data_3U8M
# 
_entry.id   3U8M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3U8M         
RCSB  RCSB068443   
WWPDB D_1000068443 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3U5J 
;Crystal structure of the acetylcholine binding protein (AChBP)from Lymnaea stagnalis in complex with NS3531 (1-(pyridin-3-yl)-1,4-diazepane)
;
unspecified 
PDB 3U5K 
;Crystal structure of the acetylcholine binding protein (AChBP) from Lymnaea stagnalis in complex with NS3573 (1-(5-ethoxypyridin-3-yl)-1,4-diazepane)
;
unspecified 
PDB 3U8L 
;Crystal structure of the acetylcholine binding protein (AChBP) from Lymnaea stagnalis in complex with NS3570 (1-(5-phenylpyridin-3-yl)-1,4-diazepane)
;
unspecified 
PDB 3U8N 
;Crystal structure of the acetylcholine binding protein (AChBP) from Lymnaea stagnalis in complex with NS3950 (1-(6-bromo-5-ethoxypyridin-3-yl)-1,4-diazepane)
;
unspecified 
PDB 1UW6 'X-RAY STRUCTURE OF ACETYLCHOLINE BINDING PROTEIN (ACHBP) IN COMPLEX WITH NICOTINE' unspecified 
PDB 1UV6 'X-RAY STRUCTURE OF ACETYLCHOLINE BINDING PROTEIN (ACHBP) IN COMPLEX WITH CARBAMYLCHOLINE' unspecified 
# 
_pdbx_database_status.entry_id                        3U8M 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-10-17 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rohde, L.A.H.'  1  
'Ahring, P.K.'   2  
'Jensen, M.L.'   3  
'Nielsen, E.O.'  4  
'Peters, D.'     5  
'Helgstrand, C.' 6  
'Krintel, C.'    7  
'Harpsoe, K.'    8  
'Gajhede, M.'    9  
'Kastrup, J.S.'  10 
'Balle, T.'      11 
# 
_citation.id                        primary 
_citation.title                     
;Intersubunit bridge formation governs agonist efficacy at nicotinic acetylcholine alpha 4 beta 2 receptors: unique role of halogen bonding revealed.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            287 
_citation.page_first                4248 
_citation.page_last                 4259 
_citation.year                      2012 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22170047 
_citation.pdbx_database_id_DOI      10.1074/jbc.M111.292243 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rohde, L.A.'    1  
primary 'Ahring, P.K.'   2  
primary 'Jensen, M.L.'   3  
primary 'Nielsen, E.'    4  
primary 'Peters, D.'     5  
primary 'Helgstrand, C.' 6  
primary 'Krintel, C.'    7  
primary 'Harpse, K.'     8  
primary 'Gajhede, M.'    9  
primary 'Kastrup, J.S.'  10 
primary 'Balle, T.'      11 
# 
_cell.entry_id           3U8M 
_cell.length_a           233.057 
_cell.length_b           268.453 
_cell.length_c           73.259 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              80 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3U8M 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Acetylcholine-binding protein'         23862.523 20  ? ? ? ? 
2 non-polymer syn '1-(6-bromopyridin-3-yl)-1,4-diazepane' 256.142   20  ? ? ? ? 
3 non-polymer syn 'SULFATE ION'                           96.063    17  ? ? ? ? 
4 water       nat water                                   18.015    328 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ACh-binding protein, AchBP' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISS
LWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSD
DSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISS
LWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSD
DSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LEU n 
1 2   ASP n 
1 3   ARG n 
1 4   ALA n 
1 5   ASP n 
1 6   ILE n 
1 7   LEU n 
1 8   TYR n 
1 9   ASN n 
1 10  ILE n 
1 11  ARG n 
1 12  GLN n 
1 13  THR n 
1 14  SER n 
1 15  ARG n 
1 16  PRO n 
1 17  ASP n 
1 18  VAL n 
1 19  ILE n 
1 20  PRO n 
1 21  THR n 
1 22  GLN n 
1 23  ARG n 
1 24  ASP n 
1 25  ARG n 
1 26  PRO n 
1 27  VAL n 
1 28  ALA n 
1 29  VAL n 
1 30  SER n 
1 31  VAL n 
1 32  SER n 
1 33  LEU n 
1 34  LYS n 
1 35  PHE n 
1 36  ILE n 
1 37  ASN n 
1 38  ILE n 
1 39  LEU n 
1 40  GLU n 
1 41  VAL n 
1 42  ASN n 
1 43  GLU n 
1 44  ILE n 
1 45  THR n 
1 46  ASN n 
1 47  GLU n 
1 48  VAL n 
1 49  ASP n 
1 50  VAL n 
1 51  VAL n 
1 52  PHE n 
1 53  TRP n 
1 54  GLN n 
1 55  GLN n 
1 56  THR n 
1 57  THR n 
1 58  TRP n 
1 59  SER n 
1 60  ASP n 
1 61  ARG n 
1 62  THR n 
1 63  LEU n 
1 64  ALA n 
1 65  TRP n 
1 66  ASN n 
1 67  SER n 
1 68  SER n 
1 69  HIS n 
1 70  SER n 
1 71  PRO n 
1 72  ASP n 
1 73  GLN n 
1 74  VAL n 
1 75  SER n 
1 76  VAL n 
1 77  PRO n 
1 78  ILE n 
1 79  SER n 
1 80  SER n 
1 81  LEU n 
1 82  TRP n 
1 83  VAL n 
1 84  PRO n 
1 85  ASP n 
1 86  LEU n 
1 87  ALA n 
1 88  ALA n 
1 89  TYR n 
1 90  ASN n 
1 91  ALA n 
1 92  ILE n 
1 93  SER n 
1 94  LYS n 
1 95  PRO n 
1 96  GLU n 
1 97  VAL n 
1 98  LEU n 
1 99  THR n 
1 100 PRO n 
1 101 GLN n 
1 102 LEU n 
1 103 ALA n 
1 104 ARG n 
1 105 VAL n 
1 106 VAL n 
1 107 SER n 
1 108 ASP n 
1 109 GLY n 
1 110 GLU n 
1 111 VAL n 
1 112 LEU n 
1 113 TYR n 
1 114 MET n 
1 115 PRO n 
1 116 SER n 
1 117 ILE n 
1 118 ARG n 
1 119 GLN n 
1 120 ARG n 
1 121 PHE n 
1 122 SER n 
1 123 CYS n 
1 124 ASP n 
1 125 VAL n 
1 126 SER n 
1 127 GLY n 
1 128 VAL n 
1 129 ASP n 
1 130 THR n 
1 131 GLU n 
1 132 SER n 
1 133 GLY n 
1 134 ALA n 
1 135 THR n 
1 136 CYS n 
1 137 ARG n 
1 138 ILE n 
1 139 LYS n 
1 140 ILE n 
1 141 GLY n 
1 142 SER n 
1 143 TRP n 
1 144 THR n 
1 145 HIS n 
1 146 HIS n 
1 147 SER n 
1 148 ARG n 
1 149 GLU n 
1 150 ILE n 
1 151 SER n 
1 152 VAL n 
1 153 ASP n 
1 154 PRO n 
1 155 THR n 
1 156 THR n 
1 157 GLU n 
1 158 ASN n 
1 159 SER n 
1 160 ASP n 
1 161 ASP n 
1 162 SER n 
1 163 GLU n 
1 164 TYR n 
1 165 PHE n 
1 166 SER n 
1 167 GLN n 
1 168 TYR n 
1 169 SER n 
1 170 ARG n 
1 171 PHE n 
1 172 GLU n 
1 173 ILE n 
1 174 LEU n 
1 175 ASP n 
1 176 VAL n 
1 177 THR n 
1 178 GLN n 
1 179 LYS n 
1 180 LYS n 
1 181 ASN n 
1 182 SER n 
1 183 VAL n 
1 184 THR n 
1 185 TYR n 
1 186 SER n 
1 187 CYS n 
1 188 CYS n 
1 189 PRO n 
1 190 GLU n 
1 191 ALA n 
1 192 TYR n 
1 193 GLU n 
1 194 ASP n 
1 195 VAL n 
1 196 GLU n 
1 197 VAL n 
1 198 SER n 
1 199 LEU n 
1 200 ASN n 
1 201 PHE n 
1 202 ARG n 
1 203 LYS n 
1 204 LYS n 
1 205 GLY n 
1 206 ARG n 
1 207 SER n 
1 208 GLU n 
1 209 ILE n 
1 210 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Great pond snail' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Lymnaea stagnalis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     6523 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Sf9 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          'pFastbac I' 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACHP_LYMST 
_struct_ref.pdbx_db_accession          P58154 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISS
LWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSD
DSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
;
_struct_ref.pdbx_align_begin           20 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3U8M A 1 ? 210 ? P58154 20 ? 229 ? 1 210 
2  1 3U8M B 1 ? 210 ? P58154 20 ? 229 ? 1 210 
3  1 3U8M C 1 ? 210 ? P58154 20 ? 229 ? 1 210 
4  1 3U8M D 1 ? 210 ? P58154 20 ? 229 ? 1 210 
5  1 3U8M E 1 ? 210 ? P58154 20 ? 229 ? 1 210 
6  1 3U8M F 1 ? 210 ? P58154 20 ? 229 ? 1 210 
7  1 3U8M G 1 ? 210 ? P58154 20 ? 229 ? 1 210 
8  1 3U8M H 1 ? 210 ? P58154 20 ? 229 ? 1 210 
9  1 3U8M I 1 ? 210 ? P58154 20 ? 229 ? 1 210 
10 1 3U8M J 1 ? 210 ? P58154 20 ? 229 ? 1 210 
11 1 3U8M K 1 ? 210 ? P58154 20 ? 229 ? 1 210 
12 1 3U8M L 1 ? 210 ? P58154 20 ? 229 ? 1 210 
13 1 3U8M M 1 ? 210 ? P58154 20 ? 229 ? 1 210 
14 1 3U8M N 1 ? 210 ? P58154 20 ? 229 ? 1 210 
15 1 3U8M O 1 ? 210 ? P58154 20 ? 229 ? 1 210 
16 1 3U8M P 1 ? 210 ? P58154 20 ? 229 ? 1 210 
17 1 3U8M Q 1 ? 210 ? P58154 20 ? 229 ? 1 210 
18 1 3U8M R 1 ? 210 ? P58154 20 ? 229 ? 1 210 
19 1 3U8M S 1 ? 210 ? P58154 20 ? 229 ? 1 210 
20 1 3U8M T 1 ? 210 ? P58154 20 ? 229 ? 1 210 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
09R non-polymer         . '1-(6-bromopyridin-3-yl)-1,4-diazepane' ? 'C10 H14 Br N3'  256.142 
ALA 'L-peptide linking' y ALANINE                                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                              ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                  ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'                           ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE                               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3U8M 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.40 
_exptl_crystal.density_percent_sol   48.77 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '50mM Tris, 1.9M Ammonium sulfate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2010-04-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.038 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-2' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-2 
_diffrn_source.pdbx_wavelength             1.038 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3U8M 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.01 
_reflns.d_resolution_high            2.700 
_reflns.number_obs                   120656 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.9 
_reflns.pdbx_Rmerge_I_obs            0.10900 
_reflns.pdbx_Rsym_value              0.10900 
_reflns.pdbx_netI_over_sigmaI        14.1000 
_reflns.B_iso_Wilson_estimate        29.2 
_reflns.pdbx_redundancy              5.300 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   98.0 
_reflns_shell.Rmerge_I_obs           0.38000 
_reflns_shell.pdbx_Rsym_value        0.38000 
_reflns_shell.meanI_over_sigI_obs    2.000 
_reflns_shell.pdbx_redundancy        5.40 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3U8M 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     120656 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.01 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    97.8 
_refine.ls_R_factor_obs                          0.220 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.219 
_refine.ls_R_factor_R_free                       0.275 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.010 
_refine.ls_number_reflns_R_free                  2501 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.500 
_refine.occupancy_max                            1.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               32.16 
_refine.aniso_B[1][1]                            -12.73980 
_refine.aniso_B[2][2]                            16.88610 
_refine.aniso_B[3][3]                            -4.14640 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -0.00000 
_refine.aniso_B[2][3]                            -0.00000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.34 
_refine.solvent_model_param_bsol                 20.67 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.95 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1UW6: PENTAMER, CHAIN A-E' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Restrained 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.370 
_refine.pdbx_overall_phase_error                 26.190 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        32059 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         365 
_refine_hist.number_atoms_solvent             328 
_refine_hist.number_atoms_total               32752 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        30.01 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.008  ? ? 33202 'X-RAY DIFFRACTION' ? 
f_angle_d          1.053  ? ? 45205 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.607 ? ? 12172 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.064  ? ? 5121  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 5804  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1  A 68  ?     ? POSITIONAL 1  1   'X-RAY DIFFRACTION' ? ? ? 
2  B 68  0.042 ? POSITIONAL 1  2   'X-RAY DIFFRACTION' ? ? ? 
3  C 68  0.053 ? POSITIONAL 1  3   'X-RAY DIFFRACTION' ? ? ? 
4  D 68  0.045 ? POSITIONAL 1  4   'X-RAY DIFFRACTION' ? ? ? 
5  E 68  0.047 ? POSITIONAL 1  5   'X-RAY DIFFRACTION' ? ? ? 
6  F 68  0.046 ? POSITIONAL 1  6   'X-RAY DIFFRACTION' ? ? ? 
7  G 68  0.039 ? POSITIONAL 1  7   'X-RAY DIFFRACTION' ? ? ? 
8  H 68  0.045 ? POSITIONAL 1  8   'X-RAY DIFFRACTION' ? ? ? 
9  I 68  0.045 ? POSITIONAL 1  9   'X-RAY DIFFRACTION' ? ? ? 
10 L 68  0.041 ? POSITIONAL 1  10  'X-RAY DIFFRACTION' ? ? ? 
11 K 68  0.050 ? POSITIONAL 1  11  'X-RAY DIFFRACTION' ? ? ? 
12 M 68  0.040 ? POSITIONAL 1  12  'X-RAY DIFFRACTION' ? ? ? 
13 N 68  0.045 ? POSITIONAL 1  13  'X-RAY DIFFRACTION' ? ? ? 
14 O 68  0.047 ? POSITIONAL 1  14  'X-RAY DIFFRACTION' ? ? ? 
15 P 68  0.044 ? POSITIONAL 1  15  'X-RAY DIFFRACTION' ? ? ? 
16 Q 68  0.050 ? POSITIONAL 1  16  'X-RAY DIFFRACTION' ? ? ? 
17 R 68  0.043 ? POSITIONAL 1  17  'X-RAY DIFFRACTION' ? ? ? 
18 S 68  0.050 ? POSITIONAL 1  18  'X-RAY DIFFRACTION' ? ? ? 
19 T 68  0.039 ? POSITIONAL 1  19  'X-RAY DIFFRACTION' ? ? ? 
1  A 16  ?     ? POSITIONAL 2  20  'X-RAY DIFFRACTION' ? ? ? 
2  B 16  0.048 ? POSITIONAL 2  21  'X-RAY DIFFRACTION' ? ? ? 
3  C 16  0.050 ? POSITIONAL 2  22  'X-RAY DIFFRACTION' ? ? ? 
4  D 16  0.041 ? POSITIONAL 2  23  'X-RAY DIFFRACTION' ? ? ? 
5  E 16  0.049 ? POSITIONAL 2  24  'X-RAY DIFFRACTION' ? ? ? 
6  F 16  0.042 ? POSITIONAL 2  25  'X-RAY DIFFRACTION' ? ? ? 
7  G 16  0.039 ? POSITIONAL 2  26  'X-RAY DIFFRACTION' ? ? ? 
8  H 16  0.038 ? POSITIONAL 2  27  'X-RAY DIFFRACTION' ? ? ? 
9  I 16  0.027 ? POSITIONAL 2  28  'X-RAY DIFFRACTION' ? ? ? 
10 K 16  0.053 ? POSITIONAL 2  29  'X-RAY DIFFRACTION' ? ? ? 
11 M 16  0.043 ? POSITIONAL 2  30  'X-RAY DIFFRACTION' ? ? ? 
12 N 16  0.028 ? POSITIONAL 2  31  'X-RAY DIFFRACTION' ? ? ? 
13 O 16  0.047 ? POSITIONAL 2  32  'X-RAY DIFFRACTION' ? ? ? 
14 P 16  0.051 ? POSITIONAL 2  33  'X-RAY DIFFRACTION' ? ? ? 
15 Q 16  0.050 ? POSITIONAL 2  34  'X-RAY DIFFRACTION' ? ? ? 
16 R 16  0.037 ? POSITIONAL 2  35  'X-RAY DIFFRACTION' ? ? ? 
17 S 16  0.043 ? POSITIONAL 2  36  'X-RAY DIFFRACTION' ? ? ? 
18 T 16  0.038 ? POSITIONAL 2  37  'X-RAY DIFFRACTION' ? ? ? 
1  A 9   ?     ? POSITIONAL 3  38  'X-RAY DIFFRACTION' ? ? ? 
2  B 9   0.055 ? POSITIONAL 3  39  'X-RAY DIFFRACTION' ? ? ? 
3  C 9   0.062 ? POSITIONAL 3  40  'X-RAY DIFFRACTION' ? ? ? 
4  D 9   0.057 ? POSITIONAL 3  41  'X-RAY DIFFRACTION' ? ? ? 
5  E 9   0.045 ? POSITIONAL 3  42  'X-RAY DIFFRACTION' ? ? ? 
6  F 9   0.028 ? POSITIONAL 3  43  'X-RAY DIFFRACTION' ? ? ? 
7  G 9   0.035 ? POSITIONAL 3  44  'X-RAY DIFFRACTION' ? ? ? 
8  H 9   0.057 ? POSITIONAL 3  45  'X-RAY DIFFRACTION' ? ? ? 
9  I 9   0.050 ? POSITIONAL 3  46  'X-RAY DIFFRACTION' ? ? ? 
10 L 9   0.037 ? POSITIONAL 3  47  'X-RAY DIFFRACTION' ? ? ? 
11 K 9   0.059 ? POSITIONAL 3  48  'X-RAY DIFFRACTION' ? ? ? 
12 M 9   0.045 ? POSITIONAL 3  49  'X-RAY DIFFRACTION' ? ? ? 
13 N 9   0.029 ? POSITIONAL 3  50  'X-RAY DIFFRACTION' ? ? ? 
14 O 9   0.041 ? POSITIONAL 3  51  'X-RAY DIFFRACTION' ? ? ? 
15 P 9   0.043 ? POSITIONAL 3  52  'X-RAY DIFFRACTION' ? ? ? 
16 Q 9   0.034 ? POSITIONAL 3  53  'X-RAY DIFFRACTION' ? ? ? 
17 R 9   0.061 ? POSITIONAL 3  54  'X-RAY DIFFRACTION' ? ? ? 
18 S 9   0.046 ? POSITIONAL 3  55  'X-RAY DIFFRACTION' ? ? ? 
19 T 9   0.055 ? POSITIONAL 3  56  'X-RAY DIFFRACTION' ? ? ? 
1  A 7   ?     ? POSITIONAL 4  57  'X-RAY DIFFRACTION' ? ? ? 
2  B 7   0.039 ? POSITIONAL 4  58  'X-RAY DIFFRACTION' ? ? ? 
3  C 7   0.052 ? POSITIONAL 4  59  'X-RAY DIFFRACTION' ? ? ? 
4  D 7   0.012 ? POSITIONAL 4  60  'X-RAY DIFFRACTION' ? ? ? 
5  E 7   0.052 ? POSITIONAL 4  61  'X-RAY DIFFRACTION' ? ? ? 
6  F 7   0.049 ? POSITIONAL 4  62  'X-RAY DIFFRACTION' ? ? ? 
7  G 7   0.028 ? POSITIONAL 4  63  'X-RAY DIFFRACTION' ? ? ? 
8  H 7   0.026 ? POSITIONAL 4  64  'X-RAY DIFFRACTION' ? ? ? 
9  I 7   0.037 ? POSITIONAL 4  65  'X-RAY DIFFRACTION' ? ? ? 
10 L 7   0.030 ? POSITIONAL 4  66  'X-RAY DIFFRACTION' ? ? ? 
11 K 7   0.042 ? POSITIONAL 4  67  'X-RAY DIFFRACTION' ? ? ? 
12 M 7   0.040 ? POSITIONAL 4  68  'X-RAY DIFFRACTION' ? ? ? 
13 N 7   0.029 ? POSITIONAL 4  69  'X-RAY DIFFRACTION' ? ? ? 
14 O 7   0.043 ? POSITIONAL 4  70  'X-RAY DIFFRACTION' ? ? ? 
15 P 7   0.038 ? POSITIONAL 4  71  'X-RAY DIFFRACTION' ? ? ? 
16 Q 7   0.034 ? POSITIONAL 4  72  'X-RAY DIFFRACTION' ? ? ? 
17 R 7   0.035 ? POSITIONAL 4  73  'X-RAY DIFFRACTION' ? ? ? 
18 S 7   0.055 ? POSITIONAL 4  74  'X-RAY DIFFRACTION' ? ? ? 
19 T 7   0.023 ? POSITIONAL 4  75  'X-RAY DIFFRACTION' ? ? ? 
1  A 30  ?     ? POSITIONAL 5  76  'X-RAY DIFFRACTION' ? ? ? 
2  B 30  0.042 ? POSITIONAL 5  77  'X-RAY DIFFRACTION' ? ? ? 
3  C 30  0.048 ? POSITIONAL 5  78  'X-RAY DIFFRACTION' ? ? ? 
4  D 30  0.042 ? POSITIONAL 5  79  'X-RAY DIFFRACTION' ? ? ? 
5  E 30  0.033 ? POSITIONAL 5  80  'X-RAY DIFFRACTION' ? ? ? 
6  F 30  0.040 ? POSITIONAL 5  81  'X-RAY DIFFRACTION' ? ? ? 
7  G 30  0.038 ? POSITIONAL 5  82  'X-RAY DIFFRACTION' ? ? ? 
8  H 30  0.047 ? POSITIONAL 5  83  'X-RAY DIFFRACTION' ? ? ? 
9  I 30  0.041 ? POSITIONAL 5  84  'X-RAY DIFFRACTION' ? ? ? 
10 L 30  0.040 ? POSITIONAL 5  85  'X-RAY DIFFRACTION' ? ? ? 
11 K 30  0.042 ? POSITIONAL 5  86  'X-RAY DIFFRACTION' ? ? ? 
12 M 30  0.039 ? POSITIONAL 5  87  'X-RAY DIFFRACTION' ? ? ? 
13 N 30  0.037 ? POSITIONAL 5  88  'X-RAY DIFFRACTION' ? ? ? 
14 O 30  0.039 ? POSITIONAL 5  89  'X-RAY DIFFRACTION' ? ? ? 
15 P 30  0.038 ? POSITIONAL 5  90  'X-RAY DIFFRACTION' ? ? ? 
16 Q 30  0.040 ? POSITIONAL 5  91  'X-RAY DIFFRACTION' ? ? ? 
17 R 30  0.036 ? POSITIONAL 5  92  'X-RAY DIFFRACTION' ? ? ? 
18 S 30  0.041 ? POSITIONAL 5  93  'X-RAY DIFFRACTION' ? ? ? 
19 T 30  0.052 ? POSITIONAL 5  94  'X-RAY DIFFRACTION' ? ? ? 
1  A 105 ?     ? POSITIONAL 6  95  'X-RAY DIFFRACTION' ? ? ? 
2  B 105 0.046 ? POSITIONAL 6  96  'X-RAY DIFFRACTION' ? ? ? 
3  C 105 0.049 ? POSITIONAL 6  97  'X-RAY DIFFRACTION' ? ? ? 
4  D 105 0.041 ? POSITIONAL 6  98  'X-RAY DIFFRACTION' ? ? ? 
5  E 105 0.044 ? POSITIONAL 6  99  'X-RAY DIFFRACTION' ? ? ? 
6  F 105 0.043 ? POSITIONAL 6  100 'X-RAY DIFFRACTION' ? ? ? 
7  G 105 0.050 ? POSITIONAL 6  101 'X-RAY DIFFRACTION' ? ? ? 
8  H 105 0.043 ? POSITIONAL 6  102 'X-RAY DIFFRACTION' ? ? ? 
9  I 105 0.046 ? POSITIONAL 6  103 'X-RAY DIFFRACTION' ? ? ? 
10 L 105 0.046 ? POSITIONAL 6  104 'X-RAY DIFFRACTION' ? ? ? 
11 K 105 0.044 ? POSITIONAL 6  105 'X-RAY DIFFRACTION' ? ? ? 
12 M 105 0.049 ? POSITIONAL 6  106 'X-RAY DIFFRACTION' ? ? ? 
13 N 105 0.043 ? POSITIONAL 6  107 'X-RAY DIFFRACTION' ? ? ? 
14 O 105 0.042 ? POSITIONAL 6  108 'X-RAY DIFFRACTION' ? ? ? 
15 P 105 0.045 ? POSITIONAL 6  109 'X-RAY DIFFRACTION' ? ? ? 
16 Q 105 0.043 ? POSITIONAL 6  110 'X-RAY DIFFRACTION' ? ? ? 
17 R 105 0.045 ? POSITIONAL 6  111 'X-RAY DIFFRACTION' ? ? ? 
18 S 105 0.048 ? POSITIONAL 6  112 'X-RAY DIFFRACTION' ? ? ? 
19 T 105 0.049 ? POSITIONAL 6  113 'X-RAY DIFFRACTION' ? ? ? 
1  A 621 ?     ? POSITIONAL 7  114 'X-RAY DIFFRACTION' ? ? ? 
2  B 621 0.047 ? POSITIONAL 7  115 'X-RAY DIFFRACTION' ? ? ? 
3  C 621 0.046 ? POSITIONAL 7  116 'X-RAY DIFFRACTION' ? ? ? 
4  D 621 0.047 ? POSITIONAL 7  117 'X-RAY DIFFRACTION' ? ? ? 
5  E 609 0.046 ? POSITIONAL 7  118 'X-RAY DIFFRACTION' ? ? ? 
6  F 621 0.044 ? POSITIONAL 7  119 'X-RAY DIFFRACTION' ? ? ? 
7  G 621 0.044 ? POSITIONAL 7  120 'X-RAY DIFFRACTION' ? ? ? 
8  H 621 0.048 ? POSITIONAL 7  121 'X-RAY DIFFRACTION' ? ? ? 
9  I 621 0.045 ? POSITIONAL 7  122 'X-RAY DIFFRACTION' ? ? ? 
10 L 621 0.047 ? POSITIONAL 7  123 'X-RAY DIFFRACTION' ? ? ? 
11 K 621 0.046 ? POSITIONAL 7  124 'X-RAY DIFFRACTION' ? ? ? 
12 M 621 0.045 ? POSITIONAL 7  125 'X-RAY DIFFRACTION' ? ? ? 
13 N 621 0.048 ? POSITIONAL 7  126 'X-RAY DIFFRACTION' ? ? ? 
14 O 621 0.046 ? POSITIONAL 7  127 'X-RAY DIFFRACTION' ? ? ? 
15 P 621 0.048 ? POSITIONAL 7  128 'X-RAY DIFFRACTION' ? ? ? 
16 Q 621 0.048 ? POSITIONAL 7  129 'X-RAY DIFFRACTION' ? ? ? 
17 R 621 0.050 ? POSITIONAL 7  130 'X-RAY DIFFRACTION' ? ? ? 
18 S 621 0.045 ? POSITIONAL 7  131 'X-RAY DIFFRACTION' ? ? ? 
19 T 621 0.048 ? POSITIONAL 7  132 'X-RAY DIFFRACTION' ? ? ? 
1  A 70  ?     ? POSITIONAL 8  133 'X-RAY DIFFRACTION' ? ? ? 
2  B 70  0.050 ? POSITIONAL 8  134 'X-RAY DIFFRACTION' ? ? ? 
3  C 70  0.053 ? POSITIONAL 8  135 'X-RAY DIFFRACTION' ? ? ? 
4  D 70  0.044 ? POSITIONAL 8  136 'X-RAY DIFFRACTION' ? ? ? 
5  E 70  0.047 ? POSITIONAL 8  137 'X-RAY DIFFRACTION' ? ? ? 
6  F 70  0.050 ? POSITIONAL 8  138 'X-RAY DIFFRACTION' ? ? ? 
7  G 70  0.044 ? POSITIONAL 8  139 'X-RAY DIFFRACTION' ? ? ? 
8  H 70  0.048 ? POSITIONAL 8  140 'X-RAY DIFFRACTION' ? ? ? 
9  I 70  0.046 ? POSITIONAL 8  141 'X-RAY DIFFRACTION' ? ? ? 
10 L 70  0.048 ? POSITIONAL 8  142 'X-RAY DIFFRACTION' ? ? ? 
11 K 70  0.049 ? POSITIONAL 8  143 'X-RAY DIFFRACTION' ? ? ? 
12 M 70  0.051 ? POSITIONAL 8  144 'X-RAY DIFFRACTION' ? ? ? 
13 N 70  0.048 ? POSITIONAL 8  145 'X-RAY DIFFRACTION' ? ? ? 
14 O 70  0.039 ? POSITIONAL 8  146 'X-RAY DIFFRACTION' ? ? ? 
15 P 70  0.039 ? POSITIONAL 8  147 'X-RAY DIFFRACTION' ? ? ? 
16 Q 70  0.054 ? POSITIONAL 8  148 'X-RAY DIFFRACTION' ? ? ? 
17 R 67  0.046 ? POSITIONAL 8  149 'X-RAY DIFFRACTION' ? ? ? 
18 S 70  0.046 ? POSITIONAL 8  150 'X-RAY DIFFRACTION' ? ? ? 
19 T 70  0.043 ? POSITIONAL 8  151 'X-RAY DIFFRACTION' ? ? ? 
1  A 22  ?     ? POSITIONAL 9  152 'X-RAY DIFFRACTION' ? ? ? 
2  B 22  0.038 ? POSITIONAL 9  153 'X-RAY DIFFRACTION' ? ? ? 
3  C 22  0.051 ? POSITIONAL 9  154 'X-RAY DIFFRACTION' ? ? ? 
4  D 22  0.037 ? POSITIONAL 9  155 'X-RAY DIFFRACTION' ? ? ? 
5  E 22  0.044 ? POSITIONAL 9  156 'X-RAY DIFFRACTION' ? ? ? 
6  F 22  0.043 ? POSITIONAL 9  157 'X-RAY DIFFRACTION' ? ? ? 
7  G 22  0.035 ? POSITIONAL 9  158 'X-RAY DIFFRACTION' ? ? ? 
8  H 22  0.039 ? POSITIONAL 9  159 'X-RAY DIFFRACTION' ? ? ? 
9  I 22  0.065 ? POSITIONAL 9  160 'X-RAY DIFFRACTION' ? ? ? 
10 L 22  0.035 ? POSITIONAL 9  161 'X-RAY DIFFRACTION' ? ? ? 
11 K 22  0.045 ? POSITIONAL 9  162 'X-RAY DIFFRACTION' ? ? ? 
12 M 22  0.039 ? POSITIONAL 9  163 'X-RAY DIFFRACTION' ? ? ? 
13 N 22  0.054 ? POSITIONAL 9  164 'X-RAY DIFFRACTION' ? ? ? 
14 O 22  0.053 ? POSITIONAL 9  165 'X-RAY DIFFRACTION' ? ? ? 
15 P 22  0.038 ? POSITIONAL 9  166 'X-RAY DIFFRACTION' ? ? ? 
16 Q 22  0.043 ? POSITIONAL 9  167 'X-RAY DIFFRACTION' ? ? ? 
17 R 22  0.038 ? POSITIONAL 9  168 'X-RAY DIFFRACTION' ? ? ? 
18 S 22  0.053 ? POSITIONAL 9  169 'X-RAY DIFFRACTION' ? ? ? 
19 T 22  0.039 ? POSITIONAL 9  170 'X-RAY DIFFRACTION' ? ? ? 
1  A 82  ?     ? POSITIONAL 10 171 'X-RAY DIFFRACTION' ? ? ? 
2  B 82  0.051 ? POSITIONAL 10 172 'X-RAY DIFFRACTION' ? ? ? 
3  C 82  0.042 ? POSITIONAL 10 173 'X-RAY DIFFRACTION' ? ? ? 
4  D 82  0.052 ? POSITIONAL 10 174 'X-RAY DIFFRACTION' ? ? ? 
5  E 82  0.041 ? POSITIONAL 10 175 'X-RAY DIFFRACTION' ? ? ? 
6  F 82  0.038 ? POSITIONAL 10 176 'X-RAY DIFFRACTION' ? ? ? 
7  G 82  0.054 ? POSITIONAL 10 177 'X-RAY DIFFRACTION' ? ? ? 
8  H 82  0.047 ? POSITIONAL 10 178 'X-RAY DIFFRACTION' ? ? ? 
9  I 82  0.043 ? POSITIONAL 10 179 'X-RAY DIFFRACTION' ? ? ? 
10 L 82  0.042 ? POSITIONAL 10 180 'X-RAY DIFFRACTION' ? ? ? 
11 K 82  0.048 ? POSITIONAL 10 181 'X-RAY DIFFRACTION' ? ? ? 
12 M 82  0.049 ? POSITIONAL 10 182 'X-RAY DIFFRACTION' ? ? ? 
13 N 82  0.049 ? POSITIONAL 10 183 'X-RAY DIFFRACTION' ? ? ? 
14 O 82  0.041 ? POSITIONAL 10 184 'X-RAY DIFFRACTION' ? ? ? 
15 P 82  0.043 ? POSITIONAL 10 185 'X-RAY DIFFRACTION' ? ? ? 
16 Q 82  0.043 ? POSITIONAL 10 186 'X-RAY DIFFRACTION' ? ? ? 
17 R 82  0.039 ? POSITIONAL 10 187 'X-RAY DIFFRACTION' ? ? ? 
18 S 82  0.051 ? POSITIONAL 10 188 'X-RAY DIFFRACTION' ? ? ? 
19 T 82  0.048 ? POSITIONAL 10 189 'X-RAY DIFFRACTION' ? ? ? 
1  A 45  ?     ? POSITIONAL 11 190 'X-RAY DIFFRACTION' ? ? ? 
2  B 45  0.044 ? POSITIONAL 11 191 'X-RAY DIFFRACTION' ? ? ? 
3  C 45  0.042 ? POSITIONAL 11 192 'X-RAY DIFFRACTION' ? ? ? 
4  D 40  0.050 ? POSITIONAL 11 193 'X-RAY DIFFRACTION' ? ? ? 
5  E 45  0.038 ? POSITIONAL 11 194 'X-RAY DIFFRACTION' ? ? ? 
6  F 45  0.050 ? POSITIONAL 11 195 'X-RAY DIFFRACTION' ? ? ? 
7  G 45  0.047 ? POSITIONAL 11 196 'X-RAY DIFFRACTION' ? ? ? 
8  H 45  0.034 ? POSITIONAL 11 197 'X-RAY DIFFRACTION' ? ? ? 
9  I 45  0.054 ? POSITIONAL 11 198 'X-RAY DIFFRACTION' ? ? ? 
10 L 45  0.036 ? POSITIONAL 11 199 'X-RAY DIFFRACTION' ? ? ? 
11 K 45  0.052 ? POSITIONAL 11 200 'X-RAY DIFFRACTION' ? ? ? 
12 M 45  0.042 ? POSITIONAL 11 201 'X-RAY DIFFRACTION' ? ? ? 
13 N 45  0.051 ? POSITIONAL 11 202 'X-RAY DIFFRACTION' ? ? ? 
14 O 45  0.048 ? POSITIONAL 11 203 'X-RAY DIFFRACTION' ? ? ? 
15 P 45  0.050 ? POSITIONAL 11 204 'X-RAY DIFFRACTION' ? ? ? 
16 Q 45  0.037 ? POSITIONAL 11 205 'X-RAY DIFFRACTION' ? ? ? 
17 R 45  0.045 ? POSITIONAL 11 206 'X-RAY DIFFRACTION' ? ? ? 
18 S 45  0.038 ? POSITIONAL 11 207 'X-RAY DIFFRACTION' ? ? ? 
19 T 45  0.055 ? POSITIONAL 11 208 'X-RAY DIFFRACTION' ? ? ? 
1  A 158 ?     ? POSITIONAL 12 209 'X-RAY DIFFRACTION' ? ? ? 
2  B 158 0.045 ? POSITIONAL 12 210 'X-RAY DIFFRACTION' ? ? ? 
3  C 158 0.044 ? POSITIONAL 12 211 'X-RAY DIFFRACTION' ? ? ? 
4  D 158 0.043 ? POSITIONAL 12 212 'X-RAY DIFFRACTION' ? ? ? 
5  E 150 0.046 ? POSITIONAL 12 213 'X-RAY DIFFRACTION' ? ? ? 
6  F 158 0.046 ? POSITIONAL 12 214 'X-RAY DIFFRACTION' ? ? ? 
7  G 158 0.041 ? POSITIONAL 12 215 'X-RAY DIFFRACTION' ? ? ? 
8  H 152 0.045 ? POSITIONAL 12 216 'X-RAY DIFFRACTION' ? ? ? 
9  I 158 0.045 ? POSITIONAL 12 217 'X-RAY DIFFRACTION' ? ? ? 
10 L 158 0.051 ? POSITIONAL 12 218 'X-RAY DIFFRACTION' ? ? ? 
11 K 158 0.046 ? POSITIONAL 12 219 'X-RAY DIFFRACTION' ? ? ? 
12 M 152 0.048 ? POSITIONAL 12 220 'X-RAY DIFFRACTION' ? ? ? 
13 N 158 0.049 ? POSITIONAL 12 221 'X-RAY DIFFRACTION' ? ? ? 
14 O 152 0.046 ? POSITIONAL 12 222 'X-RAY DIFFRACTION' ? ? ? 
15 P 158 0.044 ? POSITIONAL 12 223 'X-RAY DIFFRACTION' ? ? ? 
16 Q 158 0.113 ? POSITIONAL 12 224 'X-RAY DIFFRACTION' ? ? ? 
17 R 158 0.050 ? POSITIONAL 12 225 'X-RAY DIFFRACTION' ? ? ? 
18 S 158 0.048 ? POSITIONAL 12 226 'X-RAY DIFFRACTION' ? ? ? 
19 T 158 0.045 ? POSITIONAL 12 227 'X-RAY DIFFRACTION' ? ? ? 
1  A 37  ?     ? POSITIONAL 13 228 'X-RAY DIFFRACTION' ? ? ? 
2  B 37  0.044 ? POSITIONAL 13 229 'X-RAY DIFFRACTION' ? ? ? 
3  C 37  0.046 ? POSITIONAL 13 230 'X-RAY DIFFRACTION' ? ? ? 
4  E 37  0.057 ? POSITIONAL 13 231 'X-RAY DIFFRACTION' ? ? ? 
5  F 37  0.038 ? POSITIONAL 13 232 'X-RAY DIFFRACTION' ? ? ? 
6  G 37  0.041 ? POSITIONAL 13 233 'X-RAY DIFFRACTION' ? ? ? 
7  H 37  0.054 ? POSITIONAL 13 234 'X-RAY DIFFRACTION' ? ? ? 
8  I 37  0.036 ? POSITIONAL 13 235 'X-RAY DIFFRACTION' ? ? ? 
9  L 37  0.037 ? POSITIONAL 13 236 'X-RAY DIFFRACTION' ? ? ? 
10 K 37  0.056 ? POSITIONAL 13 237 'X-RAY DIFFRACTION' ? ? ? 
11 M 37  0.047 ? POSITIONAL 13 238 'X-RAY DIFFRACTION' ? ? ? 
12 N 37  0.039 ? POSITIONAL 13 239 'X-RAY DIFFRACTION' ? ? ? 
13 O 37  0.044 ? POSITIONAL 13 240 'X-RAY DIFFRACTION' ? ? ? 
14 P 37  0.041 ? POSITIONAL 13 241 'X-RAY DIFFRACTION' ? ? ? 
15 Q 37  0.050 ? POSITIONAL 13 242 'X-RAY DIFFRACTION' ? ? ? 
16 R 37  0.044 ? POSITIONAL 13 243 'X-RAY DIFFRACTION' ? ? ? 
17 S 37  0.057 ? POSITIONAL 13 244 'X-RAY DIFFRACTION' ? ? ? 
18 T 37  0.058 ? POSITIONAL 13 245 'X-RAY DIFFRACTION' ? ? ? 
1  A 18  ?     ? POSITIONAL 14 246 'X-RAY DIFFRACTION' ? ? ? 
2  B 18  0.033 ? POSITIONAL 14 247 'X-RAY DIFFRACTION' ? ? ? 
3  C 18  0.041 ? POSITIONAL 14 248 'X-RAY DIFFRACTION' ? ? ? 
4  D 18  0.035 ? POSITIONAL 14 249 'X-RAY DIFFRACTION' ? ? ? 
5  E 18  0.031 ? POSITIONAL 14 250 'X-RAY DIFFRACTION' ? ? ? 
6  F 18  0.024 ? POSITIONAL 14 251 'X-RAY DIFFRACTION' ? ? ? 
7  G 18  0.027 ? POSITIONAL 14 252 'X-RAY DIFFRACTION' ? ? ? 
8  H 18  0.029 ? POSITIONAL 14 253 'X-RAY DIFFRACTION' ? ? ? 
9  I 18  0.031 ? POSITIONAL 14 254 'X-RAY DIFFRACTION' ? ? ? 
10 L 18  0.035 ? POSITIONAL 14 255 'X-RAY DIFFRACTION' ? ? ? 
11 K 18  0.032 ? POSITIONAL 14 256 'X-RAY DIFFRACTION' ? ? ? 
12 M 18  0.032 ? POSITIONAL 14 257 'X-RAY DIFFRACTION' ? ? ? 
13 N 18  0.039 ? POSITIONAL 14 258 'X-RAY DIFFRACTION' ? ? ? 
14 O 18  0.033 ? POSITIONAL 14 259 'X-RAY DIFFRACTION' ? ? ? 
15 P 18  0.035 ? POSITIONAL 14 260 'X-RAY DIFFRACTION' ? ? ? 
16 Q 18  0.029 ? POSITIONAL 14 261 'X-RAY DIFFRACTION' ? ? ? 
17 R 18  0.037 ? POSITIONAL 14 262 'X-RAY DIFFRACTION' ? ? ? 
18 S 18  0.037 ? POSITIONAL 14 263 'X-RAY DIFFRACTION' ? ? ? 
19 T 18  0.020 ? POSITIONAL 14 264 'X-RAY DIFFRACTION' ? ? ? 
1  A 123 ?     ? POSITIONAL 15 265 'X-RAY DIFFRACTION' ? ? ? 
2  B 123 0.048 ? POSITIONAL 15 266 'X-RAY DIFFRACTION' ? ? ? 
3  C 123 0.057 ? POSITIONAL 15 267 'X-RAY DIFFRACTION' ? ? ? 
4  D 123 0.057 ? POSITIONAL 15 268 'X-RAY DIFFRACTION' ? ? ? 
5  E 123 0.044 ? POSITIONAL 15 269 'X-RAY DIFFRACTION' ? ? ? 
6  F 123 0.047 ? POSITIONAL 15 270 'X-RAY DIFFRACTION' ? ? ? 
7  G 123 0.050 ? POSITIONAL 15 271 'X-RAY DIFFRACTION' ? ? ? 
8  H 123 0.050 ? POSITIONAL 15 272 'X-RAY DIFFRACTION' ? ? ? 
9  I 123 0.048 ? POSITIONAL 15 273 'X-RAY DIFFRACTION' ? ? ? 
10 L 123 0.041 ? POSITIONAL 15 274 'X-RAY DIFFRACTION' ? ? ? 
11 K 123 0.049 ? POSITIONAL 15 275 'X-RAY DIFFRACTION' ? ? ? 
12 M 123 0.049 ? POSITIONAL 15 276 'X-RAY DIFFRACTION' ? ? ? 
13 N 123 0.051 ? POSITIONAL 15 277 'X-RAY DIFFRACTION' ? ? ? 
14 O 123 0.050 ? POSITIONAL 15 278 'X-RAY DIFFRACTION' ? ? ? 
15 P 123 0.049 ? POSITIONAL 15 279 'X-RAY DIFFRACTION' ? ? ? 
16 Q 123 0.045 ? POSITIONAL 15 280 'X-RAY DIFFRACTION' ? ? ? 
17 R 123 0.046 ? POSITIONAL 15 281 'X-RAY DIFFRACTION' ? ? ? 
18 S 123 0.048 ? POSITIONAL 15 282 'X-RAY DIFFRACTION' ? ? ? 
19 T 123 0.050 ? POSITIONAL 15 283 'X-RAY DIFFRACTION' ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.7000 2.7519  6732 0.2386 99.00  0.3003 . . 146 . . . . 
'X-RAY DIFFRACTION' . 2.7519 2.8080  6679 0.2516 97.00  0.3291 . . 157 . . . . 
'X-RAY DIFFRACTION' . 2.8080 2.8690  6719 0.2631 99.00  0.3955 . . 134 . . . . 
'X-RAY DIFFRACTION' . 2.8690 2.9357  6653 0.2548 97.00  0.3403 . . 163 . . . . 
'X-RAY DIFFRACTION' . 2.9357 3.0091  6731 0.2347 100.00 0.2975 . . 164 . . . . 
'X-RAY DIFFRACTION' . 3.0091 3.0904  6725 0.2134 98.00  0.2609 . . 130 . . . . 
'X-RAY DIFFRACTION' . 3.0904 3.1812  6713 0.2030 98.00  0.2764 . . 150 . . . . 
'X-RAY DIFFRACTION' . 3.1812 3.2838  6836 0.2150 100.00 0.2987 . . 116 . . . . 
'X-RAY DIFFRACTION' . 3.2838 3.4010  6754 0.2243 98.00  0.3342 . . 126 . . . . 
'X-RAY DIFFRACTION' . 3.4010 3.5369  6739 0.2312 98.00  0.3077 . . 145 . . . . 
'X-RAY DIFFRACTION' . 3.5369 3.6976  6440 0.3797 93.00  0.4462 . . 125 . . . . 
'X-RAY DIFFRACTION' . 3.6976 3.8922  6370 0.2696 92.00  0.3472 . . 126 . . . . 
'X-RAY DIFFRACTION' . 3.8922 4.1355  6849 0.2038 99.00  0.2253 . . 127 . . . . 
'X-RAY DIFFRACTION' . 4.1355 4.4538  6870 0.1584 99.00  0.2093 . . 124 . . . . 
'X-RAY DIFFRACTION' . 4.4538 4.9003  6882 0.1440 99.00  0.1835 . . 146 . . . . 
'X-RAY DIFFRACTION' . 4.9003 5.6054  6950 0.1617 99.00  0.1721 . . 140 . . . . 
'X-RAY DIFFRACTION' . 5.6054 7.0470  6986 0.2038 99.00  0.2471 . . 131 . . . . 
'X-RAY DIFFRACTION' . 7.0470 30.0084 7176 0.2018 98.00  0.2195 . . 151 . . . . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1  ? 1  
2  ? 1  
3  ? 1  
4  ? 1  
5  ? 1  
6  ? 1  
7  ? 1  
8  ? 1  
9  ? 1  
10 ? 1  
11 ? 1  
12 ? 1  
13 ? 1  
14 ? 1  
15 ? 1  
16 ? 1  
17 ? 1  
18 ? 1  
19 ? 1  
1  ? 2  
2  ? 2  
3  ? 2  
4  ? 2  
5  ? 2  
6  ? 2  
7  ? 2  
8  ? 2  
9  ? 2  
10 ? 2  
11 ? 2  
12 ? 2  
13 ? 2  
14 ? 2  
15 ? 2  
16 ? 2  
17 ? 2  
18 ? 2  
1  ? 3  
2  ? 3  
3  ? 3  
4  ? 3  
5  ? 3  
6  ? 3  
7  ? 3  
8  ? 3  
9  ? 3  
10 ? 3  
11 ? 3  
12 ? 3  
13 ? 3  
14 ? 3  
15 ? 3  
16 ? 3  
17 ? 3  
18 ? 3  
19 ? 3  
1  ? 4  
2  ? 4  
3  ? 4  
4  ? 4  
5  ? 4  
6  ? 4  
7  ? 4  
8  ? 4  
9  ? 4  
10 ? 4  
11 ? 4  
12 ? 4  
13 ? 4  
14 ? 4  
15 ? 4  
16 ? 4  
17 ? 4  
18 ? 4  
19 ? 4  
1  ? 5  
2  ? 5  
3  ? 5  
4  ? 5  
5  ? 5  
6  ? 5  
7  ? 5  
8  ? 5  
9  ? 5  
10 ? 5  
11 ? 5  
12 ? 5  
13 ? 5  
14 ? 5  
15 ? 5  
16 ? 5  
17 ? 5  
18 ? 5  
19 ? 5  
1  ? 6  
2  ? 6  
3  ? 6  
4  ? 6  
5  ? 6  
6  ? 6  
7  ? 6  
8  ? 6  
9  ? 6  
10 ? 6  
11 ? 6  
12 ? 6  
13 ? 6  
14 ? 6  
15 ? 6  
16 ? 6  
17 ? 6  
18 ? 6  
19 ? 6  
1  ? 7  
2  ? 7  
3  ? 7  
4  ? 7  
5  ? 7  
6  ? 7  
7  ? 7  
8  ? 7  
9  ? 7  
10 ? 7  
11 ? 7  
12 ? 7  
13 ? 7  
14 ? 7  
15 ? 7  
16 ? 7  
17 ? 7  
18 ? 7  
19 ? 7  
1  ? 8  
2  ? 8  
3  ? 8  
4  ? 8  
5  ? 8  
6  ? 8  
7  ? 8  
8  ? 8  
9  ? 8  
10 ? 8  
11 ? 8  
12 ? 8  
13 ? 8  
14 ? 8  
15 ? 8  
16 ? 8  
17 ? 8  
18 ? 8  
19 ? 8  
1  ? 9  
2  ? 9  
3  ? 9  
4  ? 9  
5  ? 9  
6  ? 9  
7  ? 9  
8  ? 9  
9  ? 9  
10 ? 9  
11 ? 9  
12 ? 9  
13 ? 9  
14 ? 9  
15 ? 9  
16 ? 9  
17 ? 9  
18 ? 9  
19 ? 9  
1  ? 10 
2  ? 10 
3  ? 10 
4  ? 10 
5  ? 10 
6  ? 10 
7  ? 10 
8  ? 10 
9  ? 10 
10 ? 10 
11 ? 10 
12 ? 10 
13 ? 10 
14 ? 10 
15 ? 10 
16 ? 10 
17 ? 10 
18 ? 10 
19 ? 10 
1  ? 11 
2  ? 11 
3  ? 11 
4  ? 11 
5  ? 11 
6  ? 11 
7  ? 11 
8  ? 11 
9  ? 11 
10 ? 11 
11 ? 11 
12 ? 11 
13 ? 11 
14 ? 11 
15 ? 11 
16 ? 11 
17 ? 11 
18 ? 11 
19 ? 11 
1  ? 12 
2  ? 12 
3  ? 12 
4  ? 12 
5  ? 12 
6  ? 12 
7  ? 12 
8  ? 12 
9  ? 12 
10 ? 12 
11 ? 12 
12 ? 12 
13 ? 12 
14 ? 12 
15 ? 12 
16 ? 12 
17 ? 12 
18 ? 12 
19 ? 12 
1  ? 13 
2  ? 13 
3  ? 13 
4  ? 13 
5  ? 13 
6  ? 13 
7  ? 13 
8  ? 13 
9  ? 13 
10 ? 13 
11 ? 13 
12 ? 13 
13 ? 13 
14 ? 13 
15 ? 13 
16 ? 13 
17 ? 13 
18 ? 13 
1  ? 14 
2  ? 14 
3  ? 14 
4  ? 14 
5  ? 14 
6  ? 14 
7  ? 14 
8  ? 14 
9  ? 14 
10 ? 14 
11 ? 14 
12 ? 14 
13 ? 14 
14 ? 14 
15 ? 14 
16 ? 14 
17 ? 14 
18 ? 14 
19 ? 14 
1  ? 15 
2  ? 15 
3  ? 15 
4  ? 15 
5  ? 15 
6  ? 15 
7  ? 15 
8  ? 15 
9  ? 15 
10 ? 15 
11 ? 15 
12 ? 15 
13 ? 15 
14 ? 15 
15 ? 15 
16 ? 15 
17 ? 15 
18 ? 15 
19 ? 15 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain A and resid 1:8'     
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain B and resid 1:8'     
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain C and resid 1:8'     
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain D and resid 1:8'     
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain E and resid 1:8'     
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain F and resid 1:8'     
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain G and resid 1:8'     
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain H and resid 1:8'     
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain I and resid 1:8'     
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain L and resid 1:8'     
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain K and resid 1:8'     
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain M and resid 1:8'     
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain N and resid 1:8'     
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain O and resid 1:8'     
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain P and resid 1:8'     
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain Q and resid 1:8'     
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain R and resid 1:8'     
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain S and resid 1:8'     
19 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'chain T and resid 1:8'     
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain A and resid 9:10'    
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain B and resid 9:10'    
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain C and resid 9:10'    
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain D and resid 9:10'    
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain E and resid 9:10'    
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain F and resid 9:10'    
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain G and resid 9:10'    
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain H and resid 9:10'    
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain I and resid 9:10'    
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain K and resid 9:10'    
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain M and resid 9:10'    
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain N and resid 9:10'    
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain O and resid 9:10'    
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain P and resid 9:10'    
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain Q and resid 9:10'    
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain R and resid 9:10'    
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain S and resid 9:10'    
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'chain T and resid 9:10'    
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain A and resid 12'      
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain B and resid 12'      
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain C and resid 12'      
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain D and resid 12'      
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain E and resid 12'      
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain F and resid 12'      
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain G and resid 12'      
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain H and resid 12'      
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain I and resid 12'      
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain L and resid 12'      
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain K and resid 12'      
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain M and resid 12'      
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain N and resid 12'      
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain O and resid 12'      
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain P and resid 12'      
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain Q and resid 12'      
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain R and resid 12'      
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain S and resid 12'      
19 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'chain T and resid 12'      
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain A and resid 16'      
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain B and resid 16'      
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain C and resid 16'      
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain D and resid 16'      
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain E and resid 16'      
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain F and resid 16'      
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain G and resid 16'      
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain H and resid 16'      
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain I and resid 16'      
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain L and resid 16'      
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain K and resid 16'      
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain M and resid 16'      
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain N and resid 16'      
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain O and resid 16'      
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain P and resid 16'      
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain Q and resid 16'      
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain R and resid 16'      
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain S and resid 16'      
19 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'chain T and resid 16'      
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain A and resid 17:20'   
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain B and resid 17:20'   
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain C and resid 17:20'   
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain D and resid 17:20'   
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain E and resid 17:20'   
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain F and resid 17:20'   
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain G and resid 17:20'   
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain H and resid 17:20'   
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain I and resid 17:20'   
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain L and resid 17:20'   
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain K and resid 17:20'   
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain M and resid 17:20'   
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain N and resid 17:20'   
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain O and resid 17:20'   
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain P and resid 17:20'   
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain Q and resid 17:20'   
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain R and resid 17:20'   
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain S and resid 17:20'   
19 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'chain T and resid 17:20'   
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain A and resid 26:39'   
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain B and resid 26:39'   
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain C and resid 26:39'   
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain D and resid 26:39'   
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain E and resid 26:39'   
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain F and resid 26:39'   
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain G and resid 26:39'   
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain H and resid 26:39'   
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain I and resid 26:39'   
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain L and resid 26:39'   
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain K and resid 26:39'   
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain M and resid 26:39'   
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain N and resid 26:39'   
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain O and resid 26:39'   
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain P and resid 26:39'   
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain Q and resid 26:39'   
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain R and resid 26:39'   
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain S and resid 26:39'   
19 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'chain T and resid 26:39'   
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain A and resid 41:119'  
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain B and resid 41:119'  
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain C and resid 41:119'  
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain D and resid 41:119'  
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain E and resid 41:119'  
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain F and resid 41:119'  
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain G and resid 41:119'  
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain H and resid 41:119'  
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain I and resid 41:119'  
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain L and resid 41:119'  
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain K and resid 41:119'  
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain M and resid 41:119'  
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain N and resid 41:119'  
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain O and resid 41:119'  
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain P and resid 41:119'  
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain Q and resid 41:119'  
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain R and resid 41:119'  
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain S and resid 41:119'  
19 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'chain T and resid 41:119'  
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain A and resid 121:130' 
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain B and resid 121:130' 
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain C and resid 121:130' 
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain D and resid 121:130' 
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain E and resid 121:130' 
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain F and resid 121:130' 
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain G and resid 121:130' 
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain H and resid 121:130' 
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain I and resid 121:130' 
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain L and resid 121:130' 
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain K and resid 121:130' 
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain M and resid 121:130' 
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain N and resid 121:130' 
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain O and resid 121:130' 
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain P and resid 121:130' 
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain Q and resid 121:130' 
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain R and resid 121:130' 
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain S and resid 121:130' 
19 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'chain T and resid 121:130' 
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain A and resid 133:136' 
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain B and resid 133:136' 
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain C and resid 133:136' 
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain D and resid 133:136' 
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain E and resid 133:136' 
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain F and resid 133:136' 
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain G and resid 133:136' 
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain H and resid 133:136' 
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain I and resid 133:136' 
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain L and resid 133:136' 
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain K and resid 133:136' 
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain M and resid 133:136' 
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain N and resid 133:136' 
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain O and resid 133:136' 
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain P and resid 133:136' 
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain Q and resid 133:136' 
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain R and resid 133:136' 
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain S and resid 133:136' 
19 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'chain T and resid 133:136' 
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain A and resid 138:147' 
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain B and resid 138:147' 
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain C and resid 138:147' 
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain D and resid 138:147' 
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain E and resid 138:147' 
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain F and resid 138:147' 
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain G and resid 138:147' 
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain H and resid 138:147' 
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain I and resid 138:147' 
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain L and resid 138:147' 
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain K and resid 138:147' 
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain M and resid 138:147' 
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain N and resid 138:147' 
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain O and resid 138:147' 
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain P and resid 138:147' 
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain Q and resid 138:147' 
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain R and resid 138:147' 
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain S and resid 138:147' 
19 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'chain T and resid 138:147' 
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain A and resid 149:154' 
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain B and resid 149:154' 
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain C and resid 149:154' 
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain D and resid 149:154' 
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain E and resid 149:154' 
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain F and resid 149:154' 
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain G and resid 149:154' 
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain H and resid 149:154' 
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain I and resid 149:154' 
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain L and resid 149:154' 
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain K and resid 149:154' 
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain M and resid 149:154' 
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain N and resid 149:154' 
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain O and resid 149:154' 
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain P and resid 149:154' 
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain Q and resid 149:154' 
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain R and resid 149:154' 
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain S and resid 149:154' 
19 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'chain T and resid 149:154' 
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain A and resid 162:179' 
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain B and resid 162:179' 
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain C and resid 162:179' 
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain D and resid 162:179' 
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain E and resid 162:179' 
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain F and resid 162:179' 
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain G and resid 162:179' 
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain H and resid 162:179' 
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain I and resid 162:179' 
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain L and resid 162:179' 
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain K and resid 162:179' 
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain M and resid 162:179' 
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain N and resid 162:179' 
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain O and resid 162:179' 
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain P and resid 162:179' 
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain Q and resid 162:179' 
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain R and resid 162:179' 
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain S and resid 162:179' 
19 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'chain T and resid 162:179' 
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain A and resid 180:184' 
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain B and resid 180:184' 
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain C and resid 180:184' 
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain E and resid 180:184' 
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain F and resid 180:184' 
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain G and resid 180:184' 
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain H and resid 180:184' 
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain I and resid 180:184' 
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain L and resid 180:184' 
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain K and resid 180:184' 
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain M and resid 180:184' 
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain N and resid 180:184' 
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain O and resid 180:184' 
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain P and resid 180:184' 
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain Q and resid 180:184' 
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain R and resid 180:184' 
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain S and resid 180:184' 
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'chain T and resid 180:184' 
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain A and resid 185:186' 
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain B and resid 185:186' 
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain C and resid 185:186' 
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain D and resid 185:186' 
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain E and resid 185:186' 
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain F and resid 185:186' 
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain G and resid 185:186' 
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain H and resid 185:186' 
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain I and resid 185:186' 
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain L and resid 185:186' 
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain K and resid 185:186' 
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain M and resid 185:186' 
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain N and resid 185:186' 
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain O and resid 185:186' 
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain P and resid 185:186' 
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain Q and resid 185:186' 
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain R and resid 185:186' 
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain S and resid 185:186' 
19 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'chain T and resid 185:186' 
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain A and resid 188:202' 
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain B and resid 188:202' 
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain C and resid 188:202' 
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain D and resid 188:202' 
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain E and resid 188:202' 
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain F and resid 188:202' 
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain G and resid 188:202' 
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain H and resid 188:202' 
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain I and resid 188:202' 
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain L and resid 188:202' 
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain K and resid 188:202' 
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain M and resid 188:202' 
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain N and resid 188:202' 
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain O and resid 188:202' 
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain P and resid 188:202' 
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain Q and resid 188:202' 
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain R and resid 188:202' 
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain S and resid 188:202' 
19 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'chain T and resid 188:202' 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1  ? 
2  ? 
3  ? 
4  ? 
5  ? 
6  ? 
7  ? 
8  ? 
9  ? 
10 ? 
11 ? 
12 ? 
13 ? 
14 ? 
15 ? 
# 
_struct.entry_id                  3U8M 
_struct.title                     
;Crystal structure of the acetylcholine binding protein (AChBP) from Lymnaea stagnalis in complex with NS3920 (1-(6-bromopyridin-3-yl)-1,4-diazepane)
;
_struct.pdbx_descriptor           'Acetylcholine-binding protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3U8M 
_struct_keywords.pdbx_keywords   'Acetylcholine-binding protein/agonist' 
_struct_keywords.text            
;Lymnaea stagnalis, agonist, Ligand-bindig domain, Acetylcholine, Acetylcholine-binding protein, Acetylcholine-binding protein-agonist complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 2 ? 
V  N N 3 ? 
W  N N 2 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 2 ? 
FA N N 2 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 3 ? 
LA N N 2 ? 
MA N N 3 ? 
NA N N 2 ? 
OA N N 3 ? 
PA N N 2 ? 
QA N N 3 ? 
RA N N 2 ? 
SA N N 3 ? 
TA N N 3 ? 
UA N N 2 ? 
VA N N 2 ? 
WA N N 3 ? 
XA N N 2 ? 
YA N N 2 ? 
ZA N N 2 ? 
AB N N 2 ? 
BB N N 3 ? 
CB N N 2 ? 
DB N N 2 ? 
EB N N 3 ? 
FB N N 4 ? 
GB N N 4 ? 
HB N N 4 ? 
IB N N 4 ? 
JB N N 4 ? 
KB N N 4 ? 
LB N N 4 ? 
MB N N 4 ? 
NB N N 4 ? 
OB N N 4 ? 
PB N N 4 ? 
QB N N 4 ? 
RB N N 4 ? 
SB N N 4 ? 
TB N N 4 ? 
UB N N 4 ? 
VB N N 4 ? 
WB N N 4 ? 
XB N N 4 ? 
YB N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 2   ? SER A 14  ? ASP A 2   SER A 14  1 ? 13 
HELX_P HELX_P2  2  ARG A 61  ? ALA A 64  ? ARG A 61  ALA A 64  5 ? 4  
HELX_P HELX_P3  3  SER A 79  ? LEU A 81  ? SER A 79  LEU A 81  5 ? 3  
HELX_P HELX_P4  4  ASP A 161 ? PHE A 165 ? ASP A 161 PHE A 165 5 ? 5  
HELX_P HELX_P5  5  ASP B 2   ? SER B 14  ? ASP B 2   SER B 14  1 ? 13 
HELX_P HELX_P6  6  ARG B 61  ? ALA B 64  ? ARG B 61  ALA B 64  5 ? 4  
HELX_P HELX_P7  7  SER B 79  ? LEU B 81  ? SER B 79  LEU B 81  5 ? 3  
HELX_P HELX_P8  8  ASP C 2   ? SER C 14  ? ASP C 2   SER C 14  1 ? 13 
HELX_P HELX_P9  9  ARG C 61  ? ALA C 64  ? ARG C 61  ALA C 64  5 ? 4  
HELX_P HELX_P10 10 SER C 79  ? LEU C 81  ? SER C 79  LEU C 81  5 ? 3  
HELX_P HELX_P11 11 ASP C 161 ? PHE C 165 ? ASP C 161 PHE C 165 5 ? 5  
HELX_P HELX_P12 12 ASP D 2   ? SER D 14  ? ASP D 2   SER D 14  1 ? 13 
HELX_P HELX_P13 13 THR D 21  ? ARG D 25  ? THR D 21  ARG D 25  5 ? 5  
HELX_P HELX_P14 14 ARG D 61  ? ALA D 64  ? ARG D 61  ALA D 64  5 ? 4  
HELX_P HELX_P15 15 SER D 79  ? LEU D 81  ? SER D 79  LEU D 81  5 ? 3  
HELX_P HELX_P16 16 ASP E 2   ? SER E 14  ? ASP E 2   SER E 14  1 ? 13 
HELX_P HELX_P17 17 ARG E 61  ? ALA E 64  ? ARG E 61  ALA E 64  5 ? 4  
HELX_P HELX_P18 18 SER E 79  ? LEU E 81  ? SER E 79  LEU E 81  5 ? 3  
HELX_P HELX_P19 19 ASP F 2   ? SER F 14  ? ASP F 2   SER F 14  1 ? 13 
HELX_P HELX_P20 20 ARG F 61  ? ALA F 64  ? ARG F 61  ALA F 64  5 ? 4  
HELX_P HELX_P21 21 SER F 79  ? LEU F 81  ? SER F 79  LEU F 81  5 ? 3  
HELX_P HELX_P22 22 ASP G 2   ? SER G 14  ? ASP G 2   SER G 14  1 ? 13 
HELX_P HELX_P23 23 ARG G 61  ? ALA G 64  ? ARG G 61  ALA G 64  5 ? 4  
HELX_P HELX_P24 24 SER G 79  ? LEU G 81  ? SER G 79  LEU G 81  5 ? 3  
HELX_P HELX_P25 25 ASP H 2   ? SER H 14  ? ASP H 2   SER H 14  1 ? 13 
HELX_P HELX_P26 26 ARG H 61  ? ALA H 64  ? ARG H 61  ALA H 64  5 ? 4  
HELX_P HELX_P27 27 SER H 79  ? LEU H 81  ? SER H 79  LEU H 81  5 ? 3  
HELX_P HELX_P28 28 ASP I 2   ? SER I 14  ? ASP I 2   SER I 14  1 ? 13 
HELX_P HELX_P29 29 ARG I 61  ? ALA I 64  ? ARG I 61  ALA I 64  5 ? 4  
HELX_P HELX_P30 30 SER I 79  ? LEU I 81  ? SER I 79  LEU I 81  5 ? 3  
HELX_P HELX_P31 31 ASP J 2   ? SER J 14  ? ASP J 2   SER J 14  1 ? 13 
HELX_P HELX_P32 32 ARG J 61  ? ALA J 64  ? ARG J 61  ALA J 64  5 ? 4  
HELX_P HELX_P33 33 SER J 79  ? LEU J 81  ? SER J 79  LEU J 81  5 ? 3  
HELX_P HELX_P34 34 ASP J 161 ? PHE J 165 ? ASP J 161 PHE J 165 5 ? 5  
HELX_P HELX_P35 35 ASP K 2   ? SER K 14  ? ASP K 2   SER K 14  1 ? 13 
HELX_P HELX_P36 36 THR K 21  ? ARG K 25  ? THR K 21  ARG K 25  5 ? 5  
HELX_P HELX_P37 37 ARG K 61  ? ALA K 64  ? ARG K 61  ALA K 64  5 ? 4  
HELX_P HELX_P38 38 SER K 79  ? LEU K 81  ? SER K 79  LEU K 81  5 ? 3  
HELX_P HELX_P39 39 ASP L 2   ? SER L 14  ? ASP L 2   SER L 14  1 ? 13 
HELX_P HELX_P40 40 ARG L 61  ? ALA L 64  ? ARG L 61  ALA L 64  5 ? 4  
HELX_P HELX_P41 41 SER L 79  ? LEU L 81  ? SER L 79  LEU L 81  5 ? 3  
HELX_P HELX_P42 42 ASP L 161 ? PHE L 165 ? ASP L 161 PHE L 165 5 ? 5  
HELX_P HELX_P43 43 ASP M 2   ? SER M 14  ? ASP M 2   SER M 14  1 ? 13 
HELX_P HELX_P44 44 ARG M 61  ? ALA M 64  ? ARG M 61  ALA M 64  5 ? 4  
HELX_P HELX_P45 45 SER M 79  ? LEU M 81  ? SER M 79  LEU M 81  5 ? 3  
HELX_P HELX_P46 46 ASP N 2   ? SER N 14  ? ASP N 2   SER N 14  1 ? 13 
HELX_P HELX_P47 47 ARG N 61  ? ALA N 64  ? ARG N 61  ALA N 64  5 ? 4  
HELX_P HELX_P48 48 SER N 79  ? LEU N 81  ? SER N 79  LEU N 81  5 ? 3  
HELX_P HELX_P49 49 ASP O 2   ? SER O 14  ? ASP O 2   SER O 14  1 ? 13 
HELX_P HELX_P50 50 ARG O 61  ? ALA O 64  ? ARG O 61  ALA O 64  5 ? 4  
HELX_P HELX_P51 51 SER O 79  ? LEU O 81  ? SER O 79  LEU O 81  5 ? 3  
HELX_P HELX_P52 52 ASP P 2   ? SER P 14  ? ASP P 2   SER P 14  1 ? 13 
HELX_P HELX_P53 53 ARG P 61  ? ALA P 64  ? ARG P 61  ALA P 64  5 ? 4  
HELX_P HELX_P54 54 SER P 79  ? LEU P 81  ? SER P 79  LEU P 81  5 ? 3  
HELX_P HELX_P55 55 ASP Q 2   ? SER Q 14  ? ASP Q 2   SER Q 14  1 ? 13 
HELX_P HELX_P56 56 ARG Q 61  ? ALA Q 64  ? ARG Q 61  ALA Q 64  5 ? 4  
HELX_P HELX_P57 57 SER Q 79  ? LEU Q 81  ? SER Q 79  LEU Q 81  5 ? 3  
HELX_P HELX_P58 58 ASP R 2   ? SER R 14  ? ASP R 2   SER R 14  1 ? 13 
HELX_P HELX_P59 59 ARG R 61  ? ALA R 64  ? ARG R 61  ALA R 64  5 ? 4  
HELX_P HELX_P60 60 SER R 79  ? LEU R 81  ? SER R 79  LEU R 81  5 ? 3  
HELX_P HELX_P61 61 ASP S 2   ? SER S 14  ? ASP S 2   SER S 14  1 ? 13 
HELX_P HELX_P62 62 ARG S 61  ? ALA S 64  ? ARG S 61  ALA S 64  5 ? 4  
HELX_P HELX_P63 63 SER S 79  ? LEU S 81  ? SER S 79  LEU S 81  5 ? 3  
HELX_P HELX_P64 64 ASP T 2   ? SER T 14  ? ASP T 2   SER T 14  1 ? 13 
HELX_P HELX_P65 65 ARG T 61  ? ALA T 64  ? ARG T 61  ALA T 64  5 ? 4  
HELX_P HELX_P66 66 SER T 79  ? LEU T 81  ? SER T 79  LEU T 81  5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 123 SG ? ? ? 1_555 A CYS 136 SG ? ? A CYS 123 A CYS 136 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf2  disulf ? ? A CYS 187 SG ? ? ? 1_555 A CYS 188 SG ? ? A CYS 187 A CYS 188 1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf3  disulf ? ? B CYS 123 SG ? ? ? 1_555 B CYS 136 SG ? ? B CYS 123 B CYS 136 1_555 ? ? ? ? ? ? ? 2.007 ? 
disulf4  disulf ? ? B CYS 187 SG ? ? ? 1_555 B CYS 188 SG ? ? B CYS 187 B CYS 188 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf5  disulf ? ? C CYS 123 SG ? ? ? 1_555 C CYS 136 SG ? ? C CYS 123 C CYS 136 1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf6  disulf ? ? C CYS 187 SG ? ? ? 1_555 C CYS 188 SG ? ? C CYS 187 C CYS 188 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf7  disulf ? ? D CYS 123 SG ? ? ? 1_555 D CYS 136 SG ? ? D CYS 123 D CYS 136 1_555 ? ? ? ? ? ? ? 2.007 ? 
disulf8  disulf ? ? D CYS 187 SG ? ? ? 1_555 D CYS 188 SG ? ? D CYS 187 D CYS 188 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf9  disulf ? ? E CYS 123 SG ? ? ? 1_555 E CYS 136 SG ? ? E CYS 123 E CYS 136 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf10 disulf ? ? E CYS 187 SG ? ? ? 1_555 E CYS 188 SG ? ? E CYS 187 E CYS 188 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf11 disulf ? ? F CYS 123 SG ? ? ? 1_555 F CYS 136 SG ? ? F CYS 123 F CYS 136 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf12 disulf ? ? F CYS 187 SG ? ? ? 1_555 F CYS 188 SG ? ? F CYS 187 F CYS 188 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf13 disulf ? ? G CYS 123 SG ? ? ? 1_555 G CYS 136 SG ? ? G CYS 123 G CYS 136 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf14 disulf ? ? G CYS 187 SG ? ? ? 1_555 G CYS 188 SG ? ? G CYS 187 G CYS 188 1_555 ? ? ? ? ? ? ? 2.075 ? 
disulf15 disulf ? ? H CYS 123 SG ? ? ? 1_555 H CYS 136 SG ? ? H CYS 123 H CYS 136 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf16 disulf ? ? H CYS 187 SG ? ? ? 1_555 H CYS 188 SG ? ? H CYS 187 H CYS 188 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf17 disulf ? ? I CYS 123 SG ? ? ? 1_555 I CYS 136 SG ? ? I CYS 123 I CYS 136 1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf18 disulf ? ? I CYS 187 SG ? ? ? 1_555 I CYS 188 SG ? ? I CYS 187 I CYS 188 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf19 disulf ? ? J CYS 123 SG ? ? ? 1_555 J CYS 136 SG ? ? J CYS 123 J CYS 136 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf20 disulf ? ? J CYS 187 SG ? ? ? 1_555 J CYS 188 SG ? ? J CYS 187 J CYS 188 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf21 disulf ? ? K CYS 123 SG ? ? ? 1_555 K CYS 136 SG ? ? K CYS 123 K CYS 136 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf22 disulf ? ? K CYS 187 SG ? ? ? 1_555 K CYS 188 SG ? ? K CYS 187 K CYS 188 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf23 disulf ? ? L CYS 123 SG ? ? ? 1_555 L CYS 136 SG ? ? L CYS 123 L CYS 136 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf24 disulf ? ? L CYS 187 SG ? ? ? 1_555 L CYS 188 SG ? ? L CYS 187 L CYS 188 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf25 disulf ? ? M CYS 123 SG ? ? ? 1_555 M CYS 136 SG ? ? M CYS 123 M CYS 136 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf26 disulf ? ? M CYS 187 SG ? ? ? 1_555 M CYS 188 SG ? ? M CYS 187 M CYS 188 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf27 disulf ? ? N CYS 123 SG ? ? ? 1_555 N CYS 136 SG ? ? N CYS 123 N CYS 136 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf28 disulf ? ? N CYS 187 SG B ? ? 1_555 N CYS 188 SG ? ? N CYS 187 N CYS 188 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf29 disulf ? ? O CYS 123 SG ? ? ? 1_555 O CYS 136 SG ? ? O CYS 123 O CYS 136 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf30 disulf ? ? O CYS 187 SG ? ? ? 1_555 O CYS 188 SG ? ? O CYS 187 O CYS 188 1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf31 disulf ? ? P CYS 123 SG ? ? ? 1_555 P CYS 136 SG ? ? P CYS 123 P CYS 136 1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf32 disulf ? ? P CYS 187 SG ? ? ? 1_555 P CYS 188 SG ? ? P CYS 187 P CYS 188 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf33 disulf ? ? Q CYS 123 SG ? ? ? 1_555 Q CYS 136 SG ? ? Q CYS 123 Q CYS 136 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf34 disulf ? ? Q CYS 187 SG ? ? ? 1_555 Q CYS 188 SG ? ? Q CYS 187 Q CYS 188 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf35 disulf ? ? R CYS 123 SG ? ? ? 1_555 R CYS 136 SG ? ? R CYS 123 R CYS 136 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf36 disulf ? ? R CYS 187 SG ? ? ? 1_555 R CYS 188 SG ? ? R CYS 187 R CYS 188 1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf37 disulf ? ? S CYS 123 SG ? ? ? 1_555 S CYS 136 SG ? ? S CYS 123 S CYS 136 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf38 disulf ? ? S CYS 187 SG ? ? ? 1_555 S CYS 188 SG ? ? S CYS 187 S CYS 188 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf39 disulf ? ? T CYS 123 SG ? ? ? 1_555 T CYS 136 SG ? ? T CYS 123 T CYS 136 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf40 disulf ? ? T CYS 187 SG ? ? ? 1_555 T CYS 188 SG ? ? T CYS 187 T CYS 188 1_555 ? ? ? ? ? ? ? 2.028 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 6 ? 
B  ? 6 ? 
C  ? 4 ? 
D  ? 6 ? 
E  ? 6 ? 
F  ? 4 ? 
G  ? 6 ? 
H  ? 6 ? 
I  ? 4 ? 
J  ? 6 ? 
K  ? 6 ? 
L  ? 4 ? 
M  ? 6 ? 
N  ? 6 ? 
O  ? 4 ? 
P  ? 6 ? 
Q  ? 6 ? 
R  ? 4 ? 
S  ? 6 ? 
T  ? 6 ? 
U  ? 4 ? 
V  ? 6 ? 
W  ? 6 ? 
X  ? 4 ? 
Y  ? 6 ? 
Z  ? 6 ? 
AA ? 4 ? 
AB ? 6 ? 
AC ? 6 ? 
AD ? 4 ? 
AE ? 6 ? 
AF ? 6 ? 
AG ? 4 ? 
AH ? 6 ? 
AI ? 6 ? 
AJ ? 4 ? 
AK ? 6 ? 
AL ? 6 ? 
AM ? 4 ? 
AN ? 6 ? 
AO ? 6 ? 
AP ? 4 ? 
AQ ? 6 ? 
AR ? 6 ? 
AS ? 4 ? 
AT ? 6 ? 
AU ? 6 ? 
AV ? 4 ? 
AW ? 6 ? 
AX ? 6 ? 
AY ? 4 ? 
AZ ? 6 ? 
BA ? 6 ? 
BB ? 4 ? 
BC ? 6 ? 
BD ? 6 ? 
BE ? 4 ? 
BF ? 6 ? 
BG ? 6 ? 
BH ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
A  4 5 ? anti-parallel 
A  5 6 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? parallel      
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
D  5 6 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
E  5 6 ? parallel      
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
G  4 5 ? anti-parallel 
G  5 6 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
H  4 5 ? anti-parallel 
H  5 6 ? parallel      
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
J  4 5 ? anti-parallel 
J  5 6 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
K  4 5 ? anti-parallel 
K  5 6 ? parallel      
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
M  4 5 ? anti-parallel 
M  5 6 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
N  4 5 ? anti-parallel 
N  5 6 ? parallel      
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
P  4 5 ? anti-parallel 
P  5 6 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
Q  4 5 ? anti-parallel 
Q  5 6 ? parallel      
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
S  4 5 ? anti-parallel 
S  5 6 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
T  4 5 ? anti-parallel 
T  5 6 ? parallel      
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
V  4 5 ? anti-parallel 
V  5 6 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
W  4 5 ? anti-parallel 
W  5 6 ? parallel      
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Y  4 5 ? anti-parallel 
Y  5 6 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
Z  4 5 ? anti-parallel 
Z  5 6 ? parallel      
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AC 5 6 ? parallel      
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AE 4 5 ? anti-parallel 
AE 5 6 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AF 5 6 ? parallel      
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AH 4 5 ? anti-parallel 
AH 5 6 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AI 4 5 ? anti-parallel 
AI 5 6 ? parallel      
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AK 4 5 ? anti-parallel 
AK 5 6 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? anti-parallel 
AL 4 5 ? anti-parallel 
AL 5 6 ? parallel      
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AN 4 5 ? anti-parallel 
AN 5 6 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AO 4 5 ? anti-parallel 
AO 5 6 ? parallel      
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AQ 4 5 ? anti-parallel 
AQ 5 6 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? anti-parallel 
AR 4 5 ? anti-parallel 
AR 5 6 ? parallel      
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
AT 4 5 ? anti-parallel 
AT 5 6 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
AU 4 5 ? anti-parallel 
AU 5 6 ? parallel      
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AV 3 4 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AW 3 4 ? anti-parallel 
AW 4 5 ? anti-parallel 
AW 5 6 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AX 4 5 ? anti-parallel 
AX 5 6 ? parallel      
AY 1 2 ? anti-parallel 
AY 2 3 ? anti-parallel 
AY 3 4 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
AZ 3 4 ? anti-parallel 
AZ 4 5 ? anti-parallel 
AZ 5 6 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? parallel      
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BC 4 5 ? anti-parallel 
BC 5 6 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BD 4 5 ? anti-parallel 
BD 5 6 ? parallel      
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BF 1 2 ? anti-parallel 
BF 2 3 ? anti-parallel 
BF 3 4 ? anti-parallel 
BF 4 5 ? anti-parallel 
BF 5 6 ? anti-parallel 
BG 1 2 ? anti-parallel 
BG 2 3 ? anti-parallel 
BG 3 4 ? anti-parallel 
BG 4 5 ? anti-parallel 
BG 5 6 ? parallel      
BH 1 2 ? anti-parallel 
BH 2 3 ? anti-parallel 
BH 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 GLN A 73  ? PRO A 77  ? GLN A 73  PRO A 77  
A  2 LEU A 102 ? VAL A 106 ? LEU A 102 VAL A 106 
A  3 GLU A 110 ? TYR A 113 ? GLU A 110 TYR A 113 
A  4 GLU A 47  ? SER A 59  ? GLU A 47  SER A 59  
A  5 SER A 116 ? SER A 122 ? SER A 116 SER A 122 
A  6 GLU A 96  ? VAL A 97  ? GLU A 96  VAL A 97  
B  1 GLN A 73  ? PRO A 77  ? GLN A 73  PRO A 77  
B  2 LEU A 102 ? VAL A 106 ? LEU A 102 VAL A 106 
B  3 GLU A 110 ? TYR A 113 ? GLU A 110 TYR A 113 
B  4 GLU A 47  ? SER A 59  ? GLU A 47  SER A 59  
B  5 VAL A 27  ? ASN A 42  ? VAL A 27  ASN A 42  
B  6 ILE A 150 ? ASP A 153 ? ILE A 150 ASP A 153 
C  1 LEU A 86  ? ALA A 88  ? LEU A 86  ALA A 88  
C  2 ALA A 134 ? SER A 142 ? ALA A 134 SER A 142 
C  3 ALA A 191 ? LYS A 203 ? ALA A 191 LYS A 203 
C  4 PHE A 171 ? THR A 184 ? PHE A 171 THR A 184 
D  1 GLN B 73  ? PRO B 77  ? GLN B 73  PRO B 77  
D  2 LEU B 102 ? VAL B 106 ? LEU B 102 VAL B 106 
D  3 GLU B 110 ? TYR B 113 ? GLU B 110 TYR B 113 
D  4 GLU B 47  ? SER B 59  ? GLU B 47  SER B 59  
D  5 SER B 116 ? SER B 122 ? SER B 116 SER B 122 
D  6 GLU B 96  ? VAL B 97  ? GLU B 96  VAL B 97  
E  1 GLN B 73  ? PRO B 77  ? GLN B 73  PRO B 77  
E  2 LEU B 102 ? VAL B 106 ? LEU B 102 VAL B 106 
E  3 GLU B 110 ? TYR B 113 ? GLU B 110 TYR B 113 
E  4 GLU B 47  ? SER B 59  ? GLU B 47  SER B 59  
E  5 VAL B 27  ? ASN B 42  ? VAL B 27  ASN B 42  
E  6 ILE B 150 ? ASP B 153 ? ILE B 150 ASP B 153 
F  1 LEU B 86  ? ALA B 88  ? LEU B 86  ALA B 88  
F  2 ALA B 134 ? SER B 142 ? ALA B 134 SER B 142 
F  3 ALA B 191 ? LYS B 203 ? ALA B 191 LYS B 203 
F  4 PHE B 171 ? THR B 184 ? PHE B 171 THR B 184 
G  1 GLN C 73  ? PRO C 77  ? GLN C 73  PRO C 77  
G  2 LEU C 102 ? VAL C 106 ? LEU C 102 VAL C 106 
G  3 GLU C 110 ? TYR C 113 ? GLU C 110 TYR C 113 
G  4 GLU C 47  ? SER C 59  ? GLU C 47  SER C 59  
G  5 SER C 116 ? SER C 122 ? SER C 116 SER C 122 
G  6 GLU C 96  ? VAL C 97  ? GLU C 96  VAL C 97  
H  1 GLN C 73  ? PRO C 77  ? GLN C 73  PRO C 77  
H  2 LEU C 102 ? VAL C 106 ? LEU C 102 VAL C 106 
H  3 GLU C 110 ? TYR C 113 ? GLU C 110 TYR C 113 
H  4 GLU C 47  ? SER C 59  ? GLU C 47  SER C 59  
H  5 VAL C 27  ? ASN C 42  ? VAL C 27  ASN C 42  
H  6 ILE C 150 ? ASP C 153 ? ILE C 150 ASP C 153 
I  1 LEU C 86  ? ALA C 88  ? LEU C 86  ALA C 88  
I  2 ALA C 134 ? SER C 142 ? ALA C 134 SER C 142 
I  3 ALA C 191 ? LYS C 203 ? ALA C 191 LYS C 203 
I  4 PHE C 171 ? THR C 184 ? PHE C 171 THR C 184 
J  1 GLN D 73  ? PRO D 77  ? GLN D 73  PRO D 77  
J  2 LEU D 102 ? VAL D 106 ? LEU D 102 VAL D 106 
J  3 GLU D 110 ? TYR D 113 ? GLU D 110 TYR D 113 
J  4 GLU D 47  ? SER D 59  ? GLU D 47  SER D 59  
J  5 SER D 116 ? SER D 122 ? SER D 116 SER D 122 
J  6 GLU D 96  ? VAL D 97  ? GLU D 96  VAL D 97  
K  1 GLN D 73  ? PRO D 77  ? GLN D 73  PRO D 77  
K  2 LEU D 102 ? VAL D 106 ? LEU D 102 VAL D 106 
K  3 GLU D 110 ? TYR D 113 ? GLU D 110 TYR D 113 
K  4 GLU D 47  ? SER D 59  ? GLU D 47  SER D 59  
K  5 VAL D 27  ? ASN D 42  ? VAL D 27  ASN D 42  
K  6 ILE D 150 ? ASP D 153 ? ILE D 150 ASP D 153 
L  1 LEU D 86  ? ALA D 88  ? LEU D 86  ALA D 88  
L  2 ALA D 134 ? SER D 142 ? ALA D 134 SER D 142 
L  3 CYS D 188 ? LYS D 203 ? CYS D 188 LYS D 203 
L  4 PHE D 171 ? TYR D 185 ? PHE D 171 TYR D 185 
M  1 GLN E 73  ? PRO E 77  ? GLN E 73  PRO E 77  
M  2 LEU E 102 ? VAL E 106 ? LEU E 102 VAL E 106 
M  3 GLU E 110 ? TYR E 113 ? GLU E 110 TYR E 113 
M  4 GLU E 47  ? SER E 59  ? GLU E 47  SER E 59  
M  5 SER E 116 ? SER E 122 ? SER E 116 SER E 122 
M  6 GLU E 96  ? VAL E 97  ? GLU E 96  VAL E 97  
N  1 GLN E 73  ? PRO E 77  ? GLN E 73  PRO E 77  
N  2 LEU E 102 ? VAL E 106 ? LEU E 102 VAL E 106 
N  3 GLU E 110 ? TYR E 113 ? GLU E 110 TYR E 113 
N  4 GLU E 47  ? SER E 59  ? GLU E 47  SER E 59  
N  5 VAL E 27  ? ASN E 42  ? VAL E 27  ASN E 42  
N  6 ILE E 150 ? ASP E 153 ? ILE E 150 ASP E 153 
O  1 LEU E 86  ? ALA E 88  ? LEU E 86  ALA E 88  
O  2 ALA E 134 ? SER E 142 ? ALA E 134 SER E 142 
O  3 ALA E 191 ? LYS E 203 ? ALA E 191 LYS E 203 
O  4 PHE E 171 ? THR E 184 ? PHE E 171 THR E 184 
P  1 GLN F 73  ? PRO F 77  ? GLN F 73  PRO F 77  
P  2 LEU F 102 ? VAL F 106 ? LEU F 102 VAL F 106 
P  3 GLU F 110 ? TYR F 113 ? GLU F 110 TYR F 113 
P  4 GLU F 47  ? SER F 59  ? GLU F 47  SER F 59  
P  5 SER F 116 ? SER F 122 ? SER F 116 SER F 122 
P  6 GLU F 96  ? VAL F 97  ? GLU F 96  VAL F 97  
Q  1 GLN F 73  ? PRO F 77  ? GLN F 73  PRO F 77  
Q  2 LEU F 102 ? VAL F 106 ? LEU F 102 VAL F 106 
Q  3 GLU F 110 ? TYR F 113 ? GLU F 110 TYR F 113 
Q  4 GLU F 47  ? SER F 59  ? GLU F 47  SER F 59  
Q  5 VAL F 27  ? ILE F 38  ? VAL F 27  ILE F 38  
Q  6 ILE F 150 ? ASP F 153 ? ILE F 150 ASP F 153 
R  1 LEU F 86  ? ALA F 88  ? LEU F 86  ALA F 88  
R  2 ALA F 134 ? SER F 142 ? ALA F 134 SER F 142 
R  3 ALA F 191 ? LYS F 203 ? ALA F 191 LYS F 203 
R  4 PHE F 171 ? THR F 184 ? PHE F 171 THR F 184 
S  1 GLN G 73  ? PRO G 77  ? GLN G 73  PRO G 77  
S  2 LEU G 102 ? VAL G 106 ? LEU G 102 VAL G 106 
S  3 GLU G 110 ? TYR G 113 ? GLU G 110 TYR G 113 
S  4 GLU G 47  ? SER G 59  ? GLU G 47  SER G 59  
S  5 SER G 116 ? SER G 122 ? SER G 116 SER G 122 
S  6 GLU G 96  ? VAL G 97  ? GLU G 96  VAL G 97  
T  1 GLN G 73  ? PRO G 77  ? GLN G 73  PRO G 77  
T  2 LEU G 102 ? VAL G 106 ? LEU G 102 VAL G 106 
T  3 GLU G 110 ? TYR G 113 ? GLU G 110 TYR G 113 
T  4 GLU G 47  ? SER G 59  ? GLU G 47  SER G 59  
T  5 VAL G 27  ? ASN G 42  ? VAL G 27  ASN G 42  
T  6 ILE G 150 ? PRO G 154 ? ILE G 150 PRO G 154 
U  1 LEU G 86  ? ALA G 88  ? LEU G 86  ALA G 88  
U  2 ALA G 134 ? SER G 142 ? ALA G 134 SER G 142 
U  3 ALA G 191 ? LYS G 203 ? ALA G 191 LYS G 203 
U  4 PHE G 171 ? THR G 184 ? PHE G 171 THR G 184 
V  1 GLN H 73  ? PRO H 77  ? GLN H 73  PRO H 77  
V  2 LEU H 102 ? VAL H 106 ? LEU H 102 VAL H 106 
V  3 GLU H 110 ? TYR H 113 ? GLU H 110 TYR H 113 
V  4 GLU H 47  ? SER H 59  ? GLU H 47  SER H 59  
V  5 SER H 116 ? SER H 122 ? SER H 116 SER H 122 
V  6 GLU H 96  ? VAL H 97  ? GLU H 96  VAL H 97  
W  1 GLN H 73  ? PRO H 77  ? GLN H 73  PRO H 77  
W  2 LEU H 102 ? VAL H 106 ? LEU H 102 VAL H 106 
W  3 GLU H 110 ? TYR H 113 ? GLU H 110 TYR H 113 
W  4 GLU H 47  ? SER H 59  ? GLU H 47  SER H 59  
W  5 VAL H 27  ? ASN H 42  ? VAL H 27  ASN H 42  
W  6 ILE H 150 ? ASP H 153 ? ILE H 150 ASP H 153 
X  1 LEU H 86  ? ALA H 88  ? LEU H 86  ALA H 88  
X  2 ALA H 134 ? SER H 142 ? ALA H 134 SER H 142 
X  3 ALA H 191 ? LYS H 203 ? ALA H 191 LYS H 203 
X  4 PHE H 171 ? THR H 184 ? PHE H 171 THR H 184 
Y  1 GLN I 73  ? PRO I 77  ? GLN I 73  PRO I 77  
Y  2 LEU I 102 ? VAL I 106 ? LEU I 102 VAL I 106 
Y  3 GLU I 110 ? TYR I 113 ? GLU I 110 TYR I 113 
Y  4 GLU I 47  ? SER I 59  ? GLU I 47  SER I 59  
Y  5 SER I 116 ? SER I 122 ? SER I 116 SER I 122 
Y  6 GLU I 96  ? VAL I 97  ? GLU I 96  VAL I 97  
Z  1 GLN I 73  ? PRO I 77  ? GLN I 73  PRO I 77  
Z  2 LEU I 102 ? VAL I 106 ? LEU I 102 VAL I 106 
Z  3 GLU I 110 ? TYR I 113 ? GLU I 110 TYR I 113 
Z  4 GLU I 47  ? SER I 59  ? GLU I 47  SER I 59  
Z  5 VAL I 27  ? ASN I 42  ? VAL I 27  ASN I 42  
Z  6 ILE I 150 ? ASP I 153 ? ILE I 150 ASP I 153 
AA 1 LEU I 86  ? ALA I 88  ? LEU I 86  ALA I 88  
AA 2 ALA I 134 ? SER I 142 ? ALA I 134 SER I 142 
AA 3 ALA I 191 ? LYS I 203 ? ALA I 191 LYS I 203 
AA 4 PHE I 171 ? THR I 184 ? PHE I 171 THR I 184 
AB 1 GLN J 73  ? PRO J 77  ? GLN J 73  PRO J 77  
AB 2 LEU J 102 ? VAL J 106 ? LEU J 102 VAL J 106 
AB 3 GLU J 110 ? TYR J 113 ? GLU J 110 TYR J 113 
AB 4 GLU J 47  ? SER J 59  ? GLU J 47  SER J 59  
AB 5 SER J 116 ? SER J 122 ? SER J 116 SER J 122 
AB 6 GLU J 96  ? VAL J 97  ? GLU J 96  VAL J 97  
AC 1 GLN J 73  ? PRO J 77  ? GLN J 73  PRO J 77  
AC 2 LEU J 102 ? VAL J 106 ? LEU J 102 VAL J 106 
AC 3 GLU J 110 ? TYR J 113 ? GLU J 110 TYR J 113 
AC 4 GLU J 47  ? SER J 59  ? GLU J 47  SER J 59  
AC 5 VAL J 27  ? ILE J 38  ? VAL J 27  ILE J 38  
AC 6 ILE J 150 ? PRO J 154 ? ILE J 150 PRO J 154 
AD 1 LEU J 86  ? ALA J 88  ? LEU J 86  ALA J 88  
AD 2 ALA J 134 ? SER J 142 ? ALA J 134 SER J 142 
AD 3 ALA J 191 ? LYS J 203 ? ALA J 191 LYS J 203 
AD 4 PHE J 171 ? THR J 184 ? PHE J 171 THR J 184 
AE 1 GLN K 73  ? PRO K 77  ? GLN K 73  PRO K 77  
AE 2 LEU K 102 ? VAL K 106 ? LEU K 102 VAL K 106 
AE 3 GLU K 110 ? TYR K 113 ? GLU K 110 TYR K 113 
AE 4 GLU K 47  ? SER K 59  ? GLU K 47  SER K 59  
AE 5 SER K 116 ? SER K 122 ? SER K 116 SER K 122 
AE 6 GLU K 96  ? VAL K 97  ? GLU K 96  VAL K 97  
AF 1 GLN K 73  ? PRO K 77  ? GLN K 73  PRO K 77  
AF 2 LEU K 102 ? VAL K 106 ? LEU K 102 VAL K 106 
AF 3 GLU K 110 ? TYR K 113 ? GLU K 110 TYR K 113 
AF 4 GLU K 47  ? SER K 59  ? GLU K 47  SER K 59  
AF 5 VAL K 27  ? ASN K 42  ? VAL K 27  ASN K 42  
AF 6 ILE K 150 ? ASP K 153 ? ILE K 150 ASP K 153 
AG 1 LEU K 86  ? ALA K 88  ? LEU K 86  ALA K 88  
AG 2 ALA K 134 ? SER K 142 ? ALA K 134 SER K 142 
AG 3 ALA K 191 ? LYS K 203 ? ALA K 191 LYS K 203 
AG 4 PHE K 171 ? THR K 184 ? PHE K 171 THR K 184 
AH 1 GLN L 73  ? PRO L 77  ? GLN L 73  PRO L 77  
AH 2 LEU L 102 ? VAL L 106 ? LEU L 102 VAL L 106 
AH 3 GLU L 110 ? TYR L 113 ? GLU L 110 TYR L 113 
AH 4 GLU L 47  ? SER L 59  ? GLU L 47  SER L 59  
AH 5 SER L 116 ? SER L 122 ? SER L 116 SER L 122 
AH 6 GLU L 96  ? VAL L 97  ? GLU L 96  VAL L 97  
AI 1 GLN L 73  ? PRO L 77  ? GLN L 73  PRO L 77  
AI 2 LEU L 102 ? VAL L 106 ? LEU L 102 VAL L 106 
AI 3 GLU L 110 ? TYR L 113 ? GLU L 110 TYR L 113 
AI 4 GLU L 47  ? SER L 59  ? GLU L 47  SER L 59  
AI 5 VAL L 27  ? ASN L 42  ? VAL L 27  ASN L 42  
AI 6 ILE L 150 ? PRO L 154 ? ILE L 150 PRO L 154 
AJ 1 LEU L 86  ? ALA L 88  ? LEU L 86  ALA L 88  
AJ 2 ALA L 134 ? SER L 142 ? ALA L 134 SER L 142 
AJ 3 ALA L 191 ? LYS L 203 ? ALA L 191 LYS L 203 
AJ 4 PHE L 171 ? THR L 184 ? PHE L 171 THR L 184 
AK 1 GLN M 73  ? PRO M 77  ? GLN M 73  PRO M 77  
AK 2 LEU M 102 ? VAL M 106 ? LEU M 102 VAL M 106 
AK 3 GLU M 110 ? TYR M 113 ? GLU M 110 TYR M 113 
AK 4 GLU M 47  ? SER M 59  ? GLU M 47  SER M 59  
AK 5 SER M 116 ? SER M 122 ? SER M 116 SER M 122 
AK 6 GLU M 96  ? VAL M 97  ? GLU M 96  VAL M 97  
AL 1 GLN M 73  ? PRO M 77  ? GLN M 73  PRO M 77  
AL 2 LEU M 102 ? VAL M 106 ? LEU M 102 VAL M 106 
AL 3 GLU M 110 ? TYR M 113 ? GLU M 110 TYR M 113 
AL 4 GLU M 47  ? SER M 59  ? GLU M 47  SER M 59  
AL 5 VAL M 27  ? ILE M 38  ? VAL M 27  ILE M 38  
AL 6 ILE M 150 ? PRO M 154 ? ILE M 150 PRO M 154 
AM 1 LEU M 86  ? ALA M 88  ? LEU M 86  ALA M 88  
AM 2 ALA M 134 ? SER M 142 ? ALA M 134 SER M 142 
AM 3 ALA M 191 ? LYS M 203 ? ALA M 191 LYS M 203 
AM 4 PHE M 171 ? THR M 184 ? PHE M 171 THR M 184 
AN 1 GLN N 73  ? PRO N 77  ? GLN N 73  PRO N 77  
AN 2 LEU N 102 ? VAL N 106 ? LEU N 102 VAL N 106 
AN 3 GLU N 110 ? TYR N 113 ? GLU N 110 TYR N 113 
AN 4 GLU N 47  ? SER N 59  ? GLU N 47  SER N 59  
AN 5 SER N 116 ? SER N 122 ? SER N 116 SER N 122 
AN 6 GLU N 96  ? VAL N 97  ? GLU N 96  VAL N 97  
AO 1 GLN N 73  ? PRO N 77  ? GLN N 73  PRO N 77  
AO 2 LEU N 102 ? VAL N 106 ? LEU N 102 VAL N 106 
AO 3 GLU N 110 ? TYR N 113 ? GLU N 110 TYR N 113 
AO 4 GLU N 47  ? SER N 59  ? GLU N 47  SER N 59  
AO 5 VAL N 27  ? ILE N 38  ? VAL N 27  ILE N 38  
AO 6 ILE N 150 ? ASP N 153 ? ILE N 150 ASP N 153 
AP 1 LEU N 86  ? ALA N 88  ? LEU N 86  ALA N 88  
AP 2 ALA N 134 ? SER N 142 ? ALA N 134 SER N 142 
AP 3 ALA N 191 ? LYS N 203 ? ALA N 191 LYS N 203 
AP 4 PHE N 171 ? THR N 184 ? PHE N 171 THR N 184 
AQ 1 GLN O 73  ? PRO O 77  ? GLN O 73  PRO O 77  
AQ 2 LEU O 102 ? VAL O 106 ? LEU O 102 VAL O 106 
AQ 3 GLU O 110 ? TYR O 113 ? GLU O 110 TYR O 113 
AQ 4 GLU O 47  ? SER O 59  ? GLU O 47  SER O 59  
AQ 5 SER O 116 ? SER O 122 ? SER O 116 SER O 122 
AQ 6 GLU O 96  ? VAL O 97  ? GLU O 96  VAL O 97  
AR 1 GLN O 73  ? PRO O 77  ? GLN O 73  PRO O 77  
AR 2 LEU O 102 ? VAL O 106 ? LEU O 102 VAL O 106 
AR 3 GLU O 110 ? TYR O 113 ? GLU O 110 TYR O 113 
AR 4 GLU O 47  ? SER O 59  ? GLU O 47  SER O 59  
AR 5 VAL O 27  ? ASN O 42  ? VAL O 27  ASN O 42  
AR 6 ILE O 150 ? ASP O 153 ? ILE O 150 ASP O 153 
AS 1 LEU O 86  ? ALA O 88  ? LEU O 86  ALA O 88  
AS 2 ALA O 134 ? SER O 142 ? ALA O 134 SER O 142 
AS 3 ALA O 191 ? LYS O 203 ? ALA O 191 LYS O 203 
AS 4 PHE O 171 ? THR O 184 ? PHE O 171 THR O 184 
AT 1 GLN P 73  ? PRO P 77  ? GLN P 73  PRO P 77  
AT 2 LEU P 102 ? VAL P 106 ? LEU P 102 VAL P 106 
AT 3 GLU P 110 ? TYR P 113 ? GLU P 110 TYR P 113 
AT 4 GLU P 47  ? SER P 59  ? GLU P 47  SER P 59  
AT 5 SER P 116 ? SER P 122 ? SER P 116 SER P 122 
AT 6 GLU P 96  ? VAL P 97  ? GLU P 96  VAL P 97  
AU 1 GLN P 73  ? PRO P 77  ? GLN P 73  PRO P 77  
AU 2 LEU P 102 ? VAL P 106 ? LEU P 102 VAL P 106 
AU 3 GLU P 110 ? TYR P 113 ? GLU P 110 TYR P 113 
AU 4 GLU P 47  ? SER P 59  ? GLU P 47  SER P 59  
AU 5 VAL P 27  ? ASN P 42  ? VAL P 27  ASN P 42  
AU 6 ILE P 150 ? ASP P 153 ? ILE P 150 ASP P 153 
AV 1 LEU P 86  ? ALA P 88  ? LEU P 86  ALA P 88  
AV 2 ALA P 134 ? SER P 142 ? ALA P 134 SER P 142 
AV 3 ALA P 191 ? LYS P 203 ? ALA P 191 LYS P 203 
AV 4 PHE P 171 ? THR P 184 ? PHE P 171 THR P 184 
AW 1 GLN Q 73  ? PRO Q 77  ? GLN Q 73  PRO Q 77  
AW 2 LEU Q 102 ? VAL Q 106 ? LEU Q 102 VAL Q 106 
AW 3 GLU Q 110 ? TYR Q 113 ? GLU Q 110 TYR Q 113 
AW 4 GLU Q 47  ? SER Q 59  ? GLU Q 47  SER Q 59  
AW 5 SER Q 116 ? SER Q 122 ? SER Q 116 SER Q 122 
AW 6 GLU Q 96  ? VAL Q 97  ? GLU Q 96  VAL Q 97  
AX 1 GLN Q 73  ? PRO Q 77  ? GLN Q 73  PRO Q 77  
AX 2 LEU Q 102 ? VAL Q 106 ? LEU Q 102 VAL Q 106 
AX 3 GLU Q 110 ? TYR Q 113 ? GLU Q 110 TYR Q 113 
AX 4 GLU Q 47  ? SER Q 59  ? GLU Q 47  SER Q 59  
AX 5 VAL Q 27  ? ILE Q 38  ? VAL Q 27  ILE Q 38  
AX 6 ILE Q 150 ? ASP Q 153 ? ILE Q 150 ASP Q 153 
AY 1 LEU Q 86  ? ALA Q 88  ? LEU Q 86  ALA Q 88  
AY 2 ALA Q 134 ? SER Q 142 ? ALA Q 134 SER Q 142 
AY 3 ALA Q 191 ? LYS Q 203 ? ALA Q 191 LYS Q 203 
AY 4 PHE Q 171 ? THR Q 184 ? PHE Q 171 THR Q 184 
AZ 1 GLN R 73  ? PRO R 77  ? GLN R 73  PRO R 77  
AZ 2 LEU R 102 ? VAL R 106 ? LEU R 102 VAL R 106 
AZ 3 GLU R 110 ? TYR R 113 ? GLU R 110 TYR R 113 
AZ 4 GLU R 47  ? SER R 59  ? GLU R 47  SER R 59  
AZ 5 SER R 116 ? SER R 122 ? SER R 116 SER R 122 
AZ 6 GLU R 96  ? VAL R 97  ? GLU R 96  VAL R 97  
BA 1 GLN R 73  ? PRO R 77  ? GLN R 73  PRO R 77  
BA 2 LEU R 102 ? VAL R 106 ? LEU R 102 VAL R 106 
BA 3 GLU R 110 ? TYR R 113 ? GLU R 110 TYR R 113 
BA 4 GLU R 47  ? SER R 59  ? GLU R 47  SER R 59  
BA 5 VAL R 27  ? ASN R 42  ? VAL R 27  ASN R 42  
BA 6 ILE R 150 ? ASP R 153 ? ILE R 150 ASP R 153 
BB 1 LEU R 86  ? ALA R 88  ? LEU R 86  ALA R 88  
BB 2 ALA R 134 ? SER R 142 ? ALA R 134 SER R 142 
BB 3 ALA R 191 ? LYS R 203 ? ALA R 191 LYS R 203 
BB 4 PHE R 171 ? THR R 184 ? PHE R 171 THR R 184 
BC 1 GLN S 73  ? PRO S 77  ? GLN S 73  PRO S 77  
BC 2 LEU S 102 ? VAL S 106 ? LEU S 102 VAL S 106 
BC 3 GLU S 110 ? TYR S 113 ? GLU S 110 TYR S 113 
BC 4 GLU S 47  ? SER S 59  ? GLU S 47  SER S 59  
BC 5 SER S 116 ? SER S 122 ? SER S 116 SER S 122 
BC 6 GLU S 96  ? VAL S 97  ? GLU S 96  VAL S 97  
BD 1 GLN S 73  ? PRO S 77  ? GLN S 73  PRO S 77  
BD 2 LEU S 102 ? VAL S 106 ? LEU S 102 VAL S 106 
BD 3 GLU S 110 ? TYR S 113 ? GLU S 110 TYR S 113 
BD 4 GLU S 47  ? SER S 59  ? GLU S 47  SER S 59  
BD 5 VAL S 27  ? ILE S 38  ? VAL S 27  ILE S 38  
BD 6 ILE S 150 ? ASP S 153 ? ILE S 150 ASP S 153 
BE 1 LEU S 86  ? ALA S 88  ? LEU S 86  ALA S 88  
BE 2 ALA S 134 ? SER S 142 ? ALA S 134 SER S 142 
BE 3 ALA S 191 ? LYS S 203 ? ALA S 191 LYS S 203 
BE 4 PHE S 171 ? THR S 184 ? PHE S 171 THR S 184 
BF 1 GLN T 73  ? PRO T 77  ? GLN T 73  PRO T 77  
BF 2 LEU T 102 ? VAL T 106 ? LEU T 102 VAL T 106 
BF 3 GLU T 110 ? TYR T 113 ? GLU T 110 TYR T 113 
BF 4 GLU T 47  ? SER T 59  ? GLU T 47  SER T 59  
BF 5 SER T 116 ? SER T 122 ? SER T 116 SER T 122 
BF 6 GLU T 96  ? VAL T 97  ? GLU T 96  VAL T 97  
BG 1 GLN T 73  ? PRO T 77  ? GLN T 73  PRO T 77  
BG 2 LEU T 102 ? VAL T 106 ? LEU T 102 VAL T 106 
BG 3 GLU T 110 ? TYR T 113 ? GLU T 110 TYR T 113 
BG 4 GLU T 47  ? SER T 59  ? GLU T 47  SER T 59  
BG 5 VAL T 27  ? ILE T 38  ? VAL T 27  ILE T 38  
BG 6 ILE T 150 ? ASP T 153 ? ILE T 150 ASP T 153 
BH 1 LEU T 86  ? ALA T 88  ? LEU T 86  ALA T 88  
BH 2 ALA T 134 ? SER T 142 ? ALA T 134 SER T 142 
BH 3 ALA T 191 ? LYS T 203 ? ALA T 191 LYS T 203 
BH 4 PHE T 171 ? THR T 184 ? PHE T 171 THR T 184 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N VAL A 76  ? N VAL A 76  O ALA A 103 ? O ALA A 103 
A  2 3 N ARG A 104 ? N ARG A 104 O LEU A 112 ? O LEU A 112 
A  3 4 O TYR A 113 ? O TYR A 113 N THR A 56  ? N THR A 56  
A  4 5 N PHE A 52  ? N PHE A 52  O ILE A 117 ? O ILE A 117 
A  5 6 O ARG A 118 ? O ARG A 118 N GLU A 96  ? N GLU A 96  
B  1 2 N VAL A 76  ? N VAL A 76  O ALA A 103 ? O ALA A 103 
B  2 3 N ARG A 104 ? N ARG A 104 O LEU A 112 ? O LEU A 112 
B  3 4 O TYR A 113 ? O TYR A 113 N THR A 56  ? N THR A 56  
B  4 5 O VAL A 51  ? O VAL A 51  N ILE A 36  ? N ILE A 36  
B  5 6 N VAL A 29  ? N VAL A 29  O SER A 151 ? O SER A 151 
C  1 2 N ALA A 87  ? N ALA A 87  O GLY A 141 ? O GLY A 141 
C  2 3 N ILE A 140 ? N ILE A 140 O VAL A 195 ? O VAL A 195 
C  3 4 O GLU A 196 ? O GLU A 196 N LYS A 179 ? N LYS A 179 
D  1 2 N VAL B 76  ? N VAL B 76  O ALA B 103 ? O ALA B 103 
D  2 3 N ARG B 104 ? N ARG B 104 O LEU B 112 ? O LEU B 112 
D  3 4 O TYR B 113 ? O TYR B 113 N THR B 56  ? N THR B 56  
D  4 5 N PHE B 52  ? N PHE B 52  O ILE B 117 ? O ILE B 117 
D  5 6 O ARG B 118 ? O ARG B 118 N GLU B 96  ? N GLU B 96  
E  1 2 N VAL B 76  ? N VAL B 76  O ALA B 103 ? O ALA B 103 
E  2 3 N ARG B 104 ? N ARG B 104 O LEU B 112 ? O LEU B 112 
E  3 4 O TYR B 113 ? O TYR B 113 N THR B 56  ? N THR B 56  
E  4 5 O THR B 57  ? O THR B 57  N SER B 30  ? N SER B 30  
E  5 6 N VAL B 29  ? N VAL B 29  O SER B 151 ? O SER B 151 
F  1 2 N ALA B 87  ? N ALA B 87  O GLY B 141 ? O GLY B 141 
F  2 3 N ILE B 140 ? N ILE B 140 O VAL B 195 ? O VAL B 195 
F  3 4 O GLU B 196 ? O GLU B 196 N LYS B 179 ? N LYS B 179 
G  1 2 N VAL C 76  ? N VAL C 76  O ALA C 103 ? O ALA C 103 
G  2 3 N ARG C 104 ? N ARG C 104 O LEU C 112 ? O LEU C 112 
G  3 4 O TYR C 113 ? O TYR C 113 N THR C 56  ? N THR C 56  
G  4 5 N PHE C 52  ? N PHE C 52  O ILE C 117 ? O ILE C 117 
G  5 6 O ARG C 118 ? O ARG C 118 N GLU C 96  ? N GLU C 96  
H  1 2 N VAL C 76  ? N VAL C 76  O ALA C 103 ? O ALA C 103 
H  2 3 N ARG C 104 ? N ARG C 104 O LEU C 112 ? O LEU C 112 
H  3 4 O TYR C 113 ? O TYR C 113 N THR C 56  ? N THR C 56  
H  4 5 O VAL C 51  ? O VAL C 51  N ILE C 36  ? N ILE C 36  
H  5 6 N VAL C 29  ? N VAL C 29  O SER C 151 ? O SER C 151 
I  1 2 N ALA C 87  ? N ALA C 87  O GLY C 141 ? O GLY C 141 
I  2 3 N ILE C 140 ? N ILE C 140 O VAL C 195 ? O VAL C 195 
I  3 4 O GLU C 196 ? O GLU C 196 N LYS C 179 ? N LYS C 179 
J  1 2 N VAL D 76  ? N VAL D 76  O ALA D 103 ? O ALA D 103 
J  2 3 N ARG D 104 ? N ARG D 104 O LEU D 112 ? O LEU D 112 
J  3 4 O VAL D 111 ? O VAL D 111 N TRP D 58  ? N TRP D 58  
J  4 5 N PHE D 52  ? N PHE D 52  O ILE D 117 ? O ILE D 117 
J  5 6 O ARG D 118 ? O ARG D 118 N GLU D 96  ? N GLU D 96  
K  1 2 N VAL D 76  ? N VAL D 76  O ALA D 103 ? O ALA D 103 
K  2 3 N ARG D 104 ? N ARG D 104 O LEU D 112 ? O LEU D 112 
K  3 4 O VAL D 111 ? O VAL D 111 N TRP D 58  ? N TRP D 58  
K  4 5 O VAL D 51  ? O VAL D 51  N ILE D 36  ? N ILE D 36  
K  5 6 N VAL D 29  ? N VAL D 29  O SER D 151 ? O SER D 151 
L  1 2 N ALA D 87  ? N ALA D 87  O GLY D 141 ? O GLY D 141 
L  2 3 N CYS D 136 ? N CYS D 136 O LEU D 199 ? O LEU D 199 
L  3 4 O GLU D 196 ? O GLU D 196 N LYS D 179 ? N LYS D 179 
M  1 2 N VAL E 76  ? N VAL E 76  O ALA E 103 ? O ALA E 103 
M  2 3 N ARG E 104 ? N ARG E 104 O LEU E 112 ? O LEU E 112 
M  3 4 O TYR E 113 ? O TYR E 113 N THR E 56  ? N THR E 56  
M  4 5 N PHE E 52  ? N PHE E 52  O ILE E 117 ? O ILE E 117 
M  5 6 O ARG E 118 ? O ARG E 118 N GLU E 96  ? N GLU E 96  
N  1 2 N VAL E 76  ? N VAL E 76  O ALA E 103 ? O ALA E 103 
N  2 3 N ARG E 104 ? N ARG E 104 O LEU E 112 ? O LEU E 112 
N  3 4 O TYR E 113 ? O TYR E 113 N THR E 56  ? N THR E 56  
N  4 5 O VAL E 51  ? O VAL E 51  N ILE E 36  ? N ILE E 36  
N  5 6 N VAL E 29  ? N VAL E 29  O SER E 151 ? O SER E 151 
O  1 2 N ALA E 87  ? N ALA E 87  O GLY E 141 ? O GLY E 141 
O  2 3 N ILE E 140 ? N ILE E 140 O VAL E 195 ? O VAL E 195 
O  3 4 O GLU E 196 ? O GLU E 196 N LYS E 179 ? N LYS E 179 
P  1 2 N VAL F 76  ? N VAL F 76  O ALA F 103 ? O ALA F 103 
P  2 3 N ARG F 104 ? N ARG F 104 O LEU F 112 ? O LEU F 112 
P  3 4 O TYR F 113 ? O TYR F 113 N THR F 56  ? N THR F 56  
P  4 5 N PHE F 52  ? N PHE F 52  O ILE F 117 ? O ILE F 117 
P  5 6 O ARG F 118 ? O ARG F 118 N GLU F 96  ? N GLU F 96  
Q  1 2 N VAL F 76  ? N VAL F 76  O ALA F 103 ? O ALA F 103 
Q  2 3 N ARG F 104 ? N ARG F 104 O LEU F 112 ? O LEU F 112 
Q  3 4 O TYR F 113 ? O TYR F 113 N THR F 56  ? N THR F 56  
Q  4 5 O THR F 57  ? O THR F 57  N SER F 30  ? N SER F 30  
Q  5 6 N VAL F 29  ? N VAL F 29  O SER F 151 ? O SER F 151 
R  1 2 N ALA F 87  ? N ALA F 87  O GLY F 141 ? O GLY F 141 
R  2 3 N CYS F 136 ? N CYS F 136 O LEU F 199 ? O LEU F 199 
R  3 4 O GLU F 196 ? O GLU F 196 N LYS F 179 ? N LYS F 179 
S  1 2 N VAL G 76  ? N VAL G 76  O ALA G 103 ? O ALA G 103 
S  2 3 N ARG G 104 ? N ARG G 104 O LEU G 112 ? O LEU G 112 
S  3 4 O TYR G 113 ? O TYR G 113 N THR G 56  ? N THR G 56  
S  4 5 N PHE G 52  ? N PHE G 52  O ILE G 117 ? O ILE G 117 
S  5 6 O ARG G 118 ? O ARG G 118 N GLU G 96  ? N GLU G 96  
T  1 2 N VAL G 76  ? N VAL G 76  O ALA G 103 ? O ALA G 103 
T  2 3 N ARG G 104 ? N ARG G 104 O LEU G 112 ? O LEU G 112 
T  3 4 O TYR G 113 ? O TYR G 113 N THR G 56  ? N THR G 56  
T  4 5 O VAL G 51  ? O VAL G 51  N ILE G 36  ? N ILE G 36  
T  5 6 N VAL G 29  ? N VAL G 29  O SER G 151 ? O SER G 151 
U  1 2 N ALA G 87  ? N ALA G 87  O GLY G 141 ? O GLY G 141 
U  2 3 N CYS G 136 ? N CYS G 136 O LEU G 199 ? O LEU G 199 
U  3 4 O GLU G 196 ? O GLU G 196 N LYS G 179 ? N LYS G 179 
V  1 2 N VAL H 76  ? N VAL H 76  O ALA H 103 ? O ALA H 103 
V  2 3 N ARG H 104 ? N ARG H 104 O LEU H 112 ? O LEU H 112 
V  3 4 O TYR H 113 ? O TYR H 113 N THR H 56  ? N THR H 56  
V  4 5 N PHE H 52  ? N PHE H 52  O ILE H 117 ? O ILE H 117 
V  5 6 O ARG H 118 ? O ARG H 118 N GLU H 96  ? N GLU H 96  
W  1 2 N VAL H 76  ? N VAL H 76  O ALA H 103 ? O ALA H 103 
W  2 3 N ARG H 104 ? N ARG H 104 O LEU H 112 ? O LEU H 112 
W  3 4 O TYR H 113 ? O TYR H 113 N THR H 56  ? N THR H 56  
W  4 5 O VAL H 51  ? O VAL H 51  N ILE H 36  ? N ILE H 36  
W  5 6 N VAL H 29  ? N VAL H 29  O SER H 151 ? O SER H 151 
X  1 2 N ALA H 87  ? N ALA H 87  O GLY H 141 ? O GLY H 141 
X  2 3 N ILE H 140 ? N ILE H 140 O VAL H 195 ? O VAL H 195 
X  3 4 O ASN H 200 ? O ASN H 200 N LEU H 174 ? N LEU H 174 
Y  1 2 N VAL I 76  ? N VAL I 76  O ALA I 103 ? O ALA I 103 
Y  2 3 N ARG I 104 ? N ARG I 104 O LEU I 112 ? O LEU I 112 
Y  3 4 O TYR I 113 ? O TYR I 113 N THR I 56  ? N THR I 56  
Y  4 5 N PHE I 52  ? N PHE I 52  O ILE I 117 ? O ILE I 117 
Y  5 6 O ARG I 118 ? O ARG I 118 N GLU I 96  ? N GLU I 96  
Z  1 2 N VAL I 76  ? N VAL I 76  O ALA I 103 ? O ALA I 103 
Z  2 3 N ARG I 104 ? N ARG I 104 O LEU I 112 ? O LEU I 112 
Z  3 4 O TYR I 113 ? O TYR I 113 N THR I 56  ? N THR I 56  
Z  4 5 O VAL I 51  ? O VAL I 51  N ILE I 36  ? N ILE I 36  
Z  5 6 N VAL I 29  ? N VAL I 29  O SER I 151 ? O SER I 151 
AA 1 2 N ALA I 87  ? N ALA I 87  O GLY I 141 ? O GLY I 141 
AA 2 3 N ALA I 134 ? N ALA I 134 O PHE I 201 ? O PHE I 201 
AA 3 4 O GLU I 196 ? O GLU I 196 N LYS I 179 ? N LYS I 179 
AB 1 2 N VAL J 76  ? N VAL J 76  O ALA J 103 ? O ALA J 103 
AB 2 3 N ARG J 104 ? N ARG J 104 O LEU J 112 ? O LEU J 112 
AB 3 4 O TYR J 113 ? O TYR J 113 N THR J 56  ? N THR J 56  
AB 4 5 N PHE J 52  ? N PHE J 52  O ILE J 117 ? O ILE J 117 
AB 5 6 O ARG J 118 ? O ARG J 118 N GLU J 96  ? N GLU J 96  
AC 1 2 N VAL J 76  ? N VAL J 76  O ALA J 103 ? O ALA J 103 
AC 2 3 N ARG J 104 ? N ARG J 104 O LEU J 112 ? O LEU J 112 
AC 3 4 O TYR J 113 ? O TYR J 113 N THR J 56  ? N THR J 56  
AC 4 5 O VAL J 51  ? O VAL J 51  N ILE J 36  ? N ILE J 36  
AC 5 6 N VAL J 31  ? N VAL J 31  O ASP J 153 ? O ASP J 153 
AD 1 2 N ALA J 87  ? N ALA J 87  O GLY J 141 ? O GLY J 141 
AD 2 3 N ILE J 138 ? N ILE J 138 O VAL J 197 ? O VAL J 197 
AD 3 4 O SER J 198 ? O SER J 198 N THR J 177 ? N THR J 177 
AE 1 2 N VAL K 76  ? N VAL K 76  O ALA K 103 ? O ALA K 103 
AE 2 3 N ARG K 104 ? N ARG K 104 O LEU K 112 ? O LEU K 112 
AE 3 4 O TYR K 113 ? O TYR K 113 N THR K 56  ? N THR K 56  
AE 4 5 N PHE K 52  ? N PHE K 52  O ILE K 117 ? O ILE K 117 
AE 5 6 O ARG K 118 ? O ARG K 118 N GLU K 96  ? N GLU K 96  
AF 1 2 N VAL K 76  ? N VAL K 76  O ALA K 103 ? O ALA K 103 
AF 2 3 N ARG K 104 ? N ARG K 104 O LEU K 112 ? O LEU K 112 
AF 3 4 O TYR K 113 ? O TYR K 113 N THR K 56  ? N THR K 56  
AF 4 5 O TRP K 53  ? O TRP K 53  N LYS K 34  ? N LYS K 34  
AF 5 6 N VAL K 29  ? N VAL K 29  O SER K 151 ? O SER K 151 
AG 1 2 N ALA K 87  ? N ALA K 87  O GLY K 141 ? O GLY K 141 
AG 2 3 N ILE K 140 ? N ILE K 140 O VAL K 195 ? O VAL K 195 
AG 3 4 O GLU K 196 ? O GLU K 196 N LYS K 179 ? N LYS K 179 
AH 1 2 N VAL L 76  ? N VAL L 76  O ALA L 103 ? O ALA L 103 
AH 2 3 N ARG L 104 ? N ARG L 104 O LEU L 112 ? O LEU L 112 
AH 3 4 O TYR L 113 ? O TYR L 113 N THR L 56  ? N THR L 56  
AH 4 5 N PHE L 52  ? N PHE L 52  O ILE L 117 ? O ILE L 117 
AH 5 6 O ARG L 118 ? O ARG L 118 N GLU L 96  ? N GLU L 96  
AI 1 2 N VAL L 76  ? N VAL L 76  O ALA L 103 ? O ALA L 103 
AI 2 3 N ARG L 104 ? N ARG L 104 O LEU L 112 ? O LEU L 112 
AI 3 4 O TYR L 113 ? O TYR L 113 N THR L 56  ? N THR L 56  
AI 4 5 O VAL L 51  ? O VAL L 51  N ILE L 36  ? N ILE L 36  
AI 5 6 N VAL L 29  ? N VAL L 29  O SER L 151 ? O SER L 151 
AJ 1 2 N ALA L 87  ? N ALA L 87  O GLY L 141 ? O GLY L 141 
AJ 2 3 N ILE L 140 ? N ILE L 140 O VAL L 195 ? O VAL L 195 
AJ 3 4 O GLU L 196 ? O GLU L 196 N LYS L 179 ? N LYS L 179 
AK 1 2 N VAL M 76  ? N VAL M 76  O ALA M 103 ? O ALA M 103 
AK 2 3 N ARG M 104 ? N ARG M 104 O LEU M 112 ? O LEU M 112 
AK 3 4 O TYR M 113 ? O TYR M 113 N THR M 56  ? N THR M 56  
AK 4 5 N PHE M 52  ? N PHE M 52  O ILE M 117 ? O ILE M 117 
AK 5 6 O ARG M 118 ? O ARG M 118 N GLU M 96  ? N GLU M 96  
AL 1 2 N VAL M 76  ? N VAL M 76  O ALA M 103 ? O ALA M 103 
AL 2 3 N ARG M 104 ? N ARG M 104 O LEU M 112 ? O LEU M 112 
AL 3 4 O TYR M 113 ? O TYR M 113 N THR M 56  ? N THR M 56  
AL 4 5 O VAL M 51  ? O VAL M 51  N ILE M 36  ? N ILE M 36  
AL 5 6 N VAL M 29  ? N VAL M 29  O SER M 151 ? O SER M 151 
AM 1 2 N ALA M 87  ? N ALA M 87  O GLY M 141 ? O GLY M 141 
AM 2 3 N CYS M 136 ? N CYS M 136 O LEU M 199 ? O LEU M 199 
AM 3 4 O GLU M 196 ? O GLU M 196 N LYS M 179 ? N LYS M 179 
AN 1 2 N VAL N 76  ? N VAL N 76  O ALA N 103 ? O ALA N 103 
AN 2 3 N ARG N 104 ? N ARG N 104 O LEU N 112 ? O LEU N 112 
AN 3 4 O TYR N 113 ? O TYR N 113 N THR N 56  ? N THR N 56  
AN 4 5 N PHE N 52  ? N PHE N 52  O ILE N 117 ? O ILE N 117 
AN 5 6 O ARG N 118 ? O ARG N 118 N GLU N 96  ? N GLU N 96  
AO 1 2 N VAL N 76  ? N VAL N 76  O ALA N 103 ? O ALA N 103 
AO 2 3 N ARG N 104 ? N ARG N 104 O LEU N 112 ? O LEU N 112 
AO 3 4 O TYR N 113 ? O TYR N 113 N THR N 56  ? N THR N 56  
AO 4 5 O VAL N 51  ? O VAL N 51  N ILE N 36  ? N ILE N 36  
AO 5 6 N VAL N 29  ? N VAL N 29  O SER N 151 ? O SER N 151 
AP 1 2 N ALA N 87  ? N ALA N 87  O GLY N 141 ? O GLY N 141 
AP 2 3 N CYS N 136 ? N CYS N 136 O LEU N 199 ? O LEU N 199 
AP 3 4 O GLU N 196 ? O GLU N 196 N LYS N 179 ? N LYS N 179 
AQ 1 2 N VAL O 76  ? N VAL O 76  O ALA O 103 ? O ALA O 103 
AQ 2 3 N ARG O 104 ? N ARG O 104 O LEU O 112 ? O LEU O 112 
AQ 3 4 O TYR O 113 ? O TYR O 113 N THR O 56  ? N THR O 56  
AQ 4 5 N PHE O 52  ? N PHE O 52  O ILE O 117 ? O ILE O 117 
AQ 5 6 O ARG O 118 ? O ARG O 118 N GLU O 96  ? N GLU O 96  
AR 1 2 N VAL O 76  ? N VAL O 76  O ALA O 103 ? O ALA O 103 
AR 2 3 N ARG O 104 ? N ARG O 104 O LEU O 112 ? O LEU O 112 
AR 3 4 O TYR O 113 ? O TYR O 113 N THR O 56  ? N THR O 56  
AR 4 5 O VAL O 51  ? O VAL O 51  N ILE O 36  ? N ILE O 36  
AR 5 6 N VAL O 29  ? N VAL O 29  O SER O 151 ? O SER O 151 
AS 1 2 N ALA O 87  ? N ALA O 87  O GLY O 141 ? O GLY O 141 
AS 2 3 N ILE O 140 ? N ILE O 140 O VAL O 195 ? O VAL O 195 
AS 3 4 O GLU O 196 ? O GLU O 196 N LYS O 179 ? N LYS O 179 
AT 1 2 N VAL P 76  ? N VAL P 76  O ALA P 103 ? O ALA P 103 
AT 2 3 N ARG P 104 ? N ARG P 104 O LEU P 112 ? O LEU P 112 
AT 3 4 O TYR P 113 ? O TYR P 113 N THR P 56  ? N THR P 56  
AT 4 5 N PHE P 52  ? N PHE P 52  O ILE P 117 ? O ILE P 117 
AT 5 6 O ARG P 118 ? O ARG P 118 N GLU P 96  ? N GLU P 96  
AU 1 2 N VAL P 76  ? N VAL P 76  O ALA P 103 ? O ALA P 103 
AU 2 3 N ARG P 104 ? N ARG P 104 O LEU P 112 ? O LEU P 112 
AU 3 4 O TYR P 113 ? O TYR P 113 N THR P 56  ? N THR P 56  
AU 4 5 O VAL P 51  ? O VAL P 51  N ILE P 36  ? N ILE P 36  
AU 5 6 N VAL P 29  ? N VAL P 29  O SER P 151 ? O SER P 151 
AV 1 2 N ALA P 87  ? N ALA P 87  O GLY P 141 ? O GLY P 141 
AV 2 3 N ILE P 140 ? N ILE P 140 O VAL P 195 ? O VAL P 195 
AV 3 4 O GLU P 196 ? O GLU P 196 N LYS P 179 ? N LYS P 179 
AW 1 2 N VAL Q 76  ? N VAL Q 76  O ALA Q 103 ? O ALA Q 103 
AW 2 3 N ARG Q 104 ? N ARG Q 104 O LEU Q 112 ? O LEU Q 112 
AW 3 4 O TYR Q 113 ? O TYR Q 113 N THR Q 56  ? N THR Q 56  
AW 4 5 N PHE Q 52  ? N PHE Q 52  O ILE Q 117 ? O ILE Q 117 
AW 5 6 O ARG Q 118 ? O ARG Q 118 N GLU Q 96  ? N GLU Q 96  
AX 1 2 N VAL Q 76  ? N VAL Q 76  O ALA Q 103 ? O ALA Q 103 
AX 2 3 N ARG Q 104 ? N ARG Q 104 O LEU Q 112 ? O LEU Q 112 
AX 3 4 O TYR Q 113 ? O TYR Q 113 N THR Q 56  ? N THR Q 56  
AX 4 5 O VAL Q 51  ? O VAL Q 51  N ILE Q 36  ? N ILE Q 36  
AX 5 6 N VAL Q 29  ? N VAL Q 29  O SER Q 151 ? O SER Q 151 
AY 1 2 N ALA Q 87  ? N ALA Q 87  O GLY Q 141 ? O GLY Q 141 
AY 2 3 N ILE Q 140 ? N ILE Q 140 O VAL Q 195 ? O VAL Q 195 
AY 3 4 O ASN Q 200 ? O ASN Q 200 N LEU Q 174 ? N LEU Q 174 
AZ 1 2 N VAL R 76  ? N VAL R 76  O ALA R 103 ? O ALA R 103 
AZ 2 3 N ARG R 104 ? N ARG R 104 O LEU R 112 ? O LEU R 112 
AZ 3 4 O TYR R 113 ? O TYR R 113 N THR R 56  ? N THR R 56  
AZ 4 5 N PHE R 52  ? N PHE R 52  O ILE R 117 ? O ILE R 117 
AZ 5 6 O ARG R 118 ? O ARG R 118 N GLU R 96  ? N GLU R 96  
BA 1 2 N VAL R 76  ? N VAL R 76  O ALA R 103 ? O ALA R 103 
BA 2 3 N ARG R 104 ? N ARG R 104 O LEU R 112 ? O LEU R 112 
BA 3 4 O TYR R 113 ? O TYR R 113 N THR R 56  ? N THR R 56  
BA 4 5 O VAL R 51  ? O VAL R 51  N ILE R 36  ? N ILE R 36  
BA 5 6 N VAL R 29  ? N VAL R 29  O SER R 151 ? O SER R 151 
BB 1 2 N ALA R 87  ? N ALA R 87  O GLY R 141 ? O GLY R 141 
BB 2 3 N CYS R 136 ? N CYS R 136 O LEU R 199 ? O LEU R 199 
BB 3 4 O GLU R 196 ? O GLU R 196 N LYS R 179 ? N LYS R 179 
BC 1 2 N VAL S 76  ? N VAL S 76  O ALA S 103 ? O ALA S 103 
BC 2 3 N ARG S 104 ? N ARG S 104 O LEU S 112 ? O LEU S 112 
BC 3 4 O TYR S 113 ? O TYR S 113 N THR S 56  ? N THR S 56  
BC 4 5 N PHE S 52  ? N PHE S 52  O ILE S 117 ? O ILE S 117 
BC 5 6 O ARG S 118 ? O ARG S 118 N GLU S 96  ? N GLU S 96  
BD 1 2 N VAL S 76  ? N VAL S 76  O ALA S 103 ? O ALA S 103 
BD 2 3 N ARG S 104 ? N ARG S 104 O LEU S 112 ? O LEU S 112 
BD 3 4 O TYR S 113 ? O TYR S 113 N THR S 56  ? N THR S 56  
BD 4 5 O VAL S 51  ? O VAL S 51  N ILE S 36  ? N ILE S 36  
BD 5 6 N VAL S 29  ? N VAL S 29  O SER S 151 ? O SER S 151 
BE 1 2 N ALA S 87  ? N ALA S 87  O GLY S 141 ? O GLY S 141 
BE 2 3 N CYS S 136 ? N CYS S 136 O LEU S 199 ? O LEU S 199 
BE 3 4 O GLU S 196 ? O GLU S 196 N LYS S 179 ? N LYS S 179 
BF 1 2 N VAL T 76  ? N VAL T 76  O ALA T 103 ? O ALA T 103 
BF 2 3 N ARG T 104 ? N ARG T 104 O LEU T 112 ? O LEU T 112 
BF 3 4 O TYR T 113 ? O TYR T 113 N THR T 56  ? N THR T 56  
BF 4 5 N PHE T 52  ? N PHE T 52  O ILE T 117 ? O ILE T 117 
BF 5 6 O ARG T 118 ? O ARG T 118 N GLU T 96  ? N GLU T 96  
BG 1 2 N VAL T 76  ? N VAL T 76  O ALA T 103 ? O ALA T 103 
BG 2 3 N ARG T 104 ? N ARG T 104 O LEU T 112 ? O LEU T 112 
BG 3 4 O TYR T 113 ? O TYR T 113 N THR T 56  ? N THR T 56  
BG 4 5 O TRP T 53  ? O TRP T 53  N LYS T 34  ? N LYS T 34  
BG 5 6 N VAL T 29  ? N VAL T 29  O SER T 151 ? O SER T 151 
BH 1 2 N ALA T 87  ? N ALA T 87  O GLY T 141 ? O GLY T 141 
BH 2 3 N CYS T 136 ? N CYS T 136 O LEU T 199 ? O LEU T 199 
BH 3 4 O GLU T 196 ? O GLU T 196 N LYS T 179 ? N LYS T 179 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE 09R A 211' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 212' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE 09R B 211' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 212' 
AC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 B 213' 
AC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE 09R C 211' 
AC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE 09R D 211' 
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 D 212' 
AC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 D 213' 
BC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE 09R E 211' 
BC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 D 214' 
BC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE 09R F 211' 
BC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 F 212' 
BC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE 09R G 211' 
BC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 F 213' 
BC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE 09R H 211' 
BC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 H 212' 
BC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE 09R I 211' 
CC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 I 212' 
CC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE 09R J 211' 
CC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 J 212' 
CC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE 09R K 211' 
CC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 K 212' 
CC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE 09R L 211' 
CC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 L 212' 
CC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 L 213' 
CC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE 09R M 211' 
DC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE 09R N 211' 
DC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 N 212' 
DC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE 09R O 211' 
DC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE 09R P 211' 
DC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE 09R Q 211' 
DC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE 09R R 211' 
DC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 R 212' 
DC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE 09R S 211' 
DC9 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE 09R T 211' 
EC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 T 212' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 10 TYR A  89  ? TYR A 89  . ? 1_555 ? 
