324  C CG  . LYS B  1 128 ? 0.034   28.566  49.101  1.00 76.73  ? 128  LYS B CG  1 
ATOM   5325  C CD  . LYS B  1 128 ? 0.294   29.396  50.361  1.00 89.82  ? 128  LYS B CD  1 
ATOM   5326  C CE  . LYS B  1 128 ? -0.875  30.266  50.770  1.00 103.35 ? 128  LYS B CE  1 
ATOM   5327  N NZ  . LYS B  1 128 ? -0.875  30.525  52.238  1.00 112.51 ? 128  LYS B NZ  1 
ATOM   5328  N N   . PHE B  1 129 ? 2.804   26.647  46.664  1.00 68.67  ? 129  PHE B N   1 
ATOM   5329  C CA  . PHE B  1 129 ? 3.722   27.198  45.672  1.00 69.95  ? 129  PHE B CA  1 
ATOM   5330  C C   . PHE B  1 129 ? 4.082   26.272  44.519  1.00 72.72  ? 129  PHE B C   1 
ATOM   5331  O O   . PHE B  1 129 ? 4.903   26.655  43.679  1.00 73.03  ? 129  PHE B O   1 
ATOM   5332  C CB  . PHE B  1 129 ? 4.985   27.732  46.378  1.00 72.85  ? 129  PHE B CB  1 
ATOM   5333  C CG  . PHE B  1 129 ? 4.670   28.684  47.510  1.00 77.10  ? 129  PHE B CG  1 
ATOM   5334  C CD1 . PHE B  1 129 ? 4.676   28.247  48.830  1.00 81.79  ? 129  PHE B CD1 1 
ATOM   5335  C CD2 . PHE B  1 129 ? 4.330   30.009  47.253  1.00 81.38  ? 129  PHE B CD2 1 
ATOM   5336  C CE1 . PHE B  1 129 ? 4.355   29.123  49.873  1.00 84.83  ? 129  PHE B CE1 1 
ATOM   5337  C CE2 . PHE B  1 129 ? 4.020   30.884  48.294  1.00 86.34  ? 129  PHE B CE2 1 
ATOM   5338  C CZ  . PHE B  1 129 ? 4.029   30.436  49.596  1.00 85.14  ? 129  PHE B CZ  1 
ATOM   5339  N N   . LEU B  1 130 ? 3.468   25.072  44.461  1.00 67.63  ? 130  LEU B N   1 
ATOM   5340  C CA  . LEU B  1 130 ? 3.751   24.073  43.423  1.00 66.16  ? 130  LEU B CA  1 
ATOM   5341  C C   . LEU B  1 130 ? 3.105   24.344  42.072  1.00 77.19  ? 130  LEU B C   1 
ATOM   5342  O O   . LEU B  1 130 ? 1.870   24.388  41.984  1.00 76.99  ? 130  LEU B O   1 
ATOM   5343  C CB  . LEU B  1 130 ? 3.435   22.650  43.909  1.00 63.09  ? 130  LEU B CB  1 
ATOM   5344  C CG  . LEU B  1 130 ? 3.676   21.518  42.928  1.00 63.45  ? 130  LEU B CG  1 
ATOM   5345  C CD1 . LEU B  1 130 ? 5.079   21.522  42.406  1.00 62.53  ? 130  LEU B CD1 1 
ATOM   5346  C CD2 . LEU B  1 130 ? 3.403   20.206  43.578  1.00 63.25  ? 130  LEU B CD2 1 
ATOM   5347  N N   . CYS B  1 131 ? 3.946   24.465  41.013  1.00 78.41  ? 131  CYS B N   1 
ATOM   5348  C CA  . CYS B  1 131 ? 3.462   24.698  39.660  1.00 81.96  ? 131  CYS B CA  1 
ATOM   5349  C C   . CYS B  1 131 ? 3.672   23.482  38.766  1.00 81.91  ? 131  CYS B C   1 
ATOM   5350  O O   . CYS B  1 131 ? 4.469   22.602  39.088  1.00 80.86  ? 131  CYS B O   1 
ATOM   5351  C CB  . CYS B  1 131 ? 4.109   25.941  39.056  1.00 86.67  ? 131  CYS B CB  1 
ATOM   5352  S SG  . CYS B  1 131 ? 3.582   27.520  39.788  1.00 94.67  ? 131  CYS B SG  1 
ATOM   5353  N N   . TYR B  1 132 ? 2.963   23.447  37.624  1.00 76.80  ? 132  TYR B N   1 
ATOM   5354  C CA  . TYR B  1 132 ? 3.066   22.438  36.564  1.00 75.30  ? 132  TYR B CA  1 
ATOM   5355  C C   . TYR B  1 132 ? 2.572   21.035  36.871  1.00 78.83  ? 132  TYR B C   1 
ATOM   5356  O O   . TYR B  1 132 ? 2.090   20.370  35.956  1.00 78.86  ? 132  TYR B O   1 
ATOM   5357  C CB  . TYR B  1 132 ? 4.465   22.402  35.932  1.00 75.82  ? 132  TYR B CB  1 
ATOM   5358  C CG  . TYR B  1 132 ? 5.007   23.767  35.578  1.00 78.10  ? 132  TYR B CG  1 
ATOM   5359  C CD1 . TYR B  1 132 ? 5.938   24.402  36.394  1.00 79.37  ? 132  TYR B CD1 1 
ATOM   5360  C CD2 . TYR B  1 132 ? 4.538   24.454  34.467  1.00 80.58  ? 132  TYR B CD2 1 
ATOM   5361  C CE1 . TYR B  1 132 ? 6.409   25.678  36.099  1.00 81.06  ? 132  TYR B CE1 1 
ATOM   5362  C CE2 . TYR B  1 132 ? 5.007   25.728  34.156  1.00 83.48  ? 132  TYR B CE2 1 
ATOM   5363  C CZ  . TYR B  1 132 ? 5.948   26.338  34.970  1.00 92.03  ? 132  TYR B CZ  1 
ATOM   5364  O OH  . TYR B  1 132 ? 6.389   27.608  34.649  1.00 95.28  ? 132  TYR B OH  1 
ATOM   5365  N N   . ALA B  1 133 ? 2.681   20.573  38.132  1.00 74.27  ? 133  ALA B N   1 
ATOM   5366  C CA  . ALA B  1 133 ? 2.237   19.232  38.531  1.00 72.36  ? 133  ALA B CA  1 
ATOM   5367  C C   . ALA B  1 133 ? 0.750   18.968  38.235  1.00 76.73  ? 133  ALA B C   1 
ATOM   5368  O O   . ALA B  1 133 ? 0.350   17.814  38.060  1.00 76.87  ? 133  ALA B O   1 
ATOM   5369  C CB  . ALA B  1 133 ? 2.543   18.989  39.987  1.00 72.36  ? 133  ALA B CB  1 
ATOM   5370  N N   . ASP B  1 134 ? -0.047  20.037  38.127  1.00 72.78  ? 134  ASP B N   1 
ATOM   5371  C CA  . ASP B  1 134 ? -1.463  19.961  37.773  1.00 73.10  ? 134  ASP B CA  1 
ATOM   5372  C C   . ASP B  1 134 ? -1.636  19.525  36.313  1.00 76.42  ? 134  ASP B C   1 
ATOM   5373  O O   . ASP B  1 134 ? -2.664  18.935  35.965  1.00 78.17  ? 134  ASP B O   1 
ATOM   5374  C CB  . ASP B  1 134 ? -2.147  21.318  38.016  1.00 76.65  ? 134  ASP B CB  1 
ATOM   5375  C CG  . ASP B  1 134 ? -1.414  22.536  37.468  1.00 92.37  ? 134  ASP B CG  1 
ATOM   5376  O OD1 . ASP B  1 134 ? -0.191  22.680  37.748  1.00 95.24  ? 134  ASP B OD1 1 
ATOM   5377  O OD2 . ASP B  1 134 ? -2.074  23.384  36.844  1.00 96.40  ? 134  ASP B OD2 1 
ATOM   5378  N N   . THR B  1 135 ? -0.611  19.783  35.469  1.00 68.95  ? 135  THR B N   1 
ATOM   5379  C CA  . THR B  1 135 ? -0.680  19.465  34.048  1.00 66.95  ? 135  THR B CA  1 
ATOM   5380  C C   . THR B  1 135 ? -0.467  17.994  33.765  1.00 69.91  ? 135  THR B C   1 
ATOM   5381  O O   . THR B  1 135 ? -0.911  17.512  32.723  1.00 71.53  ? 135  THR B O   1 
ATOM   5382  C CB  . THR B  1 135 ? 0.269   20.333  33.225  1.00 61.13  ? 135  THR B CB  1 
ATOM   5383  O OG1 . THR B  1 135 ? 1.530   19.698  33.144  1.00 58.57  ? 135  THR B OG1 1 
ATOM   5384  C CG2 . THR B  1 135 ? 0.430   21.723  33.774  1.00 53.80  ? 135  THR B CG2 1 
ATOM   5385  N N   . ILE B  1 136 ? 0.218   17.289  34.677  1.00 62.96  ? 136  ILE B N   1 
ATOM   5386  C CA  . ILE B  1 136 ? 0.585   15.876  34.562  1.00 60.38  ? 136  ILE B CA  1 
ATOM   5387  C C   . ILE B  1 136 ? -0.578  14.894  34.392  1.00 64.46  ? 136  ILE B C   1 
ATOM   5388  O O   . ILE B  1 136 ? -1.582  14.949  35.117  1.00 66.87  ? 136  ILE B O   1 
ATOM   5389  C CB  . ILE B  1 136 ? 1.548   15.497  35.711  1.00 62.19  ? 136  ILE B CB  1 
ATOM   5390  C CG1 . ILE B  1 136 ? 2.829   16.360  35.687  1.00 62.89  ? 136  ILE B CG1 1 
ATOM   5391  C CG2 . ILE B  1 136 ? 1.885   14.006  35.744  1.00 62.82  ? 136  ILE B CG2 1 
ATOM   5392  C CD1 . ILE B  1 136 ? 3.647   16.384  34.355  1.00 67.52  ? 136  ILE B CD1 1 
ATOM   5393  N N   . HIS B  1 137 ? -0.432  14.009  33.417  1.00 58.23  ? 137  HIS B N   1 
ATOM   5394  C CA  . HIS B  1 137 ? -1.377  12.949  33.123  1.00 57.76  ? 137  HIS B CA  1 
ATOM   5395  C C   . HIS B  1 137 ? -0.923  11.751  33.931  1.00 60.51  ? 137  HIS B C   1 
ATOM   5396  O O   . HIS B  1 137 ? -0.145  10.918  33.439  1.00 59.48  ? 137  HIS B O   1 
ATOM   5397  C CB  . HIS B  1 137 ? -1.357  12.632  31.621  1.00 59.21  ? 137  HIS B CB  1 
ATOM   5398  C CG  . HIS B  1 137 ? -2.422  11.686  31.196  1.00 63.21  ? 137  HIS B CG  1 
ATOM   5399  N ND1 . HIS B  1 137 ? -3.748  11.991  31.355  1.00 66.33  ? 137  HIS B ND1 1 
ATOM   5400  C CD2 . HIS B  1 137 ? -2.322  10.475  30.614  1.00 64.49  ? 137  HIS B CD2 1 
ATOM   5401  C CE1 . HIS B  1 137 ? -4.413  10.952  30.889  1.00 65.51  ? 137  HIS B CE1 1 
ATOM   5402  N NE2 . HIS B  1 137 ? -3.599  10.021  30.433  1.00 64.87  ? 137  HIS B NE2 1 
ATOM   5403  N N   . TRP B  1 138 ? -1.352  11.699  35.200  1.00 57.41  ? 138  TRP B N   1 
ATOM   5404  C CA  . TRP B  1 138 ? -0.964  10.630  36.131  1.00 56.34  ? 138  TRP B CA  1 
ATOM   5405  C C   . TRP B  1 138 ? -1.444  9.269   35.681  1.00 61.01  ? 138  TRP B C   1 
ATOM   5406  O O   . TRP B  1 138 ? -0.790  8.276   35.990  1.00 58.94  ? 138  TRP B O   1 
ATOM   5407  C CB  . TRP B  1 138 ? -1.436  10.934  37.558  1.00 54.88  ? 138  TRP B CB  1 
ATOM   5408  C CG  . TRP B  1 138 ? -0.803  12.160  38.135  1.00 55.91  ? 138  TRP B CG  1 
ATOM   5409  C CD1 . TRP B  1 138 ? -1.333  13.410  38.162  1.00 59.78  ? 138  TRP B CD1 1 
ATOM   5410  C CD2 . TRP B  1 138 ? 0.521   12.276  38.669  1.00 54.88  ? 138  TRP B CD2 1 
ATOM   5411  N NE1 . TRP B  1 138 ? -0.425  14.296  38.688  1.00 58.73  ? 138  TRP B NE1 1 
ATOM   5412  C CE2 . TRP B  1 138 ? 0.707   13.625  39.035  1.00 58.39  ? 138  TRP B CE2 1 
ATOM   5413  C CE3 . TRP B  1 138 ? 1.569   11.367  38.875  1.00 55.55  ? 138  TRP B CE3 1 
ATOM   5414  C CZ2 . TRP B  1 138 ? 1.891   14.094  39.589  1.00 57.37  ? 138  TRP B CZ2 1 
ATOM   5415  C CZ3 . TRP B  1 138 ? 2.754   11.835  39.416  1.00 57.22  ? 138  TRP B CZ3 1 
ATOM   5416  C CH2 . TRP B  1 138 ? 2.906   13.186  39.766  1.00 58.47  ? 138  TRP B CH2 1 
ATOM   5417  N N   . GLN B  1 139 ? -2.582  9.232   34.920  1.00 59.53  ? 139  GLN B N   1 
ATOM   5418  C CA  . GLN B  1 139 ? -3.184  8.021   34.369  1.00 58.86  ? 139  GLN B CA  1 
ATOM   5419  C C   . GLN B  1 139 ? -2.170  7.296   33.500  1.00 62.39  ? 139  GLN B C   1 
ATOM   5420  O O   . GLN B  1 139 ? -2.170  6.073   33.469  1.00 64.45  ? 139  GLN B O   1 
ATOM   5421  C CB  . GLN B  1 139 ? -4.458  8.341   33.590  1.00 61.47  ? 139  GLN B CB  1 
ATOM   5422  C CG  . GLN B  1 139 ? -5.678  8.522   34.492  1.00 92.69  ? 139  GLN B CG  1 
ATOM   5423  C CD  . GLN B  1 139 ? -6.819  9.338   33.900  1.00 125.03 ? 139  GLN B CD  1 
ATOM   5424  O OE1 . GLN B  1 139 ? -6.739  9.923   32.809  1.00 122.39 ? 139  GLN B OE1 1 
ATOM   5425  N NE2 . GLN B  1 139 ? -7.916  9.425   34.639  1.00 121.94 ? 139  GLN B NE2 1 
ATOM   5426  N N   . ASP B  1 140 ? -1.249  8.027   32.878  1.00 56.27  ? 140  ASP B N   1 
ATOM   5427  C CA  . ASP B  1 140 ? -0.231  7.398   32.056  1.00 55.48  ? 140  ASP B CA  1 
ATOM   5428  C C   . ASP B  1 140 ? 0.824   6.706   32.894  1.00 60.08  ? 140  ASP B C   1 
ATOM   5429  O O   . ASP B  1 140 ? 1.267   5.632   32.499  1.00 61.96  ? 140  ASP B O   1 
ATOM   5430  C CB  . ASP B  1 140 ? 0.398   8.387   31.058  1.00 57.43  ? 140  ASP B CB  1 
ATOM   5431  C CG  . ASP B  1 140 ? 1.110   7.706   29.913  1.00 65.19  ? 140  ASP B CG  1 
ATOM   5432  O OD1 . ASP B  1 140 ? 2.223   7.216   30.124  1.00 70.41  ? 140  ASP B OD1 1 
ATOM   5433  O OD2 . ASP B  1 140 ? 0.541   7.641   28.811  1.00 63.62  ? 140  ASP B OD2 1 
ATOM   5434  N N   . ILE B  1 141 ? 1.216   7.296   34.046  1.00 55.25  ? 141  ILE B N   1 
ATOM   5435  C CA  . ILE B  1 141 ? 2.255   6.791   34.969  1.00 53.20  ? 141  ILE B CA  1 
ATOM   5436  C C   . ILE B  1 141 ? 1.764   5.573   35.735  1.00 60.12  ? 141  ILE B C   1 
ATOM   5437  O O   . ILE B  1 141 ? 2.499   4.593   35.868  1.00 58.61  ? 141  ILE B O   1 
ATOM   5438  C CB  . ILE B  1 141 ? 2.753   7.924   35.915  1.00 55.55  ? 141  ILE B CB  1 
ATOM   5439  C CG1 . ILE B  1 141 ? 3.544   9.005   35.147  1.00 55.91  ? 141  ILE B CG1 1 
ATOM   5440  C CG2 . ILE B  1 141 ? 3.582   7.387   37.063  1.00 55.91  ? 141  ILE B CG2 1 
ATOM   5441  C CD1 . ILE B  1 141 ? 3.132   10.395  35.477  1.00 59.79  ? 141  ILE B CD1 1 
ATOM   5442  N N   . VAL B  1 142 ? 0.523   5.639   36.253  1.00 61.45  ? 142  VAL B N   1 
ATOM   5443  C CA  . VAL B  1 142 ? -0.063  4.536   37.015  1.00 62.51  ? 142  VAL B CA  1 
ATOM   5444  C C   . VAL B  1 142 ? -0.467  3.429   36.066  1.00 75.68  ? 142  VAL B C   1 
ATOM   5445  O O   . VAL B  1 142 ? -1.082  3.712   35.036  1.00 76.16  ? 142  VAL B O   1 
ATOM   5446  C CB  . VAL B  1 142 ? -1.209  4.939   37.976  1.00 63.90  ? 142  VAL B CB  1 
ATOM   5447  C CG1 . VAL B  1 142 ? -1.465  3.837   39.000  1.00 62.68  ? 142  VAL B CG1 1 
ATOM   5448  C CG2 . VAL B  1 142 ? -0.877  6.227   38.700  1.00 63.52  ? 142  VAL B CG2 1 
ATOM   5449  N N   . ARG B  1 143 ? -0.092  2.173   36.398  1.00 77.72  ? 143  ARG B N   1 
ATOM   5450  C CA  . ARG B  1 143 ? -0.439  1.019   35.566  1.00 80.14  ? 143  ARG B CA  1 
ATOM   5451  C C   . ARG B  1 143 ? -1.724  0.311   36.044  1.00 90.59  ? 143  ARG B C   1 
ATOM   5452  O O   . ARG B  1 143 ? -2.515  -0.174  35.212  1.00 89.79  ? 143  ARG B O   1 
ATOM   5453  C CB  . ARG B  1 143 ? 0.736   0.011   35.440  1.00 78.10  ? 143  ARG B CB  1 
ATOM   5454  C CG  . ARG B  1 143 ? 0.580   -0.780  34.145  1.00 85.62  ? 143  ARG B CG  1 
ATOM   5455  C CD  . ARG B  1 143 ? 1.553   -1.915  33.960  1.00 79.79  ? 143  ARG B CD  1 
ATOM   5456  N NE  . ARG B  1 143 ? 2.836   -1.424  33.452  1.00 81.24  ? 143  ARG B NE  1 
ATOM   5457  C CZ  . ARG B  1 143 ? 3.526   -1.966  32.446  1.00 91.10  ? 143  ARG B CZ  1 
ATOM   5458  N NH1 . ARG B  1 143 ? 3.054   -3.025  31.800  1.00 71.07  ? 143  ARG B NH1 1 
ATOM   5459  N NH2 . ARG B  1 143 ? 4.701   -1.459  32.088  1.00 78.23  ? 143  ARG B NH2 1 
ATOM   5460  N N   . ASN B  1 144 ? -1.911  0.233   37.388  1.00 92.32  ? 144  ASN B N   1 
ATOM   5461  C CA  . ASN B  1 144 ? -3.003  -0.536  37.986  1.00 95.36  ? 144  ASN B CA  1 
ATOM   5462  C C   . ASN B  1 144 ? -4.153  0.195   38.704  1.00 105.51 ? 144  ASN B C   1 
ATOM   5463  O O   . ASN B  1 144 ? -3.961  0.713   39.819  1.00 104.71 ? 144  ASN B O   1 
ATOM   5464  C CB  . ASN B  1 144 ? -2.458  -1.736  38.795  1.00 98.58  ? 144  ASN B CB  1 
ATOM   5465  C CG  . ASN B  1 144 ? -1.931  -2.878  37.932  1.00 128.36 ? 144  ASN B CG  1 
ATOM   5466  O OD1 . ASN B  1 144 ? -2.688  -3.770  37.516  1.00 123.79 ? 144  ASN B OD1 1 
ATOM   5467  N ND2 . ASN B  1 144 ? -0.621  -2.882  37.634  1.00 117.72 ? 144  ASN B ND2 1 
ATOM   5468  N N   . PRO B  1 145 ? -5.382  0.125   38.095  1.00 107.62 ? 145  PRO B N   1 
ATOM   5469  C CA  . PRO B  1 145 ? -6.576  0.783   38.680  1.00 114.03 ? 145  PRO B CA  1 
ATOM   5470  C C   . PRO B  1 145 ? -7.467  -0.094  39.583  1.00 131.59 ? 145  PRO B C   1 
ATOM   5471  O O   . PRO B  1 145 ? -7.261  -1.296  39.775  1.00 94.86  ? 145  PRO B O   1 
ATOM   5472  C CB  . PRO B  1 145 ? -7.367  1.234   37.437  1.00 116.13 ? 145  PRO B CB  1 
ATOM   5473  C CG  . PRO B  1 145 ? -6.613  0.663   36.216  1.00 118.80 ? 145  PRO B CG  1 
ATOM   5474  C CD  . PRO B  1 145 ? -5.718  -0.418  36.765  1.00 112.16 ? 145  PRO B CD  1 
ATOM   5475  N N   . SER B  1 148 ? -7.126  1.860   41.926  1.00 119.88 ? 148  SER B N   1 
ATOM   5476  C CA  . SER B  1 148 ? -6.552  3.105   42.446  1.00 119.29 ? 148  SER B CA  1 
ATOM   5477  C C   . SER B  1 148 ? -7.481  4.337   42.237  1.00 125.48 ? 148  SER B C   1 
ATOM   5478  O O   . SER B  1 148 ? -7.055  5.338   41.651  1.00 125.23 ? 148  SER B O   1 
ATOM   5479  C CB  . SER B  1 148 ? -5.148  3.347   41.882  1.00 118.54 ? 148  SER B CB  1 
ATOM   5480  O OG  . SER B  1 148 ? -5.178  3.722   40.514  1.00 119.74 ? 148  SER B OG  1 
ATOM   5481  N N   . ASN B  1 149 ? -8.731  4.274   42.771  1.00 123.09 ? 149  ASN B N   1 
ATOM   5482  C CA  . ASN B  1 149 ? -9.759  5.334   42.684  1.00 124.43 ? 149  ASN B CA  1 
ATOM   5483  C C   . ASN B  1 149 ? -9.331  6.703   43.284  1.00 128.77 ? 149  ASN B C   1 
ATOM   5484  O O   . ASN B  1 149 ? -10.196 7.535   43.597  1.00 130.27 ? 149  ASN B O   1 
ATOM   5485  C CB  . ASN B  1 149 ? -11.102 4.852   43.301  1.00 124.99 ? 149  ASN B CB  1 
ATOM   5486  C CG  . ASN B  1 149 ? -12.195 4.513   42.306  1.00 130.00 ? 149  ASN B CG  1 
ATOM   5487  O OD1 . ASN B  1 149 ? -12.771 5.379   41.625  1.00 123.20 ? 149  ASN B OD1 1 
ATOM   5488  N ND2 . ASN B  1 149 ? -12.547 3.246   42.258  1.00 112.92 ? 149  ASN B ND2 1 
ATOM   5489  N N   . LEU B  1 150 ? -7.995  6.930   43.418  1.00 123.25 ? 150  LEU B N   1 
ATOM   5490  C CA  . LEU B  1 150 ? -7.348  8.126   43.984  1.00 122.95 ? 150  LEU B CA  1 
ATOM   5491  C C   . LEU B  1 150 ? -6.086  8.510   43.165  1.00 122.73 ? 150  LEU B C   1 
ATOM   5492  O O   . LEU B  1 150 ? -4.979  8.067   43.492  1.00 120.86 ? 150  LEU B O   1 
ATOM   5493  C CB  . LEU B  1 150 ? -6.965  7.879   45.471  1.00 123.31 ? 150  LEU B CB  1 
ATOM   5494  C CG  . LEU B  1 150 ? -8.068  7.407   46.443  1.00 129.56 ? 150  LEU B CG  1 
ATOM   5495  C CD1 . LEU B  1 150 ? -7.774  6.001   46.972  1.00 128.88 ? 150  LEU B CD1 1 
ATOM   5496  C CD2 . LEU B  1 150 ? -8.261  8.399   47.583  1.00 132.74 ? 150  LEU B CD2 1 
ATOM   5497  N N   . THR B  1 151 ? -6.263  9.327   42.097  1.00 117.60 ? 151  THR B N   1 
ATOM   5498  C CA  . THR B  1 151 ? -5.202  9.794   41.175  1.00 115.38 ? 151  THR B CA  1 
ATOM   5499  C C   . THR B  1 151 ? -5.520  11.266  40.786  1.00 120.70 ? 151  THR B C   1 
ATOM   5500  O O   . THR B  1 151 ? -6.007  11.519  39.677  1.00 121.12 ? 151  THR B O   1 
ATOM   5501  C CB  . THR B  1 151 ? -5.058  8.786   39.969  1.00 110.85 ? 151  THR B CB  1 
ATOM   5502  O OG1 . THR B  1 151 ? -4.522  7.558   40.431  1.00 105.02 ? 151  THR B OG1 1 
ATOM   5503  C CG2 . THR B  1 151 ? -4.154  9.257   38.879  1.00 106.34 ? 151  THR B CG2 1 
ATOM   5504  N N   . LEU B  1 152 ? -5.284  12.233  41.715  1.00 117.39 ? 152  LEU B N   1 
ATOM   5505  C CA  . LEU B  1 152 ? -5.588  13.653  41.469  1.00 117.94 ? 152  LEU B CA  1 
ATOM   5506  C C   . LEU B  1 152 ? -4.617  14.658  42.101  1.00 117.91 ? 152  LEU B C   1 
ATOM   5507  O O   . LEU B  1 152 ? -4.024  14.387  43.150  1.00 115.26 ? 152  LEU B O   1 
ATOM   5508  C CB  . LEU B  1 152 ? -7.053  13.992  41.866  1.00 119.86 ? 152  LEU B CB  1 
ATOM   5509  C CG  . LEU B  1 152 ? -8.193  13.554  40.900  1.00 125.70 ? 152  LEU B CG  1 
ATOM   5510  C CD1 . LEU B  1 152 ? -9.503  13.316  41.653  1.00 126.96 ? 152  LEU B CD1 1 
ATOM   5511  C CD2 . LEU B  1 152 ? -8.381  14.555  39.750  1.00 128.93 ? 152  LEU B CD2 1 
ATOM   5512  N N   . VAL B  1 153 ? -4.517  15.851  41.458  1.00 114.82 ? 153  VAL B N   1 
ATOM   5513  C CA  . VAL B  1 153 ? -3.688  17.004  41.852  1.00 114.58 ? 153  VAL B CA  1 
ATOM   5514  C C   . VAL B  1 153 ? -4.495  18.256  42.283  1.00 119.05 ? 153  VAL B C   1 
ATOM   5515  O O   . VAL B  1 153 ? -5.303  18.770  41.511  1.00 120.69 ? 153  VAL B O   1 
ATOM   5516  C CB  . VAL B  1 153 ? -2.581  17.327  40.814  1.00 117.70 ? 153  VAL B CB  1 
ATOM   5517  C CG1 . VAL B  1 153 ? -1.832  18.609  41.165  1.00 117.91 ? 153  VAL B CG1 1 
ATOM   5518  C CG2 . VAL B  1 153 ? -1.606  16.177  40.702  1.00 116.02 ? 153  VAL B CG2 1 
ATOM   5519  N N   . SER B  1 154 ? -4.221  18.741  43.516  1.00 114.02 ? 154  SER B N   1 
ATOM   5520  C CA  . SER B  1 154 ? -4.821  19.910  44.155  1.00 121.65 ? 154  SER B CA  1 
ATOM   5521  C C   . SER B  1 154 ? -3.749  20.627  44.999  1.00 132.67 ? 154  SER B C   1 
ATOM   5522  O O   . SER B  1 154 ? -3.815  21.836  45.225  1.00 86.57  ? 154  SER B O   1 
ATOM   5523  C CB  . SER B  1 154 ? -5.997  19.474  45.024  1.00 125.36 ? 154  SER B CB  1 
ATOM   5524  O OG  . SER B  1 154 ? -6.466  20.511  45.873  1.00 137.13 ? 154  SER B OG  1 
ATOM   5525  N N   . SER B  1 159 ? -2.156  28.285  41.812  1.00 108.87 ? 159  SER B N   1 
ATOM   5526  C CA  . SER B  1 159 ? -2.678  29.384  40.967  1.00 109.99 ? 159  SER B CA  1 
ATOM   5527  C C   . SER B  1 159 ? -1.612  30.459  40.711  1.00 114.13 ? 159  SER B C   1 
ATOM   5528  O O   . SER B  1 159 ? -0.677  30.588  41.517  1.00 114.85 ? 159  SER B O   1 
ATOM   5529  C CB  . SER B  1 159 ? -3.954  29.995  41.551  1.00 114.16 ? 159  SER B CB  1 
ATOM   5530  O OG  . SER B  1 159 ? -3.727  30.940  42.584  1.00 121.01 ? 159  SER B OG  1 
ATOM   5531  N N   . GLY B  1 160 ? -1.752  31.199  39.600  1.00 108.41 ? 160  GLY B N   1 
ATOM   5532  C CA  . GLY B  1 160 ? -0.771  32.197  39.174  1.00 107.20 ? 160  GLY B CA  1 
ATOM   5533  C C   . GLY B  1 160 ? 0.529   31.544  38.720  1.00 106.09 ? 160  GLY B C   1 
ATOM   5534  O O   . GLY B  1 160 ? 1.624   31.982  39.093  1.00 105.56 ? 160  GLY B O   1 
ATOM   5535  N N   . CYS B  1 161 ? 0.404   30.457  37.939  1.00 98.63  ? 161  CYS B N   1 
ATOM   5536  C CA  . CYS B  1 161 ? 1.521   29.674  37.435  1.00 96.04  ? 161  CYS B CA  1 
ATOM   5537  C C   . CYS B  1 161 ? 1.778   29.884  35.964  1.00 100.57 ? 161  CYS B C   1 
ATOM   5538  O O   . CYS B  1 161 ? 0.850   30.161  35.208  1.00 100.57 ? 161  CYS B O   1 
ATOM   5539  C CB  . CYS B  1 161 ? 1.327   28.199  37.761  1.00 94.05  ? 161  CYS B CB  1 
ATOM   5540  S SG  . CYS B  1 161 ? 1.563   27.799  39.516  1.00 96.64  ? 161  CYS B SG  1 
ATOM   5541  N N   . GLY B  1 162 ? 3.040   29.729  35.573  1.00 97.76  ? 162  GLY B N   1 
ATOM   5542  C CA  . GLY B  1 162 ? 3.479   29.860  34.189  1.00 97.81  ? 162  GLY B CA  1 
ATOM   5543  C C   . GLY B  1 162 ? 2.928   28.742  33.332  1.00 99.20  ? 162  GLY B C   1 
ATOM   5544  O O   . GLY B  1 162 ? 2.667   27.650  33.842  1.00 98.52  ? 162  GLY B O   1 
ATOM   5545  N N   . ARG B  1 163 ? 2.695   29.018  32.044  1.00 93.34  ? 163  ARG B N   1 
ATOM   5546  C CA  . ARG B  1 163 ? 2.169   28.008  31.133  1.00 90.75  ? 163  ARG B CA  1 
ATOM   5547  C C   . ARG B  1 163 ? 3.281   27.040  30.684  1.00 89.66  ? 163  ARG B C   1 
ATOM   5548  O O   . ARG B  1 163 ? 4.474   27.365  30.811  1.00 87.72  ? 163  ARG B O   1 
ATOM   5549  C CB  . ARG B  1 163 ? 1.489   28.665  29.934  1.00 91.17  ? 163  ARG B CB  1 
ATOM   5550  C CG  . ARG B  1 163 ? 0.075   29.124  30.201  1.00 104.08 ? 163  ARG B CG  1 
ATOM   5551  C CD  . ARG B  1 163 ? -0.431  29.951  29.023  1.00 121.93 ? 163  ARG B CD  1 
ATOM   5552  N NE  . ARG B  1 163 ? -1.763  30.526  29.256  1.00 132.89 ? 163  ARG B NE  1 
ATOM   5553  C CZ  . ARG B  1 163 ? -1.992  31.739  29.763  1.00 145.87 ? 163  ARG B CZ  1 
ATOM   5554  N NH1 . ARG B  1 163 ? -0.977  32.526  30.109  1.00 132.30 ? 163  ARG B NH1 1 
ATOM   5555  N NH2 . ARG B  1 163 ? -3.236  32.169  29.933  1.00 130.33 ? 163  ARG B NH2 1 
ATOM   5556  N N   . CYS B  1 164 ? 2.876   25.831  30.200  1.00 83.92  ? 164  CYS B N   1 
ATOM   5557  C CA  . CYS B  1 164 ? 3.785   24.808  29.675  1.00 82.04  ? 164  CYS B CA  1 
ATOM   5558  C C   . CYS B  1 164 ? 4.328   25.343  28.357  1.00 87.01  ? 164  CYS B C   1 
ATOM   5559  O O   . CYS B  1 164 ? 3.644   26.118  27.686  1.00 86.62  ? 164  CYS B O   1 
ATOM   5560  C CB  . CYS B  1 164 ? 3.059   23.479  29.448  1.00 81.12  ? 164  CYS B CB  1 
ATOM   5561  S SG  . CYS B  1 164 ? 3.026   22.348  30.876  1.00 83.33  ? 164  CYS B SG  1 
ATOM   5562  N N   . HIS B  1 165 ? 5.519   24.879  27.956  1.00 84.86  ? 165  HIS B N   1 
ATOM   5563  C CA  . HIS B  1 165 ? 6.126   25.221  26.672  1.00 86.45  ? 165  HIS B CA  1 
ATOM   5564  C C   . HIS B  1 165 ? 5.240   24.686  25.522  1.00 89.89  ? 165  HIS B C   1 
ATOM   5565  O O   . HIS B  1 165 ? 4.472   23.738  25.718  1.00 90.78  ? 165  HIS B O   1 
ATOM   5566  C CB  . HIS B  1 165 ? 7.525   24.612  26.602  1.00 88.03  ? 165  HIS B CB  1 
ATOM   5567  C CG  . HIS B  1 165 ? 8.336   25.094  25.453  1.00 93.70  ? 165  HIS B CG  1 
ATOM   5568  N ND1 . HIS B  1 165 ? 9.247   26.115  25.597  1.00 97.31  ? 165  HIS B ND1 1 
ATOM   5569  C CD2 . HIS B  1 165 ? 8.355   24.666  24.173  1.00 96.81  ? 165  HIS B CD2 1 
ATOM   5570  C CE1 . HIS B  1 165 ? 9.788   26.281  24.404  1.00 98.06  ? 165  HIS B CE1 1 
ATOM   5571  N NE2 . HIS B  1 165 ? 9.278   25.429  23.515  1.00 98.04  ? 165  HIS B NE2 1 
ATOM   5572  N N   . LYS B  1 166 ? 5.298   25.334  24.348  1.00 85.68  ? 166  LYS B N   1 
ATOM   5573  C CA  . LYS B  1 166 ? 4.509   24.977  23.167  1.00 85.07  ? 166  LYS B CA  1 
ATOM   5574  C C   . LYS B  1 166 ? 4.725   23.504  22.800  1.00 87.16  ? 166  LYS B C   1 
ATOM   5575  O O   . LYS B  1 166 ? 3.743   22.784  22.589  1.00 88.39  ? 166  LYS B O   1 
ATOM   5576  C CB  . LYS B  1 166 ? 4.846   25.905  21.981  1.00 88.63  ? 166  LYS B CB  1 
ATOM   5577  C CG  . LYS B  1 166 ? 3.983   25.701  20.725  1.00 108.11 ? 166  LYS B CG  1 
ATOM   5578  C CD  . LYS B  1 166 ? 4.753   25.988  19.423  1.00 119.53 ? 166  LYS B CD  1 
ATOM   5579  C CE  . LYS B  1 166 ? 3.873   25.861  18.201  1.00 127.07 ? 166  LYS B CE  1 
ATOM   5580  N NZ  . LYS B  1 166 ? 4.669   25.809  16.945  1.00 135.94 ? 166  LYS B NZ  1 
ATOM   5581  N N   . SER B  1 167 ? 5.993   23.052  22.775  1.00 80.16  ? 167  SER B N   1 
ATOM   5582  C CA  . SER B  1 167 ? 6.348   21.683  22.414  1.00 79.36  ? 167  SER B CA  1 
ATOM   5583  C C   . SER B  1 167 ? 5.797   20.599  23.368  1.00 83.82  ? 167  SER B C   1 
ATOM   5584  O O   . SER B  1 167 ? 5.592   19.453  22.954  1.00 82.39  ? 167  SER B O   1 
ATOM   5585  C CB  . SER B  1 167 ? 7.854   21.553  22.253  1.00 82.22  ? 167  SER B CB  1 
ATOM   5586  O OG  . SER B  1 167 ? 8.520   21.790  23.479  1.00 93.28  ? 167  SER B OG  1 
ATOM   5587  N N   . CYS B  1 168 ? 5.521   20.981  24.627  1.00 81.22  ? 168  CYS B N   1 
ATOM   5588  C CA  . CYS B  1 168 ? 5.045   20.094  25.678  1.00 80.06  ? 168  CYS B CA  1 
ATOM   5589  C C   . CYS B  1 168 ? 3.655   19.547  25.524  1.00 83.65  ? 168  CYS B C   1 
ATOM   5590  O O   . CYS B  1 168 ? 3.341   18.545  26.173  1.00 84.76  ? 168  CYS B O   1 
ATOM   5591  C CB  . CYS B  1 168 ? 5.265   20.711  27.051  1.00 81.01  ? 168  CYS B CB  1 
ATOM   5592  S SG  . CYS B  1 168 ? 7.006   20.857  27.507  1.00 85.44  ? 168  CYS B SG  1 
ATOM   5593  N N   . THR B  1 169 ? 2.809   20.187  24.692  1.00 77.64  ? 169  THR B N   1 
ATOM   5594  C CA  . THR B  1 169 ? 1.440   19.732  24.449  1.00 75.96  ? 169  THR B CA  1 
ATOM   5595  C C   . THR B  1 169 ? 0.594   19.818  25.742  1.00 77.46  ? 169  THR B C   1 
ATOM   5596  O O   . THR B  1 169 ? -0.280  18.990  26.014  1.00 77.04  ? 169  THR B O   1 
ATOM   5597  C CB  . THR B  1 169 ? 1.450   18.436  23.587  1.00 77.78  ? 169  THR B CB  1 
ATOM   5598  O OG1 . THR B  1 169 ? 2.090   18.712  22.351  1.00 74.22  ? 169  THR B OG1 1 
ATOM   5599  C CG2 . THR B  1 169 ? 0.082   17.911  23.281  1.00 78.51  ? 169  THR B CG2 1 
ATOM   5600  N N   . GLY B  1 170 ? 0.874   20.858  26.513  1.00 73.14  ? 170  GLY B N   1 
ATOM   5601  C CA  . GLY B  1 170 ? 0.152   21.199  27.732  1.00 72.88  ? 170  GLY B CA  1 
ATOM   5602  C C   . GLY B  1 170 ? 0.366   20.320  28.937  1.00 75.00  ? 170  GLY B C   1 
ATOM   5603  O O   . GLY B  1 170 ? -0.391  20.454  29.908  1.00 75.56  ? 170  GLY B O   1 
ATOM   5604  N N   . ARG B  1 171 ? 1.388   19.413  28.880  1.00 68.12  ? 171  ARG B N   1 
ATOM   5605  C CA  . ARG B  1 171 ? 1.770   18.496  29.963  1.00 65.93  ? 171  ARG B CA  1 
ATOM   5606  C C   . ARG B  1 171 ? 3.283   18.561  30.203  1.00 71.66  ? 171  ARG B C   1 
ATOM   5607  O O   . ARG B  1 171 ? 4.083   18.092  29.377  1.00 69.53  ? 171  ARG B O   1 
ATOM   5608  C CB  . ARG B  1 171 ? 1.360   17.059  29.660  1.00 61.70  ? 171  ARG B CB  1 
ATOM   5609  C CG  . ARG B  1 171 ? -0.106  16.867  29.449  1.00 62.00  ? 171  ARG B CG  1 
ATOM   5610  C CD  . ARG B  1 171 ? -0.483  15.424  29.640  1.00 58.88  ? 171  ARG B CD  1 
ATOM   5611  N NE  . ARG B  1 171 ? -1.853  15.169  29.211  1.00 58.25  ? 171  ARG B NE  1 
ATOM   5612  C CZ  . ARG B  1 171 ? -2.933  15.434  29.937  1.00 65.53  ? 171  ARG B CZ  1 
ATOM   5613  N NH1 . ARG B  1 171 ? -2.815  15.970  31.150  1.00 47.89  ? 171  ARG B NH1 1 
ATOM   5614  N NH2 . ARG B  1 171 ? -4.134  15.179  29.457  1.00 53.83  ? 171  ARG B NH2 1 
ATOM   5615  N N   . CYS B  1 172 ? 3.669   19.143  31.349  1.00 70.97  ? 172  CYS B N   1 
ATOM   5616  C CA  . CYS B  1 172 ? 5.058   19.344  31.716  1.00 71.29  ? 172  CYS B CA  1 
ATOM   5617  C C   . CYS B  1 172 ? 5.260   19.426  33.231  1.00 70.31  ? 172  CYS B C   1 
ATOM   5618  O O   . CYS B  1 172 ? 4.314   19.642  33.987  1.00 66.97  ? 172  CYS B O   1 
ATOM   5619  C CB  . CYS B  1 172 ? 5.587   20.589  31.019  1.00 74.94  ? 172  CYS B CB  1 
ATOM   5620  S SG  . CYS B  1 172 ? 4.896   22.133  31.658  1.00 81.88  ? 172  CYS B SG  1 
ATOM   5621  N N   . TRP B  1 173 ? 6.514   19.265  33.661  1.00 67.58  ? 173  TRP B N   1 
ATOM   5622  C CA  . TRP B  1 173 ? 6.946   19.317  35.066  1.00 67.31  ? 173  TRP B CA  1 
ATOM   5623  C C   . TRP B  1 173 ? 7.478   20.698  35.429  1.00 72.98  ? 173  TRP B C   1 
ATOM   5624  O O   . TRP B  1 173 ? 7.532   21.048  36.614  1.00 71.24  ? 173  TRP B O   1 
ATOM   5625  C CB  . TRP B  1 173 ? 8.052   18.286  35.306  1.00 64.73  ? 173  TRP B CB  1 
ATOM   5626  C CG  . TRP B  1 173 ? 7.627   16.877  35.096  1.00 64.29  ? 173  TRP B CG  1 
ATOM   5627  C CD1 . TRP B  1 173 ? 7.887   16.089  34.015  1.00 66.87  ? 173  TRP B CD1 1 
ATOM   5628  C CD2 . TRP B  1 173 ? 6.869   16.084  36.006  1.00 63.59  ? 173  TRP B CD2 1 
ATOM   5629  N NE1 . TRP B  1 173 ? 7.341   14.840  34.201  1.00 66.10  ? 173  TRP B NE1 1 
ATOM   5630  C CE2 . TRP B  1 173 ? 6.710   14.809  35.418  1.00 67.42  ? 173  TRP B CE2 1 
ATOM   5631  C CE3 . TRP B  1 173 ? 6.298   16.330  37.268  1.00 64.72  ? 173  TRP B CE3 1 
ATOM   5632  C CZ2 . TRP B  1 173 ? 6.011   13.777  36.053  1.00 66.09  ? 173  TRP B CZ2 1 
ATOM   5633  C CZ3 . TRP B  1 173 ? 5.592   15.315  37.889  1.00 65.80  ? 173  TRP B CZ3 1 
ATOM   5634  C CH2 . TRP B  1 173 ? 5.435   14.062  37.276  1.00 65.90  ? 173  TRP B CH2 1 
ATOM   5635  N N   . GLY B  1 174 ? 7.792   21.470  34.393  1.00 73.30  ? 174  GLY B N   1 
ATOM   5636  C CA  . GLY B  1 174 ? 8.360   22.802  34.494  1.00 76.18  ? 174  GLY B CA  1 
ATOM   5637  C C   . GLY B  1 174 ? 8.203   23.689  33.268  1.00 85.12  ? 174  GLY B C   1 
ATOM   5638  O O   . GLY B  1 174 ? 7.537   23.330  32.289  1.00 84.94  ? 174  GLY B O   1 
ATOM   5639  N N   . PRO B  1 175 ? 8.869   24.859  33.274  1.00 84.27  ? 175  PRO B N   1 
ATOM   5640  C CA  . PRO B  1 175 ? 8.624   25.832  32.202  1.00 86.17  ? 175  PRO B CA  1 
ATOM   5641  C C   . PRO B  1 175 ? 9.264   25.629  30.833  1.00 92.02  ? 175  PRO B C   1 
ATOM   5642  O O   . PRO B  1 175 ? 8.696   26.083  29.837  1.00 92.82  ? 175  PRO B O   1 
ATOM   5643  C CB  . PRO B  1 175 ? 9.065   27.143  32.834  1.00 88.78  ? 175  PRO B CB  1 
ATOM   5644  C CG  . PRO B  1 175 ? 10.148  26.738  33.773  1.00 91.99  ? 175  PRO B CG  1 
ATOM   5645  C CD  . PRO B  1 175 ? 9.681   25.454  34.358  1.00 85.74  ? 175  PRO B CD  1 
ATOM   5646  N N   . THR B  1 176 ? 10.460  25.023  30.787  1.00 88.10  ? 176  THR B N   1 
ATOM   5647  C CA  . THR B  1 176 ? 11.235  24.830  29.557  1.00 88.15  ? 176  THR B CA  1 
ATOM   5648  C C   . THR B  1 176 ? 10.668  23.768  28.614  1.00 93.08  ? 176  THR B C   1 
ATOM   5649  O O   . THR B  1 176 ? 9.723   23.051  28.959  1.00 93.40  ? 176  THR B O   1 
ATOM   5650  C CB  . THR B  1 176 ? 12.730  24.579  29.878  1.00 93.76  ? 176  THR B CB  1 
ATOM   5651  O OG1 . THR B  1 176 ? 12.972  23.184  30.034  1.00 95.86  ? 176  THR B OG1 1 
ATOM   5652  C CG2 . THR B  1 176 ? 13.224  25.347  31.105  1.00 89.32  ? 176  THR B CG2 1 
ATOM   5653  N N   . GLU B  1 177 ? 11.285  23.658  27.430  1.00 89.96  ? 177  GLU B N   1 
ATOM   5654  C CA  . GLU B  1 177 ? 10.974  22.677  26.384  1.00 89.28  ? 177  GLU B CA  1 
ATOM   5655  C C   . GLU B  1 177 ? 11.573  21.309  26.728  1.00 86.47  ? 177  GLU B C   1 
ATOM   5656  O O   . GLU B  1 177 ? 11.285  20.334  26.037  1.00 84.85  ? 177  GLU B O   1 
ATOM   5657  C CB  . GLU B  1 177 ? 11.516  23.156  25.015  1.00 92.47  ? 177  GLU B CB  1 
ATOM   5658  C CG  . GLU B  1 177 ? 13.042  23.227  24.945  1.00 107.19 ? 177  GLU B CG  1 
ATOM   5659  C CD  . GLU B  1 177 ? 13.646  24.050  23.825  1.00 130.31 ? 177  GLU B CD  1 
ATOM   5660  O OE1 . GLU B  1 177 ? 14.689  23.609  23.288  1.00 111.21 ? 177  GLU B OE1 1 
ATOM   5661  O OE2 . GLU B  1 177 ? 13.110  25.144  23.513  1.00 125.19 ? 177  GLU B OE2 1 
ATOM   5662  N N   . ASN B  1 178 ? 12.430  21.250  27.754  1.00 80.72  ? 178  ASN B N   1 
ATOM   5663  C CA  . ASN B  1 178 ? 13.085  20.004  28.174  1.00 79.72  ? 178  ASN B CA  1 
ATOM   5664  C C   . ASN B  1 178 ? 12.382  19.446  29.399  1.00 83.25  ? 178  ASN B C   1 
ATOM   5665  O O   . ASN B  1 178 ? 12.877  18.511  30.032  1.00 81.56  ? 178  ASN B O   1 
ATOM   5666  C CB  . ASN B  1 178 ? 14.594  20.231  28.451  1.00 79.26  ? 178  ASN B CB  1 
ATOM   5667  C CG  . ASN B  1 178 ? 15.321  20.937  27.320  1.00 102.74 ? 178  ASN B CG  1 
ATOM   5668  O OD1 . ASN B  1 178 ? 15.642  20.336  26.283  1.00 87.57  ? 178  ASN B OD1 1 
ATOM   5669  N ND2 . ASN B  1 178 ? 15.557  22.247  27.476  1.00 96.87  ? 178  ASN B ND2 1 
ATOM   5670  N N   . HIS B  1 179 ? 11.222  20.032  29.733  1.00 80.93  ? 179  HIS B N   1 
ATOM   5671  C CA  . HIS B  1 179 ? 10.430  19.679  30.906  1.00 80.75  ? 179  HIS B CA  1 
ATOM   5672  C C   . HIS B  1 179 ? 9.161   18.922  30.575  1.00 82.51  ? 179  HIS B C   1 
ATOM   5673  O O   . HIS B  1 179 ? 8.342   18.682  31.464  1.00 81.43  ? 179  HIS B O   1 
ATOM   5674  C CB  . HIS B  1 179 ? 10.074  20.947  31.696  1.00 83.32  ? 179  HIS B CB  1 
ATOM   5675  C CG  . HIS B  1 179 ? 11.214  21.571  32.440  1.00 87.77  ? 179  HIS B CG  1 
ATOM   5676  N ND1 . HIS B  1 179 ? 12.284  20.824  32.906  1.00 89.21  ? 179  HIS B ND1 1 
ATOM   5677  C CD2 . HIS B  1 179 ? 11.391  22.856  32.811  1.00 91.27  ? 179  HIS B CD2 1 
ATOM   5678  C CE1 . HIS B  1 179 ? 13.084  21.683  33.513  1.00 89.37  ? 179  HIS B CE1 1 
ATOM   5679  N NE2 . HIS B  1 179 ? 12.580  22.913  33.495  1.00 90.97  ? 179  HIS B NE2 1 
ATOM   5680  N N   . CYS B  1 180 ? 8.996   18.536  29.308  1.00 78.20  ? 180  CYS B N   1 
ATOM   5681  C CA  . CYS B  1 180 ? 7.801   17.848  28.842  1.00 76.96  ? 180  CYS B CA  1 
ATOM   5682  C C   . CYS B  1 180 ? 7.625   16.496  29.478  1.00 75.43  ? 180  CYS B C   1 
ATOM   5683  O O   . CYS B  1 180 ? 8.607   15.779  29.699  1.00 74.11  ? 180  CYS B O   1 
ATOM   5684  C CB  . CYS B  1 180 ? 7.775   17.768  27.319  1.00 78.66  ? 180  CYS B CB  1 
ATOM   5685  S SG  . CYS B  1 180 ? 8.004   19.369  26.481  1.00 84.91  ? 180  CYS B SG  1 
ATOM   5686  N N   . GLN B  1 181 ? 6.365   16.154  29.798  1.00 68.41  ? 181  GLN B N   1 
ATOM   5687  C CA  . GLN B  1 181 ? 6.049   14.856  30.394  1.00 65.00  ? 181  GLN B CA  1 
ATOM   5688  C C   . GLN B  1 181 ? 6.104   13.803  29.294  1.00 66.47  ? 181  GLN B C   1 
ATOM   5689  O O   . GLN B  1 181 ? 5.387   13.905  28.297  1.00 67.19  ? 181  GLN B O   1 
ATOM   5690  C CB  . GLN B  1 181 ? 4.663   14.874  31.058  1.00 65.63  ? 181  GLN B CB  1 
ATOM   5691  C CG  . GLN B  1 181 ? 4.255   13.549  31.685  1.00 48.55  ? 181  GLN B CG  1 
ATOM   5692  C CD  . GLN B  1 181 ? 2.801   13.435  32.034  1.00 65.63  ? 181  GLN B CD  1 
ATOM   5693  O OE1 . GLN B  1 181 ? 2.005   14.346  31.812  1.00 74.83  ? 181  GLN B OE1 1 
ATOM   5694  N NE2 . GLN B  1 181 ? 2.401   12.276  32.545  1.00 51.50  ? 181  GLN B NE2 1 
ATOM   5695  N N   . THR B  1 182 ? 6.960   12.803  29.469  1.00 60.62  ? 182  THR B N   1 
ATOM   5696  C CA  . THR B  1 182 ? 7.072   11.723  28.499  1.00 59.81  ? 182  THR B CA  1 
ATOM   5697  C C   . THR B  1 182 ? 5.934   10.717  28.698  1.00 65.00  ? 182  THR B C   1 
ATOM   5698  O O   . THR B  1 182 ? 5.955   9.927   29.667  1.00 66.09  ? 182  THR B O   1 
ATOM   5699  C CB  . THR B  1 182 ? 8.470   11.090  28.562  1.00 58.93  ? 182  THR B CB  1 
ATOM   5700  O OG1 . THR B  1 182 ? 9.440   12.131  28.389  1.00 60.01  ? 182  THR B OG1 1 
ATOM   5701  C CG2 . THR B  1 182 ? 8.659   9.975   27.513  1.00 50.54  ? 182  THR B CG2 1 
ATOM   5702  N N   . LEU B  1 183 ? 4.913   10.770  27.813  1.00 59.53  ? 183  LEU B N   1 
ATOM   5703  C CA  . LEU B  1 183 ? 3.813   9.800   27.918  1.00 57.47  ? 183  LEU B CA  1 
ATOM   5704  C C   . LEU B  1 183 ? 4.267   8.421   27.357  1.00 59.44  ? 183  LEU B C   1 
ATOM   5705  O O   . LEU B  1 183 ? 4.885   8.347   26.302  1.00 60.00  ? 183  LEU B O   1 
ATOM   5706  C CB  . LEU B  1 183 ? 2.564   10.304  27.198  1.00 58.15  ? 183  LEU B CB  1 
ATOM   5707  C CG  . LEU B  1 183 ? 1.849   11.557  27.716  1.00 63.03  ? 183  LEU B CG  1 
ATOM   5708  C CD1 . LEU B  1 183 ? 0.407   11.486  27.355  1.00 63.33  ? 183  LEU B CD1 1 
ATOM   5709  C CD2 . LEU B  1 183 ? 1.893   11.681  29.227  1.00 65.74  ? 183  LEU B CD2 1 
ATOM   5710  N N   . THR B  1 184 ? 4.078   7.351   28.100  1.00 53.97  ? 184  THR B N   1 
ATOM   5711  C CA  . THR B  1 184 ? 4.542   6.066   27.594  1.00 52.84  ? 184  THR B CA  1 
ATOM   5712  C C   . THR B  1 184 ? 3.459   5.009   27.510  1.00 53.90  ? 184  THR B C   1 
ATOM   5713  O O   . THR B  1 184 ? 3.803   3.857   27.251  1.00 52.53  ? 184  THR B O   1 
ATOM   5714  C CB  . THR B  1 184 ? 5.767   5.557   28.367  1.00 61.88  ? 184  THR B CB  1 
ATOM   5715  O OG1 . THR B  1 184 ? 5.419   5.416   29.741  1.00 64.46  ? 184  THR B OG1 1 
ATOM   5716  C CG2 . THR B  1 184 ? 6.996   6.432   28.184  1.00 57.38  ? 184  THR B CG2 1 
ATOM   5717  N N   . ARG B  1 185 ? 2.169   5.369   27.688  1.00 49.39  ? 185  ARG B N   1 
ATOM   5718  C CA  . ARG B  1 185 ? 1.140   4.341   27.662  1.00 49.99  ? 185  ARG B CA  1 
ATOM   5719  C C   . ARG B  1 185 ? -0.043  4.657   26.797  1.00 59.30  ? 185  ARG B C   1 
ATOM   5720  O O   . ARG B  1 185 ? -0.423  3.839   25.965  1.00 61.96  ? 185  ARG B O   1 
ATOM   5721  C CB  . ARG B  1 185 ? 0.713   3.951   29.089  1.00 48.45  ? 185  ARG B CB  1 
ATOM   5722  C CG  . ARG B  1 185 ? 0.059   2.579   29.176  1.00 65.33  ? 185  ARG B CG  1 
ATOM   5723  C CD  . ARG B  1 185 ? -0.033  2.021   30.611  1.00 83.32  ? 185  ARG B CD  1 
ATOM   5724  N NE  . ARG B  1 185 ? -0.798  2.834   31.579  1.00 90.22  ? 185  ARG B NE  1 
ATOM   5725  C CZ  . ARG B  1 185 ? -2.098  3.135   31.486  1.00 99.79  ? 185  ARG B CZ  1 
ATOM   5726  N NH1 . ARG B  1 185 ? -2.816  2.720   30.445  1.00 85.81  ? 185  ARG B NH1 1 
ATOM   5727  N NH2 . ARG B  1 185 ? -2.683  3.867   32.422  1.00 79.63  ? 185  ARG B NH2 1 
ATOM   5728  N N   . THR B  1 186 ? -0.625  5.825   26.989  1.00 56.25  ? 186  THR B N   1 
ATOM   5729  C CA  . THR B  1 186 ? -1.824  6.273   26.292  1.00 57.51  ? 186  THR B CA  1 
ATOM   5730  C C   . THR B  1 186 ? -1.537  6.641   24.814  1.00 66.23  ? 186  THR B C   1 
ATOM   5731  O O   . THR B  1 186 ? -2.425  6.603   23.946  1.00 67.76  ? 186  THR B O   1 
ATOM   5732  C CB  . THR B  1 186 ? -2.424  7.446   27.090  1.00 57.49  ? 186  THR B CB  1 
ATOM   5733  O OG1 . THR B  1 186 ? -1.665  8.641   26.844  1.00 64.18  ? 186  THR B OG1 1 
ATOM   5734  C CG2 . THR B  1 186 ? -2.507  7.153   28.609  1.00 42.33  ? 186  THR B CG2 1 
ATOM   5735  N N   . VAL B  1 187 ? -0.281  6.996   24.548  1.00 63.11  ? 187  VAL B N   1 
ATOM   5736  C CA  . VAL B  1 187 ? 0.239   7.403   23.236  1.00 62.99  ? 187  VAL B CA  1 
ATOM   5737  C C   . VAL B  1 187 ? 0.696   6.215   22.356  1.00 69.42  ? 187  VAL B C   1 
ATOM   5738  O O   . VAL B  1 187 ? 1.236   6.418   21.272  1.00 68.90  ? 187  VAL B O   1 
ATOM   5739  C CB  . VAL B  1 187 ? 1.384   8.403   23.448  1.00 63.92  ? 187  VAL B CB  1 
ATOM   5740  C CG1 . VAL B  1 187 ? 0.888   9.619   24.218  1.00 63.27  ? 187  VAL B CG1 1 
ATOM   5741  C CG2 . VAL B  1 187 ? 2.551   7.739   24.158  1.00 62.09  ? 187  VAL B CG2 1 
ATOM   5742  N N   . CYS B  1 188 ? 0.476   4.991   22.820  1.00 67.08  ? 188  CYS B N   1 
ATOM   5743  C CA  . CYS B  1 188 ? 0.881   3.810   22.090  1.00 67.80  ? 188  CYS B CA  1 
ATOM   5744  C C   . CYS B  1 188 ? -0.072  3.389   20.992  1.00 68.67  ? 188  CYS B C   1 
ATOM   5745  O O   . CYS B  1 188 ? -1.243  3.756   21.024  1.00 69.39  ? 188  CYS B O   1 
ATOM   5746  C CB  . CYS B  1 188 ? 1.167   2.687   23.075  1.00 69.01  ? 188  CYS B CB  1 
ATOM   5747  S SG  . CYS B  1 188 ? 2.398   3.143   24.340  1.00 73.21  ? 188  CYS B SG  1 
ATOM   5748  N N   . ALA B  1 189 ? 0.433   2.633   20.006  1.00 63.04  ? 189  ALA B N   1 
ATOM   5749  C CA  . ALA B  1 189 ? -0.350  2.057   18.911  1.00 63.61  ? 189  ALA B CA  1 
ATOM   5750  C C   . ALA B  1 189 ? -1.414  1.180   19.541  1.00 68.86  ? 189  ALA B C   1 
ATOM   5751  O O   . ALA B  1 189 ? -1.191  0.645   20.627  1.00 67.36  ? 189  ALA B O   1 
ATOM   5752  C CB  . ALA B  1 189 ? 0.541   1.182   18.036  1.00 64.12  ? 189  ALA B CB  1 
ATOM   5753  N N   . GLU B  1 190 ? -2.533  0.970   18.865  1.00 67.64  ? 190  GLU B N   1 
ATOM   5754  C CA  . GLU B  1 190 ? -3.559  0.127   19.462  1.00 68.81  ? 190  GLU B CA  1 
ATOM   5755  C C   . GLU B  1 190 ? -3.160  -1.317  19.765  1.00 76.82  ? 190  GLU B C   1 
ATOM   5756  O O   . GLU B  1 190 ? -3.824  -1.979  20.571  1.00 76.63  ? 190  GLU B O   1 
ATOM   5757  C CB  . GLU B  1 190 ? -4.887  0.241   18.718  1.00 71.56  ? 190  GLU B CB  1 
ATOM   5758  C CG  . GLU B  1 190 ? -5.616  1.552   19.012  1.00 82.12  ? 190  GLU B CG  1 
ATOM   5759  C CD  . GLU B  1 190 ? -5.915  1.837   20.472  1.00 94.01  ? 190  GLU B CD  1 
ATOM   5760  O OE1 . GLU B  1 190 ? -6.487  0.940   21.133  1.00 76.64  ? 190  GLU B OE1 1 
ATOM   5761  O OE2 . GLU B  1 190 ? -5.575  2.947   20.953  1.00 88.43  ? 190  GLU B OE2 1 
ATOM   5762  N N   . GLN B  1 191 ? -2.027  -1.761  19.196  1.00 77.03  ? 191  GLN B N   1 
ATOM   5763  C CA  . GLN B  1 191 ? -1.500  -3.108  19.357  1.00 77.83  ? 191  GLN B CA  1 
ATOM   5764  C C   . GLN B  1 191 ? -0.521  -3.337  20.494  1.00 81.66  ? 191  GLN B C   1 
ATOM   5765  O O   . GLN B  1 191 ? -0.278  -4.507  20.825  1.00 81.42  ? 191  GLN B O   1 
ATOM   5766  C CB  . GLN B  1 191 ? -1.000  -3.672  18.033  1.00 80.67  ? 191  GLN B CB  1 
ATOM   5767  C CG  . GLN B  1 191 ? -2.112  -4.421  17.281  1.00 101.40 ? 191  GLN B CG  1 
ATOM   5768  C CD  . GLN B  1 191 ? -2.256  -4.002  15.837  1.00 113.23 ? 191  GLN B CD  1 
ATOM   5769  O OE1 . GLN B  1 191 ? -2.246  -2.796  15.514  1.00 107.63 ? 191  GLN B OE1 1 
ATOM   5770  N NE2 . GLN B  1 191 ? -2.445  -4.998  14.949  1.00 93.49  ? 191  GLN B NE2 1 
ATOM   5771  N N   . CYS B  1 192 ? 0.017   -2.250  21.117  1.00 77.93  ? 192  CYS B N   1 
ATOM   5772  C CA  . CYS B  1 192 ? 0.909   -2.387  22.276  1.00 77.48  ? 192  CYS B CA  1 
ATOM   5773  C C   . CYS B  1 192 ? 0.033   -2.763  23.444  1.00 83.35  ? 192  CYS B C   1 
ATOM   5774  O O   . CYS B  1 192 ? -1.049  -2.212  23.601  1.00 84.53  ? 192  CYS B O   1 
ATOM   5775  C CB  . CYS B  1 192 ? 1.684   -1.107  22.592  1.00 78.02  ? 192  CYS B CB  1 
ATOM   5776  S SG  . CYS B  1 192 ? 2.431   -0.270  21.164  1.00 83.33  ? 192  CYS B SG  1 
ATOM   5777  N N   . ASP B  1 193 ? 0.491   -3.670  24.278  1.00 81.32  ? 193  ASP B N   1 
ATOM   5778  C CA  . ASP B  1 193 ? -0.260  -4.055  25.476  1.00 81.70  ? 193  ASP B CA  1 
ATOM   5779  C C   . ASP B  1 193 ? 0.413   -3.453  26.706  1.00 80.88  ? 193  ASP B C   1 
ATOM   5780  O O   . ASP B  1 193 ? -0.222  -3.322  27.758  1.00 79.91  ? 193  ASP B O   1 
ATOM   5781  C CB  . ASP B  1 193 ? -0.386  -5.590  25.591  1.00 85.46  ? 193  ASP B CB  1 
ATOM   5782  C CG  . ASP B  1 193 ? -1.431  -6.216  24.671  1.00 109.61 ? 193  ASP B CG  1 
ATOM   5783  O OD1 . ASP B  1 193 ? -2.510  -5.580  24.462  1.00 112.28 ? 193  ASP B OD1 1 
ATOM   5784  O OD2 . ASP B  1 193 ? -1.192  -7.361  24.191  1.00 119.19 ? 193  ASP B OD2 1 
ATOM   5785  N N   . GLY B  1 194 ? 1.690   -3.084  26.538  1.00 73.59  ? 194  GLY B N   1 
ATOM   5786  C CA  . GLY B  1 194 ? 2.506   -2.443  27.554  1.00 70.24  ? 194  GLY B CA  1 
ATOM   5787  C C   . GLY B  1 194 ? 2.725   -0.976  27.259  1.00 69.27  ? 194  GLY B C   1 
ATOM   5788  O O   . GLY B  1 194 ? 1.792   -0.240  26.924  1.00 69.53  ? 194  GLY B O   1 
ATOM   5789  N N   . ARG B  1 195 ? 3.966   -0.554  27.422  1.00 62.60  ? 195  ARG B N   1 
ATOM   5790  C CA  . ARG B  1 195 ? 4.434   0.801   27.206  1.00 61.72  ? 195  ARG B CA  1 
ATOM   5791  C C   . ARG B  1 195 ? 5.132   0.874   25.845  1.00 68.65  ? 195  ARG B C   1 
ATOM   5792  O O   . ARG B  1 195 ? 5.262   -0.148  25.167  1.00 69.47  ? 195  ARG B O   1 
ATOM   5793  C CB  . ARG B  1 195 ? 5.368   1.226   28.353  1.00 57.35  ? 195  ARG B CB  1 
ATOM   5794  C CG  . ARG B  1 195 ? 4.669   1.209   29.691  1.00 51.88  ? 195  ARG B CG  1 
ATOM   5795  C CD  . ARG B  1 195 ? 5.355   1.989   30.775  1.00 43.86  ? 195  ARG B CD  1 
ATOM   5796  N NE  . ARG B  1 195 ? 4.439   2.117   31.907  1.00 50.93  ? 195  ARG B NE  1 
ATOM   5797  C CZ  . ARG B  1 195 ? 3.605   3.138   32.101  1.00 68.26  ? 195  ARG B CZ  1 
ATOM   5798  N NH1 . ARG B  1 195 ? 3.614   4.178   31.279  1.00 53.56  ? 195  ARG B NH1 1 
ATOM   5799  N NH2 . ARG B  1 195 ? 2.782   3.141   33.141  1.00 58.16  ? 195  ARG B NH2 1 
ATOM   5800  N N   . CYS B  1 196 ? 5.533   2.082   25.418  1.00 66.05  ? 196  CYS B N   1 
ATOM   5801  C CA  . CYS B  1 196 ? 6.182   2.276   24.124  1.00 66.56  ? 196  CYS B CA  1 
ATOM   5802  C C   . CYS B  1 196 ? 7.207   3.415   24.154  1.00 70.24  ? 196  CYS B C   1 
ATOM   5803  O O   . CYS B  1 196 ? 7.270   4.178   25.127  1.00 67.02  ? 196  CYS B O   1 
ATOM   5804  C CB  . CYS B  1 196 ? 5.129   2.494   23.042  1.00 68.15  ? 196  CYS B CB  1 
ATOM   5805  S SG  . CYS B  1 196 ? 4.039   3.900   23.361  1.00 73.04  ? 196  CYS B SG  1 
ATOM   5806  N N   . TYR B  1 197 ? 8.024   3.509   23.088  1.00 70.35  ? 197  TYR B N   1 
ATOM   5807  C CA  . TYR B  1 197 ? 9.004   4.589   22.908  1.00 72.08  ? 197  TYR B CA  1 
ATOM   5808  C C   . TYR B  1 197 ? 8.664   5.471   21.703  1.00 81.19  ? 197  TYR B C   1 
ATOM   5809  O O   . TYR B  1 197 ? 9.465   6.331   21.343  1.00 83.00  ? 197  TYR B O   1 
ATOM   5810  C CB  . TYR B  1 197 ? 10.473  4.092   22.863  1.00 72.02  ? 197  TYR B CB  1 
ATOM   5811  C CG  . TYR B  1 197 ? 10.746  3.018   21.844  1.00 73.85  ? 197  TYR B CG  1 
ATOM   5812  C CD1 . TYR B  1 197 ? 11.235  3.333   20.585  1.00 76.21  ? 197  TYR B CD1 1 
ATOM   5813  C CD2 . TYR B  1 197 ? 10.522  1.684   22.138  1.00 75.27  ? 197  TYR B CD2 1 
ATOM   5814  C CE1 . TYR B  1 197 ? 11.495  2.341   19.641  1.00 76.78  ? 197  TYR B CE1 1 
ATOM   5815  C CE2 . TYR B  1 197 ? 10.738  0.685   21.192  1.00 77.09  ? 197  TYR B CE2 1 
ATOM   5816  C CZ  . TYR B  1 197 ? 11.249  1.015   19.952  1.00 84.86  ? 197  TYR B CZ  1 
ATOM   5817  O OH  . TYR B  1 197 ? 11.460  0.016   19.032  1.00 88.39  ? 197  TYR B OH  1 
ATOM   5818  N N   . GLY B  1 198 ? 7.472   5.266   21.131  1.00 78.55  ? 198  GLY B N   1 
ATOM   5819  C CA  . GLY B  1 198 ? 6.940   5.991   19.981  1.00 79.48  ? 198  GLY B CA  1 
ATOM   5820  C C   . GLY B  1 198 ? 5.530   5.542   19.648  1.00 85.89  ? 198  GLY B C   1 
ATOM   5821  O O   . GLY B  1 198 ? 4.975   4.689   20.357  1.00 84.18  ? 198  GLY B O   1 
ATOM   5822  N N   . PRO B  1 199 ? 4.904   6.058   18.555  1.00 86.43  ? 199  PRO B N   1 
ATOM   5823  C CA  . PRO B  1 199 ? 3.492   5.736   18.307  1.00 86.80  ? 199  PRO B CA  1 
ATOM   5824  C C   . PRO B  1 199 ? 3.142   4.617   17.333  1.00 93.79  ? 199  PRO B C   1 
ATOM   5825  O O   . PRO B  1 199 ? 1.954   4.305   17.222  1.00 95.76  ? 199  PRO B O   1 
ATOM   5826  C CB  . PRO B  1 199 ? 2.904   7.085   17.886  1.00 88.79  ? 199  PRO B CB  1 
ATOM   5827  C CG  . PRO B  1 199 ? 4.070   7.878   17.359  1.00 93.75  ? 199  PRO B CG  1 
ATOM   5828  C CD  . PRO B  1 199 ? 5.346   7.108   17.619  1.00 89.39  ? 199  PRO B CD  1 
ATOM   5829  N N   . TYR B  1 200 ? 4.128   4.009   16.646  1.00 89.98  ? 200  TYR B N   1 
ATOM   5830  C CA  . TYR B  1 200 ? 3.880   2.936   15.661  1.00 90.27  ? 200  TYR B CA  1 
ATOM   5831  C C   . TYR B  1 200 ? 4.026   1.553   16.266  1.00 87.93  ? 200  TYR B C   1 
ATOM   5832  O O   . TYR B  1 200 ? 4.501   1.459   17.392  1.00 86.91  ? 200  TYR B O   1 
ATOM   5833  C CB  . TYR B  1 200 ? 4.733   3.137   14.391  1.00 94.32  ? 200  TYR B CB  1 
ATOM   5834  C CG  . TYR B  1 200 ? 4.825   4.598   13.991  1.00 99.66  ? 200  TYR B CG  1 
ATOM   5835  C CD1 . TYR B  1 200 ? 3.776   5.227   13.315  1.00 103.19 ? 200  TYR B CD1 1 
ATOM   5836  C CD2 . TYR B  1 200 ? 5.919   5.379   14.369  1.00 100.86 ? 200  TYR B CD2 1 
ATOM   5837  C CE1 . TYR B  1 200 ? 3.827   6.588   13.000  1.00 106.00 ? 200  TYR B CE1 1 
ATOM   5838  C CE2 . TYR B  1 200 ? 5.983   6.741   14.053  1.00 103.04 ? 200  TYR B CE2 1 
ATOM   5839  C CZ  . TYR B  1 200 ? 4.939   7.338   13.358  1.00 113.94 ? 200  TYR B CZ  1 
ATOM   5840  O OH  . TYR B  1 200 ? 5.000   8.675   13.032  1.00 116.67 ? 200  TYR B OH  1 
ATOM   5841  N N   . VAL B  1 201 ? 3.587   0.483   15.573  1.00 81.62  ? 201  VAL B N   1 
ATOM   5842  C CA  . VAL B  1 201 ? 3.660   -0.890  16.141  1.00 79.81  ? 201  VAL B CA  1 
ATOM   5843  C C   . VAL B  1 201 ? 5.115   -1.333  16.361  1.00 80.97  ? 201  VAL B C   1 
ATOM   5844  O O   . VAL B  1 201 ? 5.394   -2.170  17.231  1.00 78.98  ? 201  VAL B O   1 
ATOM   5845  C CB  . VAL B  1 201 ? 2.763   -1.976  15.436  1.00 84.35  ? 201  VAL B CB  1 
ATOM   5846  C CG1 . VAL B  1 201 ? 2.260   -3.052  16.414  1.00 81.65  ? 201  VAL B CG1 1 
ATOM   5847  C CG2 . VAL B  1 201 ? 1.583   -1.334  14.696  1.00 86.13  ? 201  VAL B CG2 1 
ATOM   5848  N N   . SER B  1 202 ? 6.050   -0.694  15.617  1.00 78.09  ? 202  SER B N   1 
ATOM   5849  C CA  . SER B  1 202 ? 7.512   -0.907  15.688  1.00 76.57  ? 202  SER B CA  1 
ATOM   5850  C C   . SER B  1 202 ? 8.010   -0.519  17.074  1.00 78.26  ? 202  SER B C   1 
ATOM   5851  O O   . SER B  1 202 ? 8.855   -1.211  17.646  1.00 77.91  ? 202  SER B O   1 
ATOM   5852  C CB  . SER B  1 202 ? 8.238   -0.044  14.656  1.00 79.01  ? 202  SER B CB  1 
ATOM   5853  O OG  . SER B  1 202 ? 7.449   0.216   13.504  1.00 89.67  ? 202  SER B OG  1 
ATOM   5854  N N   . ASP B  1 203 ? 7.449   0.580   17.617  1.00 72.89  ? 203  ASP B N   1 
ATOM   5855  C CA  . ASP B  1 203 ? 7.800   1.195   18.893  1.00 70.79  ? 203  ASP B CA  1 
ATOM   5856  C C   . ASP B  1 203 ? 7.214   0.607   20.218  1.00 72.50  ? 203  ASP B C   1 
ATOM   5857  O O   . ASP B  1 203 ? 7.448   1.217   21.263  1.00 69.39  ? 203  ASP B O   1 
ATOM   5858  C CB  . ASP B  1 203 ? 7.679   2.729   18.795  1.00 72.78  ? 203  ASP B CB  1 
ATOM   5859  C CG  . ASP B  1 203 ? 8.022   3.326   17.434  1.00 91.30  ? 203  ASP B CG  1 
ATOM   5860  O OD1 . ASP B  1 203 ? 8.728   2.653   16.644  1.00 92.33  ? 203  ASP B OD1 1 
ATOM   5861  O OD2 . ASP B  1 203 ? 7.557   4.456   17.142  1.00 104.46 ? 203  ASP B OD2 1 
ATOM   5862  N N   . CYS B  1 204 ? 6.506   -0.567  20.199  1.00 70.74  ? 204  CYS B N   1 
ATOM   5863  C CA  . CYS B  1 204 ? 6.006   -1.145  21.452  1.00 71.28  ? 204  CYS B CA  1 
ATOM   5864  C C   . CYS B  1 204 ? 7.108   -1.759  22.227  1.00 69.18  ? 204  CYS B C   1 
ATOM   5865  O O   . CYS B  1 204 ? 7.964   -2.451  21.664  1.00 69.82  ? 204  CYS B O   1 
ATOM   5866  C CB  . CYS B  1 204 ? 4.902   -2.175  21.249  1.00 75.06  ? 204  CYS B CB  1 
ATOM   5867  S SG  . CYS B  1 204 ? 3.568   -1.654  20.170  1.00 82.80  ? 204  CYS B SG  1 
ATOM   5868  N N   . CYS B  1 205 ? 7.005   -1.620  23.540  1.00 60.79  ? 205  CYS B N   1 
ATOM   5869  C CA  . CYS B  1 205 ? 7.906   -2.280  24.446  1.00 59.51  ? 205  CYS B CA  1 
ATOM   5870  C C   . CYS B  1 205 ? 7.429   -3.735  24.579  1.00 64.30  ? 205  CYS B C   1 
ATOM   5871  O O   . CYS B  1 205 ? 6.261   -4.048  24.265  1.00 66.50  ? 205  CYS B O   1 
ATOM   5872  C CB  . CYS B  1 205 ? 7.901   -1.589  25.806  1.00 58.85  ? 205  CYS B CB  1 
ATOM   5873  S SG  . CYS B  1 205 ? 8.746   0.001   25.843  1.00 62.90  ? 205  CYS B SG  1 
ATOM   5874  N N   . HIS B  1 206 ? 8.309   -4.604  25.128  1.00 56.27  ? 206  HIS B N   1 
ATOM   5875  C CA  . HIS B  1 206 ? 7.955   -5.966  25.473  1.00 54.43  ? 206  HIS B CA  1 
ATOM   5876  C C   . HIS B  1 206 ? 6.971   -5.859  26.658  1.00 54.17  ? 206  HIS B C   1 
ATOM   5877  O O   . HIS B  1 206 ? 7.094   -4.913  27.444  1.00 52.61  ? 206  HIS B O   1 
ATOM   5878  C CB  . HIS B  1 206 ? 9.203   -6.695  25.932  1.00 55.09  ? 206  HIS B CB  1 
ATOM   5879  C CG  . HIS B  1 206 ? 8.952   -8.125  26.257  1.00 58.68  ? 206  HIS B CG  1 
ATOM   5880  N ND1 . HIS B  1 206 ? 9.204   -9.116  25.346  1.00 61.05  ? 206  HIS B ND1 1 
ATOM   5881  C CD2 . HIS B  1 206 ? 8.446   -8.676  27.381  1.00 60.22  ? 206  HIS B CD2 1 
ATOM   5882  C CE1 . HIS B  1 206 ? 8.846   -10.242 25.936  1.00 60.28  ? 206  HIS B CE1 1 
ATOM   5883  N NE2 . HIS B  1 206 ? 8.390   -10.023 27.170  1.00 60.07  ? 206  HIS B NE2 1 
ATOM   5884  N N   . ARG B  1 207 ? 6.006   -6.810  26.790  1.00 48.36  ? 207  ARG B N   1 
ATOM   5885  C CA  . ARG B  1 207 ? 5.026   -6.823  27.882  1.00 47.10  ? 207  ARG B CA  1 
ATOM   5886  C C   . ARG B  1 207 ? 5.653   -6.767  29.251  1.00 50.85  ? 207  ARG B C   1 
ATOM   5887  O O   . ARG B  1 207 ? 5.032   -6.253  30.175  1.00 50.66  ? 207  ARG B O   1 
ATOM   5888  C CB  . ARG B  1 207 ? 4.130   -8.049  27.815  1.00 49.69  ? 207  ARG B CB  1 
ATOM   5889  C CG  . ARG B  1 207 ? 2.675   -7.730  28.172  1.00 78.12  ? 207  ARG B CG  1 
ATOM   5890  C CD  . ARG B  1 207 ? 1.911   -8.926  28.724  1.00 100.55 ? 207  ARG B CD  1 
ATOM   5891  N NE  . ARG B  1 207 ? 1.215   -9.653  27.665  1.00 120.18 ? 207  ARG B NE  1 
ATOM   5892  C CZ  . ARG B  1 207 ? 0.933   -10.951 27.705  1.00 143.57 ? 207  ARG B CZ  1 
ATOM   5893  N NH1 . ARG B  1 207 ? 1.277   -11.681 28.761  1.00 132.70 ? 207  ARG B NH1 1 
ATOM   5894  N NH2 . ARG B  1 207 ? 0.306   -11.532 26.687  1.00 136.92 ? 207  ARG B NH2 1 
ATOM   5895  N N   . GLU B  1 208 ? 6.889   -7.267  29.384  1.00 49.48  ? 208  GLU B N   1 
ATOM   5896  C CA  . GLU B  1 208 ? 7.618   -7.336  30.655  1.00 49.73  ? 208  GLU B CA  1 
ATOM   5897  C C   . GLU B  1 208 ? 8.377   -6.078  31.078  1.00 57.87  ? 208  GLU B C   1 
ATOM   5898  O O   . GLU B  1 208 ? 9.005   -6.067  32.157  1.00 58.07  ? 208  GLU B O   1 
ATOM   5899  C CB  . GLU B  1 208 ? 8.485   -8.616  30.751  1.00 50.30  ? 208  GLU B CB  1 
ATOM   5900  C CG  . GLU B  1 208 ? 7.702   -9.881  31.106  1.00 57.39  ? 208  GLU B CG  1 
ATOM   5901  C CD  . GLU B  1 208 ? 6.959   -9.891  32.435  1.00 80.16  ? 208  GLU B CD  1 
ATOM   5902  O OE1 . GLU B  1 208 ? 7.493   -9.344  33.426  1.00 83.02  ? 208  GLU B OE1 1 
ATOM   5903  O OE2 . GLU B  1 208 ? 5.829   -10.429 32.483  1.00 79.47  ? 208  GLU B OE2 1 
ATOM   5904  N N   . CYS B  1 209 ? 8.318   -5.015  30.241  1.00 56.13  ? 209  CYS B N   1 
ATOM   5905  C CA  . CYS B  1 209 ? 9.022   -3.767  30.539  1.00 55.42  ? 209  CYS B CA  1 
ATOM   5906  C C   . CYS B  1 209 ? 8.202   -2.935  31.437  1.00 58.55  ? 209  CYS B C   1 
ATOM   5907  O O   . CYS B  1 209 ? 7.010   -2.749  31.187  1.00 59.80  ? 209  CYS B O   1 
ATOM   5908  C CB  . CYS B  1 209 ? 9.415   -2.992  29.276  1.00 56.47  ? 209  CYS B CB  1 
ATOM   5909  S SG  . CYS B  1 209 ? 10.668  -3.801  28.230  1.00 60.50  ? 209  CYS B SG  1 
ATOM   5910  N N   . ALA B  1 210 ? 8.833   -2.429  32.488  1.00 54.16  ? 210  ALA B N   1 
ATOM   5911  C CA  . ALA B  1 210 ? 8.213   -1.486  33.413  1.00 54.38  ? 210  ALA B CA  1 
ATOM   5912  C C   . ALA B  1 210 ? 8.954   -0.195  33.160  1.00 58.41  ? 210  ALA B C   1 
ATOM   5913  O O   . ALA B  1 210 ? 10.149  -0.247  32.849  1.00 59.91  ? 210  ALA B O   1 
ATOM   5914  C CB  . ALA B  1 210 ? 8.403   -1.943  34.844  1.00 54.62  ? 210  ALA B CB  1 
ATOM   5915  N N   . GLY B  1 211 ? 8.250   0.927   33.175  1.00 54.34  ? 211  GLY B N   1 
ATOM   5916  C CA  . GLY B  1 211 ? 8.844   2.235   32.892  1.00 55.63  ? 211  GLY B CA  1 
ATOM   5917  C C   . GLY B  1 211 ? 8.847   2.610   31.419  1.00 63.23  ? 211  GLY B C   1 
ATOM   5918  O O   . GLY B  1 211 ? 8.298   3.645   31.023  1.00 64.81  ? 211  GLY B O   1 
ATOM   5919  N N   . GLY B  1 212 ? 9.444   1.747   30.612  1.00 59.81  ? 212  GLY B N   1 
ATOM   5920  C CA  . GLY B  1 212 ? 9.564   1.902   29.169  1.00 60.05  ? 212  GLY B CA  1 
ATOM   5921  C C   . GLY B  1 212 ? 10.701  1.069   28.621  1.00 62.06  ? 212  GLY B C   1 
ATOM   5922  O O   . GLY B  1 212 ? 11.169  0.133   29.289  1.00 61.53  ? 212  GLY B O   1 
ATOM   5923  N N   . CYS B  1 213 ? 11.155  1.414   27.405  1.00 56.70  ? 213  CYS B N   1 
ATOM   5924  C CA  . CYS B  1 213 ? 12.237  0.707   26.749  1.00 56.15  ? 213  CYS B CA  1 
ATOM   5925  C C   . CYS B  1 213 ? 12.942  1.546   25.717  1.00 61.15  ? 213  CYS B C   1 
ATOM   5926  O O   . CYS B  1 213 ? 12.554  2.658   25.404  1.00 61.84  ? 213  CYS B O   1 
ATOM   5927  C CB  . CYS B  1 213 ? 11.734  -0.589  26.136  1.00 57.64  ? 213  CYS B CB  1 
ATOM   5928  S SG  . CYS B  1 213 ? 10.498  -0.339  24.841  1.00 63.37  ? 213  CYS B SG  1 
ATOM   5929  N N   . SER B  1 214 ? 13.992  0.979   25.161  1.00 59.90  ? 214  SER B N   1 
ATOM   5930  C CA  . SER B  1 214 ? 14.838  1.578   24.123  1.00 59.49  ? 214  SER B CA  1 
ATOM   5931  C C   . SER B  1 214 ? 14.789  0.721   22.863  1.00 63.42  ? 214  SER B C   1 
ATOM   5932  O O   . SER B  1 214 ? 15.474  1.031   21.897  1.00 65.00  ? 214  SER B O   1 
ATOM   5933  C CB  . SER B  1 214 ? 16.272  1.656   24.616  1.00 59.05  ? 214  SER B CB  1 
ATOM   5934  O OG  . SER B  1 214 ? 16.602  0.391   25.160  1.00 65.91  ? 214  SER B OG  1 
ATOM   5935  N N   . GLY B  1 215 ? 13.978  -0.337  22.888  1.00 57.80  ? 215  GLY B N   1 
ATOM   5936  C CA  . GLY B  1 215 ? 13.820  -1.274  21.791  1.00 57.48  ? 215  GLY B CA  1 
ATOM   5937  C C   . GLY B  1 215 ? 12.774  -2.314  22.086  1.00 62.70  ? 215  GLY B C   1 
ATOM   5938  O O   . GLY B  1 215 ? 12.215  -2.326  23.187  1.00 63.62  ? 215  GLY B O   1 
ATOM   5939  N N   . PRO B  1 216 ? 12.495  -3.211  21.120  1.00 59.31  ? 216  PRO B N   1 
ATOM   5940  C CA  . PRO B  1 216 ? 11.404  -4.187  21.306  1.00 58.75  ? 216  PRO B CA  1 
ATOM   5941  C C   . PRO B  1 216 ? 11.618  -5.400  22.219  1.00 60.21  ? 216  PRO B C   1 
ATOM   5942  O O   . PRO B  1 216 ? 10.646  -6.000  22.688  1.00 59.73  ? 216  PRO B O   1 
ATOM   5943  C CB  . PRO B  1 216 ? 11.107  -4.621  19.874  1.00 62.03  ? 216  PRO B CB  1 
ATOM   5944  C CG  . PRO B  1 216 ? 12.400  -4.497  19.166  1.00 66.22  ? 216  PRO B CG  1 
ATOM   5945  C CD  . PRO B  1 216 ? 13.063  -3.296  19.756  1.00 61.46  ? 216  PRO B CD  1 
ATOM   5946  N N   . LYS B  1 217 ? 12.872  -5.787  22.430  1.00 56.51  ? 217  LYS B N   1 
ATOM   5947  C CA  . LYS B  1 217 ? 13.239  -6.978  23.195  1.00 55.19  ? 217  LYS B CA  1 
ATOM   5948  C C   . LYS B  1 217 ? 13.053  -6.842  24.694  1.00 58.96  ? 217  LYS B C   1 
ATOM   5949  O O   . LYS B  1 217 ? 12.965  -5.722  25.192  1.00 56.96  ? 217  LYS B O   1 
ATOM   5950  C CB  . LYS B  1 217 ? 14.655  -7.420  22.808  1.00 57.36  ? 217  LYS B CB  1 
ATOM   5951  C CG  . LYS B  1 217 ? 14.842  -7.735  21.286  1.00 58.47  ? 217  LYS B CG  1 
ATOM   5952  C CD  . LYS B  1 217 ? 16.304  -7.940  20.994  1.00 64.50  ? 217  LYS B CD  1 
ATOM   5953  C CE  . LYS B  1 217 ? 16.657  -8.488  19.657  1.00 75.52  ? 217  LYS B CE  1 
ATOM   5954  N NZ  . LYS B  1 217 ? 18.124  -8.812  19.637  1.00 76.60  ? 217  LYS B NZ  1 
ATOM   5955  N N   . ASP B  1 218 ? 12.940  -7.990  25.419  1.00 58.47  ? 218  ASP B N   1 
ATOM   5956  C CA  . ASP B  1 218 ? 12.794  -8.031  26.898  1.00 56.91  ? 218  ASP B CA  1 
ATOM   5957  C C   . ASP B  1 218 ? 14.109  -7.633  27.632  1.00 60.86  ? 218  ASP B C   1 
ATOM   5958  O O   . ASP B  1 218 ? 14.159  -7.498  28.857  1.00 60.26  ? 218  ASP B O   1 
ATOM   5959  C CB  . ASP B  1 218 ? 12.226  -9.375  27.400  1.00 57.50  ? 218  ASP B CB  1 
ATOM   5960  C CG  . ASP B  1 218 ? 13.019  -10.643 27.092  1.00 65.62  ? 218  ASP B CG  1 
ATOM   5961  O OD1 . ASP B  1 218 ? 14.231  -10.537 26.798  1.00 63.52  ? 218  ASP B OD1 1 
ATOM   5962  O OD2 . ASP B  1 218 ? 12.439  -11.752 27.215  1.00 73.24  ? 218  ASP B OD2 1 
ATOM   5963  N N   . THR B  1 219 ? 15.148  -7.390  26.856  1.00 57.85  ? 219  THR B N   1 
ATOM   5964  C CA  . THR B  1 219 ? 16.436  -6.971  27.361  1.00 57.44  ? 219  THR B CA  1 
ATOM   5965  C C   . THR B  1 219 ? 16.600  -5.452  27.194  1.00 63.43  ? 219  THR B C   1 
ATOM   5966  O O   . THR B  1 219 ? 17.583  -4.889  27.674  1.00 64.08  ? 219  THR B O   1 
ATOM   5967  C CB  . THR B  1 219 ? 17.522  -7.803  26.678  1.00 57.91  ? 219  THR B CB  1 
ATOM   5968  O OG1 . THR B  1 219 ? 17.302  -7.788  25.277  1.00 57.95  ? 219  THR B OG1 1 
ATOM   5969  C CG2 . THR B  1 219 ? 17.537  -9.247  27.158  1.00 52.11  ? 219  THR B CG2 1 
ATOM   5970  N N   . ASP B  1 220 ? 15.619  -4.799  26.532  1.00 59.88  ? 220  ASP B N   1 
ATOM   5971  C CA  . ASP B  1 220 ? 15.590  -3.362  26.239  1.00 59.38  ? 220  ASP B CA  1 
ATOM   5972  C C   . ASP B  1 220 ? 14.784  -2.534  27.239  1.00 65.25  ? 220  ASP B C   1 
ATOM   5973  O O   . ASP B  1 220 ? 14.587  -1.352  26.981  1.00 67.81  ? 220  ASP B O   1 
ATOM   5974  C CB  . ASP B  1 220 ? 15.033  -3.121  24.826  1.00 61.23  ? 220  ASP B CB  1 
ATOM   5975  C CG  . ASP B  1 220 ? 15.883  -3.719  23.719  1.00 69.85  ? 220  ASP B CG  1 
ATOM   5976  O OD1 . ASP B  1 220 ? 17.140  -3.801  23.901  1.00 72.23  ? 220  ASP B OD1 1 
ATOM   5977  O OD2 . ASP B  1 220 ? 15.304  -4.106  22.666  1.00 64.21  ? 220  ASP B OD2 1 
ATOM   5978  N N   . CYS B  1 221 ? 14.358  -3.122  28.391  1.00 58.35  ? 221  CYS B N   1 
ATOM   5979  C CA  . CYS B  1 221 ? 13.510  -2.472  29.403  1.00 55.28  ? 221  CYS B CA  1 
ATOM   5980  C C   . CYS B  1 221 ? 14.232  -1.468  30.215  1.00 53.30  ? 221  CYS B C   1 
ATOM   5981  O O   . CYS B  1 221 ? 15.386  -1.669  30.459  1.00 51.49  ? 221  CYS B O   1 
ATOM   5982  C CB  . CYS B  1 221 ? 12.868  -3.512  30.318  1.00 55.04  ? 221  CYS B CB  1 
ATOM   5983  S SG  . CYS B  1 221 ? 11.920  -4.796  29.465  1.00 59.27  ? 221  CYS B SG  1 
ATOM   5984  N N   . PHE B  1 222 ? 13.530  -0.467  30.763  1.00 50.17  ? 222  PHE B N   1 
ATOM   5985  C CA  . PHE B  1 222 ? 14.096  0.482   31.711  1.00 49.32  ? 222  PHE B CA  1 
ATOM   5986  C C   . PHE B  1 222 ? 14.073  -0.168  33.089  1.00 54.78  ? 222  PHE B C   1 
ATOM   5987  O O   . PHE B  1 222 ? 14.963  0.071   33.906  1.00 55.59  ? 222  PHE B O   1 
ATOM   5988  C CB  . PHE B  1 222 ? 13.276  1.760   31.752  1.00 51.07  ? 222  PHE B CB  1 
ATOM   5989  C CG  . PHE B  1 222 ? 13.361  2.604   30.510  1.00 53.46  ? 222  PHE B CG  1 
ATOM   5990  C CD1 . PHE B  1 222 ? 12.400  3.557   30.239  1.00 56.65  ? 222  PHE B CD1 1 
ATOM   5991  C CD2 . PHE B  1 222 ? 14.429  2.470   29.622  1.00 55.51  ? 222  PHE B CD2 1 
ATOM   5992  C CE1 . PHE B  1 222 ? 12.473  4.320   29.078  1.00 58.00  ? 222  PHE B CE1 1 
ATOM   5993  C CE2 . PHE B  1 222 ? 14.504  3.246   28.465  1.00 57.28  ? 222  PHE B CE2 1 
ATOM   5994  C CZ  . PHE B  1 222 ? 13.536  4.166   28.208  1.00 55.69  ? 222  PHE B CZ  1 
ATOM   5995  N N   . ALA B  1 223 ? 13.045  -0.984  33.348  1.00 51.28  ? 223  ALA B N   1 
ATOM   5996  C CA  . ALA B  1 223 ? 12.886  -1.729  34.592  1.00 51.25  ? 223  ALA B CA  1 
ATOM   5997  C C   . ALA B  1 223 ? 12.087  -2.997  34.318  1.00 55.99  ? 223  ALA B C   1 
ATOM   5998  O O   . ALA B  1 223 ? 11.402  -3.074  33.294  1.00 56.21  ? 223  ALA B O   1 
ATOM   5999  C CB  . ALA B  1 223 ? 12.186  -0.878  35.632  1.00 52.07  ? 223  ALA B CB  1 
ATOM   6000  N N   . CYS B  1 224 ? 12.181  -3.993  35.212  1.00 53.06  ? 224  CYS B N   1 
ATOM   6001  C CA  . CYS B  1 224 ? 11.433  -5.226  34.993  1.00 54.55  ? 224  CYS B CA  1 
ATOM   6002  C C   . CYS B  1 224 ? 10.084  -5.193  35.720  1.00 57.35  ? 224  CYS B C   1 
ATOM   6003  O O   . CYS B  1 224 ? 9.968   -4.663  36.823  1.00 56.38  ? 224  CYS B O   1 
ATOM   6004  C CB  . CYS B  1 224 ? 12.252  -6.454  35.380  1.00 55.49  ? 224  CYS B CB  1 
ATOM   6005  S SG  . CYS B  1 224 ? 13.706  -6.760  34.330  1.00 60.11  ? 224  CYS B SG  1 
ATOM   6006  N N   . MET B  1 225 ? 9.069   -5.740  35.094  1.00 52.71  ? 225  MET B N   1 
ATOM   6007  C CA  . MET B  1 225 ? 7.746   -5.812  35.687  1.00 52.50  ? 225  MET B CA  1 
ATOM   6008  C C   . MET B  1 225 ? 7.761   -6.840  36.793  1.00 59.11  ? 225  MET B C   1 
ATOM   6009  O O   . MET B  1 225 ? 7.069   -6.670  37.815  1.00 59.07  ? 225  MET B O   1 
ATOM   6010  C CB  . MET B  1 225 ? 6.736   -6.299  34.628  1.00 55.04  ? 225  MET B CB  1 
ATOM   6011  C CG  . MET B  1 225 ? 6.169   -5.210  33.793  1.00 58.83  ? 225  MET B CG  1 
ATOM   6012  S SD  . MET B  1 225 ? 5.158   -4.129  34.822  1.00 62.81  ? 225  MET B SD  1 
ATOM   6013  C CE  . MET B  1 225 ? 3.712   -5.137  35.020  1.00 59.31  ? 225  MET B CE  1 
ATOM   6014  N N   . ASN B  1 226 ? 8.542   -7.938  36.549  1.00 55.55  ? 226  ASN B N   1 
ATOM   6015  C CA  . ASN B  1 226 ? 8.637   -9.114  37.399  1.00 54.38  ? 226  ASN B CA  1 
ATOM   6016  C C   . ASN B  1 226 ? 10.022  -9.456  37.840  1.00 55.76  ? 226  ASN B C   1 
ATOM   6017  O O   . ASN B  1 226 ? 10.473  -8.826  38.803  1.00 54.70  ? 226  ASN B O   1 
ATOM   6018  C CB  . ASN B  1 226 ? 7.844   -10.290 36.808  1.00 56.51  ? 226  ASN B CB  1 
ATOM   6019  C CG  . ASN B  1 226 ? 6.367   -9.985  36.860  1.00 71.76  ? 226  ASN B CG  1 
ATOM   6020  O OD1 . ASN B  1 226 ? 5.794   -9.856  37.949  1.00 56.56  ? 226  ASN B OD1 1 
ATOM   6021  N ND2 . ASN B  1 226 ? 5.770   -9.659  35.705  1.00 66.15  ? 226  ASN B ND2 1 
ATOM   6022  N N   . PHE B  1 227 ? 10.703  -10.439 37.176  1.00 51.68  ? 227  PHE B N   1 
ATOM   6023  C CA  . PHE B  1 227 ? 12.085  -10.833 37.530  1.00 50.00  ? 227  PHE B CA  1 
ATOM   6024  C C   . PHE B  1 227 ? 13.078  -10.606 36.427  1.00 49.82  ? 227  PHE B C   1 
ATOM   6025  O O   . PHE B  1 227 ? 12.725  -10.607 35.252  1.00 49.07  ? 227  PHE B O   1 
ATOM   6026  C CB  . PHE B  1 227 ? 12.186  -12.296 37.980  1.00 52.00  ? 227  PHE B CB  1 
ATOM   6027  C CG  . PHE B  1 227 ? 11.114  -12.745 38.945  1.00 54.28  ? 227  PHE B CG  1 
ATOM   6028  C CD1 . PHE B  1 227 ? 10.004  -13.439 38.499  1.00 56.47  ? 227  PHE B CD1 1 
ATOM   6029  C CD2 . PHE B  1 227 ? 11.239  -12.509 40.307  1.00 57.43  ? 227  PHE B CD2 1 
ATOM   6030  C CE1 . PHE B  1 227 ? 9.062   -13.913 39.399  1.00 57.60  ? 227  PHE B CE1 1 
ATOM   6031  C CE2 . PHE B  1 227 ? 10.255  -12.937 41.202  1.00 58.79  ? 227  PHE B CE2 1 
ATOM   6032  C CZ  . PHE B  1 227 ? 9.199   -13.664 40.749  1.00 56.26  ? 227  PHE B CZ  1 
ATOM   6033  N N   . ASN B  1 228 ? 14.338  -10.464 36.817  1.00 44.34  ? 228  ASN B N   1 
ATOM   6034  C CA  . ASN B  1 228 ? 15.448  -10.282 35.900  1.00 43.35  ? 228  ASN B CA  1 
ATOM   6035  C C   . ASN B  1 228 ? 16.241  -11.574 35.845  1.00 49.05  ? 228  ASN B C   1 
ATOM   6036  O O   . ASN B  1 228 ? 16.712  -12.059 36.886  1.00 49.26  ? 228  ASN B O   1 
ATOM   6037  C CB  . ASN B  1 228 ? 16.301  -9.093  36.345  1.00 38.76  ? 228  ASN B CB  1 
ATOM   6038  C CG  . ASN B  1 228 ? 17.401  -8.725  35.421  1.00 68.72  ? 228  ASN B CG  1 
ATOM   6039  O OD1 . ASN B  1 228 ? 17.997  -9.578  34.751  1.00 63.91  ? 228  ASN B OD1 1 
ATOM   6040  N ND2 . ASN B  1 228 ? 17.712  -7.440  35.398  1.00 78.88  ? 228  ASN B ND2 1 
ATOM   6041  N N   . ASP B  1 229 ? 16.318  -12.173 34.648  1.00 47.54  ? 229  ASP B N   1 
ATOM   6042  C CA  . ASP B  1 229 ? 17.070  -13.412 34.368  1.00 48.64  ? 229  ASP B CA  1 
ATOM   6043  C C   . ASP B  1 229 ? 18.200  -13.101 33.363  1.00 56.65  ? 229  ASP B C   1 
ATOM   6044  O O   . ASP B  1 229 ? 18.009  -13.171 32.131  1.00 56.91  ? 229  ASP B O   1 
ATOM   6045  C CB  . ASP B  1 229 ? 16.154  -14.534 33.828  1.00 50.01  ? 229  ASP B CB  1 
ATOM   6046  C CG  . ASP B  1 229 ? 16.875  -15.845 33.453  1.00 59.25  ? 229  ASP B CG  1 
ATOM   6047  O OD1 . ASP B  1 229 ? 18.043  -16.034 33.878  1.00 58.10  ? 229  ASP B OD1 1 
ATOM   6048  O OD2 . ASP B  1 229 ? 16.247  -16.705 32.781  1.00 65.70  ? 229  ASP B OD2 1 
ATOM   6049  N N   . SER B  1 230 ? 19.364  -12.732 33.900  1.00 54.99  ? 230  SER B N   1 
ATOM   6050  C CA  . SER B  1 230 ? 20.535  -12.386 33.101  1.00 55.88  ? 230  SER B CA  1 
ATOM   6051  C C   . SER B  1 230 ? 20.225  -11.293 32.063  1.00 59.31  ? 230  SER B C   1 
ATOM   6052  O O   . SER B  1 230 ? 20.543  -11.424 30.884  1.00 60.97  ? 230  SER B O   1 
ATOM   6053  C CB  . SER B  1 230 ? 21.146  -13.635 32.460  1.00 61.62  ? 230  SER B CB  1 
ATOM   6054  O OG  . SER B  1 230 ? 21.315  -14.694 33.390  1.00 76.69  ? 230  SER B OG  1 
ATOM   6055  N N   . GLY B  1 231 ? 19.588  -10.232 32.521  1.00 53.75  ? 231  GLY B N   1 
ATOM   6056  C CA  . GLY B  1 231 ? 19.290  -9.070  31.694  1.00 53.10  ? 231  GLY B CA  1 
ATOM   6057  C C   . GLY B  1 231 ? 17.938  -9.068  31.036  1.00 55.35  ? 231  GLY B C   1 
ATOM   6058  O O   . GLY B  1 231 ? 17.494  -8.020  30.563  1.00 56.04  ? 231  GLY B O   1 
ATOM   6059  N N   . ALA B  1 232 ? 17.279  -10.223 30.999  1.00 50.40  ? 232  ALA B N   1 
ATOM   6060  C CA  . ALA B  1 232 ? 15.950  -10.393 30.416  1.00 49.64  ? 232  ALA B CA  1 
ATOM   6061  C C   . ALA B  1 232 ? 14.890  -10.227 31.479  1.00 53.68  ? 232  ALA B C   1 
ATOM   6062  O O   . ALA B  1 232 ? 14.972  -10.853 32.520  1.00 53.56  ? 232  ALA B O   1 
ATOM   6063  C CB  . ALA B  1 232 ? 15.826  -11.785 29.820  1.00 50.47  ? 232  ALA B CB  1 
ATOM   6064  N N   . CYS B  1 233 ? 13.889  -9.414  31.220  1.00 51.76  ? 233  CYS B N   1 
ATOM   6065  C CA  . CYS B  1 233 ? 12.753  -9.289  32.093  1.00 53.05  ? 233  CYS B CA  1 
ATOM   6066  C C   . CYS B  1 233 ? 11.784  -10.448 31.702  1.00 58.26  ? 233  CYS B C   1 
ATOM   6067  O O   . CYS B  1 233 ? 11.356  -10.593 30.542  1.00 59.54  ? 233  CYS B O   1 
ATOM   6068  C CB  . CYS B  1 233 ? 12.132  -7.911  31.944  1.00 55.58  ? 233  CYS B CB  1 
ATOM   6069  S SG  . CYS B  1 233 ? 13.282  -6.558  32.331  1.00 60.66  ? 233  CYS B SG  1 
ATOM   6070  N N   . VAL B  1 234 ? 11.593  -11.364 32.655  1.00 52.83  ? 234  VAL B N   1 
ATOM   6071  C CA  . VAL B  1 234 ? 10.814  -12.597 32.531  1.00 51.37  ? 234  VAL B CA  1 
ATOM   6072  C C   . VAL B  1 234 ? 9.700   -12.513 33.539  1.00 55.59  ? 234  VAL B C   1 
ATOM   6073  O O   . VAL B  1 234 ? 9.847   -11.789 34.538  1.00 55.72  ? 234  VAL B O   1 
ATOM   6074  C CB  . VAL B  1 234 ? 11.716  -13.870 32.761  1.00 53.48  ? 234  VAL B CB  1 
ATOM   6075  C CG1 . VAL B  1 234 ? 12.770  -14.009 31.679  1.00 52.97  ? 234  VAL B CG1 1 
ATOM   6076  C CG2 . VAL B  1 234 ? 12.386  -13.885 34.135  1.00 52.24  ? 234  VAL B CG2 1 
ATOM   6077  N N   . THR B  1 235 ? 8.597   -13.244 33.311  1.00 52.39  ? 235  THR B N   1 
ATOM   6078  C CA  . THR B  1 235 ? 7.472   -13.248 34.270  1.00 52.42  ? 235  THR B CA  1 
ATOM   6079  C C   . THR B  1 235 ? 7.745   -14.197 35.436  1.00 58.15  ? 235  THR B C   1 
ATOM   6080  O O   . THR B  1 235 ? 7.280   -13.926 36.553  1.00 58.81  ? 235  THR B O   1 
ATOM   6081  C CB  . THR B  1 235 ? 6.154   -13.673 33.597  1.00 57.07  ? 235  THR B CB  1 
ATOM   6082  O OG1 . THR B  1 235 ? 6.077   -13.150 32.272  1.00 59.03  ? 235  THR B OG1 1 
ATOM   6083  C CG2 . THR B  1 235 ? 4.932   -13.252 34.386  1.00 55.65  ? 235  THR B CG2 1 
ATOM   6084  N N   . GLN B  1 236 ? 8.444   -15.345 35.132  1.00 53.49  ? 236  GLN B N   1 
ATOM   6085  C CA  . GLN B  1 236 ? 8.776   -16.516 35.953  1.00 51.78  ? 236  GLN B CA  1 
ATOM   6086  C C   . GLN B  1 236 ? 10.216  -16.950 35.703  1.00 59.30  ? 236  GLN B C   1 
ATOM   6087  O O   . GLN B  1 236 ? 10.712  -16.800 34.584  1.00 60.72  ? 236  GLN B O   1 
ATOM   6088  C CB  . GLN B  1 236 ? 7.913   -17.713 35.486  1.00 52.57  ? 236  GLN B CB  1 
ATOM   6089  C CG  . GLN B  1 236 ? 6.458   -17.423 35.220  1.00 72.09  ? 236  GLN B CG  1 
ATOM   6090  C CD  . GLN B  1 236 ? 6.116   -17.357 33.753  1.00 104.80 ? 236  GLN B CD  1 
ATOM   6091  O OE1 . GLN B  1 236 ? 6.843   -16.772 32.937  1.00 97.55  ? 236  GLN B OE1 1 
ATOM   6092  N NE2 . GLN B  1 236 ? 4.967   -17.938 33.389  1.00 108.02 ? 236  GLN B NE2 1 
ATOM   6093  N N   . CYS B  1 237 ? 10.870  -17.601 36.660  1.00 57.26  ? 237  CYS B N   1 
ATOM   6094  C CA  . CYS B  1 237 ? 12.211  -18.098 36.294  1.00 58.33  ? 237  CYS B CA  1 
ATOM   6095  C C   . CYS B  1 237 ? 12.081  -19.470 35.614  1.00 62.49  ? 237  CYS B C   1 
ATOM   6096  O O   . CYS B  1 237 ? 11.051  -20.116 35.819  1.00 63.14  ? 237  CYS B O   1 
ATOM   6097  C CB  . CYS B  1 237 ? 13.134  -18.160 37.514  1.00 58.42  ? 237  CYS B CB  1 
ATOM   6098  S SG  . CYS B  1 237 ? 13.470  -16.537 38.264  1.00 61.78  ? 237  CYS B SG  1 
ATOM   6099  N N   . PRO B  1 238 ? 13.086  -19.950 34.829  1.00 57.94  ? 238  PRO B N   1 
ATOM   6100  C CA  . PRO B  1 238 ? 12.999  -21.334 34.286  1.00 56.84  ? 238  PRO B CA  1 
ATOM   6101  C C   . PRO B  1 238 ? 12.875  -22.340 35.432  1.00 58.33  ? 238  PRO B C   1 
ATOM   6102  O O   . PRO B  1 238 ? 13.703  -22.328 36.342  1.00 56.75  ? 238  PRO B O   1 
ATOM   6103  C CB  . PRO B  1 238 ? 14.330  -21.522 33.557  1.00 58.70  ? 238  PRO B CB  1 
ATOM   6104  C CG  . PRO B  1 238 ? 14.890  -20.151 33.395  1.00 63.37  ? 238  PRO B CG  1 
ATOM   6105  C CD  . PRO B  1 238 ? 14.375  -19.303 34.486  1.00 58.88  ? 238  PRO B CD  1 
ATOM   6106  N N   . GLN B  1 239 ? 11.790  -23.132 35.448  1.00 55.39  ? 239  GLN B N   1 
ATOM   6107  C CA  . GLN B  1 239 ? 11.510  -24.081 36.547  1.00 54.87  ? 239  GLN B CA  1 
ATOM   6108  C C   . GLN B  1 239 ? 12.362  -25.329 36.396  1.00 55.86  ? 239  GLN B C   1 
ATOM   6109  O O   . GLN B  1 239 ? 12.906  -25.576 35.319  1.00 52.57  ? 239  GLN B O   1 
ATOM   6110  C CB  . GLN B  1 239 ? 9.989   -24.430 36.711  1.00 57.76  ? 239  GLN B CB  1 
ATOM   6111  C CG  . GLN B  1 239 ? 9.002   -23.271 36.492  1.00 96.22  ? 239  GLN B CG  1 
ATOM   6112  C CD  . GLN B  1 239 ? 8.848   -22.801 35.036  1.00 140.26 ? 239  GLN B CD  1 
ATOM   6113  O OE1 . GLN B  1 239 ? 9.370   -23.402 34.065  1.00 139.34 ? 239  GLN B OE1 1 
ATOM   6114  N NE2 . GLN B  1 239 ? 8.159   -21.675 34.857  1.00 135.72 ? 239  GLN B NE2 1 
ATOM   6115  N N   . THR B  1 240 ? 12.500  -26.099 37.496  1.00 54.90  ? 240  THR B N   1 
ATOM   6116  C CA  . THR B  1 240 ? 13.326  -27.312 37.560  1.00 56.26  ? 240  THR B CA  1 
ATOM   6117  C C   . THR B  1 240 ? 12.764  -28.419 36.711  1.00 59.88  ? 240  THR B C   1 
ATOM   6118  O O   . THR B  1 240 ? 13.524  -29.224 36.175  1.00 59.57  ? 240  THR B O   1 
ATOM   6119  C CB  . THR B  1 240 ? 13.643  -27.708 39.024  1.00 70.66  ? 240  THR B CB  1 
ATOM   6120  O OG1 . THR B  1 240 ? 12.458  -27.610 39.826  1.00 67.81  ? 240  THR B OG1 1 
ATOM   6121  C CG2 . THR B  1 240 ? 14.716  -26.830 39.633  1.00 70.99  ? 240  THR B CG2 1 
ATOM   6122  N N   . PHE B  1 241 ? 11.435  -28.429 36.572  1.00 56.10  ? 241  PHE B N   1 
ATOM   6123  C CA  . PHE B  1 241 ? 10.718  -29.379 35.756  1.00 57.39  ? 241  PHE B CA  1 
ATOM   6124  C C   . PHE B  1 241 ? 10.055  -28.749 34.591  1.00 57.15  ? 241  PHE B C   1 
ATOM   6125  O O   . PHE B  1 241 ? 9.615   -27.603 34.664  1.00 60.59  ? 241  PHE B O   1 
ATOM   6126  C CB  . PHE B  1 241 ? 9.746   -30.200 36.591  1.00 61.73  ? 241  PHE B CB  1 
ATOM   6127  C CG  . PHE B  1 241 ? 10.528  -31.159 37.453  1.00 65.71  ? 241  PHE B CG  1 
ATOM   6128  C CD1 . PHE B  1 241 ? 10.557  -31.009 38.832  1.00 70.28  ? 241  PHE B CD1 1 
ATOM   6129  C CD2 . PHE B  1 241 ? 11.317  -32.157 36.875  1.00 69.82  ? 241  PHE B CD2 1 
ATOM   6130  C CE1 . PHE B  1 241 ? 11.325  -31.864 39.623  1.00 72.24  ? 241  PHE B CE1 1 
ATOM   6131  C CE2 . PHE B  1 241 ? 12.095  -33.003 37.662  1.00 72.91  ? 241  PHE B CE2 1 
ATOM   6132  C CZ  . PHE B  1 241 ? 12.100  -32.848 39.029  1.00 71.37  ? 241  PHE B CZ  1 
ATOM   6133  N N   . VAL B  1 242 ? 9.980   -29.491 33.512  1.00 47.39  ? 242  VAL B N   1 
ATOM   6134  C CA  . VAL B  1 242 ? 9.379   -29.041 32.274  1.00 46.19  ? 242  VAL B CA  1 
ATOM   6135  C C   . VAL B  1 242 ? 8.435   -30.143 31.695  1.00 52.34  ? 242  VAL B C   1 
ATOM   6136  O O   . VAL B  1 242 ? 8.859   -31.295 31.555  1.00 54.27  ? 242  VAL B O   1 
ATOM   6137  C CB  . VAL B  1 242 ? 10.524  -28.600 31.355  1.00 47.56  ? 242  VAL B CB  1 
ATOM   6138  C CG1 . VAL B  1 242 ? 10.257  -28.895 29.891  1.00 48.14  ? 242  VAL B CG1 1 
ATOM   6139  C CG2 . VAL B  1 242 ? 10.806  -27.131 31.571  1.00 46.02  ? 242  VAL B CG2 1 
ATOM   6140  N N   . TYR B  1 243 ? 7.143   -29.830 31.471  1.00 44.82  ? 243  TYR B N   1 
ATOM   6141  C CA  . TYR B  1 243 ? 6.224   -30.845 30.965  1.00 43.46  ? 243  TYR B CA  1 
ATOM   6142  C C   . TYR B  1 243 ? 6.514   -31.207 29.515  1.00 51.11  ? 243  TYR B C   1 
ATOM   6143  O O   . TYR B  1 243 ? 6.802   -30.336 28.685  1.00 49.87  ? 243  TYR B O   1 
ATOM   6144  C CB  . TYR B  1 243 ? 4.808   -30.359 31.112  1.00 42.63  ? 243  TYR B CB  1 
ATOM   6145  C CG  . TYR B  1 243 ? 3.726   -31.352 30.793  1.00 44.36  ? 243  TYR B CG  1 
ATOM   6146  C CD1 . TYR B  1 243 ? 3.132   -32.112 31.801  1.00 45.79  ? 243  TYR B CD1 1 
ATOM   6147  C CD2 . TYR B  1 243 ? 3.181   -31.429 29.514  1.00 46.18  ? 243  TYR B CD2 1 
ATOM   6148  C CE1 . TYR B  1 243 ? 2.030   -32.928 31.541  1.00 43.52  ? 243  TYR B CE1 1 
ATOM   6149  C CE2 . TYR B  1 243 ? 2.083   -32.248 29.242  1.00 47.94  ? 243  TYR B CE2 1 
ATOM   6150  C CZ  . TYR B  1 243 ? 1.518   -32.997 30.259  1.00 50.19  ? 243  TYR B CZ  1 
ATOM   6151  O OH  . TYR B  1 243 ? 0.509   -33.860 29.972  1.00 54.53  ? 243  TYR B OH  1 
ATOM   6152  N N   . ASN B  1 244 ? 6.445   -32.517 29.219  1.00 51.25  ? 244  ASN B N   1 
ATOM   6153  C CA  . ASN B  1 244 ? 6.642   -33.036 27.874  1.00 52.44  ? 244  ASN B CA  1 
ATOM   6154  C C   . ASN B  1 244 ? 5.302   -33.369 27.242  1.00 58.34  ? 244  ASN B C   1 
ATOM   6155  O O   . ASN B  1 244 ? 4.628   -34.312 27.674  1.00 58.51  ? 244  ASN B O   1 
ATOM   6156  C CB  . ASN B  1 244 ? 7.572   -34.215 27.850  1.00 52.77  ? 244  ASN B CB  1 
ATOM   6157  C CG  . ASN B  1 244 ? 8.133   -34.367 26.480  1.00 73.72  ? 244  ASN B CG  1 
ATOM   6158  O OD1 . ASN B  1 244 ? 7.709   -35.224 25.703  1.00 58.08  ? 244  ASN B OD1 1 
ATOM   6159  N ND2 . ASN B  1 244 ? 8.948   -33.390 26.099  1.00 73.73  ? 244  ASN B ND2 1 
ATOM   6160  N N   . PRO B  1 245 ? 4.880   -32.568 26.241  1.00 55.00  ? 245  PRO B N   1 
ATOM   6161  C CA  . PRO B  1 245 ? 3.532   -32.748 25.678  1.00 55.28  ? 245  PRO B CA  1 
ATOM   6162  C C   . PRO B  1 245 ? 3.289   -34.053 24.992  1.00 60.74  ? 245  PRO B C   1 
ATOM   6163  O O   . PRO B  1 245 ? 2.139   -34.457 24.914  1.00 63.03  ? 245  PRO B O   1 
ATOM   6164  C CB  . PRO B  1 245 ? 3.391   -31.603 24.701  1.00 57.22  ? 245  PRO B CB  1 
ATOM   6165  C CG  . PRO B  1 245 ? 4.430   -30.614 25.106  1.00 60.78  ? 245  PRO B CG  1 
ATOM   6166  C CD  . PRO B  1 245 ? 5.557   -31.399 25.658  1.00 55.67  ? 245  PRO B CD  1 
ATOM   6167  N N   . THR B  1 246 ? 4.339   -34.702 24.468  1.00 57.31  ? 246  THR B N   1 
ATOM   6168  C CA  . THR B  1 246 ? 4.176   -35.989 23.761  1.00 57.89  ? 246  THR B CA  1 
ATOM   6169  C C   . THR B  1 246 ? 4.301   -37.175 24.676  1.00 63.69  ? 246  THR B C   1 
ATOM   6170  O O   . THR B  1 246 ? 3.702   -38.204 24.401  1.00 66.98  ? 246  THR B O   1 
ATOM   6171  C CB  . THR B  1 246 ? 5.003   -36.057 22.492  1.00 57.82  ? 246  THR B CB  1 
ATOM   6172  O OG1 . THR B  1 246 ? 6.296   -35.535 22.789  1.00 63.22  ? 246  THR B OG1 1 
ATOM   6173  C CG2 . THR B  1 246 ? 4.348   -35.259 21.307  1.00 52.60  ? 246  THR B CG2 1 
ATOM   6174  N N   . THR B  1 247 ? 5.021   -37.025 25.796  1.00 58.50  ? 247  THR B N   1 
ATOM   6175  C CA  . THR B  1 247 ? 5.165   -38.096 26.782  1.00 57.54  ? 247  THR B CA  1 
ATOM   6176  C C   . THR B  1 247 ? 4.231   -37.964 27.971  1.00 61.29  ? 247  THR B C   1 
ATOM   6177  O O   . THR B  1 247 ? 4.140   -38.915 28.745  1.00 63.47  ? 247  THR B O   1 
ATOM   6178  C CB  . THR B  1 247 ? 6.612   -38.289 27.233  1.00 64.21  ? 247  THR B CB  1 
ATOM   6179  O OG1 . THR B  1 247 ? 6.965   -37.397 28.284  1.00 63.74  ? 247  THR B OG1 1 
ATOM   6180  C CG2 . THR B  1 247 ? 7.594   -38.266 26.102  1.00 65.18  ? 247  THR B CG2 1 
ATOM   6181  N N   . PHE B  1 248 ? 3.566   -36.790 28.143  1.00 54.78  ? 248  PHE B N   1 
ATOM   6182  C CA  . PHE B  1 248 ? 2.640   -36.465 29.240  1.00 51.98  ? 248  PHE B CA  1 
ATOM   6183  C C   . PHE B  1 248 ? 3.310   -36.669 30.572  1.00 54.56  ? 248  PHE B C   1 
ATOM   6184  O O   . PHE B  1 248 ? 2.734   -37.286 31.472  1.00 54.33  ? 248  PHE B O   1 
ATOM   6185  C CB  . PHE B  1 248 ? 1.342   -37.275 29.141  1.00 54.08  ? 248  PHE B CB  1 
ATOM   6186  C CG  . PHE B  1 248 ? 0.492   -36.896 27.955  1.00 55.55  ? 248  PHE B CG  1 
ATOM   6187  C CD1 . PHE B  1 248 ? -0.600  -36.047 28.104  1.00 55.62  ? 248  PHE B CD1 1 
ATOM   6188  C CD2 . PHE B  1 248 ? 0.763   -37.407 26.688  1.00 57.32  ? 248  PHE B CD2 1 
ATOM   6189  C CE1 . PHE B  1 248 ? -1.386  -35.706 27.014  1.00 55.75  ? 248  PHE B CE1 1 
ATOM   6190  C CE2 . PHE B  1 248 ? -0.039  -37.062 25.600  1.00 59.45  ? 248  PHE B CE2 1 
ATOM   6191  C CZ  . PHE B  1 248 ? -1.096  -36.204 25.771  1.00 55.81  ? 248  PHE B CZ  1 
ATOM   6192  N N   . GLN B  1 249 ? 4.571   -36.236 30.665  1.00 50.42  ? 249  GLN B N   1 
ATOM   6193  C CA  . GLN B  1 249 ? 5.373   -36.372 31.886  1.00 49.43  ? 249  GLN B CA  1 
ATOM   6194  C C   . GLN B  1 249 ? 6.272   -35.164 32.065  1.00 50.98  ? 249  GLN B C   1 
ATOM   6195  O O   . GLN B  1 249 ? 6.639   -34.487 31.084  1.00 47.98  ? 249  GLN B O   1 
ATOM   6196  C CB  . GLN B  1 249 ? 6.261   -37.657 31.897  1.00 50.82  ? 249  GLN B CB  1 
ATOM   6197  C CG  . GLN B  1 249 ? 5.581   -38.978 31.552  1.00 49.02  ? 249  GLN B CG  1 
ATOM   6198  C CD  . GLN B  1 249 ? 4.768   -39.638 32.656  1.00 65.09  ? 249  GLN B CD  1 
ATOM   6199  O OE1 . GLN B  1 249 ? 4.158   -40.706 32.441  1.00 74.74  ? 249  GLN B OE1 1 
ATOM   6200  N NE2 . GLN B  1 249 ? 4.805   -39.103 33.872  1.00 27.77  ? 249  GLN B NE2 1 
ATOM   6201  N N   . LEU B  1 250 ? 6.675   -34.942 33.329  1.00 48.82  ? 250  LEU B N   1 
ATOM   6202  C CA  . LEU B  1 250 ? 7.611   -33.882 33.685  1.00 49.05  ? 250  LEU B CA  1 
ATOM   6203  C C   . LEU B  1 250 ? 9.022   -34.408 33.460  1.00 59.71  ? 250  LEU B C   1 
ATOM   6204  O O   . LEU B  1 250 ? 9.299   -35.596 33.696  1.00 61.76  ? 250  LEU B O   1 
ATOM   6205  C CB  . LEU B  1 250 ? 7.441   -33.454 35.138  1.00 47.22  ? 250  LEU B CB  1 
ATOM   6206  C CG  . LEU B  1 250 ? 6.180   -32.704 35.475  1.00 49.33  ? 250  LEU B CG  1 
ATOM   6207  C CD1 . LEU B  1 250 ? 6.013   -32.626 36.951  1.00 47.13  ? 250  LEU B CD1 1 
ATOM   6208  C CD2 . LEU B  1 250 ? 6.182   -31.325 34.852  1.00 51.25  ? 250  LEU B CD2 1 
ATOM   6209  N N   . GLU B  1 251 ? 9.888   -33.536 32.952  1.00 57.52  ? 251  GLU B N   1 
ATOM   6210  C CA  . GLU B  1 251 ? 11.285  -33.825 32.630  1.00 58.03  ? 251  GLU B CA  1 
ATOM   6211  C C   . GLU B  1 251 ? 12.151  -32.799 33.321  1.00 66.31  ? 251  GLU B C   1 
ATOM   6212  O O   . GLU B  1 251 ? 11.685  -31.705 33.624  1.00 65.41  ? 251  GLU B O   1 
ATOM   6213  C CB  . GLU B  1 251 ? 11.518  -33.764 31.113  1.00 59.36  ? 251  GLU B CB  1 
ATOM   6214  C CG  . GLU B  1 251 ? 10.857  -34.897 30.353  1.00 67.74  ? 251  GLU B CG  1 
ATOM   6215  C CD  . GLU B  1 251 ? 11.026  -34.900 28.842  1.00 97.41  ? 251  GLU B CD  1 
ATOM   6216  O OE1 . GLU B  1 251 ? 10.529  -35.856 28.205  1.00 97.27  ? 251  GLU B OE1 1 
ATOM   6217  O OE2 . GLU B  1 251 ? 11.631  -33.951 28.289  1.00 95.91  ? 251  GLU B OE2 1 
ATOM   6218  N N   . HIS B  1 252 ? 13.400  -33.141 33.574  1.00 67.91  ? 252  HIS B N   1 
ATOM   6219  C CA  . HIS B  1 252 ? 14.322  -32.221 34.198  1.00 69.61  ? 252  HIS B CA  1 
ATOM   6220  C C   . HIS B  1 252 ? 14.723  -31.131 33.266  1.00 71.61  ? 252  HIS B C   1 
ATOM   6221  O O   . HIS B  1 252 ? 15.042  -31.384 32.108  1.00 71.27  ? 252  HIS B O   1 
ATOM   6222  C CB  . HIS B  1 252 ? 15.574  -32.942 34.619  1.00 72.90  ? 252  HIS B CB  1 
ATOM   6223  C CG  . HIS B  1 252 ? 15.649  -33.099 36.081  1.00 78.02  ? 252  HIS B CG  1 
ATOM   6224  N ND1 . HIS B  1 252 ? 15.330  -34.301 36.688  1.00 81.82  ? 252  HIS B ND1 1 
ATOM   6225  C CD2 . HIS B  1 252 ? 15.955  -32.184 37.028  1.00 80.96  ? 252  HIS B CD2 1 
ATOM   6226  C CE1 . HIS B  1 252 ? 15.475  -34.093 37.987  1.00 81.71  ? 252  HIS B CE1 1 
ATOM   6227  N NE2 . HIS B  1 252 ? 15.841  -32.827 38.242  1.00 81.33  ? 252  HIS B NE2 1 
ATOM   6228  N N   . ASN B  1 253 ? 14.694  -29.912 33.767  1.00 67.35  ? 253  ASN B N   1 
ATOM   6229  C CA  . ASN B  1 253 ? 15.166  -28.775 33.015  1.00 67.21  ? 253  ASN B CA  1 
ATOM   6230  C C   . ASN B  1 253 ? 16.499  -28.512 33.640  1.00 75.50  ? 253  ASN B C   1 
ATOM   6231  O O   . ASN B  1 253 ? 16.615  -28.387 34.861  1.00 75.54  ? 253  ASN B O   1 
ATOM   6232  C CB  . ASN B  1 253 ? 14.243  -27.586 33.136  1.00 62.10  ? 253  ASN B CB  1 
ATOM   6233  C CG  . ASN B  1 253 ? 14.714  -26.368 32.370  1.00 72.71  ? 253  ASN B CG  1 
ATOM   6234  O OD1 . ASN B  1 253 ? 15.795  -26.350 31.754  1.00 74.78  ? 253  ASN B OD1 1 
ATOM   6235  N ND2 . ASN B  1 253 ? 13.915  -25.303 32.408  1.00 50.26  ? 253  ASN B ND2 1 
ATOM   6236  N N   . PHE B  1 254 ? 17.525  -28.539 32.834  1.00 75.75  ? 254  PHE B N   1 
ATOM   6237  C CA  . PHE B  1 254 ? 18.856  -28.364 33.388  1.00 76.20  ? 254  PHE B CA  1 
ATOM   6238  C C   . PHE B  1 254 ? 19.357  -26.933 33.277  1.00 78.17  ? 254  PHE B C   1 
ATOM   6239  O O   . PHE B  1 254 ? 20.393  -26.583 33.842  1.00 76.37  ? 254  PHE B O   1 
ATOM   6240  C CB  . PHE B  1 254 ? 19.813  -29.426 32.831  1.00 79.61  ? 254  PHE B CB  1 
ATOM   6241  C CG  . PHE B  1 254 ? 19.661  -30.812 33.418  1.00 82.14  ? 254  PHE B CG  1 
ATOM   6242  C CD1 . PHE B  1 254 ? 19.592  -31.931 32.594  1.00 86.76  ? 254  PHE B CD1 1 
ATOM   6243  C CD2 . PHE B  1 254 ? 19.636  -31.005 34.800  1.00 83.57  ? 254  PHE B CD2 1 
ATOM   6244  C CE1 . PHE B  1 254 ? 19.495  -33.220 33.145  1.00 88.08  ? 254  PHE B CE1 1 
ATOM   6245  C CE2 . PHE B  1 254 ? 19.515  -32.290 35.349  1.00 86.35  ? 254  PHE B CE2 1 
ATOM   6246  C CZ  . PHE B  1 254 ? 19.458  -33.388 34.522  1.00 85.78  ? 254  PHE B CZ  1 
ATOM   6247  N N   . ASN B  1 255 ? 18.549  -26.096 32.615  1.00 75.02  ? 255  ASN B N   1 
ATOM   6248  C CA  . ASN B  1 255 ? 18.743  -24.657 32.431  1.00 74.15  ? 255  ASN B CA  1 
ATOM   6249  C C   . ASN B  1 255 ? 17.832  -23.931 33.431  1.00 71.76  ? 255  ASN B C   1 
ATOM   6250  O O   . ASN B  1 255 ? 17.521  -22.739 33.267  1.00 71.00  ? 255  ASN B O   1 
ATOM   6251  C CB  . ASN B  1 255 ? 18.362  -24.259 31.003  1.00 84.47  ? 255  ASN B CB  1 
ATOM   6252  C CG  . ASN B  1 255 ? 18.923  -25.178 29.960  1.00 120.32 ? 255  ASN B CG  1 
ATOM   6253  O OD1 . ASN B  1 255 ? 20.118  -25.526 29.986  1.00 113.36 ? 255  ASN B OD1 1 
ATOM   6254  N ND2 . ASN B  1 255 ? 18.047  -25.633 29.064  1.00 115.04 ? 255  ASN B ND2 1 
ATOM   6255  N N   . ALA B  1 256 ? 17.377  -24.677 34.456  1.00 63.22  ? 256  ALA B N   1 
ATOM   6256  C CA  . ALA B  1 256 ? 16.553  -24.143 35.513  1.00 60.65  ? 256  ALA B CA  1 
ATOM   6257  C C   . ALA B  1 256 ? 17.421  -23.211 36.317  1.00 64.76  ? 256  ALA B C   1 
ATOM   6258  O O   . ALA B  1 256 ? 18.643  -23.419 36.436  1.00 64.22  ? 256  ALA B O   1 
ATOM   6259  C CB  . ALA B  1 256 ? 16.048  -25.264 36.391  1.00 60.69  ? 256  ALA B CB  1 
ATOM   6260  N N   . LYS B  1 257 ? 16.796  -22.145 36.807  1.00 60.12  ? 257  LYS B N   1 
ATOM   6261  C CA  . LYS B  1 257 ? 17.402  -21.123 37.637  1.00 58.17  ? 257  LYS B CA  1 
ATOM   6262  C C   . LYS B  1 257 ? 16.523  -20.974 38.861  1.00 63.27  ? 257  LYS B C   1 
ATOM   6263  O O   . LYS B  1 257 ? 15.362  -21.423 38.836  1.00 65.24  ? 257  LYS B O   1 
ATOM   6264  C CB  . LYS B  1 257 ? 17.481  -19.811 36.870  1.00 58.88  ? 257  LYS B CB  1 
ATOM   6265  C CG  . LYS B  1 257 ? 18.662  -19.779 35.895  1.00 57.93  ? 257  LYS B CG  1 
ATOM   6266  C CD  . LYS B  1 257 ? 19.505  -18.552 36.161  1.00 59.93  ? 257  LYS B CD  1 
ATOM   6267  C CE  . LYS B  1 257 ? 20.301  -18.064 35.004  1.00 59.81  ? 257  LYS B CE  1 
ATOM   6268  N NZ  . LYS B  1 257 ? 20.798  -16.687 35.291  1.00 79.24  ? 257  LYS B NZ  1 
ATOM   6269  N N   . TYR B  1 258 ? 17.064  -20.355 39.933  1.00 57.79  ? 258  TYR B N   1 
ATOM   6270  C CA  . TYR B  1 258 ? 16.329  -20.129 41.167  1.00 56.25  ? 258  TYR B CA  1 
ATOM   6271  C C   . TYR B  1 258 ? 15.856  -18.731 41.279  1.00 55.49  ? 258  TYR B C   1 
ATOM   6272  O O   . TYR B  1 258 ? 16.590  -17.806 40.918  1.00 54.53  ? 258  TYR B O   1 
ATOM   6273  C CB  . TYR B  1 258 ? 17.179  -20.458 42.374  1.00 58.36  ? 258  TYR B CB  1 
ATOM   6274  C CG  . TYR B  1 258 ? 17.636  -21.888 42.356  1.00 63.38  ? 258  TYR B CG  1 
ATOM   6275  C CD1 . TYR B  1 258 ? 18.909  -22.225 41.912  1.00 65.55  ? 258  TYR B CD1 1 
ATOM   6276  C CD2 . TYR B  1 258 ? 16.780  -22.917 42.743  1.00 66.37  ? 258  TYR B CD2 1 
ATOM   6277  C CE1 . TYR B  1 258 ? 19.329  -23.552 41.869  1.00 69.13  ? 258  TYR B CE1 1 
ATOM   6278  C CE2 . TYR B  1 258 ? 17.183  -24.248 42.691  1.00 69.11  ? 258  TYR B CE2 1 
ATOM   6279  C CZ  . TYR B  1 258 ? 18.453  -24.562 42.238  1.00 82.35  ? 258  TYR B CZ  1 
ATOM   6280  O OH  . TYR B  1 258 ? 18.838  -25.878 42.177  1.00 91.71  ? 258  TYR B OH  1 
ATOM   6281  N N   . THR B  1 259 ? 14.631  -18.564 41.790  1.00 49.45  ? 259  THR B N   1 
ATOM   6282  C CA  . THR B  1 259 ? 14.064  -17.252 42.043  1.00 48.63  ? 259  THR B CA  1 
ATOM   6283  C C   . THR B  1 259 ? 14.606  -16.768 43.385  1.00 52.17  ? 259  THR B C   1 
ATOM   6284  O O   . THR B  1 259 ? 14.456  -17.430 44.397  1.00 52.61  ? 259  THR B O   1 
ATOM   6285  C CB  . THR B  1 259 ? 12.522  -17.270 42.110  1.00 56.67  ? 259  THR B CB  1 
ATOM   6286  O OG1 . THR B  1 259 ? 11.992  -18.341 41.365  1.00 68.50  ? 259  THR B OG1 1 
ATOM   6287  C CG2 . THR B  1 259 ? 11.920  -16.014 41.611  1.00 50.52  ? 259  THR B CG2 1 
ATOM   6288  N N   . TYR B  1 260 ? 15.252  -15.635 43.394  1.00 48.89  ? 260  TYR B N   1 
ATOM   6289  C CA  . TYR B  1 260 ? 15.737  -15.022 44.624  1.00 47.70  ? 260  TYR B CA  1 
ATOM   6290  C C   . TYR B  1 260 ? 15.400  -13.537 44.506  1.00 50.47  ? 260  TYR B C   1 
ATOM   6291  O O   . TYR B  1 260 ? 15.974  -12.827 43.664  1.00 51.08  ? 260  TYR B O   1 
ATOM   6292  C CB  . TYR B  1 260 ? 17.254  -15.258 44.809  1.00 47.70  ? 260  TYR B CB  1 
ATOM   6293  C CG  . TYR B  1 260 ? 17.798  -14.634 46.074  1.00 48.29  ? 260  TYR B CG  1 
ATOM   6294  C CD1 . TYR B  1 260 ? 17.133  -14.781 47.295  1.00 49.58  ? 260  TYR B CD1 1 
ATOM   6295  C CD2 . TYR B  1 260 ? 18.948  -13.856 46.048  1.00 49.13  ? 260  TYR B CD2 1 
ATOM   6296  C CE1 . TYR B  1 260 ? 17.629  -14.202 48.461  1.00 48.90  ? 260  TYR B CE1 1 
ATOM   6297  C CE2 . TYR B  1 260 ? 19.465  -13.286 47.212  1.00 49.45  ? 260  TYR B CE2 1 
ATOM   6298  C CZ  . TYR B  1 260 ? 18.806  -13.468 48.416  1.00 56.30  ? 260  TYR B CZ  1 
ATOM   6299  O OH  . TYR B  1 260 ? 19.327  -12.922 49.558  1.00 56.95  ? 260  TYR B OH  1 
ATOM   6300  N N   . GLY B  1 261 ? 14.430  -13.100 45.282  1.00 44.28  ? 261  GLY B N   1 
ATOM   6301  C CA  . GLY B  1 261 ? 13.979  -11.726 45.202  1.00 44.66  ? 261  GLY B CA  1 
ATOM   6302  C C   . GLY B  1 261 ? 13.395  -11.451 43.831  1.00 53.19  ? 261  GLY B C   1 
ATOM   6303  O O   . GLY B  1 261 ? 12.480  -12.164 43.396  1.00 53.09  ? 261  GLY B O   1 
ATOM   6304  N N   . ALA B  1 262 ? 13.970  -10.452 43.112  1.00 50.68  ? 262  ALA B N   1 
ATOM   6305  C CA  . ALA B  1 262 ? 13.512  -10.064 41.777  1.00 50.49  ? 262  ALA B CA  1 
ATOM   6306  C C   . ALA B  1 262 ? 14.428  -10.617 40.696  1.00 54.96  ? 262  ALA B C   1 
ATOM   6307  O O   . ALA B  1 262 ? 14.455  -10.082 39.579  1.00 54.74  ? 262  ALA B O   1 
ATOM   6308  C CB  . ALA B  1 262 ? 13.475  -8.562  41.691  1.00 51.39  ? 262  ALA B CB  1 
ATOM   6309  N N   . PHE B  1 263 ? 15.180  -11.706 41.031  1.00 50.44  ? 263  PHE B N   1 
ATOM   6310  C CA  . PHE B  1 263 ? 16.225  -12.287 40.176  1.00 47.88  ? 263  PHE B CA  1 
ATOM   6311  C C   . PHE B  1 263 ? 16.131  -13.764 39.919  1.00 52.91  ? 263  PHE B C   1 
ATOM   6312  O O   . PHE B  1 263 ? 15.598  -14.516 40.744  1.00 51.04  ? 263  PHE B O   1 
ATOM   6313  C CB  . PHE B  1 263 ? 17.600  -11.992 40.787  1.00 47.01  ? 263  PHE B CB  1 
ATOM   6314  C CG  . PHE B  1 263 ? 17.887  -10.529 40.757  1.00 47.23  ? 263  PHE B CG  1 
ATOM   6315  C CD1 . PHE B  1 263 ? 17.566  -9.724  41.835  1.00 49.88  ? 263  PHE B CD1 1 
ATOM   6316  C CD2 . PHE B  1 263 ? 18.394  -9.930  39.610  1.00 50.47  ? 263  PHE B CD2 1 
ATOM   6317  C CE1 . PHE B  1 263 ? 17.752  -8.347  41.773  1.00 51.60  ? 263  PHE B CE1 1 
ATOM   6318  C CE2 . PHE B  1 263 ? 18.600  -8.549  39.548  1.00 53.17  ? 263  PHE B CE2 1 
ATOM   6319  C CZ  . PHE B  1 263 ? 18.276  -7.767  40.628  1.00 51.04  ? 263  PHE B CZ  1 
ATOM   6320  N N   . CYS B  1 264 ? 16.697  -14.179 38.779  1.00 51.07  ? 264  CYS B N   1 
ATOM   6321  C CA  . CYS B  1 264 ? 16.809  -15.579 38.453  1.00 52.93  ? 264  CYS B CA  1 
ATOM   6322  C C   . CYS B  1 264 ? 18.288  -15.880 38.582  1.00 55.82  ? 264  CYS B C   1 
ATOM   6323  O O   . CYS B  1 264 ? 19.138  -15.301 37.876  1.00 57.09  ? 264  CYS B O   1 
ATOM   6324  C CB  . CYS B  1 264 ? 16.251  -15.883 37.072  1.00 55.76  ? 264  CYS B CB  1 
ATOM   6325  S SG  . CYS B  1 264 ? 14.506  -15.428 36.882  1.00 61.54  ? 264  CYS B SG  1 
ATOM   6326  N N   . VAL B  1 265 ? 18.602  -16.670 39.614  1.00 47.68  ? 265  VAL B N   1 
ATOM   6327  C CA  . VAL B  1 265 ? 19.980  -16.932 40.020  1.00 44.42  ? 265  VAL B CA  1 
ATOM   6328  C C   . VAL B  1 265 ? 20.459  -18.374 39.784  1.00 48.56  ? 265  VAL B C   1 
ATOM   6329  O O   . VAL B  1 265 ? 19.678  -19.328 39.860  1.00 47.63  ? 265  VAL B O   1 
ATOM   6330  C CB  . VAL B  1 265 ? 20.244  -16.414 41.473  1.00 44.66  ? 265  VAL B CB  1 
ATOM   6331  C CG1 . VAL B  1 265 ? 20.030  -14.923 41.576  1.00 43.28  ? 265  VAL B CG1 1 
ATOM   6332  C CG2 . VAL B  1 265 ? 19.369  -17.111 42.488  1.00 44.05  ? 265  VAL B CG2 1 
ATOM   6333  N N   . LYS B  1 266 ? 21.760  -18.523 39.534  1.00 45.96  ? 266  LYS B N   1 
ATOM   6334  C CA  . LYS B  1 266 ? 22.379  -19.823 39.291  1.00 46.71  ? 266  LYS B CA  1 
ATOM   6335  C C   . LYS B  1 266 ? 22.431  -20.692 40.564  1.00 55.09  ? 266  LYS B C   1 
ATOM   6336  O O   . LYS B  1 266 ? 22.579  -21.916 40.474  1.00 56.18  ? 266  LYS B O   1 
ATOM   6337  C CB  . LYS B  1 266 ? 23.808  -19.629 38.761  1.00 48.02  ? 266  LYS B CB  1 
ATOM   6338  C CG  . LYS B  1 266 ? 23.973  -18.709 37.561  1.00 52.90  ? 266  LYS B CG  1 
ATOM   6339  C CD  . LYS B  1 266 ? 25.452  -18.647 37.183  1.00 60.09  ? 266  LYS B CD  1 
ATOM   6340  C CE  . LYS B  1 266 ? 26.006  -17.266 36.928  1.00 62.57  ? 266  LYS B CE  1 
ATOM   6341  N NZ  . LYS B  1 266 ? 25.731  -16.756 35.551  1.00 68.21  ? 266  LYS B NZ  1 
ATOM   6342  N N   . LYS B  1 267 ? 22.308  -20.062 41.750  1.00 52.95  ? 267  LYS B N   1 
ATOM   6343  C CA  . LYS B  1 267 ? 22.485  -20.698 43.053  1.00 52.45  ? 267  LYS B CA  1 
ATOM   6344  C C   . LYS B  1 267 ? 21.755  -19.894 44.140  1.00 58.85  ? 267  LYS B C   1 
ATOM   6345  O O   . LYS B  1 267 ? 21.769  -18.649 44.115  1.00 57.50  ? 267  LYS B O   1 
ATOM   6346  C CB  . LYS B  1 267 ? 24.012  -20.620 43.337  1.00 54.33  ? 267  LYS B CB  1 
ATOM   6347  C CG  . LYS B  1 267 ? 24.543  -21.379 44.530  1.00 76.41  ? 267  LYS B CG  1 
ATOM   6348  C CD  . LYS B  1 267 ? 25.875  -20.809 44.998  1.00 92.66  ? 267  LYS B CD  1 
ATOM   6349  C CE  . LYS B  1 267 ? 25.735  -19.736 46.064  1.00 108.58 ? 267  LYS B CE  1 
ATOM   6350  N NZ  . LYS B  1 267 ? 26.849  -19.758 47.042  1.00 120.10 ? 267  LYS B NZ  1 
ATOM   6351  N N   . CYS B  1 268 ? 21.192  -20.579 45.146  1.00 57.48  ? 268  CYS B N   1 
ATOM   6352  C CA  . CYS B  1 268 ? 20.615  -19.825 46.268  1.00 57.54  ? 268  CYS B CA  1 
ATOM   6353  C C   . CYS B  1 268 ? 21.718  -19.414 47.219  1.00 62.12  ? 268  CYS B C   1 
ATOM   6354  O O   . CYS B  1 268 ? 22.619  -20.224 47.467  1.00 61.30  ? 268  CYS B O   1 
ATOM   6355  C CB  . CYS B  1 268 ? 19.579  -20.646 47.018  1.00 58.03  ? 268  CYS B CB  1 
ATOM   6356  S SG  . CYS B  1 268 ? 17.992  -20.740 46.192  1.00 62.47  ? 268  CYS B SG  1 
ATOM   6357  N N   . PRO B  1 269 ? 21.586  -18.266 47.914  1.00 59.49  ? 269  PRO B N   1 
ATOM   6358  C CA  . PRO B  1 269 ? 22.545  -17.964 48.987  1.00 59.91  ? 269  PRO B CA  1 
ATOM   6359  C C   . PRO B  1 269 ? 22.624  -19.178 49.934  1.00 69.16  ? 269  PRO B C   1 
ATOM   6360  O O   . PRO B  1 269 ? 21.580  -19.797 50.212  1.00 70.87  ? 269  PRO B O   1 
ATOM   6361  C CB  . PRO B  1 269 ? 21.887  -16.780 49.699  1.00 61.21  ? 269  PRO B CB  1 
ATOM   6362  C CG  . PRO B  1 269 ? 21.004  -16.177 48.722  1.00 65.11  ? 269  PRO B CG  1 
ATOM   6363  C CD  . PRO B  1 269 ? 20.511  -17.252 47.840  1.00 60.57  ? 269  PRO B CD  1 
ATOM   6364  N N   . HIS B  1 270 ? 23.827  -19.550 50.404  1.00 67.93  ? 270  HIS B N   1 
ATOM   6365  C CA  . HIS B  1 270 ? 23.990  -20.713 51.291  1.00 69.61  ? 270  HIS B CA  1 
ATOM   6366  C C   . HIS B  1 270 ? 23.048  -20.755 52.488  1.00 67.23  ? 270  HIS B C   1 
ATOM   6367  O O   . HIS B  1 270 ? 22.652  -21.835 52.911  1.00 68.83  ? 270  HIS B O   1 
ATOM   6368  C CB  . HIS B  1 270 ? 25.434  -20.861 51.760  1.00 73.91  ? 270  HIS B CB  1 
ATOM   6369  C CG  . HIS B  1 270 ? 25.776  -22.272 52.133  1.00 81.10  ? 270  HIS B CG  1 
ATOM   6370  N ND1 . HIS B  1 270 ? 25.577  -22.761 53.443  1.00 85.09  ? 270  HIS B ND1 1 
ATOM   6371  C CD2 . HIS B  1 270 ? 26.252  -23.280 51.359  1.00 84.71  ? 270  HIS B CD2 1 
ATOM   6372  C CE1 . HIS B  1 270 ? 25.965  -24.033 53.416  1.00 85.08  ? 270  HIS B CE1 1 
ATOM   6373  N NE2 . HIS B  1 270 ? 26.374  -24.396 52.186  1.00 85.25  ? 270  HIS B NE2 1 
ATOM   6374  N N   . ASN B  1 271 ? 22.647  -19.587 52.984  1.00 57.88  ? 271  ASN B N   1 
ATOM   6375  C CA  . ASN B  1 271 ? 21.770  -19.438 54.134  1.00 55.53  ? 271  ASN B CA  1 
ATOM   6376  C C   . ASN B  1 271 ? 20.256  -19.539 53.827  1.00 58.97  ? 271  ASN B C   1 
ATOM   6377  O O   . ASN B  1 271 ? 19.420  -19.641 54.742  1.00 57.54  ? 271  ASN B O   1 
ATOM   6378  C CB  . ASN B  1 271 ? 22.155  -18.190 54.943  1.00 48.04  ? 271  ASN B CB  1 
ATOM   6379  C CG  . ASN B  1 271 ? 21.799  -16.872 54.339  1.00 68.50  ? 271  ASN B CG  1 
ATOM   6380  O OD1 . ASN B  1 271 ? 21.926  -16.643 53.146  1.00 67.14  ? 271  ASN B OD1 1 
ATOM   6381  N ND2 . ASN B  1 271 ? 21.372  -15.952 55.172  1.00 67.88  ? 271  ASN B ND2 1 
ATOM   6382  N N   . PHE B  1 272 ? 19.914  -19.555 52.539  1.00 55.16  ? 272  PHE B N   1 
ATOM   6383  C CA  . PHE B  1 272 ? 18.521  -19.656 52.115  1.00 53.90  ? 272  PHE B CA  1 
ATOM   6384  C C   . PHE B  1 272 ? 18.133  -21.072 51.931  1.00 55.80  ? 272  PHE B C   1 
ATOM   6385  O O   . PHE B  1 272 ? 18.996  -21.919 51.756  1.00 55.63  ? 272  PHE B O   1 
ATOM   6386  C CB  . PHE B  1 272 ? 18.282  -18.857 50.832  1.00 55.33  ? 272  PHE B CB  1 
ATOM   6387  C CG  . PHE B  1 272 ? 17.849  -17.471 51.173  1.00 54.99  ? 272  PHE B CG  1 
ATOM   6388  C CD1 . PHE B  1 272 ? 18.705  -16.603 51.822  1.00 56.45  ? 272  PHE B CD1 1 
ATOM   6389  C CD2 . PHE B  1 272 ? 16.565  -17.054 50.913  1.00 56.76  ? 272  PHE B CD2 1 
ATOM   6390  C CE1 . PHE B  1 272 ? 18.274  -15.342 52.214  1.00 56.99  ? 272  PHE B CE1 1 
ATOM   6391  C CE2 . PHE B  1 272 ? 16.135  -15.787 51.310  1.00 59.34  ? 272  PHE B CE2 1 
ATOM   6392  C CZ  . PHE B  1 272 ? 16.996  -14.935 51.947  1.00 55.85  ? 272  PHE B CZ  1 
ATOM   6393  N N   . VAL B  1 273 ? 16.835  -21.335 51.982  1.00 51.51  ? 273  VAL B N   1 
ATOM   6394  C CA  . VAL B  1 273 ? 16.288  -22.672 51.840  1.00 50.62  ? 273  VAL B CA  1 
ATOM   6395  C C   . VAL B  1 273 ? 15.669  -22.804 50.441  1.00 57.64  ? 273  VAL B C   1 
ATOM   6396  O O   . VAL B  1 273 ? 15.008  -21.877 49.974  1.00 57.47  ? 273  VAL B O   1 
ATOM   6397  C CB  . VAL B  1 273 ? 15.380  -23.083 53.051  1.00 52.74  ? 273  VAL B CB  1 
ATOM   6398  C CG1 . VAL B  1 273 ? 14.461  -21.967 53.501  1.00 51.21  ? 273  VAL B CG1 1 
ATOM   6399  C CG2 . VAL B  1 273 ? 14.579  -24.349 52.773  1.00 53.71  ? 273  VAL B CG2 1 
ATOM   6400  N N   . VAL B  1 274 ? 15.985  -23.905 49.738  1.00 56.23  ? 274  VAL B N   1 
ATOM   6401  C CA  . VAL B  1 274 ? 15.507  -24.158 48.379  1.00 57.25  ? 274  VAL B CA  1 
ATOM   6402  C C   . VAL B  1 274 ? 14.208  -24.939 48.375  1.00 66.94  ? 274  VAL B C   1 
ATOM   6403  O O   . VAL B  1 274 ? 14.239  -26.150 48.574  1.00 69.84  ? 274  VAL B O   1 
ATOM   6404  C CB  . VAL B  1 274 ? 16.584  -24.840 47.494  1.00 60.25  ? 274  VAL B CB  1 
ATOM   6405  C CG1 . VAL B  1 274 ? 16.082  -24.998 46.069  1.00 60.59  ? 274  VAL B CG1 1 
ATOM   6406  C CG2 . VAL B  1 274 ? 17.902  -24.066 47.515  1.00 59.12  ? 274  VAL B CG2 1 
ATOM   6407  N N   . ASP B  1 275 ? 13.071  -24.264 48.142  1.00 65.31  ? 275  ASP B N   1 
ATOM   6408  C CA  . ASP B  1 275 ? 11.752  -24.909 48.037  1.00 66.48  ? 275  ASP B CA  1 
ATOM   6409  C C   . ASP B  1 275 ? 11.307  -24.770 46.618  1.00 72.57  ? 275  ASP B C   1 
ATOM   6410  O O   . ASP B  1 275 ? 11.224  -23.649 46.116  1.00 73.12  ? 275  ASP B O   1 
ATOM   6411  C CB  . ASP B  1 275 ? 10.718  -24.261 48.965  1.00 68.96  ? 275  ASP B CB  1 
ATOM   6412  C CG  . ASP B  1 275 ? 9.343   -24.917 49.034  1.00 86.01  ? 275  ASP B CG  1 
ATOM   6413  O OD1 . ASP B  1 275 ? 9.167   -26.016 48.442  1.00 91.33  ? 275  ASP B OD1 1 
ATOM   6414  O OD2 . ASP B  1 275 ? 8.458   -24.367 49.733  1.00 89.39  ? 275  ASP B OD2 1 
ATOM   6415  N N   . SER B  1 276 ? 10.980  -25.901 45.975  1.00 71.19  ? 276  SER B N   1 
ATOM   6416  C CA  . SER B  1 276 ? 10.608  -25.989 44.558  1.00 71.96  ? 276  SER B CA  1 
ATOM   6417  C C   . SER B  1 276 ? 11.819  -25.417 43.741  1.00 77.03  ? 276  SER B C   1 
ATOM   6418  O O   . SER B  1 276 ? 12.942  -25.936 43.904  1.00 76.95  ? 276  SER B O   1 
ATOM   6419  C CB  . SER B  1 276 ? 9.236   -25.348 44.276  1.00 75.86  ? 276  SER B CB  1 
ATOM   6420  O OG  . SER B  1 276 ? 9.256   -23.937 44.121  1.00 84.86  ? 276  SER B OG  1 
ATOM   6421  N N   . SER B  1 277 ? 11.650  -24.330 42.966  1.00 73.86  ? 277  SER B N   1 
ATOM   6422  C CA  . SER B  1 277 ? 12.808  -23.800 42.241  1.00 74.13  ? 277  SER B CA  1 
ATOM   6423  C C   . SER B  1 277 ? 13.082  -22.354 42.682  1.00 75.95  ? 277  SER B C   1 
ATOM   6424  O O   . SER B  1 277 ? 13.476  -21.518 41.859  1.00 77.25  ? 277  SER B O   1 
ATOM   6425  C CB  . SER B  1 277 ? 12.569  -23.897 40.736  1.00 81.27  ? 277  SER B CB  1 
ATOM   6426  O OG  . SER B  1 277 ? 11.958  -25.127 40.374  1.00 94.41  ? 277  SER B OG  1 
ATOM   6427  N N   . SER B  1 278 ? 12.859  -22.070 43.996  1.00 67.20  ? 278  SER B N   1 
ATOM   6428  C CA  . SER B  1 278 ? 12.963  -20.756 44.624  1.00 62.86  ? 278  SER B CA  1 
ATOM   6429  C C   . SER B  1 278 ? 13.789  -20.725 45.903  1.00 61.29  ? 278  SER B C   1 
ATOM   6430  O O   . SER B  1 278 ? 13.880  -21.725 46.597  1.00 59.98  ? 278  SER B O   1 
ATOM   6431  C CB  . SER B  1 278 ? 11.566  -20.253 44.926  1.00 65.05  ? 278  SER B CB  1 
ATOM   6432  O OG  . SER B  1 278 ? 10.804  -20.198 43.735  1.00 76.30  ? 278  SER B OG  1 
ATOM   6433  N N   . CYS B  1 279 ? 14.386  -19.559 46.206  1.00 56.00  ? 279  CYS B N   1 
ATOM   6434  C CA  . CYS B  1 279 ? 15.161  -19.277 47.405  1.00 55.09  ? 279  CYS B CA  1 
ATOM   6435  C C   . CYS B  1 279 ? 14.231  -18.632 48.387  1.00 56.65  ? 279  CYS B C   1 
ATOM   6436  O O   . CYS B  1 279 ? 13.980  -17.428 48.315  1.00 55.28  ? 279  CYS B O   1 
ATOM   6437  C CB  . CYS B  1 279 ? 16.344  -18.373 47.100  1.00 56.35  ? 279  CYS B CB  1 
ATOM   6438  S SG  . CYS B  1 279 ? 17.321  -18.893 45.670  1.00 61.66  ? 279  CYS B SG  1 
ATOM   6439  N N   . VAL B  1 280 ? 13.686  -19.443 49.297  1.00 52.33  ? 280  VAL B N   1 
ATOM   6440  C CA  . VAL B  1 280 ? 12.752  -18.982 50.325  1.00 50.71  ? 280  VAL B CA  1 
ATOM   6441  C C   . VAL B  1 280 ? 13.398  -18.730 51.685  1.00 56.39  ? 280  VAL B C   1 
ATOM   6442  O O   . VAL B  1 280 ? 14.530  -19.151 51.923  1.00 57.03  ? 280  VAL B O   1 
ATOM   6443  C CB  . VAL B  1 280 ? 11.502  -19.851 50.405  1.00 52.23  ? 280  VAL B CB  1 
ATOM   6444  C CG1 . VAL B  1 280 ? 10.743  -19.764 49.106  1.00 51.92  ? 280  VAL B CG1 1 
ATOM   6445  C CG2 . VAL B  1 280 ? 11.849  -21.296 50.738  1.00 51.72  ? 280  VAL B CG2 1 
ATOM   6446  N N   . ARG B  1 281 ? 12.703  -17.997 52.551  1.00 52.25  ? 281  ARG B N   1 
ATOM   6447  C CA  . ARG B  1 281 ? 13.204  -17.693 53.881  1.00 51.71  ? 281  ARG B CA  1 
ATOM   6448  C C   . ARG B  1 281 ? 12.736  -18.755 54.843  1.00 60.30  ? 281  ARG B C   1 
ATOM   6449  O O   . ARG B  1 281 ? 13.351  -18.940 55.899  1.00 61.32  ? 281  ARG B O   1 
ATOM   6450  C CB  . ARG B  1 281 ? 12.652  -16.352 54.366  1.00 49.12  ? 281  ARG B CB  1 
ATOM   6451  C CG  . ARG B  1 281 ? 13.046  -15.186 53.495  1.00 58.69  ? 281  ARG B CG  1 
ATOM   6452  C CD  . ARG B  1 281 ? 13.389  -13.934 54.261  1.00 60.96  ? 281  ARG B CD  1 
ATOM   6453  N NE  . ARG B  1 281 ? 12.330  -12.921 54.234  1.00 57.40  ? 281  ARG B NE  1 
ATOM   6454  C CZ  . ARG B  1 281 ? 12.534  -11.664 53.852  1.00 77.33  ? 281  ARG B CZ  1 
ATOM   6455  N NH1 . ARG B  1 281 ? 13.740  -11.276 53.414  1.00 50.28  ? 281  ARG B NH1 1 
ATOM   6456  N NH2 . ARG B  1 281 ? 11.536  -10.789 53.881  1.00 74.87  ? 281  ARG B NH2 1 
ATOM   6457  N N   . ALA B  1 282 ? 11.611  -19.425 54.516  1.00 58.32  ? 282  ALA B N   1 
ATOM   6458  C CA  . ALA B  1 282 ? 11.007  -20.407 55.396  1.00 59.10  ? 282  ALA B CA  1 
ATOM   6459  C C   . ALA B  1 282 ? 10.365  -21.537 54.670  1.00 67.34  ? 282  ALA B C   1 
ATOM   6460  O O   . ALA B  1 282 ? 9.907   -21.382 53.548  1.00 66.04  ? 282  ALA B O   1 
ATOM   6461  C CB  . ALA B  1 282 ? 9.966   -19.722 56.265  1.00 60.26  ? 282  ALA B CB  1 
ATOM   6462  N N   . CYS B  1 283 ? 10.268  -22.673 55.349  1.00 70.81  ? 283  CYS B N   1 
ATOM   6463  C CA  . CYS B  1 283 ? 9.555   -23.836 54.854  1.00 74.55  ? 283  CYS B CA  1 
ATOM   6464  C C   . CYS B  1 283 ? 8.099   -23.703 55.199  1.00 78.06  ? 283  CYS B C   1 
ATOM   6465  O O   . CYS B  1 283 ? 7.759   -23.174 56.261  1.00 77.40  ? 283  CYS B O   1 
ATOM   6466  C CB  . CYS B  1 283 ? 10.123  -25.115 55.449  1.00 78.02  ? 283  CYS B CB  1 
ATOM   6467  S SG  . CYS B  1 283 ? 11.636  -25.679 54.648  1.00 83.94  ? 283  CYS B SG  1 
ATOM   6468  N N   . PRO B  1 284 ? 7.214   -24.253 54.368  1.00 75.59  ? 284  PRO B N   1 
ATOM   6469  C CA  . PRO B  1 284 ? 5.781   -24.260 54.727  1.00 77.08  ? 284  PRO B CA  1 
ATOM   6470  C C   . PRO B  1 284 ? 5.560   -25.101 55.997  1.00 83.57  ? 284  PRO B C   1 
ATOM   6471  O O   . PRO B  1 284 ? 6.307   -26.054 56.244  1.00 82.63  ? 284  PRO B O   1 
ATOM   6472  C CB  . PRO B  1 284 ? 5.116   -24.925 53.516  1.00 79.40  ? 284  PRO B CB  1 
ATOM   6473  C CG  . PRO B  1 284 ? 6.141   -24.819 52.400  1.00 82.78  ? 284  PRO B CG  1 
ATOM   6474  C CD  . PRO B  1 284 ? 7.460   -24.940 53.090  1.00 77.19  ? 284  PRO B CD  1 
ATOM   6475  N N   . SER B  1 285 ? 4.565   -24.730 56.817  1.00 82.74  ? 285  SER B N   1 
ATOM   6476  C CA  . SER B  1 285 ? 4.218   -25.396 58.089  1.00 84.06  ? 285  SER B CA  1 
ATOM   6477  C C   . SER B  1 285 ? 4.205   -26.952 58.023  1.00 87.98  ? 285  SER B C   1 
ATOM   6478  O O   . SER B  1 285 ? 4.562   -27.630 59.002  1.00 86.91  ? 285  SER B O   1 
ATOM   6479  C CB  . SER B  1 285 ? 2.861   -24.898 58.561  1.00 90.21  ? 285  SER B CB  1 
ATOM   6480  O OG  . SER B  1 285 ? 1.898   -25.118 57.542  1.00 106.23 ? 285  SER B OG  1 
ATOM   6481  N N   . SER B  1 286 ? 3.768   -27.481 56.848  1.00 84.18  ? 286  SER B N   1 
ATOM   6482  C CA  . SER B  1 286 ? 3.657   -28.892 56.441  1.00 83.32  ? 286  SER B CA  1 
ATOM   6483  C C   . SER B  1 286 ? 5.017   -29.578 56.119  1.00 82.82  ? 286  SER B C   1 
ATOM   6484  O O   . SER B  1 286 ? 5.102   -30.807 56.214  1.00 83.07  ? 286  SER B O   1 
ATOM   6485  C CB  . SER B  1 286 ? 2.744   -29.002 55.224  1.00 87.35  ? 286  SER B CB  1 
ATOM   6486  O OG  . SER B  1 286 ? 3.011   -27.987 54.266  1.00 94.32  ? 286  SER B OG  1 
ATOM   6487  N N   . LYS B  1 287 ? 6.050   -28.796 55.720  1.00 74.77  ? 287  LYS B N   1 
ATOM   6488  C CA  . LYS B  1 287 ? 7.389   -29.300 55.390  1.00 73.14  ? 287  LYS B CA  1 
ATOM   6489  C C   . LYS B  1 287 ? 8.434   -28.926 56.491  1.00 76.41  ? 287  LYS B C   1 
ATOM   6490  O O   . LYS B  1 287 ? 8.167   -28.087 57.364  1.00 74.94  ? 287  LYS B O   1 
ATOM   6491  C CB  . LYS B  1 287 ? 7.852   -28.792 54.001  1.00 74.16  ? 287  LYS B CB  1 
ATOM   6492  C CG  . LYS B  1 287 ? 6.891   -29.065 52.849  1.00 77.42  ? 287  LYS B CG  1 
ATOM   6493  C CD  . LYS B  1 287 ? 7.466   -28.579 51.513  1.00 82.37  ? 287  LYS B CD  1 
ATOM   6494  C CE  . LYS B  1 287 ? 6.470   -28.594 50.372  1.00 93.85  ? 287  LYS B CE  1 
ATOM   6495  N NZ  . LYS B  1 287 ? 7.087   -28.182 49.074  1.00 103.67 ? 287  LYS B NZ  1 
ATOM   6496  N N   . MET B  1 288 ? 9.624   -29.551 56.421  1.00 73.33  ? 288  MET B N   1 
ATOM   6497  C CA  . MET B  1 288 ? 10.742  -29.336 57.349  1.00 72.73  ? 288  MET B CA  1 
ATOM   6498  C C   . MET B  1 288 ? 12.088  -29.122 56.627  1.00 68.37  ? 288  MET B C   1 
ATOM   6499  O O   . MET B  1 288 ? 12.359  -29.749 55.610  1.00 66.95  ? 288  MET B O   1 
ATOM   6500  C CB  . MET B  1 288 ? 10.832  -30.486 58.374  1.00 77.16  ? 288  MET B CB  1 
ATOM   6501  C CG  . MET B  1 288 ? 11.168  -31.864 57.752  1.00 83.15  ? 288  MET B CG  1 
ATOM   6502  S SD  . MET B  1 288 ? 11.965  -33.090 58.855  1.00 88.80  ? 288  MET B SD  1 
ATOM   6503  C CE  . MET B  1 288 ? 13.140  -32.054 59.716  1.00 84.28  ? 288  MET B CE  1 
ATOM   6504  N N   . GLU B  1 289 ? 12.919  -28.243 57.170  1.00 61.74  ? 289  GLU B N   1 
ATOM   6505  C CA  . GLU B  1 289 ? 14.230  -27.885 56.623  1.00 60.43  ? 289  GLU B CA  1 
ATOM   6506  C C   . GLU B  1 289 ? 15.225  -29.031 56.801  1.00 64.51  ? 289  GLU B C   1 
ATOM   6507  O O   . GLU B  1 289 ? 15.323  -29.573 57.896  1.00 65.68  ? 289  GLU B O   1 
ATOM   6508  C CB  . GLU B  1 289 ? 14.729  -26.635 57.333  1.00 60.92  ? 289  GLU B CB  1 
ATOM   6509  C CG  . GLU B  1 289 ? 15.605  -25.737 56.504  1.00 70.37  ? 289  GLU B CG  1 
ATOM   6510  C CD  . GLU B  1 289 ? 15.921  -24.430 57.203  1.00 92.26  ? 289  GLU B CD  1 
ATOM   6511  O OE1 . GLU B  1 289 ? 14.974  -23.638 57.444  1.00 57.68  ? 289  GLU B OE1 1 
ATOM   6512  O OE2 . GLU B  1 289 ? 17.117  -24.206 57.519  1.00 88.28  ? 289  GLU B OE2 1 
ATOM   6513  N N   . VAL B  1 290 ? 15.893  -29.459 55.718  1.00 60.06  ? 290  VAL B N   1 
ATOM   6514  C CA  . VAL B  1 290 ? 16.858  -30.576 55.729  1.00 60.30  ? 290  VAL B CA  1 
ATOM   6515  C C   . VAL B  1 290 ? 18.088  -30.233 54.884  1.00 65.89  ? 290  VAL B C   1 
ATOM   6516  O O   . VAL B  1 290 ? 17.954  -29.531 53.890  1.00 66.83  ? 290  VAL B O   1 
ATOM   6517  C CB  . VAL B  1 290 ? 16.263  -31.967 55.350  1.00 64.45  ? 290  VAL B CB  1 
ATOM   6518  C CG1 . VAL B  1 290 ? 14.917  -32.221 56.012  1.00 64.42  ? 290  VAL B CG1 1 
ATOM   6519  C CG2 . VAL B  1 290 ? 16.144  -32.143 53.849  1.00 64.89  ? 290  VAL B CG2 1 
ATOM   6520  N N   . GLU B  1 291 ? 19.273  -30.702 55.269  1.00 63.40  ? 291  GLU B N   1 
ATOM   6521  C CA  . GLU B  1 291 ? 20.472  -30.386 54.504  1.00 64.53  ? 291  GLU B CA  1 
ATOM   6522  C C   . GLU B  1 291 ? 20.916  -31.567 53.641  1.00 75.52  ? 291  GLU B C   1 
ATOM   6523  O O   . GLU B  1 291 ? 21.020  -32.692 54.131  1.00 79.07  ? 291  GLU B O   1 
ATOM   6524  C CB  . GLU B  1 291 ? 21.597  -29.895 55.402  1.00 65.57  ? 291  GLU B CB  1 
ATOM   6525  C CG  . GLU B  1 291 ? 22.293  -28.681 54.824  1.00 84.81  ? 291  GLU B CG  1 
ATOM   6526  C CD  . GLU B  1 291 ? 23.491  -28.160 55.594  1.00 125.87 ? 291  GLU B CD  1 
ATOM   6527  O OE1 . GLU B  1 291 ? 23.518  -26.941 55.881  1.00 117.41 ? 291  GLU B OE1 1 
ATOM   6528  O OE2 . GLU B  1 291 ? 24.425  -28.954 55.859  1.00 135.24 ? 291  GLU B OE2 1 
ATOM   6529  N N   . GLU B  1 292 ? 21.134  -31.323 52.346  1.00 72.20  ? 292  GLU B N   1 
ATOM   6530  C CA  . GLU B  1 292 ? 21.552  -32.335 51.389  1.00 71.78  ? 292  GLU B CA  1 
ATOM   6531  C C   . GLU B  1 292 ? 22.718  -31.763 50.636  1.00 72.92  ? 292  GLU B C   1 
ATOM   6532  O O   . GLU B  1 292 ? 22.540  -30.886 49.783  1.00 72.64  ? 292  GLU B O   1 
ATOM   6533  C CB  . GLU B  1 292 ? 20.399  -32.717 50.443  1.00 73.96  ? 292  GLU B CB  1 
ATOM   6534  C CG  . GLU B  1 292 ? 19.482  -33.769 51.045  1.00 95.87  ? 292  GLU B CG  1 
ATOM   6535  C CD  . GLU B  1 292 ? 18.285  -34.216 50.224  1.00 138.47 ? 292  GLU B CD  1 
ATOM   6536  O OE1 . GLU B  1 292 ? 17.309  -34.710 50.837  1.00 135.28 ? 292  GLU B OE1 1 
ATOM   6537  O OE2 . GLU B  1 292 ? 18.321  -34.093 48.977  1.00 145.72 ? 292  GLU B OE2 1 
ATOM   6538  N N   . ASN B  1 293 ? 23.922  -32.222 50.991  1.00 67.59  ? 293  ASN B N   1 
ATOM   6539  C CA  . ASN B  1 293 ? 25.189  -31.769 50.406  1.00 66.81  ? 293  ASN B CA  1 
ATOM   6540  C C   . ASN B  1 293 ? 25.385  -30.244 50.581  1.00 69.82  ? 293  ASN B C   1 
ATOM   6541  O O   . ASN B  1 293 ? 25.707  -29.521 49.643  1.00 68.03  ? 293  ASN B O   1 
ATOM   6542  C CB  . ASN B  1 293 ? 25.344  -32.268 48.957  1.00 65.99  ? 293  ASN B CB  1 
ATOM   6543  C CG  . ASN B  1 293 ? 25.287  -33.777 48.812  1.00 77.22  ? 293  ASN B CG  1 
ATOM   6544  O OD1 . ASN B  1 293 ? 25.822  -34.540 49.626  1.00 77.18  ? 293  ASN B OD1 1 
ATOM   6545  N ND2 . ASN B  1 293 ? 24.658  -34.245 47.751  1.00 65.59  ? 293  ASN B ND2 1 
ATOM   6546  N N   . GLY B  1 294 ? 25.129  -29.785 51.808  1.00 67.88  ? 294  GLY B N   1 
ATOM   6547  C CA  . GLY B  1 294 ? 25.240  -28.393 52.228  1.00 67.13  ? 294  GLY B CA  1 
ATOM   6548  C C   . GLY B  1 294 ? 24.068  -27.503 51.847  1.00 71.31  ? 294  GLY B C   1 
ATOM   6549  O O   . GLY B  1 294 ? 24.016  -26.335 52.267  1.00 72.42  ? 294  GLY B O   1 
ATOM   6550  N N   . ILE B  1 295 ? 23.098  -28.053 51.074  1.00 64.46  ? 295  ILE B N   1 
ATOM   6551  C CA  . ILE B  1 295 ? 21.933  -27.326 50.581  1.00 61.78  ? 295  ILE B CA  1 
ATOM   6552  C C   . ILE B  1 295 ? 20.699  -27.534 51.442  1.00 64.71  ? 295  ILE B C   1 
ATOM   6553  O O   . ILE B  1 295 ? 20.239  -28.650 51.565  1.00 65.15  ? 295  ILE B O   1 
ATOM   6554  C CB  . ILE B  1 295 ? 21.730  -27.632 49.077  1.00 63.14  ? 295  ILE B CB  1 
ATOM   6555  C CG1 . ILE B  1 295 ? 22.986  -27.161 48.324  1.00 63.35  ? 295  ILE B CG1 1 
ATOM   6556  C CG2 . ILE B  1 295 ? 20.435  -27.019 48.532  1.00 60.94  ? 295  ILE B CG2 1 
ATOM   6557  C CD1 . ILE B  1 295 ? 22.949  -27.310 46.850  1.00 84.41  ? 295  ILE B CD1 1 
ATOM   6558  N N   . LYS B  1 296 ? 20.176  -26.454 52.029  1.00 59.66  ? 296  LYS B N   1 
ATOM   6559  C CA  . LYS B  1 296 ? 18.975  -26.477 52.859  1.00 59.47  ? 296  LYS B CA  1 
ATOM   6560  C C   . LYS B  1 296 ? 17.756  -26.623 51.945  1.00 64.76  ? 296  LYS B C   1 
ATOM   6561  O O   . LYS B  1 296 ? 17.670  -25.945 50.926  1.00 63.54  ? 296  LYS B O   1 
ATOM   6562  C CB  . LYS B  1 296 ? 18.888  -25.191 53.707  1.00 61.74  ? 296  LYS B CB  1 
ATOM   6563  C CG  . LYS B  1 296 ? 20.109  -24.973 54.595  1.00 69.72  ? 296  LYS B CG  1 
ATOM   6564  C CD  . LYS B  1 296 ? 20.086  -23.671 55.344  1.00 75.29  ? 296  LYS B CD  1 
ATOM   6565  C CE  . LYS B  1 296 ? 21.501  -23.259 55.678  1.00 95.00  ? 296  LYS B CE  1 
ATOM   6566  N NZ  . LYS B  1 296 ? 21.552  -22.087 56.592  1.00 112.66 ? 296  LYS B NZ  1 
ATOM   6567  N N   . MET B  1 297 ? 16.851  -27.545 52.267  1.00 64.68  ? 297  MET B N   1 
ATOM   6568  C CA  . MET B  1 297 ? 15.690  -27.823 51.424  1.00 66.89  ? 297  MET B CA  1 