2   AC1 10 TRP A  143 ? TRP A 143 . ? 1_555 ? 
3   AC1 10 THR A  144 ? THR A 144 . ? 1_555 ? 
4   AC1 10 CYS A  187 ? CYS A 187 . ? 1_555 ? 
5   AC1 10 TYR A  192 ? TYR A 192 . ? 1_555 ? 
6   AC1 10 TRP B  53  ? TRP B 53  . ? 1_555 ? 
7   AC1 10 ARG B  104 ? ARG B 104 . ? 1_555 ? 
8   AC1 10 LEU B  112 ? LEU B 112 . ? 1_555 ? 
9   AC1 10 MET B  114 ? MET B 114 . ? 1_555 ? 
10  AC1 10 HOH GB .   ? HOH B 234 . ? 1_555 ? 
11  AC2 3  PRO A  71  ? PRO A 71  . ? 1_555 ? 
12  AC2 3  ASP A  72  ? ASP A 72  . ? 1_555 ? 
13  AC2 3  ARG E  148 ? ARG E 148 . ? 1_555 ? 
14  AC3 10 TYR B  89  ? TYR B 89  . ? 1_555 ? 
15  AC3 10 TRP B  143 ? TRP B 143 . ? 1_555 ? 
16  AC3 10 THR B  144 ? THR B 144 . ? 1_555 ? 
17  AC3 10 TYR B  185 ? TYR B 185 . ? 1_555 ? 
18  AC3 10 CYS B  187 ? CYS B 187 . ? 1_555 ? 
19  AC3 10 TYR B  192 ? TYR B 192 . ? 1_555 ? 
20  AC3 10 TRP C  53  ? TRP C 53  . ? 1_555 ? 
21  AC3 10 ARG C  104 ? ARG C 104 . ? 1_555 ? 
22  AC3 10 LEU C  112 ? LEU C 112 . ? 1_555 ? 
23  AC3 10 MET C  114 ? MET C 114 . ? 1_555 ? 
24  AC4 4  ARG A  148 ? ARG A 148 . ? 1_555 ? 
25  AC4 4  PRO B  71  ? PRO B 71  . ? 1_555 ? 
26  AC4 4  ASP B  72  ? ASP B 72  . ? 1_555 ? 
27  AC4 4  GLN B  73  ? GLN B 73  . ? 1_555 ? 
28  AC5 2  ARG B  148 ? ARG B 148 . ? 1_555 ? 
29  AC5 2  ASP C  72  ? ASP C 72  . ? 1_555 ? 
30  AC6 9  TYR C  89  ? TYR C 89  . ? 1_555 ? 
31  AC6 9  TRP C  143 ? TRP C 143 . ? 1_555 ? 
32  AC6 9  THR C  144 ? THR C 144 . ? 1_555 ? 
33  AC6 9  TYR C  192 ? TYR C 192 . ? 1_555 ? 
34  AC6 9  HOH HB .   ? HOH C 215 . ? 1_555 ? 
35  AC6 9  TRP D  53  ? TRP D 53  . ? 1_555 ? 
36  AC6 9  ARG D  104 ? ARG D 104 . ? 1_555 ? 
37  AC6 9  LEU D  112 ? LEU D 112 . ? 1_555 ? 
38  AC6 9  MET D  114 ? MET D 114 . ? 1_555 ? 
39  AC7 7  TYR D  89  ? TYR D 89  . ? 1_555 ? 
40  AC7 7  TRP D  143 ? TRP D 143 . ? 1_555 ? 
41  AC7 7  THR D  144 ? THR D 144 . ? 1_555 ? 
42  AC7 7  TRP E  53  ? TRP E 53  . ? 1_555 ? 
43  AC7 7  ARG E  104 ? ARG E 104 . ? 1_555 ? 
44  AC7 7  LEU E  112 ? LEU E 112 . ? 1_555 ? 
45  AC7 7  MET E  114 ? MET E 114 . ? 1_555 ? 
46  AC8 3  ARG M  148 ? ARG M 148 . ? 3_455 ? 
47  AC8 3  PRO N  71  ? PRO N 71  . ? 3_455 ? 
48  AC8 3  ASP N  72  ? ASP N 72  . ? 3_455 ? 
49  AC9 2  ARG C  148 ? ARG C 148 . ? 1_555 ? 
50  AC9 2  ASP D  72  ? ASP D 72  . ? 1_555 ? 
51  BC1 7  ARG A  104 ? ARG A 104 . ? 1_555 ? 
52  BC1 7  LEU A  112 ? LEU A 112 . ? 1_555 ? 
53  BC1 7  MET A  114 ? MET A 114 . ? 1_555 ? 
54  BC1 7  TYR E  89  ? TYR E 89  . ? 1_555 ? 
55  BC1 7  TRP E  143 ? TRP E 143 . ? 1_555 ? 
56  BC1 7  THR E  144 ? THR E 144 . ? 1_555 ? 
57  BC1 7  TYR E  192 ? TYR E 192 . ? 1_555 ? 
58  BC2 4  ARG D  148 ? ARG D 148 . ? 1_555 ? 
59  BC2 4  PRO E  71  ? PRO E 71  . ? 1_555 ? 
60  BC2 4  ASP E  72  ? ASP E 72  . ? 1_555 ? 
61  BC2 4  GLN E  73  ? GLN E 73  . ? 1_555 ? 
62  BC3 9  TYR F  89  ? TYR F 89  . ? 1_555 ? 
63  BC3 9  TRP F  143 ? TRP F 143 . ? 1_555 ? 
64  BC3 9  THR F  144 ? THR F 144 . ? 1_555 ? 
65  BC3 9  TYR F  185 ? TYR F 185 . ? 1_555 ? 
66  BC3 9  TYR F  192 ? TYR F 192 . ? 1_555 ? 
67  BC3 9  ARG G  104 ? ARG G 104 . ? 1_555 ? 
68  BC3 9  LEU G  112 ? LEU G 112 . ? 1_555 ? 
69  BC3 9  MET G  114 ? MET G 114 . ? 1_555 ? 
70  BC3 9  HOH LB .   ? HOH G 216 . ? 1_555 ? 
71  BC4 3  ARG F  3   ? ARG F 3   . ? 1_555 ? 
72  BC4 3  ASP F  72  ? ASP F 72  . ? 1_555 ? 
73  BC4 3  ARG J  148 ? ARG J 148 . ? 1_555 ? 
74  BC5 9  TYR G  89  ? TYR G 89  . ? 1_555 ? 
75  BC5 9  TRP G  143 ? TRP G 143 . ? 1_555 ? 
76  BC5 9  THR G  144 ? THR G 144 . ? 1_555 ? 
77  BC5 9  TYR G  192 ? TYR G 192 . ? 1_555 ? 
78  BC5 9  TRP H  53  ? TRP H 53  . ? 1_555 ? 
79  BC5 9  ARG H  104 ? ARG H 104 . ? 1_555 ? 
80  BC5 9  LEU H  112 ? LEU H 112 . ? 1_555 ? 
81  BC5 9  MET H  114 ? MET H 114 . ? 1_555 ? 
82  BC5 9  HOH MB .   ? HOH H 218 . ? 1_555 ? 
83  BC6 4  ARG F  148 ? ARG F 148 . ? 1_555 ? 
84  BC6 4  ARG G  3   ? ARG G 3   . ? 1_555 ? 
85  BC6 4  PRO G  71  ? PRO G 71  . ? 1_555 ? 
86  BC6 4  ASP G  72  ? ASP G 72  . ? 1_555 ? 
87  BC7 9  TYR H  89  ? TYR H 89  . ? 1_555 ? 
88  BC7 9  TRP H  143 ? TRP H 143 . ? 1_555 ? 
89  BC7 9  THR H  144 ? THR H 144 . ? 1_555 ? 
90  BC7 9  TYR H  192 ? TYR H 192 . ? 1_555 ? 
91  BC7 9  HOH MB .   ? HOH H 213 . ? 1_555 ? 
92  BC7 9  TRP I  53  ? TRP I 53  . ? 1_555 ? 
93  BC7 9  ARG I  104 ? ARG I 104 . ? 1_555 ? 
94  BC7 9  LEU I  112 ? LEU I 112 . ? 1_555 ? 
95  BC7 9  MET I  114 ? MET I 114 . ? 1_555 ? 
96  BC8 3  ARG G  148 ? ARG G 148 . ? 1_555 ? 
97  BC8 3  PRO H  71  ? PRO H 71  . ? 1_555 ? 
98  BC8 3  ASP H  72  ? ASP H 72  . ? 1_555 ? 
99  BC9 8  TYR I  89  ? TYR I 89  . ? 1_555 ? 
100 BC9 8  TRP I  143 ? TRP I 143 . ? 1_555 ? 
101 BC9 8  THR I  144 ? THR I 144 . ? 1_555 ? 
102 BC9 8  TRP J  53  ? TRP J 53  . ? 1_555 ? 
103 BC9 8  ARG J  104 ? ARG J 104 . ? 1_555 ? 
104 BC9 8  LEU J  112 ? LEU J 112 . ? 1_555 ? 
105 BC9 8  MET J  114 ? MET J 114 . ? 1_555 ? 
106 BC9 8  HOH OB .   ? HOH J 224 . ? 1_555 ? 
107 CC1 2  PRO I  71  ? PRO I 71  . ? 1_555 ? 
108 CC1 2  ASP I  72  ? ASP I 72  . ? 1_555 ? 
109 CC2 8  TRP F  53  ? TRP F 53  . ? 1_555 ? 
110 CC2 8  ARG F  104 ? ARG F 104 . ? 1_555 ? 
111 CC2 8  LEU F  112 ? LEU F 112 . ? 1_555 ? 
112 CC2 8  MET F  114 ? MET F 114 . ? 1_555 ? 
113 CC2 8  TYR J  89  ? TYR J 89  . ? 1_555 ? 
114 CC2 8  TRP J  143 ? TRP J 143 . ? 1_555 ? 
115 CC2 8  THR J  144 ? THR J 144 . ? 1_555 ? 
116 CC2 8  TYR J  192 ? TYR J 192 . ? 1_555 ? 
117 CC3 3  PRO J  71  ? PRO J 71  . ? 1_555 ? 
118 CC3 3  ASP J  72  ? ASP J 72  . ? 1_555 ? 
119 CC3 3  GLN J  73  ? GLN J 73  . ? 1_555 ? 
120 CC4 8  TYR K  89  ? TYR K 89  . ? 1_555 ? 
121 CC4 8  TRP K  143 ? TRP K 143 . ? 1_555 ? 
122 CC4 8  THR K  144 ? THR K 144 . ? 1_555 ? 
123 CC4 8  TYR K  185 ? TYR K 185 . ? 1_555 ? 
124 CC4 8  TYR K  192 ? TYR K 192 . ? 1_555 ? 
125 CC4 8  ARG L  104 ? ARG L 104 . ? 1_555 ? 
126 CC4 8  LEU L  112 ? LEU L 112 . ? 1_555 ? 
127 CC4 8  MET L  114 ? MET L 114 . ? 1_555 ? 
128 CC5 3  PRO K  71  ? PRO K 71  . ? 1_555 ? 
129 CC5 3  ASP K  72  ? ASP K 72  . ? 1_555 ? 
130 CC5 3  ARG O  148 ? ARG O 148 . ? 1_555 ? 
131 CC6 9  TYR L  89  ? TYR L 89  . ? 1_555 ? 
132 CC6 9  TRP L  143 ? TRP L 143 . ? 1_555 ? 
133 CC6 9  THR L  144 ? THR L 144 . ? 1_555 ? 
134 CC6 9  CYS L  187 ? CYS L 187 . ? 1_555 ? 
135 CC6 9  TYR L  192 ? TYR L 192 . ? 1_555 ? 
136 CC6 9  ARG M  104 ? ARG M 104 . ? 1_555 ? 
137 CC6 9  LEU M  112 ? LEU M 112 . ? 1_555 ? 
138 CC6 9  MET M  114 ? MET M 114 . ? 1_555 ? 
139 CC6 9  HOH RB .   ? HOH M 266 . ? 1_555 ? 
140 CC7 4  ARG K  148 ? ARG K 148 . ? 1_555 ? 
141 CC7 4  PRO L  71  ? PRO L 71  . ? 1_555 ? 
142 CC7 4  ASP L  72  ? ASP L 72  . ? 1_555 ? 
143 CC7 4  GLN L  73  ? GLN L 73  . ? 1_555 ? 
144 CC8 3  ARG L  148 ? ARG L 148 . ? 1_555 ? 
145 CC8 3  PRO M  71  ? PRO M 71  . ? 1_555 ? 
146 CC8 3  ASP M  72  ? ASP M 72  . ? 1_555 ? 
147 CC9 8  TYR M  89  ? TYR M 89  . ? 1_555 ? 
148 CC9 8  TRP M  143 ? TRP M 143 . ? 1_555 ? 
149 CC9 8  THR M  144 ? THR M 144 . ? 1_555 ? 
150 CC9 8  TYR M  185 ? TYR M 185 . ? 1_555 ? 
151 CC9 8  TYR M  192 ? TYR M 192 . ? 1_555 ? 
152 CC9 8  ARG N  104 ? ARG N 104 . ? 1_555 ? 
153 CC9 8  LEU N  112 ? LEU N 112 . ? 1_555 ? 
154 CC9 8  MET N  114 ? MET N 114 . ? 1_555 ? 
155 DC1 9  TYR N  89  ? TYR N 89  . ? 1_555 ? 
156 DC1 9  TRP N  143 ? TRP N 143 . ? 1_555 ? 
157 DC1 9  THR N  144 ? THR N 144 . ? 1_555 ? 
158 DC1 9  TYR N  192 ? TYR N 192 . ? 1_555 ? 
159 DC1 9  HOH SB .   ? HOH N 288 . ? 1_555 ? 
160 DC1 9  TRP O  53  ? TRP O 53  . ? 1_555 ? 
161 DC1 9  ARG O  104 ? ARG O 104 . ? 1_555 ? 
162 DC1 9  LEU O  112 ? LEU O 112 . ? 1_555 ? 
163 DC1 9  MET O  114 ? MET O 114 . ? 1_555 ? 
164 DC2 2  ARG N  148 ? ARG N 148 . ? 1_555 ? 
165 DC2 2  ASP O  72  ? ASP O 72  . ? 1_555 ? 
166 DC3 8  ARG K  104 ? ARG K 104 . ? 1_555 ? 
167 DC3 8  LEU K  112 ? LEU K 112 . ? 1_555 ? 
168 DC3 8  MET K  114 ? MET K 114 . ? 1_555 ? 
169 DC3 8  TYR O  89  ? TYR O 89  . ? 1_555 ? 
170 DC3 8  TRP O  143 ? TRP O 143 . ? 1_555 ? 
171 DC3 8  TYR O  185 ? TYR O 185 . ? 1_555 ? 
172 DC3 8  TYR O  192 ? TYR O 192 . ? 1_555 ? 
173 DC3 8  HOH TB .   ? HOH O 216 . ? 1_555 ? 
174 DC4 8  TYR P  89  ? TYR P 89  . ? 1_555 ? 
175 DC4 8  TRP P  143 ? TRP P 143 . ? 1_555 ? 
176 DC4 8  THR P  144 ? THR P 144 . ? 1_555 ? 
177 DC4 8  TYR P  185 ? TYR P 185 . ? 1_555 ? 
178 DC4 8  TYR P  192 ? TYR P 192 . ? 1_555 ? 
179 DC4 8  ARG Q  104 ? ARG Q 104 . ? 1_555 ? 
180 DC4 8  LEU Q  112 ? LEU Q 112 . ? 1_555 ? 
181 DC4 8  MET Q  114 ? MET Q 114 . ? 1_555 ? 
182 DC5 10 TYR Q  89  ? TYR Q 89  . ? 1_555 ? 
183 DC5 10 TRP Q  143 ? TRP Q 143 . ? 1_555 ? 
184 DC5 10 THR Q  144 ? THR Q 144 . ? 1_555 ? 
185 DC5 10 CYS Q  187 ? CYS Q 187 . ? 1_555 ? 
186 DC5 10 TYR Q  192 ? TYR Q 192 . ? 1_555 ? 
187 DC5 10 HOH VB .   ? HOH Q 337 . ? 1_555 ? 
188 DC5 10 TRP R  53  ? TRP R 53  . ? 1_555 ? 
189 DC5 10 ARG R  104 ? ARG R 104 . ? 1_555 ? 
190 DC5 10 LEU R  112 ? LEU R 112 . ? 1_555 ? 
191 DC5 10 MET R  114 ? MET R 114 . ? 1_555 ? 
192 DC6 7  TYR R  89  ? TYR R 89  . ? 1_555 ? 
193 DC6 7  TRP R  143 ? TRP R 143 . ? 1_555 ? 
194 DC6 7  CYS R  187 ? CYS R 187 . ? 1_555 ? 
195 DC6 7  TRP S  53  ? TRP S 53  . ? 1_555 ? 
196 DC6 7  ARG S  104 ? ARG S 104 . ? 1_555 ? 
197 DC6 7  LEU S  112 ? LEU S 112 . ? 1_555 ? 
198 DC6 7  MET S  114 ? MET S 114 . ? 1_555 ? 
199 DC7 5  ARG Q  148 ? ARG Q 148 . ? 1_555 ? 
200 DC7 5  PRO R  71  ? PRO R 71  . ? 1_555 ? 
201 DC7 5  ASP R  72  ? ASP R 72  . ? 1_555 ? 
202 DC7 5  ARG T  148 ? ARG T 148 . ? 1_554 ? 
203 DC7 5  HOH YB .   ? HOH T 370 . ? 1_554 ? 
204 DC8 8  TYR S  89  ? TYR S 89  . ? 1_555 ? 
205 DC8 8  TRP S  143 ? TRP S 143 . ? 1_555 ? 
206 DC8 8  THR S  144 ? THR S 144 . ? 1_555 ? 
207 DC8 8  TYR S  185 ? TYR S 185 . ? 1_555 ? 
208 DC8 8  TYR S  192 ? TYR S 192 . ? 1_555 ? 
209 DC8 8  ARG T  104 ? ARG T 104 . ? 1_555 ? 
210 DC8 8  LEU T  112 ? LEU T 112 . ? 1_555 ? 
211 DC8 8  MET T  114 ? MET T 114 . ? 1_555 ? 
212 DC9 9  ARG P  104 ? ARG P 104 . ? 1_555 ? 
213 DC9 9  LEU P  112 ? LEU P 112 . ? 1_555 ? 
214 DC9 9  MET P  114 ? MET P 114 . ? 1_555 ? 
215 DC9 9  HOH UB .   ? HOH P 315 . ? 1_555 ? 
216 DC9 9  TYR T  89  ? TYR T 89  . ? 1_555 ? 
217 DC9 9  SER T  142 ? SER T 142 . ? 1_555 ? 
218 DC9 9  TRP T  143 ? TRP T 143 . ? 1_555 ? 
219 DC9 9  THR T  144 ? THR T 144 . ? 1_555 ? 
220 DC9 9  TYR T  192 ? TYR T 192 . ? 1_555 ? 
221 EC1 3  ARG S  148 ? ARG S 148 . ? 1_555 ? 
222 EC1 3  PRO T  71  ? PRO T 71  . ? 1_555 ? 
223 EC1 3  ASP T  72  ? ASP T 72  . ? 1_555 ? 
# 
_atom_sites.entry_id                    3U8M 
_atom_sites.fract_transf_matrix[1][1]   0.004291 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003725 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013650 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . LEU A  1 1   ? -57.851  110.400 -23.866 1.00 44.45  ? 1   LEU A N   1 
ATOM   2     C  CA  . LEU A  1 1   ? -56.846  109.546 -23.262 1.00 37.38  ? 1   LEU A CA  1 
ATOM   3     C  C   . LEU A  1 1   ? -55.707  110.347 -22.651 1.00 40.91  ? 1   LEU A C   1 
ATOM   4     O  O   . LEU A  1 1   ? -55.106  111.179 -23.317 1.00 48.25  ? 1   LEU A O   1 
ATOM   5     C  CB  . LEU A  1 1   ? -56.268  108.606 -24.308 1.00 44.70  ? 1   LEU A CB  1 
ATOM   6     C  CG  . LEU A  1 1   ? -57.102  107.374 -24.626 1.00 46.20  ? 1   LEU A CG  1 
ATOM   7     C  CD1 . LEU A  1 1   ? -56.362  106.518 -25.639 1.00 44.35  ? 1   LEU A CD1 1 
ATOM   8     C  CD2 . LEU A  1 1   ? -57.362  106.599 -23.357 1.00 38.40  ? 1   LEU A CD2 1 
ATOM   9     N  N   . ASP A  1 2   ? -55.415  110.091 -21.381 1.00 45.21  ? 2   ASP A N   1 
ATOM   10    C  CA  . ASP A  1 2   ? -54.232  110.646 -20.733 1.00 27.77  ? 2   ASP A CA  1 
ATOM   11    C  C   . ASP A  1 2   ? -53.259  109.503 -20.454 1.00 35.97  ? 2   ASP A C   1 
ATOM   12    O  O   . ASP A  1 2   ? -53.581  108.335 -20.703 1.00 23.52  ? 2   ASP A O   1 
ATOM   13    C  CB  . ASP A  1 2   ? -54.597  111.410 -19.452 1.00 23.32  ? 2   ASP A CB  1 
ATOM   14    C  CG  . ASP A  1 2   ? -55.275  110.539 -18.422 1.00 42.62  ? 2   ASP A CG  1 
ATOM   15    O  OD1 . ASP A  1 2   ? -55.148  109.301 -18.516 1.00 39.81  ? 2   ASP A OD1 1 
ATOM   16    O  OD2 . ASP A  1 2   ? -55.933  111.092 -17.516 1.00 47.06  ? 2   ASP A OD2 1 
ATOM   17    N  N   . ARG A  1 3   ? -52.076  109.829 -19.941 1.00 23.19  ? 3   ARG A N   1 
ATOM   18    C  CA  . ARG A  1 3   ? -51.073  108.798 -19.703 1.00 32.10  ? 3   ARG A CA  1 
ATOM   19    C  C   . ARG A  1 3   ? -51.604  107.678 -18.832 1.00 27.28  ? 3   ARG A C   1 
ATOM   20    O  O   . ARG A  1 3   ? -51.473  106.501 -19.162 1.00 29.56  ? 3   ARG A O   1 
ATOM   21    C  CB  . ARG A  1 3   ? -49.803  109.388 -19.092 1.00 35.97  ? 3   ARG A CB  1 
ATOM   22    C  CG  . ARG A  1 3   ? -48.951  110.152 -20.089 1.00 30.47  ? 3   ARG A CG  1 
ATOM   23    C  CD  . ARG A  1 3   ? -47.780  110.799 -19.414 1.00 35.64  ? 3   ARG A CD  1 
ATOM   24    N  NE  . ARG A  1 3   ? -46.964  111.486 -20.395 1.00 49.82  ? 3   ARG A NE  1 
ATOM   25    C  CZ  . ARG A  1 3   ? -47.150  112.748 -20.744 1.00 55.27  ? 3   ARG A CZ  1 
ATOM   26    N  NH1 . ARG A  1 3   ? -48.120  113.446 -20.171 1.00 49.95  ? 3   ARG A NH1 1 
ATOM   27    N  NH2 . ARG A  1 3   ? -46.365  113.307 -21.659 1.00 65.26  ? 3   ARG A NH2 1 
ATOM   28    N  N   . ALA A  1 4   ? -52.212  108.051 -17.719 1.00 23.81  ? 4   ALA A N   1 
ATOM   29    C  CA  . ALA A  1 4   ? -52.842  107.067 -16.841 1.00 37.70  ? 4   ALA A CA  1 
ATOM   30    C  C   . ALA A  1 4   ? -53.756  106.080 -17.585 1.00 42.12  ? 4   ALA A C   1 
ATOM   31    O  O   . ALA A  1 4   ? -53.676  104.874 -17.361 1.00 42.05  ? 4   ALA A O   1 
ATOM   32    C  CB  . ALA A  1 4   ? -53.614  107.769 -15.731 1.00 26.86  ? 4   ALA A CB  1 
ATOM   33    N  N   . ASP A  1 5   ? -54.621  106.583 -18.463 1.00 22.46  ? 5   ASP A N   1 
ATOM   34    C  CA  . ASP A  1 5   ? -55.521  105.699 -19.201 1.00 34.40  ? 5   ASP A CA  1 
ATOM   35    C  C   . ASP A  1 5   ? -54.754  104.760 -20.131 1.00 36.62  ? 5   ASP A C   1 
ATOM   36    O  O   . ASP A  1 5   ? -54.972  103.545 -20.133 1.00 31.60  ? 5   ASP A O   1 
ATOM   37    C  CB  . ASP A  1 5   ? -56.556  106.503 -19.994 1.00 23.22  ? 5   ASP A CB  1 
ATOM   38    C  CG  . ASP A  1 5   ? -57.449  107.364 -19.101 1.00 41.53  ? 5   ASP A CG  1 
ATOM   39    O  OD1 . ASP A  1 5   ? -57.712  106.966 -17.938 1.00 27.52  ? 5   ASP A OD1 1 
ATOM   40    O  OD2 . ASP A  1 5   ? -57.870  108.448 -19.571 1.00 45.45  ? 5   ASP A OD2 1 
ATOM   41    N  N   . ILE A  1 6   ? -53.850  105.325 -20.921 1.00 25.19  ? 6   ILE A N   1 
ATOM   42    C  CA  . ILE A  1 6   ? -53.019  104.515 -21.799 1.00 24.52  ? 6   ILE A CA  1 
ATOM   43    C  C   . ILE A  1 6   ? -52.312  103.393 -21.022 1.00 34.51  ? 6   ILE A C   1 
ATOM   44    O  O   . ILE A  1 6   ? -52.358  102.226 -21.426 1.00 32.41  ? 6   ILE A O   1 
ATOM   45    C  CB  . ILE A  1 6   ? -51.966  105.379 -22.540 1.00 26.16  ? 6   ILE A CB  1 
ATOM   46    C  CG1 . ILE A  1 6   ? -52.642  106.472 -23.364 1.00 29.12  ? 6   ILE A CG1 1 
ATOM   47    C  CG2 . ILE A  1 6   ? -51.092  104.520 -23.429 1.00 24.84  ? 6   ILE A CG2 1 
ATOM   48    C  CD1 . ILE A  1 6   ? -51.684  107.496 -23.940 1.00 23.37  ? 6   ILE A CD1 1 
ATOM   49    N  N   . LEU A  1 7   ? -51.674  103.751 -19.902 1.00 25.04  ? 7   LEU A N   1 
ATOM   50    C  CA  . LEU A  1 7   ? -50.908  102.790 -19.106 1.00 24.69  ? 7   LEU A CA  1 
ATOM   51    C  C   . LEU A  1 7   ? -51.782  101.757 -18.420 1.00 26.75  ? 7   LEU A C   1 
ATOM   52    O  O   . LEU A  1 7   ? -51.380  100.618 -18.227 1.00 26.02  ? 7   LEU A O   1 
ATOM   53    C  CB  . LEU A  1 7   ? -50.034  103.501 -18.086 1.00 24.94  ? 7   LEU A CB  1 
ATOM   54    C  CG  . LEU A  1 7   ? -48.812  104.193 -18.690 1.00 25.30  ? 7   LEU A CG  1 
ATOM   55    C  CD1 . LEU A  1 7   ? -48.292  105.300 -17.810 1.00 32.45  ? 7   LEU A CD1 1 
ATOM   56    C  CD2 . LEU A  1 7   ? -47.714  103.194 -18.978 1.00 27.49  ? 7   LEU A CD2 1 
ATOM   57    N  N   . TYR A  1 8   ? -52.985  102.164 -18.049 1.00 25.29  ? 8   TYR A N   1 
ATOM   58    C  CA  . TYR A  1 8   ? -53.988  101.228 -17.563 1.00 28.62  ? 8   TYR A CA  1 
ATOM   59    C  C   . TYR A  1 8   ? -54.359  100.220 -18.652 1.00 34.19  ? 8   TYR A C   1 
ATOM   60    O  O   . TYR A  1 8   ? -54.333  99.013  -18.411 1.00 33.73  ? 8   TYR A O   1 
ATOM   61    C  CB  . TYR A  1 8   ? -55.230  101.988 -17.092 1.00 35.41  ? 8   TYR A CB  1 
ATOM   62    C  CG  . TYR A  1 8   ? -56.335  101.129 -16.493 1.00 45.78  ? 8   TYR A CG  1 
ATOM   63    C  CD1 . TYR A  1 8   ? -56.233  100.632 -15.198 1.00 53.14  ? 8   TYR A CD1 1 
ATOM   64    C  CD2 . TYR A  1 8   ? -57.494  100.844 -17.219 1.00 44.89  ? 8   TYR A CD2 1 
ATOM   65    C  CE1 . TYR A  1 8   ? -57.249  99.862  -14.644 1.00 65.13  ? 8   TYR A CE1 1 
ATOM   66    C  CE2 . TYR A  1 8   ? -58.517  100.073 -16.675 1.00 47.09  ? 8   TYR A CE2 1 
ATOM   67    C  CZ  . TYR A  1 8   ? -58.388  99.586  -15.384 1.00 67.58  ? 8   TYR A CZ  1 
ATOM   68    O  OH  . TYR A  1 8   ? -59.396  98.824  -14.829 1.00 69.09  ? 8   TYR A OH  1 
ATOM   69    N  N   . ASN A  1 9   ? -54.697  100.711 -19.846 1.00 21.52  ? 9   ASN A N   1 
ATOM   70    C  CA  . ASN A  1 9   ? -55.041  99.815  -20.944 1.00 23.62  ? 9   ASN A CA  1 
ATOM   71    C  C   . ASN A  1 9   ? -53.937  98.796  -21.173 1.00 32.52  ? 9   ASN A C   1 
ATOM   72    O  O   . ASN A  1 9   ? -54.200  97.597  -21.263 1.00 22.24  ? 9   ASN A O   1 
ATOM   73    C  CB  . ASN A  1 9   ? -55.336  100.581 -22.238 1.00 27.45  ? 9   ASN A CB  1 
ATOM   74    C  CG  . ASN A  1 9   ? -56.580  101.441 -22.139 1.00 36.41  ? 9   ASN A CG  1 
ATOM   75    O  OD1 . ASN A  1 9   ? -57.407  101.252 -21.248 1.00 36.69  ? 9   ASN A OD1 1 
ATOM   76    N  ND2 . ASN A  1 9   ? -56.719  102.393 -23.058 1.00 34.58  ? 9   ASN A ND2 1 
ATOM   77    N  N   . ILE A  1 10  ? -52.700  99.277  -21.247 1.00 25.08  ? 10  ILE A N   1 
ATOM   78    C  CA  . ILE A  1 10  ? -51.558  98.402  -21.502 1.00 26.39  ? 10  ILE A CA  1 
ATOM   79    C  C   . ILE A  1 10  ? -51.439  97.354  -20.403 1.00 34.25  ? 10  ILE A C   1 
ATOM   80    O  O   . ILE A  1 10  ? -51.290  96.164  -20.663 1.00 23.34  ? 10  ILE A O   1 
ATOM   81    C  CB  . ILE A  1 10  ? -50.265  99.201  -21.649 1.00 21.89  ? 10  ILE A CB  1 
ATOM   82    C  CG1 . ILE A  1 10  ? -50.202  99.855  -23.030 1.00 21.54  ? 10  ILE A CG1 1 
ATOM   83    C  CG2 . ILE A  1 10  ? -49.062  98.304  -21.440 1.00 25.19  ? 10  ILE A CG2 1 
ATOM   84    C  CD1 . ILE A  1 10  ? -49.156  100.920 -23.146 1.00 29.08  ? 10  ILE A CD1 1 
ATOM   85    N  N   . ARG A  1 11  ? -51.555  97.807  -19.168 1.00 30.93  ? 11  ARG A N   1 
ATOM   86    C  CA  . ARG A  1 11  ? -51.503  96.914  -18.023 1.00 38.39  ? 11  ARG A CA  1 
ATOM   87    C  C   . ARG A  1 11  ? -52.501  95.795  -18.195 1.00 25.97  ? 11  ARG A C   1 
ATOM   88    O  O   . ARG A  1 11  ? -52.142  94.614  -18.216 1.00 23.82  ? 11  ARG A O   1 
ATOM   89    C  CB  . ARG A  1 11  ? -51.793  97.681  -16.728 1.00 32.78  ? 11  ARG A CB  1 
ATOM   90    C  CG  . ARG A  1 11  ? -50.726  97.510  -15.666 1.00 28.31  ? 11  ARG A CG  1 
ATOM   91    C  CD  . ARG A  1 11  ? -50.968  96.252  -14.852 1.00 49.85  ? 11  ARG A CD  1 
ATOM   92    N  NE  . ARG A  1 11  ? -51.982  96.470  -13.819 1.00 68.73  ? 11  ARG A NE  1 
ATOM   93    C  CZ  . ARG A  1 11  ? -52.525  95.501  -13.088 1.00 70.78  ? 11  ARG A CZ  1 
ATOM   94    N  NH1 . ARG A  1 11  ? -53.435  95.800  -12.167 1.00 76.59  ? 11  ARG A NH1 1 
ATOM   95    N  NH2 . ARG A  1 11  ? -52.162  94.233  -13.283 1.00 40.23  ? 11  ARG A NH2 1 
ATOM   96    N  N   . GLN A  1 12  ? -53.757  96.179  -18.337 1.00 50.77  ? 12  GLN A N   1 
ATOM   97    C  CA  . GLN A  1 12  ? -54.837  95.209  -18.430 1.00 33.50  ? 12  GLN A CA  1 
ATOM   98    C  C   . GLN A  1 12  ? -54.752  94.315  -19.664 1.00 42.68  ? 12  GLN A C   1 
ATOM   99    O  O   . GLN A  1 12  ? -55.035  93.125  -19.605 1.00 33.47  ? 12  GLN A O   1 
ATOM   100   C  CB  . GLN A  1 12  ? -56.192  95.930  -18.443 1.00 40.67  ? 12  GLN A CB  1 
ATOM   101   C  CG  . GLN A  1 12  ? -56.519  96.691  -17.176 1.00 30.05  ? 12  GLN A CG  1 
ATOM   102   C  CD  . GLN A  1 12  ? -56.769  95.773  -16.026 1.00 33.72  ? 12  GLN A CD  1 
ATOM   103   O  OE1 . GLN A  1 12  ? -55.880  95.065  -15.578 1.00 31.42  ? 12  GLN A OE1 1 
ATOM   104   N  NE2 . GLN A  1 12  ? -57.993  95.761  -15.550 1.00 49.95  ? 12  GLN A NE2 1 
ATOM   105   N  N   . THR A  1 13  ? -54.387  94.907  -20.788 1.00 16.29  ? 13  THR A N   1 
ATOM   106   C  CA  . THR A  1 13  ? -54.718  94.323  -22.071 1.00 36.43  ? 13  THR A CA  1 
ATOM   107   C  C   . THR A  1 13  ? -53.497  93.741  -22.749 1.00 41.02  ? 13  THR A C   1 
ATOM   108   O  O   . THR A  1 13  ? -53.605  92.881  -23.624 1.00 51.02  ? 13  THR A O   1 
ATOM   109   C  CB  . THR A  1 13  ? -55.342  95.382  -22.982 1.00 27.60  ? 13  THR A CB  1 
ATOM   110   O  OG1 . THR A  1 13  ? -56.122  94.744  -23.991 1.00 54.89  ? 13  THR A OG1 1 
ATOM   111   C  CG2 . THR A  1 13  ? -54.269  96.203  -23.638 1.00 32.85  ? 13  THR A CG2 1 
ATOM   112   N  N   . SER A  1 14  ? -52.331  94.222  -22.346 1.00 37.12  ? 14  SER A N   1 
ATOM   113   C  CA  . SER A  1 14  ? -51.101  93.742  -22.935 1.00 39.43  ? 14  SER A CA  1 
ATOM   114   C  C   . SER A  1 14  ? -50.877  92.311  -22.468 1.00 49.39  ? 14  SER A C   1 
ATOM   115   O  O   . SER A  1 14  ? -51.315  91.914  -21.381 1.00 38.55  ? 14  SER A O   1 
ATOM   116   C  CB  . SER A  1 14  ? -49.933  94.656  -22.572 1.00 0.67   ? 14  SER A CB  1 
ATOM   117   O  OG  . SER A  1 14  ? -48.791  93.907  -22.219 1.00 32.97  ? 14  SER A OG  1 
ATOM   118   N  N   . ARG A  1 15  ? -50.224  91.528  -23.315 1.00 44.70  ? 15  ARG A N   1 
ATOM   119   C  CA  . ARG A  1 15  ? -50.003  90.120  -23.037 1.00 35.17  ? 15  ARG A CA  1 
ATOM   120   C  C   . ARG A  1 15  ? -48.515  89.821  -23.181 1.00 23.31  ? 15  ARG A C   1 
ATOM   121   O  O   . ARG A  1 15  ? -48.028  89.580  -24.284 1.00 48.58  ? 15  ARG A O   1 
ATOM   122   C  CB  . ARG A  1 15  ? -50.805  89.261  -24.024 1.00 57.73  ? 15  ARG A CB  1 
ATOM   123   C  CG  . ARG A  1 15  ? -52.332  89.476  -24.024 1.00 54.91  ? 15  ARG A CG  1 
ATOM   124   C  CD  . ARG A  1 15  ? -53.015  88.721  -22.874 1.00 69.43  ? 15  ARG A CD  1 
ATOM   125   N  NE  . ARG A  1 15  ? -52.802  87.276  -22.958 1.00 62.92  ? 15  ARG A NE  1 
ATOM   126   C  CZ  . ARG A  1 15  ? -53.608  86.440  -23.604 1.00 53.96  ? 15  ARG A CZ  1 
ATOM   127   N  NH1 . ARG A  1 15  ? -54.697  86.907  -24.212 1.00 34.61  ? 15  ARG A NH1 1 
ATOM   128   N  NH2 . ARG A  1 15  ? -53.327  85.142  -23.642 1.00 40.09  ? 15  ARG A NH2 1 
ATOM   129   N  N   . PRO A  1 16  ? -47.787  89.835  -22.067 1.00 34.63  ? 16  PRO A N   1 
ATOM   130   C  CA  . PRO A  1 16  ? -46.322  89.713  -22.063 1.00 34.54  ? 16  PRO A CA  1 
ATOM   131   C  C   . PRO A  1 16  ? -45.869  88.347  -22.552 1.00 27.82  ? 16  PRO A C   1 
ATOM   132   O  O   . PRO A  1 16  ? -44.723  88.180  -22.929 1.00 47.88  ? 16  PRO A O   1 
ATOM   133   C  CB  . PRO A  1 16  ? -45.959  89.874  -20.580 1.00 34.23  ? 16  PRO A CB  1 
ATOM   134   C  CG  . PRO A  1 16  ? -47.204  90.418  -19.910 1.00 34.60  ? 16  PRO A CG  1 
ATOM   135   C  CD  . PRO A  1 16  ? -48.351  89.911  -20.712 1.00 28.01  ? 16  PRO A CD  1 
ATOM   136   N  N   . ASP A  1 17  ? -46.784  87.388  -22.545 1.00 25.79  ? 17  ASP A N   1 
ATOM   137   C  CA  . ASP A  1 17  ? -46.471  85.997  -22.844 1.00 28.36  ? 17  ASP A CA  1 
ATOM   138   C  C   . ASP A  1 17  ? -46.672  85.655  -24.310 1.00 24.53  ? 17  ASP A C   1 
ATOM   139   O  O   . ASP A  1 17  ? -46.372  84.545  -24.742 1.00 49.92  ? 17  ASP A O   1 
ATOM   140   C  CB  . ASP A  1 17  ? -47.320  85.059  -21.959 1.00 37.66  ? 17  ASP A CB  1 
ATOM   141   C  CG  . ASP A  1 17  ? -48.818  85.403  -21.987 1.00 66.09  ? 17  ASP A CG  1 
ATOM   142   O  OD1 . ASP A  1 17  ? -49.166  86.606  -22.029 1.00 51.03  ? 17  ASP A OD1 1 
ATOM   143   O  OD2 . ASP A  1 17  ? -49.652  84.467  -21.959 1.00 72.29  ? 17  ASP A OD2 1 
ATOM   144   N  N   . VAL A  1 18  ? -47.165  86.621  -25.075 1.00 29.73  ? 18  VAL A N   1 
ATOM   145   C  CA  . VAL A  1 18  ? -47.646  86.370  -26.421 1.00 23.47  ? 18  VAL A CA  1 
ATOM   146   C  C   . VAL A  1 18  ? -46.865  87.146  -27.435 1.00 22.45  ? 18  VAL A C   1 
ATOM   147   O  O   . VAL A  1 18  ? -46.860  88.363  -27.420 1.00 22.32  ? 18  VAL A O   1 
ATOM   148   C  CB  . VAL A  1 18  ? -49.112  86.807  -26.566 1.00 31.71  ? 18  VAL A CB  1 
ATOM   149   C  CG1 . VAL A  1 18  ? -49.580  86.607  -28.003 1.00 23.24  ? 18  VAL A CG1 1 
ATOM   150   C  CG2 . VAL A  1 18  ? -50.011  86.060  -25.567 1.00 25.00  ? 18  VAL A CG2 1 
ATOM   151   N  N   . ILE A  1 19  ? -46.215  86.432  -28.336 1.00 28.29  ? 19  ILE A N   1 
ATOM   152   C  CA  . ILE A  1 19  ? -45.429  87.048  -29.398 1.00 20.70  ? 19  ILE A CA  1 
ATOM   153   C  C   . ILE A  1 19  ? -46.329  87.737  -30.429 1.00 24.15  ? 19  ILE A C   1 
ATOM   154   O  O   . ILE A  1 19  ? -47.199  87.103  -31.020 1.00 24.09  ? 19  ILE A O   1 
ATOM   155   C  CB  . ILE A  1 19  ? -44.520  85.989  -30.063 1.00 32.67  ? 19  ILE A CB  1 
ATOM   156   C  CG1 . ILE A  1 19  ? -43.584  86.628  -31.102 1.00 32.30  ? 19  ILE A CG1 1 
ATOM   157   C  CG2 . ILE A  1 19  ? -45.371  84.840  -30.623 1.00 20.18  ? 19  ILE A CG2 1 
ATOM   158   C  CD1 . ILE A  1 19  ? -42.568  85.666  -31.691 1.00 18.43  ? 19  ILE A CD1 1 
ATOM   159   N  N   . PRO A  1 20  ? -46.119  89.045  -30.641 1.00 20.00  ? 20  PRO A N   1 
ATOM   160   C  CA  . PRO A  1 20  ? -46.992  89.871  -31.475 1.00 19.76  ? 20  PRO A CA  1 
ATOM   161   C  C   . PRO A  1 20  ? -46.766  89.618  -32.966 1.00 33.79  ? 20  PRO A C   1 
ATOM   162   O  O   . PRO A  1 20  ? -46.608  90.555  -33.730 1.00 28.82  ? 20  PRO A O   1 
ATOM   163   C  CB  . PRO A  1 20  ? -46.585  91.293  -31.095 1.00 19.67  ? 20  PRO A CB  1 
ATOM   164   C  CG  . PRO A  1 20  ? -45.157  91.172  -30.762 1.00 19.35  ? 20  PRO A CG  1 
ATOM   165   C  CD  . PRO A  1 20  ? -44.951  89.803  -30.165 1.00 22.01  ? 20  PRO A CD  1 
ATOM   166   N  N   . THR A  1 21  ? -46.692  88.345  -33.338 1.00 26.91  ? 21  THR A N   1 
ATOM   167   C  CA  . THR A  1 21  ? -46.843  87.849  -34.711 1.00 24.90  ? 21  THR A CA  1 
ATOM   168   C  C   . THR A  1 21  ? -47.990  88.479  -35.505 1.00 33.63  ? 21  THR A C   1 
ATOM   169   O  O   . THR A  1 21  ? -49.116  88.564  -35.013 1.00 26.54  ? 21  THR A O   1 
ATOM   170   C  CB  . THR A  1 21  ? -47.206  86.357  -34.646 1.00 15.33  ? 21  THR A CB  1 
ATOM   171   O  OG1 . THR A  1 21  ? -46.094  85.602  -34.154 1.00 18.31  ? 21  THR A OG1 1 
ATOM   172   C  CG2 . THR A  1 21  ? -47.620  85.848  -35.996 1.00 31.45  ? 21  THR A CG2 1 
ATOM   173   N  N   . GLN A  1 22  ? -47.718  88.879  -36.746 1.00 50.53  ? 22  GLN A N   1 
ATOM   174   C  CA  . GLN A  1 22  ? -48.773  89.335  -37.667 1.00 45.81  ? 22  GLN A CA  1 
ATOM   175   C  C   . GLN A  1 22  ? -48.965  88.393  -38.868 1.00 46.12  ? 22  GLN A C   1 
ATOM   176   O  O   . GLN A  1 22  ? -48.146  88.363  -39.795 1.00 48.28  ? 22  GLN A O   1 
ATOM   177   C  CB  . GLN A  1 22  ? -48.491  90.752  -38.186 1.00 23.51  ? 22  GLN A CB  1 
ATOM   178   C  CG  . GLN A  1 22  ? -48.362  91.810  -37.124 1.00 39.08  ? 22  GLN A CG  1 
ATOM   179   C  CD  . GLN A  1 22  ? -48.203  93.203  -37.710 1.00 58.55  ? 22  GLN A CD  1 
ATOM   180   O  OE1 . GLN A  1 22  ? -47.464  94.034  -37.173 1.00 45.51  ? 22  GLN A OE1 1 
ATOM   181   N  NE2 . GLN A  1 22  ? -48.908  93.470  -38.810 1.00 76.41  ? 22  GLN A NE2 1 
ATOM   182   N  N   . ARG A  1 23  ? -50.055  87.635  -38.854 1.00 43.68  ? 23  ARG A N   1 
ATOM   183   C  CA  . ARG A  1 23  ? -50.380  86.742  -39.962 1.00 63.25  ? 23  ARG A CA  1 
ATOM   184   C  C   . ARG A  1 23  ? -49.308  85.671  -40.117 1.00 36.87  ? 23  ARG A C   1 
ATOM   185   O  O   . ARG A  1 23  ? -48.919  85.303  -41.229 1.00 25.27  ? 23  ARG A O   1 
ATOM   186   C  CB  . ARG A  1 23  ? -50.582  87.533  -41.264 1.00 84.53  ? 23  ARG A CB  1 
ATOM   187   C  CG  . ARG A  1 23  ? -51.965  88.192  -41.382 1.00 98.53  ? 23  ARG A CG  1 
ATOM   188   C  CD  . ARG A  1 23  ? -52.007  89.285  -42.456 1.00 100.34 ? 23  ARG A CD  1 
ATOM   189   N  NE  . ARG A  1 23  ? -51.197  90.445  -42.085 1.00 107.26 ? 23  ARG A NE  1 
ATOM   190   C  CZ  . ARG A  1 23  ? -51.664  91.522  -41.457 1.00 97.38  ? 23  ARG A CZ  1 
ATOM   191   N  NH1 . ARG A  1 23  ? -52.948  91.598  -41.128 1.00 76.38  ? 23  ARG A NH1 1 
ATOM   192   N  NH2 . ARG A  1 23  ? -50.843  92.523  -41.156 1.00 92.68  ? 23  ARG A NH2 1 
ATOM   193   N  N   . ASP A  1 24  ? -48.852  85.162  -38.981 1.00 35.20  ? 24  ASP A N   1 
ATOM   194   C  CA  . ASP A  1 24  ? -47.768  84.185  -38.945 1.00 56.22  ? 24  ASP A CA  1 
ATOM   195   C  C   . ASP A  1 24  ? -46.498  84.675  -39.633 1.00 39.00  ? 24  ASP A C   1 
ATOM   196   O  O   . ASP A  1 24  ? -45.769  83.874  -40.220 1.00 34.98  ? 24  ASP A O   1 
ATOM   197   C  CB  . ASP A  1 24  ? -48.217  82.831  -39.510 1.00 60.33  ? 24  ASP A CB  1 
ATOM   198   C  CG  . ASP A  1 24  ? -48.973  81.995  -38.482 1.00 89.40  ? 24  ASP A CG  1 
ATOM   199   O  OD1 . ASP A  1 24  ? -48.418  81.731  -37.390 1.00 86.60  ? 24  ASP A OD1 1 
ATOM   200   O  OD2 . ASP A  1 24  ? -50.133  81.615  -38.757 1.00 99.13  ? 24  ASP A OD2 1 
ATOM   201   N  N   . ARG A  1 25  ? -46.253  85.987  -39.560 1.00 20.46  ? 25  ARG A N   1 
ATOM   202   C  CA  . ARG A  1 25  ? -44.972  86.597  -39.967 1.00 33.30  ? 25  ARG A CA  1 
ATOM   203   C  C   . ARG A  1 25  ? -44.052  86.780  -38.751 1.00 12.26  ? 25  ARG A C   1 
ATOM   204   O  O   . ARG A  1 25  ? -44.530  86.962  -37.634 1.00 69.32  ? 25  ARG A O   1 
ATOM   205   C  CB  . ARG A  1 25  ? -45.194  87.970  -40.600 1.00 31.50  ? 25  ARG A CB  1 
ATOM   206   C  CG  . ARG A  1 25  ? -45.745  87.971  -42.000 1.00 38.85  ? 25  ARG A CG  1 
ATOM   207   C  CD  . ARG A  1 25  ? -45.417  89.306  -42.673 1.00 57.73  ? 25  ARG A CD  1 
ATOM   208   N  NE  . ARG A  1 25  ? -46.497  89.867  -43.494 1.00 84.47  ? 25  ARG A NE  1 
ATOM   209   C  CZ  . ARG A  1 25  ? -47.609  89.229  -43.859 1.00 66.23  ? 25  ARG A CZ  1 
ATOM   210   N  NH1 . ARG A  1 25  ? -47.816  87.969  -43.489 1.00 57.81  ? 25  ARG A NH1 1 
ATOM   211   N  NH2 . ARG A  1 25  ? -48.518  89.858  -44.605 1.00 27.84  ? 25  ARG A NH2 1 
ATOM   212   N  N   . PRO A  1 26  ? -42.731  86.761  -38.958 1.00 22.85  ? 26  PRO A N   1 
ATOM   213   C  CA  . PRO A  1 26  ? -41.922  86.905  -37.745 1.00 11.66  ? 26  PRO A CA  1 
ATOM   214   C  C   . PRO A  1 26  ? -41.863  88.346  -37.251 1.00 16.80  ? 26  PRO A C   1 
ATOM   215   O  O   . PRO A  1 26  ? -41.872  89.274  -38.057 1.00 15.60  ? 26  PRO A O   1 
ATOM   216   C  CB  . PRO A  1 26  ? -40.542  86.459  -38.198 1.00 18.65  ? 26  PRO A CB  1 
ATOM   217   C  CG  . PRO A  1 26  ? -40.513  86.811  -39.637 1.00 19.73  ? 26  PRO A CG  1 
ATOM   218   C  CD  . PRO A  1 26  ? -41.906  86.574  -40.163 1.00 16.73  ? 26  PRO A CD  1 
ATOM   219   N  N   . VAL A  1 27  ? -41.808  88.527  -35.933 1.00 21.88  ? 27  VAL A N   1 
ATOM   220   C  CA  . VAL A  1 27  ? -41.585  89.851  -35.374 1.00 22.77  ? 27  VAL A CA  1 
ATOM   221   C  C   . VAL A  1 27  ? -40.182  90.299  -35.731 1.00 17.57  ? 27  VAL A C   1 
ATOM   222   O  O   . VAL A  1 27  ? -39.212  89.606  -35.438 1.00 25.71  ? 27  VAL A O   1 
ATOM   223   C  CB  . VAL A  1 27  ? -41.703  89.843  -33.853 1.00 30.35  ? 27  VAL A CB  1 
ATOM   224   C  CG1 . VAL A  1 27  ? -41.513  91.254  -33.307 1.00 8.41   ? 27  VAL A CG1 1 
ATOM   225   C  CG2 . VAL A  1 27  ? -43.045  89.252  -33.441 1.00 35.56  ? 27  VAL A CG2 1 
ATOM   226   N  N   . ALA A  1 28  ? -40.073  91.450  -36.372 1.00 18.52  ? 28  ALA A N   1 
ATOM   227   C  CA  . ALA A  1 28  ? -38.761  91.991  -36.728 1.00 25.80  ? 28  ALA A CA  1 
ATOM   228   C  C   . ALA A  1 28  ? -38.149  92.765  -35.575 1.00 19.50  ? 28  ALA A C   1 
ATOM   229   O  O   . ALA A  1 28  ? -38.576  93.882  -35.279 1.00 8.42   ? 28  ALA A O   1 
ATOM   230   C  CB  . ALA A  1 28  ? -38.850  92.884  -37.970 1.00 8.65   ? 28  ALA A CB  1 
ATOM   231   N  N   . VAL A  1 29  ? -37.137  92.168  -34.945 1.00 19.83  ? 29  VAL A N   1 
ATOM   232   C  CA  . VAL A  1 29  ? -36.408  92.796  -33.844 1.00 12.49  ? 29  VAL A CA  1 
ATOM   233   C  C   . VAL A  1 29  ? -35.108  93.427  -34.318 1.00 13.88  ? 29  VAL A C   1 
ATOM   234   O  O   . VAL A  1 29  ? -34.290  92.780  -34.978 1.00 24.92  ? 29  VAL A O   1 
ATOM   235   C  CB  . VAL A  1 29  ? -36.067  91.771  -32.766 1.00 18.66  ? 29  VAL A CB  1 
ATOM   236   C  CG1 . VAL A  1 29  ? -35.390  92.444  -31.571 1.00 8.44   ? 29  VAL A CG1 1 
ATOM   237   C  CG2 . VAL A  1 29  ? -37.332  91.034  -32.350 1.00 13.57  ? 29  VAL A CG2 1 
ATOM   238   N  N   . SER A  1 30  ? -34.915  94.691  -33.962 1.00 22.96  ? 30  SER A N   1 
ATOM   239   C  CA  . SER A  1 30  ? -33.670  95.381  -34.251 1.00 17.16  ? 30  SER A CA  1 
ATOM   240   C  C   . SER A  1 30  ? -32.769  95.405  -33.015 1.00 31.99  ? 30  SER A C   1 
ATOM   241   O  O   . SER A  1 30  ? -33.220  95.752  -31.916 1.00 43.11  ? 30  SER A O   1 
ATOM   242   C  CB  . SER A  1 30  ? -33.950  96.794  -34.757 1.00 8.94   ? 30  SER A CB  1 
ATOM   243   O  OG  . SER A  1 30  ? -34.249  96.774  -36.142 1.00 47.75  ? 30  SER A OG  1 
ATOM   244   N  N   . VAL A  1 31  ? -31.506  95.014  -33.189 1.00 19.77  ? 31  VAL A N   1 
ATOM   245   C  CA  . VAL A  1 31  ? -30.546  95.037  -32.091 1.00 31.91  ? 31  VAL A CA  1 
ATOM   246   C  C   . VAL A  1 31  ? -29.283  95.793  -32.462 1.00 32.65  ? 31  VAL A C   1 
ATOM   247   O  O   . VAL A  1 31  ? -28.734  95.639  -33.561 1.00 26.10  ? 31  VAL A O   1 
ATOM   248   C  CB  . VAL A  1 31  ? -30.131  93.636  -31.636 1.00 28.15  ? 31  VAL A CB  1 
ATOM   249   C  CG1 . VAL A  1 31  ? -29.580  93.723  -30.238 1.00 28.29  ? 31  VAL A CG1 1 
ATOM   250   C  CG2 . VAL A  1 31  ? -31.310  92.696  -31.661 1.00 31.23  ? 31  VAL A CG2 1 
ATOM   251   N  N   . SER A  1 32  ? -28.822  96.604  -31.523 1.00 35.13  ? 32  SER A N   1 
ATOM   252   C  CA  . SER A  1 32  ? -27.631  97.413  -31.720 1.00 34.31  ? 32  SER A CA  1 
ATOM   253   C  C   . SER A  1 32  ? -26.970  97.619  -30.364 1.00 37.28  ? 32  SER A C   1 
ATOM   254   O  O   . SER A  1 32  ? -27.639  97.946  -29.385 1.00 44.10  ? 32  SER A O   1 
ATOM   255   C  CB  . SER A  1 32  ? -28.012  98.755  -32.361 1.00 34.92  ? 32  SER A CB  1 
ATOM   256   O  OG  . SER A  1 32  ? -26.891  99.604  -32.542 1.00 44.23  ? 32  SER A OG  1 
ATOM   257   N  N   . LEU A  1 33  ? -25.663  97.400  -30.291 1.00 36.20  ? 33  LEU A N   1 
ATOM   258   C  CA  . LEU A  1 33  ? -24.946  97.621  -29.041 1.00 14.02  ? 33  LEU A CA  1 
ATOM   259   C  C   . LEU A  1 33  ? -24.232  98.954  -29.089 1.00 23.71  ? 33  LEU A C   1 
ATOM   260   O  O   . LEU A  1 33  ? -23.453  99.200  -30.005 1.00 33.62  ? 33  LEU A O   1 
ATOM   261   C  CB  . LEU A  1 33  ? -23.948  96.500  -28.789 1.00 10.88  ? 33  LEU A CB  1 
ATOM   262   C  CG  . LEU A  1 33  ? -24.550  95.106  -28.705 1.00 12.50  ? 33  LEU A CG  1 
ATOM   263   C  CD1 . LEU A  1 33  ? -23.534  94.137  -28.208 1.00 11.30  ? 33  LEU A CD1 1 
ATOM   264   C  CD2 . LEU A  1 33  ? -25.755  95.108  -27.797 1.00 14.13  ? 33  LEU A CD2 1 
ATOM   265   N  N   . LYS A  1 34  ? -24.519  99.822  -28.122 1.00 24.14  ? 34  LYS A N   1 
ATOM   266   C  CA  . LYS A  1 34  ? -23.797  101.086 -27.979 1.00 22.04  ? 34  LYS A CA  1 
ATOM   267   C  C   . LYS A  1 34  ? -22.826  100.928 -26.821 1.00 17.84  ? 34  LYS A C   1 
ATOM   268   O  O   . LYS A  1 34  ? -23.238  100.934 -25.658 1.00 27.62  ? 34  LYS A O   1 
ATOM   269   C  CB  . LYS A  1 34  ? -24.751  102.245 -27.694 1.00 28.76  ? 34  LYS A CB  1 
ATOM   270   C  CG  . LYS A  1 34  ? -26.025  102.270 -28.533 1.00 41.46  ? 34  LYS A CG  1 
ATOM   271   C  CD  . LYS A  1 34  ? -25.770  102.685 -29.977 1.00 48.82  ? 34  LYS A CD  1 
ATOM   272   C  CE  . LYS A  1 34  ? -27.089  102.861 -30.718 1.00 57.27  ? 34  LYS A CE  1 
ATOM   273   N  NZ  . LYS A  1 34  ? -26.922  103.026 -32.188 1.00 61.22  ? 34  LYS A NZ  1 
ATOM   274   N  N   . PHE A  1 35  ? -21.542  100.762 -27.129 1.00 25.41  ? 35  PHE A N   1 
ATOM   275   C  CA  . PHE A  1 35  ? -20.548  100.482 -26.084 1.00 21.76  ? 35  PHE A CA  1 
ATOM   276   C  C   . PHE A  1 35  ? -20.224  101.708 -25.248 1.00 27.65  ? 35  PHE A C   1 
ATOM   277   O  O   . PHE A  1 35  ? -20.016  102.803 -25.773 1.00 20.98  ? 35  PHE A O   1 
ATOM   278   C  CB  . PHE A  1 35  ? -19.283  99.886  -26.663 1.00 13.27  ? 35  PHE A CB  1 
ATOM   279   C  CG  . PHE A  1 35  ? -19.472  98.513  -27.226 1.00 25.23  ? 35  PHE A CG  1 
ATOM   280   C  CD1 . PHE A  1 35  ? -19.449  97.406  -26.395 1.00 17.66  ? 35  PHE A CD1 1 
ATOM   281   C  CD2 . PHE A  1 35  ? -19.683  98.324  -28.585 1.00 27.19  ? 35  PHE A CD2 1 
ATOM   282   C  CE1 . PHE A  1 35  ? -19.631  96.128  -26.902 1.00 23.51  ? 35  PHE A CE1 1 
ATOM   283   C  CE2 . PHE A  1 35  ? -19.866  97.048  -29.107 1.00 28.04  ? 35  PHE A CE2 1 
ATOM   284   C  CZ  . PHE A  1 35  ? -19.838  95.949  -28.264 1.00 24.89  ? 35  PHE A CZ  1 
ATOM   285   N  N   . ILE A  1 36  ? -20.201  101.505 -23.938 1.00 26.08  ? 36  ILE A N   1 
ATOM   286   C  CA  . ILE A  1 36  ? -20.022  102.590 -22.981 1.00 28.33  ? 36  ILE A CA  1 
ATOM   287   C  C   . ILE A  1 36  ? -18.670  102.473 -22.283 1.00 32.02  ? 36  ILE A C   1 
ATOM   288   O  O   . ILE A  1 36  ? -18.014  103.472 -22.010 1.00 17.72  ? 36  ILE A O   1 
ATOM   289   C  CB  . ILE A  1 36  ? -21.138  102.572 -21.916 1.00 25.52  ? 36  ILE A CB  1 
ATOM   290   C  CG1 . ILE A  1 36  ? -22.496  102.452 -22.603 1.00 19.18  ? 36  ILE A CG1 1 
ATOM   291   C  CG2 . ILE A  1 36  ? -21.065  103.813 -21.037 1.00 11.22  ? 36  ILE A CG2 1 
ATOM   292   C  CD1 . ILE A  1 36  ? -22.819  103.627 -23.491 1.00 15.17  ? 36  ILE A CD1 1 
ATOM   293   N  N   . ASN A  1 37  ? -18.254  101.244 -22.004 1.00 19.89  ? 37  ASN A N   1 
ATOM   294   C  CA  . ASN A  1 37  ? -17.016  101.030 -21.287 1.00 12.93  ? 37  ASN A CA  1 
ATOM   295   C  C   . ASN A  1 37  ? -16.509  99.596  -21.408 1.00 24.75  ? 37  ASN A C   1 
ATOM   296   O  O   . ASN A  1 37  ? -17.284  98.646  -21.608 1.00 12.98  ? 37  ASN A O   1 
ATOM   297   C  CB  . ASN A  1 37  ? -17.194  101.412 -19.815 1.00 18.90  ? 37  ASN A CB  1 
ATOM   298   C  CG  . ASN A  1 37  ? -15.932  102.043 -19.204 1.00 37.27  ? 37  ASN A CG  1 
ATOM   299   O  OD1 . ASN A  1 37  ? -14.797  101.679 -19.542 1.00 18.03  ? 37  ASN A OD1 1 
ATOM   300   N  ND2 . ASN A  1 37  ? -16.134  102.990 -18.290 1.00 31.38  ? 37  ASN A ND2 1 
ATOM   301   N  N   . ILE A  1 38  ? -15.188  99.461  -21.311 1.00 29.65  ? 38  ILE A N   1 
ATOM   302   C  CA  . ILE A  1 38  ? -14.543  98.159  -21.234 1.00 14.77  ? 38  ILE A CA  1 
ATOM   303   C  C   . ILE A  1 38  ? -13.739  98.177  -19.949 1.00 32.95  ? 38  ILE A C   1 
ATOM   304   O  O   . ILE A  1 38  ? -12.848  99.029  -19.769 1.00 31.61  ? 38  ILE A O   1 
ATOM   305   C  CB  . ILE A  1 38  ? -13.657  97.896  -22.453 1.00 24.96  ? 38  ILE A CB  1 
ATOM   306   C  CG1 . ILE A  1 38  ? -14.478  98.048  -23.731 1.00 20.96  ? 38  ILE A CG1 1 
ATOM   307   C  CG2 . ILE A  1 38  ? -13.066  96.504  -22.394 1.00 22.54  ? 38  ILE A CG2 1 
ATOM   308   C  CD1 . ILE A  1 38  ? -13.705  97.838  -25.000 1.00 20.23  ? 38  ILE A CD1 1 
ATOM   309   N  N   . LEU A  1 39  ? -14.075  97.258  -19.045 1.00 29.54  ? 39  LEU A N   1 
ATOM   310   C  CA  . LEU A  1 39  ? -13.655  97.385  -17.646 1.00 28.44  ? 39  LEU A CA  1 
ATOM   311   C  C   . LEU A  1 39  ? -12.470  96.495  -17.254 1.00 40.61  ? 39  LEU A C   1 
ATOM   312   O  O   . LEU A  1 39  ? -11.581  96.908  -16.507 1.00 52.39  ? 39  LEU A O   1 
ATOM   313   C  CB  . LEU A  1 39  ? -14.850  97.129  -16.720 1.00 14.81  ? 39  LEU A CB  1 
ATOM   314   C  CG  . LEU A  1 39  ? -15.999  98.129  -16.904 1.00 28.88  ? 39  LEU A CG  1 
ATOM   315   C  CD1 . LEU A  1 39  ? -17.133  97.833  -15.950 1.00 27.11  ? 39  LEU A CD1 1 
ATOM   316   C  CD2 . LEU A  1 39  ? -15.486  99.550  -16.714 1.00 25.33  ? 39  LEU A CD2 1 
ATOM   317   N  N   . GLU A  1 40  ? -12.457  95.272  -17.756 1.00 25.79  ? 40  GLU A N   1 
ATOM   318   C  CA  . GLU A  1 40  ? -11.415  94.351  -17.384 1.00 27.80  ? 40  GLU A CA  1 
ATOM   319   C  C   . GLU A  1 40  ? -11.279  93.276  -18.426 1.00 14.46  ? 40  GLU A C   1 
ATOM   320   O  O   . GLU A  1 40  ? -12.178  92.486  -18.662 1.00 50.64  ? 40  GLU A O   1 
ATOM   321   C  CB  . GLU A  1 40  ? -11.663  93.746  -16.004 1.00 50.67  ? 40  GLU A CB  1 
ATOM   322   C  CG  . GLU A  1 40  ? -10.403  93.177  -15.362 1.00 46.66  ? 40  GLU A CG  1 
ATOM   323   C  CD  . GLU A  1 40  ? -10.603  91.763  -14.871 1.00 59.60  ? 40  GLU A CD  1 
ATOM   324   O  OE1 . GLU A  1 40  ? -11.765  91.384  -14.582 1.00 71.72  ? 40  GLU A OE1 1 
ATOM   325   O  OE2 . GLU A  1 40  ? -9.600   91.025  -14.788 1.00 59.99  ? 40  GLU A OE2 1 
ATOM   326   N  N   . VAL A  1 41  ? -10.120  93.279  -19.053 1.00 33.28  ? 41  VAL A N   1 
ATOM   327   C  CA  . VAL A  1 41  ? -9.809   92.394  -20.139 1.00 33.24  ? 41  VAL A CA  1 
ATOM   328   C  C   . VAL A  1 41  ? -8.819   91.371  -19.620 1.00 29.47  ? 41  VAL A C   1 
ATOM   329   O  O   . VAL A  1 41  ? -8.033   91.681  -18.730 1.00 22.38  ? 41  VAL A O   1 
ATOM   330   C  CB  . VAL A  1 41  ? -9.167   93.191  -21.265 1.00 25.83  ? 41  VAL A CB  1 
ATOM   331   C  CG1 . VAL A  1 41  ? -8.497   92.278  -22.220 1.00 31.46  ? 41  VAL A CG1 1 
ATOM   332   C  CG2 . VAL A  1 41  ? -10.197  94.021  -21.963 1.00 29.22  ? 41  VAL A CG2 1 
ATOM   333   N  N   . ASN A  1 42  ? -8.873   90.154  -20.156 1.00 25.19  ? 42  ASN A N   1 
ATOM   334   C  CA  . ASN A  1 42  ? -7.925   89.116  -19.778 1.00 20.35  ? 42  ASN A CA  1 
ATOM   335   C  C   . ASN A  1 42  ? -7.473   88.320  -20.981 1.00 29.10  ? 42  ASN A C   1 
ATOM   336   O  O   . ASN A  1 42  ? -8.207   87.465  -21.466 1.00 25.84  ? 42  ASN A O   1 
ATOM   337   C  CB  . ASN A  1 42  ? -8.505   88.182  -18.724 1.00 15.11  ? 42  ASN A CB  1 
ATOM   338   C  CG  . ASN A  1 42  ? -7.462   87.229  -18.150 1.00 34.27  ? 42  ASN A CG  1 
ATOM   339   O  OD1 . ASN A  1 42  ? -6.611   86.705  -18.878 1.00 32.85  ? 42  ASN A OD1 1 
ATOM   340   N  ND2 . ASN A  1 42  ? -7.518   87.006  -16.836 1.00 21.26  ? 42  ASN A ND2 1 
ATOM   341   N  N   . GLU A  1 43  ? -6.250   88.587  -21.444 1.00 32.29  ? 43  GLU A N   1 
ATOM   342   C  CA  . GLU A  1 43  ? -5.789   88.011  -22.701 1.00 37.55  ? 43  GLU A CA  1 
ATOM   343   C  C   . GLU A  1 43  ? -5.459   86.537  -22.535 1.00 32.24  ? 43  GLU A C   1 
ATOM   344   O  O   . GLU A  1 43  ? -5.451   85.766  -23.502 1.00 27.54  ? 43  GLU A O   1 
ATOM   345   C  CB  . GLU A  1 43  ? -4.608   88.791  -23.274 1.00 32.03  ? 43  GLU A CB  1 
ATOM   346   C  CG  . GLU A  1 43  ? -4.311   88.441  -24.728 1.00 37.17  ? 43  GLU A CG  1 
ATOM   347   C  CD  . GLU A  1 43  ? -3.340   89.404  -25.370 1.00 48.74  ? 43  GLU A CD  1 
ATOM   348   O  OE1 . GLU A  1 43  ? -2.944   90.386  -24.701 1.00 55.00  ? 43  GLU A OE1 1 
ATOM   349   O  OE2 . GLU A  1 43  ? -2.978   89.182  -26.545 1.00 48.84  ? 43  GLU A OE2 1 
ATOM   350   N  N   . ILE A  1 44  ? -5.206   86.144  -21.296 1.00 25.97  ? 44  ILE A N   1 
ATOM   351   C  CA  . ILE A  1 44  ? -4.953   84.742  -21.001 1.00 40.77  ? 44  ILE A CA  1 
ATOM   352   C  C   . ILE A  1 44  ? -6.241   83.912  -21.104 1.00 34.47  ? 44  ILE A C   1 
ATOM   353   O  O   . ILE A  1 44  ? -6.307   82.944  -21.858 1.00 22.14  ? 44  ILE A O   1 
ATOM   354   C  CB  . ILE A  1 44  ? -4.328   84.550  -19.595 1.00 48.69  ? 44  ILE A CB  1 
ATOM   355   C  CG1 . ILE A  1 44  ? -3.091   85.446  -19.408 1.00 43.78  ? 44  ILE A CG1 1 
ATOM   356   C  CG2 . ILE A  1 44  ? -3.995   83.071  -19.354 1.00 31.55  ? 44  ILE A CG2 1 
ATOM   357   C  CD1 . ILE A  1 44  ? -1.919   85.071  -20.262 1.00 37.02  ? 44  ILE A CD1 1 
ATOM   358   N  N   . THR A  1 45  ? -7.256   84.304  -20.342 1.00 32.35  ? 45  THR A N   1 
ATOM   359   C  CA  . THR A  1 45  ? -8.507   83.566  -20.276 1.00 25.11  ? 45  THR A CA  1 
ATOM   360   C  C   . THR A  1 45  ? -9.438   83.873  -21.444 1.00 25.44  ? 45  THR A C   1 
ATOM   361   O  O   . THR A  1 45  ? -10.424  83.177  -21.646 1.00 38.20  ? 45  THR A O   1 
ATOM   362   C  CB  . THR A  1 45  ? -9.267   83.864  -18.978 1.00 17.79  ? 45  THR A CB  1 
ATOM   363   O  OG1 . THR A  1 45  ? -9.641   85.248  -18.939 1.00 31.27  ? 45  THR A OG1 1 
ATOM   364   C  CG2 . THR A  1 45  ? -8.406   83.550  -17.803 1.00 16.60  ? 45  THR A CG2 1 
ATOM   365   N  N   . ASN A  1 46  ? -9.119   84.910  -22.208 1.00 28.41  ? 46  ASN A N   1 
ATOM   366   C  CA  . ASN A  1 46  ? -9.987   85.348  -23.292 1.00 19.97  ? 46  ASN A CA  1 
ATOM   367   C  C   . ASN A  1 46  ? -11.374  85.746  -22.795 1.00 27.63  ? 46  ASN A C   1 
ATOM   368   O  O   . ASN A  1 46  ? -12.392  85.297  -23.326 1.00 28.87  ? 46  ASN A O   1 
ATOM   369   C  CB  . ASN A  1 46  ? -10.090  84.274  -24.362 1.00 10.72  ? 46  ASN A CB  1 
ATOM   370   C  CG  . ASN A  1 46  ? -9.192   84.547  -25.537 1.00 25.73  ? 46  ASN A CG  1 
ATOM   371   O  OD1 . ASN A  1 46  ? -8.833   85.696  -25.815 1.00 21.62  ? 46  ASN A OD1 1 
ATOM   372   N  ND2 . ASN A  1 46  ? -8.815   83.491  -26.238 1.00 15.42  ? 46  ASN A ND2 1 
ATOM   373   N  N   . GLU A  1 47  ? -11.396  86.591  -21.770 1.00 23.20  ? 47  GLU A N   1 
ATOM   374   C  CA  . GLU A  1 47  ? -12.642  87.074  -21.190 1.00 35.88  ? 47  GLU A CA  1 
ATOM   375   C  C   . GLU A  1 47  ? -12.613  88.602  -21.091 1.00 32.94  ? 47  GLU A C   1 
ATOM   376   O  O   . GLU A  1 47  ? -11.587  89.184  -20.744 1.00 35.88  ? 47  GLU A O   1 
ATOM   377   C  CB  . GLU A  1 47  ? -12.885  86.418  -19.819 1.00 15.21  ? 47  GLU A CB  1 
ATOM   378   C  CG  . GLU A  1 47  ? -12.902  84.889  -19.890 1.00 22.74  ? 47  GLU A CG  1 
ATOM   379   C  CD  . GLU A  1 47  ? -12.997  84.215  -18.527 1.00 33.24  ? 47  GLU A CD  1 
ATOM   380   O  OE1 . GLU A  1 47  ? -13.377  84.889  -17.551 1.00 25.05  ? 47  GLU A OE1 1 
ATOM   381   O  OE2 . GLU A  1 47  ? -12.687  83.007  -18.434 1.00 36.32  ? 47  GLU A OE2 1 
ATOM   382   N  N   . VAL A  1 48  ? -13.727  89.246  -21.431 1.00 20.43  ? 48  VAL A N   1 
ATOM   383   C  CA  . VAL A  1 48  ? -13.831  90.691  -21.300 1.00 20.40  ? 48  VAL A CA  1 
ATOM   384   C  C   . VAL A  1 48  ? -15.042  91.094  -20.468 1.00 32.13  ? 48  VAL A C   1 
ATOM   385   O  O   . VAL A  1 48  ? -16.065  90.411  -20.452 1.00 27.14  ? 48  VAL A O   1 
ATOM   386   C  CB  . VAL A  1 48  ? -13.918  91.385  -22.657 1.00 9.94   ? 48  VAL A CB  1 
ATOM   387   C  CG1 . VAL A  1 48  ? -12.645  91.174  -23.429 1.00 36.63  ? 48  VAL A CG1 1 
ATOM   388   C  CG2 . VAL A  1 48  ? -15.101  90.863  -23.433 1.00 25.33  ? 48  VAL A CG2 1 
ATOM   389   N  N   . ASP A  1 49  ? -14.913  92.212  -19.770 1.00 37.76  ? 49  ASP A N   1 
ATOM   390   C  CA  . ASP A  1 49  ? -16.011  92.747  -18.989 1.00 30.80  ? 49  ASP A CA  1 
ATOM   391   C  C   . ASP A  1 49  ? -16.441  94.043  -19.669 1.00 27.26  ? 49  ASP A C   1 
ATOM   392   O  O   . ASP A  1 49  ? -15.673  95.007  -19.728 1.00 41.78  ? 49  ASP A O   1 
ATOM   393   C  CB  . ASP A  1 49  ? -15.548  92.988  -17.551 1.00 36.13  ? 49  ASP A CB  1 
ATOM   394   C  CG  . ASP A  1 49  ? -16.691  93.068  -16.583 1.00 34.27  ? 49  ASP A CG  1 
ATOM   395   O  OD1 . ASP A  1 49  ? -17.708  93.679  -16.944 1.00 47.47  ? 49  ASP A OD1 1 
ATOM   396   O  OD2 . ASP A  1 49  ? -16.573  92.532  -15.463 1.00 39.33  ? 49  ASP A OD2 1 
ATOM   397   N  N   . VAL A  1 50  ? -17.656  94.054  -20.203 1.00 19.53  ? 50  VAL A N   1 
ATOM   398   C  CA  . VAL A  1 50  ? -18.136  95.173  -21.010 1.00 28.40  ? 50  VAL A CA  1 
ATOM   399   C  C   . VAL A  1 50  ? -19.424  95.802  -20.480 1.00 28.61  ? 50  VAL A C   1 
ATOM   400   O  O   . VAL A  1 50  ? -20.264  95.128  -19.892 1.00 26.63  ? 50  VAL A O   1 
ATOM   401   C  CB  . VAL A  1 50  ? -18.376  94.717  -22.459 1.00 20.95  ? 50  VAL A CB  1 
ATOM   402   C  CG1 . VAL A  1 50  ? -18.938  95.841  -23.280 1.00 42.59  ? 50  VAL A CG1 1 
ATOM   403   C  CG2 . VAL A  1 50  ? -17.073  94.233  -23.067 1.00 31.44  ? 50  VAL A CG2 1 
ATOM   404   N  N   . VAL A  1 51  ? -19.558  97.107  -20.688 1.00 17.27  ? 51  VAL A N   1 
ATOM   405   C  CA  . VAL A  1 51  ? -20.799  97.826  -20.404 1.00 24.69  ? 51  VAL A CA  1 
ATOM   406   C  C   . VAL A  1 51  ? -21.345  98.441  -21.698 1.00 27.49  ? 51  VAL A C   1 
ATOM   407   O  O   . VAL A  1 51  ? -20.638  99.171  -22.397 1.00 28.83  ? 51  VAL A O   1 
ATOM   408   C  CB  . VAL A  1 51  ? -20.593  98.930  -19.330 1.00 12.99  ? 51  VAL A CB  1 
ATOM   409   C  CG1 . VAL A  1 51  ? -21.779  99.877  -19.302 1.00 19.31  ? 51  VAL A CG1 1 
ATOM   410   C  CG2 . VAL A  1 51  ? -20.392  98.304  -17.956 1.00 17.79  ? 51  VAL A CG2 1 
ATOM   411   N  N   . PHE A  1 52  ? -22.596  98.148  -22.026 1.00 24.28  ? 52  PHE A N   1 
ATOM   412   C  CA  . PHE A  1 52  ? -23.167  98.641  -23.275 1.00 22.66  ? 52  PHE A CA  1 
ATOM   413   C  C   . PHE A  1 52  ? -24.648  98.906  -23.102 1.00 22.66  ? 52  PHE A C   1 
ATOM   414   O  O   . PHE A  1 52  ? -25.304  98.251  -22.292 1.00 12.89  ? 52  PHE A O   1 
ATOM   415   C  CB  . PHE A  1 52  ? -22.967  97.603  -24.380 1.00 18.50  ? 52  PHE A CB  1 
ATOM   416   C  CG  . PHE A  1 52  ? -23.481  96.237  -24.017 1.00 22.84  ? 52  PHE A CG  1 
ATOM   417   C  CD1 . PHE A  1 52  ? -22.719  95.378  -23.246 1.00 20.06  ? 52  PHE A CD1 1 
ATOM   418   C  CD2 . PHE A  1 52  ? -24.736  95.823  -24.426 1.00 31.37  ? 52  PHE A CD2 1 
ATOM   419   C  CE1 . PHE A  1 52  ? -23.195  94.127  -22.903 1.00 31.29  ? 52  PHE A CE1 1 
ATOM   420   C  CE2 . PHE A  1 52  ? -25.216  94.577  -24.078 1.00 28.16  ? 52  PHE A CE2 1 
ATOM   421   C  CZ  . PHE A  1 52  ? -24.447  93.729  -23.317 1.00 23.05  ? 52  PHE A CZ  1 
ATOM   422   N  N   . TRP A  1 53  ? -25.166  99.875  -23.854 1.00 22.03  ? 53  TRP A N   1 
ATOM   423   C  CA  . TRP A  1 53  ? -26.608  100.042 -23.992 1.00 16.35  ? 53  TRP A CA  1 
ATOM   424   C  C   . TRP A  1 53  ? -27.062  99.041  -25.028 1.00 9.03   ? 53  TRP A C   1 
ATOM   425   O  O   . TRP A  1 53  ? -26.528  99.012  -26.127 1.00 15.18  ? 53  TRP A O   1 
ATOM   426   C  CB  . TRP A  1 53  ? -26.951  101.437 -24.486 1.00 16.95  ? 53  TRP A CB  1 
ATOM   427   C  CG  . TRP A  1 53  ? -26.604  102.521 -23.551 1.00 11.45  ? 53  TRP A CG  1 
ATOM   428   C  CD1 . TRP A  1 53  ? -26.072  102.391 -22.313 1.00 18.34  ? 53  TRP A CD1 1 
ATOM   429   C  CD2 . TRP A  1 53  ? -26.784  103.925 -23.772 1.00 14.80  ? 53  TRP A CD2 1 
ATOM   430   N  NE1 . TRP A  1 53  ? -25.894  103.631 -21.744 1.00 29.46  ? 53  TRP A NE1 1 
ATOM   431   C  CE2 . TRP A  1 53  ? -26.324  104.590 -22.626 1.00 13.74  ? 53  TRP A CE2 1 
ATOM   432   C  CE3 . TRP A  1 53  ? -27.283  104.684 -24.836 1.00 11.80  ? 53  TRP A CE3 1 
ATOM   433   C  CZ2 . TRP A  1 53  ? -26.349  105.981 -22.507 1.00 6.80   ? 53  TRP A CZ2 1 
ATOM   434   C  CZ3 . TRP A  1 53  ? -27.298  106.063 -24.716 1.00 15.82  ? 53  TRP A CZ3 1 
ATOM   435   C  CH2 . TRP A  1 53  ? -26.836  106.695 -23.559 1.00 17.56  ? 53  TRP A CH2 1 
ATOM   436   N  N   . GLN A  1 54  ? -28.020  98.201  -24.674 1.00 9.43   ? 54  GLN A N   1 
ATOM   437   C  CA  . GLN A  1 54  ? -28.574  97.259  -25.629 1.00 21.42  ? 54  GLN A CA  1 
ATOM   438   C  C   . GLN A  1 54  ? -29.867  97.806  -26.241 1.00 26.54  ? 54  GLN A C   1 
ATOM   439   O  O   . GLN A  1 54  ? -30.943  97.618  -25.702 1.00 26.74  ? 54  GLN A O   1 
ATOM   440   C  CB  . GLN A  1 54  ? -28.798  95.899  -24.981 1.00 16.38  ? 54  GLN A CB  1 
ATOM   441   C  CG  . GLN A  1 54  ? -29.214  94.830  -25.966 1.00 26.85  ? 54  GLN A CG  1 
ATOM   442   C  CD  . GLN A  1 54  ? -29.234  93.450  -25.352 1.00 30.19  ? 54  GLN A CD  1 
ATOM   443   O  OE1 . GLN A  1 54  ? -28.195  92.928  -24.946 1.00 39.01  ? 54  GLN A OE1 1 
ATOM   444   N  NE2 . GLN A  1 54  ? -30.417  92.845  -25.284 1.00 35.09  ? 54  GLN A NE2 1 
ATOM   445   N  N   . GLN A  1 55  ? -29.729  98.490  -27.371 1.00 26.16  ? 55  GLN A N   1 
ATOM   446   C  CA  . GLN A  1 55  ? -30.842  99.123  -28.048 1.00 22.90  ? 55  GLN A CA  1 
ATOM   447   C  C   . GLN A  1 55  ? -31.654  98.082  -28.794 1.00 28.98  ? 55  GLN A C   1 
ATOM   448   O  O   . GLN A  1 55  ? -31.164  97.493  -29.765 1.00 27.58  ? 55  GLN A O   1 
ATOM   449   C  CB  . GLN A  1 55  ? -30.332  100.156 -29.040 1.00 24.96  ? 55  GLN A CB  1 
ATOM   450   C  CG  . GLN A  1 55  ? -31.389  101.078 -29.554 1.00 18.16  ? 55  GLN A CG  1 
ATOM   451   C  CD  . GLN A  1 55  ? -30.920  101.837 -30.752 1.00 25.74  ? 55  GLN A CD  1 
ATOM   452   O  OE1 . GLN A  1 55  ? -30.685  103.044 -30.680 1.00 30.65  ? 55  GLN A OE1 1 
ATOM   453   N  NE2 . GLN A  1 55  ? -30.775  101.135 -31.874 1.00 45.31  ? 55  GLN A NE2 1 
ATOM   454   N  N   . THR A  1 56  ? -32.898  97.882  -28.336 1.00 23.29  ? 56  THR A N   1 
ATOM   455   C  CA  . THR A  1 56  ? -33.808  96.876  -28.883 1.00 16.80  ? 56  THR A CA  1 
ATOM   456   C  C   . THR A  1 56  ? -35.109  97.507  -29.382 1.00 21.25  ? 56  THR A C   1 
ATOM   457   O  O   . THR A  1 56  ? -35.712  98.318  -28.693 1.00 23.17  ? 56  THR A O   1 
ATOM   458   C  CB  . THR A  1 56  ? -34.130  95.796  -27.834 1.00 16.77  ? 56  THR A CB  1 
ATOM   459   O  OG1 . THR A  1 56  ? -32.925  95.422  -27.151 1.00 27.62  ? 56  THR A OG1 1 
ATOM   460   C  CG2 . THR A  1 56  ? -34.727  94.568  -28.497 1.00 19.21  ? 56  THR A CG2 1 
ATOM   461   N  N   . THR A  1 57  ? -35.537  97.123  -30.578 1.00 21.83  ? 57  THR A N   1 
ATOM   462   C  CA  . THR A  1 57  ? -36.654  97.780  -31.235 1.00 12.89  ? 57  THR A CA  1 
ATOM   463   C  C   . THR A  1 57  ? -37.584  96.774  -31.912 1.00 26.61  ? 57  THR A C   1 
ATOM   464   O  O   . THR A  1 57  ? -37.120  95.861  -32.600 1.00 35.41  ? 57  THR A O   1 
ATOM   465   C  CB  . THR A  1 57  ? -36.135  98.799  -32.261 1.00 22.04  ? 57  THR A CB  1 
ATOM   466   O  OG1 . THR A  1 57  ? -36.307  100.108 -31.730 1.00 22.41  ? 57  THR A OG1 1 
ATOM   467   C  CG2 . THR A  1 57  ? -36.862  98.681  -33.605 1.00 31.92  ? 57  THR A CG2 1 
ATOM   468   N  N   . TRP A  1 58  ? -38.890  96.933  -31.717 1.00 18.69  ? 58  TRP A N   1 
ATOM   469   C  CA  . TRP A  1 58  ? -39.859  96.041  -32.358 1.00 26.81  ? 58  TRP A CA  1 
ATOM   470   C  C   . TRP A  1 58  ? -41.278  96.598  -32.343 1.00 25.73  ? 58  TRP A C   1 
ATOM   471   O  O   . TRP A  1 58  ? -41.551  97.632  -31.733 1.00 27.44  ? 58  TRP A O   1 
ATOM   472   C  CB  . TRP A  1 58  ? -39.841  94.650  -31.713 1.00 21.57  ? 58  TRP A CB  1 
ATOM   473   C  CG  . TRP A  1 58  ? -40.422  94.623  -30.362 1.00 9.35   ? 58  TRP A CG  1 
ATOM   474   C  CD1 . TRP A  1 58  ? -41.721  94.375  -30.036 1.00 29.57  ? 58  TRP A CD1 1 
ATOM   475   C  CD2 . TRP A  1 58  ? -39.735  94.847  -29.132 1.00 16.94  ? 58  TRP A CD2 1 
ATOM   476   N  NE1 . TRP A  1 58  ? -41.891  94.438  -28.674 1.00 28.27  ? 58  TRP A NE1 1 
ATOM   477   C  CE2 . TRP A  1 58  ? -40.685  94.724  -28.093 1.00 21.34  ? 58  TRP A CE2 1 
ATOM   478   C  CE3 . TRP A  1 58  ? -38.413  95.137  -28.804 1.00 11.01  ? 58  TRP A CE3 1 
ATOM   479   C  CZ2 . TRP A  1 58  ? -40.351  94.887  -26.754 1.00 15.22  ? 58  TRP A CZ2 1 
ATOM   480   C  CZ3 . TRP A  1 58  ? -38.083  95.300  -27.484 1.00 13.27  ? 58  TRP A CZ3 1 
ATOM   481   C  CH2 . TRP A  1 58  ? -39.044  95.170  -26.470 1.00 19.82  ? 58  TRP A CH2 1 
ATOM   482   N  N   . SER A  1 59  ? -42.181  95.899  -33.014 1.00 32.16  ? 59  SER A N   1 
ATOM   483   C  CA  . SER A  1 59  ? -43.565  96.351  -33.105 1.00 28.37  ? 59  SER A CA  1 
ATOM   484   C  C   . SER A  1 59  ? -44.512  95.385  -32.403 1.00 20.67  ? 59  SER A C   1 
ATOM   485   O  O   . SER A  1 59  ? -44.498  94.191  -32.673 1.00 28.09  ? 59  SER A O   1 
ATOM   486   C  CB  . SER A  1 59  ? -43.970  96.518  -34.577 1.00 19.14  ? 59  SER A CB  1 
ATOM   487   O  OG  . SER A  1 59  ? -45.106  97.348  -34.704 1.00 58.20  ? 59  SER A OG  1 
ATOM   488   N  N   . ASP A  1 60  ? -45.321  95.911  -31.489 1.00 19.00  ? 60  ASP A N   1 
ATOM   489   C  CA  . ASP A  1 60  ? -46.417  95.147  -30.888 1.00 13.93  ? 60  ASP A CA  1 
ATOM   490   C  C   . ASP A  1 60  ? -47.701  95.938  -31.079 1.00 20.99  ? 60  ASP A C   1 
ATOM   491   O  O   . ASP A  1 60  ? -48.021  96.817  -30.283 1.00 22.98  ? 60  ASP A O   1 
ATOM   492   C  CB  . ASP A  1 60  ? -46.168  94.904  -29.402 1.00 10.68  ? 60  ASP A CB  1 
ATOM   493   C  CG  . ASP A  1 60  ? -47.184  93.962  -28.775 1.00 30.43  ? 60  ASP A CG  1 
ATOM   494   O  OD1 . ASP A  1 60  ? -48.254  93.729  -29.371 1.00 22.26  ? 60  ASP A OD1 1 
ATOM   495   O  OD2 . ASP A  1 60  ? -46.927  93.461  -27.663 1.00 35.58  ? 60  ASP A OD2 1 
ATOM   496   N  N   . ARG A  1 61  ? -48.433  95.630  -32.144 1.00 32.92  ? 61  ARG A N   1 
ATOM   497   C  CA  . ARG A  1 61  ? -49.636  96.394  -32.498 1.00 37.30  ? 61  ARG A CA  1 
ATOM   498   C  C   . ARG A  1 61  ? -50.684  96.406  -31.395 1.00 26.49  ? 61  ARG A C   1 
ATOM   499   O  O   . ARG A  1 61  ? -51.498  97.326  -31.317 1.00 22.20  ? 61  ARG A O   1 
ATOM   500   C  CB  . ARG A  1 61  ? -50.256  95.888  -33.803 1.00 33.74  ? 61  ARG A CB  1 
ATOM   501   C  CG  . ARG A  1 61  ? -49.322  95.997  -35.008 1.00 64.35  ? 61  ARG A CG  1 
ATOM   502   C  CD  . ARG A  1 61  ? -48.977  97.449  -35.316 1.00 77.42  ? 61  ARG A CD  1 
ATOM   503   N  NE  . ARG A  1 61  ? -47.895  97.572  -36.294 1.00 89.18  ? 61  ARG A NE  1 
ATOM   504   C  CZ  . ARG A  1 61  ? -48.073  97.684  -37.608 1.00 90.69  ? 61  ARG A CZ  1 
ATOM   505   N  NH1 . ARG A  1 61  ? -49.294  97.686  -38.115 1.00 96.06  ? 61  ARG A NH1 1 
ATOM   506   N  NH2 . ARG A  1 61  ? -47.030  97.794  -38.418 1.00 80.11  ? 61  ARG A NH2 1 
ATOM   507   N  N   . THR A  1 62  ? -50.663  95.392  -30.538 1.00 25.81  ? 62  THR A N   1 
ATOM   508   C  CA  . THR A  1 62  ? -51.687  95.263  -29.505 1.00 9.91   ? 62  THR A CA  1 
ATOM   509   C  C   . THR A  1 62  ? -51.533  96.341  -28.437 1.00 23.38  ? 62  THR A C   1 
ATOM   510   O  O   . THR A  1 62  ? -52.318  96.418  -27.504 1.00 20.80  ? 62  THR A O   1 
ATOM   511   C  CB  . THR A  1 62  ? -51.680  93.864  -28.834 1.00 19.70  ? 62  THR A CB  1 
ATOM   512   O  OG1 . THR A  1 62  ? -50.711  93.827  -27.788 1.00 33.62  ? 62  THR A OG1 1 
ATOM   513   C  CG2 . THR A  1 62  ? -51.368  92.765  -29.821 1.00 17.97  ? 62  THR A CG2 1 
ATOM   514   N  N   . LEU A  1 63  ? -50.513  97.178  -28.572 1.00 28.01  ? 63  LEU A N   1 
ATOM   515   C  CA  . LEU A  1 63  ? -50.277  98.241  -27.601 1.00 20.76  ? 63  LEU A CA  1 
ATOM   516   C  C   . LEU A  1 63  ? -50.775  99.582  -28.120 1.00 24.94  ? 63  LEU A C   1 
ATOM   517   O  O   . LEU A  1 63  ? -50.886  100.540 -27.368 1.00 27.63  ? 63  LEU A O   1 
ATOM   518   C  CB  . LEU A  1 63  ? -48.780  98.341  -27.279 1.00 25.54  ? 63  LEU A CB  1 
ATOM   519   C  CG  . LEU A  1 63  ? -48.086  97.110  -26.696 1.00 20.50  ? 63  LEU A CG  1 
ATOM   520   C  CD1 . LEU A  1 63  ? -46.584  97.304  -26.663 1.00 21.18  ? 63  LEU A CD1 1 
ATOM   521   C  CD2 . LEU A  1 63  ? -48.606  96.827  -25.312 1.00 20.64  ? 63  LEU A CD2 1 
ATOM   522   N  N   . ALA A  1 64  ? -51.062  99.640  -29.419 1.00 26.92  ? 64  ALA A N   1 
ATOM   523   C  CA  . ALA A  1 64  ? -51.403  100.886 -30.099 1.00 26.96  ? 64  ALA A CA  1 
ATOM   524   C  C   . ALA A  1 64  ? -52.656  101.553 -29.548 1.00 30.04  ? 64  ALA A C   1 
ATOM   525   O  O   . ALA A  1 64  ? -53.480  100.905 -28.917 1.00 32.57  ? 64  ALA A O   1 
ATOM   526   C  CB  . ALA A  1 64  ? -51.539  100.649 -31.599 1.00 21.77  ? 64  ALA A CB  1 
ATOM   527   N  N   . TRP A  1 65  ? -52.776  102.858 -29.784 1.00 27.80  ? 65  TRP A N   1 
ATOM   528   C  CA  . TRP A  1 65  ? -53.929  103.627 -29.335 1.00 27.59  ? 65  TRP A CA  1 
ATOM   529   C  C   . TRP A  1 65  ? -54.147  104.867 -30.212 1.00 33.89  ? 65  TRP A C   1 
ATOM   530   O  O   . TRP A  1 65  ? -53.200  105.383 -30.816 1.00 32.15  ? 65  TRP A O   1 
ATOM   531   C  CB  . TRP A  1 65  ? -53.788  104.016 -27.855 1.00 17.03  ? 65  TRP A CB  1 
ATOM   532   C  CG  . TRP A  1 65  ? -52.724  105.056 -27.571 1.00 34.29  ? 65  TRP A CG  1 
ATOM   533   C  CD1 . TRP A  1 65  ? -52.861  106.414 -27.618 1.00 38.43  ? 65  TRP A CD1 1 
ATOM   534   C  CD2 . TRP A  1 65  ? -51.373  104.807 -27.185 1.00 31.37  ? 65  TRP A CD2 1 
ATOM   535   N  NE1 . TRP A  1 65  ? -51.677  107.023 -27.285 1.00 19.03  ? 65  TRP A NE1 1 
ATOM   536   C  CE2 . TRP A  1 65  ? -50.748  106.057 -27.017 1.00 28.15  ? 65  TRP A CE2 1 
ATOM   537   C  CE3 . TRP A  1 65  ? -50.627  103.643 -26.968 1.00 26.98  ? 65  TRP A CE3 1 
ATOM   538   C  CZ2 . TRP A  1 65  ? -49.411  106.178 -26.643 1.00 33.80  ? 65  TRP A CZ2 1 
ATOM   539   C  CZ3 . TRP A  1 65  ? -49.302  103.761 -26.592 1.00 30.35  ? 65  TRP A CZ3 1 
ATOM   540   C  CH2 . TRP A  1 65  ? -48.706  105.020 -26.435 1.00 32.56  ? 65  TRP A CH2 1 
ATOM   541   N  N   . ASN A  1 66  ? -55.397  105.326 -30.288 1.00 40.22  ? 66  ASN A N   1 
ATOM   542   C  CA  . ASN A  1 66  ? -55.736  106.517 -31.061 1.00 47.42  ? 66  ASN A CA  1 
ATOM   543   C  C   . ASN A  1 66  ? -55.205  107.746 -30.348 1.00 47.86  ? 66  ASN A C   1 
ATOM   544   O  O   . ASN A  1 66  ? -55.786  108.190 -29.361 1.00 56.76  ? 66  ASN A O   1 
ATOM   545   C  CB  . ASN A  1 66  ? -57.256  106.628 -31.263 1.00 32.24  ? 66  ASN A CB  1 
ATOM   546   C  CG  . ASN A  1 66  ? -57.647  107.784 -32.187 1.00 59.16  ? 66  ASN A CG  1 
ATOM   547   O  OD1 . ASN A  1 66  ? -56.853  108.693 -32.417 1.00 67.00  ? 66  ASN A OD1 1 
ATOM   548   N  ND2 . ASN A  1 66  ? -58.879  107.755 -32.713 1.00 62.58  ? 66  ASN A ND2 1 
ATOM   549   N  N   . SER A  1 67  ? -54.102  108.294 -30.846 1.00 38.21  ? 67  SER A N   1 
ATOM   550   C  CA  . SER A  1 67  ? -53.451  109.417 -30.181 1.00 50.94  ? 67  SER A CA  1 
ATOM   551   C  C   . SER A  1 67  ? -53.895  110.775 -30.712 1.00 62.33  ? 67  SER A C   1 
ATOM   552   O  O   . SER A  1 67  ? -53.162  111.751 -30.579 1.00 62.90  ? 67  SER A O   1 
ATOM   553   C  CB  . SER A  1 67  ? -51.934  109.306 -30.314 1.00 58.25  ? 67  SER A CB  1 
ATOM   554   O  OG  . SER A  1 67  ? -51.516  109.717 -31.603 1.00 58.69  ? 67  SER A OG  1 
ATOM   555   N  N   . SER A  1 68  ? -55.084  110.841 -31.306 1.00 68.01  ? 68  SER A N   1 
ATOM   556   C  CA  . SER A  1 68  ? -55.580  112.097 -31.872 1.00 69.36  ? 68  SER A CA  1 
ATOM   557   C  C   . SER A  1 68  ? -55.461  113.255 -30.876 1.00 71.76  ? 68  SER A C   1 
ATOM   558   O  O   . SER A  1 68  ? -54.933  114.316 -31.214 1.00 80.51  ? 68  SER A O   1 
ATOM   559   C  CB  . SER A  1 68  ? -57.026  111.960 -32.370 1.00 74.70  ? 68  SER A CB  1 
ATOM   560   O  OG  . SER A  1 68  ? -57.939  111.781 -31.303 1.00 90.09  ? 68  SER A OG  1 
ATOM   561   N  N   . HIS A  1 69  ? -55.948  113.045 -29.652 1.00 49.31  ? 69  HIS A N   1 
ATOM   562   C  CA  . HIS A  1 69  ? -55.852  114.046 -28.593 1.00 55.88  ? 69  HIS A CA  1 
ATOM   563   C  C   . HIS A  1 69  ? -55.268  113.418 -27.340 1.00 64.94  ? 69  HIS A C   1 
ATOM   564   O  O   . HIS A  1 69  ? -55.827  113.546 -26.247 1.00 66.14  ? 69  HIS A O   1 
ATOM   565   C  CB  . HIS A  1 69  ? -57.226  114.637 -28.282 1.00 69.58  ? 69  HIS A CB  1 
ATOM   566   C  CG  . HIS A  1 69  ? -57.856  115.347 -29.442 1.00 85.31  ? 69  HIS A CG  1 
ATOM   567   N  ND1 . HIS A  1 69  ? -59.164  115.776 -29.428 1.00 91.47  ? 69  HIS A ND1 1 
ATOM   568   C  CD2 . HIS A  1 69  ? -57.356  115.707 -30.648 1.00 89.53  ? 69  HIS A CD2 1 
ATOM   569   C  CE1 . HIS A  1 69  ? -59.445  116.369 -30.574 1.00 97.99  ? 69  HIS A CE1 1 
ATOM   570   N  NE2 . HIS A  1 69  ? -58.364  116.340 -31.333 1.00 93.70  ? 69  HIS A NE2 1 
ATOM   571   N  N   . SER A  1 70  ? -54.136  112.738 -27.511 1.00 61.18  ? 70  SER A N   1 
ATOM   572   C  CA  . SER A  1 70  ? -53.522  111.977 -26.435 1.00 50.29  ? 70  SER A CA  1 
ATOM   573   C  C   . SER A  1 70  ? -52.004  112.033 -26.544 1.00 40.52  ? 70  SER A C   1 
ATOM   574   O  O   . SER A  1 70  ? -51.465  112.441 -27.568 1.00 40.47  ? 70  SER A O   1 
ATOM   575   C  CB  . SER A  1 70  ? -54.004  110.524 -26.486 1.00 63.01  ? 70  SER A CB  1 
ATOM   576   O  OG  . SER A  1 70  ? -55.420  110.466 -26.571 1.00 79.63  ? 70  SER A OG  1 
ATOM   577   N  N   . PRO A  1 71  ? -51.303  111.649 -25.471 1.00 40.96  ? 71  PRO A N   1 
ATOM   578   C  CA  . PRO A  1 71  ? -49.845  111.558 -25.566 1.00 24.40  ? 71  PRO A CA  1 
ATOM   579   C  C   . PRO A  1 71  ? -49.421  110.553 -26.644 1.00 39.61  ? 71  PRO A C   1 
ATOM   580   O  O   . PRO A  1 71  ? -50.097  109.548 -26.879 1.00 50.37  ? 71  PRO A O   1 
ATOM   581   C  CB  . PRO A  1 71  ? -49.441  111.058 -24.187 1.00 35.92  ? 71  PRO A CB  1 
ATOM   582   C  CG  . PRO A  1 71  ? -50.545  111.547 -23.290 1.00 50.52  ? 71  PRO A CG  1 
ATOM   583   C  CD  . PRO A  1 71  ? -51.792  111.441 -24.096 1.00 35.46  ? 71  PRO A CD  1 
ATOM   584   N  N   . ASP A  1 72  ? -48.301  110.843 -27.295 1.00 34.43  ? 72  ASP A N   1 
ATOM   585   C  CA  . ASP A  1 72  ? -47.800  110.032 -28.386 1.00 32.49  ? 72  ASP A CA  1 
ATOM   586   C  C   . ASP A  1 72  ? -46.957  108.858 -27.876 1.00 41.65  ? 72  ASP A C   1 
ATOM   587   O  O   . ASP A  1 72  ? -46.808  107.839 -28.561 1.00 34.37  ? 72  ASP A O   1 
ATOM   588   C  CB  . ASP A  1 72  ? -46.967  110.901 -29.319 1.00 24.74  ? 72  ASP A CB  1 
ATOM   589   C  CG  . ASP A  1 72  ? -46.736  110.247 -30.668 1.00 68.17  ? 72  ASP A CG  1 
ATOM   590   O  OD1 . ASP A  1 72  ? -47.736  109.797 -31.279 1.00 58.65  ? 72  ASP A OD1 1 
ATOM   591   O  OD2 . ASP A  1 72  ? -45.560  110.172 -31.111 1.00 77.66  ? 72  ASP A OD2 1 
ATOM   592   N  N   . GLN A  1 73  ? -46.398  109.007 -26.677 1.00 40.90  ? 73  GLN A N   1 
ATOM   593   C  CA  . GLN A  1 73  ? -45.570  107.959 -26.078 1.00 19.81  ? 73  GLN A CA  1 
ATOM   594   C  C   . GLN A  1 73  ? -45.734  107.860 -24.581 1.00 19.90  ? 73  GLN A C   1 
ATOM   595   O  O   . GLN A  1 73  ? -46.095  108.824 -23.909 1.00 33.58  ? 73  GLN A O   1 
ATOM   596   C  CB  . GLN A  1 73  ? -44.097  108.199 -26.355 1.00 21.45  ? 73  GLN A CB  1 
ATOM   597   C  CG  . GLN A  1 73  ? -43.729  108.255 -27.802 1.00 27.82  ? 73  GLN A CG  1 
ATOM   598   C  CD  . GLN A  1 73  ? -42.236  108.443 -27.997 1.00 30.32  ? 73  GLN A CD  1 
ATOM   599   O  OE1 . GLN A  1 73  ? -41.443  108.310 -27.058 1.00 34.93  ? 73  GLN A OE1 1 
ATOM   600   N  NE2 . GLN A  1 73  ? -41.844  108.750 -29.223 1.00 35.58  ? 73  GLN A NE2 1 
ATOM   601   N  N   . VAL A  1 74  ? -45.443  106.679 -24.063 1.00 14.57  ? 74  VAL A N   1 
ATOM   602   C  CA  . VAL A  1 74  ? -45.356  106.479 -22.625 1.00 17.87  ? 74  VAL A CA  1 
ATOM   603   C  C   . VAL A  1 74  ? -44.191  105.556 -22.259 1.00 14.34  ? 74  VAL A C   1 
ATOM   604   O  O   . VAL A  1 74  ? -43.749  104.740 -23.067 1.00 23.76  ? 74  VAL A O   1 
ATOM   605   C  CB  . VAL A  1 74  ? -46.641  105.852 -22.076 1.00 17.37  ? 74  VAL A CB  1 
ATOM   606   C  CG1 . VAL A  1 74  ? -47.786  106.860 -22.101 1.00 14.56  ? 74  VAL A CG1 1 
ATOM   607   C  CG2 . VAL A  1 74  ? -46.982  104.617 -22.876 1.00 8.54   ? 74  VAL A CG2 1 
ATOM   608   N  N   . SER A  1 75  ? -43.714  105.672 -21.031 1.00 17.08  ? 75  SER A N   1 
ATOM   609   C  CA  . SER A  1 75  ? -42.730  104.731 -20.530 1.00 12.17  ? 75  SER A CA  1 
ATOM   610   C  C   . SER A  1 75  ? -43.434  103.621 -19.777 1.00 15.65  ? 75  SER A C   1 
ATOM   611   O  O   . SER A  1 75  ? -44.290  103.873 -18.926 1.00 20.05  ? 75  SER A O   1 
ATOM   612   C  CB  . SER A  1 75  ? -41.708  105.435 -19.635 1.00 13.02  ? 75  SER A CB  1 
ATOM   613   O  OG  . SER A  1 75  ? -40.888  106.313 -20.381 1.00 17.44  ? 75  SER A OG  1 
ATOM   614   N  N   . VAL A  1 76  ? -43.071  102.389 -20.099 1.00 7.97   ? 76  VAL A N   1 
ATOM   615   C  CA  . VAL A  1 76  ? -43.774  101.231 -19.575 1.00 19.87  ? 76  VAL A CA  1 
ATOM   616   C  C   . VAL A  1 76  ? -42.796  100.221 -18.998 1.00 12.21  ? 76  VAL A C   1 
ATOM   617   O  O   . VAL A  1 76  ? -41.835  99.853  -19.654 1.00 18.42  ? 76  VAL A O   1 
ATOM   618   C  CB  . VAL A  1 76  ? -44.578  100.524 -20.694 1.00 14.92  ? 76  VAL A CB  1 
ATOM   619   C  CG1 . VAL A  1 76  ? -45.394  99.375  -20.112 1.00 24.41  ? 76  VAL A CG1 1 
ATOM   620   C  CG2 . VAL A  1 76  ? -45.460  101.511 -21.406 1.00 10.70  ? 76  VAL A CG2 1 
ATOM   621   N  N   . PRO A  1 77  ? -43.062  99.749  -17.778 1.00 18.87  ? 77  PRO A N   1 
ATOM   622   C  CA  . PRO A  1 77  ? -42.322  98.630  -17.187 1.00 18.02  ? 77  PRO A CA  1 
ATOM   623   C  C   . PRO A  1 77  ? -42.317  97.427  -18.134 1.00 14.63  ? 77  PRO A C   1 
ATOM   624   O  O   . PRO A  1 77  ? -43.376  96.956  -18.525 1.00 16.95  ? 77  PRO A O   1 
ATOM   625   C  CB  . PRO A  1 77  ? -43.155  98.289  -15.938 1.00 12.75  ? 77  PRO A CB  1 
ATOM   626   C  CG  . PRO A  1 77  ? -43.870  99.538  -15.599 1.00 21.16  ? 77  PRO A CG  1 
ATOM   627   C  CD  . PRO A  1 77  ? -44.165  100.209 -16.917 1.00 19.85  ? 77  PRO A CD  1 
ATOM   628   N  N   . ILE A  1 78  ? -41.147  96.913  -18.476 1.00 17.75  ? 78  ILE A N   1 
ATOM   629   C  CA  . ILE A  1 78  ? -41.083  95.821  -19.439 1.00 22.36  ? 78  ILE A CA  1 
ATOM   630   C  C   . ILE A  1 78  ? -41.775  94.563  -18.945 1.00 15.54  ? 78  ILE A C   1 
ATOM   631   O  O   . ILE A  1 78  ? -42.109  93.687  -19.726 1.00 27.18  ? 78  ILE A O   1 
ATOM   632   C  CB  . ILE A  1 78  ? -39.641  95.466  -19.806 1.00 20.70  ? 78  ILE A CB  1 
ATOM   633   C  CG1 . ILE A  1 78  ? -38.824  95.228  -18.531 1.00 30.09  ? 78  ILE A CG1 1 
ATOM   634   C  CG2 . ILE A  1 78  ? -39.022  96.554  -20.655 1.00 6.99   ? 78  ILE A CG2 1 
ATOM   635   C  CD1 . ILE A  1 78  ? -37.561  94.419  -18.778 1.00 29.17  ? 78  ILE A CD1 1 
ATOM   636   N  N   . SER A  1 79  ? -41.968  94.462  -17.641 1.00 17.63  ? 79  SER A N   1 
ATOM   637   C  CA  . SER A  1 79  ? -42.749  93.359  -17.083 1.00 27.26  ? 79  SER A CA  1 
ATOM   638   C  C   . SER A  1 79  ? -44.204  93.372  -17.603 1.00 35.37  ? 79  SER A C   1 
ATOM   639   O  O   . SER A  1 79  ? -44.922  92.362  -17.527 1.00 19.04  ? 79  SER A O   1 
ATOM   640   C  CB  . SER A  1 79  ? -42.721  93.394  -15.552 1.00 13.57  ? 79  SER A CB  1 
ATOM   641   O  OG  . SER A  1 79  ? -42.903  94.716  -15.077 1.00 39.44  ? 79  SER A OG  1 
ATOM   642   N  N   . SER A  1 80  ? -44.628  94.514  -18.140 1.00 21.85  ? 80  SER A N   1 
ATOM   643   C  CA  . SER A  1 80  ? -45.973  94.632  -18.676 1.00 20.82  ? 80  SER A CA  1 
ATOM   644   C  C   . SER A  1 80  ? -46.009  94.448  -20.187 1.00 27.10  ? 80  SER A C   1 
ATOM   645   O  O   . SER A  1 80  ? -47.070  94.543  -20.784 1.00 32.30  ? 80  SER A O   1 
ATOM   646   C  CB  . SER A  1 80  ? -46.592  95.984  -18.308 1.00 19.34  ? 80  SER A CB  1 
ATOM   647   O  OG  . SER A  1 80  ? -46.755  96.124  -16.904 1.00 30.78  ? 80  SER A OG  1 
ATOM   648   N  N   . LEU A  1 81  ? -44.858  94.195  -20.806 1.00 29.19  ? 81  LEU A N   1 
ATOM   649   C  CA  . LEU A  1 81  ? -44.784  94.067  -22.262 1.00 9.09   ? 81  LEU A CA  1 
ATOM   650   C  C   . LEU A  1 81  ? -44.238  92.720  -22.642 1.00 20.21  ? 81  LEU A C   1 
ATOM   651   O  O   . LEU A  1 81  ? -43.529  92.094  -21.867 1.00 30.46  ? 81  LEU A O   1 
ATOM   652   C  CB  . LEU A  1 81  ? -43.866  95.125  -22.869 1.00 12.83  ? 81  LEU A CB  1 
ATOM   653   C  CG  . LEU A  1 81  ? -44.201  96.584  -22.619 1.00 20.25  ? 81  LEU A CG  1 
ATOM   654   C  CD1 . LEU A  1 81  ? -43.199  97.449  -23.315 1.00 17.61  ? 81  LEU A CD1 1 
ATOM   655   C  CD2 . LEU A  1 81  ? -45.582  96.859  -23.140 1.00 39.30  ? 81  LEU A CD2 1 
ATOM   656   N  N   . TRP A  1 82  ? -44.567  92.269  -23.847 1.00 24.71  ? 82  TRP A N   1 
ATOM   657   C  CA  . TRP A  1 82  ? -43.823  91.175  -24.432 1.00 20.51  ? 82  TRP A CA  1 
ATOM   658   C  C   . TRP A  1 82  ? -42.459  91.725  -24.835 1.00 20.91  ? 82  TRP A C   1 
ATOM   659   O  O   . TRP A  1 82  ? -42.343  92.817  -25.394 1.00 16.00  ? 82  TRP A O   1 
ATOM   660   C  CB  . TRP A  1 82  ? -44.531  90.591  -25.652 1.00 14.01  ? 82  TRP A CB  1 
ATOM   661   C  CG  . TRP A  1 82  ? -43.691  89.540  -26.352 1.00 30.91  ? 82  TRP A CG  1 
ATOM   662   C  CD1 . TRP A  1 82  ? -43.648  88.196  -26.077 1.00 14.85  ? 82  TRP A CD1 1 
ATOM   663   C  CD2 . TRP A  1 82  ? -42.757  89.758  -27.421 1.00 27.18  ? 82  TRP A CD2 1 
ATOM   664   N  NE1 . TRP A  1 82  ? -42.761  87.569  -26.920 1.00 23.46  ? 82  TRP A NE1 1 
ATOM   665   C  CE2 . TRP A  1 82  ? -42.193  88.507  -27.745 1.00 26.95  ? 82  TRP A CE2 1 
ATOM   666   C  CE3 . TRP A  1 82  ? -42.338  90.889  -28.123 1.00 20.33  ? 82  TRP A CE3 1 
ATOM   667   C  CZ2 . TRP A  1 82  ? -41.244  88.361  -28.743 1.00 14.14  ? 82  TRP A CZ2 1 
ATOM   668   C  CZ3 . TRP A  1 82  ? -41.405  90.744  -29.100 1.00 10.26  ? 82  TRP A CZ3 1 
ATOM   669   C  CH2 . TRP A  1 82  ? -40.867  89.487  -29.412 1.00 24.46  ? 82  TRP A CH2 1 
ATOM   670   N  N   . VAL A  1 83  ? -41.424  90.969  -24.526 1.00 19.97  ? 83  VAL A N   1 
ATOM   671   C  CA  . VAL A  1 83  ? -40.071  91.346  -24.881 1.00 22.63  ? 83  VAL A CA  1 
ATOM   672   C  C   . VAL A  1 83  ? -39.432  90.157  -25.586 1.00 19.01  ? 83  VAL A C   1 
ATOM   673   O  O   . VAL A  1 83  ? -39.666  89.001  -25.208 1.00 13.91  ? 83  VAL A O   1 
ATOM   674   C  CB  . VAL A  1 83  ? -39.252  91.710  -23.625 1.00 15.14  ? 83  VAL A CB  1 
ATOM   675   C  CG1 . VAL A  1 83  ? -37.804  91.935  -23.988 1.00 49.37  ? 83  VAL A CG1 1 
ATOM   676   C  CG2 . VAL A  1 83  ? -39.814  92.956  -22.975 1.00 24.72  ? 83  VAL A CG2 1 
ATOM   677   N  N   . PRO A  1 84  ? -38.640  90.423  -26.624 1.00 5.40   ? 84  PRO A N   1 
ATOM   678   C  CA  . PRO A  1 84  ? -37.963  89.306  -27.300 1.00 10.26  ? 84  PRO A CA  1 
ATOM   679   C  C   . PRO A  1 84  ? -36.915  88.638  -26.398 1.00 22.67  ? 84  PRO A C   1 
ATOM   680   O  O   . PRO A  1 84  ? -36.200  89.301  -25.631 1.00 4.94   ? 84  PRO A O   1 
ATOM   681   C  CB  . PRO A  1 84  ? -37.315  89.961  -28.517 1.00 9.97   ? 84  PRO A CB  1 
ATOM   682   C  CG  . PRO A  1 84  ? -37.180  91.414  -28.148 1.00 22.49  ? 84  PRO A CG  1 
ATOM   683   C  CD  . PRO A  1 84  ? -38.380  91.714  -27.271 1.00 21.12  ? 84  PRO A CD  1 
ATOM   684   N  N   . ASP A  1 85  ? -36.854  87.313  -26.473 1.00 15.08  ? 85  ASP A N   1 
ATOM   685   C  CA  . ASP A  1 85  ? -35.991  86.550  -25.581 1.00 11.62  ? 85  ASP A CA  1 
ATOM   686   C  C   . ASP A  1 85  ? -34.555  86.529  -26.113 1.00 19.40  ? 85  ASP A C   1 
ATOM   687   O  O   . ASP A  1 85  ? -33.988  85.470  -26.408 1.00 25.70  ? 85  ASP A O   1 
ATOM   688   C  CB  . ASP A  1 85  ? -36.540  85.127  -25.385 1.00 10.82  ? 85  ASP A CB  1 
ATOM   689   C  CG  . ASP A  1 85  ? -36.626  84.358  -26.679 1.00 25.10  ? 85  ASP A CG  1 
ATOM   690   O  OD1 . ASP A  1 85  ? -36.845  85.011  -27.723 1.00 15.07  ? 85  ASP A OD1 1 
ATOM   691   O  OD2 . ASP A  1 85  ? -36.475  83.115  -26.650 1.00 18.62  ? 85  ASP A OD2 1 
ATOM   692   N  N   . LEU A  1 86  ? -33.975  87.714  -26.256 1.00 16.40  ? 86  LEU A N   1 
ATOM   693   C  CA  . LEU A  1 86  ? -32.616  87.825  -26.755 1.00 18.81  ? 86  LEU A CA  1 
ATOM   694   C  C   . LEU A  1 86  ? -31.630  87.359  -25.700 1.00 21.61  ? 86  LEU A C   1 
ATOM   695   O  O   . LEU A  1 86  ? -31.814  87.583  -24.505 1.00 22.02  ? 86  LEU A O   1 
ATOM   696   C  CB  . LEU A  1 86  ? -32.317  89.262  -27.142 1.00 10.44  ? 86  LEU A CB  1 
ATOM   697   C  CG  . LEU A  1 86  ? -33.211  89.856  -28.215 1.00 13.83  ? 86  LEU A CG  1 
ATOM   698   C  CD1 . LEU A  1 86  ? -32.745  91.265  -28.573 1.00 5.27   ? 86  LEU A CD1 1 
ATOM   699   C  CD2 . LEU A  1 86  ? -33.178  88.930  -29.411 1.00 12.71  ? 86  LEU A CD2 1 
ATOM   700   N  N   . ALA A  1 87  ? -30.583  86.692  -26.148 1.00 20.21  ? 87  ALA A N   1 
ATOM   701   C  CA  . ALA A  1 87  ? -29.501  86.324  -25.252 1.00 25.52  ? 87  ALA A CA  1 
ATOM   702   C  C   . ALA A  1 87  ? -28.154  86.450  -25.972 1.00 19.27  ? 87  ALA A C   1 
ATOM   703   O  O   . ALA A  1 87  ? -28.075  86.311  -27.191 1.00 28.40  ? 87  ALA A O   1 
ATOM   704   C  CB  . ALA A  1 87  ? -29.718  84.904  -24.704 1.00 17.78  ? 87  ALA A CB  1 
ATOM   705   N  N   . ALA A  1 88  ? -27.097  86.737  -25.223 1.00 13.59  ? 88  ALA A N   1 
ATOM   706   C  CA  . ALA A  1 88  ? -25.756  86.700  -25.792 1.00 7.06   ? 88  ALA A CA  1 
ATOM   707   C  C   . ALA A  1 88  ? -25.200  85.294  -25.659 1.00 13.40  ? 88  ALA A C   1 
ATOM   708   O  O   . ALA A  1 88  ? -24.978  84.822  -24.546 1.00 27.27  ? 88  ALA A O   1 
ATOM   709   C  CB  . ALA A  1 88  ? -24.873  87.678  -25.098 1.00 4.95   ? 88  ALA A CB  1 
ATOM   710   N  N   . TYR A  1 89  ? -24.986  84.622  -26.786 1.00 19.80  ? 89  TYR A N   1 
ATOM   711   C  CA  . TYR A  1 89  ? -24.499  83.238  -26.785 1.00 18.19  ? 89  TYR A CA  1 
ATOM   712   C  C   . TYR A  1 89  ? -23.194  83.044  -26.010 1.00 20.15  ? 89  TYR A C   1 
ATOM   713   O  O   . TYR A  1 89  ? -23.017  82.057  -25.277 1.00 19.63  ? 89  TYR A O   1 
ATOM   714   C  CB  . TYR A  1 89  ? -24.340  82.731  -28.221 1.00 15.06  ? 89  TYR A CB  1 
ATOM   715   C  CG  . TYR A  1 89  ? -25.662  82.353  -28.867 1.00 33.57  ? 89  TYR A CG  1 
ATOM   716   C  CD1 . TYR A  1 89  ? -26.609  83.318  -29.163 1.00 17.32  ? 89  TYR A CD1 1 
ATOM   717   C  CD2 . TYR A  1 89  ? -25.960  81.027  -29.171 1.00 6.80   ? 89  TYR A CD2 1 
ATOM   718   C  CE1 . TYR A  1 89  ? -27.812  82.977  -29.752 1.00 21.44  ? 89  TYR A CE1 1 
ATOM   719   C  CE2 . TYR A  1 89  ? -27.149  80.682  -29.759 1.00 25.84  ? 89  TYR A CE2 1 
ATOM   720   C  CZ  . TYR A  1 89  ? -28.078  81.663  -30.045 1.00 20.55  ? 89  TYR A CZ  1 
ATOM   721   O  OH  . TYR A  1 89  ? -29.279  81.342  -30.624 1.00 20.60  ? 89  TYR A OH  1 
ATOM   722   N  N   . ASN A  1 90  ? -22.281  83.993  -26.157 1.00 26.38  ? 90  ASN A N   1 
ATOM   723   C  CA  . ASN A  1 90  ? -20.965  83.847  -25.546 1.00 19.95  ? 90  ASN A CA  1 
ATOM   724   C  C   . ASN A  1 90  ? -20.801  84.659  -24.256 1.00 18.17  ? 90  ASN A C   1 
ATOM   725   O  O   . ASN A  1 90  ? -19.689  84.874  -23.770 1.00 13.89  ? 90  ASN A O   1 
ATOM   726   C  CB  . ASN A  1 90  ? -19.850  84.131  -26.564 1.00 6.37   ? 90  ASN A CB  1 
ATOM   727   C  CG  . ASN A  1 90  ? -19.937  85.521  -27.161 1.00 23.95  ? 90  ASN A CG  1 
ATOM   728   O  OD1 . ASN A  1 90  ? -21.018  86.012  -27.510 1.00 9.48   ? 90  ASN A OD1 1 
ATOM   729   N  ND2 . ASN A  1 90  ? -18.791  86.168  -27.281 1.00 25.29  ? 90  ASN A ND2 1 
ATOM   730   N  N   . ALA A  1 91  ? -21.922  85.092  -23.692 1.00 21.04  ? 91  ALA A N   1 
ATOM   731   C  CA  . ALA A  1 91  ? -21.895  85.682  -22.363 1.00 17.50  ? 91  ALA A CA  1 
ATOM   732   C  C   . ALA A  1 91  ? -21.549  84.608  -21.339 1.00 23.88  ? 91  ALA A C   1 
ATOM   733   O  O   . ALA A  1 91  ? -22.027  83.476  -21.427 1.00 21.60  ? 91  ALA A O   1 
ATOM   734   C  CB  . ALA A  1 91  ? -23.225  86.321  -22.033 1.00 13.85  ? 91  ALA A CB  1 
ATOM   735   N  N   . ILE A  1 92  ? -20.710  84.959  -20.369 1.00 25.79  ? 92  ILE A N   1 
ATOM   736   C  CA  . ILE A  1 92  ? -20.364  84.015  -19.314 1.00 19.44  ? 92  ILE A CA  1 
ATOM   737   C  C   . ILE A  1 92  ? -20.837  84.462  -17.933 1.00 18.57  ? 92  ILE A C   1 
ATOM   738   O  O   . ILE A  1 92  ? -20.556  83.812  -16.929 1.00 24.54  ? 92  ILE A O   1 
ATOM   739   C  CB  . ILE A  1 92  ? -18.883  83.697  -19.302 1.00 16.57  ? 92  ILE A CB  1 
ATOM   740   C  CG1 . ILE A  1 92  ? -18.069  84.979  -19.156 1.00 17.96  ? 92  ILE A CG1 1 
ATOM   741   C  CG2 . ILE A  1 92  ? -18.519  82.983  -20.564 1.00 10.05  ? 92  ILE A CG2 1 
ATOM   742   C  CD1 . ILE A  1 92  ? -16.620  84.734  -18.960 1.00 8.06   ? 92  ILE A CD1 1 
ATOM   743   N  N   . SER A  1 93  ? -21.567  85.570  -17.894 1.00 16.54  ? 93  SER A N   1 
ATOM   744   C  CA  . SER A  1 93  ? -22.327  85.948  -16.705 1.00 23.79  ? 93  SER A CA  1 
ATOM   745   C  C   . SER A  1 93  ? -23.713  86.373  -17.167 1.00 20.28  ? 93  SER A C   1 
ATOM   746   O  O   . SER A  1 93  ? -23.882  86.781  -18.319 1.00 19.47  ? 93  SER A O   1 
ATOM   747   C  CB  . SER A  1 93  ? -21.646  87.092  -15.960 1.00 19.39  ? 93  SER A CB  1 
ATOM   748   O  OG  . SER A  1 93  ? -21.701  88.294  -16.708 1.00 26.52  ? 93  SER A OG  1 
ATOM   749   N  N   . LYS A  1 94  ? -24.718  86.252  -16.307 1.00 25.92  ? 94  LYS A N   1 
ATOM   750   C  CA  . LYS A  1 94  ? -26.039  86.755  -16.683 1.00 23.82  ? 94  LYS A CA  1 
ATOM   751   C  C   . LYS A  1 94  ? -25.959  88.267  -16.698 1.00 25.29  ? 94  LYS A C   1 
ATOM   752   O  O   . LYS A  1 94  ? -25.206  88.862  -15.929 1.00 46.28  ? 94  LYS A O   1 
ATOM   753   C  CB  . LYS A  1 94  ? -27.148  86.252  -15.749 1.00 26.29  ? 94  LYS A CB  1 
ATOM   754   C  CG  . LYS A  1 94  ? -27.054  86.662  -14.294 1.00 42.01  ? 94  LYS A CG  1 
ATOM   755   C  CD  . LYS A  1 94  ? -28.045  85.855  -13.447 1.00 58.60  ? 94  LYS A CD  1 
ATOM   756   C  CE  . LYS A  1 94  ? -29.468  85.953  -14.000 1.00 52.52  ? 94  LYS A CE  1 
ATOM   757   N  NZ  . LYS A  1 94  ? -30.383  84.991  -13.343 1.00 53.56  ? 94  LYS A NZ  1 
ATOM   758   N  N   . PRO A  1 95  ? -26.709  88.899  -17.594 1.00 21.56  ? 95  PRO A N   1 
ATOM   759   C  CA  . PRO A  1 95  ? -26.600  90.350  -17.765 1.00 12.74  ? 95  PRO A CA  1 
ATOM   760   C  C   . PRO A  1 95  ? -27.001  91.108  -16.521 1.00 13.52  ? 95  PRO A C   1 
ATOM   761   O  O   . PRO A  1 95  ? -28.057  90.844  -15.959 1.00 26.26  ? 95  PRO A O   1 
ATOM   762   C  CB  . PRO A  1 95  ? -27.575  90.643  -18.910 1.00 11.82  ? 95  PRO A CB  1 
ATOM   763   C  CG  . PRO A  1 95  ? -28.493  89.483  -18.939 1.00 10.59  ? 95  PRO A CG  1 
ATOM   764   C  CD  . PRO A  1 95  ? -27.694  88.299  -18.504 1.00 22.57  ? 95  PRO A CD  1 
ATOM   765   N  N   . GLU A  1 96  ? -26.148  92.025  -16.083 1.00 23.15  ? 96  GLU A N   1 
ATOM   766   C  CA  . GLU A  1 96  ? -26.478  92.916  -14.983 1.00 17.36  ? 96  GLU A CA  1 
ATOM   767   C  C   . GLU A  1 96  ? -27.111  94.186  -15.564 1.00 29.56  ? 96  GLU A C   1 
ATOM   768   O  O   . GLU A  1 96  ? -26.442  95.007  -16.204 1.00 20.67  ? 96  GLU A O   1 
ATOM   769   C  CB  . GLU A  1 96  ? -25.236  93.242  -14.139 1.00 11.02  ? 96  GLU A CB  1 
ATOM   770   C  CG  . GLU A  1 96  ? -25.522  94.022  -12.845 1.00 32.62  ? 96  GLU A CG  1 
ATOM   771   C  CD  . GLU A  1 96  ? -24.252  94.448  -12.122 1.00 55.51  ? 96  GLU A CD  1 
ATOM   772   O  OE1 . GLU A  1 96  ? -23.153  94.088  -12.603 1.00 55.52  ? 96  GLU A OE1 1 
ATOM   773   O  OE2 . GLU A  1 96  ? -24.342  95.140  -11.077 1.00 54.95  ? 96  GLU A OE2 1 
ATOM   774   N  N   . VAL A  1 97  ? -28.412  94.342  -15.347 1.00 29.06  ? 97  VAL A N   1 
ATOM   775   C  CA  . VAL A  1 97  ? -29.116  95.502  -15.885 1.00 20.65  ? 97  VAL A CA  1 
ATOM   776   C  C   . VAL A  1 97  ? -29.004  96.687  -14.957 1.00 21.17  ? 97  VAL A C   1 
ATOM   777   O  O   . VAL A  1 97  ? -29.528  96.672  -13.840 1.00 19.67  ? 97  VAL A O   1 
ATOM   778   C  CB  . VAL A  1 97  ? -30.579  95.215  -16.159 1.00 16.13  ? 97  VAL A CB  1 
ATOM   779   C  CG1 . VAL A  1 97  ? -31.210  96.432  -16.764 1.00 22.19  ? 97  VAL A CG1 1 
ATOM   780   C  CG2 . VAL A  1 97  ? -30.704  94.034  -17.091 1.00 4.38   ? 97  VAL A CG2 1 
ATOM   781   N  N   . LEU A  1 98  ? -28.323  97.716  -15.442 1.00 21.22  ? 98  LEU A N   1 
ATOM   782   C  CA  . LEU A  1 98  ? -27.911  98.831  -14.603 1.00 20.07  ? 98  LEU A CA  1 
ATOM   783   C  C   . LEU A  1 98  ? -28.993  99.889  -14.469 1.00 18.34  ? 98  LEU A C   1 
ATOM   784   O  O   . LEU A  1 98  ? -29.039  100.636 -13.494 1.00 25.37  ? 98  LEU A O   1 
ATOM   785   C  CB  . LEU A  1 98  ? -26.628  99.459  -15.164 1.00 12.66  ? 98  LEU A CB  1 
ATOM   786   C  CG  . LEU A  1 98  ? -25.431  98.513  -15.311 1.00 20.71  ? 98  LEU A CG  1 
ATOM   787   C  CD1 . LEU A  1 98  ? -24.316  99.155  -16.142 1.00 10.38  ? 98  LEU A CD1 1 
ATOM   788   C  CD2 . LEU A  1 98  ? -24.933  98.079  -13.936 1.00 5.56   ? 98  LEU A CD2 1 
ATOM   789   N  N   . THR A  1 99  ? -29.864  99.958  -15.459 1.00 14.96  ? 99  THR A N   1 
ATOM   790   C  CA  . THR A  1 99  ? -30.799  101.066 -15.531 1.00 19.74  ? 99  THR A CA  1 
ATOM   791   C  C   . THR A  1 99  ? -32.218  100.624 -15.196 1.00 18.20  ? 99  THR A C   1 
ATOM   792   O  O   . THR A  1 99  ? -32.508  99.433  -15.178 1.00 16.24  ? 99  THR A O   1 
ATOM   793   C  CB  . THR A  1 99  ? -30.765  101.697 -16.912 1.00 14.95  ? 99  THR A CB  1 
ATOM   794   O  OG1 . THR A  1 99  ? -30.837  100.657 -17.899 1.00 27.81  ? 99  THR A OG1 1 
ATOM   795   C  CG2 . THR A  1 99  ? -29.469  102.485 -17.093 1.00 21.70  ? 99  THR A CG2 1 
ATOM   796   N  N   . PRO A  1 100 ? -33.097  101.586 -14.891 1.00 26.13  ? 100 PRO A N   1 
ATOM   797   C  CA  . PRO A  1 100 ? -34.520  101.262 -14.710 1.00 19.76  ? 100 PRO A CA  1 
ATOM   798   C  C   . PRO A  1 100 ? -35.070  100.503 -15.921 1.00 21.41  ? 100 PRO A C   1 
ATOM   799   O  O   . PRO A  1 100 ? -34.804  100.850 -17.070 1.00 25.77  ? 100 PRO A O   1 
ATOM   800   C  CB  . PRO A  1 100 ? -35.180  102.638 -14.577 1.00 8.64   ? 100 PRO A CB  1 
ATOM   801   C  CG  . PRO A  1 100 ? -34.078  103.500 -13.954 1.00 16.62  ? 100 PRO A CG  1 
ATOM   802   C  CD  . PRO A  1 100 ? -32.799  103.001 -14.593 1.00 23.29  ? 100 PRO A CD  1 
ATOM   803   N  N   . GLN A  1 101 ? -35.818  99.446  -15.656 1.00 9.58   ? 101 GLN A N   1 
ATOM   804   C  CA  . GLN A  1 101 ? -36.259  98.581  -16.725 1.00 21.79  ? 101 GLN A CA  1 
ATOM   805   C  C   . GLN A  1 101 ? -37.571  99.064  -17.347 1.00 29.68  ? 101 GLN A C   1 
ATOM   806   O  O   . GLN A  1 101 ? -38.633  98.427  -17.249 1.00 27.38  ? 101 GLN A O   1 
ATOM   807   C  CB  . GLN A  1 101 ? -36.306  97.135  -16.226 1.00 17.05  ? 101 GLN A CB  1 
ATOM   808   C  CG  . GLN A  1 101 ? -34.907  96.678  -15.845 1.00 19.01  ? 101 GLN A CG  1 
ATOM   809   C  CD  . GLN A  1 101 ? -34.861  95.297  -15.260 1.00 20.97  ? 101 GLN A CD  1 
ATOM   810   O  OE1 . GLN A  1 101 ? -35.663  94.430  -15.617 1.00 24.55  ? 101 GLN A OE1 1 
ATOM   811   N  NE2 . GLN A  1 101 ? -33.919  95.078  -14.349 1.00 31.78  ? 101 GLN A NE2 1 
ATOM   812   N  N   . LEU A  1 102 ? -37.470  100.216 -17.995 1.00 21.93  ? 102 LEU A N   1 
ATOM   813   C  CA  . LEU A  1 102 ? -38.606  100.823 -18.679 1.00 18.19  ? 102 LEU A CA  1 
ATOM   814   C  C   . LEU A  1 102 ? -38.444  100.763 -20.193 1.00 14.11  ? 102 LEU A C   1 
ATOM   815   O  O   . LEU A  1 102 ? -37.378  101.048 -20.726 1.00 16.57  ? 102 LEU A O   1 
ATOM   816   C  CB  . LEU A  1 102 ? -38.757  102.285 -18.242 1.00 13.16  ? 102 LEU A CB  1 
ATOM   817   C  CG  . LEU A  1 102 ? -39.007  102.461 -16.745 1.00 20.57  ? 102 LEU A CG  1 
ATOM   818   C  CD1 . LEU A  1 102 ? -39.204  103.916 -16.408 1.00 14.37  ? 102 LEU A CD1 1 
ATOM   819   C  CD2 . LEU A  1 102 ? -40.208  101.646 -16.331 1.00 21.26  ? 102 LEU A CD2 1 
ATOM   820   N  N   . ALA A  1 103 ? -39.510  100.383 -20.883 1.00 17.68  ? 103 ALA A N   1 
ATOM   821   C  CA  . ALA A  1 103 ? -39.554  100.504 -22.335 1.00 16.90  ? 103 ALA A CA  1 
ATOM   822   C  C   . ALA A  1 103 ? -40.260  101.797 -22.708 1.00 9.13   ? 103 ALA A C   1 
ATOM   823   O  O   . ALA A  1 103 ? -40.910  102.427 -21.878 1.00 28.29  ? 103 ALA A O   1 
ATOM   824   C  CB  . ALA A  1 103 ? -40.265  99.319  -22.947 1.00 3.93   ? 103 ALA A CB  1 
ATOM   825   N  N   . ARG A  1 104 ? -40.127  102.196 -23.958 1.00 7.73   ? 104 ARG A N   1 
ATOM   826   C  CA  . ARG A  1 104 ? -40.815  103.376 -24.431 1.00 14.03  ? 104 ARG A CA  1 
ATOM   827   C  C   . ARG A  1 104 ? -41.774  102.917 -25.510 1.00 19.24  ? 104 ARG A C   1 
ATOM   828   O  O   . ARG A  1 104 ? -41.363  102.236 -26.450 1.00 37.30  ? 104 ARG A O   1 
ATOM   829   C  CB  . ARG A  1 104 ? -39.819  104.381 -24.981 1.00 18.03  ? 104 ARG A CB  1 
ATOM   830   C  CG  . ARG A  1 104 ? -40.414  105.729 -25.257 1.00 23.45  ? 104 ARG A CG  1 
ATOM   831   C  CD  . ARG A  1 104 ? -40.662  106.495 -23.983 1.00 17.47  ? 104 ARG A CD  1 
ATOM   832   N  NE  . ARG A  1 104 ? -41.143  107.835 -24.309 1.00 21.46  ? 104 ARG A NE  1 
ATOM   833   C  CZ  . ARG A  1 104 ? -41.497  108.749 -23.414 1.00 24.03  ? 104 ARG A CZ  1 
ATOM   834   N  NH1 . ARG A  1 104 ? -41.442  108.481 -22.116 1.00 28.59  ? 104 ARG A NH1 1 
ATOM   835   N  NH2 . ARG A  1 104 ? -41.914  109.934 -23.820 1.00 25.76  ? 104 ARG A NH2 1 
ATOM   836   N  N   . VAL A  1 105 ? -43.052  103.251 -25.363 1.00 19.37  ? 105 VAL A N   1 
ATOM   837   C  CA  . VAL A  1 105 ? -44.058  102.773 -26.313 1.00 21.29  ? 105 VAL A CA  1 
ATOM   838   C  C   . VAL A  1 105 ? -44.709  103.922 -27.056 1.00 18.60  ? 105 VAL A C   1 
ATOM   839   O  O   . VAL A  1 105 ? -45.213  104.857 -26.438 1.00 24.93  ? 105 VAL A O   1 
ATOM   840   C  CB  . VAL A  1 105 ? -45.122  101.921 -25.618 1.00 21.59  ? 105 VAL A CB  1 
ATOM   841   C  CG1 . VAL A  1 105 ? -46.097  101.356 -26.627 1.00 10.72  ? 105 VAL A CG1 1 
ATOM   842   C  CG2 . VAL A  1 105 ? -44.446  100.801 -24.827 1.00 19.14  ? 105 VAL A CG2 1 
ATOM   843   N  N   . VAL A  1 106 ? -44.648  103.869 -28.385 1.00 19.13  ? 106 VAL A N   1 
ATOM   844   C  CA  . VAL A  1 106 ? -45.304  104.868 -29.230 1.00 31.70  ? 106 VAL A CA  1 
ATOM   845   C  C   . VAL A  1 106 ? -46.723  104.440 -29.575 1.00 25.79  ? 106 VAL A C   1 
ATOM   846   O  O   . VAL A  1 106 ? -47.001  103.251 -29.710 1.00 14.88  ? 106 VAL A O   1 
ATOM   847   C  CB  . VAL A  1 106 ? -44.533  105.088 -30.541 1.00 32.11  ? 106 VAL A CB  1 
ATOM   848   C  CG1 . VAL A  1 106 ? -45.003  106.373 -31.238 1.00 18.04  ? 106 VAL A CG1 1 
ATOM   849   C  CG2 . VAL A  1 106 ? -43.057  105.149 -30.249 1.00 23.10  ? 106 VAL A CG2 1 
ATOM   850   N  N   . SER A  1 107 ? -47.603  105.421 -29.740 1.00 24.74  ? 107 SER A N   1 
ATOM   851   C  CA  . SER A  1 107 ? -49.019  105.171 -30.015 1.00 27.03  ? 107 SER A CA  1 
ATOM   852   C  C   . SER A  1 107 ? -49.311  104.147 -31.120 1.00 23.25  ? 107 SER A C   1 
ATOM   853   O  O   . SER A  1 107 ? -50.359  103.520 -31.114 1.00 33.32  ? 107 SER A O   1 
ATOM   854   C  CB  . SER A  1 107 ? -49.752  106.484 -30.319 1.00 28.22  ? 107 SER A CB  1 
ATOM   855   O  OG  . SER A  1 107 ? -49.259  107.098 -31.497 1.00 25.65  ? 107 SER A OG  1 
ATOM   856   N  N   . ASP A  1 108 ? -48.396  103.985 -32.060 1.00 12.53  ? 108 ASP A N   1 
ATOM   857   C  CA  . ASP A  1 108 ? -48.588  103.027 -33.146 1.00 20.98  ? 108 ASP A CA  1 
ATOM   858   C  C   . ASP A  1 108 ? -48.091  101.619 -32.806 1.00 29.22  ? 108 ASP A C   1 
ATOM   859   O  O   . ASP A  1 108 ? -48.116  100.725 -33.647 1.00 33.89  ? 108 ASP A O   1 
ATOM   860   C  CB  . ASP A  1 108 ? -47.886  103.507 -34.415 1.00 24.63  ? 108 ASP A CB  1 
ATOM   861   C  CG  . ASP A  1 108 ? -46.381  103.652 -34.230 1.00 42.50  ? 108 ASP A CG  1 
ATOM   862   O  OD1 . ASP A  1 108 ? -45.896  103.267 -33.142 1.00 28.44  ? 108 ASP A OD1 1 
ATOM   863   O  OD2 . ASP A  1 108 ? -45.690  104.137 -35.167 1.00 36.34  ? 108 ASP A OD2 1 
ATOM   864   N  N   . GLY A  1 109 ? -47.612  101.426 -31.586 1.00 19.24  ? 109 GLY A N   1 
ATOM   865   C  CA  . GLY A  1 109 ? -47.180  100.106 -31.161 1.00 19.66  ? 109 GLY A CA  1 
ATOM   866   C  C   . GLY A  1 109 ? -45.690  99.811  -31.293 1.00 25.51  ? 109 GLY A C   1 
ATOM   867   O  O   . GLY A  1 109 ? -45.231  98.703  -31.005 1.00 15.88  ? 109 GLY A O   1 
ATOM   868   N  N   . GLU A  1 110 ? -44.910  100.776 -31.750 1.00 26.64  ? 110 GLU A N   1 
ATOM   869   C  CA  A GLU A  1 110 ? -43.479  100.541 -31.789 0.50 32.70  ? 110 GLU A CA  1 
ATOM   870   C  CA  B GLU A  1 110 ? -43.467  100.605 -31.795 0.50 31.76  ? 110 GLU A CA  1 
ATOM   871   C  C   . GLU A  1 110 ? -42.906  100.674 -30.365 1.00 32.40  ? 110 GLU A C   1 
ATOM   872   O  O   . GLU A  1 110 ? -43.391  101.459 -29.528 1.00 25.92  ? 110 GLU A O   1 
ATOM   873   C  CB  A GLU A  1 110 ? -42.768  101.417 -32.841 0.50 28.06  ? 110 GLU A CB  1 
ATOM   874   C  CB  B GLU A  1 110 ? -42.835  101.670 -32.699 0.50 27.04  ? 110 GLU A CB  1 
ATOM   875   C  CG  A GLU A  1 110 ? -43.151  101.080 -34.297 0.50 24.75  ? 110 GLU A CG  1 
ATOM   876   C  CG  B GLU A  1 110 ? -41.331  101.533 -32.909 0.50 22.90  ? 110 GLU A CG  1 
ATOM   877   C  CD  A GLU A  1 110 ? -41.996  100.519 -35.152 0.50 33.61  ? 110 GLU A CD  1 
ATOM   878   C  CD  B GLU A  1 110 ? -40.733  102.790 -33.487 0.50 36.50  ? 110 GLU A CD  1 
ATOM   879   O  OE1 A GLU A  1 110 ? -41.276  99.597  -34.704 0.50 10.67  ? 110 GLU A OE1 1 
ATOM   880   O  OE1 B GLU A  1 110 ? -40.335  102.776 -34.677 0.50 11.29  ? 110 GLU A OE1 1 
ATOM   881   O  OE2 A GLU A  1 110 ? -41.822  101.001 -36.296 0.50 15.69  ? 110 GLU A OE2 1 
ATOM   882   O  OE2 B GLU A  1 110 ? -40.673  103.793 -32.744 0.50 9.94   ? 110 GLU A OE2 1 
ATOM   883   N  N   . VAL A  1 111 ? -41.902  99.853  -30.080 1.00 20.89  ? 111 VAL A N   1 
ATOM   884   C  CA  . VAL A  1 111 ? -41.329  99.775  -28.743 1.00 22.48  ? 111 VAL A CA  1 
ATOM   885   C  C   . VAL A  1 111 ? -39.820  99.969  -28.807 1.00 21.64  ? 111 VAL A C   1 
ATOM   886   O  O   . VAL A  1 111 ? -39.153  99.320  -29.601 1.00 29.03  ? 111 VAL A O   1 
ATOM   887   C  CB  . VAL A  1 111 ? -41.648  98.414  -28.101 1.00 17.88  ? 111 VAL A CB  1 
ATOM   888   C  CG1 . VAL A  1 111 ? -41.250  98.404  -26.648 1.00 5.37   ? 111 VAL A CG1 1 
ATOM   889   C  CG2 . VAL A  1 111 ? -43.125  98.120  -28.229 1.00 17.73  ? 111 VAL A CG2 1 
ATOM   890   N  N   . LEU A  1 112 ? -39.297  100.899 -28.010 1.00 24.15  ? 112 LEU A N   1 
ATOM   891   C  CA  . LEU A  1 112 ? -37.854  100.987 -27.785 1.00 22.86  ? 112 LEU A CA  1 
ATOM   892   C  C   . LEU A  1 112 ? -37.566  100.507 -26.369 1.00 27.87  ? 112 LEU A C   1 
ATOM   893   O  O   . LEU A  1 112 ? -38.257  100.900 -25.419 1.00 31.17  ? 112 LEU A O   1 
ATOM   894   C  CB  . LEU A  1 112 ? -37.295  102.413 -27.984 1.00 18.00  ? 112 LEU A CB  1 
ATOM   895   C  CG  . LEU A  1 112 ? -35.775  102.609 -27.684 1.00 52.82  ? 112 LEU A CG  1 
ATOM   896   C  CD1 . LEU A  1 112 ? -34.927  101.799 -28.649 1.00 43.37  ? 112 LEU A CD1 1 
ATOM   897   C  CD2 . LEU A  1 112 ? -35.230  104.072 -27.659 1.00 9.22   ? 112 LEU A CD2 1 
ATOM   898   N  N   . TYR A  1 113 ? -36.565  99.640  -26.238 1.00 16.90  ? 113 TYR A N   1 
ATOM   899   C  CA  . TYR A  1 113 ? -36.011  99.290  -24.932 1.00 14.20  ? 113 TYR A CA  1 
ATOM   900   C  C   . TYR A  1 113 ? -34.517  99.366  -25.057 1.00 21.10  ? 113 TYR A C   1 
ATOM   901   O  O   . TYR A  1 113 ? -33.949  98.741  -25.938 1.00 26.75  ? 113 TYR A O   1 
ATOM   902   C  CB  . TYR A  1 113 ? -36.436  97.884  -24.522 1.00 9.09   ? 113 TYR A CB  1 
ATOM   903   C  CG  . TYR A  1 113 ? -35.968  97.459  -23.156 1.00 20.02  ? 113 TYR A CG  1 
ATOM   904   C  CD1 . TYR A  1 113 ? -36.025  98.333  -22.066 1.00 20.18  ? 113 TYR A CD1 1 
ATOM   905   C  CD2 . TYR A  1 113 ? -35.490  96.169  -22.944 1.00 7.65   ? 113 TYR A CD2 1 
ATOM   906   C  CE1 . TYR A  1 113 ? -35.592  97.936  -20.795 1.00 18.14  ? 113 TYR A CE1 1 
ATOM   907   C  CE2 . TYR A  1 113 ? -35.054  95.757  -21.686 1.00 13.70  ? 113 TYR A CE2 1 
ATOM   908   C  CZ  . TYR A  1 113 ? -35.108  96.644  -20.610 1.00 26.26  ? 113 TYR A CZ  1 
ATOM   909   O  OH  . TYR A  1 113 ? -34.682  96.241  -19.355 1.00 21.30  ? 113 TYR A OH  1 
ATOM   910   N  N   . MET A  1 114 ? -33.883  100.156 -24.196 1.00 30.49  ? 114 MET A N   1 
ATOM   911   C  CA  . MET A  1 114 ? -32.434  100.373 -24.257 1.00 24.31  ? 114 MET A CA  1 
ATOM   912   C  C   . MET A  1 114 ? -31.797  100.454 -22.862 1.00 20.12  ? 114 MET A C   1 
ATOM   913   O  O   . MET A  1 114 ? -31.397  101.525 -22.403 1.00 14.35  ? 114 MET A O   1 
ATOM   914   C  CB  . MET A  1 114 ? -32.122  101.638 -25.051 1.00 5.24   ? 114 MET A CB  1 
ATOM   915   C  CG  . MET A  1 114 ? -30.655  101.746 -25.470 1.00 16.31  ? 114 MET A CG  1 
ATOM   916   S  SD  . MET A  1 114 ? -30.404  102.919 -26.816 1.00 20.79  ? 114 MET A SD  1 
ATOM   917   C  CE  . MET A  1 114 ? -30.894  104.469 -26.044 1.00 15.53  ? 114 MET A CE  1 
ATOM   918   N  N   . PRO A  1 115 ? -31.719  99.313  -22.177 1.00 15.50  ? 115 PRO A N   1 
ATOM   919   C  CA  . PRO A  1 115 ? -31.127  99.304  -20.842 1.00 20.96  ? 115 PRO A CA  1 
ATOM   920   C  C   . PRO A  1 115 ? -29.605  99.343  -20.971 1.00 29.05  ? 115 PRO A C   1 
ATOM   921   O  O   . PRO A  1 115 ? -29.077  98.898  -21.994 1.00 25.32  ? 115 PRO A O   1 
ATOM   922   C  CB  . PRO A  1 115 ? -31.573  97.951  -20.288 1.00 11.64  ? 115 PRO A CB  1 
ATOM   923   C  CG  . PRO A  1 115 ? -31.619  97.076  -21.485 1.00 13.20  ? 115 PRO A CG  1 
ATOM   924   C  CD  . PRO A  1 115 ? -32.108  97.964  -22.619 1.00 10.75  ? 115 PRO A CD  1 
ATOM   925   N  N   . SER A  1 116 ? -28.913  99.885  -19.972 1.00 22.02  ? 116 SER A N   1 
ATOM   926   C  CA  . SER A  1 116 ? -27.465  99.758  -19.927 1.00 24.37  ? 116 SER A CA  1 
ATOM   927   C  C   . SER A  1 116 ? -27.124  98.444  -19.225 1.00 21.47  ? 116 SER A C   1 
ATOM   928   O  O   . SER A  1 116 ? -27.633  98.161  -18.142 1.00 28.75  ? 116 SER A O   1 
ATOM   929   C  CB  . SER A  1 116 ? -26.846  100.939 -19.204 1.00 8.06   ? 116 SER A CB  1 
ATOM   930   O  OG  . SER A  1 116 ? -25.441  100.873 -19.262 1.00 29.64  ? 116 SER A OG  1 
ATOM   931   N  N   . ILE A  1 117 ? -26.288  97.631  -19.861 1.00 14.42  ? 117 ILE A N   1 
ATOM   932   C  CA  . ILE A  1 117 ? -25.941  96.316  -19.327 1.00 21.11  ? 117 ILE A CA  1 
ATOM   933   C  C   . ILE A  1 117 ? -24.434  96.096  -19.115 1.00 15.28  ? 117 ILE A C   1 
ATOM   934   O  O   . ILE A  1 117 ? -23.613  96.457  -19.956 1.00 31.67  ? 117 ILE A O   1 
ATOM   935   C  CB  . ILE A  1 117 ? -26.459  95.220  -20.253 1.00 24.05  ? 117 ILE A CB  1 
ATOM   936   C  CG1 . ILE A  1 117 ? -27.982  95.236  -20.263 1.00 14.51  ? 117 ILE A CG1 1 
ATOM   937   C  CG2 . ILE A  1 117 ? -25.915  93.856  -19.834 1.00 18.90  ? 117 ILE A CG2 1 
ATOM   938   C  CD1 . ILE A  1 117 ? -28.586  94.274  -21.278 1.00 22.10  ? 117 ILE A CD1 1 
ATOM   939   N  N   . ARG A  1 118 ? -24.082  95.527  -17.975 1.00 19.94  ? 118 ARG A N   1 
ATOM   940   C  CA  . ARG A  1 118 ? -22.724  95.051  -17.743 1.00 14.27  ? 118 ARG A CA  1 
ATOM   941   C  C   . ARG A  1 118 ? -22.729  93.532  -17.777 1.00 12.92  ? 118 ARG A C   1 
ATOM   942   O  O   . ARG A  1 118 ? -23.502  92.874  -17.084 1.00 13.49  ? 118 ARG A O   1 
ATOM   943   C  CB  . ARG A  1 118 ? -22.183  95.531  -16.396 1.00 15.54  ? 118 ARG A CB  1 
ATOM   944   C  CG  . ARG A  1 118 ? -20.825  94.922  -16.039 1.00 15.95  ? 118 ARG A CG  1 
ATOM   945   C  CD  . ARG A  1 118 ? -20.143  95.635  -14.876 1.00 17.24  ? 118 ARG A CD  1 
ATOM   946   N  NE  . ARG A  1 118 ? -18.815  95.088  -14.643 1.00 38.86  ? 118 ARG A NE  1 
ATOM   947   C  CZ  . ARG A  1 118 ? -17.920  95.584  -13.794 1.00 32.70  ? 118 ARG A CZ  1 
ATOM   948   N  NH1 . ARG A  1 118 ? -18.208  96.662  -13.080 1.00 30.16  ? 118 ARG A NH1 1 
ATOM   949   N  NH2 . ARG A  1 118 ? -16.729  95.002  -13.677 1.00 16.00  ? 118 ARG A NH2 1 
ATOM   950   N  N   . GLN A  1 119 ? -21.846  92.974  -18.581 1.00 8.17   ? 119 GLN A N   1 
ATOM   951   C  CA  . GLN A  1 119 ? -21.837  91.541  -18.799 1.00 29.28  ? 119 GLN A CA  1 
ATOM   952   C  C   . GLN A  1 119 ? -20.429  91.098  -19.183 1.00 31.08  ? 119 GLN A C   1 
ATOM   953   O  O   . GLN A  1 119 ? -19.712  91.812  -19.896 1.00 7.48   ? 119 GLN A O   1 
ATOM   954   C  CB  . GLN A  1 119 ? -22.834  91.169  -19.909 1.00 20.16  ? 119 GLN A CB  1 
ATOM   955   C  CG  . GLN A  1 119 ? -23.263  89.718  -19.908 1.00 29.27  ? 119 GLN A CG  1 
ATOM   956   C  CD  . GLN A  1 119 ? -24.471  89.472  -20.799 1.00 26.08  ? 119 GLN A CD  1 
ATOM   957   O  OE1 . GLN A  1 119 ? -24.729  90.231  -21.736 1.00 26.52  ? 119 GLN A OE1 1 
ATOM   958   N  NE2 . GLN A  1 119 ? -25.217  88.408  -20.509 1.00 27.95  ? 119 GLN A NE2 1 
ATOM   959   N  N   . ARG A  1 120 ? -20.031  89.932  -18.687 1.00 19.29  ? 120 ARG A N   1 
ATOM   960   C  CA  . ARG A  1 120 ? -18.764  89.341  -19.073 1.00 24.78  ? 120 ARG A CA  1 
ATOM   961   C  C   . ARG A  1 120 ? -18.968  88.390  -20.251 1.00 28.06  ? 120 ARG A C   1 
ATOM   962   O  O   . ARG A  1 120 ? -19.972  87.673  -20.302 1.00 29.78  ? 120 ARG A O   1 
ATOM   963   C  CB  . ARG A  1 120 ? -18.145  88.587  -17.900 1.00 11.95  ? 120 ARG A CB  1 
ATOM   964   C  CG  . ARG A  1 120 ? -17.299  89.431  -16.963 1.00 14.56  ? 120 ARG A CG  1 
ATOM   965   C  CD  . ARG A  1 120 ? -16.787  88.554  -15.817 1.00 51.57  ? 120 ARG A CD  1 
ATOM   966   N  NE  . ARG A  1 120 ? -17.887  87.899  -15.105 1.00 79.84  ? 120 ARG A NE  1 
ATOM   967   C  CZ  . ARG A  1 120 ? -17.743  87.077  -14.069 1.00 81.94  ? 120 ARG A CZ  1 
ATOM   968   N  NH1 . ARG A  1 120 ? -16.536  86.795  -13.598 1.00 101.14 ? 120 ARG A NH1 1 
ATOM   969   N  NH2 . ARG A  1 120 ? -18.812  86.538  -13.500 1.00 64.87  ? 120 ARG A NH2 1 
ATOM   970   N  N   . PHE A  1 121 ? -18.002  88.381  -21.172 1.00 19.82  ? 121 PHE A N   1 
ATOM   971   C  CA  . PHE A  1 121 ? -18.033  87.523  -22.350 1.00 16.27  ? 121 PHE A CA  1 
ATOM   972   C  C   . PHE A  1 121 ? -16.756  86.696  -22.564 1.00 22.66  ? 121 PHE A C   1 
ATOM   973   O  O   . PHE A  1 121 ? -15.666  87.070  -22.136 1.00 29.18  ? 121 PHE A O   1 
ATOM   974   C  CB  . PHE A  1 121 ? -18.275  88.361  -23.603 1.00 15.16  ? 121 PHE A CB  1 
ATOM   975   C  CG  . PHE A  1 121 ? -19.555  89.128  -23.581 1.00 28.56  ? 121 PHE A CG  1 
ATOM   976   C  CD1 . PHE A  1 121 ? -20.720  88.565  -24.068 1.00 19.00  ? 121 PHE A CD1 1 
ATOM   977   C  CD2 . PHE A  1 121 ? -19.591  90.419  -23.087 1.00 21.30  ? 121 PHE A CD2 1 
ATOM   978   C  CE1 . PHE A  1 121 ? -21.879  89.271  -24.053 1.00 21.82  ? 121 PHE A CE1 1 
ATOM   979   C  CE2 . PHE A  1 121 ? -20.758  91.128  -23.069 1.00 20.57  ? 121 PHE A CE2 1 
ATOM   980   C  CZ  . PHE A  1 121 ? -21.903  90.557  -23.547 1.00 25.13  ? 121 PHE A CZ  1 
ATOM   981   N  N   . SER A  1 122 ? -16.923  85.572  -23.250 1.00 15.80  ? 122 SER A N   1 
ATOM   982   C  CA  . SER A  1 122 ? -15.838  84.776  -23.769 1.00 16.81  ? 122 SER A CA  1 
ATOM   983   C  C   . SER A  1 122 ? -15.679  85.070  -25.249 1.00 16.78  ? 122 SER A C   1 
ATOM   984   O  O   . SER A  1 122 ? -16.557  84.764  -26.029 1.00 31.66  ? 122 SER A O   1 
ATOM   985   C  CB  . SER A  1 122 ? -16.155  83.308  -23.582 1.00 19.16  ? 122 SER A CB  1 
ATOM   986   O  OG  . SER A  1 122 ? -15.560  82.540  -24.605 1.00 28.27  ? 122 SER A OG  1 
ATOM   987   N  N   . CYS A  1 123 ? -14.558  85.675  -25.630 1.00 29.18  ? 123 CYS A N   1 
ATOM   988   C  CA  . CYS A  1 123 ? -14.281  85.997  -27.033 1.00 28.85  ? 123 CYS A CA  1 
ATOM   989   C  C   . CYS A  1 123 ? -12.788  86.232  -27.272 1.00 39.54  ? 123 CYS A C   1 
ATOM   990   O  O   . CYS A  1 123 ? -11.975  86.197  -26.340 1.00 33.20  ? 123 CYS A O   1 
ATOM   991   C  CB  . CYS A  1 123 ? -15.051  87.239  -27.476 1.00 21.89  ? 123 CYS A CB  1 
ATOM   992   S  SG  . CYS A  1 123 ? -14.681  88.670  -26.463 1.00 31.25  ? 123 CYS A SG  1 
ATOM   993   N  N   . ASP A  1 124 ? -12.436  86.493  -28.528 1.00 34.99  ? 124 ASP A N   1 
ATOM   994   C  CA  . ASP A  1 124 ? -11.041  86.664  -28.910 1.00 28.55  ? 124 ASP A CA  1 
ATOM   995   C  C   . ASP A  1 124 ? -10.439  87.978  -28.388 1.00 35.69  ? 124 ASP A C   1 
ATOM   996   O  O   . ASP A  1 124 ? -10.676  89.053  -28.934 1.00 29.79  ? 124 ASP A O   1 
ATOM   997   C  CB  . ASP A  1 124 ? -10.902  86.595  -30.429 1.00 32.44  ? 124 ASP A CB  1 
ATOM   998   C  CG  . ASP A  1 124 ? -9.489   86.321  -30.861 1.00 39.98  ? 124 ASP A CG  1 
ATOM   999   O  OD1 . ASP A  1 124 ? -8.597   86.346  -29.988 1.00 38.64  ? 124 ASP A OD1 1 
ATOM   1000  O  OD2 . ASP A  1 124 ? -9.268   86.076  -32.065 1.00 43.57  ? 124 ASP A OD2 1 
ATOM   1001  N  N   . VAL A  1 125 ? -9.642   87.882  -27.333 1.00 26.42  ? 125 VAL A N   1 
ATOM   1002  C  CA  . VAL A  1 125 ? -9.015   89.059  -26.763 1.00 23.33  ? 125 VAL A CA  1 
ATOM   1003  C  C   . VAL A  1 125 ? -7.582   89.215  -27.285 1.00 28.54  ? 125 VAL A C   1 
ATOM   1004  O  O   . VAL A  1 125 ? -6.896   90.185  -26.989 1.00 26.06  ? 125 VAL A O   1 
ATOM   1005  C  CB  . VAL A  1 125 ? -9.027   88.984  -25.230 1.00 20.89  ? 125 VAL A CB  1 
ATOM   1006  C  CG1 . VAL A  1 125 ? -8.507   90.255  -24.652 1.00 27.80  ? 125 VAL A CG1 1 
ATOM   1007  C  CG2 . VAL A  1 125 ? -10.428  88.752  -24.741 1.00 12.61  ? 125 VAL A CG2 1 
ATOM   1008  N  N   . SER A  1 126 ? -7.136   88.256  -28.084 1.00 39.67  ? 126 SER A N   1 
ATOM   1009  C  CA  . SER A  1 126 ? -5.776   88.283  -28.601 1.00 40.64  ? 126 SER A CA  1 
ATOM   1010  C  C   . SER A  1 126 ? -5.518   89.587  -29.355 1.00 36.70  ? 126 SER A C   1 
ATOM   1011  O  O   . SER A  1 126 ? -6.373   90.066  -30.096 1.00 21.61  ? 126 SER A O   1 
ATOM   1012  C  CB  . SER A  1 126 ? -5.551   87.089  -29.510 1.00 18.52  ? 126 SER A CB  1 
ATOM   1013  O  OG  . SER A  1 126 ? -6.061   87.345  -30.799 1.00 35.98  ? 126 SER A OG  1 
ATOM   1014  N  N   . GLY A  1 127 ? -4.342   90.167  -29.149 1.00 27.17  ? 127 GLY A N   1 
ATOM   1015  C  CA  . GLY A  1 127 ? -3.960   91.378  -29.848 1.00 22.63  ? 127 GLY A CA  1 
ATOM   1016  C  C   . GLY A  1 127 ? -4.493   92.658  -29.228 1.00 36.67  ? 127 GLY A C   1 
ATOM   1017  O  O   . GLY A  1 127 ? -4.275   93.744  -29.770 1.00 23.72  ? 127 GLY A O   1 
ATOM   1018  N  N   . VAL A  1 128 ? -5.176   92.541  -28.091 1.00 21.81  ? 128 VAL A N   1 
ATOM   1019  C  CA  . VAL A  1 128 ? -5.765   93.699  -27.434 1.00 14.61  ? 128 VAL A CA  1 
ATOM   1020  C  C   . VAL A  1 128 ? -4.752   94.811  -27.194 1.00 28.39  ? 128 VAL A C   1 
ATOM   1021  O  O   . VAL A  1 128 ? -5.110   95.994  -27.154 1.00 28.00  ? 128 VAL A O   1 
ATOM   1022  C  CB  . VAL A  1 128 ? -6.438   93.332  -26.082 1.00 21.46  ? 128 VAL A CB  1 
ATOM   1023  C  CG1 . VAL A  1 128 ? -5.428   92.734  -25.128 1.00 12.82  ? 128 VAL A CG1 1 
ATOM   1024  C  CG2 . VAL A  1 128 ? -7.078   94.559  -25.467 1.00 11.58  ? 128 VAL A CG2 1 
ATOM   1025  N  N   . ASP A  1 129 ? -3.487   94.427  -27.033 1.00 23.55  ? 129 ASP A N   1 
ATOM   1026  C  CA  . ASP A  1 129 ? -2.435   95.377  -26.703 1.00 25.95  ? 129 ASP A CA  1 
ATOM   1027  C  C   . ASP A  1 129 ? -1.541   95.690  -27.900 1.00 32.55  ? 129 ASP A C   1 
ATOM   1028  O  O   . ASP A  1 129 ? -0.340   95.923  -27.754 1.00 24.41  ? 129 ASP A O   1 
ATOM   1029  C  CB  . ASP A  1 129 ? -1.599   94.866  -25.520 1.00 36.14  ? 129 ASP A CB  1 
ATOM   1030  C  CG  . ASP A  1 129 ? -1.045   95.990  -24.669 1.00 50.43  ? 129 ASP A CG  1 
ATOM   1031  O  OD1 . ASP A  1 129 ? -0.969   97.132  -25.160 1.00 53.78  ? 129 ASP A OD1 1 
ATOM   1032  O  OD2 . ASP A  1 129 ? -0.684   95.733  -23.509 1.00 58.84  ? 129 ASP A OD2 1 
ATOM   1033  N  N   . THR A  1 130 ? -2.135   95.710  -29.086 1.00 36.21  ? 130 THR A N   1 
ATOM   1034  C  CA  . THR A  1 130 ? -1.393   96.046  -30.290 1.00 32.55  ? 130 THR A CA  1 
ATOM   1035  C  C   . THR A  1 130 ? -2.079   97.151  -31.075 1.00 45.12  ? 130 THR A C   1 
ATOM   1036  O  O   . THR A  1 130 ? -3.182   97.580  -30.744 1.00 36.07  ? 130 THR A O   1 
ATOM   1037  C  CB  . THR A  1 130 ? -1.228   94.830  -31.222 1.00 36.45  ? 130 THR A CB  1 
ATOM   1038  O  OG1 . THR A  1 130 ? -2.502   94.461  -31.767 1.00 32.61  ? 130 THR A OG1 1 
ATOM   1039  C  CG2 . THR A  1 130 ? -0.634   93.651  -30.475 1.00 19.87  ? 130 THR A CG2 1 
ATOM   1040  N  N   . GLU A  1 131 ? -1.396   97.597  -32.124 1.00 37.68  ? 131 GLU A N   1 
ATOM   1041  C  CA  . GLU A  1 131 ? -1.924   98.555  -33.090 1.00 41.56  ? 131 GLU A CA  1 
ATOM   1042  C  C   . GLU A  1 131 ? -3.276   98.112  -33.666 1.00 43.55  ? 131 GLU A C   1 
ATOM   1043  O  O   . GLU A  1 131 ? -4.211   98.902  -33.821 1.00 27.42  ? 131 GLU A O   1 
ATOM   1044  C  CB  . GLU A  1 131 ? -0.924   98.663  -34.239 1.00 28.80  ? 131 GLU A CB  1 
ATOM   1045  C  CG  . GLU A  1 131 ? -1.103   99.858  -35.118 1.00 26.84  ? 131 GLU A CG  1 
ATOM   1046  C  CD  . GLU A  1 131 ? -0.684   101.131 -34.429 1.00 58.09  ? 131 GLU A CD  1 
ATOM   1047  O  OE1 . GLU A  1 131 ? -0.339   102.094 -35.149 1.00 69.39  ? 131 GLU A OE1 1 
ATOM   1048  O  OE2 . GLU A  1 131 ? -0.695   101.163 -33.173 1.00 59.19  ? 131 GLU A OE2 1 
ATOM   1049  N  N   . SER A  1 132 ? -3.347   96.832  -33.999 1.00 30.46  ? 132 SER A N   1 
ATOM   1050  C  CA  . SER A  1 132 ? -4.487   96.262  -34.668 1.00 17.67  ? 132 SER A CA  1 
ATOM   1051  C  C   . SER A  1 132 ? -5.646   96.032  -33.688 1.00 29.40  ? 132 SER A C   1 
ATOM   1052  O  O   . SER A  1 132 ? -6.812   95.906  -34.087 1.00 45.79  ? 132 SER A O   1 
ATOM   1053  C  CB  . SER A  1 132 ? -4.075   94.947  -35.343 1.00 27.48  ? 132 SER A CB  1 
ATOM   1054  O  OG  . SER A  1 132 ? -4.253   93.827  -34.481 1.00 37.16  ? 132 SER A OG  1 
ATOM   1055  N  N   . GLY A  1 133 ? -5.314   96.002  -32.404 1.00 42.31  ? 133 GLY A N   1 
ATOM   1056  C  CA  . GLY A  1 133 ? -6.275   95.724  -31.354 1.00 24.06  ? 133 GLY A CA  1 
ATOM   1057  C  C   . GLY A  1 133 ? -6.851   94.318  -31.403 1.00 35.08  ? 133 GLY A C   1 
ATOM   1058  O  O   . GLY A  1 133 ? -6.519   93.514  -32.273 1.00 34.90  ? 133 GLY A O   1 
ATOM   1059  N  N   . ALA A  1 134 ? -7.724   94.021  -30.446 1.00 36.11  ? 134 ALA A N   1 
ATOM   1060  C  CA  . ALA A  1 134 ? -8.467   92.769  -30.439 1.00 35.98  ? 134 ALA A CA  1 
ATOM   1061  C  C   . ALA A  1 134 ? -9.811   92.937  -31.133 1.00 26.68  ? 134 ALA A C   1 
ATOM   1062  O  O   . ALA A  1 134 ? -10.356  94.035  -31.208 1.00 22.99  ? 134 ALA A O   1 
ATOM   1063  C  CB  . ALA A  1 134 ? -8.672   92.293  -29.014 1.00 36.13  ? 134 ALA A CB  1 
ATOM   1064  N  N   . THR A  1 135 ? -10.339  91.842  -31.654 1.00 21.05  ? 135 THR A N   1 
ATOM   1065  C  CA  . THR A  1 135 ? -11.668  91.876  -32.246 1.00 24.40  ? 135 THR A CA  1 
ATOM   1066  C  C   . THR A  1 135 ? -12.543  90.853  -31.547 1.00 26.03  ? 135 THR A C   1 
ATOM   1067  O  O   . THR A  1 135 ? -12.399  89.642  -31.744 1.00 20.19  ? 135 THR A O   1 
ATOM   1068  C  CB  . THR A  1 135 ? -11.659  91.629  -33.768 1.00 24.43  ? 135 THR A CB  1 
ATOM   1069  O  OG1 . THR A  1 135 ? -11.040  92.733  -34.424 1.00 26.49  ? 135 THR A OG1 1 
ATOM   1070  C  CG2 . THR A  1 135 ? -13.082  91.531  -34.280 1.00 27.92  ? 135 THR A CG2 1 
ATOM   1071  N  N   . CYS A  1 136 ? -13.441  91.371  -30.718 1.00 20.60  ? 136 CYS A N   1 
ATOM   1072  C  CA  . CYS A  1 136 ? -14.286  90.562  -29.850 1.00 27.27  ? 136 CYS A CA  1 
ATOM   1073  C  C   . CYS A  1 136 ? -15.668  90.388  -30.470 1.00 36.85  ? 136 CYS A C   1 
ATOM   1074  O  O   . CYS A  1 136 ? -16.404  91.353  -30.682 1.00 21.36  ? 136 CYS A O   1 
ATOM   1075  C  CB  . CYS A  1 136 ? -14.416  91.232  -28.482 1.00 20.63  ? 136 CYS A CB  1 
ATOM   1076  S  SG  . CYS A  1 136 ? -15.420  90.347  -27.320 1.00 25.52  ? 136 CYS A SG  1 
ATOM   1077  N  N   . ARG A  1 137 ? -16.023  89.144  -30.742 1.00 38.94  ? 137 ARG A N   1 
ATOM   1078  C  CA  . ARG A  1 137 ? -17.284  88.837  -31.395 1.00 33.78  ? 137 ARG A CA  1 
ATOM   1079  C  C   . ARG A  1 137 ? -18.383  88.588  -30.349 1.00 26.69  ? 137 ARG A C   1 
ATOM   1080  O  O   . ARG A  1 137 ? -18.368  87.558  -29.675 1.00 22.61  ? 137 ARG A O   1 
ATOM   1081  C  CB  . ARG A  1 137 ? -17.073  87.579  -32.240 1.00 26.92  ? 137 ARG A CB  1 
ATOM   1082  C  CG  . ARG A  1 137 ? -17.905  87.482  -33.478 1.00 30.93  ? 137 ARG A CG  1 
ATOM   1083  C  CD  . ARG A  1 137 ? -17.547  86.214  -34.239 1.00 47.62  ? 137 ARG A CD  1 
ATOM   1084  N  NE  . ARG A  1 137 ? -17.761  84.996  -33.455 1.00 61.23  ? 137 ARG A NE  1 
ATOM   1085  C  CZ  . ARG A  1 137 ? -16.815  84.097  -33.194 1.00 49.29  ? 137 ARG A CZ  1 
ATOM   1086  N  NH1 . ARG A  1 137 ? -15.584  84.282  -33.656 1.00 61.83  ? 137 ARG A NH1 1 
ATOM   1087  N  NH2 . ARG A  1 137 ? -17.100  83.010  -32.479 1.00 30.81  ? 137 ARG A NH2 1 
ATOM   1088  N  N   . ILE A  1 138 ? -19.328  89.514  -30.193 1.00 25.47  ? 138 ILE A N   1 
ATOM   1089  C  CA  . ILE A  1 138 ? -20.490  89.228  -29.340 1.00 31.98  ? 138 ILE A CA  1 
ATOM   1090  C  C   . ILE A  1 138 ? -21.735  88.790  -30.153 1.00 24.70  ? 138 ILE A C   1 
ATOM   1091  O  O   . ILE A  1 138 ? -22.219  89.516  -31.013 1.00 18.39  ? 138 ILE A O   1 
ATOM   1092  C  CB  . ILE A  1 138 ? -20.848  90.412  -28.433 1.00 28.62  ? 138 ILE A CB  1 
ATOM   1093  C  CG1 . ILE A  1 138 ? -19.729  90.678  -27.430 1.00 12.32  ? 138 ILE A CG1 1 
ATOM   1094  C  CG2 . ILE A  1 138 ? -22.155  90.133  -27.711 1.00 12.45  ? 138 ILE A CG2 1 
ATOM   1095  C  CD1 . ILE A  1 138 ? -19.863  91.996  -26.710 1.00 12.89  ? 138 ILE A CD1 1 
ATOM   1096  N  N   . LYS A  1 139 ? -22.243  87.600  -29.863 1.00 19.64  ? 139 LYS A N   1 
ATOM   1097  C  CA  . LYS A  1 139 ? -23.369  87.021  -30.598 1.00 22.56  ? 139 LYS A CA  1 
ATOM   1098  C  C   . LYS A  1 139 ? -24.688  87.072  -29.808 1.00 31.16  ? 139 LYS A C   1 
ATOM   1099  O  O   . LYS A  1 139 ? -24.834  86.460  -28.748 1.00 30.54  ? 139 LYS A O   1 
ATOM   1100  C  CB  . LYS A  1 139 ? -23.043  85.577  -30.967 1.00 13.51  ? 139 LYS A CB  1 
ATOM   1101  C  CG  . LYS A  1 139 ? -24.129  84.821  -31.671 1.00 22.52  ? 139 LYS A CG  1 
ATOM   1102  C  CD  . LYS A  1 139 ? -23.709  83.369  -31.836 1.00 22.71  ? 139 LYS A CD  1 
ATOM   1103  C  CE  . LYS A  1 139 ? -24.815  82.508  -32.452 1.00 28.49  ? 139 LYS A CE  1 
ATOM   1104  N  NZ  . LYS A  1 139 ? -24.370  81.078  -32.549 1.00 28.65  ? 139 LYS A NZ  1 
ATOM   1105  N  N   . ILE A  1 140 ? -25.653  87.803  -30.345 1.00 19.70  ? 140 ILE A N   1 
ATOM   1106  C  CA  . ILE A  1 140 ? -26.952  87.980  -29.705 1.00 16.50  ? 140 ILE A CA  1 
ATOM   1107  C  C   . ILE A  1 140 ? -28.090  87.541  -30.640 1.00 20.94  ? 140 ILE A C   1 
ATOM   1108  O  O   . ILE A  1 140 ? -28.136  87.922  -31.814 1.00 15.63  ? 140 ILE A O   1 
ATOM   1109  C  CB  . ILE A  1 140 ? -27.180  89.444  -29.374 1.00 11.17  ? 140 ILE A CB  1 
ATOM   1110  C  CG1 . ILE A  1 140 ? -26.128  89.931  -28.396 1.00 27.90  ? 140 ILE A CG1 1 
ATOM   1111  C  CG2 . ILE A  1 140 ? -28.578  89.647  -28.843 1.00 12.36  ? 140 ILE A CG2 1 
ATOM   1112  C  CD1 . ILE A  1 140 ? -26.305  91.378  -28.009 1.00 44.84  ? 140 ILE A CD1 1 
ATOM   1113  N  N   . GLY A  1 141 ? -29.004  86.740  -30.113 1.00 23.40  ? 141 GLY A N   1 
ATOM   1114  C  CA  . GLY A  1 141 ? -30.164  86.303  -30.866 1.00 26.74  ? 141 GLY A CA  1 
ATOM   1115  C  C   . GLY A  1 141 ? -31.293  85.821  -29.969 1.00 20.29  ? 141 GLY A C   1 
ATOM   1116  O  O   . GLY A  1 141 ? -31.168  85.766  -28.753 1.00 12.20  ? 141 GLY A O   1 
ATOM   1117  N  N   . SER A  1 142 ? -32.421  85.483  -30.570 1.00 29.25  ? 142 SER A N   1 
ATOM   1118  C  CA  . SER A  1 142 ? -33.503  84.905  -29.797 1.00 27.15  ? 142 SER A CA  1 
ATOM   1119  C  C   . SER A  1 142 ? -33.052  83.540  -29.305 1.00 25.45  ? 142 SER A C   1 
ATOM   1120  O  O   . SER A  1 142 ? -32.399  82.787  -30.038 1.00 23.20  ? 142 SER A O   1 
ATOM   1121  C  CB  . SER A  1 142 ? -34.766  84.764  -30.643 1.00 33.14  ? 142 SER A CB  1 
ATOM   1122  O  OG  . SER A  1 142 ? -35.748  84.002  -29.962 1.00 27.69  ? 142 SER A OG  1 
ATOM   1123  N  N   . TRP A  1 143 ? -33.410  83.211  -28.071 1.00 18.20  ? 143 TRP A N   1 
ATOM   1124  C  CA  . TRP A  1 143 ? -33.004  81.936  -27.511 1.00 17.64  ? 143 TRP A CA  1 
ATOM   1125  C  C   . TRP A  1 143 ? -33.891  80.779  -27.973 1.00 28.43  ? 143 TRP A C   1 
ATOM   1126  O  O   . TRP A  1 143 ? -33.388  79.700  -28.308 1.00 24.09  ? 143 TRP A O   1 
ATOM   1127  C  CB  . TRP A  1 143 ? -32.935  82.003  -25.977 1.00 15.65  ? 143 TRP A CB  1 
ATOM   1128  C  CG  . TRP A  1 143 ? -32.100  80.921  -25.386 1.00 9.83   ? 143 TRP A CG  1 
ATOM   1129  C  CD1 . TRP A  1 143 ? -32.526  79.876  -24.617 1.00 25.92  ? 143 TRP A CD1 1 
ATOM   1130  C  CD2 . TRP A  1 143 ? -30.698  80.759  -25.544 1.00 14.55  ? 143 TRP A CD2 1 
ATOM   1131  N  NE1 . TRP A  1 143 ? -31.468  79.070  -24.279 1.00 13.19  ? 143 TRP A NE1 1 
ATOM   1132  C  CE2 . TRP A  1 143 ? -30.331  79.597  -24.835 1.00 19.16  ? 143 TRP A CE2 1 
ATOM   1133  C  CE3 . TRP A  1 143 ? -29.711  81.486  -26.211 1.00 13.74  ? 143 TRP A CE3 1 
ATOM   1134  C  CZ2 . TRP A  1 143 ? -29.019  79.148  -24.775 1.00 31.36  ? 143 TRP A CZ2 1 
ATOM   1135  C  CZ3 . TRP A  1 143 ? -28.408  81.033  -26.155 1.00 13.56  ? 143 TRP A CZ3 1 
ATOM   1136  C  CH2 . TRP A  1 143 ? -28.073  79.874  -25.441 1.00 11.34  ? 143 TRP A CH2 1 
ATOM   1137  N  N   . THR A  1 144 ? -35.200  81.006  -28.009 1.00 14.75  ? 144 THR A N   1 
ATOM   1138  C  CA  . THR A  1 144 ? -36.136  79.924  -28.272 1.00 10.42  ? 144 THR A CA  1 
ATOM   1139  C  C   . THR A  1 144 ? -36.983  80.112  -29.534 1.00 12.31  ? 144 THR A C   1 
ATOM   1140  O  O   . THR A  1 144 ? -37.614  79.153  -29.997 1.00 29.99  ? 144 THR A O   1 
ATOM   1141  C  CB  . THR A  1 144 ? -37.078  79.698  -27.063 1.00 12.94  ? 144 THR A CB  1 
ATOM   1142  O  OG1 . THR A  1 144 ? -37.816  80.893  -26.806 1.00 9.82   ? 144 THR A OG1 1 
ATOM   1143  C  CG2 . THR A  1 144 ? -36.288  79.339  -25.819 1.00 13.58  ? 144 THR A CG2 1 
ATOM   1144  N  N   . HIS A  1 145 ? -37.012  81.332  -30.077 1.00 13.99  ? 145 HIS A N   1 
ATOM   1145  C  CA  . HIS A  1 145 ? -37.811  81.629  -31.273 1.00 13.53  ? 145 HIS A CA  1 
ATOM   1146  C  C   . HIS A  1 145 ? -37.006  81.572  -32.574 1.00 16.37  ? 145 HIS A C   1 
ATOM   1147  O  O   . HIS A  1 145 ? -36.074  82.350  -32.761 1.00 24.04  ? 145 HIS A O   1 
ATOM   1148  C  CB  . HIS A  1 145 ? -38.469  83.000  -31.171 1.00 17.16  ? 145 HIS A CB  1 
ATOM   1149  C  CG  . HIS A  1 145 ? -39.504  83.101  -30.100 1.00 21.94  ? 145 HIS A CG  1 
ATOM   1150  N  ND1 . HIS A  1 145 ? -40.745  82.512  -30.206 1.00 25.99  ? 145 HIS A ND1 1 
ATOM   1151  C  CD2 . HIS A  1 145 ? -39.490  83.741  -28.907 1.00 17.64  ? 145 HIS A CD2 1 
ATOM   1152  C  CE1 . HIS A  1 145 ? -41.451  82.780  -29.120 1.00 29.79  ? 145 HIS A CE1 1 
ATOM   1153  N  NE2 . HIS A  1 145 ? -40.713  83.526  -28.316 1.00 37.69  ? 145 HIS A NE2 1 
ATOM   1154  N  N   . HIS A  1 146 ? -37.386  80.660  -33.472 1.00 18.63  ? 146 HIS A N   1 
ATOM   1155  C  CA  . HIS A  1 146 ? -36.713  80.511  -34.767 1.00 16.97  ? 146 HIS A CA  1 
ATOM   1156  C  C   . HIS A  1 146 ? -37.030  81.648  -35.748 1.00 18.25  ? 146 HIS A C   1 
ATOM   1157  O  O   . HIS A  1 146 ? -37.743  82.593  -35.417 1.00 28.47  ? 146 HIS A O   1 
ATOM   1158  C  CB  . HIS A  1 146 ? -36.991  79.129  -35.372 1.00 17.89  ? 146 HIS A CB  1 
ATOM   1159  C  CG  . HIS A  1 146 ? -38.445  78.817  -35.529 1.00 36.55  ? 146 HIS A CG  1 
ATOM   1160  N  ND1 . HIS A  1 146 ? -39.248  79.434  -36.467 1.00 35.95  ? 146 HIS A ND1 1 
ATOM   1161  C  CD2 . HIS A  1 146 ? -39.244  77.948  -34.864 1.00 32.25  ? 146 HIS A CD2 1 
ATOM   1162  C  CE1 . HIS A  1 146 ? -40.478  78.963  -36.369 1.00 25.83  ? 146 HIS A CE1 1 
ATOM   1163  N  NE2 . HIS A  1 146 ? -40.503  78.060  -35.404 1.00 25.07  ? 146 HIS A NE2 1 
ATOM   1164  N  N   . SER A  1 147 ? -36.492  81.547  -36.956 1.00 22.92  ? 147 SER A N   1 
ATOM   1165  C  CA  . SER A  1 147 ? -36.530  82.642  -37.937 1.00 31.11  ? 147 SER A CA  1 
ATOM   1166  C  C   . SER A  1 147 ? -37.920  83.037  -38.464 1.00 30.26  ? 147 SER A C   1 
ATOM   1167  O  O   . SER A  1 147 ? -38.084  84.105  -39.059 1.00 25.64  ? 147 SER A O   1 
ATOM   1168  C  CB  . SER A  1 147 ? -35.604  82.329  -39.116 1.00 22.90  ? 147 SER A CB  1 
ATOM   1169  O  OG  . SER A  1 147 ? -36.046  81.170  -39.793 1.00 29.41  ? 147 SER A OG  1 
ATOM   1170  N  N   . ARG A  1 148 ? -38.914  82.193  -38.220 1.00 13.73  ? 148 ARG A N   1 
ATOM   1171  C  CA  . ARG A  1 148 ? -40.272  82.430  -38.701 1.00 0.67   ? 148 ARG A CA  1 
ATOM   1172  C  C   . ARG A  1 148 ? -41.149  83.068  -37.637 1.00 0.67   ? 148 ARG A C   1 
ATOM   1173  O  O   . ARG A  1 148 ? -42.258  83.504  -37.909 1.00 22.73  ? 148 ARG A O   1 
ATOM   1174  C  CB  . ARG A  1 148 ? -40.854  81.107  -39.170 1.00 3.97   ? 148 ARG A CB  1 
ATOM   1175  C  CG  . ARG A  1 148 ? -39.767  80.283  -39.863 1.00 24.54  ? 148 ARG A CG  1 
ATOM   1176  C  CD  . ARG A  1 148 ? -40.323  79.196  -40.754 1.00 20.85  ? 148 ARG A CD  1 
ATOM   1177  N  NE  . ARG A  1 148 ? -41.031  78.197  -39.971 1.00 37.94  ? 148 ARG A NE  1 
ATOM   1178  C  CZ  . ARG A  1 148 ? -42.330  77.966  -40.078 1.00 48.60  ? 148 ARG A CZ  1 
ATOM   1179  N  NH1 . ARG A  1 148 ? -43.061  78.660  -40.955 1.00 31.04  ? 148 ARG A NH1 1 
ATOM   1180  N  NH2 . ARG A  1 148 ? -42.886  77.035  -39.315 1.00 62.13  ? 148 ARG A NH2 1 
ATOM   1181  N  N   . GLU A  1 149 ? -40.621  83.118  -36.422 1.00 33.98  ? 149 GLU A N   1 
ATOM   1182  C  CA  . GLU A  1 149 ? -41.265  83.780  -35.303 1.00 28.15  ? 149 GLU A CA  1 
ATOM   1183  C  C   . GLU A  1 149 ? -40.529  85.072  -34.953 1.00 27.09  ? 149 GLU A C   1 
ATOM   1184  O  O   . GLU A  1 149 ? -41.139  86.126  -34.787 1.00 27.01  ? 149 GLU A O   1 
ATOM   1185  C  CB  . GLU A  1 149 ? -41.315  82.834  -34.102 1.00 29.33  ? 149 GLU A CB  1 
ATOM   1186  C  CG  . GLU A  1 149 ? -42.049  81.530  -34.396 1.00 29.62  ? 149 GLU A CG  1 
ATOM   1187  C  CD  . GLU A  1 149 ? -42.217  80.636  -33.180 1.00 29.68  ? 149 GLU A CD  1 
ATOM   1188  O  OE1 . GLU A  1 149 ? -41.330  80.643  -32.296 1.00 39.41  ? 149 GLU A OE1 1 
ATOM   1189  O  OE2 . GLU A  1 149 ? -43.233  79.918  -33.106 1.00 35.71  ? 149 GLU A OE2 1 
ATOM   1190  N  N   . ILE A  1 150 ? -39.208  84.990  -34.839 1.00 26.62  ? 150 ILE A N   1 
ATOM   1191  C  CA  . ILE A  1 150 ? -38.392  86.183  -34.605 1.00 25.60  ? 150 ILE A CA  1 
ATOM   1192  C  C   . ILE A  1 150 ? -37.270  86.323  -35.629 1.00 29.76  ? 150 ILE A C   1 
ATOM   1193  O  O   . ILE A  1 150 ? -36.563  85.356  -35.940 1.00 27.24  ? 150 ILE A O   1 
ATOM   1194  C  CB  . ILE A  1 150 ? -37.766  86.218  -33.193 1.00 24.07  ? 150 ILE A CB  1 
ATOM   1195  C  CG1 . ILE A  1 150 ? -38.833  86.508  -32.148 1.00 23.43  ? 150 ILE A CG1 1 
ATOM   1196  C  CG2 . ILE A  1 150 ? -36.705  87.298  -33.123 1.00 23.53  ? 150 ILE A CG2 1 
ATOM   1197  C  CD1 . ILE A  1 150 ? -38.276  86.622  -30.774 1.00 25.38  ? 150 ILE A CD1 1 
ATOM   1198  N  N   . SER A  1 151 ? -37.124  87.532  -36.157 1.00 26.53  ? 151 SER A N   1 
ATOM   1199  C  CA  . SER A  1 151 ? -35.991  87.854  -37.003 1.00 36.66  ? 151 SER A CA  1 
ATOM   1200  C  C   . SER A  1 151 ? -35.232  88.994  -36.347 1.00 34.78  ? 151 SER A C   1 
ATOM   1201  O  O   . SER A  1 151 ? -35.844  89.925  -35.826 1.00 31.97  ? 151 SER A O   1 
ATOM   1202  C  CB  . SER A  1 151 ? -36.456  88.265  -38.400 1.00 28.88  ? 151 SER A CB  1 
ATOM   1203  O  OG  . SER A  1 151 ? -36.865  89.619  -38.402 1.00 36.06  ? 151 SER A OG  1 
ATOM   1204  N  N   . VAL A  1 152 ? -33.904  88.913  -36.357 1.00 25.59  ? 152 VAL A N   1 
ATOM   1205  C  CA  . VAL A  1 152 ? -33.077  89.959  -35.768 1.00 27.28  ? 152 VAL A CA  1 
ATOM   1206  C  C   . VAL A  1 152 ? -32.311  90.694  -36.855 1.00 25.67  ? 152 VAL A C   1 
ATOM   1207  O  O   . VAL A  1 152 ? -31.826  90.083  -37.797 1.00 26.66  ? 152 VAL A O   1 
ATOM   1208  C  CB  . VAL A  1 152 ? -32.072  89.378  -34.780 1.00 23.82  ? 152 VAL A CB  1 
ATOM   1209  C  CG1 . VAL A  1 152 ? -32.772  88.943  -33.507 1.00 27.33  ? 152 VAL A CG1 1 
ATOM   1210  C  CG2 . VAL A  1 152 ? -31.361  88.218  -35.416 1.00 31.92  ? 152 VAL A CG2 1 
ATOM   1211  N  N   . ASP A  1 153 ? -32.210  92.009  -36.719 1.00 25.49  ? 153 ASP A N   1 
ATOM   1212  C  CA  . ASP A  1 153 ? -31.464  92.803  -37.678 1.00 30.33  ? 153 ASP A CA  1 
ATOM   1213  C  C   . ASP A  1 153 ? -30.733  93.933  -36.990 1.00 37.07  ? 153 ASP A C   1 
ATOM   1214  O  O   . ASP A  1 153 ? -31.209  94.464  -35.993 1.00 49.11  ? 153 ASP A O   1 
ATOM   1215  C  CB  . ASP A  1 153 ? -32.383  93.358  -38.768 1.00 28.55  ? 153 ASP A CB  1 
ATOM   1216  C  CG  . ASP A  1 153 ? -32.652  92.348  -39.863 1.00 53.18  ? 153 ASP A CG  1 
ATOM   1217  O  OD1 . ASP A  1 153 ? -33.612  91.563  -39.732 1.00 57.84  ? 153 ASP A OD1 1 
ATOM   1218  O  OD2 . ASP A  1 153 ? -31.895  92.330  -40.857 1.00 63.91  ? 153 ASP A OD2 1 
ATOM   1219  N  N   . PRO A  1 154 ? -29.563  94.302  -37.518 1.00 36.95  ? 154 PRO A N   1 
ATOM   1220  C  CA  . PRO A  1 154 ? -28.817  95.460  -37.016 1.00 36.52  ? 154 PRO A CA  1 
ATOM   1221  C  C   . PRO A  1 154 ? -29.573  96.756  -37.309 1.00 45.00  ? 154 PRO A C   1 
ATOM   1222  O  O   . PRO A  1 154 ? -30.533  96.732  -38.074 1.00 42.04  ? 154 PRO A O   1 
ATOM   1223  C  CB  . PRO A  1 154 ? -27.520  95.412  -37.819 1.00 33.91  ? 154 PRO A CB  1 
ATOM   1224  C  CG  . PRO A  1 154 ? -27.457  94.006  -38.377 1.00 47.49  ? 154 PRO A CG  1 
ATOM   1225  C  CD  . PRO A  1 154 ? -28.863  93.615  -38.611 1.00 29.15  ? 154 PRO A CD  1 
ATOM   1226  N  N   . THR A  1 155 ? -29.172  97.858  -36.683 1.00 26.77  ? 155 THR A N   1 
ATOM   1227  C  CA  . THR A  1 155 ? -29.758  99.163  -36.980 1.00 41.08  ? 155 THR A CA  1 
ATOM   1228  C  C   . THR A  1 155 ? -28.733  100.146 -37.519 1.00 74.76  ? 155 THR A C   1 
ATOM   1229  O  O   . THR A  1 155 ? -28.211  100.974 -36.769 1.00 99.09  ? 155 THR A O   1 
ATOM   1230  C  CB  . THR A  1 155 ? -30.425  99.788  -35.743 1.00 56.89  ? 155 THR A CB  1 
ATOM   1231  O  OG1 . THR A  1 155 ? -29.544  99.703  -34.618 1.00 40.75  ? 155 THR A OG1 1 
ATOM   1232  C  CG2 . THR A  1 155 ? -31.703  99.066  -35.415 1.00 78.35  ? 155 THR A CG2 1 
ATOM   1233  N  N   . ASP A  1 160 ? -22.197  107.221 -34.324 1.00 31.72  ? 160 ASP A N   1 
ATOM   1234  C  CA  . ASP A  1 160 ? -20.769  106.971 -34.158 1.00 57.82  ? 160 ASP A CA  1 
ATOM   1235  C  C   . ASP A  1 160 ? -20.532  105.784 -33.214 1.00 76.46  ? 160 ASP A C   1 
ATOM   1236  O  O   . ASP A  1 160 ? -21.351  105.524 -32.333 1.00 93.44  ? 160 ASP A O   1 
ATOM   1237  C  CB  . ASP A  1 160 ? -20.077  108.240 -33.642 1.00 56.12  ? 160 ASP A CB  1 
ATOM   1238  C  CG  . ASP A  1 160 ? -18.683  107.975 -33.125 1.00 58.58  ? 160 ASP A CG  1 
ATOM   1239  O  OD1 . ASP A  1 160 ? -17.971  107.164 -33.749 1.00 63.53  ? 160 ASP A OD1 1 
ATOM   1240  O  OD2 . ASP A  1 160 ? -18.305  108.567 -32.087 1.00 60.68  ? 160 ASP A OD2 1 
ATOM   1241  N  N   . ASP A  1 161 ? -19.427  105.060 -33.406 1.00 68.12  ? 161 ASP A N   1 
ATOM   1242  C  CA  . ASP A  1 161 ? -19.082  103.918 -32.545 1.00 71.28  ? 161 ASP A CA  1 
ATOM   1243  C  C   . ASP A  1 161 ? -18.914  104.341 -31.084 1.00 63.86  ? 161 ASP A C   1 
ATOM   1244  O  O   . ASP A  1 161 ? -19.633  103.903 -30.177 1.00 48.17  ? 161 ASP A O   1 
ATOM   1245  C  CB  . ASP A  1 161 ? -17.752  103.284 -32.988 1.00 57.19  ? 161 ASP A CB  1 
ATOM   1246  C  CG  . ASP A  1 161 ? -17.794  102.712 -34.403 1.00 69.68  ? 161 ASP A CG  1 
ATOM   1247  O  OD1 . ASP A  1 161 ? -18.883  102.317 -34.883 1.00 57.31  ? 161 ASP A OD1 1 
ATOM   1248  O  OD2 . ASP A  1 161 ? -16.709  102.644 -35.030 1.00 64.75  ? 161 ASP A OD2 1 
ATOM   1249  N  N   . SER A  1 162 ? -17.924  105.198 -30.887 1.00 61.15  ? 162 SER A N   1 
ATOM   1250  C  CA  . SER A  1 162 ? -17.483  105.644 -29.578 1.00 72.95  ? 162 SER A CA  1 
ATOM   1251  C  C   . SER A  1 162 ? -18.332  106.803 -29.076 1.00 60.24  ? 162 SER A C   1 
ATOM   1252  O  O   . SER A  1 162 ? -17.974  107.475 -28.110 1.00 54.81  ? 162 SER A O   1 
ATOM   1253  C  CB  . SER A  1 162 ? -16.015  106.091 -29.663 1.00 72.84  ? 162 SER A CB  1 
ATOM   1254  O  OG  . SER A  1 162 ? -15.162  105.033 -30.079 1.00 75.51  ? 162 SER A OG  1 
ATOM   1255  N  N   . GLU A  1 163 ? -19.454  107.051 -29.735 1.00 45.39  ? 163 GLU A N   1 
ATOM   1256  C  CA  . GLU A  1 163 ? -20.244  108.226 -29.400 1.00 53.98  ? 163 GLU A CA  1 
ATOM   1257  C  C   . GLU A  1 163 ? -20.533  108.321 -27.903 1.00 58.05  ? 163 GLU A C   1 
ATOM   1258  O  O   . GLU A  1 163 ? -20.429  109.401 -27.319 1.00 53.62  ? 163 GLU A O   1 
ATOM   1259  C  CB  . GLU A  1 163 ? -21.551  108.259 -30.179 1.00 63.31  ? 163 GLU A CB  1 
ATOM   1260  C  CG  . GLU A  1 163 ? -22.285  109.575 -30.045 1.00 73.87  ? 163 GLU A CG  1 
ATOM   1261  C  CD  . GLU A  1 163 ? -23.725  109.482 -30.485 1.00 82.59  ? 163 GLU A CD  1 
ATOM   1262  O  OE1 . GLU A  1 163 ? -24.092  108.477 -31.132 1.00 84.00  ? 163 GLU A OE1 1 
ATOM   1263  O  OE2 . GLU A  1 163 ? -24.493  110.413 -30.170 1.00 84.94  ? 163 GLU A OE2 1 
ATOM   1264  N  N   . TYR A  1 164 ? -20.888  107.196 -27.282 1.00 42.81  ? 164 TYR A N   1 
ATOM   1265  C  CA  . TYR A  1 164 ? -21.155  107.192 -25.848 1.00 26.66  ? 164 TYR A CA  1 
ATOM   1266  C  C   . TYR A  1 164 ? -20.057  106.506 -25.040 1.00 24.85  ? 164 TYR A C   1 
ATOM   1267  O  O   . TYR A  1 164 ? -20.270  106.140 -23.887 1.00 38.32  ? 164 TYR A O   1 
ATOM   1268  C  CB  . TYR A  1 164 ? -22.498  106.524 -25.535 1.00 41.76  ? 164 TYR A CB  1 
ATOM   1269  C  CG  . TYR A  1 164 ? -23.656  107.037 -26.347 1.00 50.14  ? 164 TYR A CG  1 
ATOM   1270  C  CD1 . TYR A  1 164 ? -23.976  108.393 -26.375 1.00 48.52  ? 164 TYR A CD1 1 
ATOM   1271  C  CD2 . TYR A  1 164 ? -24.437  106.161 -27.088 1.00 52.10  ? 164 TYR A CD2 1 
ATOM   1272  C  CE1 . TYR A  1 164 ? -25.045  108.857 -27.129 1.00 57.23  ? 164 TYR A CE1 1 
ATOM   1273  C  CE2 . TYR A  1 164 ? -25.501  106.611 -27.845 1.00 57.33  ? 164 TYR A CE2 1 
ATOM   1274  C  CZ  . TYR A  1 164 ? -25.805  107.955 -27.859 1.00 59.24  ? 164 TYR A CZ  1 
ATOM   1275  O  OH  . TYR A  1 164 ? -26.871  108.385 -28.610 1.00 56.11  ? 164 TYR A OH  1 
ATOM   1276  N  N   . PHE A  1 165 ? -18.884  106.337 -25.626 1.00 26.56  ? 165 PHE A N   1 
ATOM   1277  C  CA  . PHE A  1 165 ? -17.834  105.569 -24.964 1.00 25.63  ? 165 PHE A CA  1 
ATOM   1278  C  C   . PHE A  1 165 ? -17.045  106.403 -23.968 1.00 30.15  ? 165 PHE A C   1 
ATOM   1279  O  O   . PHE A  1 165 ? -16.667  107.535 -24.256 1.00 36.23  ? 165 PHE A O   1 
ATOM   1280  C  CB  . PHE A  1 165 ? -16.891  104.945 -25.986 1.00 21.70  ? 165 PHE A CB  1 
ATOM   1281  C  CG  . PHE A  1 165 ? -16.043  103.858 -25.420 1.00 25.35  ? 165 PHE A CG  1 
ATOM   1282  C  CD1 . PHE A  1 165 ? -16.604  102.637 -25.080 1.00 24.65  ? 165 PHE A CD1 1 
ATOM   1283  C  CD2 . PHE A  1 165 ? -14.694  104.048 -25.229 1.00 18.51  ? 165 PHE A CD2 1 
ATOM   1284  C  CE1 . PHE A  1 165 ? -15.828  101.623 -24.557 1.00 26.34  ? 165 PHE A CE1 1 
ATOM   1285  C  CE2 . PHE A  1 165 ? -13.903  103.044 -24.708 1.00 23.52  ? 165 PHE A CE2 1 
ATOM   1286  C  CZ  . PHE A  1 165 ? -14.460  101.832 -24.366 1.00 28.86  ? 165 PHE A CZ  1 
ATOM   1287  N  N   . SER A  1 166 ? -16.802  105.836 -22.794 1.00 20.22  ? 166 SER A N   1 
ATOM   1288  C  CA  . SER A  1 166 ? -16.118  106.556 -21.713 1.00 32.11  ? 166 SER A CA  1 
ATOM   1289  C  C   . SER A  1 166 ? -14.682  106.934 -22.057 1.00 30.84  ? 166 SER A C   1 
ATOM   1290  O  O   . SER A  1 166 ? -13.865  106.075 -22.376 1.00 27.12  ? 166 SER A O   1 
ATOM   1291  C  CB  . SER A  1 166 ? -16.132  105.745 -20.412 1.00 21.63  ? 166 SER A CB  1 
ATOM   1292  O  OG  . SER A  1 166 ? -15.448  106.433 -19.395 1.00 19.89  ? 166 SER A OG  1 
ATOM   1293  N  N   . GLN A  1 167 ? -14.388  108.225 -21.966 1.00 31.53  ? 167 GLN A N   1 
ATOM   1294  C  CA  . GLN A  1 167 ? -13.045  108.729 -22.215 1.00 31.00  ? 167 GLN A CA  1 
ATOM   1295  C  C   . GLN A  1 167 ? -12.075  108.261 -21.124 1.00 33.33  ? 167 GLN A C   1 
ATOM   1296  O  O   . GLN A  1 167 ? -10.869  108.366 -21.270 1.00 43.78  ? 167 GLN A O   1 
ATOM   1297  C  CB  . GLN A  1 167 ? -13.070  110.256 -22.267 1.00 24.49  ? 167 GLN A CB  1 
ATOM   1298  C  CG  . GLN A  1 167 ? -13.513  110.891 -20.957 1.00 45.18  ? 167 GLN A CG  1 
ATOM   1299  C  CD  . GLN A  1 167 ? -13.645  112.397 -21.047 1.00 49.07  ? 167 GLN A CD  1 
ATOM   1300  O  OE1 . GLN A  1 167 ? -14.726  112.953 -20.838 1.00 45.88  ? 167 GLN A OE1 1 
ATOM   1301  N  NE2 . GLN A  1 167 ? -12.541  113.068 -21.347 1.00 50.62  ? 167 GLN A NE2 1 
ATOM   1302  N  N   . TYR A  1 168 ? -12.599  107.728 -20.034 1.00 26.75  ? 168 TYR A N   1 
ATOM   1303  C  CA  . TYR A  1 168 ? -11.753  107.356 -18.917 1.00 17.27  ? 168 TYR A CA  1 
ATOM   1304  C  C   . TYR A  1 168 ? -11.452  105.872 -18.880 1.00 30.18  ? 168 TYR A C   1 
ATOM   1305  O  O   . TYR A  1 168 ? -10.776  105.393 -17.963 1.00 17.67  ? 168 TYR A O   1 
ATOM   1306  C  CB  . TYR A  1 168 ? -12.381  107.813 -17.602 1.00 20.93  ? 168 TYR A CB  1 
ATOM   1307  C  CG  . TYR A  1 168 ? -12.648  109.301 -17.584 1.00 43.72  ? 168 TYR A CG  1 
ATOM   1308  C  CD1 . TYR A  1 168 ? -11.597  110.220 -17.688 1.00 17.30  ? 168 TYR A CD1 1 