ATOM   6569  C C   . MET B  1 297 ? 14.464  -28.098 52.221  1.00 73.58  ? 297  MET B C   1 
ATOM   6570  O O   . MET B  1 297 ? 14.577  -28.598 53.336  1.00 72.49  ? 297  MET B O   1 
ATOM   6571  C CB  . MET B  1 297 ? 15.940  -29.065 50.569  1.00 70.53  ? 297  MET B CB  1 
ATOM   6572  C CG  . MET B  1 297 ? 17.362  -29.243 50.150  1.00 75.62  ? 297  MET B CG  1 
ATOM   6573  S SD  . MET B  1 297 ? 17.487  -30.435 48.814  1.00 82.21  ? 297  MET B SD  1 
ATOM   6574  C CE  . MET B  1 297 ? 16.752  -29.435 47.380  1.00 77.50  ? 297  MET B CE  1 
ATOM   6575  N N   . CYS B  1 298 ? 13.285  -27.875 51.628  1.00 74.66  ? 298  CYS B N   1 
ATOM   6576  C CA  . CYS B  1 298 ? 12.047  -28.234 52.310  1.00 78.07  ? 298  CYS B CA  1 
ATOM   6577  C C   . CYS B  1 298 ? 11.643  -29.618 51.884  1.00 86.51  ? 298  CYS B C   1 
ATOM   6578  O O   . CYS B  1 298 ? 11.487  -29.869 50.686  1.00 88.24  ? 298  CYS B O   1 
ATOM   6579  C CB  . CYS B  1 298 ? 10.945  -27.226 52.033  1.00 79.83  ? 298  CYS B CB  1 
ATOM   6580  S SG  . CYS B  1 298 ? 11.328  -25.560 52.615  1.00 84.24  ? 298  CYS B SG  1 
ATOM   6581  N N   . LYS B  1 299 ? 11.542  -30.534 52.848  1.00 84.18  ? 299  LYS B N   1 
ATOM   6582  C CA  . LYS B  1 299 ? 11.157  -31.919 52.617  1.00 85.81  ? 299  LYS B CA  1 
ATOM   6583  C C   . LYS B  1 299 ? 10.000  -32.246 53.562  1.00 95.80  ? 299  LYS B C   1 
ATOM   6584  O O   . LYS B  1 299 ? 9.888   -31.588 54.598  1.00 93.81  ? 299  LYS B O   1 
ATOM   6585  C CB  . LYS B  1 299 ? 12.349  -32.863 52.822  1.00 87.53  ? 299  LYS B CB  1 
ATOM   6586  C CG  . LYS B  1 299 ? 13.428  -32.714 51.750  1.00 95.42  ? 299  LYS B CG  1 
ATOM   6587  C CD  . LYS B  1 299 ? 13.475  -33.853 50.754  1.00 107.52 ? 299  LYS B CD  1 
ATOM   6588  C CE  . LYS B  1 299 ? 14.377  -33.519 49.588  1.00 116.41 ? 299  LYS B CE  1 
ATOM   6589  N NZ  . LYS B  1 299 ? 14.490  -34.653 48.623  1.00 123.81 ? 299  LYS B NZ  1 
ATOM   6590  N N   . PRO B  1 300 ? 9.088   -33.198 53.223  1.00 99.33  ? 300  PRO B N   1 
ATOM   6591  C CA  . PRO B  1 300 ? 7.955   -33.473 54.124  1.00 102.26 ? 300  PRO B CA  1 
ATOM   6592  C C   . PRO B  1 300 ? 8.403   -33.990 55.482  1.00 115.29 ? 300  PRO B C   1 
ATOM   6593  O O   . PRO B  1 300 ? 9.477   -34.594 55.601  1.00 114.38 ? 300  PRO B O   1 
ATOM   6594  C CB  . PRO B  1 300 ? 7.142   -34.516 53.367  1.00 104.44 ? 300  PRO B CB  1 
ATOM   6595  C CG  . PRO B  1 300 ? 7.617   -34.442 51.958  1.00 107.58 ? 300  PRO B CG  1 
ATOM   6596  C CD  . PRO B  1 300 ? 9.038   -34.070 52.031  1.00 101.60 ? 300  PRO B CD  1 
ATOM   6597  N N   . CYS B  1 301 ? 7.598   -33.713 56.509  1.00 120.27 ? 301  CYS B N   1 
ATOM   6598  C CA  . CYS B  1 301 ? 7.899   -34.107 57.880  1.00 124.83 ? 301  CYS B CA  1 
ATOM   6599  C C   . CYS B  1 301 ? 7.820   -35.604 58.071  1.00 135.46 ? 301  CYS B C   1 
ATOM   6600  O O   . CYS B  1 301 ? 6.940   -36.240 57.478  1.00 136.56 ? 301  CYS B O   1 
ATOM   6601  C CB  . CYS B  1 301 ? 6.976   -33.383 58.849  1.00 127.00 ? 301  CYS B CB  1 
ATOM   6602  S SG  . CYS B  1 301 ? 7.082   -31.576 58.758  1.00 130.97 ? 301  CYS B SG  1 
ATOM   6603  N N   . THR B  1 302 ? 8.741   -36.168 58.902  1.00 134.88 ? 302  THR B N   1 
ATOM   6604  C CA  . THR B  1 302 ? 8.828   -37.600 59.246  1.00 136.29 ? 302  THR B CA  1 
ATOM   6605  C C   . THR B  1 302 ? 7.428   -38.105 59.641  1.00 142.79 ? 302  THR B C   1 
ATOM   6606  O O   . THR B  1 302 ? 6.879   -39.003 58.996  1.00 143.17 ? 302  THR B O   1 
ATOM   6607  C CB  . THR B  1 302 ? 9.900   -37.815 60.340  1.00 142.50 ? 302  THR B CB  1 
ATOM   6608  O OG1 . THR B  1 302 ? 11.145  -37.284 59.873  1.00 139.12 ? 302  THR B OG1 1 
ATOM   6609  C CG2 . THR B  1 302 ? 10.075  -39.289 60.726  1.00 141.02 ? 302  THR B CG2 1 
ATOM   6610  N N   . ASP B  1 303 ? 6.840   -37.457 60.651  1.00 140.29 ? 303  ASP B N   1 
ATOM   6611  C CA  . ASP B  1 303 ? 5.495   -37.697 61.164  1.00 141.59 ? 303  ASP B CA  1 
ATOM   6612  C C   . ASP B  1 303 ? 5.001   -36.359 61.698  1.00 143.46 ? 303  ASP B C   1 
ATOM   6613  O O   . ASP B  1 303 ? 4.039   -35.799 61.171  1.00 142.87 ? 303  ASP B O   1 
ATOM   6614  C CB  . ASP B  1 303 ? 5.511   -38.766 62.278  1.00 145.15 ? 303  ASP B CB  1 
ATOM   6615  C CG  . ASP B  1 303 ? 5.689   -40.184 61.776  1.00 161.68 ? 303  ASP B CG  1 
ATOM   6616  O OD1 . ASP B  1 303 ? 4.667   -40.829 61.447  1.00 163.82 ? 303  ASP B OD1 1 
ATOM   6617  O OD2 . ASP B  1 303 ? 6.853   -40.661 61.735  1.00 169.35 ? 303  ASP B OD2 1 
ATOM   6618  N N   . ILE B  1 304 ? 5.715   -35.822 62.706  1.00 138.47 ? 304  ILE B N   1 
ATOM   6619  C CA  . ILE B  1 304 ? 5.422   -34.545 63.348  1.00 137.26 ? 304  ILE B CA  1 
ATOM   6620  C C   . ILE B  1 304 ? 6.562   -33.557 63.062  1.00 137.21 ? 304  ILE B C   1 
ATOM   6621  O O   . ILE B  1 304 ? 7.746   -33.865 63.275  1.00 136.49 ? 304  ILE B O   1 
ATOM   6622  C CB  . ILE B  1 304 ? 5.081   -34.716 64.861  1.00 141.17 ? 304  ILE B CB  1 
ATOM   6623  C CG1 . ILE B  1 304 ? 3.799   -35.568 65.056  1.00 143.12 ? 304  ILE B CG1 1 
ATOM   6624  C CG2 . ILE B  1 304 ? 4.941   -33.364 65.578  1.00 141.00 ? 304  ILE B CG2 1 
ATOM   6625  C CD1 . ILE B  1 304 ? 4.029   -37.053 65.402  1.00 149.94 ? 304  ILE B CD1 1 
ATOM   6626  N N   . CYS B  1 305 ? 6.180   -32.385 62.534  1.00 130.28 ? 305  CYS B N   1 
ATOM   6627  C CA  . CYS B  1 305 ? 7.075   -31.298 62.156  1.00 127.10 ? 305  CYS B CA  1 
ATOM   6628  C C   . CYS B  1 305 ? 7.739   -30.681 63.373  1.00 124.62 ? 305  CYS B C   1 
ATOM   6629  O O   . CYS B  1 305 ? 7.055   -30.470 64.377  1.00 124.67 ? 305  CYS B O   1 
ATOM   6630  C CB  . CYS B  1 305 ? 6.316   -30.242 61.350  1.00 127.51 ? 305  CYS B CB  1 
ATOM   6631  S SG  . CYS B  1 305 ? 5.509   -30.889 59.865  1.00 131.96 ? 305  CYS B SG  1 
ATOM   6632  N N   . PRO B  1 306 ? 9.037   -30.298 63.293  1.00 115.76 ? 306  PRO B N   1 
ATOM   6633  C CA  . PRO B  1 306 ? 9.658   -29.587 64.422  1.00 113.59 ? 306  PRO B CA  1 
ATOM   6634  C C   . PRO B  1 306 ? 8.959   -28.245 64.690  1.00 113.37 ? 306  PRO B C   1 
ATOM   6635  O O   . PRO B  1 306 ? 8.297   -27.681 63.802  1.00 114.84 ? 306  PRO B O   1 
ATOM   6636  C CB  . PRO B  1 306 ? 11.097  -29.386 63.962  1.00 114.45 ? 306  PRO B CB  1 
ATOM   6637  C CG  . PRO B  1 306 ? 11.300  -30.396 62.891  1.00 119.28 ? 306  PRO B CG  1 
ATOM   6638  C CD  . PRO B  1 306 ? 9.994   -30.438 62.182  1.00 115.74 ? 306  PRO B CD  1 
ATOM   6639  N N   . LYS B  1 307 ? 9.039   -27.774 65.933  1.00 104.09 ? 307  LYS B N   1 
ATOM   6640  C CA  . LYS B  1 307 ? 8.351   -26.560 66.335  1.00 101.18 ? 307  LYS B CA  1 
ATOM   6641  C C   . LYS B  1 307 ? 9.030   -25.274 65.822  1.00 99.15  ? 307  LYS B C   1 
ATOM   6642  O O   . LYS B  1 307 ? 9.921   -24.727 66.481  1.00 98.98  ? 307  LYS B O   1 
ATOM   6643  C CB  . LYS B  1 307 ? 8.121   -26.581 67.857  1.00 103.24 ? 307  LYS B CB  1 
ATOM   6644  C CG  . LYS B  1 307 ? 7.286   -25.427 68.411  1.00 104.28 ? 307  LYS B CG  1 
ATOM   6645  C CD  . LYS B  1 307 ? 5.779   -25.607 68.272  1.00 108.16 ? 307  LYS B CD  1 
ATOM   6646  C CE  . LYS B  1 307 ? 5.012   -24.358 68.638  1.00 106.01 ? 307  LYS B CE  1 
ATOM   6647  N NZ  . LYS B  1 307 ? 4.988   -24.128 70.100  1.00 108.53 ? 307  LYS B NZ  1 
ATOM   6648  N N   . ALA B  1 308 ? 8.601   -24.804 64.639  1.00 89.87  ? 308  ALA B N   1 
ATOM   6649  C CA  . ALA B  1 308 ? 9.081   -23.561 64.040  1.00 85.56  ? 308  ALA B CA  1 
ATOM   6650  C C   . ALA B  1 308 ? 8.016   -22.490 64.299  1.00 84.05  ? 308  ALA B C   1 
ATOM   6651  O O   . ALA B  1 308 ? 6.840   -22.746 64.114  1.00 82.82  ? 308  ALA B O   1 
ATOM   6652  C CB  . ALA B  1 308 ? 9.325   -23.747 62.557  1.00 85.19  ? 308  ALA B CB  1 
ATOM   6653  N N   . CYS B  1 309 ? 8.427   -21.325 64.784  1.00 79.53  ? 309  CYS B N   1 
ATOM   6654  C CA  . CYS B  1 309 ? 7.526   -20.265 65.172  1.00 80.11  ? 309  CYS B CA  1 
ATOM   6655  C C   . CYS B  1 309 ? 7.691   -19.015 64.420  1.00 80.75  ? 309  CYS B C   1 
ATOM   6656  O O   . CYS B  1 309 ? 8.803   -18.641 64.057  1.00 79.11  ? 309  CYS B O   1 
ATOM   6657  C CB  . CYS B  1 309 ? 7.646   -20.022 66.664  1.00 82.99  ? 309  CYS B CB  1 
ATOM   6658  S SG  . CYS B  1 309 ? 7.474   -21.532 67.637  1.00 89.23  ? 309  CYS B SG  1 
ATOM   6659  N N   . ASP B  1 310 ? 6.581   -18.310 64.242  1.00 77.61  ? 310  ASP B N   1 
ATOM   6660  C CA  . ASP B  1 310 ? 6.571   -17.022 63.566  1.00 76.48  ? 310  ASP B CA  1 
ATOM   6661  C C   . ASP B  1 310 ? 7.353   -16.027 64.411  1.00 77.23  ? 310  ASP B C   1 
ATOM   6662  O O   . ASP B  1 310 ? 7.158   -15.960 65.635  1.00 78.67  ? 310  ASP B O   1 
ATOM   6663  C CB  . ASP B  1 310 ? 5.125   -16.532 63.333  1.00 79.01  ? 310  ASP B CB  1 
ATOM   6664  C CG  . ASP B  1 310 ? 4.400   -17.165 62.155  1.00 87.85  ? 310  ASP B CG  1 
ATOM   6665  O OD1 . ASP B  1 310 ? 5.089   -17.680 61.231  1.00 85.44  ? 310  ASP B OD1 1 
ATOM   6666  O OD2 . ASP B  1 310 ? 3.149   -17.123 62.139  1.00 95.96  ? 310  ASP B OD2 1 
ATOM   6667  N N   . GLY B  1 311 ? 8.287   -15.343 63.765  1.00 68.72  ? 311  GLY B N   1 
ATOM   6668  C CA  . GLY B  1 311 ? 9.083   -14.312 64.404  1.00 66.85  ? 311  GLY B CA  1 
ATOM   6669  C C   . GLY B  1 311 ? 8.364   -12.978 64.383  1.00 68.34  ? 311  GLY B C   1 
ATOM   6670  O O   . GLY B  1 311 ? 7.266   -12.861 63.838  1.00 68.10  ? 311  GLY B O   1 
ATOM   6671  N N   . ILE B  1 312 ? 8.974   -11.957 64.966  1.00 63.73  ? 312  ILE B N   1 
ATOM   6672  C CA  . ILE B  1 312 ? 8.404   -10.617 64.995  1.00 63.48  ? 312  ILE B CA  1 
ATOM   6673  C C   . ILE B  1 312 ? 8.430   -10.039 63.567  1.00 71.26  ? 312  ILE B C   1 
ATOM   6674  O O   . ILE B  1 312 ? 9.501   -9.906  62.953  1.00 71.67  ? 312  ILE B O   1 
ATOM   6675  C CB  . ILE B  1 312 ? 9.120   -9.741  66.053  1.00 65.46  ? 312  ILE B CB  1 
ATOM   6676  C CG1 . ILE B  1 312 ? 9.155   -10.405 67.458  1.00 65.34  ? 312  ILE B CG1 1 
ATOM   6677  C CG2 . ILE B  1 312 ? 8.568   -8.331  66.095  1.00 66.50  ? 312  ILE B CG2 1 
ATOM   6678  C CD1 . ILE B  1 312 ? 7.828   -10.825 68.082  1.00 64.64  ? 312  ILE B CD1 1 
ATOM   6679  N N   . GLY B  1 313 ? 7.234   -9.799  63.036  1.00 69.30  ? 313  GLY B N   1 
ATOM   6680  C CA  . GLY B  1 313 ? 7.004   -9.272  61.694  1.00 69.10  ? 313  GLY B CA  1 
ATOM   6681  C C   . GLY B  1 313 ? 6.737   -10.334 60.639  1.00 74.52  ? 313  GLY B C   1 
ATOM   6682  O O   . GLY B  1 313 ? 6.825   -10.037 59.443  1.00 75.53  ? 313  GLY B O   1 
ATOM   6683  N N   . THR B  1 314 ? 6.388   -11.583 61.070  1.00 69.41  ? 314  THR B N   1 
ATOM   6684  C CA  . THR B  1 314 ? 6.119   -12.744 60.202  1.00 67.25  ? 314  THR B CA  1 
ATOM   6685  C C   . THR B  1 314 ? 4.809   -13.421 60.582  1.00 72.10  ? 314  THR B C   1 
ATOM   6686  O O   . THR B  1 314 ? 4.546   -13.615 61.774  1.00 73.03  ? 314  THR B O   1 
ATOM   6687  C CB  . THR B  1 314 ? 7.318   -13.709 60.263  1.00 64.76  ? 314  THR B CB  1 
ATOM   6688  O OG1 . THR B  1 314 ? 8.417   -13.148 59.541  1.00 72.63  ? 314  THR B OG1 1 
ATOM   6689  C CG2 . THR B  1 314 ? 7.007   -15.095 59.739  1.00 53.69  ? 314  THR B CG2 1 
ATOM   6690  N N   . GLY B  1 315 ? 4.020   -13.789 59.561  1.00 67.56  ? 315  GLY B N   1 
ATOM   6691  C CA  . GLY B  1 315 ? 2.754   -14.510 59.692  1.00 66.79  ? 315  GLY B CA  1 
ATOM   6692  C C   . GLY B  1 315 ? 1.834   -13.997 60.779  1.00 71.01  ? 315  GLY B C   1 
ATOM   6693  O O   . GLY B  1 315 ? 1.366   -12.858 60.702  1.00 72.90  ? 315  GLY B O   1 
ATOM   6694  N N   . SER B  1 316 ? 1.612   -14.811 61.827  1.00 65.40  ? 316  SER B N   1 
ATOM   6695  C CA  . SER B  1 316 ? 0.753   -14.453 62.959  1.00 66.04  ? 316  SER B CA  1 
ATOM   6696  C C   . SER B  1 316 ? 1.214   -13.206 63.706  1.00 71.05  ? 316  SER B C   1 
ATOM   6697  O O   . SER B  1 316 ? 0.426   -12.591 64.437  1.00 72.32  ? 316  SER B O   1 
ATOM   6698  C CB  . SER B  1 316 ? 0.646   -15.617 63.934  1.00 71.46  ? 316  SER B CB  1 
ATOM   6699  O OG  . SER B  1 316 ? 1.918   -16.174 64.214  1.00 82.37  ? 316  SER B OG  1 
ATOM   6700  N N   . LEU B  1 317 ? 2.495   -12.837 63.534  1.00 66.72  ? 317  LEU B N   1 
ATOM   6701  C CA  . LEU B  1 317 ? 3.070   -11.689 64.204  1.00 66.28  ? 317  LEU B CA  1 
ATOM   6702  C C   . LEU B  1 317 ? 3.547   -10.612 63.222  1.00 78.35  ? 317  LEU B C   1 
ATOM   6703  O O   . LEU B  1 317 ? 4.370   -9.768  63.587  1.00 78.02  ? 317  LEU B O   1 
ATOM   6704  C CB  . LEU B  1 317 ? 4.172   -12.145 65.169  1.00 63.88  ? 317  LEU B CB  1 
ATOM   6705  C CG  . LEU B  1 317 ? 3.712   -13.018 66.310  1.00 66.70  ? 317  LEU B CG  1 
ATOM   6706  C CD1 . LEU B  1 317 ? 4.813   -13.860 66.815  1.00 66.50  ? 317  LEU B CD1 1 
ATOM   6707  C CD2 . LEU B  1 317 ? 3.170   -12.219 67.412  1.00 67.93  ? 317  LEU B CD2 1 
ATOM   6708  N N   . MET B  1 318 ? 2.980   -10.602 62.001  1.00 80.10  ? 318  MET B N   1 
ATOM   6709  C CA  . MET B  1 318 ? 3.274   -9.635  60.942  1.00 81.87  ? 318  MET B CA  1 
ATOM   6710  C C   . MET B  1 318 ? 3.228   -8.181  61.451  1.00 82.64  ? 318  MET B C   1 
ATOM   6711  O O   . MET B  1 318 ? 4.114   -7.379  61.143  1.00 81.08  ? 318  MET B O   1 
ATOM   6712  C CB  . MET B  1 318 ? 2.253   -9.791  59.811  1.00 86.26  ? 318  MET B CB  1 
ATOM   6713  C CG  . MET B  1 318 ? 2.671   -9.087  58.550  1.00 91.88  ? 318  MET B CG  1 
ATOM   6714  S SD  . MET B  1 318 ? 3.178   -10.284 57.327  1.00 97.83  ? 318  MET B SD  1 
ATOM   6715  C CE  . MET B  1 318 ? 1.461   -11.036 56.902  1.00 95.62  ? 318  MET B CE  1 
ATOM   6716  N N   . SER B  1 319 ? 2.159   -7.857  62.196  1.00 77.84  ? 319  SER B N   1 
ATOM   6717  C CA  . SER B  1 319 ? 1.884   -6.548  62.788  1.00 77.15  ? 319  SER B CA  1 
ATOM   6718  C C   . SER B  1 319 ? 2.936   -6.127  63.817  1.00 75.03  ? 319  SER B C   1 
ATOM   6719  O O   . SER B  1 319 ? 3.239   -4.942  63.896  1.00 74.94  ? 319  SER B O   1 
ATOM   6720  C CB  . SER B  1 319 ? 0.514   -6.564  63.463  1.00 84.60  ? 319  SER B CB  1 
ATOM   6721  O OG  . SER B  1 319 ? 0.471   -7.463  64.569  1.00 99.99  ? 319  SER B OG  1 
ATOM   6722  N N   . ALA B  1 320 ? 3.453   -7.091  64.632  1.00 66.76  ? 320  ALA B N   1 
ATOM   6723  C CA  . ALA B  1 320 ? 4.418   -6.859  65.715  1.00 64.58  ? 320  ALA B CA  1 
ATOM   6724  C C   . ALA B  1 320 ? 5.723   -6.141  65.343  1.00 64.13  ? 320  ALA B C   1 
ATOM   6725  O O   . ALA B  1 320 ? 6.261   -6.258  64.224  1.00 62.88  ? 320  ALA B O   1 
ATOM   6726  C CB  . ALA B  1 320 ? 4.707   -8.145  66.471  1.00 65.19  ? 320  ALA B CB  1 
ATOM   6727  N N   . GLN B  1 321 ? 6.208   -5.365  66.303  1.00 57.74  ? 321  GLN B N   1 
ATOM   6728  C CA  . GLN B  1 321 ? 7.445   -4.608  66.173  1.00 55.33  ? 321  GLN B CA  1 
ATOM   6729  C C   . GLN B  1 321 ? 8.446   -5.112  67.215  1.00 60.64  ? 321  GLN B C   1 
ATOM   6730  O O   . GLN B  1 321 ? 9.647   -4.993  67.004  1.00 60.96  ? 321  GLN B O   1 
ATOM   6731  C CB  . GLN B  1 321 ? 7.195   -3.096  66.322  1.00 56.05  ? 321  GLN B CB  1 
ATOM   6732  C CG  . GLN B  1 321 ? 6.263   -2.483  65.264  1.00 47.49  ? 321  GLN B CG  1 
ATOM   6733  C CD  . GLN B  1 321 ? 6.350   -0.991  65.258  1.00 73.22  ? 321  GLN B CD  1 
ATOM   6734  O OE1 . GLN B  1 321 ? 7.423   -0.441  65.121  1.00 76.71  ? 321  GLN B OE1 1 
ATOM   6735  N NE2 . GLN B  1 321 ? 5.231   -0.292  65.383  1.00 73.41  ? 321  GLN B NE2 1 
ATOM   6736  N N   . THR B  1 322 ? 7.947   -5.754  68.292  1.00 59.33  ? 322  THR B N   1 
ATOM   6737  C CA  . THR B  1 322 ? 8.733   -6.280  69.419  1.00 59.94  ? 322  THR B CA  1 
ATOM   6738  C C   . THR B  1 322 ? 8.069   -7.440  70.152  1.00 63.73  ? 322  THR B C   1 
ATOM   6739  O O   . THR B  1 322 ? 6.847   -7.592  70.079  1.00 65.64  ? 322  THR B O   1 
ATOM   6740  C CB  . THR B  1 322 ? 8.999   -5.140  70.448  1.00 69.82  ? 322  THR B CB  1 
ATOM   6741  O OG1 . THR B  1 322 ? 9.873   -5.620  71.466  1.00 77.49  ? 322  THR B OG1 1 
ATOM   6742  C CG2 . THR B  1 322 ? 7.729   -4.586  71.087  1.00 61.23  ? 322  THR B CG2 1 
ATOM   6743  N N   . VAL B  1 323 ? 8.875   -8.199  70.926  1.00 58.06  ? 323  VAL B N   1 
ATOM   6744  C CA  . VAL B  1 323 ? 8.362   -9.237  71.819  1.00 58.81  ? 323  VAL B CA  1 
ATOM   6745  C C   . VAL B  1 323 ? 7.750   -8.437  72.968  1.00 65.17  ? 323  VAL B C   1 
ATOM   6746  O O   . VAL B  1 323 ? 8.320   -7.420  73.343  1.00 66.69  ? 323  VAL B O   1 
ATOM   6747  C CB  . VAL B  1 323 ? 9.458   -10.221 72.332  1.00 61.69  ? 323  VAL B CB  1 
ATOM   6748  C CG1 . VAL B  1 323 ? 8.928   -11.141 73.446  1.00 61.72  ? 323  VAL B CG1 1 
ATOM   6749  C CG2 . VAL B  1 323 ? 10.021  -11.052 71.189  1.00 60.21  ? 323  VAL B CG2 1 
ATOM   6750  N N   . ASP B  1 324 ? 6.575   -8.826  73.461  1.00 61.08  ? 324  ASP B N   1 
ATOM   6751  C CA  . ASP B  1 324 ? 5.925   -8.145  74.580  1.00 62.72  ? 324  ASP B CA  1 
ATOM   6752  C C   . ASP B  1 324 ? 5.082   -9.118  75.365  1.00 68.68  ? 324  ASP B C   1 
ATOM   6753  O O   . ASP B  1 324 ? 5.009   -10.295 74.992  1.00 66.48  ? 324  ASP B O   1 
ATOM   6754  C CB  . ASP B  1 324 ? 5.101   -6.917  74.115  1.00 65.80  ? 324  ASP B CB  1 
ATOM   6755  C CG  . ASP B  1 324 ? 4.103   -7.151  72.991  1.00 75.25  ? 324  ASP B CG  1 
ATOM   6756  O OD1 . ASP B  1 324 ? 3.343   -8.134  73.068  1.00 77.54  ? 324  ASP B OD1 1 
ATOM   6757  O OD2 . ASP B  1 324 ? 4.047   -6.313  72.060  1.00 74.60  ? 324  ASP B OD2 1 
ATOM   6758  N N   . SER B  1 325 ? 4.424   -8.637  76.440  1.00 69.90  ? 325  SER B N   1 
ATOM   6759  C CA  . SER B  1 325 ? 3.544   -9.471  77.284  1.00 71.72  ? 325  SER B CA  1 
ATOM   6760  C C   . SER B  1 325 ? 2.377   -10.108 76.495  1.00 75.00  ? 325  SER B C   1 
ATOM   6761  O O   . SER B  1 325 ? 1.973   -11.236 76.810  1.00 75.59  ? 325  SER B O   1 
ATOM   6762  C CB  . SER B  1 325 ? 3.051   -8.700  78.505  1.00 76.74  ? 325  SER B CB  1 
ATOM   6763  O OG  . SER B  1 325 ? 2.528   -7.442  78.123  1.00 92.04  ? 325  SER B OG  1 
ATOM   6764  N N   . SER B  1 326 ? 1.920   -9.425  75.418  1.00 69.09  ? 326  SER B N   1 
ATOM   6765  C CA  . SER B  1 326 ? 0.835   -9.883  74.561  1.00 69.07  ? 326  SER B CA  1 
ATOM   6766  C C   . SER B  1 326 ? 1.223   -11.018 73.612  1.00 74.22  ? 326  SER B C   1 
ATOM   6767  O O   . SER B  1 326 ? 0.332   -11.619 73.000  1.00 75.39  ? 326  SER B O   1 
ATOM   6768  C CB  . SER B  1 326 ? 0.258   -8.710  73.778  1.00 73.34  ? 326  SER B CB  1 
ATOM   6769  O OG  . SER B  1 326 ? 0.838   -8.589  72.487  1.00 87.33  ? 326  SER B OG  1 
ATOM   6770  N N   . ASN B  1 327 ? 2.538   -11.278 73.427  1.00 69.34  ? 327  ASN B N   1 
ATOM   6771  C CA  . ASN B  1 327 ? 2.991   -12.306 72.495  1.00 66.95  ? 327  ASN B CA  1 
ATOM   6772  C C   . ASN B  1 327 ? 4.083   -13.230 72.997  1.00 72.21  ? 327  ASN B C   1 
ATOM   6773  O O   . ASN B  1 327 ? 4.373   -14.219 72.315  1.00 72.93  ? 327  ASN B O   1 
ATOM   6774  C CB  . ASN B  1 327 ? 3.325   -11.716 71.132  1.00 61.60  ? 327  ASN B CB  1 
ATOM   6775  C CG  . ASN B  1 327 ? 4.433   -10.697 71.099  1.00 70.79  ? 327  ASN B CG  1 
ATOM   6776  O OD1 . ASN B  1 327 ? 5.468   -10.819 71.758  1.00 57.79  ? 327  ASN B OD1 1 
ATOM   6777  N ND2 . ASN B  1 327 ? 4.274   -9.711  70.243  1.00 66.54  ? 327  ASN B ND2 1 
ATOM   6778  N N   . ILE B  1 328 ? 4.670   -12.944 74.186  1.00 68.31  ? 328  ILE B N   1 
ATOM   6779  C CA  . ILE B  1 328 ? 5.716   -13.780 74.803  1.00 68.41  ? 328  ILE B CA  1 
ATOM   6780  C C   . ILE B  1 328 ? 5.296   -15.252 74.897  1.00 75.65  ? 328  ILE B C   1 
ATOM   6781  O O   . ILE B  1 328 ? 6.121   -16.138 74.694  1.00 74.52  ? 328  ILE B O   1 
ATOM   6782  C CB  . ILE B  1 328 ? 6.223   -13.195 76.159  1.00 72.05  ? 328  ILE B CB  1 
ATOM   6783  C CG1 . ILE B  1 328 ? 7.394   -14.003 76.787  1.00 71.01  ? 328  ILE B CG1 1 
ATOM   6784  C CG2 . ILE B  1 328 ? 5.092   -12.988 77.157  1.00 75.76  ? 328  ILE B CG2 1 
ATOM   6785  C CD1 . ILE B  1 328 ? 8.733   -13.717 76.269  1.00 66.44  ? 328  ILE B CD1 1 
ATOM   6786  N N   . ASP B  1 329 ? 4.002   -15.500 75.131  1.00 76.94  ? 329  ASP B N   1 
ATOM   6787  C CA  . ASP B  1 329 ? 3.474   -16.854 75.217  1.00 78.84  ? 329  ASP B CA  1 
ATOM   6788  C C   . ASP B  1 329 ? 3.313   -17.597 73.881  1.00 82.54  ? 329  ASP B C   1 
ATOM   6789  O O   . ASP B  1 329 ? 3.169   -18.818 73.880  1.00 83.75  ? 329  ASP B O   1 
ATOM   6790  C CB  . ASP B  1 329 ? 2.263   -16.933 76.147  1.00 82.83  ? 329  ASP B CB  1 
ATOM   6791  C CG  . ASP B  1 329 ? 2.645   -16.867 77.628  1.00 102.36 ? 329  ASP B CG  1 
ATOM   6792  O OD1 . ASP B  1 329 ? 3.852   -17.027 77.946  1.00 103.82 ? 329  ASP B OD1 1 
ATOM   6793  O OD2 . ASP B  1 329 ? 1.736   -16.701 78.473  1.00 113.11 ? 329  ASP B OD2 1 
ATOM   6794  N N   . LYS B  1 330 ? 3.455   -16.888 72.747  1.00 75.83  ? 330  LYS B N   1 
ATOM   6795  C CA  . LYS B  1 330 ? 3.385   -17.518 71.432  1.00 74.52  ? 330  LYS B CA  1 
ATOM   6796  C C   . LYS B  1 330 ? 4.711   -18.240 71.125  1.00 78.87  ? 330  LYS B C   1 
ATOM   6797  O O   . LYS B  1 330 ? 4.861   -18.838 70.050  1.00 79.51  ? 330  LYS B O   1 
ATOM   6798  C CB  . LYS B  1 330 ? 3.044   -16.481 70.344  1.00 76.45  ? 330  LYS B CB  1 
ATOM   6799  C CG  . LYS B  1 330 ? 1.571   -16.100 70.312  1.00 96.38  ? 330  LYS B CG  1 
ATOM   6800  C CD  . LYS B  1 330 ? 1.266   -14.928 69.361  1.00 112.09 ? 330  LYS B CD  1 
ATOM   6801  C CE  . LYS B  1 330 ? 0.065   -14.089 69.790  1.00 128.76 ? 330  LYS B CE  1 
ATOM   6802  N NZ  . LYS B  1 330 ? -1.227  -14.833 69.701  1.00 143.35 ? 330  LYS B NZ  1 
ATOM   6803  N N   . PHE B  1 331 ? 5.676   -18.177 72.080  1.00 72.99  ? 331  PHE B N   1 
ATOM   6804  C CA  . PHE B  1 331 ? 7.010   -18.763 71.947  1.00 69.31  ? 331  PHE B CA  1 
ATOM   6805  C C   . PHE B  1 331 ? 7.259   -20.001 72.816  1.00 75.16  ? 331  PHE B C   1 
ATOM   6806  O O   . PHE B  1 331 ? 8.389   -20.494 72.824  1.00 75.45  ? 331  PHE B O   1 
ATOM   6807  C CB  . PHE B  1 331 ? 8.109   -17.697 72.120  1.00 69.12  ? 331  PHE B CB  1 
ATOM   6808  C CG  . PHE B  1 331 ? 8.071   -16.578 71.101  1.00 68.77  ? 331  PHE B CG  1 
ATOM   6809  C CD1 . PHE B  1 331 ? 7.536   -15.341 71.426  1.00 71.73  ? 331  PHE B CD1 1 
ATOM   6810  C CD2 . PHE B  1 331 ? 8.538   -16.777 69.802  1.00 68.62  ? 331  PHE B CD2 1 
ATOM   6811  C CE1 . PHE B  1 331 ? 7.474   -14.319 70.471  1.00 71.93  ? 331  PHE B CE1 1 
ATOM   6812  C CE2 . PHE B  1 331 ? 8.480   -15.758 68.848  1.00 70.24  ? 331  PHE B CE2 1 
ATOM   6813  C CZ  . PHE B  1 331 ? 7.956   -14.532 69.188  1.00 69.21  ? 331  PHE B CZ  1 
ATOM   6814  N N   . ILE B  1 332 ? 6.214   -20.547 73.500  1.00 73.46  ? 332  ILE B N   1 
ATOM   6815  C CA  . ILE B  1 332 ? 6.393   -21.762 74.314  1.00 74.03  ? 332  ILE B CA  1 
ATOM   6816  C C   . ILE B  1 332 ? 6.805   -22.947 73.436  1.00 80.35  ? 332  ILE B C   1 
ATOM   6817  O O   . ILE B  1 332 ? 6.127   -23.233 72.452  1.00 79.56  ? 332  ILE B O   1 
ATOM   6818  C CB  . ILE B  1 332 ? 5.193   -22.159 75.230  1.00 77.84  ? 332  ILE B CB  1 
ATOM   6819  C CG1 . ILE B  1 332 ? 4.302   -20.982 75.706  1.00 78.87  ? 332  ILE B CG1 1 
ATOM   6820  C CG2 . ILE B  1 332 ? 5.635   -23.102 76.364  1.00 78.71  ? 332  ILE B CG2 1 
ATOM   6821  C CD1 . ILE B  1 332 ? 4.865   -19.978 76.686  1.00 87.47  ? 332  ILE B CD1 1 
ATOM   6822  N N   . ASN B  1 333 ? 7.924   -23.611 73.796  1.00 78.89  ? 333  ASN B N   1 
ATOM   6823  C CA  . ASN B  1 333 ? 8.483   -24.796 73.146  1.00 78.56  ? 333  ASN B CA  1 
ATOM   6824  C C   . ASN B  1 333 ? 9.028   -24.605 71.748  1.00 82.56  ? 333  ASN B C   1 
ATOM   6825  O O   . ASN B  1 333 ? 9.214   -25.603 71.059  1.00 82.67  ? 333  ASN B O   1 
ATOM   6826  C CB  . ASN B  1 333 ? 7.535   -26.011 73.221  1.00 81.74  ? 333  ASN B CB  1 
ATOM   6827  C CG  . ASN B  1 333 ? 7.220   -26.534 74.593  1.00 120.81 ? 333  ASN B CG  1 
ATOM   6828  O OD1 . ASN B  1 333 ? 7.948   -26.308 75.562  1.00 117.92 ? 333  ASN B OD1 1 
ATOM   6829  N ND2 . ASN B  1 333 ? 6.114   -27.269 74.698  1.00 121.88 ? 333  ASN B ND2 1 
ATOM   6830  N N   . CYS B  1 334 ? 9.343   -23.363 71.333  1.00 80.22  ? 334  CYS B N   1 
ATOM   6831  C CA  . CYS B  1 334 ? 9.931   -23.099 70.014  1.00 80.36  ? 334  CYS B CA  1 
ATOM   6832  C C   . CYS B  1 334 ? 11.377  -23.512 69.958  1.00 80.06  ? 334  CYS B C   1 
ATOM   6833  O O   . CYS B  1 334 ? 12.161  -23.141 70.823  1.00 80.35  ? 334  CYS B O   1 
ATOM   6834  C CB  . CYS B  1 334 ? 9.776   -21.639 69.619  1.00 82.91  ? 334  CYS B CB  1 
ATOM   6835  S SG  . CYS B  1 334 ? 8.059   -21.089 69.524  1.00 89.73  ? 334  CYS B SG  1 
ATOM   6836  N N   . THR B  1 335 ? 11.742  -24.257 68.930  1.00 72.42  ? 335  THR B N   1 
ATOM   6837  C CA  . THR B  1 335 ? 13.128  -24.674 68.705  1.00 69.76  ? 335  THR B CA  1 
ATOM   6838  C C   . THR B  1 335 ? 13.752  -23.848 67.578  1.00 69.62  ? 335  THR B C   1 
ATOM   6839  O O   . THR B  1 335 ? 14.970  -23.681 67.521  1.00 69.32  ? 335  THR B O   1 
ATOM   6840  C CB  . THR B  1 335 ? 13.213  -26.173 68.433  1.00 69.17  ? 335  THR B CB  1 
ATOM   6841  O OG1 . THR B  1 335 ? 12.215  -26.515 67.496  1.00 65.35  ? 335  THR B OG1 1 
ATOM   6842  C CG2 . THR B  1 335 ? 13.039  -27.004 69.672  1.00 64.11  ? 335  THR B CG2 1 
ATOM   6843  N N   . LYS B  1 336 ? 12.897  -23.311 66.699  1.00 63.14  ? 336  LYS B N   1 
ATOM   6844  C CA  . LYS B  1 336 ? 13.271  -22.488 65.550  1.00 60.74  ? 336  LYS B CA  1 
ATOM   6845  C C   . LYS B  1 336 ? 12.366  -21.274 65.500  1.00 61.92  ? 336  LYS B C   1 
ATOM   6846  O O   . LYS B  1 336 ? 11.177  -21.394 65.775  1.00 62.86  ? 336  LYS B O   1 
ATOM   6847  C CB  . LYS B  1 336 ? 13.087  -23.294 64.253  1.00 61.71  ? 336  LYS B CB  1 
ATOM   6848  C CG  . LYS B  1 336 ? 13.858  -22.777 63.059  1.00 66.24  ? 336  LYS B CG  1 
ATOM   6849  C CD  . LYS B  1 336 ? 13.627  -23.696 61.882  1.00 68.59  ? 336  LYS B CD  1 
ATOM   6850  C CE  . LYS B  1 336 ? 14.721  -23.558 60.857  1.00 80.74  ? 336  LYS B CE  1 
ATOM   6851  N NZ  . LYS B  1 336 ? 15.369  -24.873 60.537  1.00 83.11  ? 336  LYS B NZ  1 
ATOM   6852  N N   . ILE B  1 337 ? 12.915  -20.113 65.151  1.00 54.74  ? 337  ILE B N   1 
ATOM   6853  C CA  . ILE B  1 337 ? 12.120  -18.899 64.997  1.00 52.54  ? 337  ILE B CA  1 
ATOM   6854  C C   . ILE B  1 337 ? 12.163  -18.542 63.516  1.00 56.19  ? 337  ILE B C   1 
ATOM   6855  O O   . ILE B  1 337 ? 13.254  -18.223 62.992  1.00 54.20  ? 337  ILE B O   1 
ATOM   6856  C CB  . ILE B  1 337 ? 12.554  -17.712 65.926  1.00 53.77  ? 337  ILE B CB  1 
ATOM   6857  C CG1 . ILE B  1 337 ? 12.528  -18.060 67.429  1.00 53.42  ? 337  ILE B CG1 1 
ATOM   6858  C CG2 . ILE B  1 337 ? 11.758  -16.439 65.638  1.00 53.47  ? 337  ILE B CG2 1 
ATOM   6859  C CD1 . ILE B  1 337 ? 11.170  -18.506 68.005  1.00 70.41  ? 337  ILE B CD1 1 
ATOM   6860  N N   . ASN B  1 338 ? 10.989  -18.646 62.825  1.00 52.28  ? 338  ASN B N   1 
ATOM   6861  C CA  . ASN B  1 338 ? 10.913  -18.290 61.409  1.00 51.29  ? 338  ASN B CA  1 
ATOM   6862  C C   . ASN B  1 338 ? 10.754  -16.815 61.303  1.00 54.76  ? 338  ASN B C   1 
ATOM   6863  O O   . ASN B  1 338 ? 9.641   -16.291 61.351  1.00 56.27  ? 338  ASN B O   1 
ATOM   6864  C CB  . ASN B  1 338 ? 9.896   -19.103 60.620  1.00 49.20  ? 338  ASN B CB  1 
ATOM   6865  C CG  . ASN B  1 338 ? 10.621  -20.185 59.884  1.00 92.06  ? 338  ASN B CG  1 
ATOM   6866  O OD1 . ASN B  1 338 ? 11.628  -19.948 59.204  1.00 92.95  ? 338  ASN B OD1 1 
ATOM   6867  N ND2 . ASN B  1 338 ? 10.218  -21.409 60.091  1.00 90.22  ? 338  ASN B ND2 1 
ATOM   6868  N N   . GLY B  1 339 ? 11.891  -16.146 61.317  1.00 49.34  ? 339  GLY B N   1 
ATOM   6869  C CA  . GLY B  1 339 ? 11.897  -14.701 61.344  1.00 50.13  ? 339  GLY B CA  1 
ATOM   6870  C C   . GLY B  1 339 ? 12.831  -14.107 62.371  1.00 56.30  ? 339  GLY B C   1 
ATOM   6871  O O   . GLY B  1 339 ? 13.914  -14.633 62.622  1.00 56.64  ? 339  GLY B O   1 
ATOM   6872  N N   . ASN B  1 340 ? 12.432  -12.972 62.925  1.00 54.22  ? 340  ASN B N   1 
ATOM   6873  C CA  . ASN B  1 340 ? 13.247  -12.208 63.854  1.00 54.29  ? 340  ASN B CA  1 
ATOM   6874  C C   . ASN B  1 340 ? 12.767  -12.228 65.302  1.00 59.22  ? 340  ASN B C   1 
ATOM   6875  O O   . ASN B  1 340 ? 11.622  -12.570 65.604  1.00 58.55  ? 340  ASN B O   1 
ATOM   6876  C CB  . ASN B  1 340 ? 13.309  -10.748 63.385  1.00 53.54  ? 340  ASN B CB  1 
ATOM   6877  C CG  . ASN B  1 340 ? 13.520  -10.589 61.915  1.00 69.77  ? 340  ASN B CG  1 
ATOM   6878  O OD1 . ASN B  1 340 ? 14.196  -11.373 61.263  1.00 57.69  ? 340  ASN B OD1 1 
ATOM   6879  N ND2 . ASN B  1 340 ? 12.921  -9.579  61.359  1.00 67.86  ? 340  ASN B ND2 1 
ATOM   6880  N N   . LEU B  1 341 ? 13.671  -11.827 66.199  1.00 56.05  ? 341  LEU B N   1 
ATOM   6881  C CA  . LEU B  1 341 ? 13.401  -11.615 67.614  1.00 55.67  ? 341  LEU B CA  1 
ATOM   6882  C C   . LEU B  1 341 ? 13.902  -10.237 67.895  1.00 59.94  ? 341  LEU B C   1 
ATOM   6883  O O   . LEU B  1 341 ? 15.088  -9.933  67.669  1.00 59.38  ? 341  LEU B O   1 
ATOM   6884  C CB  . LEU B  1 341 ? 14.029  -12.637 68.559  1.00 54.61  ? 341  LEU B CB  1 
ATOM   6885  C CG  . LEU B  1 341 ? 13.262  -13.917 68.726  1.00 58.25  ? 341  LEU B CG  1 
ATOM   6886  C CD1 . LEU B  1 341 ? 13.960  -14.815 69.690  1.00 57.90  ? 341  LEU B CD1 1 
ATOM   6887  C CD2 . LEU B  1 341 ? 11.840  -13.657 69.177  1.00 62.12  ? 341  LEU B CD2 1 
ATOM   6888  N N   . ILE B  1 342 ? 12.957  -9.368  68.248  1.00 55.15  ? 342  ILE B N   1 
ATOM   6889  C CA  . ILE B  1 342 ? 13.225  -7.983  68.520  1.00 55.02  ? 342  ILE B CA  1 
ATOM   6890  C C   . ILE B  1 342 ? 12.686  -7.674  69.905  1.00 60.09  ? 342  ILE B C   1 
ATOM   6891  O O   . ILE B  1 342 ? 11.546  -8.029  70.224  1.00 62.06  ? 342  ILE B O   1 
ATOM   6892  C CB  . ILE B  1 342 ? 12.624  -7.062  67.422  1.00 58.47  ? 342  ILE B CB  1 
ATOM   6893  C CG1 . ILE B  1 342 ? 13.129  -7.431  66.020  1.00 58.02  ? 342  ILE B CG1 1 
ATOM   6894  C CG2 . ILE B  1 342 ? 12.912  -5.583  67.721  1.00 61.60  ? 342  ILE B CG2 1 
ATOM   6895  C CD1 . ILE B  1 342 ? 12.091  -7.508  65.019  1.00 65.80  ? 342  ILE B CD1 1 
ATOM   6896  N N   . PHE B  1 343 ? 13.522  -7.011  70.725  1.00 53.97  ? 343  PHE B N   1 
ATOM   6897  C CA  . PHE B  1 343 ? 13.189  -6.560  72.058  1.00 53.20  ? 343  PHE B CA  1 
ATOM   6898  C C   . PHE B  1 343 ? 13.410  -5.064  72.062  1.00 61.30  ? 343  PHE B C   1 
ATOM   6899  O O   . PHE B  1 343 ? 14.555  -4.612  72.006  1.00 61.24  ? 343  PHE B O   1 
ATOM   6900  C CB  . PHE B  1 343 ? 14.055  -7.261  73.104  1.00 53.78  ? 343  PHE B CB  1 
ATOM   6901  C CG  . PHE B  1 343 ? 13.929  -8.760  73.060  1.00 53.88  ? 343  PHE B CG  1 
ATOM   6902  C CD1 . PHE B  1 343 ? 14.790  -9.525  72.280  1.00 54.22  ? 343  PHE B CD1 1 
ATOM   6903  C CD2 . PHE B  1 343 ? 12.938  -9.412  73.788  1.00 56.05  ? 343  PHE B CD2 1 
ATOM   6904  C CE1 . PHE B  1 343 ? 14.672  -10.916 72.241  1.00 54.51  ? 343  PHE B CE1 1 
ATOM   6905  C CE2 . PHE B  1 343 ? 12.820  -10.807 73.748  1.00 57.73  ? 343  PHE B CE2 1 
ATOM   6906  C CZ  . PHE B  1 343 ? 13.690  -11.550 72.981  1.00 54.71  ? 343  PHE B CZ  1 
ATOM   6907  N N   . LEU B  1 344 ? 12.308  -4.297  71.991  1.00 60.12  ? 344  LEU B N   1 
ATOM   6908  C CA  . LEU B  1 344 ? 12.343  -2.835  71.987  1.00 60.49  ? 344  LEU B CA  1 
ATOM   6909  C C   . LEU B  1 344 ? 12.047  -2.362  73.377  1.00 66.10  ? 344  LEU B C   1 
ATOM   6910  O O   . LEU B  1 344 ? 11.592  -3.150  74.204  1.00 65.55  ? 344  LEU B O   1 
ATOM   6911  C CB  . LEU B  1 344 ? 11.315  -2.235  71.002  1.00 60.54  ? 344  LEU B CB  1 
ATOM   6912  C CG  . LEU B  1 344 ? 11.536  -2.500  69.498  1.00 64.52  ? 344  LEU B CG  1 
ATOM   6913  C CD1 . LEU B  1 344 ? 10.397  -1.982  68.689  1.00 63.86  ? 344  LEU B CD1 1 
ATOM   6914  C CD2 . LEU B  1 344 ? 12.816  -1.860  68.992  1.00 68.46  ? 344  LEU B CD2 1 
ATOM   6915  N N   . VAL B  1 345 ? 12.316  -1.073  73.661  1.00 64.33  ? 345  VAL B N   1 
ATOM   6916  C CA  . VAL B  1 345 ? 12.070  -0.469  74.978  1.00 64.15  ? 345  VAL B CA  1 
ATOM   6917  C C   . VAL B  1 345 ? 10.616  -0.702  75.387  1.00 68.17  ? 345  VAL B C   1 
ATOM   6918  O O   . VAL B  1 345 ? 10.375  -1.236  76.468  1.00 68.91  ? 345  VAL B O   1 
ATOM   6919  C CB  . VAL B  1 345 ? 12.494  1.008   75.025  1.00 67.48  ? 345  VAL B CB  1 
ATOM   6920  C CG1 . VAL B  1 345 ? 12.254  1.579   76.399  1.00 69.00  ? 345  VAL B CG1 1 
ATOM   6921  C CG2 . VAL B  1 345 ? 13.963  1.170   74.641  1.00 66.13  ? 345  VAL B CG2 1 
ATOM   6922  N N   . THR B  1 346 ? 9.672   -0.432  74.467  1.00 64.01  ? 346  THR B N   1 
ATOM   6923  C CA  . THR B  1 346 ? 8.231   -0.644  74.662  1.00 65.11  ? 346  THR B CA  1 
ATOM   6924  C C   . THR B  1 346 ? 7.775   -2.114  74.811  1.00 69.28  ? 346  THR B C   1 
ATOM   6925  O O   . THR B  1 346 ? 6.624   -2.378  75.180  1.00 71.60  ? 346  THR B O   1 
ATOM   6926  C CB  . THR B  1 346 ? 7.418   0.106   73.613  1.00 72.17  ? 346  THR B CB  1 
ATOM   6927  O OG1 . THR B  1 346 ? 8.214   0.319   72.450  1.00 74.10  ? 346  THR B OG1 1 
ATOM   6928  C CG2 . THR B  1 346 ? 6.881   1.410   74.144  1.00 67.00  ? 346  THR B CG2 1 
ATOM   6929  N N   . GLY B  1 347 ? 8.660   -3.050  74.506  1.00 62.85  ? 347  GLY B N   1 
ATOM   6930  C CA  . GLY B  1 347 ? 8.372   -4.465  74.670  1.00 61.68  ? 347  GLY B CA  1 
ATOM   6931  C C   . GLY B  1 347 ? 8.647   -4.887  76.094  1.00 68.28  ? 347  GLY B C   1 
ATOM   6932  O O   . GLY B  1 347 ? 7.776   -5.445  76.768  1.00 70.27  ? 347  GLY B O   1 
ATOM   6933  N N   . ILE B  1 348 ? 9.859   -4.568  76.573  1.00 64.69  ? 348  ILE B N   1 
ATOM   6934  C CA  . ILE B  1 348 ? 10.373  -4.883  77.905  1.00 64.85  ? 348  ILE B CA  1 
ATOM   6935  C C   . ILE B  1 348 ? 9.688   -4.059  78.995  1.00 70.09  ? 348  ILE B C   1 
ATOM   6936  O O   . ILE B  1 348 ? 9.267   -4.610  80.008  1.00 70.30  ? 348  ILE B O   1 
ATOM   6937  C CB  . ILE B  1 348 ? 11.943  -4.785  77.919  1.00 67.07  ? 348  ILE B CB  1 
ATOM   6938  C CG1 . ILE B  1 348 ? 12.612  -5.780  76.937  1.00 65.34  ? 348  ILE B CG1 1 
ATOM   6939  C CG2 . ILE B  1 348 ? 12.555  -4.893  79.321  1.00 69.63  ? 348  ILE B CG2 1 
ATOM   6940  C CD1 . ILE B  1 348 ? 12.490  -7.327  77.243  1.00 69.02  ? 348  ILE B CD1 1 
ATOM   6941  N N   . HIS B  1 349 ? 9.566   -2.752  78.769  1.00 68.93  ? 349  HIS B N   1 
ATOM   6942  C CA  . HIS B  1 349 ? 9.002   -1.807  79.722  1.00 71.42  ? 349  HIS B CA  1 
ATOM   6943  C C   . HIS B  1 349 ? 7.538   -1.421  79.463  1.00 78.79  ? 349  HIS B C   1 
ATOM   6944  O O   . HIS B  1 349 ? 7.006   -0.528  80.114  1.00 80.92  ? 349  HIS B O   1 
ATOM   6945  C CB  . HIS B  1 349 ? 9.936   -0.592  79.886  1.00 72.46  ? 349  HIS B CB  1 
ATOM   6946  C CG  . HIS B  1 349 ? 11.312  -0.985  80.315  1.00 75.42  ? 349  HIS B CG  1 
ATOM   6947  N ND1 . HIS B  1 349 ? 11.641  -1.104  81.643  1.00 78.35  ? 349  HIS B ND1 1 
ATOM   6948  C CD2 . HIS B  1 349 ? 12.379  -1.346  79.565  1.00 76.78  ? 349  HIS B CD2 1 
ATOM   6949  C CE1 . HIS B  1 349 ? 12.897  -1.526  81.669  1.00 77.63  ? 349  HIS B CE1 1 
ATOM   6950  N NE2 . HIS B  1 349 ? 13.384  -1.693  80.441  1.00 76.75  ? 349  HIS B NE2 1 
ATOM   6951  N N   . GLY B  1 350 ? 6.886   -2.132  78.558  1.00 75.75  ? 350  GLY B N   1 
ATOM   6952  C CA  . GLY B  1 350 ? 5.482   -1.907  78.233  1.00 76.56  ? 350  GLY B CA  1 
ATOM   6953  C C   . GLY B  1 350 ? 5.139   -0.666  77.425  1.00 80.91  ? 350  GLY B C   1 
ATOM   6954  O O   . GLY B  1 350 ? 5.854   0.343   77.466  1.00 80.18  ? 350  GLY B O   1 
ATOM   6955  N N   . ASP B  1 351 ? 4.030   -0.762  76.665  1.00 78.85  ? 351  ASP B N   1 
ATOM   6956  C CA  . ASP B  1 351 ? 3.464   0.293   75.824  1.00 79.74  ? 351  ASP B CA  1 
ATOM   6957  C C   . ASP B  1 351 ? 2.103   0.744   76.416  1.00 86.48  ? 351  ASP B C   1 
ATOM   6958  O O   . ASP B  1 351 ? 1.051   0.189   76.067  1.00 85.44  ? 351  ASP B O   1 
ATOM   6959  C CB  . ASP B  1 351 ? 3.330   -0.184  74.358  1.00 80.30  ? 351  ASP B CB  1 
ATOM   6960  C CG  . ASP B  1 351 ? 2.801   0.840   73.361  1.00 87.49  ? 351  ASP B CG  1 
ATOM   6961  O OD1 . ASP B  1 351 ? 2.660   2.036   73.742  1.00 90.74  ? 351  ASP B OD1 1 
ATOM   6962  O OD2 . ASP B  1 351 ? 2.527   0.446   72.197  1.00 82.97  ? 351  ASP B OD2 1 
ATOM   6963  N N   . PRO B  1 352 ? 2.140   1.743   77.332  1.00 85.96  ? 352  PRO B N   1 
ATOM   6964  C CA  . PRO B  1 352 ? 0.907   2.216   77.982  1.00 88.36  ? 352  PRO B CA  1 
ATOM   6965  C C   . PRO B  1 352 ? -0.223  2.626   77.037  1.00 95.58  ? 352  PRO B C   1 
ATOM   6966  O O   . PRO B  1 352 ? -1.369  2.256   77.287  1.00 96.79  ? 352  PRO B O   1 
ATOM   6967  C CB  . PRO B  1 352 ? 1.391   3.418   78.806  1.00 90.52  ? 352  PRO B CB  1 
ATOM   6968  C CG  . PRO B  1 352 ? 2.783   3.139   79.081  1.00 93.38  ? 352  PRO B CG  1 
ATOM   6969  C CD  . PRO B  1 352 ? 3.313   2.464   77.862  1.00 87.32  ? 352  PRO B CD  1 
ATOM   6970  N N   . TYR B  1 353 ? 0.101   3.368   75.952  1.00 91.41  ? 353  TYR B N   1 
ATOM   6971  C CA  . TYR B  1 353 ? -0.877  3.840   74.970  1.00 90.65  ? 353  TYR B CA  1 
ATOM   6972  C C   . TYR B  1 353 ? -1.758  2.726   74.413  1.00 90.71  ? 353  TYR B C   1 
ATOM   6973  O O   . TYR B  1 353 ? -2.958  2.926   74.260  1.00 90.83  ? 353  TYR B O   1 
ATOM   6974  C CB  . TYR B  1 353 ? -0.184  4.608   73.834  1.00 91.29  ? 353  TYR B CB  1 
ATOM   6975  C CG  . TYR B  1 353 ? -1.142  5.243   72.854  1.00 94.09  ? 353  TYR B CG  1 
ATOM   6976  C CD1 . TYR B  1 353 ? -1.774  6.450   73.147  1.00 98.19  ? 353  TYR B CD1 1 
ATOM   6977  C CD2 . TYR B  1 353 ? -1.408  4.648   71.626  1.00 93.75  ? 353  TYR B CD2 1 
ATOM   6978  C CE1 . TYR B  1 353 ? -2.653  7.044   72.244  1.00 100.87 ? 353  TYR B CE1 1 
ATOM   6979  C CE2 . TYR B  1 353 ? -2.281  5.233   70.712  1.00 95.36  ? 353  TYR B CE2 1 
ATOM   6980  C CZ  . TYR B  1 353 ? -2.897  6.436   71.021  1.00 107.68 ? 353  TYR B CZ  1 
ATOM   6981  O OH  . TYR B  1 353 ? -3.757  7.017   70.119  1.00 112.53 ? 353  TYR B OH  1 
ATOM   6982  N N   . ASN B  1 354 ? -1.166  1.564   74.111  1.00 84.34  ? 354  ASN B N   1 
ATOM   6983  C CA  . ASN B  1 354 ? -1.909  0.426   73.582  1.00 82.57  ? 354  ASN B CA  1 
ATOM   6984  C C   . ASN B  1 354 ? -2.249  -0.588  74.674  1.00 84.67  ? 354  ASN B C   1 
ATOM   6985  O O   . ASN B  1 354 ? -2.579  -1.741  74.379  1.00 83.65  ? 354  ASN B O   1 
ATOM   6986  C CB  . ASN B  1 354 ? -1.179  -0.196  72.398  1.00 79.87  ? 354  ASN B CB  1 
ATOM   6987  C CG  . ASN B  1 354 ? -1.166  0.691   71.181  1.00 106.31 ? 354  ASN B CG  1 
ATOM   6988  O OD1 . ASN B  1 354 ? -0.209  1.426   70.931  1.00 104.91 ? 354  ASN B OD1 1 
ATOM   6989  N ND2 . ASN B  1 354 ? -2.228  0.649   70.397  1.00 98.88  ? 354  ASN B ND2 1 
ATOM   6990  N N   . ALA B  1 355 ? -2.198  -0.131  75.939  1.00 81.26  ? 355  ALA B N   1 
ATOM   6991  C CA  . ALA B  1 355 ? -2.492  -0.909  77.139  1.00 82.91  ? 355  ALA B CA  1 
ATOM   6992  C C   . ALA B  1 355 ? -1.786  -2.278  77.204  1.00 87.36  ? 355  ALA B C   1 
ATOM   6993  O O   . ALA B  1 355 ? -2.420  -3.335  77.388  1.00 86.71  ? 355  ALA B O   1 
ATOM   6994  C CB  . ALA B  1 355 ? -3.996  -1.048  77.325  1.00 85.44  ? 355  ALA B CB  1 
ATOM   6995  N N   . ILE B  1 356 ? -0.452  -2.244  77.017  1.00 83.36  ? 356  ILE B N   1 
ATOM   6996  C CA  . ILE B  1 356 ? 0.396   -3.431  77.106  1.00 81.00  ? 356  ILE B CA  1 
ATOM   6997  C C   . ILE B  1 356 ? 1.316   -3.247  78.301  1.00 87.20  ? 356  ILE B C   1 
ATOM   6998  O O   . ILE B  1 356 ? 2.030   -2.242  78.389  1.00 87.58  ? 356  ILE B O   1 
ATOM   6999  C CB  . ILE B  1 356 ? 1.118   -3.786  75.782  1.00 80.70  ? 356  ILE B CB  1 
ATOM   7000  C CG1 . ILE B  1 356 ? 0.102   -4.215  74.727  1.00 79.49  ? 356  ILE B CG1 1 
ATOM   7001  C CG2 . ILE B  1 356 ? 2.107   -4.927  75.989  1.00 81.24  ? 356  ILE B CG2 1 
ATOM   7002  C CD1 . ILE B  1 356 ? 0.200   -3.559  73.490  1.00 79.73  ? 356  ILE B CD1 1 
ATOM   7003  N N   . GLU B  1 357 ? 1.215   -4.174  79.264  1.00 84.86  ? 357  GLU B N   1 
ATOM   7004  C CA  . GLU B  1 357 ? 2.010   -4.143  80.484  1.00 85.82  ? 357  GLU B CA  1 
ATOM   7005  C C   . GLU B  1 357 ? 3.405   -4.627  80.178  1.00 87.54  ? 357  GLU B C   1 
ATOM   7006  O O   . GLU B  1 357 ? 3.599   -5.418  79.258  1.00 86.00  ? 357  GLU B O   1 
ATOM   7007  C CB  . GLU B  1 357 ? 1.374   -5.024  81.579  1.00 88.95  ? 357  GLU B CB  1 
ATOM   7008  C CG  . GLU B  1 357 ? 0.007   -4.543  82.057  1.00 109.44 ? 357  GLU B CG  1 
ATOM   7009  C CD  . GLU B  1 357 ? -0.089  -3.234  82.832  1.00 142.16 ? 357  GLU B CD  1 
ATOM   7010  O OE1 . GLU B  1 357 ? 0.521   -3.141  83.921  1.00 153.15 ? 357  GLU B OE1 1 
ATOM   7011  O OE2 . GLU B  1 357 ? -0.816  -2.321  82.374  1.00 133.52 ? 357  GLU B OE2 1 
ATOM   7012  N N   . ALA B  1 358 ? 4.384   -4.147  80.953  1.00 84.01  ? 358  ALA B N   1 
ATOM   7013  C CA  . ALA B  1 358 ? 5.777   -4.555  80.829  1.00 82.34  ? 358  ALA B CA  1 
ATOM   7014  C C   . ALA B  1 358 ? 5.899   -6.063  81.006  1.00 84.11  ? 358  ALA B C   1 
ATOM   7015  O O   . ALA B  1 358 ? 5.169   -6.690  81.774  1.00 83.11  ? 358  ALA B O   1 
ATOM   7016  C CB  . ALA B  1 358 ? 6.629   -3.841  81.853  1.00 84.18  ? 358  ALA B CB  1 
ATOM   7017  N N   . ILE B  1 359 ? 6.784   -6.647  80.233  1.00 80.59  ? 359  ILE B N   1 
ATOM   7018  C CA  . ILE B  1 359 ? 7.002   -8.084  80.237  1.00 79.56  ? 359  ILE B CA  1 
ATOM   7019  C C   . ILE B  1 359 ? 7.463   -8.610  81.623  1.00 84.90  ? 359  ILE B C   1 
ATOM   7020  O O   . ILE B  1 359 ? 8.174   -7.894  82.349  1.00 85.05  ? 359  ILE B O   1 
ATOM   7021  C CB  . ILE B  1 359 ? 7.956   -8.459  79.057  1.00 79.45  ? 359  ILE B CB  1 
ATOM   7022  C CG1 . ILE B  1 359 ? 7.737   -9.889  78.567  1.00 77.96  ? 359  ILE B CG1 1 
ATOM   7023  C CG2 . ILE B  1 359 ? 9.421   -8.171  79.366  1.00 79.77  ? 359  ILE B CG2 1 
ATOM   7024  C CD1 . ILE B  1 359 ? 8.087   -10.076 77.127  1.00 86.17  ? 359  ILE B CD1 1 
ATOM   7025  N N   . ASP B  1 360 ? 7.014   -9.842  81.989  1.00 80.52  ? 360  ASP B N   1 
ATOM   7026  C CA  . ASP B  1 360 ? 7.450   -10.524 83.206  1.00 79.92  ? 360  ASP B CA  1 
ATOM   7027  C C   . ASP B  1 360 ? 8.839   -11.093 82.879  1.00 79.38  ? 360  ASP B C   1 
ATOM   7028  O O   . ASP B  1 360 ? 8.949   -11.971 82.012  1.00 78.11  ? 360  ASP B O   1 
ATOM   7029  C CB  . ASP B  1 360 ? 6.477   -11.655 83.600  1.00 82.42  ? 360  ASP B CB  1 
ATOM   7030  C CG  . ASP B  1 360 ? 6.835   -12.444 84.870  1.00 91.98  ? 360  ASP B CG  1 
ATOM   7031  O OD1 . ASP B  1 360 ? 7.814   -12.068 85.558  1.00 91.50  ? 360  ASP B OD1 1 
ATOM   7032  O OD2 . ASP B  1 360 ? 6.120   -13.431 85.184  1.00 97.16  ? 360  ASP B OD2 1 
ATOM   7033  N N   . PRO B  1 361 ? 9.917   -10.587 83.517  1.00 73.13  ? 361  PRO B N   1 
ATOM   7034  C CA  . PRO B  1 361 ? 11.266  -11.073 83.171  1.00 71.17  ? 361  PRO B CA  1 
ATOM   7035  C C   . PRO B  1 361 ? 11.437  -12.582 83.204  1.00 75.82  ? 361  PRO B C   1 
ATOM   7036  O O   . PRO B  1 361 ? 12.189  -13.112 82.407  1.00 74.29  ? 361  PRO B O   1 
ATOM   7037  C CB  . PRO B  1 361 ? 12.161  -10.375 84.184  1.00 73.64  ? 361  PRO B CB  1 
ATOM   7038  C CG  . PRO B  1 361 ? 11.412  -9.153  84.553  1.00 79.73  ? 361  PRO B CG  1 
ATOM   7039  C CD  . PRO B  1 361 ? 9.975   -9.535  84.548  1.00 75.53  ? 361  PRO B CD  1 
ATOM   7040  N N   . GLU B  1 362 ? 10.711  -13.278 84.091  1.00 74.77  ? 362  GLU B N   1 
ATOM   7041  C CA  . GLU B  1 362 ? 10.769  -14.735 84.211  1.00 74.06  ? 362  GLU B CA  1 
ATOM   7042  C C   . GLU B  1 362 ? 10.292  -15.410 82.949  1.00 73.95  ? 362  GLU B C   1 
ATOM   7043  O O   . GLU B  1 362 ? 10.877  -16.419 82.563  1.00 72.38  ? 362  GLU B O   1 
ATOM   7044  C CB  . GLU B  1 362 ? 9.958   -15.231 85.415  1.00 77.47  ? 362  GLU B CB  1 
ATOM   7045  C CG  . GLU B  1 362 ? 10.697  -16.279 86.243  1.00 96.61  ? 362  GLU B CG  1 
ATOM   7046  C CD  . GLU B  1 362 ? 11.936  -15.782 86.981  1.00 134.99 ? 362  GLU B CD  1 
ATOM   7047  O OE1 . GLU B  1 362 ? 11.775  -15.138 88.044  1.00 139.96 ? 362  GLU B OE1 1 
ATOM   7048  O OE2 . GLU B  1 362 ? 13.067  -16.027 86.497  1.00 132.79 ? 362  GLU B OE2 1 
ATOM   7049  N N   . LYS B  1 363 ? 9.263   -14.822 82.273  1.00 68.06  ? 363  LYS B N   1 
ATOM   7050  C CA  . LYS B  1 363 ? 8.684   -15.329 81.022  1.00 65.29  ? 363  LYS B CA  1 
ATOM   7051  C C   . LYS B  1 363 ? 9.698   -15.384 79.867  1.00 66.29  ? 363  LYS B C   1 
ATOM   7052  O O   . LYS B  1 363 ? 9.512   -16.168 78.933  1.00 64.59  ? 363  LYS B O   1 
ATOM   7053  C CB  . LYS B  1 363 ? 7.403   -14.574 80.634  1.00 67.66  ? 363  LYS B CB  1 
ATOM   7054  C CG  . LYS B  1 363 ? 6.245   -14.809 81.608  1.00 83.98  ? 363  LYS B CG  1 
ATOM   7055  C CD  . LYS B  1 363 ? 4.910   -15.122 80.917  1.00 92.73  ? 363  LYS B CD  1 
ATOM   7056  C CE  . LYS B  1 363 ? 4.029   -13.892 80.750  1.00 104.92 ? 363  LYS B CE  1 
ATOM   7057  N NZ  . LYS B  1 363 ? 2.847   -14.136 79.887  1.00 112.78 ? 363  LYS B NZ  1 
ATOM   7058  N N   . LEU B  1 364 ? 10.810  -14.612 79.954  1.00 61.37  ? 364  LEU B N   1 
ATOM   7059  C CA  . LEU B  1 364 ? 11.869  -14.657 78.937  1.00 58.27  ? 364  LEU B CA  1 
ATOM   7060  C C   . LEU B  1 364 ? 12.584  -16.034 78.871  1.00 61.39  ? 364  LEU B C   1 
ATOM   7061  O O   . LEU B  1 364 ? 13.295  -16.304 77.903  1.00 61.16  ? 364  LEU B O   1 
ATOM   7062  C CB  . LEU B  1 364 ? 12.868  -13.520 79.113  1.00 56.82  ? 364  LEU B CB  1 
ATOM   7063  C CG  . LEU B  1 364 ? 12.389  -12.133 78.729  1.00 59.31  ? 364  LEU B CG  1 
ATOM   7064  C CD1 . LEU B  1 364 ? 13.379  -11.098 79.167  1.00 59.53  ? 364  LEU B CD1 1 
ATOM   7065  C CD2 . LEU B  1 364 ? 12.208  -11.997 77.262  1.00 57.17  ? 364  LEU B CD2 1 
ATOM   7066  N N   . ASN B  1 365 ? 12.322  -16.919 79.847  1.00 57.33  ? 365  ASN B N   1 
ATOM   7067  C CA  . ASN B  1 365 ? 12.878  -18.265 79.867  1.00 57.79  ? 365  ASN B CA  1 
ATOM   7068  C C   . ASN B  1 365 ? 12.285  -19.191 78.791  1.00 63.12  ? 365  ASN B C   1 
ATOM   7069  O O   . ASN B  1 365 ? 12.847  -20.277 78.563  1.00 61.97  ? 365  ASN B O   1 
ATOM   7070  C CB  . ASN B  1 365 ? 12.817  -18.884 81.260  1.00 58.64  ? 365  ASN B CB  1 
ATOM   7071  C CG  . ASN B  1 365 ? 13.792  -18.240 82.230  1.00 77.76  ? 365  ASN B CG  1 
ATOM   7072  O OD1 . ASN B  1 365 ? 15.030  -18.318 82.075  1.00 74.15  ? 365  ASN B OD1 1 
ATOM   7073  N ND2 . ASN B  1 365 ? 13.270  -17.561 83.243  1.00 57.89  ? 365  ASN B ND2 1 
ATOM   7074  N N   . VAL B  1 366 ? 11.199  -18.738 78.083  1.00 59.28  ? 366  VAL B N   1 
ATOM   7075  C CA  . VAL B  1 366 ? 10.567  -19.479 76.974  1.00 58.26  ? 366  VAL B CA  1 
ATOM   7076  C C   . VAL B  1 366 ? 11.580  -19.752 75.853  1.00 61.97  ? 366  VAL B C   1 
ATOM   7077  O O   . VAL B  1 366 ? 11.467  -20.761 75.158  1.00 63.35  ? 366  VAL B O   1 
ATOM   7078  C CB  . VAL B  1 366 ? 9.287   -18.805 76.399  1.00 61.99  ? 366  VAL B CB  1 
ATOM   7079  C CG1 . VAL B  1 366 ? 8.162   -18.799 77.408  1.00 63.71  ? 366  VAL B CG1 1 
ATOM   7080  C CG2 . VAL B  1 366 ? 9.547   -17.388 75.885  1.00 61.26  ? 366  VAL B CG2 1 
ATOM   7081  N N   . PHE B  1 367 ? 12.567  -18.845 75.699  1.00 55.41  ? 367  PHE B N   1 
ATOM   7082  C CA  . PHE B  1 367 ? 13.587  -18.885 74.665  1.00 53.89  ? 367  PHE B CA  1 
ATOM   7083  C C   . PHE B  1 367 ? 14.696  -19.912 74.863  1.00 58.91  ? 367  PHE B C   1 
ATOM   7084  O O   . PHE B  1 367 ? 15.510  -20.121 73.955  1.00 58.26  ? 367  PHE B O   1 
ATOM   7085  C CB  . PHE B  1 367 ? 14.150  -17.482 74.431  1.00 55.17  ? 367  PHE B CB  1 
ATOM   7086  C CG  . PHE B  1 367 ? 13.105  -16.475 73.988  1.00 56.66  ? 367  PHE B CG  1 
ATOM   7087  C CD1 . PHE B  1 367 ? 12.746  -15.412 74.808  1.00 59.94  ? 367  PHE B CD1 1 
ATOM   7088  C CD2 . PHE B  1 367 ? 12.464  -16.606 72.765  1.00 56.70  ? 367  PHE B CD2 1 
ATOM   7089  C CE1 . PHE B  1 367 ? 11.801  -14.483 74.391  1.00 60.49  ? 367  PHE B CE1 1 
ATOM   7090  C CE2 . PHE B  1 367 ? 11.488  -15.698 72.371  1.00 59.04  ? 367  PHE B CE2 1 
ATOM   7091  C CZ  . PHE B  1 367 ? 11.167  -14.642 73.183  1.00 58.52  ? 367  PHE B CZ  1 
ATOM   7092  N N   . ARG B  1 368 ? 14.725  -20.579 76.028  1.00 55.54  ? 368  ARG B N   1 
ATOM   7093  C CA  . ARG B  1 368 ? 15.755  -21.576 76.309  1.00 54.05  ? 368  ARG B CA  1 
ATOM   7094  C C   . ARG B  1 368 ? 15.683  -22.793 75.378  1.00 60.32  ? 368  ARG B C   1 
ATOM   7095  O O   . ARG B  1 368 ? 16.675  -23.523 75.221  1.00 61.73  ? 368  ARG B O   1 
ATOM   7096  C CB  . ARG B  1 368 ? 15.761  -21.962 77.785  1.00 51.03  ? 368  ARG B CB  1 
ATOM   7097  C CG  . ARG B  1 368 ? 16.359  -20.898 78.671  1.00 50.98  ? 368  ARG B CG  1 
ATOM   7098  C CD  . ARG B  1 368 ? 16.269  -21.282 80.121  1.00 52.85  ? 368  ARG B CD  1 
ATOM   7099  N NE  . ARG B  1 368 ? 16.769  -20.233 81.007  1.00 63.58  ? 368  ARG B NE  1 
ATOM   7100  C CZ  . ARG B  1 368 ? 18.024  -20.148 81.444  1.00 74.74  ? 368  ARG B CZ  1 
ATOM   7101  N NH1 . ARG B  1 368 ? 18.924  -21.061 81.086  1.00 44.88  ? 368  ARG B NH1 1 
ATOM   7102  N NH2 . ARG B  1 368 ? 18.385  -19.157 82.259  1.00 63.36  ? 368  ARG B NH2 1 
ATOM   7103  N N   . THR B  1 369 ? 14.535  -22.970 74.716  1.00 56.01  ? 369  THR B N   1 
ATOM   7104  C CA  . THR B  1 369 ? 14.334  -24.071 73.786  1.00 55.65  ? 369  THR B CA  1 
ATOM   7105  C C   . THR B  1 369 ? 14.824  -23.701 72.398  1.00 60.08  ? 369  THR B C   1 
ATOM   7106  O O   . THR B  1 369 ? 15.132  -24.603 71.611  1.00 61.33  ? 369  THR B O   1 
ATOM   7107  C CB  . THR B  1 369 ? 12.873  -24.502 73.760  1.00 58.53  ? 369  THR B CB  1 
ATOM   7108  O OG1 . THR B  1 369 ? 12.045  -23.355 73.542  1.00 66.97  ? 369  THR B OG1 1 
ATOM   7109  C CG2 . THR B  1 369 ? 12.472  -25.198 75.012  1.00 52.49  ? 369  THR B CG2 1 
ATOM   7110  N N   . VAL B  1 370 ? 14.888  -22.378 72.091  1.00 53.96  ? 370  VAL B N   1 
ATOM   7111  C CA  . VAL B  1 370 ? 15.315  -21.880 70.782  1.00 51.54  ? 370  VAL B CA  1 
ATOM   7112  C C   . VAL B  1 370 ? 16.757  -22.244 70.480  1.00 57.34  ? 370  VAL B C   1 
ATOM   7113  O O   . VAL B  1 370 ? 17.648  -21.921 71.268  1.00 57.88  ? 370  VAL B O   1 
ATOM   7114  C CB  . VAL B  1 370 ? 15.066  -20.376 70.587  1.00 53.33  ? 370  VAL B CB  1 
ATOM   7115  C CG1 . VAL B  1 370 ? 15.653  -19.902 69.264  1.00 52.37  ? 370  VAL B CG1 1 
ATOM   7116  C CG2 . VAL B  1 370 ? 13.589  -20.047 70.651  1.00 53.33  ? 370  VAL B CG2 1 
ATOM   7117  N N   . ARG B  1 371 ? 16.963  -22.926 69.335  1.00 54.24  ? 371  ARG B N   1 
ATOM   7118  C CA  . ARG B  1 371 ? 18.249  -23.365 68.790  1.00 54.50  ? 371  ARG B CA  1 
ATOM   7119  C C   . ARG B  1 371 ? 18.634  -22.585 67.539  1.00 59.19  ? 371  ARG B C   1 
ATOM   7120  O O   . ARG B  1 371 ? 19.823  -22.502 67.215  1.00 59.06  ? 371  ARG B O   1 
ATOM   7121  C CB  . ARG B  1 371 ? 18.193  -24.843 68.436  1.00 59.33  ? 371  ARG B CB  1 
ATOM   7122  C CG  . ARG B  1 371 ? 18.357  -25.800 69.624  1.00 80.45  ? 371  ARG B CG  1 
ATOM   7123  C CD  . ARG B  1 371 ? 18.342  -27.248 69.135  1.00 101.96 ? 371  ARG B CD  1 
ATOM   7124  N NE  . ARG B  1 371 ? 16.975  -27.760 68.964  1.00 123.49 ? 371  ARG B NE  1 
ATOM   7125  C CZ  . ARG B  1 371 ? 16.639  -28.792 68.190  1.00 144.96 ? 371  ARG B CZ  1 
ATOM   7126  N NH1 . ARG B  1 371 ? 17.559  -29.404 67.449  1.00 138.40 ? 371  ARG B NH1 1 
ATOM   7127  N NH2 . ARG B  1 371 ? 15.373  -29.189 68.114  1.00 129.29 ? 371  ARG B NH2 1 
ATOM   7128  N N   . GLU B  1 372 ? 17.629  -22.021 66.831  1.00 56.74  ? 372  GLU B N   1 
ATOM   7129  C CA  . GLU B  1 372 ? 17.836  -21.251 65.598  1.00 56.23  ? 372  GLU B CA  1 
ATOM   7130  C C   . GLU B  1 372 ? 16.902  -20.056 65.501  1.00 58.18  ? 372  GLU B C   1 
ATOM   7131  O O   . GLU B  1 372 ? 15.734  -20.154 65.879  1.00 58.62  ? 372  GLU B O   1 
ATOM   7132  C CB  . GLU B  1 372 ? 17.638  -22.155 64.359  1.00 57.74  ? 372  GLU B CB  1 
ATOM   7133  C CG  . GLU B  1 372 ? 18.163  -21.563 63.054  1.00 72.69  ? 372  GLU B CG  1 
ATOM   7134  C CD  . GLU B  1 372 ? 18.205  -22.432 61.807  1.00 98.57  ? 372  GLU B CD  1 
ATOM   7135  O OE1 . GLU B  1 372 ? 17.831  -23.626 61.897  1.00 99.89  ? 372  GLU B OE1 1 
ATOM   7136  O OE2 . GLU B  1 372 ? 18.657  -21.927 60.748  1.00 83.86  ? 372  GLU B OE2 1 
ATOM   7137  N N   . ILE B  1 373 ? 17.427  -18.939 64.950  1.00 51.86  ? 373  ILE B N   1 
ATOM   7138  C CA  . ILE B  1 373 ? 16.701  -17.701 64.619  1.00 49.82  ? 373  ILE B CA  1 
ATOM   7139  C C   . ILE B  1 373 ? 17.095  -17.477 63.161  1.00 55.18  ? 373  ILE B C   1 
ATOM   7140  O O   . ILE B  1 373 ? 18.270  -17.248 62.888  1.00 54.05  ? 373  ILE B O   1 
ATOM   7141  C CB  . ILE B  1 373 ? 17.048  -16.493 65.530  1.00 50.63  ? 373  ILE B CB  1 
ATOM   7142  C CG1 . ILE B  1 373 ? 16.560  -16.736 66.960  1.00 50.15  ? 373  ILE B CG1 1 
ATOM   7143  C CG2 . ILE B  1 373 ? 16.466  -15.203 64.972  1.00 49.60  ? 373  ILE B CG2 1 
ATOM   7144  C CD1 . ILE B  1 373 ? 17.187  -15.847 68.010  1.00 54.95  ? 373  ILE B CD1 1 
ATOM   7145  N N   . THR B  1 374 ? 16.135  -17.624 62.223  1.00 53.09  ? 374  THR B N   1 
ATOM   7146  C CA  . THR B  1 374 ? 16.416  -17.506 60.789  1.00 52.13  ? 374  THR B CA  1 
ATOM   7147  C C   . THR B  1 374 ? 16.729  -16.113 60.305  1.00 54.73  ? 374  THR B C   1 
ATOM   7148  O O   . THR B  1 374 ? 17.565  -15.966 59.401  1.00 54.60  ? 374  THR B O   1 
ATOM   7149  C CB  . THR B  1 374 ? 15.400  -18.237 59.931  1.00 61.48  ? 374  THR B CB  1 
ATOM   7150  O OG1 . THR B  1 374 ? 14.096  -17.684 60.166  1.00 67.59  ? 374  THR B OG1 1 
ATOM   7151  C CG2 . THR B  1 374 ? 15.448  -19.751 60.150  1.00 57.73  ? 374  THR B CG2 1 
ATOM   7152  N N   . GLY B  1 375 ? 16.077  -15.113 60.898  1.00 49.23  ? 375  GLY B N   1 
ATOM   7153  C CA  . GLY B  1 375 ? 16.301  -13.723 60.530  1.00 48.57  ? 375  GLY B CA  1 
ATOM   7154  C C   . GLY B  1 375 ? 17.383  -13.072 61.363  1.00 51.08  ? 375  GLY B C   1 
ATOM   7155  O O   . GLY B  1 375 ? 18.551  -13.485 61.334  1.00 48.25  ? 375  GLY B O   1 
ATOM   7156  N N   . PHE B  1 376 ? 16.984  -12.062 62.143  1.00 49.21  ? 376  PHE B N   1 
ATOM   7157  C CA  . PHE B  1 376 ? 17.924  -11.383 63.021  1.00 49.59  ? 376  PHE B CA  1 
ATOM   7158  C C   . PHE B  1 376 ? 17.484  -11.303 64.493  1.00 51.93  ? 376  PHE B C   1 
ATOM   7159  O O   . PHE B  1 376 ? 16.297  -11.470 64.801  1.00 50.34  ? 376  PHE B O   1 
ATOM   7160  C CB  . PHE B  1 376 ? 18.293  -10.003 62.478  1.00 51.82  ? 376  PHE B CB  1 
ATOM   7161  C CG  . PHE B  1 376 ? 17.162  -9.019  62.394  1.00 53.66  ? 376  PHE B CG  1 
ATOM   7162  C CD1 . PHE B  1 376 ? 16.782  -8.275  63.510  1.00 56.72  ? 376  PHE B CD1 1 
ATOM   7163  C CD2 . PHE B  1 376 ? 16.507  -8.793  61.186  1.00 55.06  ? 376  PHE B CD2 1 
ATOM   7164  C CE1 . PHE B  1 376 ? 15.732  -7.356  63.431  1.00 57.62  ? 376  PHE B CE1 1 
ATOM   7165  C CE2 . PHE B  1 376 ? 15.492  -7.847  61.098  1.00 57.99  ? 376  PHE B CE2 1 
ATOM   7166  C CZ  . PHE B  1 376 ? 15.095  -7.148  62.229  1.00 56.42  ? 376  PHE B CZ  1 
ATOM   7167  N N   . LEU B  1 377 ? 18.479  -11.057 65.399  1.00 47.36  ? 377  LEU B N   1 
ATOM   7168  C CA  . LEU B  1 377 ? 18.290  -10.876 66.839  1.00 46.82  ? 377  LEU B CA  1 
ATOM   7169  C C   . LEU B  1 377 ? 18.669  -9.450  67.157  1.00 53.16  ? 377  LEU B C   1 
ATOM   7170  O O   . LEU B  1 377 ? 19.814  -9.042  66.935  1.00 53.32  ? 377  LEU B O   1 
ATOM   7171  C CB  . LEU B  1 377 ? 19.131  -11.865 67.629  1.00 46.08  ? 377  LEU B CB  1 
ATOM   7172  C CG  . LEU B  1 377 ? 18.959  -11.877 69.129  1.00 50.17  ? 377  LEU B CG  1 
ATOM   7173  C CD1 . LEU B  1 377 ? 17.520  -12.089 69.522  1.00 49.78  ? 377  LEU B CD1 1 
ATOM   7174  C CD2 . LEU B  1 377 ? 19.861  -12.916 69.756  1.00 50.57  ? 377  LEU B CD2 1 
ATOM   7175  N N   . ASN B  1 378 ? 17.698  -8.677  67.633  1.00 49.90  ? 378  ASN B N   1 
ATOM   7176  C CA  . ASN B  1 378 ? 17.889  -7.260  67.844  1.00 49.54  ? 378  ASN B CA  1 
ATOM   7177  C C   . ASN B  1 378 ? 17.430  -6.941  69.236  1.00 56.25  ? 378  ASN B C   1 
ATOM   7178  O O   . ASN B  1 378 ? 16.230  -6.937  69.498  1.00 56.73  ? 378  ASN B O   1 
ATOM   7179  C CB  . ASN B  1 378 ? 17.099  -6.525  66.763  1.00 46.31  ? 378  ASN B CB  1 
ATOM   7180  C CG  . ASN B  1 378 ? 16.884  -5.051  66.911  1.00 67.87  ? 378  ASN B CG  1 
ATOM   7181  O OD1 . ASN B  1 378 ? 17.572  -4.347  67.655  1.00 65.32  ? 378  ASN B OD1 1 
ATOM   7182  N ND2 . ASN B  1 378 ? 15.939  -4.545  66.134  1.00 61.33  ? 378  ASN B ND2 1 
ATOM   7183  N N   . ILE B  1 379 ? 18.407  -6.733  70.148  1.00 53.02  ? 379  ILE B N   1 
ATOM   7184  C CA  . ILE B  1 379 ? 18.203  -6.448  71.573  1.00 51.91  ? 379  ILE B CA  1 
ATOM   7185  C C   . ILE B  1 379 ? 18.480  -4.977  71.867  1.00 55.59  ? 379  ILE B C   1 
ATOM   7186  O O   . ILE B  1 379 ? 19.634  -4.568  71.996  1.00 56.12  ? 379  ILE B O   1 
ATOM   7187  C CB  . ILE B  1 379 ? 18.986  -7.432  72.501  1.00 53.27  ? 379  ILE B CB  1 
ATOM   7188  C CG1 . ILE B  1 379 ? 18.579  -8.889  72.226  1.00 51.31  ? 379  ILE B CG1 1 
ATOM   7189  C CG2 . ILE B  1 379 ? 18.750  -7.074  73.985  1.00 55.14  ? 379  ILE B CG2 1 
ATOM   7190  C CD1 . ILE B  1 379 ? 19.679  -9.875  72.293  1.00 51.44  ? 379  ILE B CD1 1 
ATOM   7191  N N   . GLN B  1 380 ? 17.412  -4.185  71.958  1.00 51.23  ? 380  GLN B N   1 
ATOM   7192  C CA  . GLN B  1 380 ? 17.463  -2.742  72.241  1.00 50.97  ? 380  GLN B CA  1 
ATOM   7193  C C   . GLN B  1 380 ? 17.004  -2.480  73.677  1.00 57.08  ? 380  GLN B C   1 
ATOM   7194  O O   . GLN B  1 380 ? 17.117  -1.372  74.171  1.00 56.84  ? 380  GLN B O   1 
ATOM   7195  C CB  . GLN B  1 380 ? 16.571  -1.964  71.247  1.00 51.85  ? 380  GLN B CB  1 
ATOM   7196  C CG  . GLN B  1 380 ? 17.061  -1.976  69.802  1.00 54.45  ? 380  GLN B CG  1 
ATOM   7197  C CD  . GLN B  1 380 ? 16.403  -0.946  68.947  1.00 74.01  ? 380  GLN B CD  1 
ATOM   7198  O OE1 . GLN B  1 380 ? 15.727  -0.043  69.455  1.00 76.17  ? 380  GLN B OE1 1 
ATOM   7199  N NE2 . GLN B  1 380 ? 16.642  -1.015  67.632  1.00 64.80  ? 380  GLN B NE2 1 
ATOM   7200  N N   . SER B  1 381 ? 16.438  -3.492  74.331  1.00 56.92  ? 381  SER B N   1 
ATOM   7201  C CA  . SER B  1 381 ? 15.945  -3.405  75.701  1.00 59.01  ? 381  SER B CA  1 
ATOM   7202  C C   . SER B  1 381 ? 15.997  -4.776  76.344  1.00 62.49  ? 381  SER B C   1 
ATOM   7203  O O   . SER B  1 381 ? 15.855  -5.788  75.664  1.00 61.48  ? 381  SER B O   1 
ATOM   7204  C CB  . SER B  1 381 ? 14.528  -2.845  75.747  1.00 63.90  ? 381  SER B CB  1 
ATOM   7205  O OG  . SER B  1 381 ? 14.143  -2.517  77.070  1.00 72.94  ? 381  SER B OG  1 
ATOM   7206  N N   . TRP B  1 382 ? 16.236  -4.798  77.648  1.00 59.70  ? 382  TRP B N   1 
ATOM   7207  C CA  . TRP B  1 382 ? 16.356  -6.006  78.445  1.00 59.91  ? 382  TRP B CA  1 
ATOM   7208  C C   . TRP B  1 382 ? 16.055  -5.679  79.923  1.00 69.05  ? 382  TRP B C   1 
ATOM   7209  O O   . TRP B  1 382 ? 16.435  -4.595  80.397  1.00 70.54  ? 382  TRP B O   1 
ATOM   7210  C CB  . TRP B  1 382 ? 17.772  -6.575  78.299  1.00 56.87  ? 382  TRP B CB  1 
ATOM   7211  C CG  . TRP B  1 382 ? 17.917  -8.047  78.537  1.00 56.62  ? 382  TRP B CG  1 
ATOM   7212  C CD1 . TRP B  1 382 ? 18.750  -8.651  79.433  1.00 59.66  ? 382  TRP B CD1 1 
ATOM   7213  C CD2 . TRP B  1 382 ? 17.278  -9.100  77.808  1.00 55.40  ? 382  TRP B CD2 1 
ATOM   7214  N NE1 . TRP B  1 382 ? 18.649  -10.020 79.328  1.00 58.19  ? 382  TRP B NE1 1 
ATOM   7215  C CE2 . TRP B  1 382 ? 17.757  -10.325 78.333  1.00 59.02  ? 382  TRP B CE2 1 
ATOM   7216  C CE3 . TRP B  1 382 ? 16.349  -9.133  76.754  1.00 55.56  ? 382  TRP B CE3 1 
ATOM   7217  C CZ2 . TRP B  1 382 ? 17.345  -11.568 77.833  1.00 57.21  ? 382  TRP B CZ2 1 
ATOM   7218  C CZ3 . TRP B  1 382 ? 15.926  -10.365 76.282  1.00 55.96  ? 382  TRP B CZ3 1 
ATOM   7219  C CH2 . TRP B  1 382 ? 16.424  -11.566 76.818  1.00 56.13  ? 382  TRP B CH2 1 
ATOM   7220  N N   . PRO B  1 383 ? 15.356  -6.585  80.654  1.00 65.43  ? 383  PRO B N   1 
ATOM   7221  C CA  . PRO B  1 383 ? 15.069  -6.317  82.066  1.00 66.71  ? 383  PRO B CA  1 
ATOM   7222  C C   . PRO B  1 383 ? 16.343  -5.948  82.818  1.00 72.87  ? 383  PRO B C   1 
ATOM   7223  O O   . PRO B  1 383 ? 17.398  -6.560  82.581  1.00 71.76  ? 383  PRO B O   1 
ATOM   7224  C CB  . PRO B  1 383 ? 14.463  -7.631  82.551  1.00 69.02  ? 383  PRO B CB  1 
ATOM   7225  C CG  . PRO B  1 383 ? 13.841  -8.201  81.330  1.00 72.60  ? 383  PRO B CG  1 
ATOM   7226  C CD  . PRO B  1 383 ? 14.815  -7.896  80.242  1.00 66.47  ? 383  PRO B CD  1 
ATOM   7227  N N   . PRO B  1 384 ? 16.271  -4.887  83.662  1.00 72.05  ? 384  PRO B N   1 
ATOM   7228  C CA  . PRO B  1 384 ? 17.481  -4.385  84.339  1.00 73.07  ? 384  PRO B CA  1 
ATOM   7229  C C   . PRO B  1 384 ? 18.171  -5.353  85.295  1.00 79.01  ? 384  PRO B C   1 
ATOM   7230  O O   . PRO B  1 384 ? 19.399  -5.323  85.447  1.00 77.66  ? 384  PRO B O   1 
ATOM   7231  C CB  . PRO B  1 384 ? 16.977  -3.138  85.059  1.00 76.25  ? 384  PRO B CB  1 
ATOM   7232  C CG  . PRO B  1 384 ? 15.711  -2.767  84.348  1.00 79.92  ? 384  PRO B CG  1 
ATOM   7233  C CD  . PRO B  1 384 ? 15.100  -4.059  84.001  1.00 74.42  ? 384  PRO B CD  1 
ATOM   7234  N N   . ASN B  1 385 ? 17.371  -6.212  85.943  1.00 78.17  ? 385  ASN B N   1 
ATOM   7235  C CA  . ASN B  1 385 ? 17.878  -7.199  86.888  1.00 79.31  ? 385  ASN B CA  1 
ATOM   7236  C C   . ASN B  1 385 ? 18.578  -8.415  86.229  1.00 78.36  ? 385  ASN B C   1 
ATOM   7237  O O   . ASN B  1 385 ? 19.201  -9.225  86.927  1.00 78.18  ? 385  ASN B O   1 
ATOM   7238  C CB  . ASN B  1 385 ? 16.783  -7.579  87.886  1.00 88.97  ? 385  ASN B CB  1 
ATOM   7239  C CG  . ASN B  1 385 ? 16.529  -6.439  88.868  1.00 140.17 ? 385  ASN B CG  1 
ATOM   7240  O OD1 . ASN B  1 385 ? 15.894  -5.425  88.526  1.00 141.30 ? 385  ASN B OD1 1 
ATOM   7241  N ND2 . ASN B  1 385 ? 17.047  -6.560  90.102  1.00 138.52 ? 385  ASN B ND2 1 
ATOM   7242  N N   . MET B  1 386 ? 18.520  -8.491  84.883  1.00 69.63  ? 386  MET B N   1 
ATOM   7243  C CA  . MET B  1 386 ? 19.114  -9.559  84.076  1.00 65.94  ? 386  MET B CA  1 
ATOM   7244  C C   . MET B  1 386 ? 20.472  -9.130  83.518  1.00 66.84  ? 386  MET B C   1 
ATOM   7245  O O   . MET B  1 386 ? 20.538  -8.199  82.686  1.00 65.80  ? 386  MET B O   1 
ATOM   7246  C CB  . MET B  1 386 ? 18.144  -9.980  82.963  1.00 66.18  ? 386  MET B CB  1 
ATOM   7247  C CG  . MET B  1 386 ? 16.968  -10.716 83.482  1.00 68.99  ? 386  MET B CG  1 
ATOM   7248  S SD  . MET B  1 386 ? 15.770  -11.128 82.211  1.00 71.41  ? 386  MET B SD  1 
ATOM   7249  C CE  . MET B  1 386 ? 16.613  -12.418 81.363  1.00 67.21  ? 386  MET B CE  1 
ATOM   7250  N N   . THR B  1 387 ? 21.545  -9.796  84.028  1.00 61.06  ? 387  THR B N   1 
ATOM   7251  C CA  . THR B  1 387 ? 22.943  -9.490  83.693  1.00 60.01  ? 387  THR B CA  1 
ATOM   7252  C C   . THR B  1 387 ? 23.450  -10.104 82.402  1.00 63.31  ? 387  THR B C   1 
ATOM   7253  O O   . THR B  1 387 ? 24.620  -9.869  82.060  1.00 63.36  ? 387  THR B O   1 
ATOM   7254  C CB  . THR B  1 387 ? 23.885  -9.898  84.816  1.00 61.49  ? 387  THR B CB  1 
ATOM   7255  O OG1 . THR B  1 387 ? 23.723  -11.282 85.047  1.00 62.75  ? 387  THR B OG1 1 
ATOM   7256  C CG2 . THR B  1 387 ? 23.662  -9.135  86.078  1.00 59.57  ? 387  THR B CG2 1 
ATOM   7257  N N   . ASP B  1 388 ? 22.599  -10.896 81.690  1.00 57.96  ? 388  ASP B N   1 
ATOM   7258  C CA  . ASP B  1 388 ? 23.011  -11.591 80.469  1.00 56.47  ? 388  ASP B CA  1 
ATOM   7259  C C   . ASP B  1 388 ? 21.911  -12.303 79.688  1.00 60.43  ? 388  ASP B C   1 
ATOM   7260  O O   . ASP B  1 388 ? 20.787  -12.421 80.155  1.00 61.18  ? 388  ASP B O   1 
ATOM   7261  C CB  . ASP B  1 388 ? 24.124  -12.596 80.791  1.00 58.27  ? 388  ASP B CB  1 
ATOM   7262  C CG  . ASP B  1 388 ? 23.763  -13.547 81.899  1.00 67.73  ? 388  ASP B CG  1 
ATOM   7263  O OD1 . ASP B  1 388 ? 24.222  -13.329 83.012  1.00 74.53  ? 388  ASP B OD1 1 
ATOM   7264  O OD2 . ASP B  1 388 ? 22.996  -14.507 81.643  1.00 62.42  ? 388  ASP B OD2 1 
ATOM   7265  N N   . PHE B  1 389 ? 22.284  -12.866 78.527  1.00 57.50  ? 389  PHE B N   1 
ATOM   7266  C CA  . PHE B  1 389 ? 21.361  -13.551 77.626  1.00 57.49  ? 389  PHE B CA  1 
ATOM   7267  C C   . PHE B  1 389 ? 21.412  -15.074 77.731  1.00 59.97  ? 389  PHE B C   1 
ATOM   7268  O O   . PHE B  1 389 ? 21.346  -15.773 76.706  1.00 56.64  ? 389  PHE B O   1 
ATOM   7269  C CB  . PHE B  1 389 ? 21.561  -13.073 76.171  1.00 58.04  ? 389  PHE B CB  1 
ATOM   7270  C CG  . PHE B  1 389 ? 21.641  -11.579 76.039  1.00 59.29  ? 389  PHE B CG  1 
ATOM   7271  C CD1 . PHE B  1 389 ? 22.850  -10.954 75.779  1.00 62.20  ? 389  PHE B CD1 1 
ATOM   7272  C CD2 . PHE B  1 389 ? 20.509  -10.787 76.202  1.00 61.09  ? 389  PHE B CD2 1 
ATOM   7273  C CE1 . PHE B  1 389 ? 22.920  -9.559  75.644  1.00 63.04  ? 389  PHE B CE1 1 
ATOM   7274  C CE2 . PHE B  1 389 ? 20.581  -9.396  76.080  1.00 63.44  ? 389  PHE B CE2 1 
ATOM   7275  C CZ  . PHE B  1 389 ? 21.784  -8.793  75.801  1.00 61.45  ? 389  PHE B CZ  1 
ATOM   7276  N N   . SER B  1 390 ? 21.460  -15.588 78.978  1.00 57.78  ? 390  SER B N   1 
ATOM   7277  C CA  . SER B  1 390 ? 21.487  -17.035 79.222  1.00 57.60  ? 390  SER B CA  1 
ATOM   7278  C C   . SER B  1 390 ? 20.175  -17.723 78.824  1.00 62.29  ? 390  SER B C   1 
ATOM   7279  O O   . SER B  1 390 ? 20.170  -18.933 78.592  1.00 61.27  ? 390  SER B O   1 
ATOM   7280  C CB  . SER B  1 390 ? 21.872  -17.346 80.653  1.00 61.36  ? 390  SER B CB  1 
ATOM   7281  O OG  . SER B  1 390 ? 21.062  -16.541 81.485  1.00 75.77  ? 390  SER B OG  1 
ATOM   7282  N N   . VAL B  1 391 ? 19.091  -16.941 78.633  1.00 59.57  ? 391  VAL B N   1 
ATOM   7283  C CA  . VAL B  1 391 ? 17.826  -17.463 78.112  1.00 59.42  ? 391  VAL B CA  1 
ATOM   7284  C C   . VAL B  1 391 ? 18.054  -17.999 76.682  1.00 63.72  ? 391  VAL B C   1 
ATOM   7285  O O   . VAL B  1 391 ? 17.326  -18.874 76.223  1.00 64.27  ? 391  VAL B O   1 
ATOM   7286  C CB  . VAL B  1 391 ? 16.634  -16.461 78.188  1.00 64.26  ? 391  VAL B CB  1 
ATOM   7287  C CG1 . VAL B  1 391 ? 16.309  -16.102 79.625  1.00 66.56  ? 391  VAL B CG1 1 
ATOM   7288  C CG2 . VAL B  1 391 ? 16.863  -15.201 77.377  1.00 63.11  ? 391  VAL B CG2 1 
ATOM   7289  N N   . PHE B  1 392 ? 19.105  -17.485 75.995  1.00 58.58  ? 392  PHE B N   1 
ATOM   7290  C CA  . PHE B  1 392 ? 19.507  -17.903 74.651  1.00 56.20  ? 392  PHE B CA  1 
ATOM   7291  C C   . PHE B  1 392 ? 20.707  -18.850 74.682  1.00 60.41  ? 392  PHE B C   1 
ATOM   7292  O O   . PHE B  1 392 ? 21.485  -18.895 73.718  1.00 59.31  ? 392  PHE B O   1 
ATOM   7293  C CB  . PHE B  1 392 ? 19.812  -16.672 73.786  1.00 56.18  ? 392  PHE B CB  1 
ATOM   7294  C CG  . PHE B  1 392 ? 18.581  -15.875 73.441  1.00 56.10  ? 392  PHE B CG  1 
ATOM   7295  C CD1 . PHE B  1 392 ? 18.384  -14.610 73.969  1.00 56.92  ? 392  PHE B CD1 1 
ATOM   7296  C CD2 . PHE B  1 392 ? 17.608  -16.398 72.596  1.00 56.97  ? 392  PHE B CD2 1 
ATOM   7297  C CE1 . PHE B  1 392 ? 17.256  -13.868 73.635  1.00 57.08  ? 392  PHE B CE1 1 
ATOM   7298  C CE2 . PHE B  1 392 ? 16.468  -15.660 72.278  1.00 58.78  ? 392  PHE B CE2 1 
ATOM   7299  C CZ  . PHE B  1 392 ? 16.299  -14.402 72.806  1.00 56.58  ? 392  PHE B CZ  1 
ATOM   7300  N N   . SER B  1 393 ? 20.869  -19.587 75.808  1.00 57.68  ? 393  SER B N   1 
ATOM   7301  C CA  . SER B  1 393 ? 21.937  -20.567 76.021  1.00 57.43  ? 393  SER B CA  1 
ATOM   7302  C C   . SER B  1 393 ? 22.031  -21.645 74.925  1.00 63.00  ? 393  SER B C   1 
ATOM   7303  O O   . SER B  1 393 ? 23.121  -22.110 74.611  1.00 61.73  ? 393  SER B O   1 
ATOM   7304  C CB  . SER B  1 393 ? 21.751  -21.249 77.363  1.00 60.28  ? 393  SER B CB  1 
ATOM   7305  O OG  . SER B  1 393 ? 22.505  -20.508 78.297  1.00 74.39  ? 393  SER B OG  1 
ATOM   7306  N N   . ASN B  1 394 ? 20.883  -22.029 74.353  1.00 61.28  ? 394  ASN B N   1 
ATOM   7307  C CA  . ASN B  1 394 ? 20.771  -23.103 73.381  1.00 60.39  ? 394  ASN B CA  1 
ATOM   7308  C C   . ASN B  1 394 ? 20.852  -22.680 71.932  1.00 62.05  ? 394  ASN B C   1 
ATOM   7309  O O   . ASN B  1 394 ? 20.968  -23.549 71.072  1.00 61.86  ? 394  ASN B O   1 
ATOM   7310  C CB  . ASN B  1 394 ? 19.509  -23.898 73.671  1.00 63.15  ? 394  ASN B CB  1 
ATOM   7311  C CG  . ASN B  1 394 ? 19.636  -24.841 74.841  1.00 77.90  ? 394  ASN B CG  1 
ATOM   7312  O OD1 . ASN B  1 394 ? 20.415  -24.643 75.786  1.00 65.70  ? 394  ASN B OD1 1 
ATOM   7313  N ND2 . ASN B  1 394 ? 18.865  -25.905 74.786  1.00 74.50  ? 394  ASN B ND2 1 
ATOM   7314  N N   . LEU B  1 395 ? 20.812  -21.354 71.664  1.00 56.60  ? 395  LEU B N   1 
ATOM   7315  C CA  . LEU B  1 395 ? 20.887  -20.719 70.341  1.00 54.25  ? 395  LEU B CA  1 
ATOM   7316  C C   . LEU B  1 395 ? 22.191  -21.065 69.663  1.00 57.42  ? 395  LEU B C   1 
ATOM   7317  O O   . LEU B  1 395 ? 23.247  -20.726 70.175  1.00 58.23  ? 395  LEU B O   1 
ATOM   7318  C CB  . LEU B  1 395 ? 20.744  -19.188 70.481  1.00 53.80  ? 395  LEU B CB  1 
ATOM   7319  C CG  . LEU B  1 395 ? 20.764  -18.351 69.211  1.00 57.53  ? 395  LEU B CG  1 
ATOM   7320  C CD1 . LEU B  1 395 ? 19.608  -18.692 68.287  1.00 57.06  ? 395  LEU B CD1 1 
ATOM   7321  C CD2 . LEU B  1 395 ? 20.690  -16.902 69.540  1.00 60.36  ? 395  LEU B CD2 1 
ATOM   7322  N N   . VAL B  1 396 ? 22.115  -21.760 68.531  1.00 52.35  ? 396  VAL B N   1 
ATOM   7323  C CA  . VAL B  1 396 ? 23.278  -22.199 67.764  1.00 51.04  ? 396  VAL B CA  1 
ATOM   7324  C C   . VAL B  1 396 ? 23.501  -21.326 66.538  1.00 56.50  ? 396  VAL B C   1 
ATOM   7325  O O   . VAL B  1 396 ? 24.645  -20.983 66.227  1.00 55.62  ? 396  VAL B O   1 
ATOM   7326  C CB  . VAL B  1 396 ? 23.135  -23.684 67.350  1.00 52.58  ? 396  VAL B CB  1 
ATOM   7327  C CG1 . VAL B  1 396 ? 24.317  -24.120 66.496  1.00 51.36  ? 396  VAL B CG1 1 
ATOM   7328  C CG2 . VAL B  1 396 ? 22.992  -24.589 68.570  1.00 52.50  ? 396  VAL B CG2 1 
ATOM   7329  N N   . THR B  1 397 ? 22.401  -20.989 65.833  1.00 53.80  ? 397  THR B N   1 
ATOM   7330  C CA  . THR B  1 397 ? 22.448  -20.243 64.584  1.00 52.65  ? 397  THR B CA  1 
ATOM   7331  C C   . THR B  1 397 ? 21.568  -19.015 64.532  1.00 54.35  ? 397  THR B C   1 
ATOM   7332  O O   . THR B  1 397 ? 20.436  -19.026 65.030  1.00 55.73  ? 397  THR B O   1 
ATOM   7333  C CB  . THR B  1 397 ? 22.072  -21.202 63.437  1.00 60.05  ? 397  THR B CB  1 
ATOM   7334  O OG1 . THR B  1 397 ? 23.118  -22.142 63.266  1.00 69.35  ? 397  THR B OG1 1 
ATOM   7335  C CG2 . THR B  1 397 ? 21.832  -20.507 62.116  1.00 53.16  ? 397  THR B CG2 1 
ATOM   7336  N N   . ILE B  1 398 ? 22.095  -17.977 63.868  1.00 46.77  ? 398  ILE B N   1 
ATOM   7337  C CA  . ILE B  1 398 ? 21.415  -16.757 63.449  1.00 45.54  ? 398  ILE B CA  1 
ATOM   7338  C C   . ILE B  1 398 ? 21.627  -16.771 61.931  1.00 49.53  ? 398  ILE B C   1 
ATOM   7339  O O   . ILE B  1 398 ? 22.756  -16.719 61.458  1.00 50.16  ? 398  ILE B O   1 
ATOM   7340  C CB  . ILE B  1 398 ? 21.852  -15.448 64.150  1.00 47.65  ? 398  ILE B CB  1 
ATOM   7341  C CG1 . ILE B  1 398 ? 21.504  -15.517 65.654  1.00 47.32  ? 398  ILE B CG1 1 
ATOM   7342  C CG2 . ILE B  1 398 ? 21.149  -14.255 63.496  1.00 47.94  ? 398  ILE B CG2 1 
ATOM   7343  C CD1 . ILE B  1 398 ? 22.139  -14.502 66.516  1.00 45.27  ? 398  ILE B CD1 1 
ATOM   7344  N N   . GLY B  1 399 ? 20.552  -16.981 61.198  1.00 45.64  ? 399  GLY B N   1 
ATOM   7345  C CA  . GLY B  1 399 ? 20.600  -17.145 59.755  1.00 45.01  ? 399  GLY B CA  1 
ATOM   7346  C C   . GLY B  1 399 ? 20.921  -15.911 58.957  1.00 49.63  ? 399  GLY B C   1 
ATOM   7347  O O   . GLY B  1 399 ? 21.647  -15.992 57.982  1.00 49.01  ? 399  GLY B O   1 
ATOM   7348  N N   . GLY B  1 400 ? 20.352  -14.782 59.323  1.00 48.02  ? 400  GLY B N   1 
ATOM   7349  C CA  . GLY B  1 400 ? 20.578  -13.555 58.581  1.00 48.11  ? 400  GLY B CA  1 
ATOM   7350  C C   . GLY B  1 400 ? 19.903  -13.584 57.226  1.00 55.49  ? 400  GLY B C   1 
ATOM   7351  O O   . GLY B  1 400 ? 20.412  -12.993 56.263  1.00 58.76  ? 400  GLY B O   1 
ATOM   7352  N N   . ARG B  1 401 ? 18.761  -14.308 57.131  1.00 50.43  ? 401  ARG B N   1 
ATOM   7353  C CA  . ARG B  1 401 ? 17.931  -14.401 55.920  1.00 49.19  ? 401  ARG B CA  1 
ATOM   7354  C C   . ARG B  1 401 ? 17.204  -13.088 55.850  1.00 54.16  ? 401  ARG B C   1 
ATOM   7355  O O   . ARG B  1 401 ? 16.575  -12.756 54.839  1.00 57.26  ? 401  ARG B O   1 
ATOM   7356  C CB  . ARG B  1 401 ? 16.901  -15.530 56.036  1.00 46.05  ? 401  ARG B CB  1 
ATOM   7357  C CG  . ARG B  1 401 ? 17.537  -16.878 55.885  1.00 49.14  ? 401  ARG B CG  1 
ATOM   7358  C CD  . ARG B  1 401 ? 16.612  -18.020 56.245  1.00 45.85  ? 401  ARG B CD  1 
ATOM   7359  N NE  . ARG B  1 401 ? 17.437  -19.161 56.608  1.00 50.61  ? 401  ARG B NE  1 
ATOM   7360  C CZ  . ARG B  1 401 ? 16.993  -20.378 56.875  1.00 60.62  ? 401  ARG B CZ  1 
ATOM   7361  N NH1 . ARG B  1 401 ? 15.708  -20.659 56.767  1.00 19.69  ? 401  ARG B NH1 1 
ATOM   7362  N NH2 . ARG B  1 401 ? 17.839  -21.332 57.236  1.00 69.22  ? 401  ARG B NH2 1 
ATOM   7363  N N   . VAL B  1 402 ? 17.231  -12.368 56.974  1.00 47.68  ? 402  VAL B N   1 
ATOM   7364  C CA  . VAL B  1 402 ? 16.633  -11.051 57.112  1.00 46.61  ? 402  VAL B CA  1 
ATOM   7365  C C   . VAL B  1 402 ? 17.598  -10.162 57.872  1.00 51.64  ? 402  VAL B C   1 
ATOM   7366  O O   . VAL B  1 402 ? 18.166  -10.568 58.873  1.00 52.10  ? 402  VAL B O   1 
ATOM   7367  C CB  . VAL B  1 402 ? 15.232  -11.032 57.743  1.00 47.85  ? 402  VAL B CB  1 
ATOM   7368  C CG1 . VAL B  1 402 ? 14.451  -9.850  57.238  1.00 46.66  ? 402  VAL B CG1 1 
ATOM   7369  C CG2 . VAL B  1 402 ? 14.486  -12.308 57.460  1.00 47.64  ? 402  VAL B CG2 1 
ATOM   7370  N N   . LEU B  1 403 ? 17.797  -8.963  57.391  1.00 47.57  ? 403  LEU B N   1 
ATOM   7371  C CA  . LEU B  1 403 ? 18.695  -8.088  58.098  1.00 47.67  ? 403  LEU B CA  1 
ATOM   7372  C C   . LEU B  1 403 ? 18.070  -6.716  58.423  1.00 55.68  ? 403  LEU B C   1 
ATOM   7373  O O   . LEU B  1 403 ? 17.189  -6.220  57.704  1.00 54.88  ? 403  LEU B O   1 
ATOM   7374  C CB  . LEU B  1 403 ? 20.016  -7.953  57.327  1.00 46.59  ? 403  LEU B CB  1 
ATOM   7375  C CG  . LEU B  1 403 ? 20.717  -9.267  56.961  1.00 47.72  ? 403  LEU B CG  1 
ATOM   7376  C CD1 . LEU B  1 403 ? 21.826  -9.022  56.060  1.00 44.84  ? 403  LEU B CD1 1 
ATOM   7377  C CD2 . LEU B  1 403 ? 21.223  -9.955  58.163  1.00 50.86  ? 403  LEU B CD2 1 
ATOM   7378  N N   . TYR B  1 404 ? 18.511  -6.132  59.536  1.00 55.21  ? 404  TYR B N   1 
ATOM   7379  C CA  . TYR B  1 404 ? 18.090  -4.807  59.954  1.00 56.95  ? 404  TYR B CA  1 
ATOM   7380  C C   . TYR B  1 404 ? 19.288  -3.952  59.609  1.00 60.54  ? 404  TYR B C   1 
ATOM   7381  O O   . TYR B  1 404 ? 20.305  -4.035  60.287  1.00 60.05  ? 404  TYR B O   1 
ATOM   7382  C CB  . TYR B  1 404 ? 17.800  -4.772  61.455  1.00 59.75  ? 404  TYR B CB  1 
ATOM   7383  C CG  . TYR B  1 404 ? 17.334  -3.440  62.003  1.00 64.89  ? 404  TYR B CG  1 
ATOM   7384  C CD1 . TYR B  1 404 ? 16.056  -3.295  62.527  1.00 70.23  ? 404  TYR B CD1 1 
ATOM   7385  C CD2 . TYR B  1 404 ? 18.217  -2.378  62.157  1.00 66.37  ? 404  TYR B CD2 1 
ATOM   7386  C CE1 . TYR B  1 404 ? 15.648  -2.106  63.144  1.00 75.93  ? 404  TYR B CE1 1 
ATOM   7387  C CE2 . TYR B  1 404 ? 17.812  -1.170  62.733  1.00 69.03  ? 404  TYR B CE2 1 
ATOM   7388  C CZ  . TYR B  1 404 ? 16.524  -1.039  63.233  1.00 81.81  ? 404  TYR B CZ  1 
ATOM   7389  O OH  . TYR B  1 404 ? 16.100  0.116   63.858  1.00 85.97  ? 404  TYR B OH  1 
ATOM   7390  N N   . SER B  1 405 ? 19.203  -3.199  58.506  1.00 57.54  ? 405  SER B N   1 
ATOM   7391  C CA  . SER B  1 405 ? 20.277  -2.338  58.020  1.00 57.73  ? 405  SER B CA  1 
ATOM   7392  C C   . SER B  1 405 ? 21.600  -3.125  57.860  1.00 61.72  ? 405  SER B C   1 
ATOM   7393  O O   . SER B  1 405 ? 22.668  -2.649  58.261  1.00 61.71  ? 405  SER B O   1 
ATOM   7394  C CB  . SER B  1 405 ? 20.447  -1.129  58.937  1.00 62.76  ? 405  SER B CB  1 
ATOM   7395  O OG  . SER B  1 405 ? 19.239  -0.391  59.010  1.00 77.46  ? 405  SER B OG  1 
ATOM   7396  N N   . GLY B  1 406 ? 21.489  -4.344  57.313  1.00 56.61  ? 406  GLY B N   1 
ATOM   7397  C CA  . GLY B  1 406 ? 22.613  -5.246  57.096  1.00 54.89  ? 406  GLY B CA  1 
ATOM   7398  C C   . GLY B  1 406 ? 23.108  -5.974  58.329  1.00 57.33  ? 406  GLY B C   1 
ATOM   7399  O O   . GLY B  1 406 ? 24.147  -6.635  58.264  1.00 57.33  ? 406  GLY B O   1 
ATOM   7400  N N   . LEU B  1 407 ? 22.323  -5.940  59.443  1.00 51.56  ? 407  LEU B N   1 
ATOM   7401  C CA  . LEU B  1 407 ? 22.707  -6.529  60.730  1.00 48.79  ? 407  LEU B CA  1 
ATOM   7402  C C   . LEU B  1 407 ? 21.923  -7.774  61.115  1.00 52.76  ? 407  LEU B C   1 
ATOM   7403  O O   . LEU B  1 407 ? 20.696  -7.784  60.996  1.00 53.20  ? 407  LEU B O   1 
ATOM   7404  C CB  . LEU B  1 407 ? 22.564  -5.469  61.847  1.00 48.01  ? 407  LEU B CB  1 
ATOM   7405  C CG  . LEU B  1 407 ? 23.381  -4.167  61.718  1.00 49.77  ? 407  LEU B CG  1 
ATOM   7406  C CD1 . LEU B  1 407 ? 22.877  -3.108  62.665  1.00 48.11  ? 407  LEU B CD1 1 
ATOM   7407  C CD2 . LEU B  1 407 ? 24.879  -4.426  61.886  1.00 49.95  ? 407  LEU B CD2 1 
ATOM   7408  N N   . SER B  1 408 ? 22.617  -8.817  61.621  1.00 47.41  ? 408  SER B N   1 
ATOM   7409  C CA  . SER B  1 408 ? 21.923  -10.028 62.089  1.00 45.35  ? 408  SER B CA  1 
ATOM   7410  C C   . SER B  1 408 ? 21.943  -10.134 63.622  1.00 46.73  ? 408  SER B C   1 
ATOM   7411  O O   . SER B  1 408 ? 21.119  -10.851 64.200  1.00 46.38  ? 408  SER B O   1 
ATOM   7412  C CB  . SER B  1 408 ? 22.518  -11.273 61.456  1.00 46.41  ? 408  SER B CB  1 
ATOM   7413  O OG  . SER B  1 408 ? 23.898  -11.308 61.748  1.00 47.59  ? 408  SER B OG  1 
ATOM   7414  N N   . LEU B  1 409 ? 22.888  -9.415  64.265  1.00 40.97  ? 409  LEU B N   1 
ATOM   7415  C CA  . LEU B  1 409 ? 23.031  -9.338  65.706  1.00 41.41  ? 409  LEU B CA  1 
ATOM   7416  C C   . LEU B  1 409 ? 23.226  -7.901  66.151  1.00 53.04  ? 409  LEU B C   1 
ATOM   7417  O O   . LEU B  1 409 ? 24.191  -7.228  65.736  1.00 54.60  ? 409  LEU B O   1 
ATOM   7418  C CB  . LEU B  1 409 ? 24.184  -10.171 66.205  1.00 40.85  ? 409  LEU B CB  1 
ATOM   7419  C CG  . LEU B  1 409 ? 24.150  -10.536 67.668  1.00 45.95  ? 409  LEU B CG  1 
ATOM   7420  C CD1 . LEU B  1 409 ? 22.779  -11.049 68.083  1.00 44.75  ? 409  LEU B CD1 1 
ATOM   7421  C CD2 . LEU B  1 409 ? 25.225  -11.559 67.976  1.00 50.12  ? 409  LEU B CD2 1 
ATOM   7422  N N   . LEU B  1 410 ? 22.302  -7.431  67.029  1.00 51.28  ? 410  LEU B N   1 
ATOM   7423  C CA  . LEU B  1 410 ? 22.284  -6.076  67.575  1.00 51.04  ? 410  LEU B CA  1 
ATOM   7424  C C   . LEU B  1 410 ? 22.067  -6.209  69.068  1.00 55.76  ? 410  LEU B C   1 
ATOM   7425  O O   . LEU B  1 410 ? 21.093  -6.853  69.488  1.00 57.48  ? 410  LEU B O   1 
ATOM   7426  C CB  . LEU B  1 410 ? 21.133  -5.241  66.953  1.00 50.93  ? 410  LEU B CB  1 
ATOM   7427  C CG  . LEU B  1 410 ? 20.971  -5.144  65.389  1.00 54.20  ? 410  LEU B CG  1 
ATOM   7428  C CD1 . LEU B  1 410 ? 20.475  -6.452  64.755  1.00 53.14  ? 410  LEU B CD1 1 
ATOM   7429  C CD2 . LEU B  1 410 ? 19.955  -4.073  65.018  1.00 55.53  ? 410  LEU B CD2 1 
ATOM   7430  N N   . ILE B  1 411 ? 23.021  -5.704  69.871  1.00 49.75  ? 411  ILE B N   1 
ATOM   7431  C CA  . ILE B  1 411 ? 22.931  -5.641  71.331  1.00 48.28  ? 411  ILE B CA  1 
ATOM   7432  C C   . ILE B  1 411 ? 23.359  -4.217  71.626  1.00 53.66  ? 411  ILE B C   1 
ATOM   7433  O O   . ILE B  1 411 ? 24.537  -3.881  71.424  1.00 54.85  ? 411  ILE B O   1 
ATOM   7434  C CB  . ILE B  1 411 ? 23.761  -6.713  72.103  1.00 48.98  ? 411  ILE B CB  1 
ATOM   7435  C CG1 . ILE B  1 411 ? 23.323  -8.135  71.731  1.00 46.87  ? 411  ILE B CG1 1 
ATOM   7436  C CG2 . ILE B  1 411 ? 23.632  -6.489  73.622  1.00 49.44  ? 411  ILE B CG2 1 
ATOM   7437  C CD1 . ILE B  1 411 ? 24.384  -9.075  71.566  1.00 42.90  ? 411  ILE B CD1 1 
ATOM   7438  N N   . LEU B  1 412 ? 22.409  -3.353  71.995  1.00 49.61  ? 412  LEU B N   1 
ATOM   7439  C CA  . LEU B  1 412 ? 22.763  -1.963  72.228  1.00 51.25  ? 412  LEU B CA  1 
ATOM   7440  C C   . LEU B  1 412 ? 22.095  -1.272  73.403  1.00 57.91  ? 412  LEU B C   1 
ATOM   7441  O O   . LEU B  1 412 ? 20.981  -1.637  73.782  1.00 58.06  ? 412  LEU B O   1 
ATOM   7442  C CB  . LEU B  1 412 ? 22.700  -1.100  70.940  1.00 51.22  ? 412  LEU B CB  1 
ATOM   7443  C CG  . LEU B  1 412 ? 21.329  -0.669  70.446  1.00 56.93  ? 412  LEU B CG  1 
ATOM   7444  C CD1 . LEU B  1 412 ? 21.394  0.683   69.783  1.00 57.45  ? 412  LEU B CD1 1 
ATOM   7445  C CD2 . LEU B  1 412 ? 20.748  -1.694  69.489  1.00 60.91  ? 412  LEU B CD2 1 
ATOM   7446  N N   . LYS B  1 413 ? 22.807  -0.254  73.977  1.00 54.50  ? 413  LYS B N   1 
ATOM   7447  C CA  . LYS B  1 413 ? 22.367  0.617   75.065  1.00 53.77  ? 413  LYS B CA  1 
ATOM   7448  C C   . LYS B  1 413 ? 21.998  -0.125  76.370  1.00 59.39  ? 413  LYS B C   1 
ATOM   7449  O O   . LYS B  1 413 ? 21.447  0.486   77.292  1.00 62.92  ? 413  LYS B O   1 
ATOM   7450  C CB  . LYS B  1 413 ? 21.217  1.523   74.582  1.00 53.83  ? 413  LYS B CB  1 
ATOM   7451  C CG  . LYS B  1 413 ? 21.530  2.308   73.309  1.00 49.88  ? 413  LYS B CG  1 
ATOM   7452  C CD  . LYS B  1 413 ? 21.981  3.734   73.579  1.00 56.18  ? 413  LYS B CD  1 
ATOM   7453  C CE  . LYS B  1 413 ? 22.239  4.484   72.311  1.00 69.33  ? 413  LYS B CE  1 
ATOM   7454  N NZ  . LYS B  1 413 ? 22.229  5.947   72.539  1.00 93.15  ? 413  LYS B NZ  1 
ATOM   7455  N N   . GLN B  1 414 ? 22.329  -1.416  76.467  1.00 53.00  ? 414  GLN B N   1 
ATOM   7456  C CA  . GLN B  1 414 ? 22.015  -2.227  77.640  1.00 53.46  ? 414  GLN B CA  1 
ATOM   7457  C C   . GLN B  1 414 ? 22.974  -2.075  78.810  1.00 60.42  ? 414  GLN B C   1 
ATOM   7458  O O   . GLN B  1 414 ? 24.072  -2.617  78.781  1.00 60.55  ? 414  GLN B O   1 
ATOM   7459  C CB  . GLN B  1 414 ? 21.723  -3.695  77.264  1.00 53.11  ? 414  GLN B CB  1 
ATOM   7460  C CG  . GLN B  1 414 ? 20.507  -3.874  76.348  1.00 56.72  ? 414  GLN B CG  1 
ATOM   7461  C CD  . GLN B  1 414 ? 19.338  -3.069  76.845  1.00 82.15  ? 414  GLN B CD  1 
ATOM   7462  O OE1 . GLN B  1 414 ? 18.730  -3.401  77.865  1.00 79.55  ? 414  GLN B OE1 1 
ATOM   7463  N NE2 . GLN B  1 414 ? 19.066  -1.932  76.202  1.00 76.24  ? 414  GLN B NE2 1 
ATOM   7464  N N   . GLN B  1 415 ? 22.551  -1.329  79.845  1.00 59.27  ? 415  GLN B N   1 
ATOM   7465  C CA  . GLN B  1 415 ? 23.376  -1.055  81.036  1.00 59.98  ? 415  GLN B CA  1 
ATOM   7466  C C   . GLN B  1 415 ? 23.483  -2.231  81.998  1.00 64.95  ? 415  GLN B C   1 
ATOM   7467  O O   . GLN B  1 415 ? 24.536  -2.411  82.599  1.00 66.21  ? 415  GLN B O   1 
ATOM   7468  C CB  . GLN B  1 415 ? 22.901  0.189   81.797  1.00 62.36  ? 415  GLN B CB  1 
ATOM   7469  C CG  . GLN B  1 415 ? 22.880  1.472   80.978  1.00 87.99  ? 415  GLN B CG  1 
ATOM   7470  C CD  . GLN B  1 415 ? 24.246  1.939   80.546  1.00 110.08 ? 415  GLN B CD  1 
ATOM   7471  O OE1 . GLN B  1 415 ? 25.052  2.410   81.358  1.00 99.53  ? 415  GLN B OE1 1 
ATOM   7472  N NE2 . GLN B  1 415 ? 24.515  1.856   79.241  1.00 113.08 ? 415  GLN B NE2 1 
ATOM   7473  N N   . GLY B  1 416 ? 22.411  -3.013  82.129  1.00 60.03  ? 416  GLY B N   1 
ATOM   7474  C CA  . GLY B  1 416 ? 22.348  -4.137  83.055  1.00 59.37  ? 416  GLY B CA  1 
ATOM   7475  C C   . GLY B  1 416 ? 23.154  -5.363  82.706  1.00 61.65  ? 416  GLY B C   1 
ATOM   7476  O O   . GLY B  1 416 ? 23.401  -6.188  83.579  1.00 62.40  ? 416  GLY B O   1 
ATOM   7477  N N   . ILE B  1 417 ? 23.539  -5.523  81.441  1.00 56.98  ? 417  ILE B N   1 
ATOM   7478  C CA  . ILE B  1 417 ? 24.303  -6.701  81.001  1.00 55.82  ? 417  ILE B CA  1 
ATOM   7479  C C   . ILE B  1 417 ? 25.803  -6.572  81.285  1.00 62.34  ? 417  ILE B C   1 
ATOM   7480  O O   . ILE B  1 417 ? 26.412  -5.530  81.001  1.00 63.49  ? 417  ILE B O   1 
ATOM   7481  C CB  . ILE B  1 417 ? 24.001  -7.167  79.546  1.00 56.25  ? 417  ILE B CB  1 
ATOM   7482  C CG1 . ILE B  1 417 ? 24.201  -6.051  78.532  1.00 56.45  ? 417  ILE B CG1 1 
ATOM   7483  C CG2 . ILE B  1 417 ? 22.619  -7.741  79.441  1.00 55.11  ? 417  ILE B CG2 1 
ATOM   7484  C CD1 . ILE B  1 417 ? 24.917  -6.485  77.364  1.00 67.39  ? 417  ILE B CD1 1 
ATOM   7485  N N   . THR B  1 418 ? 26.386  -7.638  81.860  1.00 57.21  ? 418  THR B N   1 
ATOM   7486  C CA  . THR B  1 418 ? 27.807  -7.678  82.221  1.00 56.33  ? 418  THR B CA  1 
ATOM   7487  C C   . THR B  1 418 ? 28.598  -8.792  81.479  1.00 59.97  ? 418  THR B C   1 
ATOM   7488  O O   . THR B  1 418 ? 29.838  -8.759  81.428  1.00 59.74  ? 418  THR B O   1 
ATOM   7489  C CB  . THR B  1 418 ? 27.967  -7.687  83.737  1.00 54.09  ? 418  THR B CB  1 
ATOM   7490  O OG1 . THR B  1 418 ? 27.293  -8.822  84.277  1.00 54.63  ? 418  THR B OG1 1 
ATOM   7491  C CG2 . THR B  1 418 ? 27.448  -6.406  84.383  1.00 45.10  ? 418  THR B CG2 1 
ATOM   7492  N N   . SER B  1 419 ? 27.865  -9.776  80.933  1.00 54.53  ? 419  SER B N   1 
ATOM   7493  C CA  . SER B  1 419 ? 28.357  -10.880 80.113  1.00 52.54  ? 419  SER B CA  1 
ATOM   7494  C C   . SER B  1 419 ? 27.230  -11.232 79.087  1.00 52.79  ? 419  SER B C   1 
ATOM   7495  O O   . SER B  1 419 ? 26.109  -10.734 79.216  1.00 49.09  ? 419  SER B O   1 
ATOM   7496  C CB  . SER B  1 419 ? 28.805  -12.083 80.949  1.00 55.18  ? 419  SER B CB  1 
ATOM   7497  O OG  . SER B  1 419 ? 27.720  -12.755 81.562  1.00 66.51  ? 419  SER B OG  1 
ATOM   7498  N N   . LEU B  1 420 ? 27.566  -12.038 78.055  1.00 48.24  ? 420  LEU B N   1 
ATOM   7499  C CA  . LEU B  1 420 ? 26.689  -12.415 76.961  1.00 46.47  ? 420  LEU B CA  1 
ATOM   7500  C C   . LEU B  1 420 ? 26.050  -13.791 77.193  1.00 53.46  ? 420  LEU B C   1 
ATOM   7501  O O   . LEU B  1 420 ? 24.805  -13.872 77.161  1.00 55.62  ? 420  LEU B O   1 
ATOM   7502  C CB  . LEU B  1 420 ? 27.469  -12.367 75.644  1.00 44.45  ? 420  LEU B CB  1 
ATOM   7503  C CG  . LEU B  1 420 ? 27.915  -10.976 75.176  1.00 46.93  ? 420  LEU B CG  1 
ATOM   7504  C CD1 . LEU B  1 420 ? 29.090  -11.086 74.259  1.00 46.47  ? 420  LEU B CD1 1 
ATOM   7505  C CD2 . LEU B  1 420 ? 26.798  -10.254 74.436  1.00 46.36  ? 420  LEU B CD2 1 
ATOM   7506  N N   . GLN B  1 421 ? 26.881  -14.848 77.485  1.00 46.58  ? 421  GLN B N   1 
ATOM   7507  C CA  . GLN B  1 421 ? 26.439  -16.204 77.800  1.00 45.86  ? 421  GLN B CA  1 
ATOM   7508  C C   . GLN B  1 421 ? 25.755  -16.921 76.641  1.00 53.65  ? 421  GLN B C   1 
ATOM   7509  O O   . GLN B  1 421 ? 24.893  -17.776 76.875  1.00 55.05  ? 421  GLN B O   1 
ATOM   7510  C CB  . GLN B  1 421 ? 25.499  -16.268 79.037  1.00 47.45  ? 421  GLN B CB  1 
ATOM   7511  C CG  . GLN B  1 421 ? 25.952  -15.618 80.341  1.00 55.60  ? 421  GLN B CG  1 
ATOM   7512  C CD  . GLN B  1 421 ? 27.248  -16.092 80.924  1.00 66.65  ? 421  GLN B CD  1 
ATOM   7513  O OE1 . GLN B  1 421 ? 28.149  -15.299 81.176  1.00 65.53  ? 421  GLN B OE1 1 
ATOM   7514  N NE2 . GLN B  1 421 ? 27.376  -17.383 81.158  1.00 52.86  ? 421  GLN B NE2 1 
ATOM   7515  N N   . PHE B  1 422 ? 26.135  -16.619 75.399  1.00 50.96  ? 422  PHE B N   1 
ATOM   7516  C CA  . PHE B  1 422 ? 25.594  -17.294 74.207  1.00 49.50  ? 422  PHE B CA  1 
ATOM   7517  C C   . PHE B  1 422 ? 26.372  -18.610 74.025  1.00 54.55  ? 422  PHE B C   1 
ATOM   7518  O O   . PHE B  1 422 ? 27.030  -18.821 73.006  1.00 54.93  ? 422  PHE B O   1 
ATOM   7519  C CB  . PHE B  1 422 ? 25.759  -16.381 72.966  1.00 50.15  ? 422  PHE B CB  1 
ATOM   7520  C CG  . PHE B  1 422 ? 24.813  -15.209 72.926  1.00 50.77  ? 422  PHE B CG  1 
ATOM   7521  C CD1 . PHE B  1 422 ? 25.296  -13.911 72.867  1.00 53.13  ? 422  PHE B CD1 1 
ATOM   7522  C CD2 . PHE B  1 422 ? 23.431  -15.405 72.959  1.00 51.29  ? 422  PHE B CD2 1 
ATOM   7523  C CE1 . PHE B  1 422 ? 24.413  -12.829 72.821  1.00 54.30  ? 422  PHE B CE1 1 
ATOM   7524  C CE2 . PHE B  1 422 ? 22.551  -14.328 72.932  1.00 53.53  ? 422  PHE B CE2 1 
ATOM   7525  C CZ  . PHE B  1 422 ? 23.045  -13.050 72.880  1.00 52.72  ? 422  PHE B CZ  1 
ATOM   7526  N N   . GLN B  1 423 ? 26.309  -19.472 75.035  1.00 51.26  ? 423  GLN B N   1 
ATOM   7527  C CA  . GLN B  1 423 ? 27.000  -20.751 75.136  1.00 51.04  ? 423  GLN B CA  1 
ATOM   7528  C C   . GLN B  1 423 ? 26.971  -21.598 73.871  1.00 55.15  ? 423  GLN B C   1 
ATOM   7529  O O   . GLN B  1 423 ? 28.023  -21.983 73.381  1.00 56.03  ? 423  GLN B O   1 
ATOM   7530  C CB  . GLN B  1 423 ? 26.446  -21.519 76.327  1.00 52.93  ? 423  GLN B CB  1 
ATOM   7531  C CG  . GLN B  1 423 ? 27.176  -22.807 76.613  1.00 65.97  ? 423  GLN B CG  1 
ATOM   7532  C CD  . GLN B  1 423 ? 26.539  -23.524 77.774  1.00 75.51  ? 423  GLN B CD  1 
ATOM   7533  O OE1 . GLN B  1 423 ? 25.323  -23.715 77.820  1.00 63.52  ? 423  GLN B OE1 1 
ATOM   7534  N NE2 . GLN B  1 423 ? 27.350  -23.972 78.719  1.00 68.96  ? 423  GLN B NE2 1 
ATOM   7535  N N   . SER B  1 424 ? 25.794  -21.838 73.316  1.00 50.83  ? 424  SER B N   1 
ATOM   7536  C CA  . SER B  1 424 ? 25.666  -22.686 72.140  1.00 49.44  ? 424  SER B CA  1 
ATOM   7537  C C   . SER B  1 424 ? 25.891  -22.040 70.795  1.00 51.49  ? 424  SER B C   1 
ATOM   7538  O O   . SER B  1 424 ? 25.996  -22.771 69.816  1.00 50.92  ? 424  SER B O   1 
ATOM   7539  C CB  . SER B  1 424 ? 24.358  -23.468 72.181  1.00 52.34  ? 424  SER B CB  1 
ATOM   7540  O OG  . SER B  1 424 ? 24.389  -24.390 73.263  1.00 55.68  ? 424  SER B OG  1 
ATOM   7541  N N   . LEU B  1 425 ? 26.014  -20.697 70.737  1.00 47.26  ? 425  LEU B N   1 
ATOM   7542  C CA  . LEU B  1 425 ? 26.218  -19.947 69.490  1.00 45.88  ? 425  LEU B CA  1 
ATOM   7543  C C   . LEU B  1 425 ? 27.506  -20.288 68.746  1.00 53.60  ? 425  LEU B C   1 
ATOM   7544  O O   . LEU B  1 425 ? 28.624  -20.048 69.237  1.00 54.42  ? 425  LEU B O   1 
ATOM   7545  C CB  . LEU B  1 425 ? 26.067  -18.443 69.712  1.00 45.07  ? 425  LEU B CB  1 
ATOM   7546  C CG  . LEU B  1 425 ? 25.983  -17.576 68.472  1.00 48.24  ? 425  LEU B CG  1 
ATOM   7547  C CD1 . LEU B  1 425 ? 24.720  -17.857 67.660  1.00 49.82  ? 425  LEU B CD1 1 
ATOM   7548  C CD2 . LEU B  1 425 ? 25.967  -16.159 68.845  1.00 46.35  ? 425  LEU B CD2 1 
ATOM   7549  N N   . LYS B  1 426 ? 27.323  -20.856 67.542  1.00 50.83  ? 426  LYS B N   1 
ATOM   7550  C CA  . LYS B  1 426 ? 28.390  -21.316 66.649  1.00 50.46  ? 426  LYS B CA  1 
ATOM   7551  C C   . LYS B  1 426 ? 28.342  -20.649 65.264  1.00 55.54  ? 426  LYS B C   1 
ATOM   7552  O O   . LYS B  1 426 ? 29.371  -20.588 64.592  1.00 55.58  ? 426  LYS B O   1 
ATOM   7553  C CB  . LYS B  1 426 ? 28.314  -22.846 66.483  1.00 52.01  ? 426  LYS B CB  1 
ATOM   7554  C CG  . LYS B  1 426 ? 28.603  -23.650 67.762  1.00 67.15  ? 426  LYS B CG  1 
ATOM   7555  C CD  . LYS B  1 426 ? 29.992  -24.291 67.758  1.00 79.24  ? 426  LYS B CD  1 
ATOM   7556  C CE  . LYS B  1 426 ? 30.608  -24.396 69.148  1.00 90.42  ? 426  LYS B CE  1 
ATOM   7557  N NZ  . LYS B  1 426 ? 31.260  -23.118 69.612  1.00 92.52  ? 426  LYS B NZ  1 
ATOM   7558  N N   . GLU B  1 427 ? 27.165  -20.127 64.847  1.00 53.09  ? 427  GLU B N   1 
ATOM   7559  C CA  . GLU B  1 427 ? 26.996  -19.576 63.507  1.00 52.82  ? 427  GLU B CA  1 
ATOM   7560  C C   . GLU B  1 427 ? 26.110  -18.348 63.363  1.00 55.28  ? 427  GLU B C   1 
ATOM   7561  O O   . GLU B  1 427 ? 24.967  -18.343 63.833  1.00 56.90  ? 427  GLU B O   1 
ATOM   7562  C CB  . GLU B  1 427 ? 26.425  -20.681 62.629  1.00 55.20  ? 427  GLU B CB  1 
ATOM   7563  C CG  . GLU B  1 427 ? 26.624  -20.493 61.139  1.00 80.97  ? 427  GLU B CG  1 
ATOM   7564  C CD  . GLU B  1 427 ? 26.096  -21.646 60.299  1.00 118.63 ? 427  GLU B CD  1 
ATOM   7565  O OE1 . GLU B  1 427 ? 25.690  -22.693 60.871  1.00 92.78  ? 427  GLU B OE1 1 
ATOM   7566  O OE2 . GLU B  1 427 ? 26.106  -21.496 59.053  1.00 125.09 ? 427  GLU B OE2 1 
ATOM   7567  N N   . ILE B  1 428 ? 26.638  -17.324 62.652  1.00 48.86  ? 428  ILE B N   1 
ATOM   7568  C CA  . ILE B  1 428 ? 25.981  -16.071 62.244  1.00 47.05  ? 428  ILE B CA  1 
ATOM   7569  C C   . ILE B  1 428 ? 26.216  -16.057 60.728  1.00 51.68  ? 428  ILE B C   1 
ATOM   7570  O O   . ILE B  1 428 ? 27.267  -15.584 60.238  1.00 51.59  ? 428  ILE B O   1 
ATOM   7571  C CB  . ILE B  1 428 ? 26.501  -14.828 63.006  1.00 49.46  ? 428  ILE B CB  1 
ATOM   7572  C CG1 . ILE B  1 428 ? 26.171  -14.944 64.500  1.00 50.83  ? 428  ILE B CG1 1 
ATOM   7573  C CG2 . ILE B  1 428 ? 25.898  -13.558 62.444  1.00 48.62  ? 428  ILE B CG2 1 
ATOM   7574  C CD1 . ILE B  1 428 ? 27.085  -14.212 65.438  1.00 60.05  ? 428  ILE B CD1 1 
ATOM   7575  N N   . SER B  1 429 ? 25.265  -16.745 60.021  1.00 46.68  ? 429  SER B N   1 
ATOM   7576  C CA  . SER B  1 429 ? 25.251  -17.066 58.589  1.00 45.92  ? 429  SER B CA  1 
ATOM   7577  C C   . SER B  1 429 ? 25.425  -15.912 57.621  1.00 51.50  ? 429  SER B C   1 
ATOM   7578  O O   . SER B  1 429 ? 26.136  -16.033 56.620  1.00 55.38  ? 429  SER B O   1 
ATOM   7579  C CB  . SER B  1 429 ? 24.007  -17.857 58.228  1.00 49.91  ? 429  SER B CB  1 
ATOM   7580  O OG  . SER B  1 429 ? 23.805  -18.991 59.054  1.00 63.15  ? 429  SER B OG  1 
ATOM   7581  N N   . ALA B  1 430 ? 24.796  -14.799 57.915  1.00 45.01  ? 430  ALA B N   1 
ATOM   7582  C CA  . ALA B  1 430 ? 24.800  -13.607 57.092  1.00 43.36  ? 430  ALA B CA  1 
ATOM   7583  C C   . ALA B  1 430 ? 24.711  -12.427 58.029  1.00 50.12  ? 430  ALA B C   1 
ATOM   7584  O O   . ALA B  1 430 ? 24.432  -12.614 59.222  1.00 51.79  ? 430  ALA B O   1 
ATOM   7585  C CB  . ALA B  1 430 ? 23.575  -13.624 56.211  1.00 43.23  ? 430  ALA B CB  1 
ATOM   7586  N N   . GLY B  1 431 ? 24.940  -11.233 57.491  1.00 46.64  ? 431  GLY B N   1 
ATOM   7587  C CA  . GLY B  1 431 ? 24.838  -9.982  58.228  1.00 47.56  ? 431  GLY B CA  1 
ATOM   7588  C C   . GLY B  1 431 ? 26.012  -9.630  59.122  1.00 52.60  ? 431  GLY B C   1 
ATOM   7589  O O   . GLY B  1 431 ? 26.917  -10.444 59.360  1.00 50.08  ? 431  GLY B O   1 
ATOM   7590  N N   . ASN B  1 432 ? 25.972  -8.401  59.633  1.00 51.53  ? 432  ASN B N   1 
ATOM   7591  C CA  . ASN B  1 432 ? 27.003  -7.898  60.503  1.00 53.15  ? 432  ASN B CA  1 
ATOM   7592  C C   . ASN B  1 432 ? 26.515  -7.878  61.957  1.00 60.03  ? 432  ASN B C   1 
ATOM   7593  O O   . ASN B  1 432 ? 25.314  -8.035  62.219  1.00 59.78  ? 432  ASN B O   1 
ATOM   7594  C CB  . ASN B  1 432 ? 27.448  -6.507  60.044  1.00 53.97  ? 432  ASN B CB  1 
ATOM   7595  C CG  . ASN B  1 432 ? 27.950  -6.442  58.636  1.00 63.67  ? 432  ASN B CG  1 
ATOM   7596  O OD1 . ASN B  1 432 ? 28.676  -7.302  58.166  1.00 69.89  ? 432  ASN B OD1 1 
ATOM   7597  N ND2 . ASN B  1 432 ? 27.570  -5.419  57.929  1.00 47.87  ? 432  ASN B ND2 1 
ATOM   7598  N N   . ILE B  1 433 ? 27.469  -7.699  62.886  1.00 57.03  ? 433  ILE B N   1 
ATOM   7599  C CA  . ILE B  1 433 ? 27.223  -7.612  64.299  1.00 58.31  ? 433  ILE B CA  1 
ATOM   7600  C C   . ILE B  1 433 ? 27.386  -6.180  64.767  1.00 63.96  ? 433  ILE B C   1 
ATOM   7601  O O   . ILE B  1 433 ? 28.319  -5.489  64.359  1.00 65.14  ? 433  ILE B O   1 
ATOM   7602  C CB  . ILE B  1 433 ? 28.120  -8.604  65.046  1.00 62.56  ? 433  ILE B CB  1 
ATOM   7603  C CG1 . ILE B  1 433 ? 27.733  -10.023 64.651  1.00 63.08  ? 433  ILE B CG1 1 
ATOM   7604  C CG2 . ILE B  1 433 ? 28.013  -8.435  66.570  1.00 65.17  ? 433  ILE B CG2 1 
ATOM   7605  C CD1 . ILE B  1 433 ? 28.699  -10.995 65.127  1.00 80.15  ? 433  ILE B CD1 1 
ATOM   7606  N N   . TYR B  1 434 ? 26.483  -5.744  65.643  1.00 60.42  ? 434  TYR B N   1 
ATOM   7607  C CA  . TYR B  1 434 ? 26.496  -4.394  66.187  1.00 60.75  ? 434  TYR B CA  1 
ATOM   7608  C C   . TYR B  1 434 ? 26.299  -4.471  67.711  1.00 62.15  ? 434  TYR B C   1 
ATOM   7609  O O   . TYR B  1 434 ? 25.184  -4.652  68.185  1.00 61.92  ? 434  TYR B O   1 
ATOM   7610  C CB  . TYR B  1 434 ? 25.382  -3.602  65.498  1.00 61.92  ? 434  TYR B CB  1 
ATOM   7611  C CG  . TYR B  1 434 ? 25.357  -2.129  65.813  1.00 64.64  ? 434  TYR B CG  1 
ATOM   7612  C CD1 . TYR B  1 434 ? 26.157  -1.232  65.112  1.00 66.79  ? 434  TYR B CD1 1 
ATOM   7613  C CD2 . TYR B  1 434 ? 24.439  -1.609  66.718  1.00 66.24  ? 434  TYR B CD2 1 
ATOM   7614  C CE1 . TYR B  1 434 ? 26.108  0.140   65.371  1.00 68.77  ? 434  TYR B CE1 1 
ATOM   7615  C CE2 . TYR B  1 434 ? 24.361  -0.237  66.969  1.00 67.92  ? 434  TYR B CE2 1 
ATOM   7616  C CZ  . TYR B  1 434 ? 25.211  0.635   66.307  1.00 75.59  ? 434  TYR B CZ  1 
ATOM   7617  O OH  . TYR B  1 434 ? 25.161  1.985   66.596  1.00 75.81  ? 434  TYR B OH  1 
ATOM   7618  N N   . ILE B  1 435 ? 27.396  -4.417  68.466  1.00 55.82  ? 435  ILE B N   1 
ATOM   7619  C CA  . ILE B  1 435 ? 27.369  -4.482  69.926  1.00 54.65  ? 435  ILE B CA  1 
ATOM   7620  C C   . ILE B  1 435 ? 27.922  -3.162  70.419  1.00 62.50  ? 435  ILE B C   1 
ATOM   7621  O O   . ILE B  1 435 ? 29.141  -2.967  70.408  1.00 63.08  ? 435  ILE B O   1 
ATOM   7622  C CB  . ILE B  1 435 ? 28.124  -5.723  70.504  1.00 55.17  ? 435  ILE B CB  1 
ATOM   7623  C CG1 . ILE B  1 435 ? 27.451  -7.000  70.003  1.00 54.61  ? 435  ILE B CG1 1 
ATOM   7624  C CG2 . ILE B  1 435 ? 28.138  -5.691  72.039  1.00 52.90  ? 435  ILE B CG2 1 
ATOM   7625  C CD1 . ILE B  1 435 ? 28.151  -8.212  70.225  1.00 57.25  ? 435  ILE B CD1 1 
ATOM   7626  N N   . THR B  1 436 ? 27.031  -2.220  70.786  1.00 58.78  ? 436  THR B N   1 
ATOM   7627  C CA  . THR B  1 436 ? 27.467  -0.887  71.216  1.00 59.12  ? 436  THR B CA  1 
ATOM   7628  C C   . THR B  1 436 ? 26.741  -0.368  72.449  1.00 66.05  ? 436  THR B C   1 
ATOM   7629  O O   . THR B  1 436 ? 25.631  -0.812  72.743  1.00 67.10  ? 436  THR B O   1 
ATOM   7630  C CB  . THR B  1 436 ? 27.269  0.154   70.095  1.00 58.20  ? 436  THR B CB  1 
ATOM   7631  O OG1 . THR B  1 436 ? 25.874  0.330   69.852  1.00 57.87  ? 436  THR B OG1 1 
ATOM   7632  C CG2 . THR B  1 436 ? 28.005  -0.179  68.810  1.00 53.51  ? 436  THR B CG2 1 
ATOM   7633  N N   . ASP B  1 437 ? 27.364  0.613   73.140  1.00 62.33  ? 437  ASP B N   1 
ATOM   7634  C CA  . ASP B  1 437 ? 26.827  1.366   74.271  1.00 63.43  ? 437  ASP B CA  1 
ATOM   7635  C C   . ASP B  1 437 ? 26.305  0.547   75.476  1.00 66.37  ? 437  ASP B C   1 
ATOM   7636  O O   . ASP B  1 437 ? 25.511  1.054   76.293  1.00 67.05  ? 437  ASP B O   1 
ATOM   7637  C CB  . ASP B  1 437 ? 25.804  2.403   73.772  1.00 66.65  ? 437  ASP B CB  1 
ATOM   7638  C CG  . ASP B  1 437 ? 26.232  3.182   72.532  1.00 83.34  ? 437  ASP B CG  1 
ATOM   7639  O OD1 . ASP B  1 437 ? 27.154  4.040   72.645  1.00 83.37  ? 437  ASP B OD1 1 
ATOM   7640  O OD2 . ASP B  1 437 ? 25.642  2.947   71.453  1.00 94.08  ? 437  ASP B OD2 1 
ATOM   7641  N N   . ASN B  1 438 ? 26.769  -0.718  75.594  1.00 59.39  ? 438  ASN B N   1 
ATOM   7642  C CA  . ASN B  1 438 ? 26.452  -1.591  76.723  1.00 57.14  ? 438  ASN B CA  1 
ATOM   7643  C C   . ASN B  1 438 ? 27.607  -1.359  77.687  1.00 59.52  ? 438  ASN B C   1 
ATOM   7644  O O   . ASN B  1 438 ? 28.553  -2.138  77.743  1.00 60.00  ? 438  ASN B O   1 
ATOM   7645  C CB  . ASN B  1 438 ? 26.346  -3.055  76.288  1.00 48.75  ? 438  ASN B CB  1 
ATOM   7646  C CG  . ASN B  1 438 ? 25.584  -3.235  75.016  1.00 60.10  ? 438  ASN B CG  1 
ATOM   7647  O OD1 . ASN B  1 438 ? 24.373  -3.078  74.970  1.00 42.96  ? 438  ASN B OD1 1 
ATOM   7648  N ND2 . ASN B  1 438 ? 26.292  -3.517  73.939  1.00 61.27  ? 438  ASN B ND2 1 
ATOM   7649  N N   . SER B  1 439 ? 27.545  -0.241  78.403  1.00 53.94  ? 439  SER B N   1 
ATOM   7650  C CA  . SER B  1 439 ? 28.575  0.257   79.292  1.00 54.44  ? 439  SER B CA  1 
ATOM   7651  C C   . SER B  1 439 ? 29.234  -0.707  80.243  1.00 60.54  ? 439  SER B C   1 
ATOM   7652  O O   . SER B  1 439 ? 30.382  -0.454  80.617  1.00 61.18  ? 439  SER B O   1 
ATOM   7653  C CB  . SER B  1 439 ? 28.065  1.478   80.035  1.00 59.64  ? 439  SER B CB  1 
ATOM   7654  O OG  . SER B  1 439 ? 27.742  2.495   79.102  1.00 75.06  ? 439  SER B OG  1 
ATOM   7655  N N   . ASN B  1 440 ? 28.543  -1.817  80.629  1.00 56.33  ? 440  ASN B N   1 
ATOM   7656  C CA  . ASN B  1 440 ? 29.038  -2.770  81.618  1.00 55.15  ? 440  ASN B CA  1 
ATOM   7657  C C   . ASN B  1 440 ? 29.328  -4.146  81.110  1.00 58.71  ? 440  ASN B C   1 
ATOM   7658  O O   . ASN B  1 440 ? 29.783  -4.991  81.905  1.00 59.45  ? 440  ASN B O   1 
ATOM   7659  C CB  . ASN B  1 440 ? 28.129  -2.802  82.824  1.00 51.93  ? 440  ASN B CB  1 
ATOM   7660  C CG  . ASN B  1 440 ? 27.918  -1.426  83.422  1.00 75.23  ? 440  ASN B CG  1 
ATOM   7661  O OD1 . ASN B  1 440 ? 28.854  -0.765  83.889  1.00 76.61  ? 440  ASN B OD1 1 
ATOM   7662  N ND2 . ASN B  1 440 ? 26.697  -0.934  83.353  1.00 58.17  ? 440  ASN B ND2 1 
ATOM   7663  N N   . LEU B  1 441 ? 29.121  -4.371  79.787  1.00 53.56  ? 441  LEU B N   1 
ATOM   7664  C CA  . LEU B  1 441 ? 29.390  -5.654  79.124  1.00 52.38  ? 441  LEU B CA  1 
ATOM   7665  C C   . LEU B  1 441 ? 30.900  -5.919  79.120  1.00 62.38  ? 441  LEU B C   1 
ATOM   7666  O O   . LEU B  1 441 ? 31.670  -4.979  78.906  1.00 62.21  ? 441  LEU B O   1 
ATOM   7667  C CB  . LEU B  1 441 ? 28.803  -5.671  77.724  1.00 49.95  ? 441  LEU B CB  1 
ATOM   7668  C CG  . LEU B  1 441 ? 28.938  -6.952  76.960  1.00 52.10  ? 441  LEU B CG  1 
ATOM   7669  C CD1 . LEU B  1 441 ? 28.269  -8.080  77.663  1.00 52.36  ? 441  LEU B CD1 1 
ATOM   7670  C CD2 . LEU B  1 441 ? 28.374  -6.795  75.601  1.00 52.17  ? 441  LEU B CD2 1 
ATOM   7671  N N   . CYS B  1 442 ? 31.313  -7.181  79.393  1.00 62.99  ? 442  CYS B N   1 
ATOM   7672  C CA  . CYS B  1 442 ? 32.706  -7.499  79.608  1.00 66.02  ? 442  CYS B CA  1 
ATOM   7673  C C   . CYS B  1 442 ? 33.376  -8.634  78.864  1.00 71.66  ? 442  CYS B C   1 
ATOM   7674  O O   . CYS B  1 442 ? 34.616  -8.803  79.062  1.00 76.86  ? 442  CYS B O   1 
ATOM   7675  C CB  . CYS B  1 442 ? 33.007  -7.584  81.103  1.00 68.94  ? 442  CYS B CB  1 
ATOM   7676  S SG  . CYS B  1 442 ? 34.001  -6.208  81.743  1.00 75.71  ? 442  CYS B SG  1 
ATOM   7677  N N   . TYR B  1 443 ? 32.653  -9.459  78.096  1.00 59.91  ? 443  TYR B N   1 
ATOM   7678  C CA  . TYR B  1 443 ? 33.468  -10.534 77.539  1.00 57.39  ? 443  TYR B CA  1 
ATOM   7679  C C   . TYR B  1 443 ? 33.696  -10.486 76.023  1.00 56.68  ? 443  TYR B C   1 
ATOM   7680  O O   . TYR B  1 443 ? 34.602  -11.129 75.494  1.00 53.12  ? 443  TYR B O   1 
ATOM   7681  C CB  . TYR B  1 443 ? 33.046  -11.897 78.091  1.00 58.54  ? 443  TYR B CB  1 
ATOM   7682  C CG  . TYR B  1 443 ? 33.253  -12.062 79.582  1.00 61.56  ? 443  TYR B CG  1 
ATOM   7683  C CD1 . TYR B  1 443 ? 32.350  -11.535 80.490  1.00 64.43  ? 443  TYR B CD1 1 
ATOM   7684  C CD2 . TYR B  1 443 ? 34.297  -12.838 80.080  1.00 63.77  ? 443  TYR B CD2 1 
ATOM   7685  C CE1 . TYR B  1 443 ? 32.523  -11.699 81.865  1.00 68.58  ? 443  TYR B CE1 1 
ATOM   7686  C CE2 . TYR B  1 443 ? 34.474  -13.027 81.456  1.00 66.36  ? 443  TYR B CE2 1 
ATOM   7687  C CZ  . TYR B  1 443 ? 33.589  -12.443 82.350  1.00 74.22  ? 443  TYR B CZ  1 
ATOM   7688  O OH  . TYR B  1 443 ? 33.766  -12.601 83.715  1.00 71.64  ? 443  TYR B OH  1 
ATOM   7689  N N   . TYR B  1 444 ? 32.878  -9.660  75.356  1.00 53.03  ? 444  TYR B N   1 
ATOM   7690  C CA  . TYR B  1 444 ? 32.738  -9.381  73.925  1.00 50.67  ? 444  TYR B CA  1 
ATOM   7691  C C   . TYR B  1 444 ? 34.047  -9.158  73.209  1.00 54.27  ? 444  TYR B C   1 
ATOM   7692  O O   . TYR B  1 444 ? 34.126  -9.440  72.016  1.00 53.10  ? 444  TYR B O   1 
ATOM   7693  C CB  . TYR B  1 444 ? 31.828  -8.132  73.752  1.00 51.20  ? 444  TYR B CB  1 
ATOM   7694  C CG  . TYR B  1 444 ? 32.501  -6.826  74.135  1.00 54.06  ? 444  TYR B CG  1 
ATOM   7695  C CD1 . TYR B  1 444 ? 33.107  -6.021  73.171  1.00 56.30  ? 444  TYR B CD1 1 
ATOM   7696  C CD2 . TYR B  1 444 ? 32.617  -6.442  75.468  1.00 56.19  ? 444  TYR B CD2 1 
ATOM   7697  C CE1 . TYR B  1 444 ? 33.802  -4.865  73.519  1.00 58.02  ? 444  TYR B CE1 1 
ATOM   7698  C CE2 . TYR B  1 444 ? 33.321  -5.290  75.831  1.00 58.61  ? 444  TYR B CE2 1 
ATOM   7699  C CZ  . TYR B  1 444 ? 33.911  -4.502  74.850  1.00 66.82  ? 444  TYR B CZ  1 
ATOM   7700  O OH  . TYR B  1 444 ? 34.547  -3.321  75.166  1.00 68.35  ? 444  TYR B OH  1 
ATOM   7701  N N   . HIS B  1 445 ? 35.034  -8.550  73.909  1.00 52.52  ? 445  HIS B N   1 
ATOM   7702  C CA  . HIS B  1 445 ? 36.329  -8.171  73.342  1.00 52.89  ? 445  HIS B CA  1 
ATOM   7703  C C   . HIS B  1 445 ? 37.282  -9.334  73.159  1.00 57.83  ? 445  HIS B C   1 
ATOM   7704  O O   . HIS B  1 445 ? 38.263  -9.188  72.427  1.00 59.57  ? 445  HIS B O   1 
ATOM   7705  C CB  . HIS B  1 445 ? 36.994  -7.040  74.158  1.00 54.46  ? 445  HIS B CB  1 
ATOM   7706  C CG  . HIS B  1 445 ? 37.371  -7.420  75.558  1.00 58.50  ? 445  HIS B CG  1 
ATOM   7707  N ND1 . HIS B  1 445 ? 38.587  -8.018  75.844  1.00 60.29  ? 445  HIS B ND1 1 
ATOM   7708  C CD2 . HIS B  1 445 ? 36.680  -7.256  76.714  1.00 61.37  ? 445  HIS B CD2 1 
ATOM   7709  C CE1 . HIS B  1 445 ? 38.595  -8.202  77.156  1.00 60.91  ? 445  HIS B CE1 1 
ATOM   7710  N NE2 . HIS B  1 445 ? 37.462  -7.769  77.723  1.00 61.69  ? 445  HIS B NE2 1 
ATOM   7711  N N   . THR B  1 446 ? 37.022  -10.465 73.855  1.00 51.80  ? 446  THR B N   1 
ATOM   7712  C CA  . THR B  1 446 ? 37.857  -11.673 73.828  1.00 50.08  ? 446  THR B CA  1 
ATOM   7713  C C   . THR B  1 446 ? 37.481  -12.577 72.661  1.00 51.33  ? 446  THR B C   1 
ATOM   7714  O O   . THR B  1 446 ? 38.284  -13.409 72.198  1.00 52.15  ? 446  THR B O   1 
ATOM   7715  C CB  . THR B  1 446 ? 37.682  -12.447 75.125  1.00 45.08  ? 446  THR B CB  1 
ATOM   7716  O OG1 . THR B  1 446 ? 36.419  -13.124 75.117  1.00 49.96  ? 446  THR B OG1 1 
ATOM   7717  C CG2 . THR B  1 446 ? 37.809  -11.569 76.339  1.00 33.55  ? 446  THR B CG2 1 
ATOM   7718  N N   . ILE B  1 447 ? 36.238  -12.417 72.239  1.00 43.71  ? 447  ILE B N   1 
ATOM   7719  C CA  . ILE B  1 447 ? 35.578  -13.194 71.227  1.00 42.14  ? 447  ILE B CA  1 
ATOM   7720  C C   . ILE B  1 447 ? 36.134  -12.992 69.838  1.00 51.87  ? 447  ILE B C   1 
ATOM   7721  O O   . ILE B  1 447 ? 36.161  -11.853 69.352  1.00 54.01  ? 447  ILE B O   1 
ATOM   7722  C CB  . ILE B  1 447 ? 34.054  -12.965 71.330  1.00 42.34  ? 447  ILE B CB  1 
ATOM   7723  C CG1 . ILE B  1 447 ? 33.537  -13.664 72.585  1.00 43.66  ? 447  ILE B CG1 1 
ATOM   7724  C CG2 . ILE B  1 447 ? 33.334  -13.461 70.104  1.00 38.00  ? 447  ILE B CG2 1 
ATOM   7725  C CD1 . ILE B  1 447 ? 32.440  -12.954 73.289  1.00 61.39  ? 447  ILE B CD1 1 
ATOM   7726  N N   . ASN B  1 448 ? 36.563  -14.109 69.196  1.00 49.11  ? 448  ASN B N   1 
ATOM   7727  C CA  . ASN B  1 448 ? 36.995  -14.100 67.800  1.00 48.74  ? 448  ASN B CA  1 
ATOM   7728  C C   . ASN B  1 448 ? 35.725  -14.359 66.924  1.00 52.02  ? 448  ASN B C   1 
ATOM   7729  O O   . ASN B  1 448 ? 35.444  -15.494 66.523  1.00 50.62  ? 448  ASN B O   1 
ATOM   7730  C CB  . ASN B  1 448 ? 38.168  -15.062 67.537  1.00 47.26  ? 448  ASN B CB  1 
ATOM   7731  C CG  . ASN B  1 448 ? 38.594  -15.185 66.085  1.00 80.35  ? 448  ASN B CG  1 
ATOM   7732  O OD1 . ASN B  1 448 ? 38.163  -14.415 65.205  1.00 70.66  ? 448  ASN B OD1 1 
ATOM   7733  N ND2 . ASN B  1 448 ? 39.464  -16.178 65.810  1.00 86.90  ? 448  ASN B ND2 1 
ATOM   7734  N N   . TRP B  1 449 ? 34.947  -13.272 66.688  1.00 47.99  ? 449  TRP B N   1 
ATOM   7735  C CA  . TRP B  1 449 ? 33.688  -13.235 65.937  1.00 47.15  ? 449  TRP B CA  1 
ATOM   7736  C C   . TRP B  1 449 ? 33.784  -13.851 64.545  1.00 53.49  ? 449  TRP B C   1 
ATOM   7737  O O   . TRP B  1 449 ? 32.856  -14.504 64.082  1.00 52.94  ? 449  TRP B O   1 
ATOM   7738  C CB  . TRP B  1 449 ? 33.172  -11.801 65.840  1.00 45.81  ? 449  TRP B CB  1 
ATOM   7739  C CG  . TRP B  1 449 ? 32.893  -11.176 67.175  1.00 47.66  ? 449  TRP B CG  1 
ATOM   7740  C CD1 . TRP B  1 449 ? 33.713  -10.342 67.888  1.00 51.27  ? 449  TRP B CD1 1 
ATOM   7741  C CD2 . TRP B  1 449 ? 31.706  -11.351 67.969  1.00 47.29  ? 449  TRP B CD2 1 
ATOM   7742  N NE1 . TRP B  1 449 ? 33.110  -9.992  69.082  1.00 50.87  ? 449  TRP B NE1 1 
ATOM   7743  C CE2 . TRP B  1 449 ? 31.877  -10.594 69.154  1.00 51.16  ? 449  TRP B CE2 1 
ATOM   7744  C CE3 . TRP B  1 449 ? 30.532  -12.106 67.809  1.00 47.81  ? 449  TRP B CE3 1 
ATOM   7745  C CZ2 . TRP B  1 449 ? 30.913  -10.554 70.155  1.00 50.15  ? 449  TRP B CZ2 1 
ATOM   7746  C CZ3 . TRP B  1 449 ? 29.574  -12.071 68.808  1.00 49.58  ? 449  TRP B CZ3 1 
ATOM   7747  C CH2 . TRP B  1 449 ? 29.772  -11.309 69.968  1.00 50.87  ? 449  TRP B CH2 1 
ATOM   7748  N N   . THR B  1 450 ? 34.932  -13.685 63.905  1.00 53.40  ? 450  THR B N   1 
ATOM   7749  C CA  . THR B  1 450 ? 35.260  -14.222 62.584  1.00 53.49  ? 450  THR B CA  1 
ATOM   7750  C C   . THR B  1 450 ? 34.936  -15.719 62.458  1.00 56.32  ? 450  THR B C   1 
ATOM   7751  O O   . THR B  1 450 ? 34.440  -16.148 61.414  1.00 55.37  ? 450  THR B O   1 
ATOM   7752  C CB  . THR B  1 450 ? 36.704  -13.822 62.237  1.00 60.05  ? 450  THR B CB  1 
ATOM   7753  O OG1 . THR B  1 450 ? 36.643  -12.646 61.438  1.00 63.67  ? 450  THR B OG1 1 
ATOM   7754  C CG2 . THR B  1 450 ? 37.495  -14.916 61.527  1.00 57.95  ? 450  THR B CG2 1 
ATOM   7755  N N   . THR B  1 451 ? 35.158  -16.489 63.545  1.00 51.51  ? 451  THR B N   1 
ATOM   7756  C CA  . THR B  1 451 ? 34.903  -17.922 63.566  1.00 50.85  ? 451  THR B CA  1 
ATOM   7757  C C   . THR B  1 451 ? 33.433  -18.225 63.381  1.00 58.23  ? 451  THR B C   1 
ATOM   7758  O O   . THR B  1 451 ? 33.106  -19.324 62.932  1.00 59.94  ? 451  THR B O   1 
ATOM   7759  C CB  . THR B  1 451 ? 35.431  -18.568 64.833  1.00 50.61  ? 451  THR B CB  1 
ATOM   7760  O OG1 . THR B  1 451 ? 34.578  -18.227 65.912  1.00 53.23  ? 451  THR B OG1 1 
ATOM   7761  C CG2 . THR B  1 451 ? 36.869  -18.212 65.139  1.00 41.76  ? 451  THR B CG2 1 
ATOM   7762  N N   . LEU B  1 452 ? 32.543  -17.253 63.714  1.00 54.31  ? 452  LEU B N   1 
ATOM   7763  C CA  . LEU B  1 452 ? 31.096  -17.431 63.618  1.00 52.88  ? 452  LEU B CA  1 
ATOM   7764  C C   . LEU B  1 452 ? 30.560  -17.084 62.234  1.00 57.45  ? 452  LEU B C   1 
ATOM   7765  O O   . LEU B  1 452 ? 29.494  -17.586 61.836  1.00 58.88  ? 452  LEU B O   1 
ATOM   7766  C CB  . LEU B  1 452 ? 30.369  -16.620 64.706  1.00 52.60  ? 452  LEU B CB  1 
ATOM   7767  C CG  . LEU B  1 452 ? 30.848  -16.761 66.156  1.00 56.62  ? 452  LEU B CG  1 
ATOM   7768  C CD1 . LEU B  1 452 ? 30.241  -15.702 67.002  1.00 56.82  ? 452  LEU B CD1 1 
ATOM   7769  C CD2 . LEU B  1 452 ? 30.497  -18.131 66.751  1.00 57.11  ? 452  LEU B CD2 1 
ATOM   7770  N N   . PHE B  1 453 ? 31.303  -16.258 61.486  1.00 51.86  ? 453  PHE B N   1 
ATOM   7771  C CA  . PHE B  1 453 ? 30.892  -15.832 60.153  1.00 51.25  ? 453  PHE B CA  1 
ATOM   7772  C C   . PHE B  1 453 ? 31.099  -16.872 59.069  1.00 56.72  ? 453  PHE B C   1 
ATOM   7773  O O   . PHE B  1 453 ? 32.003  -17.685 59.178  1.00 55.22  ? 453  PHE B O   1 
ATOM   7774  C CB  . PHE B  1 453 ? 31.607  -14.547 59.763  1.00 52.97  ? 453  PHE B CB  1 
ATOM   7775  C CG  . PHE B  1 453 ? 31.348  -13.355 60.643  1.00 54.73  ? 453  PHE B CG  1 
ATOM   7776  C CD1 . PHE B  1 453 ? 32.331  -12.401 60.851  1.00 58.87  ? 453  PHE B CD1 1 
ATOM   7777  C CD2 . PHE B  1 453 ? 30.112  -13.173 61.250  1.00 55.62  ? 453  PHE B CD2 1 
ATOM   7778  C CE1 . PHE B  1 453 ? 32.078  -11.288 61.648  1.00 60.64  ? 453  PHE B CE1 1 
ATOM   7779  C CE2 . PHE B  1 453 ? 29.864  -12.068 62.047  1.00 58.13  ? 453  PHE B CE2 1 
ATOM   7780  C CZ  . PHE B  1 453 ? 30.841  -11.128 62.236  1.00 57.78  ? 453  PHE B CZ  1 
ATOM   7781  N N   . SER B  1 454 ? 30.269  -16.815 58.010  1.00 56.34  ? 454  SER B N   1 
ATOM   7782  C CA  . SER B  1 454 ? 30.281  -17.685 56.833  1.00 57.07  ? 454  SER B CA  1 
ATOM   7783  C C   . SER B  1 454 ? 30.933  -16.960 55.638  1.00 67.95  ? 454  SER B C   1 
ATOM   7784  O O   . SER B  1 454 ? 31.883  -17.490 55.052  1.00 70.22  ? 454  SER B O   1 
ATOM   7785  C CB  . SER B  1 454 ? 28.861  -18.126 56.485  1.00 58.52  ? 454  SER B CB  1 
ATOM   7786  O OG  . SER B  1 454 ? 28.253  -18.775 57.591  1.00 70.90  ? 454  SER B OG  1 
ATOM   7787  N N   . THR B  1 455 ? 30.426  -15.753 55.285  1.00 65.71  ? 455  THR B N   1 
ATOM   7788  C CA  . THR B  1 455 ? 30.876  -14.883 54.194  1.00 66.22  ? 455  THR B CA  1 
ATOM   7789  C C   . THR B  1 455 ? 32.079  -14.071 54.701  1.00 71.23  ? 455  THR B C   1 
ATOM   7790  O O   . THR B  1 455 ? 32.200  -13.842 55.897  1.00 70.89  ? 455  THR B O   1 
ATOM   7791  C CB  . THR B  1 455 ? 29.716  -13.916 53.794  1.00 83.69  ? 455  THR B CB  1 
ATOM   7792  O OG1 . THR B  1 455 ? 28.432  -14.574 53.810  1.00 87.19  ? 455  THR B OG1 1 
ATOM   7793  C CG2 . THR B  1 455 ? 29.948  -13.226 52.461  1.00 81.81  ? 455  THR B CG2 1 
ATOM   7794  N N   . ILE B  1 456 ? 32.948  -13.604 53.797  1.00 69.60  ? 456  ILE B N   1 
ATOM   7795  C CA  . ILE B  1 456 ? 34.107  -12.779 54.182  1.00 69.96  ? 456  ILE B CA  1 
ATOM   7796  C C   . ILE B  1 456 ? 33.736  -11.275 54.253  1.00 71.31  ? 456  ILE B C   1 
ATOM   7797  O O   . ILE B  1 456 ? 34.580  -10.420 54.522  1.00 70.72  ? 456  ILE B O   1 
ATOM   7798  C CB  . ILE B  1 456 ? 35.389  -13.097 53.337  1.00 73.79  ? 456  ILE B CB  1 
ATOM   7799  C CG1 . ILE B  1 456 ? 35.326  -12.500 51.914  1.00 75.62  ? 456  ILE B CG1 1 
ATOM   7800  C CG2 . ILE B  1 456 ? 35.669  -14.604 53.289  1.00 72.83  ? 456  ILE B CG2 1 
ATOM   7801  C CD1 . ILE B  1 456 ? 36.210  -11.335 51.678  1.00 82.50  ? 456  ILE B CD1 1 
ATOM   7802  N N   . ASN B  1 457 ? 32.460  -10.984 54.014  1.00 66.66  ? 457  ASN B N   1 
ATOM   7803  C CA  . ASN B  1 457 ? 31.860  -9.655  53.994  1.00 65.65  ? 457  ASN B CA  1 
ATOM   7804  C C   . ASN B  1 457 ? 31.390  -9.212  55.358  1.00 64.21  ? 457  ASN B C   1 
ATOM   7805  O O   . ASN B  1 457 ? 31.087  -8.044  55.550  1.00 64.22  ? 457  ASN B O   1 
ATOM   7806  C CB  . ASN B  1 457 ? 30.639  -9.682  53.043  1.00 72.07  ? 457  ASN B CB  1 
ATOM   7807  C CG  . ASN B  1 457 ? 31.004  -9.890  51.577  1.00 128.58 ? 457  ASN B CG  1 
ATOM   7808  O OD1 . ASN B  1 457 ? 32.143  -9.613  51.112  1.00 126.87 ? 457  ASN B OD1 1 
ATOM   7809  N ND2 . ASN B  1 457 ? 30.021  -10.353 50.808  1.00 125.67 ? 457  ASN B ND2 1 
ATOM   7810  N N   . GLN B  1 458 ? 31.242  -10.134 56.280  1.00 57.49  ? 458  GLN B N   1 
ATOM   7811  C CA  . GLN B  1 458 ? 30.670  -9.881  57.587  1.00 55.59  ? 458  GLN B CA  1 
ATOM   7812  C C   . GLN B  1 458 ? 31.613  -9.154  58.497  1.00 62.00  ? 458  GLN B C   1 