ATOM   1309  C  CD2 . TYR A  1 168 ? -13.954  109.795 -17.486 1.00 28.11  ? 168 TYR A CD2 1 
ATOM   1310  C  CE1 . TYR A  1 168 ? -11.839  111.588 -17.680 1.00 19.83  ? 168 TYR A CE1 1 
ATOM   1311  C  CE2 . TYR A  1 168 ? -14.206  111.170 -17.474 1.00 18.85  ? 168 TYR A CE2 1 
ATOM   1312  C  CZ  . TYR A  1 168 ? -13.143  112.056 -17.569 1.00 32.26  ? 168 TYR A CZ  1 
ATOM   1313  O  OH  . TYR A  1 168 ? -13.381  113.407 -17.557 1.00 28.34  ? 168 TYR A OH  1 
ATOM   1314  N  N   . SER A  1 169 ? -11.936  105.145 -19.883 1.00 29.51  ? 169 SER A N   1 
ATOM   1315  C  CA  . SER A  1 169 ? -11.609  103.729 -19.996 1.00 28.15  ? 169 SER A CA  1 
ATOM   1316  C  C   . SER A  1 169 ? -10.117  103.580 -20.298 1.00 33.56  ? 169 SER A C   1 
ATOM   1317  O  O   . SER A  1 169 ? -9.505   104.473 -20.892 1.00 21.94  ? 169 SER A O   1 
ATOM   1318  C  CB  . SER A  1 169 ? -12.449  103.075 -21.095 1.00 32.71  ? 169 SER A CB  1 
ATOM   1319  O  OG  . SER A  1 169 ? -12.103  101.713 -21.255 1.00 47.23  ? 169 SER A OG  1 
ATOM   1320  N  N   . ARG A  1 170 ? -9.526   102.464 -19.887 1.00 27.77  ? 170 ARG A N   1 
ATOM   1321  C  CA  . ARG A  1 170 ? -8.153   102.173 -20.269 1.00 26.01  ? 170 ARG A CA  1 
ATOM   1322  C  C   . ARG A  1 170 ? -8.085   101.817 -21.745 1.00 25.18  ? 170 ARG A C   1 
ATOM   1323  O  O   . ARG A  1 170 ? -7.013   101.706 -22.318 1.00 32.78  ? 170 ARG A O   1 
ATOM   1324  C  CB  . ARG A  1 170 ? -7.574   101.035 -19.433 1.00 20.52  ? 170 ARG A CB  1 
ATOM   1325  C  CG  . ARG A  1 170 ? -6.945   101.480 -18.137 1.00 26.13  ? 170 ARG A CG  1 
ATOM   1326  C  CD  . ARG A  1 170 ? -6.412   100.279 -17.386 1.00 47.56  ? 170 ARG A CD  1 
ATOM   1327  N  NE  . ARG A  1 170 ? -7.461   99.287  -17.192 1.00 78.23  ? 170 ARG A NE  1 
ATOM   1328  C  CZ  . ARG A  1 170 ? -7.252   97.987  -17.020 1.00 82.61  ? 170 ARG A CZ  1 
ATOM   1329  N  NH1 . ARG A  1 170 ? -6.011   97.498  -17.025 1.00 80.04  ? 170 ARG A NH1 1 
ATOM   1330  N  NH2 . ARG A  1 170 ? -8.294   97.180  -16.850 1.00 61.92  ? 170 ARG A NH2 1 
ATOM   1331  N  N   . PHE A  1 171 ? -9.242   101.641 -22.362 1.00 24.82  ? 171 PHE A N   1 
ATOM   1332  C  CA  . PHE A  1 171 ? -9.295   101.183 -23.744 1.00 25.77  ? 171 PHE A CA  1 
ATOM   1333  C  C   . PHE A  1 171 ? -9.949   102.188 -24.672 1.00 17.41  ? 171 PHE A C   1 
ATOM   1334  O  O   . PHE A  1 171 ? -10.528  103.188 -24.241 1.00 26.69  ? 171 PHE A O   1 
ATOM   1335  C  CB  . PHE A  1 171 ? -10.006  99.825  -23.832 1.00 18.76  ? 171 PHE A CB  1 
ATOM   1336  C  CG  . PHE A  1 171 ? -9.461   98.796  -22.870 1.00 19.25  ? 171 PHE A CG  1 
ATOM   1337  C  CD1 . PHE A  1 171 ? -9.842   98.806  -21.539 1.00 28.30  ? 171 PHE A CD1 1 
ATOM   1338  C  CD2 . PHE A  1 171 ? -8.557   97.835  -23.287 1.00 28.20  ? 171 PHE A CD2 1 
ATOM   1339  C  CE1 . PHE A  1 171 ? -9.346   97.872  -20.645 1.00 29.66  ? 171 PHE A CE1 1 
ATOM   1340  C  CE2 . PHE A  1 171 ? -8.053   96.897  -22.402 1.00 32.18  ? 171 PHE A CE2 1 
ATOM   1341  C  CZ  . PHE A  1 171 ? -8.450   96.916  -21.078 1.00 34.40  ? 171 PHE A CZ  1 
ATOM   1342  N  N   . GLU A  1 172 ? -9.820   101.928 -25.961 1.00 22.58  ? 172 GLU A N   1 
ATOM   1343  C  CA  . GLU A  1 172 ? -10.461  102.756 -26.974 1.00 33.91  ? 172 GLU A CA  1 
ATOM   1344  C  C   . GLU A  1 172 ? -11.023  101.878 -28.079 1.00 33.67  ? 172 GLU A C   1 
ATOM   1345  O  O   . GLU A  1 172 ? -10.529  100.773 -28.334 1.00 30.76  ? 172 GLU A O   1 
ATOM   1346  C  CB  . GLU A  1 172 ? -9.486   103.779 -27.561 1.00 33.99  ? 172 GLU A CB  1 
ATOM   1347  C  CG  . GLU A  1 172 ? -8.232   103.176 -28.159 1.00 42.03  ? 172 GLU A CG  1 
ATOM   1348  C  CD  . GLU A  1 172 ? -7.235   104.230 -28.615 1.00 46.99  ? 172 GLU A CD  1 
ATOM   1349  O  OE1 . GLU A  1 172 ? -7.572   105.429 -28.593 1.00 45.03  ? 172 GLU A OE1 1 
ATOM   1350  O  OE2 . GLU A  1 172 ? -6.108   103.859 -28.997 1.00 49.85  ? 172 GLU A OE2 1 
ATOM   1351  N  N   . ILE A  1 173 ? -12.070  102.368 -28.726 1.00 25.56  ? 173 ILE A N   1 
ATOM   1352  C  CA  . ILE A  1 173 ? -12.750  101.583 -29.739 1.00 23.42  ? 173 ILE A CA  1 
ATOM   1353  C  C   . ILE A  1 173 ? -12.263  101.984 -31.108 1.00 25.89  ? 173 ILE A C   1 
ATOM   1354  O  O   . ILE A  1 173 ? -12.324  103.151 -31.475 1.00 35.35  ? 173 ILE A O   1 
ATOM   1355  C  CB  . ILE A  1 173 ? -14.269  101.762 -29.681 1.00 28.87  ? 173 ILE A CB  1 
ATOM   1356  C  CG1 . ILE A  1 173 ? -14.815  101.161 -28.383 1.00 24.79  ? 173 ILE A CG1 1 
ATOM   1357  C  CG2 . ILE A  1 173 ? -14.900  101.114 -30.894 1.00 20.10  ? 173 ILE A CG2 1 
ATOM   1358  C  CD1 . ILE A  1 173 ? -16.308  101.335 -28.208 1.00 32.42  ? 173 ILE A CD1 1 
ATOM   1359  N  N   . LEU A  1 174 ? -11.777  101.013 -31.865 1.00 27.06  ? 174 LEU A N   1 
ATOM   1360  C  CA  . LEU A  1 174 ? -11.271  101.287 -33.200 1.00 28.09  ? 174 LEU A CA  1 
ATOM   1361  C  C   . LEU A  1 174 ? -12.403  101.188 -34.218 1.00 36.88  ? 174 LEU A C   1 
ATOM   1362  O  O   . LEU A  1 174 ? -12.521  102.017 -35.125 1.00 33.89  ? 174 LEU A O   1 
ATOM   1363  C  CB  . LEU A  1 174 ? -10.126  100.329 -33.549 1.00 27.52  ? 174 LEU A CB  1 
ATOM   1364  C  CG  . LEU A  1 174 ? -8.978   100.315 -32.525 1.00 33.18  ? 174 LEU A CG  1 
ATOM   1365  C  CD1 . LEU A  1 174 ? -7.943   99.290  -32.909 1.00 24.78  ? 174 LEU A CD1 1 
ATOM   1366  C  CD2 . LEU A  1 174 ? -8.354   101.698 -32.355 1.00 16.58  ? 174 LEU A CD2 1 
ATOM   1367  N  N   . ASP A  1 175 ? -13.254  100.184 -34.046 1.00 34.73  ? 175 ASP A N   1 
ATOM   1368  C  CA  . ASP A  1 175 ? -14.349  99.975  -34.966 1.00 28.14  ? 175 ASP A CA  1 
ATOM   1369  C  C   . ASP A  1 175 ? -15.399  99.057  -34.352 1.00 24.16  ? 175 ASP A C   1 
ATOM   1370  O  O   . ASP A  1 175 ? -15.102  98.267  -33.464 1.00 36.58  ? 175 ASP A O   1 
ATOM   1371  C  CB  . ASP A  1 175 ? -13.819  99.393  -36.277 1.00 23.80  ? 175 ASP A CB  1 
ATOM   1372  C  CG  . ASP A  1 175 ? -14.764  99.618  -37.436 1.00 46.27  ? 175 ASP A CG  1 
ATOM   1373  O  OD1 . ASP A  1 175 ? -15.580  100.559 -37.360 1.00 51.25  ? 175 ASP A OD1 1 
ATOM   1374  O  OD2 . ASP A  1 175 ? -14.691  98.854  -38.426 1.00 57.69  ? 175 ASP A OD2 1 
ATOM   1375  N  N   . VAL A  1 176 ? -16.634  99.190  -34.817 1.00 24.55  ? 176 VAL A N   1 
ATOM   1376  C  CA  . VAL A  1 176 ? -17.696  98.251  -34.491 1.00 23.71  ? 176 VAL A CA  1 
ATOM   1377  C  C   . VAL A  1 176 ? -18.452  97.886  -35.768 1.00 37.86  ? 176 VAL A C   1 
ATOM   1378  O  O   . VAL A  1 176 ? -18.988  98.762  -36.454 1.00 30.15  ? 176 VAL A O   1 
ATOM   1379  C  CB  . VAL A  1 176 ? -18.706  98.841  -33.510 1.00 23.77  ? 176 VAL A CB  1 
ATOM   1380  C  CG1 . VAL A  1 176 ? -19.729  97.803  -33.158 1.00 25.15  ? 176 VAL A CG1 1 
ATOM   1381  C  CG2 . VAL A  1 176 ? -18.015  99.323  -32.253 1.00 23.03  ? 176 VAL A CG2 1 
ATOM   1382  N  N   . THR A  1 177 ? -18.481  96.598  -36.093 1.00 36.30  ? 177 THR A N   1 
ATOM   1383  C  CA  . THR A  1 177 ? -19.239  96.129  -37.246 1.00 42.78  ? 177 THR A CA  1 
ATOM   1384  C  C   . THR A  1 177 ? -20.290  95.127  -36.804 1.00 43.98  ? 177 THR A C   1 
ATOM   1385  O  O   . THR A  1 177 ? -20.117  94.430  -35.800 1.00 36.04  ? 177 THR A O   1 
ATOM   1386  C  CB  . THR A  1 177 ? -18.347  95.484  -38.310 1.00 41.21  ? 177 THR A CB  1 
ATOM   1387  O  OG1 . THR A  1 177 ? -17.663  94.365  -37.738 1.00 45.56  ? 177 THR A OG1 1 
ATOM   1388  C  CG2 . THR A  1 177 ? -17.336  96.490  -38.833 1.00 27.76  ? 177 THR A CG2 1 
ATOM   1389  N  N   . GLN A  1 178 ? -21.381  95.067  -37.563 1.00 42.70  ? 178 GLN A N   1 
ATOM   1390  C  CA  . GLN A  1 178 ? -22.514  94.230  -37.216 1.00 37.22  ? 178 GLN A CA  1 
ATOM   1391  C  C   . GLN A  1 178 ? -22.800  93.280  -38.367 1.00 40.02  ? 178 GLN A C   1 
ATOM   1392  O  O   . GLN A  1 178 ? -22.929  93.702  -39.508 1.00 43.13  ? 178 GLN A O   1 
ATOM   1393  C  CB  . GLN A  1 178 ? -23.733  95.104  -36.889 1.00 29.79  ? 178 GLN A CB  1 
ATOM   1394  C  CG  . GLN A  1 178 ? -23.426  96.226  -35.892 1.00 49.98  ? 178 GLN A CG  1 
ATOM   1395  C  CD  . GLN A  1 178 ? -24.525  96.429  -34.846 1.00 78.33  ? 178 GLN A CD  1 
ATOM   1396  O  OE1 . GLN A  1 178 ? -25.716  96.211  -35.121 1.00 68.65  ? 178 GLN A OE1 1 
ATOM   1397  N  NE2 . GLN A  1 178 ? -24.125  96.846  -33.635 1.00 66.24  ? 178 GLN A NE2 1 
ATOM   1398  N  N   . LYS A  1 179 ? -22.863  91.989  -38.070 1.00 44.76  ? 179 LYS A N   1 
ATOM   1399  C  CA  . LYS A  1 179 ? -23.219  90.998  -39.078 1.00 44.03  ? 179 LYS A CA  1 
ATOM   1400  C  C   . LYS A  1 179 ? -24.400  90.135  -38.648 1.00 43.89  ? 179 LYS A C   1 
ATOM   1401  O  O   . LYS A  1 179 ? -24.500  89.715  -37.491 1.00 55.44  ? 179 LYS A O   1 
ATOM   1402  C  CB  . LYS A  1 179 ? -22.036  90.101  -39.400 1.00 41.66  ? 179 LYS A CB  1 
ATOM   1403  C  CG  . LYS A  1 179 ? -22.336  89.076  -40.477 1.00 57.45  ? 179 LYS A CG  1 
ATOM   1404  C  CD  . LYS A  1 179 ? -21.216  88.050  -40.600 1.00 64.85  ? 179 LYS A CD  1 
ATOM   1405  C  CE  . LYS A  1 179 ? -21.529  87.012  -41.677 1.00 70.03  ? 179 LYS A CE  1 
ATOM   1406  N  NZ  . LYS A  1 179 ? -20.483  85.950  -41.752 1.00 63.07  ? 179 LYS A NZ  1 
ATOM   1407  N  N   . LYS A  1 180 ? -25.274  89.860  -39.608 1.00 32.24  ? 180 LYS A N   1 
ATOM   1408  C  CA  . LYS A  1 180 ? -26.476  89.083  -39.345 1.00 32.08  ? 180 LYS A CA  1 
ATOM   1409  C  C   . LYS A  1 180 ? -26.342  87.643  -39.873 1.00 31.18  ? 180 LYS A C   1 
ATOM   1410  O  O   . LYS A  1 180 ? -25.787  87.415  -40.953 1.00 34.76  ? 180 LYS A O   1 
ATOM   1411  C  CB  . LYS A  1 180 ? -27.680  89.792  -39.956 1.00 26.06  ? 180 LYS A CB  1 
ATOM   1412  C  CG  . LYS A  1 180 ? -28.899  88.934  -40.119 1.00 44.31  ? 180 LYS A CG  1 
ATOM   1413  C  CD  . LYS A  1 180 ? -29.897  89.643  -40.997 1.00 55.75  ? 180 LYS A CD  1 
ATOM   1414  C  CE  . LYS A  1 180 ? -31.090  88.762  -41.306 1.00 56.78  ? 180 LYS A CE  1 
ATOM   1415  N  NZ  . LYS A  1 180 ? -31.877  88.462  -40.078 1.00 47.92  ? 180 LYS A NZ  1 
ATOM   1416  N  N   . ASN A  1 181 ? -26.826  86.673  -39.098 1.00 33.10  ? 181 ASN A N   1 
ATOM   1417  C  CA  . ASN A  1 181 ? -26.699  85.265  -39.470 1.00 25.72  ? 181 ASN A CA  1 
ATOM   1418  C  C   . ASN A  1 181 ? -27.962  84.497  -39.214 1.00 28.18  ? 181 ASN A C   1 
ATOM   1419  O  O   . ASN A  1 181 ? -28.800  84.896  -38.407 1.00 31.21  ? 181 ASN A O   1 
ATOM   1420  C  CB  . ASN A  1 181 ? -25.593  84.574  -38.668 1.00 36.04  ? 181 ASN A CB  1 
ATOM   1421  C  CG  . ASN A  1 181 ? -24.264  85.283  -38.763 1.00 36.29  ? 181 ASN A CG  1 
ATOM   1422  O  OD1 . ASN A  1 181 ? -23.563  85.162  -39.769 1.00 51.12  ? 181 ASN A OD1 1 
ATOM   1423  N  ND2 . ASN A  1 181 ? -23.905  86.028  -37.716 1.00 24.92  ? 181 ASN A ND2 1 
ATOM   1424  N  N   . SER A  1 182 ? -28.071  83.365  -39.889 1.00 26.11  ? 182 SER A N   1 
ATOM   1425  C  CA  . SER A  1 182 ? -29.179  82.453  -39.682 1.00 26.33  ? 182 SER A CA  1 
ATOM   1426  C  C   . SER A  1 182 ? -28.558  81.088  -39.461 1.00 26.28  ? 182 SER A C   1 
ATOM   1427  O  O   . SER A  1 182 ? -27.853  80.585  -40.317 1.00 34.61  ? 182 SER A O   1 
ATOM   1428  C  CB  . SER A  1 182 ? -30.097  82.455  -40.904 1.00 26.74  ? 182 SER A CB  1 
ATOM   1429  O  OG  . SER A  1 182 ? -31.333  81.817  -40.647 1.00 46.38  ? 182 SER A OG  1 
ATOM   1430  N  N   . VAL A  1 183 ? -28.804  80.491  -38.305 1.00 26.16  ? 183 VAL A N   1 
ATOM   1431  C  CA  . VAL A  1 183 ? -28.079  79.284  -37.922 1.00 35.64  ? 183 VAL A CA  1 
ATOM   1432  C  C   . VAL A  1 183 ? -29.026  78.140  -37.571 1.00 34.36  ? 183 VAL A C   1 
ATOM   1433  O  O   . VAL A  1 183 ? -30.035  78.343  -36.907 1.00 33.92  ? 183 VAL A O   1 
ATOM   1434  C  CB  . VAL A  1 183 ? -27.155  79.548  -36.691 1.00 41.90  ? 183 VAL A CB  1 
ATOM   1435  C  CG1 . VAL A  1 183 ? -26.432  78.291  -36.290 1.00 25.62  ? 183 VAL A CG1 1 
ATOM   1436  C  CG2 . VAL A  1 183 ? -26.179  80.652  -36.976 1.00 25.42  ? 183 VAL A CG2 1 
ATOM   1437  N  N   . THR A  1 184 ? -28.687  76.932  -37.999 1.00 46.83  ? 184 THR A N   1 
ATOM   1438  C  CA  . THR A  1 184 ? -29.448  75.744  -37.613 1.00 41.72  ? 184 THR A CA  1 
ATOM   1439  C  C   . THR A  1 184 ? -28.684  74.970  -36.536 1.00 38.68  ? 184 THR A C   1 
ATOM   1440  O  O   . THR A  1 184 ? -27.517  74.656  -36.719 1.00 48.77  ? 184 THR A O   1 
ATOM   1441  C  CB  . THR A  1 184 ? -29.680  74.839  -38.830 1.00 34.29  ? 184 THR A CB  1 
ATOM   1442  O  OG1 . THR A  1 184 ? -30.251  75.624  -39.884 1.00 36.77  ? 184 THR A OG1 1 
ATOM   1443  C  CG2 . THR A  1 184 ? -30.597  73.671  -38.485 1.00 27.66  ? 184 THR A CG2 1 
ATOM   1444  N  N   . TYR A  1 185 ? -29.332  74.659  -35.418 1.00 46.98  ? 185 TYR A N   1 
ATOM   1445  C  CA  . TYR A  1 185 ? -28.633  73.996  -34.317 1.00 40.87  ? 185 TYR A CA  1 
ATOM   1446  C  C   . TYR A  1 185 ? -29.030  72.521  -34.207 1.00 46.58  ? 185 TYR A C   1 
ATOM   1447  O  O   . TYR A  1 185 ? -30.139  72.140  -34.570 1.00 59.65  ? 185 TYR A O   1 
ATOM   1448  C  CB  . TYR A  1 185 ? -28.870  74.747  -32.995 1.00 33.65  ? 185 TYR A CB  1 
ATOM   1449  C  CG  . TYR A  1 185 ? -28.423  76.193  -33.049 1.00 32.50  ? 185 TYR A CG  1 
ATOM   1450  C  CD1 . TYR A  1 185 ? -29.199  77.158  -33.664 1.00 38.07  ? 185 TYR A CD1 1 
ATOM   1451  C  CD2 . TYR A  1 185 ? -27.217  76.586  -32.508 1.00 34.54  ? 185 TYR A CD2 1 
ATOM   1452  C  CE1 . TYR A  1 185 ? -28.791  78.469  -33.730 1.00 32.97  ? 185 TYR A CE1 1 
ATOM   1453  C  CE2 . TYR A  1 185 ? -26.800  77.900  -32.570 1.00 38.09  ? 185 TYR A CE2 1 
ATOM   1454  C  CZ  . TYR A  1 185 ? -27.591  78.838  -33.187 1.00 32.68  ? 185 TYR A CZ  1 
ATOM   1455  O  OH  . TYR A  1 185 ? -27.188  80.156  -33.261 1.00 36.34  ? 185 TYR A OH  1 
ATOM   1456  N  N   . SER A  1 186 ? -28.113  71.700  -33.709 1.00 56.36  ? 186 SER A N   1 
ATOM   1457  C  CA  . SER A  1 186 ? -28.331  70.260  -33.599 1.00 55.84  ? 186 SER A CA  1 
ATOM   1458  C  C   . SER A  1 186 ? -29.627  69.870  -32.897 1.00 59.76  ? 186 SER A C   1 
ATOM   1459  O  O   . SER A  1 186 ? -30.289  68.924  -33.302 1.00 59.23  ? 186 SER A O   1 
ATOM   1460  C  CB  . SER A  1 186 ? -27.145  69.591  -32.898 1.00 63.69  ? 186 SER A CB  1 
ATOM   1461  O  OG  . SER A  1 186 ? -26.061  69.418  -33.799 1.00 71.02  ? 186 SER A OG  1 
ATOM   1462  N  N   . CYS A  1 187 ? -29.992  70.586  -31.844 1.00 47.94  ? 187 CYS A N   1 
ATOM   1463  C  CA  . CYS A  1 187 ? -31.212  70.265  -31.102 1.00 74.43  ? 187 CYS A CA  1 
ATOM   1464  C  C   . CYS A  1 187 ? -32.504  70.288  -31.936 1.00 53.46  ? 187 CYS A C   1 
ATOM   1465  O  O   . CYS A  1 187 ? -33.443  69.534  -31.662 1.00 51.41  ? 187 CYS A O   1 
ATOM   1466  C  CB  . CYS A  1 187 ? -31.392  71.253  -29.951 1.00 94.48  ? 187 CYS A CB  1 
ATOM   1467  S  SG  . CYS A  1 187 ? -32.159  72.810  -30.481 1.00 52.11  ? 187 CYS A SG  1 
ATOM   1468  N  N   . CYS A  1 188 ? -32.559  71.171  -32.930 1.00 58.58  ? 188 CYS A N   1 
ATOM   1469  C  CA  . CYS A  1 188 ? -33.831  71.567  -33.520 1.00 54.09  ? 188 CYS A CA  1 
ATOM   1470  C  C   . CYS A  1 188 ? -33.729  71.696  -35.031 1.00 45.33  ? 188 CYS A C   1 
ATOM   1471  O  O   . CYS A  1 188 ? -32.666  72.012  -35.559 1.00 46.04  ? 188 CYS A O   1 
ATOM   1472  C  CB  . CYS A  1 188 ? -34.298  72.897  -32.909 1.00 59.71  ? 188 CYS A CB  1 
ATOM   1473  S  SG  . CYS A  1 188 ? -34.070  73.009  -31.125 1.00 68.69  ? 188 CYS A SG  1 
ATOM   1474  N  N   . PRO A  1 189 ? -34.856  71.473  -35.727 1.00 38.88  ? 189 PRO A N   1 
ATOM   1475  C  CA  . PRO A  1 189 ? -34.920  71.471  -37.188 1.00 28.76  ? 189 PRO A CA  1 
ATOM   1476  C  C   . PRO A  1 189 ? -34.896  72.885  -37.756 1.00 30.13  ? 189 PRO A C   1 
ATOM   1477  O  O   . PRO A  1 189 ? -34.420  73.099  -38.864 1.00 34.69  ? 189 PRO A O   1 
ATOM   1478  C  CB  . PRO A  1 189 ? -36.286  70.835  -37.460 1.00 35.32  ? 189 PRO A CB  1 
ATOM   1479  C  CG  . PRO A  1 189 ? -37.121  71.271  -36.304 1.00 18.52  ? 189 PRO A CG  1 
ATOM   1480  C  CD  . PRO A  1 189 ? -36.188  71.274  -35.118 1.00 31.56  ? 189 PRO A CD  1 
ATOM   1481  N  N   . GLU A  1 190 ? -35.424  73.841  -37.003 1.00 26.19  ? 190 GLU A N   1 
ATOM   1482  C  CA  . GLU A  1 190 ? -35.585  75.197  -37.509 1.00 34.60  ? 190 GLU A CA  1 
ATOM   1483  C  C   . GLU A  1 190 ? -34.302  76.011  -37.445 1.00 23.66  ? 190 GLU A C   1 
ATOM   1484  O  O   . GLU A  1 190 ? -33.351  75.644  -36.748 1.00 34.15  ? 190 GLU A O   1 
ATOM   1485  C  CB  . GLU A  1 190 ? -36.709  75.917  -36.759 1.00 34.68  ? 190 GLU A CB  1 
ATOM   1486  C  CG  . GLU A  1 190 ? -38.075  75.315  -36.988 1.00 46.41  ? 190 GLU A CG  1 
ATOM   1487  C  CD  . GLU A  1 190 ? -38.717  75.785  -38.291 1.00 58.45  ? 190 GLU A CD  1 
ATOM   1488  O  OE1 . GLU A  1 190 ? -38.003  76.387  -39.124 1.00 59.77  ? 190 GLU A OE1 1 
ATOM   1489  O  OE2 . GLU A  1 190 ? -39.940  75.563  -38.479 1.00 53.18  ? 190 GLU A OE2 1 
ATOM   1490  N  N   . ALA A  1 191 ? -34.296  77.121  -38.174 1.00 17.47  ? 191 ALA A N   1 
ATOM   1491  C  CA  . ALA A  1 191 ? -33.169  78.040  -38.147 1.00 22.42  ? 191 ALA A CA  1 
ATOM   1492  C  C   . ALA A  1 191 ? -33.428  79.165  -37.158 1.00 16.89  ? 191 ALA A C   1 
ATOM   1493  O  O   . ALA A  1 191 ? -34.545  79.646  -37.032 1.00 13.39  ? 191 ALA A O   1 
ATOM   1494  C  CB  . ALA A  1 191 ? -32.880  78.597  -39.549 1.00 21.51  ? 191 ALA A CB  1 
ATOM   1495  N  N   . TYR A  1 192 ? -32.385  79.569  -36.449 1.00 17.94  ? 192 TYR A N   1 
ATOM   1496  C  CA  . TYR A  1 192 ? -32.494  80.650  -35.476 1.00 29.27  ? 192 TYR A CA  1 
ATOM   1497  C  C   . TYR A  1 192 ? -31.558  81.785  -35.863 1.00 20.58  ? 192 TYR A C   1 
ATOM   1498  O  O   . TYR A  1 192 ? -30.399  81.559  -36.204 1.00 40.08  ? 192 TYR A O   1 
ATOM   1499  C  CB  . TYR A  1 192 ? -32.191  80.148  -34.066 1.00 12.54  ? 192 TYR A CB  1 
ATOM   1500  C  CG  . TYR A  1 192 ? -33.165  79.100  -33.573 1.00 21.46  ? 192 TYR A CG  1 
ATOM   1501  C  CD1 . TYR A  1 192 ? -33.085  77.788  -34.028 1.00 15.19  ? 192 TYR A CD1 1 
ATOM   1502  C  CD2 . TYR A  1 192 ? -34.156  79.417  -32.643 1.00 13.81  ? 192 TYR A CD2 1 
ATOM   1503  C  CE1 . TYR A  1 192 ? -33.977  76.817  -33.577 1.00 36.03  ? 192 TYR A CE1 1 
ATOM   1504  C  CE2 . TYR A  1 192 ? -35.043  78.455  -32.181 1.00 23.19  ? 192 TYR A CE2 1 
ATOM   1505  C  CZ  . TYR A  1 192 ? -34.955  77.160  -32.646 1.00 28.98  ? 192 TYR A CZ  1 
ATOM   1506  O  OH  . TYR A  1 192 ? -35.842  76.210  -32.188 1.00 28.14  ? 192 TYR A OH  1 
ATOM   1507  N  N   . GLU A  1 193 ? -32.078  83.007  -35.840 1.00 27.91  ? 193 GLU A N   1 
ATOM   1508  C  CA  . GLU A  1 193 ? -31.306  84.166  -36.273 1.00 22.62  ? 193 GLU A CA  1 
ATOM   1509  C  C   . GLU A  1 193 ? -30.535  84.782  -35.119 1.00 19.65  ? 193 GLU A C   1 
ATOM   1510  O  O   . GLU A  1 193 ? -30.932  84.679  -33.951 1.00 27.80  ? 193 GLU A O   1 
ATOM   1511  C  CB  . GLU A  1 193 ? -32.208  85.212  -36.947 1.00 12.10  ? 193 GLU A CB  1 
ATOM   1512  C  CG  . GLU A  1 193 ? -32.927  84.687  -38.168 1.00 27.14  ? 193 GLU A CG  1 
ATOM   1513  C  CD  . GLU A  1 193 ? -33.543  85.788  -39.016 1.00 36.15  ? 193 GLU A CD  1 
ATOM   1514  O  OE1 . GLU A  1 193 ? -33.500  86.952  -38.574 1.00 23.80  ? 193 GLU A OE1 1 
ATOM   1515  O  OE2 . GLU A  1 193 ? -34.064  85.486  -40.122 1.00 34.95  ? 193 GLU A OE2 1 
ATOM   1516  N  N   . ASP A  1 194 ? -29.419  85.404  -35.466 1.00 13.04  ? 194 ASP A N   1 
ATOM   1517  C  CA  . ASP A  1 194 ? -28.551  86.092  -34.515 1.00 20.93  ? 194 ASP A CA  1 
ATOM   1518  C  C   . ASP A  1 194 ? -27.848  87.266  -35.195 1.00 26.23  ? 194 ASP A C   1 
ATOM   1519  O  O   . ASP A  1 194 ? -27.665  87.288  -36.412 1.00 27.91  ? 194 ASP A O   1 
ATOM   1520  C  CB  . ASP A  1 194 ? -27.510  85.136  -33.894 1.00 32.83  ? 194 ASP A CB  1 
ATOM   1521  C  CG  . ASP A  1 194 ? -26.471  84.643  -34.897 1.00 34.95  ? 194 ASP A CG  1 
ATOM   1522  O  OD1 . ASP A  1 194 ? -25.669  85.475  -35.347 1.00 24.42  ? 194 ASP A OD1 1 
ATOM   1523  O  OD2 . ASP A  1 194 ? -26.444  83.428  -35.214 1.00 39.36  ? 194 ASP A OD2 1 
ATOM   1524  N  N   . VAL A  1 195 ? -27.488  88.258  -34.402 1.00 17.33  ? 195 VAL A N   1 
ATOM   1525  C  CA  . VAL A  1 195 ? -26.636  89.327  -34.869 1.00 24.13  ? 195 VAL A CA  1 
ATOM   1526  C  C   . VAL A  1 195 ? -25.276  89.181  -34.186 1.00 29.22  ? 195 VAL A C   1 
ATOM   1527  O  O   . VAL A  1 195 ? -25.198  88.949  -32.968 1.00 27.85  ? 195 VAL A O   1 
ATOM   1528  C  CB  . VAL A  1 195 ? -27.243  90.700  -34.541 1.00 16.94  ? 195 VAL A CB  1 
ATOM   1529  C  CG1 . VAL A  1 195 ? -26.243  91.797  -34.745 1.00 17.63  ? 195 VAL A CG1 1 
ATOM   1530  C  CG2 . VAL A  1 195 ? -28.427  90.947  -35.416 1.00 29.24  ? 195 VAL A CG2 1 
ATOM   1531  N  N   . GLU A  1 196 ? -24.206  89.289  -34.970 1.00 31.05  ? 196 GLU A N   1 
ATOM   1532  C  CA  . GLU A  1 196 ? -22.855  89.254  -34.422 1.00 19.66  ? 196 GLU A CA  1 
ATOM   1533  C  C   . GLU A  1 196 ? -22.250  90.633  -34.474 1.00 19.92  ? 196 GLU A C   1 
ATOM   1534  O  O   . GLU A  1 196 ? -22.031  91.194  -35.540 1.00 34.73  ? 196 GLU A O   1 
ATOM   1535  C  CB  . GLU A  1 196 ? -21.971  88.269  -35.186 1.00 33.85  ? 196 GLU A CB  1 
ATOM   1536  C  CG  . GLU A  1 196 ? -22.110  86.828  -34.729 1.00 38.46  ? 196 GLU A CG  1 
ATOM   1537  C  CD  . GLU A  1 196 ? -21.333  85.858  -35.603 1.00 46.32  ? 196 GLU A CD  1 
ATOM   1538  O  OE1 . GLU A  1 196 ? -20.579  86.320  -36.480 1.00 45.04  ? 196 GLU A OE1 1 
ATOM   1539  O  OE2 . GLU A  1 196 ? -21.481  84.633  -35.419 1.00 34.70  ? 196 GLU A OE2 1 
ATOM   1540  N  N   . VAL A  1 197 ? -21.977  91.174  -33.303 1.00 21.35  ? 197 VAL A N   1 
ATOM   1541  C  CA  . VAL A  1 197 ? -21.359  92.482  -33.172 1.00 28.45  ? 197 VAL A CA  1 
ATOM   1542  C  C   . VAL A  1 197 ? -19.867  92.294  -32.959 1.00 21.84  ? 197 VAL A C   1 
ATOM   1543  O  O   . VAL A  1 197 ? -19.449  91.693  -31.980 1.00 34.08  ? 197 VAL A O   1 
ATOM   1544  C  CB  . VAL A  1 197 ? -21.966  93.253  -31.975 1.00 24.53  ? 197 VAL A CB  1 
ATOM   1545  C  CG1 . VAL A  1 197 ? -21.467  94.677  -31.942 1.00 12.91  ? 197 VAL A CG1 1 
ATOM   1546  C  CG2 . VAL A  1 197 ? -23.495  93.202  -32.052 1.00 15.24  ? 197 VAL A CG2 1 
ATOM   1547  N  N   . SER A  1 198 ? -19.067  92.780  -33.894 1.00 25.69  ? 198 SER A N   1 
ATOM   1548  C  CA  . SER A  1 198 ? -17.619  92.670  -33.766 1.00 27.71  ? 198 SER A CA  1 
ATOM   1549  C  C   . SER A  1 198 ? -17.048  93.955  -33.188 1.00 22.74  ? 198 SER A C   1 
ATOM   1550  O  O   . SER A  1 198 ? -17.058  95.009  -33.822 1.00 26.77  ? 198 SER A O   1 
ATOM   1551  C  CB  . SER A  1 198 ? -16.971  92.345  -35.113 1.00 25.04  ? 198 SER A CB  1 
ATOM   1552  O  OG  . SER A  1 198 ? -17.313  91.036  -35.543 1.00 35.21  ? 198 SER A OG  1 
ATOM   1553  N  N   . LEU A  1 199 ? -16.568  93.857  -31.962 1.00 16.45  ? 199 LEU A N   1 
ATOM   1554  C  CA  . LEU A  1 199 ? -15.937  94.978  -31.284 1.00 18.48  ? 199 LEU A CA  1 
ATOM   1555  C  C   . LEU A  1 199 ? -14.420  94.949  -31.462 1.00 30.12  ? 199 LEU A C   1 
ATOM   1556  O  O   . LEU A  1 199 ? -13.746  94.058  -30.956 1.00 31.21  ? 199 LEU A O   1 
ATOM   1557  C  CB  . LEU A  1 199 ? -16.276  94.912  -29.801 1.00 17.83  ? 199 LEU A CB  1 
ATOM   1558  C  CG  . LEU A  1 199 ? -15.613  95.973  -28.934 1.00 26.81  ? 199 LEU A CG  1 
ATOM   1559  C  CD1 . LEU A  1 199 ? -16.082  97.353  -29.354 1.00 29.94  ? 199 LEU A CD1 1 
ATOM   1560  C  CD2 . LEU A  1 199 ? -15.930  95.729  -27.494 1.00 15.98  ? 199 LEU A CD2 1 
ATOM   1561  N  N   . ASN A  1 200 ? -13.886  95.917  -32.194 1.00 20.83  ? 200 ASN A N   1 
ATOM   1562  C  CA  . ASN A  1 200 ? -12.451  96.024  -32.381 1.00 14.19  ? 200 ASN A CA  1 
ATOM   1563  C  C   . ASN A  1 200 ? -11.870  97.110  -31.493 1.00 29.31  ? 200 ASN A C   1 
ATOM   1564  O  O   . ASN A  1 200 ? -12.118  98.293  -31.712 1.00 29.74  ? 200 ASN A O   1 
ATOM   1565  C  CB  . ASN A  1 200 ? -12.141  96.322  -33.833 1.00 27.60  ? 200 ASN A CB  1 
ATOM   1566  C  CG  . ASN A  1 200 ? -10.646  96.372  -34.116 1.00 34.47  ? 200 ASN A CG  1 
ATOM   1567  O  OD1 . ASN A  1 200 ? -10.190  97.169  -34.928 1.00 28.33  ? 200 ASN A OD1 1 
ATOM   1568  N  ND2 . ASN A  1 200 ? -9.881   95.530  -33.440 1.00 35.29  ? 200 ASN A ND2 1 
ATOM   1569  N  N   . PHE A  1 201 ? -11.106  96.704  -30.481 1.00 15.09  ? 201 PHE A N   1 
ATOM   1570  C  CA  . PHE A  1 201 ? -10.599  97.642  -29.489 1.00 17.24  ? 201 PHE A CA  1 
ATOM   1571  C  C   . PHE A  1 201 ? -9.148   97.345  -29.138 1.00 24.76  ? 201 PHE A C   1 
ATOM   1572  O  O   . PHE A  1 201 ? -8.630   96.284  -29.458 1.00 25.77  ? 201 PHE A O   1 
ATOM   1573  C  CB  . PHE A  1 201 ? -11.451  97.582  -28.225 1.00 16.09  ? 201 PHE A CB  1 
ATOM   1574  C  CG  . PHE A  1 201 ? -11.329  96.293  -27.473 1.00 16.66  ? 201 PHE A CG  1 
ATOM   1575  C  CD1 . PHE A  1 201 ? -11.710  95.098  -28.050 1.00 25.92  ? 201 PHE A CD1 1 
ATOM   1576  C  CD2 . PHE A  1 201 ? -10.836  96.274  -26.184 1.00 20.94  ? 201 PHE A CD2 1 
ATOM   1577  C  CE1 . PHE A  1 201 ? -11.604  93.904  -27.357 1.00 16.88  ? 201 PHE A CE1 1 
ATOM   1578  C  CE2 . PHE A  1 201 ? -10.730  95.081  -25.483 1.00 26.24  ? 201 PHE A CE2 1 
ATOM   1579  C  CZ  . PHE A  1 201 ? -11.118  93.898  -26.071 1.00 17.92  ? 201 PHE A CZ  1 
ATOM   1580  N  N   . ARG A  1 202 ? -8.503   98.278  -28.448 1.00 28.41  ? 202 ARG A N   1 
ATOM   1581  C  CA  . ARG A  1 202 ? -7.150   98.057  -27.968 1.00 29.66  ? 202 ARG A CA  1 
ATOM   1582  C  C   . ARG A  1 202 ? -6.892   98.829  -26.693 1.00 31.58  ? 202 ARG A C   1 
ATOM   1583  O  O   . ARG A  1 202 ? -7.611   99.792  -26.384 1.00 28.94  ? 202 ARG A O   1 
ATOM   1584  C  CB  . ARG A  1 202 ? -6.149   98.492  -29.028 1.00 33.98  ? 202 ARG A CB  1 
ATOM   1585  C  CG  . ARG A  1 202 ? -6.122   99.982  -29.250 1.00 25.80  ? 202 ARG A CG  1 
ATOM   1586  C  CD  . ARG A  1 202 ? -5.269   100.346 -30.431 1.00 27.41  ? 202 ARG A CD  1 
ATOM   1587  N  NE  . ARG A  1 202 ? -5.288   101.785 -30.644 1.00 36.60  ? 202 ARG A NE  1 
ATOM   1588  C  CZ  . ARG A  1 202 ? -4.882   102.381 -31.759 1.00 38.40  ? 202 ARG A CZ  1 
ATOM   1589  N  NH1 . ARG A  1 202 ? -4.425   101.653 -32.767 1.00 34.25  ? 202 ARG A NH1 1 
ATOM   1590  N  NH2 . ARG A  1 202 ? -4.942   103.702 -31.868 1.00 32.41  ? 202 ARG A NH2 1 
ATOM   1591  N  N   . LYS A  1 203 ? -5.876   98.390  -25.945 1.00 17.20  ? 203 LYS A N   1 
ATOM   1592  C  CA  . LYS A  1 203 ? -5.417   99.149  -24.782 1.00 4.59   ? 203 LYS A CA  1 
ATOM   1593  C  C   . LYS A  1 203 ? -4.871   100.501 -25.262 1.00 17.25  ? 203 LYS A C   1 
ATOM   1594  O  O   . LYS A  1 203 ? -4.391   100.605 -26.385 1.00 24.25  ? 203 LYS A O   1 
ATOM   1595  C  CB  . LYS A  1 203 ? -4.362   98.373  -24.015 1.00 0.67   ? 203 LYS A CB  1 
ATOM   1596  C  CG  . LYS A  1 203 ? -4.821   97.014  -23.527 1.00 28.42  ? 203 LYS A CG  1 
ATOM   1597  C  CD  . LYS A  1 203 ? -4.134   96.631  -22.214 1.00 43.83  ? 203 LYS A CD  1 
ATOM   1598  C  CE  . LYS A  1 203 ? -4.757   95.387  -21.586 1.00 47.77  ? 203 LYS A CE  1 
ATOM   1599  N  NZ  . LYS A  1 203 ? -4.282   95.163  -20.188 1.00 49.89  ? 203 LYS A NZ  1 
ATOM   1600  N  N   . LYS A  1 204 ? -4.997   101.543 -24.445 1.00 13.62  ? 204 LYS A N   1 
ATOM   1601  C  CA  . LYS A  1 204 ? -4.481   102.849 -24.818 1.00 22.10  ? 204 LYS A CA  1 
ATOM   1602  C  C   . LYS A  1 204 ? -3.032   102.877 -24.391 1.00 37.90  ? 204 LYS A C   1 
ATOM   1603  O  O   . LYS A  1 204 ? -2.654   102.212 -23.418 1.00 34.68  ? 204 LYS A O   1 
ATOM   1604  C  CB  . LYS A  1 204 ? -5.220   103.968 -24.108 1.00 0.67   ? 204 LYS A CB  1 
ATOM   1605  C  CG  . LYS A  1 204 ? -6.684   104.147 -24.519 1.00 51.59  ? 204 LYS A CG  1 
ATOM   1606  C  CD  . LYS A  1 204 ? -7.516   104.794 -23.396 1.00 20.01  ? 204 LYS A CD  1 
ATOM   1607  C  CE  . LYS A  1 204 ? -8.238   106.038 -23.869 1.00 14.23  ? 204 LYS A CE  1 
ATOM   1608  N  NZ  . LYS A  1 204 ? -8.773   106.799 -22.718 1.00 11.58  ? 204 LYS A NZ  1 
ATOM   1609  N  N   . GLY A  1 205 ? -2.222   103.643 -25.115 1.00 22.10  ? 205 GLY A N   1 
ATOM   1610  C  CA  . GLY A  1 205 ? -0.811   103.759 -24.804 1.00 42.15  ? 205 GLY A CA  1 
ATOM   1611  C  C   . GLY A  1 205 ? -0.496   104.527 -23.528 1.00 53.01  ? 205 GLY A C   1 
ATOM   1612  O  O   . GLY A  1 205 ? -1.322   105.283 -22.995 1.00 64.03  ? 205 GLY A O   1 
ATOM   1613  N  N   . ARG A  1 206 ? 0.723    104.311 -23.047 1.00 40.16  ? 206 ARG A N   1 
ATOM   1614  C  CA  . ARG A  1 206 ? 1.276    104.973 -21.871 1.00 39.77  ? 206 ARG A CA  1 
ATOM   1615  C  C   . ARG A  1 206 ? 1.136    106.509 -21.895 1.00 39.25  ? 206 ARG A C   1 
ATOM   1616  O  O   . ARG A  1 206 ? 1.467    107.184 -22.879 1.00 15.01  ? 206 ARG A O   1 
ATOM   1617  C  CB  . ARG A  1 206 ? 2.739    104.563 -21.752 1.00 40.66  ? 206 ARG A CB  1 
ATOM   1618  C  CG  . ARG A  1 206 ? 3.312    104.161 -23.114 1.00 60.06  ? 206 ARG A CG  1 
ATOM   1619  C  CD  . ARG A  1 206 ? 4.738    103.678 -23.033 1.00 51.11  ? 206 ARG A CD  1 
ATOM   1620  N  NE  . ARG A  1 206 ? 5.146    102.926 -24.217 1.00 41.82  ? 206 ARG A NE  1 
ATOM   1621  C  CZ  . ARG A  1 206 ? 5.042    101.603 -24.321 1.00 40.64  ? 206 ARG A CZ  1 
ATOM   1622  N  NH1 . ARG A  1 206 ? 4.523    100.903 -23.311 1.00 30.69  ? 206 ARG A NH1 1 
ATOM   1623  N  NH2 . ARG A  1 206 ? 5.459    100.978 -25.426 1.00 14.23  ? 206 ARG A NH2 1 
ATOM   1624  N  N   . LEU B  1 1   ? -57.730  78.190  -32.812 1.00 48.89  ? 1   LEU B N   1 
ATOM   1625  C  CA  . LEU B  1 1   ? -56.767  78.533  -31.778 1.00 44.09  ? 1   LEU B CA  1 
ATOM   1626  C  C   . LEU B  1 1   ? -55.603  79.335  -32.331 1.00 42.17  ? 1   LEU B C   1 
ATOM   1627  O  O   . LEU B  1 1   ? -54.939  78.912  -33.273 1.00 42.20  ? 1   LEU B O   1 
ATOM   1628  C  CB  . LEU B  1 1   ? -56.216  77.263  -31.134 1.00 44.17  ? 1   LEU B CB  1 
ATOM   1629  C  CG  . LEU B  1 1   ? -57.089  76.629  -30.066 1.00 46.64  ? 1   LEU B CG  1 
ATOM   1630  C  CD1 . LEU B  1 1   ? -56.398  75.407  -29.484 1.00 41.22  ? 1   LEU B CD1 1 
ATOM   1631  C  CD2 . LEU B  1 1   ? -57.391  77.654  -28.983 1.00 48.77  ? 1   LEU B CD2 1 
ATOM   1632  N  N   . ASP B  1 2   ? -55.349  80.492  -31.734 1.00 43.57  ? 2   ASP B N   1 
ATOM   1633  C  CA  . ASP B  1 2   ? -54.116  81.223  -32.017 1.00 40.12  ? 2   ASP B CA  1 
ATOM   1634  C  C   . ASP B  1 2   ? -53.174  81.138  -30.800 1.00 34.00  ? 2   ASP B C   1 
ATOM   1635  O  O   . ASP B  1 2   ? -53.524  80.559  -29.774 1.00 27.01  ? 2   ASP B O   1 
ATOM   1636  C  CB  . ASP B  1 2   ? -54.407  82.679  -32.419 1.00 29.58  ? 2   ASP B CB  1 
ATOM   1637  C  CG  . ASP B  1 2   ? -55.140  83.449  -31.339 1.00 49.07  ? 2   ASP B CG  1 
ATOM   1638  O  OD1 . ASP B  1 2   ? -55.083  83.024  -30.168 1.00 47.33  ? 2   ASP B OD1 1 
ATOM   1639  O  OD2 . ASP B  1 2   ? -55.763  84.484  -31.655 1.00 50.51  ? 2   ASP B OD2 1 
ATOM   1640  N  N   . ARG B  1 3   ? -51.978  81.694  -30.924 1.00 24.13  ? 3   ARG B N   1 
ATOM   1641  C  CA  . ARG B  1 3   ? -51.022  81.631  -29.841 1.00 27.61  ? 3   ARG B CA  1 
ATOM   1642  C  C   . ARG B  1 3   ? -51.622  82.184  -28.557 1.00 29.65  ? 3   ARG B C   1 
ATOM   1643  O  O   . ARG B  1 3   ? -51.531  81.564  -27.501 1.00 32.87  ? 3   ARG B O   1 
ATOM   1644  C  CB  . ARG B  1 3   ? -49.729  82.383  -30.208 1.00 30.17  ? 3   ARG B CB  1 
ATOM   1645  C  CG  . ARG B  1 3   ? -48.872  81.663  -31.197 1.00 17.33  ? 3   ARG B CG  1 
ATOM   1646  C  CD  . ARG B  1 3   ? -47.652  82.456  -31.562 1.00 27.44  ? 3   ARG B CD  1 
ATOM   1647  N  NE  . ARG B  1 3   ? -46.799  81.672  -32.448 1.00 50.81  ? 3   ARG B NE  1 
ATOM   1648  C  CZ  . ARG B  1 3   ? -46.902  81.678  -33.773 1.00 56.45  ? 3   ARG B CZ  1 
ATOM   1649  N  NH1 . ARG B  1 3   ? -47.816  82.439  -34.362 1.00 53.31  ? 3   ARG B NH1 1 
ATOM   1650  N  NH2 . ARG B  1 3   ? -46.097  80.925  -34.510 1.00 58.80  ? 3   ARG B NH2 1 
ATOM   1651  N  N   . ALA B  1 4   ? -52.227  83.359  -28.649 1.00 30.02  ? 4   ALA B N   1 
ATOM   1652  C  CA  . ALA B  1 4   ? -52.862  83.977  -27.488 1.00 40.30  ? 4   ALA B CA  1 
ATOM   1653  C  C   . ALA B  1 4   ? -53.821  83.023  -26.773 1.00 35.06  ? 4   ALA B C   1 
ATOM   1654  O  O   . ALA B  1 4   ? -53.797  82.926  -25.548 1.00 27.07  ? 4   ALA B O   1 
ATOM   1655  C  CB  . ALA B  1 4   ? -53.597  85.253  -27.900 1.00 40.06  ? 4   ALA B CB  1 
ATOM   1656  N  N   . ASP B  1 5   ? -54.663  82.330  -27.531 1.00 17.70  ? 5   ASP B N   1 
ATOM   1657  C  CA  . ASP B  1 5   ? -55.624  81.411  -26.916 1.00 41.35  ? 5   ASP B CA  1 
ATOM   1658  C  C   . ASP B  1 5   ? -54.905  80.250  -26.222 1.00 42.03  ? 5   ASP B C   1 
ATOM   1659  O  O   . ASP B  1 5   ? -55.215  79.922  -25.068 1.00 25.57  ? 5   ASP B O   1 
ATOM   1660  C  CB  . ASP B  1 5   ? -56.657  80.874  -27.929 1.00 25.33  ? 5   ASP B CB  1 
ATOM   1661  C  CG  . ASP B  1 5   ? -57.440  81.968  -28.598 1.00 36.08  ? 5   ASP B CG  1 
ATOM   1662  O  OD1 . ASP B  1 5   ? -57.741  82.981  -27.928 1.00 33.83  ? 5   ASP B OD1 1 
ATOM   1663  O  OD2 . ASP B  1 5   ? -57.734  81.820  -29.804 1.00 48.92  ? 5   ASP B OD2 1 
ATOM   1664  N  N   . ILE B  1 6   ? -53.963  79.628  -26.933 1.00 18.67  ? 6   ILE B N   1 
ATOM   1665  C  CA  . ILE B  1 6   ? -53.170  78.538  -26.370 1.00 24.36  ? 6   ILE B CA  1 
ATOM   1666  C  C   . ILE B  1 6   ? -52.501  78.948  -25.061 1.00 28.32  ? 6   ILE B C   1 
ATOM   1667  O  O   . ILE B  1 6   ? -52.562  78.233  -24.065 1.00 35.44  ? 6   ILE B O   1 
ATOM   1668  C  CB  . ILE B  1 6   ? -52.080  78.054  -27.363 1.00 36.22  ? 6   ILE B CB  1 
ATOM   1669  C  CG1 . ILE B  1 6   ? -52.732  77.572  -28.669 1.00 36.59  ? 6   ILE B CG1 1 
ATOM   1670  C  CG2 . ILE B  1 6   ? -51.238  76.947  -26.737 1.00 13.15  ? 6   ILE B CG2 1 
ATOM   1671  C  CD1 . ILE B  1 6   ? -51.754  77.236  -29.755 1.00 28.23  ? 6   ILE B CD1 1 
ATOM   1672  N  N   . LEU B  1 7   ? -51.869  80.113  -25.069 1.00 22.40  ? 7   LEU B N   1 
ATOM   1673  C  CA  . LEU B  1 7   ? -51.147  80.601  -23.907 1.00 19.05  ? 7   LEU B CA  1 
ATOM   1674  C  C   . LEU B  1 7   ? -52.085  80.978  -22.769 1.00 34.01  ? 7   LEU B C   1 
ATOM   1675  O  O   . LEU B  1 7   ? -51.749  80.815  -21.587 1.00 28.86  ? 7   LEU B O   1 
ATOM   1676  C  CB  . LEU B  1 7   ? -50.258  81.773  -24.307 1.00 23.04  ? 7   LEU B CB  1 
ATOM   1677  C  CG  . LEU B  1 7   ? -48.998  81.362  -25.087 1.00 24.01  ? 7   LEU B CG  1 
ATOM   1678  C  CD1 . LEU B  1 7   ? -48.444  82.528  -25.862 1.00 30.10  ? 7   LEU B CD1 1 
ATOM   1679  C  CD2 . LEU B  1 7   ? -47.954  80.807  -24.144 1.00 20.44  ? 7   LEU B CD2 1 
ATOM   1680  N  N   . TYR B  1 8   ? -53.270  81.465  -23.129 1.00 24.22  ? 8   TYR B N   1 
ATOM   1681  C  CA  . TYR B  1 8   ? -54.306  81.765  -22.138 1.00 29.10  ? 8   TYR B CA  1 
ATOM   1682  C  C   . TYR B  1 8   ? -54.746  80.477  -21.455 1.00 33.70  ? 8   TYR B C   1 
ATOM   1683  O  O   . TYR B  1 8   ? -54.814  80.399  -20.231 1.00 31.80  ? 8   TYR B O   1 
ATOM   1684  C  CB  . TYR B  1 8   ? -55.497  82.463  -22.797 1.00 25.62  ? 8   TYR B CB  1 
ATOM   1685  C  CG  . TYR B  1 8   ? -56.630  82.824  -21.864 1.00 42.05  ? 8   TYR B CG  1 
ATOM   1686  C  CD1 . TYR B  1 8   ? -56.546  83.930  -21.024 1.00 57.21  ? 8   TYR B CD1 1 
ATOM   1687  C  CD2 . TYR B  1 8   ? -57.800  82.080  -21.839 1.00 48.55  ? 8   TYR B CD2 1 
ATOM   1688  C  CE1 . TYR B  1 8   ? -57.595  84.275  -20.179 1.00 59.32  ? 8   TYR B CE1 1 
ATOM   1689  C  CE2 . TYR B  1 8   ? -58.853  82.421  -20.992 1.00 48.47  ? 8   TYR B CE2 1 
ATOM   1690  C  CZ  . TYR B  1 8   ? -58.741  83.516  -20.167 1.00 55.91  ? 8   TYR B CZ  1 
ATOM   1691  O  OH  . TYR B  1 8   ? -59.783  83.856  -19.333 1.00 67.32  ? 8   TYR B OH  1 
ATOM   1692  N  N   . ASN B  1 9   ? -55.029  79.454  -22.249 1.00 19.04  ? 9   ASN B N   1 
ATOM   1693  C  CA  . ASN B  1 9   ? -55.415  78.166  -21.691 1.00 20.55  ? 9   ASN B CA  1 
ATOM   1694  C  C   . ASN B  1 9   ? -54.340  77.571  -20.771 1.00 38.65  ? 9   ASN B C   1 
ATOM   1695  O  O   . ASN B  1 9   ? -54.632  77.170  -19.632 1.00 28.39  ? 9   ASN B O   1 
ATOM   1696  C  CB  . ASN B  1 9   ? -55.782  77.182  -22.794 1.00 20.90  ? 9   ASN B CB  1 
ATOM   1697  C  CG  . ASN B  1 9   ? -56.914  77.674  -23.638 1.00 33.68  ? 9   ASN B CG  1 
ATOM   1698  O  OD1 . ASN B  1 9   ? -57.689  78.536  -23.213 1.00 31.14  ? 9   ASN B OD1 1 
ATOM   1699  N  ND2 . ASN B  1 9   ? -57.023  77.139  -24.847 1.00 34.40  ? 9   ASN B ND2 1 
ATOM   1700  N  N   . ILE B  1 10  ? -53.100  77.524  -21.261 1.00 32.05  ? 10  ILE B N   1 
ATOM   1701  C  CA  . ILE B  1 10  ? -51.992  76.970  -20.490 1.00 20.12  ? 10  ILE B CA  1 
ATOM   1702  C  C   . ILE B  1 10  ? -51.850  77.683  -19.155 1.00 34.53  ? 10  ILE B C   1 
ATOM   1703  O  O   . ILE B  1 10  ? -51.792  77.047  -18.109 1.00 24.51  ? 10  ILE B O   1 
ATOM   1704  C  CB  . ILE B  1 10  ? -50.693  77.021  -21.262 1.00 21.81  ? 10  ILE B CB  1 
ATOM   1705  C  CG1 . ILE B  1 10  ? -50.671  75.892  -22.289 1.00 17.74  ? 10  ILE B CG1 1 
ATOM   1706  C  CG2 . ILE B  1 10  ? -49.527  76.866  -20.329 1.00 15.68  ? 10  ILE B CG2 1 
ATOM   1707  C  CD1 . ILE B  1 10  ? -49.618  76.078  -23.359 1.00 27.05  ? 10  ILE B CD1 1 
ATOM   1708  N  N   . ARG B  1 11  ? -51.819  79.009  -19.189 1.00 26.98  ? 11  ARG B N   1 
ATOM   1709  C  CA  . ARG B  1 11  ? -51.791  79.786  -17.956 1.00 6.72   ? 11  ARG B CA  1 
ATOM   1710  C  C   . ARG B  1 11  ? -53.036  79.543  -17.078 1.00 18.70  ? 11  ARG B C   1 
ATOM   1711  O  O   . ARG B  1 11  ? -52.940  79.516  -15.866 1.00 12.28  ? 11  ARG B O   1 
ATOM   1712  C  CB  . ARG B  1 11  ? -51.621  81.274  -18.268 1.00 23.86  ? 11  ARG B CB  1 
ATOM   1713  C  CG  . ARG B  1 11  ? -51.145  82.117  -17.095 1.00 46.83  ? 11  ARG B CG  1 
ATOM   1714  C  CD  . ARG B  1 11  ? -52.253  83.047  -16.612 1.00 55.73  ? 11  ARG B CD  1 
ATOM   1715  N  NE  . ARG B  1 11  ? -52.814  83.849  -17.700 1.00 69.52  ? 11  ARG B NE  1 
ATOM   1716  C  CZ  . ARG B  1 11  ? -52.884  85.179  -17.697 1.00 76.79  ? 11  ARG B CZ  1 
ATOM   1717  N  NH1 . ARG B  1 11  ? -52.421  85.858  -16.646 1.00 75.48  ? 11  ARG B NH1 1 
ATOM   1718  N  NH2 . ARG B  1 11  ? -53.425  85.825  -18.736 1.00 45.37  ? 11  ARG B NH2 1 
ATOM   1719  N  N   . GLN B  1 12  ? -54.203  79.341  -17.676 1.00 54.14  ? 12  GLN B N   1 
ATOM   1720  C  CA  . GLN B  1 12  ? -55.408  79.171  -16.865 1.00 34.07  ? 12  GLN B CA  1 
ATOM   1721  C  C   . GLN B  1 12  ? -55.552  77.754  -16.290 1.00 51.01  ? 12  GLN B C   1 
ATOM   1722  O  O   . GLN B  1 12  ? -56.163  77.573  -15.237 1.00 45.10  ? 12  GLN B O   1 
ATOM   1723  C  CB  . GLN B  1 12  ? -56.654  79.580  -17.648 1.00 37.53  ? 12  GLN B CB  1 
ATOM   1724  C  CG  . GLN B  1 12  ? -56.692  81.036  -18.032 1.00 34.41  ? 12  GLN B CG  1 
ATOM   1725  C  CD  . GLN B  1 12  ? -56.900  81.937  -16.836 1.00 42.64  ? 12  GLN B CD  1 
ATOM   1726  O  OE1 . GLN B  1 12  ? -56.068  81.996  -15.936 1.00 46.98  ? 12  GLN B OE1 1 
ATOM   1727  N  NE2 . GLN B  1 12  ? -58.025  82.641  -16.813 1.00 52.64  ? 12  GLN B NE2 1 
ATOM   1728  N  N   . THR B  1 13  ? -54.953  76.760  -16.951 1.00 22.69  ? 13  THR B N   1 
ATOM   1729  C  CA  . THR B  1 13  ? -55.067  75.367  -16.497 1.00 32.97  ? 13  THR B CA  1 
ATOM   1730  C  C   . THR B  1 13  ? -53.760  74.670  -16.077 1.00 39.53  ? 13  THR B C   1 
ATOM   1731  O  O   . THR B  1 13  ? -53.786  73.495  -15.699 1.00 29.40  ? 13  THR B O   1 
ATOM   1732  C  CB  . THR B  1 13  ? -55.731  74.466  -17.561 1.00 29.15  ? 13  THR B CB  1 
ATOM   1733  O  OG1 . THR B  1 13  ? -54.928  74.460  -18.747 1.00 22.86  ? 13  THR B OG1 1 
ATOM   1734  C  CG2 . THR B  1 13  ? -57.144  74.945  -17.890 1.00 35.70  ? 13  THR B CG2 1 
ATOM   1735  N  N   . SER B  1 14  ? -52.630  75.370  -16.148 1.00 47.14  ? 14  SER B N   1 
ATOM   1736  C  CA  . SER B  1 14  ? -51.334  74.776  -15.788 1.00 63.89  ? 14  SER B CA  1 
ATOM   1737  C  C   . SER B  1 14  ? -51.240  74.462  -14.296 1.00 49.43  ? 14  SER B C   1 
ATOM   1738  O  O   . SER B  1 14  ? -51.585  75.295  -13.468 1.00 14.31  ? 14  SER B O   1 
ATOM   1739  C  CB  . SER B  1 14  ? -50.188  75.720  -16.158 1.00 65.93  ? 14  SER B CB  1 
ATOM   1740  O  OG  . SER B  1 14  ? -50.233  76.909  -15.373 1.00 67.09  ? 14  SER B OG  1 
ATOM   1741  N  N   . ARG B  1 15  ? -50.767  73.268  -13.954 1.00 26.12  ? 15  ARG B N   1 
ATOM   1742  C  CA  . ARG B  1 15  ? -50.461  72.970  -12.567 1.00 14.54  ? 15  ARG B CA  1 
ATOM   1743  C  C   . ARG B  1 15  ? -48.936  72.802  -12.362 1.00 15.36  ? 15  ARG B C   1 
ATOM   1744  O  O   . ARG B  1 15  ? -48.415  71.678  -12.298 1.00 12.92  ? 15  ARG B O   1 
ATOM   1745  C  CB  . ARG B  1 15  ? -51.210  71.722  -12.099 1.00 20.88  ? 15  ARG B CB  1 
ATOM   1746  C  CG  . ARG B  1 15  ? -52.731  71.754  -12.216 1.00 9.29   ? 15  ARG B CG  1 
ATOM   1747  C  CD  . ARG B  1 15  ? -53.449  72.712  -11.237 1.00 31.68  ? 15  ARG B CD  1 
ATOM   1748  N  NE  . ARG B  1 15  ? -52.975  72.675  -9.845  1.00 50.93  ? 15  ARG B NE  1 
ATOM   1749  C  CZ  . ARG B  1 15  ? -53.209  71.694  -8.972  1.00 37.76  ? 15  ARG B CZ  1 
ATOM   1750  N  NH1 . ARG B  1 15  ? -53.885  70.617  -9.338  1.00 3.13   ? 15  ARG B NH1 1 
ATOM   1751  N  NH2 . ARG B  1 15  ? -52.732  71.777  -7.731  1.00 40.63  ? 15  ARG B NH2 1 
ATOM   1752  N  N   . PRO B  1 16  ? -48.218  73.925  -12.237 1.00 22.86  ? 16  PRO B N   1 
ATOM   1753  C  CA  . PRO B  1 16  ? -46.762  73.905  -12.122 1.00 28.20  ? 16  PRO B CA  1 
ATOM   1754  C  C   . PRO B  1 16  ? -46.286  73.073  -10.932 1.00 21.70  ? 16  PRO B C   1 
ATOM   1755  O  O   . PRO B  1 16  ? -45.136  72.657  -10.907 1.00 50.03  ? 16  PRO B O   1 
ATOM   1756  C  CB  . PRO B  1 16  ? -46.412  75.379  -11.908 1.00 27.17  ? 16  PRO B CB  1 
ATOM   1757  C  CG  . PRO B  1 16  ? -47.605  76.138  -12.343 1.00 23.61  ? 16  PRO B CG  1 
ATOM   1758  C  CD  . PRO B  1 16  ? -48.765  75.275  -12.057 1.00 18.67  ? 16  PRO B CD  1 
ATOM   1759  N  N   . ASP B  1 17  ? -47.172  72.819  -9.975  1.00 26.62  ? 17  ASP B N   1 
ATOM   1760  C  CA  . ASP B  1 17  ? -46.834  72.109  -8.741  1.00 24.31  ? 17  ASP B CA  1 
ATOM   1761  C  C   . ASP B  1 17  ? -47.086  70.601  -8.841  1.00 14.17  ? 17  ASP B C   1 
ATOM   1762  O  O   . ASP B  1 17  ? -46.788  69.839  -7.914  1.00 31.38  ? 17  ASP B O   1 
ATOM   1763  C  CB  . ASP B  1 17  ? -47.623  72.696  -7.567  1.00 35.02  ? 17  ASP B CB  1 
ATOM   1764  C  CG  . ASP B  1 17  ? -49.137  72.759  -7.834  1.00 65.60  ? 17  ASP B CG  1 
ATOM   1765  O  OD1 . ASP B  1 17  ? -49.543  73.047  -8.988  1.00 49.39  ? 17  ASP B OD1 1 
ATOM   1766  O  OD2 . ASP B  1 17  ? -49.923  72.525  -6.884  1.00 71.83  ? 17  ASP B OD2 1 
ATOM   1767  N  N   . VAL B  1 18  ? -47.605  70.175  -9.988  1.00 13.17  ? 18  VAL B N   1 
ATOM   1768  C  CA  . VAL B  1 18  ? -48.084  68.813  -10.133 1.00 17.72  ? 18  VAL B CA  1 
ATOM   1769  C  C   . VAL B  1 18  ? -47.342  68.037  -11.208 1.00 14.18  ? 18  VAL B C   1 
ATOM   1770  O  O   . VAL B  1 18  ? -47.380  68.390  -12.369 1.00 14.45  ? 18  VAL B O   1 
ATOM   1771  C  CB  . VAL B  1 18  ? -49.575  68.780  -10.485 1.00 27.81  ? 18  VAL B CB  1 
ATOM   1772  C  CG1 . VAL B  1 18  ? -50.029  67.354  -10.632 1.00 18.18  ? 18  VAL B CG1 1 
ATOM   1773  C  CG2 . VAL B  1 18  ? -50.393  69.507  -9.428  1.00 27.72  ? 18  VAL B CG2 1 
ATOM   1774  N  N   . ILE B  1 19  ? -46.693  66.958  -10.800 1.00 19.12  ? 19  ILE B N   1 
ATOM   1775  C  CA  . ILE B  1 19  ? -45.945  66.122  -11.707 1.00 24.00  ? 19  ILE B CA  1 
ATOM   1776  C  C   . ILE B  1 19  ? -46.897  65.333  -12.628 1.00 33.20  ? 19  ILE B C   1 
ATOM   1777  O  O   . ILE B  1 19  ? -47.758  64.576  -12.168 1.00 19.39  ? 19  ILE B O   1 
ATOM   1778  C  CB  . ILE B  1 19  ? -45.005  65.185  -10.917 1.00 37.10  ? 19  ILE B CB  1 
ATOM   1779  C  CG1 . ILE B  1 19  ? -44.125  64.357  -11.869 1.00 38.33  ? 19  ILE B CG1 1 
ATOM   1780  C  CG2 . ILE B  1 19  ? -45.826  64.320  -9.947  1.00 14.89  ? 19  ILE B CG2 1 
ATOM   1781  C  CD1 . ILE B  1 19  ? -43.035  63.548  -11.170 1.00 17.33  ? 19  ILE B CD1 1 
ATOM   1782  N  N   . PRO B  1 20  ? -46.741  65.517  -13.944 1.00 28.16  ? 20  PRO B N   1 
ATOM   1783  C  CA  . PRO B  1 20  ? -47.688  64.992  -14.931 1.00 16.87  ? 20  PRO B CA  1 
ATOM   1784  C  C   . PRO B  1 20  ? -47.539  63.483  -15.167 1.00 35.52  ? 20  PRO B C   1 
ATOM   1785  O  O   . PRO B  1 20  ? -47.262  63.070  -16.292 1.00 33.41  ? 20  PRO B O   1 
ATOM   1786  C  CB  . PRO B  1 20  ? -47.311  65.762  -16.202 1.00 23.03  ? 20  PRO B CB  1 
ATOM   1787  C  CG  . PRO B  1 20  ? -45.847  66.010  -16.066 1.00 24.26  ? 20  PRO B CG  1 
ATOM   1788  C  CD  . PRO B  1 20  ? -45.604  66.211  -14.573 1.00 20.15  ? 20  PRO B CD  1 
ATOM   1789  N  N   . THR B  1 21  ? -47.746  62.665  -14.142 1.00 27.11  ? 21  THR B N   1 
ATOM   1790  C  CA  . THR B  1 21  ? -47.572  61.221  -14.309 1.00 30.32  ? 21  THR B CA  1 
ATOM   1791  C  C   . THR B  1 21  ? -48.747  60.528  -14.984 1.00 24.34  ? 21  THR B C   1 
ATOM   1792  O  O   . THR B  1 21  ? -49.892  60.664  -14.558 1.00 37.32  ? 21  THR B O   1 
ATOM   1793  C  CB  . THR B  1 21  ? -47.283  60.501  -12.980 1.00 34.18  ? 21  THR B CB  1 
ATOM   1794  O  OG1 . THR B  1 21  ? -48.336  60.777  -12.052 1.00 18.78  ? 21  THR B OG1 1 
ATOM   1795  C  CG2 . THR B  1 21  ? -45.912  60.926  -12.397 1.00 15.17  ? 21  THR B CG2 1 
ATOM   1796  N  N   . GLN B  1 22  ? -48.428  59.776  -16.039 1.00 61.07  ? 22  GLN B N   1 
ATOM   1797  C  CA  . GLN B  1 22  ? -49.400  58.984  -16.796 1.00 83.32  ? 22  GLN B CA  1 
ATOM   1798  C  C   . GLN B  1 22  ? -49.748  57.685  -16.061 1.00 75.90  ? 22  GLN B C   1 
ATOM   1799  O  O   . GLN B  1 22  ? -49.053  56.673  -16.193 1.00 57.98  ? 22  GLN B O   1 
ATOM   1800  C  CB  . GLN B  1 22  ? -48.874  58.685  -18.214 1.00 103.31 ? 22  GLN B CB  1 
ATOM   1801  C  CG  . GLN B  1 22  ? -49.261  59.732  -19.281 1.00 105.81 ? 22  GLN B CG  1 
ATOM   1802  C  CD  . GLN B  1 22  ? -48.081  60.214  -20.140 1.00 86.13  ? 22  GLN B CD  1 
ATOM   1803  O  OE1 . GLN B  1 22  ? -47.862  61.421  -20.292 1.00 91.06  ? 22  GLN B OE1 1 
ATOM   1804  N  NE2 . GLN B  1 22  ? -47.331  59.273  -20.712 1.00 33.31  ? 22  GLN B NE2 1 
ATOM   1805  N  N   . ARG B  1 23  ? -50.838  57.729  -15.297 1.00 82.08  ? 23  ARG B N   1 
ATOM   1806  C  CA  . ARG B  1 23  ? -51.220  56.631  -14.417 1.00 66.10  ? 23  ARG B CA  1 
ATOM   1807  C  C   . ARG B  1 23  ? -50.149  56.462  -13.348 1.00 69.94  ? 23  ARG B C   1 
ATOM   1808  O  O   . ARG B  1 23  ? -49.570  57.445  -12.883 1.00 66.73  ? 23  ARG B O   1 
ATOM   1809  C  CB  . ARG B  1 23  ? -51.458  55.334  -15.205 1.00 44.77  ? 23  ARG B CB  1 
ATOM   1810  C  CG  . ARG B  1 23  ? -52.683  55.408  -16.121 1.00 53.97  ? 23  ARG B CG  1 
ATOM   1811  C  CD  . ARG B  1 23  ? -52.801  54.215  -17.067 1.00 60.76  ? 23  ARG B CD  1 
ATOM   1812  N  NE  . ARG B  1 23  ? -53.167  52.971  -16.388 1.00 82.29  ? 23  ARG B NE  1 
ATOM   1813  C  CZ  . ARG B  1 23  ? -53.487  51.838  -17.015 1.00 73.89  ? 23  ARG B CZ  1 
ATOM   1814  N  NH1 . ARG B  1 23  ? -53.490  51.794  -18.346 1.00 57.39  ? 23  ARG B NH1 1 
ATOM   1815  N  NH2 . ARG B  1 23  ? -53.813  50.749  -16.314 1.00 55.78  ? 23  ARG B NH2 1 
ATOM   1816  N  N   . ASP B  1 24  ? -49.882  55.223  -12.959 1.00 77.74  ? 24  ASP B N   1 
ATOM   1817  C  CA  . ASP B  1 24  ? -48.926  54.955  -11.888 1.00 86.09  ? 24  ASP B CA  1 
ATOM   1818  C  C   . ASP B  1 24  ? -47.484  55.256  -12.294 1.00 72.75  ? 24  ASP B C   1 
ATOM   1819  O  O   . ASP B  1 24  ? -46.600  55.338  -11.439 1.00 56.28  ? 24  ASP B O   1 
ATOM   1820  C  CB  . ASP B  1 24  ? -49.050  53.499  -11.409 1.00 108.16 ? 24  ASP B CB  1 
ATOM   1821  C  CG  . ASP B  1 24  ? -48.919  52.481  -12.548 1.00 104.32 ? 24  ASP B CG  1 
ATOM   1822  O  OD1 . ASP B  1 24  ? -49.612  52.626  -13.581 1.00 98.61  ? 24  ASP B OD1 1 
ATOM   1823  O  OD2 . ASP B  1 24  ? -48.122  51.529  -12.403 1.00 96.37  ? 24  ASP B OD2 1 
ATOM   1824  N  N   . ARG B  1 25  ? -47.274  55.446  -13.597 1.00 69.94  ? 25  ARG B N   1 
ATOM   1825  C  CA  . ARG B  1 25  ? -45.945  55.457  -14.225 1.00 59.27  ? 25  ARG B CA  1 
ATOM   1826  C  C   . ARG B  1 25  ? -45.128  56.748  -14.072 1.00 41.84  ? 25  ARG B C   1 
ATOM   1827  O  O   . ARG B  1 25  ? -45.668  57.818  -13.780 1.00 25.47  ? 25  ARG B O   1 
ATOM   1828  C  CB  . ARG B  1 25  ? -46.077  55.115  -15.715 1.00 67.58  ? 25  ARG B CB  1 
ATOM   1829  C  CG  . ARG B  1 25  ? -46.475  53.678  -15.990 1.00 68.23  ? 25  ARG B CG  1 
ATOM   1830  C  CD  . ARG B  1 25  ? -45.289  52.748  -15.790 1.00 82.30  ? 25  ARG B CD  1 
ATOM   1831  N  NE  . ARG B  1 25  ? -44.301  52.878  -16.860 1.00 66.41  ? 25  ARG B NE  1 
ATOM   1832  C  CZ  . ARG B  1 25  ? -43.079  52.356  -16.812 1.00 57.33  ? 25  ARG B CZ  1 
ATOM   1833  N  NH1 . ARG B  1 25  ? -42.680  51.677  -15.739 1.00 40.11  ? 25  ARG B NH1 1 
ATOM   1834  N  NH2 . ARG B  1 25  ? -42.251  52.522  -17.834 1.00 61.47  ? 25  ARG B NH2 1 
ATOM   1835  N  N   . PRO B  1 26  ? -43.809  56.649  -14.283 1.00 31.73  ? 26  PRO B N   1 
ATOM   1836  C  CA  . PRO B  1 26  ? -42.980  57.833  -14.064 1.00 23.97  ? 26  PRO B CA  1 
ATOM   1837  C  C   . PRO B  1 26  ? -42.909  58.720  -15.282 1.00 14.80  ? 26  PRO B C   1 
ATOM   1838  O  O   . PRO B  1 26  ? -42.981  58.210  -16.390 1.00 22.88  ? 26  PRO B O   1 
ATOM   1839  C  CB  . PRO B  1 26  ? -41.601  57.235  -13.786 1.00 26.59  ? 26  PRO B CB  1 
ATOM   1840  C  CG  . PRO B  1 26  ? -41.602  55.959  -14.515 1.00 17.41  ? 26  PRO B CG  1 
ATOM   1841  C  CD  . PRO B  1 26  ? -42.997  55.428  -14.414 1.00 22.50  ? 26  PRO B CD  1 
ATOM   1842  N  N   . VAL B  1 27  ? -42.781  60.026  -15.070 1.00 19.70  ? 27  VAL B N   1 
ATOM   1843  C  CA  . VAL B  1 27  ? -42.473  60.955  -16.147 1.00 15.94  ? 27  VAL B CA  1 
ATOM   1844  C  C   . VAL B  1 27  ? -41.040  60.715  -16.649 1.00 28.34  ? 27  VAL B C   1 
ATOM   1845  O  O   . VAL B  1 27  ? -40.066  60.783  -15.879 1.00 15.91  ? 27  VAL B O   1 
ATOM   1846  C  CB  . VAL B  1 27  ? -42.560  62.404  -15.670 1.00 26.73  ? 27  VAL B CB  1 
ATOM   1847  C  CG1 . VAL B  1 27  ? -42.304  63.363  -16.832 1.00 12.93  ? 27  VAL B CG1 1 
ATOM   1848  C  CG2 . VAL B  1 27  ? -43.903  62.665  -15.034 1.00 38.67  ? 27  VAL B CG2 1 
ATOM   1849  N  N   . ALA B  1 28  ? -40.914  60.439  -17.941 1.00 19.74  ? 28  ALA B N   1 
ATOM   1850  C  CA  . ALA B  1 28  ? -39.613  60.204  -18.535 1.00 16.77  ? 28  ALA B CA  1 
ATOM   1851  C  C   . ALA B  1 28  ? -38.961  61.525  -18.893 1.00 16.25  ? 28  ALA B C   1 
ATOM   1852  O  O   . ALA B  1 28  ? -39.393  62.193  -19.816 1.00 19.76  ? 28  ALA B O   1 
ATOM   1853  C  CB  . ALA B  1 28  ? -39.735  59.328  -19.748 1.00 15.04  ? 28  ALA B CB  1 
ATOM   1854  N  N   . VAL B  1 29  ? -37.921  61.887  -18.142 1.00 21.68  ? 29  VAL B N   1 
ATOM   1855  C  CA  . VAL B  1 29  ? -37.151  63.098  -18.388 1.00 17.55  ? 29  VAL B CA  1 
ATOM   1856  C  C   . VAL B  1 29  ? -35.863  62.767  -19.132 1.00 13.93  ? 29  VAL B C   1 
ATOM   1857  O  O   . VAL B  1 29  ? -35.131  61.870  -18.742 1.00 32.70  ? 29  VAL B O   1 
ATOM   1858  C  CB  . VAL B  1 29  ? -36.792  63.840  -17.080 1.00 13.36  ? 29  VAL B CB  1 
ATOM   1859  C  CG1 . VAL B  1 29  ? -36.115  65.151  -17.406 1.00 12.83  ? 29  VAL B CG1 1 
ATOM   1860  C  CG2 . VAL B  1 29  ? -38.034  64.095  -16.239 1.00 13.06  ? 29  VAL B CG2 1 
ATOM   1861  N  N   . SER B  1 30  ? -35.598  63.489  -20.212 1.00 23.37  ? 30  SER B N   1 
ATOM   1862  C  CA  . SER B  1 30  ? -34.330  63.366  -20.920 1.00 22.97  ? 30  SER B CA  1 
ATOM   1863  C  C   . SER B  1 30  ? -33.413  64.536  -20.564 1.00 33.31  ? 30  SER B C   1 
ATOM   1864  O  O   . SER B  1 30  ? -33.844  65.694  -20.575 1.00 37.39  ? 30  SER B O   1 
ATOM   1865  C  CB  . SER B  1 30  ? -34.549  63.300  -22.437 1.00 21.58  ? 30  SER B CB  1 
ATOM   1866  O  OG  . SER B  1 30  ? -34.887  61.985  -22.851 1.00 43.09  ? 30  SER B OG  1 
ATOM   1867  N  N   . VAL B  1 31  ? -32.160  64.225  -20.227 1.00 29.68  ? 31  VAL B N   1 
ATOM   1868  C  CA  . VAL B  1 31  ? -31.185  65.256  -19.870 1.00 32.84  ? 31  VAL B CA  1 
ATOM   1869  C  C   . VAL B  1 31  ? -29.904  65.066  -20.653 1.00 33.29  ? 31  VAL B C   1 
ATOM   1870  O  O   . VAL B  1 31  ? -29.419  63.946  -20.823 1.00 32.87  ? 31  VAL B O   1 
ATOM   1871  C  CB  . VAL B  1 31  ? -30.814  65.251  -18.376 1.00 29.31  ? 31  VAL B CB  1 
ATOM   1872  C  CG1 . VAL B  1 31  ? -30.245  66.597  -17.991 1.00 23.51  ? 31  VAL B CG1 1 
ATOM   1873  C  CG2 . VAL B  1 31  ? -32.020  64.946  -17.535 1.00 31.18  ? 31  VAL B CG2 1 
ATOM   1874  N  N   . SER B  1 32  ? -29.360  66.179  -21.119 1.00 32.76  ? 32  SER B N   1 
ATOM   1875  C  CA  . SER B  1 32  ? -28.164  66.165  -21.934 1.00 33.94  ? 32  SER B CA  1 
ATOM   1876  C  C   . SER B  1 32  ? -27.479  67.504  -21.741 1.00 34.73  ? 32  SER B C   1 
ATOM   1877  O  O   . SER B  1 32  ? -28.122  68.547  -21.801 1.00 41.69  ? 32  SER B O   1 
ATOM   1878  C  CB  . SER B  1 32  ? -28.525  65.949  -23.404 1.00 37.34  ? 32  SER B CB  1 
ATOM   1879  O  OG  . SER B  1 32  ? -27.373  65.981  -24.229 1.00 60.13  ? 32  SER B OG  1 
ATOM   1880  N  N   . LEU B  1 33  ? -26.178  67.473  -21.481 1.00 26.75  ? 33  LEU B N   1 
ATOM   1881  C  CA  . LEU B  1 33  ? -25.428  68.704  -21.317 1.00 18.53  ? 33  LEU B CA  1 
ATOM   1882  C  C   . LEU B  1 33  ? -24.680  69.032  -22.593 1.00 28.76  ? 33  LEU B C   1 
ATOM   1883  O  O   . LEU B  1 33  ? -23.923  68.202  -23.100 1.00 35.62  ? 33  LEU B O   1 
ATOM   1884  C  CB  . LEU B  1 33  ? -24.450  68.595  -20.149 1.00 17.42  ? 33  LEU B CB  1 
ATOM   1885  C  CG  . LEU B  1 33  ? -25.083  68.291  -18.794 1.00 25.38  ? 33  LEU B CG  1 
ATOM   1886  C  CD1 . LEU B  1 33  ? -24.060  68.452  -17.686 1.00 16.89  ? 33  LEU B CD1 1 
ATOM   1887  C  CD2 . LEU B  1 33  ? -26.257  69.194  -18.556 1.00 14.68  ? 33  LEU B CD2 1 
ATOM   1888  N  N   . LYS B  1 34  ? -24.912  70.227  -23.125 1.00 23.84  ? 34  LYS B N   1 
ATOM   1889  C  CA  . LYS B  1 34  ? -24.148  70.718  -24.265 1.00 21.34  ? 34  LYS B CA  1 
ATOM   1890  C  C   . LYS B  1 34  ? -23.137  71.745  -23.752 1.00 28.77  ? 34  LYS B C   1 
ATOM   1891  O  O   . LYS B  1 34  ? -23.510  72.874  -23.447 1.00 35.22  ? 34  LYS B O   1 
ATOM   1892  C  CB  . LYS B  1 34  ? -25.070  71.375  -25.282 1.00 19.98  ? 34  LYS B CB  1 
ATOM   1893  C  CG  . LYS B  1 34  ? -26.356  70.610  -25.570 1.00 36.77  ? 34  LYS B CG  1 
ATOM   1894  C  CD  . LYS B  1 34  ? -26.121  69.351  -26.390 1.00 47.36  ? 34  LYS B CD  1 
ATOM   1895  C  CE  . LYS B  1 34  ? -27.443  68.742  -26.827 1.00 52.30  ? 34  LYS B CE  1 
ATOM   1896  N  NZ  . LYS B  1 34  ? -27.274  67.409  -27.464 1.00 60.37  ? 34  LYS B NZ  1 
ATOM   1897  N  N   . PHE B  1 35  ? -21.867  71.357  -23.646 1.00 28.27  ? 35  PHE B N   1 
ATOM   1898  C  CA  . PHE B  1 35  ? -20.855  72.230  -23.047 1.00 23.66  ? 35  PHE B CA  1 
ATOM   1899  C  C   . PHE B  1 35  ? -20.482  73.388  -23.952 1.00 26.92  ? 35  PHE B C   1 
ATOM   1900  O  O   . PHE B  1 35  ? -20.277  73.207  -25.154 1.00 23.59  ? 35  PHE B O   1 
ATOM   1901  C  CB  . PHE B  1 35  ? -19.615  71.437  -22.655 1.00 20.30  ? 35  PHE B CB  1 
ATOM   1902  C  CG  . PHE B  1 35  ? -19.849  70.501  -21.510 1.00 33.69  ? 35  PHE B CG  1 
ATOM   1903  C  CD1 . PHE B  1 35  ? -19.823  70.968  -20.204 1.00 17.08  ? 35  PHE B CD1 1 
ATOM   1904  C  CD2 . PHE B  1 35  ? -20.106  69.160  -21.736 1.00 20.84  ? 35  PHE B CD2 1 
ATOM   1905  C  CE1 . PHE B  1 35  ? -20.051  70.110  -19.149 1.00 29.75  ? 35  PHE B CE1 1 
ATOM   1906  C  CE2 . PHE B  1 35  ? -20.335  68.302  -20.681 1.00 24.26  ? 35  PHE B CE2 1 
ATOM   1907  C  CZ  . PHE B  1 35  ? -20.308  68.778  -19.389 1.00 22.96  ? 35  PHE B CZ  1 
ATOM   1908  N  N   . ILE B  1 36  ? -20.413  74.578  -23.362 1.00 17.49  ? 36  ILE B N   1 
ATOM   1909  C  CA  . ILE B  1 36  ? -20.188  75.804  -24.112 1.00 25.96  ? 36  ILE B CA  1 
ATOM   1910  C  C   . ILE B  1 36  ? -18.828  76.392  -23.782 1.00 30.64  ? 36  ILE B C   1 
ATOM   1911  O  O   . ILE B  1 36  ? -18.155  76.950  -24.646 1.00 27.07  ? 36  ILE B O   1 
ATOM   1912  C  CB  . ILE B  1 36  ? -21.258  76.854  -23.795 1.00 25.07  ? 36  ILE B CB  1 
ATOM   1913  C  CG1 . ILE B  1 36  ? -22.653  76.251  -23.937 1.00 17.34  ? 36  ILE B CG1 1 
ATOM   1914  C  CG2 . ILE B  1 36  ? -21.121  78.057  -24.717 1.00 12.82  ? 36  ILE B CG2 1 
ATOM   1915  C  CD1 . ILE B  1 36  ? -22.921  75.709  -25.302 1.00 21.21  ? 36  ILE B CD1 1 
ATOM   1916  N  N   . ASN B  1 37  ? -18.419  76.247  -22.528 1.00 18.34  ? 37  ASN B N   1 
ATOM   1917  C  CA  . ASN B  1 37  ? -17.176  76.839  -22.072 1.00 19.21  ? 37  ASN B CA  1 
ATOM   1918  C  C   . ASN B  1 37  ? -16.691  76.263  -20.739 1.00 28.90  ? 37  ASN B C   1 
ATOM   1919  O  O   . ASN B  1 37  ? -17.479  75.794  -19.922 1.00 28.51  ? 37  ASN B O   1 
ATOM   1920  C  CB  . ASN B  1 37  ? -17.322  78.360  -21.968 1.00 15.95  ? 37  ASN B CB  1 
ATOM   1921  C  CG  . ASN B  1 37  ? -16.061  79.086  -22.364 1.00 35.39  ? 37  ASN B CG  1 
ATOM   1922  O  OD1 . ASN B  1 37  ? -14.945  78.605  -22.110 1.00 17.98  ? 37  ASN B OD1 1 
ATOM   1923  N  ND2 . ASN B  1 37  ? -16.223  80.244  -23.004 1.00 31.38  ? 37  ASN B ND2 1 
ATOM   1924  N  N   . ILE B  1 38  ? -15.379  76.288  -20.539 1.00 31.14  ? 38  ILE B N   1 
ATOM   1925  C  CA  . ILE B  1 38  ? -14.787  75.958  -19.256 1.00 20.11  ? 38  ILE B CA  1 
ATOM   1926  C  C   . ILE B  1 38  ? -13.952  77.168  -18.862 1.00 32.37  ? 38  ILE B C   1 
ATOM   1927  O  O   . ILE B  1 38  ? -13.059  77.572  -19.606 1.00 35.56  ? 38  ILE B O   1 
ATOM   1928  C  CB  . ILE B  1 38  ? -13.934  74.697  -19.349 1.00 22.34  ? 38  ILE B CB  1 
ATOM   1929  C  CG1 . ILE B  1 38  ? -14.795  73.548  -19.879 1.00 22.37  ? 38  ILE B CG1 1 
ATOM   1930  C  CG2 . ILE B  1 38  ? -13.323  74.358  -17.991 1.00 21.39  ? 38  ILE B CG2 1 
ATOM   1931  C  CD1 . ILE B  1 38  ? -14.046  72.236  -20.047 1.00 24.43  ? 38  ILE B CD1 1 
ATOM   1932  N  N   . LEU B  1 39  ? -14.260  77.757  -17.708 1.00 29.74  ? 39  LEU B N   1 
ATOM   1933  C  CA  . LEU B  1 39  ? -13.830  79.125  -17.419 1.00 31.61  ? 39  LEU B CA  1 
ATOM   1934  C  C   . LEU B  1 39  ? -12.698  79.208  -16.408 1.00 46.15  ? 39  LEU B C   1 
ATOM   1935  O  O   . LEU B  1 39  ? -11.789  80.040  -16.510 1.00 58.55  ? 39  LEU B O   1 
ATOM   1936  C  CB  . LEU B  1 39  ? -15.019  79.953  -16.929 1.00 26.17  ? 39  LEU B CB  1 
ATOM   1937  C  CG  . LEU B  1 39  ? -16.137  80.109  -17.960 1.00 30.71  ? 39  LEU B CG  1 
ATOM   1938  C  CD1 . LEU B  1 39  ? -17.236  80.996  -17.417 1.00 34.44  ? 39  LEU B CD1 1 
ATOM   1939  C  CD2 . LEU B  1 39  ? -15.557  80.676  -19.238 1.00 31.17  ? 39  LEU B CD2 1 
ATOM   1940  N  N   . GLU B  1 40  ? -12.753  78.325  -15.435 1.00 35.19  ? 40  GLU B N   1 
ATOM   1941  C  CA  . GLU B  1 40  ? -11.802  78.368  -14.360 1.00 34.96  ? 40  GLU B CA  1 
ATOM   1942  C  C   . GLU B  1 40  ? -11.668  76.964  -13.815 1.00 34.01  ? 40  GLU B C   1 
ATOM   1943  O  O   . GLU B  1 40  ? -12.654  76.270  -13.586 1.00 44.54  ? 40  GLU B O   1 
ATOM   1944  C  CB  . GLU B  1 40  ? -12.304  79.336  -13.295 1.00 63.96  ? 40  GLU B CB  1 
ATOM   1945  C  CG  . GLU B  1 40  ? -11.450  79.443  -12.059 1.00 77.60  ? 40  GLU B CG  1 
ATOM   1946  C  CD  . GLU B  1 40  ? -11.832  80.652  -11.228 1.00 86.91  ? 40  GLU B CD  1 
ATOM   1947  O  OE1 . GLU B  1 40  ? -12.551  81.538  -11.763 1.00 64.52  ? 40  GLU B OE1 1 
ATOM   1948  O  OE2 . GLU B  1 40  ? -11.416  80.714  -10.047 1.00 90.91  ? 40  GLU B OE2 1 
ATOM   1949  N  N   . VAL B  1 41  ? -10.429  76.536  -13.652 1.00 44.23  ? 41  VAL B N   1 
ATOM   1950  C  CA  . VAL B  1 41  ? -10.140  75.214  -13.141 1.00 34.30  ? 41  VAL B CA  1 
ATOM   1951  C  C   . VAL B  1 41  ? -9.165   75.371  -11.987 1.00 36.38  ? 41  VAL B C   1 
ATOM   1952  O  O   . VAL B  1 41  ? -8.337   76.279  -11.998 1.00 28.56  ? 41  VAL B O   1 
ATOM   1953  C  CB  . VAL B  1 41  ? -9.507   74.352  -14.228 1.00 34.35  ? 41  VAL B CB  1 
ATOM   1954  C  CG1 . VAL B  1 41  ? -8.847   73.151  -13.619 1.00 42.31  ? 41  VAL B CG1 1 
ATOM   1955  C  CG2 . VAL B  1 41  ? -10.543  73.942  -15.263 1.00 30.72  ? 41  VAL B CG2 1 
ATOM   1956  N  N   . ASN B  1 42  ? -9.282   74.512  -10.978 1.00 33.83  ? 42  ASN B N   1 
ATOM   1957  C  CA  . ASN B  1 42  ? -8.348   74.537  -9.861  1.00 20.85  ? 42  ASN B CA  1 
ATOM   1958  C  C   . ASN B  1 42  ? -7.959   73.121  -9.467  1.00 36.45  ? 42  ASN B C   1 
ATOM   1959  O  O   . ASN B  1 42  ? -8.748   72.401  -8.846  1.00 40.39  ? 42  ASN B O   1 
ATOM   1960  C  CB  . ASN B  1 42  ? -8.963   75.255  -8.669  1.00 24.16  ? 42  ASN B CB  1 
ATOM   1961  C  CG  . ASN B  1 42  ? -7.963   75.501  -7.559  1.00 38.30  ? 42  ASN B CG  1 
ATOM   1962  O  OD1 . ASN B  1 42  ? -7.107   74.657  -7.262  1.00 43.18  ? 42  ASN B OD1 1 
ATOM   1963  N  ND2 . ASN B  1 42  ? -8.060   76.671  -6.942  1.00 26.32  ? 42  ASN B ND2 1 
ATOM   1964  N  N   . GLU B  1 43  ? -6.742   72.717  -9.830  1.00 32.84  ? 43  GLU B N   1 
ATOM   1965  C  CA  . GLU B  1 43  ? -6.341   71.328  -9.643  1.00 38.25  ? 43  GLU B CA  1 
ATOM   1966  C  C   . GLU B  1 43  ? -6.043   71.036  -8.180  1.00 39.69  ? 43  GLU B C   1 
ATOM   1967  O  O   . GLU B  1 43  ? -6.072   69.875  -7.752  1.00 37.53  ? 43  GLU B O   1 
ATOM   1968  C  CB  . GLU B  1 43  ? -5.141   70.975  -10.518 1.00 40.16  ? 43  GLU B CB  1 
ATOM   1969  C  CG  . GLU B  1 43  ? -4.886   69.470  -10.621 1.00 45.03  ? 43  GLU B CG  1 
ATOM   1970  C  CD  . GLU B  1 43  ? -3.867   69.111  -11.699 1.00 49.94  ? 43  GLU B CD  1 
ATOM   1971  O  OE1 . GLU B  1 43  ? -3.409   70.028  -12.416 1.00 49.77  ? 43  GLU B OE1 1 
ATOM   1972  O  OE2 . GLU B  1 43  ? -3.526   67.913  -11.834 1.00 43.57  ? 43  GLU B OE2 1 
ATOM   1973  N  N   . ILE B  1 44  ? -5.753   72.093  -7.421  1.00 28.91  ? 44  ILE B N   1 
ATOM   1974  C  CA  . ILE B  1 44  ? -5.581   71.971  -5.982  1.00 33.44  ? 44  ILE B CA  1 
ATOM   1975  C  C   . ILE B  1 44  ? -6.907   71.705  -5.258  1.00 31.60  ? 44  ILE B C   1 
ATOM   1976  O  O   . ILE B  1 44  ? -7.047   70.720  -4.543  1.00 33.14  ? 44  ILE B O   1 
ATOM   1977  C  CB  . ILE B  1 44  ? -4.963   73.231  -5.379  1.00 47.23  ? 44  ILE B CB  1 
ATOM   1978  C  CG1 . ILE B  1 44  ? -3.684   73.624  -6.136  1.00 53.39  ? 44  ILE B CG1 1 
ATOM   1979  C  CG2 . ILE B  1 44  ? -4.722   73.025  -3.869  1.00 35.02  ? 44  ILE B CG2 1 
ATOM   1980  C  CD1 . ILE B  1 44  ? -2.493   72.632  -5.997  1.00 36.96  ? 44  ILE B CD1 1 
ATOM   1981  N  N   . THR B  1 45  ? -7.874   72.593  -5.438  1.00 32.74  ? 45  THR B N   1 
ATOM   1982  C  CA  . THR B  1 45  ? -9.182   72.453  -4.784  1.00 32.97  ? 45  THR B CA  1 
ATOM   1983  C  C   . THR B  1 45  ? -10.128  71.450  -5.454  1.00 24.70  ? 45  THR B C   1 
ATOM   1984  O  O   . THR B  1 45  ? -11.141  71.082  -4.879  1.00 42.29  ? 45  THR B O   1 
ATOM   1985  C  CB  . THR B  1 45  ? -9.927   73.802  -4.699  1.00 27.38  ? 45  THR B CB  1 
ATOM   1986  O  OG1 . THR B  1 45  ? -10.278  74.247  -6.017  1.00 23.49  ? 45  THR B OG1 1 
ATOM   1987  C  CG2 . THR B  1 45  ? -9.067   74.847  -4.006  1.00 20.94  ? 45  THR B CG2 1 
ATOM   1988  N  N   . ASN B  1 46  ? -9.801   71.014  -6.662  1.00 27.59  ? 46  ASN B N   1 
ATOM   1989  C  CA  . ASN B  1 46  ? -10.665  70.110  -7.403  1.00 19.26  ? 46  ASN B CA  1 
ATOM   1990  C  C   . ASN B  1 46  ? -12.021  70.755  -7.643  1.00 27.40  ? 46  ASN B C   1 
ATOM   1991  O  O   . ASN B  1 46  ? -13.074  70.180  -7.340  1.00 33.43  ? 46  ASN B O   1 
ATOM   1992  C  CB  . ASN B  1 46  ? -10.825  68.780  -6.674  1.00 14.07  ? 46  ASN B CB  1 
ATOM   1993  C  CG  . ASN B  1 46  ? -9.957   67.688  -7.254  1.00 32.88  ? 46  ASN B CG  1 
ATOM   1994  O  OD1 . ASN B  1 46  ? -9.522   67.749  -8.418  1.00 35.43  ? 46  ASN B OD1 1 
ATOM   1995  N  ND2 . ASN B  1 46  ? -9.702   66.669  -6.450  1.00 22.69  ? 46  ASN B ND2 1 
ATOM   1996  N  N   . GLU B  1 47  ? -11.984  71.973  -8.165  1.00 25.03  ? 47  GLU B N   1 
ATOM   1997  C  CA  . GLU B  1 47  ? -13.198  72.712  -8.479  1.00 33.89  ? 47  GLU B CA  1 
ATOM   1998  C  C   . GLU B  1 47  ? -13.091  73.290  -9.893  1.00 33.11  ? 47  GLU B C   1 
ATOM   1999  O  O   . GLU B  1 47  ? -12.037  73.795  -10.293 1.00 35.55  ? 47  GLU B O   1 
ATOM   2000  C  CB  . GLU B  1 47  ? -13.458  73.811  -7.445  1.00 11.91  ? 47  GLU B CB  1 
ATOM   2001  C  CG  . GLU B  1 47  ? -13.569  73.292  -6.024  1.00 15.92  ? 47  GLU B CG  1 
ATOM   2002  C  CD  . GLU B  1 47  ? -13.622  74.409  -4.979  1.00 30.52  ? 47  GLU B CD  1 
ATOM   2003  O  OE1 . GLU B  1 47  ? -13.958  75.565  -5.331  1.00 19.79  ? 47  GLU B OE1 1 
ATOM   2004  O  OE2 . GLU B  1 47  ? -13.323  74.132  -3.794  1.00 39.28  ? 47  GLU B OE2 1 
ATOM   2005  N  N   . VAL B  1 48  ? -14.181  73.182  -10.650 1.00 30.50  ? 48  VAL B N   1 
ATOM   2006  C  CA  . VAL B  1 48  ? -14.247  73.723  -11.997 1.00 29.12  ? 48  VAL B CA  1 
ATOM   2007  C  C   . VAL B  1 48  ? -15.437  74.657  -12.164 1.00 27.10  ? 48  VAL B C   1 
ATOM   2008  O  O   . VAL B  1 48  ? -16.488  74.468  -11.561 1.00 26.86  ? 48  VAL B O   1 
ATOM   2009  C  CB  . VAL B  1 48  ? -14.348  72.604  -13.056 1.00 23.74  ? 48  VAL B CB  1 
ATOM   2010  C  CG1 . VAL B  1 48  ? -13.090  71.772  -13.048 1.00 39.65  ? 48  VAL B CG1 1 
ATOM   2011  C  CG2 . VAL B  1 48  ? -15.553  71.738  -12.785 1.00 19.11  ? 48  VAL B CG2 1 
ATOM   2012  N  N   . ASP B  1 49  ? -15.259  75.668  -12.999 1.00 32.50  ? 49  ASP B N   1 
ATOM   2013  C  CA  . ASP B  1 49  ? -16.329  76.590  -13.319 1.00 28.33  ? 49  ASP B CA  1 
ATOM   2014  C  C   . ASP B  1 49  ? -16.724  76.336  -14.771 1.00 30.22  ? 49  ASP B C   1 
ATOM   2015  O  O   . ASP B  1 49  ? -15.913  76.521  -15.686 1.00 44.83  ? 49  ASP B O   1 
ATOM   2016  C  CB  . ASP B  1 49  ? -15.835  78.019  -13.130 1.00 35.41  ? 49  ASP B CB  1 
ATOM   2017  C  CG  . ASP B  1 49  ? -16.956  78.995  -12.941 1.00 36.39  ? 49  ASP B CG  1 
ATOM   2018  O  OD1 . ASP B  1 49  ? -17.971  78.866  -13.649 1.00 47.91  ? 49  ASP B OD1 1 
ATOM   2019  O  OD2 . ASP B  1 49  ? -16.825  79.891  -12.086 1.00 43.32  ? 49  ASP B OD2 1 
ATOM   2020  N  N   . VAL B  1 50  ? -17.960  75.891  -14.977 1.00 15.26  ? 50  VAL B N   1 
ATOM   2021  C  CA  . VAL B  1 50  ? -18.419  75.437  -16.291 1.00 27.58  ? 50  VAL B CA  1 
ATOM   2022  C  C   . VAL B  1 50  ? -19.655  76.182  -16.790 1.00 29.61  ? 50  VAL B C   1 
ATOM   2023  O  O   . VAL B  1 50  ? -20.490  76.615  -16.001 1.00 35.00  ? 50  VAL B O   1 
ATOM   2024  C  CB  . VAL B  1 50  ? -18.704  73.921  -16.284 1.00 13.07  ? 50  VAL B CB  1 
ATOM   2025  C  CG1 . VAL B  1 50  ? -19.243  73.478  -17.612 1.00 29.65  ? 50  VAL B CG1 1 
ATOM   2026  C  CG2 . VAL B  1 50  ? -17.420  73.167  -15.971 1.00 25.12  ? 50  VAL B CG2 1 
ATOM   2027  N  N   . VAL B  1 51  ? -19.753  76.344  -18.106 1.00 12.06  ? 51  VAL B N   1 
ATOM   2028  C  CA  . VAL B  1 51  ? -20.950  76.881  -18.734 1.00 21.09  ? 51  VAL B CA  1 
ATOM   2029  C  C   . VAL B  1 51  ? -21.489  75.861  -19.729 1.00 23.40  ? 51  VAL B C   1 
ATOM   2030  O  O   . VAL B  1 51  ? -20.773  75.416  -20.606 1.00 28.80  ? 51  VAL B O   1 
ATOM   2031  C  CB  . VAL B  1 51  ? -20.671  78.209  -19.457 1.00 14.73  ? 51  VAL B CB  1 
ATOM   2032  C  CG1 . VAL B  1 51  ? -21.813  78.546  -20.375 1.00 8.08   ? 51  VAL B CG1 1 
ATOM   2033  C  CG2 . VAL B  1 51  ? -20.456  79.319  -18.441 1.00 21.75  ? 51  VAL B CG2 1 
ATOM   2034  N  N   . PHE B  1 52  ? -22.750  75.480  -19.585 1.00 24.67  ? 52  PHE B N   1 
ATOM   2035  C  CA  . PHE B  1 52  ? -23.323  74.438  -20.433 1.00 23.62  ? 52  PHE B CA  1 
ATOM   2036  C  C   . PHE B  1 52  ? -24.805  74.703  -20.675 1.00 18.65  ? 52  PHE B C   1 
ATOM   2037  O  O   . PHE B  1 52  ? -25.462  75.322  -19.850 1.00 22.07  ? 52  PHE B O   1 
ATOM   2038  C  CB  . PHE B  1 52  ? -23.167  73.074  -19.764 1.00 19.78  ? 52  PHE B CB  1 
ATOM   2039  C  CG  . PHE B  1 52  ? -23.727  73.026  -18.375 1.00 20.89  ? 52  PHE B CG  1 
ATOM   2040  C  CD1 . PHE B  1 52  ? -22.961  73.450  -17.297 1.00 13.95  ? 52  PHE B CD1 1 
ATOM   2041  C  CD2 . PHE B  1 52  ? -25.025  72.576  -18.142 1.00 29.22  ? 52  PHE B CD2 1 
ATOM   2042  C  CE1 . PHE B  1 52  ? -23.488  73.424  -15.996 1.00 40.26  ? 52  PHE B CE1 1 
ATOM   2043  C  CE2 . PHE B  1 52  ? -25.560  72.546  -16.844 1.00 22.58  ? 52  PHE B CE2 1 
ATOM   2044  C  CZ  . PHE B  1 52  ? -24.797  72.970  -15.775 1.00 29.68  ? 52  PHE B CZ  1 
ATOM   2045  N  N   . TRP B  1 53  ? -25.311  74.256  -21.818 1.00 6.42   ? 53  TRP B N   1 
ATOM   2046  C  CA  . TRP B  1 53  ? -26.737  74.267  -22.075 1.00 19.97  ? 53  TRP B CA  1 
ATOM   2047  C  C   . TRP B  1 53  ? -27.256  73.006  -21.443 1.00 28.18  ? 53  TRP B C   1 
ATOM   2048  O  O   . TRP B  1 53  ? -26.729  71.915  -21.726 1.00 21.17  ? 53  TRP B O   1 
ATOM   2049  C  CB  . TRP B  1 53  ? -27.028  74.211  -23.567 1.00 13.47  ? 53  TRP B CB  1 
ATOM   2050  C  CG  . TRP B  1 53  ? -26.634  75.436  -24.314 1.00 17.88  ? 53  TRP B CG  1 
ATOM   2051  C  CD1 . TRP B  1 53  ? -26.101  76.573  -23.805 1.00 20.43  ? 53  TRP B CD1 1 
ATOM   2052  C  CD2 . TRP B  1 53  ? -26.768  75.648  -25.720 1.00 18.59  ? 53  TRP B CD2 1 
ATOM   2053  N  NE1 . TRP B  1 53  ? -25.882  77.484  -24.806 1.00 25.12  ? 53  TRP B NE1 1 
ATOM   2054  C  CE2 . TRP B  1 53  ? -26.284  76.937  -25.993 1.00 9.54   ? 53  TRP B CE2 1 
ATOM   2055  C  CE3 . TRP B  1 53  ? -27.245  74.866  -26.774 1.00 13.13  ? 53  TRP B CE3 1 
ATOM   2056  C  CZ2 . TRP B  1 53  ? -26.257  77.463  -27.274 1.00 21.41  ? 53  TRP B CZ2 1 
ATOM   2057  C  CZ3 . TRP B  1 53  ? -27.217  75.382  -28.042 1.00 24.51  ? 53  TRP B CZ3 1 
ATOM   2058  C  CH2 . TRP B  1 53  ? -26.724  76.674  -28.287 1.00 30.51  ? 53  TRP B CH2 1 
ATOM   2059  N  N   . GLN B  1 54  ? -28.262  73.142  -20.580 1.00 11.63  ? 54  GLN B N   1 
ATOM   2060  C  CA  . GLN B  1 54  ? -28.862  71.963  -19.979 1.00 16.72  ? 54  GLN B CA  1 
ATOM   2061  C  C   . GLN B  1 54  ? -30.151  71.597  -20.731 1.00 24.31  ? 54  GLN B C   1 
ATOM   2062  O  O   . GLN B  1 54  ? -31.232  72.131  -20.476 1.00 32.41  ? 54  GLN B O   1 
ATOM   2063  C  CB  . GLN B  1 54  ? -29.094  72.169  -18.484 1.00 19.62  ? 54  GLN B CB  1 
ATOM   2064  C  CG  . GLN B  1 54  ? -29.563  70.922  -17.761 1.00 20.21  ? 54  GLN B CG  1 
ATOM   2065  C  CD  . GLN B  1 54  ? -29.616  71.110  -16.255 1.00 29.12  ? 54  GLN B CD  1 
ATOM   2066  O  OE1 . GLN B  1 54  ? -28.596  71.343  -15.602 1.00 33.04  ? 54  GLN B OE1 1 
ATOM   2067  N  NE2 . GLN B  1 54  ? -30.817  71.015  -15.697 1.00 51.19  ? 54  GLN B NE2 1 
ATOM   2068  N  N   . GLN B  1 55  ? -30.013  70.679  -21.673 1.00 15.06  ? 55  GLN B N   1 
ATOM   2069  C  CA  . GLN B  1 55  ? -31.106  70.266  -22.526 1.00 11.49  ? 55  GLN B CA  1 
ATOM   2070  C  C   . GLN B  1 55  ? -31.978  69.274  -21.775 1.00 18.28  ? 55  GLN B C   1 
ATOM   2071  O  O   . GLN B  1 55  ? -31.548  68.177  -21.437 1.00 18.78  ? 55  GLN B O   1 
ATOM   2072  C  CB  . GLN B  1 55  ? -30.552  69.629  -23.794 1.00 16.04  ? 55  GLN B CB  1 
ATOM   2073  C  CG  . GLN B  1 55  ? -31.562  69.403  -24.841 1.00 17.69  ? 55  GLN B CG  1 
ATOM   2074  C  CD  . GLN B  1 55  ? -31.082  68.450  -25.883 1.00 29.63  ? 55  GLN B CD  1 
ATOM   2075  O  OE1 . GLN B  1 55  ? -30.778  68.848  -27.003 1.00 32.87  ? 55  GLN B OE1 1 
ATOM   2076  N  NE2 . GLN B  1 55  ? -31.009  67.175  -25.527 1.00 39.99  ? 55  GLN B NE2 1 
ATOM   2077  N  N   . THR B  1 56  ? -33.214  69.678  -21.516 1.00 24.60  ? 56  THR B N   1 
ATOM   2078  C  CA  . THR B  1 56  ? -34.147  68.874  -20.739 1.00 21.09  ? 56  THR B CA  1 
ATOM   2079  C  C   . THR B  1 56  ? -35.448  68.639  -21.518 1.00 21.28  ? 56  THR B C   1 
ATOM   2080  O  O   . THR B  1 56  ? -36.024  69.552  -22.108 1.00 15.73  ? 56  THR B O   1 
ATOM   2081  C  CB  . THR B  1 56  ? -34.439  69.549  -19.405 1.00 18.96  ? 56  THR B CB  1 
ATOM   2082  O  OG1 . THR B  1 56  ? -33.207  70.033  -18.859 1.00 26.62  ? 56  THR B OG1 1 
ATOM   2083  C  CG2 . THR B  1 56  ? -35.089  68.578  -18.432 1.00 12.95  ? 56  THR B CG2 1 
ATOM   2084  N  N   . THR B  1 57  ? -35.915  67.402  -21.505 1.00 22.99  ? 57  THR B N   1 
ATOM   2085  C  CA  . THR B  1 57  ? -37.037  67.018  -22.338 1.00 10.34  ? 57  THR B CA  1 
ATOM   2086  C  C   . THR B  1 57  ? -37.998  66.117  -21.581 1.00 26.41  ? 57  THR B C   1 
ATOM   2087  O  O   . THR B  1 57  ? -37.571  65.154  -20.934 1.00 24.65  ? 57  THR B O   1 
ATOM   2088  C  CB  . THR B  1 57  ? -36.522  66.319  -23.607 1.00 16.62  ? 57  THR B CB  1 
ATOM   2089  O  OG1 . THR B  1 57  ? -36.699  67.203  -24.705 1.00 29.22  ? 57  THR B OG1 1 
ATOM   2090  C  CG2 . THR B  1 57  ? -37.234  65.009  -23.894 1.00 18.40  ? 57  THR B CG2 1 
ATOM   2091  N  N   . TRP B  1 58  ? -39.293  66.431  -21.648 1.00 17.31  ? 58  TRP B N   1 
ATOM   2092  C  CA  . TRP B  1 58  ? -40.294  65.552  -21.059 1.00 11.72  ? 58  TRP B CA  1 
ATOM   2093  C  C   . TRP B  1 58  ? -41.691  65.751  -21.638 1.00 17.12  ? 58  TRP B C   1 
ATOM   2094  O  O   . TRP B  1 58  ? -41.922  66.648  -22.443 1.00 24.87  ? 58  TRP B O   1 
ATOM   2095  C  CB  . TRP B  1 58  ? -40.311  65.729  -19.550 1.00 10.98  ? 58  TRP B CB  1 
ATOM   2096  C  CG  . TRP B  1 58  ? -40.868  67.041  -19.128 1.00 14.07  ? 58  TRP B CG  1 
ATOM   2097  C  CD1 . TRP B  1 58  ? -42.162  67.320  -18.819 1.00 30.30  ? 58  TRP B CD1 1 
ATOM   2098  C  CD2 . TRP B  1 58  ? -40.151  68.265  -18.972 1.00 19.98  ? 58  TRP B CD2 1 
ATOM   2099  N  NE1 . TRP B  1 58  ? -42.296  68.642  -18.470 1.00 21.55  ? 58  TRP B NE1 1 
ATOM   2100  C  CE2 . TRP B  1 58  ? -41.076  69.245  -18.557 1.00 10.83  ? 58  TRP B CE2 1 
ATOM   2101  C  CE3 . TRP B  1 58  ? -38.819  68.627  -19.139 1.00 13.78  ? 58  TRP B CE3 1 
ATOM   2102  C  CZ2 . TRP B  1 58  ? -40.715  70.562  -18.319 1.00 12.92  ? 58  TRP B CZ2 1 
ATOM   2103  C  CZ3 . TRP B  1 58  ? -38.460  69.932  -18.899 1.00 16.59  ? 58  TRP B CZ3 1 
ATOM   2104  C  CH2 . TRP B  1 58  ? -39.405  70.888  -18.491 1.00 17.04  ? 58  TRP B CH2 1 
ATOM   2105  N  N   . SER B  1 59  ? -42.627  64.912  -21.221 1.00 29.09  ? 59  SER B N   1 
ATOM   2106  C  CA  . SER B  1 59  ? -44.003  65.019  -21.697 1.00 21.49  ? 59  SER B CA  1 
ATOM   2107  C  C   . SER B  1 59  ? -44.983  65.429  -20.591 1.00 15.00  ? 59  SER B C   1 
ATOM   2108  O  O   . SER B  1 59  ? -45.077  64.791  -19.545 1.00 22.26  ? 59  SER B O   1 
ATOM   2109  C  CB  . SER B  1 59  ? -44.439  63.701  -22.339 1.00 11.75  ? 59  SER B CB  1 
ATOM   2110  O  OG  . SER B  1 59  ? -45.509  63.910  -23.231 1.00 52.32  ? 59  SER B OG  1 
ATOM   2111  N  N   . ASP B  1 60  ? -45.712  66.507  -20.838 1.00 24.73  ? 60  ASP B N   1 
ATOM   2112  C  CA  . ASP B  1 60  ? -46.846  66.893  -19.996 1.00 24.22  ? 60  ASP B CA  1 
ATOM   2113  C  C   . ASP B  1 60  ? -48.119  66.973  -20.842 1.00 17.01  ? 60  ASP B C   1 
ATOM   2114  O  O   . ASP B  1 60  ? -48.407  68.004  -21.442 1.00 16.82  ? 60  ASP B O   1 
ATOM   2115  C  CB  . ASP B  1 60  ? -46.592  68.244  -19.337 1.00 17.20  ? 60  ASP B CB  1 
ATOM   2116  C  CG  . ASP B  1 60  ? -47.623  68.575  -18.264 1.00 36.58  ? 60  ASP B CG  1 
ATOM   2117  O  OD1 . ASP B  1 60  ? -48.705  67.945  -18.266 1.00 21.08  ? 60  ASP B OD1 1 
ATOM   2118  O  OD2 . ASP B  1 60  ? -47.349  69.472  -17.422 1.00 43.56  ? 60  ASP B OD2 1 
ATOM   2119  N  N   . ARG B  1 61  ? -48.869  65.879  -20.892 1.00 25.20  ? 61  ARG B N   1 
ATOM   2120  C  CA  . ARG B  1 61  ? -50.063  65.809  -21.750 1.00 34.50  ? 61  ARG B CA  1 
ATOM   2121  C  C   . ARG B  1 61  ? -51.078  66.903  -21.446 1.00 18.41  ? 61  ARG B C   1 
ATOM   2122  O  O   . ARG B  1 61  ? -51.842  67.297  -22.301 1.00 24.64  ? 61  ARG B O   1 
ATOM   2123  C  CB  . ARG B  1 61  ? -50.733  64.429  -21.668 1.00 32.98  ? 61  ARG B CB  1 
ATOM   2124  C  CG  . ARG B  1 61  ? -49.837  63.282  -22.116 1.00 66.46  ? 61  ARG B CG  1 
ATOM   2125  C  CD  . ARG B  1 61  ? -49.449  63.413  -23.587 1.00 76.74  ? 61  ARG B CD  1 
ATOM   2126  N  NE  . ARG B  1 61  ? -48.372  62.494  -23.958 1.00 89.71  ? 61  ARG B NE  1 
ATOM   2127  C  CZ  . ARG B  1 61  ? -48.563  61.274  -24.449 1.00 93.20  ? 61  ARG B CZ  1 
ATOM   2128  N  NH1 . ARG B  1 61  ? -49.795  60.814  -24.636 1.00 93.34  ? 61  ARG B NH1 1 
ATOM   2129  N  NH2 . ARG B  1 61  ? -47.522  60.514  -24.757 1.00 81.75  ? 61  ARG B NH2 1 
ATOM   2130  N  N   . THR B  1 62  ? -51.078  67.404  -20.226 1.00 19.04  ? 62  THR B N   1 
ATOM   2131  C  CA  . THR B  1 62  ? -52.084  68.379  -19.838 1.00 21.40  ? 62  THR B CA  1 
ATOM   2132  C  C   . THR B  1 62  ? -51.875  69.706  -20.557 1.00 30.24  ? 62  THR B C   1 
ATOM   2133  O  O   . THR B  1 62  ? -52.659  70.639  -20.384 1.00 36.58  ? 62  THR B O   1 
ATOM   2134  C  CB  . THR B  1 62  ? -52.139  68.608  -18.296 1.00 11.68  ? 62  THR B CB  1 
ATOM   2135  O  OG1 . THR B  1 62  ? -51.164  69.577  -17.918 1.00 29.23  ? 62  THR B OG1 1 
ATOM   2136  C  CG2 . THR B  1 62  ? -51.862  67.320  -17.546 1.00 14.89  ? 62  THR B CG2 1 
ATOM   2137  N  N   . LEU B  1 63  ? -50.820  69.799  -21.359 1.00 26.31  ? 63  LEU B N   1 
ATOM   2138  C  CA  . LEU B  1 63  ? -50.532  71.041  -22.074 1.00 18.11  ? 63  LEU B CA  1 
ATOM   2139  C  C   . LEU B  1 63  ? -50.985  70.955  -23.532 1.00 26.06  ? 63  LEU B C   1 
ATOM   2140  O  O   . LEU B  1 63  ? -51.048  71.969  -24.225 1.00 23.97  ? 63  LEU B O   1 
ATOM   2141  C  CB  . LEU B  1 63  ? -49.039  71.351  -22.017 1.00 19.78  ? 63  LEU B CB  1 
ATOM   2142  C  CG  . LEU B  1 63  ? -48.377  71.506  -20.651 1.00 19.35  ? 63  LEU B CG  1 
ATOM   2143  C  CD1 . LEU B  1 63  ? -46.857  71.588  -20.825 1.00 14.91  ? 63  LEU B CD1 1 
ATOM   2144  C  CD2 . LEU B  1 63  ? -48.907  72.729  -19.924 1.00 15.77  ? 63  LEU B CD2 1 
ATOM   2145  N  N   . ALA B  1 64  ? -51.296  69.740  -23.985 1.00 22.46  ? 64  ALA B N   1 
ATOM   2146  C  CA  . ALA B  1 64  ? -51.628  69.467  -25.387 1.00 22.86  ? 64  ALA B CA  1 
ATOM   2147  C  C   . ALA B  1 64  ? -52.831  70.236  -25.890 1.00 24.06  ? 64  ALA B C   1 
ATOM   2148  O  O   . ALA B  1 64  ? -53.676  70.655  -25.112 1.00 30.71  ? 64  ALA B O   1 
ATOM   2149  C  CB  . ALA B  1 64  ? -51.845  67.982  -25.603 1.00 14.31  ? 64  ALA B CB  1 
ATOM   2150  N  N   . TRP B  1 65  ? -52.897  70.422  -27.203 1.00 29.36  ? 65  TRP B N   1 
ATOM   2151  C  CA  . TRP B  1 65  ? -54.030  71.099  -27.837 1.00 25.69  ? 65  TRP B CA  1 
ATOM   2152  C  C   . TRP B  1 65  ? -54.225  70.599  -29.270 1.00 28.04  ? 65  TRP B C   1 
ATOM   2153  O  O   . TRP B  1 65  ? -53.286  70.086  -29.881 1.00 32.49  ? 65  TRP B O   1 
ATOM   2154  C  CB  . TRP B  1 65  ? -53.869  72.630  -27.800 1.00 11.66  ? 65  TRP B CB  1 
ATOM   2155  C  CG  . TRP B  1 65  ? -52.751  73.179  -28.660 1.00 27.56  ? 65  TRP B CG  1 
ATOM   2156  C  CD1 . TRP B  1 65  ? -52.833  73.548  -29.960 1.00 36.96  ? 65  TRP B CD1 1 
ATOM   2157  C  CD2 . TRP B  1 65  ? -51.396  73.418  -28.264 1.00 25.53  ? 65  TRP B CD2 1 
ATOM   2158  N  NE1 . TRP B  1 65  ? -51.620  73.999  -30.413 1.00 17.16  ? 65  TRP B NE1 1 
ATOM   2159  C  CE2 . TRP B  1 65  ? -50.716  73.932  -29.389 1.00 34.07  ? 65  TRP B CE2 1 
ATOM   2160  C  CE3 . TRP B  1 65  ? -50.695  73.252  -27.075 1.00 12.47  ? 65  TRP B CE3 1 
ATOM   2161  C  CZ2 . TRP B  1 65  ? -49.356  74.273  -29.360 1.00 23.75  ? 65  TRP B CZ2 1 
ATOM   2162  C  CZ3 . TRP B  1 65  ? -49.347  73.595  -27.044 1.00 33.40  ? 65  TRP B CZ3 1 
ATOM   2163  C  CH2 . TRP B  1 65  ? -48.695  74.101  -28.180 1.00 24.48  ? 65  TRP B CH2 1 
ATOM   2164  N  N   . ASN B  1 66  ? -55.449  70.725  -29.785 1.00 46.73  ? 66  ASN B N   1 
ATOM   2165  C  CA  . ASN B  1 66  ? -55.770  70.352  -31.168 1.00 49.16  ? 66  ASN B CA  1 
ATOM   2166  C  C   . ASN B  1 66  ? -55.177  71.379  -32.119 1.00 44.79  ? 66  ASN B C   1 
ATOM   2167  O  O   . ASN B  1 66  ? -55.699  72.485  -32.254 1.00 58.27  ? 66  ASN B O   1 
ATOM   2168  C  CB  . ASN B  1 66  ? -57.294  70.254  -31.372 1.00 38.23  ? 66  ASN B CB  1 
ATOM   2169  C  CG  . ASN B  1 66  ? -57.670  69.726  -32.752 1.00 61.92  ? 66  ASN B CG  1 
ATOM   2170  O  OD1 . ASN B  1 66  ? -56.857  69.757  -33.678 1.00 65.72  ? 66  ASN B OD1 1 
ATOM   2171  N  ND2 . ASN B  1 66  ? -58.908  69.243  -32.898 1.00 55.77  ? 66  ASN B ND2 1 
ATOM   2172  N  N   . SER B  1 67  ? -54.080  71.015  -32.772 1.00 34.98  ? 67  SER B N   1 
ATOM   2173  C  CA  . SER B  1 67  ? -53.358  71.968  -33.616 1.00 58.93  ? 67  SER B CA  1 
ATOM   2174  C  C   . SER B  1 67  ? -53.770  71.887  -35.087 1.00 66.26  ? 67  SER B C   1 
ATOM   2175  O  O   . SER B  1 67  ? -53.009  72.274  -35.969 1.00 61.24  ? 67  SER B O   1 
ATOM   2176  C  CB  . SER B  1 67  ? -51.836  71.783  -33.484 1.00 62.40  ? 67  SER B CB  1 
ATOM   2177  O  OG  . SER B  1 67  ? -51.382  70.652  -34.214 1.00 55.99  ? 67  SER B OG  1 
ATOM   2178  N  N   . SER B  1 68  ? -54.978  71.397  -35.348 1.00 71.82  ? 68  SER B N   1 
ATOM   2179  C  CA  . SER B  1 68  ? -55.430  71.222  -36.718 1.00 67.77  ? 68  SER B CA  1 
ATOM   2180  C  C   . SER B  1 68  ? -55.247  72.507  -37.519 1.00 68.19  ? 68  SER B C   1 
ATOM   2181  O  O   . SER B  1 68  ? -54.687  72.491  -38.616 1.00 77.44  ? 68  SER B O   1 
ATOM   2182  C  CB  . SER B  1 68  ? -56.884  70.760  -36.759 1.00 72.68  ? 68  SER B CB  1 
ATOM   2183  O  OG  . SER B  1 68  ? -57.753  71.758  -36.258 1.00 90.99  ? 68  SER B OG  1 
ATOM   2184  N  N   . HIS B  1 69  ? -55.713  73.622  -36.966 1.00 56.76  ? 69  HIS B N   1 
ATOM   2185  C  CA  . HIS B  1 69  ? -55.543  74.926  -37.613 1.00 64.29  ? 69  HIS B CA  1 
ATOM   2186  C  C   . HIS B  1 69  ? -54.953  75.923  -36.623 1.00 69.33  ? 69  HIS B C   1 
ATOM   2187  O  O   . HIS B  1 69  ? -55.481  77.024  -36.438 1.00 71.60  ? 69  HIS B O   1 
ATOM   2188  C  CB  . HIS B  1 69  ? -56.881  75.451  -38.137 1.00 73.02  ? 69  HIS B CB  1 
ATOM   2189  C  CG  . HIS B  1 69  ? -57.511  74.572  -39.171 1.00 85.79  ? 69  HIS B CG  1 
ATOM   2190  N  ND1 . HIS B  1 69  ? -58.807  74.746  -39.604 1.00 97.19  ? 69  HIS B ND1 1 
ATOM   2191  C  CD2 . HIS B  1 69  ? -57.025  73.512  -39.858 1.00 87.59  ? 69  HIS B CD2 1 
ATOM   2192  C  CE1 . HIS B  1 69  ? -59.092  73.832  -40.514 1.00 103.68 ? 69  HIS B CE1 1 
ATOM   2193  N  NE2 . HIS B  1 69  ? -58.028  73.069  -40.685 1.00 96.39  ? 69  HIS B NE2 1 
ATOM   2194  N  N   . SER B  1 70  ? -53.859  75.524  -35.986 1.00 57.79  ? 70  SER B N   1 
ATOM   2195  C  CA  . SER B  1 70  ? -53.272  76.308  -34.917 1.00 50.21  ? 70  SER B CA  1 
ATOM   2196  C  C   . SER B  1 70  ? -51.764  76.146  -34.937 1.00 38.39  ? 70  SER B C   1 
ATOM   2197  O  O   . SER B  1 70  ? -51.257  75.236  -35.580 1.00 44.87  ? 70  SER B O   1 
ATOM   2198  C  CB  . SER B  1 70  ? -53.827  75.839  -33.572 1.00 64.26  ? 70  SER B CB  1 
ATOM   2199  O  OG  . SER B  1 70  ? -55.246  75.747  -33.611 1.00 78.21  ? 70  SER B OG  1 
ATOM   2200  N  N   . PRO B  1 71  ? -51.039  77.040  -34.246 1.00 44.40  ? 71  PRO B N   1 
ATOM   2201  C  CA  . PRO B  1 71  ? -49.585  76.887  -34.130 1.00 36.06  ? 71  PRO B CA  1 
ATOM   2202  C  C   . PRO B  1 71  ? -49.219  75.545  -33.507 1.00 29.94  ? 71  PRO B C   1 
ATOM   2203  O  O   . PRO B  1 71  ? -49.945  75.025  -32.668 1.00 50.60  ? 71  PRO B O   1 
ATOM   2204  C  CB  . PRO B  1 71  ? -49.186  78.040  -33.209 1.00 32.40  ? 71  PRO B CB  1 
ATOM   2205  C  CG  . PRO B  1 71  ? -50.216  79.087  -33.473 1.00 41.63  ? 71  PRO B CG  1 
ATOM   2206  C  CD  . PRO B  1 71  ? -51.498  78.325  -33.687 1.00 46.03  ? 71  PRO B CD  1 
ATOM   2207  N  N   . ASP B  1 72  ? -48.104  74.987  -33.949 1.00 32.59  ? 72  ASP B N   1 
ATOM   2208  C  CA  . ASP B  1 72  ? -47.633  73.693  -33.480 1.00 40.64  ? 72  ASP B CA  1 
ATOM   2209  C  C   . ASP B  1 72  ? -46.815  73.823  -32.187 1.00 45.54  ? 72  ASP B C   1 
ATOM   2210  O  O   . ASP B  1 72  ? -46.690  72.873  -31.409 1.00 35.02  ? 72  ASP B O   1 
ATOM   2211  C  CB  . ASP B  1 72  ? -46.765  73.043  -34.558 1.00 31.26  ? 72  ASP B CB  1 
ATOM   2212  C  CG  . ASP B  1 72  ? -46.591  71.560  -34.338 1.00 64.38  ? 72  ASP B CG  1 
ATOM   2213  O  OD1 . ASP B  1 72  ? -47.607  70.868  -34.089 1.00 62.74  ? 72  ASP B OD1 1 
ATOM   2214  O  OD2 . ASP B  1 72  ? -45.435  71.091  -34.399 1.00 71.14  ? 72  ASP B OD2 1 
ATOM   2215  N  N   . GLN B  1 73  ? -46.240  74.999  -31.964 1.00 36.51  ? 73  GLN B N   1 
ATOM   2216  C  CA  . GLN B  1 73  ? -45.441  75.225  -30.768 1.00 21.70  ? 73  GLN B CA  1 
ATOM   2217  C  C   . GLN B  1 73  ? -45.549  76.629  -30.230 1.00 20.55  ? 73  GLN B C   1 
ATOM   2218  O  O   . GLN B  1 73  ? -45.785  77.582  -30.969 1.00 28.79  ? 73  GLN B O   1 
ATOM   2219  C  CB  . GLN B  1 73  ? -43.973  74.985  -31.057 1.00 29.54  ? 73  GLN B CB  1 
ATOM   2220  C  CG  . GLN B  1 73  ? -43.632  73.600  -31.498 1.00 35.25  ? 73  GLN B CG  1 
ATOM   2221  C  CD  . GLN B  1 73  ? -42.153  73.434  -31.710 1.00 27.24  ? 73  GLN B CD  1 
ATOM   2222  O  OE1 . GLN B  1 73  ? -41.342  74.271  -31.284 1.00 31.72  ? 73  GLN B OE1 1 
ATOM   2223  N  NE2 . GLN B  1 73  ? -41.783  72.350  -32.366 1.00 29.53  ? 73  GLN B NE2 1 
ATOM   2224  N  N   . VAL B  1 74  ? -45.331  76.752  -28.932 1.00 9.41   ? 74  VAL B N   1 
ATOM   2225  C  CA  . VAL B  1 74  ? -45.236  78.062  -28.320 1.00 8.00   ? 74  VAL B CA  1 
ATOM   2226  C  C   . VAL B  1 74  ? -44.104  78.095  -27.297 1.00 22.92  ? 74  VAL B C   1 
ATOM   2227  O  O   . VAL B  1 74  ? -43.701  77.055  -26.758 1.00 24.28  ? 74  VAL B O   1 
ATOM   2228  C  CB  . VAL B  1 74  ? -46.557  78.473  -27.620 1.00 21.27  ? 74  VAL B CB  1 
ATOM   2229  C  CG1 . VAL B  1 74  ? -47.636  78.823  -28.633 1.00 9.07   ? 74  VAL B CG1 1 
ATOM   2230  C  CG2 . VAL B  1 74  ? -47.049  77.383  -26.664 1.00 19.30  ? 74  VAL B CG2 1 
ATOM   2231  N  N   . SER B  1 75  ? -43.587  79.292  -27.031 1.00 27.31  ? 75  SER B N   1 
ATOM   2232  C  CA  . SER B  1 75  ? -42.626  79.471  -25.953 1.00 18.20  ? 75  SER B CA  1 
ATOM   2233  C  C   . SER B  1 75  ? -43.377  79.898  -24.701 1.00 19.05  ? 75  SER B C   1 
ATOM   2234  O  O   . SER B  1 75  ? -44.188  80.823  -24.722 1.00 16.66  ? 75  SER B O   1 
ATOM   2235  C  CB  . SER B  1 75  ? -41.549  80.490  -26.325 1.00 18.25  ? 75  SER B CB  1 
ATOM   2236  O  OG  . SER B  1 75  ? -40.732  79.993  -27.374 1.00 31.78  ? 75  SER B OG  1 
ATOM   2237  N  N   . VAL B  1 76  ? -43.096  79.205  -23.606 1.00 19.03  ? 76  VAL B N   1 
ATOM   2238  C  CA  . VAL B  1 76  ? -43.811  79.405  -22.366 1.00 16.40  ? 76  VAL B CA  1 
ATOM   2239  C  C   . VAL B  1 76  ? -42.842  79.620  -21.210 1.00 15.60  ? 76  VAL B C   1 
ATOM   2240  O  O   . VAL B  1 76  ? -41.862  78.889  -21.081 1.00 19.45  ? 76  VAL B O   1 
ATOM   2241  C  CB  . VAL B  1 76  ? -44.666  78.172  -22.056 1.00 22.43  ? 76  VAL B CB  1 
ATOM   2242  C  CG1 . VAL B  1 76  ? -45.477  78.376  -20.785 1.00 17.16  ? 76  VAL B CG1 1 
ATOM   2243  C  CG2 . VAL B  1 76  ? -45.555  77.843  -23.234 1.00 10.70  ? 76  VAL B CG2 1 
ATOM   2244  N  N   . PRO B  1 77  ? -43.123  80.625  -20.365 1.00 20.57  ? 77  PRO B N   1 
ATOM   2245  C  CA  . PRO B  1 77  ? -42.374  80.869  -19.125 1.00 18.46  ? 77  PRO B CA  1 
ATOM   2246  C  C   . PRO B  1 77  ? -42.390  79.622  -18.252 1.00 23.94  ? 77  PRO B C   1 
ATOM   2247  O  O   . PRO B  1 77  ? -43.488  79.143  -17.955 1.00 25.91  ? 77  PRO B O   1 
ATOM   2248  C  CB  . PRO B  1 77  ? -43.195  81.968  -18.446 1.00 5.81   ? 77  PRO B CB  1 
ATOM   2249  C  CG  . PRO B  1 77  ? -43.858  82.687  -19.571 1.00 24.63  ? 77  PRO B CG  1 
ATOM   2250  C  CD  . PRO B  1 77  ? -44.187  81.627  -20.580 1.00 18.53  ? 77  PRO B CD  1 
ATOM   2251  N  N   . ILE B  1 78  ? -41.231  79.106  -17.835 1.00 10.63  ? 78  ILE B N   1 
ATOM   2252  C  CA  . ILE B  1 78  ? -41.234  77.851  -17.067 1.00 20.19  ? 78  ILE B CA  1 
ATOM   2253  C  C   . ILE B  1 78  ? -41.973  77.963  -15.724 1.00 24.93  ? 78  ILE B C   1 
ATOM   2254  O  O   . ILE B  1 78  ? -42.384  76.963  -15.129 1.00 31.80  ? 78  ILE B O   1 
ATOM   2255  C  CB  . ILE B  1 78  ? -39.840  77.318  -16.797 1.00 11.08  ? 78  ILE B CB  1 
ATOM   2256  C  CG1 . ILE B  1 78  ? -38.992  78.421  -16.180 1.00 27.90  ? 78  ILE B CG1 1 
ATOM   2257  C  CG2 . ILE B  1 78  ? -39.214  76.786  -18.065 1.00 10.53  ? 78  ILE B CG2 1 
ATOM   2258  C  CD1 . ILE B  1 78  ? -37.753  77.903  -15.502 1.00 24.29  ? 78  ILE B CD1 1 
ATOM   2259  N  N   . SER B  1 79  ? -42.138  79.183  -15.245 1.00 21.83  ? 79  SER B N   1 
ATOM   2260  C  CA  . SER B  1 79  ? -42.967  79.426  -14.080 1.00 18.30  ? 79  SER B CA  1 
ATOM   2261  C  C   . SER B  1 79  ? -44.426  78.995  -14.317 1.00 27.10  ? 79  SER B C   1 
ATOM   2262  O  O   . SER B  1 79  ? -45.196  78.821  -13.374 1.00 14.79  ? 79  SER B O   1 
ATOM   2263  C  CB  . SER B  1 79  ? -42.906  80.908  -13.697 1.00 23.18  ? 79  SER B CB  1 
ATOM   2264  O  OG  . SER B  1 79  ? -43.087  81.753  -14.820 1.00 32.60  ? 79  SER B OG  1 
ATOM   2265  N  N   . SER B  1 80  ? -44.801  78.811  -15.579 1.00 25.42  ? 80  SER B N   1 
ATOM   2266  C  CA  . SER B  1 80  ? -46.157  78.368  -15.899 1.00 27.21  ? 80  SER B CA  1 
ATOM   2267  C  C   . SER B  1 80  ? -46.236  76.872  -16.177 1.00 31.51  ? 80  SER B C   1 
ATOM   2268  O  O   . SER B  1 80  ? -47.308  76.358  -16.476 1.00 33.19  ? 80  SER B O   1 
ATOM   2269  C  CB  . SER B  1 80  ? -46.730  79.136  -17.096 1.00 13.04  ? 80  SER B CB  1 
ATOM   2270  O  OG  . SER B  1 80  ? -46.747  80.528  -16.854 1.00 30.48  ? 80  SER B OG  1 
ATOM   2271  N  N   . LEU B  1 81  ? -45.106  76.180  -16.096 1.00 22.09  ? 81  LEU B N   1 
ATOM   2272  C  CA  . LEU B  1 81  ? -45.085  74.756  -16.371 1.00 14.04  ? 81  LEU B CA  1 
ATOM   2273  C  C   . LEU B  1 81  ? -44.573  73.967  -15.181 1.00 29.45  ? 81  LEU B C   1 
ATOM   2274  O  O   . LEU B  1 81  ? -43.798  74.488  -14.380 1.00 36.22  ? 81  LEU B O   1 
ATOM   2275  C  CB  . LEU B  1 81  ? -44.157  74.465  -17.539 1.00 20.16  ? 81  LEU B CB  1 
ATOM   2276  C  CG  . LEU B  1 81  ? -44.419  75.149  -18.865 1.00 26.66  ? 81  LEU B CG  1 
ATOM   2277  C  CD1 . LEU B  1 81  ? -43.371  74.724  -19.852 1.00 25.23  ? 81  LEU B CD1 1 
ATOM   2278  C  CD2 . LEU B  1 81  ? -45.785  74.747  -19.339 1.00 41.02  ? 81  LEU B CD2 1 
ATOM   2279  N  N   . TRP B  1 82  ? -44.988  72.707  -15.068 1.00 17.66  ? 82  TRP B N   1 
ATOM   2280  C  CA  . TRP B  1 82  ? -44.280  71.811  -14.190 1.00 13.05  ? 82  TRP B CA  1 
ATOM   2281  C  C   . TRP B  1 82  ? -42.903  71.562  -14.809 1.00 24.56  ? 82  TRP B C   1 
ATOM   2282  O  O   . TRP B  1 82  ? -42.782  71.324  -16.010 1.00 23.60  ? 82  TRP B O   1 
ATOM   2283  C  CB  . TRP B  1 82  ? -45.006  70.490  -14.028 1.00 4.18   ? 82  TRP B CB  1 
ATOM   2284  C  CG  . TRP B  1 82  ? -44.217  69.484  -13.214 1.00 32.95  ? 82  TRP B CG  1 
ATOM   2285  C  CD1 . TRP B  1 82  ? -44.213  69.345  -11.845 1.00 17.62  ? 82  TRP B CD1 1 
ATOM   2286  C  CD2 . TRP B  1 82  ? -43.303  68.498  -13.716 1.00 25.71  ? 82  TRP B CD2 1 
ATOM   2287  N  NE1 . TRP B  1 82  ? -43.376  68.324  -11.478 1.00 19.81  ? 82  TRP B NE1 1 
ATOM   2288  C  CE2 . TRP B  1 82  ? -42.802  67.788  -12.603 1.00 23.08  ? 82  TRP B CE2 1 
ATOM   2289  C  CE3 . TRP B  1 82  ? -42.861  68.145  -15.001 1.00 25.31  ? 82  TRP B CE3 1 
ATOM   2290  C  CZ2 . TRP B  1 82  ? -41.885  66.748  -12.735 1.00 20.79  ? 82  TRP B CZ2 1 
ATOM   2291  C  CZ3 . TRP B  1 82  ? -41.965  67.107  -15.131 1.00 19.07  ? 82  TRP B CZ3 1 
ATOM   2292  C  CH2 . TRP B  1 82  ? -41.480  66.421  -14.004 1.00 28.75  ? 82  TRP B CH2 1 
ATOM   2293  N  N   . VAL B  1 83  ? -41.874  71.625  -13.974 1.00 22.18  ? 83  VAL B N   1 
ATOM   2294  C  CA  . VAL B  1 83  ? -40.512  71.326  -14.388 1.00 21.60  ? 83  VAL B CA  1 
ATOM   2295  C  C   . VAL B  1 83  ? -39.920  70.274  -13.454 1.00 23.63  ? 83  VAL B C   1 
ATOM   2296  O  O   . VAL B  1 83  ? -40.165  70.301  -12.246 1.00 24.70  ? 83  VAL B O   1 
ATOM   2297  C  CB  . VAL B  1 83  ? -39.642  72.586  -14.365 1.00 20.50  ? 83  VAL B CB  1 
ATOM   2298  C  CG1 . VAL B  1 83  ? -38.208  72.230  -14.648 1.00 43.48  ? 83  VAL B CG1 1 
ATOM   2299  C  CG2 . VAL B  1 83  ? -40.148  73.597  -15.394 1.00 20.05  ? 83  VAL B CG2 1 
ATOM   2300  N  N   . PRO B  1 84  ? -39.161  69.316  -14.009 1.00 16.71  ? 84  PRO B N   1 
ATOM   2301  C  CA  . PRO B  1 84  ? -38.547  68.328  -13.120 1.00 18.83  ? 84  PRO B CA  1 
ATOM   2302  C  C   . PRO B  1 84  ? -37.531  68.998  -12.182 1.00 20.10  ? 84  PRO B C   1 
ATOM   2303  O  O   . PRO B  1 84  ? -36.821  69.902  -12.611 1.00 13.52  ? 84  PRO B O   1 
ATOM   2304  C  CB  . PRO B  1 84  ? -37.867  67.354  -14.093 1.00 13.01  ? 84  PRO B CB  1 
ATOM   2305  C  CG  . PRO B  1 84  ? -37.678  68.118  -15.322 1.00 13.45  ? 84  PRO B CG  1 
ATOM   2306  C  CD  . PRO B  1 84  ? -38.863  69.040  -15.420 1.00 14.36  ? 84  PRO B CD  1 
ATOM   2307  N  N   . ASP B  1 85  ? -37.495  68.564  -10.922 1.00 15.26  ? 85  ASP B N   1 
ATOM   2308  C  CA  . ASP B  1 85  ? -36.628  69.134  -9.895  1.00 11.62  ? 85  ASP B CA  1 
ATOM   2309  C  C   . ASP B  1 85  ? -35.208  68.553  -9.985  1.00 18.16  ? 85  ASP B C   1 
ATOM   2310  O  O   . ASP B  1 85  ? -34.682  67.972  -9.035  1.00 18.64  ? 85  ASP B O   1 
ATOM   2311  C  CB  . ASP B  1 85  ? -37.226  68.885  -8.504  1.00 7.55   ? 85  ASP B CB  1 
ATOM   2312  C  CG  . ASP B  1 85  ? -37.295  67.405  -8.162  1.00 29.25  ? 85  ASP B CG  1 
ATOM   2313  O  OD1 . ASP B  1 85  ? -37.474  66.600  -9.097  1.00 19.34  ? 85  ASP B OD1 1 
ATOM   2314  O  OD2 . ASP B  1 85  ? -37.147  67.037  -6.971  1.00 22.67  ? 85  ASP B OD2 1 
ATOM   2315  N  N   . LEU B  1 86  ? -34.600  68.714  -11.152 1.00 20.28  ? 86  LEU B N   1 
ATOM   2316  C  CA  . LEU B  1 86  ? -33.244  68.257  -11.380 1.00 20.00  ? 86  LEU B CA  1 
ATOM   2317  C  C   . LEU B  1 86  ? -32.230  69.097  -10.600 1.00 16.15  ? 86  LEU B C   1 
ATOM   2318  O  O   . LEU B  1 86  ? -32.332  70.319  -10.495 1.00 10.72  ? 86  LEU B O   1 
ATOM   2319  C  CB  . LEU B  1 86  ? -32.930  68.317  -12.866 1.00 11.10  ? 86  LEU B CB  1 
ATOM   2320  C  CG  . LEU B  1 86  ? -33.802  67.471  -13.778 1.00 17.57  ? 86  LEU B CG  1 
ATOM   2321  C  CD1 . LEU B  1 86  ? -33.232  67.545  -15.184 1.00 6.21   ? 86  LEU B CD1 1 
ATOM   2322  C  CD2 . LEU B  1 86  ? -33.895  66.024  -13.280 1.00 5.69   ? 86  LEU B CD2 1 
ATOM   2323  N  N   . ALA B  1 87  ? -31.246  68.426  -10.039 1.00 16.91  ? 87  ALA B N   1 
ATOM   2324  C  CA  . ALA B  1 87  ? -30.140  69.129  -9.407  1.00 24.49  ? 87  ALA B CA  1 
ATOM   2325  C  C   . ALA B  1 87  ? -28.811  68.427  -9.703  1.00 16.70  ? 87  ALA B C   1 
ATOM   2326  O  O   . ALA B  1 87  ? -28.768  67.221  -9.956  1.00 20.62  ? 87  ALA B O   1 
ATOM   2327  C  CB  . ALA B  1 87  ? -30.370  69.247  -7.912  1.00 13.69  ? 87  ALA B CB  1 
ATOM   2328  N  N   . ALA B  1 88  ? -27.729  69.193  -9.694  1.00 18.07  ? 88  ALA B N   1 
ATOM   2329  C  CA  . ALA B  1 88  ? -26.391  68.608  -9.824  1.00 10.88  ? 88  ALA B CA  1 
ATOM   2330  C  C   . ALA B  1 88  ? -25.844  68.303  -8.437  1.00 10.25  ? 88  ALA B C   1 
ATOM   2331  O  O   . ALA B  1 88  ? -25.579  69.218  -7.647  1.00 8.15   ? 88  ALA B O   1 
ATOM   2332  C  CB  . ALA B  1 88  ? -25.468  69.541  -10.572 1.00 5.92   ? 88  ALA B CB  1 
ATOM   2333  N  N   . TYR B  1 89  ? -25.702  67.018  -8.142  1.00 7.01   ? 89  TYR B N   1 
ATOM   2334  C  CA  . TYR B  1 89  ? -25.271  66.578  -6.826  1.00 18.98  ? 89  TYR B CA  1 
ATOM   2335  C  C   . TYR B  1 89  ? -23.955  67.215  -6.368  1.00 24.93  ? 89  TYR B C   1 
ATOM   2336  O  O   . TYR B  1 89  ? -23.802  67.604  -5.206  1.00 26.24  ? 89  TYR B O   1 
ATOM   2337  C  CB  . TYR B  1 89  ? -25.172  65.051  -6.778  1.00 9.37   ? 89  TYR B CB  1 
ATOM   2338  C  CG  . TYR B  1 89  ? -26.519  64.369  -6.626  1.00 30.21  ? 89  TYR B CG  1 
ATOM   2339  C  CD1 . TYR B  1 89  ? -27.469  64.440  -7.635  1.00 18.49  ? 89  TYR B CD1 1 
ATOM   2340  C  CD2 . TYR B  1 89  ? -26.841  63.655  -5.477  1.00 8.71   ? 89  TYR B CD2 1 
ATOM   2341  C  CE1 . TYR B  1 89  ? -28.704  63.821  -7.505  1.00 17.94  ? 89  TYR B CE1 1 
ATOM   2342  C  CE2 . TYR B  1 89  ? -28.074  63.029  -5.343  1.00 33.96  ? 89  TYR B CE2 1 
ATOM   2343  C  CZ  . TYR B  1 89  ? -29.001  63.115  -6.366  1.00 29.52  ? 89  TYR B CZ  1 
ATOM   2344  O  OH  . TYR B  1 89  ? -30.232  62.501  -6.267  1.00 24.36  ? 89  TYR B OH  1 
ATOM   2345  N  N   . ASN B  1 90  ? -23.006  67.339  -7.281  1.00 19.44  ? 90  ASN B N   1 
ATOM   2346  C  CA  . ASN B  1 90  ? -21.695  67.855  -6.900  1.00 23.07  ? 90  ASN B CA  1 
ATOM   2347  C  C   . ASN B  1 90  ? -21.474  69.322  -7.277  1.00 21.71  ? 90  ASN B C   1 
ATOM   2348  O  O   . ASN B  1 90  ? -20.343  69.807  -7.260  1.00 29.08  ? 90  ASN B O   1 
ATOM   2349  C  CB  . ASN B  1 90  ? -20.559  66.957  -7.435  1.00 8.88   ? 90  ASN B CB  1 
ATOM   2350  C  CG  . ASN B  1 90  ? -20.606  66.790  -8.930  1.00 24.55  ? 90  ASN B CG  1 
ATOM   2351  O  OD1 . ASN B  1 90  ? -21.688  66.700  -9.523  1.00 31.98  ? 90  ASN B OD1 1 
ATOM   2352  N  ND2 . ASN B  1 90  ? -19.442  66.772  -9.558  1.00 19.95  ? 90  ASN B ND2 1 
ATOM   2353  N  N   . ALA B  1 91  ? -22.553  70.019  -7.614  1.00 16.93  ? 91  ALA B N   1 
ATOM   2354  C  CA  . ALA B  1 91  ? -22.509  71.465  -7.752  1.00 19.76  ? 91  ALA B CA  1 
ATOM   2355  C  C   . ALA B  1 91  ? -22.162  72.104  -6.413  1.00 22.07  ? 91  ALA B C   1 
ATOM   2356  O  O   . ALA B  1 91  ? -22.606  71.652  -5.355  1.00 17.11  ? 91  ALA B O   1 
ATOM   2357  C  CB  . ALA B  1 91  ? -23.857  71.990  -8.249  1.00 18.58  ? 91  ALA B CB  1 
ATOM   2358  N  N   . ILE B  1 92  ? -21.369  73.162  -6.444  1.00 20.24  ? 92  ILE B N   1 
ATOM   2359  C  CA  . ILE B  1 92  ? -21.029  73.828  -5.196  1.00 16.86  ? 92  ILE B CA  1 
ATOM   2360  C  C   . ILE B  1 92  ? -21.473  75.276  -5.210  1.00 22.93  ? 92  ILE B C   1 
ATOM   2361  O  O   . ILE B  1 92  ? -21.198  76.037  -4.278  1.00 24.04  ? 92  ILE B O   1 
ATOM   2362  C  CB  . ILE B  1 92  ? -19.538  73.717  -4.863  1.00 14.78  ? 92  ILE B CB  1 
ATOM   2363  C  CG1 . ILE B  1 92  ? -18.699  74.245  -6.029  1.00 24.09  ? 92  ILE B CG1 1 
ATOM   2364  C  CG2 . ILE B  1 92  ? -19.196  72.279  -4.538  1.00 8.80   ? 92  ILE B CG2 1 
ATOM   2365  C  CD1 . ILE B  1 92  ? -17.208  74.318  -5.725  1.00 22.49  ? 92  ILE B CD1 1 
ATOM   2366  N  N   . SER B  1 93  ? -22.169  75.648  -6.274  1.00 13.64  ? 93  SER B N   1 
ATOM   2367  C  CA  . SER B  1 93  ? -22.846  76.935  -6.310  1.00 25.46  ? 93  SER B CA  1 
ATOM   2368  C  C   . SER B  1 93  ? -24.230  76.677  -6.870  1.00 19.12  ? 93  SER B C   1 
ATOM   2369  O  O   . SER B  1 93  ? -24.439  75.710  -7.593  1.00 22.35  ? 93  SER B O   1 
ATOM   2370  C  CB  . SER B  1 93  ? -22.085  77.944  -7.177  1.00 22.45  ? 93  SER B CB  1 
ATOM   2371  O  OG  . SER B  1 93  ? -22.153  77.589  -8.552  1.00 25.38  ? 93  SER B OG  1 
ATOM   2372  N  N   . LYS B  1 94  ? -25.200  77.508  -6.533  1.00 20.93  ? 94  LYS B N   1 
ATOM   2373  C  CA  . LYS B  1 94  ? -26.494  77.330  -7.189  1.00 31.41  ? 94  LYS B CA  1 
ATOM   2374  C  C   . LYS B  1 94  ? -26.342  77.747  -8.643  1.00 18.25  ? 94  LYS B C   1 
ATOM   2375  O  O   . LYS B  1 94  ? -25.540  78.625  -8.965  1.00 38.66  ? 94  LYS B O   1 
ATOM   2376  C  CB  . LYS B  1 94  ? -27.632  78.074  -6.471  1.00 26.96  ? 94  LYS B CB  1 
ATOM   2377  C  CG  . LYS B  1 94  ? -27.485  79.585  -6.408  1.00 49.65  ? 94  LYS B CG  1 
ATOM   2378  C  CD  . LYS B  1 94  ? -28.460  80.184  -5.395  1.00 60.05  ? 94  LYS B CD  1 
ATOM   2379  C  CE  . LYS B  1 94  ? -29.883  79.730  -5.670  1.00 59.25  ? 94  LYS B CE  1 
ATOM   2380  N  NZ  . LYS B  1 94  ? -30.808  80.147  -4.592  1.00 54.72  ? 94  LYS B NZ  1 
ATOM   2381  N  N   . PRO B  1 95  ? -27.082  77.091  -9.532  1.00 24.54  ? 95  PRO B N   1 
ATOM   2382  C  CA  . PRO B  1 95  ? -26.928  77.354  -10.968 1.00 18.95  ? 95  PRO B CA  1 
ATOM   2383  C  C   . PRO B  1 95  ? -27.273  78.788  -11.336 1.00 18.01  ? 95  PRO B C   1 
ATOM   2384  O  O   . PRO B  1 95  ? -28.357  79.249  -10.982 1.00 14.25  ? 95  PRO B O   1 
ATOM   2385  C  CB  . PRO B  1 95  ? -27.936  76.389  -11.611 1.00 13.77  ? 95  PRO B CB  1 
ATOM   2386  C  CG  . PRO B  1 95  ? -28.904  76.034  -10.521 1.00 11.20  ? 95  PRO B CG  1 
ATOM   2387  C  CD  . PRO B  1 95  ? -28.125  76.088  -9.248  1.00 20.56  ? 95  PRO B CD  1 
ATOM   2388  N  N   . GLU B  1 96  ? -26.359  79.479  -12.019 1.00 17.09  ? 96  GLU B N   1 
ATOM   2389  C  CA  . GLU B  1 96  ? -26.666  80.786  -12.586 1.00 19.09  ? 96  GLU B CA  1 
ATOM   2390  C  C   . GLU B  1 96  ? -27.275  80.587  -13.987 1.00 33.84  ? 96  GLU B C   1 
ATOM   2391  O  O   . GLU B  1 96  ? -26.606  80.128  -14.918 1.00 23.08  ? 96  GLU B O   1 
ATOM   2392  C  CB  . GLU B  1 96  ? -25.411  81.645  -12.656 1.00 15.47  ? 96  GLU B CB  1 
ATOM   2393  C  CG  . GLU B  1 96  ? -25.625  83.124  -13.011 1.00 34.19  ? 96  GLU B CG  1 
ATOM   2394  C  CD  . GLU B  1 96  ? -24.296  83.896  -13.164 1.00 50.60  ? 96  GLU B CD  1 
ATOM   2395  O  OE1 . GLU B  1 96  ? -23.220  83.289  -12.975 1.00 41.02  ? 96  GLU B OE1 1 
ATOM   2396  O  OE2 . GLU B  1 96  ? -24.321  85.108  -13.472 1.00 52.72  ? 96  GLU B OE2 1 
ATOM   2397  N  N   . VAL B  1 97  ? -28.557  80.906  -14.131 1.00 25.18  ? 97  VAL B N   1 
ATOM   2398  C  CA  . VAL B  1 97  ? -29.219  80.737  -15.419 1.00 11.87  ? 97  VAL B CA  1 
ATOM   2399  C  C   . VAL B  1 97  ? -29.000  81.971  -16.251 1.00 15.11  ? 97  VAL B C   1 
ATOM   2400  O  O   . VAL B  1 97  ? -29.396  83.069  -15.865 1.00 21.81  ? 97  VAL B O   1 
ATOM   2401  C  CB  . VAL B  1 97  ? -30.711  80.485  -15.238 1.00 25.85  ? 97  VAL B CB  1 
ATOM   2402  C  CG1 . VAL B  1 97  ? -31.384  80.347  -16.579 1.00 31.15  ? 97  VAL B CG1 1 
ATOM   2403  C  CG2 . VAL B  1 97  ? -30.907  79.235  -14.398 1.00 12.65  ? 97  VAL B CG2 1 
ATOM   2404  N  N   . LEU B  1 98  ? -28.349  81.787  -17.392 1.00 17.64  ? 98  LEU B N   1 
ATOM   2405  C  CA  . LEU B  1 98  ? -27.877  82.918  -18.190 1.00 21.49  ? 98  LEU B CA  1 
ATOM   2406  C  C   . LEU B  1 98  ? -28.915  83.408  -19.189 1.00 17.68  ? 98  LEU B C   1 
ATOM   2407  O  O   . LEU B  1 98  ? -28.924  84.571  -19.588 1.00 30.88  ? 98  LEU B O   1 
ATOM   2408  C  CB  . LEU B  1 98  ? -26.594  82.541  -18.933 1.00 6.77   ? 98  LEU B CB  1 
ATOM   2409  C  CG  . LEU B  1 98  ? -25.462  82.078  -18.030 1.00 17.56  ? 98  LEU B CG  1 
ATOM   2410  C  CD1 . LEU B  1 98  ? -24.310  81.551  -18.875 1.00 21.32  ? 98  LEU B CD1 1 
ATOM   2411  C  CD2 . LEU B  1 98  ? -25.000  83.211  -17.145 1.00 14.46  ? 98  LEU B CD2 1 
ATOM   2412  N  N   . THR B  1 99  ? -29.783  82.507  -19.602 1.00 11.63  ? 99  THR B N   1 
ATOM   2413  C  CA  . THR B  1 99  ? -30.686  82.790  -20.693 1.00 17.45  ? 99  THR B CA  1 
ATOM   2414  C  C   . THR B  1 99  ? -32.106  83.014  -20.189 1.00 22.35  ? 99  THR B C   1 
ATOM   2415  O  O   . THR B  1 99  ? -32.413  82.650  -19.051 1.00 17.57  ? 99  THR B O   1 
ATOM   2416  C  CB  . THR B  1 99  ? -30.653  81.636  -21.685 1.00 6.37   ? 99  THR B CB  1 
ATOM   2417  O  OG1 . THR B  1 99  ? -30.781  80.402  -20.983 1.00 15.77  ? 99  THR B OG1 1 
ATOM   2418  C  CG2 . THR B  1 99  ? -29.339  81.623  -22.401 1.00 13.55  ? 99  THR B CG2 1 
ATOM   2419  N  N   . PRO B  1 100 ? -32.966  83.632  -21.023 1.00 20.15  ? 100 PRO B N   1 
ATOM   2420  C  CA  . PRO B  1 100 ? -34.396  83.762  -20.702 1.00 19.13  ? 100 PRO B CA  1 
ATOM   2421  C  C   . PRO B  1 100 ? -34.998  82.418  -20.350 1.00 12.85  ? 100 PRO B C   1 
ATOM   2422  O  O   . PRO B  1 100 ? -34.758  81.411  -21.034 1.00 21.78  ? 100 PRO B O   1 
ATOM   2423  C  CB  . PRO B  1 100 ? -34.999  84.294  -22.002 1.00 22.53  ? 100 PRO B CB  1 
ATOM   2424  C  CG  . PRO B  1 100 ? -33.854  85.096  -22.626 1.00 17.22  ? 100 PRO B CG  1 
ATOM   2425  C  CD  . PRO B  1 100 ? -32.622  84.289  -22.299 1.00 23.18  ? 100 PRO B CD  1 
ATOM   2426  N  N   . GLN B  1 101 ? -35.769  82.391  -19.275 1.00 14.30  ? 101 GLN B N   1 
ATOM   2427  C  CA  . GLN B  1 101 ? -36.269  81.115  -18.783 1.00 26.51  ? 101 GLN B CA  1 
ATOM   2428  C  C   . GLN B  1 101 ? -37.572  80.680  -19.459 1.00 25.36  ? 101 GLN B C   1 
ATOM   2429  O  O   . GLN B  1 101 ? -38.629  80.606  -18.842 1.00 30.36  ? 101 GLN B O   1 
ATOM   2430  C  CB  . GLN B  1 101 ? -36.343  81.136  -17.261 1.00 14.86  ? 101 GLN B CB  1 
ATOM   2431  C  CG  . GLN B  1 101 ? -34.948  81.290  -16.656 1.00 10.47  ? 101 GLN B CG  1 
ATOM   2432  C  CD  . GLN B  1 101 ? -34.935  81.480  -15.144 1.00 17.10  ? 101 GLN B CD  1 
ATOM   2433  O  OE1 . GLN B  1 101 ? -35.716  80.873  -14.410 1.00 29.05  ? 101 GLN B OE1 1 
ATOM   2434  N  NE2 . GLN B  1 101 ? -34.029  82.319  -14.674 1.00 34.75  ? 101 GLN B NE2 1 
ATOM   2435  N  N   . LEU B  1 102 ? -37.458  80.380  -20.748 1.00 26.27  ? 102 LEU B N   1 
ATOM   2436  C  CA  . LEU B  1 102 ? -38.583  79.975  -21.578 1.00 15.48  ? 102 LEU B CA  1 
ATOM   2437  C  C   . LEU B  1 102 ? -38.472  78.516  -21.988 1.00 12.88  ? 102 LEU B C   1 
ATOM   2438  O  O   . LEU B  1 102 ? -37.416  78.044  -22.377 1.00 25.53  ? 102 LEU B O   1 
ATOM   2439  C  CB  . LEU B  1 102 ? -38.646  80.845  -22.834 1.00 9.62   ? 102 LEU B CB  1 
ATOM   2440  C  CG  . LEU B  1 102 ? -38.865  82.327  -22.557 1.00 10.83  ? 102 LEU B CG  1 
ATOM   2441  C  CD1 . LEU B  1 102 ? -38.987  83.086  -23.835 1.00 14.55  ? 102 LEU B CD1 1 
ATOM   2442  C  CD2 . LEU B  1 102 ? -40.128  82.486  -21.744 1.00 23.15  ? 102 LEU B CD2 1 
ATOM   2443  N  N   . ALA B  1 103 ? -39.575  77.795  -21.889 1.00 15.49  ? 103 ALA B N   1 
ATOM   2444  C  CA  . ALA B  1 103 ? -39.627  76.442  -22.421 1.00 17.57  ? 103 ALA B CA  1 
ATOM   2445  C  C   . ALA B  1 103 ? -40.295  76.481  -23.775 1.00 19.65  ? 103 ALA B C   1 
ATOM   2446  O  O   . ALA B  1 103 ? -40.913  77.475  -24.163 1.00 34.46  ? 103 ALA B O   1 
ATOM   2447  C  CB  . ALA B  1 103 ? -40.386  75.518  -21.493 1.00 7.87   ? 103 ALA B CB  1 
ATOM   2448  N  N   . ARG B  1 104 ? -40.174  75.390  -24.503 1.00 21.75  ? 104 ARG B N   1 
ATOM   2449  C  CA  . ARG B  1 104 ? -40.844  75.282  -25.780 1.00 23.94  ? 104 ARG B CA  1 
ATOM   2450  C  C   . ARG B  1 104 ? -41.848  74.133  -25.687 1.00 19.92  ? 104 ARG B C   1 
ATOM   2451  O  O   . ARG B  1 104 ? -41.493  73.007  -25.344 1.00 33.78  ? 104 ARG B O   1 
ATOM   2452  C  CB  . ARG B  1 104 ? -39.812  75.040  -26.872 1.00 17.51  ? 104 ARG B CB  1 
ATOM   2453  C  CG  . ARG B  1 104 ? -40.332  75.210  -28.261 1.00 25.64  ? 104 ARG B CG  1 
ATOM   2454  C  CD  . ARG B  1 104 ? -40.637  76.655  -28.590 1.00 18.78  ? 104 ARG B CD  1 
ATOM   2455  N  NE  . ARG B  1 104 ? -41.054  76.743  -29.989 1.00 22.23  ? 104 ARG B NE  1 
ATOM   2456  C  CZ  . ARG B  1 104 ? -41.319  77.879  -30.620 1.00 31.14  ? 104 ARG B CZ  1 
ATOM   2457  N  NH1 . ARG B  1 104 ? -41.231  79.046  -29.977 1.00 23.81  ? 104 ARG B NH1 1 
ATOM   2458  N  NH2 . ARG B  1 104 ? -41.677  77.843  -31.896 1.00 22.03  ? 104 ARG B NH2 1 
ATOM   2459  N  N   . VAL B  1 105 ? -43.110  74.429  -25.955 1.00 23.53  ? 105 VAL B N   1 
ATOM   2460  C  CA  . VAL B  1 105 ? -44.152  73.415  -25.838 1.00 16.65  ? 105 VAL B CA  1 
ATOM   2461  C  C   . VAL B  1 105 ? -44.778  73.081  -27.184 1.00 18.96  ? 105 VAL B C   1 
ATOM   2462  O  O   . VAL B  1 105 ? -45.233  73.974  -27.911 1.00 14.26  ? 105 VAL B O   1 
ATOM   2463  C  CB  . VAL B  1 105 ? -45.229  73.858  -24.866 1.00 14.50  ? 105 VAL B CB  1 
ATOM   2464  C  CG1 . VAL B  1 105 ? -46.228  72.748  -24.655 1.00 18.45  ? 105 VAL B CG1 1 
ATOM   2465  C  CG2 . VAL B  1 105 ? -44.593  74.251  -23.549 1.00 18.98  ? 105 VAL B CG2 1 
ATOM   2466  N  N   . VAL B  1 106 ? -44.768  71.789  -27.512 1.00 22.18  ? 106 VAL B N   1 
ATOM   2467  C  CA  . VAL B  1 106 ? -45.379  71.287  -28.740 1.00 27.81  ? 106 VAL B CA  1 
ATOM   2468  C  C   . VAL B  1 106 ? -46.822  70.866  -28.478 1.00 26.87  ? 106 VAL B C   1 
ATOM   2469  O  O   . VAL B  1 106 ? -47.163  70.415  -27.385 1.00 17.20  ? 106 VAL B O   1 
ATOM   2470  C  CB  . VAL B  1 106 ? -44.612  70.074  -29.302 1.00 25.43  ? 106 VAL B CB  1 
ATOM   2471  C  CG1 . VAL B  1 106 ? -45.035  69.787  -30.742 1.00 18.26  ? 106 VAL B CG1 1 
ATOM   2472  C  CG2 . VAL B  1 106 ? -43.156  70.339  -29.245 1.00 20.92  ? 106 VAL B CG2 1 
ATOM   2473  N  N   . SER B  1 107 ? -47.658  71.003  -29.499 1.00 24.67  ? 107 SER B N   1 
ATOM   2474  C  CA  . SER B  1 107 ? -49.086  70.748  -29.385 1.00 25.12  ? 107 SER B CA  1 
ATOM   2475  C  C   . SER B  1 107 ? -49.437  69.406  -28.735 1.00 35.38  ? 107 SER B C   1 
ATOM   2476  O  O   . SER B  1 107 ? -50.519  69.275  -28.137 1.00 28.22  ? 107 SER B O   1 
ATOM   2477  C  CB  . SER B  1 107 ? -49.759  70.867  -30.749 1.00 24.05  ? 107 SER B CB  1 
ATOM   2478  O  OG  . SER B  1 107 ? -49.259  69.899  -31.652 1.00 30.20  ? 107 SER B OG  1 
ATOM   2479  N  N   . ASP B  1 108 ? -48.533  68.425  -28.843 1.00 20.00  ? 108 ASP B N   1 
ATOM   2480  C  CA  . ASP B  1 108 ? -48.771  67.103  -28.259 1.00 20.57  ? 108 ASP B CA  1 
ATOM   2481  C  C   . ASP B  1 108 ? -48.350  66.988  -26.794 1.00 30.36  ? 108 ASP B C   1 
ATOM   2482  O  O   . ASP B  1 108 ? -48.452  65.916  -26.199 1.00 33.80  ? 108 ASP B O   1 
ATOM   2483  C  CB  . ASP B  1 108 ? -48.069  66.020  -29.075 1.00 16.51  ? 108 ASP B CB  1 
ATOM   2484  C  CG  . ASP B  1 108 ? -46.573  66.208  -29.121 1.00 41.90  ? 108 ASP B CG  1 
ATOM   2485  O  OD1 . ASP B  1 108 ? -46.068  67.107  -28.413 1.00 32.56  ? 108 ASP B OD1 1 
ATOM   2486  O  OD2 . ASP B  1 108 ? -45.895  65.449  -29.855 1.00 36.61  ? 108 ASP B OD2 1 
ATOM   2487  N  N   . GLY B  1 109 ? -47.861  68.087  -26.226 1.00 20.48  ? 109 GLY B N   1 
ATOM   2488  C  CA  . GLY B  1 109 ? -47.456  68.103  -24.833 1.00 23.09  ? 109 GLY B CA  1 
ATOM   2489  C  C   . GLY B  1 109 ? -45.982  67.824  -24.563 1.00 20.72  ? 109 GLY B C   1 
ATOM   2490  O  O   . GLY B  1 109 ? -45.566  67.743  -23.406 1.00 16.54  ? 109 GLY B O   1 
ATOM   2491  N  N   . GLU B  1 110 ? -45.183  67.673  -25.613 1.00 27.65  ? 110 GLU B N   1 
ATOM   2492  C  CA  . GLU B  1 110 ? -43.742  67.570  -25.405 1.00 29.29  ? 110 GLU B CA  1 
ATOM   2493  C  C   . GLU B  1 110 ? -43.157  68.936  -25.035 1.00 32.93  ? 110 GLU B C   1 
ATOM   2494  O  O   . GLU B  1 110 ? -43.596  69.978  -25.531 1.00 34.89  ? 110 GLU B O   1 
ATOM   2495  C  CB  . GLU B  1 110 ? -43.039  66.955  -26.608 1.00 50.45  ? 110 GLU B CB  1 
ATOM   2496  C  CG  . GLU B  1 110 ? -42.545  65.536  -26.357 1.00 71.55  ? 110 GLU B CG  1 
ATOM   2497  C  CD  . GLU B  1 110 ? -41.116  65.483  -25.828 1.00 78.91  ? 110 GLU B CD  1 
ATOM   2498  O  OE1 . GLU B  1 110 ? -40.345  66.439  -26.084 1.00 62.97  ? 110 GLU B OE1 1 
ATOM   2499  O  OE2 . GLU B  1 110 ? -40.766  64.480  -25.159 1.00 72.83  ? 110 GLU B OE2 1 
ATOM   2500  N  N   . VAL B  1 111 ? -42.191  68.920  -24.126 1.00 21.32  ? 111 VAL B N   1 
ATOM   2501  C  CA  . VAL B  1 111 ? -41.574  70.138  -23.633 1.00 17.55  ? 111 VAL B CA  1 
ATOM   2502  C  C   . VAL B  1 111 ? -40.056  70.074  -23.787 1.00 22.51  ? 111 VAL B C   1 
ATOM   2503  O  O   . VAL B  1 111 ? -39.441  69.079  -23.410 1.00 32.21  ? 111 VAL B O   1 
ATOM   2504  C  CB  . VAL B  1 111 ? -41.932  70.365  -22.154 1.00 23.84  ? 111 VAL B CB  1 
ATOM   2505  C  CG1 . VAL B  1 111 ? -41.490  71.740  -21.694 1.00 10.62  ? 111 VAL B CG1 1 
ATOM   2506  C  CG2 . VAL B  1 111 ? -43.436  70.226  -21.961 1.00 21.09  ? 111 VAL B CG2 1 
ATOM   2507  N  N   . LEU B  1 112 ? -39.473  71.117  -24.386 1.00 20.44  ? 112 LEU B N   1 
ATOM   2508  C  CA  . LEU B  1 112 ? -38.025  71.307  -24.402 1.00 21.78  ? 112 LEU B CA  1 
ATOM   2509  C  C   . LEU B  1 112 ? -37.743  72.503  -23.526 1.00 17.77  ? 112 LEU B C   1 
ATOM   2510  O  O   . LEU B  1 112 ? -38.406  73.528  -23.630 1.00 22.00  ? 112 LEU B O   1 
ATOM   2511  C  CB  . LEU B  1 112 ? -37.432  71.539  -25.826 1.00 17.04  ? 112 LEU B CB  1 
ATOM   2512  C  CG  . LEU B  1 112 ? -35.900  71.804  -25.890 1.00 43.10  ? 112 LEU B CG  1 
ATOM   2513  C  CD1 . LEU B  1 112 ? -35.131  70.605  -25.382 1.00 42.45  ? 112 LEU B CD1 1 
ATOM   2514  C  CD2 . LEU B  1 112 ? -35.311  72.209  -27.255 1.00 10.99  ? 112 LEU B CD2 1 
ATOM   2515  N  N   . TYR B  1 113 ? -36.763  72.352  -22.648 1.00 18.41  ? 113 TYR B N   1 
ATOM   2516  C  CA  . TYR B  1 113 ? -36.196  73.470  -21.925 1.00 18.01  ? 113 TYR B CA  1 
ATOM   2517  C  C   . TYR B  1 113 ? -34.679  73.302  -22.014 1.00 31.66  ? 113 TYR B C   1 
ATOM   2518  O  O   . TYR B  1 113 ? -34.141  72.239  -21.680 1.00 28.52  ? 113 TYR B O   1 
ATOM   2519  C  CB  . TYR B  1 113 ? -36.692  73.491  -20.469 1.00 9.87   ? 113 TYR B CB  1 
ATOM   2520  C  CG  . TYR B  1 113 ? -36.176  74.646  -19.629 1.00 22.08  ? 113 TYR B CG  1 
ATOM   2521  C  CD1 . TYR B  1 113 ? -36.196  75.953  -20.115 1.00 15.40  ? 113 TYR B CD1 1 
ATOM   2522  C  CD2 . TYR B  1 113 ? -35.693  74.431  -18.341 1.00 12.46  ? 113 TYR B CD2 1 
ATOM   2523  C  CE1 . TYR B  1 113 ? -35.731  77.015  -19.350 1.00 19.30  ? 113 TYR B CE1 1 
ATOM   2524  C  CE2 . TYR B  1 113 ? -35.229  75.487  -17.564 1.00 13.34  ? 113 TYR B CE2 1 
ATOM   2525  C  CZ  . TYR B  1 113 ? -35.250  76.775  -18.076 1.00 24.88  ? 113 TYR B CZ  1 
ATOM   2526  O  OH  . TYR B  1 113 ? -34.791  77.820  -17.309 1.00 16.88  ? 113 TYR B OH  1 
ATOM   2527  N  N   . MET B  1 114 ? -33.996  74.345  -22.484 1.00 25.50  ? 114 MET B N   1 
ATOM   2528  C  CA  . MET B  1 114 ? -32.541  74.305  -22.637 1.00 18.20  ? 114 MET B CA  1 
ATOM   2529  C  C   . MET B  1 114 ? -31.889  75.640  -22.292 1.00 23.77  ? 114 MET B C   1 
ATOM   2530  O  O   . MET B  1 114 ? -31.432  76.365  -23.180 1.00 6.98   ? 114 MET B O   1 
ATOM   2531  C  CB  . MET B  1 114 ? -32.183  73.914  -24.059 1.00 6.52   ? 114 MET B CB  1 
ATOM   2532  C  CG  . MET B  1 114 ? -30.770  73.485  -24.236 1.00 10.97  ? 114 MET B CG  1 
ATOM   2533  S  SD  . MET B  1 114 ? -30.512  72.574  -25.767 1.00 17.20  ? 114 MET B SD  1 
ATOM   2534  C  CE  . MET B  1 114 ? -30.938  73.820  -26.986 1.00 10.53  ? 114 MET B CE  1 
ATOM   2535  N  N   . PRO B  1 115 ? -31.844  75.970  -20.992 1.00 20.24  ? 115 PRO B N   1 
ATOM   2536  C  CA  . PRO B  1 115 ? -31.196  77.209  -20.569 1.00 18.77  ? 115 PRO B CA  1 
ATOM   2537  C  C   . PRO B  1 115 ? -29.671  77.048  -20.599 1.00 18.97  ? 115 PRO B C   1 
ATOM   2538  O  O   . PRO B  1 115 ? -29.143  75.938  -20.457 1.00 18.34  ? 115 PRO B O   1 
ATOM   2539  C  CB  . PRO B  1 115 ? -31.673  77.356  -19.127 1.00 6.65   ? 115 PRO B CB  1 
ATOM   2540  C  CG  . PRO B  1 115 ? -31.758  75.947  -18.660 1.00 7.14   ? 115 PRO B CG  1 
ATOM   2541  C  CD  . PRO B  1 115 ? -32.267  75.152  -19.843 1.00 3.47   ? 115 PRO B CD  1 
ATOM   2542  N  N   . SER B  1 116 ? -28.961  78.150  -20.786 1.00 16.52  ? 116 SER B N   1 
ATOM   2543  C  CA  . SER B  1 116 ? -27.520  78.119  -20.600 1.00 23.03  ? 116 SER B CA  1 
ATOM   2544  C  C   . SER B  1 116 ? -27.217  78.392  -19.130 1.00 22.81  ? 116 SER B C   1 
ATOM   2545  O  O   . SER B  1 116 ? -27.704  79.364  -18.553 1.00 25.99  ? 116 SER B O   1 
ATOM   2546  C  CB  . SER B  1 116 ? -26.817  79.139  -21.495 1.00 15.44  ? 116 SER B CB  1 
ATOM   2547  O  OG  . SER B  1 116 ? -25.408  78.966  -21.468 1.00 26.65  ? 116 SER B OG  1 
ATOM   2548  N  N   . ILE B  1 117 ? -26.414  77.524  -18.529 1.00 24.18  ? 117 ILE B N   1 
ATOM   2549  C  CA  . ILE B  1 117 ? -26.109  77.625  -17.121 1.00 18.06  ? 117 ILE B CA  1 
ATOM   2550  C  C   . ILE B  1 117 ? -24.608  77.724  -16.840 1.00 19.21  ? 117 ILE B C   1 
ATOM   2551  O  O   . ILE B  1 117 ? -23.798  77.012  -17.438 1.00 22.58  ? 117 ILE B O   1 
ATOM   2552  C  CB  . ILE B  1 117 ? -26.685  76.431  -16.363 1.00 28.48  ? 117 ILE B CB  1 
ATOM   2553  C  CG1 . ILE B  1 117 ? -28.212  76.460  -16.426 1.00 21.52  ? 117 ILE B CG1 1 
ATOM   2554  C  CG2 . ILE B  1 117 ? -26.189  76.420  -14.904 1.00 24.77  ? 117 ILE B CG2 1 
ATOM   2555  C  CD1 . ILE B  1 117 ? -28.854  75.236  -15.802 1.00 16.94  ? 117 ILE B CD1 1 
ATOM   2556  N  N   . ARG B  1 118 ? -24.254  78.638  -15.941 1.00 22.41  ? 118 ARG B N   1 
ATOM   2557  C  CA  . ARG B  1 118 ? -22.928  78.677  -15.356 1.00 14.97  ? 118 ARG B CA  1 
ATOM   2558  C  C   . ARG B  1 118 ? -23.013  78.175  -13.924 1.00 16.36  ? 118 ARG B C   1 
ATOM   2559  O  O   . ARG B  1 118 ? -23.789  78.692  -13.122 1.00 21.27  ? 118 ARG B O   1 
ATOM   2560  C  CB  . ARG B  1 118 ? -22.335  80.086  -15.385 1.00 13.08  ? 118 ARG B CB  1 
ATOM   2561  C  CG  . ARG B  1 118 ? -20.962  80.155  -14.712 1.00 15.63  ? 118 ARG B CG  1 
ATOM   2562  C  CD  . ARG B  1 118 ? -20.233  81.466  -14.984 1.00 24.87  ? 118 ARG B CD  1 
ATOM   2563  N  NE  . ARG B  1 118 ? -18.918  81.483  -14.358 1.00 32.90  ? 118 ARG B NE  1 
ATOM   2564  C  CZ  . ARG B  1 118 ? -18.001  82.428  -14.542 1.00 34.98  ? 118 ARG B CZ  1 
ATOM   2565  N  NH1 . ARG B  1 118 ? -18.239  83.463  -15.342 1.00 33.90  ? 118 ARG B NH1 1 
ATOM   2566  N  NH2 . ARG B  1 118 ? -16.837  82.337  -13.913 1.00 32.15  ? 118 ARG B NH2 1 
ATOM   2567  N  N   . GLN B  1 119 ? -22.199  77.173  -13.607 1.00 20.20  ? 119 GLN B N   1 
ATOM   2568  C  CA  . GLN B  1 119 ? -22.183  76.580  -12.276 1.00 27.61  ? 119 GLN B CA  1 
ATOM   2569  C  C   . GLN B  1 119 ? -20.778  76.051  -11.947 1.00 28.40  ? 119 GLN B C   1 
ATOM   2570  O  O   . GLN B  1 119 ? -20.086  75.562  -12.816 1.00 19.82  ? 119 GLN B O   1 
ATOM   2571  C  CB  . GLN B  1 119 ? -23.195  75.443  -12.251 1.00 21.05  ? 119 GLN B CB  1 
ATOM   2572  C  CG  . GLN B  1 119 ? -23.653  75.014  -10.884 1.00 25.62  ? 119 GLN B CG  1 
ATOM   2573  C  CD  . GLN B  1 119 ? -24.934  74.172  -10.943 1.00 30.79  ? 119 GLN B CD  1 
ATOM   2574  O  OE1 . GLN B  1 119 ? -25.264  73.586  -11.988 1.00 32.71  ? 119 GLN B OE1 1 
ATOM   2575  N  NE2 . GLN B  1 119 ? -25.663  74.116  -9.827  1.00 25.76  ? 119 GLN B NE2 1 
ATOM   2576  N  N   . ARG B  1 120 ? -20.336  76.175  -10.709 1.00 7.57   ? 120 ARG B N   1 
ATOM   2577  C  CA  . ARG B  1 120 ? -19.113  75.499  -10.277 1.00 10.34  ? 120 ARG B CA  1 
ATOM   2578  C  C   . ARG B  1 120 ? -19.405  74.065  -9.819  1.00 3.43   ? 120 ARG B C   1 
ATOM   2579  O  O   . ARG B  1 120 ? -20.454  73.795  -9.229  1.00 43.15  ? 120 ARG B O   1 
ATOM   2580  C  CB  . ARG B  1 120 ? -18.488  76.254  -9.105  1.00 14.22  ? 120 ARG B CB  1 
ATOM   2581  C  CG  . ARG B  1 120 ? -17.604  77.431  -9.473  1.00 33.88  ? 120 ARG B CG  1 
ATOM   2582  C  CD  . ARG B  1 120 ? -17.094  78.102  -8.207  1.00 64.14  ? 120 ARG B CD  1 
ATOM   2583  N  NE  . ARG B  1 120 ? -18.200  78.642  -7.414  1.00 96.30  ? 120 ARG B NE  1 
ATOM   2584  C  CZ  . ARG B  1 120 ? -18.122  78.979  -6.128  1.00 89.34  ? 120 ARG B CZ  1 
ATOM   2585  N  NH1 . ARG B  1 120 ? -16.980  78.826  -5.461  1.00 92.99  ? 120 ARG B NH1 1 
ATOM   2586  N  NH2 . ARG B  1 120 ? -19.195  79.464  -5.508  1.00 64.04  ? 120 ARG B NH2 1 
ATOM   2587  N  N   . PHE B  1 121 ? -18.478  73.150  -10.059 1.00 21.39  ? 121 PHE B N   1 
ATOM   2588  C  CA  . PHE B  1 121 ? -18.602  71.780  -9.551  1.00 23.13  ? 121 PHE B CA  1 
ATOM   2589  C  C   . PHE B  1 121 ? -17.375  71.310  -8.784  1.00 26.22  ? 121 PHE B C   1 
ATOM   2590  O  O   . PHE B  1 121 ? -16.255  71.780  -9.014  1.00 32.58  ? 121 PHE B O   1 
ATOM   2591  C  CB  . PHE B  1 121 ? -18.839  70.802  -10.686 1.00 21.70  ? 121 PHE B CB  1 
ATOM   2592  C  CG  . PHE B  1 121 ? -20.087  71.072  -11.469 1.00 36.63  ? 121 PHE B CG  1 
ATOM   2593  C  CD1 . PHE B  1 121 ? -21.279  70.470  -11.108 1.00 29.19  ? 121 PHE B CD1 1 
ATOM   2594  C  CD2 . PHE B  1 121 ? -20.072  71.924  -12.577 1.00 24.75  ? 121 PHE B CD2 1 
ATOM   2595  C  CE1 . PHE B  1 121 ? -22.427  70.706  -11.833 1.00 28.49  ? 121 PHE B CE1 1 
ATOM   2596  C  CE2 . PHE B  1 121 ? -21.214  72.169  -13.296 1.00 21.72  ? 121 PHE B CE2 1 
ATOM   2597  C  CZ  . PHE B  1 121 ? -22.395  71.561  -12.931 1.00 26.50  ? 121 PHE B CZ  1 
ATOM   2598  N  N   . SER B  1 122 ? -17.597  70.358  -7.885  1.00 22.67  ? 122 SER B N   1 
ATOM   2599  C  CA  . SER B  1 122 ? -16.507  69.612  -7.261  1.00 23.45  ? 122 SER B CA  1 
ATOM   2600  C  C   . SER B  1 122 ? -16.345  68.273  -7.978  1.00 27.45  ? 122 SER B C   1 
ATOM   2601  O  O   . SER B  1 122 ? -17.268  67.467  -8.010  1.00 35.00  ? 122 SER B O   1 
ATOM   2602  C  CB  . SER B  1 122 ? -16.785  69.389  -5.778  1.00 23.62  ? 122 SER B CB  1 
ATOM   2603  O  OG  . SER B  1 122 ? -16.218  68.170  -5.332  1.00 24.29  ? 122 SER B OG  1 
ATOM   2604  N  N   . CYS B  1 123 ? -15.176  68.049  -8.575  1.00 39.57  ? 123 CYS B N   1 
ATOM   2605  C  CA  . CYS B  1 123 ? -14.899  66.809  -9.300  1.00 28.94  ? 123 CYS B CA  1 
ATOM   2606  C  C   . CYS B  1 123 ? -13.406  66.656  -9.556  1.00 32.67  ? 123 CYS B C   1 
ATOM   2607  O  O   . CYS B  1 123 ? -12.620  67.555  -9.271  1.00 31.72  ? 123 CYS B O   1 
ATOM   2608  C  CB  . CYS B  1 123 ? -15.648  66.794  -10.633 1.00 33.86  ? 123 CYS B CB  1 
ATOM   2609  S  SG  . CYS B  1 123 ? -15.228  68.209  -11.662 1.00 37.52  ? 123 CYS B SG  1 
ATOM   2610  N  N   . ASP B  1 124 ? -13.030  65.515  -10.119 1.00 36.17  ? 124 ASP B N   1 
ATOM   2611  C  CA  . ASP B  1 124 ? -11.630  65.194  -10.362 1.00 28.06  ? 124 ASP B CA  1 
ATOM   2612  C  C   . ASP B  1 124 ? -11.010  66.064  -11.446 1.00 31.72  ? 124 ASP B C   1 
ATOM   2613  O  O   . ASP B  1 124 ? -11.264  65.856  -12.624 1.00 28.16  ? 124 ASP B O   1 
ATOM   2614  C  CB  . ASP B  1 124 ? -11.490  63.726  -10.771 1.00 32.97  ? 124 ASP B CB  1 
ATOM   2615  C  CG  . ASP B  1 124 ? -10.086  63.209  -10.577 1.00 38.98  ? 124 ASP B CG  1 
ATOM   2616  O  OD1 . ASP B  1 124 ? -9.185   64.030  -10.294 1.00 34.30  ? 124 ASP B OD1 1 
ATOM   2617  O  OD2 . ASP B  1 124 ? -9.896   61.984  -10.700 1.00 43.13  ? 124 ASP B OD2 1 
ATOM   2618  N  N   . VAL B  1 125 ? -10.182  67.021  -11.044 1.00 27.52  ? 125 VAL B N   1 
ATOM   2619  C  CA  . VAL B  1 125 ? -9.530   67.898  -12.000 1.00 27.73  ? 125 VAL B CA  1 
ATOM   2620  C  C   . VAL B  1 125 ? -8.100   67.419  -12.275 1.00 31.85  ? 125 VAL B C   1 
ATOM   2621  O  O   . VAL B  1 125 ? -7.398   67.970  -13.127 1.00 29.32  ? 125 VAL B O   1 
ATOM   2622  C  CB  . VAL B  1 125 ? -9.531   69.341  -11.490 1.00 27.32  ? 125 VAL B CB  1 
ATOM   2623  C  CG1 . VAL B  1 125 ? -8.993   70.253  -12.521 1.00 27.50  ? 125 VAL B CG1 1 
ATOM   2624  C  CG2 . VAL B  1 125 ? -10.933  69.758  -11.155 1.00 27.51  ? 125 VAL B CG2 1 
ATOM   2625  N  N   . SER B  1 126 ? -7.676   66.384  -11.553 1.00 29.47  ? 126 SER B N   1 
ATOM   2626  C  CA  . SER B  1 126 ? -6.305   65.896  -11.670 1.00 39.23  ? 126 SER B CA  1 
ATOM   2627  C  C   . SER B  1 126 ? -6.009   65.552  -13.133 1.00 45.12  ? 126 SER B C   1 
ATOM   2628  O  O   . SER B  1 126 ? -6.865   65.023  -13.845 1.00 40.07  ? 126 SER B O   1 
ATOM   2629  C  CB  . SER B  1 126 ? -6.066   64.678  -10.770 1.00 31.17  ? 126 SER B CB  1 
ATOM   2630  O  OG  . SER B  1 126 ? -6.556   63.491  -11.369 1.00 47.60  ? 126 SER B OG  1 
ATOM   2631  N  N   . GLY B  1 127 ? -4.798   65.873  -13.582 1.00 37.88  ? 127 GLY B N   1 
ATOM   2632  C  CA  . GLY B  1 127 ? -4.381   65.566  -14.939 1.00 32.61  ? 127 GLY B CA  1 
ATOM   2633  C  C   . GLY B  1 127 ? -4.861   66.545  -15.998 1.00 45.83  ? 127 GLY B C   1 
ATOM   2634  O  O   . GLY B  1 127 ? -4.571   66.364  -17.176 1.00 32.59  ? 127 GLY B O   1 
ATOM   2635  N  N   . VAL B  1 128 ? -5.589   67.582  -15.586 1.00 37.03  ? 128 VAL B N   1 
ATOM   2636  C  CA  . VAL B  1 128 ? -6.120   68.565  -16.528 1.00 30.59  ? 128 VAL B CA  1 
ATOM   2637  C  C   . VAL B  1 128 ? -5.048   69.100  -17.460 1.00 31.51  ? 128 VAL B C   1 
ATOM   2638  O  O   . VAL B  1 128 ? -5.326   69.460  -18.600 1.00 34.36  ? 128 VAL B O   1 
ATOM   2639  C  CB  . VAL B  1 128 ? -6.804   69.751  -15.822 1.00 29.63  ? 128 VAL B CB  1 
ATOM   2640  C  CG1 . VAL B  1 128 ? -5.847   70.492  -14.911 1.00 30.05  ? 128 VAL B CG1 1 
ATOM   2641  C  CG2 . VAL B  1 128 ? -7.368   70.693  -16.859 1.00 29.14  ? 128 VAL B CG2 1 
ATOM   2642  N  N   . ASP B  1 129 ? -3.814   69.148  -16.979 1.00 32.45  ? 129 ASP B N   1 
ATOM   2643  C  CA  . ASP B  1 129 ? -2.739   69.708  -17.780 1.00 35.62  ? 129 ASP B CA  1 
ATOM   2644  C  C   . ASP B  1 129 ? -1.828   68.640  -18.368 1.00 34.66  ? 129 ASP B C   1 
ATOM   2645  O  O   . ASP B  1 129 ? -0.613   68.826  -18.435 1.00 35.76  ? 129 ASP B O   1 
ATOM   2646  C  CB  . ASP B  1 129 ? -1.916   70.683  -16.949 1.00 45.19  ? 129 ASP B CB  1 
ATOM   2647  C  CG  . ASP B  1 129 ? -1.300   71.790  -17.788 1.00 60.68  ? 129 ASP B CG  1 
ATOM   2648  O  OD1 . ASP B  1 129 ? -1.168   71.610  -19.019 1.00 41.02  ? 129 ASP B OD1 1 
ATOM   2649  O  OD2 . ASP B  1 129 ? -0.956   72.844  -17.207 1.00 75.46  ? 129 ASP B OD2 1 
ATOM   2650  N  N   . THR B  1 130 ? -2.419   67.528  -18.797 1.00 34.52  ? 130 THR B N   1 
ATOM   2651  C  CA  . THR B  1 130 ? -1.667   66.447  -19.446 1.00 38.31  ? 130 THR B CA  1 
ATOM   2652  C  C   . THR B  1 130 ? -2.317   66.067  -20.779 1.00 42.48  ? 130 THR B C   1 
ATOM   2653  O  O   . THR B  1 130 ? -3.421   66.499  -21.073 1.00 38.47  ? 130 THR B O   1 
ATOM   2654  C  CB  . THR B  1 130 ? -1.547   65.219  -18.520 1.00 47.28  ? 130 THR B CB  1 
ATOM   2655  O  OG1 . THR B  1 130 ? -2.823   64.570  -18.401 1.00 43.61  ? 130 THR B OG1 1 
ATOM   2656  C  CG2 . THR B  1 130 ? -1.065   65.648  -17.126 1.00 35.92  ? 130 THR B CG2 1 
ATOM   2657  N  N   . GLU B  1 131 ? -1.644   65.290  -21.617 1.00 40.19  ? 131 GLU B N   1 
ATOM   2658  C  CA  . GLU B  1 131 ? -2.250   65.022  -22.928 1.00 69.38  ? 131 GLU B CA  1 
ATOM   2659  C  C   . GLU B  1 131 ? -3.588   64.281  -22.800 1.00 51.58  ? 131 GLU B C   1 
ATOM   2660  O  O   . GLU B  1 131 ? -4.458   64.434  -23.655 1.00 32.61  ? 131 GLU B O   1 
ATOM   2661  C  CB  . GLU B  1 131 ? -1.300   64.301  -23.907 1.00 68.34  ? 131 GLU B CB  1 
ATOM   2662  C  CG  . GLU B  1 131 ? -1.666   64.514  -25.396 1.00 68.78  ? 131 GLU B CG  1 
ATOM   2663  C  CD  . GLU B  1 131 ? -0.720   65.473  -26.135 1.00 69.86  ? 131 GLU B CD  1 
ATOM   2664  O  OE1 . GLU B  1 131 ? 0.410    65.017  -26.421 1.00 71.70  ? 131 GLU B OE1 1 
ATOM   2665  O  OE2 . GLU B  1 131 ? -1.093   66.654  -26.438 1.00 26.79  ? 131 GLU B OE2 1 
ATOM   2666  N  N   . SER B  1 132 ? -3.750   63.503  -21.728 1.00 23.10  ? 132 SER B N   1 
ATOM   2667  C  CA  . SER B  1 132 ? -4.949   62.686  -21.542 1.00 28.18  ? 132 SER B CA  1 
ATOM   2668  C  C   . SER B  1 132 ? -6.028   63.435  -20.794 1.00 30.69  ? 132 SER B C   1 
ATOM   2669  O  O   . SER B  1 132 ? -7.186   63.023  -20.798 1.00 51.56  ? 132 SER B O   1 
ATOM   2670  C  CB  . SER B  1 132 ? -4.628   61.382  -20.814 1.00 8.77   ? 132 SER B CB  1 
ATOM   2671  O  OG  . SER B  1 132 ? -3.662   61.614  -19.813 1.00 48.38  ? 132 SER B OG  1 
ATOM   2672  N  N   . GLY B  1 133 ? -5.628   64.521  -20.137 1.00 42.63  ? 133 GLY B N   1 
ATOM   2673  C  CA  . GLY B  1 133 ? -6.550   65.460  -19.510 1.00 29.42  ? 133 GLY B CA  1 
ATOM   2674  C  C   . GLY B  1 133 ? -7.198   65.003  -18.215 1.00 31.48  ? 133 GLY B C   1 
ATOM   2675  O  O   . GLY B  1 133 ? -6.922   63.919  -17.704 1.00 34.05  ? 133 GLY B O   1 
ATOM   2676  N  N   . ALA B  1 134 ? -8.069   65.848  -17.683 1.00 30.48  ? 134 ALA B N   1 
ATOM   2677  C  CA  . ALA B  1 134 ? -8.860   65.487  -16.514 1.00 34.61  ? 134 ALA B CA  1 
ATOM   2678  C  C   . ALA B  1 134 ? -10.197  64.905  -16.948 1.00 35.97  ? 134 ALA B C   1 
ATOM   2679  O  O   . ALA B  1 134 ? -10.695  65.187  -18.041 1.00 38.23  ? 134 ALA B O   1 
ATOM   2680  C  CB  . ALA B  1 134 ? -9.077   66.697  -15.623 1.00 24.13  ? 134 ALA B CB  1 
ATOM   2681  N  N   . THR B  1 135 ? -10.777  64.078  -16.094 1.00 32.06  ? 135 THR B N   1 
ATOM   2682  C  CA  . THR B  1 135 ? -12.136  63.596  -16.328 1.00 30.57  ? 135 THR B CA  1 
ATOM   2683  C  C   . THR B  1 135 ? -13.042  63.976  -15.167 1.00 26.35  ? 135 THR B C   1 
ATOM   2684  O  O   . THR B  1 135 ? -12.973  63.385  -14.086 1.00 23.03  ? 135 THR B O   1 
ATOM   2685  C  CB  . THR B  1 135 ? -12.186  62.085  -16.553 1.00 28.86  ? 135 THR B CB  1 
ATOM   2686  O  OG1 . THR B  1 135 ? -11.541  61.780  -17.797 1.00 32.51  ? 135 THR B OG1 1 
ATOM   2687  C  CG2 . THR B  1 135 ? -13.635  61.609  -16.597 1.00 24.37  ? 135 THR B CG2 1 
ATOM   2688  N  N   . CYS B  1 136 ? -13.879  64.979  -15.411 1.00 22.38  ? 136 CYS B N   1 
ATOM   2689  C  CA  . CYS B  1 136 ? -14.744  65.557  -14.400 1.00 21.59  ? 136 CYS B CA  1 
ATOM   2690  C  C   . CYS B  1 136 ? -16.143  64.961  -14.496 1.00 31.09  ? 136 CYS B C   1 
ATOM   2691  O  O   . CYS B  1 136 ? -16.832  65.125  -15.501 1.00 24.57  ? 136 CYS B O   1 
ATOM   2692  C  CB  . CYS B  1 136 ? -14.800  67.065  -14.614 1.00 21.08  ? 136 CYS B CB  1 
ATOM   2693  S  SG  . CYS B  1 136 ? -15.914  67.916  -13.525 1.00 32.78  ? 136 CYS B SG  1 
ATOM   2694  N  N   . ARG B  1 137 ? -16.573  64.266  -13.454 1.00 20.57  ? 137 ARG B N   1 
ATOM   2695  C  CA  . ARG B  1 137 ? -17.878  63.616  -13.489 1.00 27.12  ? 137 ARG B CA  1 
ATOM   2696  C  C   . ARG B  1 137 ? -18.979  64.480  -12.822 1.00 18.32  ? 137 ARG B C   1 
ATOM   2697  O  O   . ARG B  1 137 ? -18.883  64.816  -11.638 1.00 33.78  ? 137 ARG B O   1 
ATOM   2698  C  CB  . ARG B  1 137 ? -17.772  62.211  -12.867 1.00 14.94  ? 137 ARG B CB  1 
ATOM   2699  C  CG  . ARG B  1 137 ? -19.059  61.364  -12.890 1.00 42.22  ? 137 ARG B CG  1 
ATOM   2700  C  CD  . ARG B  1 137 ? -18.995  60.199  -11.887 1.00 56.75  ? 137 ARG B CD  1 
ATOM   2701  N  NE  . ARG B  1 137 ? -18.907  60.658  -10.495 1.00 66.62  ? 137 ARG B NE  1 
ATOM   2702  C  CZ  . ARG B  1 137 ? -17.895  60.400  -9.666  1.00 58.75  ? 137 ARG B CZ  1 
ATOM   2703  N  NH1 . ARG B  1 137 ? -16.857  59.667  -10.063 1.00 27.58  ? 137 ARG B NH1 1 
ATOM   2704  N  NH2 . ARG B  1 137 ? -17.929  60.871  -8.427  1.00 69.86  ? 137 ARG B NH2 1 
ATOM   2705  N  N   . ILE B  1 138 ? -20.008  64.844  -13.589 1.00 25.07  ? 138 ILE B N   1 
ATOM   2706  C  CA  . ILE B  1 138 ? -21.142  65.614  -13.063 1.00 31.97  ? 138 ILE B CA  1 
ATOM   2707  C  C   . ILE B  1 138 ? -22.432  64.777  -12.964 1.00 24.49  ? 138 ILE B C   1 
ATOM   2708  O  O   . ILE B  1 138 ? -22.900  64.224  -13.956 1.00 18.01  ? 138 ILE B O   1 
ATOM   2709  C  CB  . ILE B  1 138 ? -21.425  66.865  -13.914 1.00 29.65  ? 138 ILE B CB  1 
ATOM   2710  C  CG1 . ILE B  1 138 ? -20.244  67.828  -13.855 1.00 18.13  ? 138 ILE B CG1 1 
ATOM   2711  C  CG2 . ILE B  1 138 ? -22.677  67.554  -13.429 1.00 17.27  ? 138 ILE B CG2 1 
ATOM   2712  C  CD1 . ILE B  1 138 ? -20.358  68.961  -14.838 1.00 17.86  ? 138 ILE B CD1 1 
ATOM   2713  N  N   . LYS B  1 139 ? -23.000  64.698  -11.763 1.00 22.81  ? 139 LYS B N   1 
ATOM   2714  C  CA  . LYS B  1 139 ? -24.164  63.860  -11.497 1.00 22.81  ? 139 LYS B CA  1 
ATOM   2715  C  C   . LYS B  1 139 ? -25.422  64.707  -11.343 1.00 27.89  ? 139 LYS B C   1 
ATOM   2716  O  O   . LYS B  1 139 ? -25.503  65.561  -10.463 1.00 25.38  ? 139 LYS B O   1 
ATOM   2717  C  CB  . LYS B  1 139 ? -23.925  63.030  -10.241 1.00 21.64  ? 139 LYS B CB  1 
ATOM   2718  C  CG  . LYS B  1 139 ? -25.085  62.184  -9.760  1.00 21.14  ? 139 LYS B CG  1 
ATOM   2719  C  CD  . LYS B  1 139 ? -24.723  61.542  -8.422  1.00 18.89  ? 139 LYS B CD  1 
ATOM   2720  C  CE  . LYS B  1 139 ? -25.899  60.794  -7.806  1.00 32.87  ? 139 LYS B CE  1 
ATOM   2721  N  NZ  . LYS B  1 139 ? -25.543  60.202  -6.490  1.00 19.58  ? 139 LYS B NZ  1 
ATOM   2722  N  N   . ILE B  1 140 ? -26.393  64.460  -12.218 1.00 16.77  ? 140 ILE B N   1 
ATOM   2723  C  CA  . ILE B  1 140 ? -27.655  65.192  -12.216 1.00 20.93  ? 140 ILE B CA  1 
ATOM   2724  C  C   . ILE B  1 140 ? -28.844  64.252  -12.146 1.00 18.85  ? 140 ILE B C   1 
ATOM   2725  O  O   . ILE B  1 140 ? -28.913  63.285  -12.892 1.00 24.88  ? 140 ILE B O   1 
ATOM   2726  C  CB  . ILE B  1 140 ? -27.808  66.028  -13.472 1.00 20.54  ? 140 ILE B CB  1 
ATOM   2727  C  CG1 . ILE B  1 140 ? -26.683  67.064  -13.559 1.00 28.82  ? 140 ILE B CG1 1 
ATOM   2728  C  CG2 . ILE B  1 140 ? -29.172  66.708  -13.484 1.00 15.66  ? 140 ILE B CG2 1 
ATOM   2729  C  CD1 . ILE B  1 140 ? -26.751  67.908  -14.808 1.00 37.14  ? 140 ILE B CD1 1 
ATOM   2730  N  N   . GLY B  1 141 ? -29.776  64.541  -11.243 1.00 26.25  ? 141 GLY B N   1 