ATOM   7813  O O   . GLN B  1 458 ? 32.740  -9.585  58.757  1.00 62.01  ? 458  GLN B O   1 
ATOM   7814  C CB  . GLN B  1 458 ? 30.113  -11.168 58.196  1.00 55.91  ? 458  GLN B CB  1 
ATOM   7815  C CG  . GLN B  1 458 ? 29.161  -11.933 57.267  1.00 44.51  ? 458  GLN B CG  1 
ATOM   7816  C CD  . GLN B  1 458 ? 28.622  -13.165 57.913  1.00 59.14  ? 458  GLN B CD  1 
ATOM   7817  O OE1 . GLN B  1 458 ? 27.743  -13.111 58.778  1.00 59.74  ? 458  GLN B OE1 1 
ATOM   7818  N NE2 . GLN B  1 458 ? 29.111  -14.304 57.490  1.00 43.10  ? 458  GLN B NE2 1 
ATOM   7819  N N   . ARG B  1 459 ? 31.163  -7.983  58.908  1.00 60.87  ? 459  ARG B N   1 
ATOM   7820  C CA  . ARG B  1 459 ? 31.888  -7.054  59.747  1.00 61.57  ? 459  ARG B CA  1 
ATOM   7821  C C   . ARG B  1 459 ? 31.361  -7.167  61.138  1.00 65.50  ? 459  ARG B C   1 
ATOM   7822  O O   . ARG B  1 459 ? 30.312  -7.748  61.385  1.00 64.85  ? 459  ARG B O   1 
ATOM   7823  C CB  . ARG B  1 459 ? 31.648  -5.601  59.271  1.00 64.33  ? 459  ARG B CB  1 
ATOM   7824  C CG  . ARG B  1 459 ? 32.237  -5.184  57.929  1.00 80.29  ? 459  ARG B CG  1 
ATOM   7825  C CD  . ARG B  1 459 ? 32.198  -3.666  57.768  1.00 103.02 ? 459  ARG B CD  1 
ATOM   7826  N NE  . ARG B  1 459 ? 30.855  -3.084  57.910  1.00 113.16 ? 459  ARG B NE  1 
ATOM   7827  C CZ  . ARG B  1 459 ? 30.587  -1.966  58.585  1.00 124.18 ? 459  ARG B CZ  1 
ATOM   7828  N NH1 . ARG B  1 459 ? 31.559  -1.303  59.204  1.00 114.04 ? 459  ARG B NH1 1 
ATOM   7829  N NH2 . ARG B  1 459 ? 29.346  -1.508  58.655  1.00 104.87 ? 459  ARG B NH2 1 
ATOM   7830  N N   . ILE B  1 460 ? 32.067  -6.519  62.041  1.00 63.24  ? 460  ILE B N   1 
ATOM   7831  C CA  . ILE B  1 460 ? 31.737  -6.408  63.444  1.00 62.50  ? 460  ILE B CA  1 
ATOM   7832  C C   . ILE B  1 460 ? 31.898  -4.923  63.866  1.00 62.74  ? 460  ILE B C   1 
ATOM   7833  O O   . ILE B  1 460 ? 32.919  -4.304  63.583  1.00 62.07  ? 460  ILE B O   1 
ATOM   7834  C CB  . ILE B  1 460 ? 32.578  -7.426  64.262  1.00 66.19  ? 460  ILE B CB  1 
ATOM   7835  C CG1 . ILE B  1 460 ? 32.452  -7.186  65.758  1.00 68.96  ? 460  ILE B CG1 1 
ATOM   7836  C CG2 . ILE B  1 460 ? 34.036  -7.441  63.842  1.00 66.81  ? 460  ILE B CG2 1 
ATOM   7837  C CD1 . ILE B  1 460 ? 31.383  -7.976  66.391  1.00 86.02  ? 460  ILE B CD1 1 
ATOM   7838  N N   . VAL B  1 461 ? 30.856  -4.350  64.476  1.00 57.56  ? 461  VAL B N   1 
ATOM   7839  C CA  . VAL B  1 461 ? 30.841  -2.971  64.967  1.00 57.15  ? 461  VAL B CA  1 
ATOM   7840  C C   . VAL B  1 461 ? 30.735  -3.025  66.510  1.00 63.27  ? 461  VAL B C   1 
ATOM   7841  O O   . VAL B  1 461 ? 29.633  -3.196  67.055  1.00 62.50  ? 461  VAL B O   1 
ATOM   7842  C CB  . VAL B  1 461 ? 29.691  -2.150  64.338  1.00 59.63  ? 461  VAL B CB  1 
ATOM   7843  C CG1 . VAL B  1 461 ? 29.699  -0.702  64.840  1.00 59.93  ? 461  VAL B CG1 1 
ATOM   7844  C CG2 . VAL B  1 461 ? 29.716  -2.210  62.816  1.00 58.40  ? 461  VAL B CG2 1 
ATOM   7845  N N   . ILE B  1 462 ? 31.888  -2.967  67.200  1.00 61.59  ? 462  ILE B N   1 
ATOM   7846  C CA  . ILE B  1 462 ? 31.931  -2.989  68.672  1.00 62.38  ? 462  ILE B CA  1 
ATOM   7847  C C   . ILE B  1 462 ? 32.418  -1.652  69.167  1.00 68.94  ? 462  ILE B C   1 
ATOM   7848  O O   . ILE B  1 462 ? 33.549  -1.256  68.878  1.00 73.15  ? 462  ILE B O   1 
ATOM   7849  C CB  . ILE B  1 462 ? 32.549  -4.253  69.383  1.00 64.92  ? 462  ILE B CB  1 
ATOM   7850  C CG1 . ILE B  1 462 ? 34.015  -4.436  69.063  1.00 67.74  ? 462  ILE B CG1 1 
ATOM   7851  C CG2 . ILE B  1 462 ? 31.802  -5.493  69.000  1.00 62.25  ? 462  ILE B CG2 1 
ATOM   7852  C CD1 . ILE B  1 462 ? 34.871  -5.380  70.002  1.00 87.53  ? 462  ILE B CD1 1 
ATOM   7853  N N   . ARG B  1 463 ? 31.546  -0.911  69.845  1.00 62.49  ? 463  ARG B N   1 
ATOM   7854  C CA  . ARG B  1 463 ? 31.866  0.439   70.307  1.00 61.20  ? 463  ARG B CA  1 
ATOM   7855  C C   . ARG B  1 463 ? 31.218  0.735   71.658  1.00 63.30  ? 463  ARG B C   1 
ATOM   7856  O O   . ARG B  1 463 ? 30.097  0.308   71.908  1.00 64.90  ? 463  ARG B O   1 
ATOM   7857  C CB  . ARG B  1 463 ? 31.375  1.437   69.225  1.00 57.67  ? 463  ARG B CB  1 
ATOM   7858  C CG  . ARG B  1 463 ? 31.445  2.902   69.577  1.00 64.86  ? 463  ARG B CG  1 
ATOM   7859  C CD  . ARG B  1 463 ? 30.789  3.782   68.548  1.00 73.40  ? 463  ARG B CD  1 
ATOM   7860  N NE  . ARG B  1 463 ? 29.334  3.778   68.663  1.00 80.35  ? 463  ARG B NE  1 
ATOM   7861  C CZ  . ARG B  1 463 ? 28.517  3.377   67.695  1.00 94.34  ? 463  ARG B CZ  1 
ATOM   7862  N NH1 . ARG B  1 463 ? 29.009  2.944   66.537  1.00 71.32  ? 463  ARG B NH1 1 
ATOM   7863  N NH2 . ARG B  1 463 ? 27.201  3.418   67.869  1.00 89.23  ? 463  ARG B NH2 1 
ATOM   7864  N N   . ASP B  1 464 ? 31.912  1.487   72.502  1.00 57.30  ? 464  ASP B N   1 
ATOM   7865  C CA  . ASP B  1 464 ? 31.424  2.014   73.774  1.00 57.42  ? 464  ASP B CA  1 
ATOM   7866  C C   . ASP B  1 464 ? 30.847  1.043   74.795  1.00 61.10  ? 464  ASP B C   1 
ATOM   7867  O O   . ASP B  1 464 ? 29.918  1.386   75.524  1.00 61.36  ? 464  ASP B O   1 
ATOM   7868  C CB  . ASP B  1 464 ? 30.515  3.240   73.566  1.00 59.67  ? 464  ASP B CB  1 
ATOM   7869  C CG  . ASP B  1 464 ? 31.096  4.420   72.783  1.00 75.14  ? 464  ASP B CG  1 
ATOM   7870  O OD1 . ASP B  1 464 ? 32.272  4.803   73.050  1.00 75.28  ? 464  ASP B OD1 1 
ATOM   7871  O OD2 . ASP B  1 464 ? 30.352  5.002   71.943  1.00 84.56  ? 464  ASP B OD2 1 
ATOM   7872  N N   . ASN B  1 465 ? 31.413  -0.160  74.878  1.00 57.21  ? 465  ASN B N   1 
ATOM   7873  C CA  . ASN B  1 465 ? 31.038  -1.128  75.914  1.00 56.68  ? 465  ASN B CA  1 
ATOM   7874  C C   . ASN B  1 465 ? 32.131  -0.972  76.982  1.00 63.27  ? 465  ASN B C   1 
ATOM   7875  O O   . ASN B  1 465 ? 32.854  0.028   76.930  1.00 66.04  ? 465  ASN B O   1 
ATOM   7876  C CB  . ASN B  1 465 ? 30.931  -2.549  75.345  1.00 50.17  ? 465  ASN B CB  1 
ATOM   7877  C CG  . ASN B  1 465 ? 29.968  -2.616  74.178  1.00 59.37  ? 465  ASN B CG  1 
ATOM   7878  O OD1 . ASN B  1 465 ? 28.766  -2.434  74.323  1.00 59.72  ? 465  ASN B OD1 1 
ATOM   7879  N ND2 . ASN B  1 465 ? 30.478  -2.740  72.977  1.00 42.82  ? 465  ASN B ND2 1 
ATOM   7880  N N   . ARG B  1 466 ? 32.273  -1.873  77.945  1.00 57.82  ? 466  ARG B N   1 
ATOM   7881  C CA  . ARG B  1 466 ? 33.322  -1.606  78.922  1.00 58.53  ? 466  ARG B CA  1 
ATOM   7882  C C   . ARG B  1 466 ? 34.707  -1.866  78.362  1.00 62.64  ? 466  ARG B C   1 
ATOM   7883  O O   . ARG B  1 466 ? 34.949  -2.955  77.840  1.00 61.51  ? 466  ARG B O   1 
ATOM   7884  C CB  . ARG B  1 466 ? 33.102  -2.348  80.240  1.00 61.67  ? 466  ARG B CB  1 
ATOM   7885  C CG  . ARG B  1 466 ? 34.064  -1.893  81.332  1.00 77.39  ? 466  ARG B CG  1 
ATOM   7886  C CD  . ARG B  1 466 ? 33.767  -2.553  82.634  1.00 91.61  ? 466  ARG B CD  1 
ATOM   7887  N NE  . ARG B  1 466 ? 32.579  -1.958  83.231  1.00 98.75  ? 466  ARG B NE  1 
ATOM   7888  C CZ  . ARG B  1 466 ? 32.583  -1.254  84.348  1.00 119.70 ? 466  ARG B CZ  1 
ATOM   7889  N NH1 . ARG B  1 466 ? 33.713  -1.055  85.009  1.00 118.82 ? 466  ARG B NH1 1 
ATOM   7890  N NH2 . ARG B  1 466 ? 31.452  -0.765  84.832  1.00 107.18 ? 466  ARG B NH2 1 
ATOM   7891  N N   . LYS B  1 467 ? 35.623  -0.856  78.489  1.00 60.76  ? 467  LYS B N   1 
ATOM   7892  C CA  . LYS B  1 467 ? 37.014  -0.906  77.998  1.00 59.55  ? 467  LYS B CA  1 
ATOM   7893  C C   . LYS B  1 467 ? 37.676  -2.200  78.398  1.00 64.60  ? 467  LYS B C   1 
ATOM   7894  O O   . LYS B  1 467 ? 37.626  -2.576  79.566  1.00 65.44  ? 467  LYS B O   1 
ATOM   7895  C CB  . LYS B  1 467 ? 37.843  0.307   78.463  1.00 61.13  ? 467  LYS B CB  1 
ATOM   7896  C CG  . LYS B  1 467 ? 38.826  0.787   77.408  1.00 71.06  ? 467  LYS B CG  1 
ATOM   7897  C CD  . LYS B  1 467 ? 39.892  1.773   77.921  1.00 87.02  ? 467  LYS B CD  1 
ATOM   7898  C CE  . LYS B  1 467 ? 40.929  2.057   76.836  1.00 101.65 ? 467  LYS B CE  1 
ATOM   7899  N NZ  . LYS B  1 467 ? 42.062  2.922   77.271  1.00 108.02 ? 467  LYS B NZ  1 
ATOM   7900  N N   . ALA B  1 468 ? 38.231  -2.916  77.413  1.00 61.66  ? 468  ALA B N   1 
ATOM   7901  C CA  . ALA B  1 468 ? 38.919  -4.207  77.596  1.00 62.33  ? 468  ALA B CA  1 
ATOM   7902  C C   . ALA B  1 468 ? 39.948  -4.200  78.734  1.00 70.46  ? 468  ALA B C   1 
ATOM   7903  O O   . ALA B  1 468 ? 40.088  -5.200  79.434  1.00 71.48  ? 468  ALA B O   1 
ATOM   7904  C CB  . ALA B  1 468 ? 39.588  -4.629  76.299  1.00 62.18  ? 468  ALA B CB  1 
ATOM   7905  N N   . GLU B  1 469 ? 40.633  -3.061  78.927  1.00 68.85  ? 469  GLU B N   1 
ATOM   7906  C CA  . GLU B  1 469 ? 41.646  -2.827  79.952  1.00 70.21  ? 469  GLU B CA  1 
ATOM   7907  C C   . GLU B  1 469 ? 40.981  -2.866  81.329  1.00 74.87  ? 469  GLU B C   1 
ATOM   7908  O O   . GLU B  1 469 ? 41.515  -3.514  82.233  1.00 76.07  ? 469  GLU B O   1 
ATOM   7909  C CB  . GLU B  1 469 ? 42.359  -1.477  79.703  1.00 72.74  ? 469  GLU B CB  1 
ATOM   7910  C CG  . GLU B  1 469 ? 43.257  -1.413  78.463  1.00 89.45  ? 469  GLU B CG  1 
ATOM   7911  C CD  . GLU B  1 469 ? 42.672  -1.753  77.093  1.00 118.55 ? 469  GLU B CD  1 
ATOM   7912  O OE1 . GLU B  1 469 ? 41.605  -1.198  76.730  1.00 97.54  ? 469  GLU B OE1 1 
ATOM   7913  O OE2 . GLU B  1 469 ? 43.280  -2.594  76.386  1.00 116.45 ? 469  GLU B OE2 1 
ATOM   7914  N N   . ASN B  1 470 ? 39.780  -2.242  81.453  1.00 69.67  ? 470  ASN B N   1 
ATOM   7915  C CA  . ASN B  1 470 ? 38.971  -2.199  82.677  1.00 70.23  ? 470  ASN B CA  1 
ATOM   7916  C C   . ASN B  1 470 ? 38.481  -3.619  83.056  1.00 75.79  ? 470  ASN B C   1 
ATOM   7917  O O   . ASN B  1 470 ? 38.580  -4.027  84.216  1.00 76.71  ? 470  ASN B O   1 
ATOM   7918  C CB  . ASN B  1 470 ? 37.772  -1.239  82.481  1.00 69.71  ? 470  ASN B CB  1 
ATOM   7919  C CG  . ASN B  1 470 ? 37.008  -0.860  83.735  1.00 101.84 ? 470  ASN B CG  1 
ATOM   7920  O OD1 . ASN B  1 470 ? 36.347  -1.690  84.374  1.00 100.83 ? 470  ASN B OD1 1 
ATOM   7921  N ND2 . ASN B  1 470 ? 37.060  0.423   84.104  1.00 99.21  ? 470  ASN B ND2 1 
ATOM   7922  N N   . CYS B  1 471 ? 37.941  -4.356  82.069  1.00 71.90  ? 471  CYS B N   1 
ATOM   7923  C CA  . CYS B  1 471 ? 37.421  -5.701  82.233  1.00 70.98  ? 471  CYS B CA  1 
ATOM   7924  C C   . CYS B  1 471 ? 38.514  -6.535  82.771  1.00 73.03  ? 471  CYS B C   1 
ATOM   7925  O O   . CYS B  1 471 ? 38.348  -7.056  83.859  1.00 73.83  ? 471  CYS B O   1 
ATOM   7926  C CB  . CYS B  1 471 ? 36.905  -6.253  80.907  1.00 71.12  ? 471  CYS B CB  1 
ATOM   7927  S SG  . CYS B  1 471 ? 35.349  -5.515  80.349  1.00 75.22  ? 471  CYS B SG  1 
ATOM   7928  N N   . THR B  1 472 ? 39.671  -6.586  82.065  1.00 69.37  ? 472  THR B N   1 
ATOM   7929  C CA  . THR B  1 472 ? 40.853  -7.364  82.464  1.00 69.97  ? 472  THR B CA  1 
ATOM   7930  C C   . THR B  1 472 ? 41.258  -7.013  83.903  1.00 72.89  ? 472  THR B C   1 
ATOM   7931  O O   . THR B  1 472 ? 41.423  -7.920  84.728  1.00 70.09  ? 472  THR B O   1 
ATOM   7932  C CB  . THR B  1 472 ? 42.020  -7.196  81.476  1.00 83.35  ? 472  THR B CB  1 
ATOM   7933  O OG1 . THR B  1 472 ? 41.555  -7.383  80.147  1.00 87.37  ? 472  THR B OG1 1 
ATOM   7934  C CG2 . THR B  1 472 ? 43.137  -8.186  81.732  1.00 82.43  ? 472  THR B CG2 1 
ATOM   7935  N N   . ALA B  1 473 ? 41.321  -5.681  84.196  1.00 71.10  ? 473  ALA B N   1 
ATOM   7936  C CA  . ALA B  1 473 ? 41.667  -5.071  85.486  1.00 72.53  ? 473  ALA B CA  1 
ATOM   7937  C C   . ALA B  1 473 ? 40.730  -5.485  86.597  1.00 78.15  ? 473  ALA B C   1 
ATOM   7938  O O   . ALA B  1 473 ? 41.176  -5.662  87.728  1.00 80.34  ? 473  ALA B O   1 
ATOM   7939  C CB  . ALA B  1 473 ? 41.673  -3.563  85.366  1.00 73.83  ? 473  ALA B CB  1 
ATOM   7940  N N   . GLU B  1 474 ? 39.443  -5.638  86.283  1.00 74.25  ? 474  GLU B N   1 
ATOM   7941  C CA  . GLU B  1 474 ? 38.422  -6.070  87.228  1.00 74.62  ? 474  GLU B CA  1 
ATOM   7942  C C   . GLU B  1 474 ? 38.267  -7.613  87.257  1.00 76.72  ? 474  GLU B C   1 
ATOM   7943  O O   . GLU B  1 474 ? 37.359  -8.143  87.897  1.00 76.59  ? 474  GLU B O   1 
ATOM   7944  C CB  . GLU B  1 474 ? 37.105  -5.352  86.951  1.00 75.77  ? 474  GLU B CB  1 
ATOM   7945  C CG  . GLU B  1 474 ? 37.025  -4.000  87.630  1.00 90.94  ? 474  GLU B CG  1 
ATOM   7946  C CD  . GLU B  1 474 ? 35.633  -3.392  87.703  1.00 134.91 ? 474  GLU B CD  1 
ATOM   7947  O OE1 . GLU B  1 474 ? 34.635  -4.144  87.826  1.00 146.49 ? 474  GLU B OE1 1 
ATOM   7948  O OE2 . GLU B  1 474 ? 35.547  -2.143  87.663  1.00 133.93 ? 474  GLU B OE2 1 
ATOM   7949  N N   . GLY B  1 475 ? 39.187  -8.302  86.590  1.00 71.32  ? 475  GLY B N   1 
ATOM   7950  C CA  . GLY B  1 475 ? 39.248  -9.754  86.573  1.00 70.71  ? 475  GLY B CA  1 
ATOM   7951  C C   . GLY B  1 475 ? 38.260  -10.489 85.699  1.00 74.10  ? 475  GLY B C   1 
ATOM   7952  O O   . GLY B  1 475 ? 38.189  -11.724 85.779  1.00 73.70  ? 475  GLY B O   1 
ATOM   7953  N N   . MET B  1 476 ? 37.510  -9.765  84.842  1.00 70.18  ? 476  MET B N   1 
ATOM   7954  C CA  . MET B  1 476 ? 36.538  -10.390 83.934  1.00 69.41  ? 476  MET B CA  1 
ATOM   7955  C C   . MET B  1 476 ? 37.309  -10.934 82.739  1.00 74.18  ? 476  MET B C   1 
ATOM   7956  O O   . MET B  1 476 ? 37.317  -10.323 81.653  1.00 74.13  ? 476  MET B O   1 
ATOM   7957  C CB  . MET B  1 476 ? 35.447  -9.413  83.477  1.00 71.91  ? 476  MET B CB  1 
ATOM   7958  C CG  . MET B  1 476 ? 35.148  -8.318  84.458  1.00 77.41  ? 476  MET B CG  1 
ATOM   7959  S SD  . MET B  1 476 ? 34.074  -8.885  85.757  1.00 82.24  ? 476  MET B SD  1 
ATOM   7960  C CE  . MET B  1 476 ? 33.965  -7.398  86.718  1.00 80.64  ? 476  MET B CE  1 
ATOM   7961  N N   . VAL B  1 477 ? 38.017  -12.062 82.969  1.00 70.26  ? 477  VAL B N   1 
ATOM   7962  C CA  . VAL B  1 477 ? 38.834  -12.711 81.956  1.00 68.33  ? 477  VAL B CA  1 
ATOM   7963  C C   . VAL B  1 477 ? 38.311  -14.095 81.654  1.00 70.98  ? 477  VAL B C   1 
ATOM   7964  O O   . VAL B  1 477 ? 37.535  -14.658 82.440  1.00 68.88  ? 477  VAL B O   1 
ATOM   7965  C CB  . VAL B  1 477 ? 40.365  -12.709 82.249  1.00 71.98  ? 477  VAL B CB  1 
ATOM   7966  C CG1 . VAL B  1 477 ? 40.870  -11.330 82.624  1.00 73.21  ? 477  VAL B CG1 1 
ATOM   7967  C CG2 . VAL B  1 477 ? 40.744  -13.727 83.303  1.00 72.19  ? 477  VAL B CG2 1 
ATOM   7968  N N   . CYS B  1 478 ? 38.773  -14.643 80.512  1.00 68.19  ? 478  CYS B N   1 
ATOM   7969  C CA  . CYS B  1 478 ? 38.434  -15.974 80.081  1.00 68.07  ? 478  CYS B CA  1 
ATOM   7970  C C   . CYS B  1 478 ? 39.166  -16.983 80.912  1.00 73.53  ? 478  CYS B C   1 
ATOM   7971  O O   . CYS B  1 478 ? 40.307  -16.739 81.340  1.00 72.87  ? 478  CYS B O   1 
ATOM   7972  C CB  . CYS B  1 478 ? 38.732  -16.150 78.599  1.00 67.94  ? 478  CYS B CB  1 
ATOM   7973  S SG  . CYS B  1 478 ? 37.546  -15.315 77.522  1.00 71.20  ? 478  CYS B SG  1 
ATOM   7974  N N   . ASN B  1 479 ? 38.492  -18.124 81.138  1.00 71.43  ? 479  ASN B N   1 
ATOM   7975  C CA  . ASN B  1 479 ? 38.992  -19.281 81.875  1.00 72.12  ? 479  ASN B CA  1 
ATOM   7976  C C   . ASN B  1 479 ? 40.233  -19.789 81.154  1.00 77.92  ? 479  ASN B C   1 
ATOM   7977  O O   . ASN B  1 479 ? 40.297  -19.689 79.914  1.00 77.52  ? 479  ASN B O   1 
ATOM   7978  C CB  . ASN B  1 479 ? 37.920  -20.352 81.879  1.00 69.90  ? 479  ASN B CB  1 
ATOM   7979  C CG  . ASN B  1 479 ? 38.188  -21.491 82.805  1.00 82.59  ? 479  ASN B CG  1 
ATOM   7980  O OD1 . ASN B  1 479 ? 38.825  -22.490 82.406  1.00 66.97  ? 479  ASN B OD1 1 
ATOM   7981  N ND2 . ASN B  1 479 ? 37.689  -21.356 84.051  1.00 74.42  ? 479  ASN B ND2 1 
ATOM   7982  N N   . HIS B  1 480 ? 41.235  -20.298 81.919  1.00 75.26  ? 480  HIS B N   1 
ATOM   7983  C CA  . HIS B  1 480 ? 42.484  -20.796 81.320  1.00 74.71  ? 480  HIS B CA  1 
ATOM   7984  C C   . HIS B  1 480 ? 42.289  -21.932 80.273  1.00 75.93  ? 480  HIS B C   1 
ATOM   7985  O O   . HIS B  1 480 ? 43.114  -22.063 79.365  1.00 74.59  ? 480  HIS B O   1 
ATOM   7986  C CB  . HIS B  1 480 ? 43.504  -21.183 82.391  1.00 76.26  ? 480  HIS B CB  1 
ATOM   7987  C CG  . HIS B  1 480 ? 43.190  -22.465 83.075  1.00 79.89  ? 480  HIS B CG  1 
ATOM   7988  N ND1 . HIS B  1 480 ? 42.218  -22.538 84.056  1.00 82.18  ? 480  HIS B ND1 1 
ATOM   7989  C CD2 . HIS B  1 480 ? 43.730  -23.691 82.894  1.00 81.74  ? 480  HIS B CD2 1 
ATOM   7990  C CE1 . HIS B  1 480 ? 42.196  -23.804 84.441  1.00 81.99  ? 480  HIS B CE1 1 
ATOM   7991  N NE2 . HIS B  1 480 ? 43.096  -24.535 83.775  1.00 82.11  ? 480  HIS B NE2 1 
ATOM   7992  N N   . LEU B  1 481 ? 41.192  -22.715 80.389  1.00 69.81  ? 481  LEU B N   1 
ATOM   7993  C CA  . LEU B  1 481 ? 40.916  -23.809 79.475  1.00 68.12  ? 481  LEU B CA  1 
ATOM   7994  C C   . LEU B  1 481 ? 40.270  -23.397 78.150  1.00 69.98  ? 481  LEU B C   1 
ATOM   7995  O O   . LEU B  1 481 ? 40.098  -24.254 77.266  1.00 67.69  ? 481  LEU B O   1 
ATOM   7996  C CB  . LEU B  1 481 ? 40.115  -24.903 80.176  1.00 68.27  ? 481  LEU B CB  1 
ATOM   7997  C CG  . LEU B  1 481 ? 40.876  -25.711 81.229  1.00 73.91  ? 481  LEU B CG  1 
ATOM   7998  C CD1 . LEU B  1 481 ? 39.921  -26.424 82.160  1.00 74.33  ? 481  LEU B CD1 1 
ATOM   7999  C CD2 . LEU B  1 481 ? 41.854  -26.706 80.575  1.00 76.18  ? 481  LEU B CD2 1 
ATOM   8000  N N   . CYS B  1 482 ? 39.919  -22.099 77.999  1.00 66.36  ? 482  CYS B N   1 
ATOM   8001  C CA  . CYS B  1 482 ? 39.341  -21.559 76.762  1.00 65.77  ? 482  CYS B CA  1 
ATOM   8002  C C   . CYS B  1 482 ? 40.427  -21.440 75.724  1.00 67.12  ? 482  CYS B C   1 
ATOM   8003  O O   . CYS B  1 482 ? 41.569  -21.256 76.090  1.00 69.25  ? 482  CYS B O   1 
ATOM   8004  C CB  . CYS B  1 482 ? 38.689  -20.200 77.014  1.00 67.21  ? 482  CYS B CB  1 
ATOM   8005  S SG  . CYS B  1 482 ? 37.094  -20.264 77.892  1.00 71.73  ? 482  CYS B SG  1 
ATOM   8006  N N   . SER B  1 483 ? 40.096  -21.463 74.444  1.00 61.18  ? 483  SER B N   1 
ATOM   8007  C CA  . SER B  1 483 ? 41.118  -21.249 73.421  1.00 61.27  ? 483  SER B CA  1 
ATOM   8008  C C   . SER B  1 483 ? 41.344  -19.742 73.252  1.00 66.96  ? 483  SER B C   1 
ATOM   8009  O O   . SER B  1 483 ? 40.650  -18.953 73.886  1.00 68.04  ? 483  SER B O   1 
ATOM   8010  C CB  . SER B  1 483 ? 40.691  -21.882 72.101  1.00 64.24  ? 483  SER B CB  1 
ATOM   8011  O OG  . SER B  1 483 ? 39.568  -21.208 71.568  1.00 75.18  ? 483  SER B OG  1 
ATOM   8012  N N   . SER B  1 484 ? 42.269  -19.323 72.390  1.00 63.56  ? 484  SER B N   1 
ATOM   8013  C CA  . SER B  1 484 ? 42.460  -17.890 72.142  1.00 62.99  ? 484  SER B CA  1 
ATOM   8014  C C   . SER B  1 484 ? 41.219  -17.243 71.457  1.00 67.02  ? 484  SER B C   1 
ATOM   8015  O O   . SER B  1 484 ? 41.155  -16.027 71.300  1.00 68.93  ? 484  SER B O   1 
ATOM   8016  C CB  . SER B  1 484 ? 43.722  -17.663 71.316  1.00 67.22  ? 484  SER B CB  1 
ATOM   8017  O OG  . SER B  1 484 ? 43.696  -18.378 70.092  1.00 77.22  ? 484  SER B OG  1 
ATOM   8018  N N   . ASP B  1 485 ? 40.211  -18.051 71.103  1.00 62.09  ? 485  ASP B N   1 
ATOM   8019  C CA  . ASP B  1 485 ? 38.979  -17.590 70.458  1.00 59.97  ? 485  ASP B CA  1 
ATOM   8020  C C   . ASP B  1 485 ? 38.014  -16.875 71.395  1.00 60.00  ? 485  ASP B C   1 
ATOM   8021  O O   . ASP B  1 485 ? 37.074  -16.213 70.928  1.00 59.01  ? 485  ASP B O   1 
ATOM   8022  C CB  . ASP B  1 485 ? 38.290  -18.719 69.682  1.00 60.95  ? 485  ASP B CB  1 
ATOM   8023  C CG  . ASP B  1 485 ? 38.847  -18.938 68.298  1.00 75.90  ? 485  ASP B CG  1 
ATOM   8024  O OD1 . ASP B  1 485 ? 39.674  -18.104 67.842  1.00 77.98  ? 485  ASP B OD1 1 
ATOM   8025  O OD2 . ASP B  1 485 ? 38.487  -19.953 67.676  1.00 86.10  ? 485  ASP B OD2 1 
ATOM   8026  N N   . GLY B  1 486 ? 38.229  -17.059 72.691  1.00 54.02  ? 486  GLY B N   1 
ATOM   8027  C CA  . GLY B  1 486 ? 37.486  -16.341 73.709  1.00 54.33  ? 486  GLY B CA  1 
ATOM   8028  C C   . GLY B  1 486 ? 36.379  -17.064 74.408  1.00 59.96  ? 486  GLY B C   1 
ATOM   8029  O O   . GLY B  1 486 ? 36.242  -18.287 74.297  1.00 58.59  ? 486  GLY B O   1 
ATOM   8030  N N   . CYS B  1 487 ? 35.589  -16.271 75.150  1.00 59.47  ? 487  CYS B N   1 
ATOM   8031  C CA  . CYS B  1 487 ? 34.487  -16.755 75.969  1.00 60.75  ? 487  CYS B CA  1 
ATOM   8032  C C   . CYS B  1 487 ? 33.325  -15.755 76.044  1.00 60.99  ? 487  CYS B C   1 
ATOM   8033  O O   . CYS B  1 487 ? 33.532  -14.552 75.871  1.00 59.39  ? 487  CYS B O   1 
ATOM   8034  C CB  . CYS B  1 487 ? 34.995  -17.147 77.353  1.00 63.71  ? 487  CYS B CB  1 
ATOM   8035  S SG  . CYS B  1 487 ? 35.689  -15.772 78.299  1.00 70.30  ? 487  CYS B SG  1 
ATOM   8036  N N   . TRP B  1 488 ? 32.102  -16.284 76.270  1.00 55.35  ? 488  TRP B N   1 
ATOM   8037  C CA  . TRP B  1 488 ? 30.830  -15.567 76.327  1.00 54.39  ? 488  TRP B CA  1 
ATOM   8038  C C   . TRP B  1 488 ? 30.530  -15.042 77.705  1.00 60.94  ? 488  TRP B C   1 
ATOM   8039  O O   . TRP B  1 488 ? 29.545  -14.325 77.926  1.00 62.87  ? 488  TRP B O   1 
ATOM   8040  C CB  . TRP B  1 488 ? 29.711  -16.509 75.918  1.00 52.25  ? 488  TRP B CB  1 
ATOM   8041  C CG  . TRP B  1 488 ? 29.844  -17.049 74.525  1.00 52.13  ? 488  TRP B CG  1 
ATOM   8042  C CD1 . TRP B  1 488 ? 30.166  -18.321 74.174  1.00 54.46  ? 488  TRP B CD1 1 
ATOM   8043  C CD2 . TRP B  1 488 ? 29.567  -16.351 73.301  1.00 51.51  ? 488  TRP B CD2 1 
ATOM   8044  N NE1 . TRP B  1 488 ? 30.130  -18.458 72.809  1.00 52.85  ? 488  TRP B NE1 1 
ATOM   8045  C CE2 . TRP B  1 488 ? 29.753  -17.269 72.246  1.00 53.82  ? 488  TRP B CE2 1 
ATOM   8046  C CE3 . TRP B  1 488 ? 29.190  -15.028 72.991  1.00 53.05  ? 488  TRP B CE3 1 
ATOM   8047  C CZ2 . TRP B  1 488 ? 29.529  -16.930 70.906  1.00 51.99  ? 488  TRP B CZ2 1 
ATOM   8048  C CZ3 . TRP B  1 488 ? 29.001  -14.688 71.661  1.00 53.58  ? 488  TRP B CZ3 1 
ATOM   8049  C CH2 . TRP B  1 488 ? 29.180  -15.632 70.635  1.00 53.13  ? 488  TRP B CH2 1 
ATOM   8050  N N   . GLY B  1 489 ? 31.360  -15.438 78.636  1.00 57.28  ? 489  GLY B N   1 
ATOM   8051  C CA  . GLY B  1 489 ? 31.231  -15.046 80.023  1.00 58.17  ? 489  GLY B CA  1 
ATOM   8052  C C   . GLY B  1 489 ? 32.238  -15.812 80.833  1.00 62.90  ? 489  GLY B C   1 
ATOM   8053  O O   . GLY B  1 489 ? 33.202  -16.340 80.279  1.00 62.87  ? 489  GLY B O   1 
ATOM   8054  N N   . PRO B  1 490 ? 32.036  -15.918 82.149  1.00 59.01  ? 490  PRO B N   1 
ATOM   8055  C CA  . PRO B  1 490 ? 33.011  -16.640 82.976  1.00 58.80  ? 490  PRO B CA  1 
ATOM   8056  C C   . PRO B  1 490 ? 32.806  -18.145 83.012  1.00 65.22  ? 490  PRO B C   1 
ATOM   8057  O O   . PRO B  1 490 ? 31.692  -18.618 82.794  1.00 67.80  ? 490  PRO B O   1 
ATOM   8058  C CB  . PRO B  1 490 ? 32.818  -16.010 84.341  1.00 60.97  ? 490  PRO B CB  1 
ATOM   8059  C CG  . PRO B  1 490 ? 31.423  -15.542 84.355  1.00 64.86  ? 490  PRO B CG  1 
ATOM   8060  C CD  . PRO B  1 490 ? 30.967  -15.321 82.966  1.00 60.12  ? 490  PRO B CD  1 
ATOM   8061  N N   . GLY B  1 491 ? 33.866  -18.888 83.306  1.00 60.43  ? 491  GLY B N   1 
ATOM   8062  C CA  . GLY B  1 491 ? 33.768  -20.333 83.445  1.00 59.84  ? 491  GLY B CA  1 
ATOM   8063  C C   . GLY B  1 491 ? 34.202  -21.131 82.237  1.00 65.18  ? 491  GLY B C   1 
ATOM   8064  O O   . GLY B  1 491 ? 34.391  -20.567 81.144  1.00 64.70  ? 491  GLY B O   1 
ATOM   8065  N N   . PRO B  1 492 ? 34.422  -22.469 82.429  1.00 61.57  ? 492  PRO B N   1 
ATOM   8066  C CA  . PRO B  1 492 ? 34.872  -23.319 81.309  1.00 59.53  ? 492  PRO B CA  1 
ATOM   8067  C C   . PRO B  1 492 ? 33.723  -23.835 80.456  1.00 60.90  ? 492  PRO B C   1 
ATOM   8068  O O   . PRO B  1 492 ? 33.955  -24.418 79.404  1.00 58.66  ? 492  PRO B O   1 
ATOM   8069  C CB  . PRO B  1 492 ? 35.610  -24.439 82.012  1.00 61.74  ? 492  PRO B CB  1 
ATOM   8070  C CG  . PRO B  1 492 ? 34.896  -24.582 83.290  1.00 67.31  ? 492  PRO B CG  1 
ATOM   8071  C CD  . PRO B  1 492 ? 34.311  -23.256 83.672  1.00 63.32  ? 492  PRO B CD  1 
ATOM   8072  N N   . ASP B  1 493 ? 32.479  -23.583 80.888  1.00 58.62  ? 493  ASP B N   1 
ATOM   8073  C CA  . ASP B  1 493 ? 31.333  -23.971 80.092  1.00 58.16  ? 493  ASP B CA  1 
ATOM   8074  C C   . ASP B  1 493 ? 30.910  -22.875 79.099  1.00 62.53  ? 493  ASP B C   1 
ATOM   8075  O O   . ASP B  1 493 ? 29.925  -23.069 78.399  1.00 63.33  ? 493  ASP B O   1 
ATOM   8076  C CB  . ASP B  1 493 ? 30.181  -24.564 80.947  1.00 60.72  ? 493  ASP B CB  1 
ATOM   8077  C CG  . ASP B  1 493 ? 29.382  -23.639 81.851  1.00 83.75  ? 493  ASP B CG  1 
ATOM   8078  O OD1 . ASP B  1 493 ? 29.831  -22.496 82.083  1.00 87.15  ? 493  ASP B OD1 1 
ATOM   8079  O OD2 . ASP B  1 493 ? 28.307  -24.075 82.357  1.00 94.89  ? 493  ASP B OD2 1 
ATOM   8080  N N   . GLN B  1 494 ? 31.698  -21.754 78.991  1.00 58.03  ? 494  GLN B N   1 
ATOM   8081  C CA  . GLN B  1 494 ? 31.439  -20.555 78.154  1.00 56.15  ? 494  GLN B CA  1 
ATOM   8082  C C   . GLN B  1 494 ? 32.471  -20.287 77.053  1.00 61.94  ? 494  GLN B C   1 
ATOM   8083  O O   . GLN B  1 494 ? 32.449  -19.216 76.440  1.00 59.87  ? 494  GLN B O   1 
ATOM   8084  C CB  . GLN B  1 494 ? 31.313  -19.283 79.026  1.00 56.60  ? 494  GLN B CB  1 
ATOM   8085  C CG  . GLN B  1 494 ? 30.057  -19.188 79.882  1.00 54.88  ? 494  GLN B CG  1 
ATOM   8086  C CD  . GLN B  1 494 ? 28.754  -19.635 79.238  1.00 63.03  ? 494  GLN B CD  1 
ATOM   8087  O OE1 . GLN B  1 494 ? 28.235  -19.048 78.292  1.00 59.88  ? 494  GLN B OE1 1 
ATOM   8088  N NE2 . GLN B  1 494 ? 28.138  -20.628 79.815  1.00 58.46  ? 494  GLN B NE2 1 
ATOM   8089  N N   . CYS B  1 495 ? 33.375  -21.242 76.803  1.00 61.61  ? 495  CYS B N   1 
ATOM   8090  C CA  . CYS B  1 495 ? 34.422  -21.079 75.795  1.00 61.68  ? 495  CYS B CA  1 
ATOM   8091  C C   . CYS B  1 495 ? 33.839  -21.175 74.415  1.00 61.08  ? 495  CYS B C   1 
ATOM   8092  O O   . CYS B  1 495 ? 32.787  -21.772 74.237  1.00 60.29  ? 495  CYS B O   1 
ATOM   8093  C CB  . CYS B  1 495 ? 35.540  -22.098 75.997  1.00 63.87  ? 495  CYS B CB  1 
ATOM   8094  S SG  . CYS B  1 495 ? 36.258  -22.113 77.666  1.00 70.38  ? 495  CYS B SG  1 
ATOM   8095  N N   . LEU B  1 496 ? 34.486  -20.560 73.443  1.00 56.67  ? 496  LEU B N   1 
ATOM   8096  C CA  . LEU B  1 496 ? 34.048  -20.671 72.060  1.00 55.78  ? 496  LEU B CA  1 
ATOM   8097  C C   . LEU B  1 496 ? 34.596  -22.001 71.534  1.00 62.29  ? 496  LEU B C   1 
ATOM   8098  O O   . LEU B  1 496 ? 33.900  -22.725 70.817  1.00 62.30  ? 496  LEU B O   1 
ATOM   8099  C CB  . LEU B  1 496 ? 34.586  -19.499 71.234  1.00 55.39  ? 496  LEU B CB  1 
ATOM   8100  C CG  . LEU B  1 496 ? 33.669  -18.306 70.971  1.00 59.66  ? 496  LEU B CG  1 
ATOM   8101  C CD1 . LEU B  1 496 ? 32.464  -18.724 70.240  1.00 60.33  ? 496  LEU B CD1 1 
ATOM   8102  C CD2 . LEU B  1 496 ? 33.379  -17.497 72.224  1.00 61.48  ? 496  LEU B CD2 1 
ATOM   8103  N N   . SER B  1 497 ? 35.854  -22.306 71.915  1.00 59.70  ? 497  SER B N   1 
ATOM   8104  C CA  . SER B  1 497 ? 36.625  -23.522 71.668  1.00 59.71  ? 497  SER B CA  1 
ATOM   8105  C C   . SER B  1 497 ? 37.454  -23.743 72.925  1.00 64.12  ? 497  SER B C   1 
ATOM   8106  O O   . SER B  1 497 ? 37.599  -22.828 73.730  1.00 62.49  ? 497  SER B O   1 
ATOM   8107  C CB  . SER B  1 497 ? 37.561  -23.405 70.452  1.00 64.64  ? 497  SER B CB  1 
ATOM   8108  O OG  . SER B  1 497 ? 37.685  -22.145 69.807  1.00 75.59  ? 497  SER B OG  1 
ATOM   8109  N N   . CYS B  1 498 ? 37.998  -24.951 73.085  1.00 63.86  ? 498  CYS B N   1 
ATOM   8110  C CA  . CYS B  1 498 ? 38.835  -25.314 74.219  1.00 66.12  ? 498  CYS B CA  1 
ATOM   8111  C C   . CYS B  1 498 ? 40.301  -25.350 73.888  1.00 69.07  ? 498  CYS B C   1 
ATOM   8112  O O   . CYS B  1 498 ? 40.680  -25.604 72.741  1.00 67.14  ? 498  CYS B O   1 
ATOM   8113  C CB  . CYS B  1 498 ? 38.368  -26.623 74.817  1.00 68.05  ? 498  CYS B CB  1 
ATOM   8114  S SG  . CYS B  1 498 ? 36.587  -26.658 75.166  1.00 72.52  ? 498  CYS B SG  1 
ATOM   8115  N N   . ARG B  1 499 ? 41.129  -25.058 74.896  1.00 66.33  ? 499  ARG B N   1 
ATOM   8116  C CA  . ARG B  1 499 ? 42.581  -25.032 74.767  1.00 66.99  ? 499  ARG B CA  1 
ATOM   8117  C C   . ARG B  1 499 ? 43.094  -26.468 74.694  1.00 76.21  ? 499  ARG B C   1 
ATOM   8118  O O   . ARG B  1 499 ? 44.013  -26.743 73.916  1.00 78.51  ? 499  ARG B O   1 
ATOM   8119  C CB  . ARG B  1 499 ? 43.179  -24.293 75.980  1.00 64.16  ? 499  ARG B CB  1 
ATOM   8120  C CG  . ARG B  1 499 ? 44.680  -24.042 75.965  1.00 64.45  ? 499  ARG B CG  1 
ATOM   8121  C CD  . ARG B  1 499 ? 45.023  -22.757 76.691  1.00 79.63  ? 499  ARG B CD  1 
ATOM   8122  N NE  . ARG B  1 499 ? 45.202  -21.657 75.730  1.00 102.51 ? 499  ARG B NE  1 
ATOM   8123  C CZ  . ARG B  1 499 ? 44.865  -20.385 75.938  1.00 122.03 ? 499  ARG B CZ  1 
ATOM   8124  N NH1 . ARG B  1 499 ? 44.332  -20.012 77.094  1.00 111.20 ? 499  ARG B NH1 1 
ATOM   8125  N NH2 . ARG B  1 499 ? 45.038  -19.482 74.981  1.00 113.13 ? 499  ARG B NH2 1 
ATOM   8126  N N   . ARG B  1 500 ? 42.521  -27.371 75.525  1.00 73.43  ? 500  ARG B N   1 
ATOM   8127  C CA  . ARG B  1 500 ? 42.942  -28.767 75.586  1.00 73.37  ? 500  ARG B CA  1 
ATOM   8128  C C   . ARG B  1 500 ? 41.803  -29.681 75.139  1.00 76.43  ? 500  ARG B C   1 
ATOM   8129  O O   . ARG B  1 500 ? 41.727  -30.015 73.947  1.00 75.39  ? 500  ARG B O   1 
ATOM   8130  C CB  . ARG B  1 500 ? 43.430  -29.163 77.010  1.00 74.50  ? 500  ARG B CB  1 
ATOM   8131  C CG  . ARG B  1 500 ? 44.474  -28.251 77.674  1.00 79.77  ? 500  ARG B CG  1 
ATOM   8132  C CD  . ARG B  1 500 ? 45.246  -28.951 78.781  1.00 83.47  ? 500  ARG B CD  1 
ATOM   8133  N NE  . ARG B  1 500 ? 46.401  -29.665 78.230  1.00 94.43  ? 500  ARG B NE  1 
ATOM   8134  C CZ  . ARG B  1 500 ? 46.701  -30.940 78.463  1.00 119.19 ? 500  ARG B CZ  1 
ATOM   8135  N NH1 . ARG B  1 500 ? 45.934  -31.676 79.260  1.00 120.21 ? 500  ARG B NH1 1 
ATOM   8136  N NH2 . ARG B  1 500 ? 47.773  -31.489 77.904  1.00 105.18 ? 500  ARG B NH2 1 
ATOM   8137  N N   . PHE B  1 501 ? 40.902  -30.065 76.097  1.00 71.65  ? 501  PHE B N   1 
ATOM   8138  C CA  . PHE B  1 501 ? 39.845  -31.041 75.843  1.00 69.78  ? 501  PHE B CA  1 
ATOM   8139  C C   . PHE B  1 501 ? 38.479  -30.593 76.252  1.00 73.69  ? 501  PHE B C   1 
ATOM   8140  O O   . PHE B  1 501 ? 38.334  -29.575 76.934  1.00 75.19  ? 501  PHE B O   1 
ATOM   8141  C CB  . PHE B  1 501 ? 40.186  -32.372 76.504  1.00 71.37  ? 501  PHE B CB  1 
ATOM   8142  C CG  . PHE B  1 501 ? 41.459  -32.977 75.960  1.00 72.86  ? 501  PHE B CG  1 
ATOM   8143  C CD1 . PHE B  1 501 ? 42.675  -32.805 76.624  1.00 76.02  ? 501  PHE B CD1 1 
ATOM   8144  C CD2 . PHE B  1 501 ? 41.451  -33.701 74.775  1.00 73.59  ? 501  PHE B CD2 1 
ATOM   8145  C CE1 . PHE B  1 501 ? 43.852  -33.342 76.103  1.00 76.74  ? 501  PHE B CE1 1 
ATOM   8146  C CE2 . PHE B  1 501 ? 42.630  -34.236 74.254  1.00 76.02  ? 501  PHE B CE2 1 
ATOM   8147  C CZ  . PHE B  1 501 ? 43.822  -34.051 74.920  1.00 74.74  ? 501  PHE B CZ  1 
ATOM   8148  N N   . SER B  1 502 ? 37.472  -31.356 75.822  1.00 66.58  ? 502  SER B N   1 
ATOM   8149  C CA  . SER B  1 502 ? 36.078  -31.070 76.060  1.00 64.21  ? 502  SER B CA  1 
ATOM   8150  C C   . SER B  1 502 ? 35.255  -32.332 76.275  1.00 66.15  ? 502  SER B C   1 
ATOM   8151  O O   . SER B  1 502 ? 35.432  -33.333 75.576  1.00 65.03  ? 502  SER B O   1 
ATOM   8152  C CB  . SER B  1 502 ? 35.506  -30.271 74.889  1.00 65.48  ? 502  SER B CB  1 
ATOM   8153  O OG  . SER B  1 502 ? 35.564  -30.955 73.644  1.00 69.53  ? 502  SER B OG  1 
ATOM   8154  N N   . ARG B  1 503 ? 34.349  -32.272 77.241  1.00 62.03  ? 503  ARG B N   1 
ATOM   8155  C CA  . ARG B  1 503 ? 33.391  -33.324 77.503  1.00 62.19  ? 503  ARG B CA  1 
ATOM   8156  C C   . ARG B  1 503 ? 32.029  -32.600 77.526  1.00 68.85  ? 503  ARG B C   1 
ATOM   8157  O O   . ARG B  1 503 ? 31.654  -31.974 78.521  1.00 71.63  ? 503  ARG B O   1 
ATOM   8158  C CB  . ARG B  1 503 ? 33.712  -34.052 78.814  1.00 61.88  ? 503  ARG B CB  1 
ATOM   8159  C CG  . ARG B  1 503 ? 32.635  -35.035 79.285  1.00 63.55  ? 503  ARG B CG  1 
ATOM   8160  C CD  . ARG B  1 503 ? 33.123  -36.018 80.340  1.00 68.76  ? 503  ARG B CD  1 
ATOM   8161  N NE  . ARG B  1 503 ? 33.876  -35.374 81.417  1.00 73.98  ? 503  ARG B NE  1 
ATOM   8162  C CZ  . ARG B  1 503 ? 35.154  -35.619 81.689  1.00 87.12  ? 503  ARG B CZ  1 
ATOM   8163  N NH1 . ARG B  1 503 ? 35.836  -36.504 80.971  1.00 67.59  ? 503  ARG B NH1 1 
ATOM   8164  N NH2 . ARG B  1 503 ? 35.760  -34.982 82.683  1.00 79.16  ? 503  ARG B NH2 1 
ATOM   8165  N N   . GLY B  1 504 ? 31.330  -32.641 76.401  1.00 63.27  ? 504  GLY B N   1 
ATOM   8166  C CA  . GLY B  1 504 ? 30.036  -31.992 76.273  1.00 62.36  ? 504  GLY B CA  1 
ATOM   8167  C C   . GLY B  1 504 ? 30.192  -30.497 76.150  1.00 65.53  ? 504  GLY B C   1 
ATOM   8168  O O   . GLY B  1 504 ? 30.908  -30.038 75.259  1.00 67.55  ? 504  GLY B O   1 
ATOM   8169  N N   . ARG B  1 505 ? 29.571  -29.725 77.053  1.00 58.36  ? 505  ARG B N   1 
ATOM   8170  C CA  . ARG B  1 505 ? 29.681  -28.261 77.005  1.00 55.57  ? 505  ARG B CA  1 
ATOM   8171  C C   . ARG B  1 505 ? 30.905  -27.729 77.773  1.00 58.27  ? 505  ARG B C   1 
ATOM   8172  O O   . ARG B  1 505 ? 31.233  -26.555 77.652  1.00 58.74  ? 505  ARG B O   1 
ATOM   8173  C CB  . ARG B  1 505 ? 28.372  -27.568 77.475  1.00 51.07  ? 505  ARG B CB  1 
ATOM   8174  C CG  . ARG B  1 505 ? 27.137  -27.933 76.655  1.00 56.95  ? 505  ARG B CG  1 
ATOM   8175  C CD  . ARG B  1 505 ? 26.089  -26.836 76.596  1.00 61.11  ? 505  ARG B CD  1 
ATOM   8176  N NE  . ARG B  1 505 ? 24.776  -27.287 76.092  1.00 67.72  ? 505  ARG B NE  1 
ATOM   8177  C CZ  . ARG B  1 505 ? 23.709  -26.491 75.944  1.00 78.08  ? 505  ARG B CZ  1 
ATOM   8178  N NH1 . ARG B  1 505 ? 23.785  -25.203 76.245  1.00 70.50  ? 505  ARG B NH1 1 
ATOM   8179  N NH2 . ARG B  1 505 ? 22.560  -26.981 75.496  1.00 47.26  ? 505  ARG B NH2 1 
ATOM   8180  N N   . ILE B  1 506 ? 31.593  -28.592 78.518  1.00 54.82  ? 506  ILE B N   1 
ATOM   8181  C CA  . ILE B  1 506 ? 32.693  -28.228 79.411  1.00 55.18  ? 506  ILE B CA  1 
ATOM   8182  C C   . ILE B  1 506 ? 34.073  -28.468 78.818  1.00 66.80  ? 506  ILE B C   1 
ATOM   8183  O O   . ILE B  1 506 ? 34.319  -29.544 78.279  1.00 69.15  ? 506  ILE B O   1 
ATOM   8184  C CB  . ILE B  1 506 ? 32.547  -28.971 80.777  1.00 56.42  ? 506  ILE B CB  1 
ATOM   8185  C CG1 . ILE B  1 506 ? 31.137  -28.891 81.348  1.00 55.13  ? 506  ILE B CG1 1 
ATOM   8186  C CG2 . ILE B  1 506 ? 33.537  -28.465 81.785  1.00 58.12  ? 506  ILE B CG2 1 
ATOM   8187  C CD1 . ILE B  1 506 ? 30.325  -30.178 81.136  1.00 65.02  ? 506  ILE B CD1 1 
ATOM   8188  N N   . CYS B  1 507 ? 34.982  -27.481 78.968  1.00 66.26  ? 507  CYS B N   1 
ATOM   8189  C CA  . CYS B  1 507 ? 36.391  -27.584 78.582  1.00 67.77  ? 507  CYS B CA  1 
ATOM   8190  C C   . CYS B  1 507 ? 37.112  -28.144 79.798  1.00 74.17  ? 507  CYS B C   1 
ATOM   8191  O O   . CYS B  1 507 ? 36.961  -27.627 80.918  1.00 74.19  ? 507  CYS B O   1 
ATOM   8192  C CB  . CYS B  1 507 ? 36.983  -26.237 78.179  1.00 68.68  ? 507  CYS B CB  1 
ATOM   8193  S SG  . CYS B  1 507 ? 36.170  -25.454 76.772  1.00 72.48  ? 507  CYS B SG  1 
ATOM   8194  N N   . ILE B  1 508 ? 37.915  -29.184 79.589  1.00 71.57  ? 508  ILE B N   1 
ATOM   8195  C CA  . ILE B  1 508 ? 38.623  -29.854 80.684  1.00 71.95  ? 508  ILE B CA  1 
ATOM   8196  C C   . ILE B  1 508 ? 40.129  -29.945 80.469  1.00 77.64  ? 508  ILE B C   1 
ATOM   8197  O O   . ILE B  1 508 ? 40.613  -29.635 79.364  1.00 77.94  ? 508  ILE B O   1 
ATOM   8198  C CB  . ILE B  1 508 ? 37.974  -31.231 80.960  1.00 74.25  ? 508  ILE B CB  1 
ATOM   8199  C CG1 . ILE B  1 508 ? 37.905  -32.099 79.672  1.00 72.67  ? 508  ILE B CG1 1 
ATOM   8200  C CG2 . ILE B  1 508 ? 36.616  -31.057 81.667  1.00 74.04  ? 508  ILE B CG2 1 
ATOM   8201  C CD1 . ILE B  1 508 ? 37.250  -33.382 79.835  1.00 69.89  ? 508  ILE B CD1 1 
ATOM   8202  N N   . GLU B  1 509 ? 40.875  -30.347 81.529  1.00 74.77  ? 509  GLU B N   1 
ATOM   8203  C CA  . GLU B  1 509 ? 42.326  -30.535 81.423  1.00 75.67  ? 509  GLU B CA  1 
ATOM   8204  C C   . GLU B  1 509 ? 42.644  -31.722 80.508  1.00 81.27  ? 509  GLU B C   1 
ATOM   8205  O O   . GLU B  1 509 ? 43.288  -31.582 79.470  1.00 77.93  ? 509  GLU B O   1 
ATOM   8206  C CB  . GLU B  1 509 ? 42.981  -30.721 82.806  1.00 78.08  ? 509  GLU B CB  1 
ATOM   8207  C CG  . GLU B  1 509 ? 43.150  -29.433 83.602  1.00 91.35  ? 509  GLU B CG  1 
ATOM   8208  C CD  . GLU B  1 509 ? 44.128  -28.389 83.075  1.00 114.64 ? 509  GLU B CD  1 
ATOM   8209  O OE1 . GLU B  1 509 ? 44.933  -28.700 82.162  1.00 104.33 ? 509  GLU B OE1 1 
ATOM   8210  O OE2 . GLU B  1 509 ? 44.078  -27.245 83.587  1.00 100.70 ? 509  GLU B OE2 1 
ATOM   8211  N N   . SER B  1 510 ? 42.109  -32.880 80.870  1.00 83.05  ? 510  SER B N   1 
ATOM   8212  C CA  . SER B  1 510 ? 42.328  -34.115 80.140  1.00 84.62  ? 510  SER B CA  1 
ATOM   8213  C C   . SER B  1 510 ? 41.135  -35.050 80.276  1.00 88.67  ? 510  SER B C   1 
ATOM   8214  O O   . SER B  1 510 ? 40.300  -34.883 81.175  1.00 87.28  ? 510  SER B O   1 
ATOM   8215  C CB  . SER B  1 510 ? 43.595  -34.798 80.657  1.00 91.88  ? 510  SER B CB  1 
ATOM   8216  O OG  . SER B  1 510 ? 43.462  -35.151 82.026  1.00 106.40 ? 510  SER B OG  1 
ATOM   8217  N N   . CYS B  1 511 ? 41.086  -36.053 79.387  1.00 86.99  ? 511  CYS B N   1 
ATOM   8218  C CA  . CYS B  1 511 ? 40.062  -37.093 79.385  1.00 88.54  ? 511  CYS B CA  1 
ATOM   8219  C C   . CYS B  1 511 ? 40.301  -38.064 80.565  1.00 94.63  ? 511  CYS B C   1 
ATOM   8220  O O   . CYS B  1 511 ? 41.365  -38.042 81.192  1.00 95.58  ? 511  CYS B O   1 
ATOM   8221  C CB  . CYS B  1 511 ? 40.058  -37.841 78.048  1.00 89.35  ? 511  CYS B CB  1 
ATOM   8222  S SG  . CYS B  1 511 ? 39.859  -36.783 76.573  1.00 92.34  ? 511  CYS B SG  1 
ATOM   8223  N N   . ASN B  1 512 ? 39.327  -38.942 80.850  1.00 90.91  ? 512  ASN B N   1 
ATOM   8224  C CA  . ASN B  1 512 ? 39.470  -39.952 81.902  1.00 90.41  ? 512  ASN B CA  1 
ATOM   8225  C C   . ASN B  1 512 ? 40.282  -41.130 81.342  1.00 92.18  ? 512  ASN B C   1 
ATOM   8226  O O   . ASN B  1 512 ? 39.743  -42.210 81.146  1.00 91.73  ? 512  ASN B O   1 
ATOM   8227  C CB  . ASN B  1 512 ? 38.091  -40.383 82.409  1.00 87.21  ? 512  ASN B CB  1 
ATOM   8228  C CG  . ASN B  1 512 ? 37.403  -39.366 83.288  1.00 106.64 ? 512  ASN B CG  1 
ATOM   8229  O OD1 . ASN B  1 512 ? 38.020  -38.426 83.821  1.00 95.49  ? 512  ASN B OD1 1 
ATOM   8230  N ND2 . ASN B  1 512 ? 36.103  -39.555 83.488  1.00 100.43 ? 512  ASN B ND2 1 
ATOM   8231  N N   . LEU B  1 513 ? 41.577  -40.895 81.040  1.00 88.05  ? 513  LEU B N   1 
ATOM   8232  C CA  . LEU B  1 513 ? 42.487  -41.877 80.436  1.00 87.93  ? 513  LEU B CA  1 
ATOM   8233  C C   . LEU B  1 513 ? 43.003  -42.929 81.412  1.00 94.36  ? 513  LEU B C   1 
ATOM   8234  O O   . LEU B  1 513 ? 43.006  -44.113 81.072  1.00 95.17  ? 513  LEU B O   1 
ATOM   8235  C CB  . LEU B  1 513 ? 43.668  -41.190 79.721  1.00 87.15  ? 513  LEU B CB  1 
ATOM   8236  C CG  . LEU B  1 513 ? 43.329  -40.261 78.546  1.00 90.23  ? 513  LEU B CG  1 
ATOM   8237  C CD1 . LEU B  1 513 ? 44.411  -39.298 78.335  1.00 90.61  ? 513  LEU B CD1 1 
ATOM   8238  C CD2 . LEU B  1 513 ? 43.068  -41.016 77.229  1.00 91.02  ? 513  LEU B CD2 1 
ATOM   8239  N N   . TYR B  1 514 ? 43.431  -42.501 82.615  1.00 90.83  ? 514  TYR B N   1 
ATOM   8240  C CA  . TYR B  1 514 ? 44.023  -43.372 83.623  1.00 91.29  ? 514  TYR B CA  1 
ATOM   8241  C C   . TYR B  1 514 ? 43.222  -43.439 84.908  1.00 96.59  ? 514  TYR B C   1 
ATOM   8242  O O   . TYR B  1 514 ? 43.439  -44.331 85.719  1.00 97.45  ? 514  TYR B O   1 
ATOM   8243  C CB  . TYR B  1 514 ? 45.477  -42.942 83.882  1.00 93.25  ? 514  TYR B CB  1 
ATOM   8244  C CG  . TYR B  1 514 ? 46.321  -42.851 82.624  1.00 95.39  ? 514  TYR B CG  1 
ATOM   8245  C CD1 . TYR B  1 514 ? 46.499  -41.636 81.962  1.00 97.03  ? 514  TYR B CD1 1 
ATOM   8246  C CD2 . TYR B  1 514 ? 46.915  -43.982 82.076  1.00 96.58  ? 514  TYR B CD2 1 
ATOM   8247  C CE1 . TYR B  1 514 ? 47.255  -41.553 80.787  1.00 97.92  ? 514  TYR B CE1 1 
ATOM   8248  C CE2 . TYR B  1 514 ? 47.681  -43.910 80.911  1.00 97.04  ? 514  TYR B CE2 1 
ATOM   8249  C CZ  . TYR B  1 514 ? 47.856  -42.693 80.274  1.00 101.12 ? 514  TYR B CZ  1 
ATOM   8250  O OH  . TYR B  1 514 ? 48.626  -42.639 79.135  1.00 96.38  ? 514  TYR B OH  1 
ATOM   8251  N N   . ASP B  1 515 ? 42.269  -42.533 85.077  1.00 94.93  ? 515  ASP B N   1 
ATOM   8252  C CA  . ASP B  1 515 ? 41.416  -42.429 86.270  1.00 96.66  ? 515  ASP B CA  1 
ATOM   8253  C C   . ASP B  1 515 ? 39.978  -42.098 85.859  1.00 98.67  ? 515  ASP B C   1 
ATOM   8254  O O   . ASP B  1 515 ? 39.750  -41.742 84.706  1.00 97.29  ? 515  ASP B O   1 
ATOM   8255  C CB  . ASP B  1 515 ? 41.961  -41.320 87.202  1.00 100.26 ? 515  ASP B CB  1 
ATOM   8256  C CG  . ASP B  1 515 ? 42.483  -40.073 86.482  1.00 121.96 ? 515  ASP B CG  1 
ATOM   8257  O OD1 . ASP B  1 515 ? 41.664  -39.362 85.835  1.00 123.25 ? 515  ASP B OD1 1 
ATOM   8258  O OD2 . ASP B  1 515 ? 43.706  -39.803 86.569  1.00 131.96 ? 515  ASP B OD2 1 
ATOM   8259  N N   . GLY B  1 516 ? 39.031  -42.237 86.787  1.00 94.64  ? 516  GLY B N   1 
ATOM   8260  C CA  . GLY B  1 516 ? 37.634  -41.878 86.558  1.00 93.22  ? 516  GLY B CA  1 
ATOM   8261  C C   . GLY B  1 516 ? 36.663  -43.016 86.368  1.00 96.06  ? 516  GLY B C   1 
ATOM   8262  O O   . GLY B  1 516 ? 37.023  -44.039 85.782  1.00 94.75  ? 516  GLY B O   1 
ATOM   8263  N N   . GLU B  1 517 ? 35.407  -42.808 86.848  1.00 93.47  ? 517  GLU B N   1 
ATOM   8264  C CA  . GLU B  1 517 ? 34.253  -43.729 86.804  1.00 93.91  ? 517  GLU B CA  1 
ATOM   8265  C C   . GLU B  1 517 ? 34.055  -44.378 85.422  1.00 96.63  ? 517  GLU B C   1 
ATOM   8266  O O   . GLU B  1 517 ? 33.806  -45.586 85.335  1.00 98.52  ? 517  GLU B O   1 
ATOM   8267  C CB  . GLU B  1 517 ? 32.967  -42.990 87.226  1.00 95.43  ? 517  GLU B CB  1 
ATOM   8268  C CG  . GLU B  1 517 ? 31.762  -43.894 87.483  1.00 109.31 ? 517  GLU B CG  1 
ATOM   8269  C CD  . GLU B  1 517 ? 30.475  -43.219 87.935  1.00 137.05 ? 517  GLU B CD  1 
ATOM   8270  O OE1 . GLU B  1 517 ? 30.539  -42.241 88.717  1.00 146.19 ? 517  GLU B OE1 1 
ATOM   8271  O OE2 . GLU B  1 517 ? 29.391  -43.705 87.542  1.00 127.46 ? 517  GLU B OE2 1 
ATOM   8272  N N   . PHE B  1 518 ? 34.158  -43.567 84.356  1.00 88.80  ? 518  PHE B N   1 
ATOM   8273  C CA  . PHE B  1 518 ? 34.028  -44.018 82.982  1.00 86.55  ? 518  PHE B CA  1 
ATOM   8274  C C   . PHE B  1 518 ? 35.272  -43.599 82.255  1.00 88.30  ? 518  PHE B C   1 
ATOM   8275  O O   . PHE B  1 518 ? 35.515  -42.399 82.104  1.00 88.88  ? 518  PHE B O   1 
ATOM   8276  C CB  . PHE B  1 518 ? 32.788  -43.411 82.317  1.00 87.43  ? 518  PHE B CB  1 
ATOM   8277  C CG  . PHE B  1 518 ? 31.495  -43.860 82.931  1.00 89.98  ? 518  PHE B CG  1 
ATOM   8278  C CD1 . PHE B  1 518 ? 30.883  -43.109 83.923  1.00 94.69  ? 518  PHE B CD1 1 
ATOM   8279  C CD2 . PHE B  1 518 ? 30.895  -45.044 82.533  1.00 92.68  ? 518  PHE B CD2 1 
ATOM   8280  C CE1 . PHE B  1 518 ? 29.690  -43.539 84.509  1.00 96.69  ? 518  PHE B CE1 1 
ATOM   8281  C CE2 . PHE B  1 518 ? 29.711  -45.481 83.129  1.00 96.61  ? 518  PHE B CE2 1 
ATOM   8282  C CZ  . PHE B  1 518 ? 29.119  -44.730 84.119  1.00 95.59  ? 518  PHE B CZ  1 
ATOM   8283  N N   . ARG B  1 519 ? 36.095  -44.579 81.848  1.00 81.81  ? 519  ARG B N   1 
ATOM   8284  C CA  . ARG B  1 519 ? 37.329  -44.293 81.125  1.00 79.34  ? 519  ARG B CA  1 
ATOM   8285  C C   . ARG B  1 519 ? 37.034  -43.835 79.718  1.00 81.06  ? 519  ARG B C   1 
ATOM   8286  O O   . ARG B  1 519 ? 35.943  -44.066 79.200  1.00 79.36  ? 519  ARG B O   1 
ATOM   8287  C CB  . ARG B  1 519 ? 38.352  -45.426 81.190  1.00 77.21  ? 519  ARG B CB  1 
ATOM   8288  C CG  . ARG B  1 519 ? 38.725  -45.856 82.609  1.00 81.03  ? 519  ARG B CG  1 
ATOM   8289  C CD  . ARG B  1 519 ? 39.755  -44.967 83.270  1.00 86.74  ? 519  ARG B CD  1 
ATOM   8290  N NE  . ARG B  1 519 ? 39.658  -45.035 84.727  1.00 97.28  ? 519  ARG B NE  1 
ATOM   8291  C CZ  . ARG B  1 519 ? 40.278  -45.937 85.486  1.00 117.42 ? 519  ARG B CZ  1 
ATOM   8292  N NH1 . ARG B  1 519 ? 41.036  -46.879 84.931  1.00 100.27 ? 519  ARG B NH1 1 
ATOM   8293  N NH2 . ARG B  1 519 ? 40.137  -45.910 86.807  1.00 108.12 ? 519  ARG B NH2 1 
ATOM   8294  N N   . GLU B  1 520 ? 37.962  -43.075 79.149  1.00 78.20  ? 520  GLU B N   1 
ATOM   8295  C CA  . GLU B  1 520 ? 37.774  -42.414 77.871  1.00 77.16  ? 520  GLU B CA  1 
ATOM   8296  C C   . GLU B  1 520 ? 39.016  -42.438 77.012  1.00 80.95  ? 520  GLU B C   1 
ATOM   8297  O O   . GLU B  1 520 ? 40.126  -42.670 77.488  1.00 80.85  ? 520  GLU B O   1 
ATOM   8298  C CB  . GLU B  1 520 ? 37.372  -40.933 78.107  1.00 78.08  ? 520  GLU B CB  1 
ATOM   8299  C CG  . GLU B  1 520 ? 36.020  -40.697 78.776  1.00 91.70  ? 520  GLU B CG  1 
ATOM   8300  C CD  . GLU B  1 520 ? 35.656  -39.245 79.042  1.00 115.69 ? 520  GLU B CD  1 
ATOM   8301  O OE1 . GLU B  1 520 ? 34.498  -38.857 78.758  1.00 120.00 ? 520  GLU B OE1 1 
ATOM   8302  O OE2 . GLU B  1 520 ? 36.526  -38.497 79.542  1.00 101.91 ? 520  GLU B OE2 1 
ATOM   8303  N N   . PHE B  1 521 ? 38.808  -42.186 75.730  1.00 77.61  ? 521  PHE B N   1 
ATOM   8304  C CA  . PHE B  1 521 ? 39.861  -42.041 74.750  1.00 77.87  ? 521  PHE B CA  1 
ATOM   8305  C C   . PHE B  1 521 ? 39.633  -40.667 74.139  1.00 83.41  ? 521  PHE B C   1 
ATOM   8306  O O   . PHE B  1 521 ? 38.512  -40.136 74.196  1.00 82.15  ? 521  PHE B O   1 
ATOM   8307  C CB  . PHE B  1 521 ? 39.812  -43.139 73.677  1.00 79.23  ? 521  PHE B CB  1 
ATOM   8308  C CG  . PHE B  1 521 ? 38.694  -43.043 72.664  1.00 79.13  ? 521  PHE B CG  1 
ATOM   8309  C CD1 . PHE B  1 521 ? 38.867  -42.349 71.472  1.00 80.12  ? 521  PHE B CD1 1 
ATOM   8310  C CD2 . PHE B  1 521 ? 37.480  -43.672 72.887  1.00 81.22  ? 521  PHE B CD2 1 
ATOM   8311  C CE1 . PHE B  1 521 ? 37.837  -42.266 70.536  1.00 79.97  ? 521  PHE B CE1 1 
ATOM   8312  C CE2 . PHE B  1 521 ? 36.458  -43.600 71.943  1.00 83.29  ? 521  PHE B CE2 1 
ATOM   8313  C CZ  . PHE B  1 521 ? 36.643  -42.892 70.777  1.00 80.10  ? 521  PHE B CZ  1 
ATOM   8314  N N   . GLU B  1 522 ? 40.683  -40.097 73.544  1.00 80.58  ? 522  GLU B N   1 
ATOM   8315  C CA  . GLU B  1 522 ? 40.576  -38.784 72.947  1.00 78.73  ? 522  GLU B CA  1 
ATOM   8316  C C   . GLU B  1 522 ? 40.359  -38.808 71.459  1.00 81.79  ? 522  GLU B C   1 
ATOM   8317  O O   . GLU B  1 522 ? 41.256  -39.189 70.702  1.00 81.77  ? 522  GLU B O   1 
ATOM   8318  C CB  . GLU B  1 522 ? 41.708  -37.831 73.391  1.00 79.83  ? 522  GLU B CB  1 
ATOM   8319  C CG  . GLU B  1 522 ? 43.120  -38.396 73.442  1.00 82.19  ? 522  GLU B CG  1 
ATOM   8320  C CD  . GLU B  1 522 ? 44.043  -37.663 74.398  1.00 106.44 ? 522  GLU B CD  1 
ATOM   8321  O OE1 . GLU B  1 522 ? 43.656  -37.456 75.574  1.00 102.79 ? 522  GLU B OE1 1 
ATOM   8322  O OE2 . GLU B  1 522 ? 45.167  -37.309 73.972  1.00 108.49 ? 522  GLU B OE2 1 
ATOM   8323  N N   . ASN B  1 523 ? 39.147  -38.392 71.046  1.00 78.18  ? 523  ASN B N   1 
ATOM   8324  C CA  . ASN B  1 523 ? 38.719  -38.264 69.651  1.00 78.51  ? 523  ASN B CA  1 
ATOM   8325  C C   . ASN B  1 523 ? 39.147  -36.855 69.172  1.00 86.51  ? 523  ASN B C   1 
ATOM   8326  O O   . ASN B  1 523 ? 38.341  -36.099 68.612  1.00 85.12  ? 523  ASN B O   1 
ATOM   8327  C CB  . ASN B  1 523 ? 37.192  -38.480 69.547  1.00 75.25  ? 523  ASN B CB  1 
ATOM   8328  C CG  . ASN B  1 523 ? 36.595  -38.359 68.171  1.00 113.70 ? 523  ASN B CG  1 
ATOM   8329  O OD1 . ASN B  1 523 ? 37.285  -38.422 67.144  1.00 114.75 ? 523  ASN B OD1 1 
ATOM   8330  N ND2 . ASN B  1 523 ? 35.288  -38.171 68.116  1.00 116.93 ? 523  ASN B ND2 1 
ATOM   8331  N N   . ASP B  1 524 ? 40.445  -36.514 69.405  1.00 86.90  ? 524  ASP B N   1 
ATOM   8332  C CA  . ASP B  1 524 ? 41.058  -35.225 69.105  1.00 88.28  ? 524  ASP B CA  1 
ATOM   8333  C C   . ASP B  1 524 ? 40.239  -34.122 69.794  1.00 91.62  ? 524  ASP B C   1 
ATOM   8334  O O   . ASP B  1 524 ? 39.279  -33.584 69.199  1.00 92.29  ? 524  ASP B O   1 
ATOM   8335  C CB  . ASP B  1 524 ? 41.194  -34.999 67.574  1.00 91.97  ? 524  ASP B CB  1 
ATOM   8336  C CG  . ASP B  1 524 ? 41.825  -33.675 67.080  1.00 114.78 ? 524  ASP B CG  1 
ATOM   8337  O OD1 . ASP B  1 524 ? 42.238  -32.828 67.938  1.00 115.55 ? 524  ASP B OD1 1 
ATOM   8338  O OD2 . ASP B  1 524 ? 41.939  -33.499 65.842  1.00 124.35 ? 524  ASP B OD2 1 
ATOM   8339  N N   . SER B  1 525 ? 40.586  -33.843 71.081  1.00 84.86  ? 525  SER B N   1 
ATOM   8340  C CA  . SER B  1 525 ? 39.945  -32.851 71.959  1.00 82.45  ? 525  SER B CA  1 
ATOM   8341  C C   . SER B  1 525 ? 38.568  -33.227 72.487  1.00 82.91  ? 525  SER B C   1 
ATOM   8342  O O   . SER B  1 525 ? 38.183  -32.665 73.497  1.00 83.94  ? 525  SER B O   1 
ATOM   8343  C CB  . SER B  1 525 ? 39.989  -31.423 71.399  1.00 83.96  ? 525  SER B CB  1 
ATOM   8344  O OG  . SER B  1 525 ? 38.949  -31.166 70.468  1.00 89.80  ? 525  SER B OG  1 
ATOM   8345  N N   . ILE B  1 526 ? 37.831  -34.155 71.839  1.00 76.20  ? 526  ILE B N   1 
ATOM   8346  C CA  . ILE B  1 526 ? 36.518  -34.608 72.335  1.00 75.64  ? 526  ILE B CA  1 
ATOM   8347  C C   . ILE B  1 526 ? 36.731  -35.884 73.158  1.00 83.31  ? 526  ILE B C   1 
ATOM   8348  O O   . ILE B  1 526 ? 37.322  -36.851 72.660  1.00 83.66  ? 526  ILE B O   1 
ATOM   8349  C CB  . ILE B  1 526 ? 35.443  -34.811 71.241  1.00 76.97  ? 526  ILE B CB  1 
ATOM   8350  C CG1 . ILE B  1 526 ? 35.338  -33.626 70.310  1.00 77.21  ? 526  ILE B CG1 1 
ATOM   8351  C CG2 . ILE B  1 526 ? 34.103  -35.146 71.838  1.00 75.70  ? 526  ILE B CG2 1 
ATOM   8352  C CD1 . ILE B  1 526 ? 35.877  -33.930 68.906  1.00 90.20  ? 526  ILE B CD1 1 
ATOM   8353  N N   . CYS B  1 527 ? 36.271  -35.876 74.414  1.00 82.05  ? 527  CYS B N   1 
ATOM   8354  C CA  . CYS B  1 527 ? 36.427  -37.019 75.294  1.00 83.84  ? 527  CYS B CA  1 
ATOM   8355  C C   . CYS B  1 527 ? 35.237  -37.945 75.188  1.00 85.25  ? 527  CYS B C   1 
ATOM   8356  O O   . CYS B  1 527 ? 34.127  -37.602 75.615  1.00 84.57  ? 527  CYS B O   1 
ATOM   8357  C CB  . CYS B  1 527 ? 36.706  -36.586 76.727  1.00 86.12  ? 527  CYS B CB  1 
ATOM   8358  S SG  . CYS B  1 527 ? 38.210  -35.587 76.905  1.00 91.31  ? 527  CYS B SG  1 
ATOM   8359  N N   . VAL B  1 528 ? 35.483  -39.111 74.549  1.00 79.74  ? 528  VAL B N   1 
ATOM   8360  C CA  . VAL B  1 528 ? 34.508  -40.166 74.278  1.00 78.21  ? 528  VAL B CA  1 
ATOM   8361  C C   . VAL B  1 528 ? 34.775  -41.353 75.176  1.00 82.30  ? 528  VAL B C   1 
ATOM   8362  O O   . VAL B  1 528 ? 35.909  -41.818 75.258  1.00 83.29  ? 528  VAL B O   1 
ATOM   8363  C CB  . VAL B  1 528 ? 34.482  -40.557 72.787  1.00 80.57  ? 528  VAL B CB  1 
ATOM   8364  C CG1 . VAL B  1 528 ? 33.404  -41.592 72.503  1.00 80.53  ? 528  VAL B CG1 1 
ATOM   8365  C CG2 . VAL B  1 528 ? 34.267  -39.327 71.918  1.00 79.73  ? 528  VAL B CG2 1 
ATOM   8366  N N   . GLU B  1 529 ? 33.726  -41.845 75.833  1.00 77.49  ? 529  GLU B N   1 
ATOM   8367  C CA  . GLU B  1 529 ? 33.785  -42.975 76.741  1.00 77.96  ? 529  GLU B CA  1 
ATOM   8368  C C   . GLU B  1 529 ? 34.075  -44.303 76.025  1.00 85.13  ? 529  GLU B C   1 
ATOM   8369  O O   . GLU B  1 529 ? 33.562  -44.557 74.926  1.00 84.25  ? 529  GLU B O   1 
ATOM   8370  C CB  . GLU B  1 529 ? 32.481  -43.067 77.530  1.00 79.16  ? 529  GLU B CB  1 
ATOM   8371  C CG  . GLU B  1 529 ? 32.426  -42.128 78.720  1.00 85.58  ? 529  GLU B CG  1 
ATOM   8372  C CD  . GLU B  1 529 ? 31.121  -42.118 79.490  1.00 102.83 ? 529  GLU B CD  1 
ATOM   8373  O OE1 . GLU B  1 529 ? 30.331  -43.079 79.337  1.00 108.47 ? 529  GLU B OE1 1 
ATOM   8374  O OE2 . GLU B  1 529 ? 30.917  -41.183 80.300  1.00 94.87  ? 529  GLU B OE2 1 
ATOM   8375  N N   . CYS B  1 530 ? 34.899  -45.154 76.671  1.00 84.85  ? 530  CYS B N   1 
ATOM   8376  C CA  . CYS B  1 530 ? 35.270  -46.484 76.189  1.00 86.17  ? 530  CYS B CA  1 
ATOM   8377  C C   . CYS B  1 530 ? 34.051  -47.370 76.222  1.00 86.44  ? 530  CYS B C   1 
ATOM   8378  O O   . CYS B  1 530 ? 33.169  -47.162 77.071  1.00 85.83  ? 530  CYS B O   1 
ATOM   8379  C CB  . CYS B  1 530 ? 36.402  -47.078 77.028  1.00 89.10  ? 530  CYS B CB  1 
ATOM   8380  S SG  . CYS B  1 530 ? 37.988  -46.211 76.863  1.00 94.03  ? 530  CYS B SG  1 
ATOM   8381  N N   . ASP B  1 531 ? 33.999  -48.369 75.309  1.00 80.98  ? 531  ASP B N   1 
ATOM   8382  C CA  . ASP B  1 531 ? 32.888  -49.324 75.233  1.00 80.73  ? 531  ASP B CA  1 
ATOM   8383  C C   . ASP B  1 531 ? 32.683  -49.999 76.602  1.00 81.50  ? 531  ASP B C   1 
ATOM   8384  O O   . ASP B  1 531 ? 33.676  -50.279 77.277  1.00 80.54  ? 531  ASP B O   1 
ATOM   8385  C CB  . ASP B  1 531 ? 33.133  -50.359 74.115  1.00 83.79  ? 531  ASP B CB  1 
ATOM   8386  C CG  . ASP B  1 531 ? 31.912  -51.162 73.705  1.00 98.00  ? 531  ASP B CG  1 
ATOM   8387  O OD1 . ASP B  1 531 ? 30.951  -50.562 73.159  1.00 97.85  ? 531  ASP B OD1 1 
ATOM   8388  O OD2 . ASP B  1 531 ? 31.928  -52.385 73.885  1.00 107.44 ? 531  ASP B OD2 1 
ATOM   8389  N N   . PRO B  1 532 ? 31.428  -50.225 77.063  1.00 77.35  ? 532  PRO B N   1 
ATOM   8390  C CA  . PRO B  1 532 ? 31.220  -50.858 78.389  1.00 78.53  ? 532  PRO B CA  1 
ATOM   8391  C C   . PRO B  1 532 ? 31.947  -52.190 78.617  1.00 86.37  ? 532  PRO B C   1 
ATOM   8392  O O   . PRO B  1 532 ? 32.154  -52.600 79.773  1.00 86.83  ? 532  PRO B O   1 
ATOM   8393  C CB  . PRO B  1 532 ? 29.704  -51.047 78.449  1.00 79.80  ? 532  PRO B CB  1 
ATOM   8394  C CG  . PRO B  1 532 ? 29.163  -50.030 77.530  1.00 82.34  ? 532  PRO B CG  1 
ATOM   8395  C CD  . PRO B  1 532 ? 30.138  -49.937 76.410  1.00 77.43  ? 532  PRO B CD  1 
ATOM   8396  N N   . GLN B  1 533 ? 32.346  -52.843 77.494  1.00 84.75  ? 533  GLN B N   1 
ATOM   8397  C CA  . GLN B  1 533 ? 33.039  -54.123 77.403  1.00 85.97  ? 533  GLN B CA  1 
ATOM   8398  C C   . GLN B  1 533 ? 34.515  -54.085 77.728  1.00 93.91  ? 533  GLN B C   1 
ATOM   8399  O O   . GLN B  1 533 ? 35.086  -55.119 78.066  1.00 93.79  ? 533  GLN B O   1 
ATOM   8400  C CB  . GLN B  1 533 ? 32.791  -54.772 76.041  1.00 86.52  ? 533  GLN B CB  1 
ATOM   8401  C CG  . GLN B  1 533 ? 31.512  -55.600 75.989  1.00 91.22  ? 533  GLN B CG  1 
ATOM   8402  C CD  . GLN B  1 533 ? 31.254  -56.424 77.238  1.00 97.57  ? 533  GLN B CD  1 
ATOM   8403  O OE1 . GLN B  1 533 ? 32.021  -57.335 77.610  1.00 98.83  ? 533  GLN B OE1 1 
ATOM   8404  N NE2 . GLN B  1 533 ? 30.175  -56.089 77.921  1.00 72.76  ? 533  GLN B NE2 1 
ATOM   8405  N N   . CYS B  1 534 ? 35.137  -52.902 77.600  1.00 94.05  ? 534  CYS B N   1 
ATOM   8406  C CA  . CYS B  1 534 ? 36.540  -52.659 77.940  1.00 95.45  ? 534  CYS B CA  1 
ATOM   8407  C C   . CYS B  1 534 ? 36.671  -52.735 79.474  1.00 99.05  ? 534  CYS B C   1 
ATOM   8408  O O   . CYS B  1 534 ? 35.854  -52.151 80.203  1.00 98.36  ? 534  CYS B O   1 
ATOM   8409  C CB  . CYS B  1 534 ? 37.000  -51.297 77.417  1.00 95.59  ? 534  CYS B CB  1 
ATOM   8410  S SG  . CYS B  1 534 ? 37.011  -51.118 75.606  1.00 99.26  ? 534  CYS B SG  1 
ATOM   8411  N N   . GLU B  1 535 ? 37.676  -53.478 79.954  1.00 95.57  ? 535  GLU B N   1 
ATOM   8412  C CA  . GLU B  1 535 ? 37.922  -53.624 81.388  1.00 95.72  ? 535  GLU B CA  1 
ATOM   8413  C C   . GLU B  1 535 ? 38.692  -52.405 81.856  1.00 96.08  ? 535  GLU B C   1 
ATOM   8414  O O   . GLU B  1 535 ? 39.670  -52.023 81.205  1.00 94.20  ? 535  GLU B O   1 
ATOM   8415  C CB  . GLU B  1 535 ? 38.688  -54.929 81.697  1.00 98.56  ? 535  GLU B CB  1 
ATOM   8416  C CG  . GLU B  1 535 ? 38.742  -55.271 83.177  1.00 110.99 ? 535  GLU B CG  1 
ATOM   8417  C CD  . GLU B  1 535 ? 39.385  -56.610 83.472  1.00 139.15 ? 535  GLU B CD  1 
ATOM   8418  O OE1 . GLU B  1 535 ? 38.759  -57.655 83.179  1.00 140.03 ? 535  GLU B OE1 1 
ATOM   8419  O OE2 . GLU B  1 535 ? 40.511  -56.614 84.020  1.00 134.52 ? 535  GLU B OE2 1 
ATOM   8420  N N   . LYS B  1 536 ? 38.231  -51.789 82.972  1.00 92.09  ? 536  LYS B N   1 
ATOM   8421  C CA  . LYS B  1 536 ? 38.811  -50.597 83.601  1.00 91.40  ? 536  LYS B CA  1 
ATOM   8422  C C   . LYS B  1 536 ? 40.259  -50.860 84.012  1.00 98.47  ? 536  LYS B C   1 
ATOM   8423  O O   . LYS B  1 536 ? 40.520  -51.386 85.098  1.00 98.96  ? 536  LYS B O   1 
ATOM   8424  C CB  . LYS B  1 536 ? 37.973  -50.136 84.812  1.00 93.10  ? 536  LYS B CB  1 
ATOM   8425  C CG  . LYS B  1 536 ? 36.748  -49.292 84.471  1.00 98.71  ? 536  LYS B CG  1 
ATOM   8426  C CD  . LYS B  1 536 ? 36.745  -47.904 85.136  1.00 105.35 ? 536  LYS B CD  1 
ATOM   8427  C CE  . LYS B  1 536 ? 36.308  -47.876 86.587  1.00 111.65 ? 536  LYS B CE  1 
ATOM   8428  N NZ  . LYS B  1 536 ? 36.998  -46.793 87.345  1.00 113.87 ? 536  LYS B NZ  1 
ATOM   8429  N N   . MET B  1 537 ? 41.196  -50.514 83.110  1.00 96.71  ? 537  MET B N   1 
ATOM   8430  C CA  . MET B  1 537 ? 42.632  -50.712 83.285  1.00 98.23  ? 537  MET B CA  1 
ATOM   8431  C C   . MET B  1 537 ? 43.212  -49.772 84.330  1.00 105.95 ? 537  MET B C   1 
ATOM   8432  O O   . MET B  1 537 ? 43.140  -48.545 84.174  1.00 105.66 ? 537  MET B O   1 
ATOM   8433  C CB  . MET B  1 537 ? 43.373  -50.559 81.945  1.00 99.98  ? 537  MET B CB  1 
ATOM   8434  C CG  . MET B  1 537 ? 43.000  -51.601 80.901  1.00 104.36 ? 537  MET B CG  1 
ATOM   8435  S SD  . MET B  1 537 ? 43.025  -53.323 81.471  1.00 110.60 ? 537  MET B SD  1 
ATOM   8436  C CE  . MET B  1 537 ? 44.765  -53.566 81.758  1.00 108.21 ? 537  MET B CE  1 
ATOM   8437  N N   . GLU B  1 538 ? 43.782  -50.355 85.402  1.00 104.56 ? 538  GLU B N   1 
ATOM   8438  C CA  . GLU B  1 538 ? 44.415  -49.593 86.475  1.00 105.08 ? 538  GLU B CA  1 
ATOM   8439  C C   . GLU B  1 538 ? 45.940  -49.630 86.283  1.00 112.29 ? 538  GLU B C   1 
ATOM   8440  O O   . GLU B  1 538 ? 46.426  -50.249 85.326  1.00 111.56 ? 538  GLU B O   1 
ATOM   8441  C CB  . GLU B  1 538 ? 44.000  -50.118 87.861  1.00 107.32 ? 538  GLU B CB  1 
ATOM   8442  C CG  . GLU B  1 538 ? 42.499  -50.187 88.114  1.00 119.19 ? 538  GLU B CG  1 
ATOM   8443  C CD  . GLU B  1 538 ? 41.705  -48.895 88.199  1.00 147.09 ? 538  GLU B CD  1 
ATOM   8444  O OE1 . GLU B  1 538 ? 42.294  -47.838 88.522  1.00 149.74 ? 538  GLU B OE1 1 
ATOM   8445  O OE2 . GLU B  1 538 ? 40.473  -48.953 87.979  1.00 144.10 ? 538  GLU B OE2 1 
ATOM   8446  N N   . ASP B  1 539 ? 46.687  -48.942 87.181  1.00 111.74 ? 539  ASP B N   1 
ATOM   8447  C CA  . ASP B  1 539 ? 48.152  -48.837 87.190  1.00 113.07 ? 539  ASP B CA  1 
ATOM   8448  C C   . ASP B  1 539 ? 48.718  -48.196 85.900  1.00 118.28 ? 539  ASP B C   1 
ATOM   8449  O O   . ASP B  1 539 ? 49.512  -48.818 85.181  1.00 118.74 ? 539  ASP B O   1 
ATOM   8450  C CB  . ASP B  1 539 ? 48.834  -50.181 87.553  1.00 116.31 ? 539  ASP B CB  1 
ATOM   8451  C CG  . ASP B  1 539 ? 48.321  -50.846 88.827  1.00 129.85 ? 539  ASP B CG  1 
ATOM   8452  O OD1 . ASP B  1 539 ? 47.776  -51.969 88.733  1.00 130.02 ? 539  ASP B OD1 1 
ATOM   8453  O OD2 . ASP B  1 539 ? 48.495  -50.258 89.924  1.00 139.38 ? 539  ASP B OD2 1 
ATOM   8454  N N   . GLY B  1 540 ? 48.268  -46.964 85.625  1.00 114.25 ? 540  GLY B N   1 
ATOM   8455  C CA  . GLY B  1 540 ? 48.694  -46.156 84.484  1.00 113.59 ? 540  GLY B CA  1 
ATOM   8456  C C   . GLY B  1 540 ? 48.511  -46.761 83.103  1.00 117.30 ? 540  GLY B C   1 
ATOM   8457  O O   . GLY B  1 540 ? 49.271  -46.450 82.174  1.00 116.31 ? 540  GLY B O   1 
ATOM   8458  N N   . LEU B  1 541 ? 47.471  -47.589 82.942  1.00 113.56 ? 541  LEU B N   1 
ATOM   8459  C CA  . LEU B  1 541 ? 47.164  -48.222 81.659  1.00 112.42 ? 541  LEU B CA  1 
ATOM   8460  C C   . LEU B  1 541 ? 45.917  -47.625 80.998  1.00 111.01 ? 541  LEU B C   1 
ATOM   8461  O O   . LEU B  1 541 ? 44.979  -47.247 81.704  1.00 110.65 ? 541  LEU B O   1 
ATOM   8462  C CB  . LEU B  1 541 ? 46.974  -49.729 81.856  1.00 113.64 ? 541  LEU B CB  1 
ATOM   8463  C CG  . LEU B  1 541 ? 48.237  -50.556 81.988  1.00 119.63 ? 541  LEU B CG  1 
ATOM   8464  C CD1 . LEU B  1 541 ? 47.971  -51.812 82.803  1.00 120.94 ? 541  LEU B CD1 1 
ATOM   8465  C CD2 . LEU B  1 541 ? 48.825  -50.891 80.610  1.00 120.97 ? 541  LEU B CD2 1 
ATOM   8466  N N   . LEU B  1 542 ? 45.901  -47.550 79.652  1.00 102.72 ? 542  LEU B N   1 
ATOM   8467  C CA  . LEU B  1 542 ? 44.736  -47.045 78.923  1.00 99.98  ? 542  LEU B CA  1 
ATOM   8468  C C   . LEU B  1 542 ? 43.674  -48.156 78.805  1.00 105.28 ? 542  LEU B C   1 
ATOM   8469  O O   . LEU B  1 542 ? 44.040  -49.301 78.530  1.00 107.32 ? 542  LEU B O   1 
ATOM   8470  C CB  . LEU B  1 542 ? 45.128  -46.529 77.533  1.00 98.29  ? 542  LEU B CB  1 
ATOM   8471  C CG  . LEU B  1 542 ? 46.021  -45.298 77.481  1.00 101.69 ? 542  LEU B CG  1 
ATOM   8472  C CD1 . LEU B  1 542 ? 46.418  -44.988 76.067  1.00 101.02 ? 542  LEU B CD1 1 
ATOM   8473  C CD2 . LEU B  1 542 ? 45.337  -44.086 78.058  1.00 102.33 ? 542  LEU B CD2 1 
ATOM   8474  N N   . THR B  1 543 ? 42.374  -47.835 79.047  1.00 98.64  ? 543  THR B N   1 
ATOM   8475  C CA  . THR B  1 543 ? 41.259  -48.800 78.980  1.00 96.63  ? 543  THR B CA  1 
ATOM   8476  C C   . THR B  1 543 ? 40.918  -49.137 77.532  1.00 98.26  ? 543  THR B C   1 
ATOM   8477  O O   . THR B  1 543 ? 40.555  -50.280 77.240  1.00 99.20  ? 543  THR B O   1 
ATOM   8478  C CB  . THR B  1 543 ? 40.078  -48.312 79.840  1.00 94.60  ? 543  THR B CB  1 
ATOM   8479  O OG1 . THR B  1 543 ? 40.463  -48.341 81.208  1.00 90.75  ? 543  THR B OG1 1 
ATOM   8480  C CG2 . THR B  1 543 ? 38.825  -49.141 79.683  1.00 91.23  ? 543  THR B CG2 1 
ATOM   8481  N N   . CYS B  1 544 ? 41.043  -48.146 76.630  1.00 92.40  ? 544  CYS B N   1 
ATOM   8482  C CA  . CYS B  1 544 ? 40.772  -48.282 75.195  1.00 91.55  ? 544  CYS B CA  1 
ATOM   8483  C C   . CYS B  1 544 ? 41.568  -47.271 74.380  1.00 94.53  ? 544  CYS B C   1 
ATOM   8484  O O   . CYS B  1 544 ? 41.924  -46.195 74.876  1.00 94.07  ? 544  CYS B O   1 
ATOM   8485  C CB  . CYS B  1 544 ? 39.274  -48.199 74.886  1.00 91.15  ? 544  CYS B CB  1 
ATOM   8486  S SG  . CYS B  1 544 ? 38.585  -46.516 74.921  1.00 93.65  ? 544  CYS B SG  1 
ATOM   8487  N N   . HIS B  1 545 ? 41.795  -47.609 73.111  1.00 89.95  ? 545  HIS B N   1 
ATOM   8488  C CA  . HIS B  1 545 ? 42.552  -46.807 72.149  1.00 88.57  ? 545  HIS B CA  1 
ATOM   8489  C C   . HIS B  1 545 ? 41.680  -46.469 70.916  1.00 88.15  ? 545  HIS B C   1 
ATOM   8490  O O   . HIS B  1 545 ? 42.197  -46.304 69.807  1.00 87.07  ? 545  HIS B O   1 
ATOM   8491  C CB  . HIS B  1 545 ? 43.856  -47.543 71.763  1.00 90.35  ? 545  HIS B CB  1 
ATOM   8492  C CG  . HIS B  1 545 ? 43.650  -48.996 71.453  1.00 94.63  ? 545  HIS B CG  1 
ATOM   8493  N ND1 . HIS B  1 545 ? 43.182  -49.412 70.209  1.00 96.21  ? 545  HIS B ND1 1 
ATOM   8494  C CD2 . HIS B  1 545 ? 43.814  -50.081 72.245  1.00 97.15  ? 545  HIS B CD2 1 
ATOM   8495  C CE1 . HIS B  1 545 ? 43.106  -50.729 70.278  1.00 96.43  ? 545  HIS B CE1 1 
ATOM   8496  N NE2 . HIS B  1 545 ? 43.476  -51.178 71.483  1.00 97.49  ? 545  HIS B NE2 1 
ATOM   8497  N N   . GLY B  1 546 ? 40.370  -46.348 71.144  1.00 81.79  ? 546  GLY B N   1 
ATOM   8498  C CA  . GLY B  1 546 ? 39.393  -46.027 70.113  1.00 80.45  ? 546  GLY B CA  1 
ATOM   8499  C C   . GLY B  1 546 ? 37.980  -46.450 70.454  1.00 85.72  ? 546  GLY B C   1 
ATOM   8500  O O   . GLY B  1 546 ? 37.735  -46.956 71.557  1.00 86.65  ? 546  GLY B O   1 
ATOM   8501  N N   . PRO B  1 547 ? 37.022  -46.277 69.515  1.00 82.37  ? 547  PRO B N   1 
ATOM   8502  C CA  . PRO B  1 547 ? 35.622  -46.654 69.806  1.00 83.18  ? 547  PRO B CA  1 
ATOM   8503  C C   . PRO B  1 547 ? 35.243  -48.086 69.444  1.00 91.48  ? 547  PRO B C   1 
ATOM   8504  O O   . PRO B  1 547 ? 35.797  -48.682 68.511  1.00 91.30  ? 547  PRO B O   1 
ATOM   8505  C CB  . PRO B  1 547 ? 34.813  -45.657 68.987  1.00 83.58  ? 547  PRO B CB  1 
ATOM   8506  C CG  . PRO B  1 547 ? 35.740  -45.269 67.834  1.00 86.87  ? 547  PRO B CG  1 
ATOM   8507  C CD  . PRO B  1 547 ? 37.149  -45.688 68.169  1.00 82.74  ? 547  PRO B CD  1 
ATOM   8508  N N   . GLY B  1 548 ? 34.266  -48.607 70.177  1.00 91.39  ? 548  GLY B N   1 
ATOM   8509  C CA  . GLY B  1 548 ? 33.751  -49.959 69.998  1.00 92.93  ? 548  GLY B CA  1 
ATOM   8510  C C   . GLY B  1 548 ? 34.488  -51.022 70.806  1.00 98.53  ? 548  GLY B C   1 
ATOM   8511  O O   . GLY B  1 548 ? 35.532  -50.730 71.413  1.00 99.35  ? 548  GLY B O   1 
ATOM   8512  N N   . PRO B  1 549 ? 33.978  -52.285 70.814  1.00 93.51  ? 549  PRO B N   1 
ATOM   8513  C CA  . PRO B  1 549 ? 34.648  -53.341 71.588  1.00 94.03  ? 549  PRO B CA  1 
ATOM   8514  C C   . PRO B  1 549 ? 35.921  -53.900 70.943  1.00 99.30  ? 549  PRO B C   1 
ATOM   8515  O O   . PRO B  1 549 ? 36.700  -54.598 71.613  1.00 97.66  ? 549  PRO B O   1 
ATOM   8516  C CB  . PRO B  1 549 ? 33.568  -54.404 71.741  1.00 96.45  ? 549  PRO B CB  1 
ATOM   8517  C CG  . PRO B  1 549 ? 32.350  -53.883 71.016  1.00 99.95  ? 549  PRO B CG  1 
ATOM   8518  C CD  . PRO B  1 549 ? 32.781  -52.805 70.129  1.00 94.16  ? 549  PRO B CD  1 
ATOM   8519  N N   . ASP B  1 550 ? 36.133  -53.600 69.635  1.00 97.90  ? 550  ASP B N   1 
ATOM   8520  C CA  . ASP B  1 550 ? 37.316  -54.027 68.881  1.00 98.78  ? 550  ASP B CA  1 
ATOM   8521  C C   . ASP B  1 550 ? 38.553  -53.280 69.340  1.00 102.65 ? 550  ASP B C   1 
ATOM   8522  O O   . ASP B  1 550 ? 39.632  -53.882 69.407  1.00 104.79 ? 550  ASP B O   1 
ATOM   8523  C CB  . ASP B  1 550 ? 37.116  -53.903 67.358  1.00 100.63 ? 550  ASP B CB  1 
ATOM   8524  C CG  . ASP B  1 550 ? 36.562  -52.574 66.878  1.00 118.08 ? 550  ASP B CG  1 
ATOM   8525  O OD1 . ASP B  1 550 ? 35.329  -52.371 66.976  1.00 118.73 ? 550  ASP B OD1 1 
ATOM   8526  O OD2 . ASP B  1 550 ? 37.346  -51.765 66.341  1.00 129.27 ? 550  ASP B OD2 1 
ATOM   8527  N N   . ASN B  1 551 ? 38.386  -51.994 69.729  1.00 95.77  ? 551  ASN B N   1 
ATOM   8528  C CA  . ASN B  1 551 ? 39.469  -51.133 70.206  1.00 94.44  ? 551  ASN B CA  1 
ATOM   8529  C C   . ASN B  1 551 ? 39.699  -51.151 71.740  1.00 97.32  ? 551  ASN B C   1 
ATOM   8530  O O   . ASN B  1 551 ? 40.165  -50.159 72.306  1.00 96.15  ? 551  ASN B O   1 
ATOM   8531  C CB  . ASN B  1 551 ? 39.306  -49.718 69.652  1.00 93.46  ? 551  ASN B CB  1 
ATOM   8532  C CG  . ASN B  1 551 ? 39.677  -49.572 68.194  1.00 113.49 ? 551  ASN B CG  1 
ATOM   8533  O OD1 . ASN B  1 551 ? 40.845  -49.736 67.804  1.00 110.94 ? 551  ASN B OD1 1 
ATOM   8534  N ND2 . ASN B  1 551 ? 38.697  -49.206 67.363  1.00 99.84  ? 551  ASN B ND2 1 
ATOM   8535  N N   . CYS B  1 552 ? 39.417  -52.298 72.395  1.00 94.87  ? 552  CYS B N   1 
ATOM   8536  C CA  . CYS B  1 552 ? 39.612  -52.493 73.839  1.00 95.59  ? 552  CYS B CA  1 
ATOM   8537  C C   . CYS B  1 552 ? 41.073  -52.878 74.132  1.00 98.45  ? 552  CYS B C   1 
ATOM   8538  O O   . CYS B  1 552 ? 41.797  -53.324 73.237  1.00 98.51  ? 552  CYS B O   1 
ATOM   8539  C CB  . CYS B  1 552 ? 38.654  -53.554 74.394  1.00 97.08  ? 552  CYS B CB  1 
ATOM   8540  S SG  . CYS B  1 552 ? 36.961  -52.980 74.765  1.00 100.39 ? 552  CYS B SG  1 
ATOM   8541  N N   . THR B  1 553 ? 41.476  -52.758 75.401  1.00 93.94  ? 553  THR B N   1 
ATOM   8542  C CA  . THR B  1 553 ? 42.797  -53.163 75.869  1.00 94.37  ? 553  THR B CA  1 
ATOM   8543  C C   . THR B  1 553 ? 42.674  -54.625 76.365  1.00 102.76 ? 553  THR B C   1 
ATOM   8544  O O   . THR B  1 553 ? 43.416  -55.514 75.913  1.00 104.38 ? 553  THR B O   1 
ATOM   8545  C CB  . THR B  1 553 ? 43.317  -52.143 76.894  1.00 90.42  ? 553  THR B CB  1 
ATOM   8546  O OG1 . THR B  1 553 ? 43.675  -50.960 76.186  1.00 89.22  ? 553  THR B OG1 1 
ATOM   8547  C CG2 . THR B  1 553 ? 44.516  -52.629 77.657  1.00 85.18  ? 553  THR B CG2 1 
ATOM   8548  N N   . LYS B  1 554 ? 41.692  -54.864 77.262  1.00 98.91  ? 554  LYS B N   1 
ATOM   8549  C CA  . LYS B  1 554 ? 41.363  -56.159 77.852  1.00 98.45  ? 554  LYS B CA  1 
ATOM   8550  C C   . LYS B  1 554 ? 39.843  -56.232 77.924  1.00 102.19 ? 554  LYS B C   1 
ATOM   8551  O O   . LYS B  1 554 ? 39.195  -55.207 78.159  1.00 101.57 ? 554  LYS B O   1 
ATOM   8552  C CB  . LYS B  1 554 ? 41.971  -56.264 79.258  1.00 100.52 ? 554  LYS B CB  1 
ATOM   8553  C CG  . LYS B  1 554 ? 41.957  -57.671 79.846  1.00 116.05 ? 554  LYS B CG  1 
ATOM   8554  C CD  . LYS B  1 554 ? 42.255  -57.655 81.345  1.00 122.60 ? 554  LYS B CD  1 
ATOM   8555  C CE  . LYS B  1 554 ? 42.255  -59.019 81.979  1.00 124.78 ? 554  LYS B CE  1 
ATOM   8556  N NZ  . LYS B  1 554 ? 43.535  -59.737 81.737  1.00 130.44 ? 554  LYS B NZ  1 
ATOM   8557  N N   . CYS B  1 555 ? 39.269  -57.425 77.706  1.00 99.51  ? 555  CYS B N   1 
ATOM   8558  C CA  . CYS B  1 555 ? 37.818  -57.608 77.761  1.00 99.21  ? 555  CYS B CA  1 
ATOM   8559  C C   . CYS B  1 555 ? 37.364  -57.931 79.153  1.00 102.33 ? 555  CYS B C   1 
ATOM   8560  O O   . CYS B  1 555 ? 38.042  -58.688 79.851  1.00 102.54 ? 555  CYS B O   1 
ATOM   8561  C CB  . CYS B  1 555 ? 37.360  -58.665 76.770  1.00 100.48 ? 555  CYS B CB  1 
ATOM   8562  S SG  . CYS B  1 555 ? 37.935  -58.383 75.077  1.00 103.91 ? 555  CYS B SG  1 
ATOM   8563  N N   . SER B  1 556 ? 36.190  -57.384 79.540  1.00 98.68  ? 556  SER B N   1 
ATOM   8564  C CA  . SER B  1 556 ? 35.557  -57.568 80.855  1.00 99.60  ? 556  SER B CA  1 
ATOM   8565  C C   . SER B  1 556 ? 35.124  -59.018 80.985  1.00 105.69 ? 556  SER B C   1 
ATOM   8566  O O   . SER B  1 556 ? 35.344  -59.691 82.018  1.00 107.34 ? 556  SER B O   1 
ATOM   8567  C CB  . SER B  1 556 ? 34.295  -56.709 80.971  1.00 103.08 ? 556  SER B CB  1 
ATOM   8568  O OG  . SER B  1 556 ? 34.523  -55.320 81.130  1.00 117.92 ? 556  SER B OG  1 
ATOM   8569  N N   . HIS B  1 557 ? 34.485  -59.490 79.907  1.00 100.21 ? 557  HIS B N   1 
ATOM   8570  C CA  . HIS B  1 557 ? 33.891  -60.808 79.892  1.00 99.42  ? 557  HIS B CA  1 
ATOM   8571  C C   . HIS B  1 557 ? 34.529  -61.736 78.860  1.00 101.31 ? 557  HIS B C   1 
ATOM   8572  O O   . HIS B  1 557 ? 35.498  -62.420 79.209  1.00 100.49 ? 557  HIS B O   1 
ATOM   8573  C CB  . HIS B  1 557 ? 32.348  -60.702 79.792  1.00 99.20  ? 557  HIS B CB  1 
ATOM   8574  C CG  . HIS B  1 557 ? 31.739  -59.855 80.873  1.00 101.45 ? 557  HIS B CG  1 
ATOM   8575  N ND1 . HIS B  1 557 ? 31.340  -58.554 80.631  1.00 101.56 ? 557  HIS B ND1 1 
ATOM   8576  C CD2 . HIS B  1 557 ? 31.539  -60.134 82.179  1.00 103.27 ? 557  HIS B CD2 1 
ATOM   8577  C CE1 . HIS B  1 557 ? 30.892  -58.097 81.786  1.00 100.79 ? 557  HIS B CE1 1 
ATOM   8578  N NE2 . HIS B  1 557 ? 30.997  -59.014 82.747  1.00 102.32 ? 557  HIS B NE2 1 
ATOM   8579  N N   . PHE B  1 558 ? 34.020  -61.751 77.605  1.00 96.30  ? 558  PHE B N   1 
ATOM   8580  C CA  . PHE B  1 558 ? 34.508  -62.632 76.538  1.00 95.89  ? 558  PHE B CA  1 
ATOM   8581  C C   . PHE B  1 558 ? 34.942  -61.871 75.297  1.00 97.90  ? 558  PHE B C   1 
ATOM   8582  O O   . PHE B  1 558 ? 34.620  -60.695 75.180  1.00 95.35  ? 558  PHE B O   1 
ATOM   8583  C CB  . PHE B  1 558 ? 33.439  -63.674 76.159  1.00 98.06  ? 558  PHE B CB  1 
ATOM   8584  C CG  . PHE B  1 558 ? 32.891  -64.485 77.308  1.00 100.10 ? 558  PHE B CG  1 
ATOM   8585  C CD1 . PHE B  1 558 ? 31.633  -64.209 77.837  1.00 102.85 ? 558  PHE B CD1 1 
ATOM   8586  C CD2 . PHE B  1 558 ? 33.622  -65.535 77.851  1.00 102.32 ? 558  PHE B CD2 1 
ATOM   8587  C CE1 . PHE B  1 558 ? 31.111  -64.975 78.880  1.00 104.59 ? 558  PHE B CE1 1 
ATOM   8588  C CE2 . PHE B  1 558 ? 33.111  -66.282 78.910  1.00 106.16 ? 558  PHE B CE2 1 
ATOM   8589  C CZ  . PHE B  1 558 ? 31.854  -66.004 79.411  1.00 104.39 ? 558  PHE B CZ  1 
ATOM   8590  N N   . LYS B  1 559 ? 35.654  -62.561 74.362  1.00 95.51  ? 559  LYS B N   1 
ATOM   8591  C CA  . LYS B  1 559 ? 36.160  -62.007 73.106  1.00 94.83  ? 559  LYS B CA  1 
ATOM   8592  C C   . LYS B  1 559 ? 35.729  -62.845 71.876  1.00 99.40  ? 559  LYS B C   1 
ATOM   8593  O O   . LYS B  1 559 ? 36.310  -63.906 71.608  1.00 101.57 ? 559  LYS B O   1 
ATOM   8594  C CB  . LYS B  1 559 ? 37.692  -61.843 73.173  1.00 97.79  ? 559  LYS B CB  1 
ATOM   8595  C CG  . LYS B  1 559 ? 38.288  -60.953 72.068  1.00 119.01 ? 559  LYS B CG  1 
ATOM   8596  C CD  . LYS B  1 559 ? 39.826  -60.938 72.117  1.00 132.59 ? 559  LYS B CD  1 
ATOM   8597  C CE  . LYS B  1 559 ? 40.445  -59.823 71.295  1.00 136.33 ? 559  LYS B CE  1 
ATOM   8598  N NZ  . LYS B  1 559 ? 41.877  -59.606 71.641  1.00 142.21 ? 559  LYS B NZ  1 
ATOM   8599  N N   . ASP B  1 560 ? 34.704  -62.361 71.137  1.00 93.66  ? 560  ASP B N   1 
ATOM   8600  C CA  . ASP B  1 560 ? 34.216  -63.015 69.922  1.00 93.79  ? 560  ASP B CA  1 
ATOM   8601  C C   . ASP B  1 560 ? 34.990  -62.441 68.736  1.00 99.63  ? 560  ASP B C   1 
ATOM   8602  O O   . ASP B  1 560 ? 34.521  -61.507 68.066  1.00 97.08  ? 560  ASP B O   1 
ATOM   8603  C CB  . ASP B  1 560 ? 32.692  -62.842 69.745  1.00 94.63  ? 560  ASP B CB  1 
ATOM   8604  C CG  . ASP B  1 560 ? 32.065  -63.538 68.540  1.00 103.97 ? 560  ASP B CG  1 
ATOM   8605  O OD1 . ASP B  1 560 ? 32.777  -64.300 67.841  1.00 106.07 ? 560  ASP B OD1 1 
ATOM   8606  O OD2 . ASP B  1 560 ? 30.855  -63.347 68.312  1.00 107.36 ? 560  ASP B OD2 1 
ATOM   8607  N N   . GLY B  1 561 ? 36.183  -63.000 68.513  1.00 98.89  ? 561  GLY B N   1 
ATOM   8608  C CA  . GLY B  1 561 ? 37.087  -62.585 67.452  1.00 99.11  ? 561  GLY B CA  1 
ATOM   8609  C C   . GLY B  1 561 ? 37.764  -61.273 67.784  1.00 104.53 ? 561  GLY B C   1 
ATOM   8610  O O   . GLY B  1 561 ? 38.564  -61.230 68.725  1.00 105.24 ? 561  GLY B O   1 
ATOM   8611  N N   . PRO B  1 562 ? 37.441  -60.167 67.060  1.00 100.68 ? 562  PRO B N   1 
ATOM   8612  C CA  . PRO B  1 562 ? 38.093  -58.876 67.366  1.00 99.60  ? 562  PRO B CA  1 
ATOM   8613  C C   . PRO B  1 562 ? 37.484  -58.082 68.532  1.00 102.70 ? 562  PRO B C   1 
ATOM   8614  O O   . PRO B  1 562 ? 38.217  -57.378 69.232  1.00 102.19 ? 562  PRO B O   1 
ATOM   8615  C CB  . PRO B  1 562 ? 37.972  -58.111 66.048  1.00 100.49 ? 562  PRO B CB  1 
ATOM   8616  C CG  . PRO B  1 562 ? 36.713  -58.644 65.411  1.00 104.67 ? 562  PRO B CG  1 
ATOM   8617  C CD  . PRO B  1 562 ? 36.510  -60.049 65.911  1.00 101.56 ? 562  PRO B CD  1 
ATOM   8618  N N   . ASN B  1 563 ? 36.142  -58.181 68.716  1.00 98.44  ? 563  ASN B N   1 
ATOM   8619  C CA  . ASN B  1 563 ? 35.344  -57.475 69.722  1.00 96.96  ? 563  ASN B CA  1 
ATOM   8620  C C   . ASN B  1 563 ? 35.150  -58.226 71.038  1.00 99.77  ? 563  ASN B C   1 
ATOM   8621  O O   . ASN B  1 563 ? 35.020  -59.451 71.055  1.00 99.44  ? 563  ASN B O   1 
ATOM   8622  C CB  . ASN B  1 563 ? 33.946  -57.104 69.180  1.00 96.96  ? 563  ASN B CB  1 
ATOM   8623  C CG  . ASN B  1 563 ? 33.803  -57.071 67.694  1.00 127.32 ? 563  ASN B CG  1 
ATOM   8624  O OD1 . ASN B  1 563 ? 33.974  -56.033 67.059  1.00 118.87 ? 563  ASN B OD1 1 
ATOM   8625  N ND2 . ASN B  1 563 ? 33.477  -58.208 67.113  1.00 128.30 ? 563  ASN B ND2 1 
ATOM   8626  N N   . CYS B  1 564 ? 35.048  -57.459 72.128  1.00 95.54  ? 564  CYS B N   1 
ATOM   8627  C CA  . CYS B  1 564 ? 34.726  -57.964 73.447  1.00 96.38  ? 564  CYS B CA  1 
ATOM   8628  C C   . CYS B  1 564 ? 33.209  -58.085 73.517  1.00 98.97  ? 564  CYS B C   1 
ATOM   8629  O O   . CYS B  1 564 ? 32.478  -57.196 73.043  1.00 96.88  ? 564  CYS B O   1 
ATOM   8630  C CB  . CYS B  1 564 ? 35.249  -57.041 74.537  1.00 97.01  ? 564  CYS B CB  1 
ATOM   8631  S SG  . CYS B  1 564 ? 37.011  -56.686 74.422  1.00 101.67 ? 564  CYS B SG  1 
ATOM   8632  N N   . VAL B  1 565 ? 32.731  -59.196 74.100  1.00 95.16  ? 565  VAL B N   1 
ATOM   8633  C CA  . VAL B  1 565 ? 31.305  -59.452 74.231  1.00 93.77  ? 565  VAL B CA  1 
ATOM   8634  C C   . VAL B  1 565 ? 30.925  -59.814 75.654  1.00 93.83  ? 565  VAL B C   1 
ATOM   8635  O O   . VAL B  1 565 ? 31.751  -60.339 76.405  1.00 93.94  ? 565  VAL B O   1 
ATOM   8636  C CB  . VAL B  1 565 ? 30.800  -60.490 73.198  1.00 98.90  ? 565  VAL B CB  1 
ATOM   8637  C CG1 . VAL B  1 565 ? 30.762  -59.893 71.796  1.00 97.81  ? 565  VAL B CG1 1 
ATOM   8638  C CG2 . VAL B  1 565 ? 31.640  -61.774 73.220  1.00 100.02 ? 565  VAL B CG2 1 
ATOM   8639  N N   . GLU B  1 566 ? 29.671  -59.518 76.014  1.00 87.28  ? 566  GLU B N   1 
ATOM   8640  C CA  . GLU B  1 566 ? 29.085  -59.811 77.307  1.00 87.23  ? 566  GLU B CA  1 
ATOM   8641  C C   . GLU B  1 566 ? 28.961  -61.345 77.478  1.00 94.78  ? 566  GLU B C   1 
ATOM   8642  O O   . GLU B  1 566 ? 29.289  -61.880 78.538  1.00 94.86  ? 566  GLU B O   1 
ATOM   8643  C CB  . GLU B  1 566 ? 27.721  -59.104 77.377  1.00 87.73  ? 566  GLU B CB  1 
ATOM   8644  C CG  . GLU B  1 566 ? 27.041  -59.085 78.734  1.00 99.20  ? 566  GLU B CG  1 
ATOM   8645  C CD  . GLU B  1 566 ? 27.868  -58.682 79.940  1.00 118.55 ? 566  GLU B CD  1 
ATOM   8646  O OE1 . GLU B  1 566 ? 28.284  -57.503 80.019  1.00 91.30  ? 566  GLU B OE1 1 
ATOM   8647  O OE2 . GLU B  1 566 ? 28.048  -59.541 80.835  1.00 124.73 ? 566  GLU B OE2 1 
ATOM   8648  N N   . LYS B  1 567 ? 28.525  -62.041 76.408  1.00 93.29  ? 567  LYS B N   1 
ATOM   8649  C CA  . LYS B  1 567 ? 28.343  -63.488 76.352  1.00 94.92  ? 567  LYS B CA  1 
ATOM   8650  C C   . LYS B  1 567 ? 28.629  -64.028 74.935  1.00 100.71 ? 567  LYS B C   1 
ATOM   8651  O O   . LYS B  1 567 ? 28.534  -63.287 73.951  1.00 98.57  ? 567  LYS B O   1 
ATOM   8652  C CB  . LYS B  1 567 ? 26.913  -63.855 76.805  1.00 98.22  ? 567  LYS B CB  1 
ATOM   8653  C CG  . LYS B  1 567 ? 26.767  -65.274 77.408  1.00 123.37 ? 567  LYS B CG  1 
ATOM   8654  C CD  . LYS B  1 567 ? 27.451  -65.491 78.791  1.00 129.10 ? 567  LYS B CD  1 
ATOM   8655  C CE  . LYS B  1 567 ? 27.928  -66.915 78.986  1.00 126.55 ? 567  LYS B CE  1 
ATOM   8656  N NZ  . LYS B  1 567 ? 28.655  -67.101 80.273  1.00 123.93 ? 567  LYS B NZ  1 
ATOM   8657  N N   . CYS B  1 568 ? 28.989  -65.323 74.840  1.00 101.37 ? 568  CYS B N   1 
ATOM   8658  C CA  . CYS B  1 568 ? 29.245  -65.987 73.561  1.00 102.62 ? 568  CYS B CA  1 
ATOM   8659  C C   . CYS B  1 568 ? 27.920  -66.194 72.820  1.00 107.87 ? 568  CYS B C   1 
ATOM   8660  O O   . CYS B  1 568 ? 26.932  -66.554 73.457  1.00 108.68 ? 568  CYS B O   1 
ATOM   8661  C CB  . CYS B  1 568 ? 29.994  -67.307 73.753  1.00 104.76 ? 568  CYS B CB  1 
ATOM   8662  S SG  . CYS B  1 568 ? 31.777  -67.133 74.088  1.00 108.80 ? 568  CYS B SG  1 
ATOM   8663  N N   . PRO B  1 569 ? 27.877  -65.957 71.491  1.00 104.92 ? 569  PRO B N   1 
ATOM   8664  C CA  . PRO B  1 569 ? 26.619  -66.126 70.738  1.00 105.64 ? 569  PRO B CA  1 
ATOM   8665  C C   . PRO B  1 569 ? 25.818  -67.416 70.982  1.00 112.61 ? 569  PRO B C   1 
ATOM   8666  O O   . PRO B  1 569 ? 26.412  -68.491 71.083  1.00 111.95 ? 569  PRO B O   1 
ATOM   8667  C CB  . PRO B  1 569 ? 27.080  -66.029 69.283  1.00 106.93 ? 569  PRO B CB  1 
ATOM   8668  C CG  . PRO B  1 569 ? 28.267  -65.186 69.328  1.00 110.11 ? 569  PRO B CG  1 
ATOM   8669  C CD  . PRO B  1 569 ? 28.969  -65.503 70.606  1.00 105.91 ? 569  PRO B CD  1 
ATOM   8670  N N   . ASP B  1 570 ? 24.456  -67.289 71.063  1.00 112.49 ? 570  ASP B N   1 
ATOM   8671  C CA  . ASP B  1 570 ? 23.481  -68.386 71.254  1.00 115.80 ? 570  ASP B CA  1 
ATOM   8672  C C   . ASP B  1 570 ? 22.161  -68.255 70.400  1.00 121.08 ? 570  ASP B C   1 
ATOM   8673  O O   . ASP B  1 570 ? 21.037  -68.405 70.908  1.00 120.95 ? 570  ASP B O   1 
ATOM   8674  C CB  . ASP B  1 570 ? 23.223  -68.691 72.757  1.00 119.40 ? 570  ASP B CB  1 
ATOM   8675  C CG  . ASP B  1 570 ? 22.269  -67.736 73.468  1.00 139.31 ? 570  ASP B CG  1 
ATOM   8676  O OD1 . ASP B  1 570 ? 22.664  -66.566 73.713  1.00 140.78 ? 570  ASP B OD1 1 
ATOM   8677  O OD2 . ASP B  1 570 ? 21.114  -68.152 73.760  1.00 147.38 ? 570  ASP B OD2 1 
ATOM   8678  N N   . GLY B  1 571 ? 22.337  -67.996 69.101  1.00 118.14 ? 571  GLY B N   1 
ATOM   8679  C CA  . GLY B  1 571 ? 21.253  -67.873 68.126  1.00 118.22 ? 571  GLY B CA  1 
ATOM   8680  C C   . GLY B  1 571 ? 20.507  -66.550 68.110  1.00 120.86 ? 571  GLY B C   1 
ATOM   8681  O O   . GLY B  1 571 ? 19.305  -66.522 67.833  1.00 120.89 ? 571  GLY B O   1 
ATOM   8682  N N   . LEU B  1 572 ? 21.202  -65.445 68.432  1.00 115.43 ? 572  LEU B N   1 
ATOM   8683  C CA  . LEU B  1 572 ? 20.605  -64.105 68.444  1.00 123.18 ? 572  LEU B CA  1 
ATOM   8684  C C   . LEU B  1 572 ? 21.248  -63.277 67.349  1.00 146.34 ? 572  LEU B C   1 
ATOM   8685  O O   . LEU B  1 572 ? 21.517  -63.817 66.274  1.00 112.31 ? 572  LEU B O   1 
ATOM   8686  C CB  . LEU B  1 572 ? 20.735  -63.422 69.826  1.00 122.39 ? 572  LEU B CB  1 
ATOM   8687  C CG  . LEU B  1 572 ? 19.703  -63.847 70.895  1.00 127.41 ? 572  LEU B CG  1 
ATOM   8688  C CD1 . LEU B  1 572 ? 20.381  -64.275 72.189  1.00 127.70 ? 572  LEU B CD1 1 
ATOM   8689  C CD2 . LEU B  1 572 ? 18.680  -62.747 71.155  1.00 127.74 ? 572  LEU B CD2 1 
ATOM   8690  N N   . PHE B  1 578 ? 21.488  -66.408 64.092  1.00 120.05 ? 578  PHE B N   1 
ATOM   8691  C CA  . PHE B  1 578 ? 21.444  -67.823 64.488  1.00 122.16 ? 578  PHE B CA  1 
ATOM   8692  C C   . PHE B  1 578 ? 22.833  -68.510 64.435  1.00 122.98 ? 578  PHE B C   1 
ATOM   8693  O O   . PHE B  1 578 ? 23.044  -69.502 63.729  1.00 122.84 ? 578  PHE B O   1 
ATOM   8694  C CB  . PHE B  1 578 ? 20.368  -68.599 63.690  1.00 126.30 ? 578  PHE B CB  1 
ATOM   8695  C CG  . PHE B  1 578 ? 18.971  -68.712 64.282  1.00 129.81 ? 578  PHE B CG  1 
ATOM   8696  C CD1 . PHE B  1 578 ? 18.052  -69.627 63.770  1.00 135.45 ? 578  PHE B CD1 1 
ATOM   8697  C CD2 . PHE B  1 578 ? 18.563  -67.881 65.325  1.00 131.90 ? 578  PHE B CD2 1 
ATOM   8698  C CE1 . PHE B  1 578 ? 16.755  -69.720 64.302  1.00 137.45 ? 578  PHE B CE1 1 
ATOM   8699  C CE2 . PHE B  1 578 ? 17.269  -67.979 65.862  1.00 135.80 ? 578  PHE B CE2 1 
ATOM   8700  C CZ  . PHE B  1 578 ? 16.373  -68.894 65.345  1.00 135.75 ? 578  PHE B CZ  1 
ATOM   8701  N N   . ILE B  1 579 ? 23.776  -67.953 65.203  1.00 116.69 ? 579  ILE B N   1 
ATOM   8702  C CA  . ILE B  1 579 ? 25.165  -68.407 65.289  1.00 115.67 ? 579  ILE B CA  1 
ATOM   8703  C C   . ILE B  1 579 ? 25.426  -68.887 66.713  1.00 117.16 ? 579  ILE B C   1 
ATOM   8704  O O   . ILE B  1 579 ? 25.076  -68.171 67.656  1.00 117.32 ? 579  ILE B O   1 
ATOM   8705  C CB  . ILE B  1 579 ? 26.129  -67.241 64.882  1.00 117.02 ? 579  ILE B CB  1 
ATOM   8706  C CG1 . ILE B  1 579 ? 25.836  -66.677 63.459  1.00 116.70 ? 579  ILE B CG1 1 
ATOM   8707  C CG2 . ILE B  1 579 ? 27.613  -67.599 65.079  1.00 118.06 ? 579  ILE B CG2 1 
ATOM   8708  C CD1 . ILE B  1 579 ? 25.604  -67.752 62.260  1.00 126.63 ? 579  ILE B CD1 1 
ATOM   8709  N N   . PHE B  1 580 ? 26.044  -70.078 66.874  1.00 110.17 ? 580  PHE B N   1 
ATOM   8710  C CA  . PHE B  1 580 ? 26.333  -70.636 68.198  1.00 108.63 ? 580  PHE B CA  1 
ATOM   8711  C C   . PHE B  1 580 ? 27.809  -70.759 68.443  1.00 109.27 ? 580  PHE B C   1 
ATOM   8712  O O   . PHE B  1 580 ? 28.527  -71.294 67.596  1.00 109.94 ? 580  PHE B O   1 
ATOM   8713  C CB  . PHE B  1 580 ? 25.678  -71.999 68.375  1.00 111.95 ? 580  PHE B CB  1 
ATOM   8714  C CG  . PHE B  1 580 ? 24.188  -71.998 68.185  1.00 113.64 ? 580  PHE B CG  1 
ATOM   8715  C CD1 . PHE B  1 580 ? 23.630  -72.313 66.954  1.00 117.34 ? 580  PHE B CD1 1 
ATOM   8716  C CD2 . PHE B  1 580 ? 23.337  -71.714 69.246  1.00 115.83 ? 580  PHE B CD2 1 
ATOM   8717  C CE1 . PHE B  1 580 ? 22.248  -72.339 66.786  1.00 119.03 ? 580  PHE B CE1 1 
ATOM   8718  C CE2 . PHE B  1 580 ? 21.953  -71.744 69.078  1.00 119.36 ? 580  PHE B CE2 1 
ATOM   8719  C CZ  . PHE B  1 580 ? 21.417  -72.059 67.850  1.00 118.05 ? 580  PHE B CZ  1 
ATOM   8720  N N   . LYS B  1 581 ? 28.262  -70.291 69.609  1.00 101.55 ? 581  LYS B N   1 
ATOM   8721  C CA  . LYS B  1 581 ? 29.662  -70.332 69.998  1.00 99.45  ? 581  LYS B CA  1 
ATOM   8722  C C   . LYS B  1 581 ? 29.799  -70.686 71.471  1.00 102.49 ? 581  LYS B C   1 
ATOM   8723  O O   . LYS B  1 581 ? 29.003  -70.234 72.289  1.00 102.59 ? 581  LYS B O   1 
ATOM   8724  C CB  . LYS B  1 581 ? 30.333  -68.978 69.719  1.00 99.33  ? 581  LYS B CB  1 
ATOM   8725  C CG  . LYS B  1 581 ? 30.731  -68.744 68.269  1.00 104.20 ? 581  LYS B CG  1 
ATOM   8726  C CD  . LYS B  1 581 ? 31.273  -67.345 68.026  1.00 101.86 ? 581  LYS B CD  1 
ATOM   8727  C CE  . LYS B  1 581 ? 31.976  -67.237 66.696  1.00 99.47  ? 581  LYS B CE  1 
ATOM   8728  N NZ  . LYS B  1 581 ? 33.440  -67.449 66.829  1.00 105.44 ? 581  LYS B NZ  1 
ATOM   8729  N N   . TYR B  1 582 ? 30.804  -71.496 71.810  1.00 98.48  ? 582  TYR B N   1 
ATOM   8730  C CA  . TYR B  1 582 ? 31.123  -71.868 73.194  1.00 98.46  ? 582  TYR B CA  1 
ATOM   8731  C C   . TYR B  1 582 ? 32.354  -71.018 73.646  1.00 101.26 ? 582  TYR B C   1 
ATOM   8732  O O   . TYR B  1 582 ? 33.029  -70.442 72.784  1.00 99.54  ? 582  TYR B O   1 
ATOM   8733  C CB  . TYR B  1 582 ? 31.398  -73.390 73.300  1.00 100.95 ? 582  TYR B CB  1 
ATOM   8734  C CG  . TYR B  1 582 ? 32.767  -73.813 72.802  1.00 101.58 ? 582  TYR B CG  1 
ATOM   8735  C CD1 . TYR B  1 582 ? 33.846  -73.920 73.677  1.00 103.24 ? 582  TYR B CD1 1 
ATOM   8736  C CD2 . TYR B  1 582 ? 32.990  -74.080 71.453  1.00 102.11 ? 582  TYR B CD2 1 
ATOM   8737  C CE1 . TYR B  1 582 ? 35.116  -74.262 73.219  1.00 103.30 ? 582  TYR B CE1 1 
ATOM   8738  C CE2 . TYR B  1 582 ? 34.252  -74.437 70.987  1.00 103.07 ? 582  TYR B CE2 1 
ATOM   8739  C CZ  . TYR B  1 582 ? 35.311  -74.534 71.876  1.00 108.24 ? 582  TYR B CZ  1 
ATOM   8740  O OH  . TYR B  1 582 ? 36.556  -74.897 71.424  1.00 107.79 ? 582  TYR B OH  1 
ATOM   8741  N N   . ALA B  1 583 ? 32.661  -70.965 74.966  1.00 98.16  ? 583  ALA B N   1 
ATOM   8742  C CA  . ALA B  1 583 ? 33.808  -70.195 75.472  1.00 97.49  ? 583  ALA B CA  1 
ATOM   8743  C C   . ALA B  1 583 ? 34.911  -71.085 76.007  1.00 106.43 ? 583  ALA B C   1 
ATOM   8744  O O   . ALA B  1 583 ? 34.653  -71.939 76.854  1.00 107.75 ? 583  ALA B O   1 
ATOM   8745  C CB  . ALA B  1 583 ? 33.361  -69.229 76.544  1.00 96.97  ? 583  ALA B CB  1 
ATOM   8746  N N   . ASP B  1 584 ? 36.136  -70.897 75.514  1.00 106.02 ? 584  ASP B N   1 
ATOM   8747  C CA  . ASP B  1 584 ? 37.288  -71.684 75.959  1.00 108.96 ? 584  ASP B CA  1 
ATOM   8748  C C   . ASP B  1 584 ? 37.855  -71.163 77.316  1.00 115.21 ? 584  ASP B C   1 
ATOM   8749  O O   . ASP B  1 584 ? 37.476  -70.059 77.722  1.00 112.25 ? 584  ASP B O   1 
ATOM   8750  C CB  . ASP B  1 584 ? 38.360  -71.753 74.844  1.00 111.37 ? 584  ASP B CB  1 
ATOM   8751  C CG  . ASP B  1 584 ? 39.343  -70.595 74.772  1.00 125.11 ? 584  ASP B CG  1 
ATOM   8752  O OD1 . ASP B  1 584 ? 38.909  -69.464 74.464  1.00 124.72 ? 584  ASP B OD1 1 
ATOM   8753  O OD2 . ASP B  1 584 ? 40.558  -70.840 74.934  1.00 133.87 ? 584  ASP B OD2 1 
ATOM   8754  N N   . PRO B  1 585 ? 38.754  -71.906 78.033  1.00 116.21 ? 585  PRO B N   1 
ATOM   8755  C CA  . PRO B  1 585 ? 39.277  -71.392 79.325  1.00 116.88 ? 585  PRO B CA  1 
ATOM   8756  C C   . PRO B  1 585 ? 40.024  -70.041 79.287  1.00 119.65 ? 585  PRO B C   1 
ATOM   8757  O O   . PRO B  1 585 ? 40.262  -69.434 80.337  1.00 118.59 ? 585  PRO B O   1 
ATOM   8758  C CB  . PRO B  1 585 ? 40.166  -72.533 79.832  1.00 120.37 ? 585  PRO B CB  1 
ATOM   8759  C CG  . PRO B  1 585 ? 40.520  -73.325 78.607  1.00 125.19 ? 585  PRO B CG  1 
ATOM   8760  C CD  . PRO B  1 585 ? 39.310  -73.245 77.733  1.00 119.77 ? 585  PRO B CD  1 
ATOM   8761  N N   . ASP B  1 586 ? 40.379  -69.574 78.077  1.00 115.99 ? 586  ASP B N   1 
ATOM   8762  C CA  . ASP B  1 586 ? 41.032  -68.283 77.822  1.00 115.18 ? 586  ASP B CA  1 
ATOM   8763  C C   . ASP B  1 586 ? 39.976  -67.198 77.458  1.00 115.88 ? 586  ASP B C   1 
ATOM   8764  O O   . ASP B  1 586 ? 40.323  -66.116 76.980  1.00 114.36 ? 586  ASP B O   1 
ATOM   8765  C CB  . ASP B  1 586 ? 42.089  -68.418 76.703  1.00 117.87 ? 586  ASP B CB  1 
ATOM   8766  C CG  . ASP B  1 586 ? 43.237  -69.370 77.020  1.00 133.46 ? 586  ASP B CG  1 
ATOM   8767  O OD1 . ASP B  1 586 ? 43.666  -69.428 78.208  1.00 134.46 ? 586  ASP B OD1 1 
ATOM   8768  O OD2 . ASP B  1 586 ? 43.738  -70.020 76.082  1.00 141.86 ? 586  ASP B OD2 1 
ATOM   8769  N N   . ARG B  1 587 ? 38.685  -67.518 77.687  1.00 109.88 ? 587  ARG B N   1 
ATOM   8770  C CA  . ARG B  1 587 ? 37.507  -66.675 77.469  1.00 106.32 ? 587  ARG B CA  1 
ATOM   8771  C C   . ARG B  1 587 ? 37.192  -66.251 76.033  1.00 108.71 ? 587  ARG B C   1 
ATOM   8772  O O   . ARG B  1 587 ? 36.406  -65.329 75.846  1.00 107.50 ? 587  ARG B O   1 
ATOM   8773  C CB  . ARG B  1 587 ? 37.447  -65.512 78.475  1.00 100.09 ? 587  ARG B CB  1 
ATOM   8774  C CG  . ARG B  1 587 ? 37.466  -65.973 79.918  1.00 99.37  ? 587  ARG B CG  1 
ATOM   8775  C CD  . ARG B  1 587 ? 36.814  -64.991 80.835  1.00 97.53  ? 587  ARG B CD  1 
ATOM   8776  N NE  . ARG B  1 587 ? 36.702  -65.532 82.183  1.00 109.75 ? 587  ARG B NE  1 
ATOM   8777  C CZ  . ARG B  1 587 ? 36.216  -64.857 83.215  1.00 130.35 ? 587  ARG B CZ  1 
ATOM   8778  N NH1 . ARG B  1 587 ? 35.809  -63.602 83.064  1.00 114.67 ? 587  ARG B NH1 1 
ATOM   8779  N NH2 . ARG B  1 587 ? 36.138  -65.429 84.411  1.00 124.59 ? 587  ARG B NH2 1 
ATOM   8780  N N   . GLU B  1 588 ? 37.737  -66.947 75.020  1.00 105.96 ? 588  GLU B N   1 
ATOM   8781  C CA  . GLU B  1 588 ? 37.456  -66.609 73.618  1.00 105.29 ? 588  GLU B CA  1 
ATOM   8782  C C   . GLU B  1 588 ? 36.324  -67.455 73.064  1.00 107.70 ? 588  GLU B C   1 
ATOM   8783  O O   . GLU B  1 588 ? 36.212  -68.634 73.409  1.00 107.84 ? 588  GLU B O   1 
ATOM   8784  C CB  . GLU B  1 588 ? 38.724  -66.691 72.743  1.00 107.18 ? 588  GLU B CB  1 
ATOM   8785  C CG  . GLU B  1 588 ? 39.619  -65.468 72.894  1.00 120.97 ? 588  GLU B CG  1 
ATOM   8786  C CD  . GLU B  1 588 ? 41.057  -65.582 72.424  1.00 150.96 ? 588  GLU B CD  1 
ATOM   8787  O OE1 . GLU B  1 588 ? 41.768  -66.517 72.871  1.00 158.28 ? 588  GLU B OE1 1 
ATOM   8788  O OE2 . GLU B  1 588 ? 41.503  -64.663 71.697  1.00 145.33 ? 588  GLU B OE2 1 
ATOM   8789  N N   . CYS B  1 589 ? 35.465  -66.844 72.237  1.00 103.28 ? 589  CYS B N   1 
ATOM   8790  C CA  . CYS B  1 589 ? 34.324  -67.524 71.634  1.00 104.56 ? 589  CYS B CA  1 
ATOM   8791  C C   . CYS B  1 589 ? 34.705  -68.294 70.367  1.00 112.56 ? 589  CYS B C   1 
ATOM   8792  O O   . CYS B  1 589 ? 35.091  -67.681 69.368  1.00 112.52 ? 589  CYS B O   1 
ATOM   8793  C CB  . CYS B  1 589 ? 33.181  -66.549 71.371  1.00 103.35 ? 589  CYS B CB  1 
ATOM   8794  S SG  . CYS B  1 589 ? 32.574  -65.699 72.846  1.00 106.61 ? 589  CYS B SG  1 
ATOM   8795  N N   . HIS B  1 590 ? 34.604  -69.633 70.407  1.00 111.47 ? 590  HIS B N   1 
ATOM   8796  C CA  . HIS B  1 590 ? 34.891  -70.493 69.257  1.00 112.68 ? 590  HIS B CA  1 
ATOM   8797  C C   . HIS B  1 590 ? 33.592  -71.089 68.795  1.00 115.87 ? 590  HIS B C   1 
ATOM   8798  O O   . HIS B  1 590 ? 32.747  -71.365 69.648  1.00 116.84 ? 590  HIS B O   1 
ATOM   8799  C CB  . HIS B  1 590 ? 35.879  -71.616 69.607  1.00 115.69 ? 590  HIS B CB  1 
ATOM   8800  C CG  . HIS B  1 590 ? 37.134  -71.132 70.231  1.00 119.53 ? 590  HIS B CG  1 
ATOM   8801  N ND1 . HIS B  1 590 ? 38.073  -70.418 69.504  1.00 121.14 ? 590  HIS B ND1 1 
ATOM   8802  C CD2 . HIS B  1 590 ? 37.560  -71.258 71.505  1.00 122.23 ? 590  HIS B CD2 1 
ATOM   8803  C CE1 . HIS B  1 590 ? 39.033  -70.123 70.360  1.00 120.81 ? 590  HIS B CE1 1 
ATOM   8804  N NE2 . HIS B  1 590 ? 38.774  -70.619 71.576  1.00 121.79 ? 590  HIS B NE2 1 
ATOM   8805  N N   . PRO B  1 591 ? 33.398  -71.314 67.469  1.00 110.29 ? 591  PRO B N   1 
ATOM   8806  C CA  . PRO B  1 591 ? 32.126  -71.874 67.006  1.00 109.53 ? 591  PRO B CA  1 
ATOM   8807  C C   . PRO B  1 591 ? 31.870  -73.321 67.414  1.00 111.20 ? 591  PRO B C   1 
ATOM   8808  O O   . PRO B  1 591 ? 32.782  -74.077 67.806  1.00 111.16 ? 591  PRO B O   1 
ATOM   8809  C CB  . PRO B  1 591 ? 32.186  -71.701 65.482  1.00 111.25 ? 591  PRO B CB  1 
ATOM   8810  C CG  . PRO B  1 591 ? 33.296  -70.768 65.227  1.00 115.10 ? 591  PRO B CG  1 
ATOM   8811  C CD  . PRO B  1 591 ? 34.274  -71.021 66.321  1.00 111.30 ? 591  PRO B CD  1 
ATOM   8812  N N   . CYS B  1 592 ? 30.592  -73.686 67.344  1.00 105.75 ? 592  CYS B N   1 
ATOM   8813  C CA  . CYS B  1 592 ? 30.124  -75.020 67.685  1.00 106.32 ? 592  CYS B CA  1 
ATOM   8814  C C   . CYS B  1 592 ? 30.356  -75.960 66.525  1.00 112.59 ? 592  CYS B C   1 
ATOM   8815  O O   . CYS B  1 592 ? 30.475  -75.500 65.388  1.00 111.47 ? 592  CYS B O   1 
ATOM   8816  C CB  . CYS B  1 592 ? 28.647  -74.976 68.079  1.00 105.35 ? 592  CYS B CB  1 
ATOM   8817  S SG  . CYS B  1 592 ? 28.337  -74.368 69.766  1.00 107.35 ? 592  CYS B SG  1 
ATOM   8818  N N   . HIS B  1 593 ? 30.388  -77.278 66.803  1.00 112.29 ? 593  HIS B N   1 
ATOM   8819  C CA  . HIS B  1 593 ? 30.481  -78.305 65.773  1.00 114.38 ? 593  HIS B CA  1 
ATOM   8820  C C   . HIS B  1 593 ? 29.198  -78.156 64.924  1.00 120.98 ? 593  HIS B C   1 
ATOM   8821  O O   . HIS B  1 593 ? 28.137  -77.897 65.505  1.00 121.39 ? 593  HIS B O   1 
ATOM   8822  C CB  . HIS B  1 593 ? 30.532  -79.689 66.415  1.00 117.12 ? 593  HIS B CB  1 
ATOM   8823  C CG  . HIS B  1 593 ? 30.903  -80.783 65.469  1.00 122.26 ? 593  HIS B CG  1 
ATOM   8824  N ND1 . HIS B  1 593 ? 29.982  -81.320 64.591  1.00 125.12 ? 593  HIS B ND1 1 
ATOM   8825  C CD2 . HIS B  1 593 ? 32.079  -81.437 65.324  1.00 125.13 ? 593  HIS B CD2 1 
ATOM   8826  C CE1 . HIS B  1 593 ? 30.627  -82.270 63.933  1.00 126.26 ? 593  HIS B CE1 1 
ATOM   8827  N NE2 . HIS B  1 593 ? 31.890  -82.381 64.345  1.00 126.63 ? 593  HIS B NE2 1 
ATOM   8828  N N   . PRO B  1 594 ? 29.260  -78.235 63.570  1.00 118.10 ? 594  PRO B N   1 
ATOM   8829  C CA  . PRO B  1 594 ? 28.038  -78.015 62.763  1.00 117.23 ? 594  PRO B CA  1 
ATOM   8830  C C   . PRO B  1 594 ? 26.777  -78.759 63.213  1.00 118.92 ? 594  PRO B C   1 
ATOM   8831  O O   . PRO B  1 594 ? 25.687  -78.191 63.093  1.00 118.09 ? 594  PRO B O   1 
ATOM   8832  C CB  . PRO B  1 594 ? 28.473  -78.401 61.351  1.00 120.03 ? 594  PRO B CB  1 
ATOM   8833  C CG  . PRO B  1 594 ? 29.938  -78.140 61.331  1.00 124.01 ? 594  PRO B CG  1 
ATOM   8834  C CD  . PRO B  1 594 ? 30.435  -78.486 62.706  1.00 119.97 ? 594  PRO B CD  1 
ATOM   8835  N N   . ASN B  1 595 ? 26.933  -79.991 63.766  1.00 113.52 ? 595  ASN B N   1 
ATOM   8836  C CA  . ASN B  1 595 ? 25.838  -80.832 64.264  1.00 113.84 ? 595  ASN B CA  1 
ATOM   8837  C C   . ASN B  1 595 ? 25.001  -80.194 65.390  1.00 113.21 ? 595  ASN B C   1 
ATOM   8838  O O   . ASN B  1 595 ? 23.792  -80.414 65.431  1.00 114.68 ? 595  ASN B O   1 
ATOM   8839  C CB  . ASN B  1 595 ? 26.360  -82.197 64.715  1.00 118.20 ? 595  ASN B CB  1 
ATOM   8840  C CG  . ASN B  1 595 ? 27.087  -82.982 63.648  1.00 147.41 ? 595  ASN B CG  1 
ATOM   8841  O OD1 . ASN B  1 595 ? 27.569  -82.435 62.635  1.00 144.69 ? 595  ASN B OD1 1 
ATOM   8842  N ND2 . ASN B  1 595 ? 27.219  -84.284 63.882  1.00 136.47 ? 595  ASN B ND2 1 
ATOM   8843  N N   . CYS B  1 596 ? 25.630  -79.421 66.293  1.00 103.46 ? 596  CYS B N   1 
ATOM   8844  C CA  . CYS B  1 596 ? 24.958  -78.762 67.415  1.00 100.45 ? 596  CYS B CA  1 
ATOM   8845  C C   . CYS B  1 596 ? 24.108  -77.567 66.962  1.00 99.50  ? 596  CYS B C   1 
ATOM   8846  O O   . CYS B  1 596 ? 24.560  -76.413 67.014  1.00 95.97  ? 596  CYS B O   1 
ATOM   8847  C CB  . CYS B  1 596 ? 25.969  -78.355 68.481  1.00 99.97  ? 596  CYS B CB  1 
ATOM   8848  S SG  . CYS B  1 596 ? 27.201  -79.624 68.875  1.00 105.41 ? 596  CYS B SG  1 
ATOM   8849  N N   . THR B  1 597 ? 22.865  -77.861 66.530  1.00 96.60  ? 597  THR B N   1 
ATOM   8850  C CA  . THR B  1 597 ? 21.881  -76.895 66.014  1.00 95.49  ? 597  THR B CA  1 
ATOM   8851  C C   . THR B  1 597 ? 21.185  -76.058 67.097  1.00 99.58  ? 597  THR B C   1 
ATOM   8852  O O   . THR B  1 597 ? 20.547  -75.048 66.770  1.00 98.40  ? 597  THR B O   1 
ATOM   8853  C CB  . THR B  1 597 ? 20.858  -77.598 65.120  1.00 102.85 ? 597  THR B CB  1 
ATOM   8854  O OG1 . THR B  1 597 ? 20.147  -78.556 65.895  1.00 103.72 ? 597  THR B OG1 1 
ATOM   8855  C CG2 . THR B  1 597 ? 21.490  -78.277 63.925  1.00 102.88 ? 597  THR B CG2 1 
ATOM   8856  N N   . GLN B  1 598 ? 21.280  -76.496 68.373  1.00 96.30  ? 598  GLN B N   1 
ATOM   8857  C CA  . GLN B  1 598 ? 20.682  -75.815 69.526  1.00 94.63  ? 598  GLN B CA  1 
ATOM   8858  C C   . GLN B  1 598 ? 21.757  -75.274 70.492  1.00 98.02  ? 598  GLN B C   1 
ATOM   8859  O O   . GLN B  1 598 ? 21.430  -74.851 71.603  1.00 97.97  ? 598  GLN B O   1 
ATOM   8860  C CB  . GLN B  1 598 ? 19.675  -76.726 70.245  1.00 96.94  ? 598  GLN B CB  1 
ATOM   8861  C CG  . GLN B  1 598 ? 18.445  -77.054 69.412  1.00 98.99  ? 598  GLN B CG  1 
ATOM   8862  C CD  . GLN B  1 598 ? 17.732  -78.284 69.898  1.00 114.67 ? 598  GLN B CD  1 
ATOM   8863  O OE1 . GLN B  1 598 ? 17.075  -78.265 70.932  1.00 108.67 ? 598  GLN B OE1 1 
ATOM   8864  N NE2 . GLN B  1 598 ? 17.815  -79.378 69.144  1.00 111.36 ? 598  GLN B NE2 1 
ATOM   8865  N N   . GLY B  1 599 ? 23.017  -75.268 70.049  1.00 93.56  ? 599  GLY B N   1 
ATOM   8866  C CA  . GLY B  1 599 ? 24.142  -74.789 70.849  1.00 92.48  ? 599  GLY B CA  1 
ATOM   8867  C C   . GLY B  1 599 ? 25.046  -75.882 71.375  1.00 97.27  ? 599  GLY B C   1 
ATOM   8868  O O   . GLY B  1 599 ? 24.722  -77.054 71.230  1.00 98.48  ? 599  GLY B O   1 
ATOM   8869  N N   . CYS B  1 600 ? 26.166  -75.509 72.011  1.00 95.14  ? 600  CYS B N   1 
ATOM   8870  C CA  . CYS B  1 600 ? 27.161  -76.434 72.556  1.00 99.14  ? 600  CYS B CA  1 
ATOM   8871  C C   . CYS B  1 600 ? 27.922  -75.875 73.768  1.00 98.83  ? 600  CYS B C   1 
ATOM   8872  O O   . CYS B  1 600 ? 27.777  -74.700 74.092  1.00 97.60  ? 600  CYS B O   1 
ATOM   8873  C CB  . CYS B  1 600 ? 28.126  -76.881 71.462  1.00 103.38 ? 600  CYS B CB  1 
ATOM   8874  S SG  . CYS B  1 600 ? 29.356  -75.636 71.002  1.00 108.04 ? 600  CYS B SG  1 
ATOM   8875  N N   . ASN B  1 601 ? 28.745  -76.717 74.430  1.00 93.52  ? 601  ASN B N   1 
ATOM   8876  C CA  . ASN B  1 601 ? 29.589  -76.298 75.558  1.00 91.35  ? 601  ASN B CA  1 
ATOM   8877  C C   . ASN B  1 601 ? 31.075  -76.661 75.367  1.00 96.44  ? 601  ASN B C   1 
ATOM   8878  O O   . ASN B  1 601 ? 31.914  -76.350 76.208  1.00 95.93  ? 601  ASN B O   1 
ATOM   8879  C CB  . ASN B  1 601 ? 29.020  -76.765 76.900  1.00 86.03  ? 601  ASN B CB  1 
ATOM   8880  C CG  . ASN B  1 601 ? 29.077  -78.225 77.177  1.00 89.51  ? 601  ASN B CG  1 
ATOM   8881  O OD1 . ASN B  1 601 ? 29.164  -79.067 76.284  1.00 88.55  ? 601  ASN B OD1 1 
ATOM   8882  N ND2 . ASN B  1 601 ? 28.970  -78.551 78.437  1.00 78.42  ? 601  ASN B ND2 1 
ATOM   8883  N N   . GLY B  1 602 ? 31.366  -77.293 74.238  1.00 94.97  ? 602  GLY B N   1 
ATOM   8884  C CA  . GLY B  1 602 ? 32.694  -77.710 73.807  1.00 95.41  ? 602  GLY B CA  1 
ATOM   8885  C C   . GLY B  1 602 ? 32.792  -77.737 72.289  1.00 100.05 ? 602  GLY B C   1 
ATOM   8886  O O   . GLY B  1 602 ? 31.795  -77.491 71.592  1.00 99.50  ? 602  GLY B O   1 
ATOM   8887  N N   . PRO B  1 603 ? 33.979  -78.044 71.722  1.00 96.37  ? 603  PRO B N   1 
ATOM   8888  C CA  . PRO B  1 603 ? 34.105  -78.008 70.252  1.00 95.84  ? 603  PRO B CA  1 
ATOM   8889  C C   . PRO B  1 603 ? 33.567  -79.210 69.482  1.00 100.80 ? 603  PRO B C   1 
ATOM   8890  O O   . PRO B  1 603 ? 33.088  -79.046 68.358  1.00 100.21 ? 603  PRO B O   1 
ATOM   8891  C CB  . PRO B  1 603 ? 35.602  -77.822 70.040  1.00 97.43  ? 603  PRO B CB  1 
ATOM   8892  C CG  . PRO B  1 603 ? 36.239  -78.426 71.255  1.00 102.39 ? 603  PRO B CG  1 
ATOM   8893  C CD  . PRO B  1 603 ? 35.269  -78.337 72.382  1.00 97.90  ? 603  PRO B CD  1 
ATOM   8894  N N   . THR B  1 604 ? 33.661  -80.410 70.088  1.00 98.13  ? 604  THR B N   1 
ATOM   8895  C CA  . THR B  1 604 ? 33.259  -81.706 69.531  1.00 99.12  ? 604  THR B CA  1 
ATOM   8896  C C   . THR B  1 604 ? 31.756  -81.858 69.257  1.00 101.70 ? 604  THR B C   1 
ATOM   8897  O O   . THR B  1 604 ? 30.940  -81.093 69.768  1.00 100.37 ? 604  THR B O   1 
ATOM   8898  C CB  . THR B  1 604 ? 33.789  -82.851 70.403  1.00 106.42 ? 604  THR B CB  1 
ATOM   8899  O OG1 . THR B  1 604 ? 33.166  -82.781 71.676  1.00 105.01 ? 604  THR B OG1 1 
ATOM   8900  C CG2 . THR B  1 604 ? 35.302  -82.816 70.566  1.00 106.05 ? 604  THR B CG2 1 
ATOM   8901  N N   . SER B  1 605 ? 31.404  -82.878 68.460  1.00 99.01  ? 605  SER B N   1 
ATOM   8902  C CA  . SER B  1 605 ? 30.041  -83.213 68.060  1.00 99.32  ? 605  SER B CA  1 
ATOM   8903  C C   . SER B  1 605 ? 29.214  -83.780 69.225  1.00 103.66 ? 605  SER B C   1 
ATOM   8904  O O   . SER B  1 605 ? 27.994  -83.849 69.109  1.00 104.38 ? 605  SER B O   1 
ATOM   8905  C CB  . SER B  1 605 ? 30.073  -84.215 66.911  1.00 105.59 ? 605  SER B CB  1 
ATOM   8906  O OG  . SER B  1 605 ? 30.731  -85.411 67.312  1.00 118.29 ? 605  SER B OG  1 
ATOM   8907  N N   . HIS B  1 606 ? 29.862  -84.207 70.328  1.00 98.70  ? 606  HIS B N   1 
ATOM   8908  C CA  . HIS B  1 606 ? 29.163  -84.744 71.496  1.00 98.19  ? 606  HIS B CA  1 
ATOM   8909  C C   . HIS B  1 606 ? 28.881  -83.726 72.632  1.00 100.91 ? 606  HIS B C   1 
ATOM   8910  O O   . HIS B  1 606 ? 28.252  -84.071 73.643  1.00 102.15 ? 606  HIS B O   1 
ATOM   8911  C CB  . HIS B  1 606 ? 29.878  -85.964 72.021  1.00 100.09 ? 606  HIS B CB  1 
ATOM   8912  C CG  . HIS B  1 606 ? 31.315  -85.745 72.339  1.00 102.57 ? 606  HIS B CG  1 
ATOM   8913  N ND1 . HIS B  1 606 ? 32.311  -86.250 71.533  1.00 105.09 ? 606  HIS B ND1 1 
ATOM   8914  C CD2 . HIS B  1 606 ? 31.881  -85.164 73.418  1.00 103.21 ? 606  HIS B CD2 1 
ATOM   8915  C CE1 . HIS B  1 606 ? 33.447  -85.970 72.145  1.00 103.85 ? 606  HIS B CE1 1 
ATOM   8916  N NE2 . HIS B  1 606 ? 33.240  -85.304 73.274  1.00 103.12 ? 606  HIS B NE2 1 
ATOM   8917  N N   . ASP B  1 607 ? 29.322  -82.473 72.455  1.00 93.81  ? 607  ASP B N   1 
ATOM   8918  C CA  . ASP B  1 607 ? 29.127  -81.423 73.438  1.00 91.40  ? 607  ASP B CA  1 
ATOM   8919  C C   . ASP B  1 607 ? 27.914  -80.535 73.113  1.00 97.49  ? 607  ASP B C   1 
ATOM   8920  O O   . ASP B  1 607 ? 27.813  -79.428 73.649  1.00 94.47  ? 607  ASP B O   1 
ATOM   8921  C CB  . ASP B  1 607 ? 30.408  -80.597 73.573  1.00 90.51  ? 607  ASP B CB  1 
ATOM   8922  C CG  . ASP B  1 607 ? 31.584  -81.323 74.194  1.00 95.51  ? 607  ASP B CG  1 
ATOM   8923  O OD1 . ASP B  1 607 ? 31.377  -82.052 75.186  1.00 95.84  ? 607  ASP B OD1 1 
ATOM   8924  O OD2 . ASP B  1 607 ? 32.725  -81.088 73.748  1.00 100.10 ? 607  ASP B OD2 1 
ATOM   8925  N N   . CYS B  1 608 ? 26.974  -81.037 72.275  1.00 98.68  ? 608  CYS B N   1 
ATOM   8926  C CA  . CYS B  1 608 ? 25.767  -80.312 71.876  1.00 99.45  ? 608  CYS B CA  1 
ATOM   8927  C C   . CYS B  1 608 ? 24.793  -80.117 73.028  1.00 101.64 ? 608  CYS B C   1 
ATOM   8928  O O   . CYS B  1 608 ? 24.754  -80.932 73.957  1.00 103.07 ? 608  CYS B O   1 
ATOM   8929  C CB  . CYS B  1 608 ? 25.079  -81.001 70.700  1.00 103.06 ? 608  CYS B CB  1 
ATOM   8930  S SG  . CYS B  1 608 ? 26.154  -81.332 69.281  1.00 108.32 ? 608  CYS B SG  1 
ATOM   8931  N N   . ILE B  1 609 ? 23.978  -79.050 72.925  1.00 95.52  ? 609  ILE B N   1 
ATOM   8932  C CA  . ILE B  1 609 ? 22.918  -78.656 73.860  1.00 94.96  ? 609  ILE B CA  1 
ATOM   8933  C C   . ILE B  1 609 ? 21.552  -78.933 73.193  1.00 101.77 ? 609  ILE B C   1 
ATOM   8934  O O   . ILE B  1 609 ? 21.417  -78.745 71.986  1.00 100.66 ? 609  ILE B O   1 
ATOM   8935  C CB  . ILE B  1 609 ? 23.093  -77.169 74.298  1.00 94.82  ? 609  ILE B CB  1 
ATOM   8936  C CG1 . ILE B  1 609 ? 24.314  -77.004 75.215  1.00 94.23  ? 609  ILE B CG1 1 
ATOM   8937  C CG2 . ILE B  1 609 ? 21.839  -76.610 74.975  1.00 95.79  ? 609  ILE B CG2 1 
ATOM   8938  C CD1 . ILE B  1 609 ? 24.738  -75.557 75.466  1.00 101.73 ? 609  ILE B CD1 1 
ATOM   8939  N N   . TYR B  1 610 ? 20.557  -79.401 73.972  1.00 101.30 ? 610  TYR B N   1 
ATOM   8940  C CA  . TYR B  1 610 ? 19.230  -79.713 73.450  1.00 103.58 ? 610  TYR B CA  1 
ATOM   8941  C C   . TYR B  1 610 ? 18.158  -78.993 74.268  1.00 110.11 ? 610  TYR B C   1 
ATOM   8942  O O   . TYR B  1 610 ? 18.028  -79.256 75.467  1.00 111.25 ? 610  TYR B O   1 
ATOM   8943  C CB  . TYR B  1 610 ? 19.004  -81.242 73.391  1.00 108.02 ? 610  TYR B CB  1 
ATOM   8944  C CG  . TYR B  1 610 ? 20.114  -81.977 72.667  1.00 111.39 ? 610  TYR B CG  1 
ATOM   8945  C CD1 . TYR B  1 610 ? 21.348  -82.194 73.275  1.00 113.90 ? 610  TYR B CD1 1 
ATOM   8946  C CD2 . TYR B  1 610 ? 19.941  -82.434 71.366  1.00 112.74 ? 610  TYR B CD2 1 
ATOM   8947  C CE1 . TYR B  1 610 ? 22.397  -82.794 72.590  1.00 115.31 ? 610  TYR B CE1 1 
ATOM   8948  C CE2 . TYR B  1 610 ? 20.968  -83.088 70.689  1.00 114.27 ? 610  TYR B CE2 1 
ATOM   8949  C CZ  . TYR B  1 610 ? 22.197  -83.262 71.306  1.00 122.15 ? 610  TYR B CZ  1 
ATOM   8950  O OH  . TYR B  1 610 ? 23.239  -83.865 70.651  1.00 125.06 ? 610  TYR B OH  1 
ATOM   8951  N N   . TYR B  1 611 ? 17.434  -78.039 73.623  1.00 107.02 ? 611  TYR B N   1 
ATOM   8952  C CA  . TYR B  1 611 ? 16.377  -77.209 74.213  1.00 106.97 ? 611  TYR B CA  1 
ATOM   8953  C C   . TYR B  1 611 ? 15.249  -78.076 74.791  1.00 112.87 ? 611  TYR B C   1 
ATOM   8954  O O   . TYR B  1 611 ? 14.737  -78.952 74.079  1.00 113.63 ? 611  TYR B O   1 
ATOM   8955  C CB  . TYR B  1 611 ? 15.763  -76.239 73.176  1.00 107.84 ? 611  TYR B CB  1 
ATOM   8956  C CG  . TYR B  1 611 ? 16.687  -75.255 72.472  1.00 109.61 ? 611  TYR B CG  1 
ATOM   8957  C CD1 . TYR B  1 611 ? 17.749  -74.656 73.146  1.00 111.25 ? 611  TYR B CD1 1 
ATOM   8958  C CD2 . TYR B  1 611 ? 16.409  -74.813 71.177  1.00 109.50 ? 611  TYR B CD2 1 
ATOM   8959  C CE1 . TYR B  1 611 ? 18.552  -73.698 72.525  1.00 112.05 ? 611  TYR B CE1 1 
ATOM   8960  C CE2 . TYR B  1 611 ? 17.218  -73.874 70.538  1.00 108.32 ? 611  TYR B CE2 1 
ATOM   8961  C CZ  . TYR B  1 611 ? 18.286  -73.312 71.217  1.00 116.68 ? 611  TYR B CZ  1 
ATOM   8962  O OH  . TYR B  1 611 ? 19.077  -72.361 70.599  1.00 114.46 ? 611  TYR B OH  1 
ATOM   8963  N N   . PRO B  1 612 ? 14.831  -77.832 76.064  1.00 109.39 ? 612  PRO B N   1 
ATOM   8964  C CA  . PRO B  1 612 ? 13.735  -78.642 76.639  1.00 113.29 ? 612  PRO B CA  1 
ATOM   8965  C C   . PRO B  1 612 ? 12.366  -78.307 76.042  1.00 139.39 ? 612  PRO B C   1 
ATOM   8966  O O   . PRO B  1 612 ? 11.441  -79.114 76.092  1.00 109.78 ? 612  PRO B O   1 
ATOM   8967  C CB  . PRO B  1 612 ? 13.808  -78.329 78.136  1.00 114.69 ? 612  PRO B CB  1 
ATOM   8968  C CG  . PRO B  1 612 ? 14.432  -76.963 78.215  1.00 115.59 ? 612  PRO B CG  1 
ATOM   8969  C CD  . PRO B  1 612 ? 15.348  -76.832 77.031  1.00 109.44 ? 612  PRO B CD  1 
ATOM   8970  N N   . GLN C  1 1   ? -65.830 4.687   14.715  1.00 93.72  ? 1    GLN C N   1 
ATOM   8971  C CA  . GLN C  1 1   ? -66.722 4.146   13.679  1.00 94.37  ? 1    GLN C CA  1 
ATOM   8972  C C   . GLN C  1 1   ? -66.939 5.072   12.439  1.00 97.93  ? 1    GLN C C   1 
ATOM   8973  O O   . GLN C  1 1   ? -66.734 4.586   11.317  1.00 97.97  ? 1    GLN C O   1 
ATOM   8974  C CB  . GLN C  1 1   ? -68.050 3.598   14.261  1.00 96.97  ? 1    GLN C CB  1 
ATOM   8975  C CG  . GLN C  1 1   ? -68.135 2.053   14.262  1.00 123.32 ? 1    GLN C CG  1 
ATOM   8976  C CD  . GLN C  1 1   ? -68.234 1.428   15.651  1.00 151.20 ? 1    GLN C CD  1 
ATOM   8977  O OE1 . GLN C  1 1   ? -69.294 1.428   16.285  1.00 148.63 ? 1    GLN C OE1 1 
ATOM   8978  N NE2 . GLN C  1 1   ? -67.149 0.813   16.135  1.00 144.89 ? 1    GLN C NE2 1 
ATOM   8979  N N   . SER C  1 2   ? -67.358 6.386   12.629  1.00 91.74  ? 2    SER C N   1 
ATOM   8980  C CA  . SER C  1 2   ? -67.514 7.364   11.527  1.00 89.64  ? 2    SER C CA  1 
ATOM   8981  C C   . SER C  1 2   ? -66.132 7.797   11.014  1.00 91.23  ? 2    SER C C   1 
ATOM   8982  O O   . SER C  1 2   ? -65.265 8.257   11.764  1.00 90.74  ? 2    SER C O   1 
ATOM   8983  C CB  . SER C  1 2   ? -68.357 8.560   11.930  1.00 91.53  ? 2    SER C CB  1 
ATOM   8984  O OG  . SER C  1 2   ? -67.917 9.099   13.160  1.00 97.07  ? 2    SER C OG  1 
ATOM   8985  N N   . VAL C  1 3   ? -65.918 7.560   9.737   1.00 85.39  ? 3    VAL C N   1 
ATOM   8986  C CA  . VAL C  1 3   ? -64.659 7.732   9.048   1.00 83.29  ? 3    VAL C CA  1 
ATOM   8987  C C   . VAL C  1 3   ? -64.736 8.876   8.026   1.00 88.04  ? 3    VAL C C   1 
ATOM   8988  O O   . VAL C  1 3   ? -65.794 9.136   7.462   1.00 88.43  ? 3    VAL C O   1 
ATOM   8989  C CB  . VAL C  1 3   ? -64.335 6.350   8.411   1.00 85.51  ? 3    VAL C CB  1 
ATOM   8990  C CG1 . VAL C  1 3   ? -63.293 6.424   7.303   1.00 85.17  ? 3    VAL C CG1 1 
ATOM   8991  C CG2 . VAL C  1 3   ? -63.926 5.341   9.467   1.00 84.16  ? 3    VAL C CG2 1 
ATOM   8992  N N   . CYS C  1 4   ? -63.615 9.572   7.813   1.00 85.17  ? 4    CYS C N   1 
ATOM   8993  C CA  . CYS C  1 4   ? -63.472 10.643  6.830   1.00 86.00  ? 4    CYS C CA  1 
ATOM   8994  C C   . CYS C  1 4   ? -62.048 10.625  6.275   1.00 88.04  ? 4    CYS C C   1 
ATOM   8995  O O   . CYS C  1 4   ? -61.143 10.050  6.890   1.00 85.84  ? 4    CYS C O   1 
ATOM   8996  C CB  . CYS C  1 4   ? -63.859 12.002  7.406   1.00 88.06  ? 4    CYS C CB  1 
ATOM   8997  S SG  . CYS C  1 4   ? -62.760 12.591  8.718   1.00 91.94  ? 4    CYS C SG  1 
ATOM   8998  N N   . ALA C  1 5   ? -61.860 11.196  5.096   1.00 85.88  ? 5    ALA C N   1 
ATOM   8999  C CA  . ALA C  1 5   ? -60.570 11.105  4.445   1.00 86.32  ? 5    ALA C CA  1 
ATOM   9000  C C   . ALA C  1 5   ? -59.508 12.109  4.872   1.00 91.22  ? 5    ALA C C   1 
ATOM   9001  O O   . ALA C  1 5   ? -58.322 11.755  4.886   1.00 91.06  ? 5    ALA C O   1 
ATOM   9002  C CB  . ALA C  1 5   ? -60.741 11.099  2.936   1.00 87.76  ? 5    ALA C CB  1 
ATOM   9003  N N   . GLY C  1 6   ? -59.911 13.348  5.150   1.00 87.11  ? 6    GLY C N   1 
ATOM   9004  C CA  . GLY C  1 6   ? -58.956 14.388  5.507   1.00 87.16  ? 6    GLY C CA  1 
ATOM   9005  C C   . GLY C  1 6   ? -58.143 14.888  4.325   1.00 89.59  ? 6    GLY C C   1 
ATOM   9006  O O   . GLY C  1 6   ? -57.985 14.185  3.324   1.00 88.51  ? 6    GLY C O   1 
ATOM   9007  N N   . THR C  1 7   ? -57.606 16.118  4.453   1.00 84.98  ? 7    THR C N   1 
ATOM   9008  C CA  . THR C  1 7   ? -56.814 16.812  3.430   1.00 83.39  ? 7    THR C CA  1 
ATOM   9009  C C   . THR C  1 7   ? -55.351 16.354  3.288   1.00 80.49  ? 7    THR C C   1 
ATOM   9010  O O   . THR C  1 7   ? -54.886 15.457  4.004   1.00 77.84  ? 7    THR C O   1 
ATOM   9011  C CB  . THR C  1 7   ? -56.978 18.334  3.545   1.00 93.38  ? 7    THR C CB  1 
ATOM   9012  O OG1 . THR C  1 7   ? -56.715 18.753  4.883   1.00 93.65  ? 7    THR C OG1 1 
ATOM   9013  C CG2 . THR C  1 7   ? -58.338 18.809  3.109   1.00 94.57  ? 7    THR C CG2 1 
ATOM   9014  N N   . GLU C  1 8   ? -54.675 16.944  2.283   1.00 74.41  ? 8    GLU C N   1 
ATOM   9015  C CA  . GLU C  1 8   ? -53.287 16.767  1.858   1.00 72.16  ? 8    GLU C CA  1 
ATOM   9016  C C   . GLU C  1 8   ? -52.795 18.125  1.275   1.00 73.95  ? 8    GLU C C   1 
ATOM   9017  O O   . GLU C  1 8   ? -52.054 18.175  0.272   1.00 73.17  ? 8    GLU C O   1 
ATOM   9018  C CB  . GLU C  1 8   ? -53.195 15.651  0.797   1.00 72.47  ? 8    GLU C CB  1 
ATOM   9019  C CG  . GLU C  1 8   ? -52.961 14.264  1.364   1.00 81.16  ? 8    GLU C CG  1 
ATOM   9020  C CD  . GLU C  1 8   ? -52.565 13.190  0.361   1.00 109.69 ? 8    GLU C CD  1 
ATOM   9021  O OE1 . GLU C  1 8   ? -52.883 13.330  -0.845  1.00 82.85  ? 8    GLU C OE1 1 
ATOM   9022  O OE2 . GLU C  1 8   ? -51.955 12.185  0.797   1.00 116.23 ? 8    GLU C OE2 1 
ATOM   9023  N N   . ASN C  1 9   ? -53.225 19.229  1.922   1.00 69.20  ? 9    ASN C N   1 
ATOM   9024  C CA  . ASN C  1 9   ? -52.913 20.592  1.495   1.00 70.10  ? 9    ASN C CA  1 
ATOM   9025  C C   . ASN C  1 9   ? -51.626 21.127  2.068   1.00 73.57  ? 9    ASN C C   1 
ATOM   9026  O O   . ASN C  1 9   ? -51.035 22.020  1.451   1.00 75.39  ? 9    ASN C O   1 
ATOM   9027  C CB  . ASN C  1 9   ? -54.054 21.548  1.833   1.00 69.48  ? 9    ASN C CB  1 
ATOM   9028  C CG  . ASN C  1 9   ? -55.409 21.117  1.310   1.00 100.43 ? 9    ASN C CG  1 
ATOM   9029  O OD1 . ASN C  1 9   ? -55.553 20.410  0.298   1.00 93.00  ? 9    ASN C OD1 1 
ATOM   9030  N ND2 . ASN C  1 9   ? -56.445 21.512  2.018   1.00 98.13  ? 9    ASN C ND2 1 
ATOM   9031  N N   . LYS C  1 10  ? -51.200 20.598  3.247   1.00 66.48  ? 10   LYS C N   1 
ATOM   9032  C CA  . LYS C  1 10  ? -50.030 21.040  4.012   1.00 65.55  ? 10   LYS C CA  1 
ATOM   9033  C C   . LYS C  1 10  ? -50.326 22.474  4.508   1.00 75.55  ? 10   LYS C C   1 
ATOM   9034  O O   . LYS C  1 10  ? -51.403 22.697  5.094   1.00 75.76  ? 10   LYS C O   1 
ATOM   9035  C CB  . LYS C  1 10  ? -48.716 20.926  3.208   1.00 64.73  ? 10   LYS C CB  1 
ATOM   9036  C CG  . LYS C  1 10  ? -48.326 19.504  2.888   1.00 59.77  ? 10   LYS C CG  1 
ATOM   9037  C CD  . LYS C  1 10  ? -48.009 19.306  1.424   1.00 70.53  ? 10   LYS C CD  1 
ATOM   9038  C CE  . LYS C  1 10  ? -48.037 17.850  1.023   1.00 88.88  ? 10   LYS C CE  1 
ATOM   9039  N NZ  . LYS C  1 10  ? -47.870 17.668  -0.446  1.00 104.09 ? 10   LYS C NZ  1 
ATOM   9040  N N   . LEU C  1 11  ? -49.429 23.450  4.223   1.00 74.22  ? 11   LEU C N   1 
ATOM   9041  C CA  . LEU C  1 11  ? -49.645 24.832  4.641   1.00 76.12  ? 11   LEU C CA  1 
ATOM   9042  C C   . LEU C  1 11  ? -50.581 25.663  3.733   1.00 81.41  ? 11   LEU C C   1 
ATOM   9043  O O   . LEU C  1 11  ? -51.048 26.742  4.140   1.00 81.03  ? 11   LEU C O   1 
ATOM   9044  C CB  . LEU C  1 11  ? -48.319 25.527  4.927   1.00 77.32  ? 11   LEU C CB  1 
ATOM   9045  C CG  . LEU C  1 11  ? -47.483 24.893  6.038   1.00 81.30  ? 11   LEU C CG  1 
ATOM   9046  C CD1 . LEU C  1 11  ? -46.205 25.638  6.221   1.00 82.93  ? 11   LEU C CD1 1 
ATOM   9047  C CD2 . LEU C  1 11  ? -48.233 24.872  7.360   1.00 83.98  ? 11   LEU C CD2 1 
ATOM   9048  N N   . SER C  1 12  ? -50.900 25.117  2.537   1.00 79.02  ? 12   SER C N   1 
ATOM   9049  C CA  . SER C  1 12  ? -51.796 25.726  1.567   1.00 81.09  ? 12   SER C CA  1 
ATOM   9050  C C   . SER C  1 12  ? -53.199 25.783  2.133   1.00 88.73  ? 12   SER C C   1 
ATOM   9051  O O   . SER C  1 12  ? -53.578 24.922  2.929   1.00 87.81  ? 12   SER C O   1 
ATOM   9052  C CB  . SER C  1 12  ? -51.776 24.963  0.253   1.00 83.29  ? 12   SER C CB  1 
ATOM   9053  O OG  . SER C  1 12  ? -50.445 24.912  -0.228  1.00 90.67  ? 12   SER C OG  1 
ATOM   9054  N N   . SER C  1 13  ? -53.937 26.845  1.773   1.00 88.33  ? 13   SER C N   1 
ATOM   9055  C CA  . SER C  1 13  ? -55.286 27.138  2.263   1.00 88.69  ? 13   SER C CA  1 
ATOM   9056  C C   . SER C  1 13  ? -56.103 27.973  1.242   1.00 94.07  ? 13   SER C C   1 
ATOM   9057  O O   . SER C  1 13  ? -55.622 28.253  0.140   1.00 94.61  ? 13   SER C O   1 