ATOM   2731  C  CA  . GLY B  1 141 ? -30.967  63.723  -11.077 1.00 30.48  ? 141 GLY B CA  1 
ATOM   2732  C  C   . GLY B  1 141 ? -32.078  64.479  -10.383 1.00 15.06  ? 141 GLY B C   1 
ATOM   2733  O  O   . GLY B  1 141 ? -31.875  65.603  -9.955  1.00 14.87  ? 141 GLY B O   1 
ATOM   2734  N  N   . SER B  1 142 ? -33.258  63.878  -10.299 1.00 21.35  ? 142 SER B N   1 
ATOM   2735  C  CA  . SER B  1 142 ? -34.352  64.475  -9.538  1.00 22.67  ? 142 SER B CA  1 
ATOM   2736  C  C   . SER B  1 142 ? -33.958  64.495  -8.074  1.00 26.75  ? 142 SER B C   1 
ATOM   2737  O  O   . SER B  1 142 ? -33.370  63.535  -7.568  1.00 30.75  ? 142 SER B O   1 
ATOM   2738  C  CB  . SER B  1 142 ? -35.642  63.668  -9.708  1.00 30.51  ? 142 SER B CB  1 
ATOM   2739  O  OG  . SER B  1 142 ? -36.644  64.137  -8.827  1.00 16.69  ? 142 SER B OG  1 
ATOM   2740  N  N   . TRP B  1 143 ? -34.275  65.582  -7.386  1.00 24.09  ? 143 TRP B N   1 
ATOM   2741  C  CA  . TRP B  1 143 ? -33.918  65.684  -5.989  1.00 15.18  ? 143 TRP B CA  1 
ATOM   2742  C  C   . TRP B  1 143 ? -34.894  64.924  -5.100  1.00 20.77  ? 143 TRP B C   1 
ATOM   2743  O  O   . TRP B  1 143 ? -34.471  64.204  -4.192  1.00 26.02  ? 143 TRP B O   1 
ATOM   2744  C  CB  . TRP B  1 143 ? -33.790  67.146  -5.557  1.00 15.09  ? 143 TRP B CB  1 
ATOM   2745  C  CG  . TRP B  1 143 ? -32.978  67.316  -4.298  1.00 20.45  ? 143 TRP B CG  1 
ATOM   2746  C  CD1 . TRP B  1 143 ? -33.423  67.740  -3.082  1.00 30.24  ? 143 TRP B CD1 1 
ATOM   2747  C  CD2 . TRP B  1 143 ? -31.582  67.030  -4.135  1.00 20.03  ? 143 TRP B CD2 1 
ATOM   2748  N  NE1 . TRP B  1 143 ? -32.389  67.742  -2.172  1.00 16.85  ? 143 TRP B NE1 1 
ATOM   2749  C  CE2 . TRP B  1 143 ? -31.251  67.312  -2.797  1.00 21.72  ? 143 TRP B CE2 1 
ATOM   2750  C  CE3 . TRP B  1 143 ? -30.580  66.564  -4.994  1.00 21.94  ? 143 TRP B CE3 1 
ATOM   2751  C  CZ2 . TRP B  1 143 ? -29.963  67.152  -2.301  1.00 34.38  ? 143 TRP B CZ2 1 
ATOM   2752  C  CZ3 . TRP B  1 143 ? -29.313  66.397  -4.504  1.00 16.94  ? 143 TRP B CZ3 1 
ATOM   2753  C  CH2 . TRP B  1 143 ? -29.010  66.691  -3.169  1.00 20.83  ? 143 TRP B CH2 1 
ATOM   2754  N  N   . THR B  1 144 ? -36.191  65.065  -5.363  1.00 15.00  ? 144 THR B N   1 
ATOM   2755  C  CA  . THR B  1 144 ? -37.212  64.490  -4.461  1.00 19.66  ? 144 THR B CA  1 
ATOM   2756  C  C   . THR B  1 144 ? -38.090  63.393  -5.054  1.00 15.12  ? 144 THR B C   1 
ATOM   2757  O  O   . THR B  1 144 ? -38.753  62.663  -4.322  1.00 34.13  ? 144 THR B O   1 
ATOM   2758  C  CB  . THR B  1 144 ? -38.136  65.570  -3.872  1.00 15.05  ? 144 THR B CB  1 
ATOM   2759  O  OG1 . THR B  1 144 ? -38.898  66.188  -4.925  1.00 14.52  ? 144 THR B OG1 1 
ATOM   2760  C  CG2 . THR B  1 144 ? -37.306  66.628  -3.130  1.00 24.61  ? 144 THR B CG2 1 
ATOM   2761  N  N   . HIS B  1 145 ? -38.079  63.264  -6.373  1.00 14.64  ? 145 HIS B N   1 
ATOM   2762  C  CA  . HIS B  1 145 ? -38.870  62.247  -7.055  1.00 14.53  ? 145 HIS B CA  1 
ATOM   2763  C  C   . HIS B  1 145 ? -38.108  60.952  -7.379  1.00 15.10  ? 145 HIS B C   1 
ATOM   2764  O  O   . HIS B  1 145 ? -37.139  60.950  -8.125  1.00 31.77  ? 145 HIS B O   1 
ATOM   2765  C  CB  . HIS B  1 145 ? -39.461  62.829  -8.339  1.00 16.57  ? 145 HIS B CB  1 
ATOM   2766  C  CG  . HIS B  1 145 ? -40.438  63.943  -8.108  1.00 34.32  ? 145 HIS B CG  1 
ATOM   2767  N  ND1 . HIS B  1 145 ? -41.720  63.724  -7.640  1.00 28.94  ? 145 HIS B ND1 1 
ATOM   2768  C  CD2 . HIS B  1 145 ? -40.324  65.282  -8.290  1.00 12.85  ? 145 HIS B CD2 1 
ATOM   2769  C  CE1 . HIS B  1 145 ? -42.351  64.882  -7.539  1.00 28.98  ? 145 HIS B CE1 1 
ATOM   2770  N  NE2 . HIS B  1 145 ? -41.529  65.841  -7.932  1.00 36.35  ? 145 HIS B NE2 1 
ATOM   2771  N  N   . HIS B  1 146 ? -38.568  59.842  -6.830  1.00 15.66  ? 146 HIS B N   1 
ATOM   2772  C  CA  . HIS B  1 146 ? -37.954  58.546  -7.085  1.00 16.33  ? 146 HIS B CA  1 
ATOM   2773  C  C   . HIS B  1 146 ? -38.284  57.997  -8.479  1.00 19.47  ? 146 HIS B C   1 
ATOM   2774  O  O   . HIS B  1 146 ? -38.946  58.659  -9.273  1.00 15.50  ? 146 HIS B O   1 
ATOM   2775  C  CB  . HIS B  1 146 ? -38.319  57.537  -5.980  1.00 17.13  ? 146 HIS B CB  1 
ATOM   2776  C  CG  . HIS B  1 146 ? -39.794  57.373  -5.754  1.00 38.59  ? 146 HIS B CG  1 
ATOM   2777  N  ND1 . HIS B  1 146 ? -40.621  56.736  -6.656  1.00 43.87  ? 146 HIS B ND1 1 
ATOM   2778  C  CD2 . HIS B  1 146 ? -40.590  57.755  -4.724  1.00 24.18  ? 146 HIS B CD2 1 
ATOM   2779  C  CE1 . HIS B  1 146 ? -41.860  56.737  -6.199  1.00 30.73  ? 146 HIS B CE1 1 
ATOM   2780  N  NE2 . HIS B  1 146 ? -41.868  57.345  -5.025  1.00 32.42  ? 146 HIS B NE2 1 
ATOM   2781  N  N   . SER B  1 147 ? -37.825  56.778  -8.757  1.00 19.16  ? 147 SER B N   1 
ATOM   2782  C  CA  . SER B  1 147 ? -37.795  56.229  -10.117 1.00 27.91  ? 147 SER B CA  1 
ATOM   2783  C  C   . SER B  1 147 ? -39.176  55.881  -10.639 1.00 24.87  ? 147 SER B C   1 
ATOM   2784  O  O   . SER B  1 147 ? -39.409  55.759  -11.839 1.00 24.12  ? 147 SER B O   1 
ATOM   2785  C  CB  . SER B  1 147 ? -36.906  54.984  -10.176 1.00 24.51  ? 147 SER B CB  1 
ATOM   2786  O  OG  . SER B  1 147 ? -37.440  53.938  -9.389  1.00 34.74  ? 147 SER B OG  1 
ATOM   2787  N  N   . ARG B  1 148 ? -40.072  55.680  -9.696  1.00 7.72   ? 148 ARG B N   1 
ATOM   2788  C  CA  . ARG B  1 148 ? -41.469  55.445  -9.979  1.00 26.42  ? 148 ARG B CA  1 
ATOM   2789  C  C   . ARG B  1 148 ? -42.167  56.732  -10.386 1.00 31.77  ? 148 ARG B C   1 
ATOM   2790  O  O   . ARG B  1 148 ? -43.225  56.699  -11.003 1.00 14.21  ? 148 ARG B O   1 
ATOM   2791  C  CB  . ARG B  1 148 ? -42.151  54.824  -8.759  1.00 1.62   ? 148 ARG B CB  1 
ATOM   2792  C  CG  . ARG B  1 148 ? -41.854  53.327  -8.625  1.00 18.70  ? 148 ARG B CG  1 
ATOM   2793  C  CD  . ARG B  1 148 ? -42.942  52.603  -7.864  1.00 41.14  ? 148 ARG B CD  1 
ATOM   2794  N  NE  . ARG B  1 148 ? -42.984  53.025  -6.463  1.00 77.85  ? 148 ARG B NE  1 
ATOM   2795  C  CZ  . ARG B  1 148 ? -44.038  53.578  -5.862  1.00 60.99  ? 148 ARG B CZ  1 
ATOM   2796  N  NH1 . ARG B  1 148 ? -45.177  53.783  -6.522  1.00 48.89  ? 148 ARG B NH1 1 
ATOM   2797  N  NH2 . ARG B  1 148 ? -43.948  53.922  -4.587  1.00 20.23  ? 148 ARG B NH2 1 
ATOM   2798  N  N   . GLU B  1 149 ? -41.563  57.867  -10.063 1.00 34.11  ? 149 GLU B N   1 
ATOM   2799  C  CA  . GLU B  1 149 ? -42.166  59.146  -10.422 1.00 10.87  ? 149 GLU B CA  1 
ATOM   2800  C  C   . GLU B  1 149 ? -41.385  59.845  -11.527 1.00 24.01  ? 149 GLU B C   1 
ATOM   2801  O  O   . GLU B  1 149 ? -41.977  60.353  -12.477 1.00 26.22  ? 149 GLU B O   1 
ATOM   2802  C  CB  . GLU B  1 149 ? -42.295  60.041  -9.188  1.00 24.34  ? 149 GLU B CB  1 
ATOM   2803  C  CG  . GLU B  1 149 ? -43.007  59.354  -8.012  1.00 34.13  ? 149 GLU B CG  1 
ATOM   2804  C  CD  . GLU B  1 149 ? -43.230  60.265  -6.816  1.00 33.24  ? 149 GLU B CD  1 
ATOM   2805  O  OE1 . GLU B  1 149 ? -42.377  61.141  -6.562  1.00 26.42  ? 149 GLU B OE1 1 
ATOM   2806  O  OE2 . GLU B  1 149 ? -44.269  60.103  -6.136  1.00 30.27  ? 149 GLU B OE2 1 
ATOM   2807  N  N   . ILE B  1 150 ? -40.057  59.872  -11.403 1.00 26.79  ? 150 ILE B N   1 
ATOM   2808  C  CA  . ILE B  1 150 ? -39.204  60.451  -12.441 1.00 24.95  ? 150 ILE B CA  1 
ATOM   2809  C  C   . ILE B  1 150 ? -38.049  59.533  -12.811 1.00 25.64  ? 150 ILE B C   1 
ATOM   2810  O  O   . ILE B  1 150 ? -37.347  59.006  -11.943 1.00 29.34  ? 150 ILE B O   1 
ATOM   2811  C  CB  . ILE B  1 150 ? -38.600  61.829  -12.058 1.00 18.17  ? 150 ILE B CB  1 
ATOM   2812  C  CG1 . ILE B  1 150 ? -39.674  62.921  -12.105 1.00 24.95  ? 150 ILE B CG1 1 
ATOM   2813  C  CG2 . ILE B  1 150 ? -37.494  62.178  -13.029 1.00 11.36  ? 150 ILE B CG2 1 
ATOM   2814  C  CD1 . ILE B  1 150 ? -39.158  64.303  -11.833 1.00 19.19  ? 150 ILE B CD1 1 
ATOM   2815  N  N   . SER B  1 151 ? -37.861  59.355  -14.114 1.00 29.47  ? 151 SER B N   1 
ATOM   2816  C  CA  . SER B  1 151 ? -36.721  58.630  -14.636 1.00 36.80  ? 151 SER B CA  1 
ATOM   2817  C  C   . SER B  1 151 ? -35.937  59.566  -15.539 1.00 31.47  ? 151 SER B C   1 
ATOM   2818  O  O   . SER B  1 151 ? -36.531  60.295  -16.335 1.00 16.55  ? 151 SER B O   1 
ATOM   2819  C  CB  . SER B  1 151 ? -37.169  57.400  -15.414 1.00 10.90  ? 151 SER B CB  1 
ATOM   2820  O  OG  . SER B  1 151 ? -37.472  57.754  -16.735 1.00 32.60  ? 151 SER B OG  1 
ATOM   2821  N  N   . VAL B  1 152 ? -34.610  59.556  -15.400 1.00 11.66  ? 152 VAL B N   1 
ATOM   2822  C  CA  . VAL B  1 152 ? -33.783  60.412  -16.214 1.00 18.92  ? 152 VAL B CA  1 
ATOM   2823  C  C   . VAL B  1 152 ? -32.979  59.573  -17.171 1.00 22.10  ? 152 VAL B C   1 
ATOM   2824  O  O   . VAL B  1 152 ? -32.496  58.505  -16.812 1.00 29.21  ? 152 VAL B O   1 
ATOM   2825  C  CB  . VAL B  1 152 ? -32.809  61.238  -15.376 1.00 25.75  ? 152 VAL B CB  1 
ATOM   2826  C  CG1 . VAL B  1 152 ? -33.555  62.344  -14.634 1.00 21.76  ? 152 VAL B CG1 1 
ATOM   2827  C  CG2 . VAL B  1 152 ? -32.038  60.335  -14.427 1.00 35.02  ? 152 VAL B CG2 1 
ATOM   2828  N  N   . ASP B  1 153 ? -32.823  60.069  -18.391 1.00 31.80  ? 153 ASP B N   1 
ATOM   2829  C  CA  . ASP B  1 153 ? -32.024  59.383  -19.392 1.00 23.80  ? 153 ASP B CA  1 
ATOM   2830  C  C   . ASP B  1 153 ? -31.256  60.369  -20.260 1.00 21.04  ? 153 ASP B C   1 
ATOM   2831  O  O   . ASP B  1 153 ? -31.688  61.500  -20.480 1.00 38.07  ? 153 ASP B O   1 
ATOM   2832  C  CB  . ASP B  1 153 ? -32.911  58.470  -20.246 1.00 14.14  ? 153 ASP B CB  1 
ATOM   2833  C  CG  . ASP B  1 153 ? -33.178  57.134  -19.585 1.00 50.87  ? 153 ASP B CG  1 
ATOM   2834  O  OD1 . ASP B  1 153 ? -34.166  57.018  -18.837 1.00 61.60  ? 153 ASP B OD1 1 
ATOM   2835  O  OD2 . ASP B  1 153 ? -32.397  56.194  -19.813 1.00 63.45  ? 153 ASP B OD2 1 
ATOM   2836  N  N   . PRO B  1 154 ? -30.091  59.946  -20.748 1.00 38.81  ? 154 PRO B N   1 
ATOM   2837  C  CA  . PRO B  1 154 ? -29.311  60.759  -21.691 1.00 39.51  ? 154 PRO B CA  1 
ATOM   2838  C  C   . PRO B  1 154 ? -30.049  60.851  -23.026 1.00 44.27  ? 154 PRO B C   1 
ATOM   2839  O  O   . PRO B  1 154 ? -30.911  60.024  -23.300 1.00 40.43  ? 154 PRO B O   1 
ATOM   2840  C  CB  . PRO B  1 154 ? -28.001  59.975  -21.826 1.00 35.23  ? 154 PRO B CB  1 
ATOM   2841  C  CG  . PRO B  1 154 ? -27.955  59.082  -20.604 1.00 42.62  ? 154 PRO B CG  1 
ATOM   2842  C  CD  . PRO B  1 154 ? -29.375  58.731  -20.330 1.00 35.52  ? 154 PRO B CD  1 
ATOM   2843  N  N   . THR B  1 155 ? -29.764  61.877  -23.819 1.00 51.06  ? 155 THR B N   1 
ATOM   2844  C  CA  . THR B  1 155 ? -30.487  62.098  -25.071 1.00 31.92  ? 155 THR B CA  1 
ATOM   2845  C  C   . THR B  1 155 ? -30.157  61.038  -26.119 1.00 35.83  ? 155 THR B C   1 
ATOM   2846  O  O   . THR B  1 155 ? -28.989  60.790  -26.419 1.00 63.13  ? 155 THR B O   1 
ATOM   2847  C  CB  . THR B  1 155 ? -30.218  63.511  -25.634 1.00 42.32  ? 155 THR B CB  1 
ATOM   2848  O  OG1 . THR B  1 155 ? -30.998  64.470  -24.906 1.00 52.32  ? 155 THR B OG1 1 
ATOM   2849  C  CG2 . THR B  1 155 ? -30.598  63.584  -27.104 1.00 75.81  ? 155 THR B CG2 1 
ATOM   2850  N  N   . SER B  1 162 ? -18.022  68.905  -28.762 1.00 56.41  ? 162 SER B N   1 
ATOM   2851  C  CA  . SER B  1 162 ? -17.460  70.250  -28.840 1.00 72.34  ? 162 SER B CA  1 
ATOM   2852  C  C   . SER B  1 162 ? -18.239  71.096  -29.833 1.00 63.88  ? 162 SER B C   1 
ATOM   2853  O  O   . SER B  1 162 ? -17.819  72.200  -30.182 1.00 65.37  ? 162 SER B O   1 
ATOM   2854  C  CB  . SER B  1 162 ? -15.982  70.213  -29.267 1.00 69.49  ? 162 SER B CB  1 
ATOM   2855  O  OG  . SER B  1 162 ? -15.178  69.499  -28.348 1.00 72.43  ? 162 SER B OG  1 
ATOM   2856  N  N   . GLU B  1 163 ? -19.368  70.584  -30.300 1.00 41.94  ? 163 GLU B N   1 
ATOM   2857  C  CA  . GLU B  1 163 ? -20.069  71.274  -31.373 1.00 51.25  ? 163 GLU B CA  1 
ATOM   2858  C  C   . GLU B  1 163 ? -20.321  72.752  -31.051 1.00 48.76  ? 163 GLU B C   1 
ATOM   2859  O  O   . GLU B  1 163 ? -20.192  73.611  -31.922 1.00 51.51  ? 163 GLU B O   1 
ATOM   2860  C  CB  . GLU B  1 163 ? -21.369  70.560  -31.724 1.00 59.82  ? 163 GLU B CB  1 
ATOM   2861  C  CG  . GLU B  1 163 ? -22.032  71.103  -32.972 1.00 75.81  ? 163 GLU B CG  1 
ATOM   2862  C  CD  . GLU B  1 163 ? -23.495  70.711  -33.066 1.00 89.24  ? 163 GLU B CD  1 
ATOM   2863  O  OE1 . GLU B  1 163 ? -23.927  69.816  -32.305 1.00 93.62  ? 163 GLU B OE1 1 
ATOM   2864  O  OE2 . GLU B  1 163 ? -24.218  71.306  -33.895 1.00 90.43  ? 163 GLU B OE2 1 
ATOM   2865  N  N   . TYR B  1 164 ? -20.668  73.051  -29.802 1.00 36.61  ? 164 TYR B N   1 
ATOM   2866  C  CA  . TYR B  1 164 ? -20.957  74.431  -29.410 1.00 31.29  ? 164 TYR B CA  1 
ATOM   2867  C  C   . TYR B  1 164 ? -19.900  74.978  -28.467 1.00 33.54  ? 164 TYR B C   1 
ATOM   2868  O  O   . TYR B  1 164 ? -20.124  75.987  -27.798 1.00 38.02  ? 164 TYR B O   1 
ATOM   2869  C  CB  . TYR B  1 164 ? -22.335  74.552  -28.731 1.00 42.72  ? 164 TYR B CB  1 
ATOM   2870  C  CG  . TYR B  1 164 ? -23.492  73.963  -29.507 1.00 49.99  ? 164 TYR B CG  1 
ATOM   2871  C  CD1 . TYR B  1 164 ? -23.744  74.330  -30.823 1.00 50.46  ? 164 TYR B CD1 1 
ATOM   2872  C  CD2 . TYR B  1 164 ? -24.338  73.031  -28.915 1.00 54.18  ? 164 TYR B CD2 1 
ATOM   2873  C  CE1 . TYR B  1 164 ? -24.809  73.783  -31.523 1.00 58.07  ? 164 TYR B CE1 1 
ATOM   2874  C  CE2 . TYR B  1 164 ? -25.407  72.484  -29.605 1.00 55.88  ? 164 TYR B CE2 1 
ATOM   2875  C  CZ  . TYR B  1 164 ? -25.637  72.861  -30.904 1.00 57.73  ? 164 TYR B CZ  1 
ATOM   2876  O  OH  . TYR B  1 164 ? -26.689  72.301  -31.584 1.00 52.61  ? 164 TYR B OH  1 
ATOM   2877  N  N   . PHE B  1 165 ? -18.753  74.313  -28.406 1.00 35.88  ? 165 PHE B N   1 
ATOM   2878  C  CA  . PHE B  1 165 ? -17.714  74.688  -27.448 1.00 31.53  ? 165 PHE B CA  1 
ATOM   2879  C  C   . PHE B  1 165 ? -16.876  75.872  -27.914 1.00 26.11  ? 165 PHE B C   1 
ATOM   2880  O  O   . PHE B  1 165 ? -16.456  75.931  -29.060 1.00 24.94  ? 165 PHE B O   1 
ATOM   2881  C  CB  . PHE B  1 165 ? -16.814  73.495  -27.124 1.00 23.25  ? 165 PHE B CB  1 
ATOM   2882  C  CG  . PHE B  1 165 ? -16.013  73.676  -25.878 1.00 25.23  ? 165 PHE B CG  1 
ATOM   2883  C  CD1 . PHE B  1 165 ? -16.634  73.651  -24.626 1.00 25.40  ? 165 PHE B CD1 1 
ATOM   2884  C  CD2 . PHE B  1 165 ? -14.643  73.883  -25.950 1.00 18.82  ? 165 PHE B CD2 1 
ATOM   2885  C  CE1 . PHE B  1 165 ? -15.895  73.821  -23.450 1.00 22.19  ? 165 PHE B CE1 1 
ATOM   2886  C  CE2 . PHE B  1 165 ? -13.886  74.053  -24.788 1.00 23.02  ? 165 PHE B CE2 1 
ATOM   2887  C  CZ  . PHE B  1 165 ? -14.521  74.021  -23.528 1.00 23.84  ? 165 PHE B CZ  1 
ATOM   2888  N  N   . SER B  1 166 ? -16.634  76.813  -27.012 1.00 21.49  ? 166 SER B N   1 
ATOM   2889  C  CA  . SER B  1 166 ? -15.906  78.027  -27.358 1.00 22.32  ? 166 SER B CA  1 
ATOM   2890  C  C   . SER B  1 166 ? -14.466  77.750  -27.777 1.00 33.01  ? 166 SER B C   1 
ATOM   2891  O  O   . SER B  1 166 ? -13.678  77.128  -27.046 1.00 20.41  ? 166 SER B O   1 
ATOM   2892  C  CB  . SER B  1 166 ? -15.919  79.013  -26.192 1.00 27.25  ? 166 SER B CB  1 
ATOM   2893  O  OG  . SER B  1 166 ? -15.238  80.209  -26.523 1.00 30.37  ? 166 SER B OG  1 
ATOM   2894  N  N   . GLN B  1 167 ? -14.125  78.231  -28.962 1.00 25.61  ? 167 GLN B N   1 
ATOM   2895  C  CA  . GLN B  1 167 ? -12.772  78.095  -29.454 1.00 30.97  ? 167 GLN B CA  1 
ATOM   2896  C  C   . GLN B  1 167 ? -11.796  78.946  -28.632 1.00 33.08  ? 167 GLN B C   1 
ATOM   2897  O  O   . GLN B  1 167 ? -10.581  78.778  -28.729 1.00 34.95  ? 167 GLN B O   1 
ATOM   2898  C  CB  . GLN B  1 167 ? -12.728  78.500  -30.924 1.00 20.46  ? 167 GLN B CB  1 
ATOM   2899  C  CG  . GLN B  1 167 ? -13.069  79.951  -31.149 1.00 34.97  ? 167 GLN B CG  1 
ATOM   2900  C  CD  . GLN B  1 167 ? -13.127  80.306  -32.619 1.00 50.70  ? 167 GLN B CD  1 
ATOM   2901  O  OE1 . GLN B  1 167 ? -14.175  80.694  -33.131 1.00 55.52  ? 167 GLN B OE1 1 
ATOM   2902  N  NE2 . GLN B  1 167 ? -11.999  80.174  -33.308 1.00 49.11  ? 167 GLN B NE2 1 
ATOM   2903  N  N   . TYR B  1 168 ? -12.328  79.857  -27.825 1.00 25.88  ? 168 TYR B N   1 
ATOM   2904  C  CA  . TYR B  1 168 ? -11.484  80.796  -27.085 1.00 24.50  ? 168 TYR B CA  1 
ATOM   2905  C  C   . TYR B  1 168 ? -11.242  80.391  -25.618 1.00 31.35  ? 168 TYR B C   1 
ATOM   2906  O  O   . TYR B  1 168 ? -10.573  81.097  -24.859 1.00 25.15  ? 168 TYR B O   1 
ATOM   2907  C  CB  . TYR B  1 168 ? -12.043  82.219  -27.186 1.00 14.42  ? 168 TYR B CB  1 
ATOM   2908  C  CG  . TYR B  1 168 ? -12.238  82.659  -28.609 1.00 35.05  ? 168 TYR B CG  1 
ATOM   2909  C  CD1 . TYR B  1 168 ? -11.149  82.798  -29.466 1.00 15.79  ? 168 TYR B CD1 1 
ATOM   2910  C  CD2 . TYR B  1 168 ? -13.511  82.917  -29.107 1.00 24.55  ? 168 TYR B CD2 1 
ATOM   2911  C  CE1 . TYR B  1 168 ? -11.321  83.181  -30.785 1.00 24.94  ? 168 TYR B CE1 1 
ATOM   2912  C  CE2 . TYR B  1 168 ? -13.698  83.306  -30.437 1.00 17.78  ? 168 TYR B CE2 1 
ATOM   2913  C  CZ  . TYR B  1 168 ? -12.593  83.435  -31.268 1.00 34.76  ? 168 TYR B CZ  1 
ATOM   2914  O  OH  . TYR B  1 168 ? -12.756  83.822  -32.577 1.00 41.89  ? 168 TYR B OH  1 
ATOM   2915  N  N   . SER B  1 169 ? -11.790  79.253  -25.222 1.00 27.79  ? 169 SER B N   1 
ATOM   2916  C  CA  . SER B  1 169 ? -11.517  78.727  -23.905 1.00 16.70  ? 169 SER B CA  1 
ATOM   2917  C  C   . SER B  1 169 ? -10.049  78.326  -23.825 1.00 34.75  ? 169 SER B C   1 
ATOM   2918  O  O   . SER B  1 169 ? -9.420   77.999  -24.840 1.00 19.55  ? 169 SER B O   1 
ATOM   2919  C  CB  . SER B  1 169 ? -12.384  77.506  -23.636 1.00 28.04  ? 169 SER B CB  1 
ATOM   2920  O  OG  . SER B  1 169 ? -12.017  76.882  -22.416 1.00 35.71  ? 169 SER B OG  1 
ATOM   2921  N  N   . ARG B  1 170 ? -9.502   78.356  -22.615 1.00 32.47  ? 170 ARG B N   1 
ATOM   2922  C  CA  . ARG B  1 170 ? -8.146   77.875  -22.389 1.00 25.76  ? 170 ARG B CA  1 
ATOM   2923  C  C   . ARG B  1 170 ? -8.127   76.362  -22.471 1.00 35.39  ? 170 ARG B C   1 
ATOM   2924  O  O   . ARG B  1 170 ? -7.066   75.744  -22.436 1.00 49.15  ? 170 ARG B O   1 
ATOM   2925  C  CB  . ARG B  1 170 ? -7.603   78.316  -21.020 1.00 16.52  ? 170 ARG B CB  1 
ATOM   2926  C  CG  . ARG B  1 170 ? -6.971   79.691  -21.029 1.00 25.71  ? 170 ARG B CG  1 
ATOM   2927  C  CD  . ARG B  1 170 ? -6.481   80.053  -19.658 1.00 47.34  ? 170 ARG B CD  1 
ATOM   2928  N  NE  . ARG B  1 170 ? -7.569   79.964  -18.700 1.00 78.60  ? 170 ARG B NE  1 
ATOM   2929  C  CZ  . ARG B  1 170 ? -7.420   79.752  -17.397 1.00 80.34  ? 170 ARG B CZ  1 
ATOM   2930  N  NH1 . ARG B  1 170 ? -6.205   79.604  -16.877 1.00 76.90  ? 170 ARG B NH1 1 
ATOM   2931  N  NH2 . ARG B  1 170 ? -8.497   79.683  -16.620 1.00 57.11  ? 170 ARG B NH2 1 
ATOM   2932  N  N   . PHE B  1 171 ? -9.299   75.757  -22.576 1.00 23.97  ? 171 PHE B N   1 
ATOM   2933  C  CA  . PHE B  1 171 ? -9.365   74.312  -22.541 1.00 22.91  ? 171 PHE B CA  1 
ATOM   2934  C  C   . PHE B  1 171 ? -9.987   73.758  -23.811 1.00 17.67  ? 171 PHE B C   1 
ATOM   2935  O  O   . PHE B  1 171 ? -10.471  74.499  -24.663 1.00 15.38  ? 171 PHE B O   1 
ATOM   2936  C  CB  . PHE B  1 171 ? -10.121  73.837  -21.295 1.00 19.80  ? 171 PHE B CB  1 
ATOM   2937  C  CG  . PHE B  1 171 ? -9.617   74.448  -20.012 1.00 19.39  ? 171 PHE B CG  1 
ATOM   2938  C  CD1 . PHE B  1 171 ? -9.987   75.732  -19.647 1.00 22.60  ? 171 PHE B CD1 1 
ATOM   2939  C  CD2 . PHE B  1 171 ? -8.773   73.745  -19.178 1.00 28.28  ? 171 PHE B CD2 1 
ATOM   2940  C  CE1 . PHE B  1 171 ? -9.519   76.308  -18.477 1.00 25.53  ? 171 PHE B CE1 1 
ATOM   2941  C  CE2 . PHE B  1 171 ? -8.310   74.311  -17.992 1.00 33.31  ? 171 PHE B CE2 1 
ATOM   2942  C  CZ  . PHE B  1 171 ? -8.684   75.596  -17.646 1.00 25.88  ? 171 PHE B CZ  1 
ATOM   2943  N  N   . GLU B  1 172 ? -9.942   72.438  -23.933 1.00 27.37  ? 172 GLU B N   1 
ATOM   2944  C  CA  . GLU B  1 172 ? -10.564  71.739  -25.049 1.00 29.42  ? 172 GLU B CA  1 
ATOM   2945  C  C   . GLU B  1 172 ? -11.180  70.448  -24.551 1.00 31.53  ? 172 GLU B C   1 
ATOM   2946  O  O   . GLU B  1 172 ? -10.731  69.872  -23.561 1.00 37.78  ? 172 GLU B O   1 
ATOM   2947  C  CB  . GLU B  1 172 ? -9.544   71.449  -26.146 1.00 31.21  ? 172 GLU B CB  1 
ATOM   2948  C  CG  . GLU B  1 172 ? -8.325   70.662  -25.674 1.00 47.41  ? 172 GLU B CG  1 
ATOM   2949  C  CD  . GLU B  1 172 ? -7.281   70.512  -26.760 1.00 45.55  ? 172 GLU B CD  1 
ATOM   2950  O  OE1 . GLU B  1 172 ? -7.574   70.899  -27.907 1.00 35.34  ? 172 GLU B OE1 1 
ATOM   2951  O  OE2 . GLU B  1 172 ? -6.175   70.008  -26.465 1.00 50.79  ? 172 GLU B OE2 1 
ATOM   2952  N  N   . ILE B  1 173 ? -12.221  70.003  -25.231 1.00 23.70  ? 173 ILE B N   1 
ATOM   2953  C  CA  . ILE B  1 173 ? -12.934  68.808  -24.809 1.00 24.58  ? 173 ILE B CA  1 
ATOM   2954  C  C   . ILE B  1 173 ? -12.423  67.611  -25.577 1.00 24.84  ? 173 ILE B C   1 
ATOM   2955  O  O   . ILE B  1 173 ? -12.418  67.606  -26.808 1.00 31.81  ? 173 ILE B O   1 
ATOM   2956  C  CB  . ILE B  1 173 ? -14.457  68.950  -25.032 1.00 23.13  ? 173 ILE B CB  1 
ATOM   2957  C  CG1 . ILE B  1 173 ? -15.009  70.018  -24.109 1.00 15.48  ? 173 ILE B CG1 1 
ATOM   2958  C  CG2 . ILE B  1 173 ? -15.165  67.631  -24.803 1.00 11.74  ? 173 ILE B CG2 1 
ATOM   2959  C  CD1 . ILE B  1 173 ? -16.476  70.258  -24.295 1.00 37.79  ? 173 ILE B CD1 1 
ATOM   2960  N  N   . LEU B  1 174 ? -12.001  66.591  -24.851 1.00 22.65  ? 174 LEU B N   1 
ATOM   2961  C  CA  . LEU B  1 174 ? -11.524  65.375  -25.482 1.00 28.14  ? 174 LEU B CA  1 
ATOM   2962  C  C   . LEU B  1 174 ? -12.678  64.424  -25.729 1.00 27.31  ? 174 LEU B C   1 
ATOM   2963  O  O   . LEU B  1 174 ? -12.766  63.824  -26.793 1.00 37.98  ? 174 LEU B O   1 
ATOM   2964  C  CB  . LEU B  1 174 ? -10.437  64.710  -24.630 1.00 26.57  ? 174 LEU B CB  1 
ATOM   2965  C  CG  . LEU B  1 174 ? -9.292   65.646  -24.245 1.00 33.31  ? 174 LEU B CG  1 
ATOM   2966  C  CD1 . LEU B  1 174 ? -8.288   64.959  -23.338 1.00 31.11  ? 174 LEU B CD1 1 
ATOM   2967  C  CD2 . LEU B  1 174 ? -8.618   66.168  -25.493 1.00 28.05  ? 174 LEU B CD2 1 
ATOM   2968  N  N   . ASP B  1 175 ? -13.576  64.306  -24.757 1.00 27.50  ? 175 ASP B N   1 
ATOM   2969  C  CA  . ASP B  1 175 ? -14.699  63.387  -24.875 1.00 26.25  ? 175 ASP B CA  1 
ATOM   2970  C  C   . ASP B  1 175 ? -15.782  63.718  -23.864 1.00 22.81  ? 175 ASP B C   1 
ATOM   2971  O  O   . ASP B  1 175 ? -15.507  64.299  -22.822 1.00 33.77  ? 175 ASP B O   1 
ATOM   2972  C  CB  . ASP B  1 175 ? -14.223  61.941  -24.671 1.00 30.37  ? 175 ASP B CB  1 
ATOM   2973  C  CG  . ASP B  1 175 ? -15.179  60.918  -25.267 1.00 46.88  ? 175 ASP B CG  1 
ATOM   2974  O  OD1 . ASP B  1 175 ? -15.957  61.285  -26.173 1.00 57.97  ? 175 ASP B OD1 1 
ATOM   2975  O  OD2 . ASP B  1 175 ? -15.149  59.744  -24.840 1.00 56.72  ? 175 ASP B OD2 1 
ATOM   2976  N  N   . VAL B  1 176 ? -17.019  63.354  -24.185 1.00 29.33  ? 176 VAL B N   1 
ATOM   2977  C  CA  . VAL B  1 176 ? -18.121  63.428  -23.242 1.00 18.19  ? 176 VAL B CA  1 
ATOM   2978  C  C   . VAL B  1 176 ? -18.886  62.110  -23.288 1.00 28.34  ? 176 VAL B C   1 
ATOM   2979  O  O   . VAL B  1 176 ? -19.336  61.695  -24.344 1.00 35.18  ? 176 VAL B O   1 
ATOM   2980  C  CB  . VAL B  1 176 ? -19.084  64.573  -23.580 1.00 16.04  ? 176 VAL B CB  1 
ATOM   2981  C  CG1 . VAL B  1 176 ? -20.188  64.640  -22.557 1.00 21.02  ? 176 VAL B CG1 1 
ATOM   2982  C  CG2 . VAL B  1 176 ? -18.355  65.883  -23.628 1.00 16.11  ? 176 VAL B CG2 1 
ATOM   2983  N  N   . THR B  1 177 ? -19.018  61.440  -22.150 1.00 31.90  ? 177 THR B N   1 
ATOM   2984  C  CA  . THR B  1 177 ? -19.827  60.225  -22.083 1.00 42.33  ? 177 THR B CA  1 
ATOM   2985  C  C   . THR B  1 177 ? -20.929  60.387  -21.046 1.00 45.27  ? 177 THR B C   1 
ATOM   2986  O  O   . THR B  1 177 ? -20.771  61.108  -20.065 1.00 45.50  ? 177 THR B O   1 
ATOM   2987  C  CB  . THR B  1 177 ? -18.998  58.965  -21.738 1.00 43.08  ? 177 THR B CB  1 
ATOM   2988  O  OG1 . THR B  1 177 ? -18.417  59.103  -20.431 1.00 37.79  ? 177 THR B OG1 1 
ATOM   2989  C  CG2 . THR B  1 177 ? -17.903  58.744  -22.777 1.00 28.85  ? 177 THR B CG2 1 
ATOM   2990  N  N   . GLN B  1 178 ? -22.044  59.706  -21.272 1.00 44.25  ? 178 GLN B N   1 
ATOM   2991  C  CA  . GLN B  1 178 ? -23.203  59.819  -20.401 1.00 41.69  ? 178 GLN B CA  1 
ATOM   2992  C  C   . GLN B  1 178 ? -23.601  58.453  -19.855 1.00 46.73  ? 178 GLN B C   1 
ATOM   2993  O  O   . GLN B  1 178 ? -23.764  57.498  -20.608 1.00 54.56  ? 178 GLN B O   1 
ATOM   2994  C  CB  . GLN B  1 178 ? -24.372  60.455  -21.160 1.00 33.13  ? 178 GLN B CB  1 
ATOM   2995  C  CG  . GLN B  1 178 ? -23.963  61.731  -21.913 1.00 53.48  ? 178 GLN B CG  1 
ATOM   2996  C  CD  . GLN B  1 178 ? -25.034  62.815  -21.891 1.00 75.57  ? 178 GLN B CD  1 
ATOM   2997  O  OE1 . GLN B  1 178 ? -26.228  62.521  -21.826 1.00 73.58  ? 178 GLN B OE1 1 
ATOM   2998  N  NE2 . GLN B  1 178 ? -24.605  64.079  -21.935 1.00 62.55  ? 178 GLN B NE2 1 
ATOM   2999  N  N   . LYS B  1 179 ? -23.737  58.360  -18.539 1.00 46.06  ? 179 LYS B N   1 
ATOM   3000  C  CA  . LYS B  1 179 ? -24.137  57.112  -17.916 1.00 46.80  ? 179 LYS B CA  1 
ATOM   3001  C  C   . LYS B  1 179 ? -25.349  57.373  -17.034 1.00 47.04  ? 179 LYS B C   1 
ATOM   3002  O  O   . LYS B  1 179 ? -25.402  58.359  -16.306 1.00 59.98  ? 179 LYS B O   1 
ATOM   3003  C  CB  . LYS B  1 179 ? -22.986  56.510  -17.096 1.00 45.58  ? 179 LYS B CB  1 
ATOM   3004  C  CG  . LYS B  1 179 ? -23.312  55.154  -16.468 1.00 60.43  ? 179 LYS B CG  1 
ATOM   3005  C  CD  . LYS B  1 179 ? -22.260  54.725  -15.448 1.00 64.53  ? 179 LYS B CD  1 
ATOM   3006  C  CE  . LYS B  1 179 ? -22.661  53.424  -14.749 1.00 68.40  ? 179 LYS B CE  1 
ATOM   3007  N  NZ  . LYS B  1 179 ? -21.671  52.993  -13.716 1.00 69.02  ? 179 LYS B NZ  1 
ATOM   3008  N  N   . LYS B  1 180 ? -26.332  56.494  -17.120 1.00 37.07  ? 180 LYS B N   1 
ATOM   3009  C  CA  . LYS B  1 180 ? -27.520  56.618  -16.296 1.00 31.53  ? 180 LYS B CA  1 
ATOM   3010  C  C   . LYS B  1 180 ? -27.442  55.662  -15.111 1.00 20.39  ? 180 LYS B C   1 
ATOM   3011  O  O   . LYS B  1 180 ? -26.971  54.537  -15.242 1.00 32.00  ? 180 LYS B O   1 
ATOM   3012  C  CB  . LYS B  1 180 ? -28.752  56.341  -17.152 1.00 24.40  ? 180 LYS B CB  1 
ATOM   3013  C  CG  . LYS B  1 180 ? -29.997  56.005  -16.380 1.00 40.42  ? 180 LYS B CG  1 
ATOM   3014  C  CD  . LYS B  1 180 ? -31.055  55.494  -17.335 1.00 58.92  ? 180 LYS B CD  1 
ATOM   3015  C  CE  . LYS B  1 180 ? -32.251  54.951  -16.598 1.00 49.28  ? 180 LYS B CE  1 
ATOM   3016  N  NZ  . LYS B  1 180 ? -32.954  56.029  -15.917 1.00 42.16  ? 180 LYS B NZ  1 
ATOM   3017  N  N   . ASN B  1 181 ? -27.896  56.118  -13.954 1.00 20.38  ? 181 ASN B N   1 
ATOM   3018  C  CA  . ASN B  1 181 ? -27.845  55.293  -12.758 1.00 21.63  ? 181 ASN B CA  1 
ATOM   3019  C  C   . ASN B  1 181 ? -29.125  55.332  -11.944 1.00 30.10  ? 181 ASN B C   1 
ATOM   3020  O  O   . ASN B  1 181 ? -29.916  56.263  -12.043 1.00 34.22  ? 181 ASN B O   1 
ATOM   3021  C  CB  . ASN B  1 181 ? -26.695  55.710  -11.835 1.00 31.50  ? 181 ASN B CB  1 
ATOM   3022  C  CG  . ASN B  1 181 ? -25.358  55.742  -12.535 1.00 37.72  ? 181 ASN B CG  1 
ATOM   3023  O  OD1 . ASN B  1 181 ? -24.746  54.699  -12.783 1.00 45.92  ? 181 ASN B OD1 1 
ATOM   3024  N  ND2 . ASN B  1 181 ? -24.881  56.949  -12.844 1.00 35.09  ? 181 ASN B ND2 1 
ATOM   3025  N  N   . SER B  1 182 ? -29.296  54.316  -11.113 1.00 28.35  ? 182 SER B N   1 
ATOM   3026  C  CA  . SER B  1 182 ? -30.366  54.277  -10.145 1.00 24.28  ? 182 SER B CA  1 
ATOM   3027  C  C   . SER B  1 182 ? -29.724  54.007  -8.784  1.00 33.18  ? 182 SER B C   1 
ATOM   3028  O  O   . SER B  1 182 ? -29.080  52.976  -8.592  1.00 38.72  ? 182 SER B O   1 
ATOM   3029  C  CB  . SER B  1 182 ? -31.338  53.165  -10.507 1.00 22.29  ? 182 SER B CB  1 
ATOM   3030  O  OG  . SER B  1 182 ? -32.540  53.308  -9.790  1.00 45.89  ? 182 SER B OG  1 
ATOM   3031  N  N   . VAL B  1 183 ? -29.888  54.933  -7.844  1.00 25.10  ? 183 VAL B N   1 
ATOM   3032  C  CA  . VAL B  1 183 ? -29.185  54.845  -6.576  1.00 28.16  ? 183 VAL B CA  1 
ATOM   3033  C  C   . VAL B  1 183 ? -30.134  54.853  -5.387  1.00 31.10  ? 183 VAL B C   1 
ATOM   3034  O  O   . VAL B  1 183 ? -31.107  55.588  -5.373  1.00 32.71  ? 183 VAL B O   1 
ATOM   3035  C  CB  . VAL B  1 183 ? -28.210  56.017  -6.419  1.00 40.21  ? 183 VAL B CB  1 
ATOM   3036  C  CG1 . VAL B  1 183 ? -27.524  55.949  -5.083  1.00 23.48  ? 183 VAL B CG1 1 
ATOM   3037  C  CG2 . VAL B  1 183 ? -27.190  56.019  -7.538  1.00 22.21  ? 183 VAL B CG2 1 
ATOM   3038  N  N   . THR B  1 184 ? -29.839  54.033  -4.384  1.00 44.54  ? 184 THR B N   1 
ATOM   3039  C  CA  . THR B  1 184 ? -30.592  54.053  -3.134  1.00 38.27  ? 184 THR B CA  1 
ATOM   3040  C  C   . THR B  1 184 ? -29.823  54.795  -2.037  1.00 38.50  ? 184 THR B C   1 
ATOM   3041  O  O   . THR B  1 184 ? -28.668  54.484  -1.731  1.00 37.92  ? 184 THR B O   1 
ATOM   3042  C  CB  . THR B  1 184 ? -30.940  52.632  -2.667  1.00 38.26  ? 184 THR B CB  1 
ATOM   3043  O  OG1 . THR B  1 184 ? -31.551  51.906  -3.746  1.00 37.81  ? 184 THR B OG1 1 
ATOM   3044  C  CG2 . THR B  1 184 ? -31.887  52.672  -1.467  1.00 27.32  ? 184 THR B CG2 1 
ATOM   3045  N  N   . TYR B  1 185 ? -30.504  55.774  -1.452  1.00 48.28  ? 185 TYR B N   1 
ATOM   3046  C  CA  . TYR B  1 185 ? -29.946  56.664  -0.445  1.00 39.64  ? 185 TYR B CA  1 
ATOM   3047  C  C   . TYR B  1 185 ? -30.424  56.267  0.951   1.00 49.54  ? 185 TYR B C   1 
ATOM   3048  O  O   . TYR B  1 185 ? -31.490  55.675  1.098   1.00 59.88  ? 185 TYR B O   1 
ATOM   3049  C  CB  . TYR B  1 185 ? -30.349  58.100  -0.772  1.00 31.45  ? 185 TYR B CB  1 
ATOM   3050  C  CG  . TYR B  1 185 ? -29.830  58.549  -2.115  1.00 33.14  ? 185 TYR B CG  1 
ATOM   3051  C  CD1 . TYR B  1 185 ? -30.445  58.154  -3.284  1.00 32.38  ? 185 TYR B CD1 1 
ATOM   3052  C  CD2 . TYR B  1 185 ? -28.703  59.354  -2.212  1.00 36.09  ? 185 TYR B CD2 1 
ATOM   3053  C  CE1 . TYR B  1 185 ? -29.955  58.556  -4.518  1.00 33.81  ? 185 TYR B CE1 1 
ATOM   3054  C  CE2 . TYR B  1 185 ? -28.209  59.758  -3.434  1.00 32.67  ? 185 TYR B CE2 1 
ATOM   3055  C  CZ  . TYR B  1 185 ? -28.837  59.357  -4.583  1.00 30.50  ? 185 TYR B CZ  1 
ATOM   3056  O  OH  . TYR B  1 185 ? -28.345  59.770  -5.799  1.00 38.66  ? 185 TYR B OH  1 
ATOM   3057  N  N   . SER B  1 186 ? -29.628  56.585  1.968   1.00 60.26  ? 186 SER B N   1 
ATOM   3058  C  CA  . SER B  1 186 ? -29.919  56.206  3.355   1.00 55.32  ? 186 SER B CA  1 
ATOM   3059  C  C   . SER B  1 186 ? -31.291  56.642  3.823   1.00 60.00  ? 186 SER B C   1 
ATOM   3060  O  O   . SER B  1 186 ? -31.993  55.888  4.502   1.00 55.24  ? 186 SER B O   1 
ATOM   3061  C  CB  . SER B  1 186 ? -28.884  56.817  4.304   1.00 57.66  ? 186 SER B CB  1 
ATOM   3062  O  OG  . SER B  1 186 ? -27.696  56.063  4.320   1.00 67.07  ? 186 SER B OG  1 
ATOM   3063  N  N   . CYS B  1 187 ? -31.636  57.882  3.486   1.00 44.99  ? 187 CYS B N   1 
ATOM   3064  C  CA  . CYS B  1 187 ? -32.863  58.516  3.960   1.00 67.45  ? 187 CYS B CA  1 
ATOM   3065  C  C   . CYS B  1 187 ? -34.119  57.762  3.540   1.00 55.44  ? 187 CYS B C   1 
ATOM   3066  O  O   . CYS B  1 187 ? -35.090  57.656  4.300   1.00 39.25  ? 187 CYS B O   1 
ATOM   3067  C  CB  . CYS B  1 187 ? -32.954  59.965  3.451   1.00 78.86  ? 187 CYS B CB  1 
ATOM   3068  S  SG  . CYS B  1 187 ? -33.613  60.174  1.759   1.00 66.30  ? 187 CYS B SG  1 
ATOM   3069  N  N   . CYS B  1 188 ? -34.097  57.234  2.325   1.00 62.93  ? 188 CYS B N   1 
ATOM   3070  C  CA  . CYS B  1 188 ? -35.340  56.831  1.689   1.00 52.80  ? 188 CYS B CA  1 
ATOM   3071  C  C   . CYS B  1 188 ? -35.258  55.428  1.129   1.00 38.71  ? 188 CYS B C   1 
ATOM   3072  O  O   . CYS B  1 188 ? -34.188  54.963  0.748   1.00 54.09  ? 188 CYS B O   1 
ATOM   3073  C  CB  . CYS B  1 188 ? -35.708  57.828  0.593   1.00 49.94  ? 188 CYS B CB  1 
ATOM   3074  S  SG  . CYS B  1 188 ? -35.416  59.545  1.048   1.00 54.39  ? 188 CYS B SG  1 
ATOM   3075  N  N   . PRO B  1 189 ? -36.396  54.746  1.091   1.00 29.29  ? 189 PRO B N   1 
ATOM   3076  C  CA  . PRO B  1 189 ? -36.476  53.348  0.674   1.00 37.59  ? 189 PRO B CA  1 
ATOM   3077  C  C   . PRO B  1 189 ? -36.393  53.207  -0.835  1.00 39.88  ? 189 PRO B C   1 
ATOM   3078  O  O   . PRO B  1 189 ? -35.917  52.189  -1.339  1.00 38.99  ? 189 PRO B O   1 
ATOM   3079  C  CB  . PRO B  1 189 ? -37.875  52.934  1.154   1.00 40.67  ? 189 PRO B CB  1 
ATOM   3080  C  CG  . PRO B  1 189 ? -38.676  54.194  1.091   1.00 30.52  ? 189 PRO B CG  1 
ATOM   3081  C  CD  . PRO B  1 189 ? -37.713  55.294  1.470   1.00 35.44  ? 189 PRO B CD  1 
ATOM   3082  N  N   . GLU B  1 190 ? -36.859  54.228  -1.546  1.00 31.00  ? 190 GLU B N   1 
ATOM   3083  C  CA  . GLU B  1 190 ? -36.972  54.156  -2.996  1.00 35.30  ? 190 GLU B CA  1 
ATOM   3084  C  C   . GLU B  1 190 ? -35.655  54.433  -3.702  1.00 29.16  ? 190 GLU B C   1 
ATOM   3085  O  O   . GLU B  1 190 ? -34.714  54.951  -3.103  1.00 36.70  ? 190 GLU B O   1 
ATOM   3086  C  CB  . GLU B  1 190 ? -38.039  55.125  -3.494  1.00 40.81  ? 190 GLU B CB  1 
ATOM   3087  C  CG  . GLU B  1 190 ? -39.439  54.772  -3.049  1.00 50.50  ? 190 GLU B CG  1 
ATOM   3088  C  CD  . GLU B  1 190 ? -40.067  53.699  -3.921  1.00 58.77  ? 190 GLU B CD  1 
ATOM   3089  O  OE1 . GLU B  1 190 ? -39.325  53.073  -4.711  1.00 55.87  ? 190 GLU B OE1 1 
ATOM   3090  O  OE2 . GLU B  1 190 ? -41.304  53.489  -3.823  1.00 58.19  ? 190 GLU B OE2 1 
ATOM   3091  N  N   . ALA B  1 191 ? -35.608  54.081  -4.984  1.00 27.47  ? 191 ALA B N   1 
ATOM   3092  C  CA  . ALA B  1 191 ? -34.442  54.350  -5.807  1.00 24.51  ? 191 ALA B CA  1 
ATOM   3093  C  C   . ALA B  1 191 ? -34.650  55.652  -6.558  1.00 28.87  ? 191 ALA B C   1 
ATOM   3094  O  O   . ALA B  1 191 ? -35.751  55.943  -7.020  1.00 22.74  ? 191 ALA B O   1 
ATOM   3095  C  CB  . ALA B  1 191 ? -34.201  53.222  -6.776  1.00 24.94  ? 191 ALA B CB  1 
ATOM   3096  N  N   . TYR B  1 192 ? -33.583  56.441  -6.664  1.00 27.71  ? 192 TYR B N   1 
ATOM   3097  C  CA  . TYR B  1 192 ? -33.622  57.686  -7.422  1.00 29.27  ? 192 TYR B CA  1 
ATOM   3098  C  C   . TYR B  1 192 ? -32.640  57.626  -8.585  1.00 19.88  ? 192 TYR B C   1 
ATOM   3099  O  O   . TYR B  1 192 ? -31.499  57.204  -8.432  1.00 35.73  ? 192 TYR B O   1 
ATOM   3100  C  CB  . TYR B  1 192 ? -33.328  58.873  -6.514  1.00 20.08  ? 192 TYR B CB  1 
ATOM   3101  C  CG  . TYR B  1 192 ? -34.328  59.041  -5.403  1.00 20.77  ? 192 TYR B CG  1 
ATOM   3102  C  CD1 . TYR B  1 192 ? -34.336  58.180  -4.315  1.00 22.09  ? 192 TYR B CD1 1 
ATOM   3103  C  CD2 . TYR B  1 192 ? -35.260  60.064  -5.436  1.00 20.18  ? 192 TYR B CD2 1 
ATOM   3104  C  CE1 . TYR B  1 192 ? -35.243  58.330  -3.284  1.00 26.04  ? 192 TYR B CE1 1 
ATOM   3105  C  CE2 . TYR B  1 192 ? -36.177  60.228  -4.406  1.00 34.29  ? 192 TYR B CE2 1 
ATOM   3106  C  CZ  . TYR B  1 192 ? -36.159  59.356  -3.331  1.00 29.36  ? 192 TYR B CZ  1 
ATOM   3107  O  OH  . TYR B  1 192 ? -37.062  59.511  -2.312  1.00 35.87  ? 192 TYR B OH  1 
ATOM   3108  N  N   . GLU B  1 193 ? -33.099  58.037  -9.757  1.00 22.48  ? 193 GLU B N   1 
ATOM   3109  C  CA  . GLU B  1 193 ? -32.286  57.940  -10.951 1.00 20.37  ? 193 GLU B CA  1 
ATOM   3110  C  C   . GLU B  1 193 ? -31.454  59.202  -11.140 1.00 21.40  ? 193 GLU B C   1 
ATOM   3111  O  O   . GLU B  1 193 ? -31.823  60.283  -10.667 1.00 32.51  ? 193 GLU B O   1 
ATOM   3112  C  CB  . GLU B  1 193 ? -33.163  57.653  -12.184 1.00 18.41  ? 193 GLU B CB  1 
ATOM   3113  C  CG  . GLU B  1 193 ? -33.910  56.319  -12.119 1.00 31.11  ? 193 GLU B CG  1 
ATOM   3114  C  CD  . GLU B  1 193 ? -34.568  55.918  -13.435 1.00 34.92  ? 193 GLU B CD  1 
ATOM   3115  O  OE1 . GLU B  1 193 ? -34.567  56.729  -14.381 1.00 18.60  ? 193 GLU B OE1 1 
ATOM   3116  O  OE2 . GLU B  1 193 ? -35.078  54.782  -13.525 1.00 29.17  ? 193 GLU B OE2 1 
ATOM   3117  N  N   . ASP B  1 194 ? -30.323  59.038  -11.816 1.00 17.04  ? 194 ASP B N   1 
ATOM   3118  C  CA  . ASP B  1 194 ? -29.438  60.141  -12.149 1.00 21.98  ? 194 ASP B CA  1 
ATOM   3119  C  C   . ASP B  1 194 ? -28.707  59.836  -13.454 1.00 29.33  ? 194 ASP B C   1 
ATOM   3120  O  O   . ASP B  1 194 ? -28.527  58.673  -13.836 1.00 24.20  ? 194 ASP B O   1 
ATOM   3121  C  CB  . ASP B  1 194 ? -28.430  60.427  -11.015 1.00 28.68  ? 194 ASP B CB  1 
ATOM   3122  C  CG  . ASP B  1 194 ? -27.385  59.298  -10.819 1.00 42.70  ? 194 ASP B CG  1 
ATOM   3123  O  OD1 . ASP B  1 194 ? -26.516  59.112  -11.700 1.00 34.09  ? 194 ASP B OD1 1 
ATOM   3124  O  OD2 . ASP B  1 194 ? -27.408  58.618  -9.763  1.00 44.17  ? 194 ASP B OD2 1 
ATOM   3125  N  N   . VAL B  1 195 ? -28.308  60.891  -14.147 1.00 14.71  ? 195 VAL B N   1 
ATOM   3126  C  CA  . VAL B  1 195 ? -27.402  60.757  -15.269 1.00 25.90  ? 195 VAL B CA  1 
ATOM   3127  C  C   . VAL B  1 195 ? -26.013  61.288  -14.890 1.00 17.30  ? 195 VAL B C   1 
ATOM   3128  O  O   . VAL B  1 195 ? -25.883  62.370  -14.313 1.00 29.06  ? 195 VAL B O   1 
ATOM   3129  C  CB  . VAL B  1 195 ? -27.911  61.525  -16.467 1.00 14.95  ? 195 VAL B CB  1 
ATOM   3130  C  CG1 . VAL B  1 195 ? -26.797  61.641  -17.495 1.00 34.16  ? 195 VAL B CG1 1 
ATOM   3131  C  CG2 . VAL B  1 195 ? -29.111  60.816  -17.053 1.00 27.25  ? 195 VAL B CG2 1 
ATOM   3132  N  N   . GLU B  1 196 ? -24.976  60.518  -15.184 1.00 27.60  ? 196 GLU B N   1 
ATOM   3133  C  CA  . GLU B  1 196 ? -23.608  60.984  -14.962 1.00 33.08  ? 196 GLU B CA  1 
ATOM   3134  C  C   . GLU B  1 196 ? -22.929  61.356  -16.270 1.00 23.81  ? 196 GLU B C   1 
ATOM   3135  O  O   . GLU B  1 196 ? -22.722  60.517  -17.132 1.00 30.91  ? 196 GLU B O   1 
ATOM   3136  C  CB  . GLU B  1 196 ? -22.781  59.941  -14.216 1.00 34.93  ? 196 GLU B CB  1 
ATOM   3137  C  CG  . GLU B  1 196 ? -22.945  59.990  -12.709 1.00 33.45  ? 196 GLU B CG  1 
ATOM   3138  C  CD  . GLU B  1 196 ? -22.307  58.810  -12.031 1.00 43.06  ? 196 GLU B CD  1 
ATOM   3139  O  OE1 . GLU B  1 196 ? -21.551  58.063  -12.696 1.00 50.56  ? 196 GLU B OE1 1 
ATOM   3140  O  OE2 . GLU B  1 196 ? -22.573  58.628  -10.830 1.00 34.83  ? 196 GLU B OE2 1 
ATOM   3141  N  N   . VAL B  1 197 ? -22.615  62.635  -16.405 1.00 16.54  ? 197 VAL B N   1 
ATOM   3142  C  CA  . VAL B  1 197 ? -21.941  63.147  -17.575 1.00 21.18  ? 197 VAL B CA  1 
ATOM   3143  C  C   . VAL B  1 197 ? -20.436  63.255  -17.269 1.00 31.82  ? 197 VAL B C   1 
ATOM   3144  O  O   . VAL B  1 197 ? -20.014  64.012  -16.394 1.00 31.73  ? 197 VAL B O   1 
ATOM   3145  C  CB  . VAL B  1 197 ? -22.497  64.518  -17.978 1.00 14.40  ? 197 VAL B CB  1 
ATOM   3146  C  CG1 . VAL B  1 197 ? -21.950  64.925  -19.325 1.00 21.98  ? 197 VAL B CG1 1 
ATOM   3147  C  CG2 . VAL B  1 197 ? -24.006  64.484  -18.017 1.00 17.47  ? 197 VAL B CG2 1 
ATOM   3148  N  N   . SER B  1 198 ? -19.632  62.471  -17.976 1.00 31.42  ? 198 SER B N   1 
ATOM   3149  C  CA  . SER B  1 198 ? -18.190  62.510  -17.800 1.00 22.66  ? 198 SER B CA  1 
ATOM   3150  C  C   . SER B  1 198 ? -17.565  63.430  -18.830 1.00 22.48  ? 198 SER B C   1 
ATOM   3151  O  O   . SER B  1 198 ? -17.537  63.130  -20.025 1.00 27.26  ? 198 SER B O   1 
ATOM   3152  C  CB  . SER B  1 198 ? -17.597  61.107  -17.901 1.00 26.29  ? 198 SER B CB  1 
ATOM   3153  O  OG  . SER B  1 198 ? -17.943  60.332  -16.768 1.00 38.28  ? 198 SER B OG  1 
ATOM   3154  N  N   . LEU B  1 199 ? -17.088  64.567  -18.347 1.00 19.55  ? 199 LEU B N   1 
ATOM   3155  C  CA  . LEU B  1 199 ? -16.404  65.551  -19.170 1.00 25.60  ? 199 LEU B CA  1 
ATOM   3156  C  C   . LEU B  1 199 ? -14.872  65.347  -19.143 1.00 36.82  ? 199 LEU B C   1 
ATOM   3157  O  O   . LEU B  1 199 ? -14.224  65.557  -18.121 1.00 35.12  ? 199 LEU B O   1 
ATOM   3158  C  CB  . LEU B  1 199 ? -16.757  66.953  -18.681 1.00 14.36  ? 199 LEU B CB  1 
ATOM   3159  C  CG  . LEU B  1 199 ? -16.030  68.080  -19.405 1.00 29.23  ? 199 LEU B CG  1 
ATOM   3160  C  CD1 . LEU B  1 199 ? -16.428  68.098  -20.874 1.00 23.83  ? 199 LEU B CD1 1 
ATOM   3161  C  CD2 . LEU B  1 199 ? -16.344  69.398  -18.752 1.00 13.93  ? 199 LEU B CD2 1 
ATOM   3162  N  N   . ASN B  1 200 ? -14.307  64.929  -20.272 1.00 30.53  ? 200 ASN B N   1 
ATOM   3163  C  CA  . ASN B  1 200 ? -12.871  64.729  -20.394 1.00 20.60  ? 200 ASN B CA  1 
ATOM   3164  C  C   . ASN B  1 200 ? -12.235  65.897  -21.149 1.00 29.84  ? 200 ASN B C   1 
ATOM   3165  O  O   . ASN B  1 200 ? -12.442  66.067  -22.349 1.00 33.81  ? 200 ASN B O   1 
ATOM   3166  C  CB  . ASN B  1 200 ? -12.582  63.397  -21.090 1.00 28.63  ? 200 ASN B CB  1 
ATOM   3167  C  CG  . ASN B  1 200 ? -11.099  63.098  -21.182 1.00 36.03  ? 200 ASN B CG  1 
ATOM   3168  O  OD1 . ASN B  1 200 ? -10.632  62.522  -22.164 1.00 31.37  ? 200 ASN B OD1 1 
ATOM   3169  N  ND2 . ASN B  1 200 ? -10.349  63.498  -20.162 1.00 35.23  ? 200 ASN B ND2 1 
ATOM   3170  N  N   . PHE B  1 201 ? -11.477  66.714  -20.431 1.00 22.89  ? 201 PHE B N   1 
ATOM   3171  C  CA  . PHE B  1 201 ? -10.909  67.926  -21.001 1.00 23.40  ? 201 PHE B CA  1 
ATOM   3172  C  C   . PHE B  1 201 ? -9.468   68.120  -20.537 1.00 33.32  ? 201 PHE B C   1 
ATOM   3173  O  O   . PHE B  1 201 ? -9.003   67.451  -19.598 1.00 31.02  ? 201 PHE B O   1 
ATOM   3174  C  CB  . PHE B  1 201 ? -11.740  69.137  -20.591 1.00 15.26  ? 201 PHE B CB  1 
ATOM   3175  C  CG  . PHE B  1 201 ? -11.665  69.453  -19.122 1.00 15.85  ? 201 PHE B CG  1 
ATOM   3176  C  CD1 . PHE B  1 201 ? -12.148  68.564  -18.180 1.00 21.81  ? 201 PHE B CD1 1 
ATOM   3177  C  CD2 . PHE B  1 201 ? -11.112  70.645  -18.683 1.00 28.38  ? 201 PHE B CD2 1 
ATOM   3178  C  CE1 . PHE B  1 201 ? -12.081  68.861  -16.820 1.00 22.73  ? 201 PHE B CE1 1 
ATOM   3179  C  CE2 . PHE B  1 201 ? -11.034  70.950  -17.323 1.00 27.67  ? 201 PHE B CE2 1 
ATOM   3180  C  CZ  . PHE B  1 201 ? -11.521  70.058  -16.394 1.00 21.29  ? 201 PHE B CZ  1 
ATOM   3181  N  N   . ARG B  1 202 ? -8.774   69.048  -21.194 1.00 29.25  ? 202 ARG B N   1 
ATOM   3182  C  CA  . ARG B  1 202 ? -7.408   69.410  -20.818 1.00 34.81  ? 202 ARG B CA  1 
ATOM   3183  C  C   . ARG B  1 202 ? -7.074   70.848  -21.237 1.00 32.85  ? 202 ARG B C   1 
ATOM   3184  O  O   . ARG B  1 202 ? -7.805   71.453  -22.019 1.00 28.38  ? 202 ARG B O   1 
ATOM   3185  C  CB  . ARG B  1 202 ? -6.419   68.457  -21.478 1.00 30.63  ? 202 ARG B CB  1 
ATOM   3186  C  CG  . ARG B  1 202 ? -6.328   68.689  -22.954 1.00 32.15  ? 202 ARG B CG  1 
ATOM   3187  C  CD  . ARG B  1 202 ? -5.449   67.673  -23.632 1.00 31.44  ? 202 ARG B CD  1 
ATOM   3188  N  NE  . ARG B  1 202 ? -5.436   67.913  -25.070 1.00 41.20  ? 202 ARG B NE  1 
ATOM   3189  C  CZ  . ARG B  1 202 ? -5.018   67.035  -25.976 1.00 42.56  ? 202 ARG B CZ  1 
ATOM   3190  N  NH1 . ARG B  1 202 ? -4.562   65.844  -25.593 1.00 38.51  ? 202 ARG B NH1 1 
ATOM   3191  N  NH2 . ARG B  1 202 ? -5.055   67.352  -27.266 1.00 30.31  ? 202 ARG B NH2 1 
ATOM   3192  N  N   . LYS B  1 203 ? -5.964   71.388  -20.736 1.00 31.08  ? 203 LYS B N   1 
ATOM   3193  C  CA  . LYS B  1 203 ? -5.492   72.700  -21.173 1.00 31.77  ? 203 LYS B CA  1 
ATOM   3194  C  C   . LYS B  1 203 ? -4.937   72.561  -22.590 1.00 18.01  ? 203 LYS B C   1 
ATOM   3195  O  O   . LYS B  1 203 ? -4.547   71.467  -22.984 1.00 6.76   ? 203 LYS B O   1 
ATOM   3196  C  CB  . LYS B  1 203 ? -4.428   73.235  -20.205 1.00 51.61  ? 203 LYS B CB  1 
ATOM   3197  C  CG  . LYS B  1 203 ? -4.181   74.742  -20.303 1.00 70.14  ? 203 LYS B CG  1 
ATOM   3198  C  CD  . LYS B  1 203 ? -3.295   75.273  -19.167 1.00 66.27  ? 203 LYS B CD  1 
ATOM   3199  C  CE  . LYS B  1 203 ? -4.035   75.309  -17.826 1.00 63.26  ? 203 LYS B CE  1 
ATOM   3200  N  NZ  . LYS B  1 203 ? -3.268   76.012  -16.744 1.00 37.22  ? 203 LYS B NZ  1 
ATOM   3201  N  N   . LYS B  1 204 ? -4.918   73.645  -23.367 1.00 25.63  ? 204 LYS B N   1 
ATOM   3202  C  CA  . LYS B  1 204 ? -4.384   73.589  -24.739 1.00 24.07  ? 204 LYS B CA  1 
ATOM   3203  C  C   . LYS B  1 204 ? -2.901   73.920  -24.768 1.00 31.31  ? 204 LYS B C   1 
ATOM   3204  O  O   . LYS B  1 204 ? -2.425   74.676  -23.927 1.00 70.08  ? 204 LYS B O   1 
ATOM   3205  C  CB  . LYS B  1 204 ? -5.125   74.558  -25.672 1.00 31.48  ? 204 LYS B CB  1 
ATOM   3206  C  CG  . LYS B  1 204 ? -6.576   74.199  -25.978 1.00 36.54  ? 204 LYS B CG  1 
ATOM   3207  C  CD  . LYS B  1 204 ? -7.445   75.450  -25.999 1.00 25.70  ? 204 LYS B CD  1 
ATOM   3208  C  CE  . LYS B  1 204 ? -7.888   75.835  -27.401 1.00 24.81  ? 204 LYS B CE  1 
ATOM   3209  N  NZ  . LYS B  1 204 ? -8.871   76.962  -27.331 1.00 27.25  ? 204 LYS B NZ  1 
ATOM   3210  N  N   . GLY B  1 205 ? -2.186   73.365  -25.750 1.00 49.38  ? 205 GLY B N   1 
ATOM   3211  C  CA  . GLY B  1 205 ? -0.758   73.586  -25.955 1.00 25.82  ? 205 GLY B CA  1 
ATOM   3212  C  C   . GLY B  1 205 ? -0.197   74.869  -25.355 1.00 58.19  ? 205 GLY B C   1 
ATOM   3213  O  O   . GLY B  1 205 ? -0.042   75.891  -26.037 1.00 64.37  ? 205 GLY B O   1 
ATOM   3214  N  N   . LEU C  1 1   ? -58.807  60.739  -4.714  1.00 51.79  ? 1   LEU C N   1 
ATOM   3215  C  CA  . LEU C  1 1   ? -57.754  61.738  -4.644  1.00 33.72  ? 1   LEU C CA  1 
ATOM   3216  C  C   . LEU C  1 1   ? -56.603  61.392  -5.558  1.00 40.38  ? 1   LEU C C   1 
ATOM   3217  O  O   . LEU C  1 1   ? -56.028  60.314  -5.447  1.00 49.12  ? 1   LEU C O   1 
ATOM   3218  C  CB  . LEU C  1 1   ? -57.222  61.843  -3.224  1.00 35.25  ? 1   LEU C CB  1 
ATOM   3219  C  CG  . LEU C  1 1   ? -58.060  62.689  -2.276  1.00 43.42  ? 1   LEU C CG  1 
ATOM   3220  C  CD1 . LEU C  1 1   ? -57.418  62.741  -0.906  1.00 40.59  ? 1   LEU C CD1 1 
ATOM   3221  C  CD2 . LEU C  1 1   ? -58.215  64.076  -2.846  1.00 45.52  ? 1   LEU C CD2 1 
ATOM   3222  N  N   . ASP C  1 2   ? -56.263  62.307  -6.459  1.00 42.37  ? 2   ASP C N   1 
ATOM   3223  C  CA  . ASP C  1 2   ? -55.041  62.178  -7.244  1.00 32.78  ? 2   ASP C CA  1 
ATOM   3224  C  C   . ASP C  1 2   ? -54.036  63.215  -6.747  1.00 34.38  ? 2   ASP C C   1 
ATOM   3225  O  O   . ASP C  1 2   ? -54.366  64.031  -5.882  1.00 24.42  ? 2   ASP C O   1 
ATOM   3226  C  CB  . ASP C  1 2   ? -55.328  62.333  -8.746  1.00 25.93  ? 2   ASP C CB  1 
ATOM   3227  C  CG  . ASP C  1 2   ? -55.942  63.675  -9.098  1.00 45.39  ? 2   ASP C CG  1 
ATOM   3228  O  OD1 . ASP C  1 2   ? -55.808  64.626  -8.295  1.00 41.65  ? 2   ASP C OD1 1 
ATOM   3229  O  OD2 . ASP C  1 2   ? -56.551  63.780  -10.190 1.00 41.00  ? 2   ASP C OD2 1 
ATOM   3230  N  N   . ARG C  1 3   ? -52.819  63.182  -7.286  1.00 29.35  ? 3   ARG C N   1 
ATOM   3231  C  CA  . ARG C  1 3   ? -51.779  64.125  -6.880  1.00 22.40  ? 3   ARG C CA  1 
ATOM   3232  C  C   . ARG C  1 3   ? -52.255  65.566  -6.947  1.00 30.01  ? 3   ARG C C   1 
ATOM   3233  O  O   . ARG C  1 3   ? -52.094  66.331  -5.998  1.00 29.74  ? 3   ARG C O   1 
ATOM   3234  C  CB  . ARG C  1 3   ? -50.520  63.947  -7.726  1.00 23.47  ? 3   ARG C CB  1 
ATOM   3235  C  CG  . ARG C  1 3   ? -49.763  62.685  -7.401  1.00 34.25  ? 3   ARG C CG  1 
ATOM   3236  C  CD  . ARG C  1 3   ? -48.485  62.537  -8.194  1.00 29.99  ? 3   ARG C CD  1 
ATOM   3237  N  NE  . ARG C  1 3   ? -47.760  61.353  -7.748  1.00 37.28  ? 3   ARG C NE  1 
ATOM   3238  C  CZ  . ARG C  1 3   ? -47.989  60.127  -8.202  1.00 49.99  ? 3   ARG C CZ  1 
ATOM   3239  N  NH1 . ARG C  1 3   ? -48.921  59.927  -9.124  1.00 54.98  ? 3   ARG C NH1 1 
ATOM   3240  N  NH2 . ARG C  1 3   ? -47.289  59.104  -7.738  1.00 58.35  ? 3   ARG C NH2 1 
ATOM   3241  N  N   . ALA C  1 4   ? -52.855  65.932  -8.073  1.00 39.13  ? 4   ALA C N   1 
ATOM   3242  C  CA  . ALA C  1 4   ? -53.373  67.288  -8.248  1.00 36.13  ? 4   ALA C CA  1 
ATOM   3243  C  C   . ALA C  1 4   ? -54.293  67.692  -7.117  1.00 31.65  ? 4   ALA C C   1 
ATOM   3244  O  O   . ALA C  1 4   ? -54.155  68.789  -6.598  1.00 44.28  ? 4   ALA C O   1 
ATOM   3245  C  CB  . ALA C  1 4   ? -54.066  67.438  -9.570  1.00 29.23  ? 4   ALA C CB  1 
ATOM   3246  N  N   . ASP C  1 5   ? -55.216  66.815  -6.721  1.00 22.90  ? 5   ASP C N   1 
ATOM   3247  C  CA  . ASP C  1 5   ? -56.155  67.150  -5.636  1.00 37.34  ? 5   ASP C CA  1 
ATOM   3248  C  C   . ASP C  1 5   ? -55.431  67.344  -4.300  1.00 42.33  ? 5   ASP C C   1 
ATOM   3249  O  O   . ASP C  1 5   ? -55.628  68.352  -3.611  1.00 33.60  ? 5   ASP C O   1 
ATOM   3250  C  CB  . ASP C  1 5   ? -57.249  66.088  -5.475  1.00 20.23  ? 5   ASP C CB  1 
ATOM   3251  C  CG  . ASP C  1 5   ? -58.087  65.917  -6.714  1.00 40.77  ? 5   ASP C CG  1 
ATOM   3252  O  OD1 . ASP C  1 5   ? -58.329  66.932  -7.408  1.00 39.21  ? 5   ASP C OD1 1 
ATOM   3253  O  OD2 . ASP C  1 5   ? -58.503  64.763  -6.989  1.00 38.52  ? 5   ASP C OD2 1 
ATOM   3254  N  N   . ILE C  1 6   ? -54.607  66.363  -3.939  1.00 26.98  ? 6   ILE C N   1 
ATOM   3255  C  CA  . ILE C  1 6   ? -53.780  66.447  -2.740  1.00 28.68  ? 6   ILE C CA  1 
ATOM   3256  C  C   . ILE C  1 6   ? -52.995  67.766  -2.661  1.00 32.31  ? 6   ILE C C   1 
ATOM   3257  O  O   . ILE C  1 6   ? -53.033  68.458  -1.648  1.00 33.91  ? 6   ILE C O   1 
ATOM   3258  C  CB  . ILE C  1 6   ? -52.787  65.262  -2.656  1.00 26.04  ? 6   ILE C CB  1 
ATOM   3259  C  CG1 . ILE C  1 6   ? -53.549  63.936  -2.676  1.00 27.30  ? 6   ILE C CG1 1 
ATOM   3260  C  CG2 . ILE C  1 6   ? -51.947  65.377  -1.407  1.00 25.68  ? 6   ILE C CG2 1 
ATOM   3261  C  CD1 . ILE C  1 6   ? -52.661  62.711  -2.737  1.00 25.87  ? 6   ILE C CD1 1 
ATOM   3262  N  N   . LEU C  1 7   ? -52.290  68.106  -3.731  1.00 19.06  ? 7   LEU C N   1 
ATOM   3263  C  CA  . LEU C  1 7   ? -51.495  69.321  -3.771  1.00 19.77  ? 7   LEU C CA  1 
ATOM   3264  C  C   . LEU C  1 7   ? -52.348  70.591  -3.734  1.00 34.92  ? 7   LEU C C   1 
ATOM   3265  O  O   . LEU C  1 7   ? -51.959  71.606  -3.148  1.00 29.60  ? 7   LEU C O   1 
ATOM   3266  C  CB  . LEU C  1 7   ? -50.578  69.312  -5.003  1.00 28.29  ? 7   LEU C CB  1 
ATOM   3267  C  CG  . LEU C  1 7   ? -49.409  68.323  -4.909  1.00 27.58  ? 7   LEU C CG  1 
ATOM   3268  C  CD1 . LEU C  1 7   ? -48.882  67.947  -6.275  1.00 34.92  ? 7   LEU C CD1 1 
ATOM   3269  C  CD2 . LEU C  1 7   ? -48.327  68.905  -4.024  1.00 27.97  ? 7   LEU C CD2 1 
ATOM   3270  N  N   . TYR C  1 8   ? -53.519  70.530  -4.353  1.00 30.20  ? 8   TYR C N   1 
ATOM   3271  C  CA  . TYR C  1 8   ? -54.467  71.634  -4.293  1.00 22.95  ? 8   TYR C CA  1 
ATOM   3272  C  C   . TYR C  1 8   ? -54.945  71.817  -2.875  1.00 35.06  ? 8   TYR C C   1 
ATOM   3273  O  O   . TYR C  1 8   ? -54.934  72.930  -2.340  1.00 41.47  ? 8   TYR C O   1 
ATOM   3274  C  CB  . TYR C  1 8   ? -55.664  71.365  -5.198  1.00 23.54  ? 8   TYR C CB  1 
ATOM   3275  C  CG  . TYR C  1 8   ? -56.709  72.468  -5.210  1.00 47.94  ? 8   TYR C CG  1 
ATOM   3276  C  CD1 . TYR C  1 8   ? -56.505  73.642  -5.933  1.00 51.61  ? 8   TYR C CD1 1 
ATOM   3277  C  CD2 . TYR C  1 8   ? -57.912  72.325  -4.518  1.00 36.72  ? 8   TYR C CD2 1 
ATOM   3278  C  CE1 . TYR C  1 8   ? -57.465  74.641  -5.960  1.00 63.29  ? 8   TYR C CE1 1 
ATOM   3279  C  CE2 . TYR C  1 8   ? -58.867  73.313  -4.547  1.00 42.05  ? 8   TYR C CE2 1 
ATOM   3280  C  CZ  . TYR C  1 8   ? -58.646  74.471  -5.264  1.00 60.27  ? 8   TYR C CZ  1 
ATOM   3281  O  OH  . TYR C  1 8   ? -59.608  75.459  -5.293  1.00 64.33  ? 8   TYR C OH  1 
ATOM   3282  N  N   . ASN C  1 9   ? -55.400  70.721  -2.277  1.00 39.43  ? 9   ASN C N   1 
ATOM   3283  C  CA  . ASN C  1 9   ? -55.879  70.800  -0.907  1.00 39.21  ? 9   ASN C CA  1 
ATOM   3284  C  C   . ASN C  1 9   ? -54.819  71.415  0.005   1.00 41.62  ? 9   ASN C C   1 
ATOM   3285  O  O   . ASN C  1 9   ? -55.090  72.405  0.695   1.00 38.67  ? 9   ASN C O   1 
ATOM   3286  C  CB  . ASN C  1 9   ? -56.321  69.433  -0.375  1.00 39.09  ? 9   ASN C CB  1 
ATOM   3287  C  CG  . ASN C  1 9   ? -57.485  68.855  -1.151  1.00 42.41  ? 9   ASN C CG  1 
ATOM   3288  O  OD1 . ASN C  1 9   ? -58.141  69.560  -1.914  1.00 42.94  ? 9   ASN C OD1 1 
ATOM   3289  N  ND2 . ASN C  1 9   ? -57.743  67.566  -0.963  1.00 39.84  ? 9   ASN C ND2 1 
ATOM   3290  N  N   . ILE C  1 10  ? -53.614  70.844  -0.010  1.00 37.95  ? 10  ILE C N   1 
ATOM   3291  C  CA  . ILE C  1 10  ? -52.517  71.366  0.793   1.00 37.35  ? 10  ILE C CA  1 
ATOM   3292  C  C   . ILE C  1 10  ? -52.263  72.853  0.520   1.00 43.46  ? 10  ILE C C   1 
ATOM   3293  O  O   . ILE C  1 10  ? -52.148  73.644  1.459   1.00 37.96  ? 10  ILE C O   1 
ATOM   3294  C  CB  . ILE C  1 10  ? -51.213  70.550  0.590   1.00 36.77  ? 10  ILE C CB  1 
ATOM   3295  C  CG1 . ILE C  1 10  ? -51.328  69.204  1.305   1.00 36.39  ? 10  ILE C CG1 1 
ATOM   3296  C  CG2 . ILE C  1 10  ? -50.016  71.331  1.090   1.00 36.45  ? 10  ILE C CG2 1 
ATOM   3297  C  CD1 . ILE C  1 10  ? -50.294  68.209  0.917   1.00 36.02  ? 10  ILE C CD1 1 
ATOM   3298  N  N   . ARG C  1 11  ? -52.201  73.231  -0.760  1.00 7.32   ? 11  ARG C N   1 
ATOM   3299  C  CA  . ARG C  1 11  ? -51.948  74.624  -1.147  1.00 32.25  ? 11  ARG C CA  1 
ATOM   3300  C  C   . ARG C  1 11  ? -53.011  75.587  -0.611  1.00 32.68  ? 11  ARG C C   1 
ATOM   3301  O  O   . ARG C  1 11  ? -52.701  76.689  -0.156  1.00 37.12  ? 11  ARG C O   1 
ATOM   3302  C  CB  . ARG C  1 11  ? -51.853  74.733  -2.670  1.00 21.18  ? 11  ARG C CB  1 
ATOM   3303  C  CG  . ARG C  1 11  ? -51.661  76.128  -3.234  1.00 33.22  ? 11  ARG C CG  1 
ATOM   3304  C  CD  . ARG C  1 11  ? -51.700  76.060  -4.772  1.00 60.11  ? 11  ARG C CD  1 
ATOM   3305  N  NE  . ARG C  1 11  ? -51.330  77.319  -5.420  1.00 76.56  ? 11  ARG C NE  1 
ATOM   3306  C  CZ  . ARG C  1 11  ? -52.192  78.145  -6.008  1.00 71.52  ? 11  ARG C CZ  1 
ATOM   3307  N  NH1 . ARG C  1 11  ? -53.482  77.842  -6.038  1.00 53.27  ? 11  ARG C NH1 1 
ATOM   3308  N  NH2 . ARG C  1 11  ? -51.762  79.270  -6.571  1.00 68.71  ? 11  ARG C NH2 1 
ATOM   3309  N  N   . GLN C  1 12  ? -54.266  75.161  -0.660  1.00 55.01  ? 12  GLN C N   1 
ATOM   3310  C  CA  . GLN C  1 12  ? -55.369  76.017  -0.281  1.00 36.82  ? 12  GLN C CA  1 
ATOM   3311  C  C   . GLN C  1 12  ? -55.636  75.988  1.223   1.00 50.83  ? 12  GLN C C   1 
ATOM   3312  O  O   . GLN C  1 12  ? -56.145  76.953  1.789   1.00 36.53  ? 12  GLN C O   1 
ATOM   3313  C  CB  . GLN C  1 12  ? -56.627  75.619  -1.056  1.00 40.25  ? 12  GLN C CB  1 
ATOM   3314  C  CG  . GLN C  1 12  ? -56.541  75.865  -2.551  1.00 37.32  ? 12  GLN C CG  1 
ATOM   3315  C  CD  . GLN C  1 12  ? -56.487  77.339  -2.890  1.00 45.24  ? 12  GLN C CD  1 
ATOM   3316  O  OE1 . GLN C  1 12  ? -55.575  78.055  -2.473  1.00 36.57  ? 12  GLN C OE1 1 
ATOM   3317  N  NE2 . GLN C  1 12  ? -57.476  77.805  -3.640  1.00 49.53  ? 12  GLN C NE2 1 
ATOM   3318  N  N   . THR C  1 13  ? -55.262  74.902  1.885   1.00 21.34  ? 13  THR C N   1 
ATOM   3319  C  CA  . THR C  1 13  ? -55.631  74.754  3.277   1.00 25.07  ? 13  THR C CA  1 
ATOM   3320  C  C   . THR C  1 13  ? -54.473  74.918  4.258   1.00 60.73  ? 13  THR C C   1 
ATOM   3321  O  O   . THR C  1 13  ? -54.624  75.574  5.285   1.00 91.52  ? 13  THR C O   1 
ATOM   3322  C  CB  . THR C  1 13  ? -56.354  73.418  3.529   1.00 27.76  ? 13  THR C CB  1 
ATOM   3323  O  OG1 . THR C  1 13  ? -55.417  72.334  3.485   1.00 29.76  ? 13  THR C OG1 1 
ATOM   3324  C  CG2 . THR C  1 13  ? -57.438  73.196  2.481   1.00 20.02  ? 13  THR C CG2 1 
ATOM   3325  N  N   . SER C  1 14  ? -53.322  74.330  3.951   1.00 53.67  ? 14  SER C N   1 
ATOM   3326  C  CA  . SER C  1 14  ? -52.204  74.335  4.892   1.00 39.39  ? 14  SER C CA  1 
ATOM   3327  C  C   . SER C  1 14  ? -51.815  75.748  5.333   1.00 44.00  ? 14  SER C C   1 
ATOM   3328  O  O   . SER C  1 14  ? -52.053  76.740  4.626   1.00 36.23  ? 14  SER C O   1 
ATOM   3329  C  CB  . SER C  1 14  ? -50.999  73.604  4.301   1.00 31.93  ? 14  SER C CB  1 
ATOM   3330  O  OG  . SER C  1 14  ? -49.933  74.504  4.089   1.00 41.55  ? 14  SER C OG  1 
ATOM   3331  N  N   . ARG C  1 15  ? -51.221  75.842  6.514   1.00 36.66  ? 15  ARG C N   1 
ATOM   3332  C  CA  . ARG C  1 15  ? -50.865  77.147  7.056   1.00 46.61  ? 15  ARG C CA  1 
ATOM   3333  C  C   . ARG C  1 15  ? -49.417  77.194  7.498   1.00 35.01  ? 15  ARG C C   1 
ATOM   3334  O  O   . ARG C  1 15  ? -49.072  76.653  8.547   1.00 49.09  ? 15  ARG C O   1 
ATOM   3335  C  CB  . ARG C  1 15  ? -51.769  77.500  8.235   1.00 60.34  ? 15  ARG C CB  1 
ATOM   3336  C  CG  . ARG C  1 15  ? -53.132  78.000  7.820   1.00 86.26  ? 15  ARG C CG  1 
ATOM   3337  C  CD  . ARG C  1 15  ? -53.032  79.368  7.167   1.00 95.42  ? 15  ARG C CD  1 
ATOM   3338  N  NE  . ARG C  1 15  ? -52.673  80.410  8.126   1.00 91.57  ? 15  ARG C NE  1 
ATOM   3339  C  CZ  . ARG C  1 15  ? -53.382  80.710  9.212   1.00 83.60  ? 15  ARG C CZ  1 
ATOM   3340  N  NH1 . ARG C  1 15  ? -54.493  80.038  9.498   1.00 72.25  ? 15  ARG C NH1 1 
ATOM   3341  N  NH2 . ARG C  1 15  ? -52.973  81.681  10.017  1.00 81.60  ? 15  ARG C NH2 1 
ATOM   3342  N  N   . PRO C  1 16  ? -48.564  77.852  6.704   1.00 35.51  ? 16  PRO C N   1 
ATOM   3343  C  CA  . PRO C  1 16  ? -47.125  77.847  6.986   1.00 38.24  ? 16  PRO C CA  1 
ATOM   3344  C  C   . PRO C  1 16  ? -46.738  78.684  8.208   1.00 30.36  ? 16  PRO C C   1 
ATOM   3345  O  O   . PRO C  1 16  ? -45.741  78.376  8.854   1.00 52.22  ? 16  PRO C O   1 
ATOM   3346  C  CB  . PRO C  1 16  ? -46.517  78.470  5.733   1.00 30.43  ? 16  PRO C CB  1 
ATOM   3347  C  CG  . PRO C  1 16  ? -47.602  78.456  4.712   1.00 35.38  ? 16  PRO C CG  1 
ATOM   3348  C  CD  . PRO C  1 16  ? -48.880  78.544  5.449   1.00 30.40  ? 16  PRO C CD  1 
ATOM   3349  N  N   . ASP C  1 17  ? -47.497  79.741  8.491   1.00 35.20  ? 17  ASP C N   1 
ATOM   3350  C  CA  . ASP C  1 17  ? -47.248  80.647  9.619   1.00 35.33  ? 17  ASP C CA  1 
ATOM   3351  C  C   . ASP C  1 17  ? -47.571  80.004  10.974  1.00 34.20  ? 17  ASP C C   1 
ATOM   3352  O  O   . ASP C  1 17  ? -47.280  80.565  12.026  1.00 43.82  ? 17  ASP C O   1 
ATOM   3353  C  CB  . ASP C  1 17  ? -48.054  81.946  9.426   1.00 36.72  ? 17  ASP C CB  1 
ATOM   3354  C  CG  . ASP C  1 17  ? -49.563  81.685  9.153   1.00 70.23  ? 17  ASP C CG  1 
ATOM   3355  O  OD1 . ASP C  1 17  ? -49.909  80.698  8.454   1.00 52.49  ? 17  ASP C OD1 1 
ATOM   3356  O  OD2 . ASP C  1 17  ? -50.415  82.472  9.638   1.00 75.36  ? 17  ASP C OD2 1 
ATOM   3357  N  N   . VAL C  1 18  ? -48.147  78.808  10.930  1.00 33.37  ? 18  VAL C N   1 
ATOM   3358  C  CA  . VAL C  1 18  ? -48.710  78.152  12.108  1.00 32.40  ? 18  VAL C CA  1 
ATOM   3359  C  C   . VAL C  1 18  ? -47.960  76.886  12.520  1.00 30.99  ? 18  VAL C C   1 
ATOM   3360  O  O   . VAL C  1 18  ? -47.902  75.917  11.783  1.00 30.56  ? 18  VAL C O   1 
ATOM   3361  C  CB  . VAL C  1 18  ? -50.188  77.749  11.861  1.00 38.60  ? 18  VAL C CB  1 
ATOM   3362  C  CG1 . VAL C  1 18  ? -50.756  77.032  13.077  1.00 31.52  ? 18  VAL C CG1 1 
ATOM   3363  C  CG2 . VAL C  1 18  ? -51.040  78.958  11.485  1.00 33.95  ? 18  VAL C CG2 1 
ATOM   3364  N  N   . ILE C  1 19  ? -47.402  76.897  13.719  1.00 32.81  ? 19  ILE C N   1 
ATOM   3365  C  CA  . ILE C  1 19  ? -46.651  75.757  14.211  1.00 29.00  ? 19  ILE C CA  1 
ATOM   3366  C  C   . ILE C  1 19  ? -47.606  74.599  14.524  1.00 31.94  ? 19  ILE C C   1 
ATOM   3367  O  O   . ILE C  1 19  ? -48.547  74.748  15.307  1.00 28.11  ? 19  ILE C O   1 
ATOM   3368  C  CB  . ILE C  1 19  ? -45.835  76.167  15.446  1.00 37.22  ? 19  ILE C CB  1 
ATOM   3369  C  CG1 . ILE C  1 19  ? -44.927  75.027  15.928  1.00 27.29  ? 19  ILE C CG1 1 
ATOM   3370  C  CG2 . ILE C  1 19  ? -46.779  76.708  16.531  1.00 28.70  ? 19  ILE C CG2 1 
ATOM   3371  C  CD1 . ILE C  1 19  ? -44.042  75.422  17.061  1.00 26.92  ? 19  ILE C CD1 1 
ATOM   3372  N  N   . PRO C  1 20  ? -47.367  73.440  13.900  1.00 27.48  ? 20  PRO C N   1 
ATOM   3373  C  CA  . PRO C  1 20  ? -48.291  72.306  13.943  1.00 26.78  ? 20  PRO C CA  1 
ATOM   3374  C  C   . PRO C  1 20  ? -48.288  71.586  15.282  1.00 33.28  ? 20  PRO C C   1 
ATOM   3375  O  O   . PRO C  1 20  ? -48.057  70.378  15.345  1.00 39.79  ? 20  PRO C O   1 
ATOM   3376  C  CB  . PRO C  1 20  ? -47.763  71.394  12.833  1.00 26.48  ? 20  PRO C CB  1 
ATOM   3377  C  CG  . PRO C  1 20  ? -46.289  71.663  12.826  1.00 26.37  ? 20  PRO C CG  1 
ATOM   3378  C  CD  . PRO C  1 20  ? -46.137  73.122  13.155  1.00 27.31  ? 20  PRO C CD  1 
ATOM   3379  N  N   . THR C  1 21  ? -48.599  72.340  16.325  1.00 8.93   ? 21  THR C N   1 
ATOM   3380  C  CA  . THR C  1 21  ? -48.581  71.866  17.705  1.00 31.83  ? 21  THR C CA  1 
ATOM   3381  C  C   . THR C  1 21  ? -49.736  70.935  17.991  1.00 39.04  ? 21  THR C C   1 
ATOM   3382  O  O   . THR C  1 21  ? -50.896  71.275  17.766  1.00 31.71  ? 21  THR C O   1 
ATOM   3383  C  CB  . THR C  1 21  ? -48.595  73.056  18.691  1.00 27.17  ? 21  THR C CB  1 
ATOM   3384  O  OG1 . THR C  1 21  ? -47.244  73.357  19.050  1.00 18.98  ? 21  THR C OG1 1 
ATOM   3385  C  CG2 . THR C  1 21  ? -49.377  72.732  19.943  1.00 24.95  ? 21  THR C CG2 1 
ATOM   3386  N  N   . GLN C  1 22  ? -49.413  69.744  18.472  1.00 49.18  ? 22  GLN C N   1 
ATOM   3387  C  CA  . GLN C  1 22  ? -50.441  68.748  18.730  1.00 63.85  ? 22  GLN C CA  1 
ATOM   3388  C  C   . GLN C  1 22  ? -50.589  68.525  20.224  1.00 51.08  ? 22  GLN C C   1 
ATOM   3389  O  O   . GLN C  1 22  ? -49.705  67.940  20.854  1.00 42.30  ? 22  GLN C O   1 
ATOM   3390  C  CB  . GLN C  1 22  ? -50.113  67.430  18.020  1.00 72.40  ? 22  GLN C CB  1 
ATOM   3391  C  CG  . GLN C  1 22  ? -50.651  67.336  16.596  1.00 82.41  ? 22  GLN C CG  1 
ATOM   3392  C  CD  . GLN C  1 22  ? -52.137  67.014  16.550  1.00 65.32  ? 22  GLN C CD  1 
ATOM   3393  O  OE1 . GLN C  1 22  ? -52.559  65.921  16.940  1.00 43.93  ? 22  GLN C OE1 1 
ATOM   3394  N  NE2 . GLN C  1 22  ? -52.936  67.967  16.073  1.00 41.18  ? 22  GLN C NE2 1 
ATOM   3395  N  N   . ARG C  1 23  ? -51.700  69.010  20.781  1.00 50.28  ? 23  ARG C N   1 
ATOM   3396  C  CA  . ARG C  1 23  ? -52.037  68.797  22.193  1.00 76.01  ? 23  ARG C CA  1 
ATOM   3397  C  C   . ARG C  1 23  ? -51.158  69.624  23.134  1.00 61.56  ? 23  ARG C C   1 
ATOM   3398  O  O   . ARG C  1 23  ? -50.705  69.136  24.179  1.00 42.92  ? 23  ARG C O   1 
ATOM   3399  C  CB  . ARG C  1 23  ? -51.947  67.310  22.550  1.00 76.10  ? 23  ARG C CB  1 
ATOM   3400  C  CG  . ARG C  1 23  ? -52.781  66.424  21.652  1.00 54.09  ? 23  ARG C CG  1 
ATOM   3401  C  CD  . ARG C  1 23  ? -52.295  64.994  21.686  1.00 52.84  ? 23  ARG C CD  1 
ATOM   3402  N  NE  . ARG C  1 23  ? -53.361  64.093  21.266  1.00 75.39  ? 23  ARG C NE  1 
ATOM   3403  C  CZ  . ARG C  1 23  ? -53.356  62.782  21.474  1.00 86.84  ? 23  ARG C CZ  1 
ATOM   3404  N  NH1 . ARG C  1 23  ? -52.329  62.211  22.100  1.00 74.15  ? 23  ARG C NH1 1 
ATOM   3405  N  NH2 . ARG C  1 23  ? -54.382  62.044  21.060  1.00 80.00  ? 23  ARG C NH2 1 
ATOM   3406  N  N   . ASP C  1 24  ? -50.931  70.878  22.755  1.00 35.42  ? 24  ASP C N   1 
ATOM   3407  C  CA  . ASP C  1 24  ? -50.043  71.756  23.505  1.00 70.74  ? 24  ASP C CA  1 
ATOM   3408  C  C   . ASP C  1 24  ? -48.713  71.075  23.886  1.00 82.63  ? 24  ASP C C   1 
ATOM   3409  O  O   . ASP C  1 24  ? -48.082  71.433  24.880  1.00 89.24  ? 24  ASP C O   1 
ATOM   3410  C  CB  . ASP C  1 24  ? -50.747  72.326  24.742  1.00 61.14  ? 24  ASP C CB  1 
ATOM   3411  C  CG  . ASP C  1 24  ? -50.297  73.751  25.064  1.00 73.21  ? 24  ASP C CG  1 
ATOM   3412  O  OD1 . ASP C  1 24  ? -51.020  74.699  24.667  1.00 66.10  ? 24  ASP C OD1 1 
ATOM   3413  O  OD2 . ASP C  1 24  ? -49.215  73.921  25.695  1.00 42.78  ? 24  ASP C OD2 1 
ATOM   3414  N  N   . ARG C  1 25  ? -48.305  70.087  23.093  1.00 56.17  ? 25  ARG C N   1 
ATOM   3415  C  CA  . ARG C  1 25  ? -46.953  69.547  23.157  1.00 43.08  ? 25  ARG C CA  1 
ATOM   3416  C  C   . ARG C  1 25  ? -46.097  70.237  22.089  1.00 45.74  ? 25  ARG C C   1 
ATOM   3417  O  O   . ARG C  1 25  ? -46.616  70.735  21.082  1.00 46.67  ? 25  ARG C O   1 
ATOM   3418  C  CB  . ARG C  1 25  ? -46.957  68.045  22.884  1.00 48.13  ? 25  ARG C CB  1 
ATOM   3419  C  CG  . ARG C  1 25  ? -47.902  67.240  23.746  1.00 69.94  ? 25  ARG C CG  1 
ATOM   3420  C  CD  . ARG C  1 25  ? -48.231  65.930  23.047  1.00 94.43  ? 25  ARG C CD  1 
ATOM   3421  N  NE  . ARG C  1 25  ? -48.623  64.874  23.977  1.00 109.66 ? 25  ARG C NE  1 
ATOM   3422  C  CZ  . ARG C  1 25  ? -47.782  63.982  24.496  1.00 100.30 ? 25  ARG C CZ  1 
ATOM   3423  N  NH1 . ARG C  1 25  ? -46.492  64.016  24.182  1.00 89.34  ? 25  ARG C NH1 1 
ATOM   3424  N  NH2 . ARG C  1 25  ? -48.231  63.053  25.332  1.00 96.71  ? 25  ARG C NH2 1 
ATOM   3425  N  N   . PRO C  1 26  ? -44.773  70.258  22.292  1.00 35.69  ? 26  PRO C N   1 
ATOM   3426  C  CA  . PRO C  1 26  ? -43.909  70.847  21.262  1.00 26.68  ? 26  PRO C CA  1 
ATOM   3427  C  C   . PRO C  1 26  ? -43.826  69.984  20.011  1.00 14.98  ? 26  PRO C C   1 
ATOM   3428  O  O   . PRO C  1 26  ? -43.891  68.763  20.097  1.00 23.41  ? 26  PRO C O   1 
ATOM   3429  C  CB  . PRO C  1 26  ? -42.541  70.877  21.940  1.00 24.20  ? 26  PRO C CB  1 
ATOM   3430  C  CG  . PRO C  1 26  ? -42.594  69.738  22.901  1.00 16.96  ? 26  PRO C CG  1 
ATOM   3431  C  CD  . PRO C  1 26  ? -43.999  69.714  23.423  1.00 16.32  ? 26  PRO C CD  1 
ATOM   3432  N  N   . VAL C  1 27  ? -43.684  70.620  18.857  1.00 23.82  ? 27  VAL C N   1 
ATOM   3433  C  CA  . VAL C  1 27  ? -43.405  69.890  17.629  1.00 25.24  ? 27  VAL C CA  1 
ATOM   3434  C  C   . VAL C  1 27  ? -42.006  69.279  17.705  1.00 25.72  ? 27  VAL C C   1 
ATOM   3435  O  O   . VAL C  1 27  ? -41.016  69.990  17.897  1.00 23.79  ? 27  VAL C O   1 
ATOM   3436  C  CB  . VAL C  1 27  ? -43.456  70.803  16.400  1.00 30.86  ? 27  VAL C CB  1 
ATOM   3437  C  CG1 . VAL C  1 27  ? -43.244  69.983  15.133  1.00 13.34  ? 27  VAL C CG1 1 
ATOM   3438  C  CG2 . VAL C  1 27  ? -44.774  71.555  16.343  1.00 30.72  ? 27  VAL C CG2 1 
ATOM   3439  N  N   . ALA C  1 28  ? -41.933  67.962  17.560  1.00 23.04  ? 28  ALA C N   1 
ATOM   3440  C  CA  . ALA C  1 28  ? -40.655  67.268  17.601  1.00 17.92  ? 28  ALA C CA  1 
ATOM   3441  C  C   . ALA C  1 28  ? -39.989  67.335  16.240  1.00 17.35  ? 28  ALA C C   1 
ATOM   3442  O  O   . ALA C  1 28  ? -40.399  66.650  15.315  1.00 16.67  ? 28  ALA C O   1 
ATOM   3443  C  CB  . ALA C  1 28  ? -40.844  65.830  18.008  1.00 12.70  ? 28  ALA C CB  1 
ATOM   3444  N  N   . VAL C  1 29  ? -38.952  68.156  16.136  1.00 20.34  ? 29  VAL C N   1 
ATOM   3445  C  CA  . VAL C  1 29  ? -38.149  68.247  14.921  1.00 22.47  ? 29  VAL C CA  1 
ATOM   3446  C  C   . VAL C  1 29  ? -36.898  67.374  15.001  1.00 19.85  ? 29  VAL C C   1 
ATOM   3447  O  O   . VAL C  1 29  ? -36.159  67.431  15.984  1.00 36.92  ? 29  VAL C O   1 
ATOM   3448  C  CB  . VAL C  1 29  ? -37.706  69.703  14.668  1.00 17.78  ? 29  VAL C CB  1 
ATOM   3449  C  CG1 . VAL C  1 29  ? -36.963  69.810  13.341  1.00 8.76   ? 29  VAL C CG1 1 
ATOM   3450  C  CG2 . VAL C  1 29  ? -38.908  70.621  14.716  1.00 15.15  ? 29  VAL C CG2 1 
ATOM   3451  N  N   . SER C  1 30  ? -36.655  66.573  13.971  1.00 30.40  ? 30  SER C N   1 
ATOM   3452  C  CA  . SER C  1 30  ? -35.389  65.835  13.878  1.00 19.38  ? 30  SER C CA  1 
ATOM   3453  C  C   . SER C  1 30  ? -34.445  66.497  12.891  1.00 23.98  ? 30  SER C C   1 
ATOM   3454  O  O   . SER C  1 30  ? -34.836  66.837  11.772  1.00 39.27  ? 30  SER C O   1 
ATOM   3455  C  CB  . SER C  1 30  ? -35.612  64.381  13.475  1.00 12.61  ? 30  SER C CB  1 
ATOM   3456  O  OG  . SER C  1 30  ? -36.078  63.613  14.564  1.00 39.89  ? 30  SER C OG  1 
ATOM   3457  N  N   . VAL C  1 31  ? -33.198  66.681  13.312  1.00 26.69  ? 31  VAL C N   1 
ATOM   3458  C  CA  . VAL C  1 31  ? -32.184  67.286  12.459  1.00 33.93  ? 31  VAL C CA  1 
ATOM   3459  C  C   . VAL C  1 31  ? -30.968  66.386  12.374  1.00 29.55  ? 31  VAL C C   1 
ATOM   3460  O  O   . VAL C  1 31  ? -30.540  65.798  13.361  1.00 35.93  ? 31  VAL C O   1 
ATOM   3461  C  CB  . VAL C  1 31  ? -31.737  68.683  12.955  1.00 31.10  ? 31  VAL C CB  1 
ATOM   3462  C  CG1 . VAL C  1 31  ? -31.104  69.442  11.818  1.00 34.01  ? 31  VAL C CG1 1 
ATOM   3463  C  CG2 . VAL C  1 31  ? -32.905  69.462  13.490  1.00 35.52  ? 31  VAL C CG2 1 
ATOM   3464  N  N   . SER C  1 32  ? -30.412  66.304  11.179  1.00 26.22  ? 32  SER C N   1 
ATOM   3465  C  CA  . SER C  1 32  ? -29.246  65.494  10.933  1.00 28.80  ? 32  SER C CA  1 
ATOM   3466  C  C   . SER C  1 32  ? -28.501  66.102  9.747   1.00 34.08  ? 32  SER C C   1 
ATOM   3467  O  O   . SER C  1 32  ? -29.117  66.420  8.740   1.00 37.30  ? 32  SER C O   1 
ATOM   3468  C  CB  . SER C  1 32  ? -29.675  64.060  10.638  1.00 25.28  ? 32  SER C CB  1 
ATOM   3469  O  OG  . SER C  1 32  ? -28.560  63.228  10.398  1.00 54.58  ? 32  SER C OG  1 
ATOM   3470  N  N   . LEU C  1 33  ? -27.187  66.292  9.879   1.00 31.63  ? 33  LEU C N   1 
ATOM   3471  C  CA  . LEU C  1 33  ? -26.384  66.833  8.786   1.00 14.30  ? 33  LEU C CA  1 
ATOM   3472  C  C   . LEU C  1 33  ? -25.644  65.732  8.042   1.00 24.84  ? 33  LEU C C   1 
ATOM   3473  O  O   . LEU C  1 33  ? -24.882  64.974  8.634   1.00 34.23  ? 33  LEU C O   1 
ATOM   3474  C  CB  . LEU C  1 33  ? -25.390  67.859  9.301   1.00 16.84  ? 33  LEU C CB  1 
ATOM   3475  C  CG  . LEU C  1 33  ? -25.970  69.048  10.050  1.00 17.97  ? 33  LEU C CG  1 
ATOM   3476  C  CD1 . LEU C  1 33  ? -24.889  70.076  10.261  1.00 10.96  ? 33  LEU C CD1 1 
ATOM   3477  C  CD2 . LEU C  1 33  ? -27.114  69.633  9.274   1.00 13.30  ? 33  LEU C CD2 1 
ATOM   3478  N  N   . LYS C  1 34  ? -25.884  65.629  6.744   1.00 21.32  ? 34  LYS C N   1 
ATOM   3479  C  CA  . LYS C  1 34  ? -25.165  64.667  5.933   1.00 21.33  ? 34  LYS C CA  1 
ATOM   3480  C  C   . LYS C  1 34  ? -24.139  65.463  5.155   1.00 21.90  ? 34  LYS C C   1 
ATOM   3481  O  O   . LYS C  1 34  ? -24.488  66.156  4.206   1.00 18.05  ? 34  LYS C O   1 
ATOM   3482  C  CB  . LYS C  1 34  ? -26.099  63.934  4.964   1.00 31.12  ? 34  LYS C CB  1 
ATOM   3483  C  CG  . LYS C  1 34  ? -27.419  63.449  5.564   1.00 41.75  ? 34  LYS C CG  1 
ATOM   3484  C  CD  . LYS C  1 34  ? -27.254  62.224  6.456   1.00 50.18  ? 34  LYS C CD  1 
ATOM   3485  C  CE  . LYS C  1 34  ? -28.624  61.671  6.877   1.00 57.85  ? 34  LYS C CE  1 
ATOM   3486  N  NZ  . LYS C  1 34  ? -28.554  60.636  7.956   1.00 60.82  ? 34  LYS C NZ  1 
ATOM   3487  N  N   . PHE C  1 35  ? -22.877  65.376  5.569   1.00 23.68  ? 35  PHE C N   1 
ATOM   3488  C  CA  . PHE C  1 35  ? -21.815  66.161  4.950   1.00 23.03  ? 35  PHE C CA  1 
ATOM   3489  C  C   . PHE C  1 35  ? -21.444  65.680  3.552   1.00 25.20  ? 35  PHE C C   1 
ATOM   3490  O  O   . PHE C  1 35  ? -21.279  64.481  3.315   1.00 18.04  ? 35  PHE C O   1 
ATOM   3491  C  CB  . PHE C  1 35  ? -20.575  66.212  5.850   1.00 25.77  ? 35  PHE C CB  1 
ATOM   3492  C  CG  . PHE C  1 35  ? -20.782  66.998  7.102   1.00 27.79  ? 35  PHE C CG  1 
ATOM   3493  C  CD1 . PHE C  1 35  ? -20.672  68.382  7.090   1.00 18.58  ? 35  PHE C CD1 1 
ATOM   3494  C  CD2 . PHE C  1 35  ? -21.099  66.356  8.288   1.00 15.05  ? 35  PHE C CD2 1 
ATOM   3495  C  CE1 . PHE C  1 35  ? -20.875  69.113  8.237   1.00 27.75  ? 35  PHE C CE1 1 
ATOM   3496  C  CE2 . PHE C  1 35  ? -21.296  67.076  9.440   1.00 27.42  ? 35  PHE C CE2 1 
ATOM   3497  C  CZ  . PHE C  1 35  ? -21.184  68.458  9.418   1.00 30.16  ? 35  PHE C CZ  1 
ATOM   3498  N  N   . ILE C  1 36  ? -21.321  66.633  2.639   1.00 9.62   ? 36  ILE C N   1 
ATOM   3499  C  CA  . ILE C  1 36  ? -21.080  66.314  1.248   1.00 27.90  ? 36  ILE C CA  1 
ATOM   3500  C  C   . ILE C  1 36  ? -19.663  66.742  0.848   1.00 33.46  ? 36  ILE C C   1 
ATOM   3501  O  O   . ILE C  1 36  ? -18.977  66.059  0.097   1.00 27.78  ? 36  ILE C O   1 
ATOM   3502  C  CB  . ILE C  1 36  ? -22.116  67.007  0.344   1.00 14.49  ? 36  ILE C CB  1 
ATOM   3503  C  CG1 . ILE C  1 36  ? -23.526  66.725  0.860   1.00 19.88  ? 36  ILE C CG1 1 
ATOM   3504  C  CG2 . ILE C  1 36  ? -21.977  66.524  -1.065  1.00 10.98  ? 36  ILE C CG2 1 
ATOM   3505  C  CD1 . ILE C  1 36  ? -23.875  65.241  0.902   1.00 13.95  ? 36  ILE C CD1 1 
ATOM   3506  N  N   . ASN C  1 37  ? -19.222  67.873  1.376   1.00 20.42  ? 37  ASN C N   1 
ATOM   3507  C  CA  . ASN C  1 37  ? -17.959  68.435  0.977   1.00 11.79  ? 37  ASN C CA  1 
ATOM   3508  C  C   . ASN C  1 37  ? -17.462  69.486  1.957   1.00 20.42  ? 37  ASN C C   1 
ATOM   3509  O  O   . ASN C  1 37  ? -18.232  70.139  2.643   1.00 20.62  ? 37  ASN C O   1 
ATOM   3510  C  CB  . ASN C  1 37  ? -18.072  69.035  -0.434  1.00 24.12  ? 37  ASN C CB  1 
ATOM   3511  C  CG  . ASN C  1 37  ? -16.802  68.842  -1.258  1.00 30.56  ? 37  ASN C CG  1 
ATOM   3512  O  OD1 . ASN C  1 37  ? -15.701  68.862  -0.728  1.00 23.15  ? 37  ASN C OD1 1 
ATOM   3513  N  ND2 . ASN C  1 37  ? -16.963  68.645  -2.558  1.00 30.77  ? 37  ASN C ND2 1 
ATOM   3514  N  N   . ILE C  1 38  ? -16.149  69.639  2.012   1.00 28.94  ? 38  ILE C N   1 
ATOM   3515  C  CA  . ILE C  1 38  ? -15.537  70.721  2.756   1.00 11.94  ? 38  ILE C CA  1 
ATOM   3516  C  C   . ILE C  1 38  ? -14.673  71.441  1.737   1.00 24.91  ? 38  ILE C C   1 
ATOM   3517  O  O   . ILE C  1 38  ? -13.789  70.833  1.123   1.00 35.09  ? 38  ILE C O   1 
ATOM   3518  C  CB  . ILE C  1 38  ? -14.713  70.170  3.944   1.00 26.85  ? 38  ILE C CB  1 
ATOM   3519  C  CG1 . ILE C  1 38  ? -15.610  69.305  4.828   1.00 14.64  ? 38  ILE C CG1 1 
ATOM   3520  C  CG2 . ILE C  1 38  ? -14.076  71.294  4.755   1.00 12.02  ? 38  ILE C CG2 1 
ATOM   3521  C  CD1 . ILE C  1 38  ? -14.942  68.725  5.997   1.00 17.09  ? 38  ILE C CD1 1 
ATOM   3522  N  N   . LEU C  1 39  ? -14.943  72.728  1.541   1.00 22.80  ? 39  LEU C N   1 
ATOM   3523  C  CA  . LEU C  1 39  ? -14.455  73.441  0.357   1.00 22.12  ? 39  LEU C CA  1 
ATOM   3524  C  C   . LEU C  1 39  ? -13.284  74.357  0.627   1.00 35.14  ? 39  LEU C C   1 
ATOM   3525  O  O   . LEU C  1 39  ? -12.353  74.458  -0.167  1.00 62.91  ? 39  LEU C O   1 
ATOM   3526  C  CB  . LEU C  1 39  ? -15.591  74.243  -0.269  1.00 12.71  ? 39  LEU C CB  1 
ATOM   3527  C  CG  . LEU C  1 39  ? -16.722  73.364  -0.814  1.00 30.29  ? 39  LEU C CG  1 
ATOM   3528  C  CD1 . LEU C  1 39  ? -17.767  74.194  -1.491  1.00 27.35  ? 39  LEU C CD1 1 
ATOM   3529  C  CD2 . LEU C  1 39  ? -16.190  72.308  -1.777  1.00 25.62  ? 39  LEU C CD2 1 
ATOM   3530  N  N   . GLU C  1 40  ? -13.355  75.048  1.741   1.00 24.89  ? 40  GLU C N   1 
ATOM   3531  C  CA  . GLU C  1 40  ? -12.259  75.870  2.158   1.00 6.68   ? 40  GLU C CA  1 
ATOM   3532  C  C   . GLU C  1 40  ? -12.197  75.914  3.666   1.00 38.78  ? 40  GLU C C   1 
ATOM   3533  O  O   . GLU C  1 40  ? -13.215  75.991  4.353   1.00 39.97  ? 40  GLU C O   1 
ATOM   3534  C  CB  . GLU C  1 40  ? -12.392  77.279  1.637   1.00 8.27   ? 40  GLU C CB  1 
ATOM   3535  C  CG  . GLU C  1 40  ? -11.142  78.076  1.878   1.00 18.27  ? 40  GLU C CG  1 
ATOM   3536  C  CD  . GLU C  1 40  ? -11.426  79.539  1.941   1.00 68.32  ? 40  GLU C CD  1 
ATOM   3537  O  OE1 . GLU C  1 40  ? -12.562  79.912  1.565   1.00 78.22  ? 40  GLU C OE1 1 
ATOM   3538  O  OE2 . GLU C  1 40  ? -10.531  80.304  2.373   1.00 74.56  ? 40  GLU C OE2 1 
ATOM   3539  N  N   . VAL C  1 41  ? -10.972  75.852  4.165   1.00 45.62  ? 41  VAL C N   1 
ATOM   3540  C  CA  . VAL C  1 41  ? -10.705  75.883  5.581   1.00 31.81  ? 41  VAL C CA  1 
ATOM   3541  C  C   . VAL C  1 41  ? -9.699   76.993  5.836   1.00 20.15  ? 41  VAL C C   1 
ATOM   3542  O  O   . VAL C  1 41  ? -8.889   77.299  4.983   1.00 21.29  ? 41  VAL C O   1 
ATOM   3543  C  CB  . VAL C  1 41  ? -10.138  74.548  6.018   1.00 32.94  ? 41  VAL C CB  1 
ATOM   3544  C  CG1 . VAL C  1 41  ? -9.473   74.680  7.350   1.00 41.85  ? 41  VAL C CG1 1 
ATOM   3545  C  CG2 . VAL C  1 41  ? -11.245  73.497  6.055   1.00 31.22  ? 41  VAL C CG2 1 
ATOM   3546  N  N   . ASN C  1 42  ? -9.796   77.645  6.980   1.00 20.49  ? 42  ASN C N   1 
ATOM   3547  C  CA  . ASN C  1 42  ? -8.830   78.659  7.358   1.00 15.89  ? 42  ASN C CA  1 
ATOM   3548  C  C   . ASN C  1 42  ? -8.493   78.532  8.839   1.00 30.92  ? 42  ASN C C   1 
ATOM   3549  O  O   . ASN C  1 42  ? -9.291   78.905  9.713   1.00 33.23  ? 42  ASN C O   1 
ATOM   3550  C  CB  . ASN C  1 42  ? -9.350   80.056  7.049   1.00 20.65  ? 42  ASN C CB  1 
ATOM   3551  C  CG  . ASN C  1 42  ? -8.278   81.122  7.211   1.00 31.52  ? 42  ASN C CG  1 
ATOM   3552  O  OD1 . ASN C  1 42  ? -7.453   81.055  8.120   1.00 26.74  ? 42  ASN C OD1 1 
ATOM   3553  N  ND2 . ASN C  1 42  ? -8.283   82.107  6.325   1.00 22.84  ? 42  ASN C ND2 1 
ATOM   3554  N  N   . GLU C  1 43  ? -7.316   77.991  9.124   1.00 19.95  ? 43  GLU C N   1 
ATOM   3555  C  CA  . GLU C  1 43  ? -6.944   77.721  10.498  1.00 32.05  ? 43  GLU C CA  1 
ATOM   3556  C  C   . GLU C  1 43  ? -6.624   79.014  11.246  1.00 29.50  ? 43  GLU C C   1 
ATOM   3557  O  O   . GLU C  1 43  ? -6.696   79.071  12.465  1.00 32.78  ? 43  GLU C O   1 
ATOM   3558  C  CB  . GLU C  1 43  ? -5.767   76.750  10.560  1.00 37.02  ? 43  GLU C CB  1 
ATOM   3559  C  CG  . GLU C  1 43  ? -5.543   76.153  11.945  1.00 34.83  ? 43  GLU C CG  1 
ATOM   3560  C  CD  . GLU C  1 43  ? -4.612   74.950  11.940  1.00 47.28  ? 43  GLU C CD  1 
ATOM   3561  O  OE1 . GLU C  1 43  ? -4.152   74.518  10.852  1.00 52.87  ? 43  GLU C OE1 1 
ATOM   3562  O  OE2 . GLU C  1 43  ? -4.345   74.430  13.040  1.00 44.53  ? 43  GLU C OE2 1 
ATOM   3563  N  N   . ILE C  1 44  ? -6.286   80.059  10.508  1.00 27.49  ? 44  ILE C N   1 
ATOM   3564  C  CA  . ILE C  1 44  ? -6.012   81.351  11.117  1.00 36.38  ? 44  ILE C CA  1 
ATOM   3565  C  C   . ILE C  1 44  ? -7.301   82.001  11.588  1.00 29.78  ? 44  ILE C C   1 
ATOM   3566  O  O   . ILE C  1 44  ? -7.436   82.349  12.749  1.00 30.72  ? 44  ILE C O   1 
ATOM   3567  C  CB  . ILE C  1 44  ? -5.315   82.323  10.132  1.00 47.52  ? 44  ILE C CB  1 
ATOM   3568  C  CG1 . ILE C  1 44  ? -4.061   81.681  9.512   1.00 51.13  ? 44  ILE C CG1 1 
ATOM   3569  C  CG2 . ILE C  1 44  ? -4.992   83.655  10.827  1.00 27.92  ? 44  ILE C CG2 1 
ATOM   3570  C  CD1 . ILE C  1 44  ? -2.909   81.417  10.496  1.00 38.97  ? 44  ILE C CD1 1 
ATOM   3571  N  N   . THR C  1 45  ? -8.250   82.167  10.677  1.00 29.13  ? 45  THR C N   1 
ATOM   3572  C  CA  . THR C  1 45  ? -9.522   82.810  11.009  1.00 25.67  ? 45  THR C CA  1 
ATOM   3573  C  C   . THR C  1 45  ? -10.510  81.890  11.711  1.00 20.70  ? 45  THR C C   1 
ATOM   3574  O  O   . THR C  1 45  ? -11.510  82.356  12.247  1.00 33.71  ? 45  THR C O   1 
ATOM   3575  C  CB  . THR C  1 45  ? -10.219  83.352  9.772   1.00 17.01  ? 45  THR C CB  1 
ATOM   3576  O  OG1 . THR C  1 45  ? -10.527  82.264  8.898   1.00 25.13  ? 45  THR C OG1 1 
ATOM   3577  C  CG2 . THR C  1 45  ? -9.341   84.347  9.046   1.00 14.64  ? 45  THR C CG2 1 
ATOM   3578  N  N   . ASN C  1 46  ? -10.237  80.590  11.702  1.00 25.49  ? 46  ASN C N   1 
ATOM   3579  C  CA  . ASN C  1 46  ? -11.148  79.623  12.295  1.00 19.02  ? 46  ASN C CA  1 
ATOM   3580  C  C   . ASN C  1 46  ? -12.519  79.655  11.597  1.00 33.49  ? 46  ASN C C   1 
ATOM   3581  O  O   . ASN C  1 46  ? -13.564  79.795  12.241  1.00 33.47  ? 46  ASN C O   1 
ATOM   3582  C  CB  . ASN C  1 46  ? -11.310  79.885  13.791  1.00 13.26  ? 46  ASN C CB  1 
ATOM   3583  C  CG  . ASN C  1 46  ? -10.504  78.926  14.648  1.00 27.70  ? 46  ASN C CG  1 
ATOM   3584  O  OD1 . ASN C  1 46  ? -10.168  77.814  14.230  1.00 25.28  ? 46  ASN C OD1 1 
ATOM   3585  N  ND2 . ASN C  1 46  ? -10.200  79.352  15.866  1.00 19.48  ? 46  ASN C ND2 1 
ATOM   3586  N  N   . GLU C  1 47  ? -12.494  79.535  10.273  1.00 28.77  ? 47  GLU C N   1 
ATOM   3587  C  CA  . GLU C  1 47  ? -13.690  79.573  9.460   1.00 24.75  ? 47  GLU C CA  1 
ATOM   3588  C  C   . GLU C  1 47  ? -13.625  78.431  8.466   1.00 27.22  ? 47  GLU C C   1 
ATOM   3589  O  O   . GLU C  1 47  ? -12.578  78.152  7.909   1.00 36.70  ? 47  GLU C O   1 
ATOM   3590  C  CB  . GLU C  1 47  ? -13.811  80.923  8.748   1.00 7.98   ? 47  GLU C CB  1 
ATOM   3591  C  CG  . GLU C  1 47  ? -13.865  82.115  9.716   1.00 23.62  ? 47  GLU C CG  1 
ATOM   3592  C  CD  . GLU C  1 47  ? -13.855  83.469  9.015   1.00 29.32  ? 47  GLU C CD  1 
ATOM   3593  O  OE1 . GLU C  1 47  ? -14.172  83.517  7.811   1.00 22.94  ? 47  GLU C OE1 1 
ATOM   3594  O  OE2 . GLU C  1 47  ? -13.526  84.487  9.667   1.00 26.80  ? 47  GLU C OE2 1 
ATOM   3595  N  N   . VAL C  1 48  ? -14.750  77.760  8.262   1.00 29.13  ? 48  VAL C N   1 
ATOM   3596  C  CA  . VAL C  1 48  ? -14.828  76.668  7.301   1.00 25.14  ? 48  VAL C CA  1 
ATOM   3597  C  C   . VAL C  1 48  ? -15.992  76.865  6.349   1.00 27.50  ? 48  VAL C C   1 
ATOM   3598  O  O   . VAL C  1 48  ? -17.014  77.448  6.699   1.00 31.66  ? 48  VAL C O   1 
ATOM   3599  C  CB  . VAL C  1 48  ? -14.989  75.300  7.988   1.00 23.79  ? 48  VAL C CB  1 
ATOM   3600  C  CG1 . VAL C  1 48  ? -13.759  74.982  8.821   1.00 36.43  ? 48  VAL C CG1 1 
ATOM   3601  C  CG2 . VAL C  1 48  ? -16.226  75.290  8.859   1.00 27.30  ? 48  VAL C CG2 1 
ATOM   3602  N  N   . ASP C  1 49  ? -15.823  76.380  5.131   1.00 38.38  ? 49  ASP C N   1 
ATOM   3603  C  CA  . ASP C  1 49  ? -16.874  76.455  4.135   1.00 34.49  ? 49  ASP C CA  1 
ATOM   3604  C  C   . ASP C  1 49  ? -17.333  75.027  3.877   1.00 31.93  ? 49  ASP C C   1 
ATOM   3605  O  O   . ASP C  1 49  ? -16.556  74.191  3.407   1.00 47.12  ? 49  ASP C O   1 
ATOM   3606  C  CB  . ASP C  1 49  ? -16.335  77.100  2.862   1.00 38.79  ? 49  ASP C CB  1 
ATOM   3607  C  CG  . ASP C  1 49  ? -17.432  77.652  1.989   1.00 36.38  ? 49  ASP C CG  1 
ATOM   3608  O  OD1 . ASP C  1 49  ? -18.461  76.968  1.851   1.00 40.82  ? 49  ASP C OD1 1 
ATOM   3609  O  OD2 . ASP C  1 49  ? -17.264  78.765  1.442   1.00 42.66  ? 49  ASP C OD2 1 
ATOM   3610  N  N   . VAL C  1 50  ? -18.578  74.739  4.232   1.00 8.77   ? 50  VAL C N   1 
ATOM   3611  C  CA  . VAL C  1 50  ? -19.095  73.380  4.176   1.00 25.29  ? 50  VAL C CA  1 
ATOM   3612  C  C   . VAL C  1 50  ? -20.365  73.235  3.295   1.00 33.14  ? 50  VAL C C   1 
ATOM   3613  O  O   . VAL C  1 50  ? -21.159  74.166  3.145   1.00 23.30  ? 50  VAL C O   1 
ATOM   3614  C  CB  . VAL C  1 50  ? -19.393  72.871  5.596   1.00 16.93  ? 50  VAL C CB  1 
ATOM   3615  C  CG1 . VAL C  1 50  ? -19.965  71.468  5.556   1.00 38.88  ? 50  VAL C CG1 1 
ATOM   3616  C  CG2 . VAL C  1 50  ? -18.153  72.886  6.420   1.00 19.90  ? 50  VAL C CG2 1 
ATOM   3617  N  N   . VAL C  1 51  ? -20.524  72.060  2.698   1.00 10.47  ? 51  VAL C N   1 
ATOM   3618  C  CA  . VAL C  1 51  ? -21.723  71.696  1.972   1.00 14.22  ? 51  VAL C CA  1 
ATOM   3619  C  C   . VAL C  1 51  ? -22.300  70.437  2.618   1.00 25.14  ? 51  VAL C C   1 
ATOM   3620  O  O   . VAL C  1 51  ? -21.603  69.424  2.804   1.00 13.37  ? 51  VAL C O   1 
ATOM   3621  C  CB  . VAL C  1 51  ? -21.435  71.447  0.467   1.00 13.39  ? 51  VAL C CB  1 
ATOM   3622  C  CG1 . VAL C  1 51  ? -22.572  70.737  -0.186  1.00 4.66   ? 51  VAL C CG1 1 
ATOM   3623  C  CG2 . VAL C  1 51  ? -21.181  72.747  -0.251  1.00 15.16  ? 51  VAL C CG2 1 
ATOM   3624  N  N   . PHE C  1 52  ? -23.579  70.504  2.969   1.00 18.84  ? 52  PHE C N   1 
ATOM   3625  C  CA  . PHE C  1 52  ? -24.236  69.398  3.657   1.00 21.02  ? 52  PHE C CA  1 
ATOM   3626  C  C   . PHE C  1 52  ? -25.712  69.321  3.285   1.00 24.08  ? 52  PHE C C   1 
ATOM   3627  O  O   . PHE C  1 52  ? -26.357  70.339  3.020   1.00 22.59  ? 52  PHE C O   1 
ATOM   3628  C  CB  . PHE C  1 52  ? -24.107  69.562  5.173   1.00 12.67  ? 52  PHE C CB  1 
ATOM   3629  C  CG  . PHE C  1 52  ? -24.611  70.889  5.674   1.00 14.83  ? 52  PHE C CG  1 
ATOM   3630  C  CD1 . PHE C  1 52  ? -23.820  72.018  5.594   1.00 22.85  ? 52  PHE C CD1 1 
ATOM   3631  C  CD2 . PHE C  1 52  ? -25.872  71.012  6.198   1.00 25.02  ? 52  PHE C CD2 1 
ATOM   3632  C  CE1 . PHE C  1 52  ? -24.281  73.242  6.036   1.00 32.67  ? 52  PHE C CE1 1 
ATOM   3633  C  CE2 . PHE C  1 52  ? -26.339  72.234  6.644   1.00 23.68  ? 52  PHE C CE2 1 
ATOM   3634  C  CZ  . PHE C  1 52  ? -25.542  73.348  6.559   1.00 25.19  ? 52  PHE C CZ  1 
ATOM   3635  N  N   . TRP C  1 53  ? -26.244  68.109  3.258   1.00 12.73  ? 53  TRP C N   1 
ATOM   3636  C  CA  . TRP C  1 53  ? -27.679  67.928  3.197   1.00 14.00  ? 53  TRP C CA  1 
ATOM   3637  C  C   . TRP C  1 53  ? -28.220  68.124  4.607   1.00 21.47  ? 53  TRP C C   1 
ATOM   3638  O  O   . TRP C  1 53  ? -27.757  67.465  5.540   1.00 21.19  ? 53  TRP C O   1 
ATOM   3639  C  CB  . TRP C  1 53  ? -28.010  66.518  2.755   1.00 5.37   ? 53  TRP C CB  1 
ATOM   3640  C  CG  . TRP C  1 53  ? -27.613  66.209  1.402   1.00 9.13   ? 53  TRP C CG  1 
ATOM   3641  C  CD1 . TRP C  1 53  ? -26.993  67.039  0.513   1.00 23.87  ? 53  TRP C CD1 1 
ATOM   3642  C  CD2 . TRP C  1 53  ? -27.792  64.960  0.733   1.00 18.53  ? 53  TRP C CD2 1 
ATOM   3643  N  NE1 . TRP C  1 53  ? -26.772  66.377  -0.676  1.00 25.61  ? 53  TRP C NE1 1 
ATOM   3644  C  CE2 . TRP C  1 53  ? -27.253  65.098  -0.562  1.00 15.22  ? 53  TRP C CE2 1 
ATOM   3645  C  CE3 . TRP C  1 53  ? -28.357  63.737  1.101   1.00 14.50  ? 53  TRP C CE3 1 
ATOM   3646  C  CZ2 . TRP C  1 53  ? -27.276  64.065  -1.486  1.00 17.05  ? 53  TRP C CZ2 1 
ATOM   3647  C  CZ3 . TRP C  1 53  ? -28.362  62.707  0.188   1.00 15.52  ? 53  TRP C CZ3 1 
ATOM   3648  C  CH2 . TRP C  1 53  ? -27.830  62.877  -1.091  1.00 29.03  ? 53  TRP C CH2 1 
ATOM   3649  N  N   . GLN C  1 54  ? -29.191  69.019  4.767   1.00 14.46  ? 54  GLN C N   1 
ATOM   3650  C  CA  . GLN C  1 54  ? -29.791  69.245  6.078   1.00 18.81  ? 54  GLN C CA  1 
ATOM   3651  C  C   . GLN C  1 54  ? -31.103  68.481  6.199   1.00 28.90  ? 54  GLN C C   1 
ATOM   3652  O  O   . GLN C  1 54  ? -32.164  68.973  5.826   1.00 27.31  ? 54  GLN C O   1 
ATOM   3653  C  CB  . GLN C  1 54  ? -30.004  70.734  6.346   1.00 19.87  ? 54  GLN C CB  1 
ATOM   3654  C  CG  . GLN C  1 54  ? -30.462  71.022  7.755   1.00 25.49  ? 54  GLN C CG  1 
ATOM   3655  C  CD  . GLN C  1 54  ? -30.451  72.495  8.066   1.00 28.88  ? 54  GLN C CD  1 
ATOM   3656  O  OE1 . GLN C  1 54  ? -29.398  73.136  8.078   1.00 38.45  ? 54  GLN C OE1 1 
ATOM   3657  N  NE2 . GLN C  1 54  ? -31.630  73.049  8.311   1.00 46.43  ? 54  GLN C NE2 1 
ATOM   3658  N  N   . GLN C  1 55  ? -31.009  67.262  6.715   1.00 20.47  ? 55  GLN C N   1 
ATOM   3659  C  CA  . GLN C  1 55  ? -32.153  66.377  6.802   1.00 22.43  ? 55  GLN C CA  1 
ATOM   3660  C  C   . GLN C  1 55  ? -33.043  66.786  7.977   1.00 26.33  ? 55  GLN C C   1 
ATOM   3661  O  O   . GLN C  1 55  ? -32.638  66.706  9.131   1.00 26.90  ? 55  GLN C O   1 
ATOM   3662  C  CB  . GLN C  1 55  ? -31.677  64.936  6.954   1.00 19.72  ? 55  GLN C CB  1 
ATOM   3663  C  CG  . GLN C  1 55  ? -32.749  63.891  6.744   1.00 25.00  ? 55  GLN C CG  1 
ATOM   3664  C  CD  . GLN C  1 55  ? -32.359  62.553  7.337   1.00 31.87  ? 55  GLN C CD  1 
ATOM   3665  O  OE1 . GLN C  1 55  ? -32.062  61.602  6.616   1.00 30.01  ? 55  GLN C OE1 1 
ATOM   3666  N  NE2 . GLN C  1 55  ? -32.346  62.476  8.663   1.00 49.01  ? 55  GLN C NE2 1 
ATOM   3667  N  N   . THR C  1 56  ? -34.262  67.218  7.665   1.00 27.43  ? 56  THR C N   1 
ATOM   3668  C  CA  . THR C  1 56  ? -35.183  67.744  8.658   1.00 11.26  ? 56  THR C CA  1 
ATOM   3669  C  C   . THR C  1 56  ? -36.497  66.978  8.597   1.00 16.56  ? 56  THR C C   1 
ATOM   3670  O  O   . THR C  1 56  ? -37.045  66.745  7.530   1.00 17.22  ? 56  THR C O   1 
ATOM   3671  C  CB  . THR C  1 56  ? -35.432  69.264  8.436   1.00 17.40  ? 56  THR C CB  1 
ATOM   3672  O  OG1 . THR C  1 56  ? -34.193  69.935  8.178   1.00 31.66  ? 56  THR C OG1 1 
ATOM   3673  C  CG2 . THR C  1 56  ? -36.042  69.884  9.659   1.00 26.64  ? 56  THR C CG2 1 
ATOM   3674  N  N   . THR C  1 57  ? -37.015  66.601  9.758   1.00 29.87  ? 57  THR C N   1 
ATOM   3675  C  CA  . THR C  1 57  ? -38.183  65.737  9.820   1.00 15.52  ? 57  THR C CA  1 
ATOM   3676  C  C   . THR C  1 57  ? -39.113  66.181  10.920  1.00 27.37  ? 57  THR C C   1 
ATOM   3677  O  O   . THR C  1 57  ? -38.655  66.467  12.028  1.00 17.60  ? 57  THR C O   1 
ATOM   3678  C  CB  . THR C  1 57  ? -37.750  64.278  10.072  1.00 22.12  ? 57  THR C CB  1 
ATOM   3679  O  OG1 . THR C  1 57  ? -37.949  63.529  8.878   1.00 26.76  ? 57  THR C OG1 1 
ATOM   3680  C  CG2 . THR C  1 57  ? -38.534  63.633  11.196  1.00 24.37  ? 57  THR C CG2 1 
ATOM   3681  N  N   . TRP C  1 58  ? -40.412  66.232  10.611  1.00 25.38  ? 58  TRP C N   1 
ATOM   3682  C  CA  . TRP C  1 58  ? -41.437  66.564  11.604  1.00 17.86  ? 58  TRP C CA  1 
ATOM   3683  C  C   . TRP C  1 58  ? -42.850  66.164  11.172  1.00 22.05  ? 58  TRP C C   1 
ATOM   3684  O  O   . TRP C  1 58  ? -43.077  65.717  10.049  1.00 26.57  ? 58  TRP C O   1 
ATOM   3685  C  CB  . TRP C  1 58  ? -41.403  68.059  11.927  1.00 19.19  ? 58  TRP C CB  1 
ATOM   3686  C  CG  . TRP C  1 58  ? -41.906  68.919  10.807  1.00 19.06  ? 58  TRP C CG  1 
ATOM   3687  C  CD1 . TRP C  1 58  ? -43.188  69.349  10.612  1.00 26.17  ? 58  TRP C CD1 1 
ATOM   3688  C  CD2 . TRP C  1 58  ? -41.135  69.445  9.725   1.00 18.83  ? 58  TRP C CD2 1 
ATOM   3689  N  NE1 . TRP C  1 58  ? -43.259  70.115  9.477   1.00 24.13  ? 58  TRP C NE1 1 
ATOM   3690  C  CE2 . TRP C  1 58  ? -42.012  70.191  8.913   1.00 18.07  ? 58  TRP C CE2 1 
ATOM   3691  C  CE3 . TRP C  1 58  ? -39.787  69.356  9.363   1.00 12.48  ? 58  TRP C CE3 1 
ATOM   3692  C  CZ2 . TRP C  1 58  ? -41.588  70.842  7.760   1.00 16.07  ? 58  TRP C CZ2 1 
ATOM   3693  C  CZ3 . TRP C  1 58  ? -39.369  70.000  8.223   1.00 16.39  ? 58  TRP C CZ3 1 
ATOM   3694  C  CH2 . TRP C  1 58  ? -40.265  70.741  7.433   1.00 19.43  ? 58  TRP C CH2 1 
ATOM   3695  N  N   . SER C  1 59  ? -43.803  66.347  12.073  1.00 22.94  ? 59  SER C N   1 
ATOM   3696  C  CA  . SER C  1 59  ? -45.180  65.979  11.795  1.00 23.82  ? 59  SER C CA  1 
ATOM   3697  C  C   . SER C  1 59  ? -46.080  67.206  11.734  1.00 21.60  ? 59  SER C C   1 
ATOM   3698  O  O   . SER C  1 59  ? -46.117  68.005  12.670  1.00 38.18  ? 59  SER C O   1 
ATOM   3699  C  CB  . SER C  1 59  ? -45.696  65.019  12.876  1.00 21.69  ? 59  SER C CB  1 
ATOM   3700  O  OG  . SER C  1 59  ? -46.806  64.274  12.405  1.00 58.74  ? 59  SER C OG  1 
ATOM   3701  N  N   . ASP C  1 60  ? -46.806  67.357  10.632  1.00 12.49  ? 60  ASP C N   1 
ATOM   3702  C  CA  . ASP C  1 60  ? -47.877  68.350  10.559  1.00 15.28  ? 60  ASP C CA  1 
ATOM   3703  C  C   . ASP C  1 60  ? -49.188  67.648  10.198  1.00 23.53  ? 60  ASP C C   1 
ATOM   3704  O  O   . ASP C  1 60  ? -49.476  67.432  9.010   1.00 28.16  ? 60  ASP C O   1 
ATOM   3705  C  CB  . ASP C  1 60  ? -47.552  69.417  9.519   1.00 10.91  ? 60  ASP C CB  1 
ATOM   3706  C  CG  . ASP C  1 60  ? -48.519  70.586  9.561   1.00 34.87  ? 60  ASP C CG  1 
ATOM   3707  O  OD1 . ASP C  1 60  ? -49.612  70.436  10.140  1.00 26.34  ? 60  ASP C OD1 1 
ATOM   3708  O  OD2 . ASP C  1 60  ? -48.195  71.657  9.006   1.00 40.90  ? 60  ASP C OD2 1 
ATOM   3709  N  N   . ARG C  1 61  ? -49.974  67.292  11.213  1.00 19.38  ? 61  ARG C N   1 
ATOM   3710  C  CA  . ARG C  1 61  ? -51.194  66.510  10.985  1.00 36.13  ? 61  ARG C CA  1 
ATOM   3711  C  C   . ARG C  1 61  ? -52.168  67.187  10.027  1.00 23.70  ? 61  ARG C C   1 
ATOM   3712  O  O   . ARG C  1 61  ? -52.909  66.520  9.328   1.00 23.51  ? 61  ARG C O   1 
ATOM   3713  C  CB  . ARG C  1 61  ? -51.890  66.168  12.306  1.00 36.87  ? 61  ARG C CB  1 
ATOM   3714  C  CG  . ARG C  1 61  ? -51.052  65.305  13.240  1.00 62.95  ? 61  ARG C CG  1 
ATOM   3715  C  CD  . ARG C  1 61  ? -50.743  63.949  12.622  1.00 76.58  ? 61  ARG C CD  1 
ATOM   3716  N  NE  . ARG C  1 61  ? -49.711  63.240  13.373  1.00 91.32  ? 61  ARG C NE  1 
ATOM   3717  C  CZ  . ARG C  1 61  ? -49.955  62.381  14.356  1.00 94.49  ? 61  ARG C CZ  1 
ATOM   3718  N  NH1 . ARG C  1 61  ? -51.204  62.116  14.711  1.00 96.54  ? 61  ARG C NH1 1 
ATOM   3719  N  NH2 . ARG C  1 61  ? -48.947  61.789  14.984  1.00 83.02  ? 61  ARG C NH2 1 
ATOM   3720  N  N   . THR C  1 62  ? -52.142  68.511  9.983   1.00 21.09  ? 62  THR C N   1 
ATOM   3721  C  CA  . THR C  1 62  ? -53.070  69.252  9.146   1.00 14.34  ? 62  THR C CA  1 
ATOM   3722  C  C   . THR C  1 62  ? -52.827  69.018  7.660   1.00 29.76  ? 62  THR C C   1 
ATOM   3723  O  O   . THR C  1 62  ? -53.555  69.541  6.823   1.00 43.63  ? 62  THR C O   1 
ATOM   3724  C  CB  . THR C  1 62  ? -53.046  70.779  9.439   1.00 19.68  ? 62  THR C CB  1 
ATOM   3725  O  OG1 . THR C  1 62  ? -52.041  71.424  8.645   1.00 31.92  ? 62  THR C OG1 1 
ATOM   3726  C  CG2 . THR C  1 62  ? -52.798  71.048  10.911  1.00 17.80  ? 62  THR C CG2 1 
ATOM   3727  N  N   . LEU C  1 63  ? -51.807  68.239  7.326   1.00 29.56  ? 63  LEU C N   1 
ATOM   3728  C  CA  . LEU C  1 63  ? -51.524  67.945  5.927   1.00 23.91  ? 63  LEU C CA  1 
ATOM   3729  C  C   . LEU C  1 63  ? -52.072  66.582  5.524   1.00 22.69  ? 63  LEU C C   1 
ATOM   3730  O  O   . LEU C  1 63  ? -52.170  66.280  4.342   1.00 36.81  ? 63  LEU C O   1 
ATOM   3731  C  CB  . LEU C  1 63  ? -50.019  67.997  5.663   1.00 24.84  ? 63  LEU C CB  1 
ATOM   3732  C  CG  . LEU C  1 63  ? -49.301  69.320  5.931   1.00 30.21  ? 63  LEU C CG  1 
ATOM   3733  C  CD1 . LEU C  1 63  ? -47.802  69.121  5.824   1.00 24.11  ? 63  LEU C CD1 1 
ATOM   3734  C  CD2 . LEU C  1 63  ? -49.747  70.421  4.974   1.00 19.32  ? 63  LEU C CD2 1 
ATOM   3735  N  N   . ALA C  1 64  ? -52.435  65.769  6.512   1.00 18.11  ? 64  ALA C N   1 
ATOM   3736  C  CA  . ALA C  1 64  ? -52.807  64.367  6.286   1.00 28.06  ? 64  ALA C CA  1 
ATOM   3737  C  C   . ALA C  1 64  ? -54.017  64.192  5.378   1.00 27.71  ? 64  ALA C C   1 
ATOM   3738  O  O   . ALA C  1 64  ? -54.831  65.099  5.250   1.00 26.93  ? 64  ALA C O   1 
ATOM   3739  C  CB  . ALA C  1 64  ? -53.046  63.661  7.614   1.00 13.51  ? 64  ALA C CB  1 
ATOM   3740  N  N   . TRP C  1 65  ? -54.125  63.018  4.756   1.00 32.22  ? 65  TRP C N   1 
ATOM   3741  C  CA  . TRP C  1 65  ? -55.254  62.688  3.876   1.00 28.70  ? 65  TRP C CA  1 
ATOM   3742  C  C   . TRP C  1 65  ? -55.519  61.183  3.847   1.00 32.29  ? 65  TRP C C   1 
ATOM   3743  O  O   . TRP C  1 65  ? -54.619  60.387  4.102   1.00 30.62  ? 65  TRP C O   1 
ATOM   3744  C  CB  . TRP C  1 65  ? -55.046  63.235  2.448   1.00 13.50  ? 65  TRP C CB  1 
ATOM   3745  C  CG  . TRP C  1 65  ? -53.937  62.554  1.664   1.00 37.55  ? 65  TRP C CG  1 
ATOM   3746  C  CD1 . TRP C  1 65  ? -54.047  61.434  0.892   1.00 40.61  ? 65  TRP C CD1 1 
ATOM   3747  C  CD2 . TRP C  1 65  ? -52.561  62.965  1.571   1.00 36.57  ? 65  TRP C CD2 1 
ATOM   3748  N  NE1 . TRP C  1 65  ? -52.823  61.118  0.330   1.00 23.88  ? 65  TRP C NE1 1 
ATOM   3749  C  CE2 . TRP C  1 65  ? -51.900  62.039  0.737   1.00 25.97  ? 65  TRP C CE2 1 
ATOM   3750  C  CE3 . TRP C  1 65  ? -51.826  64.021  2.120   1.00 22.88  ? 65  TRP C CE3 1 
ATOM   3751  C  CZ2 . TRP C  1 65  ? -50.551  62.133  0.446   1.00 25.06  ? 65  TRP C CZ2 1 
ATOM   3752  C  CZ3 . TRP C  1 65  ? -50.477  64.113  1.825   1.00 26.76  ? 65  TRP C CZ3 1 
ATOM   3753  C  CH2 . TRP C  1 65  ? -49.856  63.176  0.998   1.00 30.08  ? 65  TRP C CH2 1 
ATOM   3754  N  N   . ASN C  1 66  ? -56.762  60.804  3.552   1.00 38.79  ? 66  ASN C N   1 
ATOM   3755  C  CA  . ASN C  1 66  ? -57.136  59.401  3.429   1.00 43.76  ? 66  ASN C CA  1 
ATOM   3756  C  C   . ASN C  1 66  ? -56.535  58.850  2.153   1.00 46.54  ? 66  ASN C C   1 
ATOM   3757  O  O   . ASN C  1 66  ? -57.021  59.133  1.060   1.00 54.74  ? 66  ASN C O   1 
ATOM   3758  C  CB  . ASN C  1 66  ? -58.670  59.246  3.412   1.00 45.38  ? 66  ASN C CB  1 
ATOM   3759  C  CG  . ASN C  1 66  ? -59.129  57.781  3.419   1.00 61.18  ? 66  ASN C CG  1 
ATOM   3760  O  OD1 . ASN C  1 66  ? -58.357  56.883  3.093   1.00 65.33  ? 66  ASN C OD1 1 
ATOM   3761  N  ND2 . ASN C  1 66  ? -60.394  57.543  3.785   1.00 59.53  ? 66  ASN C ND2 1 
ATOM   3762  N  N   . SER C  1 67  ? -55.473  58.067  2.289   1.00 40.14  ? 67  SER C N   1 
ATOM   3763  C  CA  . SER C  1 67  ? -54.777  57.537  1.119   1.00 54.77  ? 67  SER C CA  1 
ATOM   3764  C  C   . SER C  1 67  ? -55.252  56.140  0.713   1.00 62.60  ? 67  SER C C   1 
ATOM   3765  O  O   . SER C  1 67  ? -54.507  55.398  0.073   1.00 62.67  ? 67  SER C O   1 
ATOM   3766  C  CB  . SER C  1 67  ? -53.262  57.516  1.355   1.00 59.07  ? 67  SER C CB  1 
ATOM   3767  O  OG  . SER C  1 67  ? -52.880  56.425  2.179   1.00 61.31  ? 67  SER C OG  1 
ATOM   3768  N  N   . SER C  1 68  ? -56.479  55.781  1.074   1.00 59.28  ? 68  SER C N   1 
ATOM   3769  C  CA  . SER C  1 68  ? -56.985  54.448  0.768   1.00 65.51  ? 68  SER C CA  1 
ATOM   3770  C  C   . SER C  1 68  ? -56.794  54.114  -0.712  1.00 70.92  ? 68  SER C C   1 
ATOM   3771  O  O   . SER C  1 68  ? -56.277  53.046  -1.058  1.00 78.21  ? 68  SER C O   1 
ATOM   3772  C  CB  . SER C  1 68  ? -58.452  54.297  1.177   1.00 72.50  ? 68  SER C CB  1 
ATOM   3773  O  OG  . SER C  1 68  ? -59.295  55.134  0.411   1.00 90.94  ? 68  SER C OG  1 
ATOM   3774  N  N   . HIS C  1 69  ? -57.197  55.033  -1.583  1.00 49.48  ? 69  HIS C N   1 
ATOM   3775  C  CA  . HIS C  1 69  ? -57.025  54.841  -3.018  1.00 60.22  ? 69  HIS C CA  1 
ATOM   3776  C  C   . HIS C  1 69  ? -56.371  56.074  -3.614  1.00 63.02  ? 69  HIS C C   1 
ATOM   3777  O  O   . HIS C  1 69  ? -56.848  56.640  -4.595  1.00 70.24  ? 69  HIS C O   1 
ATOM   3778  C  CB  . HIS C  1 69  ? -58.370  54.584  -3.703  1.00 74.92  ? 69  HIS C CB  1 
ATOM   3779  C  CG  . HIS C  1 69  ? -59.066  53.345  -3.233  1.00 85.24  ? 69  HIS C CG  1 
ATOM   3780  N  ND1 . HIS C  1 69  ? -60.369  53.054  -3.570  1.00 91.51  ? 69  HIS C ND1 1 
ATOM   3781  C  CD2 . HIS C  1 69  ? -58.640  52.322  -2.455  1.00 88.03  ? 69  HIS C CD2 1 
ATOM   3782  C  CE1 . HIS C  1 69  ? -60.717  51.905  -3.018  1.00 99.08  ? 69  HIS C CE1 1 
ATOM   3783  N  NE2 . HIS C  1 69  ? -59.686  51.441  -2.335  1.00 92.54  ? 69  HIS C NE2 1 
ATOM   3784  N  N   . SER C  1 70  ? -55.270  56.487  -3.008  1.00 61.89  ? 70  SER C N   1 
ATOM   3785  C  CA  . SER C  1 70  ? -54.606  57.718  -3.399  1.00 55.76  ? 70  SER C CA  1 
ATOM   3786  C  C   . SER C  1 70  ? -53.104  57.572  -3.236  1.00 38.65  ? 70  SER C C   1 
ATOM   3787  O  O   . SER C  1 70  ? -52.633  56.637  -2.598  1.00 36.38  ? 70  SER C O   1 
ATOM   3788  C  CB  . SER C  1 70  ? -55.126  58.871  -2.542  1.00 65.09  ? 70  SER C CB  1 
ATOM   3789  O  OG  . SER C  1 70  ? -56.546  58.840  -2.471  1.00 70.53  ? 70  SER C OG  1 
ATOM   3790  N  N   . PRO C  1 71  ? -52.341  58.486  -3.838  1.00 44.11  ? 71  PRO C N   1 
ATOM   3791  C  CA  . PRO C  1 71  ? -50.895  58.458  -3.630  1.00 30.29  ? 71  PRO C CA  1 
ATOM   3792  C  C   . PRO C  1 71  ? -50.561  58.595  -2.152  1.00 22.00  ? 71  PRO C C   1 
ATOM   3793  O  O   . PRO C  1 71  ? -51.260  59.273  -1.412  1.00 47.24  ? 71  PRO C O   1 
ATOM   3794  C  CB  . PRO C  1 71  ? -50.414  59.676  -4.418  1.00 32.54  ? 71  PRO C CB  1 
ATOM   3795  C  CG  . PRO C  1 71  ? -51.408  59.813  -5.504  1.00 38.73  ? 71  PRO C CG  1 
ATOM   3796  C  CD  . PRO C  1 71  ? -52.728  59.457  -4.874  1.00 43.80  ? 71  PRO C CD  1 
ATOM   3797  N  N   . ASP C  1 72  ? -49.490  57.939  -1.741  1.00 34.35  ? 72  ASP C N   1 
ATOM   3798  C  CA  . ASP C  1 72  ? -49.035  57.933  -0.361  1.00 36.17  ? 72  ASP C CA  1 
ATOM   3799  C  C   . ASP C  1 72  ? -48.180  59.161  -0.041  1.00 36.27  ? 72  ASP C C   1 
ATOM   3800  O  O   . ASP C  1 72  ? -48.084  59.573  1.115   1.00 39.15  ? 72  ASP C O   1 
ATOM   3801  C  CB  . ASP C  1 72  ? -48.241  56.650  -0.092  1.00 27.48  ? 72  ASP C CB  1 
ATOM   3802  C  CG  . ASP C  1 72  ? -48.092  56.363  1.376   1.00 66.31  ? 72  ASP C CG  1 
ATOM   3803  O  OD1 . ASP C  1 72  ? -49.114  56.405  2.099   1.00 67.16  ? 72  ASP C OD1 1 
ATOM   3804  O  OD2 . ASP C  1 72  ? -46.946  56.111  1.812   1.00 81.03  ? 72  ASP C OD2 1 
ATOM   3805  N  N   . GLN C  1 73  ? -47.560  59.743  -1.060  1.00 24.69  ? 73  GLN C N   1 
ATOM   3806  C  CA  . GLN C  1 73  ? -46.697  60.896  -0.855  1.00 24.35  ? 73  GLN C CA  1 
ATOM   3807  C  C   . GLN C  1 73  ? -46.758  61.885  -2.001  1.00 26.42  ? 73  GLN C C   1 
ATOM   3808  O  O   . GLN C  1 73  ? -47.042  61.520  -3.146  1.00 34.65  ? 73  GLN C O   1 
ATOM   3809  C  CB  . GLN C  1 73  ? -45.238  60.463  -0.704  1.00 24.13  ? 73  GLN C CB  1 
ATOM   3810  C  CG  . GLN C  1 73  ? -44.937  59.561  0.454   1.00 23.77  ? 73  GLN C CG  1 
ATOM   3811  C  CD  . GLN C  1 73  ? -43.466  59.258  0.564   1.00 33.53  ? 73  GLN C CD  1 
ATOM   3812  O  OE1 . GLN C  1 73  ? -42.618  59.898  -0.083  1.00 40.60  ? 73  GLN C OE1 1 
ATOM   3813  N  NE2 . GLN C  1 73  ? -43.143  58.276  1.380   1.00 33.54  ? 73  GLN C NE2 1 
ATOM   3814  N  N   . VAL C  1 74  ? -46.445  63.136  -1.689  1.00 10.12  ? 74  VAL C N   1 
ATOM   3815  C  CA  . VAL C  1 74  ? -46.253  64.131  -2.723  1.00 18.32  ? 74  VAL C CA  1 
ATOM   3816  C  C   . VAL C  1 74  ? -45.082  65.041  -2.405  1.00 23.64  ? 74  VAL C C   1 
ATOM   3817  O  O   . VAL C  1 74  ? -44.673  65.171  -1.243  1.00 29.23  ? 74  VAL C O   1 
ATOM   3818  C  CB  . VAL C  1 74  ? -47.499  65.001  -2.885  1.00 30.14  ? 74  VAL C CB  1 
ATOM   3819  C  CG1 . VAL C  1 74  ? -48.617  64.222  -3.610  1.00 8.84   ? 74  VAL C CG1 1 
ATOM   3820  C  CG2 . VAL C  1 74  ? -47.933  65.553  -1.518  1.00 15.60  ? 74  VAL C CG2 1 
ATOM   3821  N  N   . SER C  1 75  ? -44.551  65.682  -3.434  1.00 12.19  ? 75  SER C N   1 
ATOM   3822  C  CA  . SER C  1 75  ? -43.552  66.721  -3.205  1.00 19.52  ? 75  SER C CA  1 
ATOM   3823  C  C   . SER C  1 75  ? -44.232  68.093  -3.187  1.00 17.99  ? 75  SER C C   1 
ATOM   3824  O  O   . SER C  1 75  ? -45.074  68.406  -4.032  1.00 7.43   ? 75  SER C O   1 
ATOM   3825  C  CB  . SER C  1 75  ? -42.437  66.654  -4.243  1.00 12.12  ? 75  SER C CB  1 
ATOM   3826  O  OG  . SER C  1 75  ? -41.738  65.433  -4.128  1.00 14.19  ? 75  SER C OG  1 
ATOM   3827  N  N   . VAL C  1 76  ? -43.885  68.897  -2.195  1.00 12.80  ? 76  VAL C N   1 
ATOM   3828  C  CA  . VAL C  1 76  ? -44.571  70.153  -1.986  1.00 13.83  ? 76  VAL C CA  1 
ATOM   3829  C  C   . VAL C  1 76  ? -43.576  71.267  -1.770  1.00 8.59   ? 76  VAL C C   1 
ATOM   3830  O  O   . VAL C  1 76  ? -42.636  71.108  -0.994  1.00 23.64  ? 76  VAL C O   1 
ATOM   3831  C  CB  . VAL C  1 76  ? -45.488  70.072  -0.730  1.00 24.29  ? 76  VAL C CB  1 
ATOM   3832  C  CG1 . VAL C  1 76  ? -46.287  71.356  -0.555  1.00 14.44  ? 76  VAL C CG1 1 
ATOM   3833  C  CG2 . VAL C  1 76  ? -46.422  68.889  -0.818  1.00 11.55  ? 76  VAL C CG2 1 
ATOM   3834  N  N   . PRO C  1 77  ? -43.776  72.401  -2.454  1.00 21.55  ? 77  PRO C N   1 
ATOM   3835  C  CA  . PRO C  1 77  ? -42.973  73.619  -2.259  1.00 16.74  ? 77  PRO C CA  1 
ATOM   3836  C  C   . PRO C  1 77  ? -43.004  74.033  -0.803  1.00 20.78  ? 77  PRO C C   1 
ATOM   3837  O  O   . PRO C  1 77  ? -44.104  74.199  -0.271  1.00 23.90  ? 77  PRO C O   1 
ATOM   3838  C  CB  . PRO C  1 77  ? -43.714  74.667  -3.102  1.00 4.04   ? 77  PRO C CB  1 
ATOM   3839  C  CG  . PRO C  1 77  ? -44.393  73.881  -4.149  1.00 11.04  ? 77  PRO C CG  1 
ATOM   3840  C  CD  . PRO C  1 77  ? -44.778  72.564  -3.520  1.00 19.46  ? 77  PRO C CD  1 
ATOM   3841  N  N   . ILE C  1 78  ? -41.845  74.191  -0.158  1.00 20.08  ? 78  ILE C N   1 
ATOM   3842  C  CA  . ILE C  1 78  ? -41.853  74.505  1.271   1.00 23.07  ? 78  ILE C CA  1 
ATOM   3843  C  C   . ILE C  1 78  ? -42.524  75.832  1.600   1.00 18.31  ? 78  ILE C C   1 
ATOM   3844  O  O   . ILE C  1 78  ? -42.909  76.066  2.732   1.00 38.05  ? 78  ILE C O   1 
ATOM   3845  C  CB  . ILE C  1 78  ? -40.481  74.505  1.859   1.00 17.75  ? 78  ILE C CB  1 
ATOM   3846  C  CG1 . ILE C  1 78  ? -39.578  75.437  1.052   1.00 21.22  ? 78  ILE C CG1 1 
ATOM   3847  C  CG2 . ILE C  1 78  ? -39.948  73.072  1.931   1.00 18.66  ? 78  ILE C CG2 1 
ATOM   3848  C  CD1 . ILE C  1 78  ? -38.348  75.898  1.843   1.00 27.83  ? 78  ILE C CD1 1 
ATOM   3849  N  N   . SER C  1 79  ? -42.669  76.696  0.606   1.00 24.01  ? 79  SER C N   1 
ATOM   3850  C  CA  . SER C  1 79  ? -43.424  77.934  0.775   1.00 14.50  ? 79  SER C CA  1 
ATOM   3851  C  C   . SER C  1 79  ? -44.897  77.658  1.097   1.00 25.45  ? 79  SER C C   1 
ATOM   3852  O  O   . SER C  1 79  ? -45.618  78.546  1.556   1.00 21.72  ? 79  SER C O   1 
ATOM   3853  C  CB  . SER C  1 79  ? -43.304  78.800  -0.479  1.00 17.84  ? 79  SER C CB  1 
ATOM   3854  O  OG  . SER C  1 79  ? -43.411  78.019  -1.664  1.00 31.92  ? 79  SER C OG  1 
ATOM   3855  N  N   . SER C  1 80  ? -45.329  76.420  0.866   1.00 18.33  ? 80  SER C N   1 
ATOM   3856  C  CA  . SER C  1 80  ? -46.698  76.009  1.140   1.00 11.07  ? 80  SER C CA  1 
ATOM   3857  C  C   . SER C  1 80  ? -46.819  75.229  2.440   1.00 25.69  ? 80  SER C C   1 
ATOM   3858  O  O   . SER C  1 80  ? -47.901  74.789  2.812   1.00 25.52  ? 80  SER C O   1 
ATOM   3859  C  CB  . SER C  1 80  ? -47.257  75.162  -0.015  1.00 18.93  ? 80  SER C CB  1 
ATOM   3860  O  OG  . SER C  1 80  ? -47.303  75.897  -1.238  1.00 35.35  ? 80  SER C OG  1 
ATOM   3861  N  N   . LEU C  1 81  ? -45.701  75.050  3.131   1.00 28.85  ? 81  LEU C N   1 
ATOM   3862  C  CA  . LEU C  1 81  ? -45.704  74.305  4.375   1.00 17.12  ? 81  LEU C CA  1 
ATOM   3863  C  C   . LEU C  1 81  ? -45.219  75.149  5.537   1.00 22.21  ? 81  LEU C C   1 
ATOM   3864  O  O   . LEU C  1 81  ? -44.463  76.088  5.350   1.00 23.46  ? 81  LEU C O   1 
ATOM   3865  C  CB  . LEU C  1 81  ? -44.799  73.091  4.257   1.00 11.92  ? 81  LEU C CB  1 
ATOM   3866  C  CG  . LEU C  1 81  ? -45.162  72.072  3.201   1.00 22.42  ? 81  LEU C CG  1 
ATOM   3867  C  CD1 . LEU C  1 81  ? -44.213  70.923  3.308   1.00 24.32  ? 81  LEU C CD1 1 
ATOM   3868  C  CD2 . LEU C  1 81  ? -46.583  71.602  3.397   1.00 34.20  ? 81  LEU C CD2 1 
ATOM   3869  N  N   . TRP C  1 82  ? -45.657  74.814  6.744   1.00 23.18  ? 82  TRP C N   1 
ATOM   3870  C  CA  . TRP C  1 82  ? -44.955  75.313  7.906   1.00 25.03  ? 82  TRP C CA  1 
ATOM   3871  C  C   . TRP C  1 82  ? -43.610  74.594  7.961   1.00 26.98  ? 82  TRP C C   1 
ATOM   3872  O  O   . TRP C  1 82  ? -43.522  73.379  7.759   1.00 25.66  ? 82  TRP C O   1 
ATOM   3873  C  CB  . TRP C  1 82  ? -45.737  75.077  9.199   1.00 14.21  ? 82  TRP C CB  1 
ATOM   3874  C  CG  . TRP C  1 82  ? -44.940  75.467  10.426  1.00 28.42  ? 82  TRP C CG  1 
ATOM   3875  C  CD1 . TRP C  1 82  ? -44.870  76.699  10.991  1.00 20.84  ? 82  TRP C CD1 1 
ATOM   3876  C  CD2 . TRP C  1 82  ? -44.092  74.617  11.213  1.00 14.42  ? 82  TRP C CD2 1 
ATOM   3877  N  NE1 . TRP C  1 82  ? -44.048  76.672  12.088  1.00 29.79  ? 82  TRP C NE1 1 
ATOM   3878  C  CE2 . TRP C  1 82  ? -43.555  75.404  12.240  1.00 25.37  ? 82  TRP C CE2 1 
ATOM   3879  C  CE3 . TRP C  1 82  ? -43.738  73.272  11.146  1.00 16.39  ? 82  TRP C CE3 1 
ATOM   3880  C  CZ2 . TRP C  1 82  ? -42.680  74.888  13.194  1.00 26.86  ? 82  TRP C CZ2 1 
ATOM   3881  C  CZ3 . TRP C  1 82  ? -42.874  72.764  12.089  1.00 12.17  ? 82  TRP C CZ3 1 
ATOM   3882  C  CH2 . TRP C  1 82  ? -42.353  73.566  13.098  1.00 21.65  ? 82  TRP C CH2 1 
ATOM   3883  N  N   . VAL C  1 83  ? -42.561  75.355  8.227   1.00 26.05  ? 83  VAL C N   1 
ATOM   3884  C  CA  . VAL C  1 83  ? -41.232  74.794  8.375   1.00 14.60  ? 83  VAL C CA  1 
ATOM   3885  C  C   . VAL C  1 83  ? -40.647  75.309  9.680   1.00 18.94  ? 83  VAL C C   1 
ATOM   3886  O  O   . VAL C  1 83  ? -40.823  76.487  10.026  1.00 15.41  ? 83  VAL C O   1 
ATOM   3887  C  CB  . VAL C  1 83  ? -40.326  75.205  7.195   1.00 20.59  ? 83  VAL C CB  1 
ATOM   3888  C  CG1 . VAL C  1 83  ? -38.906  74.766  7.428   1.00 42.55  ? 83  VAL C CG1 1 
ATOM   3889  C  CG2 . VAL C  1 83  ? -40.838  74.615  5.912   1.00 24.78  ? 83  VAL C CG2 1 
ATOM   3890  N  N   . PRO C  1 84  ? -39.948  74.431  10.416  1.00 10.58  ? 84  PRO C N   1 
ATOM   3891  C  CA  . PRO C  1 84  ? -39.305  74.900  11.646  1.00 13.19  ? 84  PRO C CA  1 
ATOM   3892  C  C   . PRO C  1 84  ? -38.202  75.955  11.368  1.00 25.72  ? 84  PRO C C   1 
ATOM   3893  O  O   . PRO C  1 84  ? -37.430  75.812  10.422  1.00 8.31   ? 84  PRO C O   1 
ATOM   3894  C  CB  . PRO C  1 84  ? -38.730  73.610  12.253  1.00 7.05   ? 84  PRO C CB  1 
ATOM   3895  C  CG  . PRO C  1 84  ? -38.588  72.674  11.121  1.00 6.61   ? 84  PRO C CG  1 
ATOM   3896  C  CD  . PRO C  1 84  ? -39.696  72.999  10.165  1.00 9.85   ? 84  PRO C CD  1 
ATOM   3897  N  N   . ASP C  1 85  ? -38.154  77.007  12.186  1.00 21.38  ? 85  ASP C N   1 
ATOM   3898  C  CA  . ASP C  1 85  ? -37.236  78.128  11.977  1.00 14.67  ? 85  ASP C CA  1 
ATOM   3899  C  C   . ASP C  1 85  ? -35.845  77.800  12.507  1.00 26.77  ? 85  ASP C C   1 
ATOM   3900  O  O   . ASP C  1 85  ? -35.318  78.471  13.408  1.00 23.72  ? 85  ASP C O   1 
ATOM   3901  C  CB  . ASP C  1 85  ? -37.766  79.391  12.663  1.00 12.53  ? 85  ASP C CB  1 
ATOM   3902  C  CG  . ASP C  1 85  ? -37.862  79.236  14.164  1.00 27.27  ? 85  ASP C CG  1 
ATOM   3903  O  OD1 . ASP C  1 85  ? -38.040  78.083  14.631  1.00 12.59  ? 85  ASP C OD1 1 
ATOM   3904  O  OD2 . ASP C  1 85  ? -37.751  80.266  14.869  1.00 17.20  ? 85  ASP C OD2 1 
ATOM   3905  N  N   . LEU C  1 86  ? -35.260  76.749  11.948  1.00 20.37  ? 86  LEU C N   1 
ATOM   3906  C  CA  . LEU C  1 86  ? -33.958  76.301  12.379  1.00 14.77  ? 86  LEU C CA  1 
ATOM   3907  C  C   . LEU C  1 86  ? -32.902  77.284  11.885  1.00 19.65  ? 86  LEU C C   1 
ATOM   3908  O  O   . LEU C  1 86  ? -33.021  77.847  10.791  1.00 17.97  ? 86  LEU C O   1 
ATOM   3909  C  CB  . LEU C  1 86  ? -33.692  74.900  11.839  1.00 19.49  ? 86  LEU C CB  1 
ATOM   3910  C  CG  . LEU C  1 86  ? -34.627  73.791  12.308  1.00 11.87  ? 86  LEU C CG  1 
ATOM   3911  C  CD1 . LEU C  1 86  ? -34.104  72.451  11.828  1.00 6.26   ? 86  LEU C CD1 1 
ATOM   3912  C  CD2 . LEU C  1 86  ? -34.751  73.809  13.824  1.00 11.22  ? 86  LEU C CD2 1 
ATOM   3913  N  N   . ALA C  1 87  ? -31.882  77.507  12.703  1.00 9.00   ? 87  ALA C N   1 
ATOM   3914  C  CA  . ALA C  1 87  ? -30.740  78.305  12.284  1.00 18.42  ? 87  ALA C CA  1 
ATOM   3915  C  C   . ALA C  1 87  ? -29.439  77.733  12.861  1.00 19.27  ? 87  ALA C C   1 
ATOM   3916  O  O   . ALA C  1 87  ? -29.428  77.086  13.910  1.00 27.74  ? 87  ALA C O   1 
ATOM   3917  C  CB  . ALA C  1 87  ? -30.930  79.757  12.675  1.00 10.42  ? 87  ALA C CB  1 
ATOM   3918  N  N   . ALA C  1 88  ? -28.340  77.929  12.151  1.00 21.70  ? 88  ALA C N   1 
ATOM   3919  C  CA  . ALA C  1 88  ? -27.040  77.539  12.688  1.00 11.31  ? 88  ALA C CA  1 
ATOM   3920  C  C   . ALA C  1 88  ? -26.479  78.739  13.445  1.00 15.56  ? 88  ALA C C   1 
ATOM   3921  O  O   . ALA C  1 88  ? -26.205  79.799  12.868  1.00 20.93  ? 88  ALA C O   1 
ATOM   3922  C  CB  . ALA C  1 88  ? -26.110  77.112  11.585  1.00 6.44   ? 88  ALA C CB  1 
ATOM   3923  N  N   . TYR C  1 89  ? -26.339  78.581  14.749  1.00 18.17  ? 89  TYR C N   1 
ATOM   3924  C  CA  . TYR C  1 89  ? -25.887  79.684  15.591  1.00 28.97  ? 89  TYR C CA  1 
ATOM   3925  C  C   . TYR C  1 89  ? -24.543  80.264  15.143  1.00 22.18  ? 89  TYR C C   1 
ATOM   3926  O  O   . TYR C  1 89  ? -24.343  81.483  15.153  1.00 22.24  ? 89  TYR C O   1 
ATOM   3927  C  CB  . TYR C  1 89  ? -25.818  79.245  17.058  1.00 14.75  ? 89  TYR C CB  1 
ATOM   3928  C  CG  . TYR C  1 89  ? -27.169  79.197  17.728  1.00 30.77  ? 89  TYR C CG  1 
ATOM   3929  C  CD1 . TYR C  1 89  ? -28.142  78.288  17.318  1.00 22.58  ? 89  TYR C CD1 1 
ATOM   3930  C  CD2 . TYR C  1 89  ? -27.474  80.054  18.776  1.00 10.60  ? 89  TYR C CD2 1 
ATOM   3931  C  CE1 . TYR C  1 89  ? -29.378  78.235  17.941  1.00 17.79  ? 89  TYR C CE1 1 
ATOM   3932  C  CE2 . TYR C  1 89  ? -28.703  80.005  19.393  1.00 32.36  ? 89  TYR C CE2 1 
ATOM   3933  C  CZ  . TYR C  1 89  ? -29.651  79.095  18.977  1.00 24.02  ? 89  TYR C CZ  1 
ATOM   3934  O  OH  . TYR C  1 89  ? -30.874  79.050  19.606  1.00 26.95  ? 89  TYR C OH  1 
ATOM   3935  N  N   . ASN C  1 90  ? -23.627  79.392  14.746  1.00 16.75  ? 90  ASN C N   1 
ATOM   3936  C  CA  . ASN C  1 90  ? -22.276  79.835  14.416  1.00 17.66  ? 90  ASN C CA  1 
ATOM   3937  C  C   . ASN C  1 90  ? -22.035  79.966  12.908  1.00 18.52  ? 90  ASN C C   1 
ATOM   3938  O  O   . ASN C  1 90  ? -20.898  80.063  12.456  1.00 32.43  ? 90  ASN C O   1 
ATOM   3939  C  CB  . ASN C  1 90  ? -21.206  78.972  15.116  1.00 7.79   ? 90  ASN C CB  1 
ATOM   3940  C  CG  . ASN C  1 90  ? -21.308  77.494  14.772  1.00 9.45   ? 90  ASN C CG  1 
ATOM   3941  O  OD1 . ASN C  1 90  ? -22.386  76.927  14.684  1.00 6.90   ? 90  ASN C OD1 1 
ATOM   3942  N  ND2 . ASN C  1 90  ? -20.165  76.865  14.577  1.00 15.77  ? 90  ASN C ND2 1 
ATOM   3943  N  N   . ALA C  1 91  ? -23.111  79.974  12.134  1.00 18.04  ? 91  ALA C N   1 
ATOM   3944  C  CA  . ALA C  1 91  ? -22.999  80.273  10.722  1.00 23.43  ? 91  ALA C CA  1 
ATOM   3945  C  C   . ALA C  1 91  ? -22.599  81.737  10.573  1.00 29.42  ? 91  ALA C C   1 
ATOM   3946  O  O   . ALA C  1 91  ? -23.059  82.580  11.342  1.00 30.62  ? 91  ALA C O   1 
ATOM   3947  C  CB  . ALA C  1 91  ? -24.306  80.016  10.033  1.00 16.26  ? 91  ALA C CB  1 
ATOM   3948  N  N   . ILE C  1 92  ? -21.736  82.035  9.599   1.00 24.80  ? 92  ILE C N   1 
ATOM   3949  C  CA  . ILE C  1 92  ? -21.304  83.413  9.367   1.00 19.06  ? 92  ILE C CA  1 
ATOM   3950  C  C   . ILE C  1 92  ? -21.674  83.891  7.975   1.00 22.54  ? 92  ILE C C   1 
ATOM   3951  O  O   . ILE C  1 92  ? -21.299  84.996  7.562   1.00 24.43  ? 92  ILE C O   1 
ATOM   3952  C  CB  . ILE C  1 92  ? -19.792  83.621  9.603   1.00 23.60  ? 92  ILE C CB  1 
ATOM   3953  C  CG1 . ILE C  1 92  ? -18.986  82.656  8.732   1.00 21.57  ? 92  ILE C CG1 1 
ATOM   3954  C  CG2 . ILE C  1 92  ? -19.460  83.466  11.071  1.00 9.97   ? 92  ILE C CG2 1 
ATOM   3955  C  CD1 . ILE C  1 92  ? -17.522  82.870  8.825   1.00 15.39  ? 92  ILE C CD1 1 
ATOM   3956  N  N   . SER C  1 93  ? -22.404  83.048  7.258   1.00 14.95  ? 93  SER C N   1 
ATOM   3957  C  CA  . SER C  1 93  ? -23.091  83.471  6.043   1.00 26.41  ? 93  SER C CA  1 
ATOM   3958  C  C   . SER C  1 93  ? -24.505  82.911  6.105   1.00 24.13  ? 93  SER C C   1 
ATOM   3959  O  O   . SER C  1 93  ? -24.742  81.912  6.786   1.00 23.66  ? 93  SER C O   1 
ATOM   3960  C  CB  . SER C  1 93  ? -22.361  82.966  4.794   1.00 24.85  ? 93  SER C CB  1 
ATOM   3961  O  OG  . SER C  1 93  ? -22.406  81.551  4.699   1.00 27.28  ? 93  SER C OG  1 
ATOM   3962  N  N   . LYS C  1 94  ? -25.454  83.539  5.418   1.00 22.26  ? 94  LYS C N   1 
ATOM   3963  C  CA  . LYS C  1 94  ? -26.772  82.928  5.327   1.00 22.06  ? 94  LYS C CA  1 
ATOM   3964  C  C   . LYS C  1 94  ? -26.677  81.699  4.440   1.00 14.83  ? 94  LYS C C   1 
ATOM   3965  O  O   . LYS C  1 94  ? -25.891  81.660  3.503   1.00 35.77  ? 94  LYS C O   1 
ATOM   3966  C  CB  . LYS C  1 94  ? -27.841  83.910  4.835   1.00 33.97  ? 94  LYS C CB  1 
ATOM   3967  C  CG  . LYS C  1 94  ? -27.642  84.470  3.420   1.00 53.15  ? 94  LYS C CG  1 
ATOM   3968  C  CD  . LYS C  1 94  ? -28.611  85.642  3.140   1.00 65.15  ? 94  LYS C CD  1 
ATOM   3969  C  CE  . LYS C  1 94  ? -30.071  85.285  3.463   1.00 56.12  ? 94  LYS C CE  1 
ATOM   3970  N  NZ  . LYS C  1 94  ? -30.969  86.477  3.441   1.00 52.73  ? 94  LYS C NZ  1 
ATOM   3971  N  N   . PRO C  1 95  ? -27.475  80.680  4.739   1.00 21.68  ? 95  PRO C N   1 
ATOM   3972  C  CA  . PRO C  1 95  ? -27.365  79.402  4.023   1.00 15.72  ? 95  PRO C CA  1 
ATOM   3973  C  C   . PRO C  1 95  ? -27.705  79.537  2.557   1.00 19.17  ? 95  PRO C C   1 
ATOM   3974  O  O   . PRO C  1 95  ? -28.765  80.054  2.245   1.00 11.50  ? 95  PRO C O   1 
ATOM   3975  C  CB  . PRO C  1 95  ? -28.414  78.521  4.706   1.00 16.09  ? 95  PRO C CB  1 
ATOM   3976  C  CG  . PRO C  1 95  ? -29.368  79.478  5.366   1.00 16.39  ? 95  PRO C CG  1 
ATOM   3977  C  CD  . PRO C  1 95  ? -28.561  80.686  5.734   1.00 22.62  ? 95  PRO C CD  1 
ATOM   3978  N  N   . GLU C  1 96  ? -26.803  79.088  1.685   1.00 27.29  ? 96  GLU C N   1 
ATOM   3979  C  CA  . GLU C  1 96  ? -27.068  79.018  0.252   1.00 23.47  ? 96  GLU C CA  1 
ATOM   3980  C  C   . GLU C  1 96  ? -27.725  77.672  -0.038  1.00 22.18  ? 96  GLU C C   1 
ATOM   3981  O  O   . GLU C  1 96  ? -27.101  76.613  0.087   1.00 19.59  ? 96  GLU C O   1 
ATOM   3982  C  CB  . GLU C  1 96  ? -25.766  79.179  -0.554  1.00 19.64  ? 96  GLU C CB  1 
ATOM   3983  C  CG  . GLU C  1 96  ? -25.955  79.356  -2.049  1.00 29.37  ? 96  GLU C CG  1 
ATOM   3984  C  CD  . GLU C  1 96  ? -24.636  79.414  -2.805  1.00 57.15  ? 96  GLU C CD  1 
ATOM   3985  O  OE1 . GLU C  1 96  ? -23.559  79.367  -2.157  1.00 48.56  ? 96  GLU C OE1 1 
ATOM   3986  O  OE2 . GLU C  1 96  ? -24.678  79.505  -4.056  1.00 65.28  ? 96  GLU C OE2 1 
ATOM   3987  N  N   . VAL C  1 97  ? -28.993  77.709  -0.406  1.00 18.48  ? 97  VAL C N   1 
ATOM   3988  C  CA  . VAL C  1 97  ? -29.712  76.477  -0.696  1.00 17.09  ? 97  VAL C CA  1 
ATOM   3989  C  C   . VAL C  1 97  ? -29.500  76.092  -2.142  1.00 14.42  ? 97  VAL C C   1 
ATOM   3990  O  O   . VAL C  1 97  ? -29.868  76.829  -3.041  1.00 18.34  ? 97  VAL C O   1 
ATOM   3991  C  CB  . VAL C  1 97  ? -31.210  76.611  -0.405  1.00 23.66  ? 97  VAL C CB  1 
ATOM   3992  C  CG1 . VAL C  1 97  ? -31.926  75.311  -0.712  1.00 26.08  ? 97  VAL C CG1 1 
ATOM   3993  C  CG2 . VAL C  1 97  ? -31.403  76.987  1.044   1.00 14.22  ? 97  VAL C CG2 1 
ATOM   3994  N  N   . LEU C  1 98  ? -28.893  74.928  -2.348  1.00 17.43  ? 98  LEU C N   1 
ATOM   3995  C  CA  . LEU C  1 98  ? -28.412  74.537  -3.662  1.00 17.72  ? 98  LEU C CA  1 
ATOM   3996  C  C   . LEU C  1 98  ? -29.457  73.779  -4.448  1.00 24.17  ? 98  LEU C C   1 
ATOM   3997  O  O   . LEU C  1 98  ? -29.432  73.774  -5.672  1.00 24.64  ? 98  LEU C O   1 
ATOM   3998  C  CB  . LEU C  1 98  ? -27.161  73.678  -3.541  1.00 14.46  ? 98  LEU C CB  1 
ATOM   3999  C  CG  . LEU C  1 98  ? -25.981  74.297  -2.787  1.00 19.57  ? 98  LEU C CG  1 
ATOM   4000  C  CD1 . LEU C  1 98  ? -24.907  73.242  -2.527  1.00 18.22  ? 98  LEU C CD1 1 
ATOM   4001  C  CD2 . LEU C  1 98  ? -25.433  75.482  -3.540  1.00 7.97   ? 98  LEU C CD2 1 
ATOM   4002  N  N   . THR C  1 99  ? -30.382  73.145  -3.744  1.00 24.22  ? 99  THR C N   1 
ATOM   4003  C  CA  . THR C  1 99  ? -31.330  72.259  -4.391  1.00 20.54  ? 99  THR C CA  1 
ATOM   4004  C  C   . THR C  1 99  ? -32.715  72.869  -4.461  1.00 16.95  ? 99  THR C C   1 
ATOM   4005  O  O   . THR C  1 99  ? -32.985  73.846  -3.766  1.00 19.92  ? 99  THR C O   1 
ATOM   4006  C  CB  . THR C  1 99  ? -31.376  70.928  -3.669  1.00 14.87  ? 99  THR C CB  1 
ATOM   4007  O  OG1 . THR C  1 99  ? -31.593  71.162  -2.272  1.00 25.99  ? 99  THR C OG1 1 
ATOM   4008  C  CG2 . THR C  1 99  ? -30.041  70.203  -3.867  1.00 15.44  ? 99  THR C CG2 1 
ATOM   4009  N  N   . PRO C  1 100 ? -33.580  72.323  -5.338  1.00 19.88  ? 100 PRO C N   1 
ATOM   4010  C  CA  . PRO C  1 100 ? -34.994  72.723  -5.386  1.00 20.26  ? 100 PRO C CA  1 
ATOM   4011  C  C   . PRO C  1 100 ? -35.635  72.624  -4.006  1.00 12.51  ? 100 PRO C C   1 
ATOM   4012  O  O   . PRO C  1 100 ? -35.446  71.639  -3.290  1.00 18.08  ? 100 PRO C O   1 
ATOM   4013  C  CB  . PRO C  1 100 ? -35.615  71.699  -6.340  1.00 18.79  ? 100 PRO C CB  1 
ATOM   4014  C  CG  . PRO C  1 100 ? -34.494  71.362  -7.274  1.00 19.83  ? 100 PRO C CG  1 
ATOM   4015  C  CD  . PRO C  1 100 ? -33.258  71.342  -6.389  1.00 18.71  ? 100 PRO C CD  1 
ATOM   4016  N  N   . GLN C  1 101 ? -36.378  73.655  -3.629  1.00 19.24  ? 101 GLN C N   1 
ATOM   4017  C  CA  . GLN C  1 101 ? -36.886  73.733  -2.265  1.00 31.86  ? 101 GLN C CA  1 
ATOM   4018  C  C   . GLN C  1 101 ? -38.220  73.020  -2.124  1.00 24.78  ? 101 GLN C C   1 
ATOM   4019  O  O   . GLN C  1 101 ? -39.252  73.627  -1.910  1.00 30.53  ? 101 GLN C O   1 
ATOM   4020  C  CB  . GLN C  1 101 ? -36.908  75.181  -1.772  1.00 19.12  ? 101 GLN C CB  1 
ATOM   4021  C  CG  . GLN C  1 101 ? -35.476  75.736  -1.683  1.00 21.98  ? 101 GLN C CG  1 
ATOM   4022  C  CD  . GLN C  1 101 ? -35.410  77.223  -1.397  1.00 21.35  ? 101 GLN C CD  1 
ATOM   4023  O  OE1 . GLN C  1 101 ? -36.192  77.757  -0.615  1.00 31.58  ? 101 GLN C OE1 1 
ATOM   4024  N  NE2 . GLN C  1 101 ? -34.467  77.894  -2.028  1.00 32.45  ? 101 GLN C NE2 1 
ATOM   4025  N  N   . LEU C  1 102 ? -38.152  71.705  -2.250  1.00 22.49  ? 102 LEU C N   1 
ATOM   4026  C  CA  . LEU C  1 102 ? -39.302  70.839  -2.168  1.00 13.81  ? 102 LEU C CA  1 
ATOM   4027  C  C   . LEU C  1 102 ? -39.249  69.984  -0.917  1.00 23.14  ? 102 LEU C C   1 
ATOM   4028  O  O   . LEU C  1 102 ? -38.208  69.430  -0.580  1.00 23.36  ? 102 LEU C O   1 
ATOM   4029  C  CB  . LEU C  1 102 ? -39.336  69.933  -3.389  1.00 10.83  ? 102 LEU C CB  1 
ATOM   4030  C  CG  . LEU C  1 102 ? -39.579  70.687  -4.702  1.00 22.60  ? 102 LEU C CG  1 
ATOM   4031  C  CD1 . LEU C  1 102 ? -39.678  69.726  -5.897  1.00 10.51  ? 102 LEU C CD1 1 
ATOM   4032  C  CD2 . LEU C  1 102 ? -40.834  71.567  -4.595  1.00 17.55  ? 102 LEU C CD2 1 
ATOM   4033  N  N   . ALA C  1 103 ? -40.375  69.885  -0.219  1.00 19.07  ? 103 ALA C N   1 
ATOM   4034  C  CA  . ALA C  1 103 ? -40.481  68.934  0.873   1.00 20.95  ? 103 ALA C CA  1 
ATOM   4035  C  C   . ALA C  1 103 ? -41.211  67.697  0.366   1.00 16.50  ? 103 ALA C C   1 
ATOM   4036  O  O   . ALA C  1 103 ? -41.812  67.711  -0.702  1.00 28.25  ? 103 ALA C O   1 
ATOM   4037  C  CB  . ALA C  1 103 ? -41.200  69.544  2.063   1.00 10.97  ? 103 ALA C CB  1 
ATOM   4038  N  N   . ARG C  1 104 ? -41.133  66.618  1.129   1.00 18.45  ? 104 ARG C N   1 
ATOM   4039  C  CA  . ARG C  1 104 ? -41.861  65.414  0.800   1.00 16.32  ? 104 ARG C CA  1 
ATOM   4040  C  C   . ARG C  1 104 ? -42.910  65.196  1.899   1.00 22.05  ? 104 ARG C C   1 
ATOM   4041  O  O   . ARG C  1 104 ? -42.589  65.180  3.080   1.00 39.83  ? 104 ARG C O   1 
ATOM   4042  C  CB  . ARG C  1 104 ? -40.887  64.250  0.720   1.00 13.63  ? 104 ARG C CB  1 
ATOM   4043  C  CG  . ARG C  1 104 ? -41.424  63.013  0.093   1.00 17.71  ? 104 ARG C CG  1 
ATOM   4044  C  CD  . ARG C  1 104 ? -41.615  63.170  -1.404  1.00 20.84  ? 104 ARG C CD  1 
ATOM   4045  N  NE  . ARG C  1 104 ? -42.143  61.925  -1.954  1.00 14.75  ? 104 ARG C NE  1 
ATOM   4046  C  CZ  . ARG C  1 104 ? -42.468  61.754  -3.223  1.00 26.64  ? 104 ARG C CZ  1 
ATOM   4047  N  NH1 . ARG C  1 104 ? -42.301  62.755  -4.085  1.00 24.85  ? 104 ARG C NH1 1 
ATOM   4048  N  NH2 . ARG C  1 104 ? -42.948  60.579  -3.627  1.00 26.21  ? 104 ARG C NH2 1 
ATOM   4049  N  N   . VAL C  1 105 ? -44.170  65.058  1.514   1.00 24.48  ? 105 VAL C N   1 
ATOM   4050  C  CA  . VAL C  1 105 ? -45.232  64.896  2.498   1.00 23.69  ? 105 VAL C CA  1 
ATOM   4051  C  C   . VAL C  1 105 ? -45.942  63.552  2.375   1.00 21.56  ? 105 VAL C C   1 
ATOM   4052  O  O   . VAL C  1 105 ? -46.455  63.207  1.314   1.00 20.50  ? 105 VAL C O   1 
ATOM   4053  C  CB  . VAL C  1 105 ? -46.247  66.025  2.414   1.00 12.88  ? 105 VAL C CB  1 
ATOM   4054  C  CG1 . VAL C  1 105 ? -47.252  65.887  3.540   1.00 11.39  ? 105 VAL C CG1 1 
ATOM   4055  C  CG2 . VAL C  1 105 ? -45.527  67.362  2.515   1.00 8.92   ? 105 VAL C CG2 1 
ATOM   4056  N  N   . VAL C  1 106 ? -45.945  62.794  3.467   1.00 16.22  ? 106 VAL C N   1 
ATOM   4057  C  CA  . VAL C  1 106 ? -46.637  61.510  3.513   1.00 29.09  ? 106 VAL C CA  1 
ATOM   4058  C  C   . VAL C  1 106 ? -48.083  61.686  3.969   1.00 28.75  ? 106 VAL C C   1 
ATOM   4059  O  O   . VAL C  1 106 ? -48.395  62.581  4.753   1.00 26.73  ? 106 VAL C O   1 
ATOM   4060  C  CB  . VAL C  1 106 ? -45.949  60.523  4.474   1.00 32.00  ? 106 VAL C CB  1 
ATOM   4061  C  CG1 . VAL C  1 106 ? -46.466  59.100  4.230   1.00 17.74  ? 106 VAL C CG1 1 
ATOM   4062  C  CG2 . VAL C  1 106 ? -44.443  60.595  4.312   1.00 24.46  ? 106 VAL C CG2 1 
ATOM   4063  N  N   . SER C  1 107 ? -48.954  60.806  3.494   1.00 22.73  ? 107 SER C N   1 
ATOM   4064  C  CA  . SER C  1 107 ? -50.384  60.900  3.763   1.00 25.32  ? 107 SER C CA  1 
ATOM   4065  C  C   . SER C  1 107 ? -50.761  61.066  5.252   1.00 31.73  ? 107 SER C C   1 
ATOM   4066  O  O   . SER C  1 107 ? -51.814  61.623  5.571   1.00 32.00  ? 107 SER C O   1 
ATOM   4067  C  CB  . SER C  1 107 ? -51.106  59.695  3.153   1.00 19.57  ? 107 SER C CB  1 
ATOM   4068  O  OG  . SER C  1 107 ? -50.651  58.487  3.738   1.00 32.59  ? 107 SER C OG  1 
ATOM   4069  N  N   . ASP C  1 108 ? -49.908  60.590  6.155   1.00 22.08  ? 108 ASP C N   1 
ATOM   4070  C  CA  . ASP C  1 108 ? -50.151  60.737  7.592   1.00 23.17  ? 108 ASP C CA  1 
ATOM   4071  C  C   . ASP C  1 108 ? -49.661  62.077  8.169   1.00 32.80  ? 108 ASP C C   1 
ATOM   4072  O  O   . ASP C  1 108 ? -49.815  62.334  9.374   1.00 34.73  ? 108 ASP C O   1 
ATOM   4073  C  CB  . ASP C  1 108 ? -49.514  59.581  8.375   1.00 19.51  ? 108 ASP C CB  1 
ATOM   4074  C  CG  . ASP C  1 108 ? -47.998  59.543  8.227   1.00 38.41  ? 108 ASP C CG  1 
ATOM   4075  O  OD1 . ASP C  1 108 ? -47.436  60.521  7.694   1.00 17.11  ? 108 ASP C OD1 1 
ATOM   4076  O  OD2 . ASP C  1 108 ? -47.369  58.549  8.652   1.00 31.06  ? 108 ASP C OD2 1 
ATOM   4077  N  N   . GLY C  1 109 ? -49.070  62.923  7.328   1.00 9.03   ? 109 GLY C N   1 
ATOM   4078  C  CA  . GLY C  1 109 ? -48.634  64.234  7.778   1.00 17.56  ? 109 GLY C CA  1 
ATOM   4079  C  C   . GLY C  1 109 ? -47.163  64.326  8.181   1.00 28.41  ? 109 GLY C C   1 
ATOM   4080  O  O   . GLY C  1 109 ? -46.679  65.364  8.662   1.00 20.46  ? 109 GLY C O   1 
ATOM   4081  N  N   . GLU C  1 110 ? -46.431  63.237  7.991   1.00 28.79  ? 110 GLU C N   1 
ATOM   4082  C  CA  . GLU C  1 110 ? -44.989  63.293  8.158   1.00 14.85  ? 110 GLU C CA  1 
ATOM   4083  C  C   . GLU C  1 110 ? -44.364  64.106  7.026   1.00 24.43  ? 110 GLU C C   1 
ATOM   4084  O  O   . GLU C  1 110 ? -44.792  64.019  5.877   1.00 20.27  ? 110 GLU C O   1 
ATOM   4085  C  CB  . GLU C  1 110 ? -44.398  61.883  8.221   1.00 41.46  ? 110 GLU C CB  1 
ATOM   4086  C  CG  . GLU C  1 110 ? -44.747  61.126  9.509   1.00 54.76  ? 110 GLU C CG  1 
ATOM   4087  C  CD  . GLU C  1 110 ? -44.259  61.841  10.765  1.00 71.13  ? 110 GLU C CD  1 
ATOM   4088  O  OE1 . GLU C  1 110 ? -43.048  62.145  10.851  1.00 65.13  ? 110 GLU C OE1 1 
ATOM   4089  O  OE2 . GLU C  1 110 ? -45.089  62.106  11.664  1.00 72.01  ? 110 GLU C OE2 1 
ATOM   4090  N  N   . VAL C  1 111 ? -43.366  64.914  7.365   1.00 17.31  ? 111 VAL C N   1 
ATOM   4091  C  CA  . VAL C  1 111 ? -42.686  65.762  6.389   1.00 23.10  ? 111 VAL C CA  1 
ATOM   4092  C  C   . VAL C  1 111 ? -41.161  65.517  6.401   1.00 23.74  ? 111 VAL C C   1 
ATOM   4093  O  O   . VAL C  1 111 ? -40.534  65.559  7.462   1.00 37.59  ? 111 VAL C O   1 
ATOM   4094  C  CB  . VAL C  1 111 ? -42.986  67.261  6.670   1.00 20.06  ? 111 VAL C CB  1 
ATOM   4095  C  CG1 . VAL C  1 111 ? -42.455  68.142  5.567   1.00 6.10   ? 111 VAL C CG1 1 
ATOM   4096  C  CG2 . VAL C  1 111 ? -44.461  67.478  6.835   1.00 6.76   ? 111 VAL C CG2 1 
ATOM   4097  N  N   . LEU C  1 112 ? -40.580  65.223  5.237   1.00 18.95  ? 112 LEU C N   1 
ATOM   4098  C  CA  . LEU C  1 112 ? -39.125  65.253  5.060   1.00 16.83  ? 112 LEU C CA  1 
ATOM   4099  C  C   . LEU C  1 112 ? -38.748  66.467  4.219   1.00 28.00  ? 112 LEU C C   1 
ATOM   4100  O  O   . LEU C  1 112 ? -39.348  66.728  3.169   1.00 25.20  ? 112 LEU C O   1 
ATOM   4101  C  CB  . LEU C  1 112 ? -38.575  63.980  4.391   1.00 12.19  ? 112 LEU C CB  1 
ATOM   4102  C  CG  . LEU C  1 112 ? -37.043  63.972  4.128   1.00 46.69  ? 112 LEU C CG  1 
ATOM   4103  C  CD1 . LEU C  1 112 ? -36.260  64.020  5.426   1.00 43.53  ? 112 LEU C CD1 1 
ATOM   4104  C  CD2 . LEU C  1 112 ? -36.521  62.787  3.284   1.00 17.68  ? 112 LEU C CD2 1 
ATOM   4105  N  N   . TYR C  1 113 ? -37.766  67.220  4.699   1.00 18.87  ? 113 TYR C N   1 
ATOM   4106  C  CA  . TYR C  1 113 ? -37.134  68.262  3.905   1.00 13.11  ? 113 TYR C CA  1 
ATOM   4107  C  C   . TYR C  1 113 ? -35.624  68.082  4.040   1.00 27.43  ? 113 TYR C C   1 
ATOM   4108  O  O   . TYR C  1 113 ? -35.094  68.040  5.153   1.00 25.32  ? 113 TYR C O   1 
ATOM   4109  C  CB  . TYR C  1 113 ? -37.588  69.649  4.364   1.00 5.03   ? 113 TYR C CB  1 
ATOM   4110  C  CG  . TYR C  1 113 ? -37.016  70.802  3.563   1.00 19.55  ? 113 TYR C CG  1 
ATOM   4111  C  CD1 . TYR C  1 113 ? -37.007  70.777  2.167   1.00 24.19  ? 113 TYR C CD1 1 
ATOM   4112  C  CD2 . TYR C  1 113 ? -36.511  71.934  4.199   1.00 11.17  ? 113 TYR C CD2 1 
ATOM   4113  C  CE1 . TYR C  1 113 ? -36.479  71.840  1.423   1.00 26.58  ? 113 TYR C CE1 1 
ATOM   4114  C  CE2 . TYR C  1 113 ? -35.982  73.009  3.470   1.00 16.66  ? 113 TYR C CE2 1 
ATOM   4115  C  CZ  . TYR C  1 113 ? -35.970  72.958  2.081   1.00 30.76  ? 113 TYR C CZ  1 
ATOM   4116  O  OH  . TYR C  1 113 ? -35.453  74.027  1.361   1.00 19.29  ? 113 TYR C OH  1 
ATOM   4117  N  N   . MET C  1 114 ? -34.930  67.951  2.910   1.00 29.83  ? 114 MET C N   1 
ATOM   4118  C  CA  . MET C  1 114 ? -33.486  67.718  2.928   1.00 19.72  ? 114 MET C CA  1 
ATOM   4119  C  C   . MET C  1 114 ? -32.799  68.450  1.796   1.00 17.43  ? 114 MET C C   1 
ATOM   4120  O  O   . MET C  1 114 ? -32.393  67.839  0.816   1.00 18.55  ? 114 MET C O   1 
ATOM   4121  C  CB  . MET C  1 114 ? -33.180  66.224  2.814   1.00 11.08  ? 114 MET C CB  1 
ATOM   4122  C  CG  . MET C  1 114 ? -31.746  65.847  3.161   1.00 5.69   ? 114 MET C CG  1 
ATOM   4123  S  SD  . MET C  1 114 ? -31.544  64.092  3.555   1.00 22.19  ? 114 MET C SD  1 
ATOM   4124  C  CE  . MET C  1 114 ? -32.087  63.321  2.013   1.00 15.69  ? 114 MET C CE  1 
ATOM   4125  N  N   . PRO C  1 115 ? -32.670  69.771  1.920   1.00 16.47  ? 115 PRO C N   1 
ATOM   4126  C  CA  . PRO C  1 115 ? -31.981  70.555  0.895   1.00 22.02  ? 115 PRO C CA  1 
ATOM   4127  C  C   . PRO C  1 115 ? -30.471  70.408  1.077   1.00 29.26  ? 115 PRO C C   1 
ATOM   4128  O  O   . PRO C  1 115 ? -30.014  70.115  2.190   1.00 22.95  ? 115 PRO C O   1 
ATOM   4129  C  CB  . PRO C  1 115 ? -32.403  71.990  1.221   1.00 11.37  ? 115 PRO C CB  1 
ATOM   4130  C  CG  . PRO C  1 115 ? -32.545  71.986  2.695   1.00 11.12  ? 115 PRO C CG  1 
ATOM   4131  C  CD  . PRO C  1 115 ? -33.109  70.606  3.049   1.00 10.91  ? 115 PRO C CD  1 
ATOM   4132  N  N   . SER C  1 116 ? -29.707  70.583  -0.001  1.00 25.24  ? 116 SER C N   1 
ATOM   4133  C  CA  . SER C  1 116 ? -28.259  70.627  0.109   1.00 13.42  ? 116 SER C CA  1 
ATOM   4134  C  C   . SER C  1 116 ? -27.881  72.082  0.323   1.00 18.95  ? 116 SER C C   1 
ATOM   4135  O  O   . SER C  1 116 ? -28.335  72.966  -0.399  1.00 19.60  ? 116 SER C O   1 
ATOM   4136  C  CB  . SER C  1 116 ? -27.601  70.062  -1.138  1.00 7.25   ? 116 SER C CB  1 
ATOM   4137  O  OG  . SER C  1 116 ? -26.201  70.058  -1.021  1.00 17.93  ? 116 SER C OG  1 
ATOM   4138  N  N   . ILE C  1 117 ? -27.079  72.329  1.348   1.00 19.88  ? 117 ILE C N   1 
ATOM   4139  C  CA  . ILE C  1 117 ? -26.746  73.686  1.736   1.00 13.82  ? 117 ILE C CA  1 
ATOM   4140  C  C   . ILE C  1 117 ? -25.241  73.932  1.763   1.00 19.25  ? 117 ILE C C   1 
ATOM   4141  O  O   . ILE C  1 117 ? -24.467  73.114  2.258   1.00 25.52  ? 117 ILE C O   1 
ATOM   4142  C  CB  . ILE C  1 117 ? -27.310  74.010  3.113   1.00 16.51  ? 117 ILE C CB  1 
ATOM   4143  C  CG1 . ILE C  1 117 ? -28.840  74.048  3.054   1.00 26.20  ? 117 ILE C CG1 1 
ATOM   4144  C  CG2 . ILE C  1 117 ? -26.766  75.342  3.608   1.00 8.14   ? 117 ILE C CG2 1 
ATOM   4145  C  CD1 . ILE C  1 117 ? -29.500  74.222  4.410   1.00 25.63  ? 117 ILE C CD1 1 
ATOM   4146  N  N   . ARG C  1 118 ? -24.831  75.057  1.196   1.00 16.76  ? 118 ARG C N   1 
ATOM   4147  C  CA  . ARG C  1 118 ? -23.479  75.535  1.367   1.00 13.20  ? 118 ARG C CA  1 
ATOM   4148  C  C   . ARG C  1 118 ? -23.523  76.717  2.315   1.00 13.82  ? 118 ARG C C   1 
ATOM   4149  O  O   . ARG C  1 118 ? -24.285  77.657  2.098   1.00 16.99  ? 118 ARG C O   1 
ATOM   4150  C  CB  . ARG C  1 118 ? -22.850  75.955  0.030   1.00 17.41  ? 118 ARG C CB  1 
ATOM   4151  C  CG  . ARG C  1 118 ? -21.469  76.591  0.199   1.00 17.70  ? 118 ARG C CG  1 
ATOM   4152  C  CD  . ARG C  1 118 ? -20.721  76.719  -1.106  1.00 22.88  ? 118 ARG C CD  1 
ATOM   4153  N  NE  . ARG C  1 118 ? -19.373  77.224  -0.877  1.00 28.96  ? 118 ARG C NE  1 