ATOM   9058  C CB  . SER C  1 13  ? -55.203 27.850  3.616   1.00 92.31  ? 13   SER C CB  1 
ATOM   9059  O OG  . SER C  1 13  ? -54.200 28.850  3.675   1.00 101.94 ? 13   SER C OG  1 
ATOM   9060  N N   . LEU C  1 14  ? -57.342 28.332  1.594   1.00 90.66  ? 14   LEU C N   1 
ATOM   9061  C CA  . LEU C  1 14  ? -58.162 29.151  0.722   1.00 93.25  ? 14   LEU C CA  1 
ATOM   9062  C C   . LEU C  1 14  ? -57.923 30.611  1.089   1.00 104.80 ? 14   LEU C C   1 
ATOM   9063  O O   . LEU C  1 14  ? -57.688 30.912  2.271   1.00 105.89 ? 14   LEU C O   1 
ATOM   9064  C CB  . LEU C  1 14  ? -59.645 28.817  0.877   1.00 92.53  ? 14   LEU C CB  1 
ATOM   9065  C CG  . LEU C  1 14  ? -60.093 27.429  0.462   1.00 94.00  ? 14   LEU C CG  1 
ATOM   9066  C CD1 . LEU C  1 14  ? -61.446 27.156  0.997   1.00 93.98  ? 14   LEU C CD1 1 
ATOM   9067  C CD2 . LEU C  1 14  ? -60.091 27.247  -1.045  1.00 95.45  ? 14   LEU C CD2 1 
ATOM   9068  N N   . SER C  1 15  ? -57.984 31.517  0.076   1.00 103.87 ? 15   SER C N   1 
ATOM   9069  C CA  . SER C  1 15  ? -57.791 32.955  0.267   1.00 106.25 ? 15   SER C CA  1 
ATOM   9070  C C   . SER C  1 15  ? -58.867 33.499  1.207   1.00 110.72 ? 15   SER C C   1 
ATOM   9071  O O   . SER C  1 15  ? -58.547 34.261  2.127   1.00 110.26 ? 15   SER C O   1 
ATOM   9072  C CB  . SER C  1 15  ? -57.841 33.687  -1.071  1.00 112.59 ? 15   SER C CB  1 
ATOM   9073  O OG  . SER C  1 15  ? -56.858 33.205  -1.969  1.00 122.43 ? 15   SER C OG  1 
ATOM   9074  N N   . ASP C  1 16  ? -60.139 33.076  0.985   1.00 108.06 ? 16   ASP C N   1 
ATOM   9075  C CA  . ASP C  1 16  ? -61.272 33.482  1.816   1.00 109.58 ? 16   ASP C CA  1 
ATOM   9076  C C   . ASP C  1 16  ? -61.154 32.742  3.139   1.00 112.10 ? 16   ASP C C   1 
ATOM   9077  O O   . ASP C  1 16  ? -61.289 31.515  3.179   1.00 111.26 ? 16   ASP C O   1 
ATOM   9078  C CB  . ASP C  1 16  ? -62.625 33.206  1.117   1.00 112.47 ? 16   ASP C CB  1 
ATOM   9079  C CG  . ASP C  1 16  ? -63.890 33.749  1.793   1.00 129.17 ? 16   ASP C CG  1 
ATOM   9080  O OD1 . ASP C  1 16  ? -64.904 33.958  1.083   1.00 130.08 ? 16   ASP C OD1 1 
ATOM   9081  O OD2 . ASP C  1 16  ? -63.877 33.937  3.032   1.00 139.84 ? 16   ASP C OD2 1 
ATOM   9082  N N   . LEU C  1 17  ? -60.850 33.486  4.213   1.00 107.22 ? 17   LEU C N   1 
ATOM   9083  C CA  . LEU C  1 17  ? -60.673 32.911  5.543   1.00 104.28 ? 17   LEU C CA  1 
ATOM   9084  C C   . LEU C  1 17  ? -61.914 32.258  6.145   1.00 105.25 ? 17   LEU C C   1 
ATOM   9085  O O   . LEU C  1 17  ? -61.768 31.295  6.914   1.00 103.74 ? 17   LEU C O   1 
ATOM   9086  C CB  . LEU C  1 17  ? -59.988 33.870  6.515   1.00 105.33 ? 17   LEU C CB  1 
ATOM   9087  C CG  . LEU C  1 17  ? -58.540 34.267  6.200   1.00 110.17 ? 17   LEU C CG  1 
ATOM   9088  C CD1 . LEU C  1 17  ? -57.955 35.026  7.356   1.00 110.93 ? 17   LEU C CD1 1 
ATOM   9089  C CD2 . LEU C  1 17  ? -57.649 33.042  5.865   1.00 111.20 ? 17   LEU C CD2 1 
ATOM   9090  N N   . GLU C  1 18  ? -63.120 32.746  5.773   1.00 100.85 ? 18   GLU C N   1 
ATOM   9091  C CA  . GLU C  1 18  ? -64.394 32.157  6.187   1.00 99.80  ? 18   GLU C CA  1 
ATOM   9092  C C   . GLU C  1 18  ? -64.555 30.864  5.395   1.00 101.61 ? 18   GLU C C   1 
ATOM   9093  O O   . GLU C  1 18  ? -64.958 29.850  5.971   1.00 100.81 ? 18   GLU C O   1 
ATOM   9094  C CB  . GLU C  1 18  ? -65.570 33.113  5.926   1.00 103.71 ? 18   GLU C CB  1 
ATOM   9095  C CG  . GLU C  1 18  ? -66.947 32.532  6.233   1.00 113.05 ? 18   GLU C CG  1 
ATOM   9096  C CD  . GLU C  1 18  ? -67.553 32.865  7.585   1.00 134.29 ? 18   GLU C CD  1 
ATOM   9097  O OE1 . GLU C  1 18  ? -67.605 34.064  7.943   1.00 138.55 ? 18   GLU C OE1 1 
ATOM   9098  O OE2 . GLU C  1 18  ? -68.046 31.931  8.257   1.00 122.22 ? 18   GLU C OE2 1 
ATOM   9099  N N   . GLN C  1 19  ? -64.171 30.876  4.098   1.00 97.12  ? 19   GLN C N   1 
ATOM   9100  C CA  . GLN C  1 19  ? -64.229 29.680  3.251   1.00 95.12  ? 19   GLN C CA  1 
ATOM   9101  C C   . GLN C  1 19  ? -63.255 28.621  3.720   1.00 96.86  ? 19   GLN C C   1 
ATOM   9102  O O   . GLN C  1 19  ? -63.561 27.433  3.615   1.00 96.54  ? 19   GLN C O   1 
ATOM   9103  C CB  . GLN C  1 19  ? -64.014 30.004  1.772   1.00 97.29  ? 19   GLN C CB  1 
ATOM   9104  C CG  . GLN C  1 19  ? -65.015 29.307  0.852   1.00 104.28 ? 19   GLN C CG  1 
ATOM   9105  C CD  . GLN C  1 19  ? -66.460 29.621  1.170   1.00 117.45 ? 19   GLN C CD  1 
ATOM   9106  O OE1 . GLN C  1 19  ? -66.847 30.779  1.412   1.00 112.68 ? 19   GLN C OE1 1 
ATOM   9107  N NE2 . GLN C  1 19  ? -67.288 28.580  1.183   1.00 103.26 ? 19   GLN C NE2 1 
ATOM   9108  N N   . GLN C  1 20  ? -62.103 29.051  4.273   1.00 91.31  ? 20   GLN C N   1 
ATOM   9109  C CA  . GLN C  1 20  ? -61.092 28.166  4.845   1.00 87.80  ? 20   GLN C CA  1 
ATOM   9110  C C   . GLN C  1 20  ? -61.675 27.495  6.084   1.00 87.21  ? 20   GLN C C   1 
ATOM   9111  O O   . GLN C  1 20  ? -61.589 26.273  6.193   1.00 83.88  ? 20   GLN C O   1 
ATOM   9112  C CB  . GLN C  1 20  ? -59.800 28.949  5.173   1.00 89.49  ? 20   GLN C CB  1 
ATOM   9113  C CG  . GLN C  1 20  ? -58.707 28.160  5.923   1.00 84.22  ? 20   GLN C CG  1 
ATOM   9114  C CD  . GLN C  1 20  ? -58.129 26.967  5.192   1.00 94.99  ? 20   GLN C CD  1 
ATOM   9115  O OE1 . GLN C  1 20  ? -58.428 26.673  4.039   1.00 84.14  ? 20   GLN C OE1 1 
ATOM   9116  N NE2 . GLN C  1 20  ? -57.241 26.250  5.851   1.00 102.30 ? 20   GLN C NE2 1 
ATOM   9117  N N   . TYR C  1 21  ? -62.310 28.290  6.984   1.00 84.01  ? 21   TYR C N   1 
ATOM   9118  C CA  . TYR C  1 21  ? -62.950 27.777  8.196   1.00 83.16  ? 21   TYR C CA  1 
ATOM   9119  C C   . TYR C  1 21  ? -64.086 26.837  7.856   1.00 89.60  ? 21   TYR C C   1 
ATOM   9120  O O   . TYR C  1 21  ? -64.157 25.739  8.409   1.00 87.89  ? 21   TYR C O   1 
ATOM   9121  C CB  . TYR C  1 21  ? -63.468 28.908  9.084   1.00 85.56  ? 21   TYR C CB  1 
ATOM   9122  C CG  . TYR C  1 21  ? -64.322 28.403  10.225  1.00 86.04  ? 21   TYR C CG  1 
ATOM   9123  C CD1 . TYR C  1 21  ? -63.756 27.736  11.301  1.00 86.53  ? 21   TYR C CD1 1 
ATOM   9124  C CD2 . TYR C  1 21  ? -65.699 28.589  10.228  1.00 87.93  ? 21   TYR C CD2 1 
ATOM   9125  C CE1 . TYR C  1 21  ? -64.534 27.278  12.359  1.00 87.08  ? 21   TYR C CE1 1 
ATOM   9126  C CE2 . TYR C  1 21  ? -66.490 28.129  11.277  1.00 88.34  ? 21   TYR C CE2 1 
ATOM   9127  C CZ  . TYR C  1 21  ? -65.901 27.474  12.342  1.00 93.65  ? 21   TYR C CZ  1 
ATOM   9128  O OH  . TYR C  1 21  ? -66.664 27.022  13.385  1.00 94.85  ? 21   TYR C OH  1 
ATOM   9129  N N   . ARG C  1 22  ? -64.983 27.279  6.950   1.00 89.44  ? 22   ARG C N   1 
ATOM   9130  C CA  . ARG C  1 22  ? -66.109 26.482  6.491   1.00 89.42  ? 22   ARG C CA  1 
ATOM   9131  C C   . ARG C  1 22  ? -65.646 25.145  5.899   1.00 92.19  ? 22   ARG C C   1 
ATOM   9132  O O   . ARG C  1 22  ? -66.295 24.136  6.152   1.00 92.37  ? 22   ARG C O   1 
ATOM   9133  C CB  . ARG C  1 22  ? -66.991 27.274  5.529   1.00 91.43  ? 22   ARG C CB  1 
ATOM   9134  C CG  . ARG C  1 22  ? -68.127 28.009  6.244   1.00 102.21 ? 22   ARG C CG  1 
ATOM   9135  C CD  . ARG C  1 22  ? -68.645 29.221  5.476   1.00 118.75 ? 22   ARG C CD  1 
ATOM   9136  N NE  . ARG C  1 22  ? -69.256 28.869  4.190   1.00 134.26 ? 22   ARG C NE  1 
ATOM   9137  C CZ  . ARG C  1 22  ? -70.550 28.629  4.003   1.00 158.94 ? 22   ARG C CZ  1 
ATOM   9138  N NH1 . ARG C  1 22  ? -71.400 28.691  5.022   1.00 149.73 ? 22   ARG C NH1 1 
ATOM   9139  N NH2 . ARG C  1 22  ? -71.005 28.316  2.795   1.00 152.88 ? 22   ARG C NH2 1 
ATOM   9140  N N   . ALA C  1 23  ? -64.485 25.115  5.205   1.00 87.13  ? 23   ALA C N   1 
ATOM   9141  C CA  . ALA C  1 23  ? -63.898 23.890  4.638   1.00 84.24  ? 23   ALA C CA  1 
ATOM   9142  C C   . ALA C  1 23  ? -63.457 22.927  5.724   1.00 84.87  ? 23   ALA C C   1 
ATOM   9143  O O   . ALA C  1 23  ? -63.768 21.740  5.620   1.00 83.07  ? 23   ALA C O   1 
ATOM   9144  C CB  . ALA C  1 23  ? -62.726 24.230  3.738   1.00 85.08  ? 23   ALA C CB  1 
ATOM   9145  N N   . LEU C  1 24  ? -62.761 23.440  6.782   1.00 80.67  ? 24   LEU C N   1 
ATOM   9146  C CA  . LEU C  1 24  ? -62.306 22.652  7.933   1.00 77.93  ? 24   LEU C CA  1 
ATOM   9147  C C   . LEU C  1 24  ? -63.513 21.926  8.532   1.00 80.21  ? 24   LEU C C   1 
ATOM   9148  O O   . LEU C  1 24  ? -63.497 20.702  8.661   1.00 78.31  ? 24   LEU C O   1 
ATOM   9149  C CB  . LEU C  1 24  ? -61.608 23.544  8.992   1.00 78.28  ? 24   LEU C CB  1 
ATOM   9150  C CG  . LEU C  1 24  ? -60.979 22.809  10.195  1.00 81.33  ? 24   LEU C CG  1 
ATOM   9151  C CD1 . LEU C  1 24  ? -59.635 22.184  9.844   1.00 80.04  ? 24   LEU C CD1 1 
ATOM   9152  C CD2 . LEU C  1 24  ? -60.804 23.734  11.367  1.00 83.72  ? 24   LEU C CD2 1 
ATOM   9153  N N   . ARG C  1 25  ? -64.582 22.685  8.807   1.00 78.12  ? 25   ARG C N   1 
ATOM   9154  C CA  . ARG C  1 25  ? -65.850 22.185  9.332   1.00 78.06  ? 25   ARG C CA  1 
ATOM   9155  C C   . ARG C  1 25  ? -66.437 21.103  8.407   1.00 83.98  ? 25   ARG C C   1 
ATOM   9156  O O   . ARG C  1 25  ? -66.810 20.034  8.891   1.00 84.21  ? 25   ARG C O   1 
ATOM   9157  C CB  . ARG C  1 25  ? -66.843 23.339  9.572   1.00 75.57  ? 25   ARG C CB  1 
ATOM   9158  C CG  . ARG C  1 25  ? -67.839 23.018  10.661  1.00 83.28  ? 25   ARG C CG  1 
ATOM   9159  C CD  . ARG C  1 25  ? -68.673 24.197  11.109  1.00 102.97 ? 25   ARG C CD  1 
ATOM   9160  N NE  . ARG C  1 25  ? -69.529 23.806  12.231  1.00 110.65 ? 25   ARG C NE  1 
ATOM   9161  C CZ  . ARG C  1 25  ? -69.281 24.083  13.508  1.00 127.71 ? 25   ARG C CZ  1 
ATOM   9162  N NH1 . ARG C  1 25  ? -68.219 24.804  13.846  1.00 116.70 ? 25   ARG C NH1 1 
ATOM   9163  N NH2 . ARG C  1 25  ? -70.110 23.669  14.455  1.00 116.73 ? 25   ARG C NH2 1 
ATOM   9164  N N   . LYS C  1 26  ? -66.446 21.349  7.087   1.00 80.91  ? 26   LYS C N   1 
ATOM   9165  C CA  . LYS C  1 26  ? -66.966 20.415  6.081   1.00 80.26  ? 26   LYS C CA  1 
ATOM   9166  C C   . LYS C  1 26  ? -66.236 19.083  6.134   1.00 82.91  ? 26   LYS C C   1 
ATOM   9167  O O   . LYS C  1 26  ? -66.876 18.048  6.243   1.00 81.31  ? 26   LYS C O   1 
ATOM   9168  C CB  . LYS C  1 26  ? -66.892 21.042  4.664   1.00 83.48  ? 26   LYS C CB  1 
ATOM   9169  C CG  . LYS C  1 26  ? -67.099 20.099  3.467   1.00 85.07  ? 26   LYS C CG  1 
ATOM   9170  C CD  . LYS C  1 26  ? -66.562 20.775  2.193   1.00 94.51  ? 26   LYS C CD  1 
ATOM   9171  C CE  . LYS C  1 26  ? -66.306 19.867  1.019   1.00 103.69 ? 26   LYS C CE  1 
ATOM   9172  N NZ  . LYS C  1 26  ? -65.472 20.536  -0.024  1.00 109.97 ? 26   LYS C NZ  1 
ATOM   9173  N N   . TYR C  1 27  ? -64.908 19.120  6.105   1.00 80.27  ? 27   TYR C N   1 
ATOM   9174  C CA  . TYR C  1 27  ? -64.067 17.931  6.101   1.00 78.69  ? 27   TYR C CA  1 
ATOM   9175  C C   . TYR C  1 27  ? -64.033 17.090  7.356   1.00 80.25  ? 27   TYR C C   1 
ATOM   9176  O O   . TYR C  1 27  ? -63.886 15.878  7.238   1.00 78.88  ? 27   TYR C O   1 
ATOM   9177  C CB  . TYR C  1 27  ? -62.634 18.301  5.728   1.00 80.28  ? 27   TYR C CB  1 
ATOM   9178  C CG  . TYR C  1 27  ? -62.415 18.381  4.241   1.00 84.07  ? 27   TYR C CG  1 
ATOM   9179  C CD1 . TYR C  1 27  ? -62.739 19.529  3.533   1.00 87.88  ? 27   TYR C CD1 1 
ATOM   9180  C CD2 . TYR C  1 27  ? -61.890 17.302  3.535   1.00 84.80  ? 27   TYR C CD2 1 
ATOM   9181  C CE1 . TYR C  1 27  ? -62.534 19.612  2.158   1.00 90.53  ? 27   TYR C CE1 1 
ATOM   9182  C CE2 . TYR C  1 27  ? -61.673 17.376  2.158   1.00 86.82  ? 27   TYR C CE2 1 
ATOM   9183  C CZ  . TYR C  1 27  ? -61.991 18.538  1.475   1.00 98.09  ? 27   TYR C CZ  1 
ATOM   9184  O OH  . TYR C  1 27  ? -61.792 18.626  0.120   1.00 103.88 ? 27   TYR C OH  1 
ATOM   9185  N N   . TYR C  1 28  ? -64.096 17.710  8.543   1.00 76.35  ? 28   TYR C N   1 
ATOM   9186  C CA  . TYR C  1 28  ? -63.868 16.997  9.795   1.00 75.03  ? 28   TYR C CA  1 
ATOM   9187  C C   . TYR C  1 28  ? -64.972 16.935  10.839  1.00 82.77  ? 28   TYR C C   1 
ATOM   9188  O O   . TYR C  1 28  ? -64.758 16.318  11.903  1.00 80.83  ? 28   TYR C O   1 
ATOM   9189  C CB  . TYR C  1 28  ? -62.602 17.547  10.464  1.00 74.91  ? 28   TYR C CB  1 
ATOM   9190  C CG  . TYR C  1 28  ? -61.345 17.487  9.626   1.00 72.72  ? 28   TYR C CG  1 
ATOM   9191  C CD1 . TYR C  1 28  ? -60.740 18.652  9.157   1.00 76.37  ? 28   TYR C CD1 1 
ATOM   9192  C CD2 . TYR C  1 28  ? -60.726 16.275  9.352   1.00 69.27  ? 28   TYR C CD2 1 
ATOM   9193  C CE1 . TYR C  1 28  ? -59.548 18.606  8.441   1.00 76.23  ? 28   TYR C CE1 1 
ATOM   9194  C CE2 . TYR C  1 28  ? -59.549 16.217  8.621   1.00 68.22  ? 28   TYR C CE2 1 
ATOM   9195  C CZ  . TYR C  1 28  ? -58.963 17.383  8.170   1.00 72.10  ? 28   TYR C CZ  1 
ATOM   9196  O OH  . TYR C  1 28  ? -57.812 17.322  7.447   1.00 65.22  ? 28   TYR C OH  1 
ATOM   9197  N N   . GLU C  1 29  ? -66.121 17.585  10.597  1.00 82.87  ? 29   GLU C N   1 
ATOM   9198  C CA  . GLU C  1 29  ? -67.156 17.515  11.611  1.00 83.97  ? 29   GLU C CA  1 
ATOM   9199  C C   . GLU C  1 29  ? -67.859 16.165  11.607  1.00 88.21  ? 29   GLU C C   1 
ATOM   9200  O O   . GLU C  1 29  ? -68.042 15.578  10.537  1.00 86.87  ? 29   GLU C O   1 
ATOM   9201  C CB  . GLU C  1 29  ? -68.044 18.755  11.614  1.00 87.60  ? 29   GLU C CB  1 
ATOM   9202  C CG  . GLU C  1 29  ? -69.520 18.544  11.371  1.00 104.86 ? 29   GLU C CG  1 
ATOM   9203  C CD  . GLU C  1 29  ? -70.239 19.867  11.218  1.00 138.61 ? 29   GLU C CD  1 
ATOM   9204  O OE1 . GLU C  1 29  ? -70.415 20.576  12.238  1.00 122.08 ? 29   GLU C OE1 1 
ATOM   9205  O OE2 . GLU C  1 29  ? -70.548 20.234  10.061  1.00 144.82 ? 29   GLU C OE2 1 
ATOM   9206  N N   . ASN C  1 30  ? -68.124 15.629  12.822  1.00 86.29  ? 30   ASN C N   1 
ATOM   9207  C CA  . ASN C  1 30  ? -68.735 14.315  13.093  1.00 86.57  ? 30   ASN C CA  1 
ATOM   9208  C C   . ASN C  1 30  ? -67.830 13.133  12.700  1.00 90.97  ? 30   ASN C C   1 
ATOM   9209  O O   . ASN C  1 30  ? -68.275 11.981  12.680  1.00 91.61  ? 30   ASN C O   1 
ATOM   9210  C CB  . ASN C  1 30  ? -70.160 14.175  12.502  1.00 87.37  ? 30   ASN C CB  1 
ATOM   9211  C CG  . ASN C  1 30  ? -71.065 15.299  12.868  1.00 115.83 ? 30   ASN C CG  1 
ATOM   9212  O OD1 . ASN C  1 30  ? -71.177 15.676  14.042  1.00 116.97 ? 30   ASN C OD1 1 
ATOM   9213  N ND2 . ASN C  1 30  ? -71.704 15.877  11.860  1.00 107.42 ? 30   ASN C ND2 1 
ATOM   9214  N N   . CYS C  1 31  ? -66.566 13.412  12.427  1.00 86.67  ? 31   CYS C N   1 
ATOM   9215  C CA  . CYS C  1 31  ? -65.611 12.391  12.056  1.00 85.02  ? 31   CYS C CA  1 
ATOM   9216  C C   . CYS C  1 31  ? -64.871 11.885  13.290  1.00 80.38  ? 31   CYS C C   1 
ATOM   9217  O O   . CYS C  1 31  ? -64.359 12.688  14.063  1.00 79.45  ? 31   CYS C O   1 
ATOM   9218  C CB  . CYS C  1 31  ? -64.653 12.938  11.011  1.00 87.31  ? 31   CYS C CB  1 
ATOM   9219  S SG  . CYS C  1 31  ? -63.435 11.738  10.442  1.00 91.00  ? 31   CYS C SG  1 
ATOM   9220  N N   . GLU C  1 32  ? -64.838 10.560  13.482  1.00 71.74  ? 32   GLU C N   1 
ATOM   9221  C CA  . GLU C  1 32  ? -64.178 9.918   14.614  1.00 69.26  ? 32   GLU C CA  1 
ATOM   9222  C C   . GLU C  1 32  ? -62.778 9.457   14.227  1.00 69.83  ? 32   GLU C C   1 
ATOM   9223  O O   . GLU C  1 32  ? -61.825 9.678   14.984  1.00 68.31  ? 32   GLU C O   1 
ATOM   9224  C CB  . GLU C  1 32  ? -65.005 8.740   15.126  1.00 70.21  ? 32   GLU C CB  1 
ATOM   9225  C CG  . GLU C  1 32  ? -65.948 9.090   16.259  1.00 83.43  ? 32   GLU C CG  1 
ATOM   9226  C CD  . GLU C  1 32  ? -67.324 8.454   16.177  1.00 119.31 ? 32   GLU C CD  1 
ATOM   9227  O OE1 . GLU C  1 32  ? -67.417 7.256   15.817  1.00 112.80 ? 32   GLU C OE1 1 
ATOM   9228  O OE2 . GLU C  1 32  ? -68.317 9.164   16.469  1.00 126.01 ? 32   GLU C OE2 1 
ATOM   9229  N N   . VAL C  1 33  ? -62.651 8.828   13.042  1.00 64.87  ? 33   VAL C N   1 
ATOM   9230  C CA  . VAL C  1 33  ? -61.369 8.340   12.517  1.00 63.40  ? 33   VAL C CA  1 
ATOM   9231  C C   . VAL C  1 33  ? -61.003 9.102   11.254  1.00 68.65  ? 33   VAL C C   1 
ATOM   9232  O O   . VAL C  1 33  ? -61.666 8.937   10.219  1.00 68.04  ? 33   VAL C O   1 
ATOM   9233  C CB  . VAL C  1 33  ? -61.384 6.807   12.252  1.00 65.37  ? 33   VAL C CB  1 
ATOM   9234  C CG1 . VAL C  1 33  ? -60.092 6.328   11.604  1.00 63.16  ? 33   VAL C CG1 1 
ATOM   9235  C CG2 . VAL C  1 33  ? -61.651 6.037   13.532  1.00 65.16  ? 33   VAL C CG2 1 
ATOM   9236  N N   . VAL C  1 34  ? -59.914 9.902   11.325  1.00 66.18  ? 34   VAL C N   1 
ATOM   9237  C CA  . VAL C  1 34  ? -59.400 10.640  10.156  1.00 65.63  ? 34   VAL C CA  1 
ATOM   9238  C C   . VAL C  1 34  ? -58.444 9.703   9.445   1.00 72.18  ? 34   VAL C C   1 
ATOM   9239  O O   . VAL C  1 34  ? -57.366 9.379   9.957   1.00 69.91  ? 34   VAL C O   1 
ATOM   9240  C CB  . VAL C  1 34  ? -58.782 12.006  10.477  1.00 67.55  ? 34   VAL C CB  1 
ATOM   9241  C CG1 . VAL C  1 34  ? -58.302 12.686  9.212   1.00 67.53  ? 34   VAL C CG1 1 
ATOM   9242  C CG2 . VAL C  1 34  ? -59.775 12.879  11.213  1.00 67.73  ? 34   VAL C CG2 1 
ATOM   9243  N N   . MET C  1 35  ? -58.886 9.220   8.290   1.00 73.34  ? 35   MET C N   1 
ATOM   9244  C CA  . MET C  1 35  ? -58.154 8.224   7.521   1.00 74.71  ? 35   MET C CA  1 
ATOM   9245  C C   . MET C  1 35  ? -57.246 8.893   6.564   1.00 78.86  ? 35   MET C C   1 
ATOM   9246  O O   . MET C  1 35  ? -57.437 8.803   5.351   1.00 80.53  ? 35   MET C O   1 
ATOM   9247  C CB  . MET C  1 35  ? -59.140 7.316   6.813   1.00 77.96  ? 35   MET C CB  1 
ATOM   9248  C CG  . MET C  1 35  ? -59.962 6.535   7.780   1.00 82.65  ? 35   MET C CG  1 
ATOM   9249  S SD  . MET C  1 35  ? -59.870 4.791   7.412   1.00 87.30  ? 35   MET C SD  1 
ATOM   9250  C CE  . MET C  1 35  ? -58.029 4.570   7.257   1.00 83.11  ? 35   MET C CE  1 
ATOM   9251  N N   . GLY C  1 36  ? -56.250 9.553   7.135   1.00 72.65  ? 36   GLY C N   1 
ATOM   9252  C CA  . GLY C  1 36  ? -55.314 10.417  6.441   1.00 71.78  ? 36   GLY C CA  1 
ATOM   9253  C C   . GLY C  1 36  ? -54.912 11.537  7.371   1.00 73.52  ? 36   GLY C C   1 
ATOM   9254  O O   . GLY C  1 36  ? -54.700 11.267  8.555   1.00 73.35  ? 36   GLY C O   1 
ATOM   9255  N N   . ASN C  1 37  ? -54.855 12.805  6.887   1.00 68.64  ? 37   ASN C N   1 
ATOM   9256  C CA  . ASN C  1 37  ? -54.329 13.924  7.713   1.00 67.16  ? 37   ASN C CA  1 
ATOM   9257  C C   . ASN C  1 37  ? -55.323 14.927  8.239   1.00 68.18  ? 37   ASN C C   1 
ATOM   9258  O O   . ASN C  1 37  ? -56.285 15.283  7.548   1.00 67.03  ? 37   ASN C O   1 
ATOM   9259  C CB  . ASN C  1 37  ? -53.181 14.661  7.003   1.00 59.36  ? 37   ASN C CB  1 
ATOM   9260  C CG  . ASN C  1 37  ? -52.269 13.752  6.247   1.00 67.55  ? 37   ASN C CG  1 
ATOM   9261  O OD1 . ASN C  1 37  ? -51.835 12.706  6.741   1.00 63.00  ? 37   ASN C OD1 1 
ATOM   9262  N ND2 . ASN C  1 37  ? -51.970 14.124  5.022   1.00 66.62  ? 37   ASN C ND2 1 
ATOM   9263  N N   . LEU C  1 38  ? -55.064 15.396  9.460   1.00 62.53  ? 38   LEU C N   1 
ATOM   9264  C CA  . LEU C  1 38  ? -55.870 16.423  10.111  1.00 62.01  ? 38   LEU C CA  1 
ATOM   9265  C C   . LEU C  1 38  ? -55.020 17.675  10.030  1.00 67.39  ? 38   LEU C C   1 
ATOM   9266  O O   . LEU C  1 38  ? -53.997 17.786  10.718  1.00 68.80  ? 38   LEU C O   1 
ATOM   9267  C CB  . LEU C  1 38  ? -56.203 16.052  11.579  1.00 60.33  ? 38   LEU C CB  1 
ATOM   9268  C CG  . LEU C  1 38  ? -56.862 17.114  12.433  1.00 63.45  ? 38   LEU C CG  1 
ATOM   9269  C CD1 . LEU C  1 38  ? -58.259 17.428  11.943  1.00 64.94  ? 38   LEU C CD1 1 
ATOM   9270  C CD2 . LEU C  1 38  ? -56.878 16.688  13.870  1.00 59.22  ? 38   LEU C CD2 1 
ATOM   9271  N N   . GLU C  1 39  ? -55.399 18.566  9.115   1.00 62.43  ? 39   GLU C N   1 
ATOM   9272  C CA  . GLU C  1 39  ? -54.721 19.824  8.821   1.00 61.84  ? 39   GLU C CA  1 
ATOM   9273  C C   . GLU C  1 39  ? -55.609 20.984  9.261   1.00 71.08  ? 39   GLU C C   1 
ATOM   9274  O O   . GLU C  1 39  ? -56.732 21.144  8.747   1.00 72.05  ? 39   GLU C O   1 
ATOM   9275  C CB  . GLU C  1 39  ? -54.395 19.912  7.326   1.00 61.99  ? 39   GLU C CB  1 
ATOM   9276  C CG  . GLU C  1 39  ? -53.305 18.952  6.911   1.00 66.89  ? 39   GLU C CG  1 
ATOM   9277  C CD  . GLU C  1 39  ? -53.047 18.807  5.422   1.00 85.70  ? 39   GLU C CD  1 
ATOM   9278  O OE1 . GLU C  1 39  ? -51.885 18.521  5.051   1.00 71.24  ? 39   GLU C OE1 1 
ATOM   9279  O OE2 . GLU C  1 39  ? -54.011 18.917  4.631   1.00 71.28  ? 39   GLU C OE2 1 
ATOM   9280  N N   . ILE C  1 40  ? -55.128 21.743  10.267  1.00 69.01  ? 40   ILE C N   1 
ATOM   9281  C CA  . ILE C  1 40  ? -55.795 22.920  10.833  1.00 70.51  ? 40   ILE C CA  1 
ATOM   9282  C C   . ILE C  1 40  ? -54.833 24.094  10.613  1.00 78.34  ? 40   ILE C C   1 
ATOM   9283  O O   . ILE C  1 40  ? -53.864 24.257  11.362  1.00 77.61  ? 40   ILE C O   1 
ATOM   9284  C CB  . ILE C  1 40  ? -56.162 22.691  12.327  1.00 72.46  ? 40   ILE C CB  1 
ATOM   9285  C CG1 . ILE C  1 40  ? -56.966 21.378  12.517  1.00 71.03  ? 40   ILE C CG1 1 
ATOM   9286  C CG2 . ILE C  1 40  ? -56.902 23.907  12.911  1.00 73.95  ? 40   ILE C CG2 1 
ATOM   9287  C CD1 . ILE C  1 40  ? -56.796 20.720  13.877  1.00 79.01  ? 40   ILE C CD1 1 
ATOM   9288  N N   . THR C  1 41  ? -55.049 24.847  9.516   1.00 78.55  ? 41   THR C N   1 
ATOM   9289  C CA  . THR C  1 41  ? -54.175 25.967  9.131   1.00 80.31  ? 41   THR C CA  1 
ATOM   9290  C C   . THR C  1 41  ? -54.951 27.217  8.787   1.00 84.93  ? 41   THR C C   1 
ATOM   9291  O O   . THR C  1 41  ? -56.012 27.120  8.170   1.00 85.23  ? 41   THR C O   1 
ATOM   9292  C CB  . THR C  1 41  ? -53.195 25.597  7.980   1.00 89.92  ? 41   THR C CB  1 
ATOM   9293  O OG1 . THR C  1 41  ? -53.916 25.132  6.827   1.00 93.68  ? 41   THR C OG1 1 
ATOM   9294  C CG2 . THR C  1 41  ? -52.139 24.579  8.400   1.00 83.78  ? 41   THR C CG2 1 
ATOM   9295  N N   . SER C  1 42  ? -54.397 28.394  9.166   1.00 80.96  ? 42   SER C N   1 
ATOM   9296  C CA  . SER C  1 42  ? -54.932 29.734  8.899   1.00 82.15  ? 42   SER C CA  1 
ATOM   9297  C C   . SER C  1 42  ? -56.365 29.975  9.421   1.00 85.89  ? 42   SER C C   1 
ATOM   9298  O O   . SER C  1 42  ? -57.206 30.537  8.707   1.00 87.33  ? 42   SER C O   1 
ATOM   9299  C CB  . SER C  1 42  ? -54.769 30.109  7.425   1.00 85.26  ? 42   SER C CB  1 
ATOM   9300  O OG  . SER C  1 42  ? -53.425 29.966  6.988   1.00 88.46  ? 42   SER C OG  1 
ATOM   9301  N N   . ILE C  1 43  ? -56.634 29.554  10.674  1.00 80.12  ? 43   ILE C N   1 
ATOM   9302  C CA  . ILE C  1 43  ? -57.936 29.746  11.309  1.00 79.98  ? 43   ILE C CA  1 
ATOM   9303  C C   . ILE C  1 43  ? -57.896 30.941  12.270  1.00 89.98  ? 43   ILE C C   1 
ATOM   9304  O O   . ILE C  1 43  ? -57.006 31.027  13.108  1.00 90.77  ? 43   ILE C O   1 
ATOM   9305  C CB  . ILE C  1 43  ? -58.541 28.421  11.869  1.00 79.76  ? 43   ILE C CB  1 
ATOM   9306  C CG1 . ILE C  1 43  ? -59.106 27.569  10.730  1.00 78.56  ? 43   ILE C CG1 1 
ATOM   9307  C CG2 . ILE C  1 43  ? -59.634 28.647  12.897  1.00 80.83  ? 43   ILE C CG2 1 
ATOM   9308  C CD1 . ILE C  1 43  ? -58.294 26.445  10.377  1.00 89.60  ? 43   ILE C CD1 1 
ATOM   9309  N N   . GLU C  1 44  ? -58.834 31.884  12.091  1.00 90.55  ? 44   GLU C N   1 
ATOM   9310  C CA  . GLU C  1 44  ? -58.975 33.126  12.855  1.00 93.51  ? 44   GLU C CA  1 
ATOM   9311  C C   . GLU C  1 44  ? -59.288 32.917  14.332  1.00 99.91  ? 44   GLU C C   1 
ATOM   9312  O O   . GLU C  1 44  ? -59.832 31.885  14.722  1.00 97.08  ? 44   GLU C O   1 
ATOM   9313  C CB  . GLU C  1 44  ? -60.062 34.013  12.223  1.00 97.31  ? 44   GLU C CB  1 
ATOM   9314  C CG  . GLU C  1 44  ? -59.718 34.565  10.847  1.00 109.67 ? 44   GLU C CG  1 
ATOM   9315  C CD  . GLU C  1 44  ? -60.915 34.776  9.944   1.00 125.04 ? 44   GLU C CD  1 
ATOM   9316  O OE1 . GLU C  1 44  ? -61.155 35.940  9.552   1.00 117.69 ? 44   GLU C OE1 1 
ATOM   9317  O OE2 . GLU C  1 44  ? -61.618 33.784  9.638   1.00 117.52 ? 44   GLU C OE2 1 
ATOM   9318  N N   . HIS C  1 45  ? -58.988 33.941  15.136  1.00 101.88 ? 45   HIS C N   1 
ATOM   9319  C CA  . HIS C  1 45  ? -59.178 33.986  16.581  1.00 103.53 ? 45   HIS C CA  1 
ATOM   9320  C C   . HIS C  1 45  ? -60.605 33.658  17.108  1.00 107.94 ? 45   HIS C C   1 
ATOM   9321  O O   . HIS C  1 45  ? -60.742 32.875  18.049  1.00 105.97 ? 45   HIS C O   1 
ATOM   9322  C CB  . HIS C  1 45  ? -58.696 35.346  17.103  1.00 107.11 ? 45   HIS C CB  1 
ATOM   9323  C CG  . HIS C  1 45  ? -59.005 35.569  18.548  1.00 111.50 ? 45   HIS C CG  1 
ATOM   9324  N ND1 . HIS C  1 45  ? -60.079 36.353  18.942  1.00 115.24 ? 45   HIS C ND1 1 
ATOM   9325  C CD2 . HIS C  1 45  ? -58.414 35.045  19.648  1.00 111.95 ? 45   HIS C CD2 1 
ATOM   9326  C CE1 . HIS C  1 45  ? -60.080 36.314  20.264  1.00 114.57 ? 45   HIS C CE1 1 
ATOM   9327  N NE2 . HIS C  1 45  ? -59.095 35.542  20.735  1.00 112.94 ? 45   HIS C NE2 1 
ATOM   9328  N N   . ASN C  1 46  ? -61.637 34.290  16.538  1.00 106.32 ? 46   ASN C N   1 
ATOM   9329  C CA  . ASN C  1 46  ? -63.031 34.121  16.963  1.00 106.75 ? 46   ASN C CA  1 
ATOM   9330  C C   . ASN C  1 46  ? -63.623 32.698  16.884  1.00 106.41 ? 46   ASN C C   1 
ATOM   9331  O O   . ASN C  1 46  ? -64.363 32.296  17.782  1.00 104.62 ? 46   ASN C O   1 
ATOM   9332  C CB  . ASN C  1 46  ? -63.980 35.199  16.317  1.00 112.76 ? 46   ASN C CB  1 
ATOM   9333  C CG  . ASN C  1 46  ? -64.359 35.055  14.830  1.00 125.51 ? 46   ASN C CG  1 
ATOM   9334  O OD1 . ASN C  1 46  ? -63.834 35.749  13.940  1.00 113.98 ? 46   ASN C OD1 1 
ATOM   9335  N ND2 . ASN C  1 46  ? -65.391 34.268  14.540  1.00 113.21 ? 46   ASN C ND2 1 
ATOM   9336  N N   . ARG C  1 47  ? -63.277 31.961  15.813  1.00 101.51 ? 47   ARG C N   1 
ATOM   9337  C CA  . ARG C  1 47  ? -63.751 30.639  15.373  1.00 99.41  ? 47   ARG C CA  1 
ATOM   9338  C C   . ARG C  1 47  ? -64.075 29.548  16.385  1.00 101.01 ? 47   ARG C C   1 
ATOM   9339  O O   . ARG C  1 47  ? -63.296 29.321  17.313  1.00 98.58  ? 47   ARG C O   1 
ATOM   9340  C CB  . ARG C  1 47  ? -62.856 30.084  14.251  1.00 98.27  ? 47   ARG C CB  1 
ATOM   9341  C CG  . ARG C  1 47  ? -62.669 31.016  13.056  1.00 107.79 ? 47   ARG C CG  1 
ATOM   9342  C CD  . ARG C  1 47  ? -63.992 31.273  12.380  1.00 115.26 ? 47   ARG C CD  1 
ATOM   9343  N NE  . ARG C  1 47  ? -63.859 32.095  11.189  1.00 121.13 ? 47   ARG C NE  1 
ATOM   9344  C CZ  . ARG C  1 47  ? -64.891 32.639  10.563  1.00 142.40 ? 47   ARG C CZ  1 
ATOM   9345  N NH1 . ARG C  1 47  ? -66.122 32.467  11.025  1.00 131.35 ? 47   ARG C NH1 1 
ATOM   9346  N NH2 . ARG C  1 47  ? -64.702 33.371  9.475   1.00 138.32 ? 47   ARG C NH2 1 
ATOM   9347  N N   . ASP C  1 48  ? -65.201 28.823  16.147  1.00 97.73  ? 48   ASP C N   1 
ATOM   9348  C CA  . ASP C  1 48  ? -65.646 27.702  16.981  1.00 96.70  ? 48   ASP C CA  1 
ATOM   9349  C C   . ASP C  1 48  ? -65.056 26.379  16.479  1.00 96.23  ? 48   ASP C C   1 
ATOM   9350  O O   . ASP C  1 48  ? -65.318 25.983  15.340  1.00 95.83  ? 48   ASP C O   1 
ATOM   9351  C CB  . ASP C  1 48  ? -67.184 27.619  17.058  1.00 100.54 ? 48   ASP C CB  1 
ATOM   9352  C CG  . ASP C  1 48  ? -67.709 26.362  17.761  1.00 114.86 ? 48   ASP C CG  1 
ATOM   9353  O OD1 . ASP C  1 48  ? -67.251 26.078  18.900  1.00 116.03 ? 48   ASP C OD1 1 
ATOM   9354  O OD2 . ASP C  1 48  ? -68.576 25.661  17.170  1.00 118.53 ? 48   ASP C OD2 1 
ATOM   9355  N N   . LEU C  1 49  ? -64.286 25.687  17.335  1.00 88.69  ? 49   LEU C N   1 
ATOM   9356  C CA  . LEU C  1 49  ? -63.655 24.431  16.940  1.00 85.18  ? 49   LEU C CA  1 
ATOM   9357  C C   . LEU C  1 49  ? -64.127 23.204  17.732  1.00 87.85  ? 49   LEU C C   1 
ATOM   9358  O O   . LEU C  1 49  ? -63.546 22.120  17.605  1.00 84.36  ? 49   LEU C O   1 
ATOM   9359  C CB  . LEU C  1 49  ? -62.119 24.563  16.950  1.00 83.79  ? 49   LEU C CB  1 
ATOM   9360  C CG  . LEU C  1 49  ? -61.482 25.657  16.105  1.00 88.42  ? 49   LEU C CG  1 
ATOM   9361  C CD1 . LEU C  1 49  ? -60.055 25.641  16.288  1.00 87.24  ? 49   LEU C CD1 1 
ATOM   9362  C CD2 . LEU C  1 49  ? -61.737 25.454  14.641  1.00 91.25  ? 49   LEU C CD2 1 
ATOM   9363  N N   . SER C  1 50  ? -65.218 23.365  18.506  1.00 86.51  ? 50   SER C N   1 
ATOM   9364  C CA  . SER C  1 50  ? -65.838 22.316  19.317  1.00 85.42  ? 50   SER C CA  1 
ATOM   9365  C C   . SER C  1 50  ? -66.043 21.012  18.532  1.00 87.63  ? 50   SER C C   1 
ATOM   9366  O O   . SER C  1 50  ? -65.922 19.946  19.120  1.00 86.29  ? 50   SER C O   1 
ATOM   9367  C CB  . SER C  1 50  ? -67.174 22.801  19.860  1.00 91.28  ? 50   SER C CB  1 
ATOM   9368  O OG  . SER C  1 50  ? -68.023 23.124  18.768  1.00 105.46 ? 50   SER C OG  1 
ATOM   9369  N N   . PHE C  1 51  ? -66.318 21.094  17.205  1.00 83.73  ? 51   PHE C N   1 
ATOM   9370  C CA  . PHE C  1 51  ? -66.539 19.934  16.318  1.00 80.98  ? 51   PHE C CA  1 
ATOM   9371  C C   . PHE C  1 51  ? -65.376 18.968  16.249  1.00 81.43  ? 51   PHE C C   1 
ATOM   9372  O O   . PHE C  1 51  ? -65.592 17.802  15.915  1.00 79.70  ? 51   PHE C O   1 
ATOM   9373  C CB  . PHE C  1 51  ? -66.981 20.366  14.909  1.00 83.06  ? 51   PHE C CB  1 
ATOM   9374  C CG  . PHE C  1 51  ? -65.972 21.164  14.124  1.00 83.84  ? 51   PHE C CG  1 
ATOM   9375  C CD1 . PHE C  1 51  ? -65.132 20.545  13.210  1.00 84.88  ? 51   PHE C CD1 1 
ATOM   9376  C CD2 . PHE C  1 51  ? -65.872 22.540  14.285  1.00 87.36  ? 51   PHE C CD2 1 
ATOM   9377  C CE1 . PHE C  1 51  ? -64.185 21.281  12.495  1.00 85.99  ? 51   PHE C CE1 1 
ATOM   9378  C CE2 . PHE C  1 51  ? -64.931 23.277  13.564  1.00 90.07  ? 51   PHE C CE2 1 
ATOM   9379  C CZ  . PHE C  1 51  ? -64.096 22.643  12.672  1.00 86.48  ? 51   PHE C CZ  1 
ATOM   9380  N N   . LEU C  1 52  ? -64.149 19.449  16.569  1.00 77.20  ? 52   LEU C N   1 
ATOM   9381  C CA  . LEU C  1 52  ? -62.922 18.654  16.576  1.00 75.07  ? 52   LEU C CA  1 
ATOM   9382  C C   . LEU C  1 52  ? -62.915 17.656  17.730  1.00 79.77  ? 52   LEU C C   1 
ATOM   9383  O O   . LEU C  1 52  ? -62.105 16.729  17.737  1.00 80.26  ? 52   LEU C O   1 
ATOM   9384  C CB  . LEU C  1 52  ? -61.682 19.551  16.632  1.00 75.03  ? 52   LEU C CB  1 
ATOM   9385  C CG  . LEU C  1 52  ? -61.398 20.425  15.417  1.00 79.93  ? 52   LEU C CG  1 
ATOM   9386  C CD1 . LEU C  1 52  ? -60.286 21.399  15.717  1.00 80.49  ? 52   LEU C CD1 1 
ATOM   9387  C CD2 . LEU C  1 52  ? -61.033 19.588  14.195  1.00 80.33  ? 52   LEU C CD2 1 
ATOM   9388  N N   . ARG C  1 53  ? -63.839 17.811  18.686  1.00 76.14  ? 53   ARG C N   1 
ATOM   9389  C CA  . ARG C  1 53  ? -63.965 16.885  19.807  1.00 75.11  ? 53   ARG C CA  1 
ATOM   9390  C C   . ARG C  1 53  ? -64.438 15.497  19.350  1.00 77.66  ? 53   ARG C C   1 
ATOM   9391  O O   . ARG C  1 53  ? -64.333 14.542  20.111  1.00 77.14  ? 53   ARG C O   1 
ATOM   9392  C CB  . ARG C  1 53  ? -64.880 17.456  20.897  1.00 74.23  ? 53   ARG C CB  1 
ATOM   9393  C CG  . ARG C  1 53  ? -64.227 18.568  21.690  1.00 78.38  ? 53   ARG C CG  1 
ATOM   9394  C CD  . ARG C  1 53  ? -65.259 19.364  22.428  1.00 93.26  ? 53   ARG C CD  1 
ATOM   9395  N NE  . ARG C  1 53  ? -64.638 20.358  23.293  1.00 109.23 ? 53   ARG C NE  1 
ATOM   9396  C CZ  . ARG C  1 53  ? -65.250 21.451  23.731  1.00 129.33 ? 53   ARG C CZ  1 
ATOM   9397  N NH1 . ARG C  1 53  ? -66.502 21.714  23.364  1.00 120.24 ? 53   ARG C NH1 1 
ATOM   9398  N NH2 . ARG C  1 53  ? -64.607 22.306  24.516  1.00 117.84 ? 53   ARG C NH2 1 
ATOM   9399  N N   . SER C  1 54  ? -64.926 15.372  18.110  1.00 73.57  ? 54   SER C N   1 
ATOM   9400  C CA  . SER C  1 54  ? -65.373 14.089  17.579  1.00 72.47  ? 54   SER C CA  1 
ATOM   9401  C C   . SER C  1 54  ? -64.181 13.164  17.258  1.00 74.95  ? 54   SER C C   1 
ATOM   9402  O O   . SER C  1 54  ? -64.321 11.936  17.313  1.00 72.84  ? 54   SER C O   1 
ATOM   9403  C CB  . SER C  1 54  ? -66.217 14.304  16.330  1.00 77.26  ? 54   SER C CB  1 
ATOM   9404  O OG  . SER C  1 54  ? -65.469 14.871  15.262  1.00 92.09  ? 54   SER C OG  1 
ATOM   9405  N N   . VAL C  1 55  ? -63.014 13.765  16.910  1.00 70.73  ? 55   VAL C N   1 
ATOM   9406  C CA  . VAL C  1 55  ? -61.810 13.045  16.511  1.00 67.86  ? 55   VAL C CA  1 
ATOM   9407  C C   . VAL C  1 55  ? -61.206 12.279  17.655  1.00 69.66  ? 55   VAL C C   1 
ATOM   9408  O O   . VAL C  1 55  ? -60.861 12.877  18.688  1.00 68.80  ? 55   VAL C O   1 
ATOM   9409  C CB  . VAL C  1 55  ? -60.763 13.916  15.767  1.00 71.69  ? 55   VAL C CB  1 
ATOM   9410  C CG1 . VAL C  1 55  ? -59.583 13.070  15.304  1.00 70.85  ? 55   VAL C CG1 1 
ATOM   9411  C CG2 . VAL C  1 55  ? -61.381 14.625  14.569  1.00 72.09  ? 55   VAL C CG2 1 
ATOM   9412  N N   . ARG C  1 56  ? -61.081 10.936  17.433  1.00 64.32  ? 56   ARG C N   1 
ATOM   9413  C CA  . ARG C  1 56  ? -60.519 9.903   18.307  1.00 61.61  ? 56   ARG C CA  1 
ATOM   9414  C C   . ARG C  1 56  ? -59.195 9.371   17.770  1.00 63.31  ? 56   ARG C C   1 
ATOM   9415  O O   . ARG C  1 56  ? -58.320 8.990   18.562  1.00 64.76  ? 56   ARG C O   1 
ATOM   9416  C CB  . ARG C  1 56  ? -61.521 8.736   18.456  1.00 58.93  ? 56   ARG C CB  1 
ATOM   9417  C CG  . ARG C  1 56  ? -62.418 8.856   19.676  1.00 77.57  ? 56   ARG C CG  1 
ATOM   9418  C CD  . ARG C  1 56  ? -63.827 9.311   19.341  1.00 101.29 ? 56   ARG C CD  1 
ATOM   9419  N NE  . ARG C  1 56  ? -64.522 9.898   20.497  1.00 112.82 ? 56   ARG C NE  1 
ATOM   9420  C CZ  . ARG C  1 56  ? -65.638 10.621  20.418  1.00 125.89 ? 56   ARG C CZ  1 
ATOM   9421  N NH1 . ARG C  1 56  ? -66.202 10.862  19.239  1.00 107.77 ? 56   ARG C NH1 1 
ATOM   9422  N NH2 . ARG C  1 56  ? -66.195 11.113  21.518  1.00 117.64 ? 56   ARG C NH2 1 
ATOM   9423  N N   . GLU C  1 57  ? -59.050 9.314   16.433  1.00 57.59  ? 57   GLU C N   1 
ATOM   9424  C CA  . GLU C  1 57  ? -57.872 8.750   15.763  1.00 56.22  ? 57   GLU C CA  1 
ATOM   9425  C C   . GLU C  1 57  ? -57.538 9.443   14.431  1.00 60.77  ? 57   GLU C C   1 
ATOM   9426  O O   . GLU C  1 57  ? -58.452 9.838   13.709  1.00 63.12  ? 57   GLU C O   1 
ATOM   9427  C CB  . GLU C  1 57  ? -58.138 7.257   15.536  1.00 56.49  ? 57   GLU C CB  1 
ATOM   9428  C CG  . GLU C  1 57  ? -57.240 6.548   14.531  1.00 68.65  ? 57   GLU C CG  1 
ATOM   9429  C CD  . GLU C  1 57  ? -57.412 5.041   14.442  1.00 93.66  ? 57   GLU C CD  1 
ATOM   9430  O OE1 . GLU C  1 57  ? -56.671 4.426   13.640  1.00 72.84  ? 57   GLU C OE1 1 
ATOM   9431  O OE2 . GLU C  1 57  ? -58.266 4.474   15.170  1.00 84.61  ? 57   GLU C OE2 1 
ATOM   9432  N N   . VAL C  1 58  ? -56.233 9.564   14.110  1.00 54.43  ? 58   VAL C N   1 
ATOM   9433  C CA  . VAL C  1 58  ? -55.697 10.118  12.866  1.00 53.19  ? 58   VAL C CA  1 
ATOM   9434  C C   . VAL C  1 58  ? -54.632 9.135   12.325  1.00 56.00  ? 58   VAL C C   1 
ATOM   9435  O O   . VAL C  1 58  ? -53.612 8.868   12.975  1.00 50.86  ? 58   VAL C O   1 
ATOM   9436  C CB  . VAL C  1 58  ? -55.143 11.557  13.041  1.00 57.54  ? 58   VAL C CB  1 
ATOM   9437  C CG1 . VAL C  1 58  ? -54.451 12.060  11.776  1.00 57.65  ? 58   VAL C CG1 1 
ATOM   9438  C CG2 . VAL C  1 58  ? -56.238 12.524  13.466  1.00 58.16  ? 58   VAL C CG2 1 
ATOM   9439  N N   . THR C  1 59  ? -54.917 8.579   11.137  1.00 56.76  ? 59   THR C N   1 
ATOM   9440  C CA  . THR C  1 59  ? -54.106 7.616   10.368  1.00 56.72  ? 59   THR C CA  1 
ATOM   9441  C C   . THR C  1 59  ? -52.742 8.169   9.947   1.00 61.73  ? 59   THR C C   1 
ATOM   9442  O O   . THR C  1 59  ? -51.735 7.454   10.055  1.00 60.42  ? 59   THR C O   1 
ATOM   9443  C CB  . THR C  1 59  ? -54.966 7.154   9.195   1.00 61.74  ? 59   THR C CB  1 
ATOM   9444  O OG1 . THR C  1 59  ? -55.959 6.316   9.765   1.00 62.96  ? 59   THR C OG1 1 
ATOM   9445  C CG2 . THR C  1 59  ? -54.192 6.423   8.086   1.00 56.66  ? 59   THR C CG2 1 
ATOM   9446  N N   . GLY C  1 60  ? -52.742 9.414   9.454   1.00 59.19  ? 60   GLY C N   1 
ATOM   9447  C CA  . GLY C  1 60  ? -51.559 10.105  8.964   1.00 59.95  ? 60   GLY C CA  1 
ATOM   9448  C C   . GLY C  1 60  ? -50.978 11.040  9.996   1.00 64.55  ? 60   GLY C C   1 
ATOM   9449  O O   . GLY C  1 60  ? -50.600 10.597  11.086  1.00 64.84  ? 60   GLY C O   1 
ATOM   9450  N N   . TYR C  1 61  ? -50.917 12.346  9.665   1.00 59.81  ? 61   TYR C N   1 
ATOM   9451  C CA  . TYR C  1 61  ? -50.366 13.341  10.572  1.00 58.93  ? 61   TYR C CA  1 
ATOM   9452  C C   . TYR C  1 61  ? -51.361 14.414  10.985  1.00 62.61  ? 61   TYR C C   1 
ATOM   9453  O O   . TYR C  1 61  ? -52.431 14.555  10.384  1.00 62.16  ? 61   TYR C O   1 
ATOM   9454  C CB  . TYR C  1 61  ? -49.085 13.972  10.004  1.00 60.26  ? 61   TYR C CB  1 
ATOM   9455  C CG  . TYR C  1 61  ? -49.299 14.786  8.743   1.00 61.16  ? 61   TYR C CG  1 
ATOM   9456  C CD1 . TYR C  1 61  ? -49.768 16.098  8.805   1.00 64.20  ? 61   TYR C CD1 1 
ATOM   9457  C CD2 . TYR C  1 61  ? -48.969 14.267  7.493   1.00 60.73  ? 61   TYR C CD2 1 
ATOM   9458  C CE1 . TYR C  1 61  ? -49.952 16.853  7.647   1.00 67.24  ? 61   TYR C CE1 1 
ATOM   9459  C CE2 . TYR C  1 61  ? -49.096 15.027  6.335   1.00 62.40  ? 61   TYR C CE2 1 
ATOM   9460  C CZ  . TYR C  1 61  ? -49.612 16.312  6.410   1.00 75.46  ? 61   TYR C CZ  1 
ATOM   9461  O OH  . TYR C  1 61  ? -49.787 17.026  5.243   1.00 79.66  ? 61   TYR C OH  1 
ATOM   9462  N N   . VAL C  1 62  ? -50.969 15.190  12.010  1.00 58.79  ? 62   VAL C N   1 
ATOM   9463  C CA  . VAL C  1 62  ? -51.715 16.311  12.570  1.00 58.52  ? 62   VAL C CA  1 
ATOM   9464  C C   . VAL C  1 62  ? -50.836 17.550  12.412  1.00 66.69  ? 62   VAL C C   1 
ATOM   9465  O O   . VAL C  1 62  ? -49.752 17.653  13.018  1.00 67.63  ? 62   VAL C O   1 
ATOM   9466  C CB  . VAL C  1 62  ? -52.177 16.076  14.035  1.00 59.43  ? 62   VAL C CB  1 
ATOM   9467  C CG1 . VAL C  1 62  ? -52.855 17.299  14.611  1.00 59.20  ? 62   VAL C CG1 1 
ATOM   9468  C CG2 . VAL C  1 62  ? -53.109 14.884  14.118  1.00 58.51  ? 62   VAL C CG2 1 
ATOM   9469  N N   . LEU C  1 63  ? -51.307 18.472  11.563  1.00 64.29  ? 63   LEU C N   1 
ATOM   9470  C CA  . LEU C  1 63  ? -50.662 19.752  11.291  1.00 66.05  ? 63   LEU C CA  1 
ATOM   9471  C C   . LEU C  1 63  ? -51.546 20.880  11.837  1.00 71.66  ? 63   LEU C C   1 
ATOM   9472  O O   . LEU C  1 63  ? -52.714 21.005  11.460  1.00 72.07  ? 63   LEU C O   1 
ATOM   9473  C CB  . LEU C  1 63  ? -50.403 19.901  9.769   1.00 66.38  ? 63   LEU C CB  1 
ATOM   9474  C CG  . LEU C  1 63  ? -49.772 21.178  9.246   1.00 71.54  ? 63   LEU C CG  1 
ATOM   9475  C CD1 . LEU C  1 63  ? -48.380 21.375  9.800   1.00 72.42  ? 63   LEU C CD1 1 
ATOM   9476  C CD2 . LEU C  1 63  ? -49.689 21.127  7.750   1.00 72.83  ? 63   LEU C CD2 1 
ATOM   9477  N N   . VAL C  1 64  ? -51.002 21.643  12.785  1.00 68.69  ? 64   VAL C N   1 
ATOM   9478  C CA  . VAL C  1 64  ? -51.674 22.772  13.424  1.00 69.71  ? 64   VAL C CA  1 
ATOM   9479  C C   . VAL C  1 64  ? -50.714 23.950  13.278  1.00 74.97  ? 64   VAL C C   1 
ATOM   9480  O O   . VAL C  1 64  ? -49.774 24.097  14.064  1.00 74.17  ? 64   VAL C O   1 
ATOM   9481  C CB  . VAL C  1 64  ? -52.072 22.498  14.909  1.00 72.62  ? 64   VAL C CB  1 
ATOM   9482  C CG1 . VAL C  1 64  ? -52.908 23.646  15.473  1.00 73.53  ? 64   VAL C CG1 1 
ATOM   9483  C CG2 . VAL C  1 64  ? -52.826 21.181  15.051  1.00 70.70  ? 64   VAL C CG2 1 
ATOM   9484  N N   . ALA C  1 65  ? -50.918 24.747  12.228  1.00 73.04  ? 65   ALA C N   1 
ATOM   9485  C CA  . ALA C  1 65  ? -50.041 25.878  11.933  1.00 74.79  ? 65   ALA C CA  1 
ATOM   9486  C C   . ALA C  1 65  ? -50.779 27.144  11.499  1.00 80.62  ? 65   ALA C C   1 
ATOM   9487  O O   . ALA C  1 65  ? -51.933 27.079  11.080  1.00 81.84  ? 65   ALA C O   1 
ATOM   9488  C CB  . ALA C  1 65  ? -49.015 25.481  10.881  1.00 74.99  ? 65   ALA C CB  1 
ATOM   9489  N N   . LEU C  1 66  ? -50.116 28.304  11.650  1.00 76.16  ? 66   LEU C N   1 
ATOM   9490  C CA  . LEU C  1 66  ? -50.586 29.621  11.227  1.00 76.68  ? 66   LEU C CA  1 
ATOM   9491  C C   . LEU C  1 66  ? -52.002 30.006  11.660  1.00 84.74  ? 66   LEU C C   1 
ATOM   9492  O O   . LEU C  1 66  ? -52.666 30.763  10.964  1.00 88.08  ? 66   LEU C O   1 
ATOM   9493  C CB  . LEU C  1 66  ? -50.366 29.783  9.710   1.00 75.94  ? 66   LEU C CB  1 
ATOM   9494  C CG  . LEU C  1 66  ? -48.927 29.512  9.224   1.00 78.10  ? 66   LEU C CG  1 
ATOM   9495  C CD1 . LEU C  1 66  ? -48.877 29.198  7.755   1.00 78.00  ? 66   LEU C CD1 1 
ATOM   9496  C CD2 . LEU C  1 66  ? -48.012 30.636  9.543   1.00 78.23  ? 66   LEU C CD2 1 
ATOM   9497  N N   . ASN C  1 67  ? -52.440 29.538  12.836  1.00 81.48  ? 67   ASN C N   1 
ATOM   9498  C CA  . ASN C  1 67  ? -53.772 29.834  13.388  1.00 82.30  ? 67   ASN C CA  1 
ATOM   9499  C C   . ASN C  1 67  ? -53.696 30.908  14.483  1.00 88.77  ? 67   ASN C C   1 
ATOM   9500  O O   . ASN C  1 67  ? -52.612 31.158  14.975  1.00 88.59  ? 67   ASN C O   1 
ATOM   9501  C CB  . ASN C  1 67  ? -54.379 28.567  13.952  1.00 78.83  ? 67   ASN C CB  1 
ATOM   9502  C CG  . ASN C  1 67  ? -54.508 27.476  12.934  1.00 110.01 ? 67   ASN C CG  1 
ATOM   9503  O OD1 . ASN C  1 67  ? -55.248 27.595  11.953  1.00 111.49 ? 67   ASN C OD1 1 
ATOM   9504  N ND2 . ASN C  1 67  ? -53.791 26.380  13.151  1.00 99.45  ? 67   ASN C ND2 1 
ATOM   9505  N N   . GLN C  1 68  ? -54.821 31.532  14.879  1.00 87.08  ? 68   GLN C N   1 
ATOM   9506  C CA  . GLN C  1 68  ? -54.840 32.557  15.937  1.00 89.06  ? 68   GLN C CA  1 
ATOM   9507  C C   . GLN C  1 68  ? -55.849 32.267  17.082  1.00 92.25  ? 68   GLN C C   1 
ATOM   9508  O O   . GLN C  1 68  ? -56.011 33.105  17.983  1.00 93.42  ? 68   GLN C O   1 
ATOM   9509  C CB  . GLN C  1 68  ? -55.034 33.985  15.359  1.00 93.58  ? 68   GLN C CB  1 
ATOM   9510  C CG  . GLN C  1 68  ? -53.901 34.491  14.457  1.00 112.34 ? 68   GLN C CG  1 
ATOM   9511  C CD  . GLN C  1 68  ? -54.337 34.539  13.011  1.00 130.19 ? 68   GLN C CD  1 
ATOM   9512  O OE1 . GLN C  1 68  ? -55.058 35.456  12.585  1.00 124.54 ? 68   GLN C OE1 1 
ATOM   9513  N NE2 . GLN C  1 68  ? -53.917 33.543  12.227  1.00 118.85 ? 68   GLN C NE2 1 
ATOM   9514  N N   . PHE C  1 69  ? -56.534 31.100  17.041  1.00 86.32  ? 69   PHE C N   1 
ATOM   9515  C CA  . PHE C  1 69  ? -57.478 30.701  18.097  1.00 85.50  ? 69   PHE C CA  1 
ATOM   9516  C C   . PHE C  1 69  ? -56.752 30.329  19.388  1.00 87.69  ? 69   PHE C C   1 
ATOM   9517  O O   . PHE C  1 69  ? -55.644 29.811  19.328  1.00 86.55  ? 69   PHE C O   1 
ATOM   9518  C CB  . PHE C  1 69  ? -58.399 29.569  17.641  1.00 85.65  ? 69   PHE C CB  1 
ATOM   9519  C CG  . PHE C  1 69  ? -57.698 28.340  17.127  1.00 84.80  ? 69   PHE C CG  1 
ATOM   9520  C CD1 . PHE C  1 69  ? -57.252 27.355  18.003  1.00 85.16  ? 69   PHE C CD1 1 
ATOM   9521  C CD2 . PHE C  1 69  ? -57.520 28.142  15.765  1.00 86.51  ? 69   PHE C CD2 1 
ATOM   9522  C CE1 . PHE C  1 69  ? -56.619 26.212  17.526  1.00 83.35  ? 69   PHE C CE1 1 
ATOM   9523  C CE2 . PHE C  1 69  ? -56.917 26.981  15.287  1.00 86.69  ? 69   PHE C CE2 1 
ATOM   9524  C CZ  . PHE C  1 69  ? -56.456 26.033  16.170  1.00 82.52  ? 69   PHE C CZ  1 
ATOM   9525  N N   . ARG C  1 70  ? -57.381 30.604  20.540  1.00 83.91  ? 70   ARG C N   1 
ATOM   9526  C CA  . ARG C  1 70  ? -56.850 30.392  21.893  1.00 82.48  ? 70   ARG C CA  1 
ATOM   9527  C C   . ARG C  1 70  ? -56.565 28.931  22.266  1.00 81.52  ? 70   ARG C C   1 
ATOM   9528  O O   . ARG C  1 70  ? -55.554 28.656  22.908  1.00 81.42  ? 70   ARG C O   1 
ATOM   9529  C CB  . ARG C  1 70  ? -57.820 30.997  22.933  1.00 83.43  ? 70   ARG C CB  1 
ATOM   9530  C CG  . ARG C  1 70  ? -57.222 31.213  24.332  1.00 94.27  ? 70   ARG C CG  1 
ATOM   9531  C CD  . ARG C  1 70  ? -58.237 31.084  25.453  1.00 111.01 ? 70   ARG C CD  1 
ATOM   9532  N NE  . ARG C  1 70  ? -59.129 32.250  25.523  1.00 131.28 ? 70   ARG C NE  1 
ATOM   9533  C CZ  . ARG C  1 70  ? -60.215 32.335  26.290  1.00 146.80 ? 70   ARG C CZ  1 
ATOM   9534  N NH1 . ARG C  1 70  ? -60.586 31.308  27.044  1.00 142.73 ? 70   ARG C NH1 1 
ATOM   9535  N NH2 . ARG C  1 70  ? -60.952 33.442  26.289  1.00 121.34 ? 70   ARG C NH2 1 
ATOM   9536  N N   . TYR C  1 71  ? -57.475 28.021  21.938  1.00 74.42  ? 71   TYR C N   1 
ATOM   9537  C CA  . TYR C  1 71  ? -57.397 26.641  22.387  1.00 71.52  ? 71   TYR C CA  1 
ATOM   9538  C C   . TYR C  1 71  ? -57.741 25.606  21.312  1.00 77.48  ? 71   TYR C C   1 
ATOM   9539  O O   . TYR C  1 71  ? -58.681 25.823  20.542  1.00 78.63  ? 71   TYR C O   1 
ATOM   9540  C CB  . TYR C  1 71  ? -58.322 26.520  23.607  1.00 70.75  ? 71   TYR C CB  1 
ATOM   9541  C CG  . TYR C  1 71  ? -58.600 25.133  24.123  1.00 67.06  ? 71   TYR C CG  1 
ATOM   9542  C CD1 . TYR C  1 71  ? -57.740 24.527  25.034  1.00 68.95  ? 71   TYR C CD1 1 
ATOM   9543  C CD2 . TYR C  1 71  ? -59.784 24.478  23.809  1.00 65.51  ? 71   TYR C CD2 1 
ATOM   9544  C CE1 . TYR C  1 71  ? -58.020 23.272  25.571  1.00 69.41  ? 71   TYR C CE1 1 
ATOM   9545  C CE2 . TYR C  1 71  ? -60.087 23.234  24.351  1.00 65.03  ? 71   TYR C CE2 1 
ATOM   9546  C CZ  . TYR C  1 71  ? -59.193 22.624  25.222  1.00 75.18  ? 71   TYR C CZ  1 
ATOM   9547  O OH  . TYR C  1 71  ? -59.455 21.375  25.735  1.00 76.60  ? 71   TYR C OH  1 
ATOM   9548  N N   . LEU C  1 72  ? -56.991 24.465  21.299  1.00 73.19  ? 72   LEU C N   1 
ATOM   9549  C CA  . LEU C  1 72  ? -57.137 23.335  20.364  1.00 71.32  ? 72   LEU C CA  1 
ATOM   9550  C C   . LEU C  1 72  ? -57.966 22.228  21.015  1.00 74.67  ? 72   LEU C C   1 
ATOM   9551  O O   . LEU C  1 72  ? -57.450 21.518  21.878  1.00 74.50  ? 72   LEU C O   1 
ATOM   9552  C CB  . LEU C  1 72  ? -55.750 22.818  19.939  1.00 70.09  ? 72   LEU C CB  1 
ATOM   9553  C CG  . LEU C  1 72  ? -55.726 21.689  18.922  1.00 72.68  ? 72   LEU C CG  1 
ATOM   9554  C CD1 . LEU C  1 72  ? -56.365 22.117  17.589  1.00 72.70  ? 72   LEU C CD1 1 
ATOM   9555  C CD2 . LEU C  1 72  ? -54.308 21.171  18.743  1.00 73.87  ? 72   LEU C CD2 1 
ATOM   9556  N N   . PRO C  1 73  ? -59.260 22.084  20.650  1.00 71.42  ? 73   PRO C N   1 
ATOM   9557  C CA  . PRO C  1 73  ? -60.120 21.115  21.354  1.00 70.63  ? 73   PRO C CA  1 
ATOM   9558  C C   . PRO C  1 73  ? -60.138 19.701  20.805  1.00 73.22  ? 73   PRO C C   1 
ATOM   9559  O O   . PRO C  1 73  ? -61.214 19.178  20.480  1.00 74.25  ? 73   PRO C O   1 
ATOM   9560  C CB  . PRO C  1 73  ? -61.501 21.778  21.307  1.00 73.71  ? 73   PRO C CB  1 
ATOM   9561  C CG  . PRO C  1 73  ? -61.473 22.618  20.091  1.00 78.75  ? 73   PRO C CG  1 
ATOM   9562  C CD  . PRO C  1 73  ? -60.044 22.881  19.686  1.00 73.93  ? 73   PRO C CD  1 
ATOM   9563  N N   . LEU C  1 74  ? -58.962 19.066  20.724  1.00 66.69  ? 74   LEU C N   1 
ATOM   9564  C CA  . LEU C  1 74  ? -58.849 17.689  20.248  1.00 64.71  ? 74   LEU C CA  1 
ATOM   9565  C C   . LEU C  1 74  ? -58.857 16.734  21.457  1.00 71.07  ? 74   LEU C C   1 
ATOM   9566  O O   . LEU C  1 74  ? -58.094 15.764  21.541  1.00 71.46  ? 74   LEU C O   1 
ATOM   9567  C CB  . LEU C  1 74  ? -57.572 17.548  19.413  1.00 63.32  ? 74   LEU C CB  1 
ATOM   9568  C CG  . LEU C  1 74  ? -57.609 18.154  18.032  1.00 66.41  ? 74   LEU C CG  1 
ATOM   9569  C CD1 . LEU C  1 74  ? -56.220 18.206  17.444  1.00 65.71  ? 74   LEU C CD1 1 
ATOM   9570  C CD2 . LEU C  1 74  ? -58.557 17.394  17.124  1.00 64.54  ? 74   LEU C CD2 1 
ATOM   9571  N N   . GLU C  1 75  ? -59.734 17.046  22.403  1.00 68.58  ? 75   GLU C N   1 
ATOM   9572  C CA  . GLU C  1 75  ? -59.933 16.411  23.705  1.00 67.62  ? 75   GLU C CA  1 
ATOM   9573  C C   . GLU C  1 75  ? -60.130 14.911  23.673  1.00 64.94  ? 75   GLU C C   1 
ATOM   9574  O O   . GLU C  1 75  ? -59.807 14.258  24.665  1.00 64.58  ? 75   GLU C O   1 
ATOM   9575  C CB  . GLU C  1 75  ? -61.084 17.107  24.442  1.00 71.08  ? 75   GLU C CB  1 
ATOM   9576  C CG  . GLU C  1 75  ? -60.934 18.621  24.435  1.00 88.64  ? 75   GLU C CG  1 
ATOM   9577  C CD  . GLU C  1 75  ? -62.014 19.447  25.099  1.00 123.71 ? 75   GLU C CD  1 
ATOM   9578  O OE1 . GLU C  1 75  ? -62.927 18.883  25.747  1.00 132.77 ? 75   GLU C OE1 1 
ATOM   9579  O OE2 . GLU C  1 75  ? -61.943 20.687  24.952  1.00 121.27 ? 75   GLU C OE2 1 
ATOM   9580  N N   . ASN C  1 76  ? -60.619 14.366  22.529  1.00 57.91  ? 76   ASN C N   1 
ATOM   9581  C CA  . ASN C  1 76  ? -60.844 12.932  22.366  1.00 55.47  ? 76   ASN C CA  1 
ATOM   9582  C C   . ASN C  1 76  ? -59.795 12.155  21.562  1.00 58.30  ? 76   ASN C C   1 
ATOM   9583  O O   . ASN C  1 76  ? -59.780 10.909  21.621  1.00 55.76  ? 76   ASN C O   1 
ATOM   9584  C CB  . ASN C  1 76  ? -62.218 12.707  21.734  1.00 47.39  ? 76   ASN C CB  1 
ATOM   9585  C CG  . ASN C  1 76  ? -63.357 13.067  22.668  1.00 56.48  ? 76   ASN C CG  1 
ATOM   9586  O OD1 . ASN C  1 76  ? -63.192 13.083  23.888  1.00 50.24  ? 76   ASN C OD1 1 
ATOM   9587  N ND2 . ASN C  1 76  ? -64.520 13.359  22.099  1.00 50.03  ? 76   ASN C ND2 1 
ATOM   9588  N N   . LEU C  1 77  ? -58.862 12.887  20.884  1.00 55.10  ? 77   LEU C N   1 
ATOM   9589  C CA  . LEU C  1 77  ? -57.759 12.291  20.107  1.00 52.69  ? 77   LEU C CA  1 
ATOM   9590  C C   . LEU C  1 77  ? -56.895 11.459  21.009  1.00 55.88  ? 77   LEU C C   1 
ATOM   9591  O O   . LEU C  1 77  ? -56.383 11.966  22.006  1.00 55.69  ? 77   LEU C O   1 
ATOM   9592  C CB  . LEU C  1 77  ? -56.902 13.358  19.389  1.00 52.31  ? 77   LEU C CB  1 
ATOM   9593  C CG  . LEU C  1 77  ? -55.766 12.830  18.492  1.00 54.38  ? 77   LEU C CG  1 
ATOM   9594  C CD1 . LEU C  1 77  ? -56.299 12.132  17.238  1.00 52.66  ? 77   LEU C CD1 1 
ATOM   9595  C CD2 . LEU C  1 77  ? -54.796 13.943  18.125  1.00 56.70  ? 77   LEU C CD2 1 
ATOM   9596  N N   . ARG C  1 78  ? -56.746 10.187  20.660  1.00 52.39  ? 78   ARG C N   1 
ATOM   9597  C CA  . ARG C  1 78  ? -55.977 9.218   21.438  1.00 52.12  ? 78   ARG C CA  1 
ATOM   9598  C C   . ARG C  1 78  ? -54.693 8.798   20.732  1.00 60.40  ? 78   ARG C C   1 
ATOM   9599  O O   . ARG C  1 78  ? -53.626 8.667   21.364  1.00 60.54  ? 78   ARG C O   1 
ATOM   9600  C CB  . ARG C  1 78  ? -56.876 7.997   21.689  1.00 47.19  ? 78   ARG C CB  1 
ATOM   9601  C CG  . ARG C  1 78  ? -56.223 6.770   22.306  1.00 50.00  ? 78   ARG C CG  1 
ATOM   9602  C CD  . ARG C  1 78  ? -55.853 6.871   23.771  1.00 50.57  ? 78   ARG C CD  1 
ATOM   9603  N NE  . ARG C  1 78  ? -56.954 7.270   24.646  1.00 48.83  ? 78   ARG C NE  1 
ATOM   9604  C CZ  . ARG C  1 78  ? -56.794 7.619   25.919  1.00 72.10  ? 78   ARG C CZ  1 
ATOM   9605  N NH1 . ARG C  1 78  ? -55.590 7.595   26.477  1.00 54.74  ? 78   ARG C NH1 1 
ATOM   9606  N NH2 . ARG C  1 78  ? -57.837 7.976   26.650  1.00 76.48  ? 78   ARG C NH2 1 
ATOM   9607  N N   . ILE C  1 79  ? -54.817 8.545   19.418  1.00 57.38  ? 79   ILE C N   1 
ATOM   9608  C CA  . ILE C  1 79  ? -53.721 8.033   18.627  1.00 56.04  ? 79   ILE C CA  1 
ATOM   9609  C C   . ILE C  1 79  ? -53.539 8.817   17.318  1.00 60.37  ? 79   ILE C C   1 
ATOM   9610  O O   . ILE C  1 79  ? -54.523 9.263   16.704  1.00 60.86  ? 79   ILE C O   1 
ATOM   9611  C CB  . ILE C  1 79  ? -53.951 6.489   18.405  1.00 57.73  ? 79   ILE C CB  1 
ATOM   9612  C CG1 . ILE C  1 79  ? -52.816 5.796   17.627  1.00 58.59  ? 79   ILE C CG1 1 
ATOM   9613  C CG2 . ILE C  1 79  ? -55.293 6.204   17.745  1.00 58.43  ? 79   ILE C CG2 1 
ATOM   9614  C CD1 . ILE C  1 79  ? -52.892 4.279   17.625  1.00 64.30  ? 79   ILE C CD1 1 
ATOM   9615  N N   . ILE C  1 80  ? -52.263 8.989   16.925  1.00 54.73  ? 80   ILE C N   1 
ATOM   9616  C CA  . ILE C  1 80  ? -51.822 9.488   15.637  1.00 55.08  ? 80   ILE C CA  1 
ATOM   9617  C C   . ILE C  1 80  ? -50.939 8.335   15.146  1.00 60.02  ? 80   ILE C C   1 
ATOM   9618  O O   . ILE C  1 80  ? -49.939 8.026   15.792  1.00 61.53  ? 80   ILE C O   1 
ATOM   9619  C CB  . ILE C  1 80  ? -51.068 10.853  15.677  1.00 59.07  ? 80   ILE C CB  1 
ATOM   9620  C CG1 . ILE C  1 80  ? -51.933 11.984  16.310  1.00 59.65  ? 80   ILE C CG1 1 
ATOM   9621  C CG2 . ILE C  1 80  ? -50.573 11.245  14.261  1.00 58.74  ? 80   ILE C CG2 1 
ATOM   9622  C CD1 . ILE C  1 80  ? -51.128 13.159  16.759  1.00 60.46  ? 80   ILE C CD1 1 
ATOM   9623  N N   . ARG C  1 81  ? -51.338 7.645   14.073  1.00 55.75  ? 81   ARG C N   1 
ATOM   9624  C CA  . ARG C  1 81  ? -50.564 6.492   13.569  1.00 54.56  ? 81   ARG C CA  1 
ATOM   9625  C C   . ARG C  1 81  ? -49.316 6.846   12.807  1.00 60.91  ? 81   ARG C C   1 
ATOM   9626  O O   . ARG C  1 81  ? -48.369 6.052   12.789  1.00 60.70  ? 81   ARG C O   1 
ATOM   9627  C CB  . ARG C  1 81  ? -51.426 5.574   12.734  1.00 50.88  ? 81   ARG C CB  1 
ATOM   9628  C CG  . ARG C  1 81  ? -52.668 5.172   13.458  1.00 51.87  ? 81   ARG C CG  1 
ATOM   9629  C CD  . ARG C  1 81  ? -52.985 3.746   13.179  1.00 50.11  ? 81   ARG C CD  1 
ATOM   9630  N NE  . ARG C  1 81  ? -54.172 3.343   13.922  1.00 59.20  ? 81   ARG C NE  1 
ATOM   9631  C CZ  . ARG C  1 81  ? -54.220 2.317   14.757  1.00 72.71  ? 81   ARG C CZ  1 
ATOM   9632  N NH1 . ARG C  1 81  ? -53.151 1.559   14.951  1.00 64.54  ? 81   ARG C NH1 1 
ATOM   9633  N NH2 . ARG C  1 81  ? -55.339 2.027   15.388  1.00 70.14  ? 81   ARG C NH2 1 
ATOM   9634  N N   . GLY C  1 82  ? -49.330 8.018   12.172  1.00 59.88  ? 82   GLY C N   1 
ATOM   9635  C CA  . GLY C  1 82  ? -48.210 8.540   11.399  1.00 60.59  ? 82   GLY C CA  1 
ATOM   9636  C C   . GLY C  1 82  ? -47.849 7.702   10.190  1.00 64.60  ? 82   GLY C C   1 
ATOM   9637  O O   . GLY C  1 82  ? -46.658 7.535   9.887   1.00 63.40  ? 82   GLY C O   1 
ATOM   9638  N N   . THR C  1 83  ? -48.886 7.160   9.485   1.00 60.50  ? 83   THR C N   1 
ATOM   9639  C CA  . THR C  1 83  ? -48.649 6.337   8.289   1.00 59.27  ? 83   THR C CA  1 
ATOM   9640  C C   . THR C  1 83  ? -48.027 7.185   7.189   1.00 65.97  ? 83   THR C C   1 
ATOM   9641  O O   . THR C  1 83  ? -47.242 6.679   6.387   1.00 67.69  ? 83   THR C O   1 
ATOM   9642  C CB  . THR C  1 83  ? -49.860 5.534   7.860   1.00 53.69  ? 83   THR C CB  1 
ATOM   9643  O OG1 . THR C  1 83  ? -50.877 6.428   7.466   1.00 63.12  ? 83   THR C OG1 1 
ATOM   9644  C CG2 . THR C  1 83  ? -50.369 4.618   8.943   1.00 50.04  ? 83   THR C CG2 1 
ATOM   9645  N N   . LYS C  1 84  ? -48.347 8.481   7.198   1.00 62.66  ? 84   LYS C N   1 
ATOM   9646  C CA  . LYS C  1 84  ? -47.817 9.508   6.314   1.00 63.41  ? 84   LYS C CA  1 
ATOM   9647  C C   . LYS C  1 84  ? -47.453 10.657  7.237   1.00 65.29  ? 84   LYS C C   1 
ATOM   9648  O O   . LYS C  1 84  ? -48.244 11.021  8.113   1.00 65.15  ? 84   LYS C O   1 
ATOM   9649  C CB  . LYS C  1 84  ? -48.853 9.933   5.257   1.00 67.59  ? 84   LYS C CB  1 
ATOM   9650  C CG  . LYS C  1 84  ? -48.897 9.031   4.018   1.00 90.12  ? 84   LYS C CG  1 
ATOM   9651  C CD  . LYS C  1 84  ? -50.000 9.518   3.051   1.00 109.79 ? 84   LYS C CD  1 
ATOM   9652  C CE  . LYS C  1 84  ? -50.065 8.771   1.738   1.00 124.45 ? 84   LYS C CE  1 
ATOM   9653  N NZ  . LYS C  1 84  ? -50.794 9.554   0.690   1.00 135.46 ? 84   LYS C NZ  1 
ATOM   9654  N N   . LEU C  1 85  ? -46.244 11.189  7.088   1.00 59.94  ? 85   LEU C N   1 
ATOM   9655  C CA  . LEU C  1 85  ? -45.750 12.243  7.976   1.00 59.86  ? 85   LEU C CA  1 
ATOM   9656  C C   . LEU C  1 85  ? -45.540 13.612  7.321   1.00 64.74  ? 85   LEU C C   1 
ATOM   9657  O O   . LEU C  1 85  ? -45.111 13.682  6.160   1.00 65.25  ? 85   LEU C O   1 
ATOM   9658  C CB  . LEU C  1 85  ? -44.412 11.793  8.610   1.00 59.13  ? 85   LEU C CB  1 
ATOM   9659  C CG  . LEU C  1 85  ? -44.414 10.493  9.377   1.00 60.35  ? 85   LEU C CG  1 
ATOM   9660  C CD1 . LEU C  1 85  ? -43.022 10.046  9.660   1.00 60.03  ? 85   LEU C CD1 1 
ATOM   9661  C CD2 . LEU C  1 85  ? -45.249 10.588  10.616  1.00 59.34  ? 85   LEU C CD2 1 
ATOM   9662  N N   . TYR C  1 86  ? -45.752 14.695  8.101   1.00 60.14  ? 86   TYR C N   1 
ATOM   9663  C CA  . TYR C  1 86  ? -45.477 16.037  7.612   1.00 61.36  ? 86   TYR C CA  1 
ATOM   9664  C C   . TYR C  1 86  ? -43.978 16.160  7.469   1.00 69.04  ? 86   TYR C C   1 
ATOM   9665  O O   . TYR C  1 86  ? -43.241 15.743  8.359   1.00 69.61  ? 86   TYR C O   1 
ATOM   9666  C CB  . TYR C  1 86  ? -46.034 17.122  8.538   1.00 62.46  ? 86   TYR C CB  1 
ATOM   9667  C CG  . TYR C  1 86  ? -45.782 18.525  8.028   1.00 65.13  ? 86   TYR C CG  1 
ATOM   9668  C CD1 . TYR C  1 86  ? -46.474 19.024  6.925   1.00 68.49  ? 86   TYR C CD1 1 
ATOM   9669  C CD2 . TYR C  1 86  ? -44.871 19.368  8.663   1.00 66.15  ? 86   TYR C CD2 1 
ATOM   9670  C CE1 . TYR C  1 86  ? -46.247 20.319  6.457   1.00 71.49  ? 86   TYR C CE1 1 
ATOM   9671  C CE2 . TYR C  1 86  ? -44.646 20.670  8.211   1.00 68.19  ? 86   TYR C CE2 1 
ATOM   9672  C CZ  . TYR C  1 86  ? -45.320 21.132  7.095   1.00 77.43  ? 86   TYR C CZ  1 
ATOM   9673  O OH  . TYR C  1 86  ? -45.078 22.402  6.633   1.00 82.02  ? 86   TYR C OH  1 
ATOM   9674  N N   . GLU C  1 87  ? -43.523 16.657  6.310   1.00 68.64  ? 87   GLU C N   1 
ATOM   9675  C CA  . GLU C  1 87  ? -42.106 16.805  5.954   1.00 69.60  ? 87   GLU C CA  1 
ATOM   9676  C C   . GLU C  1 87  ? -41.386 15.471  6.069   1.00 75.62  ? 87   GLU C C   1 
ATOM   9677  O O   . GLU C  1 87  ? -40.188 15.428  6.323   1.00 77.50  ? 87   GLU C O   1 
ATOM   9678  C CB  . GLU C  1 87  ? -41.431 17.937  6.755   1.00 71.87  ? 87   GLU C CB  1 
ATOM   9679  C CG  . GLU C  1 87  ? -41.840 19.310  6.240   1.00 88.58  ? 87   GLU C CG  1 