ATOM   4154  C  CZ  . ARG C  1 118 ? -18.448  77.334  -1.816  1.00 24.58  ? 118 ARG C CZ  1 
ATOM   4155  N  NH1 . ARG C  1 118 ? -18.729  76.958  -3.055  1.00 22.35  ? 118 ARG C NH1 1 
ATOM   4156  N  NH2 . ARG C  1 118 ? -17.243  77.799  -1.505  1.00 30.60  ? 118 ARG C NH2 1 
ATOM   4157  N  N   . GLN C  1 119 ? -22.690  76.673  3.346   1.00 14.75  ? 119 GLN C N   1 
ATOM   4158  C  CA  . GLN C  1 119 ? -22.698  77.699  4.384   1.00 32.10  ? 119 GLN C CA  1 
ATOM   4159  C  C   . GLN C  1 119 ? -21.325  77.769  5.045   1.00 29.15  ? 119 GLN C C   1 
ATOM   4160  O  O   . GLN C  1 119 ? -20.625  76.762  5.124   1.00 14.33  ? 119 GLN C O   1 
ATOM   4161  C  CB  . GLN C  1 119 ? -23.779  77.383  5.433   1.00 17.44  ? 119 GLN C CB  1 
ATOM   4162  C  CG  . GLN C  1 119 ? -24.217  78.574  6.275   1.00 20.43  ? 119 GLN C CG  1 
ATOM   4163  C  CD  . GLN C  1 119 ? -25.465  78.272  7.100   1.00 22.00  ? 119 GLN C CD  1 
ATOM   4164  O  OE1 . GLN C  1 119 ? -25.802  77.114  7.338   1.00 21.28  ? 119 GLN C OE1 1 
ATOM   4165  N  NE2 . GLN C  1 119 ? -26.159  79.317  7.528   1.00 25.56  ? 119 GLN C NE2 1 
ATOM   4166  N  N   . ARG C  1 120 ? -20.951  78.951  5.527   1.00 17.66  ? 120 ARG C N   1 
ATOM   4167  C  CA  . ARG C  1 120 ? -19.667  79.108  6.198   1.00 36.52  ? 120 ARG C CA  1 
ATOM   4168  C  C   . ARG C  1 120 ? -19.895  79.270  7.687   1.00 34.21  ? 120 ARG C C   1 
ATOM   4169  O  O   . ARG C  1 120 ? -20.899  79.852  8.126   1.00 14.24  ? 120 ARG C O   1 
ATOM   4170  C  CB  . ARG C  1 120 ? -18.877  80.289  5.636   1.00 32.02  ? 120 ARG C CB  1 
ATOM   4171  C  CG  . ARG C  1 120 ? -18.438  80.105  4.204   1.00 22.04  ? 120 ARG C CG  1 
ATOM   4172  C  CD  . ARG C  1 120 ? -18.160  81.444  3.562   1.00 40.98  ? 120 ARG C CD  1 
ATOM   4173  N  NE  . ARG C  1 120 ? -19.287  81.886  2.741   1.00 65.08  ? 120 ARG C NE  1 
ATOM   4174  C  CZ  . ARG C  1 120 ? -19.609  83.160  2.518   1.00 62.20  ? 120 ARG C CZ  1 
ATOM   4175  N  NH1 . ARG C  1 120 ? -18.901  84.141  3.071   1.00 40.18  ? 120 ARG C NH1 1 
ATOM   4176  N  NH2 . ARG C  1 120 ? -20.651  83.450  1.744   1.00 59.87  ? 120 ARG C NH2 1 
ATOM   4177  N  N   . PHE C  1 121 ? -18.959  78.733  8.459   1.00 26.02  ? 121 PHE C N   1 
ATOM   4178  C  CA  . PHE C  1 121 ? -19.092  78.717  9.906   1.00 23.64  ? 121 PHE C CA  1 
ATOM   4179  C  C   . PHE C  1 121 ? -17.844  79.212  10.614  1.00 26.14  ? 121 PHE C C   1 
ATOM   4180  O  O   . PHE C  1 121 ? -16.733  79.112  10.095  1.00 35.77  ? 121 PHE C O   1 
ATOM   4181  C  CB  . PHE C  1 121 ? -19.394  77.300  10.397  1.00 19.61  ? 121 PHE C CB  1 
ATOM   4182  C  CG  . PHE C  1 121 ? -20.662  76.717  9.848   1.00 31.04  ? 121 PHE C CG  1 
ATOM   4183  C  CD1 . PHE C  1 121 ? -21.848  76.911  10.500  1.00 22.61  ? 121 PHE C CD1 1 
ATOM   4184  C  CD2 . PHE C  1 121 ? -20.657  75.966  8.691   1.00 16.91  ? 121 PHE C CD2 1 
ATOM   4185  C  CE1 . PHE C  1 121 ? -22.988  76.374  10.011  1.00 28.72  ? 121 PHE C CE1 1 
ATOM   4186  C  CE2 . PHE C  1 121 ? -21.804  75.430  8.206   1.00 11.55  ? 121 PHE C CE2 1 
ATOM   4187  C  CZ  . PHE C  1 121 ? -22.963  75.636  8.860   1.00 26.70  ? 121 PHE C CZ  1 
ATOM   4188  N  N   . SER C  1 122 ? -18.049  79.737  11.815  1.00 22.56  ? 122 SER C N   1 
ATOM   4189  C  CA  . SER C  1 122 ? -16.973  80.019  12.736  1.00 11.44  ? 122 SER C CA  1 
ATOM   4190  C  C   . SER C  1 122 ? -16.904  78.868  13.734  1.00 18.43  ? 122 SER C C   1 
ATOM   4191  O  O   . SER C  1 122 ? -17.861  78.599  14.443  1.00 21.07  ? 122 SER C O   1 
ATOM   4192  C  CB  . SER C  1 122 ? -17.245  81.334  13.448  1.00 19.84  ? 122 SER C CB  1 
ATOM   4193  O  OG  . SER C  1 122 ? -16.635  81.364  14.731  1.00 26.08  ? 122 SER C OG  1 
ATOM   4194  N  N   . CYS C  1 123 ? -15.775  78.172  13.768  1.00 27.19  ? 123 CYS C N   1 
ATOM   4195  C  CA  . CYS C  1 123 ? -15.578  77.057  14.699  1.00 25.60  ? 123 CYS C CA  1 
ATOM   4196  C  C   . CYS C  1 123 ? -14.108  76.676  14.816  1.00 29.21  ? 123 CYS C C   1 
ATOM   4197  O  O   . CYS C  1 123 ? -13.257  77.242  14.135  1.00 31.78  ? 123 CYS C O   1 
ATOM   4198  C  CB  . CYS C  1 123 ? -16.389  75.832  14.266  1.00 32.70  ? 123 CYS C CB  1 
ATOM   4199  S  SG  . CYS C  1 123 ? -16.079  75.298  12.570  1.00 24.11  ? 123 CYS C SG  1 
ATOM   4200  N  N   . ASP C  1 124 ? -13.815  75.704  15.671  1.00 26.42  ? 124 ASP C N   1 
ATOM   4201  C  CA  . ASP C  1 124 ? -12.434  75.337  15.938  1.00 24.25  ? 124 ASP C CA  1 
ATOM   4202  C  C   . ASP C  1 124 ? -11.785  74.595  14.778  1.00 37.12  ? 124 ASP C C   1 
ATOM   4203  O  O   . ASP C  1 124 ? -12.065  73.421  14.564  1.00 42.25  ? 124 ASP C O   1 
ATOM   4204  C  CB  . ASP C  1 124 ? -12.350  74.480  17.188  1.00 32.22  ? 124 ASP C CB  1 
ATOM   4205  C  CG  . ASP C  1 124 ? -10.949  74.444  17.773  1.00 38.85  ? 124 ASP C CG  1 
ATOM   4206  O  OD1 . ASP C  1 124 ? -10.003  74.939  17.124  1.00 37.24  ? 124 ASP C OD1 1 
ATOM   4207  O  OD2 . ASP C  1 124 ? -10.798  73.911  18.881  1.00 27.82  ? 124 ASP C OD2 1 
ATOM   4208  N  N   . VAL C  1 125 ? -10.906  75.271  14.046  1.00 19.41  ? 125 VAL C N   1 
ATOM   4209  C  CA  . VAL C  1 125 ? -10.260  74.658  12.897  1.00 19.82  ? 125 VAL C CA  1 
ATOM   4210  C  C   . VAL C  1 125 ? -8.849   74.202  13.285  1.00 30.14  ? 125 VAL C C   1 
ATOM   4211  O  O   . VAL C  1 125 ? -8.121   73.603  12.499  1.00 24.98  ? 125 VAL C O   1 
ATOM   4212  C  CB  . VAL C  1 125 ? -10.205  75.641  11.706  1.00 22.30  ? 125 VAL C CB  1 
ATOM   4213  C  CG1 . VAL C  1 125 ? -9.595   74.982  10.496  1.00 29.57  ? 125 VAL C CG1 1 
ATOM   4214  C  CG2 . VAL C  1 125 ? -11.583  76.136  11.371  1.00 19.97  ? 125 VAL C CG2 1 
ATOM   4215  N  N   . SER C  1 126 ? -8.462   74.484  14.519  1.00 28.82  ? 126 SER C N   1 
ATOM   4216  C  CA  . SER C  1 126 ? -7.120   74.126  14.961  1.00 42.92  ? 126 SER C CA  1 
ATOM   4217  C  C   . SER C  1 126 ? -6.905   72.631  14.762  1.00 42.03  ? 126 SER C C   1 
ATOM   4218  O  O   . SER C  1 126 ? -7.825   71.831  14.976  1.00 25.12  ? 126 SER C O   1 
ATOM   4219  C  CB  . SER C  1 126 ? -6.902   74.513  16.427  1.00 27.30  ? 126 SER C CB  1 
ATOM   4220  O  OG  . SER C  1 126 ? -7.472   73.556  17.301  1.00 35.77  ? 126 SER C OG  1 
ATOM   4221  N  N   . GLY C  1 127 ? -5.700   72.266  14.326  1.00 32.45  ? 127 GLY C N   1 
ATOM   4222  C  CA  . GLY C  1 127 ? -5.323   70.874  14.153  1.00 29.05  ? 127 GLY C CA  1 
ATOM   4223  C  C   . GLY C  1 127 ? -5.804   70.236  12.861  1.00 41.61  ? 127 GLY C C   1 
ATOM   4224  O  O   . GLY C  1 127 ? -5.604   69.040  12.636  1.00 32.60  ? 127 GLY C O   1 
ATOM   4225  N  N   . VAL C  1 128 ? -6.440   71.027  12.003  1.00 25.95  ? 128 VAL C N   1 
ATOM   4226  C  CA  . VAL C  1 128 ? -6.987   70.494  10.764  1.00 24.62  ? 128 VAL C CA  1 
ATOM   4227  C  C   . VAL C  1 128 ? -5.950   69.726  9.984   1.00 26.22  ? 128 VAL C C   1 
ATOM   4228  O  O   . VAL C  1 128 ? -6.262   68.765  9.287   1.00 36.22  ? 128 VAL C O   1 
ATOM   4229  C  CB  . VAL C  1 128 ? -7.570   71.594  9.851   1.00 24.14  ? 128 VAL C CB  1 
ATOM   4230  C  CG1 . VAL C  1 128 ? -6.510   72.596  9.469   1.00 24.56  ? 128 VAL C CG1 1 
ATOM   4231  C  CG2 . VAL C  1 128 ? -8.172   70.969  8.615   1.00 21.95  ? 128 VAL C CG2 1 
ATOM   4232  N  N   . ASP C  1 129 ? -4.704   70.159  10.100  1.00 34.60  ? 129 ASP C N   1 
ATOM   4233  C  CA  . ASP C  1 129 ? -3.631   69.550  9.340   1.00 35.45  ? 129 ASP C CA  1 
ATOM   4234  C  C   . ASP C  1 129 ? -2.800   68.564  10.168  1.00 39.34  ? 129 ASP C C   1 
ATOM   4235  O  O   . ASP C  1 129 ? -1.597   68.466  9.978   1.00 41.89  ? 129 ASP C O   1 
ATOM   4236  C  CB  . ASP C  1 129 ? -2.740   70.630  8.728   1.00 33.39  ? 129 ASP C CB  1 
ATOM   4237  C  CG  . ASP C  1 129 ? -2.168   70.210  7.384   1.00 62.07  ? 129 ASP C CG  1 
ATOM   4238  O  OD1 . ASP C  1 129 ? -2.106   68.983  7.110   1.00 56.98  ? 129 ASP C OD1 1 
ATOM   4239  O  OD2 . ASP C  1 129 ? -1.788   71.107  6.597   1.00 72.16  ? 129 ASP C OD2 1 
ATOM   4240  N  N   . THR C  1 130 ? -3.446   67.836  11.073  1.00 31.52  ? 130 THR C N   1 
ATOM   4241  C  CA  . THR C  1 130 ? -2.766   66.828  11.862  1.00 33.44  ? 130 THR C CA  1 
ATOM   4242  C  C   . THR C  1 130 ? -3.483   65.488  11.805  1.00 43.11  ? 130 THR C C   1 
ATOM   4243  O  O   . THR C  1 130 ? -4.527   65.360  11.194  1.00 43.95  ? 130 THR C O   1 
ATOM   4244  C  CB  . THR C  1 130 ? -2.642   67.247  13.335  1.00 42.98  ? 130 THR C CB  1 
ATOM   4245  O  OG1 . THR C  1 130 ? -3.934   67.200  13.959  1.00 42.04  ? 130 THR C OG1 1 
ATOM   4246  C  CG2 . THR C  1 130 ? -2.057   68.649  13.449  1.00 35.15  ? 130 THR C CG2 1 
ATOM   4247  N  N   . GLU C  1 131 ? -2.940   64.493  12.489  1.00 28.18  ? 131 GLU C N   1 
ATOM   4248  C  CA  . GLU C  1 131 ? -3.511   63.161  12.418  1.00 30.72  ? 131 GLU C CA  1 
ATOM   4249  C  C   . GLU C  1 131 ? -4.856   63.065  13.171  1.00 26.91  ? 131 GLU C C   1 
ATOM   4250  O  O   . GLU C  1 131 ? -5.794   62.417  12.700  1.00 27.99  ? 131 GLU C O   1 
ATOM   4251  C  CB  . GLU C  1 131 ? -2.482   62.125  12.888  1.00 45.15  ? 131 GLU C CB  1 
ATOM   4252  C  CG  . GLU C  1 131 ? -2.648   60.746  12.255  1.00 69.71  ? 131 GLU C CG  1 
ATOM   4253  C  CD  . GLU C  1 131 ? -1.363   59.919  12.266  1.00 75.80  ? 131 GLU C CD  1 
ATOM   4254  O  OE1 . GLU C  1 131 ? -0.822   59.642  13.364  1.00 44.72  ? 131 GLU C OE1 1 
ATOM   4255  O  OE2 . GLU C  1 131 ? -0.894   59.544  11.167  1.00 88.89  ? 131 GLU C OE2 1 
ATOM   4256  N  N   . SER C  1 132 ? -4.971   63.726  14.320  1.00 21.66  ? 132 SER C N   1 
ATOM   4257  C  CA  . SER C  1 132 ? -6.264   63.730  15.023  1.00 31.76  ? 132 SER C CA  1 
ATOM   4258  C  C   . SER C  1 132 ? -7.258   64.699  14.375  1.00 34.44  ? 132 SER C C   1 
ATOM   4259  O  O   . SER C  1 132 ? -8.471   64.461  14.368  1.00 19.45  ? 132 SER C O   1 
ATOM   4260  C  CB  . SER C  1 132 ? -6.132   63.972  16.542  1.00 13.74  ? 132 SER C CB  1 
ATOM   4261  O  OG  . SER C  1 132 ? -5.022   64.791  16.890  1.00 44.01  ? 132 SER C OG  1 
ATOM   4262  N  N   . GLY C  1 133 ? -6.737   65.779  13.807  1.00 36.21  ? 133 GLY C N   1 
ATOM   4263  C  CA  . GLY C  1 133 ? -7.567   66.694  13.051  1.00 22.49  ? 133 GLY C CA  1 
ATOM   4264  C  C   . GLY C  1 133 ? -8.279   67.762  13.865  1.00 28.29  ? 133 GLY C C   1 
ATOM   4265  O  O   . GLY C  1 133 ? -8.133   67.852  15.081  1.00 27.04  ? 133 GLY C O   1 
ATOM   4266  N  N   . ALA C  1 134 ? -9.053   68.589  13.176  1.00 21.67  ? 134 ALA C N   1 
ATOM   4267  C  CA  . ALA C  1 134 ? -9.870   69.589  13.834  1.00 34.12  ? 134 ALA C CA  1 
ATOM   4268  C  C   . ALA C  1 134 ? -11.243  69.011  14.165  1.00 30.65  ? 134 ALA C C   1 
ATOM   4269  O  O   . ALA C  1 134 ? -11.677  68.027  13.579  1.00 22.74  ? 134 ALA C O   1 
ATOM   4270  C  CB  . ALA C  1 134 ? -10.004  70.818  12.966  1.00 26.70  ? 134 ALA C CB  1 
ATOM   4271  N  N   . THR C  1 135 ? -11.907  69.605  15.142  1.00 21.40  ? 135 THR C N   1 
ATOM   4272  C  CA  . THR C  1 135 ? -13.273  69.227  15.463  1.00 26.26  ? 135 THR C CA  1 
ATOM   4273  C  C   . THR C  1 135 ? -14.120  70.483  15.409  1.00 27.12  ? 135 THR C C   1 
ATOM   4274  O  O   . THR C  1 135 ? -14.041  71.355  16.288  1.00 15.22  ? 135 THR C O   1 
ATOM   4275  C  CB  . THR C  1 135 ? -13.408  68.550  16.849  1.00 28.53  ? 135 THR C CB  1 
ATOM   4276  O  OG1 . THR C  1 135 ? -12.778  67.266  16.816  1.00 38.75  ? 135 THR C OG1 1 
ATOM   4277  C  CG2 . THR C  1 135 ? -14.858  68.343  17.180  1.00 17.74  ? 135 THR C CG2 1 
ATOM   4278  N  N   . CYS C  1 136 ? -14.902  70.573  14.340  1.00 17.66  ? 136 CYS C N   1 
ATOM   4279  C  CA  . CYS C  1 136 ? -15.713  71.739  14.065  1.00 19.72  ? 136 CYS C CA  1 
ATOM   4280  C  C   . CYS C  1 136 ? -17.136  71.483  14.540  1.00 36.51  ? 136 CYS C C   1 
ATOM   4281  O  O   . CYS C  1 136 ? -17.838  70.621  14.007  1.00 30.06  ? 136 CYS C O   1 
ATOM   4282  C  CB  . CYS C  1 136 ? -15.696  72.034  12.580  1.00 11.88  ? 136 CYS C CB  1 
ATOM   4283  S  SG  . CYS C  1 136 ? -16.725  73.407  12.132  1.00 35.56  ? 136 CYS C SG  1 
ATOM   4284  N  N   . ARG C  1 137 ? -17.539  72.225  15.564  1.00 42.64  ? 137 ARG C N   1 
ATOM   4285  C  CA  . ARG C  1 137 ? -18.823  72.030  16.224  1.00 29.33  ? 137 ARG C CA  1 
ATOM   4286  C  C   . ARG C  1 137 ? -19.852  72.970  15.611  1.00 2.99   ? 137 ARG C C   1 
ATOM   4287  O  O   . ARG C  1 137 ? -19.657  74.181  15.583  1.00 17.27  ? 137 ARG C O   1 
ATOM   4288  C  CB  . ARG C  1 137 ? -18.663  72.332  17.710  1.00 21.57  ? 137 ARG C CB  1 
ATOM   4289  C  CG  . ARG C  1 137 ? -19.582  71.579  18.644  1.00 40.66  ? 137 ARG C CG  1 
ATOM   4290  C  CD  . ARG C  1 137 ? -19.150  71.793  20.111  1.00 71.12  ? 137 ARG C CD  1 
ATOM   4291  N  NE  . ARG C  1 137 ? -19.188  73.195  20.548  1.00 71.89  ? 137 ARG C NE  1 
ATOM   4292  C  CZ  . ARG C  1 137 ? -18.131  74.011  20.606  1.00 57.63  ? 137 ARG C CZ  1 
ATOM   4293  N  NH1 . ARG C  1 137 ? -16.921  73.583  20.250  1.00 51.68  ? 137 ARG C NH1 1 
ATOM   4294  N  NH2 . ARG C  1 137 ? -18.286  75.265  21.020  1.00 23.19  ? 137 ARG C NH2 1 
ATOM   4295  N  N   . ILE C  1 138 ? -20.941  72.407  15.108  1.00 30.46  ? 138 ILE C N   1 
ATOM   4296  C  CA  . ILE C  1 138 ? -22.018  73.201  14.537  1.00 25.58  ? 138 ILE C CA  1 
ATOM   4297  C  C   . ILE C  1 138 ? -23.286  73.097  15.385  1.00 28.45  ? 138 ILE C C   1 
ATOM   4298  O  O   . ILE C  1 138 ? -23.772  71.994  15.643  1.00 23.25  ? 138 ILE C O   1 
ATOM   4299  C  CB  . ILE C  1 138 ? -22.329  72.749  13.113  1.00 26.43  ? 138 ILE C CB  1 
ATOM   4300  C  CG1 . ILE C  1 138 ? -21.133  73.030  12.202  1.00 24.22  ? 138 ILE C CG1 1 
ATOM   4301  C  CG2 . ILE C  1 138 ? -23.550  73.471  12.599  1.00 21.53  ? 138 ILE C CG2 1 
ATOM   4302  C  CD1 . ILE C  1 138 ? -21.261  72.448  10.808  1.00 24.25  ? 138 ILE C CD1 1 
ATOM   4303  N  N   . LYS C  1 139 ? -23.805  74.248  15.819  1.00 29.56  ? 139 LYS C N   1 
ATOM   4304  C  CA  . LYS C  1 139 ? -24.995  74.324  16.682  1.00 24.73  ? 139 LYS C CA  1 
ATOM   4305  C  C   . LYS C  1 139 ? -26.259  74.794  15.949  1.00 27.64  ? 139 LYS C C   1 
ATOM   4306  O  O   . LYS C  1 139 ? -26.335  75.929  15.465  1.00 25.68  ? 139 LYS C O   1 
ATOM   4307  C  CB  . LYS C  1 139 ? -24.708  75.261  17.853  1.00 29.86  ? 139 LYS C CB  1 
ATOM   4308  C  CG  . LYS C  1 139 ? -25.859  75.496  18.826  1.00 23.67  ? 139 LYS C CG  1 
ATOM   4309  C  CD  . LYS C  1 139 ? -25.454  76.567  19.827  1.00 15.72  ? 139 LYS C CD  1 
ATOM   4310  C  CE  . LYS C  1 139 ? -26.606  76.970  20.717  1.00 23.04  ? 139 LYS C CE  1 
ATOM   4311  N  NZ  . LYS C  1 139 ? -26.207  78.089  21.616  1.00 34.42  ? 139 LYS C NZ  1 
ATOM   4312  N  N   . ILE C  1 140 ? -27.257  73.917  15.899  1.00 18.58  ? 140 ILE C N   1 
ATOM   4313  C  CA  . ILE C  1 140 ? -28.505  74.187  15.198  1.00 17.74  ? 140 ILE C CA  1 
ATOM   4314  C  C   . ILE C  1 140 ? -29.688  74.035  16.143  1.00 23.27  ? 140 ILE C C   1 
ATOM   4315  O  O   . ILE C  1 140 ? -29.768  73.063  16.899  1.00 20.14  ? 140 ILE C O   1 
ATOM   4316  C  CB  . ILE C  1 140 ? -28.706  73.195  14.049  1.00 18.64  ? 140 ILE C CB  1 
ATOM   4317  C  CG1 . ILE C  1 140 ? -27.601  73.350  13.002  1.00 33.48  ? 140 ILE C CG1 1 
ATOM   4318  C  CG2 . ILE C  1 140 ? -30.060  73.404  13.404  1.00 20.67  ? 140 ILE C CG2 1 
ATOM   4319  C  CD1 . ILE C  1 140 ? -27.729  72.386  11.847  1.00 34.77  ? 140 ILE C CD1 1 
ATOM   4320  N  N   . GLY C  1 141 ? -30.611  74.992  16.094  1.00 29.78  ? 141 GLY C N   1 
ATOM   4321  C  CA  . GLY C  1 141 ? -31.821  74.947  16.898  1.00 21.38  ? 141 GLY C CA  1 
ATOM   4322  C  C   . GLY C  1 141 ? -32.889  75.895  16.384  1.00 18.75  ? 141 GLY C C   1 
ATOM   4323  O  O   . GLY C  1 141 ? -32.656  76.668  15.461  1.00 24.21  ? 141 GLY C O   1 
ATOM   4324  N  N   . SER C  1 142 ? -34.078  75.833  16.968  1.00 26.75  ? 142 SER C N   1 
ATOM   4325  C  CA  . SER C  1 142 ? -35.100  76.815  16.646  1.00 26.40  ? 142 SER C CA  1 
ATOM   4326  C  C   . SER C  1 142 ? -34.624  78.207  17.053  1.00 22.97  ? 142 SER C C   1 
ATOM   4327  O  O   . SER C  1 142 ? -34.052  78.384  18.125  1.00 24.33  ? 142 SER C O   1 
ATOM   4328  C  CB  . SER C  1 142 ? -36.412  76.484  17.362  1.00 32.16  ? 142 SER C CB  1 
ATOM   4329  O  OG  . SER C  1 142 ? -37.373  77.523  17.211  1.00 23.67  ? 142 SER C OG  1 
ATOM   4330  N  N   . TRP C  1 143 ? -34.845  79.189  16.191  1.00 17.95  ? 143 TRP C N   1 
ATOM   4331  C  CA  . TRP C  1 143 ? -34.463  80.551  16.507  1.00 15.03  ? 143 TRP C CA  1 
ATOM   4332  C  C   . TRP C  1 143 ? -35.401  81.233  17.511  1.00 24.25  ? 143 TRP C C   1 
ATOM   4333  O  O   . TRP C  1 143 ? -34.933  81.886  18.443  1.00 24.45  ? 143 TRP C O   1 
ATOM   4334  C  CB  . TRP C  1 143 ? -34.326  81.390  15.236  1.00 15.67  ? 143 TRP C CB  1 
ATOM   4335  C  CG  . TRP C  1 143 ? -33.459  82.593  15.439  1.00 21.44  ? 143 TRP C CG  1 
ATOM   4336  C  CD1 . TRP C  1 143 ? -33.842  83.899  15.389  1.00 28.47  ? 143 TRP C CD1 1 
ATOM   4337  C  CD2 . TRP C  1 143 ? -32.054  82.600  15.754  1.00 15.95  ? 143 TRP C CD2 1 
ATOM   4338  N  NE1 . TRP C  1 143 ? -32.762  84.723  15.642  1.00 22.02  ? 143 TRP C NE1 1 
ATOM   4339  C  CE2 . TRP C  1 143 ? -31.659  83.946  15.880  1.00 16.42  ? 143 TRP C CE2 1 
ATOM   4340  C  CE3 . TRP C  1 143 ? -31.098  81.595  15.955  1.00 19.40  ? 143 TRP C CE3 1 
ATOM   4341  C  CZ2 . TRP C  1 143 ? -30.347  84.316  16.179  1.00 34.50  ? 143 TRP C CZ2 1 
ATOM   4342  C  CZ3 . TRP C  1 143 ? -29.800  81.962  16.256  1.00 16.81  ? 143 TRP C CZ3 1 
ATOM   4343  C  CH2 . TRP C  1 143 ? -29.433  83.312  16.359  1.00 18.81  ? 143 TRP C CH2 1 
ATOM   4344  N  N   . THR C  1 144 ? -36.711  81.069  17.336  1.00 15.05  ? 144 THR C N   1 
ATOM   4345  C  CA  . THR C  1 144 ? -37.684  81.835  18.114  1.00 17.96  ? 144 THR C CA  1 
ATOM   4346  C  C   . THR C  1 144 ? -38.592  80.978  18.990  1.00 16.86  ? 144 THR C C   1 
ATOM   4347  O  O   . THR C  1 144 ? -39.224  81.496  19.908  1.00 19.91  ? 144 THR C O   1 
ATOM   4348  C  CB  . THR C  1 144 ? -38.550  82.763  17.221  1.00 16.84  ? 144 THR C CB  1 
ATOM   4349  O  OG1 . THR C  1 144 ? -39.285  81.984  16.276  1.00 21.03  ? 144 THR C OG1 1 
ATOM   4350  C  CG2 . THR C  1 144 ? -37.685  83.719  16.457  1.00 22.43  ? 144 THR C CG2 1 
ATOM   4351  N  N   . HIS C  1 145 ? -38.637  79.675  18.717  1.00 19.40  ? 145 HIS C N   1 
ATOM   4352  C  CA  . HIS C  1 145 ? -39.496  78.770  19.462  1.00 14.79  ? 145 HIS C CA  1 
ATOM   4353  C  C   . HIS C  1 145 ? -38.801  78.044  20.599  1.00 14.52  ? 145 HIS C C   1 
ATOM   4354  O  O   . HIS C  1 145 ? -37.890  77.264  20.360  1.00 22.09  ? 145 HIS C O   1 
ATOM   4355  C  CB  . HIS C  1 145 ? -40.111  77.737  18.530  1.00 17.18  ? 145 HIS C CB  1 
ATOM   4356  C  CG  . HIS C  1 145 ? -41.080  78.309  17.545  1.00 25.00  ? 145 HIS C CG  1 
ATOM   4357  N  ND1 . HIS C  1 145 ? -42.341  78.739  17.902  1.00 33.32  ? 145 HIS C ND1 1 
ATOM   4358  C  CD2 . HIS C  1 145 ? -40.979  78.503  16.210  1.00 15.35  ? 145 HIS C CD2 1 
ATOM   4359  C  CE1 . HIS C  1 145 ? -42.971  79.183  16.827  1.00 34.29  ? 145 HIS C CE1 1 
ATOM   4360  N  NE2 . HIS C  1 145 ? -42.164  79.052  15.788  1.00 36.33  ? 145 HIS C NE2 1 
ATOM   4361  N  N   . HIS C  1 146 ? -39.268  78.265  21.834  1.00 15.37  ? 146 HIS C N   1 
ATOM   4362  C  CA  . HIS C  1 146 ? -38.679  77.618  23.014  1.00 17.45  ? 146 HIS C CA  1 
ATOM   4363  C  C   . HIS C  1 146 ? -39.067  76.139  23.169  1.00 14.69  ? 146 HIS C C   1 
ATOM   4364  O  O   . HIS C  1 146 ? -39.761  75.579  22.351  1.00 19.32  ? 146 HIS C O   1 
ATOM   4365  C  CB  . HIS C  1 146 ? -38.983  78.405  24.289  1.00 22.41  ? 146 HIS C CB  1 
ATOM   4366  C  CG  . HIS C  1 146 ? -40.441  78.634  24.526  1.00 34.26  ? 146 HIS C CG  1 
ATOM   4367  N  ND1 . HIS C  1 146 ? -41.302  77.621  24.890  1.00 34.06  ? 146 HIS C ND1 1 
ATOM   4368  C  CD2 . HIS C  1 146 ? -41.189  79.760  24.454  1.00 17.00  ? 146 HIS C CD2 1 
ATOM   4369  C  CE1 . HIS C  1 146 ? -42.520  78.112  25.026  1.00 33.07  ? 146 HIS C CE1 1 
ATOM   4370  N  NE2 . HIS C  1 146 ? -42.479  79.407  24.763  1.00 34.11  ? 146 HIS C NE2 1 
ATOM   4371  N  N   . SER C  1 147 ? -38.607  75.518  24.237  1.00 22.31  ? 147 SER C N   1 
ATOM   4372  C  CA  . SER C  1 147 ? -38.668  74.072  24.363  1.00 24.61  ? 147 SER C CA  1 
ATOM   4373  C  C   . SER C  1 147 ? -40.076  73.508  24.502  1.00 25.18  ? 147 SER C C   1 
ATOM   4374  O  O   . SER C  1 147 ? -40.299  72.321  24.281  1.00 31.32  ? 147 SER C O   1 
ATOM   4375  C  CB  . SER C  1 147 ? -37.826  73.627  25.558  1.00 21.69  ? 147 SER C CB  1 
ATOM   4376  O  OG  . SER C  1 147 ? -38.409  74.097  26.767  1.00 31.62  ? 147 SER C OG  1 
ATOM   4377  N  N   . ARG C  1 148 ? -41.025  74.332  24.912  1.00 21.14  ? 148 ARG C N   1 
ATOM   4378  C  CA  . ARG C  1 148 ? -42.405  73.849  24.974  1.00 20.04  ? 148 ARG C CA  1 
ATOM   4379  C  C   . ARG C  1 148 ? -43.136  73.967  23.618  1.00 16.05  ? 148 ARG C C   1 
ATOM   4380  O  O   . ARG C  1 148 ? -44.264  73.515  23.465  1.00 19.74  ? 148 ARG C O   1 
ATOM   4381  C  CB  . ARG C  1 148 ? -43.177  74.538  26.101  1.00 9.16   ? 148 ARG C CB  1 
ATOM   4382  C  CG  . ARG C  1 148 ? -42.586  74.242  27.474  1.00 23.58  ? 148 ARG C CG  1 
ATOM   4383  C  CD  . ARG C  1 148 ? -43.275  75.009  28.601  1.00 45.77  ? 148 ARG C CD  1 
ATOM   4384  N  NE  . ARG C  1 148 ? -43.359  76.443  28.346  1.00 40.29  ? 148 ARG C NE  1 
ATOM   4385  C  CZ  . ARG C  1 148 ? -44.446  77.038  27.872  1.00 29.32  ? 148 ARG C CZ  1 
ATOM   4386  N  NH1 . ARG C  1 148 ? -45.523  76.314  27.620  1.00 32.52  ? 148 ARG C NH1 1 
ATOM   4387  N  NH2 . ARG C  1 148 ? -44.468  78.345  27.665  1.00 5.99   ? 148 ARG C NH2 1 
ATOM   4388  N  N   . GLU C  1 149 ? -42.465  74.553  22.633  1.00 27.78  ? 149 GLU C N   1 
ATOM   4389  C  CA  . GLU C  1 149 ? -43.042  74.719  21.317  1.00 21.01  ? 149 GLU C CA  1 
ATOM   4390  C  C   . GLU C  1 149 ? -42.335  73.859  20.278  1.00 19.72  ? 149 GLU C C   1 
ATOM   4391  O  O   . GLU C  1 149 ? -42.978  73.173  19.479  1.00 13.69  ? 149 GLU C O   1 
ATOM   4392  C  CB  . GLU C  1 149 ? -43.041  76.201  20.917  1.00 20.95  ? 149 GLU C CB  1 
ATOM   4393  C  CG  . GLU C  1 149 ? -43.798  77.088  21.901  1.00 25.76  ? 149 GLU C CG  1 
ATOM   4394  C  CD  . GLU C  1 149 ? -43.925  78.529  21.451  1.00 27.03  ? 149 GLU C CD  1 
ATOM   4395  O  OE1 . GLU C  1 149 ? -43.030  79.000  20.727  1.00 22.89  ? 149 GLU C OE1 1 
ATOM   4396  O  OE2 . GLU C  1 149 ? -44.925  79.187  21.820  1.00 27.71  ? 149 GLU C OE2 1 
ATOM   4397  N  N   . ILE C  1 150 ? -41.009  73.910  20.281  1.00 27.37  ? 150 ILE C N   1 
ATOM   4398  C  CA  . ILE C  1 150 ? -40.198  73.068  19.397  1.00 22.16  ? 150 ILE C CA  1 
ATOM   4399  C  C   . ILE C  1 150 ? -39.105  72.341  20.162  1.00 17.55  ? 150 ILE C C   1 
ATOM   4400  O  O   . ILE C  1 150 ? -38.388  72.933  20.963  1.00 28.53  ? 150 ILE C O   1 
ATOM   4401  C  CB  . ILE C  1 150 ? -39.545  73.869  18.251  1.00 23.47  ? 150 ILE C CB  1 
ATOM   4402  C  CG1 . ILE C  1 150 ? -40.590  74.239  17.196  1.00 21.14  ? 150 ILE C CG1 1 
ATOM   4403  C  CG2 . ILE C  1 150 ? -38.443  73.060  17.598  1.00 15.50  ? 150 ILE C CG2 1 
ATOM   4404  C  CD1 . ILE C  1 150 ? -40.020  74.941  16.019  1.00 15.89  ? 150 ILE C CD1 1 
ATOM   4405  N  N   . SER C  1 151 ? -38.996  71.045  19.916  1.00 18.81  ? 151 SER C N   1 
ATOM   4406  C  CA  . SER C  1 151 ? -37.887  70.264  20.428  1.00 30.18  ? 151 SER C CA  1 
ATOM   4407  C  C   . SER C  1 151 ? -37.104  69.704  19.243  1.00 38.89  ? 151 SER C C   1 
ATOM   4408  O  O   . SER C  1 151 ? -37.696  69.281  18.230  1.00 27.00  ? 151 SER C O   1 
ATOM   4409  C  CB  . SER C  1 151 ? -38.393  69.130  21.312  1.00 19.18  ? 151 SER C CB  1 
ATOM   4410  O  OG  . SER C  1 151 ? -38.884  68.051  20.541  1.00 30.81  ? 151 SER C OG  1 
ATOM   4411  N  N   . VAL C  1 152 ? -35.775  69.720  19.350  1.00 26.54  ? 152 VAL C N   1 
ATOM   4412  C  CA  . VAL C  1 152 ? -34.940  69.196  18.277  1.00 24.92  ? 152 VAL C CA  1 
ATOM   4413  C  C   . VAL C  1 152 ? -34.225  67.959  18.756  1.00 23.73  ? 152 VAL C C   1 
ATOM   4414  O  O   . VAL C  1 152 ? -33.786  67.901  19.894  1.00 29.08  ? 152 VAL C O   1 
ATOM   4415  C  CB  . VAL C  1 152 ? -33.887  70.211  17.812  1.00 23.95  ? 152 VAL C CB  1 
ATOM   4416  C  CG1 . VAL C  1 152 ? -34.532  71.317  16.983  1.00 20.39  ? 152 VAL C CG1 1 
ATOM   4417  C  CG2 . VAL C  1 152 ? -33.143  70.774  19.005  1.00 24.92  ? 152 VAL C CG2 1 
ATOM   4418  N  N   . ASP C  1 153 ? -34.112  66.964  17.881  1.00 34.85  ? 153 ASP C N   1 
ATOM   4419  C  CA  . ASP C  1 153 ? -33.418  65.732  18.209  1.00 28.18  ? 153 ASP C CA  1 
ATOM   4420  C  C   . ASP C  1 153 ? -32.676  65.202  17.002  1.00 30.83  ? 153 ASP C C   1 
ATOM   4421  O  O   . ASP C  1 153 ? -33.112  65.394  15.880  1.00 51.56  ? 153 ASP C O   1 
ATOM   4422  C  CB  . ASP C  1 153 ? -34.390  64.680  18.748  1.00 26.83  ? 153 ASP C CB  1 
ATOM   4423  C  CG  . ASP C  1 153 ? -34.677  64.861  20.224  1.00 51.53  ? 153 ASP C CG  1 
ATOM   4424  O  OD1 . ASP C  1 153 ? -35.623  65.597  20.563  1.00 57.70  ? 153 ASP C OD1 1 
ATOM   4425  O  OD2 . ASP C  1 153 ? -33.951  64.278  21.053  1.00 62.66  ? 153 ASP C OD2 1 
ATOM   4426  N  N   . PRO C  1 154 ? -31.541  64.538  17.231  1.00 31.01  ? 154 PRO C N   1 
ATOM   4427  C  CA  . PRO C  1 154 ? -30.770  63.878  16.170  1.00 41.43  ? 154 PRO C CA  1 
ATOM   4428  C  C   . PRO C  1 154 ? -31.487  62.639  15.688  1.00 39.22  ? 154 PRO C C   1 
ATOM   4429  O  O   . PRO C  1 154 ? -32.534  62.302  16.210  1.00 35.31  ? 154 PRO C O   1 
ATOM   4430  C  CB  . PRO C  1 154 ? -29.483  63.442  16.887  1.00 34.97  ? 154 PRO C CB  1 
ATOM   4431  C  CG  . PRO C  1 154 ? -29.437  64.257  18.132  1.00 45.70  ? 154 PRO C CG  1 
ATOM   4432  C  CD  . PRO C  1 154 ? -30.859  64.477  18.527  1.00 30.26  ? 154 PRO C CD  1 
ATOM   4433  N  N   . THR C  1 155 ? -30.883  61.915  14.760  1.00 34.10  ? 155 THR C N   1 
ATOM   4434  C  CA  . THR C  1 155 ? -31.499  60.693  14.259  1.00 39.04  ? 155 THR C CA  1 
ATOM   4435  C  C   . THR C  1 155 ? -30.876  59.407  14.809  1.00 35.24  ? 155 THR C C   1 
ATOM   4436  O  O   . THR C  1 155 ? -31.518  58.346  14.819  1.00 46.98  ? 155 THR C O   1 
ATOM   4437  C  CB  . THR C  1 155 ? -31.456  60.663  12.739  1.00 45.76  ? 155 THR C CB  1 
ATOM   4438  O  OG1 . THR C  1 155 ? -32.150  61.813  12.234  1.00 35.82  ? 155 THR C OG1 1 
ATOM   4439  C  CG2 . THR C  1 155 ? -32.102  59.389  12.222  1.00 54.49  ? 155 THR C CG2 1 
ATOM   4440  N  N   . ASP C  1 161 ? -20.407  58.386  8.273   1.00 24.44  ? 161 ASP C N   1 
ATOM   4441  C  CA  . ASP C  1 161 ? -20.460  59.839  8.152   1.00 51.41  ? 161 ASP C CA  1 
ATOM   4442  C  C   . ASP C  1 161 ? -20.167  60.222  6.719   1.00 42.08  ? 161 ASP C C   1 
ATOM   4443  O  O   . ASP C  1 161 ? -20.793  61.101  6.127   1.00 44.11  ? 161 ASP C O   1 
ATOM   4444  C  CB  . ASP C  1 161 ? -19.409  60.510  9.046   1.00 54.54  ? 161 ASP C CB  1 
ATOM   4445  C  CG  . ASP C  1 161 ? -18.903  59.601  10.163  1.00 60.94  ? 161 ASP C CG  1 
ATOM   4446  O  OD1 . ASP C  1 161 ? -19.511  59.595  11.259  1.00 49.50  ? 161 ASP C OD1 1 
ATOM   4447  O  OD2 . ASP C  1 161 ? -17.874  58.914  9.956   1.00 51.98  ? 161 ASP C OD2 1 
ATOM   4448  N  N   . SER C  1 162 ? -19.189  59.534  6.165   1.00 56.98  ? 162 SER C N   1 
ATOM   4449  C  CA  . SER C  1 162 ? -18.646  59.906  4.878   1.00 73.68  ? 162 SER C CA  1 
ATOM   4450  C  C   . SER C  1 162 ? -19.460  59.288  3.759   1.00 65.22  ? 162 SER C C   1 
ATOM   4451  O  O   . SER C  1 162 ? -19.039  59.296  2.600   1.00 67.74  ? 162 SER C O   1 
ATOM   4452  C  CB  . SER C  1 162 ? -17.184  59.450  4.770   1.00 71.49  ? 162 SER C CB  1 
ATOM   4453  O  OG  . SER C  1 162 ? -16.378  60.035  5.781   1.00 74.84  ? 162 SER C OG  1 
ATOM   4454  N  N   . GLU C  1 163 ? -20.622  58.744  4.095   1.00 42.64  ? 163 GLU C N   1 
ATOM   4455  C  CA  . GLU C  1 163 ? -21.363  58.001  3.094   1.00 51.09  ? 163 GLU C CA  1 
ATOM   4456  C  C   . GLU C  1 163 ? -21.571  58.812  1.810   1.00 51.18  ? 163 GLU C C   1 
ATOM   4457  O  O   . GLU C  1 163 ? -21.434  58.278  0.713   1.00 51.90  ? 163 GLU C O   1 
ATOM   4458  C  CB  . GLU C  1 163 ? -22.691  57.501  3.645   1.00 60.90  ? 163 GLU C CB  1 
ATOM   4459  C  CG  . GLU C  1 163 ? -23.404  56.552  2.692   1.00 77.26  ? 163 GLU C CG  1 
ATOM   4460  C  CD  . GLU C  1 163 ? -24.876  56.385  3.025   1.00 89.64  ? 163 GLU C CD  1 
ATOM   4461  O  OE1 . GLU C  1 163 ? -25.290  56.823  4.125   1.00 92.80  ? 163 GLU C OE1 1 
ATOM   4462  O  OE2 . GLU C  1 163 ? -25.620  55.827  2.183   1.00 87.95  ? 163 GLU C OE2 1 
ATOM   4463  N  N   . TYR C  1 164 ? -21.889  60.096  1.948   1.00 39.09  ? 164 TYR C N   1 
ATOM   4464  C  CA  . TYR C  1 164 ? -22.123  60.945  0.784   1.00 33.25  ? 164 TYR C CA  1 
ATOM   4465  C  C   . TYR C  1 164 ? -21.008  61.968  0.581   1.00 37.65  ? 164 TYR C C   1 
ATOM   4466  O  O   . TYR C  1 164 ? -21.182  62.953  -0.144  1.00 36.61  ? 164 TYR C O   1 
ATOM   4467  C  CB  . TYR C  1 164 ? -23.452  61.686  0.907   1.00 44.31  ? 164 TYR C CB  1 
ATOM   4468  C  CG  . TYR C  1 164 ? -24.653  60.808  1.188   1.00 56.93  ? 164 TYR C CG  1 
ATOM   4469  C  CD1 . TYR C  1 164 ? -24.955  59.709  0.380   1.00 56.55  ? 164 TYR C CD1 1 
ATOM   4470  C  CD2 . TYR C  1 164 ? -25.494  61.085  2.262   1.00 55.82  ? 164 TYR C CD2 1 
ATOM   4471  C  CE1 . TYR C  1 164 ? -26.063  58.912  0.641   1.00 53.54  ? 164 TYR C CE1 1 
ATOM   4472  C  CE2 . TYR C  1 164 ? -26.595  60.297  2.529   1.00 56.89  ? 164 TYR C CE2 1 
ATOM   4473  C  CZ  . TYR C  1 164 ? -26.873  59.216  1.715   1.00 59.29  ? 164 TYR C CZ  1 
ATOM   4474  O  OH  . TYR C  1 164 ? -27.964  58.434  1.982   1.00 61.16  ? 164 TYR C OH  1 
ATOM   4475  N  N   . PHE C  1 165 ? -19.868  61.743  1.221   1.00 28.85  ? 165 PHE C N   1 
ATOM   4476  C  CA  . PHE C  1 165 ? -18.802  62.742  1.217   1.00 28.54  ? 165 PHE C CA  1 
ATOM   4477  C  C   . PHE C  1 165 ? -17.934  62.670  -0.047  1.00 27.17  ? 165 PHE C C   1 
ATOM   4478  O  O   . PHE C  1 165 ? -17.538  61.599  -0.485  1.00 23.20  ? 165 PHE C O   1 
ATOM   4479  C  CB  . PHE C  1 165 ? -17.952  62.622  2.492   1.00 22.01  ? 165 PHE C CB  1 
ATOM   4480  C  CG  . PHE C  1 165 ? -17.073  63.812  2.744   1.00 33.60  ? 165 PHE C CG  1 
ATOM   4481  C  CD1 . PHE C  1 165 ? -17.621  64.999  3.208   1.00 31.47  ? 165 PHE C CD1 1 
ATOM   4482  C  CD2 . PHE C  1 165 ? -15.701  63.758  2.498   1.00 23.29  ? 165 PHE C CD2 1 
ATOM   4483  C  CE1 . PHE C  1 165 ? -16.812  66.112  3.438   1.00 30.83  ? 165 PHE C CE1 1 
ATOM   4484  C  CE2 . PHE C  1 165 ? -14.887  64.873  2.725   1.00 21.65  ? 165 PHE C CE2 1 
ATOM   4485  C  CZ  . PHE C  1 165 ? -15.436  66.047  3.194   1.00 20.62  ? 165 PHE C CZ  1 
ATOM   4486  N  N   . SER C  1 166 ? -17.636  63.824  -0.620  1.00 23.57  ? 166 SER C N   1 
ATOM   4487  C  CA  . SER C  1 166 ? -16.907  63.878  -1.869  1.00 24.41  ? 166 SER C CA  1 
ATOM   4488  C  C   . SER C  1 166 ? -15.483  63.327  -1.757  1.00 34.69  ? 166 SER C C   1 
ATOM   4489  O  O   . SER C  1 166 ? -14.686  63.780  -0.941  1.00 31.80  ? 166 SER C O   1 
ATOM   4490  C  CB  . SER C  1 166 ? -16.856  65.311  -2.379  1.00 25.03  ? 166 SER C CB  1 
ATOM   4491  O  OG  . SER C  1 166 ? -16.211  65.372  -3.639  1.00 40.52  ? 166 SER C OG  1 
ATOM   4492  N  N   . GLN C  1 167 ? -15.165  62.361  -2.608  1.00 25.93  ? 167 GLN C N   1 
ATOM   4493  C  CA  . GLN C  1 167 ? -13.834  61.791  -2.655  1.00 24.25  ? 167 GLN C CA  1 
ATOM   4494  C  C   . GLN C  1 167 ? -12.828  62.806  -3.192  1.00 33.15  ? 167 GLN C C   1 
ATOM   4495  O  O   . GLN C  1 167 ? -11.622  62.621  -3.078  1.00 23.52  ? 167 GLN C O   1 
ATOM   4496  C  CB  . GLN C  1 167 ? -13.832  60.539  -3.525  1.00 24.47  ? 167 GLN C CB  1 
ATOM   4497  C  CG  . GLN C  1 167 ? -14.163  60.816  -4.973  1.00 41.96  ? 167 GLN C CG  1 
ATOM   4498  C  CD  . GLN C  1 167 ? -14.301  59.553  -5.808  1.00 47.60  ? 167 GLN C CD  1 
ATOM   4499  O  OE1 . GLN C  1 167 ? -15.369  59.265  -6.345  1.00 59.19  ? 167 GLN C OE1 1 
ATOM   4500  N  NE2 . GLN C  1 167 ? -13.221  58.804  -5.931  1.00 50.60  ? 167 GLN C NE2 1 
ATOM   4501  N  N   . TYR C  1 168 ? -13.325  63.896  -3.758  1.00 28.79  ? 168 TYR C N   1 
ATOM   4502  C  CA  . TYR C  1 168 ? -12.442  64.866  -4.386  1.00 25.53  ? 168 TYR C CA  1 
ATOM   4503  C  C   . TYR C  1 168 ? -12.175  66.082  -3.522  1.00 24.58  ? 168 TYR C C   1 
ATOM   4504  O  O   . TYR C  1 168 ? -11.443  66.978  -3.924  1.00 32.71  ? 168 TYR C O   1 
ATOM   4505  C  CB  . TYR C  1 168 ? -12.978  65.276  -5.759  1.00 27.42  ? 168 TYR C CB  1 
ATOM   4506  C  CG  . TYR C  1 168 ? -13.219  64.085  -6.655  1.00 39.95  ? 168 TYR C CG  1 
ATOM   4507  C  CD1 . TYR C  1 168 ? -12.158  63.274  -7.077  1.00 30.12  ? 168 TYR C CD1 1 
ATOM   4508  C  CD2 . TYR C  1 168 ? -14.504  63.757  -7.072  1.00 28.36  ? 168 TYR C CD2 1 
ATOM   4509  C  CE1 . TYR C  1 168 ? -12.383  62.173  -7.887  1.00 28.22  ? 168 TYR C CE1 1 
ATOM   4510  C  CE2 . TYR C  1 168 ? -14.737  62.662  -7.889  1.00 29.11  ? 168 TYR C CE2 1 
ATOM   4511  C  CZ  . TYR C  1 168 ? -13.676  61.875  -8.286  1.00 34.91  ? 168 TYR C CZ  1 
ATOM   4512  O  OH  . TYR C  1 168 ? -13.917  60.791  -9.091  1.00 44.36  ? 168 TYR C OH  1 
ATOM   4513  N  N   . SER C  1 169 ? -12.754  66.114  -2.329  1.00 33.20  ? 169 SER C N   1 
ATOM   4514  C  CA  . SER C  1 169 ? -12.390  67.144  -1.355  1.00 26.46  ? 169 SER C CA  1 
ATOM   4515  C  C   . SER C  1 169 ? -10.912  67.041  -0.967  1.00 28.94  ? 169 SER C C   1 
ATOM   4516  O  O   . SER C  1 169 ? -10.326  65.957  -0.968  1.00 21.72  ? 169 SER C O   1 
ATOM   4517  C  CB  . SER C  1 169 ? -13.243  67.017  -0.102  1.00 30.90  ? 169 SER C CB  1 
ATOM   4518  O  OG  . SER C  1 169 ? -12.875  67.974  0.876   1.00 31.73  ? 169 SER C OG  1 
ATOM   4519  N  N   . ARG C  1 170 ? -10.314  68.175  -0.631  1.00 26.59  ? 170 ARG C N   1 
ATOM   4520  C  CA  . ARG C  1 170 ? -8.976   68.156  -0.060  1.00 30.22  ? 170 ARG C CA  1 
ATOM   4521  C  C   . ARG C  1 170 ? -8.971   67.552  1.335   1.00 35.36  ? 170 ARG C C   1 
ATOM   4522  O  O   . ARG C  1 170 ? -7.911   67.257  1.873   1.00 40.37  ? 170 ARG C O   1 
ATOM   4523  C  CB  . ARG C  1 170 ? -8.383   69.565  -0.005  1.00 29.03  ? 170 ARG C CB  1 
ATOM   4524  C  CG  . ARG C  1 170 ? -7.670   69.986  -1.290  1.00 33.28  ? 170 ARG C CG  1 
ATOM   4525  C  CD  . ARG C  1 170 ? -7.126   71.383  -1.141  1.00 48.80  ? 170 ARG C CD  1 
ATOM   4526  N  NE  . ARG C  1 170 ? -8.184   72.304  -0.749  1.00 80.45  ? 170 ARG C NE  1 
ATOM   4527  C  CZ  . ARG C  1 170 ? -7.989   73.448  -0.106  1.00 82.87  ? 170 ARG C CZ  1 
ATOM   4528  N  NH1 . ARG C  1 170 ? -6.757   73.818  0.236   1.00 78.37  ? 170 ARG C NH1 1 
ATOM   4529  N  NH2 . ARG C  1 170 ? -9.033   74.214  0.196   1.00 60.98  ? 170 ARG C NH2 1 
ATOM   4530  N  N   . PHE C  1 171 ? -10.156  67.373  1.919   1.00 25.44  ? 171 PHE C N   1 
ATOM   4531  C  CA  . PHE C  1 171 ? -10.255  66.879  3.279   1.00 18.23  ? 171 PHE C CA  1 
ATOM   4532  C  C   . PHE C  1 171 ? -10.931  65.525  3.368   1.00 20.19  ? 171 PHE C C   1 
ATOM   4533  O  O   . PHE C  1 171 ? -11.445  65.003  2.381   1.00 27.68  ? 171 PHE C O   1 
ATOM   4534  C  CB  . PHE C  1 171 ? -10.964  67.906  4.141   1.00 17.90  ? 171 PHE C CB  1 
ATOM   4535  C  CG  . PHE C  1 171 ? -10.399  69.284  3.999   1.00 27.75  ? 171 PHE C CG  1 
ATOM   4536  C  CD1 . PHE C  1 171 ? -10.735  70.074  2.915   1.00 30.66  ? 171 PHE C CD1 1 
ATOM   4537  C  CD2 . PHE C  1 171 ? -9.513   69.788  4.939   1.00 35.23  ? 171 PHE C CD2 1 
ATOM   4538  C  CE1 . PHE C  1 171 ? -10.204  71.354  2.768   1.00 35.54  ? 171 PHE C CE1 1 
ATOM   4539  C  CE2 . PHE C  1 171 ? -8.979   71.062  4.801   1.00 36.37  ? 171 PHE C CE2 1 
ATOM   4540  C  CZ  . PHE C  1 171 ? -9.324   71.847  3.709   1.00 30.55  ? 171 PHE C CZ  1 
ATOM   4541  N  N   . GLU C  1 172 ? -10.905  64.954  4.563   1.00 18.95  ? 172 GLU C N   1 
ATOM   4542  C  CA  . GLU C  1 172 ? -11.581  63.695  4.822   1.00 27.22  ? 172 GLU C CA  1 
ATOM   4543  C  C   . GLU C  1 172 ? -12.225  63.750  6.206   1.00 36.30  ? 172 GLU C C   1 
ATOM   4544  O  O   . GLU C  1 172 ? -11.756  64.456  7.102   1.00 34.51  ? 172 GLU C O   1 
ATOM   4545  C  CB  . GLU C  1 172 ? -10.608  62.515  4.712   1.00 18.07  ? 172 GLU C CB  1 
ATOM   4546  C  CG  . GLU C  1 172 ? -9.404   62.618  5.642   1.00 45.40  ? 172 GLU C CG  1 
ATOM   4547  C  CD  . GLU C  1 172 ? -8.404   61.485  5.449   1.00 51.91  ? 172 GLU C CD  1 
ATOM   4548  O  OE1 . GLU C  1 172 ? -8.717   60.533  4.699   1.00 51.71  ? 172 GLU C OE1 1 
ATOM   4549  O  OE2 . GLU C  1 172 ? -7.306   61.553  6.047   1.00 43.70  ? 172 GLU C OE2 1 
ATOM   4550  N  N   . ILE C  1 173 ? -13.316  63.019  6.371   1.00 22.51  ? 173 ILE C N   1 
ATOM   4551  C  CA  . ILE C  1 173 ? -14.013  63.016  7.635   1.00 21.59  ? 173 ILE C CA  1 
ATOM   4552  C  C   . ILE C  1 173 ? -13.546  61.871  8.513   1.00 26.34  ? 173 ILE C C   1 
ATOM   4553  O  O   . ILE C  1 173 ? -13.573  60.718  8.096   1.00 22.34  ? 173 ILE C O   1 
ATOM   4554  C  CB  . ILE C  1 173 ? -15.526  62.917  7.421   1.00 27.98  ? 173 ILE C CB  1 
ATOM   4555  C  CG1 . ILE C  1 173 ? -16.030  64.178  6.722   1.00 33.10  ? 173 ILE C CG1 1 
ATOM   4556  C  CG2 . ILE C  1 173 ? -16.250  62.726  8.743   1.00 20.57  ? 173 ILE C CG2 1 
ATOM   4557  C  CD1 . ILE C  1 173 ? -17.530  64.154  6.441   1.00 39.27  ? 173 ILE C CD1 1 
ATOM   4558  N  N   . LEU C  1 174 ? -13.131  62.194  9.734   1.00 25.45  ? 174 LEU C N   1 
ATOM   4559  C  CA  . LEU C  1 174 ? -12.696  61.165  10.665  1.00 30.85  ? 174 LEU C CA  1 
ATOM   4560  C  C   . LEU C  1 174 ? -13.877  60.658  11.480  1.00 33.64  ? 174 LEU C C   1 
ATOM   4561  O  O   . LEU C  1 174 ? -14.042  59.452  11.679  1.00 36.49  ? 174 LEU C O   1 
ATOM   4562  C  CB  . LEU C  1 174 ? -11.571  61.677  11.569  1.00 27.15  ? 174 LEU C CB  1 
ATOM   4563  C  CG  . LEU C  1 174 ? -10.388  62.300  10.824  1.00 33.06  ? 174 LEU C CG  1 
ATOM   4564  C  CD1 . LEU C  1 174 ? -9.398   62.917  11.795  1.00 30.90  ? 174 LEU C CD1 1 
ATOM   4565  C  CD2 . LEU C  1 174 ? -9.714   61.282  9.912   1.00 17.01  ? 174 LEU C CD2 1 
ATOM   4566  N  N   . ASP C  1 175 ? -14.711  61.582  11.937  1.00 26.24  ? 175 ASP C N   1 
ATOM   4567  C  CA  . ASP C  1 175 ? -15.862  61.200  12.738  1.00 25.73  ? 175 ASP C CA  1 
ATOM   4568  C  C   . ASP C  1 175 ? -16.911  62.300  12.752  1.00 20.60  ? 175 ASP C C   1 
ATOM   4569  O  O   . ASP C  1 175 ? -16.608  63.462  12.534  1.00 32.60  ? 175 ASP C O   1 
ATOM   4570  C  CB  . ASP C  1 175 ? -15.416  60.864  14.165  1.00 28.22  ? 175 ASP C CB  1 
ATOM   4571  C  CG  . ASP C  1 175 ? -16.433  60.013  14.914  1.00 52.27  ? 175 ASP C CG  1 
ATOM   4572  O  OD1 . ASP C  1 175 ? -17.266  59.342  14.255  1.00 55.42  ? 175 ASP C OD1 1 
ATOM   4573  O  OD2 . ASP C  1 175 ? -16.392  60.009  16.167  1.00 57.12  ? 175 ASP C OD2 1 
ATOM   4574  N  N   . VAL C  1 176 ? -18.156  61.921  12.992  1.00 22.70  ? 176 VAL C N   1 
ATOM   4575  C  CA  . VAL C  1 176 ? -19.203  62.894  13.237  1.00 18.06  ? 176 VAL C CA  1 
ATOM   4576  C  C   . VAL C  1 176 ? -19.978  62.434  14.462  1.00 31.28  ? 176 VAL C C   1 
ATOM   4577  O  O   . VAL C  1 176 ? -20.459  61.305  14.505  1.00 39.20  ? 176 VAL C O   1 
ATOM   4578  C  CB  . VAL C  1 176 ? -20.169  63.010  12.044  1.00 15.51  ? 176 VAL C CB  1 
ATOM   4579  C  CG1 . VAL C  1 176 ? -21.202  64.054  12.310  1.00 25.04  ? 176 VAL C CG1 1 
ATOM   4580  C  CG2 . VAL C  1 176 ? -19.436  63.352  10.780  1.00 22.16  ? 176 VAL C CG2 1 
ATOM   4581  N  N   . THR C  1 177 ? -20.081  63.294  15.466  1.00 23.30  ? 177 THR C N   1 
ATOM   4582  C  CA  . THR C  1 177 ? -20.905  62.986  16.627  1.00 40.12  ? 177 THR C CA  1 
ATOM   4583  C  C   . THR C  1 177 ? -21.985  64.048  16.812  1.00 39.93  ? 177 THR C C   1 
ATOM   4584  O  O   . THR C  1 177 ? -21.805  65.201  16.439  1.00 40.99  ? 177 THR C O   1 
ATOM   4585  C  CB  . THR C  1 177 ? -20.071  62.843  17.924  1.00 37.55  ? 177 THR C CB  1 
ATOM   4586  O  OG1 . THR C  1 177 ? -19.378  64.065  18.190  1.00 35.89  ? 177 THR C OG1 1 
ATOM   4587  C  CG2 . THR C  1 177 ? -19.070  61.719  17.791  1.00 21.70  ? 177 THR C CG2 1 
ATOM   4588  N  N   . GLN C  1 178 ? -23.110  63.643  17.382  1.00 33.21  ? 178 GLN C N   1 
ATOM   4589  C  CA  . GLN C  1 178 ? -24.224  64.547  17.581  1.00 38.21  ? 178 GLN C CA  1 
ATOM   4590  C  C   . GLN C  1 178 ? -24.608  64.616  19.065  1.00 41.47  ? 178 GLN C C   1 
ATOM   4591  O  O   . GLN C  1 178 ? -24.789  63.592  19.710  1.00 46.89  ? 178 GLN C O   1 
ATOM   4592  C  CB  . GLN C  1 178 ? -25.409  64.096  16.723  1.00 28.52  ? 178 GLN C CB  1 
ATOM   4593  C  CG  . GLN C  1 178 ? -25.031  63.792  15.272  1.00 49.46  ? 178 GLN C CG  1 
ATOM   4594  C  CD  . GLN C  1 178 ? -26.081  64.263  14.260  1.00 78.96  ? 178 GLN C CD  1 
ATOM   4595  O  OE1 . GLN C  1 178 ? -27.285  64.296  14.551  1.00 73.92  ? 178 GLN C OE1 1 
ATOM   4596  N  NE2 . GLN C  1 178 ? -25.623  64.636  13.062  1.00 70.59  ? 178 GLN C NE2 1 
ATOM   4597  N  N   . LYS C  1 179 ? -24.711  65.826  19.603  1.00 47.73  ? 179 LYS C N   1 
ATOM   4598  C  CA  . LYS C  1 179 ? -25.122  66.024  20.993  1.00 43.72  ? 179 LYS C CA  1 
ATOM   4599  C  C   . LYS C  1 179 ? -26.305  66.994  21.077  1.00 35.86  ? 179 LYS C C   1 
ATOM   4600  O  O   . LYS C  1 179 ? -26.316  68.017  20.397  1.00 56.84  ? 179 LYS C O   1 
ATOM   4601  C  CB  . LYS C  1 179 ? -23.950  66.550  21.829  1.00 36.61  ? 179 LYS C CB  1 
ATOM   4602  C  CG  . LYS C  1 179 ? -24.286  66.707  23.295  1.00 54.91  ? 179 LYS C CG  1 
ATOM   4603  C  CD  . LYS C  1 179 ? -23.203  67.459  24.050  1.00 60.77  ? 179 LYS C CD  1 
ATOM   4604  C  CE  . LYS C  1 179 ? -23.580  67.627  25.524  1.00 63.90  ? 179 LYS C CE  1 
ATOM   4605  N  NZ  . LYS C  1 179 ? -22.573  68.406  26.290  1.00 60.67  ? 179 LYS C NZ  1 
ATOM   4606  N  N   . LYS C  1 180 ? -27.292  66.671  21.911  1.00 30.80  ? 180 LYS C N   1 
ATOM   4607  C  CA  . LYS C  1 180 ? -28.500  67.499  22.049  1.00 32.83  ? 180 LYS C CA  1 
ATOM   4608  C  C   . LYS C  1 180 ? -28.504  68.319  23.345  1.00 27.82  ? 180 LYS C C   1 
ATOM   4609  O  O   . LYS C  1 180 ? -28.123  67.814  24.396  1.00 33.26  ? 180 LYS C O   1 
ATOM   4610  C  CB  . LYS C  1 180 ? -29.753  66.620  21.956  1.00 24.09  ? 180 LYS C CB  1 
ATOM   4611  C  CG  . LYS C  1 180 ? -31.038  67.282  22.420  1.00 47.29  ? 180 LYS C CG  1 
ATOM   4612  C  CD  . LYS C  1 180 ? -32.128  66.231  22.576  1.00 61.67  ? 180 LYS C CD  1 
ATOM   4613  C  CE  . LYS C  1 180 ? -33.362  66.785  23.271  1.00 56.16  ? 180 LYS C CE  1 
ATOM   4614  N  NZ  . LYS C  1 180 ? -34.020  67.820  22.453  1.00 45.64  ? 180 LYS C NZ  1 
ATOM   4615  N  N   . ASN C  1 181 ? -28.917  69.585  23.264  1.00 26.39  ? 181 ASN C N   1 
ATOM   4616  C  CA  . ASN C  1 181 ? -28.903  70.467  24.433  1.00 21.40  ? 181 ASN C CA  1 
ATOM   4617  C  C   . ASN C  1 181 ? -30.165  71.281  24.599  1.00 26.49  ? 181 ASN C C   1 
ATOM   4618  O  O   . ASN C  1 181 ? -30.897  71.494  23.656  1.00 29.73  ? 181 ASN C O   1 
ATOM   4619  C  CB  . ASN C  1 181 ? -27.730  71.450  24.379  1.00 28.14  ? 181 ASN C CB  1 
ATOM   4620  C  CG  . ASN C  1 181 ? -26.415  70.769  24.202  1.00 23.71  ? 181 ASN C CG  1 
ATOM   4621  O  OD1 . ASN C  1 181 ? -25.868  70.194  25.139  1.00 35.76  ? 181 ASN C OD1 1 
ATOM   4622  N  ND2 . ASN C  1 181 ? -25.884  70.831  22.989  1.00 33.64  ? 181 ASN C ND2 1 
ATOM   4623  N  N   . SER C  1 182 ? -30.387  71.748  25.821  1.00 37.01  ? 182 SER C N   1 
ATOM   4624  C  CA  . SER C  1 182 ? -31.483  72.654  26.141  1.00 24.58  ? 182 SER C CA  1 
ATOM   4625  C  C   . SER C  1 182 ? -30.887  73.832  26.896  1.00 24.10  ? 182 SER C C   1 
ATOM   4626  O  O   . SER C  1 182 ? -30.352  73.672  27.979  1.00 35.39  ? 182 SER C O   1 
ATOM   4627  C  CB  . SER C  1 182 ? -32.530  71.948  27.005  1.00 20.91  ? 182 SER C CB  1 
ATOM   4628  O  OG  . SER C  1 182 ? -33.771  72.643  26.998  1.00 38.66  ? 182 SER C OG  1 
ATOM   4629  N  N   . VAL C  1 183 ? -30.967  75.016  26.312  1.00 28.08  ? 183 VAL C N   1 
ATOM   4630  C  CA  . VAL C  1 183 ? -30.235  76.163  26.830  1.00 30.26  ? 183 VAL C CA  1 
ATOM   4631  C  C   . VAL C  1 183 ? -31.169  77.312  27.163  1.00 27.79  ? 183 VAL C C   1 
ATOM   4632  O  O   . VAL C  1 183 ? -32.074  77.615  26.394  1.00 30.93  ? 183 VAL C O   1 
ATOM   4633  C  CB  . VAL C  1 183 ? -29.207  76.671  25.785  1.00 37.04  ? 183 VAL C CB  1 
ATOM   4634  C  CG1 . VAL C  1 183 ? -28.486  77.901  26.287  1.00 17.20  ? 183 VAL C CG1 1 
ATOM   4635  C  CG2 . VAL C  1 183 ? -28.225  75.594  25.436  1.00 18.17  ? 183 VAL C CG2 1 
ATOM   4636  N  N   . THR C  1 184 ? -30.940  77.957  28.299  1.00 29.89  ? 184 THR C N   1 
ATOM   4637  C  CA  . THR C  1 184 ? -31.680  79.158  28.640  1.00 36.45  ? 184 THR C CA  1 
ATOM   4638  C  C   . THR C  1 184 ? -30.811  80.360  28.338  1.00 37.74  ? 184 THR C C   1 
ATOM   4639  O  O   . THR C  1 184 ? -29.715  80.487  28.857  1.00 47.12  ? 184 THR C O   1 
ATOM   4640  C  CB  . THR C  1 184 ? -32.107  79.158  30.113  1.00 33.36  ? 184 THR C CB  1 
ATOM   4641  O  OG1 . THR C  1 184 ? -32.800  77.937  30.407  1.00 26.08  ? 184 THR C OG1 1 
ATOM   4642  C  CG2 . THR C  1 184 ? -33.017  80.344  30.411  1.00 17.18  ? 184 THR C CG2 1 
ATOM   4643  N  N   . TYR C  1 185 ? -31.279  81.225  27.461  1.00 46.27  ? 185 TYR C N   1 
ATOM   4644  C  CA  . TYR C  1 185 ? -30.503  82.399  27.113  1.00 40.23  ? 185 TYR C CA  1 
ATOM   4645  C  C   . TYR C  1 185 ? -30.923  83.569  27.991  1.00 44.72  ? 185 TYR C C   1 
ATOM   4646  O  O   . TYR C  1 185 ? -32.059  83.629  28.442  1.00 55.18  ? 185 TYR C O   1 
ATOM   4647  C  CB  . TYR C  1 185 ? -30.701  82.713  25.633  1.00 39.52  ? 185 TYR C CB  1 
ATOM   4648  C  CG  . TYR C  1 185 ? -30.219  81.596  24.743  1.00 37.90  ? 185 TYR C CG  1 
ATOM   4649  C  CD1 . TYR C  1 185 ? -30.977  80.461  24.559  1.00 36.22  ? 185 TYR C CD1 1 
ATOM   4650  C  CD2 . TYR C  1 185 ? -28.987  81.668  24.098  1.00 41.13  ? 185 TYR C CD2 1 
ATOM   4651  C  CE1 . TYR C  1 185 ? -30.527  79.429  23.755  1.00 40.03  ? 185 TYR C CE1 1 
ATOM   4652  C  CE2 . TYR C  1 185 ? -28.538  80.640  23.290  1.00 35.70  ? 185 TYR C CE2 1 
ATOM   4653  C  CZ  . TYR C  1 185 ? -29.308  79.524  23.129  1.00 33.08  ? 185 TYR C CZ  1 
ATOM   4654  O  OH  . TYR C  1 185 ? -28.866  78.490  22.341  1.00 38.90  ? 185 TYR C OH  1 
ATOM   4655  N  N   . SER C  1 186 ? -29.999  84.491  28.236  1.00 53.88  ? 186 SER C N   1 
ATOM   4656  C  CA  . SER C  1 186 ? -30.239  85.624  29.135  1.00 57.22  ? 186 SER C CA  1 
ATOM   4657  C  C   . SER C  1 186 ? -31.473  86.418  28.774  1.00 56.10  ? 186 SER C C   1 
ATOM   4658  O  O   . SER C  1 186 ? -32.226  86.889  29.633  1.00 44.52  ? 186 SER C O   1 
ATOM   4659  C  CB  . SER C  1 186 ? -29.046  86.571  29.120  1.00 53.85  ? 186 SER C CB  1 
ATOM   4660  O  OG  . SER C  1 186 ? -28.041  86.085  29.971  1.00 55.77  ? 186 SER C OG  1 
ATOM   4661  N  N   . CYS C  1 187 ? -31.636  86.551  27.472  1.00 6.54   ? 187 CYS C N   1 
ATOM   4662  C  CA  . CYS C  1 187 ? -32.648  87.355  26.842  1.00 22.41  ? 187 CYS C CA  1 
ATOM   4663  C  C   . CYS C  1 187 ? -34.082  86.965  27.199  1.00 10.93  ? 187 CYS C C   1 
ATOM   4664  O  O   . CYS C  1 187 ? -34.959  87.806  27.179  1.00 31.60  ? 187 CYS C O   1 
ATOM   4665  C  CB  . CYS C  1 187 ? -32.477  87.194  25.334  1.00 22.80  ? 187 CYS C CB  1 
ATOM   4666  S  SG  . CYS C  1 187 ? -33.334  85.724  24.689  1.00 61.86  ? 187 CYS C SG  1 
ATOM   4667  N  N   . CYS C  1 188 ? -34.311  85.688  27.484  1.00 51.13  ? 188 CYS C N   1 
ATOM   4668  C  CA  . CYS C  1 188 ? -35.649  85.117  27.574  1.00 48.63  ? 188 CYS C CA  1 
ATOM   4669  C  C   . CYS C  1 188 ? -35.680  84.088  28.694  1.00 38.27  ? 188 CYS C C   1 
ATOM   4670  O  O   . CYS C  1 188 ? -34.662  83.500  29.007  1.00 50.70  ? 188 CYS C O   1 
ATOM   4671  C  CB  . CYS C  1 188 ? -36.012  84.472  26.230  1.00 58.25  ? 188 CYS C CB  1 
ATOM   4672  S  SG  . CYS C  1 188 ? -35.337  85.407  24.772  1.00 38.96  ? 188 CYS C SG  1 
ATOM   4673  N  N   . PRO C  1 189 ? -36.853  83.879  29.307  1.00 34.47  ? 189 PRO C N   1 
ATOM   4674  C  CA  . PRO C  1 189 ? -37.005  82.993  30.464  1.00 26.68  ? 189 PRO C CA  1 
ATOM   4675  C  C   . PRO C  1 189 ? -37.016  81.517  30.079  1.00 36.16  ? 189 PRO C C   1 
ATOM   4676  O  O   . PRO C  1 189 ? -36.647  80.661  30.883  1.00 37.03  ? 189 PRO C O   1 
ATOM   4677  C  CB  . PRO C  1 189 ? -38.377  83.383  30.991  1.00 36.92  ? 189 PRO C CB  1 
ATOM   4678  C  CG  . PRO C  1 189 ? -39.138  83.780  29.753  1.00 13.23  ? 189 PRO C CG  1 
ATOM   4679  C  CD  . PRO C  1 189 ? -38.138  84.488  28.905  1.00 29.46  ? 189 PRO C CD  1 
ATOM   4680  N  N   . GLU C  1 190 ? -37.450  81.220  28.861  1.00 25.39  ? 190 GLU C N   1 
ATOM   4681  C  CA  . GLU C  1 190 ? -37.632  79.839  28.447  1.00 27.36  ? 190 GLU C CA  1 
ATOM   4682  C  C   . GLU C  1 190 ? -36.338  79.197  27.957  1.00 26.41  ? 190 GLU C C   1 
ATOM   4683  O  O   . GLU C  1 190 ? -35.356  79.876  27.677  1.00 30.19  ? 190 GLU C O   1 
ATOM   4684  C  CB  . GLU C  1 190 ? -38.695  79.760  27.354  1.00 44.74  ? 190 GLU C CB  1 
ATOM   4685  C  CG  . GLU C  1 190 ? -40.095  80.141  27.814  1.00 51.02  ? 190 GLU C CG  1 
ATOM   4686  C  CD  . GLU C  1 190 ? -40.827  78.998  28.497  1.00 52.86  ? 190 GLU C CD  1 
ATOM   4687  O  OE1 . GLU C  1 190 ? -40.186  77.980  28.829  1.00 56.58  ? 190 GLU C OE1 1 
ATOM   4688  O  OE2 . GLU C  1 190 ? -42.053  79.115  28.695  1.00 49.96  ? 190 GLU C OE2 1 
ATOM   4689  N  N   . ALA C  1 191 ? -36.363  77.875  27.847  1.00 29.11  ? 191 ALA C N   1 
ATOM   4690  C  CA  . ALA C  1 191 ? -35.234  77.115  27.333  1.00 10.32  ? 191 ALA C CA  1 
ATOM   4691  C  C   . ALA C  1 191 ? -35.426  76.851  25.852  1.00 18.99  ? 191 ALA C C   1 
ATOM   4692  O  O   . ALA C  1 191 ? -36.542  76.582  25.404  1.00 19.03  ? 191 ALA C O   1 
ATOM   4693  C  CB  . ALA C  1 191 ? -35.114  75.810  28.081  1.00 17.83  ? 191 ALA C CB  1 
ATOM   4694  N  N   . TYR C  1 192 ? -34.344  76.941  25.089  1.00 16.43  ? 192 TYR C N   1 
ATOM   4695  C  CA  . TYR C  1 192 ? -34.387  76.676  23.647  1.00 19.35  ? 192 TYR C CA  1 
ATOM   4696  C  C   . TYR C  1 192 ? -33.469  75.516  23.320  1.00 12.18  ? 192 TYR C C   1 
ATOM   4697  O  O   . TYR C  1 192 ? -32.328  75.457  23.783  1.00 39.74  ? 192 TYR C O   1 
ATOM   4698  C  CB  . TYR C  1 192 ? -33.989  77.912  22.849  1.00 9.36   ? 192 TYR C CB  1 
ATOM   4699  C  CG  . TYR C  1 192 ? -34.914  79.083  23.055  1.00 25.89  ? 192 TYR C CG  1 
ATOM   4700  C  CD1 . TYR C  1 192 ? -34.884  79.826  24.230  1.00 13.27  ? 192 TYR C CD1 1 
ATOM   4701  C  CD2 . TYR C  1 192 ? -35.836  79.442  22.076  1.00 18.60  ? 192 TYR C CD2 1 
ATOM   4702  C  CE1 . TYR C  1 192 ? -35.744  80.891  24.419  1.00 27.96  ? 192 TYR C CE1 1 
ATOM   4703  C  CE2 . TYR C  1 192 ? -36.684  80.511  22.253  1.00 18.94  ? 192 TYR C CE2 1 
ATOM   4704  C  CZ  . TYR C  1 192 ? -36.634  81.234  23.422  1.00 21.25  ? 192 TYR C CZ  1 
ATOM   4705  O  OH  . TYR C  1 192 ? -37.490  82.298  23.594  1.00 39.34  ? 192 TYR C OH  1 
ATOM   4706  N  N   . GLU C  1 193 ? -33.975  74.573  22.549  1.00 14.26  ? 193 GLU C N   1 
ATOM   4707  C  CA  . GLU C  1 193 ? -33.199  73.384  22.241  1.00 18.78  ? 193 GLU C CA  1 
ATOM   4708  C  C   . GLU C  1 193 ? -32.336  73.571  20.998  1.00 16.09  ? 193 GLU C C   1 
ATOM   4709  O  O   . GLU C  1 193 ? -32.657  74.366  20.109  1.00 30.68  ? 193 GLU C O   1 
ATOM   4710  C  CB  . GLU C  1 193 ? -34.105  72.158  22.100  1.00 11.52  ? 193 GLU C CB  1 
ATOM   4711  C  CG  . GLU C  1 193 ? -34.915  71.859  23.332  1.00 21.25  ? 193 GLU C CG  1 
ATOM   4712  C  CD  . GLU C  1 193 ? -35.596  70.505  23.288  1.00 35.40  ? 193 GLU C CD  1 
ATOM   4713  O  OE1 . GLU C  1 193 ? -35.570  69.862  22.219  1.00 32.23  ? 193 GLU C OE1 1 
ATOM   4714  O  OE2 . GLU C  1 193 ? -36.168  70.085  24.321  1.00 33.55  ? 193 GLU C OE2 1 
ATOM   4715  N  N   . ASP C  1 194 ? -31.225  72.844  20.967  1.00 16.42  ? 194 ASP C N   1 
ATOM   4716  C  CA  . ASP C  1 194 ? -30.299  72.845  19.845  1.00 19.94  ? 194 ASP C CA  1 
ATOM   4717  C  C   . ASP C  1 194 ? -29.654  71.469  19.694  1.00 29.19  ? 194 ASP C C   1 
ATOM   4718  O  O   . ASP C  1 194 ? -29.605  70.677  20.641  1.00 30.42  ? 194 ASP C O   1 
ATOM   4719  C  CB  . ASP C  1 194 ? -29.226  73.939  19.993  1.00 29.26  ? 194 ASP C CB  1 
ATOM   4720  C  CG  . ASP C  1 194 ? -28.241  73.673  21.137  1.00 38.72  ? 194 ASP C CG  1 
ATOM   4721  O  OD1 . ASP C  1 194 ? -27.422  72.738  21.021  1.00 35.58  ? 194 ASP C OD1 1 
ATOM   4722  O  OD2 . ASP C  1 194 ? -28.260  74.424  22.139  1.00 50.85  ? 194 ASP C OD2 1 
ATOM   4723  N  N   . VAL C  1 195 ? -29.181  71.177  18.491  1.00 16.67  ? 195 VAL C N   1 
ATOM   4724  C  CA  . VAL C  1 195 ? -28.351  70.011  18.278  1.00 18.50  ? 195 VAL C CA  1 
ATOM   4725  C  C   . VAL C  1 195 ? -26.965  70.491  17.927  1.00 11.57  ? 195 VAL C C   1 
ATOM   4726  O  O   . VAL C  1 195 ? -26.809  71.392  17.116  1.00 29.70  ? 195 VAL C O   1 
ATOM   4727  C  CB  . VAL C  1 195 ? -28.885  69.138  17.145  1.00 22.08  ? 195 VAL C CB  1 
ATOM   4728  C  CG1 . VAL C  1 195 ? -27.831  68.154  16.697  1.00 22.10  ? 195 VAL C CG1 1 
ATOM   4729  C  CG2 . VAL C  1 195 ? -30.129  68.411  17.598  1.00 34.02  ? 195 VAL C CG2 1 
ATOM   4730  N  N   . GLU C  1 196 ? -25.956  69.897  18.546  1.00 32.35  ? 196 GLU C N   1 
ATOM   4731  C  CA  . GLU C  1 196 ? -24.566  70.197  18.203  1.00 32.81  ? 196 GLU C CA  1 
ATOM   4732  C  C   . GLU C  1 196 ? -23.923  69.065  17.427  1.00 32.49  ? 196 GLU C C   1 
ATOM   4733  O  O   . GLU C  1 196 ? -23.727  67.975  17.959  1.00 34.66  ? 196 GLU C O   1 
ATOM   4734  C  CB  . GLU C  1 196 ? -23.741  70.494  19.447  1.00 31.55  ? 196 GLU C CB  1 
ATOM   4735  C  CG  . GLU C  1 196 ? -23.911  71.907  19.952  1.00 40.33  ? 196 GLU C CG  1 
ATOM   4736  C  CD  . GLU C  1 196 ? -23.245  72.127  21.291  1.00 48.02  ? 196 GLU C CD  1 
ATOM   4737  O  OE1 . GLU C  1 196 ? -22.529  71.211  21.749  1.00 54.84  ? 196 GLU C OE1 1 
ATOM   4738  O  OE2 . GLU C  1 196 ? -23.445  73.210  21.881  1.00 34.41  ? 196 GLU C OE2 1 
ATOM   4739  N  N   . VAL C  1 197 ? -23.600  69.341  16.167  1.00 15.99  ? 197 VAL C N   1 
ATOM   4740  C  CA  . VAL C  1 197 ? -22.942  68.374  15.322  1.00 18.55  ? 197 VAL C CA  1 
ATOM   4741  C  C   . VAL C  1 197 ? -21.431  68.625  15.373  1.00 33.04  ? 197 VAL C C   1 
ATOM   4742  O  O   . VAL C  1 197 ? -20.950  69.696  15.000  1.00 32.05  ? 197 VAL C O   1 
ATOM   4743  C  CB  . VAL C  1 197 ? -23.463  68.457  13.872  1.00 20.58  ? 197 VAL C CB  1 
ATOM   4744  C  CG1 . VAL C  1 197 ? -22.948  67.290  13.044  1.00 13.62  ? 197 VAL C CG1 1 
ATOM   4745  C  CG2 . VAL C  1 197 ? -24.978  68.475  13.870  1.00 14.11  ? 197 VAL C CG2 1 
ATOM   4746  N  N   . SER C  1 198 ? -20.687  67.639  15.859  1.00 26.02  ? 198 SER C N   1 
ATOM   4747  C  CA  . SER C  1 198 ? -19.242  67.742  15.913  1.00 19.25  ? 198 SER C CA  1 
ATOM   4748  C  C   . SER C  1 198 ? -18.620  67.065  14.704  1.00 27.92  ? 198 SER C C   1 
ATOM   4749  O  O   . SER C  1 198 ? -18.678  65.842  14.556  1.00 39.54  ? 198 SER C O   1 
ATOM   4750  C  CB  . SER C  1 198 ? -18.710  67.142  17.207  1.00 17.16  ? 198 SER C CB  1 
ATOM   4751  O  OG  . SER C  1 198 ? -19.007  68.002  18.291  1.00 38.10  ? 198 SER C OG  1 
ATOM   4752  N  N   . LEU C  1 199 ? -18.051  67.880  13.826  1.00 18.97  ? 199 LEU C N   1 
ATOM   4753  C  CA  . LEU C  1 199 ? -17.392  67.383  12.634  1.00 25.25  ? 199 LEU C CA  1 
ATOM   4754  C  C   . LEU C  1 199 ? -15.885  67.249  12.866  1.00 33.64  ? 199 LEU C C   1 
ATOM   4755  O  O   . LEU C  1 199 ? -15.188  68.246  13.047  1.00 31.85  ? 199 LEU C O   1 
ATOM   4756  C  CB  . LEU C  1 199 ? -17.658  68.331  11.472  1.00 25.29  ? 199 LEU C CB  1 
ATOM   4757  C  CG  . LEU C  1 199 ? -16.930  67.993  10.158  1.00 31.44  ? 199 LEU C CG  1 
ATOM   4758  C  CD1 . LEU C  1 199 ? -17.387  66.665  9.569   1.00 14.58  ? 199 LEU C CD1 1 
ATOM   4759  C  CD2 . LEU C  1 199 ? -17.134  69.089  9.151   1.00 13.25  ? 199 LEU C CD2 1 
ATOM   4760  N  N   . ASN C  1 200 ? -15.398  66.014  12.882  1.00 23.65  ? 200 ASN C N   1 
ATOM   4761  C  CA  . ASN C  1 200 ? -13.974  65.750  13.042  1.00 26.54  ? 200 ASN C CA  1 
ATOM   4762  C  C   . ASN C  1 200 ? -13.317  65.415  11.701  1.00 29.19  ? 200 ASN C C   1 
ATOM   4763  O  O   . ASN C  1 200 ? -13.549  64.348  11.127  1.00 25.05  ? 200 ASN C O   1 
ATOM   4764  C  CB  . ASN C  1 200 ? -13.739  64.629  14.057  1.00 33.62  ? 200 ASN C CB  1 
ATOM   4765  C  CG  . ASN C  1 200 ? -12.253  64.374  14.323  1.00 40.99  ? 200 ASN C CG  1 
ATOM   4766  O  OD1 . ASN C  1 200 ? -11.828  63.231  14.522  1.00 29.32  ? 200 ASN C OD1 1 
ATOM   4767  N  ND2 . ASN C  1 200 ? -11.459  65.443  14.318  1.00 36.98  ? 200 ASN C ND2 1 
ATOM   4768  N  N   . PHE C  1 201 ? -12.502  66.340  11.209  1.00 17.94  ? 201 PHE C N   1 
ATOM   4769  C  CA  . PHE C  1 201 ? -11.908  66.197  9.886   1.00 32.16  ? 201 PHE C CA  1 
ATOM   4770  C  C   . PHE C  1 201 ? -10.446  66.628  9.877   1.00 25.84  ? 201 PHE C C   1 
ATOM   4771  O  O   . PHE C  1 201 ? -9.960   67.240  10.825  1.00 32.74  ? 201 PHE C O   1 
ATOM   4772  C  CB  . PHE C  1 201 ? -12.693  67.040  8.871   1.00 30.35  ? 201 PHE C CB  1 
ATOM   4773  C  CG  . PHE C  1 201 ? -12.548  68.526  9.080   1.00 24.23  ? 201 PHE C CG  1 
ATOM   4774  C  CD1 . PHE C  1 201 ? -12.994  69.122  10.248  1.00 15.81  ? 201 PHE C CD1 1 
ATOM   4775  C  CD2 . PHE C  1 201 ? -11.935  69.316  8.114   1.00 20.58  ? 201 PHE C CD2 1 
ATOM   4776  C  CE1 . PHE C  1 201 ? -12.851  70.484  10.438  1.00 15.84  ? 201 PHE C CE1 1 
ATOM   4777  C  CE2 . PHE C  1 201 ? -11.792  70.675  8.296   1.00 21.23  ? 201 PHE C CE2 1 
ATOM   4778  C  CZ  . PHE C  1 201 ? -12.256  71.264  9.455   1.00 18.87  ? 201 PHE C CZ  1 
ATOM   4779  N  N   . ARG C  1 202 ? -9.753   66.320  8.791   1.00 31.30  ? 202 ARG C N   1 
ATOM   4780  C  CA  . ARG C  1 202 ? -8.348   66.706  8.641   1.00 34.62  ? 202 ARG C CA  1 
ATOM   4781  C  C   . ARG C  1 202 ? -7.999   66.860  7.173   1.00 23.13  ? 202 ARG C C   1 
ATOM   4782  O  O   . ARG C  1 202 ? -8.650   66.272  6.313   1.00 25.92  ? 202 ARG C O   1 
ATOM   4783  C  CB  . ARG C  1 202 ? -7.425   65.684  9.301   1.00 33.52  ? 202 ARG C CB  1 
ATOM   4784  C  CG  . ARG C  1 202 ? -7.376   64.366  8.579   1.00 33.51  ? 202 ARG C CG  1 
ATOM   4785  C  CD  . ARG C  1 202 ? -6.552   63.346  9.336   1.00 22.80  ? 202 ARG C CD  1 
ATOM   4786  N  NE  . ARG C  1 202 ? -6.579   62.077  8.628   1.00 39.36  ? 202 ARG C NE  1 
ATOM   4787  C  CZ  . ARG C  1 202 ? -6.258   60.911  9.169   1.00 40.36  ? 202 ARG C CZ  1 
ATOM   4788  N  NH1 . ARG C  1 202 ? -5.886   60.854  10.436  1.00 37.35  ? 202 ARG C NH1 1 
ATOM   4789  N  NH2 . ARG C  1 202 ? -6.310   59.800  8.444   1.00 45.56  ? 202 ARG C NH2 1 
ATOM   4790  N  N   . LYS C  1 203 ? -7.010   67.703  6.892   1.00 19.07  ? 203 LYS C N   1 
ATOM   4791  C  CA  . LYS C  1 203 ? -6.509   67.850  5.522   1.00 47.32  ? 203 LYS C CA  1 
ATOM   4792  C  C   . LYS C  1 203 ? -5.877   66.537  5.042   1.00 25.76  ? 203 LYS C C   1 
ATOM   4793  O  O   . LYS C  1 203 ? -5.201   65.861  5.816   1.00 16.49  ? 203 LYS C O   1 
ATOM   4794  C  CB  . LYS C  1 203 ? -5.493   68.999  5.424   1.00 19.07  ? 203 LYS C CB  1 
ATOM   4795  C  CG  . LYS C  1 203 ? -5.440   69.662  4.051   1.00 6.21   ? 203 LYS C CG  1 
ATOM   4796  C  CD  . LYS C  1 203 ? -4.435   70.804  4.010   1.00 45.97  ? 203 LYS C CD  1 
ATOM   4797  C  CE  . LYS C  1 203 ? -5.049   72.106  3.507   1.00 36.06  ? 203 LYS C CE  1 
ATOM   4798  N  NZ  . LYS C  1 203 ? -5.829   72.813  4.571   1.00 9.19   ? 203 LYS C NZ  1 
ATOM   4799  N  N   . LYS C  1 204 ? -6.156   66.151  3.796   1.00 26.78  ? 204 LYS C N   1 
ATOM   4800  C  CA  . LYS C  1 204 ? -5.452   65.048  3.146   1.00 36.26  ? 204 LYS C CA  1 
ATOM   4801  C  C   . LYS C  1 204 ? -4.216   65.715  2.594   1.00 44.39  ? 204 LYS C C   1 
ATOM   4802  O  O   . LYS C  1 204 ? -4.089   66.937  2.663   1.00 37.67  ? 204 LYS C O   1 
ATOM   4803  C  CB  . LYS C  1 204 ? -6.230   64.469  1.950   1.00 51.28  ? 204 LYS C CB  1 
ATOM   4804  C  CG  . LYS C  1 204 ? -7.685   63.975  2.149   1.00 25.69  ? 204 LYS C CG  1 
ATOM   4805  C  CD  . LYS C  1 204 ? -8.341   63.826  0.757   1.00 19.36  ? 204 LYS C CD  1 
ATOM   4806  C  CE  . LYS C  1 204 ? -9.745   63.197  0.775   1.00 34.30  ? 204 LYS C CE  1 
ATOM   4807  N  NZ  . LYS C  1 204 ? -10.172  62.725  -0.599  1.00 2.21   ? 204 LYS C NZ  1 
ATOM   4808  N  N   . GLY C  1 205 ? -3.316   64.928  2.024   1.00 48.52  ? 205 GLY C N   1 
ATOM   4809  C  CA  . GLY C  1 205 ? -2.150   65.484  1.372   1.00 45.41  ? 205 GLY C CA  1 
ATOM   4810  C  C   . GLY C  1 205 ? -2.130   65.214  -0.122  1.00 47.95  ? 205 GLY C C   1 
ATOM   4811  O  O   . GLY C  1 205 ? -2.400   64.093  -0.568  1.00 50.30  ? 205 GLY C O   1 
ATOM   4812  N  N   . ARG C  1 206 ? -1.810   66.243  -0.901  1.00 33.17  ? 206 ARG C N   1 
ATOM   4813  C  CA  . ARG C  1 206 ? -1.621   66.075  -2.338  1.00 39.38  ? 206 ARG C CA  1 
ATOM   4814  C  C   . ARG C  1 206 ? -0.851   64.786  -2.681  1.00 36.69  ? 206 ARG C C   1 
ATOM   4815  O  O   . ARG C  1 206 ? -1.444   63.764  -3.062  1.00 23.84  ? 206 ARG C O   1 
ATOM   4816  C  CB  . ARG C  1 206 ? -0.874   67.284  -2.870  1.00 52.28  ? 206 ARG C CB  1 
ATOM   4817  C  CG  . ARG C  1 206 ? 0.142    67.806  -1.873  1.00 59.10  ? 206 ARG C CG  1 
ATOM   4818  C  CD  . ARG C  1 206 ? 1.359    68.371  -2.572  1.00 55.61  ? 206 ARG C CD  1 
ATOM   4819  N  NE  . ARG C  1 206 ? 1.070    69.630  -3.251  1.00 44.87  ? 206 ARG C NE  1 
ATOM   4820  C  CZ  . ARG C  1 206 ? 1.666    70.024  -4.371  1.00 31.82  ? 206 ARG C CZ  1 
ATOM   4821  N  NH1 . ARG C  1 206 ? 2.577    69.251  -4.954  1.00 30.24  ? 206 ARG C NH1 1 
ATOM   4822  N  NH2 . ARG C  1 206 ? 1.344    71.190  -4.906  1.00 43.15  ? 206 ARG C NH2 1 
ATOM   4823  N  N   . LEU D  1 1   ? -59.226  81.027  21.485  1.00 50.08  ? 1   LEU D N   1 
ATOM   4824  C  CA  . LEU D  1 1   ? -58.172  81.350  20.536  1.00 37.95  ? 1   LEU D CA  1 
ATOM   4825  C  C   . LEU D  1 1   ? -57.031  80.358  20.598  1.00 42.95  ? 1   LEU D C   1 
ATOM   4826  O  O   . LEU D  1 1   ? -56.440  80.143  21.654  1.00 43.86  ? 1   LEU D O   1 
ATOM   4827  C  CB  . LEU D  1 1   ? -57.612  82.744  20.810  1.00 39.99  ? 1   LEU D CB  1 
ATOM   4828  C  CG  . LEU D  1 1   ? -58.432  83.909  20.264  1.00 48.27  ? 1   LEU D CG  1 
ATOM   4829  C  CD1 . LEU D  1 1   ? -57.718  85.223  20.550  1.00 43.49  ? 1   LEU D CD1 1 
ATOM   4830  C  CD2 . LEU D  1 1   ? -58.657  83.728  18.779  1.00 46.95  ? 1   LEU D CD2 1 
ATOM   4831  N  N   . ASP D  1 2   ? -56.718  79.761  19.453  1.00 47.47  ? 2   ASP D N   1 
ATOM   4832  C  CA  . ASP D  1 2   ? -55.511  78.955  19.316  1.00 36.15  ? 2   ASP D CA  1 
ATOM   4833  C  C   . ASP D  1 2   ? -54.512  79.707  18.422  1.00 42.49  ? 2   ASP D C   1 
ATOM   4834  O  O   . ASP D  1 2   ? -54.849  80.760  17.856  1.00 29.78  ? 2   ASP D O   1 
ATOM   4835  C  CB  . ASP D  1 2   ? -55.832  77.562  18.751  1.00 33.13  ? 2   ASP D CB  1 
ATOM   4836  C  CG  . ASP D  1 2   ? -56.470  77.613  17.354  1.00 53.13  ? 2   ASP D CG  1 
ATOM   4837  O  OD1 . ASP D  1 2   ? -56.330  78.641  16.655  1.00 42.07  ? 2   ASP D OD1 1 
ATOM   4838  O  OD2 . ASP D  1 2   ? -57.106  76.614  16.946  1.00 50.37  ? 2   ASP D OD2 1 
ATOM   4839  N  N   . ARG D  1 3   ? -53.298  79.174  18.297  1.00 30.98  ? 3   ARG D N   1 
ATOM   4840  C  CA  . ARG D  1 3   ? -52.288  79.826  17.489  1.00 30.00  ? 3   ARG D CA  1 
ATOM   4841  C  C   . ARG D  1 3   ? -52.791  80.175  16.095  1.00 29.52  ? 3   ARG D C   1 
ATOM   4842  O  O   . ARG D  1 3   ? -52.603  81.291  15.622  1.00 30.50  ? 3   ARG D O   1 
ATOM   4843  C  CB  . ARG D  1 3   ? -51.030  78.951  17.392  1.00 34.76  ? 3   ARG D CB  1 
ATOM   4844  C  CG  . ARG D  1 3   ? -50.197  78.955  18.654  1.00 31.42  ? 3   ARG D CG  1 
ATOM   4845  C  CD  . ARG D  1 3   ? -48.983  78.088  18.551  1.00 36.21  ? 3   ARG D CD  1 
ATOM   4846  N  NE  . ARG D  1 3   ? -48.218  78.185  19.787  1.00 52.14  ? 3   ARG D NE  1 
ATOM   4847  C  CZ  . ARG D  1 3   ? -48.429  77.411  20.848  1.00 57.69  ? 3   ARG D CZ  1 
ATOM   4848  N  NH1 . ARG D  1 3   ? -49.361  76.467  20.812  1.00 50.03  ? 3   ARG D NH1 1 
ATOM   4849  N  NH2 . ARG D  1 3   ? -47.697  77.570  21.941  1.00 65.39  ? 3   ARG D NH2 1 
ATOM   4850  N  N   . ALA D  1 4   ? -53.421  79.210  15.440  1.00 30.42  ? 4   ALA D N   1 
ATOM   4851  C  CA  . ALA D  1 4   ? -53.966  79.420  14.102  1.00 36.06  ? 4   ALA D CA  1 
ATOM   4852  C  C   . ALA D  1 4   ? -54.913  80.623  14.018  1.00 38.98  ? 4   ALA D C   1 
ATOM   4853  O  O   . ALA D  1 4   ? -54.871  81.388  13.057  1.00 28.32  ? 4   ALA D O   1 
ATOM   4854  C  CB  . ALA D  1 4   ? -54.672  78.166  13.629  1.00 36.42  ? 4   ALA D CB  1 
ATOM   4855  N  N   . ASP D  1 5   ? -55.780  80.780  15.014  1.00 29.44  ? 5   ASP D N   1 
ATOM   4856  C  CA  . ASP D  1 5   ? -56.713  81.906  15.014  1.00 30.31  ? 5   ASP D CA  1 
ATOM   4857  C  C   . ASP D  1 5   ? -55.957  83.216  15.173  1.00 40.13  ? 5   ASP D C   1 
ATOM   4858  O  O   . ASP D  1 5   ? -56.182  84.163  14.418  1.00 31.84  ? 5   ASP D O   1 
ATOM   4859  C  CB  . ASP D  1 5   ? -57.778  81.772  16.109  1.00 29.20  ? 5   ASP D CB  1 
ATOM   4860  C  CG  . ASP D  1 5   ? -58.643  80.527  15.941  1.00 44.89  ? 5   ASP D CG  1 
ATOM   4861  O  OD1 . ASP D  1 5   ? -58.909  80.118  14.787  1.00 38.85  ? 5   ASP D OD1 1 
ATOM   4862  O  OD2 . ASP D  1 5   ? -59.062  79.954  16.971  1.00 45.60  ? 5   ASP D OD2 1 
ATOM   4863  N  N   . ILE D  1 6   ? -55.057  83.262  16.155  1.00 27.22  ? 6   ILE D N   1 
ATOM   4864  C  CA  . ILE D  1 6   ? -54.257  84.454  16.404  1.00 26.00  ? 6   ILE D CA  1 
ATOM   4865  C  C   . ILE D  1 6   ? -53.491  84.880  15.149  1.00 27.01  ? 6   ILE D C   1 
ATOM   4866  O  O   . ILE D  1 6   ? -53.479  86.048  14.788  1.00 32.06  ? 6   ILE D O   1 
ATOM   4867  C  CB  . ILE D  1 6   ? -53.250  84.231  17.553  1.00 31.26  ? 6   ILE D CB  1 
ATOM   4868  C  CG1 . ILE D  1 6   ? -53.986  83.867  18.843  1.00 31.56  ? 6   ILE D CG1 1 
ATOM   4869  C  CG2 . ILE D  1 6   ? -52.397  85.469  17.756  1.00 24.91  ? 6   ILE D CG2 1 
ATOM   4870  C  CD1 . ILE D  1 6   ? -53.038  83.442  19.985  1.00 27.34  ? 6   ILE D CD1 1 
ATOM   4871  N  N   . LEU D  1 7   ? -52.853  83.924  14.493  1.00 25.80  ? 7   LEU D N   1 
ATOM   4872  C  CA  . LEU D  1 7   ? -52.051  84.215  13.315  1.00 29.00  ? 7   LEU D CA  1 
ATOM   4873  C  C   . LEU D  1 7   ? -52.899  84.611  12.107  1.00 32.29  ? 7   LEU D C   1 
ATOM   4874  O  O   . LEU D  1 7   ? -52.483  85.434  11.294  1.00 29.50  ? 7   LEU D O   1 
ATOM   4875  C  CB  . LEU D  1 7   ? -51.150  83.026  12.976  1.00 25.96  ? 7   LEU D CB  1 
ATOM   4876  C  CG  . LEU D  1 7   ? -49.973  82.866  13.929  1.00 26.03  ? 7   LEU D CG  1 
ATOM   4877  C  CD1 . LEU D  1 7   ? -49.458  81.442  13.913  1.00 41.64  ? 7   LEU D CD1 1 
ATOM   4878  C  CD2 . LEU D  1 7   ? -48.890  83.852  13.578  1.00 24.83  ? 7   LEU D CD2 1 
ATOM   4879  N  N   . TYR D  1 8   ? -54.084  84.020  11.996  1.00 25.82  ? 8   TYR D N   1 
ATOM   4880  C  CA  . TYR D  1 8   ? -55.040  84.404  10.968  1.00 25.25  ? 8   TYR D CA  1 
ATOM   4881  C  C   . TYR D  1 8   ? -55.425  85.839  11.216  1.00 29.46  ? 8   TYR D C   1 
ATOM   4882  O  O   . TYR D  1 8   ? -55.488  86.657  10.304  1.00 32.92  ? 8   TYR D O   1 
ATOM   4883  C  CB  . TYR D  1 8   ? -56.269  83.511  11.045  1.00 29.42  ? 8   TYR D CB  1 
ATOM   4884  C  CG  . TYR D  1 8   ? -57.353  83.801  10.023  1.00 43.28  ? 8   TYR D CG  1 
ATOM   4885  C  CD1 . TYR D  1 8   ? -57.205  83.407  8.696   1.00 53.34  ? 8   TYR D CD1 1 
ATOM   4886  C  CD2 . TYR D  1 8   ? -58.538  84.435  10.394  1.00 37.53  ? 8   TYR D CD2 1 
ATOM   4887  C  CE1 . TYR D  1 8   ? -58.189  83.656  7.756   1.00 62.07  ? 8   TYR D CE1 1 
ATOM   4888  C  CE2 . TYR D  1 8   ? -59.534  84.685  9.462   1.00 52.69  ? 8   TYR D CE2 1 
ATOM   4889  C  CZ  . TYR D  1 8   ? -59.355  84.293  8.139   1.00 67.57  ? 8   TYR D CZ  1 
ATOM   4890  O  OH  . TYR D  1 8   ? -60.344  84.536  7.200   1.00 67.79  ? 8   TYR D OH  1 
ATOM   4891  N  N   . ASN D  1 9   ? -55.643  86.151  12.478  1.00 17.08  ? 9   ASN D N   1 
ATOM   4892  C  CA  . ASN D  1 9   ? -56.048  87.493  12.826  1.00 18.56  ? 9   ASN D CA  1 
ATOM   4893  C  C   . ASN D  1 9   ? -54.976  88.504  12.496  1.00 33.25  ? 9   ASN D C   1 
ATOM   4894  O  O   . ASN D  1 9   ? -55.255  89.491  11.822  1.00 31.69  ? 9   ASN D O   1 
ATOM   4895  C  CB  . ASN D  1 9   ? -56.452  87.573  14.286  1.00 25.73  ? 9   ASN D CB  1 
ATOM   4896  C  CG  . ASN D  1 9   ? -57.644  86.687  14.606  1.00 40.94  ? 9   ASN D CG  1 
ATOM   4897  O  OD1 . ASN D  1 9   ? -58.391  86.280  13.704  1.00 33.36  ? 9   ASN D OD1 1 
ATOM   4898  N  ND2 . ASN D  1 9   ? -57.835  86.387  15.895  1.00 40.01  ? 9   ASN D ND2 1 
ATOM   4899  N  N   . ILE D  1 10  ? -53.749  88.242  12.952  1.00 33.29  ? 10  ILE D N   1 
ATOM   4900  C  CA  . ILE D  1 10  ? -52.622  89.139  12.721  1.00 20.86  ? 10  ILE D CA  1 
ATOM   4901  C  C   . ILE D  1 10  ? -52.412  89.354  11.237  1.00 33.84  ? 10  ILE D C   1 
ATOM   4902  O  O   . ILE D  1 10  ? -52.332  90.487  10.763  1.00 27.92  ? 10  ILE D O   1 
ATOM   4903  C  CB  . ILE D  1 10  ? -51.331  88.606  13.358  1.00 21.92  ? 10  ILE D CB  1 
ATOM   4904  C  CG1 . ILE D  1 10  ? -51.368  88.858  14.863  1.00 22.89  ? 10  ILE D CG1 1 
ATOM   4905  C  CG2 . ILE D  1 10  ? -50.109  89.293  12.769  1.00 11.24  ? 10  ILE D CG2 1 
ATOM   4906  C  CD1 . ILE D  1 10  ? -50.311  88.116  15.625  1.00 25.88  ? 10  ILE D CD1 1 
ATOM   4907  N  N   . ARG D  1 11  ? -52.325  88.253  10.506  1.00 12.66  ? 11  ARG D N   1 
ATOM   4908  C  CA  . ARG D  1 11  ? -52.118  88.328  9.071   1.00 34.82  ? 11  ARG D CA  1 
ATOM   4909  C  C   . ARG D  1 11  ? -53.241  89.161  8.415   1.00 49.18  ? 11  ARG D C   1 
ATOM   4910  O  O   . ARG D  1 11  ? -52.963  90.156  7.744   1.00 65.00  ? 11  ARG D O   1 
ATOM   4911  C  CB  . ARG D  1 11  ? -52.014  86.917  8.480   1.00 18.55  ? 11  ARG D CB  1 
ATOM   4912  C  CG  . ARG D  1 11  ? -51.784  86.863  6.983   1.00 30.22  ? 11  ARG D CG  1 
ATOM   4913  C  CD  . ARG D  1 11  ? -52.480  85.653  6.396   1.00 54.79  ? 11  ARG D CD  1 
ATOM   4914  N  NE  . ARG D  1 11  ? -51.699  84.420  6.480   1.00 65.00  ? 11  ARG D NE  1 
ATOM   4915  C  CZ  . ARG D  1 11  ? -52.225  83.202  6.344   1.00 80.84  ? 11  ARG D CZ  1 
ATOM   4916  N  NH1 . ARG D  1 11  ? -53.537  83.061  6.151   1.00 52.75  ? 11  ARG D NH1 1 
ATOM   4917  N  NH2 . ARG D  1 11  ? -51.449  82.122  6.405   1.00 70.83  ? 11  ARG D NH2 1 
ATOM   4918  N  N   . GLN D  1 12  ? -54.495  88.774  8.655   1.00 64.49  ? 12  GLN D N   1 
ATOM   4919  C  CA  . GLN D  1 12  ? -55.675  89.424  8.063   1.00 42.94  ? 12  GLN D CA  1 
ATOM   4920  C  C   . GLN D  1 12  ? -55.810  90.927  8.338   1.00 52.58  ? 12  GLN D C   1 
ATOM   4921  O  O   . GLN D  1 12  ? -56.341  91.663  7.511   1.00 44.97  ? 12  GLN D O   1 
ATOM   4922  C  CB  . GLN D  1 12  ? -56.954  88.713  8.506   1.00 43.22  ? 12  GLN D CB  1 
ATOM   4923  C  CG  . GLN D  1 12  ? -57.083  87.284  8.038   1.00 43.44  ? 12  GLN D CG  1 
ATOM   4924  C  CD  . GLN D  1 12  ? -57.341  87.181  6.557   1.00 46.14  ? 12  GLN D CD  1 
ATOM   4925  O  OE1 . GLN D  1 12  ? -56.504  87.565  5.740   1.00 43.25  ? 12  GLN D OE1 1 
ATOM   4926  N  NE2 . GLN D  1 12  ? -58.511  86.662  6.195   1.00 48.30  ? 12  GLN D NE2 1 
ATOM   4927  N  N   . THR D  1 13  ? -55.330  91.395  9.483   1.00 26.98  ? 13  THR D N   1 
ATOM   4928  C  CA  . THR D  1 13  ? -55.632  92.768  9.886   1.00 49.57  ? 13  THR D CA  1 
ATOM   4929  C  C   . THR D  1 13  ? -54.410  93.645  10.144  1.00 55.40  ? 13  THR D C   1 
ATOM   4930  O  O   . THR D  1 13  ? -54.555  94.831  10.449  1.00 46.81  ? 13  THR D O   1 
ATOM   4931  C  CB  . THR D  1 13  ? -56.532  92.814  11.155  1.00 39.52  ? 13  THR D CB  1 
ATOM   4932  O  OG1 . THR D  1 13  ? -55.918  92.060  12.209  1.00 17.78  ? 13  THR D OG1 1 
ATOM   4933  C  CG2 . THR D  1 13  ? -57.934  92.255  10.872  1.00 25.51  ? 13  THR D CG2 1 
ATOM   4934  N  N   . SER D  1 14  ? -53.217  93.070  10.030  1.00 63.50  ? 14  SER D N   1 
ATOM   4935  C  CA  . SER D  1 14  ? -51.996  93.805  10.354  1.00 65.62  ? 14  SER D CA  1 
ATOM   4936  C  C   . SER D  1 14  ? -51.556  94.699  9.206   1.00 54.42  ? 14  SER D C   1 
ATOM   4937  O  O   . SER D  1 14  ? -51.479  94.275  8.035   1.00 23.24  ? 14  SER D O   1 
ATOM   4938  C  CB  . SER D  1 14  ? -50.859  92.852  10.696  1.00 63.41  ? 14  SER D CB  1 
ATOM   4939  O  OG  . SER D  1 14  ? -50.460  92.163  9.524   1.00 69.87  ? 14  SER D OG  1 
ATOM   4940  N  N   . ARG D  1 15  ? -51.249  95.939  9.558   1.00 37.24  ? 15  ARG D N   1 
ATOM   4941  C  CA  . ARG D  1 15  ? -50.779  96.896  8.580   1.00 32.47  ? 15  ARG D CA  1 
ATOM   4942  C  C   . ARG D  1 15  ? -49.309  97.218  8.800   1.00 28.26  ? 15  ARG D C   1 
ATOM   4943  O  O   . ARG D  1 15  ? -48.962  98.072  9.618   1.00 26.08  ? 15  ARG D O   1 
ATOM   4944  C  CB  . ARG D  1 15  ? -51.655  98.146  8.602   1.00 30.95  ? 15  ARG D CB  1 
ATOM   4945  C  CG  . ARG D  1 15  ? -53.116  97.812  8.292   1.00 47.15  ? 15  ARG D CG  1 
ATOM   4946  C  CD  . ARG D  1 15  ? -53.951  99.045  8.001   1.00 58.56  ? 15  ARG D CD  1 
ATOM   4947  N  NE  . ARG D  1 15  ? -53.337  99.858  6.958   1.00 68.09  ? 15  ARG D NE  1 
ATOM   4948  C  CZ  . ARG D  1 15  ? -54.005  100.681 6.159   1.00 70.25  ? 15  ARG D CZ  1 
ATOM   4949  N  NH1 . ARG D  1 15  ? -55.332  100.802 6.268   1.00 56.18  ? 15  ARG D NH1 1 
ATOM   4950  N  NH2 . ARG D  1 15  ? -53.339  101.375 5.242   1.00 51.21  ? 15  ARG D NH2 1 
ATOM   4951  N  N   . PRO D  1 16  ? -48.442  96.517  8.058   1.00 28.63  ? 16  PRO D N   1 
ATOM   4952  C  CA  . PRO D  1 16  ? -46.983  96.641  8.115   1.00 34.31  ? 16  PRO D CA  1 
ATOM   4953  C  C   . PRO D  1 16  ? -46.546  98.003  7.629   1.00 26.15  ? 16  PRO D C   1 
ATOM   4954  O  O   . PRO D  1 16  ? -45.436  98.429  7.924   1.00 58.12  ? 16  PRO D O   1 
ATOM   4955  C  CB  . PRO D  1 16  ? -46.494  95.566  7.137   1.00 33.31  ? 16  PRO D CB  1 
ATOM   4956  C  CG  . PRO D  1 16  ? -47.689  94.691  6.864   1.00 31.18  ? 16  PRO D CG  1 
ATOM   4957  C  CD  . PRO D  1 16  ? -48.880  95.558  7.036   1.00 26.29  ? 16  PRO D CD  1 
ATOM   4958  N  N   . ASP D  1 17  ? -47.427  98.686  6.911   1.00 24.04  ? 17  ASP D N   1 
ATOM   4959  C  CA  . ASP D  1 17  ? -47.115  99.995  6.341   1.00 27.97  ? 17  ASP D CA  1 
ATOM   4960  C  C   . ASP D  1 17  ? -47.381  101.137 7.318   1.00 17.60  ? 17  ASP D C   1 
ATOM   4961  O  O   . ASP D  1 17  ? -47.036  102.290 7.048   1.00 48.05  ? 17  ASP D O   1 
ATOM   4962  C  CB  . ASP D  1 17  ? -47.875  100.215 5.021   1.00 37.22  ? 17  ASP D CB  1 
ATOM   4963  C  CG  . ASP D  1 17  ? -49.391  99.969  5.144   1.00 64.24  ? 17  ASP D CG  1 
ATOM   4964  O  OD1 . ASP D  1 17  ? -49.814  99.037  5.866   1.00 48.25  ? 17  ASP D OD1 1 
ATOM   4965  O  OD2 . ASP D  1 17  ? -50.167  100.713 4.498   1.00 69.25  ? 17  ASP D OD2 1 
ATOM   4966  N  N   . VAL D  1 18  ? -47.967  100.798 8.463   1.00 25.19  ? 18  VAL D N   1 
ATOM   4967  C  CA  . VAL D  1 18  ? -48.511  101.790 9.377   1.00 18.20  ? 18  VAL D CA  1 
ATOM   4968  C  C   . VAL D  1 18  ? -47.792  101.789 10.698  1.00 17.13  ? 18  VAL D C   1 
ATOM   4969  O  O   . VAL D  1 18  ? -47.779  100.793 11.393  1.00 28.08  ? 18  VAL D O   1 
ATOM   4970  C  CB  . VAL D  1 18  ? -50.023  101.534 9.649   1.00 29.89  ? 18  VAL D CB  1 
ATOM   4971  C  CG1 . VAL D  1 18  ? -50.570  102.547 10.655  1.00 20.10  ? 18  VAL D CG1 1 
ATOM   4972  C  CG2 . VAL D  1 18  ? -50.816  101.556 8.353   1.00 21.05  ? 18  VAL D CG2 1 
ATOM   4973  N  N   . ILE D  1 19  ? -47.193  102.916 11.044  1.00 25.58  ? 19  ILE D N   1 
ATOM   4974  C  CA  . ILE D  1 19  ? -46.494  103.056 12.316  1.00 22.10  ? 19  ILE D CA  1 
ATOM   4975  C  C   . ILE D  1 19  ? -47.493  103.113 13.495  1.00 30.67  ? 19  ILE D C   1 
ATOM   4976  O  O   . ILE D  1 19  ? -48.368  103.978 13.556  1.00 22.76  ? 19  ILE D O   1 
ATOM   4977  C  CB  . ILE D  1 19  ? -45.567  104.285 12.281  1.00 34.30  ? 19  ILE D CB  1 
ATOM   4978  C  CG1 . ILE D  1 19  ? -44.708  104.374 13.549  1.00 32.02  ? 19  ILE D CG1 1 
ATOM   4979  C  CG2 . ILE D  1 19  ? -46.364  105.564 11.999  1.00 15.04  ? 19  ILE D CG2 1 
ATOM   4980  C  CD1 . ILE D  1 19  ? -43.635  105.448 13.478  1.00 13.54  ? 19  ILE D CD1 1 
ATOM   4981  N  N   . PRO D  1 20  ? -47.369  102.172 14.433  1.00 20.92  ? 20  PRO D N   1 
ATOM   4982  C  CA  . PRO D  1 20  ? -48.335  102.016 15.517  1.00 16.83  ? 20  PRO D CA  1 
ATOM   4983  C  C   . PRO D  1 20  ? -48.144  103.092 16.577  1.00 34.23  ? 20  PRO D C   1 
ATOM   4984  O  O   . PRO D  1 20  ? -47.994  102.754 17.750  1.00 31.59  ? 20  PRO D O   1 
ATOM   4985  C  CB  . PRO D  1 20  ? -47.977  100.646 16.092  1.00 16.49  ? 20  PRO D CB  1 
ATOM   4986  C  CG  . PRO D  1 20  ? -46.495  100.545 15.869  1.00 22.25  ? 20  PRO D CG  1 
ATOM   4987  C  CD  . PRO D  1 20  ? -46.213  101.271 14.580  1.00 24.29  ? 20  PRO D CD  1 
ATOM   4988  N  N   . THR D  1 21  ? -48.119  104.364 16.178  1.00 7.48   ? 21  THR D N   1 
ATOM   4989  C  CA  . THR D  1 21  ? -48.015  105.466 17.152  1.00 32.47  ? 21  THR D CA  1 
ATOM   4990  C  C   . THR D  1 21  ? -49.275  105.688 17.993  1.00 35.21  ? 21  THR D C   1 
ATOM   4991  O  O   . THR D  1 21  ? -50.201  106.354 17.539  1.00 28.96  ? 21  THR D O   1 
ATOM   4992  C  CB  . THR D  1 21  ? -47.730  106.828 16.478  1.00 21.83  ? 21  THR D CB  1 
ATOM   4993  O  OG1 . THR D  1 21  ? -48.245  106.828 15.140  1.00 20.67  ? 21  THR D OG1 1 
ATOM   4994  C  CG2 . THR D  1 21  ? -46.249  107.133 16.471  1.00 18.72  ? 21  THR D CG2 1 
ATOM   4995  N  N   . GLN D  1 22  ? -49.299  105.175 19.221  1.00 30.46  ? 22  GLN D N   1 
ATOM   4996  C  CA  . GLN D  1 22  ? -50.410  105.473 20.129  1.00 44.94  ? 22  GLN D CA  1 
ATOM   4997  C  C   . GLN D  1 22  ? -50.578  106.987 20.358  1.00 32.86  ? 22  GLN D C   1 
ATOM   4998  O  O   . GLN D  1 22  ? -49.607  107.726 20.398  1.00 35.95  ? 22  GLN D O   1 
ATOM   4999  C  CB  . GLN D  1 22  ? -50.260  104.726 21.466  1.00 48.47  ? 22  GLN D CB  1 
ATOM   5000  C  CG  . GLN D  1 22  ? -50.929  103.334 21.509  1.00 80.80  ? 22  GLN D CG  1 
ATOM   5001  C  CD  . GLN D  1 22  ? -52.466  103.384 21.432  1.00 99.28  ? 22  GLN D CD  1 
ATOM   5002  O  OE1 . GLN D  1 22  ? -53.052  103.190 20.362  1.00 93.46  ? 22  GLN D OE1 1 
ATOM   5003  N  NE2 . GLN D  1 22  ? -53.117  103.628 22.574  1.00 93.34  ? 22  GLN D NE2 1 
ATOM   5004  N  N   . ARG D  1 23  ? -51.828  107.425 20.481  1.00 56.28  ? 23  ARG D N   1 
ATOM   5005  C  CA  . ARG D  1 23  ? -52.188  108.823 20.755  1.00 47.10  ? 23  ARG D CA  1 
ATOM   5006  C  C   . ARG D  1 23  ? -51.074  109.868 20.534  1.00 53.38  ? 23  ARG D C   1 
ATOM   5007  O  O   . ARG D  1 23  ? -50.624  110.523 21.476  1.00 51.32  ? 23  ARG D O   1 
ATOM   5008  C  CB  . ARG D  1 23  ? -52.747  108.938 22.173  1.00 46.80  ? 23  ARG D CB  1 
ATOM   5009  C  CG  . ARG D  1 23  ? -53.469  107.677 22.663  1.00 60.63  ? 23  ARG D CG  1 
ATOM   5010  C  CD  . ARG D  1 23  ? -53.360  107.493 24.193  1.00 74.57  ? 23  ARG D CD  1 
ATOM   5011  N  NE  . ARG D  1 23  ? -53.978  108.582 24.958  1.00 80.67  ? 23  ARG D NE  1 
ATOM   5012  C  CZ  . ARG D  1 23  ? -53.303  109.512 25.636  1.00 88.11  ? 23  ARG D CZ  1 
ATOM   5013  N  NH1 . ARG D  1 23  ? -51.976  109.498 25.657  1.00 93.88  ? 23  ARG D NH1 1 
ATOM   5014  N  NH2 . ARG D  1 23  ? -53.957  110.459 26.296  1.00 77.14  ? 23  ARG D NH2 1 
ATOM   5015  N  N   . ASP D  1 24  ? -50.637  110.018 19.287  1.00 55.81  ? 24  ASP D N   1 
ATOM   5016  C  CA  . ASP D  1 24  ? -49.721  111.101 18.901  1.00 52.24  ? 24  ASP D CA  1 
ATOM   5017  C  C   . ASP D  1 24  ? -48.273  111.005 19.440  1.00 51.77  ? 24  ASP D C   1 
ATOM   5018  O  O   . ASP D  1 24  ? -47.353  111.598 18.865  1.00 40.06  ? 24  ASP D O   1 
ATOM   5019  C  CB  . ASP D  1 24  ? -50.355  112.472 19.185  1.00 35.85  ? 24  ASP D CB  1 
ATOM   5020  C  CG  . ASP D  1 24  ? -49.452  113.390 19.984  1.00 54.28  ? 24  ASP D CG  1 
ATOM   5021  O  OD1 . ASP D  1 24  ? -49.490  113.308 21.233  1.00 53.34  ? 24  ASP D OD1 1 
ATOM   5022  O  OD2 . ASP D  1 24  ? -48.723  114.206 19.369  1.00 50.65  ? 24  ASP D OD2 1 
ATOM   5023  N  N   . ARG D  1 25  ? -48.066  110.252 20.518  1.00 37.00  ? 25  ARG D N   1 
ATOM   5024  C  CA  . ARG D  1 25  ? -46.717  110.023 21.034  1.00 38.81  ? 25  ARG D CA  1 
ATOM   5025  C  C   . ARG D  1 25  ? -45.927  109.083 20.103  1.00 44.07  ? 25  ARG D C   1 
ATOM   5026  O  O   . ARG D  1 25  ? -46.527  108.345 19.312  1.00 39.88  ? 25  ARG D O   1 
ATOM   5027  C  CB  . ARG D  1 25  ? -46.790  109.488 22.465  1.00 48.03  ? 25  ARG D CB  1 
ATOM   5028  C  CG  . ARG D  1 25  ? -47.788  110.267 23.310  1.00 70.50  ? 25  ARG D CG  1 
ATOM   5029  C  CD  . ARG D  1 25  ? -47.747  109.910 24.789  1.00 93.45  ? 25  ARG D CD  1 
ATOM   5030  N  NE  . ARG D  1 25  ? -48.916  110.454 25.488  1.00 112.58 ? 25  ARG D NE  1 
ATOM   5031  C  CZ  . ARG D  1 25  ? -48.968  111.648 26.077  1.00 104.14 ? 25  ARG D CZ  1 
ATOM   5032  N  NH1 . ARG D  1 25  ? -47.907  112.447 26.073  1.00 100.62 ? 25  ARG D NH1 1 
ATOM   5033  N  NH2 . ARG D  1 25  ? -50.086  112.042 26.676  1.00 89.63  ? 25  ARG D NH2 1 
ATOM   5034  N  N   . PRO D  1 26  ? -44.580  109.139 20.167  1.00 25.10  ? 26  PRO D N   1 
ATOM   5035  C  CA  . PRO D  1 26  ? -43.731  108.304 19.311  1.00 21.69  ? 26  PRO D CA  1 
ATOM   5036  C  C   . PRO D  1 26  ? -43.683  106.848 19.772  1.00 8.68   ? 26  PRO D C   1 
ATOM   5037  O  O   . PRO D  1 26  ? -43.804  106.577 20.955  1.00 26.20  ? 26  PRO D O   1 
ATOM   5038  C  CB  . PRO D  1 26  ? -42.346  108.937 19.474  1.00 28.29  ? 26  PRO D CB  1 
ATOM   5039  C  CG  . PRO D  1 26  ? -42.379  109.550 20.848  1.00 22.78  ? 26  PRO D CG  1 
ATOM   5040  C  CD  . PRO D  1 26  ? -43.787  110.053 21.011  1.00 18.74  ? 26  PRO D CD  1 
ATOM   5041  N  N   . VAL D  1 27  ? -43.526  105.924 18.836  1.00 17.01  ? 27  VAL D N   1 
ATOM   5042  C  CA  . VAL D  1 27  ? -43.287  104.533 19.181  1.00 16.56  ? 27  VAL D CA  1 
ATOM   5043  C  C   . VAL D  1 27  ? -41.909  104.415 19.827  1.00 32.36  ? 27  VAL D C   1 
ATOM   5044  O  O   . VAL D  1 27  ? -40.890  104.808 19.227  1.00 41.31  ? 27  VAL D O   1 
ATOM   5045  C  CB  . VAL D  1 27  ? -43.318  103.627 17.927  1.00 25.05  ? 27  VAL D CB  1 
ATOM   5046  C  CG1 . VAL D  1 27  ? -43.143  102.159 18.318  1.00 10.95  ? 27  VAL D CG1 1 
ATOM   5047  C  CG2 . VAL D  1 27  ? -44.607  103.826 17.161  1.00 32.96  ? 27  VAL D CG2 1 
ATOM   5048  N  N   . ALA D  1 28  ? -41.862  103.884 21.043  1.00 12.98  ? 28  ALA D N   1 
ATOM   5049  C  CA  . ALA D  1 28  ? -40.579  103.690 21.708  1.00 23.22  ? 28  ALA D CA  1 
ATOM   5050  C  C   . ALA D  1 28  ? -39.901  102.382 21.277  1.00 24.01  ? 28  ALA D C   1 
ATOM   5051  O  O   . ALA D  1 28  ? -40.335  101.297 21.665  1.00 17.75  ? 28  ALA D O   1 
ATOM   5052  C  CB  . ALA D  1 28  ? -40.766  103.710 23.190  1.00 11.69  ? 28  ALA D CB  1 
ATOM   5053  N  N   . VAL D  1 29  ? -38.837  102.500 20.486  1.00 10.78  ? 29  VAL D N   1 
ATOM   5054  C  CA  . VAL D  1 29  ? -38.101  101.344 20.006  1.00 10.91  ? 29  VAL D CA  1 
ATOM   5055  C  C   . VAL D  1 29  ? -36.843  101.138 20.834  1.00 14.61  ? 29  VAL D C   1 
ATOM   5056  O  O   . VAL D  1 29  ? -36.064  102.066 21.047  1.00 31.51  ? 29  VAL D O   1 
ATOM   5057  C  CB  . VAL D  1 29  ? -37.684  101.522 18.533  1.00 18.52  ? 29  VAL D CB  1 
ATOM   5058  C  CG1 . VAL D  1 29  ? -36.926  100.304 18.040  1.00 10.61  ? 29  VAL D CG1 1 
ATOM   5059  C  CG2 . VAL D  1 29  ? -38.894  101.795 17.667  1.00 9.38   ? 29  VAL D CG2 1 
ATOM   5060  N  N   . SER D  1 30  ? -36.640  99.917  21.309  1.00 30.22  ? 30  SER D N   1 
ATOM   5061  C  CA  . SER D  1 30  ? -35.417  99.571  22.030  1.00 23.49  ? 30  SER D CA  1 
ATOM   5062  C  C   . SER D  1 30  ? -34.461  98.815  21.111  1.00 24.14  ? 30  SER D C   1 
ATOM   5063  O  O   . SER D  1 30  ? -34.865  97.874  20.429  1.00 35.87  ? 30  SER D O   1 
ATOM   5064  C  CB  . SER D  1 30  ? -35.739  98.738  23.274  1.00 17.76  ? 30  SER D CB  1 
ATOM   5065  O  OG  . SER D  1 30  ? -36.095  99.570  24.359  1.00 37.17  ? 30  SER D OG  1 
ATOM   5066  N  N   . VAL D  1 31  ? -33.204  99.247  21.074  1.00 21.54  ? 31  VAL D N   1 
ATOM   5067  C  CA  . VAL D  1 31  ? -32.204  98.590  20.245  1.00 29.14  ? 31  VAL D CA  1 
ATOM   5068  C  C   . VAL D  1 31  ? -30.985  98.219  21.063  1.00 22.41  ? 31  VAL D C   1 
ATOM   5069  O  O   . VAL D  1 31  ? -30.488  99.001  21.849  1.00 30.50  ? 31  VAL D O   1 
ATOM   5070  C  CB  . VAL D  1 31  ? -31.739  99.467  19.070  1.00 31.03  ? 31  VAL D CB  1 
ATOM   5071  C  CG1 . VAL D  1 31  ? -31.114  98.600  17.989  1.00 31.32  ? 31  VAL D CG1 1 
ATOM   5072  C  CG2 . VAL D  1 31  ? -32.893  100.229 18.502  1.00 30.71  ? 31  VAL D CG2 1 
ATOM   5073  N  N   . SER D  1 32  ? -30.503  97.008  20.852  1.00 32.46  ? 32  SER D N   1 
ATOM   5074  C  CA  . SER D  1 32  ? -29.331  96.517  21.542  1.00 32.19  ? 32  SER D CA  1 
ATOM   5075  C  C   . SER D  1 32  ? -28.592  95.547  20.616  1.00 35.81  ? 32  SER D C   1 
ATOM   5076  O  O   . SER D  1 32  ? -29.211  94.671  20.019  1.00 43.31  ? 32  SER D O   1 
ATOM   5077  C  CB  . SER D  1 32  ? -29.754  95.824  22.835  1.00 32.90  ? 32  SER D CB  1 
ATOM   5078  O  OG  . SER D  1 32  ? -28.632  95.322  23.540  1.00 54.19  ? 32  SER D OG  1 
ATOM   5079  N  N   . LEU D  1 33  ? -27.279  95.719  20.474  1.00 34.46  ? 33  LEU D N   1 
ATOM   5080  C  CA  . LEU D  1 33  ? -26.479  94.801  19.670  1.00 18.76  ? 33  LEU D CA  1 
ATOM   5081  C  C   . LEU D  1 33  ? -25.776  93.761  20.537  1.00 27.89  ? 33  LEU D C   1 
ATOM   5082  O  O   . LEU D  1 33  ? -25.008  94.113  21.441  1.00 26.76  ? 33  LEU D O   1 
ATOM   5083  C  CB  . LEU D  1 33  ? -25.455  95.567  18.852  1.00 18.95  ? 33  LEU D CB  1 
ATOM   5084  C  CG  . LEU D  1 33  ? -26.031  96.611  17.891  1.00 31.06  ? 33  LEU D CG  1 
ATOM   5085  C  CD1 . LEU D  1 33  ? -24.958  97.143  16.961  1.00 18.15  ? 33  LEU D CD1 1 
ATOM   5086  C  CD2 . LEU D  1 33  ? -27.180  96.023  17.092  1.00 16.71  ? 33  LEU D CD2 1 
ATOM   5087  N  N   . LYS D  1 34  ? -26.056  92.485  20.280  1.00 25.74  ? 34  LYS D N   1 
ATOM   5088  C  CA  . LYS D  1 34  ? -25.364  91.395  20.958  1.00 20.77  ? 34  LYS D CA  1 
ATOM   5089  C  C   . LYS D  1 34  ? -24.341  90.851  19.986  1.00 24.04  ? 34  LYS D C   1 
ATOM   5090  O  O   . LYS D  1 34  ? -24.701  90.142  19.043  1.00 24.31  ? 34  LYS D O   1 
ATOM   5091  C  CB  . LYS D  1 34  ? -26.334  90.274  21.349  1.00 29.74  ? 34  LYS D CB  1 
ATOM   5092  C  CG  . LYS D  1 34  ? -27.649  90.743  21.973  1.00 40.49  ? 34  LYS D CG  1 
ATOM   5093  C  CD  . LYS D  1 34  ? -27.469  91.264  23.407  1.00 54.15  ? 34  LYS D CD  1 
ATOM   5094  C  CE  . LYS D  1 34  ? -28.817  91.560  24.051  1.00 54.02  ? 34  LYS D CE  1 
ATOM   5095  N  NZ  . LYS D  1 34  ? -28.703  92.285  25.338  1.00 55.14  ? 34  LYS D NZ  1 
ATOM   5096  N  N   . PHE D  1 35  ? -23.067  91.194  20.193  1.00 31.27  ? 35  PHE D N   1 
ATOM   5097  C  CA  . PHE D  1 35  ? -22.024  90.811  19.241  1.00 25.26  ? 35  PHE D CA  1 
ATOM   5098  C  C   . PHE D  1 35  ? -21.680  89.338  19.298  1.00 22.86  ? 35  PHE D C   1 
ATOM   5099  O  O   . PHE D  1 35  ? -21.497  88.775  20.367  1.00 26.88  ? 35  PHE D O   1 
ATOM   5100  C  CB  . PHE D  1 35  ? -20.785  91.648  19.445  1.00 24.51  ? 35  PHE D CB  1 
ATOM   5101  C  CG  . PHE D  1 35  ? -20.959  93.078  19.045  1.00 34.44  ? 35  PHE D CG  1 
ATOM   5102  C  CD1 . PHE D  1 35  ? -20.854  93.456  17.714  1.00 22.11  ? 35  PHE D CD1 1 
ATOM   5103  C  CD2 . PHE D  1 35  ? -21.215  94.047  20.001  1.00 27.42  ? 35  PHE D CD2 1 
ATOM   5104  C  CE1 . PHE D  1 35  ? -21.000  94.780  17.347  1.00 30.92  ? 35  PHE D CE1 1 
ATOM   5105  C  CE2 . PHE D  1 35  ? -21.364  95.371  19.638  1.00 31.91  ? 35  PHE D CE2 1 
ATOM   5106  C  CZ  . PHE D  1 35  ? -21.261  95.737  18.312  1.00 28.15  ? 35  PHE D CZ  1 
ATOM   5107  N  N   . ILE D  1 36  ? -21.597  88.722  18.130  1.00 22.35  ? 36  ILE D N   1 
ATOM   5108  C  CA  . ILE D  1 36  ? -21.376  87.294  18.041  1.00 26.88  ? 36  ILE D CA  1 
ATOM   5109  C  C   . ILE D  1 36  ? -19.984  86.997  17.509  1.00 33.73  ? 36  ILE D C   1 
ATOM   5110  O  O   . ILE D  1 36  ? -19.325  86.055  17.964  1.00 24.99  ? 36  ILE D O   1 
ATOM   5111  C  CB  . ILE D  1 36  ? -22.410  86.633  17.114  1.00 29.44  ? 36  ILE D CB  1 
ATOM   5112  C  CG1 . ILE D  1 36  ? -23.829  87.070  17.493  1.00 20.58  ? 36  ILE D CG1 1 
ATOM   5113  C  CG2 . ILE D  1 36  ? -22.281  85.124  17.172  1.00 21.88  ? 36  ILE D CG2 1 
ATOM   5114  C  CD1 . ILE D  1 36  ? -24.247  86.691  18.926  1.00 21.16  ? 36  ILE D CD1 1 
ATOM   5115  N  N   . ASN D  1 37  ? -19.533  87.810  16.559  1.00 23.23  ? 37  ASN D N   1 
ATOM   5116  C  CA  . ASN D  1 37  ? -18.247  87.567  15.925  1.00 24.75  ? 37  ASN D CA  1 
ATOM   5117  C  C   . ASN D  1 37  ? -17.695  88.802  15.234  1.00 28.75  ? 37  ASN D C   1 
ATOM   5118  O  O   . ASN D  1 37  ? -18.451  89.691  14.832  1.00 22.94  ? 37  ASN D O   1 
ATOM   5119  C  CB  . ASN D  1 37  ? -18.340  86.400  14.924  1.00 23.52  ? 37  ASN D CB  1 
ATOM   5120  C  CG  . ASN D  1 37  ? -17.083  85.535  14.909  1.00 33.68  ? 37  ASN D CG  1 
ATOM   5121  O  OD1 . ASN D  1 37  ? -15.968  86.031  15.068  1.00 25.63  ? 37  ASN D OD1 1 
ATOM   5122  N  ND2 . ASN D  1 37  ? -17.265  84.234  14.731  1.00 32.74  ? 37  ASN D ND2 1 
ATOM   5123  N  N   . ILE D  1 38  ? -16.369  88.861  15.122  1.00 28.97  ? 38  ILE D N   1 
ATOM   5124  C  CA  . ILE D  1 38  ? -15.722  89.865  14.299  1.00 24.98  ? 38  ILE D CA  1 
ATOM   5125  C  C   . ILE D  1 38  ? -14.879  89.087  13.310  1.00 31.38  ? 38  ILE D C   1 
ATOM   5126  O  O   . ILE D  1 38  ? -14.019  88.312  13.712  1.00 39.24  ? 38  ILE D O   1 
ATOM   5127  C  CB  . ILE D  1 38  ? -14.880  90.803  15.145  1.00 26.08  ? 38  ILE D CB  1 
ATOM   5128  C  CG1 . ILE D  1 38  ? -15.755  91.415  16.238  1.00 26.15  ? 38  ILE D CG1 1 
ATOM   5129  C  CG2 . ILE D  1 38  ? -14.294  91.881  14.289  1.00 26.07  ? 38  ILE D CG2 1 
ATOM   5130  C  CD1 . ILE D  1 38  ? -15.051  92.336  17.178  1.00 26.90  ? 38  ILE D CD1 1 
ATOM   5131  N  N   . LEU D  1 39  ? -15.138  89.268  12.021  1.00 24.46  ? 39  LEU D N   1 
ATOM   5132  C  CA  . LEU D  1 39  ? -14.652  88.325  11.019  1.00 26.69  ? 39  LEU D CA  1 
ATOM   5133  C  C   . LEU D  1 39  ? -13.452  88.810  10.243  1.00 45.55  ? 39  LEU D C   1 
ATOM   5134  O  O   . LEU D  1 39  ? -12.568  88.034  9.869   1.00 55.63  ? 39  LEU D O   1 
ATOM   5135  C  CB  . LEU D  1 39  ? -15.770  87.974  10.040  1.00 23.04  ? 39  LEU D CB  1 
ATOM   5136  C  CG  . LEU D  1 39  ? -16.924  87.258  10.737  1.00 42.60  ? 39  LEU D CG  1 
ATOM   5137  C  CD1 . LEU D  1 39  ? -17.993  86.855  9.738   1.00 35.34  ? 39  LEU D CD1 1 
ATOM   5138  C  CD2 . LEU D  1 39  ? -16.389  86.045  11.493  1.00 35.72  ? 39  LEU D CD2 1 
ATOM   5139  N  N   . GLU D  1 40  ? -13.421  90.096  9.977   1.00 35.24  ? 40  GLU D N   1 
ATOM   5140  C  CA  . GLU D  1 40  ? -12.267  90.615  9.287   1.00 29.30  ? 40  GLU D CA  1 
ATOM   5141  C  C   . GLU D  1 40  ? -12.194  92.053  9.669   1.00 38.56  ? 40  GLU D C   1 
ATOM   5142  O  O   . GLU D  1 40  ? -13.216  92.733  9.804   1.00 47.84  ? 40  GLU D O   1 
ATOM   5143  C  CB  . GLU D  1 40  ? -12.384  90.439  7.779   1.00 18.06  ? 40  GLU D CB  1 
ATOM   5144  C  CG  . GLU D  1 40  ? -11.143  90.848  7.029   1.00 43.38  ? 40  GLU D CG  1 
ATOM   5145  C  CD  . GLU D  1 40  ? -11.426  91.240  5.586   1.00 48.67  ? 40  GLU D CD  1 
ATOM   5146  O  OE1 . GLU D  1 40  ? -12.113  90.450  4.880   1.00 35.60  ? 40  GLU D OE1 1 
ATOM   5147  O  OE2 . GLU D  1 40  ? -10.956  92.343  5.176   1.00 17.18  ? 40  GLU D OE2 1 
ATOM   5148  N  N   . VAL D  1 41  ? -10.971  92.478  9.915   1.00 34.10  ? 41  VAL D N   1 
ATOM   5149  C  CA  . VAL D  1 41  ? -10.684  93.829  10.305  1.00 27.57  ? 41  VAL D CA  1 
ATOM   5150  C  C   . VAL D  1 41  ? -9.666   94.357  9.310   1.00 33.03  ? 41  VAL D C   1 
ATOM   5151  O  O   . VAL D  1 41  ? -8.816   93.603  8.824   1.00 35.16  ? 41  VAL D O   1 
ATOM   5152  C  CB  . VAL D  1 41  ? -10.110  93.854  11.727  1.00 23.40  ? 41  VAL D CB  1 
ATOM   5153  C  CG1 . VAL D  1 41  ? -9.453   95.175  12.000  1.00 33.30  ? 41  VAL D CG1 1 
ATOM   5154  C  CG2 . VAL D  1 41  ? -11.198  93.585  12.745  1.00 32.55  ? 41  VAL D CG2 1 
ATOM   5155  N  N   . ASN D  1 42  ? -9.764   95.635  8.967   1.00 13.93  ? 42  ASN D N   1 
ATOM   5156  C  CA  . ASN D  1 42  ? -8.734   96.252  8.145   1.00 22.26  ? 42  ASN D CA  1 
ATOM   5157  C  C   . ASN D  1 42  ? -8.305   97.620  8.671   1.00 28.77  ? 42  ASN D C   1 
ATOM   5158  O  O   . ASN D  1 42  ? -9.019   98.607  8.497   1.00 31.22  ? 42  ASN D O   1 
ATOM   5159  C  CB  . ASN D  1 42  ? -9.214   96.364  6.703   1.00 27.89  ? 42  ASN D CB  1 
ATOM   5160  C  CG  . ASN D  1 42  ? -8.097   96.772  5.738   1.00 39.39  ? 42  ASN D CG  1 
ATOM   5161  O  OD1 . ASN D  1 42  ? -7.248   97.614  6.055   1.00 38.06  ? 42  ASN D OD1 1 
ATOM   5162  N  ND2 . ASN D  1 42  ? -8.097   96.168  4.550   1.00 24.12  ? 42  ASN D ND2 1 
ATOM   5163  N  N   . GLU D  1 43  ? -7.136   97.681  9.306   1.00 17.74  ? 43  GLU D N   1 
ATOM   5164  C  CA  . GLU D  1 43  ? -6.726   98.907  9.977   1.00 25.04  ? 43  GLU D CA  1 
ATOM   5165  C  C   . GLU D  1 43  ? -6.375   100.004 9.002   1.00 31.41  ? 43  GLU D C   1 
ATOM   5166  O  O   . GLU D  1 43  ? -6.443   101.184 9.362   1.00 22.19  ? 43  GLU D O   1 
ATOM   5167  C  CB  . GLU D  1 43  ? -5.570   98.665  10.946  1.00 25.67  ? 43  GLU D CB  1 
ATOM   5168  C  CG  . GLU D  1 43  ? -5.329   99.840  11.897  1.00 42.81  ? 43  GLU D CG  1 
ATOM   5169  C  CD  . GLU D  1 43  ? -4.406   99.490  13.066  1.00 48.77  ? 43  GLU D CD  1 
ATOM   5170  O  OE1 . GLU D  1 43  ? -4.013   98.307  13.186  1.00 49.43  ? 43  GLU D OE1 1 
ATOM   5171  O  OE2 . GLU D  1 43  ? -4.070   100.399 13.864  1.00 36.09  ? 43  GLU D OE2 1 
ATOM   5172  N  N   . ILE D  1 44  ? -6.004   99.603  7.778   1.00 38.29  ? 44  ILE D N   1 
ATOM   5173  C  CA  . ILE D  1 44  ? -5.712   100.533 6.684   1.00 33.70  ? 44  ILE D CA  1 
ATOM   5174  C  C   . ILE D  1 44  ? -6.983   101.208 6.153   1.00 34.03  ? 44  ILE D C   1 
ATOM   5175  O  O   . ILE D  1 44  ? -7.084   102.436 6.140   1.00 28.60  ? 44  ILE D O   1 
ATOM   5176  C  CB  . ILE D  1 44  ? -5.023   99.826  5.501   1.00 48.01  ? 44  ILE D CB  1 
ATOM   5177  C  CG1 . ILE D  1 44  ? -3.791   99.042  5.967   1.00 51.94  ? 44  ILE D CG1 1 
ATOM   5178  C  CG2 . ILE D  1 44  ? -4.653   100.845 4.411   1.00 38.06  ? 44  ILE D CG2 1 
ATOM   5179  C  CD1 . ILE D  1 44  ? -2.620   99.914  6.451   1.00 32.83  ? 44  ILE D CD1 1 
ATOM   5180  N  N   . THR D  1 45  ? -7.946   100.398 5.716   1.00 29.76  ? 45  THR D N   1 
ATOM   5181  C  CA  . THR D  1 45  ? -9.202   100.912 5.167   1.00 28.75  ? 45  THR D CA  1 
ATOM   5182  C  C   . THR D  1 45  ? -10.197  101.376 6.216   1.00 21.08  ? 45  THR D C   1 
ATOM   5183  O  O   . THR D  1 45  ? -11.159  102.054 5.882   1.00 28.12  ? 45  THR D O   1 
ATOM   5184  C  CB  . THR D  1 45  ? -9.904   99.865  4.276   1.00 28.81  ? 45  THR D CB  1 
ATOM   5185  O  OG1 . THR D  1 45  ? -10.336  98.740  5.063   1.00 21.31  ? 45  THR D OG1 1 
ATOM   5186  C  CG2 . THR D  1 45  ? -8.957   99.402  3.191   1.00 16.55  ? 45  THR D CG2 1 
ATOM   5187  N  N   . ASN D  1 46  ? -9.954   101.017 7.478   1.00 32.79  ? 46  ASN D N   1 
ATOM   5188  C  CA  . ASN D  1 46  ? -10.889  101.327 8.567   1.00 28.34  ? 46  ASN D CA  1 
ATOM   5189  C  C   . ASN D  1 46  ? -12.265  100.703 8.322   1.00 29.11  ? 46  ASN D C   1 
ATOM   5190  O  O   . ASN D  1 46  ? -13.293  101.387 8.372   1.00 28.68  ? 46  ASN D O   1 
ATOM   5191  C  CB  . ASN D  1 46  ? -11.020  102.841 8.770   1.00 21.97  ? 46  ASN D CB  1 
ATOM   5192  C  CG  . ASN D  1 46  ? -10.173  103.357 9.929   1.00 32.13  ? 46  ASN D CG  1 
ATOM   5193  O  OD1 . ASN D  1 46  ? -9.870   102.637 10.878  1.00 28.11  ? 46  ASN D OD1 1 
ATOM   5194  N  ND2 . ASN D  1 46  ? -9.806   104.619 9.857   1.00 31.04  ? 46  ASN D ND2 1 
ATOM   5195  N  N   . GLU D  1 47  ? -12.260  99.402  8.037   1.00 23.75  ? 47  GLU D N   1 
ATOM   5196  C  CA  . GLU D  1 47  ? -13.479  98.646  7.782   1.00 37.98  ? 47  GLU D CA  1 
ATOM   5197  C  C   . GLU D  1 47  ? -13.473  97.367  8.615   1.00 36.56  ? 47  GLU D C   1 
ATOM   5198  O  O   . GLU D  1 47  ? -12.442  96.703  8.729   1.00 44.32  ? 47  GLU D O   1 
ATOM   5199  C  CB  . GLU D  1 47  ? -13.625  98.338  6.287   1.00 11.06  ? 47  GLU D CB  1 
ATOM   5200  C  CG  . GLU D  1 47  ? -13.650  99.597  5.429   1.00 19.49  ? 47  GLU D CG  1 
ATOM   5201  C  CD  . GLU D  1 47  ? -13.602  99.308  3.940   1.00 35.90  ? 47  GLU D CD  1 
ATOM   5202  O  OE1 . GLU D  1 47  ? -13.980  98.173  3.550   1.00 29.63  ? 47  GLU D OE1 1 
ATOM   5203  O  OE2 . GLU D  1 47  ? -13.187  100.218 3.173   1.00 28.58  ? 47  GLU D OE2 1 
ATOM   5204  N  N   . VAL D  1 48  ? -14.610  97.045  9.226   1.00 22.25  ? 48  VAL D N   1 
ATOM   5205  C  CA  . VAL D  1 48  ? -14.728  95.805  9.978   1.00 17.78  ? 48  VAL D CA  1 
ATOM   5206  C  C   . VAL D  1 48  ? -15.904  94.988  9.497   1.00 33.03  ? 48  VAL D C   1 
ATOM   5207  O  O   . VAL D  1 48  ? -16.899  95.529  9.010   1.00 32.04  ? 48  VAL D O   1 
ATOM   5208  C  CB  . VAL D  1 48  ? -14.922  96.052  11.468  1.00 21.55  ? 48  VAL D CB  1 
ATOM   5209  C  CG1 . VAL D  1 48  ? -13.690  96.718  12.036  1.00 48.84  ? 48  VAL D CG1 1 
ATOM   5210  C  CG2 . VAL D  1 48  ? -16.125  96.913  11.697  1.00 28.94  ? 48  VAL D CG2 1 
ATOM   5211  N  N   . ASP D  1 49  ? -15.781  93.675  9.634   1.00 37.12  ? 49  ASP D N   1 
ATOM   5212  C  CA  . ASP D  1 49  ? -16.860  92.776  9.270   1.00 27.29  ? 49  ASP D CA  1 
ATOM   5213  C  C   . ASP D  1 49  ? -17.357  92.168  10.566  1.00 20.48  ? 49  ASP D C   1 
ATOM   5214  O  O   . ASP D  1 49  ? -16.611  91.474  11.263  1.00 48.67  ? 49  ASP D O   1 
ATOM   5215  C  CB  . ASP D  1 49  ? -16.342  91.709  8.314   1.00 40.32  ? 49  ASP D CB  1 
ATOM   5216  C  CG  . ASP D  1 49  ? -17.441  91.062  7.517   1.00 33.37  ? 49  ASP D CG  1 
ATOM   5217  O  OD1 . ASP D  1 49  ? -18.473  90.744  8.117   1.00 42.32  ? 49  ASP D OD1 1 
ATOM   5218  O  OD2 . ASP D  1 49  ? -17.272  90.863  6.296   1.00 37.48  ? 49  ASP D OD2 1 
ATOM   5219  N  N   . VAL D  1 50  ? -18.605  92.462  10.908  1.00 10.81  ? 50  VAL D N   1 
ATOM   5220  C  CA  . VAL D  1 50  ? -19.174  92.064  12.198  1.00 29.59  ? 50  VAL D CA  1 
ATOM   5221  C  C   . VAL D  1 50  ? -20.426  91.185  12.103  1.00 28.72  ? 50  VAL D C   1 
ATOM   5222  O  O   . VAL D  1 50  ? -21.223  91.315  11.176  1.00 29.12  ? 50  VAL D O   1 
ATOM   5223  C  CB  . VAL D  1 50  ? -19.497  93.304  13.048  1.00 20.68  ? 50  VAL D CB  1 
ATOM   5224  C  CG1 . VAL D  1 50  ? -20.112  92.896  14.365  1.00 38.15  ? 50  VAL D CG1 1 
ATOM   5225  C  CG2 . VAL D  1 50  ? -18.226  94.082  13.306  1.00 35.50  ? 50  VAL D CG2 1 
ATOM   5226  N  N   . VAL D  1 51  ? -20.576  90.272  13.057  1.00 8.27   ? 51  VAL D N   1 
ATOM   5227  C  CA  . VAL D  1 51  ? -21.807  89.512  13.195  1.00 20.72  ? 51  VAL D CA  1 
ATOM   5228  C  C   . VAL D  1 51  ? -22.445  89.785  14.564  1.00 24.74  ? 51  VAL D C   1 
ATOM   5229  O  O   . VAL D  1 51  ? -21.805  89.630  15.608  1.00 24.68  ? 51  VAL D O   1 
ATOM   5230  C  CB  . VAL D  1 51  ? -21.569  88.015  13.006  1.00 15.15  ? 51  VAL D CB  1 
ATOM   5231  C  CG1 . VAL D  1 51  ? -22.782  87.223  13.491  1.00 10.27  ? 51  VAL D CG1 1 
ATOM   5232  C  CG2 . VAL D  1 51  ? -21.282  87.726  11.554  1.00 14.56  ? 51  VAL D CG2 1 
ATOM   5233  N  N   . PHE D  1 52  ? -23.703  90.209  14.561  1.00 20.21  ? 52  PHE D N   1 
ATOM   5234  C  CA  . PHE D  1 52  ? -24.371  90.566  15.808  1.00 26.48  ? 52  PHE D CA  1 
ATOM   5235  C  C   . PHE D  1 52  ? -25.854  90.224  15.759  1.00 24.08  ? 52  PHE D C   1 
ATOM   5236  O  O   . PHE D  1 52  ? -26.460  90.255  14.697  1.00 25.67  ? 52  PHE D O   1 
ATOM   5237  C  CB  . PHE D  1 52  ? -24.215  92.068  16.068  1.00 18.61  ? 52  PHE D CB  1 
ATOM   5238  C  CG  . PHE D  1 52  ? -24.685  92.923  14.926  1.00 16.83  ? 52  PHE D CG  1 
ATOM   5239  C  CD1 . PHE D  1 52  ? -23.851  93.181  13.852  1.00 23.37  ? 52  PHE D CD1 1 
ATOM   5240  C  CD2 . PHE D  1 52  ? -25.968  93.448  14.909  1.00 25.22  ? 52  PHE D CD2 1 
ATOM   5241  C  CE1 . PHE D  1 52  ? -24.283  93.956  12.776  1.00 29.00  ? 52  PHE D CE1 1 
ATOM   5242  C  CE2 . PHE D  1 52  ? -26.407  94.227  13.841  1.00 18.68  ? 52  PHE D CE2 1 
ATOM   5243  C  CZ  . PHE D  1 52  ? -25.556  94.477  12.778  1.00 26.75  ? 52  PHE D CZ  1 
ATOM   5244  N  N   . TRP D  1 53  ? -26.431  89.897  16.910  1.00 7.51   ? 53  TRP D N   1 
ATOM   5245  C  CA  . TRP D  1 53  ? -27.869  89.836  17.041  1.00 11.88  ? 53  TRP D CA  1 
ATOM   5246  C  C   . TRP D  1 53  ? -28.373  91.242  17.216  1.00 14.27  ? 53  TRP D C   1 
ATOM   5247  O  O   . TRP D  1 53  ? -27.921  91.952  18.093  1.00 17.17  ? 53  TRP D O   1 
ATOM   5248  C  CB  . TRP D  1 53  ? -28.259  89.027  18.259  1.00 13.81  ? 53  TRP D CB  1 
ATOM   5249  C  CG  . TRP D  1 53  ? -27.900  87.589  18.184  1.00 7.94   ? 53  TRP D CG  1 
ATOM   5250  C  CD1 . TRP D  1 53  ? -27.299  86.948  17.153  1.00 23.88  ? 53  TRP D CD1 1 
ATOM   5251  C  CD2 . TRP D  1 53  ? -28.139  86.602  19.188  1.00 16.62  ? 53  TRP D CD2 1 
ATOM   5252  N  NE1 . TRP D  1 53  ? -27.136  85.617  17.452  1.00 26.94  ? 53  TRP D NE1 1 
ATOM   5253  C  CE2 . TRP D  1 53  ? -27.645  85.382  18.701  1.00 17.49  ? 53  TRP D CE2 1 
ATOM   5254  C  CE3 . TRP D  1 53  ? -28.739  86.629  20.451  1.00 16.76  ? 53  TRP D CE3 1 
ATOM   5255  C  CZ2 . TRP D  1 53  ? -27.714  84.200  19.439  1.00 16.32  ? 53  TRP D CZ2 1 
ATOM   5256  C  CZ3 . TRP D  1 53  ? -28.811  85.461  21.175  1.00 23.23  ? 53  TRP D CZ3 1 
ATOM   5257  C  CH2 . TRP D  1 53  ? -28.295  84.260  20.667  1.00 26.40  ? 53  TRP D CH2 1 
ATOM   5258  N  N   . GLN D  1 54  ? -29.309  91.653  16.373  1.00 22.53  ? 54  GLN D N   1 
ATOM   5259  C  CA  . GLN D  1 54  ? -29.888  92.984  16.514  1.00 26.97  ? 54  GLN D CA  1 
ATOM   5260  C  C   . GLN D  1 54  ? -31.215  92.912  17.265  1.00 28.84  ? 54  GLN D C   1 
ATOM   5261  O  O   . GLN D  1 54  ? -32.272  92.745  16.666  1.00 29.11  ? 54  GLN D O   1 
ATOM   5262  C  CB  . GLN D  1 54  ? -30.072  93.664  15.151  1.00 19.15  ? 54  GLN D CB  1 
ATOM   5263  C  CG  . GLN D  1 54  ? -30.476  95.131  15.275  1.00 21.71  ? 54  GLN D CG  1 
ATOM   5264  C  CD  . GLN D  1 54  ? -30.417  95.862  13.967  1.00 28.84  ? 54  GLN D CD  1 
ATOM   5265  O  OE1 . GLN D  1 54  ? -29.347  96.052  13.393  1.00 48.14  ? 54  GLN D OE1 1 
ATOM   5266  N  NE2 . GLN D  1 54  ? -31.571  96.277  13.478  1.00 44.36  ? 54  GLN D NE2 1 
ATOM   5267  N  N   . GLN D  1 55  ? -31.137  93.036  18.581  1.00 19.97  ? 55  GLN D N   1 
ATOM   5268  C  CA  . GLN D  1 55  ? -32.300  92.947  19.446  1.00 23.78  ? 55  GLN D CA  1 
ATOM   5269  C  C   . GLN D  1 55  ? -33.134  94.227  19.347  1.00 27.40  ? 55  GLN D C   1 
ATOM   5270  O  O   . GLN D  1 55  ? -32.668  95.310  19.714  1.00 18.62  ? 55  GLN D O   1 
ATOM   5271  C  CB  . GLN D  1 55  ? -31.852  92.724  20.892  1.00 15.57  ? 55  GLN D CB  1 
ATOM   5272  C  CG  . GLN D  1 55  ? -32.974  92.286  21.803  1.00 29.19  ? 55  GLN D CG  1 
ATOM   5273  C  CD  . GLN D  1 55  ? -32.640  92.457  23.264  1.00 33.35  ? 55  GLN D CD  1 
ATOM   5274  O  OE1 . GLN D  1 55  ? -32.470  91.476  23.986  1.00 43.78  ? 55  GLN D OE1 1 
ATOM   5275  N  NE2 . GLN D  1 55  ? -32.547  93.705  23.713  1.00 42.23  ? 55  GLN D NE2 1 
ATOM   5276  N  N   . THR D  1 56  ? -34.359  94.086  18.842  1.00 14.88  ? 56  THR D N   1 
ATOM   5277  C  CA  . THR D  1 56  ? -35.244  95.212  18.600  1.00 10.22  ? 56  THR D CA  1 
ATOM   5278  C  C   . THR D  1 56  ? -36.602  94.982  19.285  1.00 24.81  ? 56  THR D C   1 
ATOM   5279  O  O   . THR D  1 56  ? -37.206  93.908  19.181  1.00 17.94  ? 56  THR D O   1 
ATOM   5280  C  CB  . THR D  1 56  ? -35.456  95.428  17.085  1.00 13.16  ? 56  THR D CB  1 
ATOM   5281  O  OG1 . THR D  1 56  ? -34.208  95.316  16.403  1.00 34.78  ? 56  THR D OG1 1 
ATOM   5282  C  CG2 . THR D  1 56  ? -36.020  96.801  16.812  1.00 18.93  ? 56  THR D CG2 1 
ATOM   5283  N  N   . THR D  1 57  ? -37.093  96.008  19.966  1.00 25.31  ? 57  THR D N   1 
ATOM   5284  C  CA  . THR D  1 57  ? -38.279  95.869  20.806  1.00 15.07  ? 57  THR D CA  1 
ATOM   5285  C  C   . THR D  1 57  ? -39.209  97.060  20.683  1.00 19.71  ? 57  THR D C   1 
ATOM   5286  O  O   . THR D  1 57  ? -38.774  98.205  20.749  1.00 24.43  ? 57  THR D O   1 
ATOM   5287  C  CB  . THR D  1 57  ? -37.858  95.703  22.268  1.00 25.70  ? 57  THR D CB  1 
ATOM   5288  O  OG1 . THR D  1 57  ? -38.074  94.345  22.661  1.00 37.52  ? 57  THR D OG1 1 
ATOM   5289  C  CG2 . THR D  1 57  ? -38.639  96.636  23.181  1.00 26.78  ? 57  THR D CG2 1 
ATOM   5290  N  N   . TRP D  1 58  ? -40.494  96.795  20.488  1.00 15.23  ? 58  TRP D N   1 
ATOM   5291  C  CA  . TRP D  1 58  ? -41.474  97.875  20.438  1.00 15.38  ? 58  TRP D CA  1 
ATOM   5292  C  C   . TRP D  1 58  ? -42.898  97.390  20.683  1.00 25.23  ? 58  TRP D C   1 
ATOM   5293  O  O   . TRP D  1 58  ? -43.149  96.193  20.815  1.00 24.30  ? 58  TRP D O   1 
ATOM   5294  C  CB  . TRP D  1 58  ? -41.414  98.610  19.100  1.00 18.35  ? 58  TRP D CB  1 
ATOM   5295  C  CG  . TRP D  1 58  ? -41.904  97.796  17.963  1.00 13.92  ? 58  TRP D CG  1 
ATOM   5296  C  CD1 . TRP D  1 58  ? -43.167  97.762  17.473  1.00 28.96  ? 58  TRP D CD1 1 
ATOM   5297  C  CD2 . TRP D  1 58  ? -41.137  96.883  17.171  1.00 16.92  ? 58  TRP D CD2 1 
ATOM   5298  N  NE1 . TRP D  1 58  ? -43.245  96.882  16.420  1.00 22.77  ? 58  TRP D NE1 1 
ATOM   5299  C  CE2 . TRP D  1 58  ? -42.010  96.330  16.212  1.00 15.52  ? 58  TRP D CE2 1 
ATOM   5300  C  CE3 . TRP D  1 58  ? -39.796  96.479  17.178  1.00 15.06  ? 58  TRP D CE3 1 
ATOM   5301  C  CZ2 . TRP D  1 58  ? -41.594  95.389  15.274  1.00 9.56   ? 58  TRP D CZ2 1 
ATOM   5302  C  CZ3 . TRP D  1 58  ? -39.377  95.543  16.238  1.00 21.29  ? 58  TRP D CZ3 1 
ATOM   5303  C  CH2 . TRP D  1 58  ? -40.277  95.010  15.296  1.00 19.70  ? 58  TRP D CH2 1 
ATOM   5304  N  N   . SER D  1 59  ? -43.831  98.335  20.730  1.00 31.53  ? 59  SER D N   1 
ATOM   5305  C  CA  . SER D  1 59  ? -45.217  98.010  20.998  1.00 15.49  ? 59  SER D CA  1 
ATOM   5306  C  C   . SER D  1 59  ? -46.098  98.352  19.805  1.00 17.27  ? 59  SER D C   1 
ATOM   5307  O  O   . SER D  1 59  ? -46.072  99.481  19.311  1.00 25.25  ? 59  SER D O   1 
ATOM   5308  C  CB  . SER D  1 59  ? -45.693  98.762  22.230  1.00 19.39  ? 59  SER D CB  1 
ATOM   5309  O  OG  . SER D  1 59  ? -46.850  98.155  22.775  1.00 56.16  ? 59  SER D OG  1 
ATOM   5310  N  N   . ASP D  1 60  ? -46.862  97.365  19.340  1.00 17.10  ? 60  ASP D N   1 
ATOM   5311  C  CA  . ASP D  1 60  ? -47.915  97.572  18.334  1.00 18.73  ? 60  ASP D CA  1 
ATOM   5312  C  C   . ASP D  1 60  ? -49.246  97.061  18.894  1.00 21.70  ? 60  ASP D C   1 
ATOM   5313  O  O   . ASP D  1 60  ? -49.571  95.876  18.774  1.00 22.03  ? 60  ASP D O   1 
ATOM   5314  C  CB  . ASP D  1 60  ? -47.585  96.841  17.030  1.00 10.27  ? 60  ASP D CB  1 
ATOM   5315  C  CG  . ASP D  1 60  ? -48.493  97.239  15.892  1.00 25.85  ? 60  ASP D CG  1 
ATOM   5316  O  OD1 . ASP D  1 60  ? -49.551  97.834  16.153  1.00 16.15  ? 60  ASP D OD1 1 
ATOM   5317  O  OD2 . ASP D  1 60  ? -48.153  96.949  14.729  1.00 25.09  ? 60  ASP D OD2 1 
ATOM   5318  N  N   . ARG D  1 61  ? -50.014  97.952  19.512  1.00 16.51  ? 61  ARG D N   1 
ATOM   5319  C  CA  . ARG D  1 61  ? -51.232  97.526  20.190  1.00 24.26  ? 61  ARG D CA  1 
ATOM   5320  C  C   . ARG D  1 61  ? -52.202  96.821  19.248  1.00 30.04  ? 61  ARG D C   1 
ATOM   5321  O  O   . ARG D  1 61  ? -53.006  95.999  19.690  1.00 35.36  ? 61  ARG D O   1 
ATOM   5322  C  CB  . ARG D  1 61  ? -51.918  98.712  20.867  1.00 38.35  ? 61  ARG D CB  1 
ATOM   5323  C  CG  . ARG D  1 61  ? -51.074  99.370  21.956  1.00 65.09  ? 61  ARG D CG  1 
ATOM   5324  C  CD  . ARG D  1 61  ? -50.773  98.392  23.086  1.00 75.36  ? 61  ARG D CD  1 
ATOM   5325  N  NE  . ARG D  1 61  ? -49.757  98.906  24.004  1.00 89.23  ? 61  ARG D NE  1 
ATOM   5326  C  CZ  . ARG D  1 61  ? -50.012  99.609  25.106  1.00 93.89  ? 61  ARG D CZ  1 
ATOM   5327  N  NH1 . ARG D  1 61  ? -51.259  99.897  25.450  1.00 100.47 ? 61  ARG D NH1 1 
ATOM   5328  N  NH2 . ARG D  1 61  ? -49.015  100.026 25.873  1.00 82.62  ? 61  ARG D NH2 1 
ATOM   5329  N  N   . THR D  1 62  ? -52.128  97.133  17.956  1.00 19.29  ? 62  THR D N   1 
ATOM   5330  C  CA  . THR D  1 62  ? -53.075  96.578  16.991  1.00 13.87  ? 62  THR D CA  1 
ATOM   5331  C  C   . THR D  1 62  ? -52.899  95.075  16.816  1.00 25.67  ? 62  THR D C   1 
ATOM   5332  O  O   . THR D  1 62  ? -53.632  94.436  16.067  1.00 26.05  ? 62  THR D O   1 
ATOM   5333  C  CB  . THR D  1 62  ? -53.017  97.295  15.596  1.00 17.42  ? 62  THR D CB  1 
ATOM   5334  O  OG1 . THR D  1 62  ? -52.021  96.701  14.762  1.00 12.57  ? 62  THR D OG1 1 
ATOM   5335  C  CG2 . THR D  1 62  ? -52.715  98.765  15.755  1.00 23.56  ? 62  THR D CG2 1 
ATOM   5336  N  N   . LEU D  1 63  ? -51.927  94.504  17.510  1.00 29.08  ? 63  LEU D N   1 
ATOM   5337  C  CA  . LEU D  1 63  ? -51.670  93.075  17.372  1.00 26.84  ? 63  LEU D CA  1 
ATOM   5338  C  C   . LEU D  1 63  ? -52.262  92.321  18.554  1.00 23.51  ? 63  LEU D C   1 
ATOM   5339  O  O   . LEU D  1 63  ? -52.439  91.109  18.505  1.00 24.93  ? 63  LEU D O   1 
ATOM   5340  C  CB  . LEU D  1 63  ? -50.161  92.809  17.275  1.00 19.06  ? 63  LEU D CB  1 
ATOM   5341  C  CG  . LEU D  1 63  ? -49.384  93.415  16.114  1.00 21.99  ? 63  LEU D CG  1 
ATOM   5342  C  CD1 . LEU D  1 63  ? -47.899  93.193  16.298  1.00 6.45   ? 63  LEU D CD1 1 
ATOM   5343  C  CD2 . LEU D  1 63  ? -49.863  92.824  14.800  1.00 19.33  ? 63  LEU D CD2 1 
ATOM   5344  N  N   . ALA D  1 64  ? -52.560  93.057  19.619  1.00 25.86  ? 64  ALA D N   1 
ATOM   5345  C  CA  . ALA D  1 64  ? -52.957  92.469  20.895  1.00 22.45  ? 64  ALA D CA  1 
ATOM   5346  C  C   . ALA D  1 64  ? -54.197  91.587  20.796  1.00 17.96  ? 64  ALA D C   1 
ATOM   5347  O  O   . ALA D  1 64  ? -55.009  91.754  19.889  1.00 34.23  ? 64  ALA D O   1 
ATOM   5348  C  CB  . ALA D  1 64  ? -53.155  93.572  21.922  1.00 17.21  ? 64  ALA D CB  1 
ATOM   5349  N  N   . TRP D  1 65  ? -54.332  90.646  21.727  1.00 25.98  ? 65  TRP D N   1 
ATOM   5350  C  CA  . TRP D  1 65  ? -55.510  89.774  21.797  1.00 31.70  ? 65  TRP D CA  1 
ATOM   5351  C  C   . TRP D  1 65  ? -55.832  89.356  23.238  1.00 29.59  ? 65  TRP D C   1 
ATOM   5352  O  O   . TRP D  1 65  ? -54.956  89.366  24.102  1.00 27.42  ? 65  TRP D O   1 
ATOM   5353  C  CB  . TRP D  1 65  ? -55.322  88.549  20.890  1.00 14.42  ? 65  TRP D CB  1 
ATOM   5354  C  CG  . TRP D  1 65  ? -54.268  87.591  21.340  1.00 31.52  ? 65  TRP D CG  1 
ATOM   5355  C  CD1 . TRP D  1 65  ? -54.432  86.535  22.186  1.00 41.93  ? 65  TRP D CD1 1 
ATOM   5356  C  CD2 . TRP D  1 65  ? -52.886  87.586  20.963  1.00 34.11  ? 65  TRP D CD2 1 
ATOM   5357  N  NE1 . TRP D  1 65  ? -53.238  85.878  22.367  1.00 26.97  ? 65  TRP D NE1 1 
ATOM   5358  C  CE2 . TRP D  1 65  ? -52.275  86.503  21.627  1.00 28.43  ? 65  TRP D CE2 1 
ATOM   5359  C  CE3 . TRP D  1 65  ? -52.104  88.392  20.132  1.00 22.13  ? 65  TRP D CE3 1 
ATOM   5360  C  CZ2 . TRP D  1 65  ? -50.927  86.207  21.485  1.00 26.41  ? 65  TRP D CZ2 1 
ATOM   5361  C  CZ3 . TRP D  1 65  ? -50.773  88.098  19.997  1.00 27.03  ? 65  TRP D CZ3 1 
ATOM   5362  C  CH2 . TRP D  1 65  ? -50.194  87.012  20.667  1.00 28.87  ? 65  TRP D CH2 1 
ATOM   5363  N  N   . ASN D  1 66  ? -57.089  89.005  23.497  1.00 40.34  ? 66  ASN D N   1 
ATOM   5364  C  CA  . ASN D  1 66  ? -57.500  88.499  24.815  1.00 47.18  ? 66  ASN D CA  1 
ATOM   5365  C  C   . ASN D  1 66  ? -56.946  87.095  25.020  1.00 50.32  ? 66  ASN D C   1 
ATOM   5366  O  O   . ASN D  1 66  ? -57.465  86.130  24.463  1.00 60.59  ? 66  ASN D O   1 
ATOM   5367  C  CB  . ASN D  1 66  ? -59.036  88.496  24.957  1.00 36.39  ? 66  ASN D CB  1 
ATOM   5368  C  CG  . ASN D  1 66  ? -59.504  88.145  26.367  1.00 61.54  ? 66  ASN D CG  1 
ATOM   5369  O  OD1 . ASN D  1 66  ? -58.746  87.570  27.148  1.00 68.72  ? 66  ASN D OD1 1 
ATOM   5370  N  ND2 . ASN D  1 66  ? -60.760  88.486  26.699  1.00 57.84  ? 66  ASN D ND2 1 
ATOM   5371  N  N   . SER D  1 67  ? -55.886  86.980  25.811  1.00 43.78  ? 67  SER D N   1 
ATOM   5372  C  CA  . SER D  1 67  ? -55.228  85.689  26.003  1.00 57.03  ? 67  SER D CA  1 
ATOM   5373  C  C   . SER D  1 67  ? -55.753  84.923  27.219  1.00 65.63  ? 67  SER D C   1 
ATOM   5374  O  O   . SER D  1 67  ? -55.039  84.092  27.772  1.00 68.41  ? 67  SER D O   1 
ATOM   5375  C  CB  . SER D  1 67  ? -53.706  85.863  26.126  1.00 60.63  ? 67  SER D CB  1 
ATOM   5376  O  OG  . SER D  1 67  ? -53.328  86.342  27.414  1.00 60.79  ? 67  SER D OG  1 
ATOM   5377  N  N   . SER D  1 68  ? -56.989  85.188  27.633  1.00 65.72  ? 68  SER D N   1 
ATOM   5378  C  CA  . SER D  1 68  ? -57.526  84.551  28.833  1.00 70.17  ? 68  SER D CA  1 
ATOM   5379  C  C   . SER D  1 68  ? -57.370  83.031  28.768  1.00 67.23  ? 68  SER D C   1 
ATOM   5380  O  O   . SER D  1 68  ? -56.899  82.399  29.719  1.00 68.38  ? 68  SER D O   1 
ATOM   5381  C  CB  . SER D  1 68  ? -58.992  84.942  29.057  1.00 79.62  ? 68  SER D CB  1 
ATOM   5382  O  OG  . SER D  1 68  ? -59.836  84.429  28.039  1.00 90.58  ? 68  SER D OG  1 
ATOM   5383  N  N   . HIS D  1 69  ? -57.762  82.450  27.640  1.00 49.34  ? 69  HIS D N   1 
ATOM   5384  C  CA  . HIS D  1 69  ? -57.625  81.013  27.434  1.00 54.16  ? 69  HIS D CA  1 
ATOM   5385  C  C   . HIS D  1 69  ? -56.970  80.772  26.088  1.00 63.58  ? 69  HIS D C   1 
ATOM   5386  O  O   . HIS D  1 69  ? -57.477  80.018  25.256  1.00 69.34  ? 69  HIS D O   1 
ATOM   5387  C  CB  . HIS D  1 69  ? -58.988  80.334  27.458  1.00 71.45  ? 69  HIS D CB  1 
ATOM   5388  C  CG  . HIS D  1 69  ? -59.708  80.465  28.763  1.00 86.58  ? 69  HIS D CG  1 
ATOM   5389  N  ND1 . HIS D  1 69  ? -61.025  80.096  28.925  1.00 93.67  ? 69  HIS D ND1 1 
ATOM   5390  C  CD2 . HIS D  1 69  ? -59.290  80.915  29.969  1.00 91.37  ? 69  HIS D CD2 1 
ATOM   5391  C  CE1 . HIS D  1 69  ? -61.390  80.316  30.176  1.00 100.98 ? 69  HIS D CE1 1 
ATOM   5392  N  NE2 . HIS D  1 69  ? -60.355  80.813  30.830  1.00 97.09  ? 69  HIS D NE2 1 
ATOM   5393  N  N   . SER D  1 70  ? -55.840  81.427  25.876  1.00 58.40  ? 70  SER D N   1 
ATOM   5394  C  CA  . SER D  1 70  ? -55.166  81.384  24.592  1.00 56.00  ? 70  SER D CA  1 
ATOM   5395  C  C   . SER D  1 70  ? -53.661  81.445  24.813  1.00 44.88  ? 70  SER D C   1 
ATOM   5396  O  O   . SER D  1 70  ? -53.209  81.755  25.919  1.00 40.56  ? 70  SER D O   1 
ATOM   5397  C  CB  . SER D  1 70  ? -55.635  82.555  23.724  1.00 68.55  ? 70  SER D CB  1 
ATOM   5398  O  OG  . SER D  1 70  ? -57.053  82.638  23.714  1.00 77.61  ? 70  SER D OG  1 
ATOM   5399  N  N   . PRO D  1 71  ? -52.879  81.120  23.772  1.00 39.26  ? 71  PRO D N   1 
ATOM   5400  C  CA  . PRO D  1 71  ? -51.429  81.275  23.868  1.00 29.48  ? 71  PRO D CA  1 
ATOM   5401  C  C   . PRO D  1 71  ? -51.044  82.729  24.137  1.00 32.60  ? 71  PRO D C   1 
ATOM   5402  O  O   . PRO D  1 71  ? -51.696  83.664  23.666  1.00 38.42  ? 71  PRO D O   1 
ATOM   5403  C  CB  . PRO D  1 71  ? -50.946  80.833  22.491  1.00 32.98  ? 71  PRO D CB  1 
ATOM   5404  C  CG  . PRO D  1 71  ? -51.968  79.855  22.054  1.00 42.23  ? 71  PRO D CG  1 
ATOM   5405  C  CD  . PRO D  1 71  ? -53.270  80.429  22.535  1.00 42.71  ? 71  PRO D CD  1 
ATOM   5406  N  N   . ASP D  1 72  ? -49.982  82.902  24.915  1.00 36.91  ? 72  ASP D N   1 
ATOM   5407  C  CA  . ASP D  1 72  ? -49.501  84.220  25.296  1.00 36.45  ? 72  ASP D CA  1 
ATOM   5408  C  C   . ASP D  1 72  ? -48.606  84.836  24.216  1.00 37.69  ? 72  ASP D C   1 
ATOM   5409  O  O   . ASP D  1 72  ? -48.482  86.056  24.122  1.00 35.74  ? 72  ASP D O   1 
ATOM   5410  C  CB  . ASP D  1 72  ? -48.731  84.123  26.611  1.00 28.93  ? 72  ASP D CB  1 
ATOM   5411  C  CG  . ASP D  1 72  ? -48.552  85.468  27.282  1.00 62.91  ? 72  ASP D CG  1 
ATOM   5412  O  OD1 . ASP D  1 72  ? -49.547  86.210  27.419  1.00 62.73  ? 72  ASP D OD1 1 
ATOM   5413  O  OD2 . ASP D  1 72  ? -47.408  85.792  27.665  1.00 75.36  ? 72  ASP D OD2 1 
ATOM   5414  N  N   . GLN D  1 73  ? -47.976  83.992  23.407  1.00 22.78  ? 73  GLN D N   1 
ATOM   5415  C  CA  . GLN D  1 73  ? -47.096  84.483  22.357  1.00 14.61  ? 73  GLN D CA  1 
ATOM   5416  C  C   . GLN D  1 73  ? -47.164  83.647  21.102  1.00 25.49  ? 73  GLN D C   1 
ATOM   5417  O  O   . GLN D  1 73  ? -47.471  82.448  21.143  1.00 40.62  ? 73  GLN D O   1 
ATOM   5418  C  CB  . GLN D  1 73  ? -45.645  84.486  22.808  1.00 16.82  ? 73  GLN D CB  1 
ATOM   5419  C  CG  . GLN D  1 73  ? -45.344  85.364  23.984  1.00 37.32  ? 73  GLN D CG  1 
ATOM   5420  C  CD  . GLN D  1 73  ? -43.874  85.353  24.353  1.00 32.76  ? 73  GLN D CD  1 
ATOM   5421  O  OE1 . GLN D  1 73  ? -43.022  84.895  23.585  1.00 30.66  ? 73  GLN D OE1 1 
ATOM   5422  N  NE2 . GLN D  1 73  ? -43.570  85.854  25.536  1.00 28.43  ? 73  GLN D NE2 1 
ATOM   5423  N  N   . VAL D  1 74  ? -46.845  84.289  19.984  1.00 12.02  ? 74  VAL D N   1 
ATOM   5424  C  CA  . VAL D  1 74  ? -46.669  83.588  18.726  1.00 12.97  ? 74  VAL D CA  1 
ATOM   5425  C  C   . VAL D  1 74  ? -45.446  84.112  17.974  1.00 25.23  ? 74  VAL D C   1 
ATOM   5426  O  O   . VAL D  1 74  ? -44.998  85.245  18.208  1.00 25.57  ? 74  VAL D O   1 
ATOM   5427  C  CB  . VAL D  1 74  ? -47.909  83.725  17.824  1.00 12.01  ? 74  VAL D CB  1 
ATOM   5428  C  CG1 . VAL D  1 74  ? -49.026  82.894  18.363  1.00 8.68   ? 74  VAL D CG1 1 
ATOM   5429  C  CG2 . VAL D  1 74  ? -48.301  85.184  17.680  1.00 7.47   ? 74  VAL D CG2 1 
ATOM   5430  N  N   . SER D  1 75  ? -44.915  83.285  17.073  1.00 21.12  ? 75  SER D N   1 
ATOM   5431  C  CA  . SER D  1 75  ? -43.881  83.736  16.153  1.00 12.76  ? 75  SER D CA  1 
ATOM   5432  C  C   . SER D  1 75  ? -44.523  84.141  14.845  1.00 18.73  ? 75  SER D C   1 
ATOM   5433  O  O   . SER D  1 75  ? -45.324  83.398  14.278  1.00 24.14  ? 75  SER D O   1 
ATOM   5434  C  CB  . SER D  1 75  ? -42.814  82.660  15.933  1.00 21.24  ? 75  SER D CB  1 
ATOM   5435  O  OG  . SER D  1 75  ? -42.023  82.458  17.104  1.00 32.33  ? 75  SER D OG  1 
ATOM   5436  N  N   . VAL D  1 76  ? -44.172  85.336  14.378  1.00 19.03  ? 76  VAL D N   1 
ATOM   5437  C  CA  . VAL D  1 76  ? -44.802  85.919  13.212  1.00 21.44  ? 76  VAL D CA  1 
ATOM   5438  C  C   . VAL D  1 76  ? -43.767  86.391  12.204  1.00 16.98  ? 76  VAL D C   1 
ATOM   5439  O  O   . VAL D  1 76  ? -42.813  87.075  12.572  1.00 24.17  ? 76  VAL D O   1 
ATOM   5440  C  CB  . VAL D  1 76  ? -45.656  87.139  13.625  1.00 24.04  ? 76  VAL D CB  1 
ATOM   5441  C  CG1 . VAL D  1 76  ? -46.357  87.742  12.401  1.00 14.06  ? 76  VAL D CG1 1 
ATOM   5442  C  CG2 . VAL D  1 76  ? -46.642  86.743  14.728  1.00 7.91   ? 76  VAL D CG2 1 
ATOM   5443  N  N   . PRO D  1 77  ? -43.963  86.043  10.925  1.00 14.71  ? 77  PRO D N   1 
ATOM   5444  C  CA  . PRO D  1 77  ? -43.135  86.555  9.825   1.00 17.25  ? 77  PRO D CA  1 
ATOM   5445  C  C   . PRO D  1 77  ? -43.148  88.077  9.861   1.00 24.58  ? 77  PRO D C   1 
ATOM   5446  O  O   . PRO D  1 77  ? -44.242  88.657  9.876   1.00 30.23  ? 77  PRO D O   1 
ATOM   5447  C  CB  . PRO D  1 77  ? -43.885  86.069  8.572   1.00 9.39   ? 77  PRO D CB  1 
ATOM   5448  C  CG  . PRO D  1 77  ? -44.616  84.857  9.018   1.00 20.97  ? 77  PRO D CG  1 
ATOM   5449  C  CD  . PRO D  1 77  ? -45.005  85.118  10.454  1.00 19.62  ? 77  PRO D CD  1 
ATOM   5450  N  N   . ILE D  1 78  ? -41.980  88.717  9.867   1.00 16.75  ? 78  ILE D N   1 
ATOM   5451  C  CA  . ILE D  1 78  ? -41.934  90.183  9.966   1.00 30.24  ? 78  ILE D CA  1 
ATOM   5452  C  C   . ILE D  1 78  ? -42.553  90.895  8.776   1.00 16.72  ? 78  ILE D C   1 
ATOM   5453  O  O   . ILE D  1 78  ? -42.910  92.062  8.863   1.00 33.14  ? 78  ILE D O   1 
ATOM   5454  C  CB  . ILE D  1 78  ? -40.509  90.723  10.162  1.00 20.56  ? 78  ILE D CB  1 
ATOM   5455  C  CG1 . ILE D  1 78  ? -39.593  90.170  9.084   1.00 19.25  ? 78  ILE D CG1 1 
ATOM   5456  C  CG2 . ILE D  1 78  ? -40.003  90.403  11.556  1.00 4.13   ? 78  ILE D CG2 1 
ATOM   5457  C  CD1 . ILE D  1 78  ? -38.351  90.994  8.901   1.00 19.14  ? 78  ILE D CD1 1 
ATOM   5458  N  N   . SER D  1 79  ? -42.665  90.190  7.663   1.00 14.06  ? 79  SER D N   1 
ATOM   5459  C  CA  . SER D  1 79  ? -43.396  90.703  6.517   1.00 14.54  ? 79  SER D CA  1 
ATOM   5460  C  C   . SER D  1 79  ? -44.867  90.963  6.849   1.00 29.70  ? 79  SER D C   1 
ATOM   5461  O  O   . SER D  1 79  ? -45.532  91.699  6.130   1.00 30.83  ? 79  SER D O   1 
ATOM   5462  C  CB  . SER D  1 79  ? -43.273  89.734  5.330   1.00 17.67  ? 79  SER D CB  1 
ATOM   5463  O  OG  . SER D  1 79  ? -43.478  88.396  5.733   1.00 35.57  ? 79  SER D OG  1 
ATOM   5464  N  N   . SER D  1 80  ? -45.371  90.363  7.930   1.00 24.77  ? 80  SER D N   1 
ATOM   5465  C  CA  . SER D  1 80  ? -46.753  90.586  8.361   1.00 16.38  ? 80  SER D CA  1 
ATOM   5466  C  C   . SER D  1 80  ? -46.867  91.645  9.458   1.00 28.41  ? 80  SER D C   1 
ATOM   5467  O  O   . SER D  1 80  ? -47.965  91.954  9.903   1.00 32.24  ? 80  SER D O   1 
ATOM   5468  C  CB  . SER D  1 80  ? -47.384  89.282  8.854   1.00 17.22  ? 80  SER D CB  1 
ATOM   5469  O  OG  . SER D  1 80  ? -47.405  88.287  7.847   1.00 27.98  ? 80  SER D OG  1 
ATOM   5470  N  N   . LEU D  1 81  ? -45.738  92.194  9.904   1.00 27.51  ? 81  LEU D N   1 
ATOM   5471  C  CA  . LEU D  1 81  ? -45.763  93.207  10.958  1.00 11.10  ? 81  LEU D CA  1 
ATOM   5472  C  C   . LEU D  1 81  ? -45.228  94.523  10.456  1.00 21.80  ? 81  LEU D C   1 
ATOM   5473  O  O   . LEU D  1 81  ? -44.483  94.555  9.477   1.00 27.58  ? 81  LEU D O   1 
ATOM   5474  C  CB  . LEU D  1 81  ? -44.914  92.768  12.129  1.00 19.22  ? 81  LEU D CB  1 
ATOM   5475  C  CG  . LEU D  1 81  ? -45.274  91.442  12.774  1.00 27.89  ? 81  LEU D CG  1 
ATOM   5476  C  CD1 . LEU D  1 81  ? -44.295  91.178  13.883  1.00 25.51  ? 81  LEU D CD1 1 
ATOM   5477  C  CD2 . LEU D  1 81  ? -46.672  91.519  13.307  1.00 33.26  ? 81  LEU D CD2 1 
ATOM   5478  N  N   . TRP D  1 82  ? -45.612  95.612  11.114  1.00 16.00  ? 82  TRP D N   1 
ATOM   5479  C  CA  . TRP D  1 82  ? -44.868  96.846  10.941  1.00 22.22  ? 82  TRP D CA  1 
ATOM   5480  C  C   . TRP D  1 82  ? -43.533  96.689  11.676  1.00 22.17  ? 82  TRP D C   1 
ATOM   5481  O  O   . TRP D  1 82  ? -43.471  96.174  12.786  1.00 26.45  ? 82  TRP D O   1 
ATOM   5482  C  CB  . TRP D  1 82  ? -45.628  98.052  11.473  1.00 7.77   ? 82  TRP D CB  1 
ATOM   5483  C  CG  . TRP D  1 82  ? -44.791  99.334  11.476  1.00 33.42  ? 82  TRP D CG  1 
ATOM   5484  C  CD1 . TRP D  1 82  ? -44.709  100.255 10.466  1.00 17.42  ? 82  TRP D CD1 1 
ATOM   5485  C  CD2 . TRP D  1 82  ? -43.925  99.819  12.527  1.00 14.81  ? 82  TRP D CD2 1 
ATOM   5486  N  NE1 . TRP D  1 82  ? -43.873  101.278 10.824  1.00 14.26  ? 82  TRP D NE1 1 
ATOM   5487  C  CE2 . TRP D  1 82  ? -43.382  101.038 12.085  1.00 25.52  ? 82  TRP D CE2 1 
ATOM   5488  C  CE3 . TRP D  1 82  ? -43.572  99.346  13.792  1.00 13.06  ? 82  TRP D CE3 1 
ATOM   5489  C  CZ2 . TRP D  1 82  ? -42.505  101.792 12.870  1.00 15.88  ? 82  TRP D CZ2 1 
ATOM   5490  C  CZ3 . TRP D  1 82  ? -42.700  100.094 14.568  1.00 11.59  ? 82  TRP D CZ3 1 
ATOM   5491  C  CH2 . TRP D  1 82  ? -42.180  101.301 14.104  1.00 19.70  ? 82  TRP D CH2 1 
ATOM   5492  N  N   . VAL D  1 83  ? -42.466  97.125  11.041  1.00 14.60  ? 83  VAL D N   1 
ATOM   5493  C  CA  . VAL D  1 83  ? -41.149  97.060  11.642  1.00 22.67  ? 83  VAL D CA  1 
ATOM   5494  C  C   . VAL D  1 83  ? -40.517  98.433  11.527  1.00 18.69  ? 83  VAL D C   1 
ATOM   5495  O  O   . VAL D  1 83  ? -40.687  99.108  10.517  1.00 22.12  ? 83  VAL D O   1 
ATOM   5496  C  CB  . VAL D  1 83  ? -40.271  96.021  10.925  1.00 19.36  ? 83  VAL D CB  1 
ATOM   5497  C  CG1 . VAL D  1 83  ? -38.851  96.087  11.426  1.00 46.13  ? 83  VAL D CG1 1 
ATOM   5498  C  CG2 . VAL D  1 83  ? -40.842  94.629  11.136  1.00 17.71  ? 83  VAL D CG2 1 
ATOM   5499  N  N   . PRO D  1 84  ? -39.804  98.869  12.569  1.00 5.01   ? 84  PRO D N   1 
ATOM   5500  C  CA  . PRO D  1 84  ? -39.142  100.172 12.461  1.00 6.95   ? 84  PRO D CA  1 
ATOM   5501  C  C   . PRO D  1 84  ? -38.036  100.164 11.390  1.00 18.94  ? 84  PRO D C   1 
ATOM   5502  O  O   . PRO D  1 84  ? -37.305  99.179  11.269  1.00 12.09  ? 84  PRO D O   1 
ATOM   5503  C  CB  . PRO D  1 84  ? -38.564  100.391 13.866  1.00 10.33  ? 84  PRO D CB  1 
ATOM   5504  C  CG  . PRO D  1 84  ? -38.492  99.037  14.477  1.00 4.94   ? 84  PRO D CG  1 
ATOM   5505  C  CD  . PRO D  1 84  ? -39.637  98.264  13.900  1.00 10.03  ? 84  PRO D CD  1 
ATOM   5506  N  N   . ASP D  1 85  ? -37.942  101.249 10.616  1.00 7.10   ? 85  ASP D N   1 
ATOM   5507  C  CA  . ASP D  1 85  ? -37.001  101.356 9.511   1.00 7.34   ? 85  ASP D CA  1 
ATOM   5508  C  C   . ASP D  1 85  ? -35.587  101.722 10.013  1.00 23.27  ? 85  ASP D C   1 
ATOM   5509  O  O   . ASP D  1 85  ? -34.997  102.743 9.635   1.00 17.96  ? 85  ASP D O   1 
ATOM   5510  C  CB  . ASP D  1 85  ? -37.497  102.383 8.488   1.00 9.89   ? 85  ASP D CB  1 
ATOM   5511  C  CG  . ASP D  1 85  ? -37.613  103.782 9.078   1.00 29.02  ? 85  ASP D CG  1 
ATOM   5512  O  OD1 . ASP D  1 85  ? -37.850  103.871 10.297  1.00 10.28  ? 85  ASP D OD1 1 
ATOM   5513  O  OD2 . ASP D  1 85  ? -37.452  104.789 8.345   1.00 21.31  ? 85  ASP D OD2 1 
ATOM   5514  N  N   . LEU D  1 86  ? -35.053  100.879 10.883  1.00 18.83  ? 86  LEU D N   1 
ATOM   5515  C  CA  . LEU D  1 86  ? -33.742  101.124 11.440  1.00 25.22  ? 86  LEU D CA  1 
ATOM   5516  C  C   . LEU D  1 86  ? -32.692  100.870 10.371  1.00 25.31  ? 86  LEU D C   1 
ATOM   5517  O  O   . LEU D  1 86  ? -32.828  99.956  9.561   1.00 24.85  ? 86  LEU D O   1 
ATOM   5518  C  CB  . LEU D  1 86  ? -33.497  100.222 12.645  1.00 13.00  ? 86  LEU D CB  1 
ATOM   5519  C  CG  . LEU D  1 86  ? -34.467  100.394 13.803  1.00 9.20   ? 86  LEU D CG  1 
ATOM   5520  C  CD1 . LEU D  1 86  ? -34.045  99.517  14.969  1.00 7.12   ? 86  LEU D CD1 1 
ATOM   5521  C  CD2 . LEU D  1 86  ? -34.492  101.849 14.217  1.00 8.20   ? 86  LEU D CD2 1 
ATOM   5522  N  N   . ALA D  1 87  ? -31.658  101.700 10.367  1.00 16.25  ? 87  ALA D N   1 
ATOM   5523  C  CA  . ALA D  1 87  ? -30.494  101.466 9.531   1.00 21.40  ? 87  ALA D CA  1 
ATOM   5524  C  C   . ALA D  1 87  ? -29.198  101.838 10.264  1.00 9.94   ? 87  ALA D C   1 
ATOM   5525  O  O   . ALA D  1 87  ? -29.184  102.703 11.136  1.00 22.56  ? 87  ALA D O   1 
ATOM   5526  C  CB  . ALA D  1 87  ? -30.629  102.236 8.236   1.00 19.55  ? 87  ALA D CB  1 
ATOM   5527  N  N   . ALA D  1 88  ? -28.112  101.163 9.924   1.00 19.77  ? 88  ALA D N   1 
ATOM   5528  C  CA  . ALA D  1 88  ? -26.783  101.547 10.424  1.00 12.63  ? 88  ALA D CA  1 
ATOM   5529  C  C   . ALA D  1 88  ? -26.198  102.594 9.499   1.00 10.68  ? 88  ALA D C   1 
ATOM   5530  O  O   . ALA D  1 88  ? -25.941  102.332 8.311   1.00 13.51  ? 88  ALA D O   1 
ATOM   5531  C  CB  . ALA D  1 88  ? -25.867  100.341 10.504  1.00 5.14   ? 88  ALA D CB  1 
ATOM   5532  N  N   . TYR D  1 89  ? -26.015  103.794 10.028  1.00 11.82  ? 89  TYR D N   1 
ATOM   5533  C  CA  . TYR D  1 89  ? -25.517  104.898 9.208   1.00 17.51  ? 89  TYR D CA  1 
ATOM   5534  C  C   . TYR D  1 89  ? -24.164  104.592 8.540   1.00 24.40  ? 89  TYR D C   1 
ATOM   5535  O  O   . TYR D  1 89  ? -23.921  104.924 7.376   1.00 24.36  ? 89  TYR D O   1 
ATOM   5536  C  CB  . TYR D  1 89  ? -25.443  106.181 10.038  1.00 10.50  ? 89  TYR D CB  1 
ATOM   5537  C  CG  . TYR D  1 89  ? -26.787  106.850 10.228  1.00 26.70  ? 89  TYR D CG  1 
ATOM   5538  C  CD1 . TYR D  1 89  ? -27.794  106.233 10.972  1.00 19.92  ? 89  TYR D CD1 1 
ATOM   5539  C  CD2 . TYR D  1 89  ? -27.057  108.094 9.657   1.00 6.75   ? 89  TYR D CD2 1 
ATOM   5540  C  CE1 . TYR D  1 89  ? -29.036  106.836 11.142  1.00 21.97  ? 89  TYR D CE1 1 
ATOM   5541  C  CE2 . TYR D  1 89  ? -28.288  108.707 9.829   1.00 33.61  ? 89  TYR D CE2 1 
ATOM   5542  C  CZ  . TYR D  1 89  ? -29.275  108.074 10.571  1.00 32.57  ? 89  TYR D CZ  1 
ATOM   5543  O  OH  . TYR D  1 89  ? -30.495  108.678 10.739  1.00 22.69  ? 89  TYR D OH  1 
ATOM   5544  N  N   . ASN D  1 90  ? -23.275  103.949 9.279   1.00 30.08  ? 90  ASN D N   1 
ATOM   5545  C  CA  . ASN D  1 90  ? -21.935  103.729 8.761   1.00 24.23  ? 90  ASN D CA  1 
ATOM   5546  C  C   . ASN D  1 90  ? -21.720  102.310 8.247   1.00 19.78  ? 90  ASN D C   1 
ATOM   5547  O  O   . ASN D  1 90  ? -20.581  101.873 8.072   1.00 18.12  ? 90  ASN D O   1 
ATOM   5548  C  CB  . ASN D  1 90  ? -20.880  104.130 9.802   1.00 12.90  ? 90  ASN D CB  1 
ATOM   5549  C  CG  . ASN D  1 90  ? -21.043  103.386 11.131  1.00 26.76  ? 90  ASN D CG  1 
ATOM   5550  O  OD1 . ASN D  1 90  ? -22.169  103.155 11.610  1.00 8.77   ? 90  ASN D OD1 1 
ATOM   5551  N  ND2 . ASN D  1 90  ? -19.911  102.997 11.727  1.00 19.53  ? 90  ASN D ND2 1 
ATOM   5552  N  N   . ALA D  1 91  ? -22.815  101.591 8.006   1.00 12.03  ? 91  ALA D N   1 
ATOM   5553  C  CA  . ALA D  1 91  ? -22.715  100.300 7.333   1.00 12.59  ? 91  ALA D CA  1 
ATOM   5554  C  C   . ALA D  1 91  ? -22.304  100.544 5.885   1.00 22.53  ? 91  ALA D C   1 
ATOM   5555  O  O   . ALA D  1 91  ? -22.731  101.516 5.270   1.00 34.11  ? 91  ALA D O   1 
ATOM   5556  C  CB  . ALA D  1 91  ? -24.019  99.550  7.399   1.00 16.76  ? 91  ALA D CB  1 
ATOM   5557  N  N   . ILE D  1 92  ? -21.458  99.684  5.341   1.00 23.00  ? 92  ILE D N   1 
ATOM   5558  C  CA  . ILE D  1 92  ? -21.036  99.852  3.959   1.00 19.63  ? 92  ILE D CA  1 
ATOM   5559  C  C   . ILE D  1 92  ? -21.460  98.671  3.090   1.00 22.15  ? 92  ILE D C   1 
ATOM   5560  O  O   . ILE D  1 92  ? -21.119  98.594  1.916   1.00 21.53  ? 92  ILE D O   1 
ATOM   5561  C  CB  . ILE D  1 92  ? -19.523  100.095 3.850   1.00 20.81  ? 92  ILE D CB  1 
ATOM   5562  C  CG1 . ILE D  1 92  ? -18.749  98.969  4.527   1.00 18.21  ? 92  ILE D CG1 1 
ATOM   5563  C  CG2 . ILE D  1 92  ? -19.169  101.429 4.461   1.00 10.97  ? 92  ILE D CG2 1 
ATOM   5564  C  CD1 . ILE D  1 92  ? -17.261  99.069  4.299   1.00 18.47  ? 92  ILE D CD1 1 
ATOM   5565  N  N   . SER D  1 93  ? -22.199  97.748  3.686   1.00 15.42  ? 93  SER D N   1 
ATOM   5566  C  CA  . SER D  1 93  ? -22.858  96.693  2.940   1.00 25.80  ? 93  SER D CA  1 
ATOM   5567  C  C   . SER D  1 93  ? -24.280  96.606  3.484   1.00 18.93  ? 93  SER D C   1 
ATOM   5568  O  O   . SER D  1 93  ? -24.529  96.963  4.632   1.00 7.88   ? 93  SER D O   1 
ATOM   5569  C  CB  . SER D  1 93  ? -22.123  95.356  3.098   1.00 21.89  ? 93  SER D CB  1 
ATOM   5570  O  OG  . SER D  1 93  ? -22.197  94.870  4.439   1.00 25.67  ? 93  SER D OG  1 
ATOM   5571  N  N   . LYS D  1 94  ? -25.223  96.158  2.669   1.00 23.94  ? 94  LYS D N   1 
ATOM   5572  C  CA  . LYS D  1 94  ? -26.562  95.957  3.197   1.00 25.65  ? 94  LYS D CA  1 
ATOM   5573  C  C   . LYS D  1 94  ? -26.514  94.763  4.141   1.00 18.73  ? 94  LYS D C   1 
ATOM   5574  O  O   . LYS D  1 94  ? -25.725  93.841  3.943   1.00 28.74  ? 94  LYS D O   1 
ATOM   5575  C  CB  . LYS D  1 94  ? -27.608  95.797  2.085   1.00 34.51  ? 94  LYS D CB  1 
ATOM   5576  C  CG  . LYS D  1 94  ? -27.448  94.587  1.180   1.00 44.76  ? 94  LYS D CG  1 
ATOM   5577  C  CD  . LYS D  1 94  ? -28.354  94.706  -0.036  1.00 56.43  ? 94  LYS D CD  1 
ATOM   5578  C  CE  . LYS D  1 94  ? -29.807  94.948  0.373   1.00 60.28  ? 94  LYS D CE  1 
ATOM   5579  N  NZ  . LYS D  1 94  ? -30.684  95.284  -0.791  1.00 60.68  ? 94  LYS D NZ  1 
ATOM   5580  N  N   . PRO D  1 95  ? -27.323  94.801  5.203   1.00 24.90  ? 95  PRO D N   1 
ATOM   5581  C  CA  . PRO D  1 95  ? -27.262  93.751  6.226   1.00 18.03  ? 95  PRO D CA  1 
ATOM   5582  C  C   . PRO D  1 95  ? -27.617  92.372  5.675   1.00 15.58  ? 95  PRO D C   1 
ATOM   5583  O  O   . PRO D  1 95  ? -28.665  92.209  5.052   1.00 23.86  ? 95  PRO D O   1 
ATOM   5584  C  CB  . PRO D  1 95  ? -28.317  94.199  7.248   1.00 20.30  ? 95  PRO D CB  1 
ATOM   5585  C  CG  . PRO D  1 95  ? -29.224  95.135  6.505   1.00 13.48  ? 95  PRO D CG  1 
ATOM   5586  C  CD  . PRO D  1 95  ? -28.337  95.825  5.514   1.00 21.22  ? 95  PRO D CD  1 
ATOM   5587  N  N   . GLU D  1 96  ? -26.744  91.396  5.893   1.00 20.97  ? 96  GLU D N   1 
ATOM   5588  C  CA  . GLU D  1 96  ? -27.049  90.018  5.556   1.00 15.54  ? 96  GLU D CA  1 
ATOM   5589  C  C   . GLU D  1 96  ? -27.753  89.383  6.746   1.00 26.69  ? 96  GLU D C   1 
ATOM   5590  O  O   . GLU D  1 96  ? -27.151  89.197  7.807   1.00 29.10  ? 96  GLU D O   1 
ATOM   5591  C  CB  . GLU D  1 96  ? -25.777  89.258  5.216   1.00 11.86  ? 96  GLU D CB  1 
ATOM   5592  C  CG  . GLU D  1 96  ? -25.999  87.860  4.642   1.00 31.07  ? 96  GLU D CG  1 
ATOM   5593  C  CD  . GLU D  1 96  ? -24.695  87.107  4.399   1.00 51.84  ? 96  GLU D CD  1 
ATOM   5594  O  OE1 . GLU D  1 96  ? -23.614  87.693  4.637   1.00 40.88  ? 96  GLU D OE1 1 
ATOM   5595  O  OE2 . GLU D  1 96  ? -24.751  85.930  3.972   1.00 52.60  ? 96  GLU D OE2 1 
ATOM   5596  N  N   . VAL D  1 97  ? -29.038  89.083  6.590   1.00 10.85  ? 97  VAL D N   1 
ATOM   5597  C  CA  . VAL D  1 97  ? -29.784  88.499  7.688   1.00 13.34  ? 97  VAL D CA  1 
ATOM   5598  C  C   . VAL D  1 97  ? -29.599  86.999  7.681   1.00 20.68  ? 97  VAL D C   1 
ATOM   5599  O  O   . VAL D  1 97  ? -29.976  86.326  6.726   1.00 22.99  ? 97  VAL D O   1 
ATOM   5600  C  CB  . VAL D  1 97  ? -31.273  88.833  7.590   1.00 26.56  ? 97  VAL D CB  1 
ATOM   5601  C  CG1 . VAL D  1 97  ? -32.028  88.204  8.758   1.00 28.87  ? 97  VAL D CG1 1 
ATOM   5602  C  CG2 . VAL D  1 97  ? -31.464  90.351  7.547   1.00 14.89  ? 97  VAL D CG2 1 
ATOM   5603  N  N   . LEU D  1 98  ? -29.014  86.482  8.754   1.00 21.10  ? 98  LEU D N   1 
ATOM   5604  C  CA  . LEU D  1 98  ? -28.585  85.094  8.793   1.00 15.69  ? 98  LEU D CA  1 
ATOM   5605  C  C   . LEU D  1 98  ? -29.664  84.145  9.260   1.00 17.46  ? 98  LEU D C   1 
ATOM   5606  O  O   . LEU D  1 98  ? -29.651  82.963  8.917   1.00 27.24  ? 98  LEU D O   1 
ATOM   5607  C  CB  . LEU D  1 98  ? -27.389  84.969  9.721   1.00 7.98   ? 98  LEU D CB  1 
ATOM   5608  C  CG  . LEU D  1 98  ? -26.165  85.790  9.317   1.00 20.72  ? 98  LEU D CG  1 
ATOM   5609  C  CD1 . LEU D  1 98  ? -25.115  85.708  10.431  1.00 17.37  ? 98  LEU D CD1 1 
ATOM   5610  C  CD2 . LEU D  1 98  ? -25.576  85.343  7.957   1.00 5.70   ? 98  LEU D CD2 1 
ATOM   5611  N  N   . THR D  1 99  ? -30.592  84.663  10.056  1.00 17.85  ? 99  THR D N   1 
ATOM   5612  C  CA  . THR D  1 99  ? -31.586  83.821  10.716  1.00 18.78  ? 99  THR D CA  1 
ATOM   5613  C  C   . THR D  1 99  ? -32.966  83.953  10.105  1.00 13.22  ? 99  THR D C   1 
ATOM   5614  O  O   . THR D  1 99  ? -33.232  84.907  9.378   1.00 19.95  ? 99  THR D O   1 
ATOM   5615  C  CB  . THR D  1 99  ? -31.653  84.154  12.197  1.00 9.24   ? 99  THR D CB  1 
ATOM   5616  O  OG1 . THR D  1 99  ? -31.772  85.573  12.354  1.00 21.25  ? 99  THR D OG1 1 
ATOM   5617  C  CG2 . THR D  1 99  ? -30.379  83.696  12.870  1.00 9.23   ? 99  THR D CG2 1 
ATOM   5618  N  N   . PRO D  1 100 ? -33.848  82.978  10.370  1.00 22.24  ? 100 PRO D N   1 
ATOM   5619  C  CA  . PRO D  1 100 ? -35.239  83.079  9.901   1.00 17.88  ? 100 PRO D CA  1 
ATOM   5620  C  C   . PRO D  1 100 ? -35.872  84.395  10.369  1.00 17.33  ? 100 PRO D C   1 
ATOM   5621  O  O   . PRO D  1 100 ? -35.696  84.796  11.522  1.00 26.27  ? 100 PRO D O   1 
ATOM   5622  C  CB  . PRO D  1 100 ? -35.908  81.885  10.573  1.00 18.38  ? 100 PRO D CB  1 
ATOM   5623  C  CG  . PRO D  1 100 ? -34.805  80.873  10.703  1.00 6.44   ? 100 PRO D CG  1 
ATOM   5624  C  CD  . PRO D  1 100 ? -33.580  81.687  11.026  1.00 15.45  ? 100 PRO D CD  1 
ATOM   5625  N  N   . GLN D  1 101 ? -36.585  85.070  9.479   1.00 6.76   ? 101 GLN D N   1 
ATOM   5626  C  CA  . GLN D  1 101 ? -37.050  86.412  9.791   1.00 20.75  ? 101 GLN D CA  1 
ATOM   5627  C  C   . GLN D  1 101 ? -38.408  86.415  10.489  1.00 26.72  ? 101 GLN D C   1 
ATOM   5628  O  O   . GLN D  1 101 ? -39.407  86.892  9.964   1.00 25.26  ? 101 GLN D O   1 
ATOM   5629  C  CB  . GLN D  1 101 ? -37.005  87.295  8.545   1.00 17.51  ? 101 GLN D CB  1 
ATOM   5630  C  CG  . GLN D  1 101 ? -35.576  87.486  8.040   1.00 13.97  ? 101 GLN D CG  1 
ATOM   5631  C  CD  . GLN D  1 101 ? -35.485  88.186  6.701   1.00 13.55  ? 101 GLN D CD  1 
ATOM   5632  O  OE1 . GLN D  1 101 ? -36.210  89.132  6.437   1.00 24.95  ? 101 GLN D OE1 1 
ATOM   5633  N  NE2 . GLN D  1 101 ? -34.588  87.717  5.848   1.00 30.88  ? 101 GLN D NE2 1 
ATOM   5634  N  N   . LEU D  1 102 ? -38.404  85.880  11.702  1.00 23.29  ? 102 LEU D N   1 
ATOM   5635  C  CA  . LEU D  1 102 ? -39.586  85.794  12.536  1.00 5.83   ? 102 LEU D CA  1 
ATOM   5636  C  C   . LEU D  1 102 ? -39.481  86.748  13.726  1.00 21.01  ? 102 LEU D C   1 
ATOM   5637  O  O   . LEU D  1 102 ? -38.433  86.857  14.370  1.00 18.56  ? 102 LEU D O   1 
ATOM   5638  C  CB  . LEU D  1 102 ? -39.748  84.369  13.051  1.00 5.98   ? 102 LEU D CB  1 
ATOM   5639  C  CG  . LEU D  1 102 ? -39.924  83.304  11.978  1.00 15.82  ? 102 LEU D CG  1 
ATOM   5640  C  CD1 . LEU D  1 102 ? -40.098  81.939  12.573  1.00 11.83  ? 102 LEU D CD1 1 
ATOM   5641  C  CD2 . LEU D  1 102 ? -41.116  83.626  11.142  1.00 13.74  ? 102 LEU D CD2 1 
ATOM   5642  N  N   . ALA D  1 103 ? -40.577  87.439  14.011  1.00 13.52  ? 103 ALA D N   1 
ATOM   5643  C  CA  . ALA D  1 103 ? -40.695  88.220  15.237  1.00 13.49  ? 103 ALA D CA  1 
ATOM   5644  C  C   . ALA D  1 103 ? -41.456  87.411  16.261  1.00 13.40  ? 103 ALA D C   1 
ATOM   5645  O  O   . ALA D  1 103 ? -42.065  86.386  15.948  1.00 31.64  ? 103 ALA D O   1 
ATOM   5646  C  CB  . ALA D  1 103 ? -41.410  89.525  14.978  1.00 8.42   ? 103 ALA D CB  1 
ATOM   5647  N  N   . ARG D  1 104 ? -41.428  87.873  17.492  1.00 11.20  ? 104 ARG D N   1 
ATOM   5648  C  CA  . ARG D  1 104 ? -42.165  87.216  18.546  1.00 19.61  ? 104 ARG D CA  1 
ATOM   5649  C  C   . ARG D  1 104 ? -43.145  88.237  19.060  1.00 25.05  ? 104 ARG D C   1 
ATOM   5650  O  O   . ARG D  1 104 ? -42.745  89.342  19.426  1.00 30.33  ? 104 ARG D O   1 
ATOM   5651  C  CB  . ARG D  1 104 ? -41.231  86.770  19.658  1.00 17.92  ? 104 ARG D CB  1 
ATOM   5652  C  CG  . ARG D  1 104 ? -41.845  85.841  20.636  1.00 14.98  ? 104 ARG D CG  1 
ATOM   5653  C  CD  . ARG D  1 104 ? -42.050  84.460  20.061  1.00 18.09  ? 104 ARG D CD  1 
ATOM   5654  N  NE  . ARG D  1 104 ? -42.617  83.596  21.092  1.00 25.89  ? 104 ARG D NE  1 
ATOM   5655  C  CZ  . ARG D  1 104 ? -42.959  82.331  20.910  1.00 20.53  ? 104 ARG D CZ  1 
ATOM   5656  N  NH1 . ARG D  1 104 ? -42.797  81.773  19.724  1.00 18.64  ? 104 ARG D NH1 1 
ATOM   5657  N  NH2 . ARG D  1 104 ? -43.465  81.632  21.916  1.00 18.04  ? 104 ARG D NH2 1 
ATOM   5658  N  N   . VAL D  1 105 ? -44.430  87.880  19.043  1.00 27.49  ? 105 VAL D N   1 
ATOM   5659  C  CA  . VAL D  1 105 ? -45.479  88.788  19.486  1.00 23.68  ? 105 VAL D CA  1 
ATOM   5660  C  C   . VAL D  1 105 ? -46.167  88.320  20.777  1.00 18.99  ? 105 VAL D C   1 
ATOM   5661  O  O   . VAL D  1 105 ? -46.642  87.188  20.877  1.00 14.32  ? 105 VAL D O   1 
ATOM   5662  C  CB  . VAL D  1 105 ? -46.480  89.019  18.365  1.00 25.93  ? 105 VAL D CB  1 
ATOM   5663  C  CG1 . VAL D  1 105 ? -47.534  90.035  18.790  1.00 17.85  ? 105 VAL D CG1 1 
ATOM   5664  C  CG2 . VAL D  1 105 ? -45.718  89.480  17.129  1.00 19.79  ? 105 VAL D CG2 1 
ATOM   5665  N  N   . VAL D  1 106 ? -46.185  89.195  21.774  1.00 8.33   ? 106 VAL D N   1 
ATOM   5666  C  CA  . VAL D  1 106 ? -46.922  88.910  23.000  1.00 30.89  ? 106 VAL D CA  1 
ATOM   5667  C  C   . VAL D  1 106 ? -48.365  89.430  22.953  1.00 28.17  ? 106 VAL D C   1 
ATOM   5668  O  O   . VAL D  1 106 ? -48.642  90.451  22.330  1.00 25.44  ? 106 VAL D O   1 
ATOM   5669  C  CB  . VAL D  1 106 ? -46.231  89.522  24.229  1.00 36.75  ? 106 VAL D CB  1 
ATOM   5670  C  CG1 . VAL D  1 106 ? -46.844  88.960  25.529  1.00 25.06  ? 106 VAL D CG1 1 
ATOM   5671  C  CG2 . VAL D  1 106 ? -44.728  89.267  24.176  1.00 13.27  ? 106 VAL D CG2 1 
ATOM   5672  N  N   . SER D  1 107 ? -49.270  88.730  23.629  1.00 16.69  ? 107 SER D N   1 
ATOM   5673  C  CA  . SER D  1 107 ? -50.696  89.053  23.583  1.00 24.24  ? 107 SER D CA  1 
ATOM   5674  C  C   . SER D  1 107 ? -51.039  90.533  23.807  1.00 25.88  ? 107 SER D C   1 
ATOM   5675  O  O   . SER D  1 107 ? -52.061  91.002  23.334  1.00 34.03  ? 107 SER D O   1 
ATOM   5676  C  CB  . SER D  1 107 ? -51.468  88.172  24.570  1.00 20.34  ? 107 SER D CB  1 
ATOM   5677  O  OG  . SER D  1 107 ? -51.061  88.421  25.899  1.00 29.77  ? 107 SER D OG  1 
ATOM   5678  N  N   . ASP D  1 108 ? -50.188  91.262  24.518  1.00 24.78  ? 108 ASP D N   1 
ATOM   5679  C  CA  . ASP D  1 108 ? -50.431  92.679  24.793  1.00 22.33  ? 108 ASP D CA  1 
ATOM   5680  C  C   . ASP D  1 108 ? -49.914  93.609  23.684  1.00 30.40  ? 108 ASP D C   1 
ATOM   5681  O  O   . ASP D  1 108 ? -50.043  94.835  23.781  1.00 31.26  ? 108 ASP D O   1 
ATOM   5682  C  CB  . ASP D  1 108 ? -49.797  93.089  26.132  1.00 18.40  ? 108 ASP D CB  1 
ATOM   5683  C  CG  . ASP D  1 108 ? -48.282  92.858  26.171  1.00 36.37  ? 108 ASP D CG  1 
ATOM   5684  O  OD1 . ASP D  1 108 ? -47.706  92.484  25.132  1.00 20.97  ? 108 ASP D OD1 1 
ATOM   5685  O  OD2 . ASP D  1 108 ? -47.666  93.057  27.239  1.00 31.01  ? 108 ASP D OD2 1 
ATOM   5686  N  N   . GLY D  1 109 ? -49.301  93.033  22.654  1.00 14.32  ? 109 GLY D N   1 
ATOM   5687  C  CA  . GLY D  1 109 ? -48.795  93.811  21.535  1.00 16.83  ? 109 GLY D CA  1 
ATOM   5688  C  C   . GLY D  1 109 ? -47.302  94.126  21.549  1.00 24.11  ? 109 GLY D C   1 
ATOM   5689  O  O   . GLY D  1 109 ? -46.796  94.834  20.684  1.00 24.86  ? 109 GLY D O   1 
ATOM   5690  N  N   . GLU D  1 110 ? -46.589  93.617  22.540  1.00 21.50  ? 110 GLU D N   1 
ATOM   5691  C  CA  . GLU D  1 110 ? -45.147  93.750  22.554  1.00 24.98  ? 110 GLU D CA  1 
ATOM   5692  C  C   . GLU D  1 110 ? -44.552  92.881  21.466  1.00 32.51  ? 110 GLU D C   1 
ATOM   5693  O  O   . GLU D  1 110 ? -45.002  91.747  21.245  1.00 20.50  ? 110 GLU D O   1 
ATOM   5694  C  CB  . GLU D  1 110 ? -44.570  93.311  23.901  1.00 60.30  ? 110 GLU D CB  1 
ATOM   5695  C  CG  . GLU D  1 110 ? -44.923  94.219  25.045  1.00 82.11  ? 110 GLU D CG  1 
ATOM   5696  C  CD  . GLU D  1 110 ? -44.348  95.598  24.865  1.00 75.89  ? 110 GLU D CD  1 
ATOM   5697  O  OE1 . GLU D  1 110 ? -43.379  95.733  24.083  1.00 62.95  ? 110 GLU D OE1 1 
ATOM   5698  O  OE2 . GLU D  1 110 ? -44.868  96.541  25.501  1.00 72.33  ? 110 GLU D OE2 1 
ATOM   5699  N  N   . VAL D  1 111 ? -43.525  93.412  20.805  1.00 25.39  ? 111 VAL D N   1 
ATOM   5700  C  CA  . VAL D  1 111 ? -42.831  92.697  19.746  1.00 20.85  ? 111 VAL D CA  1 
ATOM   5701  C  C   . VAL D  1 111 ? -41.326  92.594  20.036  1.00 25.75  ? 111 VAL D C   1 
ATOM   5702  O  O   . VAL D  1 111 ? -40.681  93.603  20.347  1.00 24.98  ? 111 VAL D O   1 
ATOM   5703  C  CB  . VAL D  1 111 ? -43.075  93.382  18.388  1.00 21.85  ? 111 VAL D CB  1 
ATOM   5704  C  CG1 . VAL D  1 111 ? -42.544  92.530  17.261  1.00 9.91   ? 111 VAL D CG1 1 
ATOM   5705  C  CG2 . VAL D  1 111 ? -44.557  93.636  18.202  1.00 20.43  ? 111 VAL D CG2 1 
ATOM   5706  N  N   . LEU D  1 112 ? -40.790  91.371  19.983  1.00 21.31  ? 112 LEU D N   1 
ATOM   5707  C  CA  . LEU D  1 112 ? -39.344  91.163  19.935  1.00 22.60  ? 112 LEU D CA  1 
ATOM   5708  C  C   . LEU D  1 112 ? -38.938  90.692  18.533  1.00 20.32  ? 112 LEU D C   1 
ATOM   5709  O  O   . LEU D  1 112 ? -39.534  89.789  17.968  1.00 27.11  ? 112 LEU D O   1 
ATOM   5710  C  CB  . LEU D  1 112 ? -38.840  90.165  20.998  1.00 21.39  ? 112 LEU D CB  1 
ATOM   5711  C  CG  . LEU D  1 112 ? -37.306  89.872  20.973  1.00 50.15  ? 112 LEU D CG  1 
ATOM   5712  C  CD1 . LEU D  1 112 ? -36.510  91.130  21.266  1.00 38.94  ? 112 LEU D CD1 1 
ATOM   5713  C  CD2 . LEU D  1 112 ? -36.794  88.713  21.894  1.00 4.33   ? 112 LEU D CD2 1 
ATOM   5714  N  N   . TYR D  1 113 ? -37.932  91.334  17.967  1.00 15.05  ? 113 TYR D N   1 
ATOM   5715  C  CA  . TYR D  1 113 ? -37.304  90.830  16.758  1.00 17.39  ? 113 TYR D CA  1 
ATOM   5716  C  C   . TYR D  1 113 ? -35.804  90.877  16.976  1.00 14.68  ? 113 TYR D C   1 
ATOM   5717  O  O   . TYR D  1 113 ? -35.267  91.917  17.319  1.00 15.65  ? 113 TYR D O   1 
ATOM   5718  C  CB  . TYR D  1 113 ? -37.715  91.666  15.544  1.00 9.44   ? 113 TYR D CB  1 
ATOM   5719  C  CG  . TYR D  1 113 ? -37.137  91.200  14.234  1.00 20.14  ? 113 TYR D CG  1 
ATOM   5720  C  CD1 . TYR D  1 113 ? -37.153  89.847  13.883  1.00 14.49  ? 113 TYR D CD1 1 
ATOM   5721  C  CD2 . TYR D  1 113 ? -36.595  92.111  13.329  1.00 4.56   ? 113 TYR D CD2 1 
ATOM   5722  C  CE1 . TYR D  1 113 ? -36.621  89.412  12.669  1.00 18.01  ? 113 TYR D CE1 1 
ATOM   5723  C  CE2 . TYR D  1 113 ? -36.067  91.679  12.121  1.00 10.66  ? 113 TYR D CE2 1 
ATOM   5724  C  CZ  . TYR D  1 113 ? -36.083  90.333  11.799  1.00 13.09  ? 113 TYR D CZ  1 
ATOM   5725  O  OH  . TYR D  1 113 ? -35.565  89.914  10.606  1.00 22.97  ? 113 TYR D OH  1 
ATOM   5726  N  N   . MET D  1 114 ? -35.141  89.741  16.802  1.00 17.91  ? 114 MET D N   1 
ATOM   5727  C  CA  . MET D  1 114 ? -33.709  89.632  17.076  1.00 17.92  ? 114 MET D CA  1 
ATOM   5728  C  C   . MET D  1 114 ? -33.010  88.743  16.061  1.00 8.51   ? 114 MET D C   1 
ATOM   5729  O  O   . MET D  1 114 ? -32.599  87.628  16.367  1.00 10.88  ? 114 MET D O   1 
ATOM   5730  C  CB  . MET D  1 114 ? -33.463  89.106  18.508  1.00 8.76   ? 114 MET D CB  1 
ATOM   5731  C  CG  . MET D  1 114 ? -32.042  89.292  19.014  1.00 3.85   ? 114 MET D CG  1 
ATOM   5732  S  SD  . MET D  1 114 ? -31.942  89.142  20.811  1.00 28.58  ? 114 MET D SD  1 
ATOM   5733  C  CE  . MET D  1 114 ? -32.404  87.430  21.090  1.00 4.09   ? 114 MET D CE  1 
ATOM   5734  N  N   . PRO D  1 115 ? -32.877  89.234  14.834  1.00 19.67  ? 115 PRO D N   1 
ATOM   5735  C  CA  . PRO D  1 115 ? -32.183  88.440  13.820  1.00 26.66  ? 115 PRO D CA  1 
ATOM   5736  C  C   . PRO D  1 115 ? -30.672  88.515  14.066  1.00 27.90  ? 115 PRO D C   1 
ATOM   5737  O  O   . PRO D  1 115 ? -30.184  89.488  14.672  1.00 19.61  ? 115 PRO D O   1 
ATOM   5738  C  CB  . PRO D  1 115 ? -32.548  89.162  12.518  1.00 10.77  ? 115 PRO D CB  1 
ATOM   5739  C  CG  . PRO D  1 115 ? -32.666  90.608  12.932  1.00 9.89   ? 115 PRO D CG  1 
ATOM   5740  C  CD  . PRO D  1 115 ? -33.244  90.578  14.344  1.00 19.44  ? 115 PRO D CD  1 
ATOM   5741  N  N   . SER D  1 116 ? -29.945  87.492  13.626  1.00 22.65  ? 116 SER D N   1 
ATOM   5742  C  CA  . SER D  1 116 ? -28.489  87.587  13.567  1.00 26.31  ? 116 SER D CA  1 
ATOM   5743  C  C   . SER D  1 116 ? -28.096  88.224  12.238  1.00 16.49  ? 116 SER D C   1 
ATOM   5744  O  O   . SER D  1 116 ? -28.535  87.785  11.167  1.00 29.72  ? 116 SER D O   1 
ATOM   5745  C  CB  . SER D  1 116 ? -27.835  86.215  13.728  1.00 6.59   ? 116 SER D CB  1 
ATOM   5746  O  OG  . SER D  1 116 ? -26.440  86.345  13.870  1.00 15.66  ? 116 SER D OG  1 
ATOM   5747  N  N   . ILE D  1 117 ? -27.285  89.269  12.307  1.00 20.15  ? 117 ILE D N   1 
ATOM   5748  C  CA  . ILE D  1 117 ? -26.873  89.983  11.105  1.00 25.47  ? 117 ILE D CA  1 
ATOM   5749  C  C   . ILE D  1 117 ? -25.358  90.031  10.900  1.00 16.83  ? 117 ILE D C   1 
ATOM   5750  O  O   . ILE D  1 117 ? -24.599  90.257  11.847  1.00 25.30  ? 117 ILE D O   1 
ATOM   5751  C  CB  . ILE D  1 117 ? -27.396  91.414  11.143  1.00 27.75  ? 117 ILE D CB  1 
ATOM   5752  C  CG1 . ILE D  1 117 ? -28.922  91.410  11.108  1.00 19.06  ? 117 ILE D CG1 1 
ATOM   5753  C  CG2 . ILE D  1 117 ? -26.800  92.223  9.987   1.00 21.36  ? 117 ILE D CG2 1 
ATOM   5754  C  CD1 . ILE D  1 117 ? -29.521  92.773  11.283  1.00 17.50  ? 117 ILE D CD1 1 
ATOM   5755  N  N   . ARG D  1 118 ? -24.932  89.801  9.661   1.00 19.27  ? 118 ARG D N   1 
ATOM   5756  C  CA  . ARG D  1 118 ? -23.549  90.050  9.264   1.00 8.69   ? 118 ARG D CA  1 
ATOM   5757  C  C   . ARG D  1 118 ? -23.539  91.292  8.405   1.00 5.76   ? 118 ARG D C   1 
ATOM   5758  O  O   . ARG D  1 118 ? -24.221  91.350  7.394   1.00 18.75  ? 118 ARG D O   1 
ATOM   5759  C  CB  . ARG D  1 118 ? -22.949  88.871  8.486   1.00 5.75   ? 118 ARG D CB  1 
ATOM   5760  C  CG  . ARG D  1 118 ? -21.542  89.167  7.937   1.00 17.12  ? 118 ARG D CG  1 
ATOM   5761  C  CD  . ARG D  1 118 ? -20.798  87.927  7.523   1.00 11.61  ? 118 ARG D CD  1 
ATOM   5762  N  NE  . ARG D  1 118 ? -19.453  88.256  7.110   1.00 19.78  ? 118 ARG D NE  1 
ATOM   5763  C  CZ  . ARG D  1 118 ? -18.545  87.356  6.769   1.00 27.15  ? 118 ARG D CZ  1 
ATOM   5764  N  NH1 . ARG D  1 118 ? -18.848  86.062  6.812   1.00 29.97  ? 118 ARG D NH1 1 
ATOM   5765  N  NH2 . ARG D  1 118 ? -17.336  87.752  6.399   1.00 27.89  ? 118 ARG D NH2 1 
ATOM   5766  N  N   . GLN D  1 119 ? -22.758  92.282  8.808   1.00 11.34  ? 119 GLN D N   1 
ATOM   5767  C  CA  . GLN D  1 119 ? -22.666  93.539  8.072   1.00 29.14  ? 119 GLN D CA  1 
ATOM   5768  C  C   . GLN D  1 119 ? -21.247  94.140  8.152   1.00 25.30  ? 119 GLN D C   1 
ATOM   5769  O  O   . GLN D  1 119 ? -20.532  93.924  9.119   1.00 11.70  ? 119 GLN D O   1 
ATOM   5770  C  CB  . GLN D  1 119 ? -23.692  94.506  8.654   1.00 5.57   ? 119 GLN D CB  1 
ATOM   5771  C  CG  . GLN D  1 119 ? -24.035  95.661  7.785   1.00 20.36  ? 119 GLN D CG  1 
ATOM   5772  C  CD  . GLN D  1 119 ? -25.319  96.337  8.209   1.00 17.66  ? 119 GLN D CD  1 
ATOM   5773  O  OE1 . GLN D  1 119 ? -25.737  96.233  9.355   1.00 13.55  ? 119 GLN D OE1 1 
ATOM   5774  N  NE2 . GLN D  1 119 ? -25.961  97.027  7.275   1.00 29.21  ? 119 GLN D NE2 1 
ATOM   5775  N  N   . ARG D  1 120 ? -20.840  94.911  7.158   1.00 5.92   ? 120 ARG D N   1 
ATOM   5776  C  CA  . ARG D  1 120 ? -19.537  95.550  7.247   1.00 18.35  ? 120 ARG D CA  1 
ATOM   5777  C  C   . ARG D  1 120 ? -19.647  97.033  7.545   1.00 9.41   ? 120 ARG D C   1 
ATOM   5778  O  O   . ARG D  1 120 ? -20.523  97.718  7.038   1.00 12.03  ? 120 ARG D O   1 
ATOM   5779  C  CB  . ARG D  1 120 ? -18.699  95.306  5.996   1.00 12.38  ? 120 ARG D CB  1 
ATOM   5780  C  CG  . ARG D  1 120 ? -17.604  94.299  6.207   1.00 45.12  ? 120 ARG D CG  1 
ATOM   5781  C  CD  . ARG D  1 120 ? -17.462  93.427  4.984   1.00 78.06  ? 120 ARG D CD  1 
ATOM   5782  N  NE  . ARG D  1 120 ? -18.716  92.751  4.642   1.00 79.77  ? 120 ARG D NE  1 
ATOM   5783  C  CZ  . ARG D  1 120 ? -19.308  92.823  3.450   1.00 57.98  ? 120 ARG D CZ  1 
ATOM   5784  N  NH1 . ARG D  1 120 ? -18.759  93.545  2.477   1.00 49.13  ? 120 ARG D NH1 1 
ATOM   5785  N  NH2 . ARG D  1 120 ? -20.448  92.169  3.227   1.00 19.61  ? 120 ARG D NH2 1 
ATOM   5786  N  N   . PHE D  1 121 ? -18.744  97.518  8.382   1.00 25.11  ? 121 PHE D N   1 
ATOM   5787  C  CA  . PHE D  1 121 ? -18.783  98.912  8.792   1.00 26.47  ? 121 PHE D CA  1 
ATOM   5788  C  C   . PHE D  1 121 ? -17.490  99.650  8.516   1.00 26.09  ? 121 PHE D C   1 
ATOM   5789  O  O   . PHE D  1 121 ? -16.406  99.065  8.493   1.00 40.24  ? 121 PHE D O   1 
ATOM   5790  C  CB  . PHE D  1 121 ? -19.081  99.028  10.294  1.00 23.90  ? 121 PHE D CB  1 
ATOM   5791  C  CG  . PHE D  1 121 ? -20.391  98.439  10.695  1.00 32.08  ? 121 PHE D CG  1 
ATOM   5792  C  CD1 . PHE D  1 121 ? -21.546  99.192  10.630  1.00 31.00  ? 121 PHE D CD1 1 
ATOM   5793  C  CD2 . PHE D  1 121 ? -20.467  97.134  11.124  1.00 19.62  ? 121 PHE D CD2 1 
ATOM   5794  C  CE1 . PHE D  1 121 ? -22.753  98.651  10.984  1.00 33.77  ? 121 PHE D CE1 1 
ATOM   5795  C  CE2 . PHE D  1 121 ? -21.667  96.588  11.481  1.00 30.53  ? 121 PHE D CE2 1 
ATOM   5796  C  CZ  . PHE D  1 121 ? -22.818  97.348  11.409  1.00 33.52  ? 121 PHE D CZ  1 
ATOM   5797  N  N   . SER D  1 122 ? -17.631  100.954 8.332   1.00 23.53  ? 122 SER D N   1 
ATOM   5798  C  CA  . SER D  1 122 ? -16.507  101.869 8.268   1.00 23.73  ? 122 SER D CA  1 
ATOM   5799  C  C   . SER D  1 122 ? -16.419  102.573 9.614   1.00 22.68  ? 122 SER D C   1 
ATOM   5800  O  O   . SER D  1 122 ? -17.343  103.275 10.005  1.00 33.16  ? 122 SER D O   1 
ATOM   5801  C  CB  . SER D  1 122 ? -16.713  102.888 7.149   1.00 21.41  ? 122 SER D CB  1 
ATOM   5802  O  OG  . SER D  1 122 ? -16.072  104.109 7.465   1.00 28.09  ? 122 SER D OG  1 
ATOM   5803  N  N   . CYS D  1 123 ? -15.319  102.364 10.329  1.00 32.28  ? 123 CYS D N   1 
ATOM   5804  C  CA  . CYS D  1 123 ? -15.119  102.988 11.632  1.00 22.66  ? 123 CYS D CA  1 
ATOM   5805  C  C   . CYS D  1 123 ? -13.651  102.919 12.044  1.00 29.99  ? 123 CYS D C   1 
ATOM   5806  O  O   . CYS D  1 123 ? -12.823  102.343 11.339  1.00 26.91  ? 123 CYS D O   1 
ATOM   5807  C  CB  . CYS D  1 123 ? -15.976  102.294 12.683  1.00 27.93  ? 123 CYS D CB  1 
ATOM   5808  S  SG  . CYS D  1 123 ? -15.628  100.520 12.792  1.00 28.41  ? 123 CYS D SG  1 
ATOM   5809  N  N   . ASP D  1 124 ? -13.343  103.503 13.198  1.00 30.53  ? 124 ASP D N   1 
ATOM   5810  C  CA  . ASP D  1 124 ? -11.971  103.586 13.678  1.00 27.41  ? 124 ASP D CA  1 
ATOM   5811  C  C   . ASP D  1 124 ? -11.432  102.233 14.134  1.00 35.08  ? 124 ASP D C   1 
ATOM   5812  O  O   . ASP D  1 124 ? -11.796  101.739 15.201  1.00 22.19  ? 124 ASP D O   1 
ATOM   5813  C  CB  . ASP D  1 124 ? -11.875  104.588 14.825  1.00 31.48  ? 124 ASP D CB  1 
ATOM   5814  C  CG  . ASP D  1 124 ? -10.463  105.053 15.064  1.00 39.63  ? 124 ASP D CG  1 
ATOM   5815  O  OD1 . ASP D  1 124 ? -9.545   104.476 14.443  1.00 33.82  ? 124 ASP D OD1 1 
ATOM   5816  O  OD2 . ASP D  1 124 ? -10.273  105.994 15.868  1.00 41.75  ? 124 ASP D OD2 1 
ATOM   5817  N  N   . VAL D  1 125 ? -10.551  101.645 13.328  1.00 23.59  ? 125 VAL D N   1 
ATOM   5818  C  CA  . VAL D  1 125 ? -9.975   100.347 13.655  1.00 20.72  ? 125 VAL D CA  1 
ATOM   5819  C  C   . VAL D  1 125 ? -8.567   100.533 14.221  1.00 29.17  ? 125 VAL D C   1 
ATOM   5820  O  O   . VAL D  1 125 ? -7.913   99.576  14.642  1.00 23.26  ? 125 VAL D O   1 
ATOM   5821  C  CB  . VAL D  1 125 ? -9.921   99.432  12.413  1.00 17.27  ? 125 VAL D CB  1 
ATOM   5822  C  CG1 . VAL D  1 125 ? -9.442   98.057  12.790  1.00 18.33  ? 125 VAL D CG1 1 
ATOM   5823  C  CG2 . VAL D  1 125 ? -11.282  99.331  11.787  1.00 21.93  ? 125 VAL D CG2 1 
ATOM   5824  N  N   . SER D  1 126 ? -8.105   101.774 14.236  1.00 21.62  ? 126 SER D N   1 
ATOM   5825  C  CA  . SER D  1 126 ? -6.777   102.063 14.745  1.00 37.30  ? 126 SER D CA  1 
ATOM   5826  C  C   . SER D  1 126 ? -6.628   101.515 16.169  1.00 40.66  ? 126 SER D C   1 
ATOM   5827  O  O   . SER D  1 126 ? -7.556   101.592 16.979  1.00 41.05  ? 126 SER D O   1 
ATOM   5828  C  CB  . SER D  1 126 ? -6.492   103.569 14.703  1.00 21.86  ? 126 SER D CB  1 
ATOM   5829  O  OG  . SER D  1 126 ? -7.028   104.234 15.835  1.00 48.18  ? 126 SER D OG  1 
ATOM   5830  N  N   . GLY D  1 127 ? -5.465   100.946 16.461  1.00 30.52  ? 127 GLY D N   1 
ATOM   5831  C  CA  . GLY D  1 127 ? -5.178   100.431 17.787  1.00 29.15  ? 127 GLY D CA  1 
ATOM   5832  C  C   . GLY D  1 127 ? -5.698   99.031  18.058  1.00 33.51  ? 127 GLY D C   1 
ATOM   5833  O  O   . GLY D  1 127 ? -5.526   98.495  19.149  1.00 22.53  ? 127 GLY D O   1 
ATOM   5834  N  N   . VAL D  1 128 ? -6.326   98.427  17.064  1.00 15.17  ? 128 VAL D N   1 
ATOM   5835  C  CA  . VAL D  1 128 ? -6.955   97.136  17.259  1.00 22.17  ? 128 VAL D CA  1 
ATOM   5836  C  C   . VAL D  1 128 ? -6.001   96.123  17.837  1.00 21.39  ? 128 VAL D C   1 
ATOM   5837  O  O   . VAL D  1 128 ? -6.407   95.222  18.561  1.00 24.02  ? 128 VAL D O   1 
ATOM   5838  C  CB  . VAL D  1 128 ? -7.548   96.573  15.946  1.00 28.75  ? 128 VAL D CB  1 
ATOM   5839  C  CG1 . VAL D  1 128 ? -6.470   96.408  14.923  1.00 18.45  ? 128 VAL D CG1 1 
ATOM   5840  C  CG2 . VAL D  1 128 ? -8.229   95.235  16.199  1.00 13.20  ? 128 VAL D CG2 1 
ATOM   5841  N  N   . ASP D  1 129 ? -4.726   96.269  17.507  1.00 36.25  ? 129 ASP D N   1 
ATOM   5842  C  CA  . ASP D  1 129 ? -3.723   95.310  17.950  1.00 29.24  ? 129 ASP D CA  1 
ATOM   5843  C  C   . ASP D  1 129 ? -2.887   95.842  19.111  1.00 30.49  ? 129 ASP D C   1 
ATOM   5844  O  O   . ASP D  1 129 ? -1.680   95.604  19.172  1.00 44.55  ? 129 ASP D O   1 
ATOM   5845  C  CB  . ASP D  1 129 ? -2.817   94.934  16.784  1.00 39.33  ? 129 ASP D CB  1 
ATOM   5846  C  CG  . ASP D  1 129 ? -2.281   93.519  16.890  1.00 51.49  ? 129 ASP D CG  1 
ATOM   5847  O  OD1 . ASP D  1 129 ? -2.270   92.964  18.006  1.00 38.84  ? 129 ASP D OD1 1 
ATOM   5848  O  OD2 . ASP D  1 129 ? -1.869   92.962  15.851  1.00 65.50  ? 129 ASP D OD2 1 
ATOM   5849  N  N   . THR D  1 130 ? -3.525   96.561  20.030  1.00 29.27  ? 130 THR D N   1 
ATOM   5850  C  CA  . THR D  1 130 ? -2.838   97.077  21.211  1.00 32.54  ? 130 THR D CA  1 
ATOM   5851  C  C   . THR D  1 130 ? -3.624   96.772  22.474  1.00 45.97  ? 130 THR D C   1 
ATOM   5852  O  O   . THR D  1 130 ? -4.707   96.195  22.427  1.00 37.53  ? 130 THR D O   1 
ATOM   5853  C  CB  . THR D  1 130 ? -2.660   98.603  21.155  1.00 39.82  ? 130 THR D CB  1 
ATOM   5854  O  OG1 . THR D  1 130 ? -3.942   99.242  21.300  1.00 27.49  ? 130 THR D OG1 1 
ATOM   5855  C  CG2 . THR D  1 130 ? -2.005   99.026  19.843  1.00 22.36  ? 130 THR D CG2 1 
ATOM   5856  N  N   . GLU D  1 131 ? -3.093   97.223  23.603  1.00 51.25  ? 131 GLU D N   1 
ATOM   5857  C  CA  . GLU D  1 131 ? -3.707   96.955  24.892  1.00 43.00  ? 131 GLU D CA  1 
ATOM   5858  C  C   . GLU D  1 131 ? -5.117   97.534  24.998  1.00 30.03  ? 131 GLU D C   1 
ATOM   5859  O  O   . GLU D  1 131 ? -6.058   96.833  25.373  1.00 15.94  ? 131 GLU D O   1 
ATOM   5860  C  CB  . GLU D  1 131 ? -2.823   97.496  26.023  1.00 32.12  ? 131 GLU D CB  1 
ATOM   5861  C  CG  . GLU D  1 131 ? -3.144   96.912  27.395  1.00 36.03  ? 131 GLU D CG  1 
ATOM   5862  C  CD  . GLU D  1 131 ? -2.866   95.419  27.465  1.00 65.94  ? 131 GLU D CD  1 
ATOM   5863  O  OE1 . GLU D  1 131 ? -3.214   94.796  28.494  1.00 75.05  ? 131 GLU D OE1 1 
ATOM   5864  O  OE2 . GLU D  1 131 ? -2.297   94.870  26.489  1.00 58.75  ? 131 GLU D OE2 1 
ATOM   5865  N  N   . SER D  1 132 ? -5.267   98.817  24.688  1.00 28.47  ? 132 SER D N   1 
ATOM   5866  C  CA  . SER D  1 132 ? -6.554   99.458  24.889  1.00 19.32  ? 132 SER D CA  1 
ATOM   5867  C  C   . SER D  1 132 ? -7.513   99.086  23.766  1.00 16.56  ? 132 SER D C   1 
ATOM   5868  O  O   . SER D  1 132 ? -8.730   99.187  23.926  1.00 26.29  ? 132 SER D O   1 
ATOM   5869  C  CB  . SER D  1 132 ? -6.409   100.975 25.039  1.00 31.19  ? 132 SER D CB  1 
ATOM   5870  O  OG  . SER D  1 132 ? -5.212   101.444 24.447  1.00 32.36  ? 132 SER D OG  1 
ATOM   5871  N  N   . GLY D  1 133 ? -6.959   98.629  22.642  1.00 42.32  ? 133 GLY D N   1 
ATOM   5872  C  CA  . GLY D  1 133 ? -7.755   98.194  21.501  1.00 20.01  ? 133 GLY D CA  1 
ATOM   5873  C  C   . GLY D  1 133 ? -8.358   99.315  20.675  1.00 26.29  ? 133 GLY D C   1 
ATOM   5874  O  O   . GLY D  1 133 ? -8.142   100.500 20.939  1.00 28.14  ? 133 GLY D O   1 
ATOM   5875  N  N   . ALA D  1 134 ? -9.121   98.930  19.659  1.00 30.60  ? 134 ALA D N   1 
ATOM   5876  C  CA  . ALA D  1 134 ? -9.858   99.886  18.842  1.00 34.23  ? 134 ALA D CA  1 
ATOM   5877  C  C   . ALA D  1 134 ? -11.267  100.071 19.389  1.00 29.66  ? 134 ALA D C   1 
ATOM   5878  O  O   . ALA D  1 134 ? -11.813  99.187  20.043  1.00 17.52  ? 134 ALA D O   1 
ATOM   5879  C  CB  . ALA D  1 134 ? -9.911   99.411  17.402  1.00 27.02  ? 134 ALA D CB  1 
ATOM   5880  N  N   . THR D  1 135 ? -11.854  101.229 19.124  1.00 26.23  ? 135 THR D N   1 
ATOM   5881  C  CA  . THR D  1 135 ? -13.244  101.452 19.490  1.00 22.37  ? 135 THR D CA  1 
ATOM   5882  C  C   . THR D  1 135 ? -14.035  101.809 18.249  1.00 24.39  ? 135 THR D C   1 
ATOM   5883  O  O   . THR D  1 135 ? -13.940  102.921 17.733  1.00 23.89  ? 135 THR D O   1 
ATOM   5884  C  CB  . THR D  1 135 ? -13.407  102.529 20.577  1.00 25.59  ? 135 THR D CB  1 
ATOM   5885  O  OG1 . THR D  1 135 ? -12.872  102.039 21.814  1.00 27.88  ? 135 THR D OG1 1 
ATOM   5886  C  CG2 . THR D  1 135 ? -14.871  102.845 20.789  1.00 20.66  ? 135 THR D CG2 1 
ATOM   5887  N  N   . CYS D  1 136 ? -14.807  100.838 17.774  1.00 24.45  ? 136 CYS D N   1 
ATOM   5888  C  CA  . CYS D  1 136 ? -15.575  100.958 16.541  1.00 25.13  ? 136 CYS D CA  1 
ATOM   5889  C  C   . CYS D  1 136 ? -17.012  101.376 16.834  1.00 33.73  ? 136 CYS D C   1 
ATOM   5890  O  O   . CYS D  1 136 ? -17.758  100.642 17.491  1.00 20.85  ? 136 CYS D O   1 
ATOM   5891  C  CB  . CYS D  1 136 ? -15.558  99.627  15.801  1.00 21.84  ? 136 CYS D CB  1 
ATOM   5892  S  SG  . CYS D  1 136 ? -16.558  99.591  14.308  1.00 30.19  ? 136 CYS D SG  1 
ATOM   5893  N  N   . ARG D  1 137 ? -17.378  102.554 16.325  1.00 30.45  ? 137 ARG D N   1 
ATOM   5894  C  CA  . ARG D  1 137 ? -18.663  103.203 16.614  1.00 22.63  ? 137 ARG D CA  1 
ATOM   5895  C  C   . ARG D  1 137 ? -19.715  102.866 15.557  1.00 27.89  ? 137 ARG D C   1 
ATOM   5896  O  O   . ARG D  1 137 ? -19.549  103.138 14.365  1.00 18.85  ? 137 ARG D O   1 
ATOM   5897  C  CB  . ARG D  1 137 ? -18.470  104.722 16.677  1.00 27.78  ? 137 ARG D CB  1 
ATOM   5898  C  CG  . ARG D  1 137 ? -19.586  105.496 17.377  1.00 40.31  ? 137 ARG D CG  1 
ATOM   5899  C  CD  . ARG D  1 137 ? -19.170  106.953 17.641  1.00 40.98  ? 137 ARG D CD  1 
ATOM   5900  N  NE  . ARG D  1 137 ? -19.435  107.829 16.500  1.00 50.34  ? 137 ARG D NE  1 
ATOM   5901  C  CZ  . ARG D  1 137 ? -18.553  108.143 15.554  1.00 53.53  ? 137 ARG D CZ  1 
ATOM   5902  N  NH1 . ARG D  1 137 ? -17.317  107.657 15.600  1.00 54.47  ? 137 ARG D NH1 1 
ATOM   5903  N  NH2 . ARG D  1 137 ? -18.911  108.953 14.558  1.00 60.77  ? 137 ARG D NH2 1 
ATOM   5904  N  N   . ILE D  1 138 ? -20.801  102.263 15.995  1.00 28.65  ? 138 ILE D N   1 
ATOM   5905  C  CA  . ILE D  1 138 ? -21.876  101.951 15.079  1.00 31.81  ? 138 ILE D CA  1 
ATOM   5906  C  C   . ILE D  1 138 ? -23.124  102.759 15.416  1.00 30.08  ? 138 ILE D C   1 
ATOM   5907  O  O   . ILE D  1 138 ? -23.649  102.668 16.530  1.00 25.06  ? 138 ILE D O   1 
ATOM   5908  C  CB  . ILE D  1 138 ? -22.213  100.458 15.097  1.00 31.87  ? 138 ILE D CB  1 
ATOM   5909  C  CG1 . ILE D  1 138 ? -21.019  99.649  14.589  1.00 26.10  ? 138 ILE D CG1 1 
ATOM   5910  C  CG2 . ILE D  1 138 ? -23.456  100.205 14.254  1.00 22.71  ? 138 ILE D CG2 1 
ATOM   5911  C  CD1 . ILE D  1 138 ? -21.202  98.163  14.726  1.00 25.58  ? 138 ILE D CD1 1 
ATOM   5912  N  N   . LYS D  1 139 ? -23.594  103.539 14.442  1.00 28.12  ? 139 LYS D N   1 
ATOM   5913  C  CA  . LYS D  1 139 ? -24.763  104.411 14.615  1.00 23.54  ? 139 LYS D CA  1 
ATOM   5914  C  C   . LYS D  1 139 ? -26.022  103.844 13.966  1.00 22.87  ? 139 LYS D C   1 
ATOM   5915  O  O   . LYS D  1 139 ? -26.069  103.648 12.750  1.00 20.58  ? 139 LYS D O   1 
ATOM   5916  C  CB  . LYS D  1 139 ? -24.451  105.786 14.042  1.00 24.76  ? 139 LYS D CB  1 
ATOM   5917  C  CG  . LYS D  1 139 ? -25.560  106.796 14.069  1.00 24.37  ? 139 LYS D CG  1 
ATOM   5918  C  CD  . LYS D  1 139 ? -25.121  108.062 13.345  1.00 25.85  ? 139 LYS D CD  1 
ATOM   5919  C  CE  . LYS D  1 139 ? -26.240  109.069 13.217  1.00 25.66  ? 139 LYS D CE  1 
ATOM   5920  N  NZ  . LYS D  1 139 ? -25.800  110.261 12.463  1.00 27.28  ? 139 LYS D NZ  1 
ATOM   5921  N  N   . ILE D  1 140 ? -27.034  103.585 14.790  1.00 20.15  ? 140 ILE D N   1 
ATOM   5922  C  CA  . ILE D  1 140 ? -28.307  103.037 14.321  1.00 18.12  ? 140 ILE D CA  1 
ATOM   5923  C  C   . ILE D  1 140 ? -29.478  103.917 14.726  1.00 21.47  ? 140 ILE D C   1 
ATOM   5924  O  O   . ILE D  1 140 ? -29.574  104.343 15.878  1.00 22.37  ? 140 ILE D O   1 
ATOM   5925  C  CB  . ILE D  1 140 ? -28.557  101.628 14.872  1.00 20.21  ? 140 ILE D CB  1 
ATOM   5926  C  CG1 . ILE D  1 140 ? -27.443  100.675 14.441  1.00 27.57  ? 140 ILE D CG1 1 
ATOM   5927  C  CG2 . ILE D  1 140 ? -29.912  101.104 14.429  1.00 15.52  ? 140 ILE D CG2 1 
ATOM   5928  C  CD1 . ILE D  1 140 ? -27.598  99.276  15.000  1.00 36.05  ? 140 ILE D CD1 1 
ATOM   5929  N  N   . GLY D  1 141 ? -30.375  104.176 13.778  1.00 26.91  ? 141 GLY D N   1 
ATOM   5930  C  CA  . GLY D  1 141 ? -31.558  104.973 14.053  1.00 29.42  ? 141 GLY D CA  1 
ATOM   5931  C  C   . GLY D  1 141 ? -32.619  104.812 12.990  1.00 19.38  ? 141 GLY D C   1 
ATOM   5932  O  O   . GLY D  1 141 ? -32.370  104.191 11.966  1.00 14.29  ? 141 GLY D O   1 
ATOM   5933  N  N   . SER D  1 142 ? -33.809  105.353 13.234  1.00 23.02  ? 142 SER D N   1 
ATOM   5934  C  CA  . SER D  1 142 ? -34.837  105.362 12.199  1.00 26.12  ? 142 SER D CA  1 
ATOM   5935  C  C   . SER D  1 142 ? -34.354  106.161 10.995  1.00 29.38  ? 142 SER D C   1 
ATOM   5936  O  O   . SER D  1 142 ? -33.745  107.237 11.145  1.00 24.37  ? 142 SER D O   1 
ATOM   5937  C  CB  . SER D  1 142 ? -36.134  105.972 12.719  1.00 31.07  ? 142 SER D CB  1 
ATOM   5938  O  OG  . SER D  1 142 ? -37.062  106.139 11.660  1.00 26.84  ? 142 SER D OG  1 
ATOM   5939  N  N   . TRP D  1 143 ? -34.636  105.649 9.803   1.00 18.15  ? 143 TRP D N   1 
ATOM   5940  C  CA  . TRP D  1 143 ? -34.195  106.337 8.605   1.00 14.54  ? 143 TRP D CA  1 
ATOM   5941  C  C   . TRP D  1 143 ? -35.093  107.523 8.236   1.00 25.57  ? 143 TRP D C   1 
ATOM   5942  O  O   . TRP D  1 143 ? -34.597  108.600 7.890   1.00 19.17  ? 143 TRP D O   1 
ATOM   5943  C  CB  . TRP D  1 143 ? -34.032  105.365 7.435   1.00 14.61  ? 143 TRP D CB  1 
ATOM   5944  C  CG  . TRP D  1 143 ? -33.153  105.917 6.334   1.00 25.46  ? 143 TRP D CG  1 
ATOM   5945  C  CD1 . TRP D  1 143 ? -33.533  106.270 5.062   1.00 27.96  ? 143 TRP D CD1 1 
ATOM   5946  C  CD2 . TRP D  1 143 ? -31.744  106.189 6.420   1.00 17.19  ? 143 TRP D CD2 1 
ATOM   5947  N  NE1 . TRP D  1 143 ? -32.440  106.730 4.353   1.00 31.13  ? 143 TRP D NE1 1 
ATOM   5948  C  CE2 . TRP D  1 143 ? -31.335  106.698 5.167   1.00 25.56  ? 143 TRP D CE2 1 
ATOM   5949  C  CE3 . TRP D  1 143 ? -30.793  106.054 7.435   1.00 18.27  ? 143 TRP D CE3 1 
ATOM   5950  C  CZ2 . TRP D  1 143 ? -30.020  107.069 4.908   1.00 31.02  ? 143 TRP D CZ2 1 
ATOM   5951  C  CZ3 . TRP D  1 143 ? -29.495  106.417 7.174   1.00 18.87  ? 143 TRP D CZ3 1 
ATOM   5952  C  CH2 . TRP D  1 143 ? -29.118  106.923 5.920   1.00 19.98  ? 143 TRP D CH2 1 
ATOM   5953  N  N   . THR D  1 144 ? -36.407  107.335 8.330   1.00 14.77  ? 144 THR D N   1 
ATOM   5954  C  CA  . THR D  1 144 ? -37.335  108.349 7.837   1.00 15.18  ? 144 THR D CA  1 
ATOM   5955  C  C   . THR D  1 144 ? -38.211  108.967 8.918   1.00 17.21  ? 144 THR D C   1 
ATOM   5956  O  O   . THR D  1 144 ? -38.818  110.024 8.705   1.00 30.09  ? 144 THR D O   1 
ATOM   5957  C  CB  . THR D  1 144 ? -38.214  107.799 6.701   1.00 16.32  ? 144 THR D CB  1 
ATOM   5958  O  OG1 . THR D  1 144 ? -39.020  106.719 7.196   1.00 24.40  ? 144 THR D OG1 1 
ATOM   5959  C  CG2 . THR D  1 144 ? -37.339  107.292 5.562   1.00 15.67  ? 144 THR D CG2 1 
ATOM   5960  N  N   . HIS D  1 145 ? -38.268  108.318 10.079  1.00 16.57  ? 145 HIS D N   1 
ATOM   5961  C  CA  . HIS D  1 145 ? -39.144  108.780 11.163  1.00 19.10  ? 145 HIS D CA  1 
ATOM   5962  C  C   . HIS D  1 145 ? -38.417  109.632 12.201  1.00 17.77  ? 145 HIS D C   1 
ATOM   5963  O  O   . HIS D  1 145 ? -37.518  109.155 12.883  1.00 20.05  ? 145 HIS D O   1 
ATOM   5964  C  CB  . HIS D  1 145 ? -39.823  107.603 11.866  1.00 14.02  ? 145 HIS D CB  1 
ATOM   5965  C  CG  . HIS D  1 145 ? -40.800  106.859 11.013  1.00 27.28  ? 145 HIS D CG  1 
ATOM   5966  N  ND1 . HIS D  1 145 ? -42.044  107.363 10.690  1.00 24.92  ? 145 HIS D ND1 1 
ATOM   5967  C  CD2 . HIS D  1 145 ? -40.730  105.632 10.445  1.00 16.76  ? 145 HIS D CD2 1 
ATOM   5968  C  CE1 . HIS D  1 145 ? -42.692  106.481 9.948   1.00 30.31  ? 145 HIS D CE1 1 
ATOM   5969  N  NE2 . HIS D  1 145 ? -41.918  105.421 9.787   1.00 35.62  ? 145 HIS D NE2 1 
ATOM   5970  N  N   . HIS D  1 146 ? -38.829  110.889 12.326  1.00 18.76  ? 146 HIS D N   1 
ATOM   5971  C  CA  . HIS D  1 146 ? -38.243  111.798 13.303  1.00 21.06  ? 146 HIS D CA  1 
ATOM   5972  C  C   . HIS D  1 146 ? -38.690  111.506 14.753  1.00 21.06  ? 146 HIS D C   1 
ATOM   5973  O  O   . HIS D  1 146 ? -39.433  110.563 15.016  1.00 21.16  ? 146 HIS D O   1 
ATOM   5974  C  CB  . HIS D  1 146 ? -38.528  113.257 12.909  1.00 24.57  ? 146 HIS D CB  1 
ATOM   5975  C  CG  . HIS D  1 146 ? -39.986  113.577 12.770  1.00 37.68  ? 146 HIS D CG  1 
ATOM   5976  N  ND1 . HIS D  1 146 ? -40.852  113.607 13.844  1.00 37.12  ? 146 HIS D ND1 1 
ATOM   5977  C  CD2 . HIS D  1 146 ? -40.731  113.883 11.680  1.00 27.03  ? 146 HIS D CD2 1 
ATOM   5978  C  CE1 . HIS D  1 146 ? -42.065  113.921 13.421  1.00 36.25  ? 146 HIS D CE1 1 
ATOM   5979  N  NE2 . HIS D  1 146 ? -42.017  114.098 12.112  1.00 29.52  ? 146 HIS D NE2 1 
ATOM   5980  N  N   . SER D  1 147 ? -38.231  112.334 15.687  1.00 23.77  ? 147 SER D N   1 
ATOM   5981  C  CA  . SER D  1 147 ? -38.307  112.023 17.112  1.00 24.25  ? 147 SER D CA  1 
ATOM   5982  C  C   . SER D  1 147 ? -39.725  112.020 17.698  1.00 29.62  ? 147 SER D C   1 
ATOM   5983  O  O   . SER D  1 147 ? -39.950  111.442 18.756  1.00 30.77  ? 147 SER D O   1 
ATOM   5984  C  CB  . SER D  1 147 ? -37.412  112.971 17.918  1.00 27.83  ? 147 SER D CB  1 
ATOM   5985  O  OG  . SER D  1 147 ? -37.884  114.306 17.850  1.00 40.47  ? 147 SER D OG  1 
ATOM   5986  N  N   . ARG D  1 148 ? -40.673  112.673 17.028  1.00 21.06  ? 148 ARG D N   1 
ATOM   5987  C  CA  . ARG D  1 148 ? -42.088  112.626 17.432  1.00 31.51  ? 148 ARG D CA  1 
ATOM   5988  C  C   . ARG D  1 148 ? -42.804  111.338 17.025  1.00 27.68  ? 148 ARG D C   1 
ATOM   5989  O  O   . ARG D  1 148 ? -43.870  111.016 17.581  1.00 15.53  ? 148 ARG D O   1 
ATOM   5990  C  CB  . ARG D  1 148 ? -42.870  113.841 16.904  1.00 8.25   ? 148 ARG D CB  1 
ATOM   5991  C  CG  . ARG D  1 148 ? -42.445  115.157 17.563  1.00 24.85  ? 148 ARG D CG  1 
ATOM   5992  C  CD  . ARG D  1 148 ? -43.175  116.355 16.989  1.00 0.67   ? 148 ARG D CD  1 
ATOM   5993  N  NE  . ARG D  1 148 ? -42.979  116.417 15.555  1.00 30.42  ? 148 ARG D NE  1 
ATOM   5994  C  CZ  . ARG D  1 148 ? -43.945  116.687 14.692  1.00 31.96  ? 148 ARG D CZ  1 
ATOM   5995  N  NH1 . ARG D  1 148 ? -45.168  116.940 15.132  1.00 26.62  ? 148 ARG D NH1 1 
ATOM   5996  N  NH2 . ARG D  1 148 ? -43.691  116.709 13.394  1.00 68.87  ? 148 ARG D NH2 1 
ATOM   5997  N  N   . GLU D  1 149 ? -42.209  110.613 16.073  1.00 29.56  ? 149 GLU D N   1 
ATOM   5998  C  CA  . GLU D  1 149 ? -42.784  109.379 15.541  1.00 20.74  ? 149 GLU D CA  1 
ATOM   5999  C  C   . GLU D  1 149 ? -42.053  108.141 16.036  1.00 21.67  ? 149 GLU D C   1 
ATOM   6000  O  O   . GLU D  1 149 ? -42.683  107.173 16.473  1.00 28.02  ? 149 GLU D O   1 
ATOM   6001  C  CB  . GLU D  1 149 ? -42.827  109.402 14.012  1.00 22.53  ? 149 GLU D CB  1 
ATOM   6002  C  CG  . GLU D  1 149 ? -43.610  110.582 13.450  1.00 15.79  ? 149 GLU D CG  1 
ATOM   6003  C  CD  . GLU D  1 149 ? -43.720  110.576 11.938  1.00 30.59  ? 149 GLU D CD  1 
ATOM   6004  O  OE1 . GLU D  1 149 ? -42.807  110.057 11.261  1.00 38.42  ? 149 GLU D OE1 1 
ATOM   6005  O  OE2 . GLU D  1 149 ? -44.728  111.094 11.421  1.00 28.47  ? 149 GLU D OE2 1 
ATOM   6006  N  N   . ILE D  1 150 ? -40.728  108.169 15.969  1.00 21.51  ? 150 ILE D N   1 
ATOM   6007  C  CA  . ILE D  1 150 ? -39.918  107.092 16.545  1.00 19.13  ? 150 ILE D CA  1 
ATOM   6008  C  C   . ILE D  1 150 ? -38.845  107.612 17.497  1.00 29.90  ? 150 ILE D C   1 
ATOM   6009  O  O   . ILE D  1 150 ? -38.120  108.558 17.178  1.00 22.43  ? 150 ILE D O   1 
ATOM   6010  C  CB  . ILE D  1 150 ? -39.223  106.248 15.466  1.00 23.18  ? 150 ILE D CB  1 
ATOM   6011  C  CG1 . ILE D  1 150 ? -40.239  105.351 14.759  1.00 16.23  ? 150 ILE D CG1 1 
ATOM   6012  C  CG2 . ILE D  1 150 ? -38.096  105.397 16.081  1.00 15.20  ? 150 ILE D CG2 1 
ATOM   6013  C  CD1 . ILE D  1 150 ? -39.622  104.423 13.759  1.00 15.33  ? 150 ILE D CD1 1 
ATOM   6014  N  N   . SER D  1 151 ? -38.757  106.990 18.671  1.00 33.67  ? 151 SER D N   1 
ATOM   6015  C  CA  . SER D  1 151 ? -37.657  107.245 19.594  1.00 34.65  ? 151 SER D CA  1 
ATOM   6016  C  C   . SER D  1 151 ? -36.883  105.952 19.801  1.00 30.96  ? 151 SER D C   1 
ATOM   6017  O  O   . SER D  1 151 ? -37.477  104.878 19.966  1.00 24.96  ? 151 SER D O   1 
ATOM   6018  C  CB  . SER D  1 151 ? -38.169  107.754 20.939  1.00 18.60  ? 151 SER D CB  1 
ATOM   6019  O  OG  . SER D  1 151 ? -38.547  106.675 21.766  1.00 35.56  ? 151 SER D OG  1 
ATOM   6020  N  N   . VAL D  1 152 ? -35.557  106.058 19.784  1.00 21.96  ? 152 VAL D N   1 
ATOM   6021  C  CA  . VAL D  1 152 ? -34.695  104.899 19.991  1.00 27.32  ? 152 VAL D CA  1 
ATOM   6022  C  C   . VAL D  1 152 ? -34.018  104.992 21.337  1.00 18.01  ? 152 VAL D C   1 
ATOM   6023  O  O   . VAL D  1 152 ? -33.594  106.068 21.747  1.00 30.83  ? 152 VAL D O   1 
ATOM   6024  C  CB  . VAL D  1 152 ? -33.604  104.785 18.905  1.00 18.46  ? 152 VAL D CB  1 
ATOM   6025  C  CG1 . VAL D  1 152 ? -34.213  104.323 17.596  1.00 22.61  ? 152 VAL D CG1 1 
ATOM   6026  C  CG2 . VAL D  1 152 ? -32.913  106.104 18.730  1.00 17.96  ? 152 VAL D CG2 1 
ATOM   6027  N  N   . ASP D  1 153 ? -33.927  103.870 22.035  1.00 26.01  ? 153 ASP D N   1 
ATOM   6028  C  CA  A ASP D  1 153 ? -33.180  103.850 23.279  0.50 41.20  ? 153 ASP D CA  1 
ATOM   6029  C  CA  B ASP D  1 153 ? -33.223  103.830 23.316  0.50 41.15  ? 153 ASP D CA  1 
ATOM   6030  C  C   . ASP D  1 153 ? -32.445  102.527 23.479  1.00 30.18  ? 153 ASP D C   1 
ATOM   6031  O  O   . ASP D  1 153 ? -32.839  101.490 22.945  1.00 37.49  ? 153 ASP D O   1 
ATOM   6032  C  CB  A ASP D  1 153 ? -34.074  104.218 24.472  0.50 19.18  ? 153 ASP D CB  1 
ATOM   6033  C  CB  B ASP D  1 153 ? -34.177  104.096 24.503  0.50 19.16  ? 153 ASP D CB  1 
ATOM   6034  C  CG  A ASP D  1 153 ? -34.552  105.666 24.417  0.50 19.75  ? 153 ASP D CG  1 
ATOM   6035  C  CG  B ASP D  1 153 ? -34.796  102.820 25.087  0.50 57.43  ? 153 ASP D CG  1 
ATOM   6036  O  OD1 A ASP D  1 153 ? -35.584  105.933 23.764  0.50 69.97  ? 153 ASP D OD1 1 
ATOM   6037  O  OD1 B ASP D  1 153 ? -34.634  101.729 24.507  0.50 67.37  ? 153 ASP D OD1 1 
ATOM   6038  O  OD2 A ASP D  1 153 ? -33.897  106.547 25.009  0.50 20.48  ? 153 ASP D OD2 1 
ATOM   6039  O  OD2 B ASP D  1 153 ? -35.468  102.912 26.139  0.50 20.05  ? 153 ASP D OD2 1 
ATOM   6040  N  N   . PRO D  1 154 ? -31.330  102.581 24.204  1.00 29.82  ? 154 PRO D N   1 
ATOM   6041  C  CA  . PRO D  1 154 ? -30.543  101.389 24.501  1.00 34.33  ? 154 PRO D CA  1 
ATOM   6042  C  C   . PRO D  1 154 ? -31.306  100.502 25.465  1.00 37.95  ? 154 PRO D C   1 
ATOM   6043  O  O   . PRO D  1 154 ? -32.259  100.943 26.084  1.00 40.07  ? 154 PRO D O   1 
ATOM   6044  C  CB  . PRO D  1 154 ? -29.285  101.956 25.159  1.00 37.68  ? 154 PRO D CB  1 
ATOM   6045  C  CG  . PRO D  1 154 ? -29.235  103.384 24.736  1.00 39.72  ? 154 PRO D CG  1 
ATOM   6046  C  CD  . PRO D  1 154 ? -30.658  103.813 24.637  1.00 32.78  ? 154 PRO D CD  1 
ATOM   6047  N  N   . THR D  1 155 ? -30.896  99.248  25.554  1.00 34.33  ? 155 THR D N   1 
ATOM   6048  C  CA  . THR D  1 155 ? -31.550  98.262  26.394  1.00 32.58  ? 155 THR D CA  1 
ATOM   6049  C  C   . THR D  1 155 ? -30.938  98.208  27.792  1.00 32.77  ? 155 THR D C   1 
ATOM   6050  O  O   . THR D  1 155 ? -29.762  98.549  27.997  1.00 47.12  ? 155 THR D O   1 
ATOM   6051  C  CB  . THR D  1 155 ? -31.484  96.876  25.726  1.00 39.83  ? 155 THR D CB  1 
ATOM   6052  O  OG1 . THR D  1 155 ? -32.381  96.856  24.606  1.00 45.75  ? 155 THR D OG1 1 
ATOM   6053  C  CG2 . THR D  1 155 ? -31.862  95.768  26.704  1.00 47.36  ? 155 THR D CG2 1 
ATOM   6054  N  N   . SER D  1 159 ? -25.824  94.143  31.124  1.00 61.96  ? 159 SER D N   1 
ATOM   6055  C  CA  . SER D  1 159 ? -25.444  92.795  30.700  1.00 79.63  ? 159 SER D CA  1 
ATOM   6056  C  C   . SER D  1 159 ? -24.062  92.749  30.011  1.00 77.31  ? 159 SER D C   1 
ATOM   6057  O  O   . SER D  1 159 ? -23.365  93.779  29.874  1.00 28.25  ? 159 SER D O   1 
ATOM   6058  C  CB  . SER D  1 159 ? -26.534  92.150  29.822  1.00 87.05  ? 159 SER D CB  1 
ATOM   6059  O  OG  . SER D  1 159 ? -26.643  92.771  28.552  1.00 94.52  ? 159 SER D OG  1 
ATOM   6060  N  N   . ASP D  1 160 ? -23.669  91.550  29.582  1.00 72.12  ? 160 ASP D N   1 
ATOM   6061  C  CA  . ASP D  1 160 ? -22.295  91.344  29.143  1.00 60.38  ? 160 ASP D CA  1 
ATOM   6062  C  C   . ASP D  1 160 ? -22.025  91.335  27.643  1.00 73.84  ? 160 ASP D C   1 
ATOM   6063  O  O   . ASP D  1 160 ? -22.633  90.589  26.862  1.00 36.54  ? 160 ASP D O   1 
ATOM   6064  C  CB  . ASP D  1 160 ? -21.675  90.110  29.780  1.00 70.22  ? 160 ASP D CB  1 
ATOM   6065  C  CG  . ASP D  1 160 ? -20.178  90.274  29.993  1.00 74.46  ? 160 ASP D CG  1 
ATOM   6066  O  OD1 . ASP D  1 160 ? -19.420  89.338  29.640  1.00 75.25  ? 160 ASP D OD1 1 
ATOM   6067  O  OD2 . ASP D  1 160 ? -19.773  91.354  30.502  1.00 29.25  ? 160 ASP D OD2 1 
ATOM   6068  N  N   . ASP D  1 161 ? -21.057  92.172  27.288  1.00 97.58  ? 161 ASP D N   1 
ATOM   6069  C  CA  . ASP D  1 161 ? -20.579  92.370  25.932  1.00 83.48  ? 161 ASP D CA  1 
ATOM   6070  C  C   . ASP D  1 161 ? -20.262  91.057  25.240  1.00 64.92  ? 161 ASP D C   1 
ATOM   6071  O  O   . ASP D  1 161 ? -20.543  90.886  24.052  1.00 63.00  ? 161 ASP D O   1 
ATOM   6072  C  CB  . ASP D  1 161 ? -19.316  93.225  25.990  1.00 75.83  ? 161 ASP D CB  1 
ATOM   6073  C  CG  . ASP D  1 161 ? -19.274  94.123  27.231  1.00 85.75  ? 161 ASP D CG  1 
ATOM   6074  O  OD1 . ASP D  1 161 ? -20.269  94.844  27.497  1.00 64.64  ? 161 ASP D OD1 1 
ATOM   6075  O  OD2 . ASP D  1 161 ? -18.243  94.096  27.947  1.00 90.96  ? 161 ASP D OD2 1 
ATOM   6076  N  N   . SER D  1 162 ? -19.689  90.122  25.988  1.00 61.59  ? 162 SER D N   1 
ATOM   6077  C  CA  . SER D  1 162 ? -19.162  88.924  25.358  1.00 73.31  ? 162 SER D CA  1 
ATOM   6078  C  C   . SER D  1 162 ? -20.019  87.698  25.623  1.00 62.85  ? 162 SER D C   1 
ATOM   6079  O  O   . SER D  1 162 ? -19.644  86.578  25.282  1.00 58.60  ? 162 SER D O   1 
ATOM   6080  C  CB  . SER D  1 162 ? -17.723  88.665  25.812  1.00 72.62  ? 162 SER D CB  1 
ATOM   6081  O  OG  . SER D  1 162 ? -16.873  89.758  25.502  1.00 77.11  ? 162 SER D OG  1 
ATOM   6082  N  N   . GLU D  1 163 ? -21.177  87.900  26.225  1.00 48.94  ? 163 GLU D N   1 
ATOM   6083  C  CA  . GLU D  1 163 ? -21.981  86.758  26.619  1.00 55.76  ? 163 GLU D CA  1 
ATOM   6084  C  C   . GLU D  1 163 ? -22.213  85.772  25.471  1.00 57.16  ? 163 GLU D C   1 
ATOM   6085  O  O   . GLU D  1 163 ? -22.114  84.558  25.663  1.00 52.37  ? 163 GLU D O   1 
ATOM   6086  C  CB  . GLU D  1 163 ? -23.310  87.207  27.206  1.00 64.07  ? 163 GLU D CB  1 
ATOM   6087  C  CG  . GLU D  1 163 ? -24.068  86.068  27.852  1.00 80.50  ? 163 GLU D CG  1 
ATOM   6088  C  CD  . GLU D  1 163 ? -25.529  86.393  28.088  1.00 92.89  ? 163 GLU D CD  1 
ATOM   6089  O  OE1 . GLU D  1 163 ? -25.895  87.592  28.011  1.00 97.80  ? 163 GLU D OE1 1 
ATOM   6090  O  OE2 . GLU D  1 163 ? -26.308  85.442  28.342  1.00 91.59  ? 163 GLU D OE2 1 
ATOM   6091  N  N   . TYR D  1 164 ? -22.519  86.289  24.282  1.00 42.27  ? 164 TYR D N   1 
ATOM   6092  C  CA  . TYR D  1 164 ? -22.735  85.425  23.125  1.00 32.61  ? 164 TYR D CA  1 
ATOM   6093  C  C   . TYR D  1 164 ? -21.579  85.475  22.105  1.00 40.70  ? 164 TYR D C   1 
ATOM   6094  O  O   . TYR D  1 164 ? -21.724  85.020  20.955  1.00 32.50  ? 164 TYR D O   1 
ATOM   6095  C  CB  . TYR D  1 164 ? -24.048  85.766  22.413  1.00 47.88  ? 164 TYR D CB  1 
ATOM   6096  C  CG  . TYR D  1 164 ? -25.251  85.854  23.310  1.00 50.66  ? 164 TYR D CG  1 
ATOM   6097  C  CD1 . TYR D  1 164 ? -25.614  84.792  24.124  1.00 55.69  ? 164 TYR D CD1 1 
ATOM   6098  C  CD2 . TYR D  1 164 ? -26.037  86.999  23.333  1.00 49.55  ? 164 TYR D CD2 1 
ATOM   6099  C  CE1 . TYR D  1 164 ? -26.725  84.875  24.950  1.00 62.06  ? 164 TYR D CE1 1 
ATOM   6100  C  CE2 . TYR D  1 164 ? -27.147  87.092  24.152  1.00 57.98  ? 164 TYR D CE2 1 
ATOM   6101  C  CZ  . TYR D  1 164 ? -27.490  86.030  24.960  1.00 58.53  ? 164 TYR D CZ  1 
ATOM   6102  O  OH  . TYR D  1 164 ? -28.591  86.129  25.784  1.00 48.41  ? 164 TYR D OH  1 
ATOM   6103  N  N   . PHE D  1 165 ? -20.435  86.014  22.516  1.00 31.38  ? 165 PHE D N   1 
ATOM   6104  C  CA  . PHE D  1 165 ? -19.348  86.228  21.571  1.00 22.92  ? 165 PHE D CA  1 
ATOM   6105  C  C   . PHE D  1 165 ? -18.558  84.952  21.314  1.00 28.71  ? 165 PHE D C   1 
ATOM   6106  O  O   . PHE D  1 165 ? -18.264  84.199  22.235  1.00 31.40  ? 165 PHE D O   1 
ATOM   6107  C  CB  . PHE D  1 165 ? -18.446  87.342  22.056  1.00 22.12  ? 165 PHE D CB  1 
ATOM   6108  C  CG  . PHE D  1 165 ? -17.544  87.876  21.006  1.00 34.65  ? 165 PHE D CG  1 
ATOM   6109  C  CD1 . PHE D  1 165 ? -18.049  88.669  19.994  1.00 27.84  ? 165 PHE D CD1 1 
ATOM   6110  C  CD2 . PHE D  1 165 ? -16.179  87.594  21.025  1.00 20.79  ? 165 PHE D CD2 1 
ATOM   6111  C  CE1 . PHE D  1 165 ? -17.206  89.178  19.021  1.00 25.80  ? 165 PHE D CE1 1 
ATOM   6112  C  CE2 . PHE D  1 165 ? -15.346  88.093  20.050  1.00 20.57  ? 165 PHE D CE2 1 
ATOM   6113  C  CZ  . PHE D  1 165 ? -15.863  88.889  19.047  1.00 21.36  ? 165 PHE D CZ  1 
ATOM   6114  N  N   . SER D  1 166 ? -18.213  84.715  20.052  1.00 23.46  ? 166 SER D N   1 
ATOM   6115  C  CA  . SER D  1 166 ? -17.514  83.492  19.663  1.00 22.11  ? 166 SER D CA  1 
ATOM   6116  C  C   . SER D  1 166 ? -16.107  83.397  20.248  1.00 23.96  ? 166 SER D C   1 
ATOM   6117  O  O   . SER D  1 166 ? -15.296  84.308  20.109  1.00 21.94  ? 166 SER D O   1 
ATOM   6118  C  CB  . SER D  1 166 ? -17.449  83.382  18.151  1.00 22.62  ? 166 SER D CB  1 
ATOM   6119  O  OG  . SER D  1 166 ? -16.777  82.200  17.780  1.00 39.62  ? 166 SER D OG  1 
ATOM   6120  N  N   . GLN D  1 167 ? -15.827  82.282  20.905  1.00 23.71  ? 167 GLN D N   1 
ATOM   6121  C  CA  . GLN D  1 167 ? -14.525  82.064  21.510  1.00 28.49  ? 167 GLN D CA  1 
ATOM   6122  C  C   . GLN D  1 167 ? -13.502  81.790  20.409  1.00 39.80  ? 167 GLN D C   1 
ATOM   6123  O  O   . GLN D  1 167 ? -12.296  81.812  20.649  1.00 36.71  ? 167 GLN D O   1 
ATOM   6124  C  CB  . GLN D  1 167 ? -14.582  80.879  22.478  1.00 22.00  ? 167 GLN D CB  1 
ATOM   6125  C  CG  . GLN D  1 167 ? -14.968  79.587  21.782  1.00 44.97  ? 167 GLN D CG  1 
ATOM   6126  C  CD  . GLN D  1 167 ? -15.125  78.435  22.733  1.00 45.63  ? 167 GLN D CD  1 
ATOM   6127  O  OE1 . GLN D  1 167 ? -16.206  77.871  22.864  1.00 57.32  ? 167 GLN D OE1 1 
ATOM   6128  N  NE2 . GLN D  1 167 ? -14.045  78.063  23.389  1.00 37.03  ? 167 GLN D NE2 1 
ATOM   6129  N  N   . TYR D  1 168 ? -13.979  81.544  19.195  1.00 28.98  ? 168 TYR D N   1 
ATOM   6130  C  CA  . TYR D  1 168 ? -13.072  81.184  18.111  1.00 22.83  ? 168 TYR D CA  1 
ATOM   6131  C  C   . TYR D  1 168 ? -12.717  82.362  17.209  1.00 29.84  ? 168 TYR D C   1 
ATOM   6132  O  O   . TYR D  1 168 ? -11.940  82.226  16.263  1.00 25.91  ? 168 TYR D O   1 
ATOM   6133  C  CB  . TYR D  1 168 ? -13.632  80.004  17.309  1.00 23.09  ? 168 TYR D CB  1 
ATOM   6134  C  CG  . TYR D  1 168 ? -13.952  78.814  18.182  1.00 30.35  ? 168 TYR D CG  1 
ATOM   6135  C  CD1 . TYR D  1 168 ? -12.943  78.115  18.810  1.00 19.28  ? 168 TYR D CD1 1 
ATOM   6136  C  CD2 . TYR D  1 168 ? -15.263  78.394  18.379  1.00 21.58  ? 168 TYR D CD2 1 
ATOM   6137  C  CE1 . TYR D  1 168 ? -13.221  77.032  19.624  1.00 28.31  ? 168 TYR D CE1 1 
ATOM   6138  C  CE2 . TYR D  1 168 ? -15.557  77.307  19.176  1.00 21.05  ? 168 TYR D CE2 1 
ATOM   6139  C  CZ  . TYR D  1 168 ? -14.532  76.632  19.803  1.00 39.77  ? 168 TYR D CZ  1 
ATOM   6140  O  OH  . TYR D  1 168 ? -14.817  75.553  20.605  1.00 42.20  ? 168 TYR D OH  1 
ATOM   6141  N  N   . SER D  1 169 ? -13.264  83.528  17.519  1.00 26.32  ? 169 SER D N   1 
ATOM   6142  C  CA  . SER D  1 169 ? -12.883  84.729  16.796  1.00 29.28  ? 169 SER D CA  1 
ATOM   6143  C  C   . SER D  1 169 ? -11.402  85.025  17.014  1.00 31.04  ? 169 SER D C   1 
ATOM   6144  O  O   . SER D  1 169 ? -10.849  84.690  18.062  1.00 23.25  ? 169 SER D O   1 
ATOM   6145  C  CB  . SER D  1 169 ? -13.722  85.913  17.268  1.00 27.31  ? 169 SER D CB  1 
ATOM   6146  O  OG  . SER D  1 169 ? -13.302  87.106  16.639  1.00 42.85  ? 169 SER D OG  1 
ATOM   6147  N  N   . ARG D  1 170 ? -10.763  85.662  16.040  1.00 25.09  ? 170 ARG D N   1 
ATOM   6148  C  CA  . ARG D  1 170 ? -9.395   86.133  16.238  1.00 26.83  ? 170 ARG D CA  1 
ATOM   6149  C  C   . ARG D  1 170 ? -9.366   87.330  17.176  1.00 37.38  ? 170 ARG D C   1 
ATOM   6150  O  O   . ARG D  1 170 ? -8.293   87.773  17.594  1.00 42.69  ? 170 ARG D O   1 
ATOM   6151  C  CB  . ARG D  1 170 ? -8.744   86.535  14.917  1.00 20.82  ? 170 ARG D CB  1 
ATOM   6152  C  CG  . ARG D  1 170 ? -8.118   85.394  14.151  1.00 25.48  ? 170 ARG D CG  1 
ATOM   6153  C  CD  . ARG D  1 170 ? -7.522   85.913  12.853  1.00 48.21  ? 170 ARG D CD  1 
ATOM   6154  N  NE  . ARG D  1 170 ? -8.528   86.603  12.059  1.00 77.83  ? 170 ARG D NE  1 
ATOM   6155  C  CZ  . ARG D  1 170 ? -8.273   87.544  11.158  1.00 80.52  ? 170 ARG D CZ  1 
ATOM   6156  N  NH1 . ARG D  1 170 ? -7.021   87.938  10.927  1.00 76.98  ? 170 ARG D NH1 1 
ATOM   6157  N  NH2 . ARG D  1 170 ? -9.283   88.094  10.493  1.00 58.39  ? 170 ARG D NH2 1 
ATOM   6158  N  N   . PHE D  1 171 ? -10.539  87.864  17.494  1.00 28.31  ? 171 PHE D N   1 
ATOM   6159  C  CA  . PHE D  1 171 ? -10.624  89.037  18.352  1.00 26.00  ? 171 PHE D CA  1 
ATOM   6160  C  C   . PHE D  1 171 ? -11.352  88.761  19.672  1.00 27.45  ? 171 PHE D C   1 
ATOM   6161  O  O   . PHE D  1 171 ? -11.917  87.684  19.888  1.00 27.45  ? 171 PHE D O   1 
ATOM   6162  C  CB  . PHE D  1 171 ? -11.281  90.185  17.598  1.00 19.05  ? 171 PHE D CB  1 
ATOM   6163  C  CG  . PHE D  1 171 ? -10.693  90.410  16.247  1.00 19.28  ? 171 PHE D CG  1 
ATOM   6164  C  CD1 . PHE D  1 171 ? -11.044  89.599  15.176  1.00 26.85  ? 171 PHE D CD1 1 
ATOM   6165  C  CD2 . PHE D  1 171 ? -9.768   91.419  16.040  1.00 26.24  ? 171 PHE D CD2 1 
ATOM   6166  C  CE1 . PHE D  1 171 ? -10.495  89.803  13.906  1.00 31.41  ? 171 PHE D CE1 1 
ATOM   6167  C  CE2 . PHE D  1 171 ? -9.212   91.624  14.794  1.00 30.80  ? 171 PHE D CE2 1 
ATOM   6168  C  CZ  . PHE D  1 171 ? -9.582   90.813  13.719  1.00 33.28  ? 171 PHE D CZ  1 
ATOM   6169  N  N   . GLU D  1 172 ? -11.301  89.751  20.554  1.00 29.85  ? 172 GLU D N   1 
ATOM   6170  C  CA  . GLU D  1 172 ? -11.997  89.700  21.820  1.00 30.80  ? 172 GLU D CA  1 
ATOM   6171  C  C   . GLU D  1 172 ? -12.600  91.074  22.127  1.00 30.93  ? 172 GLU D C   1 
ATOM   6172  O  O   . GLU D  1 172 ? -12.113  92.108  21.666  1.00 24.46  ? 172 GLU D O   1 
ATOM   6173  C  CB  . GLU D  1 172 ? -11.051  89.239  22.929  1.00 19.08  ? 172 GLU D CB  1 
ATOM   6174  C  CG  . GLU D  1 172 ? -9.824   90.109  23.112  1.00 41.53  ? 172 GLU D CG  1 
ATOM   6175  C  CD  . GLU D  1 172 ? -8.872   89.571  24.186  1.00 52.46  ? 172 GLU D CD  1 
ATOM   6176  O  OE1 . GLU D  1 172 ? -9.226   88.576  24.855  1.00 54.66  ? 172 GLU D OE1 1 
ATOM   6177  O  OE2 . GLU D  1 172 ? -7.768   90.137  24.366  1.00 41.78  ? 172 GLU D OE2 1 
ATOM   6178  N  N   . ILE D  1 173 ? -13.679  91.079  22.892  1.00 29.14  ? 173 ILE D N   1 
ATOM   6179  C  CA  . ILE D  1 173 ? -14.365  92.317  23.192  1.00 19.33  ? 173 ILE D CA  1 
ATOM   6180  C  C   . ILE D  1 173 ? -13.945  92.807  24.551  1.00 27.82  ? 173 ILE D C   1 
ATOM   6181  O  O   . ILE D  1 173 ? -14.042  92.081  25.541  1.00 29.78  ? 173 ILE D O   1 
ATOM   6182  C  CB  . ILE D  1 173 ? -15.880  92.129  23.189  1.00 26.21  ? 173 ILE D CB  1 
ATOM   6183  C  CG1 . ILE D  1 173 ? -16.372  91.856  21.764  1.00 25.25  ? 173 ILE D CG1 1 
ATOM   6184  C  CG2 . ILE D  1 173 ? -16.562  93.347  23.769  1.00 24.79  ? 173 ILE D CG2 1 
ATOM   6185  C  CD1 . ILE D  1 173 ? -17.877  91.621  21.670  1.00 36.20  ? 173 ILE D CD1 1 
ATOM   6186  N  N   . LEU D  1 174 ? -13.472  94.045  24.597  1.00 32.21  ? 174 LEU D N   1 
ATOM   6187  C  CA  . LEU D  1 174 ? -13.022  94.629  25.849  1.00 31.44  ? 174 LEU D CA  1 
ATOM   6188  C  C   . LEU D  1 174 ? -14.184  95.316  26.547  1.00 32.20  ? 174 LEU D C   1 
ATOM   6189  O  O   . LEU D  1 174 ? -14.355  95.184  27.754  1.00 38.57  ? 174 LEU D O   1 
ATOM   6190  C  CB  . LEU D  1 174 ? -11.866  95.608  25.610  1.00 25.41  ? 174 LEU D CB  1 
ATOM   6191  C  CG  . LEU D  1 174 ? -10.693  95.014  24.843  1.00 30.52  ? 174 LEU D CG  1 
ATOM   6192  C  CD1 . LEU D  1 174 ? -9.660   96.080  24.565  1.00 31.68  ? 174 LEU D CD1 1 
ATOM   6193  C  CD2 . LEU D  1 174 ? -10.105  93.843  25.619  1.00 19.41  ? 174 LEU D CD2 1 
ATOM   6194  N  N   . ASP D  1 175 ? -14.987  96.037  25.776  1.00 26.35  ? 175 ASP D N   1 
ATOM   6195  C  CA  . ASP D  1 175 ? -16.119  96.744  26.336  1.00 30.51  ? 175 ASP D CA  1 
ATOM   6196  C  C   . ASP D  1 175 ? -17.128  97.099  25.246  1.00 30.48  ? 175 ASP D C   1 
ATOM   6197  O  O   . ASP D  1 175 ? -16.775  97.211  24.077  1.00 30.55  ? 175 ASP D O   1 
ATOM   6198  C  CB  . ASP D  1 175 ? -15.639  98.013  27.046  1.00 27.82  ? 175 ASP D CB  1 
ATOM   6199  C  CG  . ASP D  1 175 ? -16.625  98.517  28.079  1.00 41.55  ? 175 ASP D CG  1 
ATOM   6200  O  OD1 . ASP D  1 175 ? -17.448  97.715  28.560  1.00 53.03  ? 175 ASP D OD1 1 
ATOM   6201  O  OD2 . ASP D  1 175 ? -16.571  99.718  28.418  1.00 52.77  ? 175 ASP D OD2 1 
ATOM   6202  N  N   . VAL D  1 176 ? -18.385  97.256  25.646  1.00 22.33  ? 176 VAL D N   1 
ATOM   6203  C  CA  . VAL D  1 176 ? -19.412  97.807  24.789  1.00 24.65  ? 176 VAL D CA  1 
ATOM   6204  C  C   . VAL D  1 176 ? -20.173  98.871  25.569  1.00 31.48  ? 176 VAL D C   1 
ATOM   6205  O  O   . VAL D  1 176 ? -20.695  98.596  26.649  1.00 25.14  ? 176 VAL D O   1 
ATOM   6206  C  CB  . VAL D  1 176 ? -20.412  96.731  24.320  1.00 24.63  ? 176 VAL D CB  1 
ATOM   6207  C  CG1 . VAL D  1 176 ? -21.429  97.339  23.386  1.00 25.25  ? 176 VAL D CG1 1 
ATOM   6208  C  CG2 . VAL D  1 176 ? -19.702  95.604  23.622  1.00 23.60  ? 176 VAL D CG2 1 
ATOM   6209  N  N   . THR D  1 177 ? -20.220  100.086 25.030  1.00 29.55  ? 177 THR D N   1 
ATOM   6210  C  CA  . THR D  1 177 ? -21.015  101.152 25.637  1.00 39.82  ? 177 THR D CA  1 
ATOM   6211  C  C   . THR D  1 177 ? -22.023  101.686 24.638  1.00 41.25  ? 177 THR D C   1 
ATOM   6212  O  O   . THR D  1 177 ? -21.774  101.680 23.438  1.00 50.52  ? 177 THR D O   1 
ATOM   6213  C  CB  . THR D  1 177 ? -20.159  102.328 26.137  1.00 43.53  ? 177 THR D CB  1 
ATOM   6214  O  OG1 . THR D  1 177 ? -19.479  102.934 25.028  1.00 43.60  ? 177 THR D OG1 1 
ATOM   6215  C  CG2 . THR D  1 177 ? -19.156  101.853 27.187  1.00 23.60  ? 177 THR D CG2 1 
ATOM   6216  N  N   . GLN D  1 178 ? -23.160  102.146 25.139  1.00 34.10  ? 178 GLN D N   1 
ATOM   6217  C  CA  . GLN D  1 178 ? -24.230  102.625 24.276  1.00 35.43  ? 178 GLN D CA  1 
ATOM   6218  C  C   . GLN D  1 178 ? -24.571  104.072 24.626  1.00 44.01  ? 178 GLN D C   1 
ATOM   6219  O  O   . GLN D  1 178 ? -24.778  104.414 25.786  1.00 49.09  ? 178 GLN D O   1 
ATOM   6220  C  CB  . GLN D  1 178 ? -25.460  101.720 24.405  1.00 29.98  ? 178 GLN D CB  1 
ATOM   6221  C  CG  . GLN D  1 178 ? -25.132  100.226 24.343  1.00 45.45  ? 178 GLN D CG  1 
ATOM   6222  C  CD  . GLN D  1 178 ? -26.212  99.399  23.628  1.00 78.33  ? 178 GLN D CD  1 
ATOM   6223  O  OE1 . GLN D  1 178 ? -27.405  99.737  23.653  1.00 68.26  ? 178 GLN D OE1 1 
ATOM   6224  N  NE2 . GLN D  1 178 ? -25.790  98.311  22.978  1.00 68.75  ? 178 GLN D NE2 1 
ATOM   6225  N  N   . LYS D  1 179 ? -24.606  104.930 23.619  1.00 49.39  ? 179 LYS D N   1 
ATOM   6226  C  CA  . LYS D  1 179 ? -24.973  106.320 23.833  1.00 44.34  ? 179 LYS D CA  1 
ATOM   6227  C  C   . LYS D  1 179 ? -26.118  106.715 22.901  1.00 40.41  ? 179 LYS D C   1 
ATOM   6228  O  O   . LYS D  1 179 ? -26.139  106.340 21.730  1.00 58.46  ? 179 LYS D O   1 
ATOM   6229  C  CB  . LYS D  1 179 ? -23.764  107.229 23.622  1.00 41.73  ? 179 LYS D CB  1 
ATOM   6230  C  CG  . LYS D  1 179 ? -24.055  108.701 23.856  1.00 56.87  ? 179 LYS D CG  1 
ATOM   6231  C  CD  . LYS D  1 179 ? -22.927  109.587 23.343  1.00 55.88  ? 179 LYS D CD  1 
ATOM   6232  C  CE  . LYS D  1 179 ? -23.273  111.055 23.541  1.00 67.54  ? 179 LYS D CE  1 
ATOM   6233  N  NZ  . LYS D  1 179 ? -22.210  111.954 23.019  1.00 71.44  ? 179 LYS D NZ  1 
ATOM   6234  N  N   . LYS D  1 180 ? -27.070  107.470 23.435  1.00 17.25  ? 180 LYS D N   1 
ATOM   6235  C  CA  . LYS D  1 180 ? -28.235  107.907 22.668  1.00 24.93  ? 180 LYS D CA  1 
ATOM   6236  C  C   . LYS D  1 180 ? -28.106  109.381 22.221  1.00 9.53   ? 180 LYS D C   1 
ATOM   6237  O  O   . LYS D  1 180 ? -27.690  110.227 23.001  1.00 14.06  ? 180 LYS D O   1 
ATOM   6238  C  CB  . LYS D  1 180 ? -29.506  107.637 23.500  1.00 15.64  ? 180 LYS D CB  1 
ATOM   6239  C  CG  . LYS D  1 180 ? -30.583  108.707 23.462  1.00 32.79  ? 180 LYS D CG  1 
ATOM   6240  C  CD  . LYS D  1 180 ? -31.806  108.274 22.694  1.00 22.66  ? 180 LYS D CD  1 
ATOM   6241  C  CE  . LYS D  1 180 ? -32.723  109.475 22.511  1.00 55.95  ? 180 LYS D CE  1 
ATOM   6242  N  NZ  . LYS D  1 180 ? -31.957  110.756 22.280  1.00 40.59  ? 180 LYS D NZ  1 
ATOM   6243  N  N   . ASN D  1 181 ? -28.418  109.686 20.961  1.00 7.09   ? 181 ASN D N   1 
ATOM   6244  C  CA  . ASN D  1 181 ? -28.378  111.083 20.514  1.00 0.67   ? 181 ASN D CA  1 
ATOM   6245  C  C   . ASN D  1 181 ? -29.575  111.530 19.705  1.00 29.98  ? 181 ASN D C   1 
ATOM   6246  O  O   . ASN D  1 181 ? -30.389  110.731 19.227  1.00 16.73  ? 181 ASN D O   1 
ATOM   6247  C  CB  . ASN D  1 181 ? -27.125  111.430 19.681  1.00 22.29  ? 181 ASN D CB  1 
ATOM   6248  C  CG  . ASN D  1 181 ? -25.952  110.552 19.987  1.00 26.43  ? 181 ASN D CG  1 
ATOM   6249  O  OD1 . ASN D  1 181 ? -25.175  110.823 20.908  1.00 34.03  ? 181 ASN D OD1 1 
ATOM   6250  N  ND2 . ASN D  1 181 ? -25.807  109.481 19.212  1.00 32.71  ? 181 ASN D ND2 1 
ATOM   6251  N  N   . SER D  1 182 ? -29.629  112.838 19.517  1.00 30.80  ? 182 SER D N   1 
ATOM   6252  C  CA  . SER D  1 182 ? -30.724  113.463 18.824  1.00 19.46  ? 182 SER D CA  1 
ATOM   6253  C  C   . SER D  1 182 ? -30.112  114.450 17.840  1.00 14.94  ? 182 SER D C   1 
ATOM   6254  O  O   . SER D  1 182 ? -29.562  115.481 18.240  1.00 21.34  ? 182 SER D O   1 
ATOM   6255  C  CB  . SER D  1 182 ? -31.627  114.160 19.845  1.00 17.31  ? 182 SER D CB  1 
ATOM   6256  O  OG  . SER D  1 182 ? -32.843  114.595 19.263  1.00 62.24  ? 182 SER D OG  1 
ATOM   6257  N  N   . VAL D  1 183 ? -30.224  114.136 16.553  1.00 16.39  ? 183 VAL D N   1 
ATOM   6258  C  CA  . VAL D  1 183 ? -29.507  114.865 15.506  1.00 18.09  ? 183 VAL D CA  1 
ATOM   6259  C  C   . VAL D  1 183 ? -30.404  115.384 14.368  1.00 13.41  ? 183 VAL D C   1 
ATOM   6260  O  O   . VAL D  1 183 ? -31.323  114.693 13.940  1.00 21.98  ? 183 VAL D O   1 
ATOM   6261  C  CB  . VAL D  1 183 ? -28.436  113.942 14.886  1.00 29.24  ? 183 VAL D CB  1 
ATOM   6262  C  CG1 . VAL D  1 183 ? -27.753  114.610 13.683  1.00 32.61  ? 183 VAL D CG1 1 
ATOM   6263  C  CG2 . VAL D  1 183 ? -27.440  113.513 15.951  1.00 15.85  ? 183 VAL D CG2 1 
ATOM   6264  N  N   . THR D  1 184 ? -30.114  116.581 13.860  1.00 13.67  ? 184 THR D N   1 
ATOM   6265  C  CA  . THR D  1 184 ? -30.817  117.109 12.686  1.00 28.98  ? 184 THR D CA  1 
ATOM   6266  C  C   . THR D  1 184 ? -30.018  116.902 11.402  1.00 29.38  ? 184 THR D C   1 
ATOM   6267  O  O   . THR D  1 184 ? -28.812  116.642 11.448  1.00 27.46  ? 184 THR D O   1 
ATOM   6268  C  CB  . THR D  1 184 ? -31.046  118.602 12.814  1.00 13.34  ? 184 THR D CB  1 
ATOM   6269  O  OG1 . THR D  1 184 ? -29.779  119.265 12.740  1.00 14.36  ? 184 THR D OG1 1 
ATOM   6270  C  CG2 . THR D  1 184 ? -31.681  118.912 14.144  1.00 16.19  ? 184 THR D CG2 1 
ATOM   6271  N  N   . TYR D  1 185 ? -30.697  117.050 10.267  1.00 37.76  ? 185 TYR D N   1 
ATOM   6272  C  CA  . TYR D  1 185 ? -30.126  116.820 8.947   1.00 27.43  ? 185 TYR D CA  1 
ATOM   6273  C  C   . TYR D  1 185 ? -30.589  117.900 7.972   1.00 42.87  ? 185 TYR D C   1 
ATOM   6274  O  O   . TYR D  1 185 ? -31.630  118.519 8.179   1.00 55.95  ? 185 TYR D O   1 
ATOM   6275  C  CB  . TYR D  1 185 ? -30.523  115.431 8.450   1.00 32.89  ? 185 TYR D CB  1 
ATOM   6276  C  CG  . TYR D  1 185 ? -30.023  114.332 9.354   1.00 33.76  ? 185 TYR D CG  1 
ATOM   6277  C  CD1 . TYR D  1 185 ? -30.645  114.059 10.565  1.00 37.20  ? 185 TYR D CD1 1 
ATOM   6278  C  CD2 . TYR D  1 185 ? -28.915  113.580 9.012   1.00 30.17  ? 185 TYR D CD2 1 
ATOM   6279  C  CE1 . TYR D  1 185 ? -30.168  113.061 11.403  1.00 36.96  ? 185 TYR D CE1 1 
ATOM   6280  C  CE2 . TYR D  1 185 ? -28.432  112.589 9.842   1.00 31.77  ? 185 TYR D CE2 1 
ATOM   6281  C  CZ  . TYR D  1 185 ? -29.059  112.331 11.029  1.00 35.04  ? 185 TYR D CZ  1 
ATOM   6282  O  OH  . TYR D  1 185 ? -28.573  111.339 11.843  1.00 31.79  ? 185 TYR D OH  1 
ATOM   6283  N  N   . SER D  1 186 ? -29.807  118.133 6.920   1.00 57.65  ? 186 SER D N   1 
ATOM   6284  C  CA  . SER D  1 186 ? -30.074  119.206 5.952   1.00 56.02  ? 186 SER D CA  1 
ATOM   6285  C  C   . SER D  1 186 ? -31.460  119.153 5.338   1.00 58.43  ? 186 SER D C   1 
ATOM   6286  O  O   . SER D  1 186 ? -32.126  120.171 5.181   1.00 52.94  ? 186 SER D O   1 
ATOM   6287  C  CB  . SER D  1 186 ? -29.048  119.184 4.812   1.00 56.55  ? 186 SER D CB  1 
ATOM   6288  O  OG  . SER D  1 186 ? -27.835  119.782 5.206   1.00 67.33  ? 186 SER D OG  1 
ATOM   6289  N  N   . CYS D  1 187 ? -31.886  117.966 4.947   1.00 39.49  ? 187 CYS D N   1 
ATOM   6290  C  CA  . CYS D  1 187 ? -33.121  117.871 4.204   1.00 11.57  ? 187 CYS D CA  1 
ATOM   6291  C  C   . CYS D  1 187 ? -34.263  118.224 5.095   1.00 12.26  ? 187 CYS D C   1 
ATOM   6292  O  O   . CYS D  1 187 ? -35.333  118.560 4.604   1.00 34.13  ? 187 CYS D O   1 
ATOM   6293  C  CB  . CYS D  1 187 ? -33.339  116.454 3.691   1.00 25.93  ? 187 CYS D CB  1 
ATOM   6294  S  SG  . CYS D  1 187 ? -33.642  115.278 5.000   1.00 25.16  ? 187 CYS D SG  1 
ATOM   6295  N  N   . CYS D  1 188 ? -34.069  118.130 6.406   1.00 52.25  ? 188 CYS D N   1 
ATOM   6296  C  CA  . CYS D  1 188 ? -35.261  118.095 7.222   1.00 42.72  ? 188 CYS D CA  1 
ATOM   6297  C  C   . CYS D  1 188 ? -35.177  118.911 8.486   1.00 38.60  ? 188 CYS D C   1 
ATOM   6298  O  O   . CYS D  1 188 ? -34.123  119.001 9.108   1.00 53.46  ? 188 CYS D O   1 
ATOM   6299  C  CB  . CYS D  1 188 ? -35.634  116.640 7.526   1.00 53.87  ? 188 CYS D CB  1 
ATOM   6300  S  SG  . CYS D  1 188 ? -35.313  115.480 6.151   1.00 36.70  ? 188 CYS D SG  1 
ATOM   6301  N  N   . PRO D  1 189 ? -36.307  119.504 8.873   1.00 27.21  ? 189 PRO D N   1 
ATOM   6302  C  CA  . PRO D  1 189 ? -36.423  120.406 10.020  1.00 33.81  ? 189 PRO D CA  1 
ATOM   6303  C  C   . PRO D  1 189 ? -36.435  119.666 11.358  1.00 33.36  ? 189 PRO D C   1 
ATOM   6304  O  O   . PRO D  1 189 ? -36.009  120.208 12.368  1.00 21.38  ? 189 PRO D O   1 
ATOM   6305  C  CB  . PRO D  1 189 ? -37.781  121.085 9.784   1.00 26.82  ? 189 PRO D CB  1 
ATOM   6306  C  CG  . PRO D  1 189 ? -38.600  120.027 9.092   1.00 15.61  ? 189 PRO D CG  1 
ATOM   6307  C  CD  . PRO D  1 189 ? -37.604  119.295 8.197   1.00 34.12  ? 189 PRO D CD  1 
ATOM   6308  N  N   . GLU D  1 190 ? -36.935  118.442 11.360  1.00 29.39  ? 190 GLU D N   1 
ATOM   6309  C  CA  . GLU D  1 190 ? -37.126  117.698 12.591  1.00 11.74  ? 190 GLU D CA  1 
ATOM   6310  C  C   . GLU D  1 190 ? -35.847  117.019 13.028  1.00 26.43  ? 190 GLU D C   1 
ATOM   6311  O  O   . GLU D  1 190 ? -34.905  116.867 12.246  1.00 45.33  ? 190 GLU D O   1 
ATOM   6312  C  CB  . GLU D  1 190 ? -38.204  116.641 12.384  1.00 47.85  ? 190 GLU D CB  1 
ATOM   6313  C  CG  . GLU D  1 190 ? -39.607  117.200 12.131  1.00 52.85  ? 190 GLU D CG  1 
ATOM   6314  C  CD  . GLU D  1 190 ? -40.309  117.572 13.416  1.00 50.10  ? 190 GLU D CD  1 
ATOM   6315  O  OE1 . GLU D  1 190 ? -39.642  117.633 14.468  1.00 60.46  ? 190 GLU D OE1 1 
ATOM   6316  O  OE2 . GLU D  1 190 ? -41.526  117.795 13.377  1.00 45.89  ? 190 GLU D OE2 1 
ATOM   6317  N  N   . ALA D  1 191 ? -35.820  116.606 14.287  1.00 28.79  ? 191 ALA D N   1 
ATOM   6318  C  CA  . ALA D  1 191 ? -34.701  115.859 14.837  1.00 12.24  ? 191 ALA D CA  1 
ATOM   6319  C  C   . ALA D  1 191 ? -34.973  114.362 14.739  1.00 23.38  ? 191 ALA D C   1 
ATOM   6320  O  O   . ALA D  1 191 ? -36.101  113.904 14.968  1.00 20.92  ? 191 ALA D O   1 
ATOM   6321  C  CB  . ALA D  1 191 ? -34.483  116.246 16.282  1.00 19.51  ? 191 ALA D CB  1 
ATOM   6322  N  N   . TYR D  1 192 ? -33.939  113.604 14.404  1.00 11.65  ? 192 TYR D N   1 
ATOM   6323  C  CA  . TYR D  1 192 ? -34.040  112.151 14.353  1.00 19.48  ? 192 TYR D CA  1 
ATOM   6324  C  C   . TYR D  1 192 ? -33.113  111.511 15.379  1.00 18.25  ? 192 TYR D C   1 
ATOM   6325  O  O   . TYR D  1 192 ? -31.949  111.888 15.506  1.00 28.80  ? 192 TYR D O   1 
ATOM   6326  C  CB  . TYR D  1 192 ? -33.723  111.643 12.950  1.00 10.84  ? 192 TYR D CB  1 
ATOM   6327  C  CG  . TYR D  1 192 ? -34.661  112.176 11.882  1.00 25.87  ? 192 TYR D CG  1 
ATOM   6328  C  CD1 . TYR D  1 192 ? -34.623  113.512 11.495  1.00 16.67  ? 192 TYR D CD1 1 
ATOM   6329  C  CD2 . TYR D  1 192 ? -35.582  111.345 11.262  1.00 15.02  ? 192 TYR D CD2 1 
ATOM   6330  C  CE1 . TYR D  1 192 ? -35.466  113.998 10.521  1.00 25.45  ? 192 TYR D CE1 1 
ATOM   6331  C  CE2 . TYR D  1 192 ? -36.431  111.827 10.298  1.00 17.17  ? 192 TYR D CE2 1 
ATOM   6332  C  CZ  . TYR D  1 192 ? -36.358  113.150 9.930   1.00 21.56  ? 192 TYR D CZ  1 
ATOM   6333  O  OH  . TYR D  1 192 ? -37.196  113.638 8.978   1.00 27.89  ? 192 TYR D OH  1 
ATOM   6334  N  N   . GLU D  1 193 ? -33.644  110.541 16.117  1.00 29.73  ? 193 GLU D N   1 
ATOM   6335  C  CA  . GLU D  1 193 ? -32.882  109.889 17.175  1.00 24.15  ? 193 GLU D CA  1 
ATOM   6336  C  C   . GLU D  1 193 ? -32.056  108.723 16.648  1.00 24.90  ? 193 GLU D C   1 
ATOM   6337  O  O   . GLU D  1 193 ? -32.401  108.090 15.640  1.00 30.42  ? 193 GLU D O   1 
ATOM   6338  C  CB  . GLU D  1 193 ? -33.797  109.443 18.332  1.00 12.40  ? 193 GLU D CB  1 
ATOM   6339  C  CG  . GLU D  1 193 ? -34.617  110.576 18.918  1.00 29.12  ? 193 GLU D CG  1 
ATOM   6340  C  CD  . GLU D  1 193 ? -35.243  110.232 20.246  1.00 35.02  ? 193 GLU D CD  1 
ATOM   6341  O  OE1 . GLU D  1 193 ? -35.180  109.054 20.656  1.00 19.89  ? 193 GLU D OE1 1 
ATOM   6342  O  OE2 . GLU D  1 193 ? -35.782  111.157 20.886  1.00 34.85  ? 193 GLU D OE2 1 
ATOM   6343  N  N   . ASP D  1 194 ? -30.946  108.466 17.338  1.00 16.66  ? 194 ASP D N   1 
ATOM   6344  C  CA  . ASP D  1 194 ? -30.092  107.334 17.034  1.00 24.12  ? 194 ASP D CA  1 
ATOM   6345  C  C   . ASP D  1 194 ? -29.475  106.814 18.319  1.00 30.64  ? 194 ASP D C   1 
ATOM   6346  O  O   . ASP D  1 194 ? -29.405  107.530 19.332  1.00 26.02  ? 194 ASP D O   1 
ATOM   6347  C  CB  . ASP D  1 194 ? -29.003  107.700 16.001  1.00 33.30  ? 194 ASP D CB  1 
ATOM   6348  C  CG  . ASP D  1 194 ? -27.971  108.718 16.534  1.00 37.45  ? 194 ASP D CG  1 
ATOM   6349  O  OD1 . ASP D  1 194 ? -27.145  108.348 17.383  1.00 35.44  ? 194 ASP D OD1 1 
ATOM   6350  O  OD2 . ASP D  1 194 ? -27.951  109.884 16.084  1.00 44.94  ? 194 ASP D OD2 1 
ATOM   6351  N  N   . VAL D  1 195 ? -29.057  105.553 18.282  1.00 17.98  ? 195 VAL D N   1 
ATOM   6352  C  CA  . VAL D  1 195 ? -28.228  104.996 19.343  1.00 29.58  ? 195 VAL D CA  1 
ATOM   6353  C  C   . VAL D  1 195 ? -26.823  104.724 18.790  1.00 19.12  ? 195 VAL D C   1 
ATOM   6354  O  O   . VAL D  1 195 ? -26.675  104.160 17.706  1.00 30.92  ? 195 VAL D O   1 
ATOM   6355  C  CB  . VAL D  1 195 ? -28.834  103.697 19.908  1.00 19.99  ? 195 VAL D CB  1 
ATOM   6356  C  CG1 . VAL D  1 195 ? -27.807  102.970 20.766  1.00 32.13  ? 195 VAL D CG1 1 
ATOM   6357  C  CG2 . VAL D  1 195 ? -30.077  104.004 20.701  1.00 24.46  ? 195 VAL D CG2 1 
ATOM   6358  N  N   . GLU D  1 196 ? -25.795  105.144 19.512  1.00 23.42  ? 196 GLU D N   1 
ATOM   6359  C  CA  . GLU D  1 196 ? -24.427  104.835 19.102  1.00 26.19  ? 196 GLU D CA  1 
ATOM   6360  C  C   . GLU D  1 196 ? -23.838  103.771 19.996  1.00 27.67  ? 196 GLU D C   1 
ATOM   6361  O  O   . GLU D  1 196 ? -23.654  103.977 21.197  1.00 31.28  ? 196 GLU D O   1 
ATOM   6362  C  CB  . GLU D  1 196 ? -23.538  106.073 19.117  1.00 32.60  ? 196 GLU D CB  1 
ATOM   6363  C  CG  . GLU D  1 196 ? -23.640  106.917 17.863  1.00 32.51  ? 196 GLU D CG  1 
ATOM   6364  C  CD  . GLU D  1 196 ? -22.964  108.256 18.013  1.00 37.08  ? 196 GLU D CD  1 
ATOM   6365  O  OE1 . GLU D  1 196 ? -22.252  108.461 19.016  1.00 47.86  ? 196 GLU D OE1 1 
ATOM   6366  O  OE2 . GLU D  1 196 ? -23.155  109.110 17.132  1.00 27.47  ? 196 GLU D OE2 1 
ATOM   6367  N  N   . VAL D  1 197 ? -23.561  102.622 19.397  1.00 15.41  ? 197 VAL D N   1 
ATOM   6368  C  CA  . VAL D  1 197 ? -22.921  101.526 20.103  1.00 26.68  ? 197 VAL D CA  1 
ATOM   6369  C  C   . VAL D  1 197 ? -21.404  101.576 19.871  1.00 26.53  ? 197 VAL D C   1 
ATOM   6370  O  O   . VAL D  1 197 ? -20.936  101.455 18.747  1.00 23.01  ? 197 VAL D O   1 
ATOM   6371  C  CB  . VAL D  1 197 ? -23.489  100.172 19.637  1.00 21.78  ? 197 VAL D CB  1 
ATOM   6372  C  CG1 . VAL D  1 197 ? -23.010  99.045  20.550  1.00 13.87  ? 197 VAL D CG1 1 
ATOM   6373  C  CG2 . VAL D  1 197 ? -25.008  100.228 19.595  1.00 16.90  ? 197 VAL D CG2 1 
ATOM   6374  N  N   . SER D  1 198 ? -20.641  101.781 20.937  1.00 33.07  ? 198 SER D N   1 
ATOM   6375  C  CA  . SER D  1 198 ? -19.191  101.818 20.831  1.00 22.08  ? 198 SER D CA  1 
ATOM   6376  C  C   . SER D  1 198 ? -18.625  100.464 21.194  1.00 21.72  ? 198 SER D C   1 
ATOM   6377  O  O   . SER D  1 198 ? -18.708  100.018 22.342  1.00 31.14  ? 198 SER D O   1 
ATOM   6378  C  CB  . SER D  1 198 ? -18.624  102.906 21.727  1.00 24.02  ? 198 SER D CB  1 
ATOM   6379  O  OG  . SER D  1 198 ? -18.916  104.183 21.188  1.00 34.98  ? 198 SER D OG  1 
ATOM   6380  N  N   . LEU D  1 199 ? -18.068  99.809  20.191  1.00 16.00  ? 199 LEU D N   1 
ATOM   6381  C  CA  . LEU D  1 199 ? -17.460  98.495  20.349  1.00 25.29  ? 199 LEU D CA  1 
ATOM   6382  C  C   . LEU D  1 199 ? -15.949  98.623  20.533  1.00 28.27  ? 199 LEU D C   1 
ATOM   6383  O  O   . LEU D  1 199 ? -15.239  99.014  19.615  1.00 36.02  ? 199 LEU D O   1 
ATOM   6384  C  CB  . LEU D  1 199 ? -17.740  97.645  19.108  1.00 20.63  ? 199 LEU D CB  1 
ATOM   6385  C  CG  . LEU D  1 199 ? -17.074  96.275  19.105  1.00 23.95  ? 199 LEU D CG  1 
ATOM   6386  C  CD1 . LEU D  1 199 ? -17.578  95.436  20.271  1.00 26.03  ? 199 LEU D CD1 1 
ATOM   6387  C  CD2 . LEU D  1 199 ? -17.319  95.570  17.798  1.00 14.09  ? 199 LEU D CD2 1 
ATOM   6388  N  N   . ASN D  1 200 ? -15.460  98.294  21.723  1.00 28.19  ? 200 ASN D N   1 
ATOM   6389  C  CA  . ASN D  1 200 ? -14.033  98.337  22.000  1.00 18.66  ? 200 ASN D CA  1 
ATOM   6390  C  C   . ASN D  1 200 ? -13.439  96.932  21.977  1.00 27.93  ? 200 ASN D C   1 
ATOM   6391  O  O   . ASN D  1 200 ? -13.756  96.101  22.822  1.00 21.51  ? 200 ASN D O   1 
ATOM   6392  C  CB  . ASN D  1 200 ? -13.773  99.031  23.330  1.00 21.42  ? 200 ASN D CB  1 
ATOM   6393  C  CG  . ASN D  1 200 ? -12.292  99.176  23.636  1.00 41.45  ? 200 ASN D CG  1 
ATOM   6394  O  OD1 . ASN D  1 200 ? -11.866  99.048  24.793  1.00 32.63  ? 200 ASN D OD1 1 
ATOM   6395  N  ND2 . ASN D  1 200 ? -11.494  99.431  22.598  1.00 40.24  ? 200 ASN D ND2 1 
ATOM   6396  N  N   . PHE D  1 201 ? -12.596  96.669  20.983  1.00 22.62  ? 201 PHE D N   1 
ATOM   6397  C  CA  . PHE D  1 201 ? -12.073  95.328  20.755  1.00 26.49  ? 201 PHE D CA  1 
ATOM   6398  C  C   . PHE D  1 201 ? -10.614  95.366  20.319  1.00 26.74  ? 201 PHE D C   1 
ATOM   6399  O  O   . PHE D  1 201 ? -10.082  96.417  19.971  1.00 29.10  ? 201 PHE D O   1 
ATOM   6400  C  CB  . PHE D  1 201 ? -12.899  94.619  19.678  1.00 29.73  ? 201 PHE D CB  1 
ATOM   6401  C  CG  . PHE D  1 201 ? -12.715  95.189  18.302  1.00 17.72  ? 201 PHE D CG  1 
ATOM   6402  C  CD1 . PHE D  1 201 ? -13.133  96.474  18.013  1.00 21.85  ? 201 PHE D CD1 1 
ATOM   6403  C  CD2 . PHE D  1 201 ? -12.113  94.438  17.299  1.00 24.35  ? 201 PHE D CD2 1 
ATOM   6404  C  CE1 . PHE D  1 201 ? -12.949  97.009  16.741  1.00 14.90  ? 201 PHE D CE1 1 
ATOM   6405  C  CE2 . PHE D  1 201 ? -11.933  94.956  16.026  1.00 16.15  ? 201 PHE D CE2 1 
ATOM   6406  C  CZ  . PHE D  1 201 ? -12.348  96.241  15.748  1.00 17.88  ? 201 PHE D CZ  1 
ATOM   6407  N  N   . ARG D  1 202 ? -9.970   94.206  20.332  1.00 22.79  ? 202 ARG D N   1 
ATOM   6408  C  CA  . ARG D  1 202 ? -8.578   94.103  19.922  1.00 23.35  ? 202 ARG D CA  1 
ATOM   6409  C  C   . ARG D  1 202 ? -8.242   92.676  19.513  1.00 30.57  ? 202 ARG D C   1 
ATOM   6410  O  O   . ARG D  1 202 ? -9.000   91.756  19.813  1.00 25.25  ? 202 ARG D O   1 
ATOM   6411  C  CB  . ARG D  1 202 ? -7.678   94.486  21.072  1.00 34.55  ? 202 ARG D CB  1 
ATOM   6412  C  CG  . ARG D  1 202 ? -7.654   93.449  22.149  1.00 31.37  ? 202 ARG D CG  1 
ATOM   6413  C  CD  . ARG D  1 202 ? -6.860   93.903  23.338  1.00 25.78  ? 202 ARG D CD  1 
ATOM   6414  N  NE  . ARG D  1 202 ? -6.887   92.876  24.363  1.00 27.45  ? 202 ARG D NE  1 
ATOM   6415  C  CZ  . ARG D  1 202 ? -6.502   93.077  25.614  1.00 41.96  ? 202 ARG D CZ  1 
ATOM   6416  N  NH1 . ARG D  1 202 ? -6.056   94.271  25.976  1.00 41.23  ? 202 ARG D NH1 1 
ATOM   6417  N  NH2 . ARG D  1 202 ? -6.564   92.091  26.503  1.00 39.86  ? 202 ARG D NH2 1 
ATOM   6418  N  N   . LYS D  1 203 ? -7.098   92.481  18.854  1.00 20.78  ? 203 LYS D N   1 
ATOM   6419  C  CA  . LYS D  1 203 ? -6.664   91.135  18.477  1.00 22.05  ? 203 LYS D CA  1 
ATOM   6420  C  C   . LYS D  1 203 ? -6.385   90.299  19.744  1.00 33.69  ? 203 LYS D C   1 
ATOM   6421  O  O   . LYS D  1 203 ? -5.881   90.825  20.721  1.00 12.89  ? 203 LYS D O   1 
ATOM   6422  C  CB  . LYS D  1 203 ? -5.414   91.228  17.607  1.00 30.06  ? 203 LYS D CB  1 
ATOM   6423  C  CG  . LYS D  1 203 ? -5.520   90.558  16.263  1.00 30.77  ? 203 LYS D CG  1 
ATOM   6424  C  CD  . LYS D  1 203 ? -4.537   91.199  15.307  1.00 47.17  ? 203 LYS D CD  1 
ATOM   6425  C  CE  . LYS D  1 203 ? -4.834   90.867  13.848  1.00 64.19  ? 203 LYS D CE  1 
ATOM   6426  N  NZ  . LYS D  1 203 ? -3.996   91.687  12.925  1.00 54.54  ? 203 LYS D NZ  1 
ATOM   6427  N  N   . LYS D  1 204 ? -6.733   89.013  19.746  1.00 37.66  ? 204 LYS D N   1 
ATOM   6428  C  CA  . LYS D  1 204 ? -6.427   88.155  20.894  1.00 18.34  ? 204 LYS D CA  1 
ATOM   6429  C  C   . LYS D  1 204 ? -4.930   87.884  20.876  1.00 23.10  ? 204 LYS D C   1 
ATOM   6430  O  O   . LYS D  1 204 ? -4.269   88.155  19.875  1.00 57.02  ? 204 LYS D O   1 
ATOM   6431  C  CB  . LYS D  1 204 ? -7.218   86.833  20.853  1.00 11.99  ? 204 LYS D CB  1 
ATOM   6432  C  CG  . LYS D  1 204 ? -8.680   86.945  21.271  1.00 35.21  ? 204 LYS D CG  1 
ATOM   6433  C  CD  . LYS D  1 204 ? -9.532   85.732  20.841  1.00 42.15  ? 204 LYS D CD  1 
ATOM   6434  C  CE  . LYS D  1 204 ? -9.011   84.415  21.407  1.00 25.20  ? 204 LYS D CE  1 
ATOM   6435  N  NZ  . LYS D  1 204 ? -10.076  83.564  22.043  1.00 16.02  ? 204 LYS D NZ  1 
ATOM   6436  N  N   . GLY D  1 205 ? -4.399   87.359  21.981  1.00 51.59  ? 205 GLY D N   1 
ATOM   6437  C  CA  . GLY D  1 205 ? -2.972   87.101  22.129  1.00 49.24  ? 205 GLY D CA  1 
ATOM   6438  C  C   . GLY D  1 205 ? -2.317   86.292  21.017  1.00 48.85  ? 205 GLY D C   1 
ATOM   6439  O  O   . GLY D  1 205 ? -2.734   85.177  20.698  1.00 31.57  ? 205 GLY D O   1 
ATOM   6440  N  N   . LEU E  1 1   ? -58.930  111.645 9.245   1.00 47.67  ? 1   LEU E N   1 
ATOM   6441  C  CA  . LEU E  1 1   ? -57.851  110.851 8.674   1.00 36.34  ? 1   LEU E CA  1 
ATOM   6442  C  C   . LEU E  1 1   ? -56.760  110.566 9.683   1.00 34.84  ? 1   LEU E C   1 
ATOM   6443  O  O   . LEU E  1 1   ? -56.213  111.476 10.291  1.00 38.49  ? 1   LEU E O   1 
ATOM   6444  C  CB  . LEU E  1 1   ? -57.239  111.564 7.474   1.00 38.69  ? 1   LEU E CB  1 
ATOM   6445  C  CG  . LEU E  1 1   ? -58.029  111.465 6.173   1.00 43.84  ? 1   LEU E CG  1 
ATOM   6446  C  CD1 . LEU E  1 1   ? -57.290  112.203 5.072   1.00 41.37  ? 1   LEU E CD1 1 
ATOM   6447  C  CD2 . LEU E  1 1   ? -58.252  110.006 5.811   1.00 44.28  ? 1   LEU E CD2 1 
ATOM   6448  N  N   . ASP E  1 2   ? -56.451  109.292 9.857   1.00 35.52  ? 2   ASP E N   1 
ATOM   6449  C  CA  . ASP E  1 2   ? -55.278  108.896 10.616  1.00 27.22  ? 2   ASP E CA  1 
ATOM   6450  C  C   . ASP E  1 2   ? -54.230  108.325 9.651   1.00 33.53  ? 2   ASP E C   1 
ATOM   6451  O  O   . ASP E  1 2   ? -54.501  108.172 8.465   1.00 26.14  ? 2   ASP E O   1 
ATOM   6452  C  CB  . ASP E  1 2   ? -55.641  107.897 11.728  1.00 13.19  ? 2   ASP E CB  1 
ATOM   6453  C  CG  . ASP E  1 2   ? -56.260  106.611 11.200  1.00 44.33  ? 2   ASP E CG  1 
ATOM   6454  O  OD1 . ASP E  1 2   ? -56.092  106.308 10.005  1.00 41.40  ? 2   ASP E OD1 1 
ATOM   6455  O  OD2 . ASP E  1 2   ? -56.917  105.892 11.989  1.00 43.95  ? 2   ASP E OD2 1 
ATOM   6456  N  N   . ARG E  1 3   ? -53.035  108.025 10.152  1.00 25.94  ? 3   ARG E N   1 
ATOM   6457  C  CA  . ARG E  1 3   ? -51.979  107.487 9.305   1.00 25.71  ? 3   ARG E CA  1 
ATOM   6458  C  C   . ARG E  1 3   ? -52.440  106.277 8.499   1.00 27.59  ? 3   ARG E C   1 
ATOM   6459  O  O   . ARG E  1 3   ? -52.188  106.201 7.297   1.00 31.28  ? 3   ARG E O   1 
ATOM   6460  C  CB  . ARG E  1 3   ? -50.746  107.122 10.135  1.00 31.13  ? 3   ARG E CB  1 
ATOM   6461  C  CG  . ARG E  1 3   ? -49.996  108.312 10.641  1.00 29.90  ? 3   ARG E CG  1 
ATOM   6462  C  CD  . ARG E  1 3   ? -48.803  107.920 11.484  1.00 35.73  ? 3   ARG E CD  1 
ATOM   6463  N  NE  . ARG E  1 3   ? -48.045  109.109 11.853  1.00 49.29  ? 3   ARG E NE  1 
ATOM   6464  C  CZ  . ARG E  1 3   ? -48.286  109.839 12.933  1.00 50.11  ? 3   ARG E CZ  1 
ATOM   6465  N  NH1 . ARG E  1 3   ? -49.256  109.487 13.760  1.00 53.36  ? 3   ARG E NH1 1 
ATOM   6466  N  NH2 . ARG E  1 3   ? -47.554  110.912 13.187  1.00 58.23  ? 3   ARG E NH2 1 
ATOM   6467  N  N   . ALA E  1 4   ? -53.096  105.333 9.168   1.00 17.69  ? 4   ALA E N   1 
ATOM   6468  C  CA  . ALA E  1 4   ? -53.626  104.140 8.507   1.00 28.79  ? 4   ALA E CA  1 
ATOM   6469  C  C   . ALA E  1 4   ? -54.508  104.479 7.302   1.00 36.89  ? 4   ALA E C   1 
ATOM   6470  O  O   . ALA E  1 4   ? -54.359  103.887 6.240   1.00 43.53  ? 4   ALA E O   1 
ATOM   6471  C  CB  . ALA E  1 4   ? -54.399  103.273 9.494   1.00 30.70  ? 4   ALA E CB  1 
ATOM   6472  N  N   . ASP E  1 5   ? -55.418  105.431 7.458   1.00 10.97  ? 5   ASP E N   1 
ATOM   6473  C  CA  . ASP E  1 5   ? -56.279  105.819 6.351   1.00 32.42  ? 5   ASP E CA  1 
ATOM   6474  C  C   . ASP E  1 5   ? -55.458  106.412 5.213   1.00 33.91  ? 5   ASP E C   1 
ATOM   6475  O  O   . ASP E  1 5   ? -55.591  105.995 4.057   1.00 22.33  ? 5   ASP E O   1 
ATOM   6476  C  CB  . ASP E  1 5   ? -57.372  106.803 6.802   1.00 28.78  ? 5   ASP E CB  1 
ATOM   6477  C  CG  . ASP E  1 5   ? -58.270  106.232 7.891   1.00 40.46  ? 5   ASP E CG  1 
ATOM   6478  O  OD1 . ASP E  1 5   ? -58.561  105.002 7.882   1.00 33.36  ? 5   ASP E OD1 1 
ATOM   6479  O  OD2 . ASP E  1 5   ? -58.674  107.034 8.761   1.00 35.18  ? 5   ASP E OD2 1 
ATOM   6480  N  N   . ILE E  1 6   ? -54.609  107.381 5.543   1.00 24.99  ? 6   ILE E N   1 
ATOM   6481  C  CA  . ILE E  1 6   ? -53.758  108.015 4.543   1.00 29.12  ? 6   ILE E CA  1 
ATOM   6482  C  C   . ILE E  1 6   ? -52.982  106.975 3.741   1.00 30.91  ? 6   ILE E C   1 
ATOM   6483  O  O   . ILE E  1 6   ? -52.977  107.003 2.514   1.00 30.51  ? 6   ILE E O   1 
ATOM   6484  C  CB  . ILE E  1 6   ? -52.766  109.012 5.180   1.00 26.28  ? 6   ILE E CB  1 
ATOM   6485  C  CG1 . ILE E  1 6   ? -53.522  110.115 5.910   1.00 25.90  ? 6   ILE E CG1 1 
ATOM   6486  C  CG2 . ILE E  1 6   ? -51.855  109.614 4.113   1.00 18.06  ? 6   ILE E CG2 1 
ATOM   6487  C  CD1 . ILE E  1 6   ? -52.639  111.036 6.722   1.00 25.42  ? 6   ILE E CD1 1 
ATOM   6488  N  N   . LEU E  1 7   ? -52.331  106.057 4.447   1.00 23.01  ? 7   LEU E N   1 
ATOM   6489  C  CA  . LEU E  1 7   ? -51.507  105.034 3.817   1.00 20.35  ? 7   LEU E CA  1 
ATOM   6490  C  C   . LEU E  1 7   ? -52.336  104.040 3.002   1.00 33.13  ? 7   LEU E C   1 
ATOM   6491  O  O   . LEU E  1 7   ? -51.905  103.570 1.944   1.00 30.86  ? 7   LEU E O   1 
ATOM   6492  C  CB  . LEU E  1 7   ? -50.657  104.320 4.871   1.00 24.41  ? 7   LEU E CB  1 
ATOM   6493  C  CG  . LEU E  1 7   ? -49.486  105.149 5.413   1.00 31.03  ? 7   LEU E CG  1 
ATOM   6494  C  CD1 . LEU E  1 7   ? -49.033  104.641 6.749   1.00 31.61  ? 7   LEU E CD1 1 
ATOM   6495  C  CD2 . LEU E  1 7   ? -48.329  105.145 4.419   1.00 28.74  ? 7   LEU E CD2 1 
ATOM   6496  N  N   . TYR E  1 8   ? -53.525  103.721 3.495   1.00 20.41  ? 8   TYR E N   1 
ATOM   6497  C  CA  . TYR E  1 8   ? -54.464  102.900 2.732   1.00 28.32  ? 8   TYR E CA  1 
ATOM   6498  C  C   . TYR E  1 8   ? -54.840  103.576 1.406   1.00 33.34  ? 8   TYR E C   1 
ATOM   6499  O  O   . TYR E  1 8   ? -54.803  102.963 0.347   1.00 24.11  ? 8   TYR E O   1 
ATOM   6500  C  CB  . TYR E  1 8   ? -55.727  102.629 3.560   1.00 31.66  ? 8   TYR E CB  1 
ATOM   6501  C  CG  . TYR E  1 8   ? -56.774  101.761 2.883   1.00 46.25  ? 8   TYR E CG  1 
ATOM   6502  C  CD1 . TYR E  1 8   ? -56.611  100.386 2.802   1.00 54.11  ? 8   TYR E CD1 1 
ATOM   6503  C  CD2 . TYR E  1 8   ? -57.939  102.317 2.350   1.00 44.09  ? 8   TYR E CD2 1 
ATOM   6504  C  CE1 . TYR E  1 8   ? -57.565  99.589  2.200   1.00 62.53  ? 8   TYR E CE1 1 
ATOM   6505  C  CE2 . TYR E  1 8   ? -58.903  101.524 1.753   1.00 44.50  ? 8   TYR E CE2 1 
ATOM   6506  C  CZ  . TYR E  1 8   ? -58.708  100.158 1.681   1.00 61.03  ? 8   TYR E CZ  1 
ATOM   6507  O  OH  . TYR E  1 8   ? -59.650  99.347  1.093   1.00 65.63  ? 8   TYR E OH  1 
ATOM   6508  N  N   . ASN E  1 9   ? -55.212  104.843 1.474   1.00 16.70  ? 9   ASN E N   1 
ATOM   6509  C  CA  . ASN E  1 9   ? -55.593  105.561 0.278   1.00 23.77  ? 9   ASN E CA  1 
ATOM   6510  C  C   . ASN E  1 9   ? -54.477  105.578 -0.765  1.00 34.60  ? 9   ASN E C   1 
ATOM   6511  O  O   . ASN E  1 9   ? -54.694  105.209 -1.917  1.00 28.30  ? 9   ASN E O   1 
ATOM   6512  C  CB  . ASN E  1 9   ? -56.033  106.982 0.622   1.00 35.78  ? 9   ASN E CB  1 
ATOM   6513  C  CG  . ASN E  1 9   ? -57.256  107.011 1.516   1.00 36.33  ? 9   ASN E CG  1 
ATOM   6514  O  OD1 . ASN E  1 9   ? -57.961  106.013 1.640   1.00 28.21  ? 9   ASN E OD1 1 
ATOM   6515  N  ND2 . ASN E  1 9   ? -57.516  108.159 2.137   1.00 27.61  ? 9   ASN E ND2 1 
ATOM   6516  N  N   . ILE E  1 10  ? -53.281  105.989 -0.356  1.00 31.57  ? 10  ILE E N   1 
ATOM   6517  C  CA  . ILE E  1 10  ? -52.127  106.010 -1.249  1.00 19.62  ? 10  ILE E CA  1 
ATOM   6518  C  C   . ILE E  1 10  ? -51.877  104.653 -1.904  1.00 32.48  ? 10  ILE E C   1 
ATOM   6519  O  O   . ILE E  1 10  ? -51.660  104.595 -3.099  1.00 15.64  ? 10  ILE E O   1 
ATOM   6520  C  CB  . ILE E  1 10  ? -50.872  106.474 -0.523  1.00 25.15  ? 10  ILE E CB  1 
ATOM   6521  C  CG1 . ILE E  1 10  ? -50.943  107.980 -0.287  1.00 16.02  ? 10  ILE E CG1 1 
ATOM   6522  C  CG2 . ILE E  1 10  ? -49.638  106.110 -1.319  1.00 19.52  ? 10  ILE E CG2 1 
ATOM   6523  C  CD1 . ILE E  1 10  ? -49.938  108.473 0.705   1.00 19.45  ? 10  ILE E CD1 1 
ATOM   6524  N  N   . ARG E  1 11  ? -51.931  103.571 -1.126  1.00 0.67   ? 11  ARG E N   1 
ATOM   6525  C  CA  . ARG E  1 11  ? -51.790  102.216 -1.671  1.00 17.40  ? 11  ARG E CA  1 
ATOM   6526  C  C   . ARG E  1 11  ? -52.823  101.851 -2.757  1.00 29.16  ? 11  ARG E C   1 
ATOM   6527  O  O   . ARG E  1 11  ? -52.434  101.546 -3.889  1.00 19.91  ? 11  ARG E O   1 
ATOM   6528  C  CB  . ARG E  1 11  ? -51.788  101.168 -0.555  1.00 18.15  ? 11  ARG E CB  1 
ATOM   6529  C  CG  . ARG E  1 11  ? -51.717  99.722  -1.057  1.00 36.49  ? 11  ARG E CG  1 
ATOM   6530  C  CD  . ARG E  1 11  ? -51.482  98.713  0.079   1.00 51.92  ? 11  ARG E CD  1 
ATOM   6531  N  NE  . ARG E  1 11  ? -52.670  98.465  0.900   1.00 55.07  ? 11  ARG E NE  1 
ATOM   6532  C  CZ  . ARG E  1 11  ? -52.879  98.990  2.111   1.00 49.48  ? 11  ARG E CZ  1 
ATOM   6533  N  NH1 . ARG E  1 11  ? -53.995  98.708  2.794   1.00 30.51  ? 11  ARG E NH1 1 
ATOM   6534  N  NH2 . ARG E  1 11  ? -51.973  99.797  2.648   1.00 26.94  ? 11  ARG E NH2 1 
ATOM   6535  N  N   . GLN E  1 12  ? -54.117  101.886 -2.414  1.00 56.50  ? 12  GLN E N   1 
ATOM   6536  C  CA  . GLN E  1 12  ? -55.218  101.546 -3.334  1.00 31.32  ? 12  GLN E CA  1 
ATOM   6537  C  C   . GLN E  1 12  ? -55.335  102.445 -4.567  1.00 45.98  ? 12  GLN E C   1 
ATOM   6538  O  O   . GLN E  1 12  ? -55.666  101.971 -5.653  1.00 32.84  ? 12  GLN E O   1 
ATOM   6539  C  CB  . GLN E  1 12  ? -56.560  101.580 -2.598  1.00 34.04  ? 12  GLN E CB  1 
ATOM   6540  C  CG  . GLN E  1 12  ? -56.720  100.539 -1.521  1.00 32.03  ? 12  GLN E CG  1 
ATOM   6541  C  CD  . GLN E  1 12  ? -56.810  99.139  -2.081  1.00 45.21  ? 12  GLN E CD  1 
ATOM   6542  O  OE1 . GLN E  1 12  ? -55.875  98.650  -2.715  1.00 44.96  ? 12  GLN E OE1 1 
ATOM   6543  N  NE2 . GLN E  1 12  ? -57.945  98.485  -1.860  1.00 52.10  ? 12  GLN E NE2 1 
ATOM   6544  N  N   . THR E  1 13  ? -55.131  103.748 -4.389  1.00 11.30  ? 13  THR E N   1 
ATOM   6545  C  CA  . THR E  1 13  ? -55.142  104.685 -5.516  1.00 11.38  ? 13  THR E CA  1 
ATOM   6546  C  C   . THR E  1 13  ? -53.723  105.025 -6.058  1.00 40.94  ? 13  THR E C   1 
ATOM   6547  O  O   . THR E  1 13  ? -53.547  105.872 -6.944  1.00 10.00  ? 13  THR E O   1 
ATOM   6548  C  CB  . THR E  1 13  ? -55.928  105.981 -5.162  1.00 24.94  ? 13  THR E CB  1 
ATOM   6549  O  OG1 . THR E  1 13  ? -55.694  106.990 -6.151  1.00 57.18  ? 13  THR E OG1 1 
ATOM   6550  C  CG2 . THR E  1 13  ? -55.492  106.531 -3.858  1.00 4.77   ? 13  THR E CG2 1 
ATOM   6551  N  N   . SER E  1 14  ? -52.705  104.364 -5.528  1.00 59.78  ? 14  SER E N   1 
ATOM   6552  C  CA  . SER E  1 14  ? -51.349  104.646 -5.975  1.00 75.16  ? 14  SER E CA  1 
ATOM   6553  C  C   . SER E  1 14  ? -51.249  104.289 -7.432  1.00 54.49  ? 14  SER E C   1 
ATOM   6554  O  O   . SER E  1 14  ? -51.692  103.214 -7.841  1.00 58.31  ? 14  SER E O   1 
ATOM   6555  C  CB  . SER E  1 14  ? -50.337  103.792 -5.218  1.00 86.74  ? 14  SER E CB  1 
ATOM   6556  O  OG  . SER E  1 14  ? -50.353  102.455 -5.697  1.00 83.69  ? 14  SER E OG  1 
ATOM   6557  N  N   . ARG E  1 15  ? -50.663  105.180 -8.219  1.00 41.80  ? 15  ARG E N   1 
ATOM   6558  C  CA  . ARG E  1 15  ? -50.322  104.824 -9.593  1.00 48.84  ? 15  ARG E CA  1 
ATOM   6559  C  C   . ARG E  1 15  ? -48.830  104.999 -9.872  1.00 21.46  ? 15  ARG E C   1 
ATOM   6560  O  O   . ARG E  1 15  ? -48.394  106.037 -10.370 1.00 36.83  ? 15  ARG E O   1 
ATOM   6561  C  CB  . ARG E  1 15  ? -51.196  105.586 -10.594 1.00 38.40  ? 15  ARG E CB  1 
ATOM   6562  C  CG  . ARG E  1 15  ? -52.588  104.994 -10.760 1.00 20.13  ? 15  ARG E CG  1 
ATOM   6563  C  CD  . ARG E  1 15  ? -52.543  103.634 -11.454 1.00 22.82  ? 15  ARG E CD  1 
ATOM   6564  N  NE  . ARG E  1 15  ? -52.130  103.761 -12.855 1.00 70.15  ? 15  ARG E NE  1 
ATOM   6565  C  CZ  . ARG E  1 15  ? -52.962  103.952 -13.878 1.00 49.39  ? 15  ARG E CZ  1 
ATOM   6566  N  NH1 . ARG E  1 15  ? -54.270  104.031 -13.671 1.00 40.55  ? 15  ARG E NH1 1 
ATOM   6567  N  NH2 . ARG E  1 15  ? -52.482  104.066 -15.110 1.00 26.75  ? 15  ARG E NH2 1 
ATOM   6568  N  N   . PRO E  1 16  ? -48.048  103.965 -9.553  1.00 37.41  ? 16  PRO E N   1 
ATOM   6569  C  CA  . PRO E  1 16  ? -46.578  103.956 -9.620  1.00 43.21  ? 16  PRO E CA  1 
ATOM   6570  C  C   . PRO E  1 16  ? -46.026  104.035 -11.036 1.00 35.96  ? 16  PRO E C   1 
ATOM   6571  O  O   . PRO E  1 16  ? -44.945  104.568 -11.244 1.00 56.63  ? 16  PRO E O   1 
ATOM   6572  C  CB  . PRO E  1 16  ? -46.206  102.580 -9.043  1.00 40.16  ? 16  PRO E CB  1 
ATOM   6573  C  CG  . PRO E  1 16  ? -47.451  102.055 -8.393  1.00 38.54  ? 16  PRO E CG  1 
ATOM   6574  C  CD  . PRO E  1 16  ? -48.593  102.663 -9.139  1.00 35.89  ? 16  PRO E CD  1 
ATOM   6575  N  N   . ASP E  1 17  ? -46.741  103.439 -11.977 1.00 19.71  ? 17  ASP E N   1 
ATOM   6576  C  CA  . ASP E  1 17  ? -46.350  103.372 -13.383 1.00 26.16  ? 17  ASP E CA  1 
ATOM   6577  C  C   . ASP E  1 17  ? -46.604  104.677 -14.131 1.00 15.34  ? 17  ASP E C   1 
ATOM   6578  O  O   . ASP E  1 17  ? -46.260  104.807 -15.296 1.00 39.61  ? 17  ASP E O   1 
ATOM   6579  C  CB  . ASP E  1 17  ? -47.106  102.220 -14.074 1.00 39.82  ? 17  ASP E CB  1 
ATOM   6580  C  CG  . ASP E  1 17  ? -48.635  102.271 -13.840 1.00 69.06  ? 17  ASP E CG  1 
ATOM   6581  O  OD1 . ASP E  1 17  ? -49.079  102.644 -12.727 1.00 57.18  ? 17  ASP E OD1 1 
ATOM   6582  O  OD2 . ASP E  1 17  ? -49.399  101.926 -14.773 1.00 74.78  ? 17  ASP E OD2 1 
ATOM   6583  N  N   . VAL E  1 18  ? -47.201  105.643 -13.441 1.00 22.93  ? 18  VAL E N   1 
ATOM   6584  C  CA  . VAL E  1 18  ? -47.720  106.845 -14.080 1.00 14.95  ? 18  VAL E CA  1 
ATOM   6585  C  C   . VAL E  1 18  ? -47.038  108.110 -13.601 1.00 16.85  ? 18  VAL E C   1 
ATOM   6586  O  O   . VAL E  1 18  ? -47.102  108.455 -12.427 1.00 19.77  ? 18  VAL E O   1 
ATOM   6587  C  CB  . VAL E  1 18  ? -49.219  107.009 -13.810 1.00 25.88  ? 18  VAL E CB  1 
ATOM   6588  C  CG1 . VAL E  1 18  ? -49.728  108.297 -14.442 1.00 21.26  ? 18  VAL E CG1 1 
ATOM   6589  C  CG2 . VAL E  1 18  ? -49.982  105.797 -14.297 1.00 15.87  ? 18  VAL E CG2 1 
ATOM   6590  N  N   . ILE E  1 19  ? -46.400  108.808 -14.526 1.00 18.17  ? 19  ILE E N   1 
ATOM   6591  C  CA  . ILE E  1 19  ? -45.662  110.002 -14.183 1.00 23.15  ? 19  ILE E CA  1 
ATOM   6592  C  C   . ILE E  1 19  ? -46.650  111.131 -13.845 1.00 28.78  ? 19  ILE E C   1 
ATOM   6593  O  O   . ILE E  1 19  ? -47.491  111.489 -14.651 1.00 14.04  ? 19  ILE E O   1 
ATOM   6594  C  CB  . ILE E  1 19  ? -44.687  110.388 -15.330 1.00 36.11  ? 19  ILE E CB  1 
ATOM   6595  C  CG1 . ILE E  1 19  ? -43.828  111.595 -14.945 1.00 28.03  ? 19  ILE E CG1 1 
ATOM   6596  C  CG2 . ILE E  1 19  ? -45.454  110.617 -16.633 1.00 13.97  ? 19  ILE E CG2 1 
ATOM   6597  C  CD1 . ILE E  1 19  ? -42.780  111.919 -15.936 1.00 13.22  ? 19  ILE E CD1 1 
ATOM   6598  N  N   . PRO E  1 20  ? -46.533  111.699 -12.636 1.00 32.25  ? 20  PRO E N   1 
ATOM   6599  C  CA  . PRO E  1 20  ? -47.486  112.699 -12.139 1.00 16.56  ? 20  PRO E CA  1 
ATOM   6600  C  C   . PRO E  1 20  ? -47.289  114.090 -12.770 1.00 35.59  ? 20  PRO E C   1 
ATOM   6601  O  O   . PRO E  1 20  ? -47.197  115.088 -12.057 1.00 35.62  ? 20  PRO E O   1 
ATOM   6602  C  CB  . PRO E  1 20  ? -47.162  112.764 -10.646 1.00 24.03  ? 20  PRO E CB  1 
ATOM   6603  C  CG  . PRO E  1 20  ? -45.675  112.487 -10.584 1.00 14.67  ? 20  PRO E CG  1 
ATOM   6604  C  CD  . PRO E  1 20  ? -45.385  111.521 -11.721 1.00 22.88  ? 20  PRO E CD  1 
ATOM   6605  N  N   . THR E  1 21  ? -47.204  114.148 -14.091 1.00 15.69  ? 21  THR E N   1 
ATOM   6606  C  CA  . THR E  1 21  ? -47.162  115.412 -14.827 1.00 20.41  ? 21  THR E CA  1 
ATOM   6607  C  C   . THR E  1 21  ? -48.426  116.285 -14.621 1.00 54.46  ? 21  THR E C   1 
ATOM   6608  O  O   . THR E  1 21  ? -49.560  115.784 -14.702 1.00 29.51  ? 21  THR E O   1 
ATOM   6609  C  CB  . THR E  1 21  ? -46.975  115.096 -16.326 1.00 35.22  ? 21  THR E CB  1 
ATOM   6610  O  OG1 . THR E  1 21  ? -45.691  115.565 -16.755 1.00 35.89  ? 21  THR E OG1 1 
ATOM   6611  C  CG2 . THR E  1 21  ? -48.099  115.700 -17.180 1.00 23.31  ? 21  THR E CG2 1 
ATOM   6612  N  N   . GLN E  1 22  ? -48.227  117.579 -14.343 1.00 57.81  ? 22  GLN E N   1 
ATOM   6613  C  CA  . GLN E  1 22  ? -49.341  118.524 -14.122 1.00 72.20  ? 22  GLN E CA  1 
ATOM   6614  C  C   . GLN E  1 22  ? -49.571  119.448 -15.327 1.00 67.21  ? 22  GLN E C   1 
ATOM   6615  O  O   . GLN E  1 22  ? -48.666  120.181 -15.733 1.00 66.46  ? 22  GLN E O   1 
ATOM   6616  C  CB  . GLN E  1 22  ? -49.141  119.376 -12.841 1.00 15.02  ? 22  GLN E CB  1 
ATOM   6617  C  CG  . GLN E  1 22  ? -49.933  118.917 -11.563 1.00 134.39 ? 22  GLN E CG  1 
ATOM   6618  C  CD  . GLN E  1 22  ? -51.490  118.963 -11.664 1.00 78.85  ? 22  GLN E CD  1 
ATOM   6619  O  OE1 . GLN E  1 22  ? -52.131  117.926 -11.877 1.00 68.36  ? 22  GLN E OE1 1 
ATOM   6620  N  NE2 . GLN E  1 22  ? -52.090  120.154 -11.457 1.00 29.15  ? 22  GLN E NE2 1 
ATOM   6621  N  N   . ARG E  1 23  ? -50.784  119.420 -15.882 1.00 65.52  ? 23  ARG E N   1 
ATOM   6622  C  CA  . ARG E  1 23  ? -51.137  120.240 -17.049 1.00 65.03  ? 23  ARG E CA  1 
ATOM   6623  C  C   . ARG E  1 23  ? -50.035  120.242 -18.122 1.00 72.40  ? 23  ARG E C   1 
ATOM   6624  O  O   . ARG E  1 23  ? -49.314  121.228 -18.308 1.00 66.79  ? 23  ARG E O   1 
ATOM   6625  C  CB  . ARG E  1 23  ? -51.516  121.673 -16.627 1.00 61.10  ? 23  ARG E CB  1 
ATOM   6626  C  CG  . ARG E  1 23  ? -51.900  122.612 -17.786 1.00 78.67  ? 23  ARG E CG  1 
ATOM   6627  C  CD  . ARG E  1 23  ? -52.695  123.845 -17.325 1.00 80.74  ? 23  ARG E CD  1 
ATOM   6628  N  NE  . ARG E  1 23  ? -54.140  123.594 -17.310 1.00 95.70  ? 23  ARG E NE  1 
ATOM   6629  C  CZ  . ARG E  1 23  ? -55.058  124.445 -16.850 1.00 97.15  ? 23  ARG E CZ  1 
ATOM   6630  N  NH1 . ARG E  1 23  ? -54.700  125.623 -16.347 1.00 98.30  ? 23  ARG E NH1 1 
ATOM   6631  N  NH2 . ARG E  1 23  ? -56.343  124.116 -16.889 1.00 90.92  ? 23  ARG E NH2 1 
ATOM   6632  N  N   . PRO E  1 26  ? -43.354  119.460 -17.421 1.00 32.40  ? 26  PRO E N   1 
ATOM   6633  C  CA  . PRO E  1 26  ? -42.552  118.336 -16.911 1.00 25.96  ? 26  PRO E CA  1 
ATOM   6634  C  C   . PRO E  1 26  ? -42.532  118.298 -15.395 1.00 12.17  ? 26  PRO E C   1 
ATOM   6635  O  O   . PRO E  1 26  ? -42.599  119.348 -14.758 1.00 22.60  ? 26  PRO E O   1 
ATOM   6636  C  CB  . PRO E  1 26  ? -41.148  118.646 -17.429 1.00 24.55  ? 26  PRO E CB  1 
ATOM   6637  C  CG  . PRO E  1 26  ? -41.122  120.145 -17.541 1.00 15.85  ? 26  PRO E CG  1 
ATOM   6638  C  CD  . PRO E  1 26  ? -42.511  120.539 -17.974 1.00 21.30  ? 26  PRO E CD  1 
ATOM   6639  N  N   . VAL E  1 27  ? -42.440  117.102 -14.824 1.00 26.25  ? 27  VAL E N   1 
ATOM   6640  C  CA  . VAL E  1 27  ? -42.223  116.966 -13.380 1.00 24.46  ? 27  VAL E CA  1 
ATOM   6641  C  C   . VAL E  1 27  ? -40.830  117.448 -12.992 1.00 21.32  ? 27  VAL E C   1 
ATOM   6642  O  O   . VAL E  1 27  ? -39.818  116.934 -13.481 1.00 26.17  ? 27  VAL E O   1 
ATOM   6643  C  CB  . VAL E  1 27  ? -42.331  115.510 -12.935 1.00 30.80  ? 27  VAL E CB  1 
ATOM   6644  C  CG1 . VAL E  1 27  ? -42.158  115.422 -11.443 1.00 12.55  ? 27  VAL E CG1 1 
ATOM   6645  C  CG2 . VAL E  1 27  ? -43.662  114.918 -13.378 1.00 36.31  ? 27  VAL E CG2 1 
ATOM   6646  N  N   . ALA E  1 28  ? -40.768  118.437 -12.119 1.00 19.48  ? 28  ALA E N   1 
ATOM   6647  C  CA  . ALA E  1 28  ? -39.474  118.975 -11.705 1.00 20.64  ? 28  ALA E CA  1 
ATOM   6648  C  C   . ALA E  1 28  ? -38.853  118.125 -10.589 1.00 21.31  ? 28  ALA E C   1 
ATOM   6649  O  O   . ALA E  1 28  ? -39.277  118.174 -9.443  1.00 15.11  ? 28  ALA E O   1 
ATOM   6650  C  CB  . ALA E  1 28  ? -39.606  120.423 -11.275 1.00 11.56  ? 28  ALA E CB  1 
ATOM   6651  N  N   . VAL E  1 29  ? -37.847  117.337 -10.948 1.00 16.28  ? 29  VAL E N   1 
ATOM   6652  C  CA  . VAL E  1 29  ? -37.120  116.521 -9.983  1.00 15.86  ? 29  VAL E CA  1 
ATOM   6653  C  C   . VAL E  1 29  ? -35.855  117.213 -9.491  1.00 16.25  ? 29  VAL E C   1 
ATOM   6654  O  O   . VAL E  1 29  ? -35.051  117.687 -10.295 1.00 28.40  ? 29  VAL E O   1 
ATOM   6655  C  CB  . VAL E  1 29  ? -36.716  115.167 -10.596 1.00 20.26  ? 29  VAL E CB  1 
ATOM   6656  C  CG1 . VAL E  1 29  ? -36.069  114.272 -9.546  1.00 10.08  ? 29  VAL E CG1 1 
ATOM   6657  C  CG2 . VAL E  1 29  ? -37.928  114.503 -11.191 1.00 16.13  ? 29  VAL E CG2 1 
ATOM   6658  N  N   . SER E  1 30  ? -35.687  117.273 -8.174  1.00 25.44  ? 30  SER E N   1 
ATOM   6659  C  CA  . SER E  1 30  ? -34.448  117.774 -7.584  1.00 17.35  ? 30  SER E CA  1 
ATOM   6660  C  C   . SER E  1 30  ? -33.555  116.618 -7.165  1.00 17.69  ? 30  SER E C   1 
ATOM   6661  O  O   . SER E  1 30  ? -34.000  115.686 -6.504  1.00 28.40  ? 30  SER E O   1 
ATOM   6662  C  CB  . SER E  1 30  ? -34.727  118.701 -6.408  1.00 10.39  ? 30  SER E CB  1 
ATOM   6663  O  OG  . SER E  1 30  ? -35.078  119.993 -6.865  1.00 39.61  ? 30  SER E OG  1 
ATOM   6664  N  N   . VAL E  1 31  ? -32.296  116.675 -7.583  1.00 25.23  ? 31  VAL E N   1 
ATOM   6665  C  CA  . VAL E  1 31  ? -31.318  115.673 -7.189  1.00 33.83  ? 31  VAL E CA  1 
ATOM   6666  C  C   . VAL E  1 31  ? -30.125  116.313 -6.507  1.00 26.22  ? 31  VAL E C   1 
ATOM   6667  O  O   . VAL E  1 31  ? -29.629  117.353 -6.930  1.00 28.60  ? 31  VAL E O   1 
ATOM   6668  C  CB  . VAL E  1 31  ? -30.827  114.847 -8.388  1.00 26.58  ? 31  VAL E CB  1 
ATOM   6669  C  CG1 . VAL E  1 31  ? -30.250  113.533 -7.896  1.00 30.53  ? 31  VAL E CG1 1 
ATOM   6670  C  CG2 . VAL E  1 31  ? -31.962  114.570 -9.307  1.00 32.36  ? 31  VAL E CG2 1 
ATOM   6671  N  N   . SER E  1 32  ? -29.661  115.672 -5.449  1.00 30.53  ? 32  SER E N   1 
ATOM   6672  C  CA  . SER E  1 32  ? -28.474  116.131 -4.751  1.00 32.25  ? 32  SER E CA  1 
ATOM   6673  C  C   . SER E  1 32  ? -27.803  114.920 -4.106  1.00 38.38  ? 32  SER E C   1 
ATOM   6674  O  O   . SER E  1 32  ? -28.474  114.096 -3.485  1.00 45.84  ? 32  SER E O   1 
ATOM   6675  C  CB  . SER E  1 32  ? -28.879  117.166 -3.706  1.00 35.22  ? 32  SER E CB  1 
ATOM   6676  O  OG  . SER E  1 32  ? -27.767  117.626 -2.974  1.00 53.47  ? 32  SER E OG  1 
ATOM   6677  N  N   . LEU E  1 33  ? -26.490  114.790 -4.273  1.00 37.25  ? 33  LEU E N   1 
ATOM   6678  C  CA  . LEU E  1 33  ? -25.756  113.692 -3.636  1.00 18.82  ? 33  LEU E CA  1 
ATOM   6679  C  C   . LEU E  1 33  ? -25.076  114.149 -2.357  1.00 27.20  ? 33  LEU E C   1 
ATOM   6680  O  O   . LEU E  1 33  ? -24.307  115.106 -2.368  1.00 30.22  ? 33  LEU E O   1 
ATOM   6681  C  CB  . LEU E  1 33  ? -24.718  113.119 -4.582  1.00 12.22  ? 33  LEU E CB  1 
ATOM   6682  C  CG  . LEU E  1 33  ? -25.262  112.609 -5.910  1.00 30.97  ? 33  LEU E CG  1 
ATOM   6683  C  CD1 . LEU E  1 33  ? -24.161  111.892 -6.689  1.00 14.39  ? 33  LEU E CD1 1 
ATOM   6684  C  CD2 . LEU E  1 33  ? -26.468  111.700 -5.653  1.00 25.22  ? 33  LEU E CD2 1 
ATOM   6685  N  N   . LYS E  1 34  ? -25.383  113.476 -1.254  1.00 21.18  ? 34  LYS E N   1 
ATOM   6686  C  CA  . LYS E  1 34  ? -24.705  113.743 -0.008  1.00 20.95  ? 34  LYS E CA  1 
ATOM   6687  C  C   . LYS E  1 34  ? -23.714  112.609 0.209   1.00 24.78  ? 34  LYS E C   1 
ATOM   6688  O  O   . LYS E  1 34  ? -24.096  111.495 0.560   1.00 28.08  ? 34  LYS E O   1 
ATOM   6689  C  CB  . LYS E  1 34  ? -25.696  113.804 1.155   1.00 27.03  ? 34  LYS E CB  1 
ATOM   6690  C  CG  . LYS E  1 34  ? -26.965  114.593 0.889   1.00 41.52  ? 34  LYS E CG  1 
ATOM   6691  C  CD  . LYS E  1 34  ? -26.738  116.100 0.872   1.00 53.10  ? 34  LYS E CD  1 
ATOM   6692  C  CE  . LYS E  1 34  ? -28.077  116.837 0.812   1.00 60.16  ? 34  LYS E CE  1 
ATOM   6693  N  NZ  . LYS E  1 34  ? -27.933  118.295 0.548   1.00 63.94  ? 34  LYS E NZ  1 
ATOM   6694  N  N   . PHE E  1 35  ? -22.436  112.886 0.003   1.00 17.13  ? 35  PHE E N   1 
ATOM   6695  C  CA  . PHE E  1 35  ? -21.427  111.835 0.100   1.00 18.48  ? 35  PHE E CA  1 
ATOM   6696  C  C   . PHE E  1 35  ? -21.127  111.411 1.534   1.00 21.23  ? 35  PHE E C   1 
ATOM   6697  O  O   . PHE E  1 35  ? -20.963  112.241 2.422   1.00 16.59  ? 35  PHE E O   1 
ATOM   6698  C  CB  . PHE E  1 35  ? -20.139  112.263 -0.607  1.00 17.13  ? 35  PHE E CB  1 
ATOM   6699  C  CG  . PHE E  1 35  ? -20.278  112.370 -2.093  1.00 28.87  ? 35  PHE E CG  1 
ATOM   6700  C  CD1 . PHE E  1 35  ? -20.176  111.238 -2.890  1.00 23.82  ? 35  PHE E CD1 1 
ATOM   6701  C  CD2 . PHE E  1 35  ? -20.513  113.601 -2.696  1.00 19.91  ? 35  PHE E CD2 1 
ATOM   6702  C  CE1 . PHE E  1 35  ? -20.300  111.331 -4.266  1.00 30.58  ? 35  PHE E CE1 1 
ATOM   6703  C  CE2 . PHE E  1 35  ? -20.628  113.704 -4.066  1.00 23.69  ? 35  PHE E CE2 1 
ATOM   6704  C  CZ  . PHE E  1 35  ? -20.525  112.566 -4.855  1.00 25.43  ? 35  PHE E CZ  1 
ATOM   6705  N  N   . ILE E  1 36  ? -21.045  110.104 1.737   1.00 15.20  ? 36  ILE E N   1 
ATOM   6706  C  CA  . ILE E  1 36  ? -20.900  109.541 3.059   1.00 24.18  ? 36  ILE E CA  1 
ATOM   6707  C  C   . ILE E  1 36  ? -19.531  108.890 3.211   1.00 31.32  ? 36  ILE E C   1 
ATOM   6708  O  O   . ILE E  1 36  ? -18.889  108.968 4.277   1.00 16.47  ? 36  ILE E O   1 
ATOM   6709  C  CB  . ILE E  1 36  ? -21.995  108.491 3.342   1.00 21.50  ? 36  ILE E CB  1 
ATOM   6710  C  CG1 . ILE E  1 36  ? -23.373  109.052 3.000   1.00 10.71  ? 36  ILE E CG1 1 
ATOM   6711  C  CG2 . ILE E  1 36  ? -21.941  108.035 4.797   1.00 7.02   ? 36  ILE E CG2 1 
ATOM   6712  C  CD1 . ILE E  1 36  ? -23.755  110.280 3.801   1.00 17.82  ? 36  ILE E CD1 1 
ATOM   6713  N  N   . ASN E  1 37  ? -19.086  108.250 2.139   1.00 14.00  ? 37  ASN E N   1 
ATOM   6714  C  CA  . ASN E  1 37  ? -17.836  107.513 2.175   1.00 16.95  ? 37  ASN E CA  1 
ATOM   6715  C  C   . ASN E  1 37  ? -17.262  107.215 0.808   1.00 14.79  ? 37  ASN E C   1 
ATOM   6716  O  O   . ASN E  1 37  ? -17.995  107.086 -0.165  1.00 18.04  ? 37  ASN E O   1 
ATOM   6717  C  CB  . ASN E  1 37  ? -18.009  106.207 2.944   1.00 11.38  ? 37  ASN E CB  1 
ATOM   6718  C  CG  . ASN E  1 37  ? -16.787  105.871 3.782   1.00 36.48  ? 37  ASN E CG  1 
ATOM   6719  O  OD1 . ASN E  1 37  ? -15.646  106.157 3.385   1.00 19.27  ? 37  ASN E OD1 1 
ATOM   6720  N  ND2 . ASN E  1 37  ? -17.016  105.281 4.959   1.00 36.04  ? 37  ASN E ND2 1 
ATOM   6721  N  N   . ILE E  1 38  ? -15.937  107.115 0.741   1.00 31.17  ? 38  ILE E N   1 
ATOM   6722  C  CA  . ILE E  1 38  ? -15.266  106.648 -0.465  1.00 16.20  ? 38  ILE E CA  1 
ATOM   6723  C  C   . ILE E  1 38  ? -14.465  105.443 -0.034  1.00 23.28  ? 38  ILE E C   1 
ATOM   6724  O  O   . ILE E  1 38  ? -13.636  105.548 0.855   1.00 28.10  ? 38  ILE E O   1 
ATOM   6725  C  CB  . ILE E  1 38  ? -14.391  107.740 -1.078  1.00 18.17  ? 38  ILE E CB  1 
ATOM   6726  C  CG1 . ILE E  1 38  ? -15.236  108.992 -1.352  1.00 17.52  ? 38  ILE E CG1 1 
ATOM   6727  C  CG2 . ILE E  1 38  ? -13.764  107.244 -2.352  1.00 18.80  ? 38  ILE E CG2 1 
ATOM   6728  C  CD1 . ILE E  1 38  ? -14.478  110.176 -1.873  1.00 17.99  ? 38  ILE E CD1 1 
ATOM   6729  N  N   . LEU E  1 39  ? -14.744  104.293 -0.639  1.00 28.92  ? 39  LEU E N   1 
ATOM   6730  C  CA  . LEU E  1 39  ? -14.325  103.008 -0.076  1.00 23.81  ? 39  LEU E CA  1 
ATOM   6731  C  C   . LEU E  1 39  ? -13.144  102.370 -0.778  1.00 42.64  ? 39  LEU E C   1 
ATOM   6732  O  O   . LEU E  1 39  ? -12.247  101.809 -0.141  1.00 59.12  ? 39  LEU E O   1 
ATOM   6733  C  CB  . LEU E  1 39  ? -15.495  102.036 -0.090  1.00 20.69  ? 39  LEU E CB  1 
ATOM   6734  C  CG  . LEU E  1 39  ? -16.657  102.493 0.779   1.00 32.58  ? 39  LEU E CG  1 
ATOM   6735  C  CD1 . LEU E  1 39  ? -17.755  101.443 0.766   1.00 27.52  ? 39  LEU E CD1 1 
ATOM   6736  C  CD2 . LEU E  1 39  ? -16.157  102.771 2.201   1.00 25.05  ? 39  LEU E CD2 1 
ATOM   6737  N  N   . GLU E  1 40  ? -13.170  102.416 -2.097  1.00 41.74  ? 40  GLU E N   1 
ATOM   6738  C  CA  . GLU E  1 40  ? -11.994  102.059 -2.849  1.00 41.86  ? 40  GLU E CA  1 
ATOM   6739  C  C   . GLU E  1 40  ? -11.814  102.985 -4.021  1.00 37.93  ? 40  GLU E C   1 
ATOM   6740  O  O   . GLU E  1 40  ? -12.772  103.502 -4.586  1.00 54.06  ? 40  GLU E O   1 
ATOM   6741  C  CB  . GLU E  1 40  ? -12.029  100.623 -3.337  1.00 32.28  ? 40  GLU E CB  1 
ATOM   6742  C  CG  . GLU E  1 40  ? -10.961  100.385 -4.388  1.00 33.61  ? 40  GLU E CG  1 
ATOM   6743  C  CD  . GLU E  1 40  ? -10.817  98.929  -4.756  1.00 56.72  ? 40  GLU E CD  1 
ATOM   6744  O  OE1 . GLU E  1 40  ? -11.414  98.078  -4.051  1.00 60.60  ? 40  GLU E OE1 1 
ATOM   6745  O  OE2 . GLU E  1 40  ? -10.109  98.640  -5.753  1.00 35.57  ? 40  GLU E OE2 1 
ATOM   6746  N  N   . VAL E  1 41  ? -10.561  103.203 -4.358  1.00 34.41  ? 41  VAL E N   1 
ATOM   6747  C  CA  . VAL E  1 41  ? -10.208  104.006 -5.493  1.00 35.59  ? 41  VAL E CA  1 
ATOM   6748  C  C   . VAL E  1 41  ? -9.179   103.237 -6.311  1.00 34.45  ? 41  VAL E C   1 
ATOM   6749  O  O   . VAL E  1 41  ? -8.348   102.508 -5.763  1.00 32.21  ? 41  VAL E O   1 
ATOM   6750  C  CB  . VAL E  1 41  ? -9.631   105.358 -5.037  1.00 37.50  ? 41  VAL E CB  1 
ATOM   6751  C  CG1 . VAL E  1 41  ? -8.893   106.021 -6.173  1.00 42.45  ? 41  VAL E CG1 1 
ATOM   6752  C  CG2 . VAL E  1 41  ? -10.739  106.255 -4.509  1.00 28.81  ? 41  VAL E CG2 1 
ATOM   6753  N  N   . ASN E  1 42  ? -9.242   103.374 -7.626  1.00 26.91  ? 42  ASN E N   1 
ATOM   6754  C  CA  . ASN E  1 42  ? -8.241   102.734 -8.474  1.00 25.87  ? 42  ASN E CA  1 
ATOM   6755  C  C   . ASN E  1 42  ? -7.803   103.676 -9.594  1.00 27.48  ? 42  ASN E C   1 
ATOM   6756  O  O   . ASN E  1 42  ? -8.520   103.881 -10.569 1.00 28.34  ? 42  ASN E O   1 
ATOM   6757  C  CB  . ASN E  1 42  ? -8.774   101.415 -9.026  1.00 24.05  ? 42  ASN E CB  1 
ATOM   6758  C  CG  . ASN E  1 42  ? -7.714   100.601 -9.727  1.00 35.04  ? 42  ASN E CG  1 
ATOM   6759  O  OD1 . ASN E  1 42  ? -6.841   101.136 -10.414 1.00 36.47  ? 42  ASN E OD1 1 
ATOM   6760  N  ND2 . ASN E  1 42  ? -7.790   99.287  -9.563  1.00 27.96  ? 42  ASN E ND2 1 
ATOM   6761  N  N   . GLU E  1 43  ? -6.623   104.257 -9.436  1.00 24.17  ? 43  GLU E N   1 
ATOM   6762  C  CA  . GLU E  1 43  ? -6.148   105.262 -10.372 1.00 40.18  ? 43  GLU E CA  1 
ATOM   6763  C  C   . GLU E  1 43  ? -5.778   104.649 -11.720 1.00 35.87  ? 43  GLU E C   1 
ATOM   6764  O  O   . GLU E  1 43  ? -5.775   105.340 -12.749 1.00 28.45  ? 43  GLU E O   1 
ATOM   6765  C  CB  . GLU E  1 43  ? -4.972   106.059 -9.785  1.00 34.05  ? 43  GLU E CB  1 
ATOM   6766  C  CG  . GLU E  1 43  ? -4.677   107.345 -10.560 1.00 43.81  ? 43  GLU E CG  1 
ATOM   6767  C  CD  . GLU E  1 43  ? -3.727   108.271 -9.828  1.00 48.72  ? 43  GLU E CD  1 
ATOM   6768  O  OE1 . GLU E  1 43  ? -3.361   107.952 -8.678  1.00 51.69  ? 43  GLU E OE1 1 
ATOM   6769  O  OE2 . GLU E  1 43  ? -3.354   109.320 -10.395 1.00 40.09  ? 43  GLU E OE2 1 
ATOM   6770  N  N   . ILE E  1 44  ? -5.477   103.354 -11.709 1.00 32.88  ? 44  ILE E N   1 
ATOM   6771  C  CA  . ILE E  1 44  ? -5.148   102.637 -12.934 1.00 39.55  ? 44  ILE E CA  1 
ATOM   6772  C  C   . ILE E  1 44  ? -6.393   102.419 -13.773 1.00 31.21  ? 44  ILE E C   1 
ATOM   6773  O  O   . ILE E  1 44  ? -6.439   102.828 -14.931 1.00 34.80  ? 44  ILE E O   1 
ATOM   6774  C  CB  . ILE E  1 44  ? -4.503   101.261 -12.652 1.00 48.75  ? 44  ILE E CB  1 
ATOM   6775  C  CG1 . ILE E  1 44  ? -3.287   101.395 -11.719 1.00 42.25  ? 44  ILE E CG1 1 
ATOM   6776  C  CG2 . ILE E  1 44  ? -4.120   100.585 -13.953 1.00 35.97  ? 44  ILE E CG2 1 
ATOM   6777  C  CD1 . ILE E  1 44  ? -2.118   102.130 -12.321 1.00 42.94  ? 44  ILE E CD1 1 
ATOM   6778  N  N   . THR E  1 45  ? -7.397   101.777 -13.181 1.00 27.37  ? 45  THR E N   1 
ATOM   6779  C  CA  . THR E  1 45  ? -8.670   101.483 -13.870 1.00 31.51  ? 45  THR E CA  1 
ATOM   6780  C  C   . THR E  1 45  ? -9.656   102.652 -13.946 1.00 22.28  ? 45  THR E C   1 
ATOM   6781  O  O   . THR E  1 45  ? -10.647  102.573 -14.663 1.00 39.81  ? 45  THR E O   1 
ATOM   6782  C  CB  . THR E  1 45  ? -9.432   100.311 -13.214 1.00 32.01  ? 45  THR E CB  1 
ATOM   6783  O  OG1 . THR E  1 45  ? -9.897   100.703 -11.914 1.00 36.82  ? 45  THR E OG1 1 
ATOM   6784  C  CG2 . THR E  1 45  ? -8.543   99.060  -13.103 1.00 22.66  ? 45  THR E CG2 1 
ATOM   6785  N  N   . ASN E  1 46  ? -9.385   103.724 -13.210 1.00 24.19  ? 46  ASN E N   1 
ATOM   6786  C  CA  . ASN E  1 46  ? -10.274  104.876 -13.180 1.00 21.72  ? 46  ASN E CA  1 
ATOM   6787  C  C   . ASN E  1 46  ? -11.664  104.487 -12.692 1.00 22.78  ? 46  ASN E C   1 
ATOM   6788  O  O   . ASN E  1 46  ? -12.671  104.798 -13.321 1.00 21.45  ? 46  ASN E O   1 
ATOM   6789  C  CB  . ASN E  1 46  ? -10.361  105.543 -14.550 1.00 19.85  ? 46  ASN E CB  1 
ATOM   6790  C  CG  . ASN E  1 46  ? -9.491   106.781 -14.652 1.00 31.39  ? 46  ASN E CG  1 
ATOM   6791  O  OD1 . ASN E  1 46  ? -9.154   107.401 -13.644 1.00 36.26  ? 46  ASN E OD1 1 
ATOM   6792  N  ND2 . ASN E  1 46  ? -9.121   107.151 -15.870 1.00 21.43  ? 46  ASN E ND2 1 
ATOM   6793  N  N   . GLU E  1 47  ? -11.697  103.784 -11.568 1.00 27.93  ? 47  GLU E N   1 
ATOM   6794  C  CA  . GLU E  1 47  ? -12.939  103.323 -10.961 1.00 34.39  ? 47  GLU E CA  1 
ATOM   6795  C  C   . GLU E  1 47  ? -12.945  103.659 -9.465  1.00 32.59  ? 47  GLU E C   1 
ATOM   6796  O  O   . GLU E  1 47  ? -11.926  103.525 -8.781  1.00 39.00  ? 47  GLU E O   1 
ATOM   6797  C  CB  . GLU E  1 47  ? -13.121  101.815 -11.185 1.00 16.73  ? 47  GLU E CB  1 
ATOM   6798  C  CG  . GLU E  1 47  ? -13.078  101.409 -12.639 1.00 18.47  ? 47  GLU E CG  1 
ATOM   6799  C  CD  . GLU E  1 47  ? -13.135  99.904  -12.846 1.00 33.97  ? 47  GLU E CD  1 
ATOM   6800  O  OE1 . GLU E  1 47  ? -13.543  99.180  -11.915 1.00 27.39  ? 47  GLU E OE1 1 
ATOM   6801  O  OE2 . GLU E  1 47  ? -12.774  99.446  -13.954 1.00 39.02  ? 47  GLU E OE2 1 
ATOM   6802  N  N   . VAL E  1 48  ? -14.083  104.126 -8.969  1.00 22.02  ? 48  VAL E N   1 
ATOM   6803  C  CA  . VAL E  1 48  ? -14.197  104.469 -7.563  1.00 23.16  ? 48  VAL E CA  1 
ATOM   6804  C  C   . VAL E  1 48  ? -15.419  103.794 -6.976  1.00 31.02  ? 48  VAL E C   1 
ATOM   6805  O  O   . VAL E  1 48  ? -16.404  103.565 -7.663  1.00 26.03  ? 48  VAL E O   1 
ATOM   6806  C  CB  . VAL E  1 48  ? -14.334  105.992 -7.334  1.00 20.88  ? 48  VAL E CB  1 
ATOM   6807  C  CG1 . VAL E  1 48  ? -13.084  106.695 -7.765  1.00 40.28  ? 48  VAL E CG1 1 
ATOM   6808  C  CG2 . VAL E  1 48  ? -15.529  106.531 -8.083  1.00 29.55  ? 48  VAL E CG2 1 
ATOM   6809  N  N   . ASP E  1 49  ? -15.337  103.470 -5.696  1.00 38.31  ? 49  ASP E N   1 
ATOM   6810  C  CA  . ASP E  1 49  ? -16.445  102.881 -4.980  1.00 25.83  ? 49  ASP E CA  1 
ATOM   6811  C  C   . ASP E  1 49  ? -16.919  103.915 -3.970  1.00 23.20  ? 49  ASP E C   1 
ATOM   6812  O  O   . ASP E  1 49  ? -16.179  104.284 -3.054  1.00 35.23  ? 49  ASP E O   1 
ATOM   6813  C  CB  . ASP E  1 49  ? -15.980  101.607 -4.287  1.00 41.32  ? 49  ASP E CB  1 
ATOM   6814  C  CG  . ASP E  1 49  ? -17.121  100.678 -3.947  1.00 41.45  ? 49  ASP E CG  1 
ATOM   6815  O  OD1 . ASP E  1 49  ? -18.167  101.173 -3.474  1.00 54.82  ? 49  ASP E OD1 1 
ATOM   6816  O  OD2 . ASP E  1 49  ? -16.980  99.454  -4.148  1.00 43.10  ? 49  ASP E OD2 1 
ATOM   6817  N  N   . VAL E  1 50  ? -18.144  104.392 -4.154  1.00 12.26  ? 50  VAL E N   1 
ATOM   6818  C  CA  . VAL E  1 50  ? -18.672  105.500 -3.358  1.00 32.80  ? 50  VAL E CA  1 
ATOM   6819  C  C   . VAL E  1 50  ? -19.958  105.155 -2.609  1.00 32.65  ? 50  VAL E C   1 
ATOM   6820  O  O   . VAL E  1 50  ? -20.766  104.351 -3.078  1.00 36.41  ? 50  VAL E O   1 
ATOM   6821  C  CB  . VAL E  1 50  ? -18.935  106.733 -4.245  1.00 23.03  ? 50  VAL E CB  1 
ATOM   6822  C  CG1 . VAL E  1 50  ? -19.545  107.862 -3.428  1.00 35.05  ? 50  VAL E CG1 1 
ATOM   6823  C  CG2 . VAL E  1 50  ? -17.652  107.182 -4.864  1.00 22.91  ? 50  VAL E CG2 1 
ATOM   6824  N  N   . VAL E  1 51  ? -20.129  105.760 -1.436  1.00 14.72  ? 51  VAL E N   1 
ATOM   6825  C  CA  . VAL E  1 51  ? -21.387  105.670 -0.692  1.00 24.12  ? 51  VAL E CA  1 
ATOM   6826  C  C   . VAL E  1 51  ? -21.991  107.063 -0.498  1.00 25.62  ? 51  VAL E C   1 
ATOM   6827  O  O   . VAL E  1 51  ? -21.339  107.948 0.044   1.00 25.92  ? 51  VAL E O   1 
ATOM   6828  C  CB  . VAL E  1 51  ? -21.190  104.998 0.654   1.00 10.44  ? 51  VAL E CB  1 
ATOM   6829  C  CG1 . VAL E  1 51  ? -22.396  105.217 1.524   1.00 13.40  ? 51  VAL E CG1 1 
ATOM   6830  C  CG2 . VAL E  1 51  ? -20.955  103.530 0.450   1.00 17.05  ? 51  VAL E CG2 1 
ATOM   6831  N  N   . PHE E  1 52  ? -23.229  107.258 -0.946  1.00 18.16  ? 52  PHE E N   1 
ATOM   6832  C  CA  . PHE E  1 52  ? -23.861  108.571 -0.879  1.00 22.50  ? 52  PHE E CA  1 
ATOM   6833  C  C   . PHE E  1 52  ? -25.357  108.460 -0.626  1.00 15.60  ? 52  PHE E C   1 
ATOM   6834  O  O   . PHE E  1 52  ? -25.990  107.486 -1.025  1.00 8.83   ? 52  PHE E O   1 
ATOM   6835  C  CB  . PHE E  1 52  ? -23.658  109.301 -2.203  1.00 20.52  ? 52  PHE E CB  1 
ATOM   6836  C  CG  . PHE E  1 52  ? -24.135  108.523 -3.390  1.00 24.14  ? 52  PHE E CG  1 
ATOM   6837  C  CD1 . PHE E  1 52  ? -23.329  107.558 -3.959  1.00 17.37  ? 52  PHE E CD1 1 
ATOM   6838  C  CD2 . PHE E  1 52  ? -25.402  108.746 -3.928  1.00 27.65  ? 52  PHE E CD2 1 
ATOM   6839  C  CE1 . PHE E  1 52  ? -23.763  106.828 -5.053  1.00 30.82  ? 52  PHE E CE1 1 
ATOM   6840  C  CE2 . PHE E  1 52  ? -25.847  108.015 -5.018  1.00 22.18  ? 52  PHE E CE2 1 
ATOM   6841  C  CZ  . PHE E  1 52  ? -25.025  107.053 -5.581  1.00 28.92  ? 52  PHE E CZ  1 
ATOM   6842  N  N   . TRP E  1 53  ? -25.911  109.466 0.039   1.00 12.49  ? 53  TRP E N   1 
ATOM   6843  C  CA  . TRP E  1 53  ? -27.353  109.617 0.129   1.00 19.27  ? 53  TRP E CA  1 
ATOM   6844  C  C   . TRP E  1 53  ? -27.778  110.273 -1.167  1.00 24.18  ? 53  TRP E C   1 
ATOM   6845  O  O   . TRP E  1 53  ? -27.235  111.315 -1.529  1.00 28.72  ? 53  TRP E O   1 
ATOM   6846  C  CB  . TRP E  1 53  ? -27.748  110.517 1.296   1.00 12.53  ? 53  TRP E CB  1 
ATOM   6847  C  CG  . TRP E  1 53  ? -27.437  109.955 2.633   1.00 20.57  ? 53  TRP E CG  1 
ATOM   6848  C  CD1 . TRP E  1 53  ? -26.897  108.733 2.912   1.00 20.72  ? 53  TRP E CD1 1 
ATOM   6849  C  CD2 . TRP E  1 53  ? -27.642  110.599 3.889   1.00 20.72  ? 53  TRP E CD2 1 
ATOM   6850  N  NE1 . TRP E  1 53  ? -26.756  108.580 4.265   1.00 23.97  ? 53  TRP E NE1 1 
ATOM   6851  C  CE2 . TRP E  1 53  ? -27.211  109.710 4.887   1.00 16.13  ? 53  TRP E CE2 1 
ATOM   6852  C  CE3 . TRP E  1 53  ? -28.153  111.842 4.266   1.00 16.56  ? 53  TRP E CE3 1 
ATOM   6853  C  CZ2 . TRP E  1 53  ? -27.272  110.027 6.239   1.00 21.35  ? 53  TRP E CZ2 1 
ATOM   6854  C  CZ3 . TRP E  1 53  ? -28.210  112.152 5.606   1.00 16.35  ? 53  TRP E CZ3 1 
ATOM   6855  C  CH2 . TRP E  1 53  ? -27.773  111.251 6.576   1.00 20.83  ? 53  TRP E CH2 1 
ATOM   6856  N  N   . GLN E  1 54  ? -28.724  109.658 -1.873  1.00 16.44  ? 54  GLN E N   1 
ATOM   6857  C  CA  . GLN E  1 54  ? -29.267  110.246 -3.083  1.00 17.30  ? 54  GLN E CA  1 
ATOM   6858  C  C   . GLN E  1 54  ? -30.596  110.958 -2.794  1.00 30.08  ? 54  GLN E C   1 
ATOM   6859  O  O   . GLN E  1 54  ? -31.668  110.353 -2.831  1.00 28.10  ? 54  GLN E O   1 
ATOM   6860  C  CB  . GLN E  1 54  ? -29.427  109.188 -4.169  1.00 20.75  ? 54  GLN E CB  1 
ATOM   6861  C  CG  . GLN E  1 54  ? -29.802  109.786 -5.512  1.00 27.16  ? 54  GLN E CG  1 
ATOM   6862  C  CD  . GLN E  1 54  ? -29.796  108.769 -6.622  1.00 27.67  ? 54  GLN E CD  1 
ATOM   6863  O  OE1 . GLN E  1 54  ? -28.756  108.206 -6.963  1.00 33.21  ? 54  GLN E OE1 1 
ATOM   6864  N  NE2 . GLN E  1 54  ? -30.963  108.535 -7.206  1.00 39.54  ? 54  GLN E NE2 1 
ATOM   6865  N  N   . GLN E  1 55  ? -30.500  112.248 -2.485  1.00 29.65  ? 55  GLN E N   1 
ATOM   6866  C  CA  . GLN E  1 55  ? -31.649  113.049 -2.095  1.00 17.80  ? 55  GLN E CA  1 
ATOM   6867  C  C   . GLN E  1 55  ? -32.429  113.417 -3.340  1.00 27.67  ? 55  GLN E C   1 
ATOM   6868  O  O   . GLN E  1 55  ? -31.928  114.144 -4.198  1.00 31.73  ? 55  GLN E O   1 
ATOM   6869  C  CB  . GLN E  1 55  ? -31.184  114.311 -1.388  1.00 14.72  ? 55  GLN E CB  1 
ATOM   6870  C  CG  . GLN E  1 55  ? -32.279  115.082 -0.720  1.00 19.78  ? 55  GLN E CG  1 
ATOM   6871  C  CD  . GLN E  1 55  ? -31.864  116.498 -0.390  1.00 30.38  ? 55  GLN E CD  1 
ATOM   6872  O  OE1 . GLN E  1 55  ? -31.640  116.840 0.771   1.00 36.74  ? 55  GLN E OE1 1 
ATOM   6873  N  NE2 . GLN E  1 55  ? -31.749  117.329 -1.414  1.00 46.67  ? 55  GLN E NE2 1 
ATOM   6874  N  N   . THR E  1 56  ? -33.657  112.909 -3.426  1.00 28.53  ? 56  THR E N   1 
ATOM   6875  C  CA  . THR E  1 56  ? -34.525  113.102 -4.587  1.00 17.33  ? 56  THR E CA  1 
ATOM   6876  C  C   . THR E  1 56  ? -35.874  113.723 -4.178  1.00 20.71  ? 56  THR E C   1 
ATOM   6877  O  O   . THR E  1 56  ? -36.536  113.289 -3.230  1.00 14.75  ? 56  THR E O   1 
ATOM   6878  C  CB  . THR E  1 56  ? -34.776  111.755 -5.309  1.00 16.30  ? 56  THR E CB  1 
ATOM   6879  O  OG1 . THR E  1 56  ? -33.545  111.034 -5.437  1.00 24.71  ? 56  THR E OG1 1 
ATOM   6880  C  CG2 . THR E  1 56  ? -35.365  111.976 -6.676  1.00 12.43  ? 56  THR E CG2 1 
ATOM   6881  N  N   . THR E  1 57  ? -36.291  114.731 -4.915  1.00 17.83  ? 57  THR E N   1 
ATOM   6882  C  CA  . THR E  1 57  ? -37.450  115.504 -4.519  1.00 16.41  ? 57  THR E CA  1 
ATOM   6883  C  C   . THR E  1 57  ? -38.368  115.792 -5.704  1.00 27.97  ? 57  THR E C   1 
ATOM   6884  O  O   . THR E  1 57  ? -37.893  116.208 -6.760  1.00 29.10  ? 57  THR E O   1 
ATOM   6885  C  CB  . THR E  1 57  ? -36.990  116.819 -3.859  1.00 16.01  ? 57  THR E CB  1 
ATOM   6886  O  OG1 . THR E  1 57  ? -37.218  116.732 -2.455  1.00 23.96  ? 57  THR E OG1 1 
ATOM   6887  C  CG2 . THR E  1 57  ? -37.721  118.029 -4.432  1.00 25.20  ? 57  THR E CG2 1 
ATOM   6888  N  N   . TRP E  1 58  ? -39.672  115.567 -5.540  1.00 15.60  ? 58  TRP E N   1 
ATOM   6889  C  CA  . TRP E  1 58  ? -40.618  115.923 -6.596  1.00 18.62  ? 58  TRP E CA  1 
ATOM   6890  C  C   . TRP E  1 58  ? -42.042  116.068 -6.085  1.00 22.30  ? 58  TRP E C   1 
ATOM   6891  O  O   . TRP E  1 58  ? -42.333  115.809 -4.919  1.00 19.44  ? 58  TRP E O   1 
ATOM   6892  C  CB  . TRP E  1 58  ? -40.571  114.905 -7.746  1.00 11.82  ? 58  TRP E CB  1 
ATOM   6893  C  CG  . TRP E  1 58  ? -41.123  113.582 -7.361  1.00 21.75  ? 58  TRP E CG  1 
ATOM   6894  C  CD1 . TRP E  1 58  ? -42.415  113.151 -7.515  1.00 23.28  ? 58  TRP E CD1 1 
ATOM   6895  C  CD2 . TRP E  1 58  ? -40.415  112.509 -6.728  1.00 19.55  ? 58  TRP E CD2 1 
ATOM   6896  N  NE1 . TRP E  1 58  ? -42.546  111.872 -7.027  1.00 24.87  ? 58  TRP E NE1 1 
ATOM   6897  C  CE2 . TRP E  1 58  ? -41.333  111.453 -6.543  1.00 20.92  ? 58  TRP E CE2 1 
ATOM   6898  C  CE3 . TRP E  1 58  ? -39.101  112.336 -6.310  1.00 9.66   ? 58  TRP E CE3 1 
ATOM   6899  C  CZ2 . TRP E  1 58  ? -40.971  110.247 -5.950  1.00 14.94  ? 58  TRP E CZ2 1 
ATOM   6900  C  CZ3 . TRP E  1 58  ? -38.743  111.135 -5.731  1.00 20.59  ? 58  TRP E CZ3 1 
ATOM   6901  C  CH2 . TRP E  1 58  ? -39.671  110.109 -5.553  1.00 21.77  ? 58  TRP E CH2 1 
ATOM   6902  N  N   . SER E  1 59  ? -42.936  116.469 -6.983  1.00 39.05  ? 59  SER E N   1 
ATOM   6903  C  CA  . SER E  1 59  ? -44.342  116.651 -6.639  1.00 25.30  ? 59  SER E CA  1 
ATOM   6904  C  C   . SER E  1 59  ? -45.227  115.637 -7.353  1.00 16.90  ? 59  SER E C   1 
ATOM   6905  O  O   . SER E  1 59  ? -45.175  115.526 -8.574  1.00 34.87  ? 59  SER E O   1 
ATOM   6906  C  CB  . SER E  1 59  ? -44.781  118.074 -6.990  1.00 14.49  ? 59  SER E CB  1 
ATOM   6907  O  OG  . SER E  1 59  ? -45.927  118.426 -6.242  1.00 69.00  ? 59  SER E OG  1 
ATOM   6908  N  N   . ASP E  1 60  ? -46.027  114.901 -6.589  1.00 18.21  ? 60  ASP E N   1 
ATOM   6909  C  CA  . ASP E  1 60  ? -47.105  114.071 -7.140  1.00 16.62  ? 60  ASP E CA  1 
ATOM   6910  C  C   . ASP E  1 60  ? -48.436  114.474 -6.483  1.00 25.01  ? 60  ASP E C   1 
ATOM   6911  O  O   . ASP E  1 60  ? -48.795  113.970 -5.415  1.00 27.28  ? 60  ASP E O   1 
ATOM   6912  C  CB  . ASP E  1 60  ? -46.816  112.577 -6.921  1.00 11.60  ? 60  ASP E CB  1 
ATOM   6913  C  CG  . ASP E  1 60  ? -47.790  111.664 -7.658  1.00 37.19  ? 60  ASP E CG  1 
ATOM   6914  O  OD1 . ASP E  1 60  ? -48.868  112.130 -8.099  1.00 28.07  ? 60  ASP E OD1 1 
ATOM   6915  O  OD2 . ASP E  1 60  ? -47.474  110.462 -7.792  1.00 38.85  ? 60  ASP E OD2 1 
ATOM   6916  N  N   . ARG E  1 61  ? -49.166  115.384 -7.123  1.00 34.79  ? 61  ARG E N   1 
ATOM   6917  C  CA  . ARG E  1 61  ? -50.417  115.903 -6.556  1.00 35.45  ? 61  ARG E CA  1 
ATOM   6918  C  C   . ARG E  1 61  ? -51.449  114.822 -6.250  1.00 26.72  ? 61  ARG E C   1 
ATOM   6919  O  O   . ARG E  1 61  ? -52.315  115.004 -5.396  1.00 30.45  ? 61  ARG E O   1 
ATOM   6920  C  CB  . ARG E  1 61  ? -51.037  116.954 -7.472  1.00 34.01  ? 61  ARG E CB  1 
ATOM   6921  C  CG  . ARG E  1 61  ? -50.152  118.171 -7.687  1.00 66.87  ? 61  ARG E CG  1 
ATOM   6922  C  CD  . ARG E  1 61  ? -49.853  118.902 -6.379  1.00 77.20  ? 61  ARG E CD  1 
ATOM   6923  N  NE  . ARG E  1 61  ? -48.783  119.890 -6.534  1.00 88.61  ? 61  ARG E NE  1 
ATOM   6924  C  CZ  . ARG E  1 61  ? -48.979  121.171 -6.833  1.00 94.05  ? 61  ARG E CZ  1 
ATOM   6925  N  NH1 . ARG E  1 61  ? -50.213  121.637 -7.008  1.00 98.49  ? 61  ARG E NH1 1 
ATOM   6926  N  NH2 . ARG E  1 61  ? -47.940  121.989 -6.952  1.00 80.83  ? 61  ARG E NH2 1 
ATOM   6927  N  N   . THR E  1 62  ? -51.358  113.693 -6.939  1.00 24.95  ? 62  THR E N   1 
ATOM   6928  C  CA  . THR E  1 62  ? -52.342  112.634 -6.756  1.00 19.88  ? 62  THR E CA  1 
ATOM   6929  C  C   . THR E  1 62  ? -52.207  111.955 -5.396  1.00 34.50  ? 62  THR E C   1 
ATOM   6930  O  O   . THR E  1 62  ? -52.988  111.059 -5.067  1.00 36.38  ? 62  THR E O   1 
ATOM   6931  C  CB  . THR E  1 62  ? -52.254  111.561 -7.868  1.00 21.74  ? 62  THR E CB  1 
ATOM   6932  O  OG1 . THR E  1 62  ? -51.247  110.599 -7.545  1.00 21.53  ? 62  THR E OG1 1 
ATOM   6933  C  CG2 . THR E  1 62  ? -51.941  112.189 -9.218  1.00 18.84  ? 62  THR E CG2 1 
ATOM   6934  N  N   . LEU E  1 63  ? -51.213  112.366 -4.609  1.00 33.71  ? 63  LEU E N   1 
ATOM   6935  C  CA  . LEU E  1 63  ? -51.012  111.788 -3.280  1.00 21.88  ? 63  LEU E CA  1 
ATOM   6936  C  C   . LEU E  1 63  ? -51.584  112.678 -2.188  1.00 20.06  ? 63  LEU E C   1 
ATOM   6937  O  O   . LEU E  1 63  ? -51.765  112.240 -1.059  1.00 30.31  ? 63  LEU E O   1 
ATOM   6938  C  CB  . LEU E  1 63  ? -49.521  111.544 -3.020  1.00 24.55  ? 63  LEU E CB  1 
ATOM   6939  C  CG  . LEU E  1 63  ? -48.767  110.637 -3.989  1.00 22.62  ? 63  LEU E CG  1 
ATOM   6940  C  CD1 . LEU E  1 63  ? -47.314  110.736 -3.706  1.00 11.02  ? 63  LEU E CD1 1 
ATOM   6941  C  CD2 . LEU E  1 63  ? -49.233  109.201 -3.878  1.00 17.70  ? 63  LEU E CD2 1 
ATOM   6942  N  N   . ALA E  1 64  ? -51.880  113.926 -2.538  1.00 20.79  ? 64  ALA E N   1 
ATOM   6943  C  CA  . ALA E  1 64  ? -52.296  114.943 -1.572  1.00 30.33  ? 64  ALA E CA  1 
ATOM   6944  C  C   . ALA E  1 64  ? -53.574  114.593 -0.802  1.00 26.00  ? 64  ALA E C   1 
ATOM   6945  O  O   . ALA E  1 64  ? -54.390  113.810 -1.265  1.00 23.58  ? 64  ALA E O   1 
ATOM   6946  C  CB  . ALA E  1 64  ? -52.443  116.303 -2.262  1.00 16.40  ? 64  ALA E CB  1 
ATOM   6947  N  N   . TRP E  1 65  ? -53.729  115.191 0.376   1.00 31.35  ? 65  TRP E N   1 
ATOM   6948  C  CA  . TRP E  1 65  ? -54.909  114.994 1.216   1.00 27.78  ? 65  TRP E CA  1 
ATOM   6949  C  C   . TRP E  1 65  ? -55.172  116.212 2.103   1.00 32.58  ? 65  TRP E C   1 
ATOM   6950  O  O   . TRP E  1 65  ? -54.260  116.997 2.398   1.00 30.43  ? 65  TRP E O   1 
ATOM   6951  C  CB  . TRP E  1 65  ? -54.767  113.725 2.077   1.00 26.79  ? 65  TRP E CB  1 
ATOM   6952  C  CG  . TRP E  1 65  ? -53.715  113.800 3.166   1.00 28.06  ? 65  TRP E CG  1 
ATOM   6953  C  CD1 . TRP E  1 65  ? -53.886  114.265 4.428   1.00 30.14  ? 65  TRP E CD1 1 
ATOM   6954  C  CD2 . TRP E  1 65  ? -52.345  113.387 3.077   1.00 35.82  ? 65  TRP E CD2 1 
ATOM   6955  N  NE1 . TRP E  1 65  ? -52.713  114.173 5.140   1.00 22.75  ? 65  TRP E NE1 1 
ATOM   6956  C  CE2 . TRP E  1 65  ? -51.749  113.640 4.329   1.00 35.63  ? 65  TRP E CE2 1 
ATOM   6957  C  CE3 . TRP E  1 65  ? -51.559  112.840 2.057   1.00 26.30  ? 65  TRP E CE3 1 
ATOM   6958  C  CZ2 . TRP E  1 65  ? -50.411  113.361 4.587   1.00 26.24  ? 65  TRP E CZ2 1 
ATOM   6959  C  CZ3 . TRP E  1 65  ? -50.230  112.561 2.319   1.00 18.08  ? 65  TRP E CZ3 1 
ATOM   6960  C  CH2 . TRP E  1 65  ? -49.673  112.820 3.567   1.00 27.90  ? 65  TRP E CH2 1 
ATOM   6961  N  N   . ASN E  1 66  ? -56.426  116.371 2.514   1.00 38.55  ? 66  ASN E N   1 
ATOM   6962  C  CA  . ASN E  1 66  ? -56.809  117.468 3.395   1.00 48.13  ? 66  ASN E CA  1 
ATOM   6963  C  C   . ASN E  1 66  ? -56.308  117.207 4.805   1.00 45.89  ? 66  ASN E C   1 
ATOM   6964  O  O   . ASN E  1 66  ? -56.860  116.364 5.503   1.00 51.80  ? 66  ASN E O   1 
ATOM   6965  C  CB  . ASN E  1 66  ? -58.333  117.658 3.400   1.00 39.46  ? 66  ASN E CB  1 
ATOM   6966  C  CG  . ASN E  1 66  ? -58.774  118.896 4.186   1.00 62.20  ? 66  ASN E CG  1 
ATOM   6967  O  OD1 . ASN E  1 66  ? -58.007  119.422 4.994   1.00 68.39  ? 66  ASN E OD1 1 
ATOM   6968  N  ND2 . ASN E  1 66  ? -60.017  119.358 3.957   1.00 59.55  ? 66  ASN E ND2 1 
ATOM   6969  N  N   . HIS E  1 69  ? -57.163  118.206 10.001  1.00 41.65  ? 69  HIS E N   1 
ATOM   6970  C  CA  . HIS E  1 69  ? -57.101  117.498 11.280  1.00 58.72  ? 69  HIS E CA  1 
ATOM   6971  C  C   . HIS E  1 69  ? -56.484  116.127 11.086  1.00 62.93  ? 69  HIS E C   1 
ATOM   6972  O  O   . HIS E  1 69  ? -57.026  115.112 11.529  1.00 69.01  ? 69  HIS E O   1 
ATOM   6973  C  CB  . HIS E  1 69  ? -58.497  117.335 11.895  1.00 73.40  ? 69  HIS E CB  1 
ATOM   6974  C  CG  . HIS E  1 69  ? -59.179  118.632 12.207  1.00 86.52  ? 69  HIS E CG  1 
ATOM   6975  N  ND1 . HIS E  1 69  ? -60.496  118.703 12.603  1.00 89.76  ? 69  HIS E ND1 1 
ATOM   6976  C  CD2 . HIS E  1 69  ? -58.724  119.907 12.180  1.00 90.03  ? 69  HIS E CD2 1 
ATOM   6977  C  CE1 . HIS E  1 69  ? -60.824  119.966 12.807  1.00 96.45  ? 69  HIS E CE1 1 
ATOM   6978  N  NE2 . HIS E  1 69  ? -59.767  120.716 12.555  1.00 92.05  ? 69  HIS E NE2 1 
ATOM   6979  N  N   . SER E  1 70  ? -55.342  116.103 10.418  1.00 59.39  ? 70  SER E N   1 
ATOM   6980  C  CA  . SER E  1 70  ? -54.707  114.847 10.072  1.00 53.20  ? 70  SER E CA  1 
ATOM   6981  C  C   . SER E  1 70  ? -53.206  115.020 10.126  1.00 36.47  ? 70  SER E C   1 
ATOM   6982  O  O   . SER E  1 70  ? -52.724  116.143 10.220  1.00 35.10  ? 70  SER E O   1 
ATOM   6983  C  CB  . SER E  1 70  ? -55.153  114.423 8.674   1.00 68.23  ? 70  SER E CB  1 
ATOM   6984  O  OG  . SER E  1 70  ? -56.569  114.488 8.559   1.00 77.16  ? 70  SER E OG  1 
ATOM   6985  N  N   . PRO E  1 71  ? -52.460  113.908 10.102  1.00 38.08  ? 71  PRO E N   1 
ATOM   6986  C  CA  . PRO E  1 71  ? -51.002  114.008 10.022  1.00 29.93  ? 71  PRO E CA  1 
ATOM   6987  C  C   . PRO E  1 71  ? -50.568  114.725 8.743   1.00 35.91  ? 71  PRO E C   1 
ATOM   6988  O  O   . PRO E  1 71  ? -51.227  114.592 7.703   1.00 48.49  ? 71  PRO E O   1 
ATOM   6989  C  CB  . PRO E  1 71  ? -50.562  112.546 9.998   1.00 38.15  ? 71  PRO E CB  1 
ATOM   6990  C  CG  . PRO E  1 71  ? -51.636  111.835 10.742  1.00 36.29  ? 71  PRO E CG  1 
ATOM   6991  C  CD  . PRO E  1 71  ? -52.902  112.523 10.329  1.00 35.58  ? 71  PRO E CD  1 
ATOM   6992  N  N   . ASP E  1 72  ? -49.478  115.483 8.839   1.00 33.49  ? 72  ASP E N   1 
ATOM   6993  C  CA  . ASP E  1 72  ? -48.963  116.273 7.734   1.00 31.98  ? 72  ASP E CA  1 
ATOM   6994  C  C   . ASP E  1 72  ? -48.089  115.427 6.798   1.00 38.76  ? 72  ASP E C   1 
ATOM   6995  O  O   . ASP E  1 72  ? -47.938  115.750 5.617   1.00 35.68  ? 72  ASP E O   1 
ATOM   6996  C  CB  . ASP E  1 72  ? -48.166  117.451 8.284   1.00 25.62  ? 72  ASP E CB  1 
ATOM   6997  C  CG  . ASP E  1 72  ? -47.925  118.522 7.248   1.00 60.68  ? 72  ASP E CG  1 
ATOM   6998  O  OD1 . ASP E  1 72  ? -48.892  118.933 6.577   1.00 55.56  ? 72  ASP E OD1 1 