ATOM   9680  C CD  . GLU C  1 87  ? -41.300 20.544  6.942   1.00 124.03 ? 87   GLU C CD  1 
ATOM   9681  O OE1 . GLU C  1 87  ? -40.726 20.418  8.050   1.00 125.24 ? 87   GLU C OE1 1 
ATOM   9682  O OE2 . GLU C  1 87  ? -41.471 21.651  6.384   1.00 122.03 ? 87   GLU C OE2 1 
ATOM   9683  N N   . ASP C  1 88  ? -42.144 14.373  5.905   1.00 72.64  ? 88   ASP C N   1 
ATOM   9684  C CA  . ASP C  1 88  ? -41.683 12.986  6.017   1.00 72.55  ? 88   ASP C CA  1 
ATOM   9685  C C   . ASP C  1 88  ? -40.957 12.670  7.334   1.00 74.08  ? 88   ASP C C   1 
ATOM   9686  O O   . ASP C  1 88  ? -40.179 11.722  7.393   1.00 74.46  ? 88   ASP C O   1 
ATOM   9687  C CB  . ASP C  1 88  ? -40.909 12.538  4.754   1.00 75.81  ? 88   ASP C CB  1 
ATOM   9688  C CG  . ASP C  1 88  ? -41.782 12.394  3.505   1.00 92.31  ? 88   ASP C CG  1 
ATOM   9689  O OD1 . ASP C  1 88  ? -43.031 12.320  3.642   1.00 92.59  ? 88   ASP C OD1 1 
ATOM   9690  O OD2 . ASP C  1 88  ? -41.219 12.283  2.403   1.00 99.66  ? 88   ASP C OD2 1 
ATOM   9691  N N   . ARG C  1 89  ? -41.250 13.456  8.391   1.00 67.84  ? 89   ARG C N   1 
ATOM   9692  C CA  . ARG C  1 89  ? -40.664 13.319  9.713   1.00 66.12  ? 89   ARG C CA  1 
ATOM   9693  C C   . ARG C  1 89  ? -41.596 13.557  10.896  1.00 68.33  ? 89   ARG C C   1 
ATOM   9694  O O   . ARG C  1 89  ? -41.384 12.923  11.924  1.00 69.62  ? 89   ARG C O   1 
ATOM   9695  C CB  . ARG C  1 89  ? -39.369 14.124  9.855   1.00 70.04  ? 89   ARG C CB  1 
ATOM   9696  C CG  . ARG C  1 89  ? -39.478 15.628  9.612   1.00 91.57  ? 89   ARG C CG  1 
ATOM   9697  C CD  . ARG C  1 89  ? -38.165 16.198  9.083   1.00 117.58 ? 89   ARG C CD  1 
ATOM   9698  N NE  . ARG C  1 89  ? -38.312 17.609  8.725   1.00 137.34 ? 89   ARG C NE  1 
ATOM   9699  C CZ  . ARG C  1 89  ? -37.523 18.584  9.162   1.00 156.10 ? 89   ARG C CZ  1 
ATOM   9700  N NH1 . ARG C  1 89  ? -36.494 18.310  9.954   1.00 149.23 ? 89   ARG C NH1 1 
ATOM   9701  N NH2 . ARG C  1 89  ? -37.748 19.842  8.801   1.00 142.37 ? 89   ARG C NH2 1 
ATOM   9702  N N   . TYR C  1 90  ? -42.601 14.439  10.794  1.00 62.22  ? 90   TYR C N   1 
ATOM   9703  C CA  . TYR C  1 90  ? -43.461 14.686  11.941  1.00 61.71  ? 90   TYR C CA  1 
ATOM   9704  C C   . TYR C  1 90  ? -44.862 14.119  11.871  1.00 64.31  ? 90   TYR C C   1 
ATOM   9705  O O   . TYR C  1 90  ? -45.598 14.356  10.902  1.00 64.41  ? 90   TYR C O   1 
ATOM   9706  C CB  . TYR C  1 90  ? -43.536 16.172  12.288  1.00 66.02  ? 90   TYR C CB  1 
ATOM   9707  C CG  . TYR C  1 90  ? -42.198 16.873  12.295  1.00 72.09  ? 90   TYR C CG  1 
ATOM   9708  C CD1 . TYR C  1 90  ? -41.943 17.936  11.436  1.00 74.96  ? 90   TYR C CD1 1 
ATOM   9709  C CD2 . TYR C  1 90  ? -41.178 16.467  13.154  1.00 73.66  ? 90   TYR C CD2 1 
ATOM   9710  C CE1 . TYR C  1 90  ? -40.717 18.592  11.442  1.00 75.77  ? 90   TYR C CE1 1 
ATOM   9711  C CE2 . TYR C  1 90  ? -39.936 17.099  13.147  1.00 75.88  ? 90   TYR C CE2 1 
ATOM   9712  C CZ  . TYR C  1 90  ? -39.713 18.165  12.291  1.00 84.21  ? 90   TYR C CZ  1 
ATOM   9713  O OH  . TYR C  1 90  ? -38.501 18.813  12.279  1.00 88.58  ? 90   TYR C OH  1 
ATOM   9714  N N   . ALA C  1 91  ? -45.261 13.432  12.959  1.00 58.09  ? 91   ALA C N   1 
ATOM   9715  C CA  . ALA C  1 91  ? -46.604 12.904  13.144  1.00 55.93  ? 91   ALA C CA  1 
ATOM   9716  C C   . ALA C  1 91  ? -47.486 14.021  13.711  1.00 61.12  ? 91   ALA C C   1 
ATOM   9717  O O   . ALA C  1 91  ? -48.678 14.051  13.440  1.00 61.84  ? 91   ALA C O   1 
ATOM   9718  C CB  . ALA C  1 91  ? -46.562 11.723  14.095  1.00 55.09  ? 91   ALA C CB  1 
ATOM   9719  N N   . LEU C  1 92  ? -46.888 14.937  14.509  1.00 57.91  ? 92   LEU C N   1 
ATOM   9720  C CA  . LEU C  1 92  ? -47.545 16.100  15.119  1.00 56.97  ? 92   LEU C CA  1 
ATOM   9721  C C   . LEU C  1 92  ? -46.674 17.321  14.914  1.00 65.37  ? 92   LEU C C   1 
ATOM   9722  O O   . LEU C  1 92  ? -45.512 17.339  15.328  1.00 66.40  ? 92   LEU C O   1 
ATOM   9723  C CB  . LEU C  1 92  ? -47.803 15.868  16.613  1.00 55.37  ? 92   LEU C CB  1 
ATOM   9724  C CG  . LEU C  1 92  ? -48.519 16.958  17.368  1.00 58.40  ? 92   LEU C CG  1 
ATOM   9725  C CD1 . LEU C  1 92  ? -49.941 17.121  16.894  1.00 57.98  ? 92   LEU C CD1 1 
ATOM   9726  C CD2 . LEU C  1 92  ? -48.501 16.677  18.833  1.00 57.21  ? 92   LEU C CD2 1 
ATOM   9727  N N   . ALA C  1 93  ? -47.233 18.334  14.250  1.00 64.51  ? 93   ALA C N   1 
ATOM   9728  C CA  . ALA C  1 93  ? -46.531 19.590  13.963  1.00 66.15  ? 93   ALA C CA  1 
ATOM   9729  C C   . ALA C  1 93  ? -47.422 20.779  14.339  1.00 69.18  ? 93   ALA C C   1 
ATOM   9730  O O   . ALA C  1 93  ? -48.474 20.990  13.721  1.00 68.98  ? 93   ALA C O   1 
ATOM   9731  C CB  . ALA C  1 93  ? -46.118 19.649  12.493  1.00 67.31  ? 93   ALA C CB  1 
ATOM   9732  N N   . ILE C  1 94  ? -47.034 21.490  15.414  1.00 64.72  ? 94   ILE C N   1 
ATOM   9733  C CA  . ILE C  1 94  ? -47.741 22.663  15.947  1.00 65.26  ? 94   ILE C CA  1 
ATOM   9734  C C   . ILE C  1 94  ? -46.761 23.836  15.931  1.00 71.48  ? 94   ILE C C   1 
ATOM   9735  O O   . ILE C  1 94  ? -45.856 23.881  16.755  1.00 70.77  ? 94   ILE C O   1 
ATOM   9736  C CB  . ILE C  1 94  ? -48.367 22.411  17.357  1.00 66.89  ? 94   ILE C CB  1 
ATOM   9737  C CG1 . ILE C  1 94  ? -49.281 21.169  17.358  1.00 65.13  ? 94   ILE C CG1 1 
ATOM   9738  C CG2 . ILE C  1 94  ? -49.142 23.634  17.830  1.00 68.77  ? 94   ILE C CG2 1 
ATOM   9739  C CD1 . ILE C  1 94  ? -49.422 20.493  18.714  1.00 60.73  ? 94   ILE C CD1 1 
ATOM   9740  N N   . PHE C  1 95  ? -46.906 24.753  14.966  1.00 70.26  ? 95   PHE C N   1 
ATOM   9741  C CA  . PHE C  1 95  ? -45.992 25.897  14.842  1.00 72.02  ? 95   PHE C CA  1 
ATOM   9742  C C   . PHE C  1 95  ? -46.658 27.157  14.292  1.00 79.33  ? 95   PHE C C   1 
ATOM   9743  O O   . PHE C  1 95  ? -47.628 27.053  13.540  1.00 79.63  ? 95   PHE C O   1 
ATOM   9744  C CB  . PHE C  1 95  ? -44.732 25.536  14.025  1.00 72.78  ? 95   PHE C CB  1 
ATOM   9745  C CG  . PHE C  1 95  ? -44.978 25.097  12.602  1.00 73.28  ? 95   PHE C CG  1 
ATOM   9746  C CD1 . PHE C  1 95  ? -44.880 26.001  11.553  1.00 77.71  ? 95   PHE C CD1 1 
ATOM   9747  C CD2 . PHE C  1 95  ? -45.293 23.774  12.307  1.00 73.26  ? 95   PHE C CD2 1 
ATOM   9748  C CE1 . PHE C  1 95  ? -45.109 25.589  10.235  1.00 78.34  ? 95   PHE C CE1 1 
ATOM   9749  C CE2 . PHE C  1 95  ? -45.511 23.361  10.987  1.00 75.51  ? 95   PHE C CE2 1 
ATOM   9750  C CZ  . PHE C  1 95  ? -45.425 24.269  9.961   1.00 75.10  ? 95   PHE C CZ  1 
ATOM   9751  N N   . LEU C  1 96  ? -46.126 28.343  14.676  1.00 75.62  ? 96   LEU C N   1 
ATOM   9752  C CA  . LEU C  1 96  ? -46.578 29.668  14.246  1.00 76.66  ? 96   LEU C CA  1 
ATOM   9753  C C   . LEU C  1 96  ? -48.055 29.959  14.499  1.00 83.11  ? 96   LEU C C   1 
ATOM   9754  O O   . LEU C  1 96  ? -48.700 30.649  13.714  1.00 84.46  ? 96   LEU C O   1 
ATOM   9755  C CB  . LEU C  1 96  ? -46.192 29.927  12.781  1.00 76.72  ? 96   LEU C CB  1 
ATOM   9756  C CG  . LEU C  1 96  ? -44.717 29.854  12.445  1.00 80.11  ? 96   LEU C CG  1 
ATOM   9757  C CD1 . LEU C  1 96  ? -44.503 29.847  10.977  1.00 80.19  ? 96   LEU C CD1 1 
ATOM   9758  C CD2 . LEU C  1 96  ? -43.977 31.006  13.029  1.00 82.75  ? 96   LEU C CD2 1 
ATOM   9759  N N   . ASN C  1 97  ? -48.580 29.468  15.613  1.00 80.56  ? 97   ASN C N   1 
ATOM   9760  C CA  . ASN C  1 97  ? -49.982 29.653  15.969  1.00 81.44  ? 97   ASN C CA  1 
ATOM   9761  C C   . ASN C  1 97  ? -50.243 30.914  16.805  1.00 89.22  ? 97   ASN C C   1 
ATOM   9762  O O   . ASN C  1 97  ? -50.741 30.863  17.931  1.00 88.16  ? 97   ASN C O   1 
ATOM   9763  C CB  . ASN C  1 97  ? -50.586 28.372  16.560  1.00 78.84  ? 97   ASN C CB  1 
ATOM   9764  C CG  . ASN C  1 97  ? -50.536 27.220  15.600  1.00 86.80  ? 97   ASN C CG  1 
ATOM   9765  O OD1 . ASN C  1 97  ? -51.354 27.124  14.684  1.00 85.15  ? 97   ASN C OD1 1 
ATOM   9766  N ND2 . ASN C  1 97  ? -49.544 26.356  15.753  1.00 69.43  ? 97   ASN C ND2 1 
ATOM   9767  N N   . TYR C  1 98  ? -49.932 32.063  16.194  1.00 90.44  ? 98   TYR C N   1 
ATOM   9768  C CA  . TYR C  1 98  ? -50.110 33.423  16.728  1.00 93.52  ? 98   TYR C CA  1 
ATOM   9769  C C   . TYR C  1 98  ? -49.980 34.430  15.580  1.00 101.89 ? 98   TYR C C   1 
ATOM   9770  O O   . TYR C  1 98  ? -49.420 34.082  14.530  1.00 101.19 ? 98   TYR C O   1 
ATOM   9771  C CB  . TYR C  1 98  ? -49.081 33.723  17.855  1.00 94.40  ? 98   TYR C CB  1 
ATOM   9772  C CG  . TYR C  1 98  ? -47.640 33.873  17.408  1.00 95.34  ? 98   TYR C CG  1 
ATOM   9773  C CD1 . TYR C  1 98  ? -47.083 35.130  17.198  1.00 99.43  ? 98   TYR C CD1 1 
ATOM   9774  C CD2 . TYR C  1 98  ? -46.817 32.762  17.251  1.00 94.24  ? 98   TYR C CD2 1 
ATOM   9775  C CE1 . TYR C  1 98  ? -45.757 35.276  16.795  1.00 101.15 ? 98   TYR C CE1 1 
ATOM   9776  C CE2 . TYR C  1 98  ? -45.487 32.895  16.855  1.00 95.55  ? 98   TYR C CE2 1 
ATOM   9777  C CZ  . TYR C  1 98  ? -44.961 34.154  16.631  1.00 105.27 ? 98   TYR C CZ  1 
ATOM   9778  O OH  . TYR C  1 98  ? -43.650 34.278  16.242  1.00 105.46 ? 98   TYR C OH  1 
ATOM   9779  N N   . ARG C  1 99  ? -50.476 35.669  15.776  1.00 102.07 ? 99   ARG C N   1 
ATOM   9780  C CA  . ARG C  1 99  ? -50.286 36.722  14.772  1.00 104.49 ? 99   ARG C CA  1 
ATOM   9781  C C   . ARG C  1 99  ? -49.024 37.548  15.113  1.00 108.09 ? 99   ARG C C   1 
ATOM   9782  O O   . ARG C  1 99  ? -48.881 38.004  16.254  1.00 106.47 ? 99   ARG C O   1 
ATOM   9783  C CB  . ARG C  1 99  ? -51.551 37.581  14.540  1.00 108.87 ? 99   ARG C CB  1 
ATOM   9784  C CG  . ARG C  1 99  ? -52.084 38.375  15.741  1.00 126.12 ? 99   ARG C CG  1 
ATOM   9785  C CD  . ARG C  1 99  ? -53.397 39.077  15.419  1.00 138.98 ? 99   ARG C CD  1 
ATOM   9786  N NE  . ARG C  1 99  ? -53.223 40.209  14.502  1.00 151.80 ? 99   ARG C NE  1 
ATOM   9787  C CZ  . ARG C  1 99  ? -53.536 40.188  13.209  1.00 169.83 ? 99   ARG C CZ  1 
ATOM   9788  N NH1 . ARG C  1 99  ? -54.039 39.090  12.658  1.00 157.17 ? 99   ARG C NH1 1 
ATOM   9789  N NH2 . ARG C  1 99  ? -53.342 41.263  12.456  1.00 160.72 ? 99   ARG C NH2 1 
ATOM   9790  N N   . LYS C  1 100 ? -48.090 37.681  14.133  1.00 106.18 ? 100  LYS C N   1 
ATOM   9791  C CA  . LYS C  1 100 ? -46.810 38.396  14.284  1.00 108.16 ? 100  LYS C CA  1 
ATOM   9792  C C   . LYS C  1 100 ? -46.940 39.792  14.914  1.00 119.94 ? 100  LYS C C   1 
ATOM   9793  O O   . LYS C  1 100 ? -46.005 40.242  15.585  1.00 121.68 ? 100  LYS C O   1 
ATOM   9794  C CB  . LYS C  1 100 ? -46.023 38.443  12.964  1.00 109.18 ? 100  LYS C CB  1 
ATOM   9795  C CG  . LYS C  1 100 ? -44.529 38.366  13.185  1.00 104.14 ? 100  LYS C CG  1 
ATOM   9796  C CD  . LYS C  1 100 ? -43.745 38.222  11.901  1.00 108.86 ? 100  LYS C CD  1 
ATOM   9797  C CE  . LYS C  1 100 ? -42.309 37.794  12.135  1.00 121.26 ? 100  LYS C CE  1 
ATOM   9798  N NZ  . LYS C  1 100 ? -41.533 38.739  12.995  1.00 135.31 ? 100  LYS C NZ  1 
ATOM   9799  N N   . ASP C  1 101 ? -48.120 40.452  14.719  1.00 120.05 ? 101  ASP C N   1 
ATOM   9800  C CA  . ASP C  1 101 ? -48.514 41.744  15.298  1.00 123.36 ? 101  ASP C CA  1 
ATOM   9801  C C   . ASP C  1 101 ? -48.392 41.671  16.836  1.00 128.00 ? 101  ASP C C   1 
ATOM   9802  O O   . ASP C  1 101 ? -47.873 42.606  17.449  1.00 128.91 ? 101  ASP C O   1 
ATOM   9803  C CB  . ASP C  1 101 ? -49.968 42.103  14.896  1.00 126.73 ? 101  ASP C CB  1 
ATOM   9804  C CG  . ASP C  1 101 ? -50.156 42.693  13.496  1.00 141.27 ? 101  ASP C CG  1 
ATOM   9805  O OD1 . ASP C  1 101 ? -49.992 41.935  12.501  1.00 141.91 ? 101  ASP C OD1 1 
ATOM   9806  O OD2 . ASP C  1 101 ? -50.554 43.890  13.397  1.00 143.92 ? 101  ASP C OD2 1 
ATOM   9807  N N   . GLY C  1 102 ? -48.841 40.544  17.417  1.00 123.72 ? 102  GLY C N   1 
ATOM   9808  C CA  . GLY C  1 102 ? -48.737 40.242  18.846  1.00 123.26 ? 102  GLY C CA  1 
ATOM   9809  C C   . GLY C  1 102 ? -50.010 40.329  19.669  1.00 128.07 ? 102  GLY C C   1 
ATOM   9810  O O   . GLY C  1 102 ? -49.951 40.360  20.902  1.00 127.39 ? 102  GLY C O   1 
ATOM   9811  N N   . ASN C  1 103 ? -51.168 40.361  19.006  1.00 125.68 ? 103  ASN C N   1 
ATOM   9812  C CA  . ASN C  1 103 ? -52.452 40.449  19.692  1.00 126.14 ? 103  ASN C CA  1 
ATOM   9813  C C   . ASN C  1 103 ? -52.773 39.104  20.367  1.00 126.62 ? 103  ASN C C   1 
ATOM   9814  O O   . ASN C  1 103 ? -52.556 38.963  21.576  1.00 125.51 ? 103  ASN C O   1 
ATOM   9815  C CB  . ASN C  1 103 ? -53.564 40.884  18.692  1.00 129.91 ? 103  ASN C CB  1 
ATOM   9816  C CG  . ASN C  1 103 ? -54.597 41.884  19.199  1.00 152.60 ? 103  ASN C CG  1 
ATOM   9817  O OD1 . ASN C  1 103 ? -54.502 42.432  20.303  1.00 152.93 ? 103  ASN C OD1 1 
ATOM   9818  N ND2 . ASN C  1 103 ? -55.598 42.175  18.372  1.00 139.08 ? 103  ASN C ND2 1 
ATOM   9819  N N   . PHE C  1 104 ? -53.233 38.115  19.565  1.00 120.87 ? 104  PHE C N   1 
ATOM   9820  C CA  . PHE C  1 104 ? -53.636 36.783  20.017  1.00 117.89 ? 104  PHE C CA  1 
ATOM   9821  C C   . PHE C  1 104 ? -52.774 35.633  19.471  1.00 116.46 ? 104  PHE C C   1 
ATOM   9822  O O   . PHE C  1 104 ? -51.920 35.819  18.594  1.00 115.82 ? 104  PHE C O   1 
ATOM   9823  C CB  . PHE C  1 104 ? -55.107 36.500  19.651  1.00 119.93 ? 104  PHE C CB  1 
ATOM   9824  C CG  . PHE C  1 104 ? -55.996 37.659  19.290  1.00 124.47 ? 104  PHE C CG  1 
ATOM   9825  C CD1 . PHE C  1 104 ? -56.641 38.394  20.280  1.00 130.08 ? 104  PHE C CD1 1 
ATOM   9826  C CD2 . PHE C  1 104 ? -56.259 37.966  17.960  1.00 128.00 ? 104  PHE C CD2 1 
ATOM   9827  C CE1 . PHE C  1 104 ? -57.507 39.441  19.949  1.00 133.97 ? 104  PHE C CE1 1 
ATOM   9828  C CE2 . PHE C  1 104 ? -57.135 39.007  17.626  1.00 133.94 ? 104  PHE C CE2 1 
ATOM   9829  C CZ  . PHE C  1 104 ? -57.754 39.739  18.623  1.00 134.08 ? 104  PHE C CZ  1 
ATOM   9830  N N   . GLY C  1 105 ? -53.062 34.443  19.995  1.00 108.53 ? 105  GLY C N   1 
ATOM   9831  C CA  . GLY C  1 105 ? -52.431 33.190  19.616  1.00 105.07 ? 105  GLY C CA  1 
ATOM   9832  C C   . GLY C  1 105 ? -52.983 32.003  20.373  1.00 104.78 ? 105  GLY C C   1 
ATOM   9833  O O   . GLY C  1 105 ? -53.846 32.162  21.243  1.00 105.23 ? 105  GLY C O   1 
ATOM   9834  N N   . LEU C  1 106 ? -52.489 30.802  20.035  1.00 96.99  ? 106  LEU C N   1 
ATOM   9835  C CA  . LEU C  1 106 ? -52.840 29.560  20.717  1.00 93.76  ? 106  LEU C CA  1 
ATOM   9836  C C   . LEU C  1 106 ? -52.123 29.544  22.063  1.00 95.47  ? 106  LEU C C   1 
ATOM   9837  O O   . LEU C  1 106 ? -50.918 29.762  22.121  1.00 93.75  ? 106  LEU C O   1 
ATOM   9838  C CB  . LEU C  1 106 ? -52.480 28.335  19.853  1.00 91.50  ? 106  LEU C CB  1 
ATOM   9839  C CG  . LEU C  1 106 ? -52.627 26.933  20.468  1.00 93.51  ? 106  LEU C CG  1 
ATOM   9840  C CD1 . LEU C  1 106 ? -54.093 26.472  20.508  1.00 92.84  ? 106  LEU C CD1 1 
ATOM   9841  C CD2 . LEU C  1 106 ? -51.819 25.944  19.676  1.00 93.24  ? 106  LEU C CD2 1 
ATOM   9842  N N   . GLN C  1 107 ? -52.890 29.332  23.131  1.00 92.47  ? 107  GLN C N   1 
ATOM   9843  C CA  . GLN C  1 107 ? -52.445 29.355  24.514  1.00 93.25  ? 107  GLN C CA  1 
ATOM   9844  C C   . GLN C  1 107 ? -52.414 27.984  25.201  1.00 97.22  ? 107  GLN C C   1 
ATOM   9845  O O   . GLN C  1 107 ? -51.632 27.793  26.144  1.00 97.82  ? 107  GLN C O   1 
ATOM   9846  C CB  . GLN C  1 107 ? -53.391 30.250  25.304  1.00 96.32  ? 107  GLN C CB  1 
ATOM   9847  C CG  . GLN C  1 107 ? -53.046 31.709  25.262  1.00 113.05 ? 107  GLN C CG  1 
ATOM   9848  C CD  . GLN C  1 107 ? -54.250 32.519  25.623  1.00 139.59 ? 107  GLN C CD  1 
ATOM   9849  O OE1 . GLN C  1 107 ? -54.663 33.384  24.854  1.00 144.71 ? 107  GLN C OE1 1 
ATOM   9850  N NE2 . GLN C  1 107 ? -54.898 32.203  26.750  1.00 126.37 ? 107  GLN C NE2 1 
ATOM   9851  N N   . GLU C  1 108 ? -53.323 27.073  24.791  1.00 91.44  ? 108  GLU C N   1 
ATOM   9852  C CA  . GLU C  1 108 ? -53.478 25.761  25.404  1.00 89.30  ? 108  GLU C CA  1 
ATOM   9853  C C   . GLU C  1 108 ? -53.821 24.694  24.379  1.00 90.50  ? 108  GLU C C   1 
ATOM   9854  O O   . GLU C  1 108 ? -54.593 24.961  23.447  1.00 91.35  ? 108  GLU C O   1 
ATOM   9855  C CB  . GLU C  1 108 ? -54.595 25.824  26.463  1.00 91.45  ? 108  GLU C CB  1 
ATOM   9856  C CG  . GLU C  1 108 ? -54.596 24.678  27.466  1.00 103.06 ? 108  GLU C CG  1 
ATOM   9857  C CD  . GLU C  1 108 ? -55.768 24.644  28.426  1.00 117.68 ? 108  GLU C CD  1 
ATOM   9858  O OE1 . GLU C  1 108 ? -56.384 23.560  28.556  1.00 108.76 ? 108  GLU C OE1 1 
ATOM   9859  O OE2 . GLU C  1 108 ? -56.044 25.679  29.079  1.00 106.36 ? 108  GLU C OE2 1 
ATOM   9860  N N   . LEU C  1 109 ? -53.270 23.467  24.586  1.00 82.03  ? 109  LEU C N   1 
ATOM   9861  C CA  . LEU C  1 109 ? -53.541 22.293  23.760  1.00 78.28  ? 109  LEU C CA  1 
ATOM   9862  C C   . LEU C  1 109 ? -54.448 21.334  24.559  1.00 79.69  ? 109  LEU C C   1 
ATOM   9863  O O   . LEU C  1 109 ? -54.085 20.916  25.668  1.00 79.61  ? 109  LEU C O   1 
ATOM   9864  C CB  . LEU C  1 109 ? -52.232 21.567  23.389  1.00 76.51  ? 109  LEU C CB  1 
ATOM   9865  C CG  . LEU C  1 109 ? -51.090 22.344  22.749  1.00 80.27  ? 109  LEU C CG  1 
ATOM   9866  C CD1 . LEU C  1 109 ? -49.849 21.494  22.703  1.00 78.54  ? 109  LEU C CD1 1 
ATOM   9867  C CD2 . LEU C  1 109 ? -51.417 22.729  21.347  1.00 82.37  ? 109  LEU C CD2 1 
ATOM   9868  N N   . GLY C  1 110 ? -55.619 21.023  24.006  1.00 73.01  ? 110  GLY C N   1 
ATOM   9869  C CA  . GLY C  1 110 ? -56.544 20.070  24.604  1.00 71.40  ? 110  GLY C CA  1 
ATOM   9870  C C   . GLY C  1 110 ? -56.233 18.696  24.046  1.00 72.99  ? 110  GLY C C   1 
ATOM   9871  O O   . GLY C  1 110 ? -56.962 18.184  23.195  1.00 72.62  ? 110  GLY C O   1 
ATOM   9872  N N   . LEU C  1 111 ? -55.089 18.127  24.468  1.00 67.42  ? 111  LEU C N   1 
ATOM   9873  C CA  . LEU C  1 111 ? -54.576 16.826  24.009  1.00 63.70  ? 111  LEU C CA  1 
ATOM   9874  C C   . LEU C  1 111 ? -54.415 15.795  25.137  1.00 67.40  ? 111  LEU C C   1 
ATOM   9875  O O   . LEU C  1 111 ? -53.662 14.836  24.960  1.00 67.56  ? 111  LEU C O   1 
ATOM   9876  C CB  . LEU C  1 111 ? -53.229 17.021  23.273  1.00 61.63  ? 111  LEU C CB  1 
ATOM   9877  C CG  . LEU C  1 111 ? -53.270 17.813  21.979  1.00 63.50  ? 111  LEU C CG  1 
ATOM   9878  C CD1 . LEU C  1 111 ? -51.895 18.119  21.506  1.00 61.10  ? 111  LEU C CD1 1 
ATOM   9879  C CD2 . LEU C  1 111 ? -54.084 17.092  20.893  1.00 63.84  ? 111  LEU C CD2 1 
ATOM   9880  N N   . LYS C  1 112 ? -55.138 15.961  26.272  1.00 62.78  ? 112  LYS C N   1 
ATOM   9881  C CA  . LYS C  1 112 ? -55.052 15.084  27.457  1.00 61.13  ? 112  LYS C CA  1 
ATOM   9882  C C   . LYS C  1 112 ? -55.249 13.588  27.160  1.00 62.68  ? 112  LYS C C   1 
ATOM   9883  O O   . LYS C  1 112 ? -54.853 12.737  27.973  1.00 61.48  ? 112  LYS C O   1 
ATOM   9884  C CB  . LYS C  1 112 ? -56.010 15.555  28.581  1.00 64.31  ? 112  LYS C CB  1 
ATOM   9885  C CG  . LYS C  1 112 ? -55.555 15.177  29.998  1.00 70.11  ? 112  LYS C CG  1 
ATOM   9886  C CD  . LYS C  1 112 ? -56.698 14.979  30.989  1.00 81.15  ? 112  LYS C CD  1 
ATOM   9887  C CE  . LYS C  1 112 ? -56.180 14.339  32.259  1.00 95.35  ? 112  LYS C CE  1 
ATOM   9888  N NZ  . LYS C  1 112 ? -57.076 14.565  33.426  1.00 107.26 ? 112  LYS C NZ  1 
ATOM   9889  N N   . ASN C  1 113 ? -55.869 13.267  26.013  1.00 58.12  ? 113  ASN C N   1 
ATOM   9890  C CA  . ASN C  1 113 ? -56.113 11.878  25.654  1.00 56.62  ? 113  ASN C CA  1 
ATOM   9891  C C   . ASN C  1 113 ? -55.055 11.325  24.694  1.00 61.47  ? 113  ASN C C   1 
ATOM   9892  O O   . ASN C  1 113 ? -55.006 10.116  24.466  1.00 61.34  ? 113  ASN C O   1 
ATOM   9893  C CB  . ASN C  1 113 ? -57.532 11.695  25.130  1.00 53.46  ? 113  ASN C CB  1 
ATOM   9894  C CG  . ASN C  1 113 ? -58.489 11.150  26.161  1.00 83.48  ? 113  ASN C CG  1 
ATOM   9895  O OD1 . ASN C  1 113 ? -58.345 11.373  27.385  1.00 80.55  ? 113  ASN C OD1 1 
ATOM   9896  N ND2 . ASN C  1 113 ? -59.507 10.422  25.681  1.00 72.75  ? 113  ASN C ND2 1 
ATOM   9897  N N   . LEU C  1 114 ? -54.207 12.203  24.132  1.00 57.65  ? 114  LEU C N   1 
ATOM   9898  C CA  . LEU C  1 114 ? -53.162 11.785  23.217  1.00 56.55  ? 114  LEU C CA  1 
ATOM   9899  C C   . LEU C  1 114 ? -52.052 11.126  23.988  1.00 60.99  ? 114  LEU C C   1 
ATOM   9900  O O   . LEU C  1 114 ? -51.213 11.798  24.605  1.00 60.93  ? 114  LEU C O   1 
ATOM   9901  C CB  . LEU C  1 114 ? -52.635 12.942  22.362  1.00 57.03  ? 114  LEU C CB  1 
ATOM   9902  C CG  . LEU C  1 114 ? -51.599 12.569  21.311  1.00 60.42  ? 114  LEU C CG  1 
ATOM   9903  C CD1 . LEU C  1 114 ? -52.232 11.783  20.156  1.00 60.33  ? 114  LEU C CD1 1 
ATOM   9904  C CD2 . LEU C  1 114 ? -50.877 13.789  20.824  1.00 60.62  ? 114  LEU C CD2 1 
ATOM   9905  N N   . THR C  1 115 ? -52.110 9.787   23.996  1.00 57.66  ? 115  THR C N   1 
ATOM   9906  C CA  . THR C  1 115 ? -51.152 8.908   24.665  1.00 57.15  ? 115  THR C CA  1 
ATOM   9907  C C   . THR C  1 115 ? -50.381 8.053   23.644  1.00 58.59  ? 115  THR C C   1 
ATOM   9908  O O   . THR C  1 115 ? -49.508 7.270   24.032  1.00 56.75  ? 115  THR C O   1 
ATOM   9909  C CB  . THR C  1 115 ? -51.851 8.034   25.716  1.00 63.69  ? 115  THR C CB  1 
ATOM   9910  O OG1 . THR C  1 115 ? -52.965 7.407   25.109  1.00 64.31  ? 115  THR C OG1 1 
ATOM   9911  C CG2 . THR C  1 115 ? -52.288 8.805   26.937  1.00 60.50  ? 115  THR C CG2 1 
ATOM   9912  N N   . GLU C  1 116 ? -50.670 8.235   22.340  1.00 53.81  ? 116  GLU C N   1 
ATOM   9913  C CA  . GLU C  1 116 ? -49.995 7.454   21.315  1.00 51.62  ? 116  GLU C CA  1 
ATOM   9914  C C   . GLU C  1 116 ? -49.740 8.166   19.990  1.00 56.85  ? 116  GLU C C   1 
ATOM   9915  O O   . GLU C  1 116 ? -50.640 8.720   19.357  1.00 59.86  ? 116  GLU C O   1 
ATOM   9916  C CB  . GLU C  1 116 ? -50.769 6.166   21.073  1.00 51.35  ? 116  GLU C CB  1 
ATOM   9917  C CG  . GLU C  1 116 ? -50.059 5.130   20.244  1.00 51.88  ? 116  GLU C CG  1 
ATOM   9918  C CD  . GLU C  1 116 ? -49.260 4.154   21.078  1.00 70.53  ? 116  GLU C CD  1 
ATOM   9919  O OE1 . GLU C  1 116 ? -49.878 3.334   21.794  1.00 72.23  ? 116  GLU C OE1 1 
ATOM   9920  O OE2 . GLU C  1 116 ? -48.014 4.178   20.978  1.00 57.12  ? 116  GLU C OE2 1 
ATOM   9921  N N   . ILE C  1 117 ? -48.492 8.116   19.581  1.00 50.83  ? 117  ILE C N   1 
ATOM   9922  C CA  . ILE C  1 117 ? -47.963 8.517   18.294  1.00 49.44  ? 117  ILE C CA  1 
ATOM   9923  C C   . ILE C  1 117 ? -47.129 7.265   17.904  1.00 55.57  ? 117  ILE C C   1 
ATOM   9924  O O   . ILE C  1 117 ? -46.131 6.952   18.596  1.00 54.36  ? 117  ILE C O   1 
ATOM   9925  C CB  . ILE C  1 117 ? -47.168 9.834   18.353  1.00 51.64  ? 117  ILE C CB  1 
ATOM   9926  C CG1 . ILE C  1 117 ? -48.120 11.015  18.603  1.00 52.05  ? 117  ILE C CG1 1 
ATOM   9927  C CG2 . ILE C  1 117 ? -46.335 10.016  17.079  1.00 49.93  ? 117  ILE C CG2 1 
ATOM   9928  C CD1 . ILE C  1 117 ? -47.475 12.209  19.154  1.00 59.67  ? 117  ILE C CD1 1 
ATOM   9929  N N   . LEU C  1 118 ? -47.647 6.475   16.898  1.00 51.42  ? 118  LEU C N   1 
ATOM   9930  C CA  . LEU C  1 118 ? -47.058 5.208   16.469  1.00 50.07  ? 118  LEU C CA  1 
ATOM   9931  C C   . LEU C  1 118 ? -45.783 5.350   15.666  1.00 59.89  ? 118  LEU C C   1 
ATOM   9932  O O   . LEU C  1 118 ? -44.816 4.628   15.892  1.00 60.97  ? 118  LEU C O   1 
ATOM   9933  C CB  . LEU C  1 118 ? -48.057 4.353   15.719  1.00 48.29  ? 118  LEU C CB  1 
ATOM   9934  C CG  . LEU C  1 118 ? -49.131 3.672   16.554  1.00 52.49  ? 118  LEU C CG  1 
ATOM   9935  C CD1 . LEU C  1 118 ? -49.997 2.760   15.711  1.00 51.90  ? 118  LEU C CD1 1 
ATOM   9936  C CD2 . LEU C  1 118 ? -48.532 2.852   17.647  1.00 54.58  ? 118  LEU C CD2 1 
ATOM   9937  N N   . ASN C  1 119 ? -45.788 6.257   14.722  1.00 57.99  ? 119  ASN C N   1 
ATOM   9938  C CA  . ASN C  1 119 ? -44.659 6.476   13.856  1.00 58.77  ? 119  ASN C CA  1 
ATOM   9939  C C   . ASN C  1 119 ? -44.514 7.986   13.610  1.00 63.97  ? 119  ASN C C   1 
ATOM   9940  O O   . ASN C  1 119 ? -45.526 8.693   13.498  1.00 65.73  ? 119  ASN C O   1 
ATOM   9941  C CB  . ASN C  1 119 ? -44.882 5.703   12.548  1.00 61.14  ? 119  ASN C CB  1 
ATOM   9942  C CG  . ASN C  1 119 ? -43.772 5.857   11.515  1.00 88.25  ? 119  ASN C CG  1 
ATOM   9943  O OD1 . ASN C  1 119 ? -43.973 6.464   10.438  1.00 77.53  ? 119  ASN C OD1 1 
ATOM   9944  N ND2 . ASN C  1 119 ? -42.584 5.296   11.809  1.00 76.83  ? 119  ASN C ND2 1 
ATOM   9945  N N   . GLY C  1 120 ? -43.270 8.454   13.544  1.00 58.25  ? 120  GLY C N   1 
ATOM   9946  C CA  . GLY C  1 120 ? -42.940 9.853   13.305  1.00 58.51  ? 120  GLY C CA  1 
ATOM   9947  C C   . GLY C  1 120 ? -42.606 10.590  14.577  1.00 63.62  ? 120  GLY C C   1 
ATOM   9948  O O   . GLY C  1 120 ? -42.702 10.001  15.661  1.00 66.31  ? 120  GLY C O   1 
ATOM   9949  N N   . GLY C  1 121 ? -42.199 11.857  14.436  1.00 56.40  ? 121  GLY C N   1 
ATOM   9950  C CA  . GLY C  1 121 ? -41.830 12.720  15.548  1.00 55.23  ? 121  GLY C CA  1 
ATOM   9951  C C   . GLY C  1 121 ? -42.808 13.842  15.838  1.00 58.88  ? 121  GLY C C   1 
ATOM   9952  O O   . GLY C  1 121 ? -43.894 13.941  15.236  1.00 54.44  ? 121  GLY C O   1 
ATOM   9953  N N   . VAL C  1 122 ? -42.405 14.695  16.802  1.00 59.14  ? 122  VAL C N   1 
ATOM   9954  C CA  . VAL C  1 122 ? -43.184 15.840  17.281  1.00 60.06  ? 122  VAL C CA  1 
ATOM   9955  C C   . VAL C  1 122 ? -42.420 17.136  17.026  1.00 64.61  ? 122  VAL C C   1 
ATOM   9956  O O   . VAL C  1 122 ? -41.271 17.261  17.445  1.00 63.88  ? 122  VAL C O   1 
ATOM   9957  C CB  . VAL C  1 122 ? -43.548 15.682  18.790  1.00 62.95  ? 122  VAL C CB  1 
ATOM   9958  C CG1 . VAL C  1 122 ? -44.274 16.913  19.330  1.00 63.10  ? 122  VAL C CG1 1 
ATOM   9959  C CG2 . VAL C  1 122 ? -44.380 14.430  19.028  1.00 61.59  ? 122  VAL C CG2 1 
ATOM   9960  N N   . TYR C  1 123 ? -43.068 18.095  16.370  1.00 62.85  ? 123  TYR C N   1 
ATOM   9961  C CA  . TYR C  1 123 ? -42.504 19.416  16.141  1.00 65.22  ? 123  TYR C CA  1 
ATOM   9962  C C   . TYR C  1 123 ? -43.455 20.498  16.686  1.00 71.60  ? 123  TYR C C   1 
ATOM   9963  O O   . TYR C  1 123 ? -44.448 20.833  16.044  1.00 71.84  ? 123  TYR C O   1 
ATOM   9964  C CB  . TYR C  1 123 ? -42.134 19.635  14.657  1.00 66.05  ? 123  TYR C CB  1 
ATOM   9965  C CG  . TYR C  1 123 ? -41.657 21.037  14.334  1.00 67.42  ? 123  TYR C CG  1 
ATOM   9966  C CD1 . TYR C  1 123 ? -40.357 21.436  14.620  1.00 68.79  ? 123  TYR C CD1 1 
ATOM   9967  C CD2 . TYR C  1 123 ? -42.489 21.944  13.696  1.00 69.77  ? 123  TYR C CD2 1 
ATOM   9968  C CE1 . TYR C  1 123 ? -39.915 22.720  14.325  1.00 71.47  ? 123  TYR C CE1 1 
ATOM   9969  C CE2 . TYR C  1 123 ? -42.052 23.228  13.380  1.00 73.22  ? 123  TYR C CE2 1 
ATOM   9970  C CZ  . TYR C  1 123 ? -40.767 23.621  13.706  1.00 81.98  ? 123  TYR C CZ  1 
ATOM   9971  O OH  . TYR C  1 123 ? -40.356 24.909  13.409  1.00 87.91  ? 123  TYR C OH  1 
ATOM   9972  N N   . VAL C  1 124 ? -43.175 20.990  17.892  1.00 69.29  ? 124  VAL C N   1 
ATOM   9973  C CA  . VAL C  1 124 ? -43.962 22.043  18.527  1.00 70.94  ? 124  VAL C CA  1 
ATOM   9974  C C   . VAL C  1 124 ? -42.993 23.176  18.735  1.00 81.38  ? 124  VAL C C   1 
ATOM   9975  O O   . VAL C  1 124 ? -42.097 23.048  19.553  1.00 83.48  ? 124  VAL C O   1 
ATOM   9976  C CB  . VAL C  1 124 ? -44.667 21.580  19.833  1.00 73.12  ? 124  VAL C CB  1 
ATOM   9977  C CG1 . VAL C  1 124 ? -45.463 22.717  20.476  1.00 73.45  ? 124  VAL C CG1 1 
ATOM   9978  C CG2 . VAL C  1 124 ? -45.575 20.385  19.560  1.00 71.45  ? 124  VAL C CG2 1 
ATOM   9979  N N   . ASP C  1 125 ? -43.088 24.226  17.929  1.00 81.73  ? 125  ASP C N   1 
ATOM   9980  C CA  . ASP C  1 125 ? -42.143 25.353  17.972  1.00 84.79  ? 125  ASP C CA  1 
ATOM   9981  C C   . ASP C  1 125 ? -42.801 26.652  17.489  1.00 90.57  ? 125  ASP C C   1 
ATOM   9982  O O   . ASP C  1 125 ? -43.849 26.610  16.846  1.00 89.35  ? 125  ASP C O   1 
ATOM   9983  C CB  . ASP C  1 125 ? -40.916 25.015  17.079  1.00 87.43  ? 125  ASP C CB  1 
ATOM   9984  C CG  . ASP C  1 125 ? -39.777 26.030  17.015  1.00 110.26 ? 125  ASP C CG  1 
ATOM   9985  O OD1 . ASP C  1 125 ? -39.575 26.771  18.008  1.00 113.64 ? 125  ASP C OD1 1 
ATOM   9986  O OD2 . ASP C  1 125 ? -39.082 26.076  15.975  1.00 120.59 ? 125  ASP C OD2 1 
ATOM   9987  N N   . GLN C  1 126 ? -42.175 27.805  17.795  1.00 89.16  ? 126  GLN C N   1 
ATOM   9988  C CA  . GLN C  1 126 ? -42.610 29.125  17.344  1.00 90.91  ? 126  GLN C CA  1 
ATOM   9989  C C   . GLN C  1 126 ? -44.076 29.413  17.722  1.00 93.66  ? 126  GLN C C   1 
ATOM   9990  O O   . GLN C  1 126 ? -44.830 29.910  16.889  1.00 94.14  ? 126  GLN C O   1 
ATOM   9991  C CB  . GLN C  1 126 ? -42.416 29.260  15.809  1.00 92.87  ? 126  GLN C CB  1 
ATOM   9992  C CG  . GLN C  1 126 ? -41.037 28.924  15.248  1.00 113.05 ? 126  GLN C CG  1 
ATOM   9993  C CD  . GLN C  1 126 ? -40.075 30.089  15.275  1.00 152.97 ? 126  GLN C CD  1 
ATOM   9994  O OE1 . GLN C  1 126 ? -38.875 29.916  15.022  1.00 152.75 ? 126  GLN C OE1 1 
ATOM   9995  N NE2 . GLN C  1 126 ? -40.572 31.312  15.533  1.00 150.88 ? 126  GLN C NE2 1 
ATOM   9996  N N   . ASN C  1 127 ? -44.484 29.071  18.954  1.00 88.60  ? 127  ASN C N   1 
ATOM   9997  C CA  . ASN C  1 127 ? -45.864 29.297  19.415  1.00 88.10  ? 127  ASN C CA  1 
ATOM   9998  C C   . ASN C  1 127 ? -45.950 30.333  20.568  1.00 93.58  ? 127  ASN C C   1 
ATOM   9999  O O   . ASN C  1 127 ? -46.295 29.984  21.701  1.00 92.79  ? 127  ASN C O   1 
ATOM   10000 C CB  . ASN C  1 127 ? -46.535 27.948  19.754  1.00 81.23  ? 127  ASN C CB  1 
ATOM   10001 C CG  . ASN C  1 127 ? -46.931 27.134  18.542  1.00 77.76  ? 127  ASN C CG  1 
ATOM   10002 O OD1 . ASN C  1 127 ? -46.781 25.913  18.495  1.00 68.26  ? 127  ASN C OD1 1 
ATOM   10003 N ND2 . ASN C  1 127 ? -47.486 27.781  17.548  1.00 61.11  ? 127  ASN C ND2 1 
ATOM   10004 N N   . LYS C  1 128 ? -45.633 31.607  20.261  1.00 92.35  ? 128  LYS C N   1 
ATOM   10005 C CA  . LYS C  1 128 ? -45.539 32.734  21.211  1.00 94.66  ? 128  LYS C CA  1 
ATOM   10006 C C   . LYS C  1 128 ? -46.411 32.705  22.486  1.00 99.43  ? 128  LYS C C   1 
ATOM   10007 O O   . LYS C  1 128 ? -45.907 33.036  23.558  1.00 100.38 ? 128  LYS C O   1 
ATOM   10008 C CB  . LYS C  1 128 ? -45.678 34.085  20.484  1.00 99.04  ? 128  LYS C CB  1 
ATOM   10009 C CG  . LYS C  1 128 ? -44.984 35.263  21.155  1.00 111.77 ? 128  LYS C CG  1 
ATOM   10010 C CD  . LYS C  1 128 ? -45.264 36.563  20.400  1.00 126.61 ? 128  LYS C CD  1 
ATOM   10011 C CE  . LYS C  1 128 ? -44.138 37.565  20.498  1.00 138.77 ? 128  LYS C CE  1 
ATOM   10012 N NZ  . LYS C  1 128 ? -44.144 38.495  19.337  1.00 150.58 ? 128  LYS C NZ  1 
ATOM   10013 N N   . PHE C  1 129 ? -47.691 32.301  22.367  1.00 95.00  ? 129  PHE C N   1 
ATOM   10014 C CA  . PHE C  1 129 ? -48.679 32.333  23.443  1.00 95.16  ? 129  PHE C CA  1 
ATOM   10015 C C   . PHE C  1 129 ? -48.986 31.015  24.135  1.00 98.08  ? 129  PHE C C   1 
ATOM   10016 O O   . PHE C  1 129 ? -49.655 31.021  25.174  1.00 98.82  ? 129  PHE C O   1 
ATOM   10017 C CB  . PHE C  1 129 ? -49.969 32.999  22.937  1.00 98.40  ? 129  PHE C CB  1 
ATOM   10018 C CG  . PHE C  1 129 ? -49.775 34.434  22.499  1.00 102.61 ? 129  PHE C CG  1 
ATOM   10019 C CD1 . PHE C  1 129 ? -49.411 34.736  21.191  1.00 106.52 ? 129  PHE C CD1 1 
ATOM   10020 C CD2 . PHE C  1 129 ? -49.936 35.481  23.398  1.00 106.56 ? 129  PHE C CD2 1 
ATOM   10021 C CE1 . PHE C  1 129 ? -49.207 36.058  20.792  1.00 109.87 ? 129  PHE C CE1 1 
ATOM   10022 C CE2 . PHE C  1 129 ? -49.747 36.803  22.995  1.00 112.03 ? 129  PHE C CE2 1 
ATOM   10023 C CZ  . PHE C  1 129 ? -49.383 37.083  21.695  1.00 110.78 ? 129  PHE C CZ  1 
ATOM   10024 N N   . LEU C  1 130 ? -48.500 29.892  23.572  1.00 92.16  ? 130  LEU C N   1 
ATOM   10025 C CA  . LEU C  1 130 ? -48.704 28.528  24.077  1.00 88.87  ? 130  LEU C CA  1 
ATOM   10026 C C   . LEU C  1 130 ? -47.950 28.205  25.362  1.00 96.91  ? 130  LEU C C   1 
ATOM   10027 O O   . LEU C  1 130 ? -46.718 28.233  25.389  1.00 96.77  ? 130  LEU C O   1 
ATOM   10028 C CB  . LEU C  1 130 ? -48.372 27.510  22.975  1.00 85.65  ? 130  LEU C CB  1 
ATOM   10029 C CG  . LEU C  1 130 ? -48.505 26.045  23.296  1.00 86.08  ? 130  LEU C CG  1 
ATOM   10030 C CD1 . LEU C  1 130 ? -49.909 25.705  23.754  1.00 85.96  ? 130  LEU C CD1 1 
ATOM   10031 C CD2 . LEU C  1 130 ? -48.109 25.210  22.107  1.00 83.96  ? 130  LEU C CD2 1 
ATOM   10032 N N   . CYS C  1 131 ? -48.704 27.849  26.407  1.00 96.36  ? 131  CYS C N   1 
ATOM   10033 C CA  . CYS C  1 131 ? -48.159 27.453  27.698  1.00 97.85  ? 131  CYS C CA  1 
ATOM   10034 C C   . CYS C  1 131 ? -48.334 25.951  27.903  1.00 96.27  ? 131  CYS C C   1 
ATOM   10035 O O   . CYS C  1 131 ? -49.134 25.306  27.219  1.00 94.85  ? 131  CYS C O   1 
ATOM   10036 C CB  . CYS C  1 131 ? -48.830 28.229  28.829  1.00 102.05 ? 131  CYS C CB  1 
ATOM   10037 S SG  . CYS C  1 131 ? -48.380 29.978  28.941  1.00 110.32 ? 131  CYS C SG  1 
ATOM   10038 N N   . TYR C  1 132 ? -47.625 25.415  28.904  1.00 90.11  ? 132  TYR C N   1 
ATOM   10039 C CA  . TYR C  1 132 ? -47.707 24.032  29.370  1.00 87.36  ? 132  TYR C CA  1 
ATOM   10040 C C   . TYR C  1 132 ? -47.147 22.929  28.464  1.00 85.74  ? 132  TYR C C   1 
ATOM   10041 O O   . TYR C  1 132 ? -46.646 21.942  29.000  1.00 84.27  ? 132  TYR C O   1 
ATOM   10042 C CB  . TYR C  1 132 ? -49.108 23.683  29.927  1.00 88.80  ? 132  TYR C CB  1 
ATOM   10043 C CG  . TYR C  1 132 ? -49.664 24.726  30.870  1.00 93.10  ? 132  TYR C CG  1 
ATOM   10044 C CD1 . TYR C  1 132 ? -49.302 24.743  32.213  1.00 96.47  ? 132  TYR C CD1 1 
ATOM   10045 C CD2 . TYR C  1 132 ? -50.566 25.684  30.426  1.00 94.96  ? 132  TYR C CD2 1 
ATOM   10046 C CE1 . TYR C  1 132 ? -49.790 25.716  33.083  1.00 100.32 ? 132  TYR C CE1 1 
ATOM   10047 C CE2 . TYR C  1 132 ? -51.055 26.670  31.284  1.00 98.20  ? 132  TYR C CE2 1 
ATOM   10048 C CZ  . TYR C  1 132 ? -50.647 26.695  32.609  1.00 110.57 ? 132  TYR C CZ  1 
ATOM   10049 O OH  . TYR C  1 132 ? -51.109 27.675  33.458  1.00 116.37 ? 132  TYR C OH  1 
ATOM   10050 N N   . ALA C  1 133 ? -47.207 23.082  27.113  1.00 78.42  ? 133  ALA C N   1 
ATOM   10051 C CA  . ALA C  1 133 ? -46.721 22.087  26.139  1.00 74.49  ? 133  ALA C CA  1 
ATOM   10052 C C   . ALA C  1 133 ? -45.228 21.769  26.283  1.00 76.66  ? 133  ALA C C   1 
ATOM   10053 O O   . ALA C  1 133 ? -44.768 20.714  25.819  1.00 74.17  ? 133  ALA C O   1 
ATOM   10054 C CB  . ALA C  1 133 ? -47.040 22.529  24.730  1.00 74.77  ? 133  ALA C CB  1 
ATOM   10055 N N   . ASP C  1 134 ? -44.480 22.682  26.957  1.00 73.92  ? 134  ASP C N   1 
ATOM   10056 C CA  . ASP C  1 134 ? -43.058 22.517  27.288  1.00 73.29  ? 134  ASP C CA  1 
ATOM   10057 C C   . ASP C  1 134 ? -42.840 21.422  28.360  1.00 73.20  ? 134  ASP C C   1 
ATOM   10058 O O   . ASP C  1 134 ? -41.807 20.767  28.365  1.00 73.34  ? 134  ASP C O   1 
ATOM   10059 C CB  . ASP C  1 134 ? -42.441 23.848  27.749  1.00 77.49  ? 134  ASP C CB  1 
ATOM   10060 C CG  . ASP C  1 134 ? -43.250 24.631  28.784  1.00 101.58 ? 134  ASP C CG  1 
ATOM   10061 O OD1 . ASP C  1 134 ? -44.461 24.895  28.528  1.00 104.53 ? 134  ASP C OD1 1 
ATOM   10062 O OD2 . ASP C  1 134 ? -42.659 25.042  29.816  1.00 111.59 ? 134  ASP C OD2 1 
ATOM   10063 N N   . THR C  1 135 ? -43.832 21.213  29.233  1.00 65.67  ? 135  THR C N   1 
ATOM   10064 C CA  . THR C  1 135 ? -43.778 20.266  30.335  1.00 62.98  ? 135  THR C CA  1 
ATOM   10065 C C   . THR C  1 135 ? -44.063 18.831  29.921  1.00 63.51  ? 135  THR C C   1 
ATOM   10066 O O   . THR C  1 135 ? -43.735 17.893  30.656  1.00 62.71  ? 135  THR C O   1 
ATOM   10067 C CB  . THR C  1 135 ? -44.632 20.765  31.503  1.00 62.81  ? 135  THR C CB  1 
ATOM   10068 O OG1 . THR C  1 135 ? -45.981 20.372  31.350  1.00 60.11  ? 135  THR C OG1 1 
ATOM   10069 C CG2 . THR C  1 135 ? -44.566 22.248  31.664  1.00 61.30  ? 135  THR C CG2 1 
ATOM   10070 N N   . ILE C  1 136 ? -44.651 18.660  28.740  1.00 57.46  ? 136  ILE C N   1 
ATOM   10071 C CA  . ILE C  1 136 ? -45.012 17.349  28.211  1.00 54.65  ? 136  ILE C CA  1 
ATOM   10072 C C   . ILE C  1 136 ? -43.824 16.415  27.917  1.00 60.75  ? 136  ILE C C   1 
ATOM   10073 O O   . ILE C  1 136 ? -42.831 16.808  27.288  1.00 63.15  ? 136  ILE C O   1 
ATOM   10074 C CB  . ILE C  1 136 ? -45.969 17.525  27.016  1.00 56.21  ? 136  ILE C CB  1 
ATOM   10075 C CG1 . ILE C  1 136 ? -47.249 18.275  27.433  1.00 57.39  ? 136  ILE C CG1 1 
ATOM   10076 C CG2 . ILE C  1 136 ? -46.267 16.207  26.301  1.00 55.16  ? 136  ILE C CG2 1 
ATOM   10077 C CD1 . ILE C  1 136 ? -48.065 17.671  28.630  1.00 66.83  ? 136  ILE C CD1 1 
ATOM   10078 N N   . HIS C  1 137 ? -43.937 15.180  28.387  1.00 56.32  ? 137  HIS C N   1 
ATOM   10079 C CA  . HIS C  1 137 ? -42.953 14.137  28.164  1.00 56.10  ? 137  HIS C CA  1 
ATOM   10080 C C   . HIS C  1 137 ? -43.347 13.431  26.896  1.00 63.00  ? 137  HIS C C   1 
ATOM   10081 O O   . HIS C  1 137 ? -44.089 12.446  26.948  1.00 64.36  ? 137  HIS C O   1 
ATOM   10082 C CB  . HIS C  1 137 ? -42.937 13.169  29.347  1.00 56.50  ? 137  HIS C CB  1 
ATOM   10083 C CG  . HIS C  1 137 ? -41.819 12.185  29.283  1.00 59.89  ? 137  HIS C CG  1 
ATOM   10084 N ND1 . HIS C  1 137 ? -40.505 12.589  29.250  1.00 62.59  ? 137  HIS C ND1 1 
ATOM   10085 C CD2 . HIS C  1 137 ? -41.858 10.836  29.249  1.00 61.01  ? 137  HIS C CD2 1 
ATOM   10086 C CE1 . HIS C  1 137 ? -39.791 11.479  29.185  1.00 61.29  ? 137  HIS C CE1 1 
ATOM   10087 N NE2 . HIS C  1 137 ? -40.561 10.400  29.185  1.00 60.51  ? 137  HIS C NE2 1 
ATOM   10088 N N   . TRP C  1 138 ? -42.925 13.981  25.743  1.00 59.90  ? 138  TRP C N   1 
ATOM   10089 C CA  . TRP C  1 138 ? -43.277 13.443  24.423  1.00 58.33  ? 138  TRP C CA  1 
ATOM   10090 C C   . TRP C  1 138 ? -42.735 12.056  24.194  1.00 62.29  ? 138  TRP C C   1 
ATOM   10091 O O   . TRP C  1 138 ? -43.350 11.294  23.446  1.00 61.30  ? 138  TRP C O   1 
ATOM   10092 C CB  . TRP C  1 138 ? -42.854 14.382  23.299  1.00 57.02  ? 138  TRP C CB  1 
ATOM   10093 C CG  . TRP C  1 138 ? -43.520 15.710  23.358  1.00 58.46  ? 138  TRP C CG  1 
ATOM   10094 C CD1 . TRP C  1 138 ? -43.010 16.859  23.892  1.00 62.64  ? 138  TRP C CD1 1 
ATOM   10095 C CD2 . TRP C  1 138 ? -44.849 16.018  22.936  1.00 58.06  ? 138  TRP C CD2 1 
ATOM   10096 N NE1 . TRP C  1 138 ? -43.943 17.866  23.831  1.00 62.61  ? 138  TRP C NE1 1 
ATOM   10097 C CE2 . TRP C  1 138 ? -45.078 17.386  23.231  1.00 63.29  ? 138  TRP C CE2 1 
ATOM   10098 C CE3 . TRP C  1 138 ? -45.882 15.269  22.351  1.00 58.02  ? 138  TRP C CE3 1 
ATOM   10099 C CZ2 . TRP C  1 138 ? -46.297 18.022  22.951  1.00 62.48  ? 138  TRP C CZ2 1 
ATOM   10100 C CZ3 . TRP C  1 138 ? -47.093 15.897  22.086  1.00 59.69  ? 138  TRP C CZ3 1 
ATOM   10101 C CH2 . TRP C  1 138 ? -47.286 17.261  22.372  1.00 61.55  ? 138  TRP C CH2 1 
ATOM   10102 N N   . GLN C  1 139 ? -41.617 11.710  24.863  1.00 59.58  ? 139  GLN C N   1 
ATOM   10103 C CA  . GLN C  1 139 ? -40.990 10.389  24.777  1.00 59.67  ? 139  GLN C CA  1 
ATOM   10104 C C   . GLN C  1 139 ? -41.971 9.285   25.205  1.00 61.92  ? 139  GLN C C   1 
ATOM   10105 O O   . GLN C  1 139 ? -41.968 8.196   24.619  1.00 61.64  ? 139  GLN C O   1 
ATOM   10106 C CB  . GLN C  1 139 ? -39.700 10.329  25.617  1.00 62.59  ? 139  GLN C CB  1 
ATOM   10107 C CG  . GLN C  1 139 ? -38.473 10.896  24.900  1.00 96.90  ? 139  GLN C CG  1 
ATOM   10108 C CD  . GLN C  1 139 ? -37.349 11.394  25.801  1.00 129.32 ? 139  GLN C CD  1 
ATOM   10109 O OE1 . GLN C  1 139 ? -37.566 12.024  26.853  1.00 126.64 ? 139  GLN C OE1 1 
ATOM   10110 N NE2 . GLN C  1 139 ? -36.111 11.195  25.351  1.00 124.96 ? 139  GLN C NE2 1 
ATOM   10111 N N   . ASP C  1 140 ? -42.829 9.574   26.192  1.00 56.21  ? 140  ASP C N   1 
ATOM   10112 C CA  . ASP C  1 140 ? -43.846 8.633   26.661  1.00 55.42  ? 140  ASP C CA  1 
ATOM   10113 C C   . ASP C  1 140 ? -44.907 8.308   25.569  1.00 57.86  ? 140  ASP C C   1 
ATOM   10114 O O   . ASP C  1 140 ? -45.359 7.158   25.477  1.00 56.44  ? 140  ASP C O   1 
ATOM   10115 C CB  . ASP C  1 140 ? -44.516 9.162   27.951  1.00 57.92  ? 140  ASP C CB  1 
ATOM   10116 C CG  . ASP C  1 140 ? -45.300 8.115   28.686  1.00 68.42  ? 140  ASP C CG  1 
ATOM   10117 O OD1 . ASP C  1 140 ? -46.515 7.985   28.414  1.00 70.79  ? 140  ASP C OD1 1 
ATOM   10118 O OD2 . ASP C  1 140 ? -44.691 7.376   29.480  1.00 72.25  ? 140  ASP C OD2 1 
ATOM   10119 N N   . ILE C  1 141 ? -45.289 9.327   24.762  1.00 54.41  ? 141  ILE C N   1 
ATOM   10120 C CA  . ILE C  1 141 ? -46.303 9.280   23.692  1.00 53.82  ? 141  ILE C CA  1 
ATOM   10121 C C   . ILE C  1 141 ? -45.763 8.620   22.406  1.00 59.29  ? 141  ILE C C   1 
ATOM   10122 O O   . ILE C  1 141 ? -46.488 7.910   21.708  1.00 56.11  ? 141  ILE C O   1 
ATOM   10123 C CB  . ILE C  1 141 ? -46.833 10.728  23.402  1.00 57.09  ? 141  ILE C CB  1 
ATOM   10124 C CG1 . ILE C  1 141 ? -47.323 11.449  24.680  1.00 57.26  ? 141  ILE C CG1 1 
ATOM   10125 C CG2 . ILE C  1 141 ? -47.900 10.744  22.296  1.00 57.92  ? 141  ILE C CG2 1 
ATOM   10126 C CD1 . ILE C  1 141 ? -47.882 12.887  24.449  1.00 54.04  ? 141  ILE C CD1 1 
ATOM   10127 N N   . VAL C  1 142 ? -44.514 8.923   22.053  1.00 60.65  ? 142  VAL C N   1 
ATOM   10128 C CA  . VAL C  1 142 ? -43.951 8.401   20.820  1.00 61.70  ? 142  VAL C CA  1 
ATOM   10129 C C   . VAL C  1 142 ? -43.478 6.977   21.076  1.00 76.38  ? 142  VAL C C   1 
ATOM   10130 O O   . VAL C  1 142 ? -42.577 6.803   21.888  1.00 78.10  ? 142  VAL C O   1 
ATOM   10131 C CB  . VAL C  1 142 ? -42.869 9.336   20.201  1.00 63.41  ? 142  VAL C CB  1 
ATOM   10132 C CG1 . VAL C  1 142 ? -42.672 9.000   18.733  1.00 62.98  ? 142  VAL C CG1 1 
ATOM   10133 C CG2 . VAL C  1 142 ? -43.242 10.804  20.334  1.00 62.82  ? 142  VAL C CG2 1 
ATOM   10134 N N   . ARG C  1 143 ? -44.138 5.952   20.474  1.00 79.62  ? 143  ARG C N   1 
ATOM   10135 C CA  . ARG C  1 143 ? -43.759 4.529   20.672  1.00 81.82  ? 143  ARG C CA  1 
ATOM   10136 C C   . ARG C  1 143 ? -42.443 4.182   19.971  1.00 95.63  ? 143  ARG C C   1 
ATOM   10137 O O   . ARG C  1 143 ? -41.658 3.419   20.549  1.00 95.99  ? 143  ARG C O   1 
ATOM   10138 C CB  . ARG C  1 143 ? -44.857 3.530   20.219  1.00 76.99  ? 143  ARG C CB  1 
ATOM   10139 C CG  . ARG C  1 143 ? -45.220 2.504   21.307  1.00 83.50  ? 143  ARG C CG  1 
ATOM   10140 C CD  . ARG C  1 143 ? -46.038 1.298   20.835  1.00 84.55  ? 143  ARG C CD  1 
ATOM   10141 N NE  . ARG C  1 143 ? -47.161 0.952   21.728  1.00 91.19  ? 143  ARG C NE  1 
ATOM   10142 C CZ  . ARG C  1 143 ? -47.365 -0.247  22.290  1.00 109.04 ? 143  ARG C CZ  1 
ATOM   10143 N NH1 . ARG C  1 143 ? -46.494 -1.235  22.108  1.00 105.08 ? 143  ARG C NH1 1 
ATOM   10144 N NH2 . ARG C  1 143 ? -48.435 -0.460  23.048  1.00 86.98  ? 143  ARG C NH2 1 
ATOM   10145 N N   . ASN C  1 144 ? -42.220 4.723   18.717  1.00 98.38  ? 144  ASN C N   1 
ATOM   10146 C CA  . ASN C  1 144 ? -41.060 4.473   17.822  1.00 101.07 ? 144  ASN C CA  1 
ATOM   10147 C C   . ASN C  1 144 ? -39.946 5.521   17.937  1.00 109.50 ? 144  ASN C C   1 
ATOM   10148 O O   . ASN C  1 144 ? -39.828 6.389   17.047  1.00 109.43 ? 144  ASN C O   1 
ATOM   10149 C CB  . ASN C  1 144 ? -41.491 4.333   16.327  1.00 106.67 ? 144  ASN C CB  1 
ATOM   10150 C CG  . ASN C  1 144 ? -42.014 2.973   15.857  1.00 146.81 ? 144  ASN C CG  1 
ATOM   10151 O OD1 . ASN C  1 144 ? -41.787 1.912   16.472  1.00 143.41 ? 144  ASN C OD1 1 
ATOM   10152 N ND2 . ASN C  1 144 ? -42.698 2.976   14.706  1.00 140.42 ? 144  ASN C ND2 1 
ATOM   10153 N N   . PRO C  1 145 ? -39.079 5.428   18.988  1.00 108.86 ? 145  PRO C N   1 
ATOM   10154 C CA  . PRO C  1 145 ? -38.018 6.419   19.139  1.00 113.71 ? 145  PRO C CA  1 
ATOM   10155 C C   . PRO C  1 145 ? -36.657 5.862   18.671  1.00 148.05 ? 145  PRO C C   1 
ATOM   10156 O O   . PRO C  1 145 ? -36.576 5.047   17.740  1.00 101.53 ? 145  PRO C O   1 
ATOM   10157 C CB  . PRO C  1 145 ? -38.074 6.708   20.648  1.00 115.08 ? 145  PRO C CB  1 
ATOM   10158 C CG  . PRO C  1 145 ? -38.634 5.407   21.296  1.00 117.49 ? 145  PRO C CG  1 
ATOM   10159 C CD  . PRO C  1 145 ? -39.049 4.502   20.143  1.00 111.44 ? 145  PRO C CD  1 
ATOM   10160 N N   . SER C  1 148 ? -36.941 8.265   15.562  1.00 124.53 ? 148  SER C N   1 
ATOM   10161 C CA  . SER C  1 148 ? -37.540 9.608   15.531  1.00 124.83 ? 148  SER C CA  1 
ATOM   10162 C C   . SER C  1 148 ? -36.650 10.685  16.206  1.00 131.55 ? 148  SER C C   1 
ATOM   10163 O O   . SER C  1 148 ? -37.088 11.340  17.158  1.00 131.37 ? 148  SER C O   1 
ATOM   10164 C CB  . SER C  1 148 ? -38.948 9.585   16.129  1.00 125.34 ? 148  SER C CB  1 
ATOM   10165 O OG  . SER C  1 148 ? -38.923 9.334   17.524  1.00 126.92 ? 148  SER C OG  1 
ATOM   10166 N N   . ASN C  1 149 ? -35.412 10.880  15.680  1.00 129.82 ? 149  ASN C N   1 
ATOM   10167 C CA  . ASN C  1 149 ? -34.385 11.820  16.175  1.00 131.44 ? 149  ASN C CA  1 
ATOM   10168 C C   . ASN C  1 149 ? -34.849 13.301  16.280  1.00 136.76 ? 149  ASN C C   1 
ATOM   10169 O O   . ASN C  1 149 ? -34.004 14.200  16.396  1.00 138.58 ? 149  ASN C O   1 
ATOM   10170 C CB  . ASN C  1 149 ? -33.064 11.678  15.353  1.00 131.91 ? 149  ASN C CB  1 
ATOM   10171 C CG  . ASN C  1 149 ? -31.923 10.977  16.071  1.00 144.22 ? 149  ASN C CG  1 
ATOM   10172 O OD1 . ASN C  1 149 ? -31.256 11.548  16.940  1.00 137.58 ? 149  ASN C OD1 1 
ATOM   10173 N ND2 . ASN C  1 149 ? -31.626 9.740   15.684  1.00 130.07 ? 149  ASN C ND2 1 
ATOM   10174 N N   . LEU C  1 150 ? -36.194 13.539  16.271  1.00 131.50 ? 150  LEU C N   1 
ATOM   10175 C CA  . LEU C  1 150 ? -36.857 14.851  16.331  1.00 131.82 ? 150  LEU C CA  1 
ATOM   10176 C C   . LEU C  1 150 ? -38.114 14.821  17.246  1.00 131.72 ? 150  LEU C C   1 
ATOM   10177 O O   . LEU C  1 150 ? -39.217 14.554  16.761  1.00 130.14 ? 150  LEU C O   1 
ATOM   10178 C CB  . LEU C  1 150 ? -37.241 15.318  14.902  1.00 132.75 ? 150  LEU C CB  1 
ATOM   10179 C CG  . LEU C  1 150 ? -36.131 15.356  13.829  1.00 139.46 ? 150  LEU C CG  1 
ATOM   10180 C CD1 . LEU C  1 150 ? -36.401 14.341  12.719  1.00 139.15 ? 150  LEU C CD1 1 
ATOM   10181 C CD2 . LEU C  1 150 ? -35.953 16.754  13.253  1.00 143.63 ? 150  LEU C CD2 1 
ATOM   10182 N N   . THR C  1 151 ? -37.937 15.099  18.565  1.00 126.70 ? 151  THR C N   1 
ATOM   10183 C CA  . THR C  1 151 ? -39.000 15.112  19.599  1.00 125.00 ? 151  THR C CA  1 
ATOM   10184 C C   . THR C  1 151 ? -38.737 16.293  20.600  1.00 130.45 ? 151  THR C C   1 
ATOM   10185 O O   . THR C  1 151 ? -38.262 16.058  21.717  1.00 130.96 ? 151  THR C O   1 
ATOM   10186 C CB  . THR C  1 151 ? -39.118 13.682  20.242  1.00 120.41 ? 151  THR C CB  1 
ATOM   10187 O OG1 . THR C  1 151 ? -39.629 12.769  19.278  1.00 118.63 ? 151  THR C OG1 1 
ATOM   10188 C CG2 . THR C  1 151 ? -40.019 13.621  21.438  1.00 112.72 ? 151  THR C CG2 1 
ATOM   10189 N N   . LEU C  1 152 ? -39.009 17.564  20.184  1.00 126.69 ? 152  LEU C N   1 
ATOM   10190 C CA  . LEU C  1 152 ? -38.743 18.738  21.041  1.00 126.94 ? 152  LEU C CA  1 
ATOM   10191 C C   . LEU C  1 152 ? -39.772 19.877  20.978  1.00 127.89 ? 152  LEU C C   1 
ATOM   10192 O O   . LEU C  1 152 ? -40.384 20.100  19.929  1.00 125.82 ? 152  LEU C O   1 
ATOM   10193 C CB  . LEU C  1 152 ? -37.327 19.310  20.769  1.00 128.52 ? 152  LEU C CB  1 
ATOM   10194 C CG  . LEU C  1 152 ? -36.107 18.559  21.351  1.00 133.36 ? 152  LEU C CG  1 
ATOM   10195 C CD1 . LEU C  1 152 ? -34.864 18.786  20.503  1.00 134.37 ? 152  LEU C CD1 1 
ATOM   10196 C CD2 . LEU C  1 152 ? -35.834 18.961  22.796  1.00 136.46 ? 152  LEU C CD2 1 
ATOM   10197 N N   . VAL C  1 153 ? -39.886 20.643  22.107  1.00 124.07 ? 153  VAL C N   1 
ATOM   10198 C CA  . VAL C  1 153 ? -40.764 21.821  22.302  1.00 123.83 ? 153  VAL C CA  1 
ATOM   10199 C C   . VAL C  1 153 ? -39.968 23.128  22.578  1.00 129.31 ? 153  VAL C C   1 
ATOM   10200 O O   . VAL C  1 153 ? -39.189 23.177  23.532  1.00 130.08 ? 153  VAL C O   1 
ATOM   10201 C CB  . VAL C  1 153 ? -41.873 21.581  23.363  1.00 126.15 ? 153  VAL C CB  1 
ATOM   10202 C CG1 . VAL C  1 153 ? -42.661 22.853  23.649  1.00 126.99 ? 153  VAL C CG1 1 
ATOM   10203 C CG2 . VAL C  1 153 ? -42.811 20.479  22.926  1.00 124.23 ? 153  VAL C CG2 1 
ATOM   10204 N N   . SER C  1 154 ? -40.200 24.190  21.768  1.00 125.93 ? 154  SER C N   1 
ATOM   10205 C CA  . SER C  1 154 ? -39.524 25.478  21.907  1.00 152.55 ? 154  SER C CA  1 
ATOM   10206 C C   . SER C  1 154 ? -40.518 26.659  22.080  1.00 158.01 ? 154  SER C C   1 
ATOM   10207 O O   . SER C  1 154 ? -40.684 27.537  21.224  1.00 106.64 ? 154  SER C O   1 
ATOM   10208 C CB  . SER C  1 154 ? -38.542 25.682  20.757  1.00 157.29 ? 154  SER C CB  1 
ATOM   10209 O OG  . SER C  1 154 ? -37.829 26.905  20.862  1.00 170.26 ? 154  SER C OG  1 
ATOM   10210 N N   . SER C  1 158 ? -43.402 28.475  27.242  1.00 109.69 ? 158  SER C N   1 
ATOM   10211 C CA  . SER C  1 158 ? -43.196 29.882  26.863  1.00 111.74 ? 158  SER C CA  1 
ATOM   10212 C C   . SER C  1 158 ? -42.764 30.795  28.030  1.00 116.95 ? 158  SER C C   1 
ATOM   10213 O O   . SER C  1 158 ? -42.508 30.319  29.140  1.00 116.04 ? 158  SER C O   1 
ATOM   10214 C CB  . SER C  1 158 ? -44.416 30.459  26.135  1.00 115.04 ? 158  SER C CB  1 
ATOM   10215 O OG  . SER C  1 158 ? -44.461 30.088  24.767  1.00 120.35 ? 158  SER C OG  1 
ATOM   10216 N N   . SER C  1 159 ? -42.682 32.108  27.741  1.00 115.72 ? 159  SER C N   1 
ATOM   10217 C CA  . SER C  1 159 ? -42.280 33.229  28.606  1.00 117.88 ? 159  SER C CA  1 
ATOM   10218 C C   . SER C  1 159 ? -42.778 33.260  30.090  1.00 122.28 ? 159  SER C C   1 
ATOM   10219 O O   . SER C  1 159 ? -42.117 32.693  30.975  1.00 121.04 ? 159  SER C O   1 
ATOM   10220 C CB  . SER C  1 159 ? -42.484 34.569  27.886  1.00 122.95 ? 159  SER C CB  1 
ATOM   10221 O OG  . SER C  1 159 ? -43.625 34.590  27.040  1.00 129.53 ? 159  SER C OG  1 
ATOM   10222 N N   . GLY C  1 160 ? -43.900 33.946  30.330  1.00 119.78 ? 160  GLY C N   1 
ATOM   10223 C CA  . GLY C  1 160 ? -44.518 34.126  31.637  1.00 120.02 ? 160  GLY C CA  1 
ATOM   10224 C C   . GLY C  1 160 ? -45.704 33.202  31.770  1.00 121.38 ? 160  GLY C C   1 
ATOM   10225 O O   . GLY C  1 160 ? -46.860 33.637  31.677  1.00 122.51 ? 160  GLY C O   1 
ATOM   10226 N N   . CYS C  1 161 ? -45.405 31.904  31.934  1.00 113.26 ? 161  CYS C N   1 
ATOM   10227 C CA  . CYS C  1 161 ? -46.411 30.862  32.036  1.00 110.43 ? 161  CYS C CA  1 
ATOM   10228 C C   . CYS C  1 161 ? -46.600 30.363  33.436  1.00 113.95 ? 161  CYS C C   1 
ATOM   10229 O O   . CYS C  1 161 ? -45.613 30.197  34.162  1.00 113.87 ? 161  CYS C O   1 
ATOM   10230 C CB  . CYS C  1 161 ? -46.106 29.710  31.086  1.00 107.99 ? 161  CYS C CB  1 
ATOM   10231 S SG  . CYS C  1 161 ? -46.373 30.105  29.345  1.00 111.36 ? 161  CYS C SG  1 
ATOM   10232 N N   . GLY C  1 162 ? -47.866 30.053  33.762  1.00 109.08 ? 162  GLY C N   1 
ATOM   10233 C CA  . GLY C  1 162 ? -48.288 29.520  35.051  1.00 107.63 ? 162  GLY C CA  1 
ATOM   10234 C C   . GLY C  1 162 ? -47.691 28.158  35.296  1.00 106.91 ? 162  GLY C C   1 
ATOM   10235 O O   . GLY C  1 162 ? -47.399 27.434  34.340  1.00 106.12 ? 162  GLY C O   1 
ATOM   10236 N N   . ARG C  1 163 ? -47.461 27.814  36.567  1.00 100.49 ? 163  ARG C N   1 
ATOM   10237 C CA  . ARG C  1 163 ? -46.902 26.508  36.890  1.00 97.35  ? 163  ARG C CA  1 
ATOM   10238 C C   . ARG C  1 163 ? -47.972 25.422  36.804  1.00 97.19  ? 163  ARG C C   1 
ATOM   10239 O O   . ARG C  1 163 ? -49.173 25.727  36.795  1.00 95.82  ? 163  ARG C O   1 
ATOM   10240 C CB  . ARG C  1 163 ? -46.206 26.524  38.262  1.00 97.82  ? 163  ARG C CB  1 
ATOM   10241 C CG  . ARG C  1 163 ? -44.758 27.041  38.246  1.00 112.54 ? 163  ARG C CG  1 
ATOM   10242 C CD  . ARG C  1 163 ? -43.718 25.941  38.466  1.00 131.30 ? 163  ARG C CD  1 
ATOM   10243 N NE  . ARG C  1 163 ? -42.538 26.403  39.210  1.00 149.87 ? 163  ARG C NE  1 
ATOM   10244 C CZ  . ARG C  1 163 ? -42.205 25.996  40.436  1.00 164.30 ? 163  ARG C CZ  1 
ATOM   10245 N NH1 . ARG C  1 163 ? -42.955 25.106  41.076  1.00 145.99 ? 163  ARG C NH1 1 
ATOM   10246 N NH2 . ARG C  1 163 ? -41.116 26.475  41.027  1.00 152.52 ? 163  ARG C NH2 1 
ATOM   10247 N N   . CYS C  1 164 ? -47.527 24.150  36.688  1.00 91.97  ? 164  CYS C N   1 
ATOM   10248 C CA  . CYS C  1 164 ? -48.418 22.981  36.653  1.00 90.00  ? 164  CYS C CA  1 
ATOM   10249 C C   . CYS C  1 164 ? -48.972 22.826  38.056  1.00 95.62  ? 164  CYS C C   1 
ATOM   10250 O O   . CYS C  1 164 ? -48.289 23.183  39.019  1.00 96.03  ? 164  CYS C O   1 
ATOM   10251 C CB  . CYS C  1 164 ? -47.663 21.716  36.229  1.00 87.74  ? 164  CYS C CB  1 
ATOM   10252 S SG  . CYS C  1 164 ? -47.579 21.428  34.433  1.00 89.86  ? 164  CYS C SG  1 
ATOM   10253 N N   . HIS C  1 165 ? -50.161 22.237  38.184  1.00 93.11  ? 165  HIS C N   1 
ATOM   10254 C CA  . HIS C  1 165 ? -50.756 21.934  39.477  1.00 95.05  ? 165  HIS C CA  1 
ATOM   10255 C C   . HIS C  1 165 ? -49.834 20.945  40.270  1.00 99.84  ? 165  HIS C C   1 
ATOM   10256 O O   . HIS C  1 165 ? -49.029 20.221  39.666  1.00 98.99  ? 165  HIS C O   1 
ATOM   10257 C CB  . HIS C  1 165 ? -52.136 21.334  39.247  1.00 96.33  ? 165  HIS C CB  1 
ATOM   10258 C CG  . HIS C  1 165 ? -52.953 21.201  40.484  1.00 101.87 ? 165  HIS C CG  1 
ATOM   10259 N ND1 . HIS C  1 165 ? -53.887 22.156  40.832  1.00 105.86 ? 165  HIS C ND1 1 
ATOM   10260 C CD2 . HIS C  1 165 ? -52.958 20.217  41.414  1.00 104.20 ? 165  HIS C CD2 1 
ATOM   10261 C CE1 . HIS C  1 165 ? -54.423 21.734  41.964  1.00 106.44 ? 165  HIS C CE1 1 
ATOM   10262 N NE2 . HIS C  1 165 ? -53.899 20.563  42.346  1.00 105.77 ? 165  HIS C NE2 1 
ATOM   10263 N N   . LYS C  1 166 ? -49.911 20.973  41.615  1.00 97.09  ? 166  LYS C N   1 
ATOM   10264 C CA  . LYS C  1 166 ? -49.112 20.124  42.499  1.00 96.20  ? 166  LYS C CA  1 
ATOM   10265 C C   . LYS C  1 166 ? -49.289 18.639  42.142  1.00 97.80  ? 166  LYS C C   1 
ATOM   10266 O O   . LYS C  1 166 ? -48.295 17.918  42.004  1.00 97.09  ? 166  LYS C O   1 
ATOM   10267 C CB  . LYS C  1 166 ? -49.468 20.382  43.978  1.00 100.37 ? 166  LYS C CB  1 
ATOM   10268 C CG  . LYS C  1 166 ? -48.514 19.714  44.980  1.00 119.51 ? 166  LYS C CG  1 
ATOM   10269 C CD  . LYS C  1 166 ? -49.190 19.314  46.299  1.00 133.35 ? 166  LYS C CD  1 
ATOM   10270 C CE  . LYS C  1 166 ? -48.220 18.668  47.271  1.00 145.26 ? 166  LYS C CE  1 
ATOM   10271 N NZ  . LYS C  1 166 ? -48.913 18.063  48.440  1.00 153.78 ? 166  LYS C NZ  1 
ATOM   10272 N N   . SER C  1 167 ? -50.541 18.201  41.952  1.00 92.83  ? 167  SER C N   1 
ATOM   10273 C CA  . SER C  1 167 ? -50.855 16.811  41.611  1.00 91.05  ? 167  SER C CA  1 
ATOM   10274 C C   . SER C  1 167 ? -50.270 16.325  40.262  1.00 90.07  ? 167  SER C C   1 
ATOM   10275 O O   . SER C  1 167 ? -50.033 15.127  40.089  1.00 88.50  ? 167  SER C O   1 
ATOM   10276 C CB  . SER C  1 167 ? -52.365 16.581  41.656  1.00 95.46  ? 167  SER C CB  1 
ATOM   10277 O OG  . SER C  1 167 ? -53.044 17.360  40.687  1.00 103.74 ? 167  SER C OG  1 
ATOM   10278 N N   . CYS C  1 168 ? -50.018 17.259  39.333  1.00 83.80  ? 168  CYS C N   1 
ATOM   10279 C CA  . CYS C  1 168 ? -49.515 16.979  37.995  1.00 81.17  ? 168  CYS C CA  1 
ATOM   10280 C C   . CYS C  1 168 ? -48.112 16.471  37.880  1.00 83.27  ? 168  CYS C C   1 
ATOM   10281 O O   . CYS C  1 168 ? -47.784 15.894  36.842  1.00 82.65  ? 168  CYS C O   1 
ATOM   10282 C CB  . CYS C  1 168 ? -49.768 18.149  37.054  1.00 81.81  ? 168  CYS C CB  1 
ATOM   10283 S SG  . CYS C  1 168 ? -51.522 18.439  36.690  1.00 85.69  ? 168  CYS C SG  1 
ATOM   10284 N N   . THR C  1 169 ? -47.275 16.675  38.920  1.00 78.85  ? 169  THR C N   1 
ATOM   10285 C CA  . THR C  1 169 ? -45.891 16.190  38.934  1.00 77.43  ? 169  THR C CA  1 
ATOM   10286 C C   . THR C  1 169 ? -45.053 16.872  37.826  1.00 79.53  ? 169  THR C C   1 
ATOM   10287 O O   . THR C  1 169 ? -44.183 16.262  37.196  1.00 79.65  ? 169  THR C O   1 
ATOM   10288 C CB  . THR C  1 169 ? -45.886 14.646  39.114  1.00 83.18  ? 169  THR C CB  1 
ATOM   10289 O OG1 . THR C  1 169 ? -46.409 14.385  40.408  1.00 82.07  ? 169  THR C OG1 1 
ATOM   10290 C CG2 . THR C  1 169 ? -44.519 13.991  38.953  1.00 81.96  ? 169  THR C CG2 1 
ATOM   10291 N N   . GLY C  1 170 ? -45.348 18.147  37.611  1.00 74.15  ? 170  GLY C N   1 
ATOM   10292 C CA  . GLY C  1 170 ? -44.629 18.999  36.673  1.00 73.65  ? 170  GLY C CA  1 
ATOM   10293 C C   . GLY C  1 170 ? -44.838 18.756  35.197  1.00 75.27  ? 170  GLY C C   1 
ATOM   10294 O O   . GLY C  1 170 ? -44.103 19.334  34.390  1.00 74.62  ? 170  GLY C O   1 
ATOM   10295 N N   . ARG C  1 171 ? -45.842 17.914  34.837  1.00 69.69  ? 171  ARG C N   1 
ATOM   10296 C CA  . ARG C  1 171 ? -46.211 17.583  33.462  1.00 68.17  ? 171  ARG C CA  1 
ATOM   10297 C C   . ARG C  1 171 ? -47.727 17.734  33.274  1.00 75.07  ? 171  ARG C C   1 
ATOM   10298 O O   . ARG C  1 171 ? -48.507 16.934  33.801  1.00 74.45  ? 171  ARG C O   1 
ATOM   10299 C CB  . ARG C  1 171 ? -45.772 16.156  33.098  1.00 64.24  ? 171  ARG C CB  1 
ATOM   10300 C CG  . ARG C  1 171 ? -44.293 15.917  33.209  1.00 67.73  ? 171  ARG C CG  1 
ATOM   10301 C CD  . ARG C  1 171 ? -43.852 14.743  32.373  1.00 67.85  ? 171  ARG C CD  1 
ATOM   10302 N NE  . ARG C  1 171 ? -42.443 14.405  32.621