ATOM   6999  O  OD2 . ASP E  1 72  ? -46.764  118.949 7.096   1.00 75.35  ? 72  ASP E OD2 1 
ATOM   7000  N  N   . GLN E  1 73  ? -47.522  114.343 7.327   1.00 30.06  ? 73  GLN E N   1 
ATOM   7001  C  CA  . GLN E  1 73  ? -46.629  113.493 6.552   1.00 18.34  ? 73  GLN E CA  1 
ATOM   7002  C  C   . GLN E  1 73  ? -46.753  112.035 6.917   1.00 21.07  ? 73  GLN E C   1 
ATOM   7003  O  O   . GLN E  1 73  ? -47.104  111.691 8.042   1.00 34.00  ? 73  GLN E O   1 
ATOM   7004  C  CB  . GLN E  1 73  ? -45.175  113.893 6.768   1.00 16.10  ? 73  GLN E CB  1 
ATOM   7005  C  CG  . GLN E  1 73  ? -44.826  115.299 6.378   1.00 20.87  ? 73  GLN E CG  1 
ATOM   7006  C  CD  . GLN E  1 73  ? -43.353  115.567 6.557   1.00 29.77  ? 73  GLN E CD  1 
ATOM   7007  O  OE1 . GLN E  1 73  ? -42.550  114.643 6.768   1.00 32.93  ? 73  GLN E OE1 1 
ATOM   7008  N  NE2 . GLN E  1 73  ? -42.982  116.833 6.484   1.00 30.96  ? 73  GLN E NE2 1 
ATOM   7009  N  N   . VAL E  1 74  ? -46.437  111.181 5.955   1.00 12.84  ? 74  VAL E N   1 
ATOM   7010  C  CA  . VAL E  1 74  ? -46.290  109.759 6.213   1.00 13.52  ? 74  VAL E CA  1 
ATOM   7011  C  C   . VAL E  1 74  ? -45.080  109.190 5.489   1.00 13.98  ? 74  VAL E C   1 
ATOM   7012  O  O   . VAL E  1 74  ? -44.566  109.792 4.550   1.00 16.00  ? 74  VAL E O   1 
ATOM   7013  C  CB  . VAL E  1 74  ? -47.524  108.970 5.764   1.00 15.93  ? 74  VAL E CB  1 
ATOM   7014  C  CG1 . VAL E  1 74  ? -48.684  109.275 6.674   1.00 12.55  ? 74  VAL E CG1 1 
ATOM   7015  C  CG2 . VAL E  1 74  ? -47.858  109.293 4.319   1.00 12.44  ? 74  VAL E CG2 1 
ATOM   7016  N  N   . SER E  1 75  ? -44.630  108.028 5.942   1.00 18.33  ? 75  SER E N   1 
ATOM   7017  C  CA  . SER E  1 75  ? -43.578  107.302 5.251   1.00 16.02  ? 75  SER E CA  1 
ATOM   7018  C  C   . SER E  1 75  ? -44.219  106.202 4.430   1.00 10.41  ? 75  SER E C   1 
ATOM   7019  O  O   . SER E  1 75  ? -45.069  105.463 4.909   1.00 19.67  ? 75  SER E O   1 
ATOM   7020  C  CB  . SER E  1 75  ? -42.550  106.734 6.233   1.00 20.98  ? 75  SER E CB  1 
ATOM   7021  O  OG  . SER E  1 75  ? -41.808  107.775 6.851   1.00 19.91  ? 75  SER E OG  1 
ATOM   7022  N  N   . VAL E  1 76  ? -43.815  106.110 3.173   1.00 18.24  ? 76  VAL E N   1 
ATOM   7023  C  CA  . VAL E  1 76  ? -44.478  105.238 2.223   1.00 12.39  ? 76  VAL E CA  1 
ATOM   7024  C  C   . VAL E  1 76  ? -43.461  104.425 1.457   1.00 11.79  ? 76  VAL E C   1 
ATOM   7025  O  O   . VAL E  1 76  ? -42.513  104.973 0.906   1.00 24.48  ? 76  VAL E O   1 
ATOM   7026  C  CB  . VAL E  1 76  ? -45.313  106.061 1.196   1.00 23.67  ? 76  VAL E CB  1 
ATOM   7027  C  CG1 . VAL E  1 76  ? -46.074  105.150 0.240   1.00 20.17  ? 76  VAL E CG1 1 
ATOM   7028  C  CG2 . VAL E  1 76  ? -46.270  106.990 1.900   1.00 14.13  ? 76  VAL E CG2 1 
ATOM   7029  N  N   . PRO E  1 77  ? -43.672  103.112 1.393   1.00 20.08  ? 77  PRO E N   1 
ATOM   7030  C  CA  . PRO E  1 77  ? -42.869  102.218 0.556   1.00 15.90  ? 77  PRO E CA  1 
ATOM   7031  C  C   . PRO E  1 77  ? -42.824  102.739 -0.879  1.00 24.78  ? 77  PRO E C   1 
ATOM   7032  O  O   . PRO E  1 77  ? -43.893  102.939 -1.468  1.00 23.11  ? 77  PRO E O   1 
ATOM   7033  C  CB  . PRO E  1 77  ? -43.669  100.913 0.597   1.00 7.33   ? 77  PRO E CB  1 
ATOM   7034  C  CG  . PRO E  1 77  ? -44.398  100.964 1.857   1.00 17.56  ? 77  PRO E CG  1 
ATOM   7035  C  CD  . PRO E  1 77  ? -44.755  102.400 2.083   1.00 17.28  ? 77  PRO E CD  1 
ATOM   7036  N  N   . ILE E  1 78  ? -41.634  102.939 -1.449  1.00 18.80  ? 78  ILE E N   1 
ATOM   7037  C  CA  . ILE E  1 78  ? -41.570  103.513 -2.800  1.00 28.66  ? 78  ILE E CA  1 
ATOM   7038  C  C   . ILE E  1 78  ? -42.235  102.649 -3.868  1.00 21.31  ? 78  ILE E C   1 
ATOM   7039  O  O   . ILE E  1 78  ? -42.603  103.133 -4.933  1.00 33.84  ? 78  ILE E O   1 
ATOM   7040  C  CB  . ILE E  1 78  ? -40.142  103.823 -3.240  1.00 17.39  ? 78  ILE E CB  1 
ATOM   7041  C  CG1 . ILE E  1 78  ? -39.284  102.579 -3.091  1.00 26.60  ? 78  ILE E CG1 1 
ATOM   7042  C  CG2 . ILE E  1 78  ? -39.598  105.015 -2.465  1.00 7.27   ? 78  ILE E CG2 1 
ATOM   7043  C  CD1 . ILE E  1 78  ? -38.045  102.615 -3.937  1.00 22.78  ? 78  ILE E CD1 1 
ATOM   7044  N  N   . SER E  1 79  ? -42.379  101.366 -3.580  1.00 20.46  ? 79  SER E N   1 
ATOM   7045  C  CA  . SER E  1 79  ? -43.125  100.475 -4.455  1.00 23.80  ? 79  SER E CA  1 
ATOM   7046  C  C   . SER E  1 79  ? -44.577  100.911 -4.624  1.00 24.47  ? 79  SER E C   1 
ATOM   7047  O  O   . SER E  1 79  ? -45.244  100.458 -5.544  1.00 21.50  ? 79  SER E O   1 
ATOM   7048  C  CB  . SER E  1 79  ? -43.062  99.038  -3.935  1.00 19.18  ? 79  SER E CB  1 
ATOM   7049  O  OG  . SER E  1 79  ? -43.288  99.010  -2.538  1.00 40.64  ? 79  SER E OG  1 
ATOM   7050  N  N   . SER E  1 80  ? -45.053  101.783 -3.736  1.00 18.45  ? 80  SER E N   1 
ATOM   7051  C  CA  . SER E  1 80  ? -46.414  102.311 -3.816  1.00 21.45  ? 80  SER E CA  1 
ATOM   7052  C  C   . SER E  1 80  ? -46.456  103.701 -4.445  1.00 32.32  ? 80  SER E C   1 
ATOM   7053  O  O   . SER E  1 80  ? -47.520  104.292 -4.550  1.00 38.64  ? 80  SER E O   1 
ATOM   7054  C  CB  . SER E  1 80  ? -47.080  102.376 -2.429  1.00 9.56   ? 80  SER E CB  1 
ATOM   7055  O  OG  . SER E  1 80  ? -47.167  101.103 -1.809  1.00 22.36  ? 80  SER E OG  1 
ATOM   7056  N  N   . LEU E  1 81  ? -45.307  104.231 -4.851  1.00 31.57  ? 81  LEU E N   1 
ATOM   7057  C  CA  . LEU E  1 81  ? -45.261  105.569 -5.448  1.00 22.10  ? 81  LEU E CA  1 
ATOM   7058  C  C   . LEU E  1 81  ? -44.654  105.546 -6.828  1.00 20.80  ? 81  LEU E C   1 
ATOM   7059  O  O   . LEU E  1 81  ? -43.858  104.674 -7.166  1.00 17.62  ? 81  LEU E O   1 
ATOM   7060  C  CB  . LEU E  1 81  ? -44.421  106.536 -4.612  1.00 21.83  ? 81  LEU E CB  1 
ATOM   7061  C  CG  . LEU E  1 81  ? -44.790  106.728 -3.154  1.00 29.94  ? 81  LEU E CG  1 
ATOM   7062  C  CD1 . LEU E  1 81  ? -43.808  107.652 -2.500  1.00 22.74  ? 81  LEU E CD1 1 
ATOM   7063  C  CD2 . LEU E  1 81  ? -46.194  107.260 -3.065  1.00 35.38  ? 81  LEU E CD2 1 
ATOM   7064  N  N   . TRP E  1 82  ? -45.029  106.525 -7.634  1.00 27.12  ? 82  TRP E N   1 
ATOM   7065  C  CA  . TRP E  1 82  ? -44.272  106.761 -8.832  1.00 26.97  ? 82  TRP E CA  1 
ATOM   7066  C  C   . TRP E  1 82  ? -42.942  107.359 -8.396  1.00 27.52  ? 82  TRP E C   1 
ATOM   7067  O  O   . TRP E  1 82  ? -42.893  108.252 -7.546  1.00 26.11  ? 82  TRP E O   1 
ATOM   7068  C  CB  . TRP E  1 82  ? -44.983  107.715 -9.782  1.00 11.54  ? 82  TRP E CB  1 
ATOM   7069  C  CG  . TRP E  1 82  ? -44.095  108.078 -10.972 1.00 37.56  ? 82  TRP E CG  1 
ATOM   7070  C  CD1 . TRP E  1 82  ? -43.976  107.389 -12.150 1.00 23.10  ? 82  TRP E CD1 1 
ATOM   7071  C  CD2 . TRP E  1 82  ? -43.193  109.195 -11.073 1.00 28.66  ? 82  TRP E CD2 1 
ATOM   7072  N  NE1 . TRP E  1 82  ? -43.086  108.021 -12.979 1.00 25.76  ? 82  TRP E NE1 1 
ATOM   7073  C  CE2 . TRP E  1 82  ? -42.590  109.131 -12.344 1.00 28.76  ? 82  TRP E CE2 1 
ATOM   7074  C  CE3 . TRP E  1 82  ? -42.849  110.248 -10.216 1.00 26.58  ? 82  TRP E CE3 1 
ATOM   7075  C  CZ2 . TRP E  1 82  ? -41.666  110.085 -12.783 1.00 23.74  ? 82  TRP E CZ2 1 
ATOM   7076  C  CZ3 . TRP E  1 82  ? -41.940  111.197 -10.655 1.00 16.58  ? 82  TRP E CZ3 1 
ATOM   7077  C  CH2 . TRP E  1 82  ? -41.363  111.110 -11.928 1.00 25.47  ? 82  TRP E CH2 1 
ATOM   7078  N  N   . VAL E  1 83  ? -41.869  106.854 -8.987  1.00 27.65  ? 83  VAL E N   1 
ATOM   7079  C  CA  . VAL E  1 83  ? -40.530  107.353 -8.723  1.00 24.36  ? 83  VAL E CA  1 
ATOM   7080  C  C   . VAL E  1 83  ? -39.844  107.676 -10.042 1.00 14.85  ? 83  VAL E C   1 
ATOM   7081  O  O   . VAL E  1 83  ? -39.983  106.934 -11.008 1.00 22.54  ? 83  VAL E O   1 
ATOM   7082  C  CB  . VAL E  1 83  ? -39.708  106.316 -7.969  1.00 23.01  ? 83  VAL E CB  1 
ATOM   7083  C  CG1 . VAL E  1 83  ? -38.281  106.786 -7.848  1.00 46.28  ? 83  VAL E CG1 1 
ATOM   7084  C  CG2 . VAL E  1 83  ? -40.308  106.080 -6.596  1.00 17.41  ? 83  VAL E CG2 1 
ATOM   7085  N  N   . PRO E  1 84  ? -39.113  108.793 -10.098 1.00 8.11   ? 84  PRO E N   1 
ATOM   7086  C  CA  . PRO E  1 84  ? -38.415  109.104 -11.353 1.00 8.14   ? 84  PRO E CA  1 
ATOM   7087  C  C   . PRO E  1 84  ? -37.344  108.056 -11.671 1.00 20.28  ? 84  PRO E C   1 
ATOM   7088  O  O   . PRO E  1 84  ? -36.658  107.583 -10.759 1.00 14.97  ? 84  PRO E O   1 
ATOM   7089  C  CB  . PRO E  1 84  ? -37.815  110.492 -11.102 1.00 8.59   ? 84  PRO E CB  1 
ATOM   7090  C  CG  . PRO E  1 84  ? -37.764  110.621 -9.628  1.00 15.20  ? 84  PRO E CG  1 
ATOM   7091  C  CD  . PRO E  1 84  ? -38.910  109.826 -9.071  1.00 8.83   ? 84  PRO E CD  1 
ATOM   7092  N  N   . ASP E  1 85  ? -37.237  107.674 -12.946 1.00 18.67  ? 85  ASP E N   1 
ATOM   7093  C  CA  . ASP E  1 85  ? -36.319  106.609 -13.383 1.00 11.20  ? 85  ASP E CA  1 
ATOM   7094  C  C   . ASP E  1 85  ? -34.905  107.142 -13.550 1.00 15.60  ? 85  ASP E C   1 
ATOM   7095  O  O   . ASP E  1 85  ? -34.329  107.072 -14.649 1.00 15.43  ? 85  ASP E O   1 
ATOM   7096  C  CB  . ASP E  1 85  ? -36.804  106.005 -14.711 1.00 9.24   ? 85  ASP E CB  1 
ATOM   7097  C  CG  . ASP E  1 85  ? -36.861  107.040 -15.838 1.00 31.89  ? 85  ASP E CG  1 
ATOM   7098  O  OD1 . ASP E  1 85  ? -37.123  108.244 -15.541 1.00 17.95  ? 85  ASP E OD1 1 
ATOM   7099  O  OD2 . ASP E  1 85  ? -36.640  106.649 -17.012 1.00 15.70  ? 85  ASP E OD2 1 
ATOM   7100  N  N   . LEU E  1 86  ? -34.369  107.708 -12.467 1.00 7.35   ? 86  LEU E N   1 
ATOM   7101  C  CA  . LEU E  1 86  ? -33.016  108.254 -12.466 1.00 15.75  ? 86  LEU E CA  1 
ATOM   7102  C  C   . LEU E  1 86  ? -31.996  107.135 -12.545 1.00 16.34  ? 86  LEU E C   1 
ATOM   7103  O  O   . LEU E  1 86  ? -32.172  106.078 -11.947 1.00 7.50   ? 86  LEU E O   1 
ATOM   7104  C  CB  . LEU E  1 86  ? -32.762  109.101 -11.229 1.00 14.93  ? 86  LEU E CB  1 
ATOM   7105  C  CG  . LEU E  1 86  ? -33.705  110.290 -11.031 1.00 19.25  ? 86  LEU E CG  1 
ATOM   7106  C  CD1 . LEU E  1 86  ? -33.247  111.098 -9.832  1.00 13.96  ? 86  LEU E CD1 1 
ATOM   7107  C  CD2 . LEU E  1 86  ? -33.750  111.160 -12.262 1.00 9.28   ? 86  LEU E CD2 1 
ATOM   7108  N  N   . ALA E  1 87  ? -30.951  107.363 -13.326 1.00 16.65  ? 87  ALA E N   1 
ATOM   7109  C  CA  . ALA E  1 87  ? -29.823  106.450 -13.372 1.00 19.08  ? 87  ALA E CA  1 
ATOM   7110  C  C   . ALA E  1 87  ? -28.522  107.229 -13.452 1.00 15.37  ? 87  ALA E C   1 
ATOM   7111  O  O   . ALA E  1 87  ? -28.488  108.352 -13.950 1.00 22.61  ? 87  ALA E O   1 
ATOM   7112  C  CB  . ALA E  1 87  ? -29.956  105.505 -14.538 1.00 18.66  ? 87  ALA E CB  1 
ATOM   7113  N  N   . ALA E  1 88  ? -27.459  106.637 -12.930 1.00 10.73  ? 88  ALA E N   1 
ATOM   7114  C  CA  . ALA E  1 88  ? -26.129  107.204 -13.072 1.00 10.64  ? 88  ALA E CA  1 
ATOM   7115  C  C   . ALA E  1 88  ? -25.528  106.653 -14.354 1.00 9.20   ? 88  ALA E C   1 
ATOM   7116  O  O   . ALA E  1 88  ? -25.310  105.440 -14.478 1.00 13.28  ? 88  ALA E O   1 
ATOM   7117  C  CB  . ALA E  1 88  ? -25.269  106.840 -11.875 1.00 13.39  ? 88  ALA E CB  1 
ATOM   7118  N  N   . TYR E  1 89  ? -25.264  107.548 -15.299 1.00 11.58  ? 89  TYR E N   1 
ATOM   7119  C  CA  . TYR E  1 89  ? -24.746  107.155 -16.608 1.00 19.83  ? 89  TYR E CA  1 
ATOM   7120  C  C   . TYR E  1 89  ? -23.429  106.394 -16.532 1.00 22.38  ? 89  TYR E C   1 
ATOM   7121  O  O   . TYR E  1 89  ? -23.238  105.405 -17.247 1.00 23.17  ? 89  TYR E O   1 
ATOM   7122  C  CB  . TYR E  1 89  ? -24.614  108.365 -17.527 1.00 8.34   ? 89  TYR E CB  1 
ATOM   7123  C  CG  . TYR E  1 89  ? -25.936  108.798 -18.129 1.00 30.27  ? 89  TYR E CG  1 
ATOM   7124  C  CD1 . TYR E  1 89  ? -26.941  109.340 -17.334 1.00 15.78  ? 89  TYR E CD1 1 
ATOM   7125  C  CD2 . TYR E  1 89  ? -26.183  108.662 -19.486 1.00 8.28   ? 89  TYR E CD2 1 
ATOM   7126  C  CE1 . TYR E  1 89  ? -28.146  109.734 -17.872 1.00 19.42  ? 89  TYR E CE1 1 
ATOM   7127  C  CE2 . TYR E  1 89  ? -27.389  109.068 -20.039 1.00 34.52  ? 89  TYR E CE2 1 
ATOM   7128  C  CZ  . TYR E  1 89  ? -28.372  109.600 -19.230 1.00 32.07  ? 89  TYR E CZ  1 
ATOM   7129  O  OH  . TYR E  1 89  ? -29.584  109.998 -19.785 1.00 15.35  ? 89  TYR E OH  1 
ATOM   7130  N  N   . ASN E  1 90  ? -22.532  106.834 -15.654 1.00 21.21  ? 90  ASN E N   1 
ATOM   7131  C  CA  . ASN E  1 90  ? -21.207  106.219 -15.585 1.00 16.96  ? 90  ASN E CA  1 
ATOM   7132  C  C   . ASN E  1 90  ? -21.060  105.242 -14.424 1.00 15.79  ? 90  ASN E C   1 
ATOM   7133  O  O   . ASN E  1 90  ? -19.950  104.880 -14.044 1.00 30.37  ? 90  ASN E O   1 
ATOM   7134  C  CB  . ASN E  1 90  ? -20.094  107.277 -15.586 1.00 11.01  ? 90  ASN E CB  1 
ATOM   7135  C  CG  . ASN E  1 90  ? -20.258  108.289 -14.478 1.00 23.25  ? 90  ASN E CG  1 
ATOM   7136  O  OD1 . ASN E  1 90  ? -21.379  108.687 -14.142 1.00 20.85  ? 90  ASN E OD1 1 
ATOM   7137  N  ND2 . ASN E  1 90  ? -19.149  108.689 -13.877 1.00 20.30  ? 90  ASN E ND2 1 
ATOM   7138  N  N   . ALA E  1 91  ? -22.180  104.808 -13.865 1.00 15.97  ? 91  ALA E N   1 
ATOM   7139  C  CA  . ALA E  1 91  ? -22.145  103.749 -12.875 1.00 19.58  ? 91  ALA E CA  1 
ATOM   7140  C  C   . ALA E  1 91  ? -21.750  102.453 -13.564 1.00 20.82  ? 91  ALA E C   1 
ATOM   7141  O  O   . ALA E  1 91  ? -22.163  102.196 -14.689 1.00 27.24  ? 91  ALA E O   1 
ATOM   7142  C  CB  . ALA E  1 91  ? -23.497  103.610 -12.211 1.00 22.53  ? 91  ALA E CB  1 
ATOM   7143  N  N   . ILE E  1 92  ? -20.930  101.643 -12.900 1.00 24.29  ? 92  ILE E N   1 
ATOM   7144  C  CA  . ILE E  1 92  ? -20.516  100.367 -13.475 1.00 18.94  ? 92  ILE E CA  1 
ATOM   7145  C  C   . ILE E  1 92  ? -20.961  99.179  -12.631 1.00 20.45  ? 92  ILE E C   1 
ATOM   7146  O  O   . ILE E  1 92  ? -20.625  98.030  -12.926 1.00 24.12  ? 92  ILE E O   1 
ATOM   7147  C  CB  . ILE E  1 92  ? -19.017  100.311 -13.723 1.00 28.36  ? 92  ILE E CB  1 
ATOM   7148  C  CG1 . ILE E  1 92  ? -18.248  100.576 -12.421 1.00 21.13  ? 92  ILE E CG1 1 
ATOM   7149  C  CG2 . ILE E  1 92  ? -18.649  101.301 -14.816 1.00 17.90  ? 92  ILE E CG2 1 
ATOM   7150  C  CD1 . ILE E  1 92  ? -16.775  100.382 -12.554 1.00 13.08  ? 92  ILE E CD1 1 
ATOM   7151  N  N   . SER E  1 93  ? -21.728  99.472  -11.586 1.00 16.43  ? 93  SER E N   1 
ATOM   7152  C  CA  . SER E  1 93  ? -22.480  98.440  -10.880 1.00 28.13  ? 93  SER E CA  1 
ATOM   7153  C  C   . SER E  1 93  ? -23.891  98.962  -10.670 1.00 20.97  ? 93  SER E C   1 
ATOM   7154  O  O   . SER E  1 93  ? -24.110  100.184 -10.675 1.00 11.57  ? 93  SER E O   1 
ATOM   7155  C  CB  . SER E  1 93  ? -21.824  98.087  -9.543  1.00 21.89  ? 93  SER E CB  1 
ATOM   7156  O  OG  . SER E  1 93  ? -21.897  99.166  -8.633  1.00 19.03  ? 93  SER E OG  1 
ATOM   7157  N  N   . LYS E  1 94  ? -24.857  98.060  -10.511 1.00 22.89  ? 94  LYS E N   1 
ATOM   7158  C  CA  . LYS E  1 94  ? -26.200  98.529  -10.182 1.00 25.29  ? 94  LYS E CA  1 
ATOM   7159  C  C   . LYS E  1 94  ? -26.165  99.017  -8.751  1.00 18.02  ? 94  LYS E C   1 
ATOM   7160  O  O   . LYS E  1 94  ? -25.431  98.486  -7.928  1.00 31.62  ? 94  LYS E O   1 
ATOM   7161  C  CB  . LYS E  1 94  ? -27.280  97.471  -10.412 1.00 23.40  ? 94  LYS E CB  1 
ATOM   7162  C  CG  . LYS E  1 94  ? -27.180  96.223  -9.567  1.00 43.22  ? 94  LYS E CG  1 
ATOM   7163  C  CD  . LYS E  1 94  ? -28.123  95.137  -10.100 1.00 62.98  ? 94  LYS E CD  1 
ATOM   7164  C  CE  . LYS E  1 94  ? -29.571  95.644  -10.241 1.00 60.04  ? 94  LYS E CE  1 
ATOM   7165  N  NZ  . LYS E  1 94  ? -30.471  94.664  -10.937 1.00 51.46  ? 94  LYS E NZ  1 
ATOM   7166  N  N   . PRO E  1 95  ? -26.937  100.064 -8.455  1.00 27.16  ? 95  PRO E N   1 
ATOM   7167  C  CA  . PRO E  1 95  ? -26.879  100.684 -7.126  1.00 18.44  ? 95  PRO E CA  1 
ATOM   7168  C  C   . PRO E  1 95  ? -27.290  99.711  -6.034  1.00 20.95  ? 95  PRO E C   1 
ATOM   7169  O  O   . PRO E  1 95  ? -28.338  99.083  -6.159  1.00 18.05  ? 95  PRO E O   1 
ATOM   7170  C  CB  . PRO E  1 95  ? -27.895  101.824 -7.219  1.00 10.94  ? 95  PRO E CB  1 
ATOM   7171  C  CG  . PRO E  1 95  ? -28.795  101.443 -8.365  1.00 19.66  ? 95  PRO E CG  1 
ATOM   7172  C  CD  . PRO E  1 95  ? -27.940  100.693 -9.329  1.00 23.10  ? 95  PRO E CD  1 
ATOM   7173  N  N   . GLU E  1 96  ? -26.456  99.578  -5.005  1.00 18.50  ? 96  GLU E N   1 
ATOM   7174  C  CA  . GLU E  1 96  ? -26.808  98.811  -3.822  1.00 18.98  ? 96  GLU E CA  1 
ATOM   7175  C  C   . GLU E  1 96  ? -27.489  99.735  -2.810  1.00 28.70  ? 96  GLU E C   1 
ATOM   7176  O  O   . GLU E  1 96  ? -26.850  100.617 -2.235  1.00 23.75  ? 96  GLU E O   1 
ATOM   7177  C  CB  . GLU E  1 96  ? -25.567  98.186  -3.204  1.00 13.02  ? 96  GLU E CB  1 
ATOM   7178  C  CG  . GLU E  1 96  ? -25.837  97.188  -2.081  1.00 36.51  ? 96  GLU E CG  1 
ATOM   7179  C  CD  . GLU E  1 96  ? -24.539  96.675  -1.428  1.00 59.01  ? 96  GLU E CD  1 
ATOM   7180  O  OE1 . GLU E  1 96  ? -23.429  97.071  -1.868  1.00 46.04  ? 96  GLU E OE1 1 
ATOM   7181  O  OE2 . GLU E  1 96  ? -24.625  95.872  -0.468  1.00 64.59  ? 96  GLU E OE2 1 
ATOM   7182  N  N   . VAL E  1 97  ? -28.790  99.539  -2.612  1.00 24.61  ? 97  VAL E N   1 
ATOM   7183  C  CA  . VAL E  1 97  ? -29.552  100.402 -1.721  1.00 14.87  ? 97  VAL E CA  1 
ATOM   7184  C  C   . VAL E  1 97  ? -29.427  99.887  -0.309  1.00 21.31  ? 97  VAL E C   1 
ATOM   7185  O  O   . VAL E  1 97  ? -29.849  98.769  -0.007  1.00 27.11  ? 97  VAL E O   1 
ATOM   7186  C  CB  . VAL E  1 97  ? -31.028  100.492 -2.127  1.00 16.07  ? 97  VAL E CB  1 
ATOM   7187  C  CG1 . VAL E  1 97  ? -31.767  101.430 -1.195  1.00 30.51  ? 97  VAL E CG1 1 
ATOM   7188  C  CG2 . VAL E  1 97  ? -31.128  101.011 -3.524  1.00 12.61  ? 97  VAL E CG2 1 
ATOM   7189  N  N   . LEU E  1 98  ? -28.839  100.710 0.552   1.00 24.22  ? 98  LEU E N   1 
ATOM   7190  C  CA  . LEU E  1 98  ? -28.424  100.269 1.881   1.00 21.22  ? 98  LEU E CA  1 
ATOM   7191  C  C   . LEU E  1 98  ? -29.549  100.423 2.898   1.00 19.81  ? 98  LEU E C   1 
ATOM   7192  O  O   . LEU E  1 98  ? -29.634  99.692  3.870   1.00 22.66  ? 98  LEU E O   1 
ATOM   7193  C  CB  . LEU E  1 98  ? -27.194  101.065 2.329   1.00 6.95   ? 98  LEU E CB  1 
ATOM   7194  C  CG  . LEU E  1 98  ? -25.960  100.911 1.449   1.00 21.40  ? 98  LEU E CG  1 
ATOM   7195  C  CD1 . LEU E  1 98  ? -24.866  101.876 1.885   1.00 17.27  ? 98  LEU E CD1 1 
ATOM   7196  C  CD2 . LEU E  1 98  ? -25.465  99.474  1.486   1.00 7.80   ? 98  LEU E CD2 1 
ATOM   7197  N  N   . THR E  1 99  ? -30.416  101.390 2.659   1.00 18.80  ? 99  THR E N   1 
ATOM   7198  C  CA  . THR E  1 99  ? -31.393  101.770 3.652   1.00 10.40  ? 99  THR E CA  1 
ATOM   7199  C  C   . THR E  1 99  ? -32.788  101.276 3.275   1.00 24.45  ? 99  THR E C   1 
ATOM   7200  O  O   . THR E  1 99  ? -33.030  100.901 2.115   1.00 11.55  ? 99  THR E O   1 
ATOM   7201  C  CB  . THR E  1 99  ? -31.383  103.281 3.836   1.00 6.75   ? 99  THR E CB  1 
ATOM   7202  O  OG1 . THR E  1 99  ? -31.473  103.923 2.562   1.00 23.61  ? 99  THR E OG1 1 
ATOM   7203  C  CG2 . THR E  1 99  ? -30.111  103.702 4.496   1.00 6.84   ? 99  THR E CG2 1 
ATOM   7204  N  N   . PRO E  1 100 ? -33.705  101.244 4.262   1.00 31.37  ? 100 PRO E N   1 
ATOM   7205  C  CA  . PRO E  1 100 ? -35.108  100.917 3.986   1.00 23.27  ? 100 PRO E CA  1 
ATOM   7206  C  C   . PRO E  1 100 ? -35.650  101.821 2.879   1.00 14.85  ? 100 PRO E C   1 
ATOM   7207  O  O   . PRO E  1 100 ? -35.442  103.033 2.886   1.00 23.47  ? 100 PRO E O   1 
ATOM   7208  C  CB  . PRO E  1 100 ? -35.797  101.203 5.321   1.00 19.95  ? 100 PRO E CB  1 
ATOM   7209  C  CG  . PRO E  1 100 ? -34.749  100.929 6.332   1.00 14.58  ? 100 PRO E CG  1 
ATOM   7210  C  CD  . PRO E  1 100 ? -33.471  101.452 5.701   1.00 25.06  ? 100 PRO E CD  1 
ATOM   7211  N  N   . GLN E  1 101 ? -36.319  101.218 1.911   1.00 11.28  ? 101 GLN E N   1 
ATOM   7212  C  CA  . GLN E  1 101 ? -36.791  101.966 0.754   1.00 29.88  ? 101 GLN E CA  1 
ATOM   7213  C  C   . GLN E  1 101 ? -38.142  102.646 0.981   1.00 26.66  ? 101 GLN E C   1 
ATOM   7214  O  O   . GLN E  1 101 ? -39.157  102.282 0.383   1.00 24.60  ? 101 GLN E O   1 
ATOM   7215  C  CB  . GLN E  1 101 ? -36.776  101.066 -0.476  1.00 22.47  ? 101 GLN E CB  1 
ATOM   7216  C  CG  . GLN E  1 101 ? -35.367  100.601 -0.761  1.00 17.04  ? 101 GLN E CG  1 
ATOM   7217  C  CD  . GLN E  1 101 ? -35.291  99.561  -1.830  1.00 16.78  ? 101 GLN E CD  1 
ATOM   7218  O  OE1 . GLN E  1 101 ? -36.008  99.628  -2.823  1.00 31.21  ? 101 GLN E OE1 1 
ATOM   7219  N  NE2 . GLN E  1 101 ? -34.413  98.592  -1.645  1.00 23.77  ? 101 GLN E NE2 1 
ATOM   7220  N  N   . LEU E  1 102 ? -38.115  103.648 1.854   1.00 21.66  ? 102 LEU E N   1 
ATOM   7221  C  CA  . LEU E  1 102 ? -39.285  104.420 2.204   1.00 9.04   ? 102 LEU E CA  1 
ATOM   7222  C  C   . LEU E  1 102 ? -39.131  105.833 1.690   1.00 17.72  ? 102 LEU E C   1 
ATOM   7223  O  O   . LEU E  1 102 ? -38.059  106.424 1.770   1.00 21.64  ? 102 LEU E O   1 
ATOM   7224  C  CB  . LEU E  1 102 ? -39.444  104.462 3.713   1.00 7.78   ? 102 LEU E CB  1 
ATOM   7225  C  CG  . LEU E  1 102 ? -39.648  103.098 4.358   1.00 23.17  ? 102 LEU E CG  1 
ATOM   7226  C  CD1 . LEU E  1 102 ? -39.843  103.241 5.884   1.00 13.54  ? 102 LEU E CD1 1 
ATOM   7227  C  CD2 . LEU E  1 102 ? -40.841  102.437 3.708   1.00 22.19  ? 102 LEU E CD2 1 
ATOM   7228  N  N   . ALA E  1 103 ? -40.211  106.374 1.153   1.00 11.14  ? 103 ALA E N   1 
ATOM   7229  C  CA  . ALA E  1 103 ? -40.254  107.786 0.815   1.00 12.88  ? 103 ALA E CA  1 
ATOM   7230  C  C   . ALA E  1 103 ? -41.029  108.528 1.886   1.00 17.18  ? 103 ALA E C   1 
ATOM   7231  O  O   . ALA E  1 103 ? -41.686  107.923 2.729   1.00 28.49  ? 103 ALA E O   1 
ATOM   7232  C  CB  . ALA E  1 103 ? -40.896  107.994 -0.539  1.00 14.01  ? 103 ALA E CB  1 
ATOM   7233  N  N   . ARG E  1 104 ? -40.938  109.849 1.857   1.00 20.96  ? 104 ARG E N   1 
ATOM   7234  C  CA  . ARG E  1 104 ? -41.669  110.670 2.799   1.00 16.09  ? 104 ARG E CA  1 
ATOM   7235  C  C   . ARG E  1 104 ? -42.629  111.549 2.018   1.00 19.61  ? 104 ARG E C   1 
ATOM   7236  O  O   . ARG E  1 104 ? -42.217  112.292 1.138   1.00 34.70  ? 104 ARG E O   1 
ATOM   7237  C  CB  . ARG E  1 104 ? -40.711  111.523 3.612   1.00 15.12  ? 104 ARG E CB  1 
ATOM   7238  C  CG  . ARG E  1 104 ? -41.355  112.189 4.803   1.00 23.92  ? 104 ARG E CG  1 
ATOM   7239  C  CD  . ARG E  1 104 ? -41.681  111.203 5.907   1.00 23.14  ? 104 ARG E CD  1 
ATOM   7240  N  NE  . ARG E  1 104 ? -42.204  111.906 7.068   1.00 12.16  ? 104 ARG E NE  1 
ATOM   7241  C  CZ  . ARG E  1 104 ? -42.573  111.305 8.189   1.00 26.65  ? 104 ARG E CZ  1 
ATOM   7242  N  NH1 . ARG E  1 104 ? -42.486  109.985 8.292   1.00 20.11  ? 104 ARG E NH1 1 
ATOM   7243  N  NH2 . ARG E  1 104 ? -43.035  112.023 9.204   1.00 20.17  ? 104 ARG E NH2 1 
ATOM   7244  N  N   . VAL E  1 105 ? -43.912  111.458 2.337   1.00 15.24  ? 105 VAL E N   1 
ATOM   7245  C  CA  . VAL E  1 105 ? -44.912  112.176 1.576   1.00 18.79  ? 105 VAL E CA  1 
ATOM   7246  C  C   . VAL E  1 105 ? -45.620  113.218 2.437   1.00 26.39  ? 105 VAL E C   1 
ATOM   7247  O  O   . VAL E  1 105 ? -46.181  112.900 3.489   1.00 29.25  ? 105 VAL E O   1 
ATOM   7248  C  CB  . VAL E  1 105 ? -45.937  111.211 0.954   1.00 22.66  ? 105 VAL E CB  1 
ATOM   7249  C  CG1 . VAL E  1 105 ? -46.923  111.976 0.097   1.00 16.53  ? 105 VAL E CG1 1 
ATOM   7250  C  CG2 . VAL E  1 105 ? -45.212  110.144 0.139   1.00 20.09  ? 105 VAL E CG2 1 
ATOM   7251  N  N   . VAL E  1 106 ? -45.577  114.467 1.987   1.00 21.52  ? 106 VAL E N   1 
ATOM   7252  C  CA  . VAL E  1 106 ? -46.288  115.547 2.649   1.00 26.91  ? 106 VAL E CA  1 
ATOM   7253  C  C   . VAL E  1 106 ? -47.702  115.700 2.094   1.00 24.98  ? 106 VAL E C   1 
ATOM   7254  O  O   . VAL E  1 106 ? -47.957  115.419 0.925   1.00 22.81  ? 106 VAL E O   1 
ATOM   7255  C  CB  . VAL E  1 106 ? -45.558  116.880 2.452   1.00 33.97  ? 106 VAL E CB  1 
ATOM   7256  C  CG1 . VAL E  1 106 ? -46.081  117.927 3.447   1.00 27.40  ? 106 VAL E CG1 1 
ATOM   7257  C  CG2 . VAL E  1 106 ? -44.094  116.684 2.615   1.00 23.20  ? 106 VAL E CG2 1 
ATOM   7258  N  N   . SER E  1 107 ? -48.609  116.173 2.938   1.00 22.22  ? 107 SER E N   1 
ATOM   7259  C  CA  . SER E  1 107 ? -50.025  116.269 2.581   1.00 26.23  ? 107 SER E CA  1 
ATOM   7260  C  C   . SER E  1 107 ? -50.310  116.994 1.249   1.00 32.28  ? 107 SER E C   1 
ATOM   7261  O  O   . SER E  1 107 ? -51.314  116.724 0.597   1.00 25.44  ? 107 SER E O   1 
ATOM   7262  C  CB  . SER E  1 107 ? -50.813  116.918 3.725   1.00 21.53  ? 107 SER E CB  1 
ATOM   7263  O  OG  . SER E  1 107 ? -50.360  118.239 3.963   1.00 35.59  ? 107 SER E OG  1 
ATOM   7264  N  N   . ASP E  1 108 ? -49.433  117.911 0.849   1.00 28.26  ? 108 ASP E N   1 
ATOM   7265  C  CA  . ASP E  1 108 ? -49.615  118.634 -0.409  1.00 19.86  ? 108 ASP E CA  1 
ATOM   7266  C  C   . ASP E  1 108 ? -49.059  117.877 -1.628  1.00 30.57  ? 108 ASP E C   1 
ATOM   7267  O  O   . ASP E  1 108 ? -49.076  118.396 -2.743  1.00 34.60  ? 108 ASP E O   1 
ATOM   7268  C  CB  . ASP E  1 108 ? -48.954  120.001 -0.333  1.00 18.11  ? 108 ASP E CB  1 
ATOM   7269  C  CG  . ASP E  1 108 ? -47.458  119.908 -0.110  1.00 47.32  ? 108 ASP E CG  1 
ATOM   7270  O  OD1 . ASP E  1 108 ? -46.931  118.771 -0.143  1.00 36.52  ? 108 ASP E OD1 1 
ATOM   7271  O  OD2 . ASP E  1 108 ? -46.809  120.965 0.092   1.00 42.19  ? 108 ASP E OD2 1 
ATOM   7272  N  N   . GLY E  1 109 ? -48.538  116.670 -1.414  1.00 22.66  ? 109 GLY E N   1 
ATOM   7273  C  CA  . GLY E  1 109 ? -48.047  115.855 -2.512  1.00 24.60  ? 109 GLY E CA  1 
ATOM   7274  C  C   . GLY E  1 109 ? -46.557  115.933 -2.814  1.00 17.86  ? 109 GLY E C   1 
ATOM   7275  O  O   . GLY E  1 109 ? -46.073  115.328 -3.765  1.00 27.25  ? 109 GLY E O   1 
ATOM   7276  N  N   . GLU E  1 110 ? -45.818  116.682 -2.021  1.00 19.24  ? 110 GLU E N   1 
ATOM   7277  C  CA  . GLU E  1 110 ? -44.377  116.684 -2.178  1.00 13.82  ? 110 GLU E CA  1 
ATOM   7278  C  C   . GLU E  1 110 ? -43.829  115.362 -1.665  1.00 25.69  ? 110 GLU E C   1 
ATOM   7279  O  O   . GLU E  1 110 ? -44.333  114.788 -0.694  1.00 28.73  ? 110 GLU E O   1 
ATOM   7280  C  CB  . GLU E  1 110 ? -43.763  117.847 -1.405  1.00 43.74  ? 110 GLU E CB  1 
ATOM   7281  C  CG  . GLU E  1 110 ? -44.088  119.203 -1.986  1.00 23.41  ? 110 GLU E CG  1 
ATOM   7282  C  CD  . GLU E  1 110 ? -43.510  119.374 -3.368  1.00 59.28  ? 110 GLU E CD  1 
ATOM   7283  O  OE1 . GLU E  1 110 ? -42.267  119.368 -3.497  1.00 69.83  ? 110 GLU E OE1 1 
ATOM   7284  O  OE2 . GLU E  1 110 ? -44.295  119.497 -4.331  1.00 62.01  ? 110 GLU E OE2 1 
ATOM   7285  N  N   . VAL E  1 111 ? -42.798  114.876 -2.339  1.00 18.50  ? 111 VAL E N   1 
ATOM   7286  C  CA  . VAL E  1 111 ? -42.158  113.618 -1.972  1.00 24.71  ? 111 VAL E CA  1 
ATOM   7287  C  C   . VAL E  1 111 ? -40.646  113.803 -1.740  1.00 20.99  ? 111 VAL E C   1 
ATOM   7288  O  O   . VAL E  1 111 ? -39.966  114.418 -2.558  1.00 26.72  ? 111 VAL E O   1 
ATOM   7289  C  CB  . VAL E  1 111 ? -42.413  112.557 -3.058  1.00 19.34  ? 111 VAL E CB  1 
ATOM   7290  C  CG1 . VAL E  1 111 ? -41.969  111.187 -2.587  1.00 9.95   ? 111 VAL E CG1 1 
ATOM   7291  C  CG2 . VAL E  1 111 ? -43.876  112.531 -3.420  1.00 11.02  ? 111 VAL E CG2 1 
ATOM   7292  N  N   . LEU E  1 112 ? -40.146  113.319 -0.602  1.00 19.16  ? 112 LEU E N   1 
ATOM   7293  C  CA  . LEU E  1 112 ? -38.706  113.150 -0.394  1.00 21.49  ? 112 LEU E CA  1 
ATOM   7294  C  C   . LEU E  1 112 ? -38.371  111.657 -0.401  1.00 26.57  ? 112 LEU E C   1 
ATOM   7295  O  O   . LEU E  1 112 ? -39.052  110.853 0.235   1.00 24.29  ? 112 LEU E O   1 
ATOM   7296  C  CB  . LEU E  1 112 ? -38.198  113.785 0.914   1.00 17.87  ? 112 LEU E CB  1 
ATOM   7297  C  CG  . LEU E  1 112 ? -36.682  113.604 1.193   1.00 43.73  ? 112 LEU E CG  1 
ATOM   7298  C  CD1 . LEU E  1 112 ? -35.837  114.287 0.136   1.00 36.39  ? 112 LEU E CD1 1 
ATOM   7299  C  CD2 . LEU E  1 112 ? -36.225  114.082 2.580   1.00 19.73  ? 112 LEU E CD2 1 
ATOM   7300  N  N   . TYR E  1 113 ? -37.339  111.296 -1.155  1.00 15.06  ? 113 TYR E N   1 
ATOM   7301  C  CA  . TYR E  1 113 ? -36.751  109.970 -1.091  1.00 19.03  ? 113 TYR E CA  1 
ATOM   7302  C  C   . TYR E  1 113 ? -35.236  110.147 -1.040  1.00 32.16  ? 113 TYR E C   1 
ATOM   7303  O  O   . TYR E  1 113 ? -34.645  110.796 -1.917  1.00 21.16  ? 113 TYR E O   1 
ATOM   7304  C  CB  . TYR E  1 113 ? -37.139  109.138 -2.316  1.00 13.93  ? 113 TYR E CB  1 
ATOM   7305  C  CG  . TYR E  1 113 ? -36.607  107.726 -2.286  1.00 16.47  ? 113 TYR E CG  1 
ATOM   7306  C  CD1 . TYR E  1 113 ? -36.702  106.956 -1.134  1.00 10.43  ? 113 TYR E CD1 1 
ATOM   7307  C  CD2 . TYR E  1 113 ? -36.048  107.152 -3.415  1.00 7.32   ? 113 TYR E CD2 1 
ATOM   7308  C  CE1 . TYR E  1 113 ? -36.233  105.647 -1.108  1.00 20.56  ? 113 TYR E CE1 1 
ATOM   7309  C  CE2 . TYR E  1 113 ? -35.584  105.854 -3.402  1.00 9.65   ? 113 TYR E CE2 1 
ATOM   7310  C  CZ  . TYR E  1 113 ? -35.672  105.102 -2.241  1.00 22.45  ? 113 TYR E CZ  1 
ATOM   7311  O  OH  . TYR E  1 113 ? -35.213  103.801 -2.186  1.00 19.31  ? 113 TYR E OH  1 
ATOM   7312  N  N   . MET E  1 114 ? -34.610  109.589 -0.004  1.00 31.29  ? 114 MET E N   1 
ATOM   7313  C  CA  . MET E  1 114 ? -33.169  109.769 0.205   1.00 26.13  ? 114 MET E CA  1 
ATOM   7314  C  C   . MET E  1 114 ? -32.507  108.509 0.739   1.00 24.10  ? 114 MET E C   1 
ATOM   7315  O  O   . MET E  1 114 ? -32.107  108.456 1.908   1.00 18.81  ? 114 MET E O   1 
ATOM   7316  C  CB  . MET E  1 114 ? -32.895  110.932 1.161   1.00 8.81   ? 114 MET E CB  1 
ATOM   7317  C  CG  . MET E  1 114 ? -31.461  111.353 1.204   1.00 8.90   ? 114 MET E CG  1 
ATOM   7318  S  SD  . MET E  1 114 ? -31.254  112.976 1.904   1.00 22.60  ? 114 MET E SD  1 
ATOM   7319  C  CE  . MET E  1 114 ? -31.788  112.721 3.600   1.00 19.16  ? 114 MET E CE  1 
ATOM   7320  N  N   . PRO E  1 115 ? -32.380  107.492 -0.122  1.00 15.24  ? 115 PRO E N   1 
ATOM   7321  C  CA  . PRO E  1 115 ? -31.743  106.240 0.276   1.00 22.44  ? 115 PRO E CA  1 
ATOM   7322  C  C   . PRO E  1 115 ? -30.233  106.406 0.301   1.00 21.23  ? 115 PRO E C   1 
ATOM   7323  O  O   . PRO E  1 115 ? -29.671  107.253 -0.391  1.00 21.79  ? 115 PRO E O   1 
ATOM   7324  C  CB  . PRO E  1 115 ? -32.129  105.294 -0.858  1.00 14.66  ? 115 PRO E CB  1 
ATOM   7325  C  CG  . PRO E  1 115 ? -32.148  106.173 -2.038  1.00 6.83   ? 115 PRO E CG  1 
ATOM   7326  C  CD  . PRO E  1 115 ? -32.707  107.499 -1.554  1.00 13.12  ? 115 PRO E CD  1 
ATOM   7327  N  N   . SER E  1 116 ? -29.568  105.610 1.116   1.00 15.87  ? 116 SER E N   1 
ATOM   7328  C  CA  . SER E  1 116 ? -28.117  105.614 1.093   1.00 24.01  ? 116 SER E CA  1 
ATOM   7329  C  C   . SER E  1 116 ? -27.712  104.550 0.083   1.00 25.04  ? 116 SER E C   1 
ATOM   7330  O  O   . SER E  1 116 ? -28.218  103.420 0.130   1.00 25.56  ? 116 SER E O   1 
ATOM   7331  C  CB  . SER E  1 116 ? -27.541  105.318 2.469   1.00 6.86   ? 116 SER E CB  1 
ATOM   7332  O  OG  . SER E  1 116 ? -26.135  105.398 2.434   1.00 31.92  ? 116 SER E OG  1 
ATOM   7333  N  N   . ILE E  1 117 ? -26.835  104.924 -0.848  1.00 13.13  ? 117 ILE E N   1 
ATOM   7334  C  CA  . ILE E  1 117 ? -26.459  104.036 -1.930  1.00 19.77  ? 117 ILE E CA  1 
ATOM   7335  C  C   . ILE E  1 117 ? -24.959  103.810 -2.018  1.00 13.31  ? 117 ILE E C   1 
ATOM   7336  O  O   . ILE E  1 117 ? -24.177  104.750 -1.939  1.00 21.27  ? 117 ILE E O   1 
ATOM   7337  C  CB  . ILE E  1 117 ? -26.957  104.559 -3.286  1.00 20.73  ? 117 ILE E CB  1 
ATOM   7338  C  CG1 . ILE E  1 117 ? -28.488  104.534 -3.329  1.00 24.61  ? 117 ILE E CG1 1 
ATOM   7339  C  CG2 . ILE E  1 117 ? -26.382  103.729 -4.414  1.00 10.48  ? 117 ILE E CG2 1 
ATOM   7340  C  CD1 . ILE E  1 117 ? -29.094  105.197 -4.570  1.00 27.35  ? 117 ILE E CD1 1 
ATOM   7341  N  N   . ARG E  1 118 ? -24.574  102.547 -2.162  1.00 16.44  ? 118 ARG E N   1 
ATOM   7342  C  CA  . ARG E  1 118 ? -23.212  102.212 -2.538  1.00 15.12  ? 118 ARG E CA  1 
ATOM   7343  C  C   . ARG E  1 118 ? -23.180  101.787 -4.008  1.00 19.61  ? 118 ARG E C   1 
ATOM   7344  O  O   . ARG E  1 118 ? -23.945  100.920 -4.418  1.00 17.86  ? 118 ARG E O   1 
ATOM   7345  C  CB  . ARG E  1 118 ? -22.634  101.104 -1.656  1.00 15.04  ? 118 ARG E CB  1 
ATOM   7346  C  CG  . ARG E  1 118 ? -21.216  100.689 -2.079  1.00 19.90  ? 118 ARG E CG  1 
ATOM   7347  C  CD  . ARG E  1 118 ? -20.556  99.777  -1.090  1.00 22.07  ? 118 ARG E CD  1 
ATOM   7348  N  NE  . ARG E  1 118 ? -19.207  99.423  -1.502  1.00 17.40  ? 118 ARG E NE  1 
ATOM   7349  C  CZ  . ARG E  1 118 ? -18.329  98.771  -0.739  1.00 16.79  ? 118 ARG E CZ  1 
ATOM   7350  N  NH1 . ARG E  1 118 ? -18.631  98.397  0.491   1.00 12.63  ? 118 ARG E NH1 1 
ATOM   7351  N  NH2 . ARG E  1 118 ? -17.126  98.507  -1.212  1.00 30.81  ? 118 ARG E NH2 1 
ATOM   7352  N  N   . GLN E  1 119 ? -22.289  102.404 -4.785  1.00 13.47  ? 119 GLN E N   1 
ATOM   7353  C  CA  . GLN E  1 119 ? -22.196  102.161 -6.219  1.00 18.70  ? 119 GLN E CA  1 
ATOM   7354  C  C   . GLN E  1 119 ? -20.768  102.425 -6.735  1.00 23.43  ? 119 GLN E C   1 
ATOM   7355  O  O   . GLN E  1 119 ? -20.105  103.353 -6.289  1.00 13.74  ? 119 GLN E O   1 
ATOM   7356  C  CB  . GLN E  1 119 ? -23.202  103.064 -6.943  1.00 15.80  ? 119 GLN E CB  1 
ATOM   7357  C  CG  . GLN E  1 119 ? -23.582  102.620 -8.333  1.00 24.56  ? 119 GLN E CG  1 
ATOM   7358  C  CD  . GLN E  1 119 ? -24.826  103.320 -8.847  1.00 19.53  ? 119 GLN E CD  1 
ATOM   7359  O  OE1 . GLN E  1 119 ? -25.201  104.402 -8.370  1.00 13.89  ? 119 GLN E OE1 1 
ATOM   7360  N  NE2 . GLN E  1 119 ? -25.473  102.703 -9.826  1.00 19.68  ? 119 GLN E NE2 1 
ATOM   7361  N  N   . ARG E  1 120 ? -20.285  101.606 -7.665  1.00 27.11  ? 120 ARG E N   1 
ATOM   7362  C  CA  . ARG E  1 120 ? -18.997  101.864 -8.337  1.00 25.37  ? 120 ARG E CA  1 
ATOM   7363  C  C   . ARG E  1 120 ? -19.127  102.722 -9.628  1.00 16.42  ? 120 ARG E C   1 
ATOM   7364  O  O   . ARG E  1 120 ? -20.054  102.541 -10.431 1.00 23.40  ? 120 ARG E O   1 
ATOM   7365  C  CB  . ARG E  1 120 ? -18.280  100.543 -8.657  1.00 21.30  ? 120 ARG E CB  1 
ATOM   7366  C  CG  . ARG E  1 120 ? -17.962  99.669  -7.444  1.00 47.53  ? 120 ARG E CG  1 
ATOM   7367  C  CD  . ARG E  1 120 ? -17.367  98.318  -7.868  1.00 73.36  ? 120 ARG E CD  1 
ATOM   7368  N  NE  . ARG E  1 120 ? -18.373  97.247  -7.936  1.00 81.86  ? 120 ARG E NE  1 
ATOM   7369  C  CZ  . ARG E  1 120 ? -18.368  96.242  -8.820  1.00 73.74  ? 120 ARG E CZ  1 
ATOM   7370  N  NH1 . ARG E  1 120 ? -17.408  96.148  -9.758  1.00 15.28  ? 120 ARG E NH1 1 
ATOM   7371  N  NH2 . ARG E  1 120 ? -19.338  95.328  -8.771  1.00 73.71  ? 120 ARG E NH2 1 
ATOM   7372  N  N   . PHE E  1 121 ? -18.197  103.648 -9.828  1.00 20.71  ? 121 PHE E N   1 
ATOM   7373  C  CA  . PHE E  1 121 ? -18.216  104.506 -11.010 1.00 19.66  ? 121 PHE E CA  1 
ATOM   7374  C  C   . PHE E  1 121 ? -16.926  104.484 -11.819 1.00 17.83  ? 121 PHE E C   1 
ATOM   7375  O  O   . PHE E  1 121 ? -15.843  104.263 -11.293 1.00 35.52  ? 121 PHE E O   1 
ATOM   7376  C  CB  . PHE E  1 121 ? -18.492  105.946 -10.608 1.00 14.40  ? 121 PHE E CB  1 
ATOM   7377  C  CG  . PHE E  1 121 ? -19.796  106.134 -9.912  1.00 26.99  ? 121 PHE E CG  1 
ATOM   7378  C  CD1 . PHE E  1 121 ? -20.938  106.391 -10.624 1.00 26.13  ? 121 PHE E CD1 1 
ATOM   7379  C  CD2 . PHE E  1 121 ? -19.877  106.048 -8.541  1.00 23.89  ? 121 PHE E CD2 1 
ATOM   7380  C  CE1 . PHE E  1 121 ? -22.138  106.566 -9.977  1.00 34.16  ? 121 PHE E CE1 1 
ATOM   7381  C  CE2 . PHE E  1 121 ? -21.069  106.219 -7.890  1.00 24.31  ? 121 PHE E CE2 1 
ATOM   7382  C  CZ  . PHE E  1 121 ? -22.201  106.478 -8.606  1.00 29.30  ? 121 PHE E CZ  1 
ATOM   7383  N  N   . SER E  1 122 ? -17.072  104.751 -13.104 1.00 14.12  ? 122 SER E N   1 
ATOM   7384  C  CA  . SER E  1 122 ? -15.964  105.019 -14.003 1.00 22.03  ? 122 SER E CA  1 
ATOM   7385  C  C   . SER E  1 122 ? -15.818  106.532 -14.212 1.00 22.23  ? 122 SER E C   1 
ATOM   7386  O  O   . SER E  1 122 ? -16.691  107.176 -14.779 1.00 27.56  ? 122 SER E O   1 
ATOM   7387  C  CB  . SER E  1 122 ? -16.208  104.337 -15.348 1.00 22.60  ? 122 SER E CB  1 
ATOM   7388  O  OG  . SER E  1 122 ? -15.606  105.079 -16.387 1.00 28.77  ? 122 SER E OG  1 
ATOM   7389  N  N   . CYS E  1 123 ? -14.711  107.094 -13.743 1.00 30.29  ? 123 CYS E N   1 
ATOM   7390  C  CA  . CYS E  1 123 ? -14.468  108.531 -13.850 1.00 26.17  ? 123 CYS E CA  1 
ATOM   7391  C  C   . CYS E  1 123 ? -12.997  108.850 -13.635 1.00 31.10  ? 123 CYS E C   1 
ATOM   7392  O  O   . CYS E  1 123 ? -12.198  107.971 -13.302 1.00 33.93  ? 123 CYS E O   1 
ATOM   7393  C  CB  . CYS E  1 123 ? -15.293  109.295 -12.820 1.00 32.20  ? 123 CYS E CB  1 
ATOM   7394  S  SG  . CYS E  1 123 ? -15.031  108.732 -11.114 1.00 24.86  ? 123 CYS E SG  1 
ATOM   7395  N  N   . ASP E  1 124 ? -12.656  110.121 -13.800 1.00 23.97  ? 124 ASP E N   1 
ATOM   7396  C  CA  . ASP E  1 124 ? -11.282  110.562 -13.707 1.00 18.58  ? 124 ASP E CA  1 
ATOM   7397  C  C   . ASP E  1 124 ? -10.746  110.492 -12.280 1.00 35.45  ? 124 ASP E C   1 
ATOM   7398  O  O   . ASP E  1 124 ? -11.091  111.319 -11.442 1.00 33.45  ? 124 ASP E O   1 
ATOM   7399  C  CB  . ASP E  1 124 ? -11.154  111.981 -14.225 1.00 23.47  ? 124 ASP E CB  1 
ATOM   7400  C  CG  . ASP E  1 124 ? -9.740   112.327 -14.593 1.00 34.43  ? 124 ASP E CG  1 
ATOM   7401  O  OD1 . ASP E  1 124 ? -8.825   111.528 -14.286 1.00 29.22  ? 124 ASP E OD1 1 
ATOM   7402  O  OD2 . ASP E  1 124 ? -9.548   113.402 -15.189 1.00 40.14  ? 124 ASP E OD2 1 
ATOM   7403  N  N   . VAL E  1 125 ? -9.884   109.511 -12.019 1.00 27.71  ? 125 VAL E N   1 
ATOM   7404  C  CA  . VAL E  1 125 ? -9.282   109.334 -10.705 1.00 17.06  ? 125 VAL E CA  1 
ATOM   7405  C  C   . VAL E  1 125 ? -7.856   109.890 -10.680 1.00 34.71  ? 125 VAL E C   1 
ATOM   7406  O  O   . VAL E  1 125 ? -7.192   109.900 -9.640  1.00 30.33  ? 125 VAL E O   1 
ATOM   7407  C  CB  . VAL E  1 125 ? -9.276   107.852 -10.299 1.00 15.72  ? 125 VAL E CB  1 
ATOM   7408  C  CG1 . VAL E  1 125 ? -8.750   107.698 -8.910  1.00 24.89  ? 125 VAL E CG1 1 
ATOM   7409  C  CG2 . VAL E  1 125 ? -10.694  107.283 -10.393 1.00 23.19  ? 125 VAL E CG2 1 
ATOM   7410  N  N   . SER E  1 126 ? -7.384   110.357 -11.832 1.00 35.72  ? 126 SER E N   1 
ATOM   7411  C  CA  . SER E  1 126 ? -6.030   110.875 -11.929 1.00 34.03  ? 126 SER E CA  1 
ATOM   7412  C  C   . SER E  1 126 ? -5.841   111.993 -10.910 1.00 37.01  ? 126 SER E C   1 
ATOM   7413  O  O   . SER E  1 126 ? -6.742   112.800 -10.682 1.00 35.05  ? 126 SER E O   1 
ATOM   7414  C  CB  . SER E  1 126 ? -5.752   111.388 -13.344 1.00 25.41  ? 126 SER E CB  1 
ATOM   7415  O  OG  . SER E  1 126 ? -6.306   112.678 -13.535 1.00 42.22  ? 126 SER E OG  1 
ATOM   7416  N  N   . GLY E  1 127 ? -4.667   112.030 -10.289 1.00 30.53  ? 127 GLY E N   1 
ATOM   7417  C  CA  . GLY E  1 127 ? -4.344   113.071 -9.328  1.00 28.40  ? 127 GLY E CA  1 
ATOM   7418  C  C   . GLY E  1 127 ? -4.879   112.848 -7.916  1.00 43.01  ? 127 GLY E C   1 
ATOM   7419  O  O   . GLY E  1 127 ? -4.676   113.676 -7.025  1.00 22.91  ? 127 GLY E O   1 
ATOM   7420  N  N   . VAL E  1 128 ? -5.552   111.726 -7.697  1.00 15.97  ? 128 VAL E N   1 
ATOM   7421  C  CA  . VAL E  1 128 ? -6.173   111.473 -6.426  1.00 15.56  ? 128 VAL E CA  1 
ATOM   7422  C  C   . VAL E  1 128 ? -5.179   111.623 -5.302  1.00 30.59  ? 128 VAL E C   1 
ATOM   7423  O  O   . VAL E  1 128 ? -5.535   111.999 -4.181  1.00 39.12  ? 128 VAL E O   1 
ATOM   7424  C  CB  . VAL E  1 128 ? -6.799   110.070 -6.360  1.00 31.47  ? 128 VAL E CB  1 
ATOM   7425  C  CG1 . VAL E  1 128 ? -5.756   109.014 -6.583  1.00 15.51  ? 128 VAL E CG1 1 
ATOM   7426  C  CG2 . VAL E  1 128 ? -7.493   109.859 -5.011  1.00 14.74  ? 128 VAL E CG2 1 
ATOM   7427  N  N   . ASP E  1 129 ? -3.921   111.338 -5.589  1.00 27.79  ? 129 ASP E N   1 
ATOM   7428  C  CA  . ASP E  1 129 ? -2.921   111.354 -4.541  1.00 26.74  ? 129 ASP E CA  1 
ATOM   7429  C  C   . ASP E  1 129 ? -2.050   112.611 -4.613  1.00 31.52  ? 129 ASP E C   1 
ATOM   7430  O  O   . ASP E  1 129 ? -0.846   112.560 -4.366  1.00 41.23  ? 129 ASP E O   1 
ATOM   7431  C  CB  . ASP E  1 129 ? -2.070   110.089 -4.617  1.00 33.37  ? 129 ASP E CB  1 
ATOM   7432  C  CG  . ASP E  1 129 ? -1.517   109.672 -3.262  1.00 60.98  ? 129 ASP E CG  1 
ATOM   7433  O  OD1 . ASP E  1 129 ? -1.448   110.522 -2.341  1.00 55.54  ? 129 ASP E OD1 1 
ATOM   7434  O  OD2 . ASP E  1 129 ? -1.150   108.486 -3.116  1.00 73.30  ? 129 ASP E OD2 1 
ATOM   7435  N  N   . THR E  1 130 ? -2.662   113.740 -4.944  1.00 30.30  ? 130 THR E N   1 
ATOM   7436  C  CA  . THR E  1 130 ? -1.941   114.999 -5.001  1.00 21.24  ? 130 THR E CA  1 
ATOM   7437  C  C   . THR E  1 130 ? -2.666   116.073 -4.204  1.00 42.04  ? 130 THR E C   1 
ATOM   7438  O  O   . THR E  1 130 ? -3.810   115.896 -3.805  1.00 44.01  ? 130 THR E O   1 
ATOM   7439  C  CB  . THR E  1 130 ? -1.758   115.502 -6.458  1.00 40.69  ? 130 THR E CB  1 
ATOM   7440  O  OG1 . THR E  1 130 ? -3.017   115.941 -6.985  1.00 43.11  ? 130 THR E OG1 1 
ATOM   7441  C  CG2 . THR E  1 130 ? -1.196   114.405 -7.356  1.00 21.15  ? 130 THR E CG2 1 
ATOM   7442  N  N   . GLU E  1 131 ? -1.973   117.177 -3.958  1.00 45.69  ? 131 GLU E N   1 
ATOM   7443  C  CA  . GLU E  1 131 ? -2.557   118.352 -3.339  1.00 52.54  ? 131 GLU E CA  1 
ATOM   7444  C  C   . GLU E  1 131 ? -3.927   118.617 -3.935  1.00 39.80  ? 131 GLU E C   1 
ATOM   7445  O  O   . GLU E  1 131 ? -4.921   118.715 -3.229  1.00 41.34  ? 131 GLU E O   1 
ATOM   7446  C  CB  . GLU E  1 131 ? -1.670   119.561 -3.624  1.00 60.47  ? 131 GLU E CB  1 
ATOM   7447  C  CG  . GLU E  1 131 ? -1.985   120.780 -2.789  1.00 57.51  ? 131 GLU E CG  1 
ATOM   7448  C  CD  . GLU E  1 131 ? -1.379   120.678 -1.411  1.00 75.27  ? 131 GLU E CD  1 
ATOM   7449  O  OE1 . GLU E  1 131 ? -0.270   121.218 -1.214  1.00 61.67  ? 131 GLU E OE1 1 
ATOM   7450  O  OE2 . GLU E  1 131 ? -2.001   120.042 -0.531  1.00 95.52  ? 131 GLU E OE2 1 
ATOM   7451  N  N   . SER E  1 132 ? -3.969   118.735 -5.253  1.00 26.68  ? 132 SER E N   1 
ATOM   7452  C  CA  . SER E  1 132 ? -5.160   119.225 -5.899  1.00 28.41  ? 132 SER E CA  1 
ATOM   7453  C  C   . SER E  1 132 ? -6.238   118.156 -5.988  1.00 33.55  ? 132 SER E C   1 
ATOM   7454  O  O   . SER E  1 132 ? -7.410   118.476 -6.154  1.00 16.52  ? 132 SER E O   1 
ATOM   7455  C  CB  . SER E  1 132 ? -4.822   119.824 -7.258  1.00 38.28  ? 132 SER E CB  1 
ATOM   7456  O  OG  . SER E  1 132 ? -4.472   121.194 -7.099  1.00 43.80  ? 132 SER E OG  1 
ATOM   7457  N  N   . GLY E  1 133 ? -5.829   116.898 -5.845  1.00 40.47  ? 133 GLY E N   1 
ATOM   7458  C  CA  . GLY E  1 133 ? -6.739   115.770 -5.832  1.00 22.06  ? 133 GLY E CA  1 
ATOM   7459  C  C   . GLY E  1 133 ? -7.340   115.426 -7.182  1.00 32.93  ? 133 GLY E C   1 
ATOM   7460  O  O   . GLY E  1 133 ? -7.093   116.099 -8.179  1.00 34.51  ? 133 GLY E O   1 
ATOM   7461  N  N   . ALA E  1 134 ? -8.128   114.358 -7.212  1.00 27.19  ? 134 ALA E N   1 
ATOM   7462  C  CA  . ALA E  1 134 ? -8.895   113.994 -8.394  1.00 33.90  ? 134 ALA E CA  1 
ATOM   7463  C  C   . ALA E  1 134 ? -10.266  114.672 -8.370  1.00 33.01  ? 134 ALA E C   1 
ATOM   7464  O  O   . ALA E  1 134 ? -10.782  115.033 -7.312  1.00 34.91  ? 134 ALA E O   1 
ATOM   7465  C  CB  . ALA E  1 134 ? -9.064   112.489 -8.462  1.00 26.25  ? 134 ALA E CB  1 
ATOM   7466  N  N   . THR E  1 135 ? -10.852  114.852 -9.539  1.00 19.21  ? 135 THR E N   1 
ATOM   7467  C  CA  . THR E  1 135 ? -12.217  115.333 -9.621  1.00 19.56  ? 135 THR E CA  1 
ATOM   7468  C  C   . THR E  1 135 ? -13.045  114.340 -10.422 1.00 18.27  ? 135 THR E C   1 
ATOM   7469  O  O   . THR E  1 135 ? -12.907  114.228 -11.637 1.00 17.99  ? 135 THR E O   1 
ATOM   7470  C  CB  . THR E  1 135 ? -12.305  116.727 -10.241 1.00 29.09  ? 135 THR E CB  1 
ATOM   7471  O  OG1 . THR E  1 135 ? -11.692  117.663 -9.352  1.00 32.50  ? 135 THR E OG1 1 
ATOM   7472  C  CG2 . THR E  1 135 ? -13.761  117.119 -10.448 1.00 22.57  ? 135 THR E CG2 1 
ATOM   7473  N  N   . CYS E  1 136 ? -13.891  113.617 -9.704  1.00 21.55  ? 136 CYS E N   1 
ATOM   7474  C  CA  . CYS E  1 136 ? -14.706  112.548 -10.251 1.00 23.76  ? 136 CYS E CA  1 
ATOM   7475  C  C   . CYS E  1 136 ? -16.118  113.050 -10.536 1.00 27.28  ? 136 CYS E C   1 
ATOM   7476  O  O   . CYS E  1 136 ? -16.836  113.445 -9.644  1.00 26.04  ? 136 CYS E O   1 
ATOM   7477  C  CB  . CYS E  1 136 ? -14.760  111.387 -9.257  1.00 17.64  ? 136 CYS E CB  1 
ATOM   7478  S  SG  . CYS E  1 136 ? -15.822  110.039 -9.785  1.00 30.88  ? 136 CYS E SG  1 
ATOM   7479  N  N   . ARG E  1 137 ? -16.517  113.016 -11.792 1.00 29.92  ? 137 ARG E N   1 
ATOM   7480  C  CA  . ARG E  1 137 ? -17.813  113.533 -12.197 1.00 39.80  ? 137 ARG E CA  1 
ATOM   7481  C  C   . ARG E  1 137 ? -18.851  112.400 -12.316 1.00 25.27  ? 137 ARG E C   1 
ATOM   7482  O  O   . ARG E  1 137 ? -18.623  111.397 -12.981 1.00 10.80  ? 137 ARG E O   1 
ATOM   7483  C  CB  . ARG E  1 137 ? -17.643  114.264 -13.527 1.00 55.49  ? 137 ARG E CB  1 
ATOM   7484  C  CG  . ARG E  1 137 ? -18.773  115.176 -13.948 1.00 47.57  ? 137 ARG E CG  1 
ATOM   7485  C  CD  . ARG E  1 137 ? -18.468  115.792 -15.330 1.00 59.34  ? 137 ARG E CD  1 
ATOM   7486  N  NE  . ARG E  1 137 ? -18.238  114.785 -16.373 1.00 49.90  ? 137 ARG E NE  1 
ATOM   7487  C  CZ  . ARG E  1 137 ? -17.040  114.417 -16.821 1.00 67.79  ? 137 ARG E CZ  1 
ATOM   7488  N  NH1 . ARG E  1 137 ? -15.939  114.973 -16.327 1.00 80.58  ? 137 ARG E NH1 1 
ATOM   7489  N  NH2 . ARG E  1 137 ? -16.941  113.496 -17.771 1.00 71.16  ? 137 ARG E NH2 1 
ATOM   7490  N  N   . ILE E  1 138 ? -19.984  112.561 -11.651 1.00 24.30  ? 138 ILE E N   1 
ATOM   7491  C  CA  . ILE E  1 138 ? -21.056  111.583 -11.720 1.00 22.71  ? 138 ILE E CA  1 
ATOM   7492  C  C   . ILE E  1 138 ? -22.282  112.189 -12.390 1.00 24.10  ? 138 ILE E C   1 
ATOM   7493  O  O   . ILE E  1 138 ? -22.762  113.231 -11.963 1.00 21.79  ? 138 ILE E O   1 
ATOM   7494  C  CB  . ILE E  1 138 ? -21.441  111.096 -10.321 1.00 32.35  ? 138 ILE E CB  1 
ATOM   7495  C  CG1 . ILE E  1 138 ? -20.277  110.309 -9.720  1.00 15.93  ? 138 ILE E CG1 1 
ATOM   7496  C  CG2 . ILE E  1 138 ? -22.710  110.249 -10.381 1.00 15.57  ? 138 ILE E CG2 1 
ATOM   7497  C  CD1 . ILE E  1 138 ? -20.463  109.975 -8.292  1.00 17.22  ? 138 ILE E CD1 1 
ATOM   7498  N  N   . LYS E  1 139 ? -22.770  111.535 -13.443 1.00 23.45  ? 139 LYS E N   1 
ATOM   7499  C  CA  . LYS E  1 139 ? -23.874  112.046 -14.258 1.00 23.71  ? 139 LYS E CA  1 
ATOM   7500  C  C   . LYS E  1 139 ? -25.184  111.283 -14.002 1.00 30.93  ? 139 LYS E C   1 
ATOM   7501  O  O   . LYS E  1 139 ? -25.286  110.071 -14.248 1.00 24.73  ? 139 LYS E O   1 
ATOM   7502  C  CB  . LYS E  1 139 ? -23.491  111.988 -15.739 1.00 14.57  ? 139 LYS E CB  1 
ATOM   7503  C  CG  . LYS E  1 139 ? -24.572  112.363 -16.713 1.00 15.55  ? 139 LYS E CG  1 
ATOM   7504  C  CD  . LYS E  1 139 ? -24.141  112.055 -18.133 1.00 15.05  ? 139 LYS E CD  1 
ATOM   7505  C  CE  . LYS E  1 139 ? -25.231  112.324 -19.162 1.00 20.54  ? 139 LYS E CE  1 
ATOM   7506  N  NZ  . LYS E  1 139 ? -24.728  112.040 -20.536 1.00 23.70  ? 139 LYS E NZ  1 
ATOM   7507  N  N   . ILE E  1 140 ? -26.183  112.008 -13.510 1.00 13.69  ? 140 ILE E N   1 
ATOM   7508  C  CA  . ILE E  1 140 ? -27.472  111.417 -13.171 1.00 14.01  ? 140 ILE E CA  1 
ATOM   7509  C  C   . ILE E  1 140 ? -28.609  112.105 -13.911 1.00 13.62  ? 140 ILE E C   1 
ATOM   7510  O  O   . ILE E  1 140 ? -28.690  113.331 -13.927 1.00 27.79  ? 140 ILE E O   1 
ATOM   7511  C  CB  . ILE E  1 140 ? -27.740  111.524 -11.664 1.00 14.95  ? 140 ILE E CB  1 
ATOM   7512  C  CG1 . ILE E  1 140 ? -26.696  110.748 -10.884 1.00 18.97  ? 140 ILE E CG1 1 
ATOM   7513  C  CG2 . ILE E  1 140 ? -29.093  110.976 -11.333 1.00 21.68  ? 140 ILE E CG2 1 
ATOM   7514  C  CD1 . ILE E  1 140 ? -26.872  110.834 -9.399  1.00 42.11  ? 140 ILE E CD1 1 
ATOM   7515  N  N   . GLY E  1 141 ? -29.480  111.320 -14.534 1.00 24.77  ? 141 GLY E N   1 
ATOM   7516  C  CA  . GLY E  1 141 ? -30.656  111.861 -15.204 1.00 25.51  ? 141 GLY E CA  1 
ATOM   7517  C  C   . GLY E  1 141 ? -31.768  110.844 -15.410 1.00 17.18  ? 141 GLY E C   1 
ATOM   7518  O  O   . GLY E  1 141 ? -31.625  109.664 -15.110 1.00 16.58  ? 141 GLY E O   1 
ATOM   7519  N  N   . SER E  1 142 ? -32.896  111.294 -15.926 1.00 20.68  ? 142 SER E N   1 
ATOM   7520  C  CA  . SER E  1 142 ? -33.933  110.349 -16.301 1.00 23.76  ? 142 SER E CA  1 
ATOM   7521  C  C   . SER E  1 142 ? -33.421  109.463 -17.426 1.00 27.56  ? 142 SER E C   1 
ATOM   7522  O  O   . SER E  1 142 ? -32.744  109.937 -18.343 1.00 12.63  ? 142 SER E O   1 
ATOM   7523  C  CB  . SER E  1 142 ? -35.196  111.079 -16.746 1.00 27.87  ? 142 SER E CB  1 
ATOM   7524  O  OG  . SER E  1 142 ? -36.166  110.157 -17.202 1.00 29.46  ? 142 SER E OG  1 
ATOM   7525  N  N   . TRP E  1 143 ? -33.732  108.173 -17.356 1.00 32.33  ? 143 TRP E N   1 
ATOM   7526  C  CA  . TRP E  1 143 ? -33.284  107.247 -18.391 1.00 14.88  ? 143 TRP E CA  1 
ATOM   7527  C  C   . TRP E  1 143 ? -34.157  107.286 -19.644 1.00 23.06  ? 143 TRP E C   1 
ATOM   7528  O  O   . TRP E  1 143 ? -33.629  107.283 -20.762 1.00 26.29  ? 143 TRP E O   1 
ATOM   7529  C  CB  . TRP E  1 143 ? -33.184  105.810 -17.850 1.00 15.46  ? 143 TRP E CB  1 
ATOM   7530  C  CG  . TRP E  1 143 ? -32.297  104.933 -18.686 1.00 20.35  ? 143 TRP E CG  1 
ATOM   7531  C  CD1 . TRP E  1 143 ? -32.672  103.862 -19.440 1.00 27.25  ? 143 TRP E CD1 1 
ATOM   7532  C  CD2 . TRP E  1 143 ? -30.883  105.068 -18.856 1.00 19.89  ? 143 TRP E CD2 1 
ATOM   7533  N  NE1 . TRP E  1 143 ? -31.577  103.323 -20.076 1.00 19.49  ? 143 TRP E NE1 1 
ATOM   7534  C  CE2 . TRP E  1 143 ? -30.468  104.048 -19.732 1.00 24.12  ? 143 TRP E CE2 1 
ATOM   7535  C  CE3 . TRP E  1 143 ? -29.930  105.961 -18.362 1.00 18.17  ? 143 TRP E CE3 1 
ATOM   7536  C  CZ2 . TRP E  1 143 ? -29.138  103.890 -20.115 1.00 35.39  ? 143 TRP E CZ2 1 
ATOM   7537  C  CZ3 . TRP E  1 143 ? -28.614  105.812 -18.754 1.00 16.13  ? 143 TRP E CZ3 1 
ATOM   7538  C  CH2 . TRP E  1 143 ? -28.227  104.782 -19.617 1.00 11.33  ? 143 TRP E CH2 1 
ATOM   7539  N  N   . THR E  1 144 ? -35.480  107.326 -19.466 1.00 13.74  ? 144 THR E N   1 
ATOM   7540  C  CA  . THR E  1 144 ? -36.412  107.239 -20.601 1.00 12.60  ? 144 THR E CA  1 
ATOM   7541  C  C   . THR E  1 144 ? -37.274  108.477 -20.833 1.00 12.31  ? 144 THR E C   1 
ATOM   7542  O  O   . THR E  1 144 ? -37.827  108.640 -21.911 1.00 30.82  ? 144 THR E O   1 
ATOM   7543  C  CB  . THR E  1 144 ? -37.317  105.997 -20.523 1.00 12.87  ? 144 THR E CB  1 
ATOM   7544  O  OG1 . THR E  1 144 ? -38.144  106.083 -19.375 1.00 22.26  ? 144 THR E OG1 1 
ATOM   7545  C  CG2 . THR E  1 144 ? -36.494  104.744 -20.409 1.00 15.47  ? 144 THR E CG2 1 
ATOM   7546  N  N   . HIS E  1 145 ? -37.343  109.370 -19.855 1.00 12.83  ? 145 HIS E N   1 
ATOM   7547  C  CA  . HIS E  1 145 ? -38.146  110.582 -19.976 1.00 12.94  ? 145 HIS E CA  1 
ATOM   7548  C  C   . HIS E  1 145 ? -37.368  111.806 -20.430 1.00 12.19  ? 145 HIS E C   1 
ATOM   7549  O  O   . HIS E  1 145 ? -36.474  112.271 -19.753 1.00 20.00  ? 145 HIS E O   1 
ATOM   7550  C  CB  . HIS E  1 145 ? -38.854  110.895 -18.645 1.00 14.04  ? 145 HIS E CB  1 
ATOM   7551  C  CG  . HIS E  1 145 ? -39.867  109.867 -18.239 1.00 28.77  ? 145 HIS E CG  1 
ATOM   7552  N  ND1 . HIS E  1 145 ? -41.091  109.736 -18.864 1.00 30.72  ? 145 HIS E ND1 1 
ATOM   7553  C  CD2 . HIS E  1 145 ? -39.834  108.912 -17.278 1.00 15.61  ? 145 HIS E CD2 1 
ATOM   7554  C  CE1 . HIS E  1 145 ? -41.772  108.753 -18.301 1.00 28.51  ? 145 HIS E CE1 1 
ATOM   7555  N  NE2 . HIS E  1 145 ? -41.032  108.238 -17.334 1.00 36.81  ? 145 HIS E NE2 1 
ATOM   7556  N  N   . HIS E  1 146 ? -37.728  112.345 -21.581 1.00 11.57  ? 146 HIS E N   1 
ATOM   7557  C  CA  . HIS E  1 146 ? -37.093  113.565 -22.081 1.00 16.09  ? 146 HIS E CA  1 
ATOM   7558  C  C   . HIS E  1 146 ? -37.486  114.846 -21.330 1.00 21.98  ? 146 HIS E C   1 
ATOM   7559  O  O   . HIS E  1 146 ? -38.260  114.810 -20.369 1.00 26.16  ? 146 HIS E O   1 
ATOM   7560  C  CB  . HIS E  1 146 ? -37.346  113.725 -23.585 1.00 16.92  ? 146 HIS E CB  1 
ATOM   7561  C  CG  . HIS E  1 146 ? -38.795  113.732 -23.967 1.00 35.36  ? 146 HIS E CG  1 
ATOM   7562  N  ND1 . HIS E  1 146 ? -39.635  114.791 -23.697 1.00 37.75  ? 146 HIS E ND1 1 
ATOM   7563  C  CD2 . HIS E  1 146 ? -39.552  112.805 -24.605 1.00 24.74  ? 146 HIS E CD2 1 
ATOM   7564  C  CE1 . HIS E  1 146 ? -40.844  114.519 -24.154 1.00 28.23  ? 146 HIS E CE1 1 
ATOM   7565  N  NE2 . HIS E  1 146 ? -40.820  113.318 -24.707 1.00 26.36  ? 146 HIS E NE2 1 
ATOM   7566  N  N   . SER E  1 147 ? -36.960  115.978 -21.791 1.00 19.54  ? 147 SER E N   1 
ATOM   7567  C  CA  . SER E  1 147 ? -37.029  117.233 -21.039 1.00 28.30  ? 147 SER E CA  1 
ATOM   7568  C  C   . SER E  1 147 ? -38.426  117.820 -20.880 1.00 26.68  ? 147 SER E C   1 
ATOM   7569  O  O   . SER E  1 147 ? -38.671  118.637 -19.988 1.00 32.63  ? 147 SER E O   1 
ATOM   7570  C  CB  . SER E  1 147 ? -36.119  118.272 -21.672 1.00 25.16  ? 147 SER E CB  1 
ATOM   7571  O  OG  . SER E  1 147 ? -36.622  118.640 -22.934 1.00 40.22  ? 147 SER E OG  1 
ATOM   7572  N  N   . ARG E  1 148 ? -39.334  117.428 -21.754 1.00 19.80  ? 148 ARG E N   1 
ATOM   7573  C  CA  . ARG E  1 148 ? -40.716  117.891 -21.637 1.00 18.09  ? 148 ARG E CA  1 
ATOM   7574  C  C   . ARG E  1 148 ? -41.544  117.048 -20.640 1.00 42.44  ? 148 ARG E C   1 
ATOM   7575  O  O   . ARG E  1 148 ? -42.677  117.404 -20.307 1.00 33.68  ? 148 ARG E O   1 
ATOM   7576  C  CB  . ARG E  1 148 ? -41.375  117.997 -23.020 1.00 15.58  ? 148 ARG E CB  1 
ATOM   7577  C  CG  . ARG E  1 148 ? -40.717  119.053 -23.919 1.00 23.25  ? 148 ARG E CG  1 
ATOM   7578  C  CD  . ARG E  1 148 ? -41.193  119.050 -25.381 1.00 48.60  ? 148 ARG E CD  1 
ATOM   7579  N  NE  . ARG E  1 148 ? -41.312  117.713 -25.959 1.00 50.24  ? 148 ARG E NE  1 
ATOM   7580  C  CZ  . ARG E  1 148 ? -42.433  117.246 -26.503 1.00 40.17  ? 148 ARG E CZ  1 
ATOM   7581  N  NH1 . ARG E  1 148 ? -43.517  118.013 -26.552 1.00 35.00  ? 148 ARG E NH1 1 
ATOM   7582  N  NH2 . ARG E  1 148 ? -42.475  116.016 -26.991 1.00 25.47  ? 148 ARG E NH2 1 
ATOM   7583  N  N   . GLU E  1 149 ? -40.958  115.957 -20.143 1.00 35.63  ? 149 GLU E N   1 
ATOM   7584  C  CA  . GLU E  1 149 ? -41.615  115.111 -19.152 1.00 19.00  ? 149 GLU E CA  1 
ATOM   7585  C  C   . GLU E  1 149 ? -40.940  115.194 -17.779 1.00 20.26  ? 149 GLU E C   1 
ATOM   7586  O  O   . GLU E  1 149 ? -41.606  115.366 -16.761 1.00 24.23  ? 149 GLU E O   1 
ATOM   7587  C  CB  . GLU E  1 149 ? -41.680  113.661 -19.647 1.00 16.43  ? 149 GLU E CB  1 
ATOM   7588  C  CG  . GLU E  1 149 ? -42.359  113.519 -21.005 1.00 26.19  ? 149 GLU E CG  1 
ATOM   7589  C  CD  . GLU E  1 149 ? -42.529  112.070 -21.460 1.00 33.94  ? 149 GLU E CD  1 
ATOM   7590  O  OE1 . GLU E  1 149 ? -41.647  111.238 -21.143 1.00 28.42  ? 149 GLU E OE1 1 
ATOM   7591  O  OE2 . GLU E  1 149 ? -43.548  111.770 -22.134 1.00 28.37  ? 149 GLU E OE2 1 
ATOM   7592  N  N   . ILE E  1 150 ? -39.619  115.064 -17.753 1.00 25.77  ? 150 ILE E N   1 
ATOM   7593  C  CA  . ILE E  1 150 ? -38.852  115.238 -16.512 1.00 23.77  ? 150 ILE E CA  1 
ATOM   7594  C  C   . ILE E  1 150 ? -37.700  116.227 -16.671 1.00 27.26  ? 150 ILE E C   1 
ATOM   7595  O  O   . ILE E  1 150 ? -36.916  116.151 -17.624 1.00 27.45  ? 150 ILE E O   1 
ATOM   7596  C  CB  . ILE E  1 150 ? -38.260  113.921 -15.977 1.00 17.29  ? 150 ILE E CB  1 
ATOM   7597  C  CG1 . ILE E  1 150 ? -39.360  113.040 -15.386 1.00 17.58  ? 150 ILE E CG1 1 
ATOM   7598  C  CG2 . ILE E  1 150 ? -37.227  114.206 -14.908 1.00 15.21  ? 150 ILE E CG2 1 
ATOM   7599  C  CD1 . ILE E  1 150 ? -38.866  111.762 -14.783 1.00 16.31  ? 150 ILE E CD1 1 
ATOM   7600  N  N   . SER E  1 151 ? -37.612  117.157 -15.729 1.00 17.30  ? 151 SER E N   1 
ATOM   7601  C  CA  . SER E  1 151 ? -36.473  118.040 -15.642 1.00 35.82  ? 151 SER E CA  1 
ATOM   7602  C  C   . SER E  1 151 ? -35.764  117.786 -14.306 1.00 29.43  ? 151 SER E C   1 
ATOM   7603  O  O   . SER E  1 151 ? -36.410  117.596 -13.281 1.00 21.75  ? 151 SER E O   1 
ATOM   7604  C  CB  . SER E  1 151 ? -36.924  119.493 -15.765 1.00 18.94  ? 151 SER E CB  1 
ATOM   7605  O  OG  . SER E  1 151 ? -37.414  119.978 -14.532 1.00 29.15  ? 151 SER E OG  1 
ATOM   7606  N  N   . VAL E  1 152 ? -34.438  117.752 -14.334 1.00 19.88  ? 152 VAL E N   1 
ATOM   7607  C  CA  . VAL E  1 152 ? -33.652  117.553 -13.125 1.00 30.13  ? 152 VAL E CA  1 
ATOM   7608  C  C   . VAL E  1 152 ? -32.887  118.818 -12.796 1.00 29.17  ? 152 VAL E C   1 
ATOM   7609  O  O   . VAL E  1 152 ? -32.388  119.493 -13.689 1.00 27.16  ? 152 VAL E O   1 
ATOM   7610  C  CB  . VAL E  1 152 ? -32.621  116.429 -13.288 1.00 21.90  ? 152 VAL E CB  1 
ATOM   7611  C  CG1 . VAL E  1 152 ? -33.308  115.068 -13.249 1.00 25.49  ? 152 VAL E CG1 1 
ATOM   7612  C  CG2 . VAL E  1 152 ? -31.854  116.627 -14.585 1.00 28.78  ? 152 VAL E CG2 1 
ATOM   7613  N  N   . ASP E  1 153 ? -32.802  119.137 -11.513 1.00 32.94  ? 153 ASP E N   1 
ATOM   7614  C  CA  . ASP E  1 153 ? -32.080  120.309 -11.072 1.00 24.05  ? 153 ASP E CA  1 
ATOM   7615  C  C   . ASP E  1 153 ? -31.428  120.036 -9.737  1.00 30.27  ? 153 ASP E C   1 
ATOM   7616  O  O   . ASP E  1 153 ? -31.944  119.272 -8.933  1.00 39.51  ? 153 ASP E O   1 
ATOM   7617  C  CB  . ASP E  1 153 ? -33.017  121.511 -10.960 1.00 20.15  ? 153 ASP E CB  1 
ATOM   7618  C  CG  . ASP E  1 153 ? -33.204  122.222 -12.276 1.00 52.15  ? 153 ASP E CG  1 
ATOM   7619  O  OD1 . ASP E  1 153 ? -34.134  121.864 -13.023 1.00 57.80  ? 153 ASP E OD1 1 
ATOM   7620  O  OD2 . ASP E  1 153 ? -32.418  123.142 -12.573 1.00 61.68  ? 153 ASP E OD2 1 
ATOM   7621  N  N   . PRO E  1 154 ? -30.272  120.661 -9.501  1.00 38.15  ? 154 PRO E N   1 
ATOM   7622  C  CA  . PRO E  1 154 ? -29.577  120.570 -8.214  1.00 41.14  ? 154 PRO E CA  1 
ATOM   7623  C  C   . PRO E  1 154 ? -30.348  121.331 -7.141  1.00 49.69  ? 154 PRO E C   1 
ATOM   7624  O  O   . PRO E  1 154 ? -31.348  121.984 -7.445  1.00 39.49  ? 154 PRO E O   1 
ATOM   7625  C  CB  . PRO E  1 154 ? -28.241  121.272 -8.484  1.00 30.65  ? 154 PRO E CB  1 
ATOM   7626  C  CG  . PRO E  1 154 ? -28.114  121.305 -9.980  1.00 42.80  ? 154 PRO E CG  1 
ATOM   7627  C  CD  . PRO E  1 154 ? -29.506  121.432 -10.487 1.00 26.09  ? 154 PRO E CD  1 
ATOM   7628  N  N   . THR E  1 155 ? -29.882  121.254 -5.900  1.00 61.48  ? 155 THR E N   1 
ATOM   7629  C  CA  . THR E  1 155 ? -30.462  122.044 -4.822  1.00 58.80  ? 155 THR E CA  1 
ATOM   7630  C  C   . THR E  1 155 ? -29.429  122.951 -4.141  1.00 63.09  ? 155 THR E C   1 
ATOM   7631  O  O   . THR E  1 155 ? -28.587  122.496 -3.361  1.00 64.83  ? 155 THR E O   1 
ATOM   7632  C  CB  . THR E  1 155 ? -31.170  121.146 -3.794  1.00 67.28  ? 155 THR E CB  1 
ATOM   7633  O  OG1 . THR E  1 155 ? -30.694  119.798 -3.925  1.00 55.38  ? 155 THR E OG1 1 
ATOM   7634  C  CG2 . THR E  1 155 ? -32.672  121.167 -4.039  1.00 69.41  ? 155 THR E CG2 1 
ATOM   7635  N  N   . ASP E  1 161 ? -20.007  119.974 2.056   1.00 55.80  ? 161 ASP E N   1 
ATOM   7636  C  CA  . ASP E  1 161 ? -19.388  119.028 1.130   1.00 64.18  ? 161 ASP E CA  1 
ATOM   7637  C  C   . ASP E  1 161 ? -19.187  117.728 1.867   1.00 51.44  ? 161 ASP E C   1 
ATOM   7638  O  O   . ASP E  1 161 ? -19.345  116.630 1.319   1.00 19.52  ? 161 ASP E O   1 
ATOM   7639  C  CB  . ASP E  1 161 ? -18.009  119.525 0.681   1.00 73.44  ? 161 ASP E CB  1 
ATOM   7640  C  CG  . ASP E  1 161 ? -17.978  121.020 0.399   1.00 94.05  ? 161 ASP E CG  1 
ATOM   7641  O  OD1 . ASP E  1 161 ? -19.047  121.585 0.069   1.00 98.15  ? 161 ASP E OD1 1 
ATOM   7642  O  OD2 . ASP E  1 161 ? -16.880  121.623 0.506   1.00 82.06  ? 161 ASP E OD2 1 
ATOM   7643  N  N   . SER E  1 162 ? -18.838  117.885 3.138   1.00 63.37  ? 162 SER E N   1 
ATOM   7644  C  CA  . SER E  1 162 ? -18.345  116.796 3.960   1.00 72.59  ? 162 SER E CA  1 
ATOM   7645  C  C   . SER E  1 162 ? -19.209  116.639 5.190   1.00 62.62  ? 162 SER E C   1 
ATOM   7646  O  O   . SER E  1 162 ? -18.837  115.941 6.131   1.00 66.18  ? 162 SER E O   1 
ATOM   7647  C  CB  . SER E  1 162 ? -16.902  117.082 4.394   1.00 73.30  ? 162 SER E CB  1 
ATOM   7648  O  OG  . SER E  1 162 ? -16.025  117.161 3.275   1.00 78.14  ? 162 SER E OG  1 
ATOM   7649  N  N   . GLU E  1 163 ? -20.362  117.290 5.191   1.00 46.73  ? 163 GLU E N   1 
ATOM   7650  C  CA  . GLU E  1 163 ? -21.178  117.310 6.395   1.00 51.29  ? 163 GLU E CA  1 
ATOM   7651  C  C   . GLU E  1 163 ? -21.432  115.905 6.942   1.00 51.32  ? 163 GLU E C   1 
ATOM   7652  O  O   . GLU E  1 163 ? -21.357  115.682 8.148   1.00 46.83  ? 163 GLU E O   1 
ATOM   7653  C  CB  . GLU E  1 163 ? -22.494  118.044 6.155   1.00 62.69  ? 163 GLU E CB  1 
ATOM   7654  C  CG  . GLU E  1 163 ? -23.276  118.289 7.435   1.00 75.10  ? 163 GLU E CG  1 
ATOM   7655  C  CD  . GLU E  1 163 ? -24.724  118.641 7.170   1.00 86.54  ? 163 GLU E CD  1 
ATOM   7656  O  OE1 . GLU E  1 163 ? -25.066  118.958 6.008   1.00 88.38  ? 163 GLU E OE1 1 
ATOM   7657  O  OE2 . GLU E  1 163 ? -25.525  118.590 8.127   1.00 89.89  ? 163 GLU E OE2 1 
ATOM   7658  N  N   . TYR E  1 164 ? -21.720  114.956 6.056   1.00 40.42  ? 164 TYR E N   1 
ATOM   7659  C  CA  . TYR E  1 164 ? -21.991  113.589 6.482   1.00 24.82  ? 164 TYR E CA  1 
ATOM   7660  C  C   . TYR E  1 164 ? -20.857  112.632 6.127   1.00 37.20  ? 164 TYR E C   1 
ATOM   7661  O  O   . TYR E  1 164 ? -21.029  111.407 6.189   1.00 36.46  ? 164 TYR E O   1 
ATOM   7662  C  CB  . TYR E  1 164 ? -23.297  113.071 5.856   1.00 49.20  ? 164 TYR E CB  1 
ATOM   7663  C  CG  . TYR E  1 164 ? -24.505  113.960 6.063   1.00 51.85  ? 164 TYR E CG  1 
ATOM   7664  C  CD1 . TYR E  1 164 ? -24.869  114.395 7.330   1.00 51.83  ? 164 TYR E CD1 1 
ATOM   7665  C  CD2 . TYR E  1 164 ? -25.283  114.359 4.983   1.00 49.87  ? 164 TYR E CD2 1 
ATOM   7666  C  CE1 . TYR E  1 164 ? -25.967  115.210 7.513   1.00 59.62  ? 164 TYR E CE1 1 
ATOM   7667  C  CE2 . TYR E  1 164 ? -26.381  115.176 5.152   1.00 54.48  ? 164 TYR E CE2 1 
ATOM   7668  C  CZ  . TYR E  1 164 ? -26.717  115.601 6.416   1.00 59.70  ? 164 TYR E CZ  1 
ATOM   7669  O  OH  . TYR E  1 164 ? -27.809  116.419 6.581   1.00 57.53  ? 164 TYR E OH  1 
ATOM   7670  N  N   . PHE E  1 165 ? -19.699  113.174 5.751   1.00 39.23  ? 165 PHE E N   1 
ATOM   7671  C  CA  . PHE E  1 165 ? -18.614  112.335 5.243   1.00 25.10  ? 165 PHE E CA  1 
ATOM   7672  C  C   . PHE E  1 165 ? -17.836  111.659 6.367   1.00 27.20  ? 165 PHE E C   1 
ATOM   7673  O  O   . PHE E  1 165 ? -17.472  112.299 7.344   1.00 27.08  ? 165 PHE E O   1 
ATOM   7674  C  CB  . PHE E  1 165 ? -17.677  113.151 4.372   1.00 19.91  ? 165 PHE E CB  1 
ATOM   7675  C  CG  . PHE E  1 165 ? -16.770  112.319 3.528   1.00 27.93  ? 165 PHE E CG  1 
ATOM   7676  C  CD1 . PHE E  1 165 ? -17.269  111.629 2.437   1.00 31.72  ? 165 PHE E CD1 1 
ATOM   7677  C  CD2 . PHE E  1 165 ? -15.422  112.224 3.817   1.00 13.91  ? 165 PHE E CD2 1 
ATOM   7678  C  CE1 . PHE E  1 165 ? -16.441  110.858 1.648   1.00 29.53  ? 165 PHE E CE1 1 
ATOM   7679  C  CE2 . PHE E  1 165 ? -14.590  111.457 3.040   1.00 24.86  ? 165 PHE E CE2 1 
ATOM   7680  C  CZ  . PHE E  1 165 ? -15.098  110.766 1.950   1.00 28.61  ? 165 PHE E CZ  1 
ATOM   7681  N  N   . SER E  1 166 ? -17.576  110.366 6.207   1.00 20.86  ? 166 SER E N   1 
ATOM   7682  C  CA  . SER E  1 166 ? -16.853  109.583 7.213   1.00 20.86  ? 166 SER E CA  1 
ATOM   7683  C  C   . SER E  1 166 ? -15.443  110.087 7.520   1.00 29.68  ? 166 SER E C   1 
ATOM   7684  O  O   . SER E  1 166 ? -14.582  110.179 6.640   1.00 29.21  ? 166 SER E O   1 
ATOM   7685  C  CB  . SER E  1 166 ? -16.786  108.109 6.802   1.00 16.05  ? 166 SER E CB  1 
ATOM   7686  O  OG  . SER E  1 166 ? -16.101  107.344 7.777   1.00 30.03  ? 166 SER E OG  1 
ATOM   7687  N  N   . GLN E  1 167 ? -15.204  110.388 8.787   1.00 29.46  ? 167 GLN E N   1 
ATOM   7688  C  CA  . GLN E  1 167 ? -13.888  110.814 9.218   1.00 25.80  ? 167 GLN E CA  1 
ATOM   7689  C  C   . GLN E  1 167 ? -12.886  109.661 9.092   1.00 33.16  ? 167 GLN E C   1 
ATOM   7690  O  O   . GLN E  1 167 ? -11.683  109.877 9.135   1.00 33.67  ? 167 GLN E O   1 
ATOM   7691  C  CB  . GLN E  1 167 ? -13.952  111.306 10.660  1.00 15.90  ? 167 GLN E CB  1 
ATOM   7692  C  CG  . GLN E  1 167 ? -14.365  110.214 11.641  1.00 44.46  ? 167 GLN E CG  1 
ATOM   7693  C  CD  . GLN E  1 167 ? -14.581  110.732 13.050  1.00 49.61  ? 167 GLN E CD  1 
ATOM   7694  O  OE1 . GLN E  1 167 ? -15.684  110.656 13.586  1.00 47.07  ? 167 GLN E OE1 1 
ATOM   7695  N  NE2 . GLN E  1 167 ? -13.524  111.258 13.657  1.00 52.27  ? 167 GLN E NE2 1 
ATOM   7696  N  N   . TYR E  1 168 ? -13.380  108.439 8.924   1.00 29.25  ? 168 TYR E N   1 
ATOM   7697  C  CA  . TYR E  1 168 ? -12.497  107.277 8.924   1.00 18.38  ? 168 TYR E CA  1 
ATOM   7698  C  C   . TYR E  1 168 ? -12.137  106.796 7.540   1.00 24.35  ? 168 TYR E C   1 
ATOM   7699  O  O   . TYR E  1 168 ? -11.440  105.795 7.400   1.00 27.81  ? 168 TYR E O   1 
ATOM   7700  C  CB  . TYR E  1 168 ? -13.094  106.136 9.751   1.00 22.47  ? 168 TYR E CB  1 
ATOM   7701  C  CG  . TYR E  1 168 ? -13.415  106.572 11.160  1.00 38.48  ? 168 TYR E CG  1 
ATOM   7702  C  CD1 . TYR E  1 168 ? -12.406  106.955 12.037  1.00 20.84  ? 168 TYR E CD1 1 
ATOM   7703  C  CD2 . TYR E  1 168 ? -14.729  106.624 11.611  1.00 25.78  ? 168 TYR E CD2 1 
ATOM   7704  C  CE1 . TYR E  1 168 ? -12.701  107.367 13.323  1.00 25.83  ? 168 TYR E CE1 1 
ATOM   7705  C  CE2 . TYR E  1 168 ? -15.029  107.034 12.897  1.00 17.73  ? 168 TYR E CE2 1 
ATOM   7706  C  CZ  . TYR E  1 168 ? -14.014  107.407 13.742  1.00 31.34  ? 168 TYR E CZ  1 
ATOM   7707  O  OH  . TYR E  1 168 ? -14.319  107.819 15.011  1.00 38.94  ? 168 TYR E OH  1 
ATOM   7708  N  N   . SER E  1 169 ? -12.617  107.501 6.520   1.00 32.13  ? 169 SER E N   1 
ATOM   7709  C  CA  . SER E  1 169 ? -12.221  107.209 5.148   1.00 24.61  ? 169 SER E CA  1 
ATOM   7710  C  C   . SER E  1 169 ? -10.728  107.482 4.945   1.00 32.17  ? 169 SER E C   1 
ATOM   7711  O  O   . SER E  1 169 ? -10.148  108.329 5.618   1.00 20.74  ? 169 SER E O   1 
ATOM   7712  C  CB  . SER E  1 169 ? -13.027  108.061 4.165   1.00 32.01  ? 169 SER E CB  1 
ATOM   7713  O  OG  . SER E  1 169 ? -12.566  107.878 2.830   1.00 33.45  ? 169 SER E OG  1 
ATOM   7714  N  N   . ARG E  1 170 ? -10.112  106.754 4.015   1.00 29.86  ? 170 ARG E N   1 
ATOM   7715  C  CA  A ARG E  1 170 ? -8.745   107.031 3.587   0.50 25.59  ? 170 ARG E CA  1 
ATOM   7716  C  CA  B ARG E  1 170 ? -8.739   107.035 3.612   0.50 25.63  ? 170 ARG E CA  1 
ATOM   7717  C  C   . ARG E  1 170 ? -8.666   108.380 2.882   1.00 24.63  ? 170 ARG E C   1 
ATOM   7718  O  O   . ARG E  1 170 ? -7.594   108.945 2.707   1.00 32.50  ? 170 ARG E O   1 
ATOM   7719  C  CB  A ARG E  1 170 ? -8.251   105.932 2.642   0.50 12.42  ? 170 ARG E CB  1 
ATOM   7720  C  CB  B ARG E  1 170 ? -8.180   105.897 2.737   0.50 13.48  ? 170 ARG E CB  1 
ATOM   7721  C  CG  A ARG E  1 170 ? -7.696   104.711 3.350   0.50 17.50  ? 170 ARG E CG  1 
ATOM   7722  C  CG  B ARG E  1 170 ? -7.225   104.950 3.484   0.50 11.21  ? 170 ARG E CG  1 
ATOM   7723  C  CD  A ARG E  1 170 ? -7.357   103.621 2.358   0.50 24.38  ? 170 ARG E CD  1 
ATOM   7724  C  CD  B ARG E  1 170 ? -6.926   103.663 2.707   0.50 11.64  ? 170 ARG E CD  1 
ATOM   7725  N  NE  A ARG E  1 170 ? -8.547   103.166 1.642   0.50 35.09  ? 170 ARG E NE  1 
ATOM   7726  N  NE  B ARG E  1 170 ? -5.509   103.394 2.415   0.50 14.92  ? 170 ARG E NE  1 
ATOM   7727  C  CZ  A ARG E  1 170 ? -8.519   102.348 0.599   0.50 38.28  ? 170 ARG E CZ  1 
ATOM   7728  C  CZ  B ARG E  1 170 ? -4.467   104.161 2.755   0.50 36.25  ? 170 ARG E CZ  1 
ATOM   7729  N  NH1 A ARG E  1 170 ? -7.352   101.901 0.145   0.50 9.63   ? 170 ARG E NH1 1 
ATOM   7730  N  NH1 B ARG E  1 170 ? -4.617   105.298 3.428   0.50 8.53   ? 170 ARG E NH1 1 
ATOM   7731  N  NH2 A ARG E  1 170 ? -9.652   101.987 0.015   0.50 10.48  ? 170 ARG E NH2 1 
ATOM   7732  N  NH2 B ARG E  1 170 ? -3.246   103.779 2.412   0.50 8.79   ? 170 ARG E NH2 1 
ATOM   7733  N  N   . PHE E  1 171 ? -9.815   108.890 2.469   1.00 23.98  ? 171 PHE E N   1 
ATOM   7734  C  CA  . PHE E  1 171 ? -9.847   110.100 1.673   1.00 20.20  ? 171 PHE E CA  1 
ATOM   7735  C  C   . PHE E  1 171 ? -10.588  111.240 2.343   1.00 20.09  ? 171 PHE E C   1 
ATOM   7736  O  O   . PHE E  1 171 ? -11.246  111.056 3.371   1.00 24.64  ? 171 PHE E O   1 
ATOM   7737  C  CB  . PHE E  1 171 ? -10.465  109.793 0.320   1.00 11.77  ? 171 PHE E CB  1 
ATOM   7738  C  CG  . PHE E  1 171 ? -9.892   108.576 -0.329  1.00 13.31  ? 171 PHE E CG  1 
ATOM   7739  C  CD1 . PHE E  1 171 ? -10.296  107.313 0.046   1.00 15.54  ? 171 PHE E CD1 1 
ATOM   7740  C  CD2 . PHE E  1 171 ? -8.939   108.699 -1.316  1.00 26.39  ? 171 PHE E CD2 1 
ATOM   7741  C  CE1 . PHE E  1 171 ? -9.762   106.191 -0.557  1.00 28.28  ? 171 PHE E CE1 1 
ATOM   7742  C  CE2 . PHE E  1 171 ? -8.399   107.589 -1.917  1.00 23.21  ? 171 PHE E CE2 1 
ATOM   7743  C  CZ  . PHE E  1 171 ? -8.812   106.330 -1.539  1.00 22.82  ? 171 PHE E CZ  1 
ATOM   7744  N  N   . GLU E  1 172 ? -10.452  112.423 1.753   1.00 23.98  ? 172 GLU E N   1 
ATOM   7745  C  CA  . GLU E  1 172 ? -11.168  113.602 2.212   1.00 30.87  ? 172 GLU E CA  1 
ATOM   7746  C  C   . GLU E  1 172 ? -11.761  114.358 1.020   1.00 34.55  ? 172 GLU E C   1 
ATOM   7747  O  O   . GLU E  1 172 ? -11.265  114.268 -0.101  1.00 36.00  ? 172 GLU E O   1 
ATOM   7748  C  CB  . GLU E  1 172 ? -10.242  114.495 3.027   1.00 14.01  ? 172 GLU E CB  1 
ATOM   7749  C  CG  . GLU E  1 172 ? -8.994   114.934 2.295   1.00 41.93  ? 172 GLU E CG  1 
ATOM   7750  C  CD  . GLU E  1 172 ? -8.031   115.713 3.183   1.00 48.28  ? 172 GLU E CD  1 
ATOM   7751  O  OE1 . GLU E  1 172 ? -8.389   116.026 4.341   1.00 42.97  ? 172 GLU E OE1 1 
ATOM   7752  O  OE2 . GLU E  1 172 ? -6.911   116.009 2.717   1.00 45.10  ? 172 GLU E OE2 1 
ATOM   7753  N  N   . ILE E  1 173 ? -12.830  115.095 1.264   1.00 21.24  ? 173 ILE E N   1 
ATOM   7754  C  CA  . ILE E  1 173 ? -13.463  115.840 0.196   1.00 21.71  ? 173 ILE E CA  1 
ATOM   7755  C  C   . ILE E  1 173 ? -12.984  117.281 0.178   1.00 24.73  ? 173 ILE E C   1 
ATOM   7756  O  O   . ILE E  1 173 ? -13.070  117.981 1.179   1.00 30.07  ? 173 ILE E O   1 
ATOM   7757  C  CB  . ILE E  1 173 ? -15.000  115.797 0.317   1.00 25.03  ? 173 ILE E CB  1 
ATOM   7758  C  CG1 . ILE E  1 173 ? -15.503  114.361 0.128   1.00 19.64  ? 173 ILE E CG1 1 
ATOM   7759  C  CG2 . ILE E  1 173 ? -15.609  116.726 -0.698  1.00 14.00  ? 173 ILE E CG2 1 
ATOM   7760  C  CD1 . ILE E  1 173 ? -16.969  114.219 0.288   1.00 35.23  ? 173 ILE E CD1 1 
ATOM   7761  N  N   . LEU E  1 174 ? -12.473  117.723 -0.963  1.00 26.47  ? 174 LEU E N   1 
ATOM   7762  C  CA  . LEU E  1 174 ? -12.034  119.101 -1.096  1.00 25.66  ? 174 LEU E CA  1 
ATOM   7763  C  C   . LEU E  1 174 ? -13.194  120.001 -1.528  1.00 30.88  ? 174 LEU E C   1 
ATOM   7764  O  O   . LEU E  1 174 ? -13.377  121.098 -1.010  1.00 34.49  ? 174 LEU E O   1 
ATOM   7765  C  CB  . LEU E  1 174 ? -10.862  119.190 -2.078  1.00 27.05  ? 174 LEU E CB  1 
ATOM   7766  C  CG  . LEU E  1 174 ? -9.692   118.246 -1.766  1.00 38.40  ? 174 LEU E CG  1 
ATOM   7767  C  CD1 . LEU E  1 174 ? -8.610   118.317 -2.831  1.00 21.57  ? 174 LEU E CD1 1 
ATOM   7768  C  CD2 . LEU E  1 174 ? -9.107   118.523 -0.379  1.00 22.88  ? 174 LEU E CD2 1 
ATOM   7769  N  N   . ASP E  1 175 ? -13.991  119.523 -2.470  1.00 28.94  ? 175 ASP E N   1 
ATOM   7770  C  CA  . ASP E  1 175 ? -15.096  120.322 -2.965  1.00 35.32  ? 175 ASP E CA  1 
ATOM   7771  C  C   . ASP E  1 175 ? -16.107  119.447 -3.696  1.00 31.25  ? 175 ASP E C   1 
ATOM   7772  O  O   . ASP E  1 175 ? -15.764  118.377 -4.202  1.00 35.53  ? 175 ASP E O   1 
ATOM   7773  C  CB  . ASP E  1 175 ? -14.574  121.421 -3.895  1.00 29.96  ? 175 ASP E CB  1 
ATOM   7774  C  CG  . ASP E  1 175 ? -15.551  122.565 -4.056  1.00 44.03  ? 175 ASP E CG  1 
ATOM   7775  O  OD1 . ASP E  1 175 ? -16.422  122.736 -3.177  1.00 49.93  ? 175 ASP E OD1 1 
ATOM   7776  O  OD2 . ASP E  1 175 ? -15.436  123.300 -5.060  1.00 55.42  ? 175 ASP E OD2 1 
ATOM   7777  N  N   . VAL E  1 176 ? -17.359  119.901 -3.722  1.00 29.91  ? 176 VAL E N   1 
ATOM   7778  C  CA  . VAL E  1 176 ? -18.393  119.293 -4.551  1.00 23.79  ? 176 VAL E CA  1 
ATOM   7779  C  C   . VAL E  1 176 ? -19.121  120.389 -5.317  1.00 26.56  ? 176 VAL E C   1 
ATOM   7780  O  O   . VAL E  1 176 ? -19.639  121.320 -4.720  1.00 31.84  ? 176 VAL E O   1 
ATOM   7781  C  CB  . VAL E  1 176 ? -19.404  118.500 -3.726  1.00 15.72  ? 176 VAL E CB  1 
ATOM   7782  C  CG1 . VAL E  1 176 ? -20.362  117.800 -4.657  1.00 19.03  ? 176 VAL E CG1 1 
ATOM   7783  C  CG2 . VAL E  1 176 ? -18.703  117.484 -2.857  1.00 13.22  ? 176 VAL E CG2 1 
ATOM   7784  N  N   . THR E  1 177 ? -19.136  120.296 -6.638  1.00 23.04  ? 177 THR E N   1 
ATOM   7785  C  CA  . THR E  1 177 ? -19.897  121.234 -7.443  1.00 35.31  ? 177 THR E CA  1 
ATOM   7786  C  C   . THR E  1 177 ? -20.918  120.488 -8.287  1.00 38.46  ? 177 THR E C   1 
ATOM   7787  O  O   . THR E  1 177 ? -20.709  119.333 -8.650  1.00 49.45  ? 177 THR E O   1 
ATOM   7788  C  CB  . THR E  1 177 ? -18.999  122.082 -8.365  1.00 42.08  ? 177 THR E CB  1 
ATOM   7789  O  OG1 . THR E  1 177 ? -18.293  121.231 -9.278  1.00 42.35  ? 177 THR E OG1 1 
ATOM   7790  C  CG2 . THR E  1 177 ? -18.012  122.896 -7.549  1.00 22.03  ? 177 THR E CG2 1 
ATOM   7791  N  N   . GLN E  1 178 ? -22.015  121.159 -8.605  1.00 19.83  ? 178 GLN E N   1 
ATOM   7792  C  CA  . GLN E  1 178 ? -23.095  120.541 -9.350  1.00 35.33  ? 178 GLN E CA  1 
ATOM   7793  C  C   . GLN E  1 178 ? -23.398  121.360 -10.606 1.00 44.30  ? 178 GLN E C   1 
ATOM   7794  O  O   . GLN E  1 178 ? -23.576  122.573 -10.533 1.00 53.29  ? 178 GLN E O   1 
ATOM   7795  C  CB  . GLN E  1 178 ? -24.350  120.411 -8.458  1.00 33.49  ? 178 GLN E CB  1 
ATOM   7796  C  CG  . GLN E  1 178 ? -24.066  119.811 -7.081  1.00 47.74  ? 178 GLN E CG  1 
ATOM   7797  C  CD  . GLN E  1 178 ? -25.153  118.854 -6.600  1.00 75.17  ? 178 GLN E CD  1 
ATOM   7798  O  OE1 . GLN E  1 178 ? -26.331  119.020 -6.926  1.00 71.25  ? 178 GLN E OE1 1 
ATOM   7799  N  NE2 . GLN E  1 178 ? -24.757  117.845 -5.820  1.00 63.48  ? 178 GLN E NE2 1 
ATOM   7800  N  N   . LYS E  1 179 ? -23.449  120.698 -11.757 1.00 47.54  ? 179 LYS E N   1 
ATOM   7801  C  CA  . LYS E  1 179 ? -23.802  121.358 -13.015 1.00 40.58  ? 179 LYS E CA  1 
ATOM   7802  C  C   . LYS E  1 179 ? -24.971  120.625 -13.711 1.00 34.62  ? 179 LYS E C   1 
ATOM   7803  O  O   . LYS E  1 179 ? -24.987  119.394 -13.738 1.00 49.23  ? 179 LYS E O   1 
ATOM   7804  C  CB  . LYS E  1 179 ? -22.570  121.422 -13.929 1.00 35.05  ? 179 LYS E CB  1 
ATOM   7805  C  CG  . LYS E  1 179 ? -22.801  122.158 -15.223 1.00 53.67  ? 179 LYS E CG  1 
ATOM   7806  C  CD  . LYS E  1 179 ? -21.677  121.956 -16.213 1.00 59.30  ? 179 LYS E CD  1 
ATOM   7807  C  CE  . LYS E  1 179 ? -21.974  122.677 -17.536 1.00 68.92  ? 179 LYS E CE  1 
ATOM   7808  N  NZ  . LYS E  1 179 ? -20.894  122.492 -18.557 1.00 69.16  ? 179 LYS E NZ  1 
ATOM   7809  N  N   . LYS E  1 180 ? -25.938  121.382 -14.262 1.00 34.87  ? 180 LYS E N   1 
ATOM   7810  C  CA  . LYS E  1 180 ? -27.123  120.843 -14.993 1.00 36.06  ? 180 LYS E CA  1 
ATOM   7811  C  C   . LYS E  1 180 ? -27.008  120.921 -16.527 1.00 28.28  ? 180 LYS E C   1 
ATOM   7812  O  O   . LYS E  1 180 ? -26.565  121.939 -17.072 1.00 31.47  ? 180 LYS E O   1 
ATOM   7813  C  CB  . LYS E  1 180 ? -28.403  121.569 -14.549 1.00 20.11  ? 180 LYS E CB  1 
ATOM   7814  C  CG  . LYS E  1 180 ? -29.590  121.409 -15.484 1.00 37.03  ? 180 LYS E CG  1 
ATOM   7815  C  CD  . LYS E  1 180 ? -30.667  122.429 -15.129 1.00 57.90  ? 180 LYS E CD  1 
ATOM   7816  C  CE  . LYS E  1 180 ? -31.800  122.449 -16.144 1.00 50.28  ? 180 LYS E CE  1 
ATOM   7817  N  NZ  . LYS E  1 180 ? -32.561  121.187 -16.120 1.00 41.73  ? 180 LYS E NZ  1 
ATOM   7818  N  N   . ASN E  1 181 ? -27.408  119.851 -17.218 1.00 28.33  ? 181 ASN E N   1 
ATOM   7819  C  CA  . ASN E  1 181 ? -27.241  119.778 -18.675 1.00 19.06  ? 181 ASN E CA  1 
ATOM   7820  C  C   . ASN E  1 181 ? -28.452  119.265 -19.423 1.00 34.68  ? 181 ASN E C   1 
ATOM   7821  O  O   . ASN E  1 181 ? -29.298  118.556 -18.866 1.00 35.17  ? 181 ASN E O   1 
ATOM   7822  C  CB  . ASN E  1 181 ? -26.072  118.882 -19.052 1.00 29.39  ? 181 ASN E CB  1 
ATOM   7823  C  CG  . ASN E  1 181 ? -24.788  119.281 -18.376 1.00 32.12  ? 181 ASN E CG  1 
ATOM   7824  O  OD1 . ASN E  1 181 ? -24.150  120.270 -18.751 1.00 41.93  ? 181 ASN E OD1 1 
ATOM   7825  N  ND2 . ASN E  1 181 ? -24.388  118.503 -17.373 1.00 27.75  ? 181 ASN E ND2 1 
ATOM   7826  N  N   . SER E  1 182 ? -28.511  119.615 -20.703 1.00 30.03  ? 182 SER E N   1 
ATOM   7827  C  CA  . SER E  1 182 ? -29.550  119.116 -21.577 1.00 22.67  ? 182 SER E CA  1 
ATOM   7828  C  C   . SER E  1 182 ? -28.836  118.534 -22.773 1.00 28.90  ? 182 SER E C   1 
ATOM   7829  O  O   . SER E  1 182 ? -28.100  119.237 -23.460 1.00 31.95  ? 182 SER E O   1 
ATOM   7830  C  CB  . SER E  1 182 ? -30.486  120.247 -21.999 1.00 22.46  ? 182 SER E CB  1 
ATOM   7831  O  OG  . SER E  1 182 ? -31.682  119.743 -22.580 1.00 46.46  ? 182 SER E OG  1 
ATOM   7832  N  N   . VAL E  1 183 ? -29.037  117.245 -23.013 1.00 18.70  ? 183 VAL E N   1 
ATOM   7833  C  CA  . VAL E  1 183 ? -28.260  116.549 -24.023 1.00 25.85  ? 183 VAL E CA  1 
ATOM   7834  C  C   . VAL E  1 183 ? -29.139  115.833 -25.040 1.00 34.22  ? 183 VAL E C   1 
ATOM   7835  O  O   . VAL E  1 183 ? -30.127  115.200 -24.687 1.00 34.73  ? 183 VAL E O   1 
ATOM   7836  C  CB  . VAL E  1 183 ? -27.354  115.485 -23.381 1.00 40.67  ? 183 VAL E CB  1 
ATOM   7837  C  CG1 . VAL E  1 183 ? -26.606  114.707 -24.464 1.00 19.31  ? 183 VAL E CG1 1 
ATOM   7838  C  CG2 . VAL E  1 183 ? -26.402  116.120 -22.388 1.00 18.97  ? 183 VAL E CG2 1 
ATOM   7839  N  N   . THR E  1 184 ? -28.763  115.913 -26.307 1.00 46.82  ? 184 THR E N   1 
ATOM   7840  C  CA  . THR E  1 184 ? -29.471  115.172 -27.340 1.00 39.87  ? 184 THR E CA  1 
ATOM   7841  C  C   . THR E  1 184 ? -28.665  113.941 -27.720 1.00 37.49  ? 184 THR E C   1 
ATOM   7842  O  O   . THR E  1 184 ? -27.491  114.042 -28.078 1.00 49.40  ? 184 THR E O   1 
ATOM   7843  C  CB  . THR E  1 184 ? -29.726  116.042 -28.577 1.00 35.65  ? 184 THR E CB  1 
ATOM   7844  O  OG1 . THR E  1 184 ? -30.384  117.251 -28.176 1.00 39.25  ? 184 THR E OG1 1 
ATOM   7845  C  CG2 . THR E  1 184 ? -30.590  115.304 -29.570 1.00 20.15  ? 184 THR E CG2 1 
ATOM   7846  N  N   . TYR E  1 185 ? -29.298  112.782 -27.615 1.00 38.70  ? 185 TYR E N   1 
ATOM   7847  C  CA  . TYR E  1 185 ? -28.638  111.529 -27.933 1.00 40.37  ? 185 TYR E CA  1 
ATOM   7848  C  C   . TYR E  1 185 ? -29.047  111.042 -29.332 1.00 53.30  ? 185 TYR E C   1 
ATOM   7849  O  O   . TYR E  1 185 ? -30.141  111.352 -29.815 1.00 57.18  ? 185 TYR E O   1 
ATOM   7850  C  CB  . TYR E  1 185 ? -28.948  110.481 -26.857 1.00 37.26  ? 185 TYR E CB  1 
ATOM   7851  C  CG  . TYR E  1 185 ? -28.497  110.895 -25.478 1.00 30.16  ? 185 TYR E CG  1 
ATOM   7852  C  CD1 . TYR E  1 185 ? -29.215  111.820 -24.738 1.00 34.73  ? 185 TYR E CD1 1 
ATOM   7853  C  CD2 . TYR E  1 185 ? -27.346  110.377 -24.924 1.00 35.72  ? 185 TYR E CD2 1 
ATOM   7854  C  CE1 . TYR E  1 185 ? -28.801  112.213 -23.491 1.00 34.47  ? 185 TYR E CE1 1 
ATOM   7855  C  CE2 . TYR E  1 185 ? -26.923  110.759 -23.661 1.00 35.88  ? 185 TYR E CE2 1 
ATOM   7856  C  CZ  . TYR E  1 185 ? -27.651  111.679 -22.953 1.00 36.87  ? 185 TYR E CZ  1 
ATOM   7857  O  OH  . TYR E  1 185 ? -27.234  112.066 -21.698 1.00 36.48  ? 185 TYR E OH  1 
ATOM   7858  N  N   . SER E  1 186 ? -28.155  110.295 -29.977 1.00 58.09  ? 186 SER E N   1 
ATOM   7859  C  CA  . SER E  1 186 ? -28.370  109.821 -31.342 1.00 55.56  ? 186 SER E CA  1 
ATOM   7860  C  C   . SER E  1 186 ? -29.684  109.087 -31.502 1.00 63.95  ? 186 SER E C   1 
ATOM   7861  O  O   . SER E  1 186 ? -30.366  109.231 -32.522 1.00 62.54  ? 186 SER E O   1 
ATOM   7862  C  CB  . SER E  1 186 ? -27.235  108.891 -31.775 1.00 59.69  ? 186 SER E CB  1 
ATOM   7863  O  OG  . SER E  1 186 ? -26.100  109.638 -32.175 1.00 72.56  ? 186 SER E OG  1 
ATOM   7864  N  N   . CYS E  1 187 ? -30.023  108.300 -30.484 1.00 48.81  ? 187 CYS E N   1 
ATOM   7865  C  CA  . CYS E  1 187 ? -31.137  107.364 -30.557 1.00 30.31  ? 187 CYS E CA  1 
ATOM   7866  C  C   . CYS E  1 187 ? -32.476  108.077 -30.673 1.00 42.42  ? 187 CYS E C   1 
ATOM   7867  O  O   . CYS E  1 187 ? -33.441  107.513 -31.200 1.00 26.51  ? 187 CYS E O   1 
ATOM   7868  C  CB  . CYS E  1 187 ? -31.164  106.504 -29.300 1.00 47.85  ? 187 CYS E CB  1 
ATOM   7869  S  SG  . CYS E  1 187 ? -32.039  107.323 -27.946 1.00 63.82  ? 187 CYS E SG  1 
ATOM   7870  N  N   . CYS E  1 188 ? -32.534  109.309 -30.163 1.00 58.25  ? 188 CYS E N   1 
ATOM   7871  C  CA  . CYS E  1 188 ? -33.808  109.977 -29.959 1.00 49.54  ? 188 CYS E CA  1 
ATOM   7872  C  C   . CYS E  1 188 ? -33.725  111.454 -30.290 1.00 37.28  ? 188 CYS E C   1 
ATOM   7873  O  O   . CYS E  1 188 ? -32.679  112.072 -30.153 1.00 49.54  ? 188 CYS E O   1 
ATOM   7874  C  CB  . CYS E  1 188 ? -34.271  109.779 -28.508 1.00 61.45  ? 188 CYS E CB  1 
ATOM   7875  S  SG  . CYS E  1 188 ? -33.912  108.124 -27.839 1.00 62.64  ? 188 CYS E SG  1 
ATOM   7876  N  N   . PRO E  1 189 ? -34.848  112.026 -30.714 1.00 32.86  ? 189 PRO E N   1 
ATOM   7877  C  CA  . PRO E  1 189 ? -34.933  113.420 -31.159 1.00 42.86  ? 189 PRO E CA  1 
ATOM   7878  C  C   . PRO E  1 189 ? -34.976  114.417 -30.004 1.00 42.74  ? 189 PRO E C   1 
ATOM   7879  O  O   . PRO E  1 189 ? -34.514  115.553 -30.135 1.00 43.56  ? 189 PRO E O   1 
ATOM   7880  C  CB  . PRO E  1 189 ? -36.273  113.455 -31.896 1.00 35.91  ? 189 PRO E CB  1 
ATOM   7881  C  CG  . PRO E  1 189 ? -37.097  112.451 -31.167 1.00 22.33  ? 189 PRO E CG  1 
ATOM   7882  C  CD  . PRO E  1 189 ? -36.151  111.341 -30.793 1.00 23.52  ? 189 PRO E CD  1 
ATOM   7883  N  N   . GLU E  1 190 ? -35.545  113.995 -28.885 1.00 29.94  ? 190 GLU E N   1 
ATOM   7884  C  CA  . GLU E  1 190 ? -35.704  114.866 -27.733 1.00 29.95  ? 190 GLU E CA  1 
ATOM   7885  C  C   . GLU E  1 190 ? -34.431  115.048 -26.881 1.00 33.44  ? 190 GLU E C   1 
ATOM   7886  O  O   . GLU E  1 190 ? -33.475  114.266 -26.953 1.00 41.52  ? 190 GLU E O   1 
ATOM   7887  C  CB  . GLU E  1 190 ? -36.833  114.330 -26.861 1.00 43.64  ? 190 GLU E CB  1 
ATOM   7888  C  CG  . GLU E  1 190 ? -38.182  114.338 -27.542 1.00 49.79  ? 190 GLU E CG  1 
ATOM   7889  C  CD  . GLU E  1 190 ? -38.840  115.699 -27.485 1.00 56.31  ? 190 GLU E CD  1 
ATOM   7890  O  OE1 . GLU E  1 190 ? -38.148  116.676 -27.134 1.00 61.68  ? 190 GLU E OE1 1 
ATOM   7891  O  OE2 . GLU E  1 190 ? -40.049  115.794 -27.775 1.00 55.86  ? 190 GLU E OE2 1 
ATOM   7892  N  N   . ALA E  1 191 ? -34.440  116.093 -26.063 1.00 32.18  ? 191 ALA E N   1 
ATOM   7893  C  CA  . ALA E  1 191 ? -33.346  116.350 -25.142 1.00 16.90  ? 191 ALA E CA  1 
ATOM   7894  C  C   . ALA E  1 191 ? -33.658  115.743 -23.789 1.00 22.49  ? 191 ALA E C   1 
ATOM   7895  O  O   . ALA E  1 191 ? -34.801  115.770 -23.329 1.00 15.77  ? 191 ALA E O   1 
ATOM   7896  C  CB  . ALA E  1 191 ? -33.115  117.833 -25.002 1.00 26.66  ? 191 ALA E CB  1 
ATOM   7897  N  N   . TYR E  1 192 ? -32.630  115.186 -23.158 1.00 20.77  ? 192 TYR E N   1 
ATOM   7898  C  CA  . TYR E  1 192 ? -32.750  114.570 -21.831 1.00 21.36  ? 192 TYR E CA  1 
ATOM   7899  C  C   . TYR E  1 192 ? -31.846  115.297 -20.853 1.00 14.96  ? 192 TYR E C   1 
ATOM   7900  O  O   . TYR E  1 192 ? -30.669  115.538 -21.127 1.00 42.71  ? 192 TYR E O   1 
ATOM   7901  C  CB  . TYR E  1 192 ? -32.412  113.080 -21.875 1.00 14.91  ? 192 TYR E CB  1 
ATOM   7902  C  CG  . TYR E  1 192 ? -33.338  112.279 -22.761 1.00 21.11  ? 192 TYR E CG  1 
ATOM   7903  C  CD1 . TYR E  1 192 ? -33.272  112.380 -24.149 1.00 18.54  ? 192 TYR E CD1 1 
ATOM   7904  C  CD2 . TYR E  1 192 ? -34.283  111.427 -22.215 1.00 17.58  ? 192 TYR E CD2 1 
ATOM   7905  C  CE1 . TYR E  1 192 ? -34.126  111.659 -24.962 1.00 32.75  ? 192 TYR E CE1 1 
ATOM   7906  C  CE2 . TYR E  1 192 ? -35.143  110.693 -23.022 1.00 24.85  ? 192 TYR E CE2 1 
ATOM   7907  C  CZ  . TYR E  1 192 ? -35.061  110.812 -24.388 1.00 31.97  ? 192 TYR E CZ  1 
ATOM   7908  O  OH  . TYR E  1 192 ? -35.915  110.076 -25.176 1.00 40.60  ? 192 TYR E OH  1 
ATOM   7909  N  N   . GLU E  1 193 ? -32.410  115.681 -19.721 1.00 24.81  ? 193 GLU E N   1 
ATOM   7910  C  CA  . GLU E  1 193 ? -31.669  116.440 -18.726 1.00 28.31  ? 193 GLU E CA  1 
ATOM   7911  C  C   . GLU E  1 193 ? -30.891  115.540 -17.769 1.00 19.69  ? 193 GLU E C   1 
ATOM   7912  O  O   . GLU E  1 193 ? -31.269  114.398 -17.502 1.00 22.30  ? 193 GLU E O   1 
ATOM   7913  C  CB  . GLU E  1 193 ? -32.613  117.367 -17.952 1.00 21.10  ? 193 GLU E CB  1 
ATOM   7914  C  CG  . GLU E  1 193 ? -33.306  118.384 -18.846 1.00 27.67  ? 193 GLU E CG  1 
ATOM   7915  C  CD  . GLU E  1 193 ? -33.965  119.509 -18.067 1.00 33.28  ? 193 GLU E CD  1 
ATOM   7916  O  OE1 . GLU E  1 193 ? -34.006  119.423 -16.824 1.00 26.50  ? 193 GLU E OE1 1 
ATOM   7917  O  OE2 . GLU E  1 193 ? -34.433  120.481 -18.700 1.00 29.14  ? 193 GLU E OE2 1 
ATOM   7918  N  N   . ASP E  1 194 ? -29.787  116.076 -17.275 1.00 18.79  ? 194 ASP E N   1 
ATOM   7919  C  CA  . ASP E  1 194 ? -28.958  115.387 -16.293 1.00 24.62  ? 194 ASP E CA  1 
ATOM   7920  C  C   . ASP E  1 194 ? -28.335  116.402 -15.353 1.00 29.59  ? 194 ASP E C   1 
ATOM   7921  O  O   . ASP E  1 194 ? -28.190  117.592 -15.693 1.00 26.49  ? 194 ASP E O   1 
ATOM   7922  C  CB  . ASP E  1 194 ? -27.862  114.527 -16.963 1.00 33.70  ? 194 ASP E CB  1 
ATOM   7923  C  CG  . ASP E  1 194 ? -26.818  115.357 -17.722 1.00 42.14  ? 194 ASP E CG  1 
ATOM   7924  O  OD1 . ASP E  1 194 ? -26.000  116.032 -17.061 1.00 41.19  ? 194 ASP E OD1 1 
ATOM   7925  O  OD2 . ASP E  1 194 ? -26.795  115.316 -18.975 1.00 47.23  ? 194 ASP E OD2 1 
ATOM   7926  N  N   . VAL E  1 195 ? -28.003  115.941 -14.157 1.00 15.79  ? 195 VAL E N   1 
ATOM   7927  C  CA  . VAL E  1 195 ? -27.147  116.720 -13.278 1.00 30.59  ? 195 VAL E CA  1 
ATOM   7928  C  C   . VAL E  1 195 ? -25.760  116.081 -13.204 1.00 13.27  ? 195 VAL E C   1 
ATOM   7929  O  O   . VAL E  1 195 ? -25.636  114.864 -13.098 1.00 16.56  ? 195 VAL E O   1 
ATOM   7930  C  CB  . VAL E  1 195 ? -27.753  116.827 -11.876 1.00 24.91  ? 195 VAL E CB  1 
ATOM   7931  C  CG1 . VAL E  1 195 ? -26.714  117.359 -10.892 1.00 23.27  ? 195 VAL E CG1 1 
ATOM   7932  C  CG2 . VAL E  1 195 ? -28.979  117.718 -11.908 1.00 26.97  ? 195 VAL E CG2 1 
ATOM   7933  N  N   . GLU E  1 196 ? -24.720  116.898 -13.286 1.00 20.72  ? 196 GLU E N   1 
ATOM   7934  C  CA  . GLU E  1 196 ? -23.360  116.391 -13.118 1.00 23.05  ? 196 GLU E CA  1 
ATOM   7935  C  C   . GLU E  1 196 ? -22.770  116.840 -11.799 1.00 28.10  ? 196 GLU E C   1 
ATOM   7936  O  O   . GLU E  1 196 ? -22.539  118.031 -11.578 1.00 35.06  ? 196 GLU E O   1 
ATOM   7937  C  CB  . GLU E  1 196 ? -22.460  116.828 -14.260 1.00 29.62  ? 196 GLU E CB  1 
ATOM   7938  C  CG  . GLU E  1 196 ? -22.534  115.934 -15.457 1.00 37.37  ? 196 GLU E CG  1 
ATOM   7939  C  CD  . GLU E  1 196 ? -21.773  116.502 -16.623 1.00 45.92  ? 196 GLU E CD  1 
ATOM   7940  O  OE1 . GLU E  1 196 ? -21.073  117.521 -16.426 1.00 43.84  ? 196 GLU E OE1 1 
ATOM   7941  O  OE2 . GLU E  1 196 ? -21.879  115.930 -17.730 1.00 38.81  ? 196 GLU E OE2 1 
ATOM   7942  N  N   . VAL E  1 197 ? -22.536  115.877 -10.920 1.00 20.95  ? 197 VAL E N   1 
ATOM   7943  C  CA  . VAL E  1 197 ? -21.936  116.155 -9.625  1.00 32.11  ? 197 VAL E CA  1 
ATOM   7944  C  C   . VAL E  1 197 ? -20.425  115.944 -9.691  1.00 24.88  ? 197 VAL E C   1 
ATOM   7945  O  O   . VAL E  1 197 ? -19.960  114.836 -9.928  1.00 28.81  ? 197 VAL E O   1 
ATOM   7946  C  CB  . VAL E  1 197 ? -22.543  115.253 -8.539  1.00 20.09  ? 197 VAL E CB  1 
ATOM   7947  C  CG1 . VAL E  1 197 ? -22.077  115.712 -7.174  1.00 14.60  ? 197 VAL E CG1 1 
ATOM   7948  C  CG2 . VAL E  1 197 ? -24.045  115.289 -8.633  1.00 13.55  ? 197 VAL E CG2 1 
ATOM   7949  N  N   . SER E  1 198 ? -19.664  117.013 -9.499  1.00 22.08  ? 198 SER E N   1 
ATOM   7950  C  CA  . SER E  1 198 ? -18.209  116.900 -9.514  1.00 31.20  ? 198 SER E CA  1 
ATOM   7951  C  C   . SER E  1 198 ? -17.669  116.738 -8.104  1.00 25.75  ? 198 SER E C   1 
ATOM   7952  O  O   . SER E  1 198 ? -17.745  117.645 -7.286  1.00 30.58  ? 198 SER E O   1 
ATOM   7953  C  CB  . SER E  1 198 ? -17.555  118.091 -10.224 1.00 31.54  ? 198 SER E CB  1 
ATOM   7954  O  OG  . SER E  1 198 ? -17.802  118.036 -11.619 1.00 40.20  ? 198 SER E OG  1 
ATOM   7955  N  N   . LEU E  1 199 ? -17.147  115.555 -7.829  1.00 16.63  ? 199 LEU E N   1 
ATOM   7956  C  CA  . LEU E  1 199 ? -16.583  115.250 -6.538  1.00 23.86  ? 199 LEU E CA  1 
ATOM   7957  C  C   . LEU E  1 199 ? -15.064  115.425 -6.576  1.00 35.36  ? 199 LEU E C   1 
ATOM   7958  O  O   . LEU E  1 199 ? -14.363  114.672 -7.262  1.00 32.64  ? 199 LEU E O   1 
ATOM   7959  C  CB  . LEU E  1 199 ? -16.934  113.808 -6.154  1.00 22.54  ? 199 LEU E CB  1 
ATOM   7960  C  CG  . LEU E  1 199 ? -16.274  113.310 -4.872  1.00 16.55  ? 199 LEU E CG  1 
ATOM   7961  C  CD1 . LEU E  1 199 ? -16.798  114.108 -3.706  1.00 22.71  ? 199 LEU E CD1 1 
ATOM   7962  C  CD2 . LEU E  1 199 ? -16.560  111.860 -4.687  1.00 16.50  ? 199 LEU E CD2 1 
ATOM   7963  N  N   . ASN E  1 200 ? -14.564  116.417 -5.840  1.00 29.54  ? 200 ASN E N   1 
ATOM   7964  C  CA  . ASN E  1 200 ? -13.131  116.671 -5.762  1.00 20.30  ? 200 ASN E CA  1 
ATOM   7965  C  C   . ASN E  1 200 ? -12.564  116.144 -4.457  1.00 28.45  ? 200 ASN E C   1 
ATOM   7966  O  O   . ASN E  1 200 ? -12.844  116.684 -3.395  1.00 37.61  ? 200 ASN E O   1 
ATOM   7967  C  CB  . ASN E  1 200 ? -12.842  118.162 -5.923  1.00 24.64  ? 200 ASN E CB  1 
ATOM   7968  C  CG  . ASN E  1 200 ? -11.337  118.474 -5.946  1.00 45.16  ? 200 ASN E CG  1 
ATOM   7969  O  OD1 . ASN E  1 200 ? -10.902  119.525 -5.464  1.00 40.82  ? 200 ASN E OD1 1 
ATOM   7970  N  ND2 . ASN E  1 200 ? -10.539  117.556 -6.496  1.00 38.62  ? 200 ASN E ND2 1 
ATOM   7971  N  N   . PHE E  1 201 ? -11.773  115.083 -4.537  1.00 20.97  ? 201 PHE E N   1 
ATOM   7972  C  CA  . PHE E  1 201 ? -11.294  114.423 -3.332  1.00 25.35  ? 201 PHE E CA  1 
ATOM   7973  C  C   . PHE E  1 201 ? -9.828   114.024 -3.459  1.00 29.70  ? 201 PHE E C   1 
ATOM   7974  O  O   . PHE E  1 201 ? -9.259   114.071 -4.549  1.00 35.78  ? 201 PHE E O   1 
ATOM   7975  C  CB  . PHE E  1 201 ? -12.136  113.184 -3.040  1.00 20.06  ? 201 PHE E CB  1 
ATOM   7976  C  CG  . PHE E  1 201 ? -11.944  112.083 -4.030  1.00 20.64  ? 201 PHE E CG  1 
ATOM   7977  C  CD1 . PHE E  1 201 ? -12.309  112.256 -5.348  1.00 27.46  ? 201 PHE E CD1 1 
ATOM   7978  C  CD2 . PHE E  1 201 ? -11.400  110.875 -3.649  1.00 23.84  ? 201 PHE E CD2 1 
ATOM   7979  C  CE1 . PHE E  1 201 ? -12.141  111.247 -6.265  1.00 21.49  ? 201 PHE E CE1 1 
ATOM   7980  C  CE2 . PHE E  1 201 ? -11.226  109.863 -4.567  1.00 26.75  ? 201 PHE E CE2 1 
ATOM   7981  C  CZ  . PHE E  1 201 ? -11.601  110.055 -5.879  1.00 22.35  ? 201 PHE E CZ  1 
ATOM   7982  N  N   . ARG E  1 202 ? -9.217   113.637 -2.341  1.00 25.64  ? 202 ARG E N   1 
ATOM   7983  C  CA  . ARG E  1 202 ? -7.839   113.166 -2.355  1.00 33.95  ? 202 ARG E CA  1 
ATOM   7984  C  C   . ARG E  1 202 ? -7.576   112.209 -1.209  1.00 31.02  ? 202 ARG E C   1 
ATOM   7985  O  O   . ARG E  1 202 ? -8.350   112.161 -0.245  1.00 26.92  ? 202 ARG E O   1 
ATOM   7986  C  CB  . ARG E  1 202 ? -6.867   114.339 -2.269  1.00 34.91  ? 202 ARG E CB  1 
ATOM   7987  C  CG  . ARG E  1 202 ? -6.851   114.985 -0.918  1.00 32.98  ? 202 ARG E CG  1 
ATOM   7988  C  CD  . ARG E  1 202 ? -6.000   116.235 -0.905  1.00 27.17  ? 202 ARG E CD  1 
ATOM   7989  N  NE  . ARG E  1 202 ? -6.096   116.874 0.403   1.00 37.90  ? 202 ARG E NE  1 
ATOM   7990  C  CZ  . ARG E  1 202 ? -5.777   118.139 0.652   1.00 39.51  ? 202 ARG E CZ  1 
ATOM   7991  N  NH1 . ARG E  1 202 ? -5.332   118.925 -0.321  1.00 35.81  ? 202 ARG E NH1 1 
ATOM   7992  N  NH2 . ARG E  1 202 ? -5.911   118.616 1.881   1.00 29.86  ? 202 ARG E NH2 1 
ATOM   7993  N  N   . LYS E  1 203 ? -6.495   111.437 -1.344  1.00 7.19   ? 203 LYS E N   1 
ATOM   7994  C  CA  . LYS E  1 203 ? -5.970   110.625 -0.249  1.00 19.23  ? 203 LYS E CA  1 
ATOM   7995  C  C   . LYS E  1 203 ? -5.425   111.589 0.778   1.00 36.54  ? 203 LYS E C   1 
ATOM   7996  O  O   . LYS E  1 203 ? -4.934   112.657 0.417   1.00 32.14  ? 203 LYS E O   1 
ATOM   7997  C  CB  . LYS E  1 203 ? -4.864   109.681 -0.728  1.00 14.31  ? 203 LYS E CB  1 
ATOM   7998  C  CG  . LYS E  1 203 ? -4.732   108.386 0.081   1.00 26.64  ? 203 LYS E CG  1 
ATOM   7999  C  CD  . LYS E  1 203 ? -3.884   107.353 -0.684  1.00 52.78  ? 203 LYS E CD  1 
ATOM   8000  C  CE  . LYS E  1 203 ? -3.810   105.988 0.023   1.00 51.02  ? 203 LYS E CE  1 
ATOM   8001  N  NZ  . LYS E  1 203 ? -3.039   104.956 -0.754  1.00 31.87  ? 203 LYS E NZ  1 
ATOM   8002  N  N   . LYS E  1 204 ? -5.536   111.224 2.054   1.00 29.78  ? 204 LYS E N   1 
ATOM   8003  C  CA  . LYS E  1 204 ? -5.129   112.099 3.150   1.00 20.19  ? 204 LYS E CA  1 
ATOM   8004  C  C   . LYS E  1 204 ? -3.629   111.986 3.467   1.00 32.72  ? 204 LYS E C   1 
ATOM   8005  O  O   . LYS E  1 204 ? -3.052   110.900 3.417   1.00 26.74  ? 204 LYS E O   1 
ATOM   8006  C  CB  . LYS E  1 204 ? -5.883   111.721 4.420   1.00 4.57   ? 204 LYS E CB  1 
ATOM   8007  C  CG  . LYS E  1 204 ? -7.356   112.084 4.532   1.00 20.28  ? 204 LYS E CG  1 
ATOM   8008  C  CD  . LYS E  1 204 ? -8.026   111.087 5.467   1.00 0.67   ? 204 LYS E CD  1 
ATOM   8009  C  CE  . LYS E  1 204 ? -9.249   111.645 6.127   1.00 46.66  ? 204 LYS E CE  1 
ATOM   8010  N  NZ  . LYS E  1 204 ? -9.827   110.617 7.040   1.00 49.92  ? 204 LYS E NZ  1 
ATOM   8011  N  N   . GLY E  1 205 ? -3.011   113.101 3.835   1.00 37.08  ? 205 GLY E N   1 
ATOM   8012  C  CA  . GLY E  1 205 ? -1.681   113.063 4.418   1.00 49.38  ? 205 GLY E CA  1 
ATOM   8013  C  C   . GLY E  1 205 ? -1.706   112.510 5.835   1.00 64.19  ? 205 GLY E C   1 
ATOM   8014  O  O   . GLY E  1 205 ? -0.970   112.969 6.717   1.00 73.51  ? 205 GLY E O   1 
ATOM   8015  N  N   . LEU F  1 1   ? -58.136  102.632 17.966  1.00 45.25  ? 1   LEU F N   1 
ATOM   8016  C  CA  . LEU F  1 1   ? -59.163  102.061 17.106  1.00 37.42  ? 1   LEU F CA  1 
ATOM   8017  C  C   . LEU F  1 1   ? -60.296  103.032 16.829  1.00 34.13  ? 1   LEU F C   1 
ATOM   8018  O  O   . LEU F  1 1   ? -60.902  103.567 17.745  1.00 39.02  ? 1   LEU F O   1 
ATOM   8019  C  CB  . LEU F  1 1   ? -59.743  100.807 17.733  1.00 33.89  ? 1   LEU F CB  1 
ATOM   8020  C  CG  . LEU F  1 1   ? -58.918  99.542  17.581  1.00 45.16  ? 1   LEU F CG  1 
ATOM   8021  C  CD1 . LEU F  1 1   ? -59.655  98.375  18.221  1.00 42.88  ? 1   LEU F CD1 1 
ATOM   8022  C  CD2 . LEU F  1 1   ? -58.655  99.285  16.115  1.00 45.92  ? 1   LEU F CD2 1 
ATOM   8023  N  N   . ASP F  1 2   ? -60.572  103.265 15.555  1.00 37.07  ? 2   ASP F N   1 
ATOM   8024  C  CA  . ASP F  1 2   ? -61.769  103.995 15.166  1.00 34.05  ? 2   ASP F CA  1 
ATOM   8025  C  C   . ASP F  1 2   ? -62.766  103.023 14.527  1.00 31.94  ? 2   ASP F C   1 
ATOM   8026  O  O   . ASP F  1 2   ? -62.466  101.849 14.323  1.00 22.38  ? 2   ASP F O   1 
ATOM   8027  C  CB  . ASP F  1 2   ? -61.430  105.177 14.237  1.00 22.81  ? 2   ASP F CB  1 
ATOM   8028  C  CG  . ASP F  1 2   ? -60.784  104.746 12.939  1.00 44.26  ? 2   ASP F CG  1 
ATOM   8029  O  OD1 . ASP F  1 2   ? -60.927  103.563 12.556  1.00 35.17  ? 2   ASP F OD1 1 
ATOM   8030  O  OD2 . ASP F  1 2   ? -60.141  105.603 12.291  1.00 51.83  ? 2   ASP F OD2 1 
ATOM   8031  N  N   . ARG F  1 3   ? -63.954  103.507 14.216  1.00 23.72  ? 3   ARG F N   1 
ATOM   8032  C  CA  . ARG F  1 3   ? -64.955  102.655 13.593  1.00 27.53  ? 3   ARG F CA  1 
ATOM   8033  C  C   . ARG F  1 3   ? -64.431  101.953 12.346  1.00 28.73  ? 3   ARG F C   1 
ATOM   8034  O  O   . ARG F  1 3   ? -64.626  100.755 12.179  1.00 37.55  ? 3   ARG F O   1 
ATOM   8035  C  CB  . ARG F  1 3   ? -66.212  103.454 13.254  1.00 34.54  ? 3   ARG F CB  1 
ATOM   8036  C  CG  . ARG F  1 3   ? -67.024  103.831 14.457  1.00 20.06  ? 3   ARG F CG  1 
ATOM   8037  C  CD  . ARG F  1 3   ? -68.216  104.654 14.064  1.00 37.99  ? 3   ARG F CD  1 
ATOM   8038  N  NE  . ARG F  1 3   ? -69.025  104.927 15.239  1.00 50.84  ? 3   ARG F NE  1 
ATOM   8039  C  CZ  . ARG F  1 3   ? -68.836  105.974 16.027  1.00 51.68  ? 3   ARG F CZ  1 
ATOM   8040  N  NH1 . ARG F  1 3   ? -67.880  106.848 15.734  1.00 45.58  ? 3   ARG F NH1 1 
ATOM   8041  N  NH2 . ARG F  1 3   ? -69.610  106.151 17.091  1.00 60.42  ? 3   ARG F NH2 1 
ATOM   8042  N  N   . ALA F  1 4   ? -63.768  102.698 11.467  1.00 31.68  ? 4   ALA F N   1 
ATOM   8043  C  CA  . ALA F  1 4   ? -63.190  102.108 10.258  1.00 35.84  ? 4   ALA F CA  1 
ATOM   8044  C  C   . ALA F  1 4   ? -62.259  100.925 10.562  1.00 40.21  ? 4   ALA F C   1 
ATOM   8045  O  O   . ALA F  1 4   ? -62.322  99.888  9.892   1.00 30.51  ? 4   ALA F O   1 
ATOM   8046  C  CB  . ALA F  1 4   ? -62.461  103.163 9.452   1.00 30.17  ? 4   ALA F CB  1 
ATOM   8047  N  N   . ASP F  1 5   ? -61.405  101.073 11.572  1.00 19.99  ? 5   ASP F N   1 
ATOM   8048  C  CA  . ASP F  1 5   ? -60.494  99.992  11.918  1.00 33.95  ? 5   ASP F CA  1 
ATOM   8049  C  C   . ASP F  1 5   ? -61.281  98.776  12.410  1.00 41.76  ? 5   ASP F C   1 
ATOM   8050  O  O   . ASP F  1 5   ? -61.070  97.651  11.945  1.00 34.13  ? 5   ASP F O   1 
ATOM   8051  C  CB  . ASP F  1 5   ? -59.479  100.445 12.978  1.00 23.53  ? 5   ASP F CB  1 
ATOM   8052  C  CG  . ASP F  1 5   ? -58.567  101.562 12.485  1.00 38.91  ? 5   ASP F CG  1 
ATOM   8053  O  OD1 . ASP F  1 5   ? -58.250  101.607 11.276  1.00 37.52  ? 5   ASP F OD1 1 
ATOM   8054  O  OD2 . ASP F  1 5   ? -58.155  102.396 13.319  1.00 40.82  ? 5   ASP F OD2 1 
ATOM   8055  N  N   . ILE F  1 6   ? -62.195  99.015  13.346  1.00 20.40  ? 6   ILE F N   1 
ATOM   8056  C  CA  . ILE F  1 6   ? -63.003  97.945  13.908  1.00 26.41  ? 6   ILE F CA  1 
ATOM   8057  C  C   . ILE F  1 6   ? -63.709  97.159  12.805  1.00 36.06  ? 6   ILE F C   1 
ATOM   8058  O  O   . ILE F  1 6   ? -63.656  95.925  12.779  1.00 38.98  ? 6   ILE F O   1 
ATOM   8059  C  CB  . ILE F  1 6   ? -64.035  98.490  14.922  1.00 21.62  ? 6   ILE F CB  1 
ATOM   8060  C  CG1 . ILE F  1 6   ? -63.318  99.177  16.083  1.00 19.91  ? 6   ILE F CG1 1 
ATOM   8061  C  CG2 . ILE F  1 6   ? -64.944  97.377  15.417  1.00 20.25  ? 6   ILE F CG2 1 
ATOM   8062  C  CD1 . ILE F  1 6   ? -64.256  99.918  17.011  1.00 31.13  ? 6   ILE F CD1 1 
ATOM   8063  N  N   . LEU F  1 7   ? -64.349  97.885  11.886  1.00 22.07  ? 7   LEU F N   1 
ATOM   8064  C  CA  . LEU F  1 7   ? -65.130  97.280  10.812  1.00 21.52  ? 7   LEU F CA  1 
ATOM   8065  C  C   . LEU F  1 7   ? -64.243  96.561  9.826   1.00 28.36  ? 7   LEU F C   1 
ATOM   8066  O  O   . LEU F  1 7   ? -64.629  95.540  9.264   1.00 24.95  ? 7   LEU F O   1 
ATOM   8067  C  CB  . LEU F  1 7   ? -65.992  98.327  10.107  1.00 20.88  ? 7   LEU F CB  1 
ATOM   8068  C  CG  . LEU F  1 7   ? -67.208  98.780  10.917  1.00 30.39  ? 7   LEU F CG  1 
ATOM   8069  C  CD1 . LEU F  1 7   ? -67.727  100.150 10.473  1.00 35.89  ? 7   LEU F CD1 1 
ATOM   8070  C  CD2 . LEU F  1 7   ? -68.300  97.733  10.856  1.00 27.43  ? 7   LEU F CD2 1 
ATOM   8071  N  N   . TYR F  1 8   ? -63.046  97.093  9.625   1.00 22.51  ? 8   TYR F N   1 
ATOM   8072  C  CA  . TYR F  1 8   ? -62.067  96.420  8.793   1.00 25.89  ? 8   TYR F CA  1 
ATOM   8073  C  C   . TYR F  1 8   ? -61.706  95.093  9.444   1.00 33.81  ? 8   TYR F C   1 
ATOM   8074  O  O   . TYR F  1 8   ? -61.778  94.041  8.811   1.00 38.57  ? 8   TYR F O   1 
ATOM   8075  C  CB  . TYR F  1 8   ? -60.830  97.302  8.591   1.00 35.55  ? 8   TYR F CB  1 
ATOM   8076  C  CG  . TYR F  1 8   ? -59.726  96.727  7.697   1.00 40.15  ? 8   TYR F CG  1 
ATOM   8077  C  CD1 . TYR F  1 8   ? -59.848  96.726  6.321   1.00 52.53  ? 8   TYR F CD1 1 
ATOM   8078  C  CD2 . TYR F  1 8   ? -58.553  96.224  8.246   1.00 34.99  ? 8   TYR F CD2 1 
ATOM   8079  C  CE1 . TYR F  1 8   ? -58.840  96.220  5.522   1.00 65.53  ? 8   TYR F CE1 1 
ATOM   8080  C  CE2 . TYR F  1 8   ? -57.553  95.720  7.467   1.00 36.24  ? 8   TYR F CE2 1 
ATOM   8081  C  CZ  . TYR F  1 8   ? -57.691  95.718  6.105   1.00 63.52  ? 8   TYR F CZ  1 
ATOM   8082  O  OH  . TYR F  1 8   ? -56.678  95.210  5.317   1.00 68.62  ? 8   TYR F OH  1 
ATOM   8083  N  N   . ASN F  1 9   ? -61.335  95.134  10.718  1.00 37.33  ? 9   ASN F N   1 
ATOM   8084  C  CA  . ASN F  1 9   ? -60.977  93.905  11.410  1.00 37.37  ? 9   ASN F CA  1 
ATOM   8085  C  C   . ASN F  1 9   ? -62.061  92.846  11.293  1.00 44.85  ? 9   ASN F C   1 
ATOM   8086  O  O   . ASN F  1 9   ? -61.769  91.702  10.912  1.00 37.35  ? 9   ASN F O   1 
ATOM   8087  C  CB  . ASN F  1 9   ? -60.634  94.155  12.876  1.00 37.65  ? 9   ASN F CB  1 
ATOM   8088  C  CG  . ASN F  1 9   ? -59.432  95.046  13.040  1.00 47.34  ? 9   ASN F CG  1 
ATOM   8089  O  OD1 . ASN F  1 9   ? -58.633  95.228  12.105  1.00 37.77  ? 9   ASN F OD1 1 
ATOM   8090  N  ND2 . ASN F  1 9   ? -59.290  95.617  14.232  1.00 44.38  ? 9   ASN F ND2 1 
ATOM   8091  N  N   . ILE F  1 10  ? -63.301  93.231  11.612  1.00 37.35  ? 10  ILE F N   1 
ATOM   8092  C  CA  . ILE F  1 10  ? -64.441  92.316  11.553  1.00 37.41  ? 10  ILE F CA  1 
ATOM   8093  C  C   . ILE F  1 10  ? -64.589  91.729  10.158  1.00 39.40  ? 10  ILE F C   1 
ATOM   8094  O  O   . ILE F  1 10  ? -64.694  90.515  9.986   1.00 37.44  ? 10  ILE F O   1 
ATOM   8095  C  CB  . ILE F  1 10  ? -65.756  93.020  11.959  1.00 37.54  ? 10  ILE F CB  1 
ATOM   8096  C  CG1 . ILE F  1 10  ? -65.836  93.147  13.476  1.00 37.92  ? 10  ILE F CG1 1 
ATOM   8097  C  CG2 . ILE F  1 10  ? -66.948  92.247  11.460  1.00 37.61  ? 10  ILE F CG2 1 
ATOM   8098  C  CD1 . ILE F  1 10  ? -66.866  94.132  13.935  1.00 38.18  ? 10  ILE F CD1 1 
ATOM   8099  N  N   . ARG F  1 11  ? -64.586  92.614  9.169   1.00 11.19  ? 11  ARG F N   1 
ATOM   8100  C  CA  . ARG F  1 11  ? -64.760  92.232  7.772   1.00 26.47  ? 11  ARG F CA  1 
ATOM   8101  C  C   . ARG F  1 11  ? -63.691  91.217  7.354   1.00 42.81  ? 11  ARG F C   1 
ATOM   8102  O  O   . ARG F  1 11  ? -64.015  90.169  6.781   1.00 25.52  ? 11  ARG F O   1 
ATOM   8103  C  CB  . ARG F  1 11  ? -64.716  93.484  6.883   1.00 31.65  ? 11  ARG F CB  1 
ATOM   8104  C  CG  . ARG F  1 11  ? -65.120  93.288  5.431   1.00 24.78  ? 11  ARG F CG  1 
ATOM   8105  C  CD  . ARG F  1 11  ? -64.673  94.490  4.595   1.00 50.93  ? 11  ARG F CD  1 
ATOM   8106  N  NE  . ARG F  1 11  ? -65.779  95.084  3.845   1.00 98.46  ? 11  ARG F NE  1 
ATOM   8107  C  CZ  . ARG F  1 11  ? -65.621  95.900  2.805   1.00 119.22 ? 11  ARG F CZ  1 
ATOM   8108  N  NH1 . ARG F  1 11  ? -64.400  96.211  2.393   1.00 130.58 ? 11  ARG F NH1 1 
ATOM   8109  N  NH2 . ARG F  1 11  ? -66.678  96.403  2.173   1.00 109.47 ? 11  ARG F NH2 1 
ATOM   8110  N  N   . GLN F  1 12  ? -62.425  91.525  7.655   1.00 61.21  ? 12  GLN F N   1 
ATOM   8111  C  CA  . GLN F  1 12  ? -61.331  90.616  7.335   1.00 47.92  ? 12  GLN F CA  1 
ATOM   8112  C  C   . GLN F  1 12  ? -61.381  89.300  8.106   1.00 47.99  ? 12  GLN F C   1 
ATOM   8113  O  O   . GLN F  1 12  ? -61.121  88.248  7.541   1.00 48.21  ? 12  GLN F O   1 
ATOM   8114  C  CB  . GLN F  1 12  ? -59.962  91.274  7.576   1.00 48.39  ? 12  GLN F CB  1 
ATOM   8115  C  CG  . GLN F  1 12  ? -59.649  92.452  6.677   1.00 49.01  ? 12  GLN F CG  1 
ATOM   8116  C  CD  . GLN F  1 12  ? -59.480  92.052  5.221   1.00 48.87  ? 12  GLN F CD  1 
ATOM   8117  O  OE1 . GLN F  1 12  ? -60.418  91.582  4.570   1.00 48.70  ? 12  GLN F OE1 1 
ATOM   8118  N  NE2 . GLN F  1 12  ? -58.273  92.236  4.703   1.00 49.79  ? 12  GLN F NE2 1 
ATOM   8119  N  N   . THR F  1 13  ? -61.655  89.348  9.404   1.00 5.54   ? 13  THR F N   1 
ATOM   8120  C  CA  . THR F  1 13  ? -61.551  88.129  10.207  1.00 4.31   ? 13  THR F CA  1 
ATOM   8121  C  C   . THR F  1 13  ? -62.842  87.356  10.356  1.00 33.24  ? 13  THR F C   1 
ATOM   8122  O  O   . THR F  1 13  ? -62.801  86.161  10.636  1.00 62.55  ? 13  THR F O   1 
ATOM   8123  C  CB  . THR F  1 13  ? -61.009  88.364  11.658  1.00 9.57   ? 13  THR F CB  1 
ATOM   8124  O  OG1 . THR F  1 13  ? -61.900  89.207  12.385  1.00 16.73  ? 13  THR F OG1 1 
ATOM   8125  C  CG2 . THR F  1 13  ? -59.615  88.970  11.652  1.00 10.88  ? 13  THR F CG2 1 
ATOM   8126  N  N   . SER F  1 14  ? -63.981  88.024  10.206  1.00 27.78  ? 14  SER F N   1 
ATOM   8127  C  CA  . SER F  1 14  ? -65.259  87.397  10.555  1.00 57.76  ? 14  SER F CA  1 
ATOM   8128  C  C   . SER F  1 14  ? -65.423  86.071  9.838   1.00 63.19  ? 14  SER F C   1 
ATOM   8129  O  O   . SER F  1 14  ? -65.265  85.989  8.620   1.00 57.67  ? 14  SER F O   1 
ATOM   8130  C  CB  . SER F  1 14  ? -66.436  88.297  10.189  1.00 67.87  ? 14  SER F CB  1 
ATOM   8131  O  OG  . SER F  1 14  ? -66.700  88.227  8.789   1.00 67.67  ? 14  SER F OG  1 
ATOM   8132  N  N   . ARG F  1 15  ? -65.752  85.029  10.584  1.00 48.02  ? 15  ARG F N   1 
ATOM   8133  C  CA  . ARG F  1 15  ? -66.044  83.762  9.945   1.00 38.79  ? 15  ARG F CA  1 
ATOM   8134  C  C   . ARG F  1 15  ? -67.545  83.485  9.943   1.00 27.31  ? 15  ARG F C   1 
ATOM   8135  O  O   . ARG F  1 15  ? -68.024  82.730  10.782  1.00 12.38  ? 15  ARG F O   1 
ATOM   8136  C  CB  . ARG F  1 15  ? -65.292  82.628  10.633  1.00 34.94  ? 15  ARG F CB  1 
ATOM   8137  C  CG  . ARG F  1 15  ? -63.842  82.511  10.208  1.00 61.94  ? 15  ARG F CG  1 
ATOM   8138  C  CD  . ARG F  1 15  ? -63.703  82.290  8.709   1.00 68.97  ? 15  ARG F CD  1 
ATOM   8139  N  NE  . ARG F  1 15  ? -64.324  81.045  8.260   1.00 78.27  ? 15  ARG F NE  1 
ATOM   8140  C  CZ  . ARG F  1 15  ? -63.821  79.831  8.469   1.00 64.86  ? 15  ARG F CZ  1 
ATOM   8141  N  NH1 . ARG F  1 15  ? -62.690  79.675  9.141   1.00 54.42  ? 15  ARG F NH1 1 
ATOM   8142  N  NH2 . ARG F  1 15  ? -64.461  78.767  8.013   1.00 73.24  ? 15  ARG F NH2 1 
ATOM   8143  N  N   . PRO F  1 16  ? -68.277  84.060  8.967   1.00 31.37  ? 16  PRO F N   1 
ATOM   8144  C  CA  . PRO F  1 16  ? -69.743  83.967  8.926   1.00 33.15  ? 16  PRO F CA  1 
ATOM   8145  C  C   . PRO F  1 16  ? -70.251  82.527  8.916   1.00 16.70  ? 16  PRO F C   1 
ATOM   8146  O  O   . PRO F  1 16  ? -71.340  82.236  9.370   1.00 34.38  ? 16  PRO F O   1 
ATOM   8147  C  CB  . PRO F  1 16  ? -70.104  84.634  7.585   1.00 26.59  ? 16  PRO F CB  1 
ATOM   8148  C  CG  . PRO F  1 16  ? -68.907  85.370  7.164   1.00 23.95  ? 16  PRO F CG  1 
ATOM   8149  C  CD  . PRO F  1 16  ? -67.733  84.639  7.727   1.00 20.38  ? 16  PRO F CD  1 
ATOM   8150  N  N   . ASP F  1 17  ? -69.461  81.643  8.341   1.00 24.94  ? 17  ASP F N   1 
ATOM   8151  C  CA  . ASP F  1 17  ? -69.837  80.253  8.142   1.00 30.26  ? 17  ASP F CA  1 
ATOM   8152  C  C   . ASP F  1 17  ? -69.672  79.403  9.403   1.00 21.64  ? 17  ASP F C   1 
ATOM   8153  O  O   . ASP F  1 17  ? -70.020  78.220  9.419   1.00 41.28  ? 17  ASP F O   1 
ATOM   8154  C  CB  . ASP F  1 17  ? -68.995  79.670  6.991   1.00 37.50  ? 17  ASP F CB  1 
ATOM   8155  C  CG  . ASP F  1 17  ? -67.478  79.923  7.162   1.00 66.81  ? 17  ASP F CG  1 
ATOM   8156  O  OD1 . ASP F  1 17  ? -67.077  81.007  7.653   1.00 51.57  ? 17  ASP F OD1 1 
ATOM   8157  O  OD2 . ASP F  1 17  ? -66.682  79.030  6.788   1.00 71.45  ? 17  ASP F OD2 1 
ATOM   8158  N  N   . VAL F  1 18  ? -69.135  80.020  10.451  1.00 26.70  ? 18  VAL F N   1 
ATOM   8159  C  CA  . VAL F  1 18  ? -68.677  79.297  11.635  1.00 20.91  ? 18  VAL F CA  1 
ATOM   8160  C  C   . VAL F  1 18  ? -69.477  79.646  12.885  1.00 21.39  ? 18  VAL F C   1 
ATOM   8161  O  O   . VAL F  1 18  ? -69.500  80.789  13.324  1.00 18.61  ? 18  VAL F O   1 
ATOM   8162  C  CB  . VAL F  1 18  ? -67.182  79.580  11.928  1.00 32.22  ? 18  VAL F CB  1 
ATOM   8163  C  CG1 . VAL F  1 18  ? -66.723  78.837  13.194  1.00 23.60  ? 18  VAL F CG1 1 
ATOM   8164  C  CG2 . VAL F  1 18  ? -66.305  79.209  10.726  1.00 30.31  ? 18  VAL F CG2 1 
ATOM   8165  N  N   . ILE F  1 19  ? -70.115  78.640  13.461  1.00 24.10  ? 19  ILE F N   1 
ATOM   8166  C  CA  . ILE F  1 19  ? -70.937  78.850  14.633  1.00 29.72  ? 19  ILE F CA  1 
ATOM   8167  C  C   . ILE F  1 19  ? -70.044  79.085  15.853  1.00 29.14  ? 19  ILE F C   1 
ATOM   8168  O  O   . ILE F  1 19  ? -69.220  78.248  16.190  1.00 24.14  ? 19  ILE F O   1 
ATOM   8169  C  CB  . ILE F  1 19  ? -71.895  77.658  14.845  1.00 34.69  ? 19  ILE F CB  1 
ATOM   8170  C  CG1 . ILE F  1 19  ? -72.819  77.908  16.040  1.00 31.20  ? 19  ILE F CG1 1 
ATOM   8171  C  CG2 . ILE F  1 19  ? -71.095  76.362  14.963  1.00 19.83  ? 19  ILE F CG2 1 
ATOM   8172  C  CD1 . ILE F  1 19  ? -73.875  76.854  16.208  1.00 22.40  ? 19  ILE F CD1 1 
ATOM   8173  N  N   . PRO F  1 20  ? -70.220  80.236  16.520  1.00 28.66  ? 20  PRO F N   1 
ATOM   8174  C  CA  . PRO F  1 20  ? -69.316  80.667  17.593  1.00 18.99  ? 20  PRO F CA  1 
ATOM   8175  C  C   . PRO F  1 20  ? -69.512  79.881  18.883  1.00 31.20  ? 20  PRO F C   1 
ATOM   8176  O  O   . PRO F  1 20  ? -69.737  80.499  19.911  1.00 29.75  ? 20  PRO F O   1 
ATOM   8177  C  CB  . PRO F  1 20  ? -69.701  82.136  17.798  1.00 24.10  ? 20  PRO F CB  1 
ATOM   8178  C  CG  . PRO F  1 20  ? -71.179  82.176  17.441  1.00 22.50  ? 20  PRO F CG  1 
ATOM   8179  C  CD  . PRO F  1 20  ? -71.373  81.147  16.355  1.00 25.59  ? 20  PRO F CD  1 
ATOM   8180  N  N   . THR F  1 21  ? -69.415  78.550  18.823  1.00 33.41  ? 21  THR F N   1 
ATOM   8181  C  CA  . THR F  1 21  ? -69.442  77.701  20.021  1.00 25.42  ? 21  THR F CA  1 
ATOM   8182  C  C   . THR F  1 21  ? -68.163  77.898  20.841  1.00 31.97  ? 21  THR F C   1 
ATOM   8183  O  O   . THR F  1 21  ? -67.100  78.150  20.284  1.00 29.87  ? 21  THR F O   1 
ATOM   8184  C  CB  . THR F  1 21  ? -69.542  76.184  19.678  1.00 19.79  ? 21  THR F CB  1 
ATOM   8185  O  OG1 . THR F  1 21  ? -68.306  75.725  19.103  1.00 28.15  ? 21  THR F OG1 1 
ATOM   8186  C  CG2 . THR F  1 21  ? -70.703  75.890  18.724  1.00 8.39   ? 21  THR F CG2 1 
ATOM   8187  N  N   . GLN F  1 22  ? -68.273  77.779  22.160  1.00 44.37  ? 22  GLN F N   1 
ATOM   8188  C  CA  . GLN F  1 22  ? -67.118  77.847  23.051  1.00 25.34  ? 22  GLN F CA  1 
ATOM   8189  C  C   . GLN F  1 22  ? -67.069  76.615  23.922  1.00 31.60  ? 22  GLN F C   1 
ATOM   8190  O  O   . GLN F  1 22  ? -67.948  76.414  24.755  1.00 35.38  ? 22  GLN F O   1 
ATOM   8191  C  CB  . GLN F  1 22  ? -67.179  79.076  23.962  1.00 25.82  ? 22  GLN F CB  1 
ATOM   8192  C  CG  . GLN F  1 22  ? -66.781  80.392  23.288  1.00 63.40  ? 22  GLN F CG  1 
ATOM   8193  C  CD  . GLN F  1 22  ? -67.043  81.610  24.167  1.00 72.76  ? 22  GLN F CD  1 
ATOM   8194  O  OE1 . GLN F  1 22  ? -66.230  82.532  24.228  1.00 81.67  ? 22  GLN F OE1 1 
ATOM   8195  N  NE2 . GLN F  1 22  ? -68.185  81.617  24.851  1.00 67.77  ? 22  GLN F NE2 1 
ATOM   8196  N  N   . ARG F  1 23  ? -66.035  75.800  23.727  1.00 67.35  ? 23  ARG F N   1 
ATOM   8197  C  CA  . ARG F  1 23  ? -65.758  74.650  24.593  1.00 73.77  ? 23  ARG F CA  1 
ATOM   8198  C  C   . ARG F  1 23  ? -66.823  73.556  24.409  1.00 43.38  ? 23  ARG F C   1 
ATOM   8199  O  O   . ARG F  1 23  ? -67.185  72.849  25.341  1.00 36.60  ? 23  ARG F O   1 
ATOM   8200  C  CB  . ARG F  1 23  ? -65.564  75.112  26.063  1.00 21.75  ? 23  ARG F CB  1 
ATOM   8201  C  CG  . ARG F  1 23  ? -64.424  76.175  26.187  1.00 51.55  ? 23  ARG F CG  1 
ATOM   8202  C  CD  . ARG F  1 23  ? -64.482  77.095  27.441  1.00 77.90  ? 23  ARG F CD  1 
ATOM   8203  N  NE  . ARG F  1 23  ? -64.505  78.539  27.117  1.00 92.42  ? 23  ARG F NE  1 
ATOM   8204  C  CZ  . ARG F  1 23  ? -63.466  79.256  26.665  1.00 87.00  ? 23  ARG F CZ  1 
ATOM   8205  N  NH1 . ARG F  1 23  ? -62.292  78.667  26.459  1.00 103.24 ? 23  ARG F NH1 1 
ATOM   8206  N  NH2 . ARG F  1 23  ? -63.596  80.566  26.404  1.00 26.24  ? 23  ARG F NH2 1 
ATOM   8207  N  N   . ASP F  1 24  ? -67.290  73.416  23.172  1.00 32.57  ? 24  ASP F N   1 
ATOM   8208  C  CA  . ASP F  1 24  ? -68.410  72.532  22.831  1.00 66.28  ? 24  ASP F CA  1 
ATOM   8209  C  C   . ASP F  1 24  ? -69.656  72.668  23.738  1.00 60.27  ? 24  ASP F C   1 
ATOM   8210  O  O   . ASP F  1 24  ? -70.277  71.683  24.150  1.00 41.66  ? 24  ASP F O   1 
ATOM   8211  C  CB  . ASP F  1 24  ? -67.949  71.079  22.634  1.00 86.93  ? 24  ASP F CB  1 
ATOM   8212  C  CG  . ASP F  1 24  ? -67.446  70.818  21.201  1.00 99.63  ? 24  ASP F CG  1 
ATOM   8213  O  OD1 . ASP F  1 24  ? -68.276  70.485  20.319  1.00 96.72  ? 24  ASP F OD1 1 
ATOM   8214  O  OD2 . ASP F  1 24  ? -66.225  70.962  20.951  1.00 89.47  ? 24  ASP F OD2 1 
ATOM   8215  N  N   . ARG F  1 25  ? -69.996  73.922  24.019  1.00 46.57  ? 25  ARG F N   1 
ATOM   8216  C  CA  . ARG F  1 25  ? -71.213  74.307  24.703  1.00 37.52  ? 25  ARG F CA  1 
ATOM   8217  C  C   . ARG F  1 25  ? -71.995  75.095  23.655  1.00 35.48  ? 25  ARG F C   1 
ATOM   8218  O  O   . ARG F  1 25  ? -71.390  75.721  22.787  1.00 36.76  ? 25  ARG F O   1 
ATOM   8219  C  CB  . ARG F  1 25  ? -70.864  75.201  25.894  1.00 33.21  ? 25  ARG F CB  1 
ATOM   8220  C  CG  . ARG F  1 25  ? -71.384  74.705  27.243  1.00 49.48  ? 25  ARG F CG  1 
ATOM   8221  C  CD  . ARG F  1 25  ? -71.386  75.837  28.261  1.00 63.05  ? 25  ARG F CD  1 
ATOM   8222  N  NE  . ARG F  1 25  ? -72.730  76.312  28.601  1.00 74.65  ? 25  ARG F NE  1 
ATOM   8223  C  CZ  . ARG F  1 25  ? -72.990  77.501  29.151  1.00 86.21  ? 25  ARG F CZ  1 
ATOM   8224  N  NH1 . ARG F  1 25  ? -72.000  78.351  29.406  1.00 102.57 ? 25  ARG F NH1 1 
ATOM   8225  N  NH2 . ARG F  1 25  ? -74.239  77.851  29.441  1.00 63.07  ? 25  ARG F NH2 1 
ATOM   8226  N  N   . PRO F  1 26  ? -73.337  75.075  23.723  1.00 27.53  ? 26  PRO F N   1 
ATOM   8227  C  CA  . PRO F  1 26  ? -74.146  75.678  22.653  1.00 15.29  ? 26  PRO F CA  1 
ATOM   8228  C  C   . PRO F  1 26  ? -74.165  77.200  22.689  1.00 10.44  ? 26  PRO F C   1 
ATOM   8229  O  O   . PRO F  1 26  ? -74.086  77.792  23.749  1.00 24.64  ? 26  PRO F O   1 
ATOM   8230  C  CB  . PRO F  1 26  ? -75.550  75.142  22.944  1.00 26.48  ? 26  PRO F CB  1 
ATOM   8231  C  CG  . PRO F  1 26  ? -75.581  74.932  24.404  1.00 12.68  ? 26  PRO F CG  1 
ATOM   8232  C  CD  . PRO F  1 26  ? -74.173  74.470  24.772  1.00 24.27  ? 26  PRO F CD  1 
ATOM   8233  N  N   . VAL F  1 27  ? -74.258  77.829  21.530  1.00 23.94  ? 27  VAL F N   1 
ATOM   8234  C  CA  . VAL F  1 27  ? -74.456  79.264  21.474  1.00 19.22  ? 27  VAL F CA  1 
ATOM   8235  C  C   . VAL F  1 27  ? -75.851  79.580  21.975  1.00 28.14  ? 27  VAL F C   1 
ATOM   8236  O  O   . VAL F  1 27  ? -76.841  79.063  21.441  1.00 30.51  ? 27  VAL F O   1 
ATOM   8237  C  CB  . VAL F  1 27  ? -74.371  79.777  20.036  1.00 33.48  ? 27  VAL F CB  1 
ATOM   8238  C  CG1 . VAL F  1 27  ? -74.548  81.302  20.005  1.00 17.65  ? 27  VAL F CG1 1 
ATOM   8239  C  CG2 . VAL F  1 27  ? -73.058  79.352  19.401  1.00 39.78  ? 27  VAL F CG2 1 
ATOM   8240  N  N   . ALA F  1 28  ? -75.936  80.435  22.989  1.00 25.85  ? 28  ALA F N   1 
ATOM   8241  C  CA  . ALA F  1 28  ? -77.234  80.831  23.531  1.00 22.73  ? 28  ALA F CA  1 
ATOM   8242  C  C   . ALA F  1 28  ? -77.865  81.967  22.721  1.00 18.12  ? 28  ALA F C   1 
ATOM   8243  O  O   . ALA F  1 28  ? -77.428  83.112  22.802  1.00 23.13  ? 28  ALA F O   1 
ATOM   8244  C  CB  . ALA F  1 28  ? -77.092  81.224  24.970  1.00 11.16  ? 28  ALA F CB  1 
ATOM   8245  N  N   . VAL F  1 29  ? -78.892  81.636  21.944  1.00 15.09  ? 29  VAL F N   1 
ATOM   8246  C  CA  . VAL F  1 29  ? -79.625  82.630  21.161  1.00 12.39  ? 29  VAL F CA  1 
ATOM   8247  C  C   . VAL F  1 29  ? -80.904  83.082  21.863  1.00 13.19  ? 29  VAL F C   1 
ATOM   8248  O  O   . VAL F  1 29  ? -81.718  82.262  22.296  1.00 20.19  ? 29  VAL F O   1 
ATOM   8249  C  CB  . VAL F  1 29  ? -80.002  82.076  19.779  1.00 15.61  ? 29  VAL F CB  1 
ATOM   8250  C  CG1 . VAL F  1 29  ? -80.639  83.172  18.920  1.00 7.84   ? 29  VAL F CG1 1 
ATOM   8251  C  CG2 . VAL F  1 29  ? -78.779  81.495  19.096  1.00 12.06  ? 29  VAL F CG2 1 
ATOM   8252  N  N   . SER F  1 30  ? -81.082  84.392  21.978  1.00 26.06  ? 30  SER F N   1 
ATOM   8253  C  CA  . SER F  1 30  ? -82.333  84.936  22.505  1.00 20.27  ? 30  SER F CA  1 
ATOM   8254  C  C   . SER F  1 30  ? -83.240  85.409  21.378  1.00 23.27  ? 30  SER F C   1 
ATOM   8255  O  O   . SER F  1 30  ? -82.808  86.131  20.488  1.00 39.40  ? 30  SER F O   1 
ATOM   8256  C  CB  . SER F  1 30  ? -82.063  86.091  23.468  1.00 16.95  ? 30  SER F CB  1 
ATOM   8257  O  OG  . SER F  1 30  ? -81.744  85.589  24.745  1.00 52.91  ? 30  SER F OG  1 
ATOM   8258  N  N   . VAL F  1 31  ? -84.502  84.997  21.419  1.00 22.78  ? 31  VAL F N   1 
ATOM   8259  C  CA  . VAL F  1 31  ? -85.467  85.419  20.415  1.00 29.66  ? 31  VAL F CA  1 
ATOM   8260  C  C   . VAL F  1 31  ? -86.688  86.041  21.065  1.00 29.62  ? 31  VAL F C   1 
ATOM   8261  O  O   . VAL F  1 31  ? -87.190  85.559  22.074  1.00 30.26  ? 31  VAL F O   1 
ATOM   8262  C  CB  . VAL F  1 31  ? -85.929  84.262  19.532  1.00 30.58  ? 31  VAL F CB  1 
ATOM   8263  C  CG1 . VAL F  1 31  ? -86.508  84.808  18.261  1.00 37.59  ? 31  VAL F CG1 1 
ATOM   8264  C  CG2 . VAL F  1 31  ? -84.760  83.367  19.201  1.00 39.31  ? 31  VAL F CG2 1 
ATOM   8265  N  N   . SER F  1 32  ? -87.152  87.131  20.475  1.00 31.91  ? 32  SER F N   1 
ATOM   8266  C  CA  . SER F  1 32  ? -88.322  87.831  20.960  1.00 35.83  ? 32  SER F CA  1 
ATOM   8267  C  C   . SER F  1 32  ? -89.013  88.517  19.780  1.00 38.48  ? 32  SER F C   1 
ATOM   8268  O  O   . SER F  1 32  ? -88.363  89.195  18.994  1.00 40.78  ? 32  SER F O   1 
ATOM   8269  C  CB  . SER F  1 32  ? -87.917  88.851  22.025  1.00 34.86  ? 32  SER F CB  1 
ATOM   8270  O  OG  . SER F  1 32  ? -89.049  89.553  22.532  1.00 49.76  ? 32  SER F OG  1 
ATOM   8271  N  N   . LEU F  1 33  ? -90.325  88.320  19.648  1.00 34.05  ? 33  LEU F N   1 
ATOM   8272  C  CA  . LEU F  1 33  ? -91.083  88.978  18.593  1.00 19.23  ? 33  LEU F CA  1 
ATOM   8273  C  C   . LEU F  1 33  ? -91.764  90.228  19.116  1.00 22.49  ? 33  LEU F C   1 
ATOM   8274  O  O   . LEU F  1 33  ? -92.519  90.154  20.071  1.00 27.49  ? 33  LEU F O   1 
ATOM   8275  C  CB  . LEU F  1 33  ? -92.126  88.032  18.010  1.00 10.84  ? 33  LEU F CB  1 
ATOM   8276  C  CG  . LEU F  1 33  ? -91.551  86.748  17.420  1.00 26.38  ? 33  LEU F CG  1 
ATOM   8277  C  CD1 . LEU F  1 33  ? -92.629  86.014  16.655  1.00 10.69  ? 33  LEU F CD1 1 
ATOM   8278  C  CD2 . LEU F  1 33  ? -90.333  87.033  16.521  1.00 11.26  ? 33  LEU F CD2 1 
ATOM   8279  N  N   . LYS F  1 34  ? -91.465  91.373  18.515  1.00 21.61  ? 34  LYS F N   1 
ATOM   8280  C  CA  . LYS F  1 34  ? -92.172  92.609  18.815  1.00 14.19  ? 34  LYS F CA  1 
ATOM   8281  C  C   . LYS F  1 34  ? -93.144  92.863  17.672  1.00 21.62  ? 34  LYS F C   1 
ATOM   8282  O  O   . LYS F  1 34  ? -92.755  93.276  16.584  1.00 17.78  ? 34  LYS F O   1 
ATOM   8283  C  CB  . LYS F  1 34  ? -91.223  93.796  18.968  1.00 18.43  ? 34  LYS F CB  1 
ATOM   8284  C  CG  . LYS F  1 34  ? -89.927  93.489  19.701  1.00 43.80  ? 34  LYS F CG  1 
ATOM   8285  C  CD  . LYS F  1 34  ? -90.124  93.376  21.202  1.00 52.74  ? 34  LYS F CD  1 
ATOM   8286  C  CE  . LYS F  1 34  ? -88.787  93.271  21.923  1.00 53.36  ? 34  LYS F CE  1 
ATOM   8287  N  NZ  . LYS F  1 34  ? -88.939  92.948  23.359  1.00 54.86  ? 34  LYS F NZ  1 
ATOM   8288  N  N   . PHE F  1 35  ? -94.421  92.606  17.920  1.00 33.06  ? 35  PHE F N   1 
ATOM   8289  C  CA  . PHE F  1 35  ? -95.431  92.741  16.880  1.00 17.19  ? 35  PHE F CA  1 
ATOM   8290  C  C   . PHE F  1 35  ? -95.750  94.187  16.529  1.00 17.60  ? 35  PHE F C   1 
ATOM   8291  O  O   . PHE F  1 35  ? -95.953  95.025  17.393  1.00 18.21  ? 35  PHE F O   1 
ATOM   8292  C  CB  . PHE F  1 35  ? -96.689  92.003  17.284  1.00 17.70  ? 35  PHE F CB  1 
ATOM   8293  C  CG  . PHE F  1 35  ? -96.524  90.522  17.317  1.00 26.45  ? 35  PHE F CG  1 
ATOM   8294  C  CD1 . PHE F  1 35  ? -96.614  89.778  16.157  1.00 18.40  ? 35  PHE F CD1 1 
ATOM   8295  C  CD2 . PHE F  1 35  ? -96.274  89.876  18.503  1.00 20.87  ? 35  PHE F CD2 1 
ATOM   8296  C  CE1 . PHE F  1 35  ? -96.465  88.411  16.183  1.00 28.92  ? 35  PHE F CE1 1 
ATOM   8297  C  CE2 . PHE F  1 35  ? -96.121  88.505  18.531  1.00 32.16  ? 35  PHE F CE2 1 
ATOM   8298  C  CZ  . PHE F  1 35  ? -96.219  87.773  17.372  1.00 24.83  ? 35  PHE F CZ  1 
ATOM   8299  N  N   . ILE F  1 36  ? -95.792  94.454  15.234  1.00 22.55  ? 36  ILE F N   1 
ATOM   8300  C  CA  . ILE F  1 36  ? -95.962  95.798  14.714  1.00 28.73  ? 36  ILE F CA  1 
ATOM   8301  C  C   . ILE F  1 36  ? -97.335  95.963  14.074  1.00 22.79  ? 36  ILE F C   1 
ATOM   8302  O  O   . ILE F  1 36  ? -97.931  97.024  14.158  1.00 6.76   ? 36  ILE F O   1 
ATOM   8303  C  CB  . ILE F  1 36  ? -94.870  96.127  13.661  1.00 16.23  ? 36  ILE F CB  1 
ATOM   8304  C  CG1 . ILE F  1 36  ? -93.503  95.807  14.232  1.00 21.34  ? 36  ILE F CG1 1 
ATOM   8305  C  CG2 . ILE F  1 36  ? -94.920  97.591  13.274  1.00 4.95   ? 36  ILE F CG2 1 
ATOM   8306  C  CD1 . ILE F  1 36  ? -93.178  96.574  15.513  1.00 11.25  ? 36  ILE F CD1 1 
ATOM   8307  N  N   . ASN F  1 37  ? -97.813  94.908  13.421  1.00 12.18  ? 37  ASN F N   1 
ATOM   8308  C  CA  . ASN F  1 37  ? -99.048  94.980  12.661  1.00 21.53  ? 37  ASN F CA  1 
ATOM   8309  C  C   . ASN F  1 37  ? -99.598  93.605  12.297  1.00 25.74  ? 37  ASN F C   1 
ATOM   8310  O  O   . ASN F  1 37  ? -98.848  92.640  12.143  1.00 23.01  ? 37  ASN F O   1 
ATOM   8311  C  CB  . ASN F  1 37  ? -98.850  95.816  11.390  1.00 21.07  ? 37  ASN F CB  1 
ATOM   8312  C  CG  . ASN F  1 37  ? -100.066 96.625  11.042  1.00 32.54  ? 37  ASN F CG  1 
ATOM   8313  O  OD1 . ASN F  1 37  ? -101.191 96.208  11.307  1.00 17.99  ? 37  ASN F OD1 1 
ATOM   8314  N  ND2 . ASN F  1 37  ? -99.849  97.797  10.457  1.00 29.28  ? 37  ASN F ND2 1 
ATOM   8315  N  N   . ILE F  1 38  ? -100.917 93.526  12.182  1.00 18.21  ? 38  ILE F N   1 
ATOM   8316  C  CA  . ILE F  1 38  ? -101.581 92.338  11.665  1.00 15.95  ? 38  ILE F CA  1 
ATOM   8317  C  C   . ILE F  1 38  ? -102.405 92.798  10.461  1.00 30.68  ? 38  ILE F C   1 
ATOM   8318  O  O   . ILE F  1 38  ? -103.252 93.673  10.584  1.00 30.08  ? 38  ILE F O   1 
ATOM   8319  C  CB  . ILE F  1 38  ? -102.462 91.691  12.721  1.00 21.16  ? 38  ILE F CB  1 
ATOM   8320  C  CG1 . ILE F  1 38  ? -101.610 91.377  13.955  1.00 24.63  ? 38  ILE F CG1 1 
ATOM   8321  C  CG2 . ILE F  1 38  ? -103.092 90.433  12.175  1.00 15.80  ? 38  ILE F CG2 1 
ATOM   8322  C  CD1 . ILE F  1 38  ? -102.367 90.768  15.093  1.00 27.11  ? 38  ILE F CD1 1 
ATOM   8323  N  N   . LEU F  1 39  ? -102.125 92.227  9.293   1.00 31.33  ? 39  LEU F N   1 
ATOM   8324  C  CA  . LEU F  1 39  ? -102.528 92.834  8.033   1.00 20.60  ? 39  LEU F CA  1 
ATOM   8325  C  C   . LEU F  1 39  ? -103.704 92.151  7.342   1.00 40.21  ? 39  LEU F C   1 
ATOM   8326  O  O   . LEU F  1 39  ? -104.594 92.820  6.817   1.00 56.92  ? 39  LEU F O   1 
ATOM   8327  C  CB  . LEU F  1 39  ? -101.330 92.891  7.075   1.00 9.28   ? 39  LEU F CB  1 
ATOM   8328  C  CG  . LEU F  1 39  ? -100.192 93.782  7.538   1.00 36.07  ? 39  LEU F CG  1 
ATOM   8329  C  CD1 . LEU F  1 39  ? -99.102  93.860  6.470   1.00 34.50  ? 39  LEU F CD1 1 
ATOM   8330  C  CD2 . LEU F  1 39  ? -100.702 95.178  7.897   1.00 36.58  ? 39  LEU F CD2 1 
ATOM   8331  N  N   . GLU F  1 40  ? -103.712 90.823  7.318   1.00 35.73  ? 40  GLU F N   1 
ATOM   8332  C  CA  . GLU F  1 40  ? -104.725 90.128  6.536   1.00 25.83  ? 40  GLU F CA  1 
ATOM   8333  C  C   . GLU F  1 40  ? -105.087 88.759  7.084   1.00 35.80  ? 40  GLU F C   1 
ATOM   8334  O  O   . GLU F  1 40  ? -104.488 87.739  6.728   1.00 51.86  ? 40  GLU F O   1 
ATOM   8335  C  CB  . GLU F  1 40  ? -104.250 89.994  5.108   1.00 26.59  ? 40  GLU F CB  1 
ATOM   8336  C  CG  . GLU F  1 40  ? -105.341 89.694  4.119   1.00 61.50  ? 40  GLU F CG  1 
ATOM   8337  C  CD  . GLU F  1 40  ? -104.885 89.979  2.695   1.00 85.79  ? 40  GLU F CD  1 
ATOM   8338  O  OE1 . GLU F  1 40  ? -103.655 90.145  2.497   1.00 86.90  ? 40  GLU F OE1 1 
ATOM   8339  O  OE2 . GLU F  1 40  ? -105.747 90.054  1.785   1.00 68.96  ? 40  GLU F OE2 1 
ATOM   8340  N  N   . VAL F  1 41  ? -106.100 88.745  7.933   1.00 34.71  ? 41  VAL F N   1 
ATOM   8341  C  CA  . VAL F  1 41  ? -106.514 87.532  8.611   1.00 33.72  ? 41  VAL F CA  1 
ATOM   8342  C  C   . VAL F  1 41  ? -107.536 86.773  7.767   1.00 35.89  ? 41  VAL F C   1 
ATOM   8343  O  O   . VAL F  1 41  ? -108.342 87.381  7.060   1.00 28.84  ? 41  VAL F O   1 
ATOM   8344  C  CB  . VAL F  1 41  ? -107.119 87.872  9.994   1.00 31.76  ? 41  VAL F CB  1 
ATOM   8345  C  CG1 . VAL F  1 41  ? -107.833 86.696  10.557  1.00 35.93  ? 41  VAL F CG1 1 
ATOM   8346  C  CG2 . VAL F  1 41  ? -106.042 88.346  10.954  1.00 27.47  ? 41  VAL F CG2 1 
ATOM   8347  N  N   . ASN F  1 42  ? -107.489 85.445  7.820   1.00 37.47  ? 42  ASN F N   1 
ATOM   8348  C  CA  . ASN F  1 42  ? -108.470 84.621  7.124   1.00 16.17  ? 42  ASN F CA  1 
ATOM   8349  C  C   . ASN F  1 42  ? -108.884 83.457  8.004   1.00 29.70  ? 42  ASN F C   1 
ATOM   8350  O  O   . ASN F  1 42  ? -108.143 82.487  8.158   1.00 32.12  ? 42  ASN F O   1 
ATOM   8351  C  CB  . ASN F  1 42  ? -107.908 84.117  5.795   1.00 26.03  ? 42  ASN F CB  1 
ATOM   8352  C  CG  . ASN F  1 42  ? -108.971 83.451  4.927   1.00 42.88  ? 42  ASN F CG  1 
ATOM   8353  O  OD1 . ASN F  1 42  ? -109.835 82.721  5.429   1.00 37.02  ? 42  ASN F OD1 1 
ATOM   8354  N  ND2 . ASN F  1 42  ? -108.921 83.713  3.618   1.00 25.37  ? 42  ASN F ND2 1 
ATOM   8355  N  N   . GLU F  1 43  ? -110.072 83.562  8.592   1.00 30.37  ? 43  GLU F N   1 
ATOM   8356  C  CA  . GLU F  1 43  ? -110.529 82.555  9.533   1.00 28.43  ? 43  GLU F CA  1 
ATOM   8357  C  C   . GLU F  1 43  ? -110.895 81.240  8.848   1.00 29.67  ? 43  GLU F C   1 
ATOM   8358  O  O   . GLU F  1 43  ? -110.906 80.178  9.484   1.00 24.98  ? 43  GLU F O   1 
ATOM   8359  C  CB  . GLU F  1 43  ? -111.690 83.083  10.362  1.00 32.36  ? 43  GLU F CB  1 
ATOM   8360  C  CG  . GLU F  1 43  ? -111.991 82.223  11.579  1.00 40.24  ? 43  GLU F CG  1 
ATOM   8361  C  CD  . GLU F  1 43  ? -112.908 82.899  12.561  1.00 39.00  ? 43  GLU F CD  1 
ATOM   8362  O  OE1 . GLU F  1 43  ? -113.276 84.065  12.329  1.00 44.38  ? 43  GLU F OE1 1 
ATOM   8363  O  OE2 . GLU F  1 43  ? -113.246 82.263  13.574  1.00 39.20  ? 43  GLU F OE2 1 
ATOM   8364  N  N   . ILE F  1 44  ? -111.189 81.316  7.552   1.00 30.09  ? 44  ILE F N   1 
ATOM   8365  C  CA  . ILE F  1 44  ? -111.460 80.120  6.760   1.00 38.80  ? 44  ILE F CA  1 
ATOM   8366  C  C   . ILE F  1 44  ? -110.179 79.311  6.526   1.00 34.95  ? 44  ILE F C   1 
ATOM   8367  O  O   . ILE F  1 44  ? -110.092 78.138  6.897   1.00 29.86  ? 44  ILE F O   1 
ATOM   8368  C  CB  . ILE F  1 44  ? -112.090 80.461  5.389   1.00 45.36  ? 44  ILE F CB  1 
ATOM   8369  C  CG1 . ILE F  1 44  ? -113.315 81.367  5.552   1.00 52.48  ? 44  ILE F CG1 1 
ATOM   8370  C  CG2 . ILE F  1 44  ? -112.475 79.177  4.650   1.00 34.43  ? 44  ILE F CG2 1 
ATOM   8371  C  CD1 . ILE F  1 44  ? -114.523 80.695  6.254   1.00 45.47  ? 44  ILE F CD1 1 
ATOM   8372  N  N   . THR F  1 45  ? -109.191 79.950  5.914   1.00 28.41  ? 45  THR F N   1 
ATOM   8373  C  CA  . THR F  1 45  ? -107.932 79.294  5.591   1.00 33.74  ? 45  THR F CA  1 
ATOM   8374  C  C   . THR F  1 45  ? -106.972 79.145  6.771   1.00 27.87  ? 45  THR F C   1 
ATOM   8375  O  O   . THR F  1 45  ? -105.967 78.439  6.681   1.00 47.31  ? 45  THR F O   1 
ATOM   8376  C  CB  . THR F  1 45  ? -107.193 80.056  4.467   1.00 37.66  ? 45  THR F CB  1 
ATOM   8377  O  OG1 . THR F  1 45  ? -106.772 81.344  4.935   1.00 29.11  ? 45  THR F OG1 1 
ATOM   8378  C  CG2 . THR F  1 45  ? -108.110 80.222  3.251   1.00 24.87  ? 45  THR F CG2 1 
ATOM   8379  N  N   . ASN F  1 46  ? -107.270 79.817  7.871   1.00 27.42  ? 46  ASN F N   1 
ATOM   8380  C  CA  . ASN F  1 46  ? -106.378 79.799  9.017   1.00 29.26  ? 46  ASN F CA  1 
ATOM   8381  C  C   . ASN F  1 46  ? -104.993 80.332  8.660   1.00 28.04  ? 46  ASN F C   1 
ATOM   8382  O  O   . ASN F  1 46  ? -103.980 79.698  8.929   1.00 27.74  ? 46  ASN F O   1 
ATOM   8383  C  CB  . ASN F  1 46  ? -106.291 78.395  9.608   1.00 16.82  ? 46  ASN F CB  1 
ATOM   8384  C  CG  . ASN F  1 46  ? -107.157 78.239  10.834  1.00 32.23  ? 46  ASN F CG  1 
ATOM   8385  O  OD1 . ASN F  1 46  ? -107.457 79.214  11.520  1.00 27.77  ? 46  ASN F OD1 1 
ATOM   8386  N  ND2 . ASN F  1 46  ? -107.565 77.010  11.119  1.00 29.77  ? 46  ASN F ND2 1 
ATOM   8387  N  N   . GLU F  1 47  ? -104.977 81.508  8.050   1.00 22.54  ? 47  GLU F N   1 
ATOM   8388  C  CA  . GLU F  1 47  ? -103.749 82.150  7.635   1.00 31.99  ? 47  GLU F CA  1 
ATOM   8389  C  C   . GLU F  1 47  ? -103.747 83.615  8.071   1.00 32.24  ? 47  GLU F C   1 
ATOM   8390  O  O   . GLU F  1 47  ? -104.757 84.302  7.962   1.00 36.04  ? 47  GLU F O   1 
ATOM   8391  C  CB  . GLU F  1 47  ? -103.597 82.025  6.121   1.00 12.70  ? 47  GLU F CB  1 
ATOM   8392  C  CG  . GLU F  1 47  ? -103.597 80.578  5.638   1.00 33.94  ? 47  GLU F CG  1 
ATOM   8393  C  CD  . GLU F  1 47  ? -103.538 80.439  4.113   1.00 36.24  ? 47  GLU F CD  1 
ATOM   8394  O  OE1 . GLU F  1 47  ? -103.145 81.414  3.426   1.00 16.15  ? 47  GLU F OE1 1 
ATOM   8395  O  OE2 . GLU F  1 47  ? -103.886 79.339  3.618   1.00 30.17  ? 47  GLU F OE2 1 
ATOM   8396  N  N   . VAL F  1 48  ? -102.616 84.081  8.588   1.00 28.21  ? 48  VAL F N   1 
ATOM   8397  C  CA  . VAL F  1 48  ? -102.489 85.468  9.001   1.00 26.84  ? 48  VAL F CA  1 
ATOM   8398  C  C   . VAL F  1 48  ? -101.266 86.119  8.363   1.00 32.33  ? 48  VAL F C   1 
ATOM   8399  O  O   . VAL F  1 48  ? -100.264 85.465  8.088   1.00 31.31  ? 48  VAL F O   1 
ATOM   8400  C  CB  . VAL F  1 48  ? -102.364 85.604  10.526  1.00 20.43  ? 48  VAL F CB  1 
ATOM   8401  C  CG1 . VAL F  1 48  ? -103.634 85.166  11.195  1.00 37.61  ? 48  VAL F CG1 1 
ATOM   8402  C  CG2 . VAL F  1 48  ? -101.177 84.801  11.036  1.00 24.05  ? 48  VAL F CG2 1 
ATOM   8403  N  N   . ASP F  1 49  ? -101.360 87.418  8.132   1.00 28.87  ? 49  ASP F N   1 
ATOM   8404  C  CA  . ASP F  1 49  ? -100.265 88.163  7.582   1.00 14.57  ? 49  ASP F CA  1 
ATOM   8405  C  C   . ASP F  1 49  ? -99.832  89.123  8.669   1.00 21.57  ? 49  ASP F C   1 
ATOM   8406  O  O   . ASP F  1 49  ? -100.609 89.984  9.079   1.00 33.91  ? 49  ASP F O   1 
ATOM   8407  C  CB  . ASP F  1 49  ? -100.729 88.905  6.342   1.00 35.21  ? 49  ASP F CB  1 
ATOM   8408  C  CG  . ASP F  1 49  ? -99.586  89.322  5.453   1.00 32.61  ? 49  ASP F CG  1 
ATOM   8409  O  OD1 . ASP F  1 49  ? -98.547  89.736  5.985   1.00 49.64  ? 49  ASP F OD1 1 
ATOM   8410  O  OD2 . ASP F  1 49  ? -99.718  89.242  4.223   1.00 37.12  ? 49  ASP F OD2 1 
ATOM   8411  N  N   . VAL F  1 50  ? -98.598  88.957  9.146   1.00 17.78  ? 50  VAL F N   1 
ATOM   8412  C  CA  . VAL F  1 50  ? -98.092  89.687  10.314  1.00 21.17  ? 50  VAL F CA  1 
ATOM   8413  C  C   . VAL F  1 50  ? -96.797  90.451  10.031  1.00 27.84  ? 50  VAL F C   1 
ATOM   8414  O  O   . VAL F  1 50  ? -95.971  90.036  9.221   1.00 35.66  ? 50  VAL F O   1 
ATOM   8415  C  CB  . VAL F  1 50  ? -97.854  88.731  11.503  1.00 8.42   ? 50  VAL F CB  1 
ATOM   8416  C  CG1 . VAL F  1 50  ? -97.263  89.465  12.676  1.00 33.84  ? 50  VAL F CG1 1 
ATOM   8417  C  CG2 . VAL F  1 50  ? -99.141  88.067  11.909  1.00 21.43  ? 50  VAL F CG2 1 
ATOM   8418  N  N   . VAL F  1 51  ? -96.623  91.575  10.710  1.00 22.73  ? 51  VAL F N   1 
ATOM   8419  C  CA  . VAL F  1 51  ? -95.368  92.320  10.657  1.00 24.31  ? 51  VAL F CA  1 
ATOM   8420  C  C   . VAL F  1 51  ? -94.808  92.442  12.064  1.00 25.94  ? 51  VAL F C   1 
ATOM   8421  O  O   . VAL F  1 51  ? -95.487  92.911  12.964  1.00 28.62  ? 51  VAL F O   1 
ATOM   8422  C  CB  . VAL F  1 51  ? -95.568  93.718  10.077  1.00 13.15  ? 51  VAL F CB  1 
ATOM   8423  C  CG1 . VAL F  1 51  ? -94.365  94.570  10.368  1.00 17.68  ? 51  VAL F CG1 1 
ATOM   8424  C  CG2 . VAL F  1 51  ? -95.818  93.629  8.586   1.00 13.28  ? 51  VAL F CG2 1 
ATOM   8425  N  N   . PHE F  1 52  ? -93.569  92.014  12.256  1.00 21.63  ? 52  PHE F N   1 
ATOM   8426  C  CA  . PHE F  1 52  ? -92.971  92.019  13.592  1.00 24.16  ? 52  PHE F CA  1 
ATOM   8427  C  C   . PHE F  1 52  ? -91.474  92.298  13.523  1.00 17.07  ? 52  PHE F C   1 
ATOM   8428  O  O   . PHE F  1 52  ? -90.809  91.930  12.561  1.00 24.18  ? 52  PHE F O   1 
ATOM   8429  C  CB  . PHE F  1 52  ? -93.187  90.661  14.263  1.00 21.88  ? 52  PHE F CB  1 
ATOM   8430  C  CG  . PHE F  1 52  ? -92.699  89.507  13.443  1.00 16.46  ? 52  PHE F CG  1 
ATOM   8431  C  CD1 . PHE F  1 52  ? -93.500  88.966  12.443  1.00 19.29  ? 52  PHE F CD1 1 
ATOM   8432  C  CD2 . PHE F  1 52  ? -91.429  88.984  13.642  1.00 23.49  ? 52  PHE F CD2 1 
ATOM   8433  C  CE1 . PHE F  1 52  ? -93.052  87.903  11.656  1.00 34.50  ? 52  PHE F CE1 1 
ATOM   8434  C  CE2 . PHE F  1 52  ? -90.965  87.919  12.858  1.00 32.37  ? 52  PHE F CE2 1 
ATOM   8435  C  CZ  . PHE F  1 52  ? -91.781  87.378  11.861  1.00 31.43  ? 52  PHE F CZ  1 
ATOM   8436  N  N   . TRP F  1 53  ? -90.946  92.957  14.543  1.00 8.44   ? 53  TRP F N   1 
ATOM   8437  C  CA  . TRP F  1 53  ? -89.500  93.028  14.725  1.00 22.49  ? 53  TRP F CA  1 
ATOM   8438  C  C   . TRP F  1 53  ? -89.042  91.709  15.320  1.00 24.84  ? 53  TRP F C   1 
ATOM   8439  O  O   . TRP F  1 53  ? -89.524  91.303  16.374  1.00 10.77  ? 53  TRP F O   1 
ATOM   8440  C  CB  . TRP F  1 53  ? -89.118  94.146  15.689  1.00 10.63  ? 53  TRP F CB  1 
ATOM   8441  C  CG  . TRP F  1 53  ? -89.438  95.504  15.193  1.00 10.09  ? 53  TRP F CG  1 
ATOM   8442  C  CD1 . TRP F  1 53  ? -89.979  95.836  13.996  1.00 15.18  ? 53  TRP F CD1 1 
ATOM   8443  C  CD2 . TRP F  1 53  ? -89.246  96.726  15.903  1.00 21.02  ? 53  TRP F CD2 1 
ATOM   8444  N  NE1 . TRP F  1 53  ? -90.139  97.197  13.909  1.00 27.66  ? 53  TRP F NE1 1 
ATOM   8445  C  CE2 . TRP F  1 53  ? -89.685  97.766  15.069  1.00 13.72  ? 53  TRP F CE2 1 
ATOM   8446  C  CE3 . TRP F  1 53  ? -88.733  97.042  17.170  1.00 12.97  ? 53  TRP F CE3 1 
ATOM   8447  C  CZ2 . TRP F  1 53  ? -89.639  99.098  15.457  1.00 22.01  ? 53  TRP F CZ2 1 
ATOM   8448  C  CZ3 . TRP F  1 53  ? -88.677  98.370  17.551  1.00 19.51  ? 53  TRP F CZ3 1 
ATOM   8449  C  CH2 . TRP F  1 53  ? -89.129  99.382  16.699  1.00 27.65  ? 53  TRP F CH2 1 
ATOM   8450  N  N   . GLN F  1 54  ? -88.107  91.043  14.653  1.00 20.69  ? 54  GLN F N   1 
ATOM   8451  C  CA  . GLN F  1 54  ? -87.550  89.808  15.192  1.00 17.72  ? 54  GLN F CA  1 
ATOM   8452  C  C   . GLN F  1 54  ? -86.246  90.079  15.949  1.00 29.99  ? 54  GLN F C   1 
ATOM   8453  O  O   . GLN F  1 54  ? -85.161  90.065  15.369  1.00 32.06  ? 54  GLN F O   1 
ATOM   8454  C  CB  . GLN F  1 54  ? -87.334  88.780  14.090  1.00 7.67   ? 54  GLN F CB  1 
ATOM   8455  C  CG  . GLN F  1 54  ? -86.968  87.420  14.625  1.00 18.96  ? 54  GLN F CG  1 
ATOM   8456  C  CD  . GLN F  1 54  ? -86.979  86.361  13.546  1.00 30.57  ? 54  GLN F CD  1 
ATOM   8457  O  OE1 . GLN F  1 54  ? -88.017  86.061  12.969  1.00 41.01  ? 54  GLN F OE1 1 
ATOM   8458  N  NE2 . GLN F  1 54  ? -85.816  85.792  13.263  1.00 44.15  ? 54  GLN F NE2 1 
ATOM   8459  N  N   . GLN F  1 55  ? -86.371  90.335  17.247  1.00 20.41  ? 55  GLN F N   1 
ATOM   8460  C  CA  . GLN F  1 55  ? -85.246  90.681  18.087  1.00 11.21  ? 55  GLN F CA  1 
ATOM   8461  C  C   . GLN F  1 55  ? -84.422  89.434  18.397  1.00 22.18  ? 55  GLN F C   1 
ATOM   8462  O  O   . GLN F  1 55  ? -84.893  88.528  19.084  1.00 27.48  ? 55  GLN F O   1 
ATOM   8463  C  CB  . GLN F  1 55  ? -85.746  91.309  19.378  1.00 19.59  ? 55  GLN F CB  1 
ATOM   8464  C  CG  . GLN F  1 55  ? -84.664  91.959  20.217  1.00 29.30  ? 55  GLN F CG  1 
ATOM   8465  C  CD  . GLN F  1 55  ? -85.120  92.201  21.652  1.00 35.56  ? 55  GLN F CD  1 
ATOM   8466  O  OE1 . GLN F  1 55  ? -85.367  93.340  22.071  1.00 35.64  ? 55  GLN F OE1 1 
ATOM   8467  N  NE2 . GLN F  1 55  ? -85.240  91.125  22.410  1.00 51.06  ? 55  GLN F NE2 1 
ATOM   8468  N  N   . THR F  1 56  ? -83.189  89.402  17.888  1.00 17.18  ? 56  THR F N   1 
ATOM   8469  C  CA  . THR F  1 56  ? -82.316  88.245  18.029  1.00 12.96  ? 56  THR F CA  1 
ATOM   8470  C  C   . THR F  1 56  ? -80.979  88.626  18.694  1.00 17.73  ? 56  THR F C   1 
ATOM   8471  O  O   . THR F  1 56  ? -80.340  89.606  18.333  1.00 25.63  ? 56  THR F O   1 
ATOM   8472  C  CB  . THR F  1 56  ? -82.060  87.591  16.665  1.00 17.03  ? 56  THR F CB  1 
ATOM   8473  O  OG1 . THR F  1 56  ? -83.278  87.554  15.910  1.00 28.87  ? 56  THR F OG1 1 
ATOM   8474  C  CG2 . THR F  1 56  ? -81.538  86.184  16.848  1.00 14.05  ? 56  THR F CG2 1 
ATOM   8475  N  N   . THR F  1 57  ? -80.552  87.834  19.660  1.00 23.93  ? 57  THR F N   1 
ATOM   8476  C  CA  . THR F  1 57  ? -79.402  88.190  20.475  1.00 17.71  ? 57  THR F CA  1 
ATOM   8477  C  C   . THR F  1 57  ? -78.504  86.988  20.725  1.00 28.45  ? 57  THR F C   1 
ATOM   8478  O  O   . THR F  1 57  ? -78.990  85.909  21.070  1.00 30.57  ? 57  THR F O   1 
ATOM   8479  C  CB  . THR F  1 57  ? -79.869  88.770  21.815  1.00 21.34  ? 57  THR F CB  1 
ATOM   8480  O  OG1 . THR F  1 57  ? -79.645  90.186  21.818  1.00 27.11  ? 57  THR F OG1 1 
ATOM   8481  C  CG2 . THR F  1 57  ? -79.139  88.122  22.973  1.00 29.61  ? 57  THR F CG2 1 
ATOM   8482  N  N   . TRP F  1 58  ? -77.197  87.175  20.538  1.00 27.48  ? 58  TRP F N   1 
ATOM   8483  C  CA  . TRP F  1 58  ? -76.225  86.119  20.816  1.00 21.74  ? 58  TRP F CA  1 
ATOM   8484  C  C   . TRP F  1 58  ? -74.796  86.642  20.974  1.00 23.54  ? 58  TRP F C   1 
ATOM   8485  O  O   . TRP F  1 58  ? -74.511  87.827  20.758  1.00 24.34  ? 58  TRP F O   1 
ATOM   8486  C  CB  . TRP F  1 58  ? -76.256  85.042  19.728  1.00 17.30  ? 58  TRP F CB  1 
ATOM   8487  C  CG  . TRP F  1 58  ? -75.693  85.501  18.437  1.00 16.77  ? 58  TRP F CG  1 
ATOM   8488  C  CD1 . TRP F  1 58  ? -74.406  85.385  18.015  1.00 25.06  ? 58  TRP F CD1 1 
ATOM   8489  C  CD2 . TRP F  1 58  ? -76.399  86.173  17.391  1.00 26.53  ? 58  TRP F CD2 1 
ATOM   8490  N  NE1 . TRP F  1 58  ? -74.261  85.935  16.764  1.00 15.54  ? 58  TRP F NE1 1 
ATOM   8491  C  CE2 . TRP F  1 58  ? -75.470  86.426  16.357  1.00 16.84  ? 58  TRP F CE2 1 
ATOM   8492  C  CE3 . TRP F  1 58  ? -77.730  86.578  17.222  1.00 18.90  ? 58  TRP F CE3 1 
ATOM   8493  C  CZ2 . TRP F  1 58  ? -75.826  87.072  15.178  1.00 14.25  ? 58  TRP F CZ2 1 
ATOM   8494  C  CZ3 . TRP F  1 58  ? -78.087  87.208  16.051  1.00 13.48  ? 58  TRP F CZ3 1 
ATOM   8495  C  CH2 . TRP F  1 58  ? -77.137  87.451  15.041  1.00 27.81  ? 58  TRP F CH2 1 
ATOM   8496  N  N   . SER F  1 59  ? -73.894  85.737  21.332  1.00 28.75  ? 59  SER F N   1 
ATOM   8497  C  CA  . SER F  1 59  ? -72.507  86.100  21.558  1.00 20.24  ? 59  SER F CA  1 
ATOM   8498  C  C   . SER F  1 59  ? -71.574  85.442  20.552  1.00 21.80  ? 59  SER F C   1 
ATOM   8499  O  O   . SER F  1 59  ? -71.586  84.219  20.382  1.00 32.45  ? 59  SER F O   1 
ATOM   8500  C  CB  . SER F  1 59  ? -72.084  85.712  22.979  1.00 29.35  ? 59  SER F CB  1 
ATOM   8501  O  OG  . SER F  1 59  ? -70.922  86.429  23.380  1.00 58.92  ? 59  SER F OG  1 
ATOM   8502  N  N   . ASP F  1 60  ? -70.766  86.262  19.884  1.00 23.37  ? 60  ASP F N   1 
ATOM   8503  C  CA  . ASP F  1 60  ? -69.699  85.759  19.021  1.00 24.12  ? 60  ASP F CA  1 
ATOM   8504  C  C   . ASP F  1 60  ? -68.394  86.401  19.464  1.00 20.00  ? 60  ASP F C   1 
ATOM   8505  O  O   . ASP F  1 60  ? -68.052  87.515  19.041  1.00 24.53  ? 60  ASP F O   1 
ATOM   8506  C  CB  . ASP F  1 60  ? -69.975  86.082  17.542  1.00 22.87  ? 60  ASP F CB  1 
ATOM   8507  C  CG  . ASP F  1 60  ? -69.000  85.398  16.596  1.00 33.49  ? 60  ASP F CG  1 
ATOM   8508  O  OD1 . ASP F  1 60  ? -67.925  84.943  17.036  1.00 19.38  ? 60  ASP F OD1 1 
ATOM   8509  O  OD2 . ASP F  1 60  ? -69.313  85.323  15.392  1.00 48.79  ? 60  ASP F OD2 1 
ATOM   8510  N  N   . ARG F  1 61  ? -67.662  85.696  20.318  1.00 25.69  ? 61  ARG F N   1 
ATOM   8511  C  CA  . ARG F  1 61  ? -66.464  86.270  20.921  1.00 35.97  ? 61  ARG F CA  1 
ATOM   8512  C  C   . ARG F  1 61  ? -65.444  86.676  19.877  1.00 31.78  ? 61  ARG F C   1 
ATOM   8513  O  O   . ARG F  1 61  ? -64.635  87.563  20.121  1.00 41.66  ? 61  ARG F O   1 
ATOM   8514  C  CB  . ARG F  1 61  ? -65.844  85.307  21.932  1.00 36.53  ? 61  ARG F CB  1 
ATOM   8515  C  CG  . ARG F  1 61  ? -66.742  85.013  23.117  1.00 61.19  ? 61  ARG F CG  1 
ATOM   8516  C  CD  . ARG F  1 61  ? -67.044  86.271  23.914  1.00 75.79  ? 61  ARG F CD  1 
ATOM   8517  N  NE  . ARG F  1 61  ? -68.117  86.056  24.884  1.00 91.70  ? 61  ARG F NE  1 
ATOM   8518  C  CZ  . ARG F  1 61  ? -67.931  85.672  26.144  1.00 96.03  ? 61  ARG F CZ  1 
ATOM   8519  N  NH1 . ARG F  1 61  ? -66.701  85.459  26.602  1.00 99.55  ? 61  ARG F NH1 1 
ATOM   8520  N  NH2 . ARG F  1 61  ? -68.976  85.501  26.948  1.00 81.58  ? 61  ARG F NH2 1 
ATOM   8521  N  N   . THR F  1 62  ? -65.487  86.043  18.708  1.00 27.99  ? 62  THR F N   1 
ATOM   8522  C  CA  . THR F  1 62  ? -64.471  86.287  17.688  1.00 19.00  ? 62  THR F CA  1 
ATOM   8523  C  C   . THR F  1 62  ? -64.612  87.682  17.094  1.00 24.49  ? 62  THR F C   1 
ATOM   8524  O  O   . THR F  1 62  ? -63.833  88.081  16.231  1.00 41.64  ? 62  THR F O   1 
ATOM   8525  C  CB  . THR F  1 62  ? -64.499  85.220  16.567  1.00 19.02  ? 62  THR F CB  1 
ATOM   8526  O  OG1 . THR F  1 62  ? -65.477  85.573  15.586  1.00 31.73  ? 62  THR F OG1 1 
ATOM   8527  C  CG2 . THR F  1 62  ? -64.835  83.850  17.138  1.00 18.61  ? 62  THR F CG2 1 
ATOM   8528  N  N   . LEU F  1 63  ? -65.603  88.427  17.556  1.00 22.79  ? 63  LEU F N   1 
ATOM   8529  C  CA  . LEU F  1 63  ? -65.834  89.766  17.031  1.00 25.75  ? 63  LEU F CA  1 
ATOM   8530  C  C   . LEU F  1 63  ? -65.275  90.824  17.979  1.00 26.36  ? 63  LEU F C   1 
ATOM   8531  O  O   . LEU F  1 63  ? -65.094  91.980  17.610  1.00 26.00  ? 63  LEU F O   1 
ATOM   8532  C  CB  . LEU F  1 63  ? -67.340  89.995  16.808  1.00 20.50  ? 63  LEU F CB  1 
ATOM   8533  C  CG  . LEU F  1 63  ? -68.055  89.092  15.800  1.00 26.76  ? 63  LEU F CG  1 
ATOM   8534  C  CD1 . LEU F  1 63  ? -69.546  89.349  15.839  1.00 19.07  ? 63  LEU F CD1 1 
ATOM   8535  C  CD2 . LEU F  1 63  ? -67.513  89.299  14.382  1.00 21.11  ? 63  LEU F CD2 1 
ATOM   8536  N  N   . ALA F  1 64  ? -65.006  90.409  19.208  1.00 18.73  ? 64  ALA F N   1 
ATOM   8537  C  CA  . ALA F  1 64  ? -64.631  91.326  20.272  1.00 25.76  ? 64  ALA F CA  1 
ATOM   8538  C  C   . ALA F  1 64  ? -63.370  92.126  19.977  1.00 25.73  ? 64  ALA F C   1 
ATOM   8539  O  O   . ALA F  1 64  ? -62.544  91.715  19.165  1.00 29.13  ? 64  ALA F O   1 
ATOM   8540  C  CB  . ALA F  1 64  ? -64.470  90.563  21.570  1.00 25.24  ? 64  ALA F CB  1 
ATOM   8541  N  N   . TRP F  1 65  ? -63.238  93.270  20.645  1.00 25.55  ? 65  TRP F N   1 
ATOM   8542  C  CA  . TRP F  1 65  ? -62.062  94.132  20.515  1.00 32.71  ? 65  TRP F CA  1 
ATOM   8543  C  C   . TRP F  1 65  ? -61.799  94.941  21.795  1.00 35.99  ? 65  TRP F C   1 
ATOM   8544  O  O   . TRP F  1 65  ? -62.714  95.184  22.584  1.00 34.53  ? 65  TRP F O   1 
ATOM   8545  C  CB  . TRP F  1 65  ? -62.185  95.060  19.297  1.00 23.99  ? 65  TRP F CB  1 
ATOM   8546  C  CG  . TRP F  1 65  ? -63.249  96.127  19.408  1.00 33.85  ? 65  TRP F CG  1 
ATOM   8547  C  CD1 . TRP F  1 65  ? -63.096  97.381  19.920  1.00 35.94  ? 65  TRP F CD1 1 
ATOM   8548  C  CD2 . TRP F  1 65  ? -64.612  96.037  18.977  1.00 32.45  ? 65  TRP F CD2 1 
ATOM   8549  N  NE1 . TRP F  1 65  ? -64.276  98.078  19.838  1.00 23.76  ? 65  TRP F NE1 1 
ATOM   8550  C  CE2 . TRP F  1 65  ? -65.225  97.274  19.272  1.00 31.01  ? 65  TRP F CE2 1 
ATOM   8551  C  CE3 . TRP F  1 65  ? -65.376  95.029  18.381  1.00 18.94  ? 65  TRP F CE3 1 
ATOM   8552  C  CZ2 . TRP F  1 65  ? -66.557  97.532  18.987  1.00 25.10  ? 65  TRP F CZ2 1 
ATOM   8553  C  CZ3 . TRP F  1 65  ? -66.698  95.289  18.090  1.00 18.79  ? 65  TRP F CZ3 1 
ATOM   8554  C  CH2 . TRP F  1 65  ? -67.277  96.529  18.395  1.00 27.12  ? 65  TRP F CH2 1 
ATOM   8555  N  N   . ASN F  1 66  ? -60.542  95.335  22.002  1.00 38.45  ? 66  ASN F N   1 
ATOM   8556  C  CA  . ASN F  1 66  ? -60.176  96.191  23.128  1.00 44.80  ? 66  ASN F CA  1 
ATOM   8557  C  C   . ASN F  1 66  ? -60.704  97.606  22.914  1.00 49.25  ? 66  ASN F C   1 
ATOM   8558  O  O   . ASN F  1 66  ? -60.140  98.383  22.141  1.00 47.97  ? 66  ASN F O   1 
ATOM   8559  C  CB  . ASN F  1 66  ? -58.650  96.214  23.325  1.00 44.24  ? 66  ASN F CB  1 
ATOM   8560  C  CG  . ASN F  1 66  ? -58.223  96.956  24.599  1.00 61.43  ? 66  ASN F CG  1 
ATOM   8561  O  OD1 . ASN F  1 66  ? -58.995  97.739  25.152  1.00 65.07  ? 66  ASN F OD1 1 
ATOM   8562  N  ND2 . ASN F  1 66  ? -56.987  96.715  25.061  1.00 55.94  ? 66  ASN F ND2 1 
ATOM   8563  N  N   . SER F  1 67  ? -61.794  97.937  23.596  1.00 41.81  ? 67  SER F N   1 
ATOM   8564  C  CA  . SER F  1 67  ? -62.435  99.231  23.393  1.00 53.92  ? 67  SER F CA  1 
ATOM   8565  C  C   . SER F  1 67  ? -61.951  100.298 24.368  1.00 63.30  ? 67  SER F C   1 
ATOM   8566  O  O   . SER F  1 67  ? -62.667  101.260 24.631  1.00 61.57  ? 67  SER F O   1 
ATOM   8567  C  CB  . SER F  1 67  ? -63.955  99.102  23.500  1.00 57.57  ? 67  SER F CB  1 
ATOM   8568  O  OG  . SER F  1 67  ? -64.372  99.028  24.851  1.00 58.97  ? 67  SER F OG  1 
ATOM   8569  N  N   . SER F  1 68  ? -60.744  100.133 24.902  1.00 65.59  ? 68  SER F N   1 
ATOM   8570  C  CA  . SER F  1 68  ? -60.238  101.080 25.893  1.00 71.14  ? 68  SER F CA  1 
ATOM   8571  C  C   . SER F  1 68  ? -60.363  102.522 25.390  1.00 71.61  ? 68  SER F C   1 
ATOM   8572  O  O   . SER F  1 68  ? -60.863  103.396 26.098  1.00 80.24  ? 68  SER F O   1 
ATOM   8573  C  CB  . SER F  1 68  ? -58.791  100.756 26.308  1.00 76.47  ? 68  SER F CB  1 
ATOM   8574  O  OG  . SER F  1 68  ? -57.874  100.935 25.241  1.00 91.70  ? 68  SER F OG  1 
ATOM   8575  N  N   . HIS F  1 69  ? -59.918  102.764 24.162  1.00 53.08  ? 69  HIS F N   1 
ATOM   8576  C  CA  . HIS F  1 69  ? -60.005  104.094 23.564  1.00 59.25  ? 69  HIS F CA  1 
ATOM   8577  C  C   . HIS F  1 69  ? -60.616  103.972 22.179  1.00 61.33  ? 69  HIS F C   1 
ATOM   8578  O  O   . HIS F  1 69  ? -60.082  104.485 21.196  1.00 65.78  ? 69  HIS F O   1 
ATOM   8579  C  CB  . HIS F  1 69  ? -58.617  104.731 23.460  1.00 74.50  ? 69  HIS F CB  1 
ATOM   8580  C  CG  . HIS F  1 69  ? -57.952  104.962 24.780  1.00 86.19  ? 69  HIS F CG  1 
ATOM   8581  N  ND1 . HIS F  1 69  ? -56.637  105.357 24.890  1.00 92.71  ? 69  HIS F ND1 1 
ATOM   8582  C  CD2 . HIS F  1 69  ? -58.423  104.862 26.046  1.00 89.82  ? 69  HIS F CD2 1 
ATOM   8583  C  CE1 . HIS F  1 69  ? -56.325  105.488 26.167  1.00 100.72 ? 69  HIS F CE1 1 
ATOM   8584  N  NE2 . HIS F  1 69  ? -57.391  105.194 26.889  1.00 96.52  ? 69  HIS F NE2 1 
ATOM   8585  N  N   . SER F  1 70  ? -61.739  103.276 22.108  1.00 54.53  ? 70  SER F N   1 
ATOM   8586  C  CA  . SER F  1 70  ? -62.357  102.963 20.834  1.00 50.71  ? 70  SER F CA  1 
ATOM   8587  C  C   . SER F  1 70  ? -63.863  102.965 20.997  1.00 43.50  ? 70  SER F C   1 
ATOM   8588  O  O   . SER F  1 70  ? -64.364  102.948 22.117  1.00 42.38  ? 70  SER F O   1 
ATOM   8589  C  CB  . SER F  1 70  ? -61.889  101.590 20.354  1.00 63.25  ? 70  SER F CB  1 
ATOM   8590  O  OG  . SER F  1 70  ? -60.478  101.481 20.458  1.00 76.43  ? 70  SER F OG  1 
ATOM   8591  N  N   . PRO F  1 71  ? -64.598  103.013 19.881  1.00 43.98  ? 71  PRO F N   1 
ATOM   8592  C  CA  . PRO F  1 71  ? -66.055  102.919 19.960  1.00 27.39  ? 71  PRO F CA  1 
ATOM   8593  C  C   . PRO F  1 71  ? -66.474  101.606 20.597  1.00 27.37  ? 71  PRO F C   1 
ATOM   8594  O  O   . PRO F  1 71  ? -65.812  100.586 20.423  1.00 43.43  ? 71  PRO F O   1 
ATOM   8595  C  CB  . PRO F  1 71  ? -66.483  102.956 18.495  1.00 36.81  ? 71  PRO F CB  1 
ATOM   8596  C  CG  . PRO F  1 71  ? -65.411  103.743 17.830  1.00 48.68  ? 71  PRO F CG  1 
ATOM   8597  C  CD  . PRO F  1 71  ? -64.139  103.346 18.523  1.00 43.47  ? 71  PRO F CD  1 
ATOM   8598  N  N   . ASP F  1 72  ? -67.584  101.649 21.325  1.00 32.28  ? 72  ASP F N   1 
ATOM   8599  C  CA  . ASP F  1 72  ? -68.106  100.503 22.050  1.00 34.95  ? 72  ASP F CA  1 
ATOM   8600  C  C   . ASP F  1 72  ? -68.981  99.609  21.159  1.00 37.35  ? 72  ASP F C   1 
ATOM   8601  O  O   . ASP F  1 72  ? -69.152  98.413  21.419  1.00 28.03  ? 72  ASP F O   1 
ATOM   8602  C  CB  . ASP F  1 72  ? -68.917  100.999 23.253  1.00 31.53  ? 72  ASP F CB  1 
ATOM   8603  C  CG  . ASP F  1 72  ? -69.148  99.915  24.286  1.00 64.97  ? 72  ASP F CG  1 
ATOM   8604  O  OD1 . ASP F  1 72  ? -68.168  99.243  24.690  1.00 64.45  ? 72  ASP F OD1 1 
ATOM   8605  O  OD2 . ASP F  1 72  ? -70.314  99.726  24.679  1.00 74.44  ? 72  ASP F OD2 1 
ATOM   8606  N  N   . GLN F  1 73  ? -69.542  100.195 20.109  1.00 29.60  ? 73  GLN F N   1 
ATOM   8607  C  CA  . GLN F  1 73  ? -70.393  99.444  19.199  1.00 22.67  ? 73  GLN F CA  1 
ATOM   8608  C  C   . GLN F  1 73  ? -70.280  99.903  17.761  1.00 26.91  ? 73  GLN F C   1 
ATOM   8609  O  O   . GLN F  1 73  ? -69.959  101.064 17.474  1.00 35.81  ? 73  GLN F O   1 
ATOM   8610  C  CB  . GLN F  1 73  ? -71.846  99.600  19.590  1.00 26.13  ? 73  GLN F CB  1 
ATOM   8611  C  CG  . GLN F  1 73  ? -72.212  99.107  20.957  1.00 30.36  ? 73  GLN F CG  1 
ATOM   8612  C  CD  . GLN F  1 73  ? -73.720  99.207  21.205  1.00 31.99  ? 73  GLN F CD  1 
ATOM   8613  O  OE1 . GLN F  1 73  ? -74.513  99.452  20.281  1.00 27.58  ? 73  GLN F OE1 1 
ATOM   8614  N  NE2 . GLN F  1 73  ? -74.118  99.031  22.457  1.00 23.91  ? 73  GLN F NE2 1 
ATOM   8615  N  N   . VAL F  1 74  ? -70.565  98.980  16.858  1.00 13.43  ? 74  VAL F N   1 
ATOM   8616  C  CA  . VAL F  1 74  ? -70.670  99.305  15.444  1.00 16.56  ? 74  VAL F CA  1 
ATOM   8617  C  C   . VAL F  1 74  ? -71.873  98.613  14.799  1.00 20.70  ? 74  VAL F C   1 
ATOM   8618  O  O   . VAL F  1 74  ? -72.372  97.604  15.292  1.00 28.88  ? 74  VAL F O   1 
ATOM   8619  C  CB  . VAL F  1 74  ? -69.399  98.913  14.666  1.00 16.50  ? 74  VAL F CB  1 
ATOM   8620  C  CG1 . VAL F  1 74  ? -68.269  99.880  14.977  1.00 14.36  ? 74  VAL F CG1 1 
ATOM   8621  C  CG2 . VAL F  1 74  ? -69.022  97.465  14.956  1.00 12.92  ? 74  VAL F CG2 1 
ATOM   8622  N  N   . SER F  1 75  ? -72.340  99.161  13.691  1.00 26.03  ? 75  SER F N   1 
ATOM   8623  C  CA  . SER F  1 75  ? -73.354  98.474  12.899  1.00 21.70  ? 75  SER F CA  1 
ATOM   8624  C  C   . SER F  1 75  ? -72.666  97.700  11.771  1.00 22.15  ? 75  SER F C   1 
ATOM   8625  O  O   . SER F  1 75  ? -71.816  98.238  11.055  1.00 26.11  ? 75  SER F O   1 
ATOM   8626  C  CB  . SER F  1 75  ? -74.385  99.464  12.349  1.00 12.91  ? 75  SER F CB  1 
ATOM   8627  O  OG  . SER F  1 75  ? -75.192  99.983  13.389  1.00 23.94  ? 75  SER F OG  1 
ATOM   8628  N  N   . VAL F  1 76  ? -73.022  96.430  11.632  1.00 21.73  ? 76  VAL F N   1 
ATOM   8629  C  CA  . VAL F  1 76  ? -72.342  95.554  10.695  1.00 16.60  ? 76  VAL F CA  1 
ATOM   8630  C  C   . VAL F  1 76  ? -73.344  94.829  9.825   1.00 12.20  ? 76  VAL F C   1 
ATOM   8631  O  O   . VAL F  1 76  ? -74.302  94.265  10.330  1.00 30.60  ? 76  VAL F O   1 
ATOM   8632  C  CB  . VAL F  1 76  ? -71.490  94.494  11.449  1.00 25.78  ? 76  VAL F CB  1 
ATOM   8633  C  CG1 . VAL F  1 76  ? -70.719  93.623  10.467  1.00 20.29  ? 76  VAL F CG1 1 
ATOM   8634  C  CG2 . VAL F  1 76  ? -70.526  95.156  12.417  1.00 14.53  ? 76  VAL F CG2 1 
ATOM   8635  N  N   . PRO F  1 77  ? -73.125  94.836  8.513   1.00 13.78  ? 77  PRO F N   1 
ATOM   8636  C  CA  . PRO F  1 77  ? -73.896  94.024  7.569   1.00 21.80  ? 77  PRO F CA  1 
ATOM   8637  C  C   . PRO F  1 77  ? -73.921  92.564  8.005   1.00 18.37  ? 77  PRO F C   1 
ATOM   8638  O  O   . PRO F  1 77  ? -72.849  91.984  8.143   1.00 15.94  ? 77  PRO F O   1 
ATOM   8639  C  CB  . PRO F  1 77  ? -73.069  94.124  6.283   1.00 19.13  ? 77  PRO F CB  1 
ATOM   8640  C  CG  . PRO F  1 77  ? -72.335  95.407  6.407   1.00 24.62  ? 77  PRO F CG  1 
ATOM   8641  C  CD  . PRO F  1 77  ? -72.051  95.591  7.854   1.00 19.73  ? 77  PRO F CD  1 
ATOM   8642  N  N   . ILE F  1 78  ? -75.100  91.970  8.170   1.00 15.60  ? 78  ILE F N   1 
ATOM   8643  C  CA  . ILE F  1 78  ? -75.171  90.598  8.675   1.00 28.97  ? 78  ILE F CA  1 
ATOM   8644  C  C   . ILE F  1 78  ? -74.486  89.590  7.760   1.00 24.85  ? 78  ILE F C   1 
ATOM   8645  O  O   . ILE F  1 78  ? -74.128  88.494  8.193   1.00 33.78  ? 78  ILE F O   1 
ATOM   8646  C  CB  . ILE F  1 78  ? -76.620  90.128  8.923   1.00 21.66  ? 78  ILE F CB  1 
ATOM   8647  C  CG1 . ILE F  1 78  ? -77.461  90.371  7.675   1.00 22.18  ? 78  ILE F CG1 1 
ATOM   8648  C  CG2 . ILE F  1 78  ? -77.204  90.798  10.154  1.00 6.20   ? 78  ILE F CG2 1 
ATOM   8649  C  CD1 . ILE F  1 78  ? -78.671  89.495  7.610   1.00 17.95  ? 78  ILE F CD1 1 
ATOM   8650  N  N   . SER F  1 79  ? -74.317  89.959  6.496   1.00 21.40  ? 79  SER F N   1 
ATOM   8651  C  CA  . SER F  1 79  ? -73.569  89.134  5.553   1.00 19.56  ? 79  SER F CA  1 
ATOM   8652  C  C   . SER F  1 79  ? -72.122  88.969  5.990   1.00 26.17  ? 79  SER F C   1 
ATOM   8653  O  O   . SER F  1 79  ? -71.436  88.074  5.523   1.00 24.90  ? 79  SER F O   1 
ATOM   8654  C  CB  . SER F  1 79  ? -73.619  89.745  4.157   1.00 26.15  ? 79  SER F CB  1 
ATOM   8655  O  OG  . SER F  1 79  ? -73.394  91.145  4.204   1.00 36.64  ? 79  SER F OG  1 
ATOM   8656  N  N   . SER F  1 80  ? -71.661  89.835  6.886   1.00 26.53  ? 80  SER F N   1 
ATOM   8657  C  CA  . SER F  1 80  ? -70.313  89.711  7.447   1.00 26.74  ? 80  SER F CA  1 
ATOM   8658  C  C   . SER F  1 80  ? -70.272  88.991  8.803   1.00 31.45  ? 80  SER F C   1 
ATOM   8659  O  O   . SER F  1 80  ? -69.202  88.818  9.380   1.00 40.14  ? 80  SER F O   1 
ATOM   8660  C  CB  . SER F  1 80  ? -69.651  91.088  7.582   1.00 21.51  ? 80  SER F CB  1 
ATOM   8661  O  OG  . SER F  1 80  ? -69.559  91.739  6.324   1.00 31.35  ? 80  SER F OG  1 
ATOM   8662  N  N   . LEU F  1 81  ? -71.431  88.580  9.312   1.00 29.83  ? 81  LEU F N   1 
ATOM   8663  C  CA  . LEU F  1 81  ? -71.503  87.913  10.607  1.00 22.03  ? 81  LEU F CA  1 
ATOM   8664  C  C   . LEU F  1 81  ? -72.074  86.518  10.484  1.00 27.10  ? 81  LEU F C   1 
ATOM   8665  O  O   . LEU F  1 81  ? -72.795  86.203  9.530   1.00 30.37  ? 81  LEU F O   1 
ATOM   8666  C  CB  . LEU F  1 81  ? -72.399  88.688  11.559  1.00 16.71  ? 81  LEU F CB  1 
ATOM   8667  C  CG  . LEU F  1 81  ? -72.010  90.135  11.812  1.00 23.28  ? 81  LEU F CG  1 
ATOM   8668  C  CD1 . LEU F  1 81  ? -72.989  90.739  12.785  1.00 26.18  ? 81  LEU F CD1 1 
ATOM   8669  C  CD2 . LEU F  1 81  ? -70.599  90.182  12.371  1.00 40.12  ? 81  LEU F CD2 1 
ATOM   8670  N  N   . TRP F  1 82  ? -71.743  85.676  11.452  1.00 17.25  ? 82  TRP F N   1 
ATOM   8671  C  CA  . TRP F  1 82  ? -72.464  84.441  11.601  1.00 19.48  ? 82  TRP F CA  1 
ATOM   8672  C  C   . TRP F  1 82  ? -73.792  84.814  12.199  1.00 18.72  ? 82  TRP F C   1 
ATOM   8673  O  O   . TRP F  1 82  ? -73.858  85.611  13.121  1.00 27.08  ? 82  TRP F O   1 
ATOM   8674  C  CB  . TRP F  1 82  ? -71.750  83.455  12.522  1.00 15.52  ? 82  TRP F CB  1 
ATOM   8675  C  CG  . TRP F  1 82  ? -72.600  82.221  12.808  1.00 36.38  ? 82  TRP F CG  1 
ATOM   8676  C  CD1 . TRP F  1 82  ? -72.656  81.066  12.075  1.00 23.19  ? 82  TRP F CD1 1 
ATOM   8677  C  CD2 . TRP F  1 82  ? -73.512  82.043  13.900  1.00 26.18  ? 82  TRP F CD2 1 
ATOM   8678  N  NE1 . TRP F  1 82  ? -73.531  80.184  12.652  1.00 30.71  ? 82  TRP F NE1 1 
ATOM   8679  C  CE2 . TRP F  1 82  ? -74.067  80.756  13.775  1.00 19.87  ? 82  TRP F CE2 1 
ATOM   8680  C  CE3 . TRP F  1 82  ? -73.905  82.848  14.973  1.00 26.65  ? 82  TRP F CE3 1 
ATOM   8681  C  CZ2 . TRP F  1 82  ? -74.987  80.258  14.674  1.00 14.74  ? 82  TRP F CZ2 1 
ATOM   8682  C  CZ3 . TRP F  1 82  ? -74.813  82.354  15.869  1.00 21.15  ? 82  TRP F CZ3 1 
ATOM   8683  C  CH2 . TRP F  1 82  ? -75.349  81.069  15.716  1.00 34.06  ? 82  TRP F CH2 1 
ATOM   8684  N  N   . VAL F  1 83  ? -74.852  84.247  11.647  1.00 26.75  ? 83  VAL F N   1 
ATOM   8685  C  CA  . VAL F  1 83  ? -76.196  84.480  12.135  1.00 18.06  ? 83  VAL F CA  1 
ATOM   8686  C  C   . VAL F  1 83  ? -76.839  83.116  12.371  1.00 22.16  ? 83  VAL F C   1 
ATOM   8687  O  O   . VAL F  1 83  ? -76.652  82.192  11.567  1.00 26.47  ? 83  VAL F O   1 
ATOM   8688  C  CB  . VAL F  1 83  ? -77.033  85.286  11.117  1.00 12.95  ? 83  VAL F CB  1 
ATOM   8689  C  CG1 . VAL F  1 83  ? -78.467  85.368  11.579  1.00 45.69  ? 83  VAL F CG1 1 
ATOM   8690  C  CG2 . VAL F  1 83  ? -76.483  86.681  10.957  1.00 15.50  ? 83  VAL F CG2 1 
ATOM   8691  N  N   . PRO F  1 84  ? -77.580  82.971  13.481  1.00 8.20   ? 84  PRO F N   1 
ATOM   8692  C  CA  . PRO F  1 84  ? -78.267  81.697  13.699  1.00 16.89  ? 84  PRO F CA  1 
ATOM   8693  C  C   . PRO F  1 84  ? -79.332  81.450  12.608  1.00 22.99  ? 84  PRO F C   1 
ATOM   8694  O  O   . PRO F  1 84  ? -80.003  82.391  12.154  1.00 7.78   ? 84  PRO F O   1 
ATOM   8695  C  CB  . PRO F  1 84  ? -78.890  81.873  15.091  1.00 12.59  ? 84  PRO F CB  1 
ATOM   8696  C  CG  . PRO F  1 84  ? -79.016  83.348  15.271  1.00 9.21   ? 84  PRO F CG  1 
ATOM   8697  C  CD  . PRO F  1 84  ? -77.843  83.940  14.560  1.00 21.29  ? 84  PRO F CD  1 
ATOM   8698  N  N   . ASP F  1 85  ? -79.442  80.193  12.181  1.00 10.29  ? 85  ASP F N   1 
ATOM   8699  C  CA  . ASP F  1 85  ? -80.345  79.798  11.107  1.00 10.46  ? 85  ASP F CA  1 
ATOM   8700  C  C   . ASP F  1 85  ? -81.789  79.598  11.610  1.00 17.82  ? 85  ASP F C   1 
ATOM   8701  O  O   . ASP F  1 85  ? -82.386  78.516  11.507  1.00 19.18  ? 85  ASP F O   1 
ATOM   8702  C  CB  . ASP F  1 85  ? -79.820  78.528  10.432  1.00 11.49  ? 85  ASP F CB  1 
ATOM   8703  C  CG  . ASP F  1 85  ? -79.757  77.352  11.379  1.00 21.13  ? 85  ASP F CG  1 
ATOM   8704  O  OD1 . ASP F  1 85  ? -79.574  77.577  12.583  1.00 14.54  ? 85  ASP F OD1 1 
ATOM   8705  O  OD2 . ASP F  1 85  ? -79.885  76.199  10.927  1.00 26.72  ? 85  ASP F OD2 1 
ATOM   8706  N  N   . LEU F  1 86  ? -82.341  80.659  12.169  1.00 13.75  ? 86  LEU F N   1 
ATOM   8707  C  CA  . LEU F  1 86  ? -83.675  80.602  12.717  1.00 27.27  ? 86  LEU F CA  1 
ATOM   8708  C  C   . LEU F  1 86  ? -84.693  80.569  11.587  1.00 25.40  ? 86  LEU F C   1 
ATOM   8709  O  O   . LEU F  1 86  ? -84.520  81.230  10.567  1.00 22.21  ? 86  LEU F O   1 
ATOM   8710  C  CB  . LEU F  1 86  ? -83.925  81.810  13.615  1.00 11.97  ? 86  LEU F CB  1 
ATOM   8711  C  CG  . LEU F  1 86  ? -83.032  81.931  14.832  1.00 11.49  ? 86  LEU F CG  1 
ATOM   8712  C  CD1 . LEU F  1 86  ? -83.497  83.104  15.641  1.00 13.71  ? 86  LEU F CD1 1 
ATOM   8713  C  CD2 . LEU F  1 86  ? -83.090  80.642  15.671  1.00 9.39   ? 86  LEU F CD2 1 
ATOM   8714  N  N   . ALA F  1 87  ? -85.749  79.790  11.775  1.00 17.93  ? 87  ALA F N   1 
ATOM   8715  C  CA  . ALA F  1 87  ? -86.844  79.749  10.829  1.00 24.83  ? 87  ALA F CA  1 
ATOM   8716  C  C   . ALA F  1 87  ? -88.164  79.595  11.588  1.00 27.30  ? 87  ALA F C   1 
ATOM   8717  O  O   . ALA F  1 87  ? -88.212  79.013  12.679  1.00 25.54  ? 87  ALA F O   1 
ATOM   8718  C  CB  . ALA F  1 87  ? -86.655  78.614  9.826   1.00 7.76   ? 87  ALA F CB  1 
ATOM   8719  N  N   . ALA F  1 88  ? -89.231  80.140  11.012  1.00 16.93  ? 88  ALA F N   1 
ATOM   8720  C  CA  . ALA F  1 88  ? -90.556  79.932  11.548  1.00 7.64   ? 88  ALA F CA  1 
ATOM   8721  C  C   . ALA F  1 88  ? -91.143  78.681  10.926  1.00 8.17   ? 88  ALA F C   1 
ATOM   8722  O  O   . ALA F  1 88  ? -91.428  78.631  9.731   1.00 14.38  ? 88  ALA F O   1 
ATOM   8723  C  CB  . ALA F  1 88  ? -91.439  81.137  11.275  1.00 14.66  ? 88  ALA F CB  1 
ATOM   8724  N  N   . TYR F  1 89  ? -91.328  77.662  11.749  1.00 20.01  ? 89  TYR F N   1 
ATOM   8725  C  CA  . TYR F  1 89  ? -91.861  76.390  11.274  1.00 23.67  ? 89  TYR F CA  1 
ATOM   8726  C  C   . TYR F  1 89  ? -93.172  76.516  10.520  1.00 20.08  ? 89  TYR F C   1 
ATOM   8727  O  O   . TYR F  1 89  ? -93.367  75.859  9.499   1.00 26.93  ? 89  TYR F O   1 
ATOM   8728  C  CB  . TYR F  1 89  ? -92.014  75.403  12.431  1.00 10.42  ? 89  TYR F CB  1 
ATOM   8729  C  CG  . TYR F  1 89  ? -90.693  74.799  12.864  1.00 34.90  ? 89  TYR F CG  1 
ATOM   8730  C  CD1 . TYR F  1 89  ? -89.699  75.589  13.441  1.00 21.60  ? 89  TYR F CD1 1 
ATOM   8731  C  CD2 . TYR F  1 89  ? -90.436  73.439  12.691  1.00 13.88  ? 89  TYR F CD2 1 
ATOM   8732  C  CE1 . TYR F  1 89  ? -88.500  75.045  13.835  1.00 19.99  ? 89  TYR F CE1 1 
ATOM   8733  C  CE2 . TYR F  1 89  ? -89.231  72.885  13.092  1.00 24.93  ? 89  TYR F CE2 1 
ATOM   8734  C  CZ  . TYR F  1 89  ? -88.265  73.696  13.662  1.00 30.20  ? 89  TYR F CZ  1 
ATOM   8735  O  OH  . TYR F  1 89  ? -87.052  73.159  14.056  1.00 30.08  ? 89  TYR F OH  1 
ATOM   8736  N  N   . ASN F  1 90  ? -94.070  77.359  11.015  1.00 21.75  ? 90  ASN F N   1 
ATOM   8737  C  CA  . ASN F  1 90  ? -95.393  77.452  10.409  1.00 25.08  ? 90  ASN F CA  1 
ATOM   8738  C  C   . ASN F  1 90  ? -95.580  78.671  9.511   1.00 14.89  ? 90  ASN F C   1 
ATOM   8739  O  O   . ASN F  1 90  ? -96.711  79.044  9.194   1.00 23.35  ? 90  ASN F O   1 
ATOM   8740  C  CB  . ASN F  1 90  ? -96.503  77.348  11.472  1.00 13.74  ? 90  ASN F CB  1 
ATOM   8741  C  CG  . ASN F  1 90  ? -96.420  78.437  12.507  1.00 19.42  ? 90  ASN F CG  1 
ATOM   8742  O  OD1 . ASN F  1 90  ? -95.336  78.823  12.919  1.00 14.12  ? 90  ASN F OD1 1 
ATOM   8743  N  ND2 . ASN F  1 90  ? -97.571  78.958  12.916  1.00 27.37  ? 90  ASN F ND2 1 
ATOM   8744  N  N   . ALA F  1 91  ? -94.468  79.281  9.103   1.00 21.06  ? 91  ALA F N   1 
ATOM   8745  C  CA  . ALA F  1 91  ? -94.500  80.326  8.088   1.00 15.66  ? 91  ALA F CA  1 
ATOM   8746  C  C   . ALA F  1 91  ? -94.855  79.687  6.745   1.00 19.75  ? 91  ALA F C   1 
ATOM   8747  O  O   . ALA F  1 91  ? -94.460  78.552  6.460   1.00 24.41  ? 91  ALA F O   1 
ATOM   8748  C  CB  . ALA F  1 91  ? -93.168  81.039  8.018   1.00 16.23  ? 91  ALA F CB  1 
ATOM   8749  N  N   . ILE F  1 92  ? -95.639  80.391  5.939   1.00 24.09  ? 92  ILE F N   1 
ATOM   8750  C  CA  . ILE F  1 92  ? -96.049  79.861  4.641   1.00 21.80  ? 92  ILE F CA  1 
ATOM   8751  C  C   . ILE F  1 92  ? -95.601  80.755  3.496   1.00 16.21  ? 92  ILE F C   1 
ATOM   8752  O  O   . ILE F  1 92  ? -95.911  80.490  2.337   1.00 15.32  ? 92  ILE F O   1 
ATOM   8753  C  CB  . ILE F  1 92  ? -97.564  79.620  4.557   1.00 20.87  ? 92  ILE F CB  1 
ATOM   8754  C  CG1 . ILE F  1 92  ? -98.326  80.900  4.899   1.00 19.02  ? 92  ILE F CG1 1 
ATOM   8755  C  CG2 . ILE F  1 92  ? -97.968  78.461  5.450   1.00 10.30  ? 92  ILE F CG2 1 
ATOM   8756  C  CD1 . ILE F  1 92  ? -99.808  80.774  4.691   1.00 19.56  ? 92  ILE F CD1 1 
ATOM   8757  N  N   . SER F  1 93  ? -94.888  81.819  3.843   1.00 9.90   ? 93  SER F N   1 
ATOM   8758  C  CA  . SER F  1 93  ? -94.125  82.599  2.877   1.00 25.69  ? 93  SER F CA  1 
ATOM   8759  C  C   . SER F  1 93  ? -92.703  82.801  3.416   1.00 24.52  ? 93  SER F C   1 
ATOM   8760  O  O   . SER F  1 93  ? -92.479  82.744  4.624   1.00 23.66  ? 93  SER F O   1 
ATOM   8761  C  CB  . SER F  1 93  ? -94.806  83.949  2.621   1.00 27.18  ? 93  SER F CB  1 
ATOM   8762  O  OG  . SER F  1 93  ? -94.801  84.790  3.768   1.00 20.71  ? 93  SER F OG  1 
ATOM   8763  N  N   . LYS F  1 94  ? -91.730  83.025  2.546   1.00 27.81  ? 94  LYS F N   1 
ATOM   8764  C  CA  . LYS F  1 94  ? -90.406  83.327  3.068   1.00 30.68  ? 94  LYS F CA  1 
ATOM   8765  C  C   . LYS F  1 94  ? -90.453  84.731  3.627   1.00 23.27  ? 94  LYS F C   1 
ATOM   8766  O  O   . LYS F  1 94  ? -91.208  85.571  3.140   1.00 35.95  ? 94  LYS F O   1 
ATOM   8767  C  CB  . LYS F  1 94  ? -89.313  83.163  2.014   1.00 35.90  ? 94  LYS F CB  1 
ATOM   8768  C  CG  . LYS F  1 94  ? -89.413  84.068  0.812   1.00 45.57  ? 94  LYS F CG  1 
ATOM   8769  C  CD  . LYS F  1 94  ? -88.441  83.608  -0.292  1.00 62.96  ? 94  LYS F CD  1 
ATOM   8770  C  CE  . LYS F  1 94  ? -87.008  83.461  0.224   1.00 58.31  ? 94  LYS F CE  1 
ATOM   8771  N  NZ  . LYS F  1 94  ? -86.121  82.822  -0.794  1.00 53.56  ? 94  LYS F NZ  1 
ATOM   8772  N  N   . PRO F  1 95  ? -89.684  84.981  4.683   1.00 26.05  ? 95  PRO F N   1 
ATOM   8773  C  CA  . PRO F  1 95  ? -89.791  86.265  5.382   1.00 20.17  ? 95  PRO F CA  1 
ATOM   8774  C  C   . PRO F  1 95  ? -89.365  87.411  4.486   1.00 15.54  ? 95  PRO F C   1 
ATOM   8775  O  O   . PRO F  1 95  ? -88.309  87.351  3.879   1.00 25.70  ? 95  PRO F O   1 
ATOM   8776  C  CB  . PRO F  1 95  ? -88.820  86.112  6.554   1.00 15.95  ? 95  PRO F CB  1 
ATOM   8777  C  CG  . PRO F  1 95  ? -87.867  85.029  6.105   1.00 25.42  ? 95  PRO F CG  1 
ATOM   8778  C  CD  . PRO F  1 95  ? -88.700  84.082  5.298   1.00 22.40  ? 95  PRO F CD  1 
ATOM   8779  N  N   . GLU F  1 96  ? -90.203  88.435  4.399   1.00 19.77  ? 96  GLU F N   1 
ATOM   8780  C  CA  . GLU F  1 96  ? -89.859  89.671  3.710   1.00 16.64  ? 96  GLU F CA  1 
ATOM   8781  C  C   . GLU F  1 96  ? -89.191  90.614  4.716   1.00 30.41  ? 96  GLU F C   1 
ATOM   8782  O  O   . GLU F  1 96  ? -89.837  91.137  5.633   1.00 22.28  ? 96  GLU F O   1 
ATOM   8783  C  CB  . GLU F  1 96  ? -91.116  90.312  3.103   1.00 8.07   ? 96  GLU F CB  1 
ATOM   8784  C  CG  . GLU F  1 96  ? -90.848  91.513  2.199   1.00 36.98  ? 96  GLU F CG  1 
ATOM   8785  C  CD  . GLU F  1 96  ? -92.127  92.165  1.672   1.00 55.21  ? 96  GLU F CD  1 
ATOM   8786  O  OE1 . GLU F  1 96  ? -93.234  91.688  2.019   1.00 52.41  ? 96  GLU F OE1 1 
ATOM   8787  O  OE2 . GLU F  1 96  ? -92.026  93.156  0.909   1.00 52.74  ? 96  GLU F OE2 1 
ATOM   8788  N  N   . VAL F  1 97  ? -87.889  90.811  4.569   1.00 18.02  ? 97  VAL F N   1 
ATOM   8789  C  CA  . VAL F  1 97  ? -87.186  91.701  5.478   1.00 11.04  ? 97  VAL F CA  1 
ATOM   8790  C  C   . VAL F  1 97  ? -87.308  93.144  5.025   1.00 16.49  ? 97  VAL F C   1 
ATOM   8791  O  O   . VAL F  1 97  ? -86.833  93.517  3.957   1.00 28.53  ? 97  VAL F O   1 
ATOM   8792  C  CB  . VAL F  1 97  ? -85.729  91.318  5.602   1.00 26.42  ? 97  VAL F CB  1 
ATOM   8793  C  CG1 . VAL F  1 97  ? -85.028  92.241  6.582   1.00 27.62  ? 97  VAL F CG1 1 
ATOM   8794  C  CG2 . VAL F  1 97  ? -85.631  89.881  6.052   1.00 11.24  ? 97  VAL F CG2 1 
ATOM   8795  N  N   . LEU F  1 98  ? -87.958  93.949  5.847   1.00 14.04  ? 98  LEU F N   1 
ATOM   8796  C  CA  . LEU F  1 98  ? -88.348  95.292  5.462   1.00 9.96   ? 98  LEU F CA  1 
ATOM   8797  C  C   . LEU F  1 98  ? -87.257  96.315  5.718   1.00 15.37  ? 98  LEU F C   1 
ATOM   8798  O  O   . LEU F  1 98  ? -87.227  97.369  5.101   1.00 26.22  ? 98  LEU F O   1 
ATOM   8799  C  CB  . LEU F  1 98  ? -89.599  95.687  6.244   1.00 13.36  ? 98  LEU F CB  1 
ATOM   8800  C  CG  . LEU F  1 98  ? -90.818  94.779  6.089   1.00 7.72   ? 98  LEU F CG  1 
ATOM   8801  C  CD1 . LEU F  1 98  ? -91.866  95.150  7.123   1.00 10.03  ? 98  LEU F CD1 1 
ATOM   8802  C  CD2 . LEU F  1 98  ? -91.369  94.863  4.690   1.00 4.91   ? 98  LEU F CD2 1 
ATOM   8803  N  N   . THR F  1 99  ? -86.372  96.011  6.653   1.00 20.89  ? 99  THR F N   1 
ATOM   8804  C  CA  . THR F  1 99  ? -85.408  96.995  7.115   1.00 22.36  ? 99  THR F CA  1 
ATOM   8805  C  C   . THR F  1 99  ? -83.992  96.677  6.638   1.00 21.00  ? 99  THR F C   1 
ATOM   8806  O  O   . THR F  1 99  ? -83.702  95.540  6.238   1.00 15.11  ? 99  THR F O   1 
ATOM   8807  C  CB  . THR F  1 99  ? -85.454  97.092  8.639   1.00 15.54  ? 99  THR F CB  1 
ATOM   8808  O  OG1 . THR F  1 99  ? -85.426  95.770  9.191   1.00 18.99  ? 99  THR F OG1 1 
ATOM   8809  C  CG2 . THR F  1 99  ? -86.746  97.764  9.053   1.00 15.58  ? 99  THR F CG2 1 
ATOM   8810  N  N   . PRO F  1 100 ? -83.109  97.688  6.652   1.00 26.72  ? 100 PRO F N   1 
ATOM   8811  C  CA  . PRO F  1 100 ? -81.694  97.451  6.339   1.00 24.00  ? 100 PRO F CA  1 
ATOM   8812  C  C   . PRO F  1 100 ? -81.133  96.299  7.178   1.00 21.40  ? 100 PRO F C   1 
ATOM   8813  O  O   . PRO F  1 100 ? -81.327  96.228  8.391   1.00 18.82  ? 100 PRO F O   1 
ATOM   8814  C  CB  . PRO F  1 100 ? -81.028  98.776  6.724   1.00 15.82  ? 100 PRO F CB  1 
ATOM   8815  C  CG  . PRO F  1 100 ? -82.094  99.790  6.483   1.00 19.47  ? 100 PRO F CG  1 
ATOM   8816  C  CD  . PRO F  1 100 ? -83.387  99.113  6.908   1.00 22.34  ? 100 PRO F CD  1 
ATOM   8817  N  N   . GLN F  1 101 ? -80.434  95.388  6.525   1.00 15.57  ? 101 GLN F N   1 
ATOM   8818  C  CA  . GLN F  1 101 ? -79.973  94.201  7.218   1.00 27.77  ? 101 GLN F CA  1 
ATOM   8819  C  C   . GLN F  1 101 ? -78.643  94.397  7.957   1.00 26.84  ? 101 GLN F C   1 
ATOM   8820  O  O   . GLN F  1 101 ? -77.624  93.804  7.615   1.00 22.68  ? 101 GLN F O   1 
ATOM   8821  C  CB  . GLN F  1 101 ? -79.967  93.016  6.257   1.00 23.87  ? 101 GLN F CB  1 
ATOM   8822  C  CG  . GLN F  1 101 ? -81.389  92.688  5.807   1.00 19.13  ? 101 GLN F CG  1 
ATOM   8823  C  CD  . GLN F  1 101 ? -81.447  91.653  4.709   1.00 20.19  ? 101 GLN F CD  1 
ATOM   8824  O  OE1 . GLN F  1 101 ? -80.699  90.686  4.717   1.00 28.25  ? 101 GLN F OE1 1 
ATOM   8825  N  NE2 . GLN F  1 101 ? -82.347  91.852  3.755   1.00 39.00  ? 101 GLN F NE2 1 
ATOM   8826  N  N   . LEU F  1 102 ? -78.692  95.228  8.994   1.00 28.80  ? 102 LEU F N   1 
ATOM   8827  C  CA  . LEU F  1 102 ? -77.529  95.536  9.809   1.00 12.79  ? 102 LEU F CA  1 
ATOM   8828  C  C   . LEU F  1 102 ? -77.705  94.944  11.182  1.00 16.09  ? 102 LEU F C   1 
ATOM   8829  O  O   . LEU F  1 102 ? -78.773  95.016  11.762  1.00 23.24  ? 102 LEU F O   1 
ATOM   8830  C  CB  . LEU F  1 102 ? -77.365  97.046  9.942   1.00 10.97  ? 102 LEU F CB  1 
ATOM   8831  C  CG  . LEU F  1 102 ? -77.160  97.760  8.607   1.00 21.16  ? 102 LEU F CG  1 
ATOM   8832  C  CD1 . LEU F  1 102 ? -76.992  99.253  8.810   1.00 12.52  ? 102 LEU F CD1 1 
ATOM   8833  C  CD2 . LEU F  1 102 ? -75.954  97.164  7.912   1.00 22.67  ? 102 LEU F CD2 1 
ATOM   8834  N  N   . ALA F  1 103 ? -76.642  94.357  11.701  1.00 9.75   ? 103 ALA F N   1 
ATOM   8835  C  CA  . ALA F  1 103 ? -76.605  93.961  13.091  1.00 7.90   ? 103 ALA F CA  1 
ATOM   8836  C  C   . ALA F  1 103 ? -75.837  95.008  13.889  1.00 16.27  ? 103 ALA F C   1 
ATOM   8837  O  O   . ALA F  1 103 ? -75.162  95.869  13.327  1.00 33.29  ? 103 ALA F O   1 
ATOM   8838  C  CB  . ALA F  1 103 ? -75.943  92.592  13.242  1.00 7.40   ? 103 ALA F CB  1 
ATOM   8839  N  N   . ARG F  1 104 ? -75.932  94.922  15.207  1.00 21.95  ? 104 ARG F N   1 
ATOM   8840  C  CA  . ARG F  1 104 ? -75.212  95.830  16.075  1.00 13.53  ? 104 ARG F CA  1 
ATOM   8841  C  C   . ARG F  1 104 ? -74.277  94.981  16.909  1.00 14.19  ? 104 ARG F C   1 
ATOM   8842  O  O   . ARG F  1 104 ? -74.686  94.002  17.521  1.00 37.89  ? 104 ARG F O   1 
ATOM   8843  C  CB  . ARG F  1 104 ? -76.187  96.596  16.948  1.00 16.98  ? 104 ARG F CB  1 
ATOM   8844  C  CG  . ARG F  1 104 ? -75.573  97.730  17.671  1.00 23.74  ? 104 ARG F CG  1 
ATOM   8845  C  CD  . ARG F  1 104 ? -75.310  98.882  16.757  1.00 18.04  ? 104 ARG F CD  1 
ATOM   8846  N  NE  . ARG F  1 104 ? -74.809  99.997  17.546  1.00 20.07  ? 104 ARG F NE  1 
ATOM   8847  C  CZ  . ARG F  1 104 ? -74.445  101.169 17.043  1.00 29.62  ? 104 ARG F CZ  1 
ATOM   8848  N  NH1 . ARG F  1 104 ? -74.525  101.385 15.736  1.00 23.38  ? 104 ARG F NH1 1 
ATOM   8849  N  NH2 . ARG F  1 104 ? -74.003  102.125 17.853  1.00 28.10  ? 104 ARG F NH2 1 
ATOM   8850  N  N   . VAL F  1 105 ? -72.999  95.330  16.893  1.00 32.73  ? 105 VAL F N   1 
ATOM   8851  C  CA  . VAL F  1 105 ? -71.987  94.530  17.579  1.00 22.98  ? 105 VAL F CA  1 
ATOM   8852  C  C   . VAL F  1 105 ? -71.301  95.329  18.672  1.00 21.22  ? 105 VAL F C   1 
ATOM   8853  O  O   . VAL F  1 105 ? -70.755  96.418  18.426  1.00 20.43  ? 105 VAL F O   1 
ATOM   8854  C  CB  . VAL F  1 105 ? -70.938  93.984  16.598  1.00 25.08  ? 105 VAL F CB  1 
ATOM   8855  C  CG1 . VAL F  1 105 ? -69.954  93.104  17.339  1.00 30.45  ? 105 VAL F CG1 1 
ATOM   8856  C  CG2 . VAL F  1 105 ? -71.619  93.190  15.481  1.00 18.48  ? 105 VAL F CG2 1 
ATOM   8857  N  N   . VAL F  1 106 ? -71.351  94.792  19.887  1.00 22.88  ? 106 VAL F N   1 
ATOM   8858  C  CA  . VAL F  1 106 ? -70.670  95.414  21.022  1.00 34.53  ? 106 VAL F CA  1 
ATOM   8859  C  C   . VAL F  1 106 ? -69.252  94.884  21.171  1.00 23.89  ? 106 VAL F C   1 
ATOM   8860  O  O   . VAL F  1 106 ? -68.989  93.730  20.865  1.00 25.12  ? 106 VAL F O   1 
ATOM   8861  C  CB  . VAL F  1 106 ? -71.410  95.149  22.331  1.00 31.44  ? 106 VAL F CB  1 
ATOM   8862  C  CG1 . VAL F  1 106 ? -70.876  96.076  23.427  1.00 17.38  ? 106 VAL F CG1 1 
ATOM   8863  C  CG2 . VAL F  1 106 ? -72.887  95.340  22.129  1.00 14.67  ? 106 VAL F CG2 1 
ATOM   8864  N  N   . SER F  1 107 ? -68.353  95.728  21.660  1.00 21.15  ? 107 SER F N   1 
ATOM   8865  C  CA  . SER F  1 107 ? -66.933  95.382  21.790  1.00 21.85  ? 107 SER F CA  1 
ATOM   8866  C  C   . SER F  1 107 ? -66.649  94.029  22.460  1.00 26.69  ? 107 SER F C   1 
ATOM   8867  O  O   . SER F  1 107 ? -65.625  93.423  22.207  1.00 39.55  ? 107 SER F O   1 
ATOM   8868  C  CB  . SER F  1 107 ? -66.178  96.492  22.516  1.00 20.64  ? 107 SER F CB  1 
ATOM   8869  O  OG  . SER F  1 107 ? -66.627  96.623  23.849  1.00 21.49  ? 107 SER F OG  1 
ATOM   8870  N  N   . ASP F  1 108 ? -67.549  93.552  23.306  1.00 25.58  ? 108 ASP F N   1 
ATOM   8871  C  CA  . ASP F  1 108 ? -67.359  92.258  23.961  1.00 23.61  ? 108 ASP F CA  1 
ATOM   8872  C  C   . ASP F  1 108 ? -67.868  91.062  23.138  1.00 30.28  ? 108 ASP F C   1 
ATOM   8873  O  O   . ASP F  1 108 ? -67.815  89.919  23.591  1.00 35.54  ? 108 ASP F O   1 
ATOM   8874  C  CB  . ASP F  1 108 ? -68.046  92.262  25.328  1.00 24.40  ? 108 ASP F CB  1 
ATOM   8875  C  CG  . ASP F  1 108 ? -69.543  92.471  25.224  1.00 41.57  ? 108 ASP F CG  1 
ATOM   8876  O  OD1 . ASP F  1 108 ? -70.044  92.474  24.077  1.00 26.52  ? 108 ASP F OD1 1 
ATOM   8877  O  OD2 . ASP F  1 108 ? -70.209  92.629  26.279  1.00 34.91  ? 108 ASP F OD2 1 
ATOM   8878  N  N   . GLY F  1 109 ? -68.387  91.327  21.945  1.00 29.48  ? 109 GLY F N   1 
ATOM   8879  C  CA  . GLY F  1 109 ? -68.859  90.264  21.070  1.00 26.17  ? 109 GLY F CA  1 
ATOM   8880  C  C   . GLY F  1 109 ? -70.345  89.967  21.118  1.00 20.08  ? 109 GLY F C   1 
ATOM   8881  O  O   . GLY F  1 109 ? -70.804  89.036  20.463  1.00 27.95  ? 109 GLY F O   1 
ATOM   8882  N  N   . GLU F  1 110 ? -71.095  90.745  21.891  1.00 21.64  ? 110 GLU F N   1 
ATOM   8883  C  CA  . GLU F  1 110 ? -72.553  90.640  21.891  1.00 21.91  ? 110 GLU F CA  1 
ATOM   8884  C  C   . GLU F  1 110 ? -73.106  91.160  20.580  1.00 31.42  ? 110 GLU F C   1 
ATOM   8885  O  O   . GLU F  1 110 ? -72.639  92.176  20.053  1.00 36.99  ? 110 GLU F O   1 
ATOM   8886  C  CB  . GLU F  1 110 ? -73.184  91.432  23.044  1.00 50.94  ? 110 GLU F CB  1 
ATOM   8887  C  CG  . GLU F  1 110 ? -72.881  90.893  24.441  1.00 85.49  ? 110 GLU F CG  1 
ATOM   8888  C  CD  . GLU F  1 110 ? -73.607  89.595  24.756  1.00 90.19  ? 110 GLU F CD  1 
ATOM   8889  O  OE1 . GLU F  1 110 ? -74.764  89.432  24.301  1.00 83.48  ? 110 GLU F OE1 1 
ATOM   8890  O  OE2 . GLU F  1 110 ? -73.016  88.741  25.460  1.00 86.92  ? 110 GLU F OE2 1 
ATOM   8891  N  N   . VAL F  1 111 ? -74.105  90.466  20.054  1.00 15.96  ? 111 VAL F N   1 
ATOM   8892  C  CA  . VAL F  1 111 ? -74.726  90.884  18.807  1.00 27.82  ? 111 VAL F CA  1 
ATOM   8893  C  C   . VAL F  1 111 ? -76.242  91.068  18.981  1.00 27.86  ? 111 VAL F C   1 
ATOM   8894  O  O   . VAL F  1 111 ? -76.919  90.177  19.505  1.00 22.30  ? 111 VAL F O   1 
ATOM   8895  C  CB  . VAL F  1 111 ? -74.441  89.854  17.687  1.00 22.25  ? 111 VAL F CB  1 
ATOM   8896  C  CG1 . VAL F  1 111 ? -74.853  90.400  16.339  1.00 8.78   ? 111 VAL F CG1 1 
ATOM   8897  C  CG2 . VAL F  1 111 ? -72.977  89.492  17.684  1.00 17.41  ? 111 VAL F CG2 1 
ATOM   8898  N  N   . LEU F  1 112 ? -76.753  92.237  18.582  1.00 22.04  ? 112 LEU F N   1 
ATOM   8899  C  CA  . LEU F  1 112 ? -78.190  92.431  18.388  1.00 16.92  ? 112 LEU F CA  1 
ATOM   8900  C  C   . LEU F  1 112 ? -78.509  92.510  16.898  1.00 18.76  ? 112 LEU F C   1 
ATOM   8901  O  O   . LEU F  1 112 ? -77.884  93.256  16.158  1.00 23.65  ? 112 LEU F O   1 
ATOM   8902  C  CB  . LEU F  1 112 ? -78.717  93.695  19.103  1.00 28.29  ? 112 LEU F CB  1 
ATOM   8903  C  CG  . LEU F  1 112 ? -80.224  93.983  18.897  1.00 43.52  ? 112 LEU F CG  1 
ATOM   8904  C  CD1 . LEU F  1 112 ? -81.060  92.889  19.530  1.00 46.32  ? 112 LEU F CD1 1 
ATOM   8905  C  CD2 . LEU F  1 112 ? -80.699  95.350  19.400  1.00 14.31  ? 112 LEU F CD2 1 
ATOM   8906  N  N   . TYR F  1 113 ? -79.473  91.717  16.462  1.00 18.93  ? 113 TYR F N   1 
ATOM   8907  C  CA  . TYR F  1 113 ? -80.066  91.885  15.144  1.00 18.93  ? 113 TYR F CA  1 
ATOM   8908  C  C   . TYR F  1 113 ? -81.604  91.915  15.319  1.00 34.05  ? 113 TYR F C   1 
ATOM   8909  O  O   . TYR F  1 113 ? -82.188  91.019  15.948  1.00 24.57  ? 113 TYR F O   1 
ATOM   8910  C  CB  . TYR F  1 113 ? -79.620  90.759  14.229  1.00 7.97   ? 113 TYR F CB  1 
ATOM   8911  C  CG  . TYR F  1 113 ? -80.158  90.849  12.814  1.00 24.89  ? 113 TYR F CG  1 
ATOM   8912  C  CD1 . TYR F  1 113 ? -80.104  92.041  12.105  1.00 16.42  ? 113 TYR F CD1 1 
ATOM   8913  C  CD2 . TYR F  1 113 ? -80.689  89.726  12.171  1.00 11.02  ? 113 TYR F CD2 1 
ATOM   8914  C  CE1 . TYR F  1 113 ? -80.569  92.116  10.798  1.00 18.54  ? 113 TYR F CE1 1 
ATOM   8915  C  CE2 . TYR F  1 113 ? -81.154  89.795  10.869  1.00 17.07  ? 113 TYR F CE2 1 
ATOM   8916  C  CZ  . TYR F  1 113 ? -81.092  90.994  10.188  1.00 22.69  ? 113 TYR F CZ  1 
ATOM   8917  O  OH  . TYR F  1 113 ? -81.560  91.071  8.893   1.00 29.41  ? 113 TYR F OH  1 
ATOM   8918  N  N   . MET F  1 114 ? -82.238  92.969  14.804  1.00 29.89  ? 114 MET F N   1 
ATOM   8919  C  CA  . MET F  1 114 ? -83.670  93.173  14.961  1.00 20.67  ? 114 MET F CA  1 
ATOM   8920  C  C   . MET F  1 114 ? -84.280  93.770  13.700  1.00 19.48  ? 114 MET F C   1 
ATOM   8921  O  O   . MET F  1 114 ? -84.632  94.950  13.663  1.00 13.16  ? 114 MET F O   1 
ATOM   8922  C  CB  . MET F  1 114 ? -83.959  94.070  16.165  1.00 7.71   ? 114 MET F CB  1 
ATOM   8923  C  CG  . MET F  1 114 ? -85.411  94.026  16.652  1.00 7.72   ? 114 MET F CG  1 
ATOM   8924  S  SD  . MET F  1 114 ? -85.650  94.671  18.342  1.00 20.37  ? 114 MET F SD  1 
ATOM   8925  C  CE  . MET F  1 114 ? -85.218  96.402  18.072  1.00 8.72   ? 114 MET F CE  1 
ATOM   8926  N  N   . PRO F  1 115 ? -84.410  92.944  12.659  1.00 13.54  ? 115 PRO F N   1 
ATOM   8927  C  CA  . PRO F  1 115 ? -85.045  93.406  11.428  1.00 25.69  ? 115 PRO F CA  1 
ATOM   8928  C  C   . PRO F  1 115 ? -86.575  93.398  11.593  1.00 24.47  ? 115 PRO F C   1 
ATOM   8929  O  O   . PRO F  1 115 ? -87.115  92.626  12.398  1.00 17.81  ? 115 PRO F O   1 
ATOM   8930  C  CB  . PRO F  1 115 ? -84.574  92.370  10.397  1.00 10.96  ? 115 PRO F CB  1 
ATOM   8931  C  CG  . PRO F  1 115 ? -84.480  91.105  11.188  1.00 4.63   ? 115 PRO F CG  1 
ATOM   8932  C  CD  . PRO F  1 115 ? -84.049  91.516  12.591  1.00 5.62   ? 115 PRO F CD  1 
ATOM   8933  N  N   . SER F  1 116 ? -87.262  94.275  10.869  1.00 27.08  ? 116 SER F N   1 
ATOM   8934  C  CA  . SER F  1 116 ? -88.719  94.216  10.809  1.00 23.69  ? 116 SER F CA  1 
ATOM   8935  C  C   . SER F  1 116 ? -89.091  93.258  9.674   1.00 20.00  ? 116 SER F C   1 
ATOM   8936  O  O   . SER F  1 116 ? -88.602  93.384  8.552   1.00 22.38  ? 116 SER F O   1 
ATOM   8937  C  CB  . SER F  1 116 ? -89.318  95.603  10.587  1.00 5.01   ? 116 SER F CB  1 
ATOM   8938  O  OG  . SER F  1 116 ? -90.732  95.566  10.649  1.00 28.61  ? 116 SER F OG  1 
ATOM   8939  N  N   . ILE F  1 117 ? -89.930  92.279  9.983   1.00 20.15  ? 117 ILE F N   1 
ATOM   8940  C  CA  . ILE F  1 117 ? -90.292  91.246  9.022   1.00 22.25  ? 117 ILE F CA  1 
ATOM   8941  C  C   . ILE F  1 117 ? -91.798  91.155  8.782   1.00 9.77   ? 117 ILE F C   1 
ATOM   8942  O  O   . ILE F  1 117 ? -92.588  91.186  9.720   1.00 28.71  ? 117 ILE F O   1 
ATOM   8943  C  CB  . ILE F  1 117 ? -89.781  89.873  9.488   1.00 24.24  ? 117 ILE F CB  1 
ATOM   8944  C  CG1 . ILE F  1 117 ? -88.262  89.850  9.464   1.00 25.55  ? 117 ILE F CG1 1 
ATOM   8945  C  CG2 . ILE F  1 117 ? -90.300  88.775  8.598   1.00 23.99  ? 117 ILE F CG2 1 
ATOM   8946  C  CD1 . ILE F  1 117 ? -87.677  88.586  10.023  1.00 28.13  ? 117 ILE F CD1 1 
ATOM   8947  N  N   . ARG F  1 118 ? -92.178  91.073  7.514   1.00 10.95  ? 118 ARG F N   1 
ATOM   8948  C  CA  . ARG F  1 118 ? -93.529  90.702  7.138   1.00 10.41  ? 118 ARG F CA  1 
ATOM   8949  C  C   . ARG F  1 118 ? -93.543  89.256  6.633   1.00 16.90  ? 118 ARG F C   1 
ATOM   8950  O  O   . ARG F  1 118 ? -92.805  88.887  5.730   1.00 20.61  ? 118 ARG F O   1 
ATOM   8951  C  CB  . ARG F  1 118 ? -94.084  91.638  6.064   1.00 18.47  ? 118 ARG F CB  1 
ATOM   8952  C  CG  . ARG F  1 118 ? -95.469  91.216  5.549   1.00 20.89  ? 118 ARG F CG  1 
ATOM   8953  C  CD  . ARG F  1 118 ? -96.134  92.282  4.691   1.00 14.70  ? 118 ARG F CD  1 
ATOM   8954  N  NE  . ARG F  1 118 ? -97.482  91.875  4.305   1.00 24.21  ? 118 ARG F NE  1 
ATOM   8955  C  CZ  . ARG F  1 118 ? -98.375  92.661  3.715   1.00 19.47  ? 118 ARG F CZ  1 
ATOM   8956  N  NH1 . ARG F  1 118 ? -98.098  93.928  3.441   1.00 19.55  ? 118 ARG F NH1 1 
ATOM   8957  N  NH2 . ARG F  1 118 ? -99.562  92.172  3.425   1.00 24.85  ? 118 ARG F NH2 1 
ATOM   8958  N  N   . GLN F  1 119 ? -94.395  88.433  7.214   1.00 17.68  ? 119 GLN F N   1 
ATOM   8959  C  CA  . GLN F  1 119 ? -94.437  87.033  6.844   1.00 21.49  ? 119 GLN F CA  1 
ATOM   8960  C  C   . GLN F  1 119 ? -95.842  86.495  7.069   1.00 30.13  ? 119 GLN F C   1 
ATOM   8961  O  O   . GLN F  1 119 ? -96.557  86.977  7.947   1.00 26.53  ? 119 GLN F O   1 
ATOM   8962  C  CB  . GLN F  1 119 ? -93.448  86.266  7.705   1.00 18.79  ? 119 GLN F CB  1 
ATOM   8963  C  CG  . GLN F  1 119 ? -93.095  84.889  7.198   1.00 18.15  ? 119 GLN F CG  1 
ATOM   8964  C  CD  . GLN F  1 119 ? -91.881  84.331  7.914   1.00 21.04  ? 119 GLN F CD  1 
ATOM   8965  O  OE1 . GLN F  1 119 ? -91.582  84.729  9.043   1.00 25.82  ? 119 GLN F OE1 1 
ATOM   8966  N  NE2 . GLN F  1 119 ? -91.157  83.427  7.257   1.00 27.13  ? 119 GLN F NE2 1 
ATOM   8967  N  N   . ARG F  1 120 ? -96.235  85.494  6.285   1.00 34.59  ? 120 ARG F N   1 
ATOM   8968  C  CA  . ARG F  1 120 ? -97.557  84.886  6.443   1.00 39.28  ? 120 ARG F CA  1 
ATOM   8969  C  C   . ARG F  1 120 ? -97.480  83.525  7.137   1.00 21.99  ? 120 ARG F C   1 
ATOM   8970  O  O   . ARG F  1 120 ? -96.667  82.689  6.760   1.00 21.57  ? 120 ARG F O   1 
ATOM   8971  C  CB  . ARG F  1 120 ? -98.262  84.752  5.096   1.00 40.38  ? 120 ARG F CB  1 
ATOM   8972  C  CG  . ARG F  1 120 ? -99.305  85.815  4.828   1.00 53.04  ? 120 ARG F CG  1 
ATOM   8973  C  CD  . ARG F  1 120 ? -99.880  85.652  3.420   1.00 76.12  ? 120 ARG F CD  1 
ATOM   8974  N  NE  . ARG F  1 120 ? -98.846  85.712  2.383   1.00 64.36  ? 120 ARG F NE  1 
ATOM   8975  C  CZ  . ARG F  1 120 ? -98.642  84.763  1.471   1.00 64.94  ? 120 ARG F CZ  1 
ATOM   8976  N  NH1 . ARG F  1 120 ? -99.414  83.673  1.464   1.00 46.61  ? 120 ARG F NH1 1 
ATOM   8977  N  NH2 . ARG F  1 120 ? -97.671  84.907  0.563   1.00 39.57  ? 120 ARG F NH2 1 
ATOM   8978  N  N   . PHE F  1 121 ? -98.343  83.317  8.140   1.00 28.42  ? 121 PHE F N   1 
ATOM   8979  C  CA  . PHE F  1 121 ? -98.363  82.081  8.924   1.00 21.25  ? 121 PHE F CA  1 
ATOM   8980  C  C   . PHE F  1 121 ? -99.654  81.268  8.835   1.00 22.43  ? 121 PHE F C   1 
ATOM   8981  O  O   . PHE F  1 121 ? -100.733 81.808  8.622   1.00 28.53  ? 121 PHE F O   1 
ATOM   8982  C  CB  . PHE F  1 121 ? -98.099  82.387  10.388  1.00 15.90  ? 121 PHE F CB  1 
ATOM   8983  C  CG  . PHE F  1 121 ? -96.791  83.069  10.634  1.00 35.34  ? 121 PHE F CG  1 
ATOM   8984  C  CD1 . PHE F  1 121 ? -95.638  82.332  10.861  1.00 25.43  ? 121 PHE F CD1 1 
ATOM   8985  C  CD2 . PHE F  1 121 ? -96.713  84.447  10.645  1.00 23.10  ? 121 PHE F CD2 1 
ATOM   8986  C  CE1 . PHE F  1 121 ? -94.451  82.965  11.093  1.00 23.21  ? 121 PHE F CE1 1 
ATOM   8987  C  CE2 . PHE F  1 121 ? -95.517  85.080  10.880  1.00 22.15  ? 121 PHE F CE2 1 
ATOM   8988  C  CZ  . PHE F  1 121 ? -94.391  84.346  11.103  1.00 23.67  ? 121 PHE F CZ  1 
ATOM   8989  N  N   . SER F  1 122 ? -99.513  79.961  9.020   1.00 17.26  ? 122 SER F N   1 
ATOM   8990  C  CA  . SER F  1 122 ? -100.634 79.067  9.204   1.00 17.56  ? 122 SER F CA  1 
ATOM   8991  C  C   . SER F  1 122 ? -100.771 78.801  10.701  1.00 25.62  ? 122 SER F C   1 
ATOM   8992  O  O   . SER F  1 122 ? -99.859  78.253  11.326  1.00 33.75  ? 122 SER F O   1 
ATOM   8993  C  CB  . SER F  1 122 ? -100.388 77.758  8.446   1.00 22.39  ? 122 SER F CB  1 
ATOM   8994  O  OG  . SER F  1 122 ? -100.992 76.659  9.104   1.00 26.05  ? 122 SER F OG  1 
ATOM   8995  N  N   . CYS F  1 123 ? -101.902 79.209  11.274  1.00 31.82  ? 123 CYS F N   1 
ATOM   8996  C  CA  . CYS F  1 123 ? -102.195 79.003  12.697  1.00 23.85  ? 123 CYS F CA  1 
ATOM   8997  C  C   . CYS F  1 123 ? -103.678 79.175  12.994  1.00 31.17  ? 123 CYS F C   1 
ATOM   8998  O  O   . CYS F  1 123 ? -104.477 79.510  12.114  1.00 31.86  ? 123 CYS F O   1 
ATOM   8999  C  CB  . CYS F  1 123 ? -101.409 79.981  13.563  1.00 26.98  ? 123 CYS F CB  1 
ATOM   9000  S  SG  . CYS F  1 123 ? -101.627 81.695  13.070  1.00 21.16  ? 123 CYS F SG  1 
ATOM   9001  N  N   . ASP F  1 124 ? -104.039 78.956  14.249  1.00 24.96  ? 124 ASP F N   1 
ATOM   9002  C  CA  . ASP F  1 124 ? -105.431 79.019  14.656  1.00 19.10  ? 124 ASP F CA  1 
ATOM   9003  C  C   . ASP F  1 124 ? -105.989 80.453  14.664  1.00 35.00  ? 124 ASP F C   1 
ATOM   9004  O  O   . ASP F  1 124 ? -105.734 81.231  15.586  1.00 32.52  ? 124 ASP F O   1 
ATOM   9005  C  CB  . ASP F  1 124 ? -105.580 78.405  16.042  1.00 35.42  ? 124 ASP F CB  1 
ATOM   9006  C  CG  . ASP F  1 124 ? -107.010 78.058  16.370  1.00 42.47  ? 124 ASP F CG  1 
ATOM   9007  O  OD1 . ASP F  1 124 ? -107.915 78.420  15.586  1.00 46.73  ? 124 ASP F OD1 1 
ATOM   9008  O  OD2 . ASP F  1 124 ? -107.227 77.419  17.414  1.00 41.03  ? 124 ASP F OD2 1 
ATOM   9009  N  N   . VAL F  1 125 ? -106.769 80.790  13.646  1.00 23.26  ? 125 VAL F N   1 
ATOM   9010  C  CA  . VAL F  1 125 ? -107.378 82.102  13.554  1.00 15.30  ? 125 VAL F CA  1 
ATOM   9011  C  C   . VAL F  1 125 ? -108.829 82.069  14.067  1.00 31.23  ? 125 VAL F C   1 
ATOM   9012  O  O   . VAL F  1 125 ? -109.503 83.102  14.148  1.00 23.67  ? 125 VAL F O   1 
ATOM   9013  C  CB  . VAL F  1 125 ? -107.340 82.594  12.111  1.00 19.26  ? 125 VAL F CB  1 
ATOM   9014  C  CG1 . VAL F  1 125 ? -107.816 84.002  12.035  1.00 21.36  ? 125 VAL F CG1 1 
ATOM   9015  C  CG2 . VAL F  1 125 ? -105.935 82.487  11.567  1.00 18.68  ? 125 VAL F CG2 1 
ATOM   9016  N  N   . SER F  1 126 ? -109.308 80.883  14.429  1.00 23.99  ? 126 SER F N   1 
ATOM   9017  C  CA  . SER F  1 126 ? -110.658 80.765  14.957  1.00 39.70  ? 126 SER F CA  1 
ATOM   9018  C  C   . SER F  1 126 ? -110.848 81.738  16.107  1.00 37.57  ? 126 SER F C   1 
ATOM   9019  O  O   . SER F  1 126 ? -109.943 81.921  16.933  1.00 23.23  ? 126 SER F O   1 
ATOM   9020  C  CB  . SER F  1 126 ? -110.973 79.329  15.407  1.00 22.59  ? 126 SER F CB  1 
ATOM   9021  O  OG  . SER F  1 126 ? -110.466 79.057  16.700  1.00 26.45  ? 126 SER F OG  1 
ATOM   9022  N  N   . GLY F  1 127 ? -112.022 82.371  16.126  1.00 35.09  ? 127 GLY F N   1 
ATOM   9023  C  CA  . GLY F  1 127 ? -112.426 83.263  17.199  1.00 28.31  ? 127 GLY F CA  1 
ATOM   9024  C  C   . GLY F  1 127 ? -111.888 84.674  17.086  1.00 28.74  ? 127 GLY F C   1 
ATOM   9025  O  O   . GLY F  1 127 ? -112.126 85.498  17.947  1.00 23.33  ? 127 GLY F O   1 
ATOM   9026  N  N   . VAL F  1 128 ? -111.155 84.952  16.023  1.00 23.14  ? 128 VAL F N   1 
ATOM   9027  C  CA  . VAL F  1 128 ? -110.527 86.258  15.865  1.00 21.99  ? 128 VAL F CA  1 
ATOM   9028  C  C   . VAL F  1 128 ? -111.534 87.393  16.041  1.00 29.58  ? 128 VAL F C   1 
ATOM   9029  O  O   . VAL F  1 128 ? -111.172 88.489  16.451  1.00 31.76  ? 128 VAL F O   1 
ATOM   9030  C  CB  . VAL F  1 128 ? -109.849 86.400  14.486  1.00 22.34  ? 128 VAL F CB  1 
ATOM   9031  C  CG1 . VAL F  1 128 ? -110.877 86.236  13.366  1.00 23.21  ? 128 VAL F CG1 1 
ATOM   9032  C  CG2 . VAL F  1 128 ? -109.173 87.744  14.378  1.00 14.01  ? 128 VAL F CG2 1 
ATOM   9033  N  N   . ASP F  1 129 ? -112.798 87.127  15.726  1.00 26.60  ? 129 ASP F N   1 
ATOM   9034  C  CA  . ASP F  1 129 ? -113.816 88.165  15.789  1.00 28.79  ? 129 ASP F CA  1 
ATOM   9035  C  C   . ASP F  1 129 ? -114.718 88.011  17.014  1.00 34.59  ? 129 ASP F C   1 
ATOM   9036  O  O   . ASP F  1 129 ? -115.916 88.240  16.953  1.00 25.98  ? 129 ASP F O   1 
ATOM   9037  C  CB  . ASP F  1 129 ? -114.662 88.164  14.517  1.00 29.41  ? 129 ASP F CB  1 
ATOM   9038  C  CG  . ASP F  1 129 ? -115.165 89.553  14.152  1.00 51.24  ? 129 ASP F CG  1 
ATOM   9039  O  OD1 . ASP F  1 129 ? -115.205 90.435  15.038  1.00 29.94  ? 129 ASP F OD1 1 
ATOM   9040  O  OD2 . ASP F  1 129 ? -115.511 89.765  12.971  1.00 66.38  ? 129 ASP F OD2 1 
ATOM   9041  N  N   . THR F  1 130 ? -114.135 87.615  18.132  1.00 33.24  ? 130 THR F N   1 
ATOM   9042  C  CA  . THR F  1 130 ? -114.897 87.495  19.363  1.00 38.58  ? 130 THR F CA  1 
ATOM   9043  C  C   . THR F  1 130 ? -114.197 88.228  20.498  1.00 54.55  ? 130 THR F C   1 
ATOM   9044  O  O   . THR F  1 130 ? -113.041 88.666  20.361  1.00 44.39  ? 130 THR F O   1 
ATOM   9045  C  CB  . THR F  1 130 ? -115.108 86.016  19.780  1.00 44.85  ? 130 THR F CB  1 
ATOM   9046  O  OG1 . THR F  1 130 ? -113.866 85.450  20.240  1.00 42.55  ? 130 THR F OG1 1 
ATOM   9047  C  CG2 . THR F  1 130 ? -115.659 85.202  18.599  1.00 18.99  ? 130 THR F CG2 1 
ATOM   9048  N  N   . GLU F  1 131 ? -114.928 88.375  21.600  1.00 52.41  ? 131 GLU F N   1 
ATOM   9049  C  CA  . GLU F  1 131 ? -114.395 88.922  22.832  1.00 41.64  ? 131 GLU F CA  1 
ATOM   9050  C  C   . GLU F  1 131 ? -112.985 88.374  23.017  1.00 25.42  ? 131 GLU F C   1 
ATOM   9051  O  O   . GLU F  1 131 ? -112.014 89.124  23.082  1.00 44.84  ? 131 GLU F O   1 
ATOM   9052  C  CB  . GLU F  1 131 ? -115.296 88.497  24.006  1.00 47.22  ? 131 GLU F CB  1 
ATOM   9053  C  CG  . GLU F  1 131 ? -115.013 89.164  25.350  1.00 48.45  ? 131 GLU F CG  1 
ATOM   9054  C  CD  . GLU F  1 131 ? -115.471 90.611  25.395  1.00 62.04  ? 131 GLU F CD  1 
ATOM   9055  O  OE1 . GLU F  1 131 ? -116.082 91.014  26.409  1.00 56.28  ? 131 GLU F OE1 1 
ATOM   9056  O  OE2 . GLU F  1 131 ? -115.215 91.352  24.420  1.00 75.02  ? 131 GLU F OE2 1 
ATOM   9057  N  N   . SER F  1 132 ? -112.888 87.050  23.054  1.00 18.47  ? 132 SER F N   1 
ATOM   9058  C  CA  . SER F  1 132 ? -111.679 86.360  23.465  1.00 32.73  ? 132 SER F CA  1 
ATOM   9059  C  C   . SER F  1 132 ? -110.620 86.316  22.373  1.00 37.31  ? 132 SER F C   1 
ATOM   9060  O  O   . SER F  1 132 ? -109.420 86.267  22.667  1.00 30.85  ? 132 SER F O   1 
ATOM   9061  C  CB  . SER F  1 132 ? -112.040 84.941  23.889  1.00 48.32  ? 132 SER F CB  1 
ATOM   9062  O  OG  . SER F  1 132 ? -112.681 84.260  22.826  1.00 44.75  ? 132 SER F OG  1 
ATOM   9063  N  N   . GLY F  1 133 ? -111.062 86.305  21.117  1.00 38.69  ? 133 GLY F N   1 
ATOM   9064  C  CA  . GLY F  1 133 ? -110.135 86.394  19.997  1.00 31.50  ? 133 GLY F CA  1 
ATOM   9065  C  C   . GLY F  1 133 ? -109.506 85.086  19.538  1.00 32.43  ? 133 GLY F C   1 
ATOM   9066  O  O   . GLY F  1 133 ? -109.792 84.008  20.058  1.00 33.30  ? 133 GLY F O   1 
ATOM   9067  N  N   . ALA F  1 134 ? -108.646 85.191  18.537  1.00 28.90  ? 134 ALA F N   1 
ATOM   9068  C  CA  . ALA F  1 134 ? -107.854 84.058  18.076  1.00 38.15  ? 134 ALA F CA  1 
ATOM   9069  C  C   . ALA F  1 134 ? -106.530 83.990  18.822  1.00 34.22  ? 134 ALA F C   1 
ATOM   9070  O  O   . ALA F  1 134 ? -106.016 85.004  19.298  1.00 25.15  ? 134 ALA F O   1 
ATOM   9071  C  CB  . ALA F  1 134 ? -107.596 84.159  16.579  1.00 25.52  ? 134 ALA F CB  1 
ATOM   9072  N  N   . THR F  1 135 ? -105.980 82.787  18.925  1.00 28.10  ? 135 THR F N   1 
ATOM   9073  C  CA  . THR F  1 135 ? -104.645 82.627  19.477  1.00 24.02  ? 135 THR F CA  1 
ATOM   9074  C  C   . THR F  1 135 ? -103.742 81.958  18.457  1.00 24.80  ? 135 THR F C   1 
ATOM   9075  O  O   . THR F  1 135 ? -103.821 80.750  18.213  1.00 28.97  ? 135 THR F O   1 
ATOM   9076  C  CB  . THR F  1 135 ? -104.649 81.847  20.792  1.00 29.69  ? 135 THR F CB  1 
ATOM   9077  O  OG1 . THR F  1 135 ? -105.323 82.621  21.796  1.00 29.05  ? 135 THR F OG1 1 
ATOM   9078  C  CG2 . THR F  1 135 ? -103.218 81.582  21.243  1.00 27.13  ? 135 THR F CG2 1 
ATOM   9079  N  N   . CYS F  1 136 ? -102.904 82.774  17.842  1.00 21.15  ? 136 CYS F N   1 
ATOM   9080  C  CA  . CYS F  1 136 ? -102.021 82.324  16.774  1.00 27.55  ? 136 CYS F CA  1 
ATOM   9081  C  C   . CYS F  1 136 ? -100.650 81.980  17.330  1.00 30.59  ? 136 CYS F C   1 
ATOM   9082  O  O   . CYS F  1 136 ? -99.964  82.825  17.907  1.00 16.81  ? 136 CYS F O   1 
ATOM   9083  C  CB  . CYS F  1 136 ? -101.891 83.416  15.720  1.00 18.79  ? 136 CYS F CB  1 
ATOM   9084  S  SG  . CYS F  1 136 ? -100.797 83.012  14.380  1.00 30.87  ? 136 CYS F SG  1 
ATOM   9085  N  N   . ARG F  1 137 ? -100.261 80.731  17.136  1.00 12.30  ? 137 ARG F N   1 
ATOM   9086  C  CA  . ARG F  1 137 ? -99.018  80.228  17.686  1.00 31.98  ? 137 ARG F CA  1 
ATOM   9087  C  C   . ARG F  1 137 ? -97.887  80.175  16.638  1.00 6.57   ? 137 ARG F C   1 
ATOM   9088  O  O   . ARG F  1 137 ? -98.002  79.486  15.628  1.00 24.25  ? 137 ARG F O   1 
ATOM   9089  C  CB  . ARG F  1 137 ? -99.280  78.848  18.283  1.00 27.53  ? 137 ARG F CB  1 
ATOM   9090  C  CG  . ARG F  1 137 ? -98.537  78.570  19.567  1.00 38.94  ? 137 ARG F CG  1 
ATOM   9091  C  CD  . ARG F  1 137 ? -98.893  77.198  20.059  1.00 49.61  ? 137 ARG F CD  1 
ATOM   9092  N  NE  . ARG F  1 137 ? -99.000  76.292  18.924  1.00 53.26  ? 137 ARG F NE  1 
ATOM   9093  C  CZ  . ARG F  1 137 ? -100.150 75.845  18.439  1.00 55.89  ? 137 ARG F CZ  1 
ATOM   9094  N  NH1 . ARG F  1 137 ? -101.294 76.202  19.008  1.00 83.09  ? 137 ARG F NH1 1 
ATOM   9095  N  NH2 . ARG F  1 137 ? -100.151 75.035  17.392  1.00 21.97  ? 137 ARG F NH2 1 
ATOM   9096  N  N   . ILE F  1 138 ? -96.803  80.908  16.880  1.00 35.03  ? 138 ILE F N   1 
ATOM   9097  C  CA  . ILE F  1 138 ? -95.666  80.933  15.955  1.00 32.49  ? 138 ILE F CA  1 
ATOM   9098  C  C   . ILE F  1 138 ? -94.424  80.240  16.534  1.00 23.35  ? 138 ILE F C   1 
ATOM   9099  O  O   . ILE F  1 138 ? -93.944  80.605  17.596  1.00 16.74  ? 138 ILE F O   1 
ATOM   9100  C  CB  . ILE F  1 138 ? -95.297  82.362  15.582  1.00 27.06  ? 138 ILE F CB  1 
ATOM   9101  C  CG1 . ILE F  1 138 ? -96.438  83.011  14.806  1.00 24.80  ? 138 ILE F CG1 1 
ATOM   9102  C  CG2 . ILE F  1 138 ? -94.043  82.359  14.755  1.00 19.08  ? 138 ILE F CG2 1 
ATOM   9103  C  CD1 . ILE F  1 138 ? -96.243  84.490  14.571  1.00 22.60  ? 138 ILE F CD1 1 
ATOM   9104  N  N   . LYS F  1 139 ? -93.919  79.243  15.821  1.00 19.04  ? 139 LYS F N   1 
ATOM   9105  C  CA  . LYS F  1 139 ? -92.800  78.420  16.274  1.00 23.90  ? 139 LYS F CA  1 
ATOM   9106  C  C   . LYS F  1 139 ? -91.496  78.734  15.527  1.00 26.58  ? 139 LYS F C   1 
ATOM   9107  O  O   . LYS F  1 139 ? -91.392  78.562  14.316  1.00 19.63  ? 139 LYS F O   1 
ATOM   9108  C  CB  . LYS F  1 139 ? -93.150  76.942  16.103  1.00 25.02  ? 139 LYS F CB  1 
ATOM   9109  C  CG  . LYS F  1 139 ? -92.036  75.958  16.412  1.00 20.77  ? 139 LYS F CG  1 
ATOM   9110  C  CD  . LYS F  1 139 ? -92.487  74.540  16.091  1.00 19.96  ? 139 LYS F CD  1 
ATOM   9111  C  CE  . LYS F  1 139 ? -91.386  73.531  16.261  1.00 20.58  ? 139 LYS F CE  1 
ATOM   9112  N  NZ  . LYS F  1 139 ? -91.850  72.191  15.902  1.00 22.03  ? 139 LYS F NZ  1 
ATOM   9113  N  N   . ILE F  1 140 ? -90.496  79.181  16.272  1.00 16.62  ? 140 ILE F N   1 
ATOM   9114  C  CA  . ILE F  1 140 ? -89.224  79.586  15.698  1.00 17.29  ? 140 ILE F CA  1 
ATOM   9115  C  C   . ILE F  1 140 ? -88.080  78.835  16.377  1.00 24.35  ? 140 ILE F C   1 
ATOM   9116  O  O   . ILE F  1 140 ? -87.997  78.778  17.610  1.00 33.04  ? 140 ILE F O   1 
ATOM   9117  C  CB  . ILE F  1 140 ? -88.978  81.096  15.911  1.00 18.50  ? 140 ILE F CB  1 
ATOM   9118  C  CG1 . ILE F  1 140 ? -90.037  81.929  15.199  1.00 32.42  ? 140 ILE F CG1 1 
ATOM   9119  C  CG2 . ILE F  1 140 ? -87.597  81.490  15.432  1.00 15.75  ? 140 ILE F CG2 1 
ATOM   9120  C  CD1 . ILE F  1 140 ? -89.835  83.432  15.360  1.00 35.55  ? 140 ILE F CD1 1 
ATOM   9121  N  N   . GLY F  1 141 ? -87.190  78.273  15.574  1.00 24.21  ? 141 GLY F N   1 
ATOM   9122  C  CA  . GLY F  1 141 ? -86.012  77.601  16.096  1.00 32.90  ? 141 GLY F CA  1 
ATOM   9123  C  C   . GLY F  1 141 ? -84.901  77.479  15.063  1.00 27.57  ? 141 GLY F C   1 
ATOM   9124  O  O   . GLY F  1 141 ? -85.095  77.807  13.894  1.00 28.62  ? 141 GLY F O   1 
ATOM   9125  N  N   . SER F  1 142 ? -83.732  77.007  15.481  1.00 21.46  ? 142 SER F N   1 
ATOM   9126  C  CA  . SER F  1 142 ? -82.686  76.704  14.521  1.00 21.67  ? 142 SER F CA  1 
ATOM   9127  C  C   . SER F  1 142 ? -83.168  75.620  13.575  1.00 20.74  ? 142 SER F C   1 
ATOM   9128  O  O   . SER F  1 142 ? -83.807  74.661  13.997  1.00 18.85  ? 142 SER F O   1 
ATOM   9129  C  CB  . SER F  1 142 ? -81.424  76.238  15.232  1.00 33.09  ? 142 SER F CB  1 
ATOM   9130  O  OG  . SER F  1 142 ? -80.456  75.790  14.301  1.00 33.94  ? 142 SER F OG  1 
ATOM   9131  N  N   . TRP F  1 143 ? -82.853  75.767  12.294  1.00 19.51  ? 143 TRP F N   1 
ATOM   9132  C  CA  . TRP F  1 143 ? -83.281  74.776  11.314  1.00 19.26  ? 143 TRP F CA  1 
ATOM   9133  C  C   . TRP F  1 143 ? -82.402  73.525  11.316  1.00 20.06  ? 143 TRP F C   1 
ATOM   9134  O  O   . TRP F  1 143 ? -82.913  72.403  11.274  1.00 21.08  ? 143 TRP F O   1 
ATOM   9135  C  CB  . TRP F  1 143 ? -83.368  75.385  9.913   1.00 19.25  ? 143 TRP F CB  1 
ATOM   9136  C  CG  . TRP F  1 143 ? -84.228  74.580  8.987   1.00 27.67  ? 143 TRP F CG  1 
ATOM   9137  C  CD1 . TRP F  1 143 ? -83.828  73.880  7.882   1.00 33.94  ? 143 TRP F CD1 1 
ATOM   9138  C  CD2 . TRP F  1 143 ? -85.642  74.377  9.095   1.00 24.40  ? 143 TRP F CD2 1 
ATOM   9139  N  NE1 . TRP F  1 143 ? -84.911  73.259  7.295   1.00 22.80  ? 143 TRP F NE1 1 
ATOM   9140  C  CE2 . TRP F  1 143 ? -86.032  73.547  8.025   1.00 21.64  ? 143 TRP F CE2 1 
ATOM   9141  C  CE3 . TRP F  1 143 ? -86.616  74.813  9.999   1.00 23.04  ? 143 TRP F CE3 1 
ATOM   9142  C  CZ2 . TRP F  1 143 ? -87.347  73.151  7.835   1.00 34.60  ? 143 TRP F CZ2 1 
ATOM   9143  C  CZ3 . TRP F  1 143 ? -87.923  74.414  9.806   1.00 20.76  ? 143 TRP F CZ3 1 
ATOM   9144  C  CH2 . TRP F  1 143 ? -88.275  73.596  8.736   1.00 21.87  ? 143 TRP F CH2 1 
ATOM   9145  N  N   . THR F  1 144 ? -81.085  73.714  11.391  1.00 19.72  ? 144 THR F N   1 
ATOM   9146  C  CA  . THR F  1 144 ? -80.142  72.603  11.221  1.00 20.53  ? 144 THR F CA  1 
ATOM   9147  C  C   . THR F  1 144 ? -79.275  72.310  12.445  1.00 22.65  ? 144 THR F C   1 
ATOM   9148  O  O   . THR F  1 144 ? -78.676  71.233  12.541  1.00 32.93  ? 144 THR F O   1 
ATOM   9149  C  CB  . THR F  1 144 ? -79.218  72.810  10.006  1.00 20.52  ? 144 THR F CB  1 
ATOM   9150  O  OG1 . THR F  1 144 ? -78.436  73.983  10.196  1.00 19.49  ? 144 THR F OG1 1 
ATOM   9151  C  CG2 . THR F  1 144 ? -80.029  72.961  8.719   1.00 25.42  ? 144 THR F CG2 1 
ATOM   9152  N  N   . HIS F  1 145 ? -79.216  73.257  13.376  1.00 19.50  ? 145 HIS F N   1 
ATOM   9153  C  CA  . HIS F  1 145 ? -78.428  73.084  14.586  1.00 21.02  ? 145 HIS F CA  1 
ATOM   9154  C  C   . HIS F  1 145 ? -79.215  72.540  15.790  1.00 20.67  ? 145 HIS F C   1 
ATOM   9155  O  O   . HIS F  1 145 ? -80.129  73.186  16.296  1.00 27.67  ? 145 HIS F O   1 
ATOM   9156  C  CB  . HIS F  1 145 ? -77.761  74.407  14.969  1.00 21.56  ? 145 HIS F CB  1 
ATOM   9157  C  CG  . HIS F  1 145 ? -76.742  74.885  13.978  1.00 32.42  ? 145 HIS F CG  1 
ATOM   9158  N  ND1 . HIS F  1 145 ? -75.504  74.291  13.833  1.00 27.56  ? 145 HIS F ND1 1 
ATOM   9159  C  CD2 . HIS F  1 145 ? -76.769  75.914  13.100  1.00 17.62  ? 145 HIS F CD2 1 
ATOM   9160  C  CE1 . HIS F  1 145 ? -74.818  74.929  12.903  1.00 24.68  ? 145 HIS F CE1 1 
ATOM   9161  N  NE2 . HIS F  1 145 ? -75.559  75.924  12.449  1.00 32.39  ? 145 HIS F NE2 1 
ATOM   9162  N  N   . HIS F  1 146 ? -78.838  71.355  16.258  1.00 21.33  ? 146 HIS F N   1 
ATOM   9163  C  CA  . HIS F  1 146 ? -79.466  70.765  17.443  1.00 22.76  ? 146 HIS F CA  1 
ATOM   9164  C  C   . HIS F  1 146 ? -79.070  71.455  18.769  1.00 27.64  ? 146 HIS F C   1 
ATOM   9165  O  O   . HIS F  1 146 ? -78.344  72.460  18.780  1.00 21.21  ? 146 HIS F O   1 
ATOM   9166  C  CB  . HIS F  1 146 ? -79.198  69.249  17.504  1.00 25.47  ? 146 HIS F CB  1 
ATOM   9167  C  CG  . HIS F  1 146 ? -77.745  68.889  17.493  1.00 35.10  ? 146 HIS F CG  1 
ATOM   9168  N  ND1 . HIS F  1 146 ? -76.922  69.083  18.581  1.00 36.34  ? 146 HIS F ND1 1 
ATOM   9169  C  CD2 . HIS F  1 146 ? -76.969  68.350  16.525  1.00 25.68  ? 146 HIS F CD2 1 
ATOM   9170  C  CE1 . HIS F  1 146 ? -75.699  68.684  18.282  1.00 32.36  ? 146 HIS F CE1 1 
ATOM   9171  N  NE2 . HIS F  1 146 ? -75.703  68.232  17.040  1.00 33.57  ? 146 HIS F NE2 1 
ATOM   9172  N  N   . SER F  1 147 ? -79.551  70.892  19.879  1.00 27.15  ? 147 SER F N   1 
ATOM   9173  C  CA  . SER F  1 147 ? -79.538  71.586  21.171  1.00 30.27  ? 147 SER F CA  1 
ATOM   9174  C  C   . SER F  1 147 ? -78.155  71.753  21.769  1.00 26.72  ? 147 SER F C   1 
ATOM   9175  O  O   . SER F  1 147 ? -77.957  72.589  22.640  1.00 33.32  ? 147 SER F O   1 
ATOM   9176  C  CB  . SER F  1 147 ? -80.462  70.893  22.180  1.00 24.10  ? 147 SER F CB  1 
ATOM   9177  O  OG  . SER F  1 147 ? -80.031  69.573  22.430  1.00 33.00  ? 147 SER F OG  1 
ATOM   9178  N  N   . ARG F  1 148 ? -77.199  70.961  21.312  1.00 16.64  ? 148 ARG F N   1 
ATOM   9179  C  CA  . ARG F  1 148 ? -75.838  71.074  21.835  1.00 35.00  ? 148 ARG F CA  1 
ATOM   9180  C  C   . ARG F  1 148 ? -75.060  72.173  21.126  1.00 18.87  ? 148 ARG F C   1 
ATOM   9181  O  O   . ARG F  1 148 ? -74.104  72.715  21.677  1.00 12.33  ? 148 ARG F O   1 
ATOM   9182  C  CB  . ARG F  1 148 ? -75.111  69.729  21.792  1.00 26.49  ? 148 ARG F CB  1 
ATOM   9183  C  CG  . ARG F  1 148 ? -75.821  68.669  22.637  1.00 31.24  ? 148 ARG F CG  1 
ATOM   9184  C  CD  . ARG F  1 148 ? -75.168  67.299  22.554  1.00 26.55  ? 148 ARG F CD  1 
ATOM   9185  N  NE  . ARG F  1 148 ? -74.963  66.858  21.176  1.00 44.95  ? 148 ARG F NE  1 
ATOM   9186  C  CZ  . ARG F  1 148 ? -73.772  66.784  20.584  1.00 48.70  ? 148 ARG F CZ  1 
ATOM   9187  N  NH1 . ARG F  1 148 ? -72.667  67.110  21.253  1.00 41.92  ? 148 ARG F NH1 1 
ATOM   9188  N  NH2 . ARG F  1 148 ? -73.682  66.370  19.327  1.00 42.13  ? 148 ARG F NH2 1 
ATOM   9189  N  N   . GLU F  1 149 ? -75.532  72.535  19.935  1.00 36.06  ? 149 GLU F N   1 
ATOM   9190  C  CA  . GLU F  1 149 ? -74.932  73.600  19.134  1.00 24.04  ? 149 GLU F CA  1 
ATOM   9191  C  C   . GLU F  1 149 ? -75.665  74.948  19.283  1.00 30.30  ? 149 GLU F C   1 
ATOM   9192  O  O   . GLU F  1 149 ? -75.024  75.992  19.452  1.00 27.45  ? 149 GLU F O   1 
ATOM   9193  C  CB  . GLU F  1 149 ? -74.872  73.177  17.667  1.00 22.27  ? 149 GLU F CB  1 
ATOM   9194  C  CG  . GLU F  1 149 ? -74.128  71.867  17.460  1.00 31.80  ? 149 GLU F CG  1 
ATOM   9195  C  CD  . GLU F  1 149 ? -73.954  71.489  16.000  1.00 29.75  ? 149 GLU F CD  1 
ATOM   9196  O  OE1 . GLU F  1 149 ? -74.818  71.850  15.186  1.00 34.49  ? 149 GLU F OE1 1 
ATOM   9197  O  OE2 . GLU F  1 149 ? -72.956  70.825  15.669  1.00 34.94  ? 149 GLU F OE2 1 
ATOM   9198  N  N   . ILE F  1 150 ? -76.999  74.924  19.210  1.00 25.31  ? 150 ILE F N   1 
ATOM   9199  C  CA  . ILE F  1 150 ? -77.802  76.131  19.417  1.00 19.61  ? 150 ILE F CA  1 
ATOM   9200  C  C   . ILE F  1 150 ? -78.946  75.886  20.378  1.00 28.99  ? 150 ILE F C   1 
ATOM   9201  O  O   . ILE F  1 150 ? -79.690  74.905  20.255  1.00 32.39  ? 150 ILE F O   1 
ATOM   9202  C  CB  . ILE F  1 150 ? -78.419  76.698  18.115  1.00 25.56  ? 150 ILE F CB  1 
ATOM   9203  C  CG1 . ILE F  1 150 ? -77.353  77.362  17.239  1.00 18.23  ? 150 ILE F CG1 1 
ATOM   9204  C  CG2 . ILE F  1 150 ? -79.518  77.711  18.459  1.00 18.91  ? 150 ILE F CG2 1 
ATOM   9205  C  CD1 . ILE F  1 150 ? -77.897  78.001  16.013  1.00 17.40  ? 150 ILE F CD1 1 
ATOM   9206  N  N   . SER F  1 151 ? -79.080  76.788  21.342  1.00 24.61  ? 151 SER F N   1 
ATOM   9207  C  CA  . SER F  1 151 ? -80.223  76.776  22.239  1.00 37.79  ? 151 SER F CA  1 
ATOM   9208  C  C   . SER F  1 151 ? -80.968  78.096  22.090  1.00 32.10  ? 151 SER F C   1 
ATOM   9209  O  O   . SER F  1 151 ? -80.347  79.157  22.037  1.00 24.67  ? 151 SER F O   1 
ATOM   9210  C  CB  . SER F  1 151 ? -79.777  76.580  23.688  1.00 23.25  ? 151 SER F CB  1 
ATOM   9211  O  OG  . SER F  1 151 ? -79.381  77.815  24.236  1.00 34.75  ? 151 SER F OG  1 
ATOM   9212  N  N   . VAL F  1 152 ? -82.292  78.023  22.010  1.00 21.81  ? 152 VAL F N   1 
ATOM   9213  C  CA  . VAL F  1 152 ? -83.108  79.213  21.850  1.00 21.99  ? 152 VAL F CA  1 
ATOM   9214  C  C   . VAL F  1 152 ? -83.879  79.473  23.114  1.00 23.26  ? 152 VAL F C   1 
ATOM   9215  O  O   . VAL F  1 152 ? -84.378  78.550  23.735  1.00 28.75  ? 152 VAL F O   1 
ATOM   9216  C  CB  . VAL F  1 152 ? -84.129  79.065  20.710  1.00 24.29  ? 152 VAL F CB  1 
ATOM   9217  C  CG1 . VAL F  1 152 ? -83.444  79.129  19.368  1.00 21.52  ? 152 VAL F CG1 1 
ATOM   9218  C  CG2 . VAL F  1 152 ? -84.899  77.768  20.852  1.00 35.57  ? 152 VAL F CG2 1 
ATOM   9219  N  N   . ASP F  1 153 ? -83.975  80.737  23.494  1.00 33.64  ? 153 ASP F N   1 
ATOM   9220  C  CA  . ASP F  1 153 ? -84.733  81.113  24.682  1.00 34.79  ? 153 ASP F CA  1 
ATOM   9221  C  C   . ASP F  1 153 ? -85.452  82.433  24.497  1.00 36.79  ? 153 ASP F C   1 
ATOM   9222  O  O   . ASP F  1 153 ? -84.950  83.322  23.811  1.00 47.76  ? 153 ASP F O   1 
ATOM   9223  C  CB  . ASP F  1 153 ? -83.821  81.192  25.897  1.00 26.89  ? 153 ASP F CB  1 
ATOM   9224  C  CG  . ASP F  1 153 ? -83.595  79.835  26.533  1.00 58.65  ? 153 ASP F CG  1 
ATOM   9225  O  OD1 . ASP F  1 153 ? -82.643  79.127  26.116  1.00 55.23  ? 153 ASP F OD1 1 
ATOM   9226  O  OD2 . ASP F  1 153 ? -84.379  79.477  27.444  1.00 69.39  ? 153 ASP F OD2 1 
ATOM   9227  N  N   . PRO F  1 154 ? -86.640  82.554  25.097  1.00 29.95  ? 154 PRO F N   1 
ATOM   9228  C  CA  . PRO F  1 154 ? -87.391  83.805  25.062  1.00 31.17  ? 154 PRO F CA  1 
ATOM   9229  C  C   . PRO F  1 154 ? -86.718  84.840  25.913  1.00 42.19  ? 154 PRO F C   1 
ATOM   9230  O  O   . PRO F  1 154 ? -85.669  84.620  26.520  1.00 39.88  ? 154 PRO F O   1 
ATOM   9231  C  CB  . PRO F  1 154 ? -88.715  83.446  25.738  1.00 38.21  ? 154 PRO F CB  1 
ATOM   9232  C  CG  . PRO F  1 154 ? -88.769  81.950  25.736  1.00 48.31  ? 154 PRO F CG  1 
ATOM   9233  C  CD  . PRO F  1 154 ? -87.358  81.487  25.807  1.00 30.20  ? 154 PRO F CD  1 
ATOM   9234  N  N   . THR F  1 155 ? -87.389  85.966  26.009  1.00 27.70  ? 155 THR F N   1 
ATOM   9235  C  CA  . THR F  1 155 ? -86.931  87.016  26.874  1.00 25.03  ? 155 THR F CA  1 
ATOM   9236  C  C   . THR F  1 155 ? -88.058  88.026  26.950  1.00 39.48  ? 155 THR F C   1 
ATOM   9237  O  O   . THR F  1 155 ? -88.460  88.627  25.957  1.00 47.53  ? 155 THR F O   1 
ATOM   9238  C  CB  . THR F  1 155 ? -85.596  87.622  26.375  1.00 29.01  ? 155 THR F CB  1 
ATOM   9239  O  OG1 . THR F  1 155 ? -85.110  88.594  27.315  1.00 27.15  ? 155 THR F OG1 1 
ATOM   9240  C  CG2 . THR F  1 155 ? -85.766  88.254  24.987  1.00 36.10  ? 155 THR F CG2 1 
ATOM   9241  N  N   . THR F  1 156 ? -88.597  88.156  28.149  1.00 40.13  ? 156 THR F N   1 
ATOM   9242  C  CA  . THR F  1 156 ? -89.652  89.100  28.438  1.00 45.82  ? 156 THR F CA  1 
ATOM   9243  C  C   . THR F  1 156 ? -89.057  90.497  28.574  1.00 37.00  ? 156 THR F C   1 
ATOM   9244  O  O   . THR F  1 156 ? -87.990  90.663  29.172  1.00 30.39  ? 156 THR F O   1 
ATOM   9245  C  CB  . THR F  1 156 ? -90.322  88.732  29.792  1.00 61.69  ? 156 THR F CB  1 
ATOM   9246  O  OG1 . THR F  1 156 ? -90.769  87.366  29.765  1.00 40.12  ? 156 THR F OG1 1 
ATOM   9247  C  CG2 . THR F  1 156 ? -91.487  89.670  30.118  1.00 52.88  ? 156 THR F CG2 1 
ATOM   9248  N  N   . GLU F  1 157 ? -89.748  91.490  28.019  1.00 47.35  ? 157 GLU F N   1 
ATOM   9249  C  CA  . GLU F  1 157 ? -89.517  92.898  28.350  1.00 57.95  ? 157 GLU F CA  1 
ATOM   9250  C  C   . GLU F  1 157 ? -90.094  93.216  29.729  1.00 34.04  ? 157 GLU F C   1 
ATOM   9251  O  O   . GLU F  1 157 ? -91.189  92.758  30.069  1.00 24.89  ? 157 GLU F O   1 
ATOM   9252  C  CB  . GLU F  1 157 ? -90.179  93.814  27.312  1.00 67.59  ? 157 GLU F CB  1 
ATOM   9253  C  CG  . GLU F  1 157 ? -89.419  95.099  27.015  1.00 59.64  ? 157 GLU F CG  1 
ATOM   9254  C  CD  . GLU F  1 157 ? -88.087  94.834  26.336  1.00 61.42  ? 157 GLU F CD  1 
ATOM   9255  O  OE1 . GLU F  1 157 ? -87.148  94.375  27.024  1.00 83.20  ? 157 GLU F OE1 1 
ATOM   9256  O  OE2 . GLU F  1 157 ? -87.980  95.074  25.113  1.00 61.37  ? 157 GLU F OE2 1 
ATOM   9257  N  N   . ASP F  1 160 ? -94.467  95.997  27.205  1.00 26.95  ? 160 ASP F N   1 
ATOM   9258  C  CA  . ASP F  1 160 ? -95.884  95.948  26.855  1.00 43.51  ? 160 ASP F CA  1 
ATOM   9259  C  C   . ASP F  1 160 ? -96.139  95.225  25.528  1.00 79.00  ? 160 ASP F C   1 
ATOM   9260  O  O   . ASP F  1 160 ? -95.376  95.379  24.566  1.00 79.25  ? 160 ASP F O   1 
ATOM   9261  C  CB  . ASP F  1 160 ? -96.472  97.360  26.799  1.00 43.65  ? 160 ASP F CB  1 
ATOM   9262  C  CG  . ASP F  1 160 ? -97.847  97.392  26.150  1.00 53.65  ? 160 ASP F CG  1 
ATOM   9263  O  OD1 . ASP F  1 160 ? -98.634  96.457  26.409  1.00 60.33  ? 160 ASP F OD1 1 
ATOM   9264  O  OD2 . ASP F  1 160 ? -98.136  98.337  25.374  1.00 31.48  ? 160 ASP F OD2 1 
ATOM   9265  N  N   . ASP F  1 161 ? -97.232  94.459  25.492  1.00 84.83  ? 161 ASP F N   1 
ATOM   9266  C  CA  . ASP F  1 161 ? -97.618  93.607  24.356  1.00 63.45  ? 161 ASP F CA  1 
ATOM   9267  C  C   . ASP F  1 161 ? -97.736  94.334  23.031  1.00 37.41  ? 161 ASP F C   1 
ATOM   9268  O  O   . ASP F  1 161 ? -97.373  93.815  21.996  1.00 16.66  ? 161 ASP F O   1 
ATOM   9269  C  CB  . ASP F  1 161 ? -98.968  92.953  24.648  1.00 44.16  ? 161 ASP F CB  1 
ATOM   9270  C  CG  . ASP F  1 161 ? -98.857  91.826  25.642  1.00 68.54  ? 161 ASP F CG  1 
ATOM   9271  O  OD1 . ASP F  1 161 ? -97.983  90.944  25.442  1.00 54.12  ? 161 ASP F OD1 1 
ATOM   9272  O  OD2 . ASP F  1 161 ? -99.638  91.829  26.623  1.00 71.42  ? 161 ASP F OD2 1 
ATOM   9273  N  N   . SER F  1 162 ? -98.270  95.540  23.103  1.00 65.43  ? 162 SER F N   1 
ATOM   9274  C  CA  . SER F  1 162 ? -98.705  96.339  21.971  1.00 75.17  ? 162 SER F CA  1 
ATOM   9275  C  C   . SER F  1 162 ? -97.867  97.604  21.920  1.00 59.04  ? 162 SER F C   1 
ATOM   9276  O  O   . SER F  1 162 ? -98.225  98.576  21.266  1.00 57.87  ? 162 SER F O   1 
ATOM   9277  C  CB  . SER F  1 162 ? -100.178 96.733  22.168  1.00 73.47  ? 162 SER F CB  1 
ATOM   9278  O  OG  . SER F  1 162 ? -101.034 95.600  22.212  1.00 74.72  ? 162 SER F OG  1 
ATOM   9279  N  N   . GLU F  1 163 ? -96.755  97.602  22.633  1.00 37.49  ? 163 GLU F N   1 
ATOM   9280  C  CA  . GLU F  1 163 ? -95.971  98.821  22.747  1.00 48.76  ? 163 GLU F CA  1 
ATOM   9281  C  C   . GLU F  1 163 ? -95.654  99.463  21.384  1.00 53.22  ? 163 GLU F C   1 
ATOM   9282  O  O   . GLU F  1 163 ? -95.727  100.684 21.235  1.00 44.29  ? 163 GLU F O   1 
ATOM   9283  C  CB  . GLU F  1 163 ? -94.688  98.561  23.526  1.00 60.26  ? 163 GLU F CB  1 
ATOM   9284  C  CG  . GLU F  1 163 ? -93.937  99.834  23.867  1.00 75.04  ? 163 GLU F CG  1 
ATOM   9285  C  CD  . GLU F  1 163 ? -92.494  99.579  24.255  1.00 86.45  ? 163 GLU F CD  1 
ATOM   9286  O  OE1 . GLU F  1 163 ? -92.132  98.406  24.506  1.00 90.94  ? 163 GLU F OE1 1 
ATOM   9287  O  OE2 . GLU F  1 163 ? -91.720  100.557 24.300  1.00 87.40  ? 163 GLU F OE2 1 
ATOM   9288  N  N   . TYR F  1 164 ? -95.303  98.644  20.394  1.00 45.82  ? 164 TYR F N   1 
ATOM   9289  C  CA  . TYR F  1 164 ? -94.994  99.149  19.050  1.00 29.03  ? 164 TYR F CA  1 
ATOM   9290  C  C   . TYR F  1 164 ? -96.082  98.795  18.033  1.00 33.52  ? 164 TYR F C   1 
ATOM   9291  O  O   . TYR F  1 164 ? -95.855  98.883  16.829  1.00 29.11  ? 164 TYR F O   1 
ATOM   9292  C  CB  . TYR F  1 164 ? -93.658  98.596  18.549  1.00 44.62  ? 164 TYR F CB  1 
ATOM   9293  C  CG  . TYR F  1 164 ? -92.501  98.774  19.501  1.00 48.43  ? 164 TYR F CG  1 
ATOM   9294  C  CD1 . TYR F  1 164 ? -92.198  100.021 20.044  1.00 49.33  ? 164 TYR F CD1 1 
ATOM   9295  C  CD2 . TYR F  1 164 ? -91.720  97.691  19.865  1.00 48.54  ? 164 TYR F CD2 1 
ATOM   9296  C  CE1 . TYR F  1 164 ? -91.145  100.180 20.920  1.00 57.37  ? 164 TYR F CE1 1 
ATOM   9297  C  CE2 . TYR F  1 164 ? -90.667  97.837  20.740  1.00 59.80  ? 164 TYR F CE2 1 
ATOM   9298  C  CZ  . TYR F  1 164 ? -90.379  99.082  21.265  1.00 62.22  ? 164 TYR F CZ  1 
ATOM   9299  O  OH  . TYR F  1 164 ? -89.322  99.219  22.142  1.00 59.15  ? 164 TYR F OH  1 
ATOM   9300  N  N   . PHE F  1 165 ? -97.259  98.396  18.514  1.00 30.25  ? 165 PHE F N   1 
ATOM   9301  C  CA  . PHE F  1 165 ? -98.314  97.931  17.625  1.00 27.18  ? 165 PHE F CA  1 
ATOM   9302  C  C   . PHE F  1 165 ? -99.087  99.082  16.965  1.00 28.95  ? 165 PHE F C   1 
ATOM   9303  O  O   . PHE F  1 165 ? -99.443  100.059 17.621  1.00 23.93  ? 165 PHE F O   1 
ATOM   9304  C  CB  . PHE F  1 165 ? -99.265  96.974  18.359  1.00 23.95  ? 165 PHE F CB  1 
ATOM   9305  C  CG  . PHE F  1 165 ? -100.127 96.166  17.437  1.00 31.20  ? 165 PHE F CG  1 
ATOM   9306  C  CD1 . PHE F  1 165 ? -99.576  95.131  16.691  1.00 27.05  ? 165 PHE F CD1 1 
ATOM   9307  C  CD2 . PHE F  1 165 ? -101.480 96.444  17.301  1.00 19.70  ? 165 PHE F CD2 1 
ATOM   9308  C  CE1 . PHE F  1 165 ? -100.347 94.379  15.830  1.00 14.68  ? 165 PHE F CE1 1 
ATOM   9309  C  CE2 . PHE F  1 165 ? -102.266 95.697  16.436  1.00 24.13  ? 165 PHE F CE2 1 
ATOM   9310  C  CZ  . PHE F  1 165 ? -101.689 94.659  15.692  1.00 25.15  ? 165 PHE F CZ  1 
ATOM   9311  N  N   . SER F  1 166 ? -99.340  98.951  15.665  1.00 17.85  ? 166 SER F N   1 
ATOM   9312  C  CA  . SER F  1 166 ? -100.001 100.000 14.897  1.00 23.56  ? 166 SER F CA  1 
ATOM   9313  C  C   . SER F  1 166 ? -101.434 100.255 15.339  1.00 32.70  ? 166 SER F C   1 
ATOM   9314  O  O   . SER F  1 166 ? -102.280 99.344  15.334  1.00 29.65  ? 166 SER F O   1 
ATOM   9315  C  CB  . SER F  1 166 ? -99.981  99.678  13.405  1.00 17.07  ? 166 SER F CB  1 
ATOM   9316  O  OG  . SER F  1 166 ? -100.641 100.688 12.663  1.00 34.71  ? 166 SER F OG  1 
ATOM   9317  N  N   . GLN F  1 167 ? -101.702 101.506 15.699  1.00 29.47  ? 167 GLN F N   1 
ATOM   9318  C  CA  . GLN F  1 167 ? -103.039 101.916 16.105  1.00 33.03  ? 167 GLN F CA  1 
ATOM   9319  C  C   . GLN F  1 167 ? -104.012 101.867 14.913  1.00 37.22  ? 167 GLN F C   1 
ATOM   9320  O  O   . GLN F  1 167 ? -105.238 101.889 15.089  1.00 38.50  ? 167 GLN F O   1 
ATOM   9321  C  CB  . GLN F  1 167 ? -102.995 103.321 16.709  1.00 22.27  ? 167 GLN F CB  1 
ATOM   9322  C  CG  . GLN F  1 167 ? -102.612 104.383 15.712  1.00 39.02  ? 167 GLN F CG  1 
ATOM   9323  C  CD  . GLN F  1 167 ? -102.480 105.751 16.347  1.00 46.08  ? 167 GLN F CD  1 
ATOM   9324  O  OE1 . GLN F  1 167 ? -101.402 106.325 16.377  1.00 51.72  ? 167 GLN F OE1 1 
ATOM   9325  N  NE2 . GLN F  1 167 ? -103.581 106.282 16.848  1.00 50.00  ? 167 GLN F NE2 1 
ATOM   9326  N  N   . TYR F  1 168 ? -103.463 101.779 13.706  1.00 28.76  ? 168 TYR F N   1 
ATOM   9327  C  CA  . TYR F  1 168 ? -104.282 101.803 12.499  1.00 19.80  ? 168 TYR F CA  1 
ATOM   9328  C  C   . TYR F  1 168 ? -104.588 100.422 11.919  1.00 30.90  ? 168 TYR F C   1 
ATOM   9329  O  O   . TYR F  1 168 ? -105.245 100.307 10.881  1.00 20.69  ? 168 TYR F O   1 
ATOM   9330  C  CB  . TYR F  1 168 ? -103.662 102.719 11.444  1.00 14.84  ? 168 TYR F CB  1 
ATOM   9331  C  CG  . TYR F  1 168 ? -103.395 104.104 11.988  1.00 40.02  ? 168 TYR F CG  1 
ATOM   9332  C  CD1 . TYR F  1 168 ? -104.444 104.932 12.378  1.00 19.06  ? 168 TYR F CD1 1 
ATOM   9333  C  CD2 . TYR F  1 168 ? -102.094 104.581 12.133  1.00 21.62  ? 168 TYR F CD2 1 
ATOM   9334  C  CE1 . TYR F  1 168 ? -104.213 106.191 12.899  1.00 20.12  ? 168 TYR F CE1 1 
ATOM   9335  C  CE2 . TYR F  1 168 ? -101.849 105.842 12.640  1.00 17.36  ? 168 TYR F CE2 1 
ATOM   9336  C  CZ  . TYR F  1 168 ? -102.915 106.645 13.023  1.00 39.69  ? 168 TYR F CZ  1 
ATOM   9337  O  OH  . TYR F  1 168 ? -102.695 107.910 13.532  1.00 42.59  ? 168 TYR F OH  1 
ATOM   9338  N  N   . SER F  1 169 ? -104.127 99.376  12.597  1.00 34.12  ? 169 SER F N   1 
ATOM   9339  C  CA  . SER F  1 169 ? -104.479 98.014  12.205  1.00 29.84  ? 169 SER F CA  1 
ATOM   9340  C  C   . SER F  1 169 ? -105.971 97.767  12.422  1.00 35.62  ? 169 SER F C   1 
ATOM   9341  O  O   . SER F  1 169 ? -106.584 98.354  13.319  1.00 26.38  ? 169 SER F O   1 
ATOM   9342  C  CB  . SER F  1 169 ? -103.681 96.990  13.018  1.00 33.07  ? 169 SER F CB  1 
ATOM   9343  O  OG  . SER F  1 169 ? -104.119 95.665  12.741  1.00 30.48  ? 169 SER F OG  1 
ATOM   9344  N  N   . ARG F  1 170 ? -106.551 96.885  11.619  1.00 20.59  ? 170 ARG F N   1 
ATOM   9345  C  CA  . ARG F  1 170 ? -107.924 96.487  11.864  1.00 32.79  ? 170 ARG F CA  1 
ATOM   9346  C  C   . ARG F  1 170 ? -108.029 95.643  13.126  1.00 30.18  ? 170 ARG F C   1 
ATOM   9347  O  O   . ARG F  1 170 ? -109.122 95.377  13.621  1.00 38.48  ? 170 ARG F O   1 
ATOM   9348  C  CB  . ARG F  1 170 ? -108.498 95.725  10.665  1.00 26.41  ? 170 ARG F CB  1 
ATOM   9349  C  CG  . ARG F  1 170 ? -109.062 96.617  9.581   1.00 17.80  ? 170 ARG F CG  1 
ATOM   9350  C  CD  . ARG F  1 170 ? -109.599 95.782  8.459   1.00 41.91  ? 170 ARG F CD  1 
ATOM   9351  N  NE  . ARG F  1 170 ? -108.562 94.914  7.939   1.00 75.55  ? 170 ARG F NE  1 
ATOM   9352  C  CZ  . ARG F  1 170 ? -108.775 93.764  7.313   1.00 80.89  ? 170 ARG F CZ  1 
ATOM   9353  N  NH1 . ARG F  1 170 ? -110.016 93.316  7.127   1.00 81.37  ? 170 ARG F NH1 1 
ATOM   9354  N  NH2 . ARG F  1 170 ? -107.734 93.059  6.883   1.00 54.08  ? 170 ARG F NH2 1 
ATOM   9355  N  N   . PHE F  1 171 ? -106.885 95.231  13.648  1.00 27.91  ? 171 PHE F N   1 
ATOM   9356  C  CA  . PHE F  1 171 ? -106.867 94.329  14.791  1.00 29.90  ? 171 PHE F CA  1 
ATOM   9357  C  C   . PHE F  1 171 ? -106.183 94.935  16.001  1.00 20.29  ? 171 PHE F C   1 
ATOM   9358  O  O   . PHE F  1 171 ? -105.574 96.000  15.918  1.00 22.80  ? 171 PHE F O   1 
ATOM   9359  C  CB  . PHE F  1 171 ? -106.209 93.004  14.417  1.00 13.97  ? 171 PHE F CB  1 
ATOM   9360  C  CG  . PHE F  1 171 ? -106.742 92.412  13.152  1.00 15.50  ? 171 PHE F CG  1 
ATOM   9361  C  CD1 . PHE F  1 171 ? -106.339 92.901  11.927  1.00 22.47  ? 171 PHE F CD1 1 
ATOM   9362  C  CD2 . PHE F  1 171 ? -107.648 91.373  13.185  1.00 23.70  ? 171 PHE F CD2 1 
ATOM   9363  C  CE1 . PHE F  1 171 ? -106.816 92.358  10.761  1.00 29.66  ? 171 PHE F CE1 1 
ATOM   9364  C  CE2 . PHE F  1 171 ? -108.135 90.828  12.018  1.00 28.46  ? 171 PHE F CE2 1 
ATOM   9365  C  CZ  . PHE F  1 171 ? -107.715 91.322  10.806  1.00 24.61  ? 171 PHE F CZ  1 
ATOM   9366  N  N   . GLU F  1 172 ? -106.316 94.246  17.130  1.00 21.33  ? 172 GLU F N   1 
ATOM   9367  C  CA  . GLU F  1 172 ? -105.687 94.657  18.372  1.00 26.23  ? 172 GLU F CA  1 
ATOM   9368  C  C   . GLU F  1 172 ? -105.147 93.427  19.076  1.00 30.96  ? 172 GLU F C   1 
ATOM   9369  O  O   . GLU F  1 172 ? -105.639 92.313  18.873  1.00 26.81  ? 172 GLU F O   1 
ATOM   9370  C  CB  . GLU F  1 172 ? -106.674 95.406  19.264  1.00 29.11  ? 172 GLU F CB  1 
ATOM   9371  C  CG  . GLU F  1 172 ? -107.937 94.614  19.625  1.00 46.20  ? 172 GLU F CG  1 
ATOM   9372  C  CD  . GLU F  1 172 ? -108.948 95.430  20.429  1.00 47.60  ? 172 GLU F CD  1 
ATOM   9373  O  OE1 . GLU F  1 172 ? -108.639 96.579  20.806  1.00 37.21  ? 172 GLU F OE1 1 
ATOM   9374  O  OE2 . GLU F  1 172 ? -110.063 94.924  20.676  1.00 53.17  ? 172 GLU F OE2 1 
ATOM   9375  N  N   . ILE F  1 173 ? -104.115 93.628  19.887  1.00 25.88  ? 173 ILE F N   1 
ATOM   9376  C  CA  . ILE F  1 173 ? -103.471 92.518  20.566  1.00 14.30  ? 173 ILE F CA  1 
ATOM   9377  C  C   . ILE F  1 173 ? -103.993 92.406  21.976  1.00 22.28  ? 173 ILE F C   1 
ATOM   9378  O  O   . ILE F  1 173 ? -103.987 93.370  22.736  1.00 33.80  ? 173 ILE F O   1 
ATOM   9379  C  CB  . ILE F  1 173 ? -101.951 92.694  20.598  1.00 24.97  ? 173 ILE F CB  1 
ATOM   9380  C  CG1 . ILE F  1 173 ? -101.363 92.572  19.186  1.00 17.28  ? 173 ILE F CG1 1 
ATOM   9381  C  CG2 . ILE F  1 173 ? -101.331 91.669  21.514  1.00 26.54  ? 173 ILE F CG2 1 
ATOM   9382  C  CD1 . ILE F  1 173 ? -99.875  92.792  19.132  1.00 28.43  ? 173 ILE F CD1 1 
ATOM   9383  N  N   . LEU F  1 174 ? -104.463 91.225  22.332  1.00 26.44  ? 174 LEU F N   1 
ATOM   9384  C  CA  . LEU F  1 174 ? -104.982 91.022  23.678  1.00 31.50  ? 174 LEU F CA  1 
ATOM   9385  C  C   . LEU F  1 174 ? -103.863 90.556  24.597  1.00 36.42  ? 174 LEU F C   1 
ATOM   9386  O  O   . LEU F  1 174 ? -103.735 91.016  25.725  1.00 33.71  ? 174 LEU F O   1 
ATOM   9387  C  CB  . LEU F  1 174 ? -106.142 90.024  23.677  1.00 25.93  ? 174 LEU F CB  1 
ATOM   9388  C  CG  . LEU F  1 174 ? -107.261 90.352  22.679  1.00 36.84  ? 174 LEU F CG  1 
ATOM   9389  C  CD1 . LEU F  1 174 ? -108.323 89.259  22.652  1.00 31.24  ? 174 LEU F CD1 1 
ATOM   9390  C  CD2 . LEU F  1 174 ? -107.884 91.710  22.982  1.00 26.20  ? 174 LEU F CD2 1 
ATOM   9391  N  N   . ASP F  1 175 ? -103.032 89.654  24.097  1.00 38.60  ? 175 ASP F N   1 
ATOM   9392  C  CA  . ASP F  1 175 ? -101.931 89.142  24.893  1.00 30.44  ? 175 ASP F CA  1 
ATOM   9393  C  C   . ASP F  1 175 ? -100.866 88.478  24.013  1.00 26.50  ? 175 ASP F C   1 
ATOM   9394  O  O   . ASP F  1 175 ? -101.156 88.005  22.913  1.00 34.75  ? 175 ASP F O   1 
ATOM   9395  C  CB  . ASP F  1 175 ? -102.467 88.144  25.920  1.00 29.39  ? 175 ASP F CB  1 
ATOM   9396  C  CG  . ASP F  1 175 ? -101.510 87.920  27.081  1.00 45.56  ? 175 ASP F CG  1 
ATOM   9397  O  OD1 . ASP F  1 175 ? -100.676 88.805  27.364  1.00 45.51  ? 175 ASP F OD1 1 
ATOM   9398  O  OD2 . ASP F  1 175 ? -101.600 86.854  27.725  1.00 57.27  ? 175 ASP F OD2 1 
ATOM   9399  N  N   . VAL F  1 176 ? -99.631  88.459  24.502  1.00 28.28  ? 176 VAL F N   1 
ATOM   9400  C  CA  . VAL F  1 176 ? -98.571  87.686  23.880  1.00 26.56  ? 176 VAL F CA  1 
ATOM   9401  C  C   . VAL F  1 176 ? -97.863  86.868  24.949  1.00 32.64  ? 176 VAL F C   1 
ATOM   9402  O  O   . VAL F  1 176 ? -97.383  87.426  25.927  1.00 32.70  ? 176 VAL F O   1 
ATOM   9403  C  CB  . VAL F  1 176 ? -97.531  88.582  23.185  1.00 23.55  ? 176 VAL F CB  1 
ATOM   9404  C  CG1 . VAL F  1 176 ? -96.511  87.725  22.470  1.00 18.89  ? 176 VAL F CG1 1 
ATOM   9405  C  CG2 . VAL F  1 176 ? -98.188  89.529  22.199  1.00 21.21  ? 176 VAL F CG2 1 
ATOM   9406  N  N   . THR F  1 177 ? -97.811  85.551  24.770  1.00 25.10  ? 177 THR F N   1 
ATOM   9407  C  CA  . THR F  1 177 ? -97.077  84.693  25.690  1.00 34.45  ? 177 THR F CA  1 
ATOM   9408  C  C   . THR F  1 177 ? -96.015  83.916  24.944  1.00 41.00  ? 177 THR F C   1 
ATOM   9409  O  O   . THR F  1 177 ? -96.179  83.600  23.764  1.00 49.26  ? 177 THR F O   1 
ATOM   9410  C  CB  . THR F  1 177 ? -97.989  83.689  26.441  1.00 39.95  ? 177 THR F CB  1 
ATOM   9411  O  OG1 . THR F  1 177 ? -98.621  82.804  25.504  1.00 27.62  ? 177 THR F OG1 1 
ATOM   9412  C  CG2 . THR F  1 177 ? -99.031  84.419  27.271  1.00 19.34  ? 177 THR F CG2 1 
ATOM   9413  N  N   . GLN F  1 178 ? -94.926  83.603  25.638  1.00 39.30  ? 178 GLN F N   1 
ATOM   9414  C  CA  . GLN F  1 178 ? -93.801  82.922  25.016  1.00 37.15  ? 178 GLN F CA  1 
ATOM   9415  C  C   . GLN F  1 178 ? -93.492  81.623  25.754  1.00 46.09  ? 178 GLN F C   1 
ATOM   9416  O  O   . GLN F  1 178 ? -93.344  81.616  26.977  1.00 54.20  ? 178 GLN F O   1 
ATOM   9417  C  CB  . GLN F  1 178 ? -92.576  83.843  24.984  1.00 30.85  ? 178 GLN F CB  1 
ATOM   9418  C  CG  . GLN F  1 178 ? -92.873  85.257  24.478  1.00 44.82  ? 178 GLN F CG  1 
ATOM   9419  C  CD  . GLN F  1 178 ? -91.758  85.831  23.610  1.00 75.11  ? 178 GLN F CD  1 
ATOM   9420  O  OE1 . GLN F  1 178 ? -90.575  85.511  23.788  1.00 67.67  ? 178 GLN F OE1 1 
ATOM   9421  N  NE2 . GLN F  1 178 ? -92.136  86.680  22.656  1.00 68.65  ? 178 GLN F NE2 1 
ATOM   9422  N  N   . LYS F  1 179 ? -93.411  80.522  25.011  1.00 48.10  ? 179 LYS F N   1 
ATOM   9423  C  CA  . LYS F  1 179 ? -93.069  79.220  25.590  1.00 45.31  ? 179 LYS F CA  1 
ATOM   9424  C  C   . LYS F  1 179 ? -91.889  78.560  24.853  1.00 43.63  ? 179 LYS F C   1 
ATOM   9425  O  O   . LYS F  1 179 ? -91.801  78.641  23.638  1.00 57.21  ? 179 LYS F O   1 
ATOM   9426  C  CB  . LYS F  1 179 ? -94.286  78.295  25.568  1.00 38.18  ? 179 LYS F CB  1 
ATOM   9427  C  CG  . LYS F  1 179 ? -94.048  76.961  26.234  1.00 56.89  ? 179 LYS F CG  1 
ATOM   9428  C  CD  . LYS F  1 179 ? -95.153  75.961  25.923  1.00 60.20  ? 179 LYS F CD  1 
ATOM   9429  C  CE  . LYS F  1 179 ? -94.855  74.600  26.554  1.00 70.67  ? 179 LYS F CE  1 
ATOM   9430  N  NZ  . LYS F  1 179 ? -95.880  73.570  26.220  1.00 67.21  ? 179 LYS F NZ  1 
ATOM   9431  N  N   . LYS F  1 180 ? -90.999  77.890  25.584  1.00 34.54  ? 180 LYS F N   1 
ATOM   9432  C  CA  . LYS F  1 180 ? -89.818  77.257  24.987  1.00 32.01  ? 180 LYS F CA  1 
ATOM   9433  C  C   . LYS F  1 180 ? -89.912  75.718  24.981  1.00 28.44  ? 180 LYS F C   1 
ATOM   9434  O  O   . LYS F  1 180 ? -90.376  75.117  25.945  1.00 38.63  ? 180 LYS F O   1 
ATOM   9435  C  CB  . LYS F  1 180 ? -88.562  77.720  25.735  1.00 18.14  ? 180 LYS F CB  1 
ATOM   9436  C  CG  . LYS F  1 180 ? -87.337  76.868  25.523  1.00 29.41  ? 180 LYS F CG  1 
ATOM   9437  C  CD  . LYS F  1 180 ? -86.291  77.218  26.554  1.00 57.24  ? 180 LYS F CD  1 
ATOM   9438  C  CE  . LYS F  1 180 ? -85.123  76.248  26.530  1.00 47.79  ? 180 LYS F CE  1 
ATOM   9439  N  NZ  . LYS F  1 180 ? -84.374  76.368  25.275  1.00 39.79  ? 180 LYS F NZ  1 
ATOM   9440  N  N   . ASN F  1 181 ? -89.478  75.085  23.897  1.00 27.47  ? 181 ASN F N   1 
ATOM   9441  C  CA  . ASN F  1 181 ? -89.555  73.634  23.784  1.00 16.80  ? 181 ASN F CA  1 
ATOM   9442  C  C   . ASN F  1 181 ? -88.292  73.007  23.224  1.00 35.70  ? 181 ASN F C   1 
ATOM   9443  O  O   . ASN F  1 181 ? -87.472  73.669  22.572  1.00 33.66  ? 181 ASN F O   1 
ATOM   9444  C  CB  . ASN F  1 181 ? -90.694  73.224  22.845  1.00 40.47  ? 181 ASN F CB  1 
ATOM   9445  C  CG  . ASN F  1 181 ? -92.020  73.827  23.226  1.00 32.23  ? 181 ASN F CG  1 
ATOM   9446  O  OD1 . ASN F  1 181 ? -92.677  73.375  24.165  1.00 44.80  ? 181 ASN F OD1 1 
ATOM   9447  N  ND2 . ASN F  1 181 ? -92.428  74.852  22.492  1.00 32.06  ? 181 ASN F ND2 1 
ATOM   9448  N  N   . SER F  1 182 ? -88.172  71.703  23.450  1.00 35.05  ? 182 SER F N   1 
ATOM   9449  C  CA  . SER F  1 182 ? -87.076  70.911  22.918  1.00 19.37  ? 182 SER F CA  1 
ATOM   9450  C  C   . SER F  1 182 ? -87.714  69.691  22.280  1.00 21.27  ? 182 SER F C   1 
ATOM   9451  O  O   . SER F  1 182 ? -88.361  68.901  22.951  1.00 29.28  ? 182 SER F O   1 
ATOM   9452  C  CB  . SER F  1 182 ? -86.117  70.508  24.052  1.00 23.06  ? 182 SER F CB  1 
ATOM   9453  O  OG  . SER F  1 182 ? -84.884  69.992  23.564  1.00 47.52  ? 182 SER F OG  1 
ATOM   9454  N  N   . VAL F  1 183 ? -87.537  69.546  20.975  1.00 26.81  ? 183 VAL F N   1 
ATOM   9455  C  CA  . VAL F  1 183 ? -88.258  68.530  20.220  1.00 28.19  ? 183 VAL F CA  1 
ATOM   9456  C  C   . VAL F  1 183 ? -87.318  67.608  19.466  1.00 35.38  ? 183 VAL F C   1 
ATOM   9457  O  O   . VAL F  1 183 ? -86.321  68.056  18.900  1.00 31.53  ? 183 VAL F O   1 
ATOM   9458  C  CB  . VAL F  1 183 ? -89.184  69.178  19.191  1.00 34.39  ? 183 VAL F CB  1 
ATOM   9459  C  CG1 . VAL F  1 183 ? -89.919  68.124  18.417  1.00 22.25  ? 183 VAL F CG1 1 
ATOM   9460  C  CG2 . VAL F  1 183 ? -90.158  70.096  19.875  1.00 18.99  ? 183 VAL F CG2 1 
ATOM   9461  N  N   . THR F  1 184 ? -87.643  66.320  19.461  1.00 41.98  ? 184 THR F N   1 
ATOM   9462  C  CA  . THR F  1 184 ? -86.904  65.343  18.673  1.00 38.62  ? 184 THR F CA  1 
ATOM   9463  C  C   . THR F  1 184 ? -87.722  64.974  17.430  1.00 38.91  ? 184 THR F C   1 
ATOM   9464  O  O   . THR F  1 184 ? -88.862  64.543  17.548  1.00 46.37  ? 184 THR F O   1 
ATOM   9465  C  CB  . THR F  1 184 ? -86.619  64.082  19.507  1.00 35.01  ? 184 THR F CB  1 
ATOM   9466  O  OG1 . THR F  1 184 ? -86.015  64.465  20.752  1.00 31.85  ? 184 THR F OG1 1 
ATOM   9467  C  CG2 . THR F  1 184 ? -85.700  63.120  18.753  1.00 19.33  ? 184 THR F CG2 1 
ATOM   9468  N  N   . TYR F  1 185 ? -87.156  65.152  16.242  1.00 47.39  ? 185 TYR F N   1 
ATOM   9469  C  CA  . TYR F  1 185 ? -87.881  64.840  15.009  1.00 43.26  ? 185 TYR F CA  1 
ATOM   9470  C  C   . TYR F  1 185 ? -87.473  63.474  14.467  1.00 50.01  ? 185 TYR F C   1 
ATOM   9471  O  O   . TYR F  1 185 ? -86.357  63.018  14.699  1.00 58.44  ? 185 TYR F O   1 
ATOM   9472  C  CB  . TYR F  1 185 ? -87.648  65.935  13.965  1.00 42.49  ? 185 TYR F CB  1 
ATOM   9473  C  CG  . TYR F  1 185 ? -88.102  67.294  14.444  1.00 40.09  ? 185 TYR F CG  1 
ATOM   9474  C  CD1 . TYR F  1 185 ? -87.339  68.028  15.352  1.00 39.87  ? 185 TYR F CD1 1 
ATOM   9475  C  CD2 . TYR F  1 185 ? -89.288  67.836  14.006  1.00 36.21  ? 185 TYR F CD2 1 
ATOM   9476  C  CE1 . TYR F  1 185 ? -87.755  69.262  15.802  1.00 34.75  ? 185 TYR F CE1 1 
ATOM   9477  C  CE2 . TYR F  1 185 ? -89.711  69.071  14.453  1.00 41.39  ? 185 TYR F CE2 1 
ATOM   9478  C  CZ  . TYR F  1 185 ? -88.939  69.781  15.352  1.00 37.94  ? 185 TYR F CZ  1 
ATOM   9479  O  OH  . TYR F  1 185 ? -89.351  71.012  15.806  1.00 38.19  ? 185 TYR F OH  1 
ATOM   9480  N  N   . SER F  1 186 ? -88.379  62.822  13.749  1.00 54.76  ? 186 SER F N   1 
ATOM   9481  C  CA  . SER F  1 186 ? -88.126  61.478  13.220  1.00 58.45  ? 186 SER F CA  1 
ATOM   9482  C  C   . SER F  1 186 ? -86.825  61.340  12.431  1.00 63.80  ? 186 SER F C   1 
ATOM   9483  O  O   . SER F  1 186 ? -86.133  60.325  12.536  1.00 56.71  ? 186 SER F O   1 
ATOM   9484  C  CB  . SER F  1 186 ? -89.286  61.033  12.336  1.00 61.92  ? 186 SER F CB  1 
ATOM   9485  O  OG  . SER F  1 186 ? -90.375  60.605  13.134  1.00 77.66  ? 186 SER F OG  1 
ATOM   9486  N  N   . CYS F  1 187 ? -86.510  62.359  11.637  1.00 29.05  ? 187 CYS F N   1 
ATOM   9487  C  CA  . CYS F  1 187 ? -85.334  62.366  10.774  1.00 57.13  ? 187 CYS F CA  1 
ATOM   9488  C  C   . CYS F  1 187 ? -84.027  62.173  11.536  1.00 68.35  ? 187 CYS F C   1 
ATOM   9489  O  O   . CYS F  1 187 ? -83.129  61.443  11.104  1.00 65.06  ? 187 CYS F O   1 
ATOM   9490  C  CB  . CYS F  1 187 ? -85.270  63.695  10.009  1.00 75.54  ? 187 CYS F CB  1 
ATOM   9491  S  SG  . CYS F  1 187 ? -83.647  64.520  10.011  1.00 129.72 ? 187 CYS F SG  1 
ATOM   9492  N  N   . CYS F  1 188 ? -83.922  62.846  12.672  1.00 59.37  ? 188 CYS F N   1 
ATOM   9493  C  CA  . CYS F  1 188 ? -82.640  63.016  13.321  1.00 49.38  ? 188 CYS F CA  1 
ATOM   9494  C  C   . CYS F  1 188 ? -82.712  62.594  14.776  1.00 41.12  ? 188 CYS F C   1 
ATOM   9495  O  O   . CYS F  1 188 ? -83.751  62.700  15.409  1.00 51.59  ? 188 CYS F O   1 
ATOM   9496  C  CB  . CYS F  1 188 ? -82.198  64.478  13.199  1.00 56.28  ? 188 CYS F CB  1 
ATOM   9497  S  SG  . CYS F  1 188 ? -82.609  65.253  11.601  1.00 51.14  ? 188 CYS F SG  1 
ATOM   9498  N  N   . PRO F  1 189 ? -81.592  62.114  15.315  1.00 38.91  ? 189 PRO F N   1 
ATOM   9499  C  CA  . PRO F  1 189 ? -81.537  61.571  16.673  1.00 38.36  ? 189 PRO F CA  1 
ATOM   9500  C  C   . PRO F  1 189 ? -81.526  62.686  17.716  1.00 42.34  ? 189 PRO F C   1 
ATOM   9501  O  O   . PRO F  1 189 ? -81.988  62.478  18.844  1.00 43.15  ? 189 PRO F O   1 
ATOM   9502  C  CB  . PRO F  1 189 ? -80.194  60.836  16.685  1.00 35.30  ? 189 PRO F CB  1 
ATOM   9503  C  CG  . PRO F  1 189 ? -79.342  61.657  15.758  1.00 19.66  ? 189 PRO F CG  1 
ATOM   9504  C  CD  . PRO F  1 189 ? -80.271  62.121  14.661  1.00 26.98  ? 189 PRO F CD  1 
ATOM   9505  N  N   . GLU F  1 190 ? -81.003  63.852  17.342  1.00 28.03  ? 190 GLU F N   1 
ATOM   9506  C  CA  . GLU F  1 190 ? -80.820  64.936  18.295  1.00 26.76  ? 190 GLU F CA  1 
ATOM   9507  C  C   . GLU F  1 190 ? -82.099  65.725  18.559  1.00 25.38  ? 190 GLU F C   1 
ATOM   9508  O  O   . GLU F  1 190 ? -83.074  65.635  17.810  1.00 34.20  ? 190 GLU F O   1 
ATOM   9509  C  CB  . GLU F  1 190 ? -79.700  65.867  17.832  1.00 33.90  ? 190 GLU F CB  1 
ATOM   9510  C  CG  . GLU F  1 190 ? -78.319  65.220  17.832  1.00 45.28  ? 190 GLU F CG  1 
ATOM   9511  C  CD  . GLU F  1 190 ? -77.678  65.164  19.216  1.00 54.49  ? 190 GLU F CD  1 
ATOM   9512  O  OE1 . GLU F  1 190 ? -78.371  65.417  20.225  1.00 55.88  ? 190 GLU F OE1 1 
ATOM   9513  O  OE2 . GLU F  1 190 ? -76.468  64.866  19.296  1.00 54.35  ? 190 GLU F OE2 1 
ATOM   9514  N  N   . ALA F  1 191 ? -82.084  66.489  19.642  1.00 20.39  ? 191 ALA F N   1 
ATOM   9515  C  CA  . ALA F  1 191 ? -83.185  67.374  19.969  1.00 19.69  ? 191 ALA F CA  1 
ATOM   9516  C  C   . ALA F  1 191 ? -82.924  68.774  19.419  1.00 27.43  ? 191 ALA F C   1 
ATOM   9517  O  O   . ALA F  1 191 ? -81.796  69.274  19.477  1.00 23.79  ? 191 ALA F O   1 
ATOM   9518  C  CB  . ALA F  1 191 ? -83.383  67.424  21.472  1.00 15.39  ? 191 ALA F CB  1 
ATOM   9519  N  N   . TYR F  1 192 ? -83.967  69.399  18.883  1.00 18.25  ? 192 TYR F N   1 
ATOM   9520  C  CA  . TYR F  1 192 ? -83.861  70.772  18.383  1.00 29.55  ? 192 TYR F CA  1 
ATOM   9521  C  C   . TYR F  1 192 ? -84.789  71.710  19.156  1.00 24.62  ? 192 TYR F C   1 
ATOM   9522  O  O   . TYR F  1 192 ? -85.973  71.421  19.361  1.00 32.63  ? 192 TYR F O   1 
ATOM   9523  C  CB  . TYR F  1 192 ? -84.157  70.838  16.883  1.00 14.87  ? 192 TYR F CB  1 
ATOM   9524  C  CG  . TYR F  1 192 ? -83.209  70.011  16.037  1.00 27.22  ? 192 TYR F CG  1 
ATOM   9525  C  CD1 . TYR F  1 192 ? -83.280  68.621  16.026  1.00 15.18  ? 192 TYR F CD1 1 
ATOM   9526  C  CD2 . TYR F  1 192 ? -82.238  70.625  15.247  1.00 26.50  ? 192 TYR F CD2 1 
ATOM   9527  C  CE1 . TYR F  1 192 ? -82.411  67.863  15.255  1.00 26.78  ? 192 TYR F CE1 1 
ATOM   9528  C  CE2 . TYR F  1 192 ? -81.356  69.873  14.472  1.00 30.17  ? 192 TYR F CE2 1 
ATOM   9529  C  CZ  . TYR F  1 192 ? -81.448  68.496  14.483  1.00 28.51  ? 192 TYR F CZ  1 
ATOM   9530  O  OH  . TYR F  1 192 ? -80.579  67.763  13.715  1.00 34.98  ? 192 TYR F OH  1 
ATOM   9531  N  N   . GLU F  1 193 ? -84.237  72.831  19.602  1.00 27.64  ? 193 GLU F N   1 
ATOM   9532  C  CA  . GLU F  1 193 ? -84.994  73.766  20.413  1.00 20.60  ? 193 GLU F CA  1 
ATOM   9533  C  C   . GLU F  1 193 ? -85.774  74.754  19.565  1.00 22.34  ? 193 GLU F C   1 
ATOM   9534  O  O   . GLU F  1 193 ? -85.409  75.057  18.423  1.00 35.67  ? 193 GLU F O   1 
ATOM   9535  C  CB  . GLU F  1 193 ? -84.073  74.493  21.390  1.00 14.37  ? 193 GLU F CB  1 
ATOM   9536  C  CG  . GLU F  1 193 ? -83.352  73.551  22.336  1.00 22.06  ? 193 GLU F CG  1 
ATOM   9537  C  CD  . GLU F  1 193 ? -82.720  74.269  23.506  1.00 35.40  ? 193 GLU F CD  1 
ATOM   9538  O  OE1 . GLU F  1 193 ? -82.743  75.516  23.500  1.00 27.51  ? 193 GLU F OE1 1 
ATOM   9539  O  OE2 . GLU F  1 193 ? -82.199  73.594  24.426  1.00 36.61  ? 193 GLU F OE2 1 
ATOM   9540  N  N   . ASP F  1 194 ? -86.876  75.225  20.126  1.00 18.95  ? 194 ASP F N   1 
ATOM   9541  C  CA  . ASP F  1 194 ? -87.720  76.216  19.474  1.00 27.69  ? 194 ASP F CA  1 
ATOM   9542  C  C   . ASP F  1 194 ? -88.388  77.080  20.533  1.00 31.08  ? 194 ASP F C   1 
ATOM   9543  O  O   . ASP F  1 194 ? -88.537  76.663  21.685  1.00 27.73  ? 194 ASP F O   1 
ATOM   9544  C  CB  . ASP F  1 194 ? -88.782  75.561  18.569  1.00 29.80  ? 194 ASP F CB  1 
ATOM   9545  C  CG  . ASP F  1 194 ? -89.829  74.767  19.349  1.00 38.14  ? 194 ASP F CG  1 
ATOM   9546  O  OD1 . ASP F  1 194 ? -90.637  75.379  20.073  1.00 36.24  ? 194 ASP F OD1 1 
ATOM   9547  O  OD2 . ASP F  1 194 ? -89.859  73.525  19.215  1.00 50.47  ? 194 ASP F OD2 1 
ATOM   9548  N  N   . VAL F  1 195 ? -88.756  78.294  20.144  1.00 18.05  ? 195 VAL F N   1 
ATOM   9549  C  CA  . VAL F  1 195 ? -89.613  79.124  20.971  1.00 27.96  ? 195 VAL F CA  1 
ATOM   9550  C  C   . VAL F  1 195 ? -90.985  79.218  20.324  1.00 14.96  ? 195 VAL F C   1 
ATOM   9551  O  O   . VAL F  1 195 ? -91.088  79.405  19.120  1.00 30.39  ? 195 VAL F O   1 
ATOM   9552  C  CB  . VAL F  1 195 ? -89.026  80.526  21.144  1.00 19.00  ? 195 VAL F CB  1 
ATOM   9553  C  CG1 . VAL F  1 195 ? -90.061  81.457  21.708  1.00 23.55  ? 195 VAL F CG1 1 
ATOM   9554  C  CG2 . VAL F  1 195 ? -87.831  80.462  22.054  1.00 34.78  ? 195 VAL F CG2 1 
ATOM   9555  N  N   . GLU F  1 196 ? -92.036  79.064  21.116  1.00 26.11  ? 196 GLU F N   1 
ATOM   9556  C  CA  . GLU F  1 196 ? -93.404  79.254  20.626  1.00 31.90  ? 196 GLU F CA  1 
ATOM   9557  C  C   . GLU F  1 196 ? -94.001  80.536  21.157  1.00 27.67  ? 196 GLU F C   1 
ATOM   9558  O  O   . GLU F  1 196 ? -94.218  80.676  22.352  1.00 30.69  ? 196 GLU F O   1 
ATOM   9559  C  CB  . GLU F  1 196 ? -94.307  78.075  20.982  1.00 29.73  ? 196 GLU F CB  1 
ATOM   9560  C  CG  . GLU F  1 196 ? -94.179  76.912  20.016  1.00 34.45  ? 196 GLU F CG  1 
ATOM   9561  C  CD  . GLU F  1 196 ? -94.912  75.689  20.501  1.00 43.40  ? 196 GLU F CD  1 
ATOM   9562  O  OE1 . GLU F  1 196 ? -95.661  75.797  21.495  1.00 45.96  ? 196 GLU F OE1 1 
ATOM   9563  O  OE2 . GLU F  1 196 ? -94.731  74.616  19.898  1.00 40.28  ? 196 GLU F OE2 1 
ATOM   9564  N  N   . VAL F  1 197 ? -94.251  81.472  20.250  1.00 21.43  ? 197 VAL F N   1 
ATOM   9565  C  CA  . VAL F  1 197 ? -94.860  82.739  20.601  1.00 23.09  ? 197 VAL F CA  1 
ATOM   9566  C  C   . VAL F  1 197 ? -96.357  82.630  20.344  1.00 23.10  ? 197 VAL F C   1 
ATOM   9567  O  O   . VAL F  1 197 ? -96.792  82.420  19.223  1.00 29.08  ? 197 VAL F O   1 
ATOM   9568  C  CB  . VAL F  1 197 ? -94.251  83.883  19.781  1.00 18.10  ? 197 VAL F CB  1 
ATOM   9569  C  CG1 . VAL F  1 197 ? -94.741  85.227  20.277  1.00 17.26  ? 197 VAL F CG1 1 
ATOM   9570  C  CG2 . VAL F  1 197 ? -92.750  83.815  19.852  1.00 15.48  ? 197 VAL F CG2 1 
ATOM   9571  N  N   . SER F  1 198 ? -97.139  82.732  21.405  1.00 26.91  ? 198 SER F N   1 
ATOM   9572  C  CA  . SER F  1 198 ? -98.596  82.700  21.281  1.00 31.16  ? 198 SER F CA  1 
ATOM   9573  C  C   . SER F  1 198 ? -99.169  84.113  21.182  1.00 27.68  ? 198 SER F C   1 
ATOM   9574  O  O   . SER F  1 198 ? -99.113  84.888  22.138  1.00 29.99  ? 198 SER F O   1 
ATOM   9575  C  CB  . SER F  1 198 ? -99.216  81.942  22.458  1.00 23.33  ? 198 SER F CB  1 
ATOM   9576  O  OG  . SER F  1 198 ? -98.932  80.556  22.360  1.00 32.63  ? 198 SER F OG  1 
ATOM   9577  N  N   . LEU F  1 199 ? -99.686  84.448  20.003  1.00 27.83  ? 199 LEU F N   1 
ATOM   9578  C  CA  . LEU F  1 199 ? -100.281 85.758  19.754  1.00 30.75  ? 199 LEU F CA  1 
ATOM   9579  C  C   . LEU F  1 199 ? -101.797 85.702  19.941  1.00 34.65  ? 199 LEU F C   1 
ATOM   9580  O  O   . LEU F  1 199 ? -102.507 85.052  19.171  1.00 33.89  ? 199 LEU F O   1 
ATOM   9581  C  CB  . LEU F  1 199 ? -99.953  86.221  18.339  1.00 16.70  ? 199 LEU F CB  1 
ATOM   9582  C  CG  . LEU F  1 199 ? -100.566 87.556  17.932  1.00 26.42  ? 199 LEU F CG  1 
ATOM   9583  C  CD1 . LEU F  1 199 ? -100.072 88.692  18.813  1.00 21.31  ? 199 LEU F CD1 1 
ATOM   9584  C  CD2 . LEU F  1 199 ? -100.265 87.841  16.494  1.00 16.96  ? 199 LEU F CD2 1 
ATOM   9585  N  N   . ASN F  1 200 ? -102.290 86.374  20.971  1.00 23.74  ? 200 ASN F N   1 
ATOM   9586  C  CA  . ASN F  1 200 ? -103.724 86.431  21.213  1.00 20.78  ? 200 ASN F CA  1 
ATOM   9587  C  C   . ASN F  1 200 ? -104.282 87.784  20.774  1.00 31.71  ? 200 ASN F C   1 
ATOM   9588  O  O   . ASN F  1 200 ? -103.982 88.820  21.384  1.00 28.33  ? 200 ASN F O   1 
ATOM   9589  C  CB  . ASN F  1 200 ? -104.022 86.154  22.690  1.00 26.87  ? 200 ASN F CB  1 
ATOM   9590  C  CG  . ASN F  1 200 ? -105.507 86.105  22.991  1.00 37.58  ? 200 ASN F CG  1 
ATOM   9591  O  OD1 . ASN F  1 200 ? -105.943 86.553  24.046  1.00 39.50  ? 200 ASN F OD1 1 
ATOM   9592  N  ND2 . ASN F  1 200 ? -106.292 85.573  22.063  1.00 39.72  ? 200 ASN F ND2 1 
ATOM   9593  N  N   . PHE F  1 201 ? -105.080 87.768  19.707  1.00 24.81  ? 201 PHE F N   1 
ATOM   9594  C  CA  . PHE F  1 201 ? -105.566 89.000  19.084  1.00 27.22  ? 201 PHE F CA  1 
ATOM   9595  C  C   . PHE F  1 201 ? -106.994 88.850  18.618  1.00 23.24  ? 201 PHE F C   1 
ATOM   9596  O  O   . PHE F  1 201 ? -107.516 87.746  18.542  1.00 38.97  ? 201 PHE F O   1 
ATOM   9597  C  CB  . PHE F  1 201 ? -104.695 89.365  17.879  1.00 26.62  ? 201 PHE F CB  1 
ATOM   9598  C  CG  . PHE F  1 201 ? -104.853 88.427  16.710  1.00 20.93  ? 201 PHE F CG  1 
ATOM   9599  C  CD1 . PHE F  1 201 ? -104.467 87.097  16.813  1.00 22.19  ? 201 PHE F CD1 1 
ATOM   9600  C  CD2 . PHE F  1 201 ? -105.374 88.878  15.508  1.00 20.22  ? 201 PHE F CD2 1 
ATOM   9601  C  CE1 . PHE F  1 201 ? -104.601 86.233  15.755  1.00 17.44  ? 201 PHE F CE1 1 
ATOM   9602  C  CE2 . PHE F  1 201 ? -105.520 88.021  14.438  1.00 17.79  ? 201 PHE F CE2 1 
ATOM   9603  C  CZ  . PHE F  1 201 ? -105.132 86.690  14.567  1.00 21.31  ? 201 PHE F CZ  1 
ATOM   9604  N  N   . ARG F  1 202 ? -107.627 89.968  18.295  1.00 24.57  ? 202 ARG F N   1 
ATOM   9605  C  CA  . ARG F  1 202 ? -109.011 89.950  17.839  1.00 27.51  ? 202 ARG F CA  1 
ATOM   9606  C  C   . ARG F  1 202 ? -109.278 91.154  16.950  1.00 18.61  ? 202 ARG F C   1 
ATOM   9607  O  O   . ARG F  1 202 ? -108.596 92.162  17.049  1.00 29.30  ? 202 ARG F O   1 
ATOM   9608  C  CB  . ARG F  1 202 ? -109.973 89.940  19.037  1.00 33.59  ? 202 ARG F CB  1 
ATOM   9609  C  CG  . ARG F  1 202 ? -110.035 91.249  19.771  1.00 29.60  ? 202 ARG F CG  1 
ATOM   9610  C  CD  . ARG F  1 202 ? -110.913 91.181  20.992  1.00 23.96  ? 202 ARG F CD  1 
ATOM   9611  N  NE  . ARG F  1 202 ? -110.882 92.456  21.701  1.00 37.02  ? 202 ARG F NE  1 
ATOM   9612  C  CZ  . ARG F  1 202 ? -111.261 92.630  22.958  1.00 32.86  ? 202 ARG F CZ  1 
ATOM   9613  N  NH1 . ARG F  1 202 ? -111.713 91.608  23.661  1.00 33.39  ? 202 ARG F NH1 1 
ATOM   9614  N  NH2 . ARG F  1 202 ? -111.187 93.829  23.506  1.00 35.25  ? 202 ARG F NH2 1 
ATOM   9615  N  N   . LYS F  1 203 ? -110.243 91.024  16.049  1.00 23.93  ? 203 LYS F N   1 
ATOM   9616  C  CA  . LYS F  1 203 ? -110.679 92.132  15.209  1.00 26.60  ? 203 LYS F CA  1 
ATOM   9617  C  C   . LYS F  1 203 ? -111.122 93.229  16.163  1.00 11.85  ? 203 LYS F C   1 
ATOM   9618  O  O   . LYS F  1 203 ? -111.732 92.931  17.191  1.00 19.07  ? 203 LYS F O   1 
ATOM   9619  C  CB  . LYS F  1 203 ? -111.865 91.679  14.344  1.00 40.65  ? 203 LYS F CB  1 
ATOM   9620  C  CG  . LYS F  1 203 ? -112.013 92.341  12.975  1.00 58.51  ? 203 LYS F CG  1 
ATOM   9621  C  CD  . LYS F  1 203 ? -113.351 91.938  12.320  1.00 69.07  ? 203 LYS F CD  1 
ATOM   9622  C  CE  . LYS F  1 203 ? -113.535 92.493  10.893  1.00 58.15  ? 203 LYS F CE  1 
ATOM   9623  N  NZ  . LYS F  1 203 ? -112.819 91.698  9.836   1.00 47.10  ? 203 LYS F NZ  1 
ATOM   9624  N  N   . LYS F  1 204 ? -110.804 94.485  15.848  1.00 29.03  ? 204 LYS F N   1 
ATOM   9625  C  CA  . LYS F  1 204 ? -111.292 95.620  16.642  1.00 19.49  ? 204 LYS F CA  1 
ATOM   9626  C  C   . LYS F  1 204 ? -112.730 95.911  16.275  1.00 26.17  ? 204 LYS F C   1 
ATOM   9627  O  O   . LYS F  1 204 ? -113.241 95.387  15.283  1.00 35.09  ? 204 LYS F O   1 
ATOM   9628  C  CB  . LYS F  1 204 ? -110.480 96.887  16.399  1.00 8.35   ? 204 LYS F CB  1 
ATOM   9629  C  CG  . LYS F  1 204 ? -109.085 96.872  16.945  1.00 17.20  ? 204 LYS F CG  1 
ATOM   9630  C  CD  . LYS F  1 204 ? -108.135 97.591  15.995  1.00 45.32  ? 204 LYS F CD  1 
ATOM   9631  C  CE  . LYS F  1 204 ? -107.859 99.024  16.410  1.00 26.27  ? 204 LYS F CE  1 
ATOM   9632  N  NZ  . LYS F  1 204 ? -106.621 99.520  15.728  1.00 27.97  ? 204 LYS F NZ  1 
ATOM   9633  N  N   . GLY F  1 205 ? -113.383 96.746  17.076  1.00 34.86  ? 205 GLY F N   1 
ATOM   9634  C  CA  . GLY F  1 205 ? -114.776 97.055  16.840  1.00 26.63  ? 205 GLY F CA  1 
ATOM   9635  C  C   . GLY F  1 205 ? -114.927 97.493  15.397  1.00 34.39  ? 205 GLY F C   1 
ATOM   9636  O  O   . GLY F  1 205 ? -114.111 98.279  14.915  1.00 54.05  ? 205 GLY F O   1 
ATOM   9637  N  N   . ARG F  1 206 ? -115.945 96.987  14.701  1.00 8.13   ? 206 ARG F N   1 
ATOM   9638  C  CA  . ARG F  1 206 ? -116.178 97.384  13.317  1.00 14.33  ? 206 ARG F CA  1 
ATOM   9639  C  C   . ARG F  1 206 ? -116.456 98.897  13.136  1.00 40.00  ? 206 ARG F C   1 
ATOM   9640  O  O   . ARG F  1 206 ? -117.038 99.303  12.132  1.00 57.19  ? 206 ARG F O   1 
ATOM   9641  C  CB  . ARG F  1 206 ? -117.304 96.554  12.707  1.00 16.81  ? 206 ARG F CB  1 
ATOM   9642  C  CG  . ARG F  1 206 ? -116.966 95.100  12.412  1.00 38.92  ? 206 ARG F CG  1 
ATOM   9643  C  CD  . ARG F  1 206 ? -118.204 94.368  11.856  1.00 42.80  ? 206 ARG F CD  1 
ATOM   9644  N  NE  . ARG F  1 206 ? -119.131 95.296  11.210  1.00 23.37  ? 206 ARG F NE  1 
ATOM   9645  C  CZ  . ARG F  1 206 ? -119.850 95.018  10.124  1.00 24.11  ? 206 ARG F CZ  1 
ATOM   9646  N  NH1 . ARG F  1 206 ? -119.766 93.830  9.545   1.00 25.74  ? 206 ARG F NH1 1 
ATOM   9647  N  NH2 . ARG F  1 206 ? -120.653 95.939  9.614   1.00 10.84  ? 206 ARG F NH2 1 
ATOM   9648  N  N   . SER F  1 207 ? -116.011 99.724  14.085  1.00 44.20  ? 207 SER F N   1 
ATOM   9649  C  CA  . SER F  1 207 ? -116.272 101.165 14.051  1.00 22.90  ? 207 SER F CA  1 
ATOM   9650  C  C   . SER F  1 207 ? -115.486 101.961 15.106  1.00 28.24  ? 207 SER F C   1 
ATOM   9651  O  O   . SER F  1 207 ? -114.401 101.561 15.546  1.00 31.45  ? 207 SER F O   1 
ATOM   9652  C  CB  . SER F  1 207 ? -117.765 101.403 14.242  1.00 22.84  ? 207 SER F CB  1 
ATOM   9653  O  OG  . SER F  1 207 ? -118.241 100.769 15.425  1.00 22.91  ? 207 SER F OG  1 
ATOM   9654  N  N   . LEU G  1 1   ? -58.728  69.495  14.787  1.00 42.84  ? 1   LEU G N   1 
ATOM   9655  C  CA  . LEU G  1 1   ? -59.768  70.088  13.957  1.00 40.53  ? 1   LEU G CA  1 
ATOM   9656  C  C   . LEU G  1 1   ? -60.957  70.596  14.773  1.00 46.25  ? 1   LEU G C   1 
ATOM   9657  O  O   . LEU G  1 1   ? -61.577  69.846  15.534  1.00 44.76  ? 1   LEU G O   1 
ATOM   9658  C  CB  . LEU G  1 1   ? -60.276  69.075  12.936  1.00 39.39  ? 1   LEU G CB  1 
ATOM   9659  C  CG  . LEU G  1 1   ? -59.404  68.888  11.706  1.00 46.30  ? 1   LEU G CG  1 
ATOM   9660  C  CD1 . LEU G  1 1   ? -60.051  67.918  10.728  1.00 37.86  ? 1   LEU G CD1 1 
ATOM   9661  C  CD2 . LEU G  1 1   ? -59.193  70.233  11.060  1.00 54.09  ? 1   LEU G CD2 1 
ATOM   9662  N  N   . ASP G  1 2   ? -61.271  71.876  14.608  1.00 40.91  ? 2   ASP G N   1 
ATOM   9663  C  CA  . ASP G  1 2   ? -62.504  72.419  15.150  1.00 39.32  ? 2   ASP G CA  1 
ATOM   9664  C  C   . ASP G  1 2   ? -63.452  72.742  13.982  1.00 42.10  ? 2   ASP G C   1 
ATOM   9665  O  O   . ASP G  1 2   ? -63.065  72.619  12.811  1.00 24.63  ? 2   ASP G O   1 
ATOM   9666  C  CB  . ASP G  1 2   ? -62.234  73.649  16.029  1.00 30.10  ? 2   ASP G CB  1 
ATOM   9667  C  CG  . ASP G  1 2   ? -61.556  74.772  15.273  1.00 50.69  ? 2   ASP G CG  1 
ATOM   9668  O  OD1 . ASP G  1 2   ? -61.586  74.737  14.028  1.00 48.52  ? 2   ASP G OD1 1 
ATOM   9669  O  OD2 . ASP G  1 2   ? -61.001  75.693  15.918  1.00 49.36  ? 2   ASP G OD2 1 
ATOM   9670  N  N   . ARG G  1 3   ? -64.686  73.139  14.295  1.00 33.43  ? 3   ARG G N   1 
ATOM   9671  C  CA  . ARG G  1 3   ? -65.656  73.442  13.255  1.00 23.96  ? 3   ARG G CA  1 
ATOM   9672  C  C   . ARG G  1 3   ? -65.090  74.413  12.225  1.00 33.14  ? 3   ARG G C   1 
ATOM   9673  O  O   . ARG G  1 3   ? -65.215  74.199  11.018  1.00 38.26  ? 3   ARG G O   1 
ATOM   9674  C  CB  . ARG G  1 3   ? -66.942  73.997  13.860  1.00 23.07  ? 3   ARG G CB  1 
ATOM   9675  C  CG  . ARG G  1 3   ? -67.761  72.930  14.538  1.00 34.94  ? 3   ARG G CG  1 
ATOM   9676  C  CD  . ARG G  1 3   ? -69.042  73.470  15.129  1.00 33.91  ? 3   ARG G CD  1 
ATOM   9677  N  NE  . ARG G  1 3   ? -69.822  72.388  15.718  1.00 46.75  ? 3   ARG G NE  1 
ATOM   9678  C  CZ  . ARG G  1 3   ? -69.677  71.962  16.968  1.00 58.28  ? 3   ARG G CZ  1 
ATOM   9679  N  NH1 . ARG G  1 3   ? -68.774  72.524  17.769  1.00 57.16  ? 3   ARG G NH1 1 
ATOM   9680  N  NH2 . ARG G  1 3   ? -70.435  70.972  17.418  1.00 61.51  ? 3   ARG G NH2 1 
ATOM   9681  N  N   . ALA G  1 4   ? -64.471  75.486  12.705  1.00 25.47  ? 4   ALA G N   1 
ATOM   9682  C  CA  . ALA G  1 4   ? -63.934  76.506  11.821  1.00 32.55  ? 4   ALA G CA  1 
ATOM   9683  C  C   . ALA G  1 4   ? -62.941  75.913  10.803  1.00 39.92  ? 4   ALA G C   1 
ATOM   9684  O  O   . ALA G  1 4   ? -62.982  76.245  9.619   1.00 35.06  ? 4   ALA G O   1 
ATOM   9685  C  CB  . ALA G  1 4   ? -63.292  77.612  12.636  1.00 30.42  ? 4   ALA G CB  1 
ATOM   9686  N  N   . ASP G  1 5   ? -62.061  75.026  11.262  1.00 28.37  ? 5   ASP G N   1 
ATOM   9687  C  CA  . ASP G  1 5   ? -61.088  74.395  10.373  1.00 30.57  ? 5   ASP G CA  1 
ATOM   9688  C  C   . ASP G  1 5   ? -61.802  73.528  9.340   1.00 40.06  ? 5   ASP G C   1 
ATOM   9689  O  O   . ASP G  1 5   ? -61.545  73.651  8.137   1.00 35.89  ? 5   ASP G O   1 
ATOM   9690  C  CB  . ASP G  1 5   ? -60.064  73.562  11.158  1.00 26.27  ? 5   ASP G CB  1 
ATOM   9691  C  CG  . ASP G  1 5   ? -59.242  74.403  12.133  1.00 45.55  ? 5   ASP G CG  1 
ATOM   9692  O  OD1 . ASP G  1 5   ? -58.999  75.599  11.842  1.00 30.37  ? 5   ASP G OD1 1 
ATOM   9693  O  OD2 . ASP G  1 5   ? -58.846  73.866  13.200  1.00 47.79  ? 5   ASP G OD2 1 
ATOM   9694  N  N   . ILE G  1 6   ? -62.698  72.659  9.809   1.00 25.28  ? 6   ILE G N   1 
ATOM   9695  C  CA  . ILE G  1 6   ? -63.457  71.789  8.917   1.00 29.70  ? 6   ILE G CA  1 
ATOM   9696  C  C   . ILE G  1 6   ? -64.168  72.593  7.824   1.00 33.24  ? 6   ILE G C   1 
ATOM   9697  O  O   . ILE G  1 6   ? -64.066  72.272  6.637   1.00 29.42  ? 6   ILE G O   1 
ATOM   9698  C  CB  . ILE G  1 6   ? -64.489  70.944  9.687   1.00 31.90  ? 6   ILE G CB  1 
ATOM   9699  C  CG1 . ILE G  1 6   ? -63.792  70.077  10.733  1.00 18.29  ? 6   ILE G CG1 1 
ATOM   9700  C  CG2 . ILE G  1 6   ? -65.324  70.097  8.718   1.00 14.25  ? 6   ILE G CG2 1 
ATOM   9701  C  CD1 . ILE G  1 6   ? -64.752  69.344  11.664  1.00 20.43  ? 6   ILE G CD1 1 
ATOM   9702  N  N   . LEU G  1 7   ? -64.881  73.640  8.236   1.00 26.74  ? 7   LEU G N   1 
ATOM   9703  C  CA  . LEU G  1 7   ? -65.632  74.487  7.305   1.00 23.19  ? 7   LEU G CA  1 
ATOM   9704  C  C   . LEU G  1 7   ? -64.721  75.271  6.359   1.00 34.88  ? 7   LEU G C   1 
ATOM   9705  O  O   . LEU G  1 7   ? -65.080  75.520  5.204   1.00 33.88  ? 7   LEU G O   1 
ATOM   9706  C  CB  . LEU G  1 7   ? -66.561  75.429  8.063   1.00 17.50  ? 7   LEU G CB  1 
ATOM   9707  C  CG  . LEU G  1 7   ? -67.751  74.716  8.685   1.00 25.13  ? 7   LEU G CG  1 
ATOM   9708  C  CD1 . LEU G  1 7   ? -68.330  75.532  9.812   1.00 39.99  ? 7   LEU G CD1 1 
ATOM   9709  C  CD2 . LEU G  1 7   ? -68.815  74.459  7.638   1.00 25.12  ? 7   LEU G CD2 1 
ATOM   9710  N  N   . TYR G  1 8   ? -63.549  75.659  6.856   1.00 20.68  ? 8   TYR G N   1 
ATOM   9711  C  CA  . TYR G  1 8   ? -62.536  76.307  6.017   1.00 28.27  ? 8   TYR G CA  1 
ATOM   9712  C  C   . TYR G  1 8   ? -62.092  75.341  4.934   1.00 33.45  ? 8   TYR G C   1 
ATOM   9713  O  O   . TYR G  1 8   ? -62.064  75.689  3.762   1.00 34.01  ? 8   TYR G O   1 
ATOM   9714  C  CB  . TYR G  1 8   ? -61.341  76.766  6.859   1.00 23.98  ? 8   TYR G CB  1 
ATOM   9715  C  CG  . TYR G  1 8   ? -60.248  77.482  6.093   1.00 42.36  ? 8   TYR G CG  1 
ATOM   9716  C  CD1 . TYR G  1 8   ? -60.397  78.808  5.686   1.00 55.17  ? 8   TYR G CD1 1 
ATOM   9717  C  CD2 . TYR G  1 8   ? -59.048  76.836  5.796   1.00 47.51  ? 8   TYR G CD2 1 
ATOM   9718  C  CE1 . TYR G  1 8   ? -59.388  79.461  4.994   1.00 61.50  ? 8   TYR G CE1 1 
ATOM   9719  C  CE2 . TYR G  1 8   ? -58.038  77.477  5.113   1.00 44.32  ? 8   TYR G CE2 1 
ATOM   9720  C  CZ  . TYR G  1 8   ? -58.211  78.790  4.712   1.00 63.17  ? 8   TYR G CZ  1 
ATOM   9721  O  OH  . TYR G  1 8   ? -57.196  79.430  4.034   1.00 73.12  ? 8   TYR G OH  1 
ATOM   9722  N  N   . ASN G  1 9   ? -61.776  74.117  5.331   1.00 34.93  ? 9   ASN G N   1 
ATOM   9723  C  CA  . ASN G  1 9   ? -61.421  73.086  4.377   1.00 35.16  ? 9   ASN G CA  1 
ATOM   9724  C  C   . ASN G  1 9   ? -62.475  72.883  3.291   1.00 43.86  ? 9   ASN G C   1 
ATOM   9725  O  O   . ASN G  1 9   ? -62.157  72.866  2.082   1.00 37.15  ? 9   ASN G O   1 
ATOM   9726  C  CB  . ASN G  1 9   ? -61.132  71.771  5.093   1.00 35.46  ? 9   ASN G CB  1 
ATOM   9727  C  CG  . ASN G  1 9   ? -59.932  71.869  6.033   1.00 46.53  ? 9   ASN G CG  1 
ATOM   9728  O  OD1 . ASN G  1 9   ? -59.087  72.770  5.908   1.00 36.52  ? 9   ASN G OD1 1 
ATOM   9729  N  ND2 . ASN G  1 9   ? -59.847  70.933  6.972   1.00 39.98  ? 9   ASN G ND2 1 
ATOM   9730  N  N   . ILE G  1 10  ? -63.724  72.730  3.722   1.00 34.69  ? 10  ILE G N   1 
ATOM   9731  C  CA  . ILE G  1 10  ? -64.839  72.530  2.805   1.00 34.47  ? 10  ILE G CA  1 
ATOM   9732  C  C   . ILE G  1 10  ? -64.939  73.685  1.820   1.00 34.25  ? 10  ILE G C   1 
ATOM   9733  O  O   . ILE G  1 10  ? -65.087  73.478  0.625   1.00 34.24  ? 10  ILE G O   1 
ATOM   9734  C  CB  . ILE G  1 10  ? -66.175  72.359  3.570   1.00 34.23  ? 10  ILE G CB  1 
ATOM   9735  C  CG1 . ILE G  1 10  ? -66.259  70.954  4.178   1.00 34.45  ? 10  ILE G CG1 1 
ATOM   9736  C  CG2 . ILE G  1 10  ? -67.353  72.615  2.646   1.00 33.95  ? 10  ILE G CG2 1 
ATOM   9737  C  CD1 . ILE G  1 10  ? -67.381  70.779  5.162   1.00 34.27  ? 10  ILE G CD1 1 
ATOM   9738  N  N   . ARG G  1 11  ? -64.837  74.902  2.335   1.00 21.78  ? 11  ARG G N   1 
ATOM   9739  C  CA  . ARG G  1 11  ? -64.973  76.114  1.535   1.00 22.31  ? 11  ARG G CA  1 
ATOM   9740  C  C   . ARG G  1 11  ? -63.884  76.160  0.465   1.00 35.78  ? 11  ARG G C   1 
ATOM   9741  O  O   . ARG G  1 11  ? -64.149  76.390  -0.715  1.00 36.19  ? 11  ARG G O   1 
ATOM   9742  C  CB  . ARG G  1 11  ? -64.861  77.318  2.475   1.00 40.89  ? 11  ARG G CB  1 
ATOM   9743  C  CG  . ARG G  1 11  ? -65.127  78.698  1.889   1.00 43.92  ? 11  ARG G CG  1 
ATOM   9744  C  CD  . ARG G  1 11  ? -64.601  79.778  2.864   1.00 62.05  ? 11  ARG G CD  1 
ATOM   9745  N  NE  . ARG G  1 11  ? -65.655  80.569  3.507   1.00 84.95  ? 11  ARG G NE  1 
ATOM   9746  C  CZ  . ARG G  1 11  ? -65.438  81.457  4.477   1.00 86.25  ? 11  ARG G CZ  1 
ATOM   9747  N  NH1 . ARG G  1 11  ? -64.207  81.652  4.930   1.00 94.10  ? 11  ARG G NH1 1 
ATOM   9748  N  NH2 . ARG G  1 11  ? -66.447  82.146  5.001   1.00 65.72  ? 11  ARG G NH2 1 
ATOM   9749  N  N   . GLN G  1 12  ? -62.654  75.897  0.892   1.00 63.80  ? 12  GLN G N   1 
ATOM   9750  C  CA  . GLN G  1 12  ? -61.470  76.064  0.056   1.00 61.76  ? 12  GLN G CA  1 
ATOM   9751  C  C   . GLN G  1 12  ? -61.324  75.029  -1.052  1.00 62.13  ? 12  GLN G C   1 
ATOM   9752  O  O   . GLN G  1 12  ? -60.829  75.346  -2.126  1.00 62.39  ? 12  GLN G O   1 
ATOM   9753  C  CB  . GLN G  1 12  ? -60.217  76.041  0.923   1.00 62.24  ? 12  GLN G CB  1 
ATOM   9754  C  CG  . GLN G  1 12  ? -60.113  77.183  1.910   1.00 62.18  ? 12  GLN G CG  1 
ATOM   9755  C  CD  . GLN G  1 12  ? -59.899  78.507  1.230   1.00 62.00  ? 12  GLN G CD  1 
ATOM   9756  O  OE1 . GLN G  1 12  ? -60.753  78.974  0.483   1.00 61.92  ? 12  GLN G OE1 1 
ATOM   9757  N  NE2 . GLN G  1 12  ? -58.748  79.119  1.474   1.00 62.46  ? 12  GLN G NE2 1 
ATOM   9758  N  N   . THR G  1 13  ? -61.743  73.793  -0.803  1.00 33.88  ? 13  THR G N   1 
ATOM   9759  C  CA  . THR G  1 13  ? -61.509  72.751  -1.802  1.00 28.49  ? 13  THR G CA  1 
ATOM   9760  C  C   . THR G  1 13  ? -62.750  71.992  -2.312  1.00 28.99  ? 13  THR G C   1 
ATOM   9761  O  O   . THR G  1 13  ? -62.646  71.190  -3.236  1.00 41.91  ? 13  THR G O   1 
ATOM   9762  C  CB  . THR G  1 13  ? -60.441  71.749  -1.323  1.00 14.11  ? 13  THR G CB  1 
ATOM   9763  O  OG1 . THR G  1 13  ? -61.066  70.661  -0.635  1.00 16.92  ? 13  THR G OG1 1 
ATOM   9764  C  CG2 . THR G  1 13  ? -59.459  72.438  -0.401  1.00 26.97  ? 13  THR G CG2 1 
ATOM   9765  N  N   . SER G  1 14  ? -63.913  72.237  -1.722  1.00 51.49  ? 14  SER G N   1 
ATOM   9766  C  CA  . SER G  1 14  ? -65.153  71.650  -2.239  1.00 54.90  ? 14  SER G CA  1 
ATOM   9767  C  C   . SER G  1 14  ? -65.396  72.098  -3.675  1.00 48.28  ? 14  SER G C   1 
ATOM   9768  O  O   . SER G  1 14  ? -65.114  73.238  -4.056  1.00 36.00  ? 14  SER G O   1 
ATOM   9769  C  CB  . SER G  1 14  ? -66.356  72.100  -1.415  1.00 25.73  ? 14  SER G CB  1 
ATOM   9770  O  OG  . SER G  1 14  ? -66.620  73.481  -1.670  1.00 30.31  ? 14  SER G OG  1 
ATOM   9771  N  N   . ARG G  1 15  ? -65.954  71.213  -4.475  1.00 30.47  ? 15  ARG G N   1 
ATOM   9772  C  CA  . ARG G  1 15  ? -66.304  71.616  -5.816  1.00 10.20  ? 15  ARG G CA  1 
ATOM   9773  C  C   . ARG G  1 15  ? -67.785  71.464  -5.962  1.00 4.97   ? 15  ARG G C   1 
ATOM   9774  O  O   . ARG G  1 15  ? -68.295  70.346  -5.969  1.00 24.46  ? 15  ARG G O   1 
ATOM   9775  C  CB  . ARG G  1 15  ? -65.547  70.780  -6.854  1.00 16.38  ? 15  ARG G CB  1 
ATOM   9776  C  CG  . ARG G  1 15  ? -64.032  71.073  -6.895  1.00 4.19   ? 15  ARG G CG  1 
ATOM   9777  C  CD  . ARG G  1 15  ? -63.746  72.379  -7.669  1.00 14.49  ? 15  ARG G CD  1 
ATOM   9778  N  NE  . ARG G  1 15  ? -64.091  72.272  -9.094  1.00 48.27  ? 15  ARG G NE  1 
ATOM   9779  C  CZ  . ARG G  1 15  ? -63.403  71.561  -9.992  1.00 35.75  ? 15  ARG G CZ  1 
ATOM   9780  N  NH1 . ARG G  1 15  ? -62.322  70.887  -9.624  1.00 36.93  ? 15  ARG G NH1 1 
ATOM   9781  N  NH2 . ARG G  1 15  ? -63.788  71.527  -11.262 1.00 12.00  ? 15  ARG G NH2 1 
ATOM   9782  N  N   . PRO G  1 16  ? -68.486  72.600  -6.057  1.00 31.03  ? 16  PRO G N   1 
ATOM   9783  C  CA  . PRO G  1 16  ? -69.932  72.712  -6.265  1.00 32.34  ? 16  PRO G CA  1 
ATOM   9784  C  C   . PRO G  1 16  ? -70.367  72.193  -7.640  1.00 22.81  ? 16  PRO G C   1 
ATOM   9785  O  O   . PRO G  1 16  ? -71.527  71.826  -7.815  1.00 43.85  ? 16  PRO G O   1 
ATOM   9786  C  CB  . PRO G  1 16  ? -70.174  74.225  -6.212  1.00 28.53  ? 16  PRO G CB  1 
ATOM   9787  C  CG  . PRO G  1 16  ? -68.953  74.824  -5.631  1.00 23.99  ? 16  PRO G CG  1 
ATOM   9788  C  CD  . PRO G  1 16  ? -67.830  73.915  -5.986  1.00 23.47  ? 16  PRO G CD  1 
ATOM   9789  N  N   . ASP G  1 17  ? -69.444  72.173  -8.599  1.00 20.89  ? 17  ASP G N   1 
ATOM   9790  C  CA  . ASP G  1 17  ? -69.760  71.929  -10.009 1.00 27.61  ? 17  ASP G CA  1 
ATOM   9791  C  C   . ASP G  1 17  ? -69.544  70.475  -10.432 1.00 18.20  ? 17  ASP G C   1 
ATOM   9792  O  O   . ASP G  1 17  ? -69.867  70.085  -11.559 1.00 36.09  ? 17  ASP G O   1 
ATOM   9793  C  CB  . ASP G  1 17  ? -68.944  72.872  -10.913 1.00 35.09  ? 17  ASP G CB  1 
ATOM   9794  C  CG  . ASP G  1 17  ? -67.426  72.818  -10.634 1.00 63.39  ? 17  ASP G CG  1 
ATOM   9795  O  OD1 . ASP G  1 17  ? -67.017  72.691  -9.456  1.00 50.39  ? 17  ASP G OD1 1 
ATOM   9796  O  OD2 . ASP G  1 17  ? -66.637  72.915  -11.601 1.00 71.21  ? 17  ASP G OD2 1 
ATOM   9797  N  N   . VAL G  1 18  ? -69.010  69.680  -9.512  1.00 21.38  ? 18  VAL G N   1 
ATOM   9798  C  CA  . VAL G  1 18  ? -68.549  68.339  -9.835  1.00 18.28  ? 18  VAL G CA  1 
ATOM   9799  C  C   . VAL G  1 18  ? -69.336  67.257  -9.109  1.00 17.64  ? 18  VAL G C   1 
ATOM   9800  O  O   . VAL G  1 18  ? -69.353  67.192  -7.885  1.00 19.54  ? 18  VAL G O   1 
ATOM   9801  C  CB  . VAL G  1 18  ? -67.051  68.162  -9.482  1.00 31.58  ? 18  VAL G CB  1 
ATOM   9802  C  CG1 . VAL G  1 18  ? -66.584  66.737  -9.805  1.00 19.36  ? 18  VAL G CG1 1 
ATOM   9803  C  CG2 . VAL G  1 18  ? -66.194  69.210  -10.192 1.00 23.76  ? 18  VAL G CG2 1 
ATOM   9804  N  N   . ILE G  1 19  ? -69.982  66.398  -9.875  1.00 21.75  ? 19  ILE G N   1 
ATOM   9805  C  CA  . ILE G  1 19  ? -70.766  65.328  -9.305  1.00 20.43  ? 19  ILE G CA  1 
ATOM   9806  C  C   . ILE G  1 19  ? -69.850  64.261  -8.696  1.00 27.96  ? 19  ILE G C   1 
ATOM   9807  O  O   . ILE G  1 19  ? -69.023  63.669  -9.382  1.00 18.39  ? 19  ILE G O   1 
ATOM   9808  C  CB  . ILE G  1 19  ? -71.697  64.731  -10.372 1.00 30.59  ? 19  ILE G CB  1 
ATOM   9809  C  CG1 . ILE G  1 19  ? -72.597  63.650  -9.772  1.00 26.06  ? 19  ILE G CG1 1 
ATOM   9810  C  CG2 . ILE G  1 19  ? -70.874  64.231  -11.551 1.00 16.80  ? 19  ILE G CG2 1 
ATOM   9811  C  CD1 . ILE G  1 19  ? -73.612  63.118  -10.725 1.00 15.59  ? 19  ILE G CD1 1 
ATOM   9812  N  N   . PRO G  1 20  ? -70.009  64.010  -7.389  1.00 31.22  ? 20  PRO G N   1 
ATOM   9813  C  CA  . PRO G  1 20  ? -69.099  63.132  -6.642  1.00 24.89  ? 20  PRO G CA  1 
ATOM   9814  C  C   . PRO G  1 20  ? -69.270  61.638  -6.977  1.00 40.91  ? 20  PRO G C   1 
ATOM   9815  O  O   . PRO G  1 20  ? -69.500  60.847  -6.053  1.00 33.37  ? 20  PRO G O   1 
ATOM   9816  C  CB  . PRO G  1 20  ? -69.489  63.402  -5.188  1.00 21.76  ? 20  PRO G CB  1 
ATOM   9817  C  CG  . PRO G  1 20  ? -70.953  63.720  -5.266  1.00 19.09  ? 20  PRO G CG  1 
ATOM   9818  C  CD  . PRO G  1 20  ? -71.150  64.455  -6.565  1.00 20.92  ? 20  PRO G CD  1 
ATOM   9819  N  N   . THR G  1 21  ? -69.133  61.261  -8.255  1.00 19.71  ? 21  THR G N   1 
ATOM   9820  C  CA  . THR G  1 21  ? -69.233  59.851  -8.648  1.00 30.94  ? 21  THR G CA  1 
ATOM   9821  C  C   . THR G  1 21  ? -68.026  59.074  -8.188  1.00 31.85  ? 21  THR G C   1 
ATOM   9822  O  O   . THR G  1 21  ? -66.925  59.304  -8.669  1.00 24.90  ? 21  THR G O   1 
ATOM   9823  C  CB  . THR G  1 21  ? -69.355  59.632  -10.172 1.00 51.99  ? 21  THR G CB  1 
ATOM   9824  O  OG1 . THR G  1 21  ? -68.234  60.224  -10.840 1.00 59.84  ? 21  THR G OG1 1 
ATOM   9825  C  CG2 . THR G  1 21  ? -70.659  60.212  -10.710 1.00 66.51  ? 21  THR G CG2 1 
ATOM   9826  N  N   . GLN G  1 22  ? -68.274  58.142  -7.270  1.00 52.20  ? 22  GLN G N   1 
ATOM   9827  C  CA  . GLN G  1 22  ? -67.274  57.269  -6.659  1.00 52.73  ? 22  GLN G CA  1 
ATOM   9828  C  C   . GLN G  1 22  ? -67.041  55.984  -7.478  1.00 61.04  ? 22  GLN G C   1 
ATOM   9829  O  O   . GLN G  1 22  ? -67.854  55.060  -7.458  1.00 59.24  ? 22  GLN G O   1 
ATOM   9830  C  CB  . GLN G  1 22  ? -67.693  56.938  -5.213  1.00 39.97  ? 22  GLN G CB  1 
ATOM   9831  C  CG  . GLN G  1 22  ? -68.953  56.046  -5.047  1.00 103.47 ? 22  GLN G CG  1 
ATOM   9832  C  CD  . GLN G  1 22  ? -70.298  56.740  -5.360  1.00 94.57  ? 22  GLN G CD  1 
ATOM   9833  O  OE1 . GLN G  1 22  ? -70.425  57.482  -6.335  1.00 104.73 ? 22  GLN G OE1 1 
ATOM   9834  N  NE2 . GLN G  1 22  ? -71.310  56.470  -4.532  1.00 59.57  ? 22  GLN G NE2 1 
ATOM   9835  N  N   . ARG G  1 23  ? -65.911  55.926  -8.177  1.00 85.88  ? 23  ARG G N   1 
ATOM   9836  C  CA  . ARG G  1 23  ? -65.639  54.860  -9.150  1.00 84.33  ? 23  ARG G CA  1 
ATOM   9837  C  C   . ARG G  1 23  ? -66.735  54.796  -10.209 1.00 58.50  ? 23  ARG G C   1 
ATOM   9838  O  O   . ARG G  1 23  ? -67.156  55.823  -10.749 1.00 62.99  ? 23  ARG G O   1 
ATOM   9839  C  CB  . ARG G  1 23  ? -65.444  53.482  -8.482  1.00 90.08  ? 23  ARG G CB  1 
ATOM   9840  C  CG  . ARG G  1 23  ? -63.978  53.114  -8.112  1.00 43.12  ? 23  ARG G CG  1 
ATOM   9841  C  CD  . ARG G  1 23  ? -62.991  53.219  -9.297  1.00 67.71  ? 23  ARG G CD  1 
ATOM   9842  N  NE  . ARG G  1 23  ? -63.041  52.071  -10.211 1.00 85.30  ? 23  ARG G NE  1 
ATOM   9843  C  CZ  . ARG G  1 23  ? -62.221  51.894  -11.248 1.00 70.58  ? 23  ARG G CZ  1